BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c80886_g1_i1 len=970 path=[948:0-969]

Length=970
                                                                      Score     E

ref|XP_009587068.1|  PREDICTED: protein DCL, chloroplastic-like         201   4e-59   
ref|XP_009614786.1|  PREDICTED: protein DCL, chloroplastic-like         198   3e-58   
ref|XP_006354776.1|  PREDICTED: protein DCL, chloroplastic-like         196   3e-57   
ref|XP_009768743.1|  PREDICTED: protein DCL, chloroplastic-like         196   3e-57   
ref|XP_004299358.1|  PREDICTED: uncharacterized protein LOC101304576    194   2e-56   
ref|XP_009778685.1|  PREDICTED: protein DCL, chloroplastic-like i...    192   4e-56   
ref|XP_004241584.1|  PREDICTED: protein DCL, chloroplastic-like         193   4e-56   
ref|XP_006364595.1|  PREDICTED: protein DCL, chloroplastic-like         190   4e-55   
gb|EYU24371.1|  hypothetical protein MIMGU_mgv1a013650mg                187   6e-54   
ref|XP_008239940.1|  PREDICTED: protein DCL, chloroplastic              186   2e-53   
ref|XP_009778678.1|  PREDICTED: protein DCL, chloroplastic-like i...    186   2e-53   
emb|CDP12303.1|  unnamed protein product                                186   3e-53   
ref|XP_007209564.1|  hypothetical protein PRUPE_ppa011021mg             186   3e-53   
ref|XP_006440602.1|  hypothetical protein CICLE_v10022133mg             185   5e-53   
ref|XP_011087245.1|  PREDICTED: protein DCL, chloroplastic-like         184   6e-53   
ref|XP_011071644.1|  PREDICTED: protein DCL, chloroplastic              182   1e-52   
ref|XP_006477458.1|  PREDICTED: protein DCL, chloroplastic-like         183   3e-52   
ref|XP_004236037.1|  PREDICTED: protein DCL, chloroplastic-like         182   5e-52   
ref|XP_008351848.1|  PREDICTED: protein DCL, chloroplastic-like         178   2e-50   
gb|EPS64007.1|  hypothetical protein M569_10774                         177   2e-50   
ref|XP_008393164.1|  PREDICTED: protein DCL, chloroplastic-like         178   2e-50   
ref|XP_011036794.1|  PREDICTED: protein DCL, chloroplastic-like i...    177   3e-50   
ref|XP_002514753.1|  conserved hypothetical protein                     177   6e-50   Ricinus communis
ref|XP_011036792.1|  PREDICTED: protein DCL, chloroplastic-like i...    177   8e-50   
ref|XP_008453205.1|  PREDICTED: protein DCL, chloroplastic              177   8e-50   
ref|XP_009339285.1|  PREDICTED: protein DCL, chloroplastic-like         176   9e-50   
ref|XP_004154974.1|  PREDICTED: uncharacterized protein LOC101228008    176   1e-49   
ref|XP_006440603.1|  hypothetical protein CICLE_v10022133mg             175   1e-49   
ref|XP_002284935.1|  PREDICTED: uncharacterized protein LOC100255290    176   2e-49   Vitis vinifera
ref|XP_008374549.1|  PREDICTED: protein DCL, chloroplastic-like         174   6e-49   
gb|KDP31255.1|  hypothetical protein JCGZ_11631                         174   7e-49   
ref|XP_011023607.1|  PREDICTED: protein DCL, chloroplastic-like         172   5e-48   
ref|XP_009369291.1|  PREDICTED: protein DCL, chloroplastic-like         172   6e-48   
ref|XP_010257491.1|  PREDICTED: protein DCL, chloroplastic-like         172   8e-48   
ref|XP_009401349.1|  PREDICTED: protein DCL, chloroplastic-like         169   5e-47   
ref|XP_009413463.1|  PREDICTED: high mobility group nucleosome-bi...    172   7e-47   
ref|XP_006382598.1|  hypothetical protein POPTR_0005s03610g             169   9e-47   
ref|NP_201050.2|  uncharacterized protein                               167   1e-46   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002866491.1|  hypothetical protein ARALYDRAFT_496421             167   1e-46   
ref|XP_010916681.1|  PREDICTED: uncharacterized protein LOC105041409    169   2e-46   
ref|XP_008782334.1|  PREDICTED: DNA-directed RNA polymerase V sub...    171   3e-46   
ref|XP_006281035.1|  hypothetical protein CARUB_v10027052mg             167   3e-46   
emb|CDY65200.1|  BnaCnng45980D                                          166   4e-46   
ref|XP_010550601.1|  PREDICTED: protein DCL, chloroplastic              166   5e-46   
ref|XP_010483956.1|  PREDICTED: uncharacterized protein LOC104762379    166   7e-46   
ref|XP_007037355.1|  Uncharacterized protein TCM_014003                 166   7e-46   
ref|XP_004499475.1|  PREDICTED: protein DCL, chloroplastic-like         166   1e-45   
ref|XP_007138179.1|  hypothetical protein PHAVU_009G187000g             165   5e-45   
ref|XP_004508733.1|  PREDICTED: protein DCL, chloroplastic-like         164   5e-45   
ref|XP_006649525.1|  PREDICTED: cyclic nucleotide-gated cation ch...    164   7e-45   
ref|XP_010678517.1|  PREDICTED: protein DCL, chloroplastic              164   7e-45   
ref|XP_009130215.1|  PREDICTED: uncharacterized protein LOC103855007    162   7e-45   
ref|XP_010458929.1|  PREDICTED: uncharacterized protein LOC104740096    163   9e-45   
emb|CDY67519.1|  BnaAnng24490D                                          162   1e-44   
ref|XP_010444092.1|  PREDICTED: uncharacterized protein LOC104726842    162   1e-44   
ref|XP_003527083.1|  PREDICTED: nucleolin-like                          163   3e-44   
ref|XP_002468368.1|  hypothetical protein SORBIDRAFT_01g044760          162   4e-44   Sorghum bicolor [broomcorn]
ref|XP_003558636.1|  PREDICTED: protein DCL, chloroplastic              162   6e-44   
emb|CDY00287.1|  BnaA06g21880D                                          160   8e-44   
gb|KHG12161.1|  Protein DCL, chloroplastic                              161   8e-44   
ref|XP_009151366.1|  PREDICTED: protein DCL, chloroplastic              160   1e-43   
gb|KFK27971.1|  hypothetical protein AALP_AA8G455200                    160   1e-43   
ref|XP_010029845.1|  PREDICTED: zinc finger CCCH domain-containin...    160   2e-43   
ref|XP_003523019.1|  PREDICTED: zinc finger CCCH domain-containin...    160   2e-43   
ref|NP_001236280.1|  uncharacterized protein LOC100305757               159   3e-43   
gb|ABR25889.1|  unknown                                                 157   3e-43   Oryza sativa Indica Group [Indian rice]
gb|EMS51361.1|  hypothetical protein TRIUR3_16777                       158   3e-43   
ref|XP_006842642.1|  hypothetical protein AMTR_s00077p00189420          162   4e-43   
gb|KEH33322.1|  DUF3223 family protein                                  159   7e-43   
ref|NP_001049206.1|  Os03g0187000                                       158   1e-42   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001144806.1|  uncharacterized protein LOC100277882               158   1e-42   Zea mays [maize]
ref|XP_004985426.1|  PREDICTED: protein DCL, chloroplastic-like         155   1e-41   
ref|XP_010258340.1|  PREDICTED: uncharacterized protein LOC104598124    155   3e-41   
ref|XP_002319012.2|  hypothetical protein POPTR_0013s02280g             152   3e-41   Populus trichocarpa [western balsam poplar]
gb|KHN18554.1|  hypothetical protein glysoja_006967                     152   9e-41   
ref|XP_007155309.1|  hypothetical protein PHAVU_003G190000g             152   1e-40   
ref|XP_009403245.1|  PREDICTED: uncharacterized protein LOC103986852    152   1e-40   
gb|KHG30734.1|  DNA-directed RNA polymerase D subunit 1 -like pro...    151   3e-40   
ref|NP_001145212.1|  uncharacterized protein LOC100278469               152   3e-40   Zea mays [maize]
gb|KHG30737.1|  DNA-directed RNA polymerase D subunit 1 -like pro...    150   3e-40   
ref|XP_002319542.1|  hypothetical protein POPTR_0013s02340g             151   5e-40   Populus trichocarpa [western balsam poplar]
ref|XP_003550782.1|  PREDICTED: protein DCL, chloroplastic-like         150   8e-40   
ref|XP_010091522.1|  hypothetical protein L484_015949                   149   2e-39   
ref|XP_008795182.1|  PREDICTED: protein DCL, chloroplastic-like         143   1e-38   
gb|KHN32529.1|  Protein DCL, chloroplastic                              144   2e-38   
gb|KHN26248.1|  DNA-directed RNA polymerase E subunit 1                 144   2e-38   
emb|CBI15220.3|  unnamed protein product                                142   9e-38   
gb|ABF94367.1|  expressed protein                                       138   3e-36   Oryza sativa Japonica Group [Japonica rice]
gb|KHN48689.1|  DNA-directed RNA polymerase E subunit 1                 137   4e-36   
ref|XP_001753803.1|  predicted protein                                  134   9e-35   
ref|XP_002977413.1|  hypothetical protein SELMODRAFT_417447             137   2e-34   
ref|XP_002974996.1|  hypothetical protein SELMODRAFT_442719             136   3e-34   
ref|XP_001753605.1|  predicted protein                                  134   4e-34   
ref|XP_003609061.1|  hypothetical protein MTR_4g108450                  122   2e-29   
ref|XP_004497728.1|  PREDICTED: uncharacterized protein LOC101504695    116   4e-28   
ref|XP_004492623.1|  PREDICTED: uncharacterized protein LOC101492280    117   5e-28   
ref|XP_002500133.1|  predicted protein                                  112   1e-25   Micromonas commoda
dbj|BAB11494.1|  unnamed protein product                                105   2e-24   Arabidopsis thaliana [mouse-ear cress]
emb|CAN70579.1|  hypothetical protein VITISV_004014                     104   5e-24   Vitis vinifera
ref|XP_009615031.1|  PREDICTED: protein DCL, chloroplastic-like         102   2e-23   
emb|CEF98737.1|  Copper amine oxidase, N2/N3-terminal                   102   3e-22   
ref|XP_007514553.1|  predicted protein                                91.7    3e-18   
ref|XP_003057804.1|  predicted protein                                89.4    5e-18   
ref|XP_005646811.1|  hypothetical protein COCSUDRAFT_47805            90.1    3e-17   
ref|XP_001774741.1|  predicted protein                                78.6    3e-15   
ref|XP_005848324.1|  hypothetical protein CHLNCDRAFT_145004           81.6    9e-15   
ref|XP_002957335.1|  tRNA pseudouridine synthase mitochondrial pr...  84.0    2e-14   
ref|XP_001418710.1|  predicted protein                                75.9    5e-13   Ostreococcus lucimarinus CCE9901
ref|XP_003597253.1|  hypothetical protein MTR_2g094530                72.4    4e-12   
gb|KFM25263.1|  Guanine nucleotide-binding protein subunit beta-l...  74.3    2e-11   
gb|KDD73790.1|  hypothetical protein H632_c1835p1                     68.6    2e-10   
ref|XP_004348505.1|  RNA binding motif protein                        68.9    6e-10   
emb|CDY16774.1|  BnaA09g06080D                                        63.5    1e-09   
emb|CDX87249.1|  BnaC09g05640D                                        62.8    3e-09   
ref|XP_002504634.1|  predicted protein                                64.7    4e-08   Micromonas commoda
ref|WP_038069582.1|  hypothetical protein                             59.7    8e-08   
ref|WP_007120620.1|  MULTISPECIES: hypothetical protein               59.3    9e-08   
ref|XP_003063587.1|  predicted protein                                63.5    9e-08   
ref|XP_001755235.1|  predicted protein                                62.8    1e-07   
ref|XP_007136687.1|  hypothetical protein PHAVU_009G065400g           60.8    1e-07   
ref|WP_011805632.1|  hypothetical protein                             58.5    2e-07   
emb|CAD12248.1|  DCL protein                                          60.5    2e-07   Coffea arabica [arabica coffee]
ref|XP_002991942.1|  hypothetical protein SELMODRAFT_448611           61.6    2e-07   
ref|XP_009393664.1|  PREDICTED: protein DCL, chloroplastic isofor...  60.5    2e-07   
emb|CDP01368.1|  unnamed protein product                              60.5    2e-07   
ref|XP_007225808.1|  hypothetical protein PRUPE_ppa011355mg           59.7    3e-07   
tpg|DAA43777.1|  TPA: hypothetical protein ZEAMMB73_746378            58.9    3e-07   
ref|XP_002962468.1|  hypothetical protein SELMODRAFT_404272           59.3    4e-07   
ref|XP_011074428.1|  PREDICTED: protein DCL, chloroplastic            59.7    4e-07   
ref|NP_001235407.1|  uncharacterized protein LOC100306718             59.3    4e-07   
gb|KHG04572.1|  Protein DCL, chloroplastic                            59.3    5e-07   
gb|EYU36304.1|  hypothetical protein MIMGU_mgv1a013445mg              59.3    5e-07   
gb|ABC47855.1|  defective chloroplast and leaves protein              58.9    5e-07   Glycine max [soybeans]
ref|XP_006434757.1|  hypothetical protein CICLE_v10002377mg           59.3    5e-07   
ref|XP_008378043.1|  PREDICTED: protein DCL, chloroplastic            58.9    5e-07   
ref|XP_008367666.1|  PREDICTED: protein DCL, chloroplastic-like       58.9    6e-07   
gb|AFK33859.1|  unknown                                               59.3    6e-07   
dbj|BAB11495.1|  unnamed protein product                              57.8    7e-07   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006354878.1|  PREDICTED: protein DCL, chloroplastic-like       58.9    7e-07   
ref|XP_008797270.1|  PREDICTED: protein DCL, chloroplastic            58.9    7e-07   
ref|XP_002459901.1|  hypothetical protein SORBIDRAFT_02g014000        58.5    7e-07   Sorghum bicolor [broomcorn]
ref|NP_001148729.1|  LOC100282345                                     58.2    8e-07   Zea mays [maize]
ref|NP_001235676.1|  uncharacterized protein LOC100527410             58.5    9e-07   
ref|XP_004291102.1|  PREDICTED: protein DCL, chloroplastic-like       58.2    9e-07   
ref|XP_009359615.1|  PREDICTED: protein DCL, chloroplastic            58.2    1e-06   
ref|XP_002454603.1|  hypothetical protein SORBIDRAFT_04g034170        58.5    1e-06   Sorghum bicolor [broomcorn]
ref|XP_006838071.1|  hypothetical protein AMTR_s00091p00171300        56.2    1e-06   
ref|XP_010919205.1|  PREDICTED: DNA-directed RNA polymerase IV su...  60.1    1e-06   
ref|NP_001233874.1|  protein DCL, chloroplastic                       58.2    2e-06   
ref|XP_010552513.1|  PREDICTED: protein DCL, chloroplastic-like       57.8    2e-06   
ref|XP_010112190.1|  hypothetical protein L484_009556                 57.8    2e-06   
ref|XP_003603048.1|  Protein DCL                                      57.8    2e-06   
gb|AFK49399.1|  unknown                                               57.8    2e-06   
ref|XP_006473317.1|  PREDICTED: protein DCL, chloroplastic-like       57.8    2e-06   
dbj|BAD17127.1|  DCL protein-like                                     55.8    2e-06   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004501564.1|  PREDICTED: protein DCL, chloroplastic-like       57.4    2e-06   
ref|XP_008352141.1|  PREDICTED: protein DCL, chloroplastic-like       57.4    2e-06   
dbj|BAJ93491.1|  predicted protein                                    57.4    2e-06   
ref|XP_009793573.1|  PREDICTED: protein DCL, chloroplastic            57.4    2e-06   
ref|XP_011083836.1|  PREDICTED: protein DCL, chloroplastic-like       57.4    2e-06   
ref|XP_004954026.1|  PREDICTED: protein DCL, chloroplastic-like       57.4    3e-06   
gb|KDP38331.1|  hypothetical protein JCGZ_04256                       57.0    3e-06   
ref|XP_006649071.1|  PREDICTED: protein DCL, chloroplastic-like       56.2    3e-06   
ref|NP_001048223.1|  Os02g0766000                                     55.8    3e-06   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002989419.1|  hypothetical protein SELMODRAFT_29281            54.7    3e-06   
emb|CBI21428.3|  unnamed protein product                              55.1    3e-06   
ref|XP_010688879.1|  PREDICTED: protein DCL, chloroplastic            57.0    3e-06   
ref|XP_009107447.1|  PREDICTED: protein DCL, chloroplastic            56.6    4e-06   
ref|XP_008803255.1|  PREDICTED: DNA-directed RNA polymerase IV su...  58.9    4e-06   
ref|XP_008452556.1|  PREDICTED: protein DCL, chloroplastic            57.0    4e-06   
emb|CDY17057.1|  BnaA08g04210D                                        56.6    4e-06   
ref|XP_009627784.1|  PREDICTED: protein DCL, chloroplastic            57.0    4e-06   
ref|XP_006393639.1|  hypothetical protein EUTSA_v10011763mg           56.6    4e-06   
gb|KHG15662.1|  Protein DCL, chloroplastic                            56.6    5e-06   
ref|XP_004141259.1|  PREDICTED: protein DCL, chloroplastic-like       56.6    5e-06   
gb|EMT07000.1|  hypothetical protein F775_07046                       56.2    5e-06   
ref|XP_002282478.1|  PREDICTED: protein DCL, chloroplastic            56.2    5e-06   Vitis vinifera
ref|WP_012647889.1|  hypothetical protein                             56.2    5e-06   
emb|CDY43215.1|  BnaC08g04880D                                        56.2    5e-06   
ref|XP_010236078.1|  PREDICTED: protein DCL, chloroplastic            56.6    5e-06   
ref|WP_011388268.1|  hypothetical protein                             54.3    6e-06   
ref|NP_001031151.1|  uncharacterized protein                          56.2    6e-06   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007017215.1|  Uncharacterized protein isoform 1                55.8    7e-06   
ref|XP_004308588.1|  PREDICTED: DNA-directed RNA polymerase E sub...  58.2    7e-06   
ref|WP_018646984.1|  MULTISPECIES: hypothetical protein               53.9    7e-06   
ref|WP_008891939.1|  hypothetical protein                             53.9    7e-06   
ref|NP_683398.1|  uncharacterized protein                             55.8    8e-06   Arabidopsis thaliana [mouse-ear cress]
ref|WP_011084973.1|  MULTISPECIES: hypothetical protein               53.9    8e-06   
ref|XP_010263539.1|  PREDICTED: protein DCL, chloroplastic            55.8    9e-06   
gb|EMT19779.1|  hypothetical protein F775_42610                       54.7    9e-06   
ref|WP_011388568.1|  hypothetical protein                             53.9    9e-06   
ref|XP_011029161.1|  PREDICTED: DNA-directed RNA polymerase IV su...  57.4    9e-06   
ref|XP_010939420.1|  PREDICTED: protein DCL, chloroplastic            55.8    9e-06   
ref|WP_027516036.1|  hypothetical protein                             53.5    1e-05   
ref|XP_011014513.1|  PREDICTED: DNA-directed RNA polymerase IV su...  57.4    1e-05   
pdb|2K0M|A  Chain A, Solution Nmr Structure Of The Uncharacterize...  53.9    1e-05   
gb|KFK36162.1|  hypothetical protein AALP_AA4G086100                  55.5    1e-05   
ref|XP_006304196.1|  hypothetical protein CARUB_v10010275mg           55.1    1e-05   
ref|XP_002894020.1|  hypothetical protein ARALYDRAFT_473852           55.1    1e-05   
ref|XP_006573757.1|  PREDICTED: DNA-directed RNA polymerase IV su...  57.0    1e-05   
ref|XP_003611164.1|  DNA-directed RNA polymerase subunit beta         57.0    1e-05   
gb|AES94122.2|  DNA-directed RNA polymerase                           57.0    1e-05   
ref|XP_010461498.1|  PREDICTED: protein DCL, chloroplastic-like       55.1    1e-05   
ref|XP_010479096.1|  PREDICTED: protein DCL, chloroplastic-like       55.1    1e-05   
ref|XP_010500205.1|  PREDICTED: protein DCL, chloroplastic            55.1    1e-05   
ref|XP_009133402.1|  PREDICTED: DNA-directed RNA polymerase V sub...  57.0    2e-05   
ref|XP_011017195.1|  PREDICTED: protein DCL, chloroplastic-like       54.7    2e-05   
ref|XP_002284778.1|  PREDICTED: protein DCL, chloroplastic            54.7    2e-05   Vitis vinifera
gb|EYU25429.1|  hypothetical protein MIMGU_mgv1a021420mg              54.7    2e-05   
ref|XP_010059925.1|  PREDICTED: protein DCL, chloroplastic            55.1    2e-05   
gb|KHN37673.1|  DNA-directed RNA polymerase E subunit 1               56.6    2e-05   
ref|NP_001062578.1|  Os09g0112400                                     53.5    2e-05   Oryza sativa Japonica Group [Japonica rice]
ref|XP_003541591.1|  PREDICTED: DNA-directed RNA polymerase V sub...  56.6    2e-05   
ref|WP_008120591.1|  hypothetical protein                             52.8    2e-05   
gb|EAZ24730.1|  hypothetical protein OsJ_08502                        55.5    2e-05   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006590533.1|  PREDICTED: DNA-directed RNA polymerase IV su...  56.2    2e-05   
gb|EMS54113.1|  Protein DCL, chloroplastic                            53.1    2e-05   
ref|XP_008348940.1|  PREDICTED: DNA-directed RNA polymerase V sub...  55.8    3e-05   
ref|XP_006573756.1|  PREDICTED: DNA-directed RNA polymerase IV su...  56.2    3e-05   
ref|XP_006573755.1|  PREDICTED: DNA-directed RNA polymerase IV su...  56.2    3e-05   
ref|XP_006573754.1|  PREDICTED: DNA-directed RNA polymerase IV su...  56.2    3e-05   
gb|KHN04477.1|  Protein DCL, chloroplastic                            53.5    3e-05   
ref|XP_004140346.1|  PREDICTED: LOW QUALITY PROTEIN: DNA-directed...  55.8    3e-05   
ref|XP_007158453.1|  hypothetical protein PHAVU_002G153700g           55.8    3e-05   
ref|XP_007158454.1|  hypothetical protein PHAVU_002G153700g           55.8    3e-05   
ref|XP_010108047.1|  DNA-directed RNA polymerase D subunit 1          55.8    3e-05   
ref|XP_006598109.1|  PREDICTED: DNA-directed RNA polymerase V sub...  55.8    3e-05   
gb|KHN27337.1|  DNA-directed RNA polymerase E subunit 1               55.8    3e-05   
ref|XP_008465860.1|  PREDICTED: DNA-directed RNA polymerase V sub...  55.8    3e-05   
gb|KGN51090.1|  hypothetical protein Csa_5G435050                     55.8    3e-05   
ref|XP_004155767.1|  PREDICTED: DNA-directed RNA polymerase E sub...  55.8    3e-05   
gb|KHN34995.1|  DNA-directed RNA polymerase D subunit 1               55.8    3e-05   
gb|KDP25521.1|  hypothetical protein JCGZ_20677                       55.8    3e-05   
gb|EPS74753.1|  hypothetical protein M569_00001                       55.8    4e-05   
gb|EPS63154.1|  hypothetical protein M569_11634                       52.4    4e-05   
ref|XP_007017220.1|  Uncharacterized protein isoform 6                53.9    4e-05   
ref|XP_007133762.1|  hypothetical protein PHAVU_011G206900g           55.8    4e-05   
ref|XP_010093644.1|  hypothetical protein L484_011068                 53.5    4e-05   
ref|XP_010512942.1|  PREDICTED: DNA-directed RNA polymerase V sub...  55.5    4e-05   
emb|CDY60335.1|  BnaC03g72290D                                        55.5    4e-05   
ref|XP_010412959.1|  PREDICTED: DNA-directed RNA polymerase V sub...  55.5    5e-05   
ref|XP_010509007.1|  PREDICTED: LOW QUALITY PROTEIN: DNA-directed...  55.5    5e-05   
ref|XP_004511611.1|  PREDICTED: DNA-directed RNA polymerase D sub...  55.5    5e-05   
ref|XP_004511607.1|  PREDICTED: DNA-directed RNA polymerase D sub...  55.5    5e-05   
ref|NP_001141526.1|  uncharacterized protein LOC100273638             53.5    5e-05   Zea mays [maize]
ref|XP_008351988.1|  PREDICTED: protein DCL, chloroplastic-like i...  53.1    5e-05   
ref|XP_002302436.1|  hypothetical protein POPTR_0002s12730g           53.1    5e-05   Populus trichocarpa [western balsam poplar]
ref|XP_003573687.1|  PREDICTED: protein DCL, chloroplastic-like       52.8    5e-05   
ref|WP_011975386.1|  hypothetical protein                             51.6    5e-05   
ref|XP_008231662.1|  PREDICTED: DNA-directed RNA polymerase V sub...  55.1    6e-05   
ref|XP_009593318.1|  PREDICTED: DNA-directed RNA polymerase IV su...  55.1    6e-05   
ref|XP_009797468.1|  PREDICTED: DNA-directed RNA polymerase IV su...  55.1    6e-05   
ref|XP_011081158.1|  PREDICTED: DNA-directed RNA polymerase IV su...  55.1    6e-05   
ref|WP_015069800.1|  hypothetical protein                             51.6    6e-05   
ref|XP_003523609.1|  PREDICTED: protein DCL, chloroplastic-like       53.1    6e-05   
ref|XP_007218881.1|  hypothetical protein PRUPE_ppa000088mg           55.1    6e-05   
ref|XP_009797463.1|  PREDICTED: DNA-directed RNA polymerase IV su...  55.1    6e-05   
gb|EYU38999.1|  hypothetical protein MIMGU_mgv1a000239mg              55.1    6e-05   
ref|XP_009593317.1|  PREDICTED: DNA-directed RNA polymerase IV su...  55.1    6e-05   
ref|XP_010676559.1|  PREDICTED: DNA-directed RNA polymerase IV su...  55.1    7e-05   
ref|WP_033446681.1|  hypothetical protein                             52.0    7e-05   
ref|XP_010053343.1|  PREDICTED: DNA-directed RNA polymerase IV su...  54.7    8e-05   
ref|XP_010943194.1|  PREDICTED: protein DCL, chloroplastic            52.4    8e-05   
ref|WP_010183323.1|  hypothetical protein                             51.2    8e-05   
ref|XP_009361958.1|  PREDICTED: DNA-directed RNA polymerase V sub...  54.7    8e-05   
ref|XP_006374928.1|  hypothetical protein POPTR_0014s02820g           52.8    9e-05   
ref|XP_007226523.1|  hypothetical protein PRUPE_ppa024709mg           51.6    9e-05   
ref|WP_009374911.1|  hypothetical protein                             50.8    9e-05   
gb|KGN55963.1|  hypothetical protein Csa_3G039340                     54.3    9e-05   
ref|XP_004147993.1|  PREDICTED: DNA-directed RNA polymerase D sub...  54.3    1e-04   
ref|XP_008448971.1|  PREDICTED: LOW QUALITY PROTEIN: DNA-directed...  54.3    1e-04   
ref|XP_002509696.1|  DNA-directed RNA polymerase, putative            54.3    1e-04   Ricinus communis
ref|XP_011029859.1|  PREDICTED: protein DCL, chloroplastic            52.4    1e-04   
ref|XP_008351987.1|  PREDICTED: protein DCL, chloroplastic-like i...  52.4    1e-04   
gb|KDP41687.1|  hypothetical protein JCGZ_16094                       52.0    1e-04   
ref|WP_002714803.1|  hypothetical protein                             52.4    1e-04   
ref|XP_010661376.1|  PREDICTED: DNA-directed RNA polymerase IV su...  53.9    1e-04   
emb|CDP09818.1|  unnamed protein product                              53.9    1e-04   
ref|XP_010094661.1|  hypothetical protein L484_008893                 52.4    1e-04   
ref|XP_010269801.1|  PREDICTED: protein DCL, chloroplastic-like       52.4    2e-04   
ref|WP_008134936.1|  hypothetical protein                             50.1    2e-04   
ref|XP_002510210.1|  DCL protein, chloroplast precursor, putative     52.0    2e-04   
ref|XP_008378000.1|  PREDICTED: protein DCL, chloroplastic-like       51.6    2e-04   
ref|XP_008375320.1|  PREDICTED: DNA-directed RNA polymerase V sub...  53.5    2e-04   
ref|WP_018791465.1|  hypothetical protein                             52.0    2e-04   
ref|XP_007136710.1|  hypothetical protein PHAVU_009G067500g           51.6    2e-04   
dbj|BAJ90337.1|  predicted protein                                    51.2    2e-04   
ref|WP_018586305.1|  hypothetical protein                             52.0    2e-04   
ref|XP_008220273.1|  PREDICTED: protein DCL, chloroplastic            51.6    2e-04   
gb|ABK26866.1|  unknown                                               52.4    2e-04   
gb|EMT22317.1|  DNA-directed RNA polymerase III subunit RPC1          53.5    2e-04   
ref|XP_007017218.1|  Uncharacterized protein isoform 4                51.6    2e-04   
ref|XP_009360061.1|  PREDICTED: protein DCL, chloroplastic-like       51.6    2e-04   
emb|CBI34757.3|  unnamed protein product                              53.1    2e-04   
ref|WP_023752066.1|  MULTISPECIES: hypothetical protein               49.7    2e-04   
ref|XP_007160882.1|  hypothetical protein PHAVU_001G024800g           50.8    3e-04   
gb|KCV33622.1|  PF11523 family protein                                49.7    3e-04   
ref|XP_010661369.1|  PREDICTED: DNA-directed RNA polymerase IV su...  53.1    3e-04   
gb|ESY14377.1|  hypothetical protein X751_26805                       49.3    3e-04   
ref|XP_009776877.1|  PREDICTED: uncharacterized protein LOC104226...  50.4    3e-04   
ref|XP_004956292.1|  PREDICTED: protein DCL, chloroplastic-like       50.8    3e-04   
ref|XP_010661365.1|  PREDICTED: DNA-directed RNA polymerase IV su...  52.8    3e-04   
ref|WP_019488384.1|  hypothetical protein                             51.6    3e-04   
ref|XP_011029320.1|  PREDICTED: protein DCL, chloroplastic-like       50.8    3e-04   
ref|XP_011020393.1|  PREDICTED: DNA-directed RNA polymerase V sub...  52.8    3e-04   
ref|XP_009354160.1|  PREDICTED: protein DCL, chloroplastic-like       50.8    4e-04   
ref|XP_007010999.1|  DNA-directed RNA polymerase E subunit 1, put...  52.8    4e-04   
ref|XP_006659296.1|  PREDICTED: protein DCL, chloroplastic-like       50.4    4e-04   
ref|XP_006411250.1|  hypothetical protein EUTSA_v10016128mg           52.4    4e-04   
ref|XP_009354163.1|  PREDICTED: protein DCL, chloroplastic-like       50.8    4e-04   
ref|NP_001148429.1|  DCL protein                                      50.4    4e-04   
ref|XP_006855235.1|  hypothetical protein AMTR_s00051p00224060        50.4    4e-04   
ref|XP_008452601.1|  PREDICTED: protein DCL, chloroplastic            50.4    5e-04   
ref|XP_004141276.1|  PREDICTED: protein DCL, chloroplastic-like       50.1    5e-04   
ref|XP_006470866.1|  PREDICTED: DNA-directed RNA polymerase V sub...  52.4    5e-04   
gb|KGN55233.1|  hypothetical protein Csa_4G641650                     50.4    5e-04   
ref|XP_006420718.1|  hypothetical protein CICLE_v10004129mg           52.4    5e-04   
emb|CDP01288.1|  unnamed protein product                              50.4    5e-04   
dbj|BAJ90438.1|  predicted protein                                    50.1    5e-04   
ref|XP_006358859.1|  PREDICTED: DNA-directed RNA polymerase IV su...  52.0    5e-04   
ref|XP_007017144.1|  Uncharacterized protein TCM_033766               50.1    5e-04   
ref|XP_010534197.1|  PREDICTED: DNA-directed RNA polymerase V sub...  52.0    5e-04   
gb|KDO53583.1|  hypothetical protein CISIN_1g0002912mg                52.0    6e-04   
gb|KHN22486.1|  DNA-directed RNA polymerase E subunit 1               49.3    6e-04   
ref|WP_032808334.1|  hypothetical protein                             48.5    6e-04   
gb|AAB95289.1|  unknown protein                                       52.0    6e-04   
ref|XP_002879839.1|  NRPD1b                                           52.0    6e-04   
dbj|BAG95839.1|  unnamed protein product                              49.3    6e-04   
gb|AET02314.2|  DNA-directed RNA polymerase                           52.0    6e-04   
ref|XP_006358858.1|  PREDICTED: DNA-directed RNA polymerase IV su...  52.0    6e-04   
ref|XP_008813811.1|  PREDICTED: protein DCL, chloroplastic            49.7    7e-04   
ref|XP_004238128.1|  PREDICTED: protein DCL, chloroplastic            49.7    7e-04   
ref|XP_003627838.1|  DNA-directed RNA polymerase subunit              51.6    7e-04   
ref|XP_006354844.1|  PREDICTED: protein DCL, chloroplastic-like       49.7    7e-04   
gb|AAQ56405.1|  putative defective chloroplasts and leaves (DCL) ...  49.7    7e-04   
ref|XP_003627850.1|  Protein DCL                                      51.2    7e-04   
ref|XP_003550320.1|  PREDICTED: DNA-directed RNA polymerase V sub...  49.3    7e-04   
ref|WP_018827610.1|  hypothetical protein                             50.1    7e-04   
gb|AAY89362.1|  RNA polymerase IV largest subunit                     51.6    8e-04   
ref|NP_181532.2|  nuclear RNA polymerase D1B                          51.6    8e-04   
ref|WP_028184335.1|  hypothetical protein                             50.1    8e-04   
ref|WP_033422067.1|  hypothetical protein                             49.7    8e-04   
ref|XP_008378172.1|  PREDICTED: uncharacterized protein LOC103441252  50.4    9e-04   
ref|XP_002303926.2|  hypothetical protein POPTR_0003s19630g           51.6    9e-04   
ref|XP_011069724.1|  PREDICTED: protein DCL, chloroplastic            49.7    9e-04   
ref|XP_002466454.1|  hypothetical protein SORBIDRAFT_01g008000        49.3    9e-04   
ref|XP_006293553.1|  hypothetical protein CARUB_v10022497mg           51.2    9e-04   
ref|XP_009411452.1|  PREDICTED: DNA-directed RNA polymerase IV su...  51.2    0.001   
ref|XP_010548418.1|  PREDICTED: protein DCL, chloroplastic-like       49.3    0.001   
ref|XP_009411449.1|  PREDICTED: DNA-directed RNA polymerase IV su...  51.2    0.001   
gb|EMT14856.1|  hypothetical protein F775_12212                       49.3    0.001   
ref|XP_004291069.1|  PREDICTED: protein DCL, chloroplastic-like       49.3    0.001   
ref|XP_010538119.1|  PREDICTED: protein DCL, chloroplastic isofor...  49.7    0.001   



>ref|XP_009587068.1| PREDICTED: protein DCL, chloroplastic-like [Nicotiana tomentosiformis]
Length=229

 Score =   201 bits (511),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 112/184 (61%), Positives = 142/184 (77%), Gaps = 5/184 (3%)
 Frame = +1

Query  127  SENMDVETNSPEDLAAENGGAAKrpreegdepdnddngdASKKTKVQNPEEEQKVETLeg  306
            +++MDVE  + +D AAENG + +   EE +EP+N+D   A+KK KV    EEQ++E L+G
Sbjct  27   AQDMDVEAQTADD-AAENGSSKRPREEEKNEPENED---ATKKLKVDKSVEEQRLENLDG  82

Query  307  kesaaegekkedksgPVTLGPKTFVSSVEMFDYFYKLLHSWSTNLNVNKYEHLVLLELLN  486
             E+A + EKK     P ++G K F SSVEMFDYFYKLLHSWS NLN+NKYEHLVLL+LL 
Sbjct  83   SETAVDEEKKNGSG-PASVGSKNFWSSVEMFDYFYKLLHSWSPNLNLNKYEHLVLLDLLK  141

Query  487  KGHPEPEKKIGKGVGGFQVRFHPKYKSRCFFITGEDGSSDDFSFRKCVDNILPLPENMPI  666
            KGH EP++KIG G+  FQ+RFHP++KSRCFF+  EDGS DDFSFRKCVD+ILPLPENM +
Sbjct  142  KGHLEPDRKIGTGIRAFQIRFHPQFKSRCFFVIREDGSVDDFSFRKCVDHILPLPENMQV  201

Query  667  KHDT  678
            KH+ 
Sbjct  202  KHEA  205



>ref|XP_009614786.1| PREDICTED: protein DCL, chloroplastic-like [Nicotiana tomentosiformis]
Length=215

 Score =   198 bits (504),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 115/203 (57%), Positives = 140/203 (69%), Gaps = 21/203 (10%)
 Frame = +1

Query  76   MAEQTPEVPDTVA----EKASSENMDVETNSPEDLAAENGGAAKrpreegdepdnddngd  243
            MAE  P+ P+TVA    E+ S++ MDVE  + +  AAENGG+ +   E  +   N +NGD
Sbjct  1    MAETEPQAPETVAQTEKEETSAQKMDVEAQAAD-DAAENGGSKRLREEGDELEVNGENGD  59

Query  244  ASKKTKVQNPEEEQKVETLegkesaaegekkedksgPVTLGPKTFVSSVEMFDYFYKLLH  423
            A+KK KV N  EE+K +                 S PVT+GPK+F SSVEMFDYFYKLLH
Sbjct  60   ATKKPKVDNFVEEKKKDG----------------SDPVTVGPKSFGSSVEMFDYFYKLLH  103

Query  424  SWSTNLNVNKYEHLVLLELLNKGHPEPEKKIGKGVGGFQVRFHPKYKSRCFFITGEDGSS  603
            SW+ NLN+NKYE +VLL+LL KGH EPEKKIG GV  FQ+RFHP++KSRCFF+  ED S 
Sbjct  104  SWTLNLNLNKYEQVVLLDLLKKGHSEPEKKIGTGVRAFQIRFHPQFKSRCFFVVREDDSV  163

Query  604  DDFSFRKCVDNILPLPENMPIKH  672
            DDFSFRKCVD I PLP NM +KH
Sbjct  164  DDFSFRKCVDQIQPLPANMQVKH  186



>ref|XP_006354776.1| PREDICTED: protein DCL, chloroplastic-like [Solanum tuberosum]
Length=226

 Score =   196 bits (498),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 106/188 (56%), Positives = 136/188 (72%), Gaps = 7/188 (4%)
 Frame = +1

Query  115  EKASSENMDVETNSPEDLAAENGGAAKrpreegdepdnddngdASKKTKVQNPEEEQKVE  294
            E  S+++MDVE  + +D   ENGG+ +   EE +  + D     +KK KV    EE++ E
Sbjct  23   EDTSAQDMDVEAQAADD-TEENGGSKRPREEENEVENED----VTKKLKVDKSVEEERFE  77

Query  295  TLegkesaaegekkedksgPVTLGPKTFVSSVEMFDYFYKLLHSWSTNLNVNKYEHLVLL  474
             L+G ++  E +K E    PV++GPK F SSVEMFDYFYKLLHSWS NLN+NKYEH+VLL
Sbjct  78   NLDGSKTVEEEKKYESG--PVSVGPKNFGSSVEMFDYFYKLLHSWSPNLNLNKYEHIVLL  135

Query  475  ELLNKGHPEPEKKIGKGVGGFQVRFHPKYKSRCFFITGEDGSSDDFSFRKCVDNILPLPE  654
            +LL KGH EP++KIG GV  FQ+RFHP++KSRCFF+  ED S DDFSFRKCVD+I PLPE
Sbjct  136  DLLKKGHLEPDRKIGTGVRAFQIRFHPQFKSRCFFVIREDDSVDDFSFRKCVDHISPLPE  195

Query  655  NMPIKHDT  678
            NM +KH+ 
Sbjct  196  NMQVKHEA  203



>ref|XP_009768743.1| PREDICTED: protein DCL, chloroplastic-like [Nicotiana sylvestris]
Length=235

 Score =   196 bits (498),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 98/145 (68%), Positives = 117/145 (81%), Gaps = 1/145 (1%)
 Frame = +1

Query  244  ASKKTKVQNPEEEQKVETLegkesaaegekkedksgPVTLGPKTFVSSVEMFDYFYKLLH  423
            ASKK KV    EEQ++E L+G E+A + EKK     P ++GPK F SSVEMFDYFYKLLH
Sbjct  62   ASKKLKVDKSVEEQRLENLDGSETAVDEEKKNGSG-PASVGPKNFGSSVEMFDYFYKLLH  120

Query  424  SWSTNLNVNKYEHLVLLELLNKGHPEPEKKIGKGVGGFQVRFHPKYKSRCFFITGEDGSS  603
            SWS NLN+NKYEHLVLL+LL KGH EP++KIG G+  FQ+RFHP++KSRCFF+  EDGS 
Sbjct  121  SWSPNLNLNKYEHLVLLDLLKKGHLEPDRKIGTGIRAFQIRFHPQFKSRCFFVIREDGSV  180

Query  604  DDFSFRKCVDNILPLPENMPIKHDT  678
            DDFSFRKCVD+ILPLPENM +KH+ 
Sbjct  181  DDFSFRKCVDHILPLPENMQVKHEA  205



>ref|XP_004299358.1| PREDICTED: uncharacterized protein LOC101304576 [Fragaria vesca 
subsp. vesca]
Length=218

 Score =   194 bits (492),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 108/204 (53%), Positives = 139/204 (68%), Gaps = 15/204 (7%)
 Frame = +1

Query  76   MAEQT-PEVPDTVAEKASSENMDVETNSPEDL-AAENGGAAKrpreegdepdnddngdAS  249
            MAE T  E+ DT     ++E+MD+ET   +++  A+NG A  +   E +E +      A+
Sbjct  1    MAETTVAEIADT---NPAAEDMDLETAPAQNIDEAQNGDATAKRAREEEEAEESGGDGAA  57

Query  250  KKTKVQ-NPEEEQKVETLegkesaaegekkedksgPVTLGPKTFVSSVEMFDYFYKLLHS  426
            KK KV+    EEQ++E L   E+ A           V+LGPK+F S+VEMFDYFYKLLH 
Sbjct  58   KKAKVEEKSAEEQRLEKLGEGENGAGR---------VSLGPKSFGSAVEMFDYFYKLLHY  108

Query  427  WSTNLNVNKYEHLVLLELLNKGHPEPEKKIGKGVGGFQVRFHPKYKSRCFFITGEDGSSD  606
            W T+LN+NKYE+LVLL+LL KGH EP+KKIG G+  FQVRFHP Y+SRC+F+  EDG+SD
Sbjct  109  WPTDLNINKYEYLVLLDLLKKGHSEPDKKIGGGIQAFQVRFHPLYRSRCYFLVREDGASD  168

Query  607  DFSFRKCVDNILPLPENMPIKHDT  678
            DFSFRKCVD+ILPLPENM    D 
Sbjct  169  DFSFRKCVDHILPLPENMKAHGDA  192



>ref|XP_009778685.1| PREDICTED: protein DCL, chloroplastic-like isoform X2 [Nicotiana 
sylvestris]
Length=216

 Score =   192 bits (489),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 110/203 (54%), Positives = 140/203 (69%), Gaps = 21/203 (10%)
 Frame = +1

Query  76   MAEQTPEVPDTVA----EKASSENMDVETNSPEDLAAENGGAAKrpreegdepdnddngd  243
            MAE  P+  +TVA    E+AS++ MDVE  + +  AAENG + +   E  +   N +NGD
Sbjct  1    MAETEPQASETVAQTEKEEASAQKMDVEAQAAD-DAAENGSSKRLREEGDELEVNGENGD  59

Query  244  ASKKTKVQNPEEEQKVETLegkesaaegekkedksgPVTLGPKTFVSSVEMFDYFYKLLH  423
            A+KK KV+N  +E+K +                 S PV++G K+F SSVEMFDYFYKLLH
Sbjct  60   ATKKPKVENSVQEEKKDG----------------SDPVSVGSKSFGSSVEMFDYFYKLLH  103

Query  424  SWSTNLNVNKYEHLVLLELLNKGHPEPEKKIGKGVGGFQVRFHPKYKSRCFFITGEDGSS  603
            SW+ NL++NKYEH++LL+LL KGH EPEKKIG GV  FQ+RFHP++KSRCFF+  ED S 
Sbjct  104  SWTLNLDLNKYEHMLLLDLLKKGHSEPEKKIGTGVRSFQIRFHPQFKSRCFFVVREDDSV  163

Query  604  DDFSFRKCVDNILPLPENMPIKH  672
            DDFSFRKCVD I PLP NM +KH
Sbjct  164  DDFSFRKCVDQIQPLPANMQVKH  186



>ref|XP_004241584.1| PREDICTED: protein DCL, chloroplastic-like [Solanum lycopersicum]
Length=227

 Score =   193 bits (490),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 103/188 (55%), Positives = 135/188 (72%), Gaps = 7/188 (4%)
 Frame = +1

Query  115  EKASSENMDVETNSPEDLAAENGGAAKrpreegdepdnddngdASKKTKVQNPEEEQKVE  294
            E  S+++MDVE  + +D   ENGG+ +   EE +    D    A+KK KV    EE++ E
Sbjct  24   EDTSAQDMDVEAQAADD-TEENGGSKRPREEENEVEKED----ATKKLKVDKSVEEERFE  78

Query  295  TLegkesaaegekkedksgPVTLGPKTFVSSVEMFDYFYKLLHSWSTNLNVNKYEHLVLL  474
             L+G ++  E +K      P+++GPK F SSVE+F+YFYKLLHSWS NLN+NKYE++VLL
Sbjct  79   NLDGSKTVDEEKKDVSG--PISVGPKNFGSSVEVFNYFYKLLHSWSPNLNLNKYEYIVLL  136

Query  475  ELLNKGHPEPEKKIGKGVGGFQVRFHPKYKSRCFFITGEDGSSDDFSFRKCVDNILPLPE  654
            +LL KGH EP++KIG GV  FQ+RFHP+YKSRCFFI  ED S DDFSFRKC+D+I PLPE
Sbjct  137  DLLKKGHLEPDRKIGTGVRAFQIRFHPQYKSRCFFIIREDDSVDDFSFRKCIDHISPLPE  196

Query  655  NMPIKHDT  678
            NM +KH+ 
Sbjct  197  NMQVKHEA  204



>ref|XP_006364595.1| PREDICTED: protein DCL, chloroplastic-like [Solanum tuberosum]
Length=205

 Score =   190 bits (482),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 100/186 (54%), Positives = 123/186 (66%), Gaps = 20/186 (11%)
 Frame = +1

Query  115  EKASSENMDVETNSPEDLAAENGGAAKrpreegdepdnddngdASKKTKVQNPEEEQKVE  294
            E+ S + MDVE  + +D    NGG+ +   E     D ++  D  K    Q+ EEE+K  
Sbjct  18   EETSVQKMDVEVPAVDDA---NGGSKRPREEGDKLEDEENGDDTKKPRVDQSVEEEKKDV  74

Query  295  TLegkesaaegekkedksgPVTLGPKTFVSSVEMFDYFYKLLHSWSTNLNVNKYEHLVLL  474
            ++                 PV++G K+FVSSVEMFDYFYKLLHSWS NLN+NKYEH+VLL
Sbjct  75   SV-----------------PVSVGSKSFVSSVEMFDYFYKLLHSWSVNLNLNKYEHMVLL  117

Query  475  ELLNKGHPEPEKKIGKGVGGFQVRFHPKYKSRCFFITGEDGSSDDFSFRKCVDNILPLPE  654
            +LL KGH EPE+KIG GVG FQ+RFHP +KSRCFF+  ED + DDFSFRKCVD I PLPE
Sbjct  118  DLLKKGHSEPERKIGTGVGAFQIRFHPHFKSRCFFVVREDDTVDDFSFRKCVDQIQPLPE  177

Query  655  NMPIKH  672
            NM  KH
Sbjct  178  NMQTKH  183



>gb|EYU24371.1| hypothetical protein MIMGU_mgv1a013650mg [Erythranthe guttata]
Length=214

 Score =   187 bits (474),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 101/204 (50%), Positives = 139/204 (68%), Gaps = 15/204 (7%)
 Frame = +1

Query  76   MAEQT-PEVPDTVAEKASSENMDVETNSPEDLAAENGGAAKrpreegdepdnddngdASK  252
            MAE+  PEVP  +  KA      + T++   + +ENGG+ +   E      N       K
Sbjct  1    MAEEAAPEVPMELEPKAQ-----ISTDANPAVDSENGGSKRAREEVEAPEQN-----GDK  50

Query  253  KTKVQNPE--EEQKVETLegkesaaegekkedksgPVTLGPKTFVSSVEMFDYFYKLLHS  426
            K K+++ +  EE+++E+        +  ++++  G  T+GPKTF SSVEMFDYFYKLLH+
Sbjct  51   KAKIEDEKSSEERRLES--SGGGDDKMVEEKESGGAATIGPKTFGSSVEMFDYFYKLLHA  108

Query  427  WSTNLNVNKYEHLVLLELLNKGHPEPEKKIGKGVGGFQVRFHPKYKSRCFFITGEDGSSD  606
            W+ NLN+NKYEH+++LELL KGH E ++KIGKG+  FQVRFHPK+ SRCFF+T ED ++D
Sbjct  109  WTPNLNINKYEHMMVLELLKKGHLEADRKIGKGIKAFQVRFHPKFHSRCFFLTREDDTTD  168

Query  607  DFSFRKCVDNILPLPENMPIKHDT  678
            DFSFRKCVD ILPLPENM +K+D 
Sbjct  169  DFSFRKCVDQILPLPENMQVKNDV  192



>ref|XP_008239940.1| PREDICTED: protein DCL, chloroplastic [Prunus mume]
Length=226

 Score =   186 bits (472),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 107/207 (52%), Positives = 135/207 (65%), Gaps = 16/207 (8%)
 Frame = +1

Query  76   MAEQT-PEVPDTVAE-KASSENMDVETNSPEDLA----AENGGAAKrpreegdepdnddn  237
            MAE+T  E+ +T +E  A++E+M++E + P          NG A    +   DE  ++ N
Sbjct  1    MAEKTVSELAETNSETAAAAEDMELEASEPAPAEKPDEGTNGEAEANAKRLRDEEGSEGN  60

Query  238  gdASKKTKVQNPEEEQKVETLegkesaaegekkedksgPVTLGPKTFVSSVEMFDYFYKL  417
               +KKTKV+   EE+++E L   + +            V+LGPK+F SSVEMFDYFYKL
Sbjct  61   DAVAKKTKVEKSPEEERLEKLGEGKESGR----------VSLGPKSFGSSVEMFDYFYKL  110

Query  418  LHSWSTNLNVNKYEHLVLLELLNKGHPEPEKKIGKGVGGFQVRFHPKYKSRCFFITGEDG  597
            LH W T+L+VNKYEHLVLL+LL KGH EP+KKIG GV  FQVR HP YKSRCFF+  ED 
Sbjct  111  LHYWPTDLSVNKYEHLVLLDLLKKGHAEPDKKIGGGVHAFQVRTHPLYKSRCFFLIREDE  170

Query  598  SSDDFSFRKCVDNILPLPENMPIKHDT  678
            + DDFSFRKCVD ILPLPENM    D 
Sbjct  171  AVDDFSFRKCVDQILPLPENMKAHSDA  197



>ref|XP_009778678.1| PREDICTED: protein DCL, chloroplastic-like isoform X1 [Nicotiana 
sylvestris]
Length=234

 Score =   186 bits (472),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 109/220 (50%), Positives = 139/220 (63%), Gaps = 37/220 (17%)
 Frame = +1

Query  76   MAEQTPEVPDTVA----EKASSENMDVETNSPEDLAAE-----------------NGGAA  192
            MAE  P+  +TVA    E+AS++ MDVE  + +D A                   NG + 
Sbjct  1    MAETEPQASETVAQTEKEEASAQKMDVEAQAADDAAESGGSKRHVEAQAADDAAENGSSK  60

Query  193  KrpreegdepdnddngdASKKTKVQNPEEEQKVETLegkesaaegekkedksgPVTLGPK  372
            +   E  +   N +NGDA+KK KV+N  +E+K +                 S PV++G K
Sbjct  61   RLREEGDELEVNGENGDATKKPKVENSVQEEKKDG----------------SDPVSVGSK  104

Query  373  TFVSSVEMFDYFYKLLHSWSTNLNVNKYEHLVLLELLNKGHPEPEKKIGKGVGGFQVRFH  552
            +F SSVEMFDYFYKLLHSW+ NL++NKYEH++LL+LL KGH EPEKKIG GV  FQ+RFH
Sbjct  105  SFGSSVEMFDYFYKLLHSWTLNLDLNKYEHMLLLDLLKKGHSEPEKKIGTGVRSFQIRFH  164

Query  553  PKYKSRCFFITGEDGSSDDFSFRKCVDNILPLPENMPIKH  672
            P++KSRCFF+  ED S DDFSFRKCVD I PLP NM +KH
Sbjct  165  PQFKSRCFFVVREDDSVDDFSFRKCVDQIQPLPANMQVKH  204



>emb|CDP12303.1| unnamed protein product [Coffea canephora]
Length=246

 Score =   186 bits (473),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 81/109 (74%), Positives = 94/109 (86%), Gaps = 0/109 (0%)
 Frame = +1

Query  352  PVTLGPKTFVSSVEMFDYFYKLLHSWSTNLNVNKYEHLVLLELLNKGHPEPEKKIGKGVG  531
            PV LGPK+F SSVEMFDYFYK LH W+ N+NVNKYEH++LLEL+ KGH EP+KKIG G+ 
Sbjct  106  PVELGPKSFESSVEMFDYFYKFLHFWTPNVNVNKYEHVMLLELIKKGHLEPDKKIGNGIR  165

Query  532  GFQVRFHPKYKSRCFFITGEDGSSDDFSFRKCVDNILPLPENMPIKHDT  678
             FQVR+HPK+KSRCFF+T ED S DDFSFRKCVD+ILPLPENM +KHD 
Sbjct  166  AFQVRYHPKFKSRCFFLTREDDSVDDFSFRKCVDHILPLPENMQVKHDV  214



>ref|XP_007209564.1| hypothetical protein PRUPE_ppa011021mg [Prunus persica]
 gb|EMJ10763.1| hypothetical protein PRUPE_ppa011021mg [Prunus persica]
Length=226

 Score =   186 bits (471),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 106/207 (51%), Positives = 135/207 (65%), Gaps = 16/207 (8%)
 Frame = +1

Query  76   MAEQT-PEVPDTVAE-KASSENMDVETNSPEDLA----AENGGAAKrpreegdepdnddn  237
            MAE+T  E+ +T +E  A++E+M++E + P          NG A    +   DE  ++ N
Sbjct  1    MAEKTVSELAETNSETAAAAEDMELEASEPAPAEKPDEGTNGEAEANAKRLRDEEGSEGN  60

Query  238  gdASKKTKVQNPEEEQKVETLegkesaaegekkedksgPVTLGPKTFVSSVEMFDYFYKL  417
               +KKTKV+   EE+++E L   + +            V+LGPK+F SSVEMFDYFY+L
Sbjct  61   DAVAKKTKVEKSPEEERLEKLGEGKESGR----------VSLGPKSFGSSVEMFDYFYRL  110

Query  418  LHSWSTNLNVNKYEHLVLLELLNKGHPEPEKKIGKGVGGFQVRFHPKYKSRCFFITGEDG  597
            LH W T+L+VNKYEHLVLL+LL KGH EP+KKIG GV  FQVR HP YKSRCFF+  ED 
Sbjct  111  LHYWPTDLSVNKYEHLVLLDLLKKGHAEPDKKIGGGVQAFQVRTHPLYKSRCFFLIREDE  170

Query  598  SSDDFSFRKCVDNILPLPENMPIKHDT  678
            + DDFSFRKCVD ILPLPENM    D 
Sbjct  171  TVDDFSFRKCVDQILPLPENMKAHSDA  197



>ref|XP_006440602.1| hypothetical protein CICLE_v10022133mg [Citrus clementina]
 gb|ESR53842.1| hypothetical protein CICLE_v10022133mg [Citrus clementina]
 gb|KDO55563.1| hypothetical protein CISIN_1g027552mg [Citrus sinensis]
Length=222

 Score =   185 bits (469),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 105/201 (52%), Positives = 131/201 (65%), Gaps = 16/201 (8%)
 Frame = +1

Query  76   MAEQTPEVPDTVAEKASSENMDVETNSPEDLAAENGGAAKrpreegdepdnddngdASKK  255
            MAE+  +  +     A++E+MD+E         ENGG A   R   D+   + NGD SKK
Sbjct  1    MAEEAAK--ELTESNAAAEDMDLE-------GGENGGDANAKRARDDDDGGEGNGDVSKK  51

Query  256  TKVQNPEEEQKVETLegkesaaegekkedksgPVTLGPKTFVSSVEMFDYFYKLLHSWST  435
             K+   E+  + E LE KE      +       V LGPK F SS+EMFDYFYK LH W  
Sbjct  52   QKIDEDEKSVEEERLEKKEVVNGSGR-------VKLGPKEFGSSIEMFDYFYKFLHFWPP  104

Query  436  NLNVNKYEHLVLLELLNKGHPEPEKKIGKGVGGFQVRFHPKYKSRCFFITGEDGSSDDFS  615
            NLNVNKYEH+VLL+LL KGHPEP+KKIG G+  FQVR+HP YKSRCFF+  ED ++DDFS
Sbjct  105  NLNVNKYEHMVLLDLLKKGHPEPDKKIGGGIQAFQVRYHPTYKSRCFFLIREDETADDFS  164

Query  616  FRKCVDNILPLPENMPIKHDT  678
            FRKCVD++LPLPE+M +K D 
Sbjct  165  FRKCVDHMLPLPEDMKVKSDA  185



>ref|XP_011087245.1| PREDICTED: protein DCL, chloroplastic-like [Sesamum indicum]
Length=221

 Score =   184 bits (468),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 82/107 (77%), Positives = 93/107 (87%), Gaps = 0/107 (0%)
 Frame = +1

Query  358  TLGPKTFVSSVEMFDYFYKLLHSWSTNLNVNKYEHLVLLELLNKGHPEPEKKIGKGVGGF  537
            T+GPKTF SSVEMFDYFYKLLH+W  NLN+NKYEH+VLLELL KGH E E+KIGKGV  F
Sbjct  93   TIGPKTFGSSVEMFDYFYKLLHAWPANLNLNKYEHIVLLELLKKGHLEAERKIGKGVKSF  152

Query  538  QVRFHPKYKSRCFFITGEDGSSDDFSFRKCVDNILPLPENMPIKHDT  678
            QVRFHP++KSRCFF+  ED S DDFSFRKCV++ILPLPENM +KHD 
Sbjct  153  QVRFHPQFKSRCFFLIREDESVDDFSFRKCVNHILPLPENMQVKHDV  199



>ref|XP_011071644.1| PREDICTED: protein DCL, chloroplastic [Sesamum indicum]
Length=182

 Score =   182 bits (463),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 80/108 (74%), Positives = 93/108 (86%), Gaps = 0/108 (0%)
 Frame = +1

Query  355  VTLGPKTFVSSVEMFDYFYKLLHSWSTNLNVNKYEHLVLLELLNKGHPEPEKKIGKGVGG  534
             T+GPKTF SSVEMFDYFYK+LHSW TNL++NKYEH +LLELL KGH E ++KIGKGV  
Sbjct  53   ATVGPKTFGSSVEMFDYFYKILHSWPTNLDLNKYEHTMLLELLKKGHLEADRKIGKGVKA  112

Query  535  FQVRFHPKYKSRCFFITGEDGSSDDFSFRKCVDNILPLPENMPIKHDT  678
            FQ+RFHP++KSRCFF+  ED S DDFSFRKC+D+ILPLPENM IKHD 
Sbjct  113  FQIRFHPQFKSRCFFLIREDNSVDDFSFRKCIDHILPLPENMQIKHDV  160



>ref|XP_006477458.1| PREDICTED: protein DCL, chloroplastic-like [Citrus sinensis]
Length=223

 Score =   183 bits (464),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 104/202 (51%), Positives = 134/202 (66%), Gaps = 20/202 (10%)
 Frame = +1

Query  76   MAEQTPEVPDTVAEKASSENMDVETNSPEDLAAENGGAAKrpreegdepdnddngdASKK  255
            MAE+  +  +     A++E+MD+E         ENGG A   R   D+   + NGD SKK
Sbjct  1    MAEEAAK--ELTESNAAAEDMDLE-------GGENGGDANAKRARDDDDGGEGNGDVSKK  51

Query  256  TKV-QNPEEEQKVETLegkesaaegekkedksgPVTLGPKTFVSSVEMFDYFYKLLHSWS  432
             K+ +   EE+++E           ++  + SG V LGPK F SS+EMFDYFYK LH W 
Sbjct  52   QKIDEKSVEEERLEK----------KEVVNGSGRVKLGPKEFGSSIEMFDYFYKFLHFWP  101

Query  433  TNLNVNKYEHLVLLELLNKGHPEPEKKIGKGVGGFQVRFHPKYKSRCFFITGEDGSSDDF  612
             NLNVNKYEH+VLL+LL KGHPEP+KKIG G+  FQVR+HP YKSRCFF+  ED ++DDF
Sbjct  102  PNLNVNKYEHMVLLDLLKKGHPEPDKKIGGGIQAFQVRYHPTYKSRCFFLIREDETADDF  161

Query  613  SFRKCVDNILPLPENMPIKHDT  678
            SFRKCVD++LPLPE+M +K D 
Sbjct  162  SFRKCVDHMLPLPEDMKVKSDA  183



>ref|XP_004236037.1| PREDICTED: protein DCL, chloroplastic-like [Solanum lycopersicum]
Length=206

 Score =   182 bits (461),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 100/203 (49%), Positives = 127/203 (63%), Gaps = 24/203 (12%)
 Frame = +1

Query  76   MAEQTPEVPDTVA----EKASSENMDVETNSPEDLAAENGGAAKrpreegdepdnddngd  243
            MAE  P   + +     E+ S + MDVE  +  D    NGG+ +   E     D+++  D
Sbjct  1    MAETEPVTNEALGMAEKEETSVQKMDVEVPAANDA---NGGSKRPREEGDVPEDDENGED  57

Query  244  ASKKTKVQNPEEEQKVETLegkesaaegekkedksgPVTLGPKTFVSSVEMFDYFYKLLH  423
              K    Q+ EEE+K  ++                 PV++G K+FVSSVEMF+YFYKLLH
Sbjct  58   TKKPRVDQSVEEEKKDVSV-----------------PVSVGSKSFVSSVEMFNYFYKLLH  100

Query  424  SWSTNLNVNKYEHLVLLELLNKGHPEPEKKIGKGVGGFQVRFHPKYKSRCFFITGEDGSS  603
            SWS NLN+NKYEH++LL+LL KGH E E+KIG GV  FQ+RFHP+YKSRCFF+  ED + 
Sbjct  101  SWSVNLNLNKYEHMILLDLLKKGHSESERKIGSGVRAFQIRFHPQYKSRCFFLVREDDTV  160

Query  604  DDFSFRKCVDNILPLPENMPIKH  672
            DDFSFRKCVD I PLP NM  KH
Sbjct  161  DDFSFRKCVDQIQPLPANMQTKH  183



>ref|XP_008351848.1| PREDICTED: protein DCL, chloroplastic-like [Malus domestica]
Length=230

 Score =   178 bits (452),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 92/145 (63%), Positives = 104/145 (72%), Gaps = 11/145 (8%)
 Frame = +1

Query  247  SKKTKVQ-NPEEEQKVETLegkesaaegekkedksgPVTLGPKTFVSSVEMFDYFYKLLH  423
            +KKTKV+ +PEEE+  E L   E++            V+LGPK+F SSVEMFDYFYK LH
Sbjct  64   AKKTKVEKSPEEERLEEKLGEGENSGR----------VSLGPKSFGSSVEMFDYFYKFLH  113

Query  424  SWSTNLNVNKYEHLVLLELLNKGHPEPEKKIGKGVGGFQVRFHPKYKSRCFFITGEDGSS  603
             W T+LNVNKYEHLVLL+LL KGH EP+KKIG GV  FQVR HP YKSRCFF+  ED   
Sbjct  114  YWPTDLNVNKYEHLVLLDLLKKGHAEPDKKIGGGVKAFQVRIHPLYKSRCFFLIREDEVV  173

Query  604  DDFSFRKCVDNILPLPENMPIKHDT  678
            DDFSFRKCVD ILPLPENM    D 
Sbjct  174  DDFSFRKCVDQILPLPENMKANADA  198



>gb|EPS64007.1| hypothetical protein M569_10774 [Genlisea aurea]
Length=198

 Score =   177 bits (449),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 75/109 (69%), Positives = 92/109 (84%), Gaps = 0/109 (0%)
 Frame = +1

Query  352  PVTLGPKTFVSSVEMFDYFYKLLHSWSTNLNVNKYEHLVLLELLNKGHPEPEKKIGKGVG  531
            PV++GPKTF SSV MFDYFYKLLH+W   +++NKYEH++LLEL+ KGH EP+KKIG GV 
Sbjct  66   PVSVGPKTFTSSVAMFDYFYKLLHTWPPKVDLNKYEHMMLLELVKKGHSEPDKKIGSGVK  125

Query  532  GFQVRFHPKYKSRCFFITGEDGSSDDFSFRKCVDNILPLPENMPIKHDT  678
             FQVRFHP+YKSRCFF+  ED S+DDFSFRKCVD ++PLPENM ++ D 
Sbjct  126  VFQVRFHPQYKSRCFFLVREDESADDFSFRKCVDRLIPLPENMQVQQDA  174



>ref|XP_008393164.1| PREDICTED: protein DCL, chloroplastic-like [Malus domestica]
Length=230

 Score =   178 bits (451),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 92/145 (63%), Positives = 104/145 (72%), Gaps = 11/145 (8%)
 Frame = +1

Query  247  SKKTKVQ-NPEEEQKVETLegkesaaegekkedksgPVTLGPKTFVSSVEMFDYFYKLLH  423
            +KKTKV+ +PEEE+  E L   E++            V+LGPK+F SSVEMFDYFYK LH
Sbjct  64   AKKTKVEKSPEEERLEEKLGEGENSGR----------VSLGPKSFGSSVEMFDYFYKFLH  113

Query  424  SWSTNLNVNKYEHLVLLELLNKGHPEPEKKIGKGVGGFQVRFHPKYKSRCFFITGEDGSS  603
             W T+LNVNKYEHLVLL+LL KGH EP+KKIG GV  FQVR HP YKSRCFF+  ED   
Sbjct  114  YWPTDLNVNKYEHLVLLDLLKKGHAEPDKKIGGGVKAFQVRIHPLYKSRCFFLIREDEVV  173

Query  604  DDFSFRKCVDNILPLPENMPIKHDT  678
            DDFSFRKCVD ILPLPENM    D 
Sbjct  174  DDFSFRKCVDQILPLPENMKANADA  198



>ref|XP_011036794.1| PREDICTED: protein DCL, chloroplastic-like isoform X3 [Populus 
euphratica]
 ref|XP_011036795.1| PREDICTED: protein DCL, chloroplastic-like isoform X4 [Populus 
euphratica]
Length=228

 Score =   177 bits (450),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 78/110 (71%), Positives = 91/110 (83%), Gaps = 0/110 (0%)
 Frame = +1

Query  352  PVTLGPKTFVSSVEMFDYFYKLLHSWSTNLNVNKYEHLVLLELLNKGHPEPEKKIGKGVG  531
            PV+LGPK+F S+VEMFDYFY LLH W  NLNVNKYE +VLLELL +GH EP+KKIG G+ 
Sbjct  86   PVSLGPKSFASAVEMFDYFYNLLHYWPPNLNVNKYEQMVLLELLKRGHTEPDKKIGGGIQ  145

Query  532  GFQVRFHPKYKSRCFFITGEDGSSDDFSFRKCVDNILPLPENMPIKHDTY  681
             FQVRFHP +KSRCFF+  +D S DDFSFRKCVD+ILPLPE+M IK D +
Sbjct  146  TFQVRFHPMFKSRCFFLIRDDESVDDFSFRKCVDHILPLPEDMKIKSDNF  195



>ref|XP_002514753.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF47859.1| conserved hypothetical protein [Ricinus communis]
Length=224

 Score =   177 bits (448),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 78/108 (72%), Positives = 89/108 (82%), Gaps = 0/108 (0%)
 Frame = +1

Query  352  PVTLGPKTFVSSVEMFDYFYKLLHSWSTNLNVNKYEHLVLLELLNKGHPEPEKKIGKGVG  531
            PV+LGPK+F SSVEMFDYFY LLH W  NL VNKYEH+VLLELL KGH +PEKKIG G+ 
Sbjct  82   PVSLGPKSFGSSVEMFDYFYNLLHYWPPNLTVNKYEHMVLLELLKKGHSDPEKKIGGGIQ  141

Query  532  GFQVRFHPKYKSRCFFITGEDGSSDDFSFRKCVDNILPLPENMPIKHD  675
             FQVR+HP +KSRCFF+  +D + DDFSFRKCVD ILPLPE+M IK D
Sbjct  142  AFQVRYHPMWKSRCFFLIRDDDTMDDFSFRKCVDKILPLPEDMKIKSD  189



>ref|XP_011036792.1| PREDICTED: protein DCL, chloroplastic-like isoform X1 [Populus 
euphratica]
 ref|XP_011036793.1| PREDICTED: protein DCL, chloroplastic-like isoform X2 [Populus 
euphratica]
Length=248

 Score =   177 bits (449),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 78/110 (71%), Positives = 91/110 (83%), Gaps = 0/110 (0%)
 Frame = +1

Query  352  PVTLGPKTFVSSVEMFDYFYKLLHSWSTNLNVNKYEHLVLLELLNKGHPEPEKKIGKGVG  531
            PV+LGPK+F S+VEMFDYFY LLH W  NLNVNKYE +VLLELL +GH EP+KKIG G+ 
Sbjct  106  PVSLGPKSFASAVEMFDYFYNLLHYWPPNLNVNKYEQMVLLELLKRGHTEPDKKIGGGIQ  165

Query  532  GFQVRFHPKYKSRCFFITGEDGSSDDFSFRKCVDNILPLPENMPIKHDTY  681
             FQVRFHP +KSRCFF+  +D S DDFSFRKCVD+ILPLPE+M IK D +
Sbjct  166  TFQVRFHPMFKSRCFFLIRDDESVDDFSFRKCVDHILPLPEDMKIKSDNF  215



>ref|XP_008453205.1| PREDICTED: protein DCL, chloroplastic [Cucumis melo]
Length=232

 Score =   177 bits (448),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 102/208 (49%), Positives = 131/208 (63%), Gaps = 13/208 (6%)
 Frame = +1

Query  76   MAEQTPEVPDTVAEKASSENMDVETNSPEDL--AAENGGAA-----Krpreegdepdndd  234
            MAE+T    D     + +E+M++ET  P+    A+E   AA         +   E   DD
Sbjct  1    MAEETIPQLDPEVTNSGTEDMELETTVPKGSSDASEATEAAPVINGDANSKREREESADD  60

Query  235  ngdASKKTKVQNPEEEQKVETLegkesaaegekkedksgPVTLGPKTFVSSVEMFDYFYK  414
                 KK K++   EE++VE L G     E         PV+LGPK+F SSVE+FDYFYK
Sbjct  61   GVGDGKKQKIEKSVEEERVEKLGGDGKCEEEPV------PVSLGPKSFRSSVELFDYFYK  114

Query  415  LLHSWSTNLNVNKYEHLVLLELLNKGHPEPEKKIGKGVGGFQVRFHPKYKSRCFFITGED  594
            +LH+W  NLNVN+YE +VL++LL KGH EPEKKIG G+  FQ+RFHP +KS+CFF+  ED
Sbjct  115  ILHNWPINLNVNQYEQMVLVDLLKKGHLEPEKKIGCGIQAFQIRFHPVWKSKCFFLIRED  174

Query  595  GSSDDFSFRKCVDNILPLPENMPIKHDT  678
             S+DDFSFRKCVD+ILPLPEN   K D 
Sbjct  175  ESADDFSFRKCVDHILPLPENFKAKSDA  202



>ref|XP_009339285.1| PREDICTED: protein DCL, chloroplastic-like [Pyrus x bretschneideri]
Length=225

 Score =   176 bits (447),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 108/209 (52%), Positives = 130/209 (62%), Gaps = 22/209 (11%)
 Frame = +1

Query  76   MAEQTPEVPDTVAEKASSENMDVETNSPEDLAAEN-------GGAAKrpreegdepdndd  234
            M E+  E  +  A   + ++MDVET+ P   AA+N        G A+   +   + +  +
Sbjct  1    MPEKLAETSEATAADGA-KHMDVETSEP--AAAQNCDEADGINGEAEANSKRVRDEEGSE  57

Query  235  ngdASKKTKV-QNPEEEQKVETLegkesaaegekkedksgPVTLGPKTFVSSVEMFDYFY  411
              DA KKTKV ++PEEE+  E L   E +            V LGPK+F SSVEMFDYFY
Sbjct  58   GNDA-KKTKVDKSPEEERLEEKLGEGEKSGR----------VGLGPKSFGSSVEMFDYFY  106

Query  412  KLLHSWSTNLNVNKYEHLVLLELLNKGHPEPEKKIGKGVGGFQVRFHPKYKSRCFFITGE  591
            K LH W T+LNVNKYE+LVLL+LL KGH EP+KKIG GV  FQVR HP YKSRCFF+  E
Sbjct  107  KFLHYWPTDLNVNKYEYLVLLDLLKKGHAEPDKKIGGGVKAFQVRTHPLYKSRCFFLIRE  166

Query  592  DGSSDDFSFRKCVDNILPLPENMPIKHDT  678
            D   DDFSFRKCVD ILPLPENM    D 
Sbjct  167  DEVVDDFSFRKCVDQILPLPENMKANADA  195



>ref|XP_004154974.1| PREDICTED: uncharacterized protein LOC101228008 [Cucumis sativus]
 gb|KGN63669.1| hypothetical protein Csa_1G009730 [Cucumis sativus]
Length=232

 Score =   176 bits (447),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 100/208 (48%), Positives = 130/208 (63%), Gaps = 13/208 (6%)
 Frame = +1

Query  76   MAEQTPEVPDTVAEKASSENMDVETNSPE---DLAAENGGA----AKrpreegdepdndd  234
            MAE+T    D     + +E+M++ET  P+   D +  N  A         +   E   DD
Sbjct  1    MAEETIPQLDPEVTNSGTEDMELETTEPKASTDASEANEAAPVINGDATSKREREESADD  60

Query  235  ngdASKKTKVQNPEEEQKVETLegkesaaegekkedksgPVTLGPKTFVSSVEMFDYFYK  414
                 KK K++   EE+++E L G     E         PV+LGPK+F SSVE+FDYFYK
Sbjct  61   GVADGKKQKIEKSVEEERLEKLGGDGKCEEEPV------PVSLGPKSFRSSVELFDYFYK  114

Query  415  LLHSWSTNLNVNKYEHLVLLELLNKGHPEPEKKIGKGVGGFQVRFHPKYKSRCFFITGED  594
            +LH W  NLNVN+YE +VL++LL KGH EPEKKIG G+  FQ+RFHP++KS+CFF+  ED
Sbjct  115  ILHHWPVNLNVNQYEQMVLVDLLKKGHLEPEKKIGCGIHSFQIRFHPEWKSKCFFLIRED  174

Query  595  GSSDDFSFRKCVDNILPLPENMPIKHDT  678
             S+DDFSFRKCVD+ILPLPEN   K D 
Sbjct  175  ESADDFSFRKCVDHILPLPENFKGKFDA  202



>ref|XP_006440603.1| hypothetical protein CICLE_v10022133mg [Citrus clementina]
 gb|ESR53843.1| hypothetical protein CICLE_v10022133mg [Citrus clementina]
Length=208

 Score =   175 bits (444),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 100/201 (50%), Positives = 124/201 (62%), Gaps = 30/201 (15%)
 Frame = +1

Query  76   MAEQTPEVPDTVAEKASSENMDVETNSPEDLAAENGGAAKrpreegdepdnddngdASKK  255
            MAE+     +     A++E+MD+E         ENGG A   R   D+   + NGD SKK
Sbjct  1    MAEEA--AKELTESNAAAEDMDLE-------GGENGGDANAKRARDDDDGGEGNGDVSKK  51

Query  256  TKVQNPEEEQKVETLegkesaaegekkedksgPVTLGPKTFVSSVEMFDYFYKLLHSWST  435
             K+   E+E+ VE                      L  K F SS+EMFDYFYK LH W  
Sbjct  52   QKID--EDEKSVEE-------------------ERLEKKEFGSSIEMFDYFYKFLHFWPP  90

Query  436  NLNVNKYEHLVLLELLNKGHPEPEKKIGKGVGGFQVRFHPKYKSRCFFITGEDGSSDDFS  615
            NLNVNKYEH+VLL+LL KGHPEP+KKIG G+  FQVR+HP YKSRCFF+  ED ++DDFS
Sbjct  91   NLNVNKYEHMVLLDLLKKGHPEPDKKIGGGIQAFQVRYHPTYKSRCFFLIREDETADDFS  150

Query  616  FRKCVDNILPLPENMPIKHDT  678
            FRKCVD++LPLPE+M +K D 
Sbjct  151  FRKCVDHMLPLPEDMKVKSDA  171



>ref|XP_002284935.1| PREDICTED: uncharacterized protein LOC100255290 [Vitis vinifera]
Length=235

 Score =   176 bits (445),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 102/208 (49%), Positives = 130/208 (63%), Gaps = 19/208 (9%)
 Frame = +1

Query  76   MAEQT-PEVPDTVAEK--ASSENMDVETNSPE-----DLA--AENGGAAKrpreegdepd  225
            MAE    E P+TV E+  A++++MDVE   P      D A    NG +  +   E     
Sbjct  1    MAETVVSETPETVTERETANTQDMDVEAPEPSQPNGSDSADNVTNGDSNSKRGREEAGEG  60

Query  226  nddngdASKKTKVQNPEEEQKVETLegkesaaegekkedksgPVTLGPKTFVSSVEMFDY  405
             D N   +KK KV+   EE+++E LE +                +LGPKTF SSVEMFD+
Sbjct  61   EDANDAVTKKQKVEKSVEEERLEKLEAEVVETGR---------FSLGPKTFGSSVEMFDH  111

Query  406  FYKLLHSWSTNLNVNKYEHLVLLELLNKGHPEPEKKIGKGVGGFQVRFHPKYKSRCFFIT  585
            F+K LH W  NL+VNKYEH++LL+LL KGH EP+KKIG G+  FQVR+HP +KSRCFF+ 
Sbjct  112  FFKFLHYWPANLDVNKYEHMMLLDLLKKGHTEPDKKIGGGIHAFQVRYHPVFKSRCFFVI  171

Query  586  GEDGSSDDFSFRKCVDNILPLPENMPIK  669
             +D S DDFSFRKCVD+I PLPENM  K
Sbjct  172  RDDESVDDFSFRKCVDHISPLPENMKAK  199



>ref|XP_008374549.1| PREDICTED: protein DCL, chloroplastic-like [Malus domestica]
Length=228

 Score =   174 bits (442),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 79/103 (77%), Positives = 87/103 (84%), Gaps = 0/103 (0%)
 Frame = +1

Query  352  PVTLGPKTFVSSVEMFDYFYKLLHSWSTNLNVNKYEHLVLLELLNKGHPEPEKKIGKGVG  531
            PV+LGPK+F SSVEMFDYFYK LH W T+LNVNKYE+LVLL+LL KGH EP+KKIG GV 
Sbjct  89   PVSLGPKSFGSSVEMFDYFYKFLHYWPTDLNVNKYEYLVLLDLLKKGHAEPDKKIGGGVQ  148

Query  532  GFQVRFHPKYKSRCFFITGEDGSSDDFSFRKCVDNILPLPENM  660
             FQVR HP YKSRCFF+  ED   DDFSFRKCVD+ILPLPENM
Sbjct  149  AFQVRIHPLYKSRCFFLIREDEVVDDFSFRKCVDHILPLPENM  191



>gb|KDP31255.1| hypothetical protein JCGZ_11631 [Jatropha curcas]
Length=235

 Score =   174 bits (442),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 77/108 (71%), Positives = 88/108 (81%), Gaps = 0/108 (0%)
 Frame = +1

Query  352  PVTLGPKTFVSSVEMFDYFYKLLHSWSTNLNVNKYEHLVLLELLNKGHPEPEKKIGKGVG  531
            PV+LGPKTF SSVEMFDYFY  LH W  NLNVNKYE +VLL+LL KGH EPEKKIG G+ 
Sbjct  95   PVSLGPKTFGSSVEMFDYFYNFLHFWPPNLNVNKYEQMVLLDLLKKGHTEPEKKIGVGIR  154

Query  532  GFQVRFHPKYKSRCFFITGEDGSSDDFSFRKCVDNILPLPENMPIKHD  675
             FQVR+HP +KSRC F+  ++ + DDFSFRKCVD ILPLPE+M IKHD
Sbjct  155  AFQVRYHPMWKSRCLFLIRDNDTVDDFSFRKCVDKILPLPEDMKIKHD  202



>ref|XP_011023607.1| PREDICTED: protein DCL, chloroplastic-like [Populus euphratica]
 ref|XP_011023608.1| PREDICTED: protein DCL, chloroplastic-like [Populus euphratica]
Length=236

 Score =   172 bits (436),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 71/110 (65%), Positives = 90/110 (82%), Gaps = 0/110 (0%)
 Frame = +1

Query  352  PVTLGPKTFVSSVEMFDYFYKLLHSWSTNLNVNKYEHLVLLELLNKGHPEPEKKIGKGVG  531
            PV+LGPK+F S+VEMFDYFY  LH W  N+ VNKYEH++L++LL  GH EP+KKIG G+ 
Sbjct  94   PVSLGPKSFGSAVEMFDYFYNFLHQWPPNIKVNKYEHMMLVDLLKTGHSEPDKKIGSGIQ  153

Query  532  GFQVRFHPKYKSRCFFITGEDGSSDDFSFRKCVDNILPLPENMPIKHDTY  681
             FQVRFHP++KSRCFF+  +D + DDFSFRKCVD+ILPLPEN+ +K D +
Sbjct  154  AFQVRFHPRFKSRCFFLIRDDDTVDDFSFRKCVDHILPLPENLKVKSDNF  203



>ref|XP_009369291.1| PREDICTED: protein DCL, chloroplastic-like [Pyrus x bretschneideri]
Length=225

 Score =   172 bits (435),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 78/102 (76%), Positives = 86/102 (84%), Gaps = 0/102 (0%)
 Frame = +1

Query  355  VTLGPKTFVSSVEMFDYFYKLLHSWSTNLNVNKYEHLVLLELLNKGHPEPEKKIGKGVGG  534
            V+LGPK+F SSVEMFDYFYK LH W T+LNVNKYE+LVLL+LL KGH EP+KKIG GV  
Sbjct  90   VSLGPKSFGSSVEMFDYFYKFLHYWPTDLNVNKYEYLVLLDLLKKGHAEPDKKIGGGVKA  149

Query  535  FQVRFHPKYKSRCFFITGEDGSSDDFSFRKCVDNILPLPENM  660
            FQVR HP YKSRCFF+  ED   DDFSFRKCVD+ILPLPENM
Sbjct  150  FQVRIHPLYKSRCFFLIREDEVVDDFSFRKCVDHILPLPENM  191



>ref|XP_010257491.1| PREDICTED: protein DCL, chloroplastic-like [Nelumbo nucifera]
Length=265

 Score =   172 bits (437),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 83/140 (59%), Positives = 106/140 (76%), Gaps = 0/140 (0%)
 Frame = +1

Query  259  KVQNPEEEQKVETLegkesaaegekkedksgPVTLGPKTFVSSVEMFDYFYKLLHSWSTN  438
            K+Q  EE+ +V+    ++   + +++E K  PV+LGPK F SS +MF+YFYKLLH W  N
Sbjct  95   KLQQSEEDDEVKEDGKEKDEEQEKEEEKKEDPVSLGPKKFSSSEDMFNYFYKLLHYWPPN  154

Query  439  LNVNKYEHLVLLELLNKGHPEPEKKIGKGVGGFQVRFHPKYKSRCFFITGEDGSSDDFSF  618
            +NVN+YEH+VLL+LL KGH E EKK+G GVG FQVR+HP +KSRCFF+   D S DDFSF
Sbjct  155  INVNEYEHMVLLDLLKKGHAEAEKKLGGGVGAFQVRYHPMWKSRCFFLIRHDESVDDFSF  214

Query  619  RKCVDNILPLPENMPIKHDT  678
            RKCVD+ILPLPENM +K D 
Sbjct  215  RKCVDHILPLPENMKVKSDV  234



>ref|XP_009401349.1| PREDICTED: protein DCL, chloroplastic-like [Musa acuminata subsp. 
malaccensis]
Length=226

 Score =   169 bits (429),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 72/105 (69%), Positives = 88/105 (84%), Gaps = 0/105 (0%)
 Frame = +1

Query  355  VTLGPKTFVSSVEMFDYFYKLLHSWSTNLNVNKYEHLVLLELLNKGHPEPEKKIGKGVGG  534
             ++GPK F SSVEMFDYF KLL SW  NLN+NKYEH+VLL+LL KGHPEP KKIG+G+  
Sbjct  86   ASIGPKVFTSSVEMFDYFLKLLRSWLPNLNINKYEHMVLLDLLKKGHPEPAKKIGEGIEA  145

Query  535  FQVRFHPKYKSRCFFITGEDGSSDDFSFRKCVDNILPLPENMPIK  669
            FQVR+HP YKSRCFF+   DG++DDFSFRKCVD ILPLP+++ ++
Sbjct  146  FQVRYHPTYKSRCFFLIRVDGTTDDFSFRKCVDKILPLPDHLKVQ  190



>ref|XP_009413463.1| PREDICTED: high mobility group nucleosome-binding domain-containing 
protein 5-like [Musa acuminata subsp. malaccensis]
Length=348

 Score =   172 bits (437),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 74/105 (70%), Positives = 89/105 (85%), Gaps = 0/105 (0%)
 Frame = +1

Query  355  VTLGPKTFVSSVEMFDYFYKLLHSWSTNLNVNKYEHLVLLELLNKGHPEPEKKIGKGVGG  534
            V++GPK F SSVEMF+YF+KLLHSWS NL++NKYEH+VL +LLNKGHPEP KKIG G+  
Sbjct  195  VSVGPKVFTSSVEMFEYFFKLLHSWSPNLDLNKYEHMVLHDLLNKGHPEPTKKIGVGIQA  254

Query  535  FQVRFHPKYKSRCFFITGEDGSSDDFSFRKCVDNILPLPENMPIK  669
            FQVR+HP +KSRCFF+   D + DDFSFRKCVDNILPLP+NM  +
Sbjct  255  FQVRYHPAWKSRCFFVVRVDETIDDFSFRKCVDNILPLPDNMKAR  299



>ref|XP_006382598.1| hypothetical protein POPTR_0005s03610g [Populus trichocarpa]
 gb|ERP60395.1| hypothetical protein POPTR_0005s03610g [Populus trichocarpa]
Length=250

 Score =   169 bits (429),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 75/110 (68%), Positives = 88/110 (80%), Gaps = 0/110 (0%)
 Frame = +1

Query  352  PVTLGPKTFVSSVEMFDYFYKLLHSWSTNLNVNKYEHLVLLELLNKGHPEPEKKIGKGVG  531
            PV LG K+F S+VEMFDYFY  LH W  NLNVNKYE +VLL+LL +GH EP+KKIG G+ 
Sbjct  106  PVRLGLKSFGSAVEMFDYFYNFLHYWPPNLNVNKYEQMVLLDLLKRGHTEPDKKIGGGIQ  165

Query  532  GFQVRFHPKYKSRCFFITGEDGSSDDFSFRKCVDNILPLPENMPIKHDTY  681
             FQVRFHP +KSRCFF+  +D S DDFSFRKCVD+ILPLPE+M IK D +
Sbjct  166  TFQVRFHPMFKSRCFFLIRDDESVDDFSFRKCVDHILPLPEDMKIKSDNF  215



>ref|NP_201050.2| uncharacterized protein [Arabidopsis thaliana]
 gb|AAM21312.1|AF371327_1 EMB514 [Arabidopsis thaliana]
 gb|AAM65405.1| unknown [Arabidopsis thaliana]
 gb|AAP40395.1| unknown protein [Arabidopsis thaliana]
 gb|AAP40494.1| unknown protein [Arabidopsis thaliana]
 dbj|BAD43068.1| unnamed protein product [Arabidopsis thaliana]
 dbj|BAF01556.1| hypothetical protein [Arabidopsis thaliana]
 gb|AED97608.1| uncharacterized protein AT5G62440 [Arabidopsis thaliana]
Length=202

 Score =   167 bits (424),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 74/103 (72%), Positives = 85/103 (83%), Gaps = 0/103 (0%)
 Frame = +1

Query  352  PVTLGPKTFVSSVEMFDYFYKLLHSWSTNLNVNKYEHLVLLELLNKGHPEPEKKIGKGVG  531
            PV LGPK FV+SV MFDYF K LH W T+L+VNKYEH+VLL+L+ KGH EPEKKIG G+ 
Sbjct  66   PVKLGPKEFVTSVAMFDYFVKFLHFWPTDLDVNKYEHMVLLDLIKKGHSEPEKKIGGGIK  125

Query  532  GFQVRFHPKYKSRCFFITGEDGSSDDFSFRKCVDNILPLPENM  660
             FQVR HP +KSRCFF+  ED ++DDFSFRKCVD ILPLPENM
Sbjct  126  TFQVRTHPMWKSRCFFLVREDDTADDFSFRKCVDQILPLPENM  168



>ref|XP_002866491.1| hypothetical protein ARALYDRAFT_496421 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH42750.1| hypothetical protein ARALYDRAFT_496421 [Arabidopsis lyrata subsp. 
lyrata]
Length=203

 Score =   167 bits (424),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 74/103 (72%), Positives = 86/103 (83%), Gaps = 0/103 (0%)
 Frame = +1

Query  352  PVTLGPKTFVSSVEMFDYFYKLLHSWSTNLNVNKYEHLVLLELLNKGHPEPEKKIGKGVG  531
            PV LGPK FV+SV MFDYF K LH W T+L+VNKYEH+VLL+L+ KGH EPEKKIG G+ 
Sbjct  66   PVKLGPKEFVTSVAMFDYFVKFLHFWPTDLDVNKYEHMVLLDLIKKGHSEPEKKIGGGIK  125

Query  532  GFQVRFHPKYKSRCFFITGEDGSSDDFSFRKCVDNILPLPENM  660
             FQVR HP +KSRCFF+  ED ++DDFSFRKCVD+ILPLPENM
Sbjct  126  TFQVRTHPMWKSRCFFLVREDDTADDFSFRKCVDHILPLPENM  168



>ref|XP_010916681.1| PREDICTED: uncharacterized protein LOC105041409 [Elaeis guineensis]
Length=273

 Score =   169 bits (428),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 72/102 (71%), Positives = 85/102 (83%), Gaps = 0/102 (0%)
 Frame = +1

Query  355  VTLGPKTFVSSVEMFDYFYKLLHSWSTNLNVNKYEHLVLLELLNKGHPEPEKKIGKGVGG  534
            V LGPK F SS EMFDYF+KLL  WS NL++N+YEH+VLL+LL KGHPEPEKKIG+G+  
Sbjct  131  VCLGPKAFDSSKEMFDYFFKLLRQWSPNLDINEYEHMVLLDLLQKGHPEPEKKIGEGIQA  190

Query  535  FQVRFHPKYKSRCFFITGEDGSSDDFSFRKCVDNILPLPENM  660
            FQVR+ P +KSRCFFI   DG+ DDFSFRKC+D ILPLPE+M
Sbjct  191  FQVRYQPAWKSRCFFIVRVDGTDDDFSFRKCIDQILPLPEHM  232



>ref|XP_008782334.1| PREDICTED: DNA-directed RNA polymerase V subunit 1-like [Phoenix 
dactylifera]
Length=353

 Score =   171 bits (433),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 72/104 (69%), Positives = 86/104 (83%), Gaps = 0/104 (0%)
 Frame = +1

Query  355  VTLGPKTFVSSVEMFDYFYKLLHSWSTNLNVNKYEHLVLLELLNKGHPEPEKKIGKGVGG  534
             +LGP  F SSVEMFDYF+KLLH WS NL++NKYEH+VLL LL KGHPEP+KKIG+G+  
Sbjct  133  ASLGPNVFTSSVEMFDYFFKLLHHWSPNLDINKYEHMVLLNLLQKGHPEPDKKIGEGIQA  192

Query  535  FQVRFHPKYKSRCFFITGEDGSSDDFSFRKCVDNILPLPENMPI  666
            FQVR+HP +KSRCFFI   DG+ DDFSFRKC+D ILPLP+ M +
Sbjct  193  FQVRYHPTWKSRCFFIVRVDGTDDDFSFRKCIDRILPLPDQMKV  236



>ref|XP_006281035.1| hypothetical protein CARUB_v10027052mg, partial [Capsella rubella]
 gb|EOA13933.1| hypothetical protein CARUB_v10027052mg, partial [Capsella rubella]
Length=232

 Score =   167 bits (424),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 74/103 (72%), Positives = 85/103 (83%), Gaps = 0/103 (0%)
 Frame = +1

Query  352  PVTLGPKTFVSSVEMFDYFYKLLHSWSTNLNVNKYEHLVLLELLNKGHPEPEKKIGKGVG  531
            PV LGPK FV+SV MFDYF K LH W T+L+VNKYEH+VLL+L+ KGH EPEKKIG G+ 
Sbjct  95   PVKLGPKEFVTSVAMFDYFVKFLHFWPTDLDVNKYEHMVLLDLIKKGHSEPEKKIGGGIK  154

Query  532  GFQVRFHPKYKSRCFFITGEDGSSDDFSFRKCVDNILPLPENM  660
             FQVR HP +KSRCFF+  ED ++DDFSFRKCVD ILPLPENM
Sbjct  155  TFQVRTHPMWKSRCFFLVREDDTADDFSFRKCVDQILPLPENM  197



>emb|CDY65200.1| BnaCnng45980D [Brassica napus]
Length=203

 Score =   166 bits (420),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 73/103 (71%), Positives = 83/103 (81%), Gaps = 0/103 (0%)
 Frame = +1

Query  352  PVTLGPKTFVSSVEMFDYFYKLLHSWSTNLNVNKYEHLVLLELLNKGHPEPEKKIGKGVG  531
            PV LGPK FVSSV MFDYF K +H W T L+VNKYE +VLL+L+ KGH EP+KKIG G+ 
Sbjct  67   PVKLGPKEFVSSVAMFDYFTKFMHFWPTGLDVNKYEQMVLLDLIKKGHSEPDKKIGGGIK  126

Query  532  GFQVRFHPKYKSRCFFITGEDGSSDDFSFRKCVDNILPLPENM  660
             FQVR HP +KSRCFF+  ED S+DDFSFRKCVD ILPLPENM
Sbjct  127  AFQVRTHPMWKSRCFFLVREDDSADDFSFRKCVDQILPLPENM  169



>ref|XP_010550601.1| PREDICTED: protein DCL, chloroplastic [Tarenaya hassleriana]
Length=215

 Score =   166 bits (421),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 73/100 (73%), Positives = 85/100 (85%), Gaps = 0/100 (0%)
 Frame = +1

Query  361  LGPKTFVSSVEMFDYFYKLLHSWSTNLNVNKYEHLVLLELLNKGHPEPEKKIGKGVGGFQ  540
            LGPK FVSSVEMFDYF K LH W T+L+VNKYEH VLL+L+ KGHPEPE+KIG G+  FQ
Sbjct  86   LGPKEFVSSVEMFDYFVKFLHFWPTDLDVNKYEHTVLLDLVKKGHPEPERKIGGGIKAFQ  145

Query  541  VRFHPKYKSRCFFITGEDGSSDDFSFRKCVDNILPLPENM  660
            +R HP +KSRCFF+  ED ++DDFSFRKCVD+ILPLPENM
Sbjct  146  IRNHPMWKSRCFFLVREDDTTDDFSFRKCVDHILPLPENM  185



>ref|XP_010483956.1| PREDICTED: uncharacterized protein LOC104762379 [Camelina sativa]
Length=203

 Score =   166 bits (419),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 73/103 (71%), Positives = 85/103 (83%), Gaps = 0/103 (0%)
 Frame = +1

Query  352  PVTLGPKTFVSSVEMFDYFYKLLHSWSTNLNVNKYEHLVLLELLNKGHPEPEKKIGKGVG  531
            PV LGPK FV+SV MFDYF K +H W T+L+VNKYE++VLL+L+ KGH EPEKKIG GV 
Sbjct  66   PVKLGPKEFVTSVAMFDYFVKFMHFWPTDLDVNKYEYMVLLDLIKKGHSEPEKKIGGGVK  125

Query  532  GFQVRFHPKYKSRCFFITGEDGSSDDFSFRKCVDNILPLPENM  660
             FQVR HP +KSRCFF+  ED ++DDFSFRKCVD ILPLPENM
Sbjct  126  TFQVRTHPMWKSRCFFLVREDDTADDFSFRKCVDQILPLPENM  168



>ref|XP_007037355.1| Uncharacterized protein TCM_014003 [Theobroma cacao]
 gb|EOY21856.1| Uncharacterized protein TCM_014003 [Theobroma cacao]
Length=225

 Score =   166 bits (421),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 83/144 (58%), Positives = 101/144 (70%), Gaps = 10/144 (7%)
 Frame = +1

Query  247  SKKTKVQNPEEEQKVETLegkesaaegekkedksgPVTLGPKTFVSSVEMFDYFYKLLHS  426
            SKK KV+   EE+++E           E +  +S P  LGPK F SS+EMFDYFY LLH 
Sbjct  63   SKKQKVEKSVEEERMEK----------ESRSSESCPAHLGPKEFGSSMEMFDYFYNLLHY  112

Query  427  WSTNLNVNKYEHLVLLELLNKGHPEPEKKIGKGVGGFQVRFHPKYKSRCFFITGEDGSSD  606
            W T LN+NKYEH+VLL+LL KGH EP KKIG G+  FQ+R HP +KS+CFF+  +D + D
Sbjct  113  WPTQLNLNKYEHMVLLDLLKKGHLEPGKKIGSGIRAFQIRNHPMWKSKCFFVIRDDETID  172

Query  607  DFSFRKCVDNILPLPENMPIKHDT  678
            DFSFRKCVD+ILPLPE M IK D 
Sbjct  173  DFSFRKCVDHILPLPEEMKIKLDA  196



>ref|XP_004499475.1| PREDICTED: protein DCL, chloroplastic-like [Cicer arietinum]
Length=228

 Score =   166 bits (420),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 94/192 (49%), Positives = 126/192 (66%), Gaps = 2/192 (1%)
 Frame = +1

Query  109  VAEKASSENMD--VETNSPEDLAAENGGAAKrpreegdepdnddngdASKKTKVQNPEEE  282
            +AE A+ E +D  + T +  D+  EN   +K  R   DE   DD      K   +   EE
Sbjct  1    MAEGAAPEVVDPNITTVATVDMDVENVVESKEKRAREDEESKDDVVLKKIKVDEEKSVEE  60

Query  283  QKVETLegkesaaegekkedksgPVTLGPKTFVSSVEMFDYFYKLLHSWSTNLNVNKYEH  462
            Q++E LE ++     E++++ SG + LGPK F SS+EMF YF+  LH+W  NLNVNKYEH
Sbjct  61   QRLEKLEKQQDKTVEEEEKEPSGAINLGPKHFCSSLEMFHYFHNFLHAWPQNLNVNKYEH  120

Query  463  LVLLELLNKGHPEPEKKIGKGVGGFQVRFHPKYKSRCFFITGEDGSSDDFSFRKCVDNIL  642
            ++LLELL  GH EP++KIG G+  FQVR HP +KSRC+F+  ED S DDFSFRKCVD+IL
Sbjct  121  MMLLELLKNGHAEPDRKIGGGICAFQVRDHPHFKSRCYFLIREDDSVDDFSFRKCVDHIL  180

Query  643  PLPENMPIKHDT  678
            PLPE M +K++ 
Sbjct  181  PLPEEMQLKNEA  192



>ref|XP_007138179.1| hypothetical protein PHAVU_009G187000g [Phaseolus vulgaris]
 gb|ESW10173.1| hypothetical protein PHAVU_009G187000g [Phaseolus vulgaris]
Length=248

 Score =   165 bits (417),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 75/108 (69%), Positives = 84/108 (78%), Gaps = 0/108 (0%)
 Frame = +1

Query  355  VTLGPKTFVSSVEMFDYFYKLLHSWSTNLNVNKYEHLVLLELLNKGHPEPEKKIGKGVGG  534
            V LGPK+F SS EMF YFY  LH+W   LNVNKYEH +LLELL  GH EP+KKIG GV  
Sbjct  98   VKLGPKSFGSSSEMFHYFYNFLHNWPQYLNVNKYEHAMLLELLKNGHAEPDKKIGGGVRA  157

Query  535  FQVRFHPKYKSRCFFITGEDGSSDDFSFRKCVDNILPLPENMPIKHDT  678
            FQVR HP YKSRCFF+  ED S+DDFSFRKCVD+ILPLPE+M +K D 
Sbjct  158  FQVRKHPTYKSRCFFLIREDDSADDFSFRKCVDHILPLPEDMHLKSDA  205



>ref|XP_004508733.1| PREDICTED: protein DCL, chloroplastic-like [Cicer arietinum]
Length=214

 Score =   164 bits (414),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 73/109 (67%), Positives = 87/109 (80%), Gaps = 0/109 (0%)
 Frame = +1

Query  352  PVTLGPKTFVSSVEMFDYFYKLLHSWSTNLNVNKYEHLVLLELLNKGHPEPEKKIGKGVG  531
            PV LG KTF +S+E+FDYF   LH W+ NLNVNKYEH +LLEL+ KGHPEP+KKIG  + 
Sbjct  76   PVKLGHKTFGNSLELFDYFNSFLHDWAPNLNVNKYEHKMLLELIMKGHPEPDKKIGGEIC  135

Query  532  GFQVRFHPKYKSRCFFITGEDGSSDDFSFRKCVDNILPLPENMPIKHDT  678
             FQVR HP +KS+CFF+  ED S+DDFSFRKCVD+ILPLPE M +KHD 
Sbjct  136  AFQVRRHPMWKSKCFFLIREDESADDFSFRKCVDHILPLPEAMQVKHDA  184



>ref|XP_006649525.1| PREDICTED: cyclic nucleotide-gated cation channel beta-1-like 
[Oryza brachyantha]
Length=229

 Score =   164 bits (415),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 71/105 (68%), Positives = 86/105 (82%), Gaps = 0/105 (0%)
 Frame = +1

Query  352  PVTLGPKTFVSSVEMFDYFYKLLHSWSTNLNVNKYEHLVLLELLNKGHPEPEKKIGKGVG  531
            PV LGPK F +SVEMFDYF+ LLHSW+  L++NKYEH+VL +LL KGH E ++KIG GV 
Sbjct  89   PVKLGPKEFATSVEMFDYFFALLHSWAPQLDINKYEHMVLEDLLKKGHAESDRKIGPGVE  148

Query  532  GFQVRFHPKYKSRCFFITGEDGSSDDFSFRKCVDNILPLPENMPI  666
             F++R HP ++SRCFF+   DGSSDDFSFRKCVDNILPLPE+M I
Sbjct  149  AFEIRNHPVWQSRCFFVRRVDGSSDDFSFRKCVDNILPLPEDMKI  193



>ref|XP_010678517.1| PREDICTED: protein DCL, chloroplastic [Beta vulgaris subsp. vulgaris]
Length=228

 Score =   164 bits (414),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 94/185 (51%), Positives = 122/185 (66%), Gaps = 4/185 (2%)
 Frame = +1

Query  109  VAEKASSENMDVETNSPEDLAAENGGAAKrpreegdepdnddngdASKKTKVQNPEEEQK  288
            + E A+ E+M++ET  P   ++    A KR RE+    D +      +K   +   EE +
Sbjct  6    ITEAATMEDMELETLKP---SSNTDVATKREREDEATADENGAVSKKQKLDDEKSVEETR  62

Query  289  VETLegke-saaegekkedksgPVTLGPKTFVSSVEMFDYFYKLLHSWSTNLNVNKYEHL  465
            +E L+       E +K+E    PV +GPKTF SS+EMF+YFYKLLHSW   L++NKYEH+
Sbjct  63   MEKLQENSGEVEEEKKEEKIVDPVKIGPKTFGSSLEMFNYFYKLLHSWPLFLDLNKYEHM  122

Query  466  VLLELLNKGHPEPEKKIGKGVGGFQVRFHPKYKSRCFFITGEDGSSDDFSFRKCVDNILP  645
            VLLEL+ KGHPE +KKIG GV  F+VR H  YKSRCFF    D S++DFSFRKCV+NILP
Sbjct  123  VLLELIKKGHPEADKKIGSGVEAFEVREHSVYKSRCFFAVRTDKSAEDFSFRKCVNNILP  182

Query  646  LPENM  660
            LPENM
Sbjct  183  LPENM  187



>ref|XP_009130215.1| PREDICTED: uncharacterized protein LOC103855007 [Brassica rapa]
Length=192

 Score =   162 bits (411),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 70/103 (68%), Positives = 85/103 (83%), Gaps = 0/103 (0%)
 Frame = +1

Query  352  PVTLGPKTFVSSVEMFDYFYKLLHSWSTNLNVNKYEHLVLLELLNKGHPEPEKKIGKGVG  531
            PV LGPK FV+SV MFDYF K +H W T+L+VNKYEH+VLL+L+ KGH EP+ KIG G+ 
Sbjct  57   PVKLGPKEFVTSVAMFDYFTKFMHFWPTDLDVNKYEHMVLLDLIKKGHTEPDNKIGGGIK  116

Query  532  GFQVRFHPKYKSRCFFITGEDGSSDDFSFRKCVDNILPLPENM  660
             FQVR HP +KSRCFF+  ED ++DDFS+RKCVD+ILPLPENM
Sbjct  117  AFQVRTHPMWKSRCFFLVREDDTADDFSYRKCVDHILPLPENM  159



>ref|XP_010458929.1| PREDICTED: uncharacterized protein LOC104740096 [Camelina sativa]
Length=205

 Score =   163 bits (412),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 72/103 (70%), Positives = 84/103 (82%), Gaps = 0/103 (0%)
 Frame = +1

Query  352  PVTLGPKTFVSSVEMFDYFYKLLHSWSTNLNVNKYEHLVLLELLNKGHPEPEKKIGKGVG  531
            PV LGPK FV+SV MFDYF K +H W T+L+VNKYE++VLL+L+ KGH E EKKIG GV 
Sbjct  68   PVKLGPKEFVTSVAMFDYFVKFMHFWPTDLDVNKYEYMVLLDLIKKGHSEHEKKIGGGVK  127

Query  532  GFQVRFHPKYKSRCFFITGEDGSSDDFSFRKCVDNILPLPENM  660
             FQVR HP +KSRCFF+  ED ++DDFSFRKCVD ILPLPENM
Sbjct  128  SFQVRTHPMWKSRCFFLVREDDTADDFSFRKCVDQILPLPENM  170



>emb|CDY67519.1| BnaAnng24490D [Brassica napus]
Length=195

 Score =   162 bits (410),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 70/103 (68%), Positives = 85/103 (83%), Gaps = 0/103 (0%)
 Frame = +1

Query  352  PVTLGPKTFVSSVEMFDYFYKLLHSWSTNLNVNKYEHLVLLELLNKGHPEPEKKIGKGVG  531
            PV LGPK FV+SV MFDYF K +H W T+L+VNKYEH+VLL+L+ KGH EP+ KIG G+ 
Sbjct  60   PVKLGPKEFVTSVAMFDYFTKFMHFWPTDLDVNKYEHMVLLDLIKKGHTEPDNKIGGGIK  119

Query  532  GFQVRFHPKYKSRCFFITGEDGSSDDFSFRKCVDNILPLPENM  660
             FQVR HP +KSRCFF+  ED ++DDFS+RKCVD+ILPLPENM
Sbjct  120  AFQVRTHPMWKSRCFFLVREDDTADDFSYRKCVDHILPLPENM  162



>ref|XP_010444092.1| PREDICTED: uncharacterized protein LOC104726842 [Camelina sativa]
Length=203

 Score =   162 bits (411),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 71/103 (69%), Positives = 84/103 (82%), Gaps = 0/103 (0%)
 Frame = +1

Query  352  PVTLGPKTFVSSVEMFDYFYKLLHSWSTNLNVNKYEHLVLLELLNKGHPEPEKKIGKGVG  531
            PV LGPK FV+SV MFDYF K +  W T+L+VNKYE++VLL+L+ KGH EPEKKIG G+ 
Sbjct  66   PVKLGPKEFVTSVAMFDYFVKFMQFWPTDLDVNKYEYMVLLDLIKKGHSEPEKKIGGGIK  125

Query  532  GFQVRFHPKYKSRCFFITGEDGSSDDFSFRKCVDNILPLPENM  660
             FQVR HP +KSRCFF+  ED ++DDFSFRKCVD ILPLPENM
Sbjct  126  TFQVRTHPMWKSRCFFLVREDDTADDFSFRKCVDQILPLPENM  168



>ref|XP_003527083.1| PREDICTED: nucleolin-like [Glycine max]
Length=252

 Score =   163 bits (412),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 75/108 (69%), Positives = 84/108 (78%), Gaps = 0/108 (0%)
 Frame = +1

Query  355  VTLGPKTFVSSVEMFDYFYKLLHSWSTNLNVNKYEHLVLLELLNKGHPEPEKKIGKGVGG  534
            V LG K+FVSS EMF YFY  LH+W   LNVNKYEHL+LLELL  GH EP+KKIG GV  
Sbjct  101  VNLGFKSFVSSSEMFHYFYNFLHTWPQYLNVNKYEHLMLLELLKNGHAEPDKKIGGGVRA  160

Query  535  FQVRFHPKYKSRCFFITGEDGSSDDFSFRKCVDNILPLPENMPIKHDT  678
            FQVR HP +KSRCFF+  ED S+DDFSFRKCVD+ILPLPE M +K D 
Sbjct  161  FQVRKHPTFKSRCFFLIREDDSADDFSFRKCVDHILPLPEEMHLKFDA  208



>ref|XP_002468368.1| hypothetical protein SORBIDRAFT_01g044760 [Sorghum bicolor]
 gb|EER95366.1| hypothetical protein SORBIDRAFT_01g044760 [Sorghum bicolor]
Length=245

 Score =   162 bits (411),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 71/105 (68%), Positives = 83/105 (79%), Gaps = 0/105 (0%)
 Frame = +1

Query  352  PVTLGPKTFVSSVEMFDYFYKLLHSWSTNLNVNKYEHLVLLELLNKGHPEPEKKIGKGVG  531
            PV LGPK F S+VEMFDYF+ LLHSW+  L  NKYE LVL +LL KGH +P KKIG GV 
Sbjct  99   PVKLGPKEFASAVEMFDYFFALLHSWTPQLEFNKYEQLVLEDLLKKGHADPAKKIGAGVE  158

Query  532  GFQVRFHPKYKSRCFFITGEDGSSDDFSFRKCVDNILPLPENMPI  666
             F++R HP ++SRCFF+   DGS+DDFSFRKCVDNILPLPE+M I
Sbjct  159  AFEIRNHPVWQSRCFFVRRTDGSADDFSFRKCVDNILPLPEDMKI  203



>ref|XP_003558636.1| PREDICTED: protein DCL, chloroplastic [Brachypodium distachyon]
Length=236

 Score =   162 bits (409),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 70/103 (68%), Positives = 84/103 (82%), Gaps = 0/103 (0%)
 Frame = +1

Query  352  PVTLGPKTFVSSVEMFDYFYKLLHSWSTNLNVNKYEHLVLLELLNKGHPEPEKKIGKGVG  531
            PV LGPK F SSV+MFDYF+ LLHSW+  L +NKYEH+VL +L+ KGH EP KKIG GV 
Sbjct  89   PVKLGPKEFASSVDMFDYFFALLHSWTPQLEINKYEHMVLEDLVKKGHAEPSKKIGAGVE  148

Query  532  GFQVRFHPKYKSRCFFITGEDGSSDDFSFRKCVDNILPLPENM  660
             F++R HP ++SRCFF+   DGSSDDFSFRKCVDNILPLPE++
Sbjct  149  AFEIRNHPVWQSRCFFVRRVDGSSDDFSFRKCVDNILPLPEDL  191



>emb|CDY00287.1| BnaA06g21880D [Brassica napus]
Length=203

 Score =   160 bits (405),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 71/102 (70%), Positives = 81/102 (79%), Gaps = 0/102 (0%)
 Frame = +1

Query  355  VTLGPKTFVSSVEMFDYFYKLLHSWSTNLNVNKYEHLVLLELLNKGHPEPEKKIGKGVGG  534
            V LGPK F SSV MFDYF K +H W T L+VNKYE +VLL+L+ KGH EP+KKIG G+  
Sbjct  68   VKLGPKEFGSSVAMFDYFTKFMHFWPTGLDVNKYEQMVLLDLIKKGHSEPDKKIGGGIKA  127

Query  535  FQVRFHPKYKSRCFFITGEDGSSDDFSFRKCVDNILPLPENM  660
            FQVR HP +KSRCFF+  ED S+DDFSFRKCVD ILPLPENM
Sbjct  128  FQVRTHPMWKSRCFFLVREDDSADDFSFRKCVDQILPLPENM  169



>gb|KHG12161.1| Protein DCL, chloroplastic [Gossypium arboreum]
Length=223

 Score =   161 bits (407),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 93/203 (46%), Positives = 127/203 (63%), Gaps = 12/203 (6%)
 Frame = +1

Query  76   MAEQTPEVPDTVAEKASSENMDVET--NSPEDLAAENGGAAKrpreegdepdnddngdAS  249
            MA++ P  P+       SE+MD+E   +S ++  A +        + G E D ++  D S
Sbjct  1    MADKEP-SPEPAEANPPSEDMDLENLDSSAQNPNAGDDANGDSKSKRGREEDGEETEDVS  59

Query  250  KKTKVQNPEEEQKVETLegkesaaegekkedksgPVTLGPKTFVSSVEMFDYFYKLLHSW  429
            KK K++   EE+++E             +  +SG V LGPK F SS EM DYF  LLH W
Sbjct  60   KKQKLEKSVEEERLEK---------KSDESPESGRVRLGPKEFGSSSEMLDYFCYLLHHW  110

Query  430  STNLNVNKYEHLVLLELLNKGHPEPEKKIGKGVGGFQVRFHPKYKSRCFFITGEDGSSDD  609
             T LN NKYEH+VLL+LL KGH EPE+KIG GV  FQ+R HP++KS+CFF+  +D + DD
Sbjct  111  GTQLNFNKYEHMVLLDLLKKGHLEPERKIGGGVKAFQIRIHPQWKSKCFFVIRDDETMDD  170

Query  610  FSFRKCVDNILPLPENMPIKHDT  678
            FSFRKC+D+ILPLPE++  K D+
Sbjct  171  FSFRKCIDHILPLPEDLKGKSDS  193



>ref|XP_009151366.1| PREDICTED: protein DCL, chloroplastic [Brassica rapa]
Length=203

 Score =   160 bits (404),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 71/102 (70%), Positives = 81/102 (79%), Gaps = 0/102 (0%)
 Frame = +1

Query  355  VTLGPKTFVSSVEMFDYFYKLLHSWSTNLNVNKYEHLVLLELLNKGHPEPEKKIGKGVGG  534
            V LGPK F SSV MFDYF K +H W T L+VNKYE +VLL+L+ KGH EP+KKIG G+  
Sbjct  68   VKLGPKEFGSSVAMFDYFTKFMHFWPTGLDVNKYEQMVLLDLIKKGHSEPDKKIGGGIKA  127

Query  535  FQVRFHPKYKSRCFFITGEDGSSDDFSFRKCVDNILPLPENM  660
            FQVR HP +KSRCFF+  ED S+DDFSFRKCVD ILPLPENM
Sbjct  128  FQVRTHPMWKSRCFFLVREDDSADDFSFRKCVDQILPLPENM  169



>gb|KFK27971.1| hypothetical protein AALP_AA8G455200 [Arabis alpina]
Length=205

 Score =   160 bits (404),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 67/103 (65%), Positives = 85/103 (83%), Gaps = 0/103 (0%)
 Frame = +1

Query  352  PVTLGPKTFVSSVEMFDYFYKLLHSWSTNLNVNKYEHLVLLELLNKGHPEPEKKIGKGVG  531
            PV LGPK FV+S+ MFDYF K +  W T+L+VNKYE++VLL+L+ KGH EP+KKIG G+ 
Sbjct  70   PVKLGPKEFVTSIAMFDYFTKFMQFWPTDLDVNKYEYMVLLDLIKKGHAEPDKKIGGGIK  129

Query  532  GFQVRFHPKYKSRCFFITGEDGSSDDFSFRKCVDNILPLPENM  660
             FQ++ HP +KSRCFF+  ED S+DDFSFRKCVD+ILPLP+NM
Sbjct  130  TFQIKIHPMWKSRCFFLVREDDSADDFSFRKCVDHILPLPDNM  172



>ref|XP_010029845.1| PREDICTED: zinc finger CCCH domain-containing protein 4 [Eucalyptus 
grandis]
 gb|KCW83613.1| hypothetical protein EUGRSUZ_B00508 [Eucalyptus grandis]
Length=239

 Score =   160 bits (406),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 71/103 (69%), Positives = 83/103 (81%), Gaps = 0/103 (0%)
 Frame = +1

Query  361  LGPKTFVSSVEMFDYFYKLLHSWSTNLNVNKYEHLVLLELLNKGHPEPEKKIGKGVGGFQ  540
            +GPK F S+VEMFDYF+K LH W  N+NVNKYE+L LLEL+ KGH EPEKKIG G+  FQ
Sbjct  103  VGPKEFGSAVEMFDYFFKFLHFWPANVNVNKYEYLTLLELIKKGHSEPEKKIGAGIKAFQ  162

Query  541  VRFHPKYKSRCFFITGEDGSSDDFSFRKCVDNILPLPENMPIK  669
            VRFHP +KS+CFF+  ED S DDFSFRKCVD+I+PLPE M  K
Sbjct  163  VRFHPTFKSKCFFLIREDDSMDDFSFRKCVDHIIPLPEEMKAK  205



>ref|XP_003523019.1| PREDICTED: zinc finger CCCH domain-containing protein 4-like 
[Glycine max]
Length=252

 Score =   160 bits (406),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 74/108 (69%), Positives = 84/108 (78%), Gaps = 0/108 (0%)
 Frame = +1

Query  355  VTLGPKTFVSSVEMFDYFYKLLHSWSTNLNVNKYEHLVLLELLNKGHPEPEKKIGKGVGG  534
            V LG K+F SS+EMF YFY  LH+W   LNVNKYEHL+LLELL  GH EP+KKIG GV  
Sbjct  104  VNLGFKSFGSSLEMFHYFYNFLHTWPQYLNVNKYEHLMLLELLKNGHAEPDKKIGGGVRA  163

Query  535  FQVRFHPKYKSRCFFITGEDGSSDDFSFRKCVDNILPLPENMPIKHDT  678
            FQVR HP +KSRCFF+  ED S+DDFSFRKCVD+ILPLPE M +K D 
Sbjct  164  FQVRKHPTFKSRCFFLIREDDSADDFSFRKCVDHILPLPEEMHLKSDA  211



>ref|NP_001236280.1| uncharacterized protein LOC100305757 [Glycine max]
 gb|ACU13611.1| unknown [Glycine max]
Length=206

 Score =   159 bits (401),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 70/109 (64%), Positives = 85/109 (78%), Gaps = 0/109 (0%)
 Frame = +1

Query  352  PVTLGPKTFVSSVEMFDYFYKLLHSWSTNLNVNKYEHLVLLELLNKGHPEPEKKIGKGVG  531
            PV LG K+F SSVEMFDYFY LLH+W   LN+N+YEH++LLELL  GH EP+ KIG G+ 
Sbjct  65   PVKLGFKSFASSVEMFDYFYNLLHAWPAYLNLNQYEHMMLLELLKNGHTEPDTKIGGGIR  124

Query  532  GFQVRFHPKYKSRCFFITGEDGSSDDFSFRKCVDNILPLPENMPIKHDT  678
             FQVR HP +KSRCFF+  +D S DDFSFRKCVD+ILPLP+ M ++ D 
Sbjct  125  VFQVRKHPMWKSRCFFLVRDDESVDDFSFRKCVDHILPLPQEMQVRPDA  173



>gb|ABR25889.1| unknown [Oryza sativa Indica Group]
Length=150

 Score =   157 bits (396),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 68/105 (65%), Positives = 84/105 (80%), Gaps = 0/105 (0%)
 Frame = +1

Query  352  PVTLGPKTFVSSVEMFDYFYKLLHSWSTNLNVNKYEHLVLLELLNKGHPEPEKKIGKGVG  531
            PV LGPK F + VEMFDYF+ LLHSW+  L +NKYEH+VL +LL KGH E ++KIG G+ 
Sbjct  5    PVKLGPKEFATGVEMFDYFFALLHSWAPQLEINKYEHMVLEDLLKKGHAESDRKIGAGIE  64

Query  532  GFQVRFHPKYKSRCFFITGEDGSSDDFSFRKCVDNILPLPENMPI  666
             F++R HP ++SRCFF+   DGSSDDFSFRKCVD+ILPLPE+M I
Sbjct  65   AFEIRNHPVFQSRCFFVRRVDGSSDDFSFRKCVDSILPLPEDMKI  109



>gb|EMS51361.1| hypothetical protein TRIUR3_16777 [Triticum urartu]
Length=185

 Score =   158 bits (399),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 69/103 (67%), Positives = 83/103 (81%), Gaps = 0/103 (0%)
 Frame = +1

Query  352  PVTLGPKTFVSSVEMFDYFYKLLHSWSTNLNVNKYEHLVLLELLNKGHPEPEKKIGKGVG  531
            PV LGPK F ++V+MFDYF+ LLHSWS NL  NKYE +VL +L+ KGH EP KKIG GV 
Sbjct  38   PVKLGPKEFATAVDMFDYFFALLHSWSPNLEFNKYEQMVLEDLVKKGHAEPAKKIGSGVE  97

Query  532  GFQVRFHPKYKSRCFFITGEDGSSDDFSFRKCVDNILPLPENM  660
             F++R HP ++SRCFFI   DGS+DDFSFRKCVDNILPLPE++
Sbjct  98   AFEIRNHPVWQSRCFFIRRVDGSADDFSFRKCVDNILPLPEDL  140



>ref|XP_006842642.1| hypothetical protein AMTR_s00077p00189420 [Amborella trichopoda]
 gb|ERN04317.1| hypothetical protein AMTR_s00077p00189420 [Amborella trichopoda]
Length=342

 Score =   162 bits (411),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 67/108 (62%), Positives = 88/108 (81%), Gaps = 0/108 (0%)
 Frame = +1

Query  352  PVTLGPKTFVSSVEMFDYFYKLLHSWSTNLNVNKYEHLVLLELLNKGHPEPEKKIGKGVG  531
            PV+LGPK F +SVEMFDYFYK +  W  +++ NKYEH+VL++L+ +GHP+P+KKIG G+ 
Sbjct  198  PVSLGPKGFSTSVEMFDYFYKFITFWPPHVDFNKYEHMVLMDLIKRGHPDPDKKIGNGIR  257

Query  532  GFQVRFHPKYKSRCFFITGEDGSSDDFSFRKCVDNILPLPENMPIKHD  675
             FQVR+HP +KS+C+FI  +DG +DDFS+RKCVD ILPLPENM  K D
Sbjct  258  AFQVRYHPLWKSKCYFIVRDDGLADDFSYRKCVDKILPLPENMKAKTD  305



>gb|KEH33322.1| DUF3223 family protein [Medicago truncatula]
Length=235

 Score =   159 bits (401),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 69/105 (66%), Positives = 84/105 (80%), Gaps = 0/105 (0%)
 Frame = +1

Query  355  VTLGPKTFVSSVEMFDYFYKLLHSWSTNLNVNKYEHLVLLELLNKGHPEPEKKIGKGVGG  534
            V LGPKTF SS++MF YF+K LH+W  NLNVNKYEH +LLELL  GH EP++KIG G+  
Sbjct  88   VKLGPKTFGSSLDMFHYFHKFLHAWPQNLNVNKYEHTMLLELLKNGHAEPDRKIGVGICA  147

Query  535  FQVRFHPKYKSRCFFITGEDGSSDDFSFRKCVDNILPLPENMPIK  669
            FQVR HP+Y SRC+F+  ED ++DDFSFRKCVD+I PLPE M +K
Sbjct  148  FQVRDHPRYNSRCYFLIREDDTADDFSFRKCVDHISPLPEEMQLK  192



>ref|NP_001049206.1| Os03g0187000 [Oryza sativa Japonica Group]
 gb|ABF94366.1| expressed protein [Oryza sativa Japonica Group]
 dbj|BAF11120.1| Os03g0187000 [Oryza sativa Japonica Group]
 dbj|BAG87151.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC74651.1| hypothetical protein OsI_10304 [Oryza sativa Indica Group]
 gb|EEE58461.1| hypothetical protein OsJ_09703 [Oryza sativa Japonica Group]
Length=232

 Score =   158 bits (400),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 68/105 (65%), Positives = 84/105 (80%), Gaps = 0/105 (0%)
 Frame = +1

Query  352  PVTLGPKTFVSSVEMFDYFYKLLHSWSTNLNVNKYEHLVLLELLNKGHPEPEKKIGKGVG  531
            PV LGPK F + VEMFDYF+ LLHSW+  L +NKYEH+VL +LL KGH E ++KIG G+ 
Sbjct  87   PVKLGPKEFATGVEMFDYFFALLHSWAPQLEINKYEHMVLEDLLKKGHAESDRKIGAGIE  146

Query  532  GFQVRFHPKYKSRCFFITGEDGSSDDFSFRKCVDNILPLPENMPI  666
             F++R HP ++SRCFF+   DGSSDDFSFRKCVD+ILPLPE+M I
Sbjct  147  AFEIRNHPVFQSRCFFVRRVDGSSDDFSFRKCVDSILPLPEDMKI  191



>ref|NP_001144806.1| uncharacterized protein LOC100277882 [Zea mays]
 gb|ACG43005.1| hypothetical protein [Zea mays]
 gb|ACG43097.1| hypothetical protein [Zea mays]
 gb|ACG44008.1| hypothetical protein [Zea mays]
 gb|ACN37012.1| unknown [Zea mays]
 gb|AFW89435.1| hypothetical protein ZEAMMB73_275111 [Zea mays]
Length=235

 Score =   158 bits (399),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 71/105 (68%), Positives = 82/105 (78%), Gaps = 0/105 (0%)
 Frame = +1

Query  352  PVTLGPKTFVSSVEMFDYFYKLLHSWSTNLNVNKYEHLVLLELLNKGHPEPEKKIGKGVG  531
            PV LGPK F SSVEMFDYF+ LLH W+  +  NKYE +VL +LL KGH EP KKIG GV 
Sbjct  91   PVKLGPKEFSSSVEMFDYFFGLLHYWTPQIEFNKYEQMVLEDLLKKGHAEPAKKIGAGVE  150

Query  532  GFQVRFHPKYKSRCFFITGEDGSSDDFSFRKCVDNILPLPENMPI  666
             F++R HP ++SRCFFI   DGSSDDFSFRKCVDNILPLPE+M +
Sbjct  151  AFEIRNHPVWQSRCFFIRRIDGSSDDFSFRKCVDNILPLPEDMKV  195



>ref|XP_004985426.1| PREDICTED: protein DCL, chloroplastic-like [Setaria italica]
Length=231

 Score =   155 bits (392),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 68/105 (65%), Positives = 82/105 (78%), Gaps = 0/105 (0%)
 Frame = +1

Query  352  PVTLGPKTFVSSVEMFDYFYKLLHSWSTNLNVNKYEHLVLLELLNKGHPEPEKKIGKGVG  531
            P  LGPK F ++VEMFDYF+ LLHSW+  L  NKYE +VL +LL KGH EP KKIG G+ 
Sbjct  87   PAKLGPKEFATAVEMFDYFFALLHSWAPQLEFNKYEQMVLEDLLKKGHAEPAKKIGPGIE  146

Query  532  GFQVRFHPKYKSRCFFITGEDGSSDDFSFRKCVDNILPLPENMPI  666
             F++R HP ++SRCFF+   DGS+DDFSFRKCVDNILPLPE+M I
Sbjct  147  AFEIRNHPVWQSRCFFVRRVDGSADDFSFRKCVDNILPLPEDMKI  191



>ref|XP_010258340.1| PREDICTED: uncharacterized protein LOC104598124 [Nelumbo nucifera]
Length=239

 Score =   155 bits (391),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 66/109 (61%), Positives = 85/109 (78%), Gaps = 0/109 (0%)
 Frame = +1

Query  352  PVTLGPKTFVSSVEMFDYFYKLLHSWSTNLNVNKYEHLVLLELLNKGHPEPEKKIGKGVG  531
            PV++GPK F SS E+F+YFYK LH W  N+NVN+YEH++LL LL KGH + E+K+G GV 
Sbjct  100  PVSVGPKNFSSSEEIFNYFYKFLHCWPPNVNVNQYEHMMLLNLLEKGHADAERKLGGGVD  159

Query  532  GFQVRFHPKYKSRCFFITGEDGSSDDFSFRKCVDNILPLPENMPIKHDT  678
             FQVR+HP +K RCFF+  +D S DDFSFRKC+D+ILPLPE+M +  D 
Sbjct  160  AFQVRYHPLWKKRCFFLIRQDESVDDFSFRKCIDHILPLPESMKVNSDV  208



>ref|XP_002319012.2| hypothetical protein POPTR_0013s02280g [Populus trichocarpa]
 gb|EEE94935.2| hypothetical protein POPTR_0013s02280g [Populus trichocarpa]
Length=152

 Score =   152 bits (383),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 70/109 (64%), Positives = 83/109 (76%), Gaps = 0/109 (0%)
 Frame = +1

Query  352  PVTLGPKTFVSSVEMFDYFYKLLHSWSTNLNVNKYEHLVLLELLNKGHPEPEKKIGKGVG  531
            PV LGPKTFVS+VEMFD+FY  LH W  NLNVNK+EH+VL+ELL + H EPEKKIG G+ 
Sbjct  20   PVRLGPKTFVSAVEMFDFFYNFLHFWPPNLNVNKFEHMVLVELLMQDHLEPEKKIGCGIQ  79

Query  532  GFQVRFHPKYKSRCFFITGEDGSSDDFSFRKCVDNILPLPENMPIKHDT  678
             FQ+RF P +K+RC F+  +D   DDFSF K  DNILPLPE+M IK D 
Sbjct  80   AFQLRFRPMWKTRCIFLIWDDEFVDDFSFWKRTDNILPLPEDMRIKSDA  128



>gb|KHN18554.1| hypothetical protein glysoja_006967 [Glycine soja]
Length=216

 Score =   152 bits (385),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 70/109 (64%), Positives = 83/109 (76%), Gaps = 0/109 (0%)
 Frame = +1

Query  352  PVTLGPKTFVSSVEMFDYFYKLLHSWSTNLNVNKYEHLVLLELLNKGHPEPEKKIGKGVG  531
            PV LG K+F SS+EMFDYFY LLH+W    N+N+YEH++LLELL  GH EP+ KIG G+ 
Sbjct  61   PVKLGFKSFASSLEMFDYFYNLLHAWPPFQNLNQYEHMMLLELLKNGHTEPDTKIGGGIC  120

Query  532  GFQVRFHPKYKSRCFFITGEDGSSDDFSFRKCVDNILPLPENMPIKHDT  678
             FQVR HP +KSRCFF+  E  S DDFSFRKCVD+ILPLPE M +K D 
Sbjct  121  VFQVRKHPMWKSRCFFLVREGESVDDFSFRKCVDHILPLPEEMQVKPDA  169



>ref|XP_007155309.1| hypothetical protein PHAVU_003G190000g [Phaseolus vulgaris]
 gb|ESW27303.1| hypothetical protein PHAVU_003G190000g [Phaseolus vulgaris]
Length=219

 Score =   152 bits (385),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 91/193 (47%), Positives = 121/193 (63%), Gaps = 8/193 (4%)
 Frame = +1

Query  100  PDTVAEKASSENMDVETNSPEDLAAENGGAAKrpreegdepdnddngdASKKTKVQNPEE  279
            P+ V    +   +D+   S E  A ++    +  ++   E  + +    SKK KV+ PEE
Sbjct  4    PEIVDPSTTDAAVDMAVESSEPAAVDSASNGEPNQKRSRENHDGEVDGVSKKHKVE-PEE  62

Query  280  EQKVETLegkesaaegekkedksgPVTLGPKTFVSSVEMFDYFYKLLHSWSTNLNVNKYE  459
            E++  T        E EK++  SGPV LG  +F SSVEMFDYF  LLH+W   LN+N+YE
Sbjct  63   EREPLT-------GEDEKEKKPSGPVKLGFLSFASSVEMFDYFNNLLHTWPPYLNLNQYE  115

Query  460  HLVLLELLNKGHPEPEKKIGKGVGGFQVRFHPKYKSRCFFITGEDGSSDDFSFRKCVDNI  639
            H +LLELL  GH  P++KIG G+  FQVR HP +KSRCFF+  ++ S DDFSFRKCVD+I
Sbjct  116  HTMLLELLKNGHTGPDEKIGGGIRVFQVRKHPMWKSRCFFLIRDNESVDDFSFRKCVDSI  175

Query  640  LPLPENMPIKHDT  678
            LPLPE M +KHD 
Sbjct  176  LPLPEEMQVKHDA  188



>ref|XP_009403245.1| PREDICTED: uncharacterized protein LOC103986852 [Musa acuminata 
subsp. malaccensis]
Length=226

 Score =   152 bits (385),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 67/102 (66%), Positives = 83/102 (81%), Gaps = 0/102 (0%)
 Frame = +1

Query  355  VTLGPKTFVSSVEMFDYFYKLLHSWSTNLNVNKYEHLVLLELLNKGHPEPEKKIGKGVGG  534
              +GPK F SSVEMF+YF KLL SWS +L++NKYEH+VLL+LL KGHP+P KKIG G+  
Sbjct  86   ANVGPKGFKSSVEMFEYFLKLLRSWSPDLDINKYEHMVLLDLLKKGHPDPAKKIGAGIEA  145

Query  535  FQVRFHPKYKSRCFFITGEDGSSDDFSFRKCVDNILPLPENM  660
            FQVR HP +KSRCFF+   DG+SDDFSF KCVD ILP+P+++
Sbjct  146  FQVRNHPTFKSRCFFLVRADGTSDDFSFCKCVDMILPMPDHL  187



>gb|KHG30734.1| DNA-directed RNA polymerase D subunit 1 -like protein [Gossypium 
arboreum]
Length=216

 Score =   151 bits (382),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 74/102 (73%), Positives = 87/102 (85%), Gaps = 0/102 (0%)
 Frame = +1

Query  355  VTLGPKTFVSSVEMFDYFYKLLHSWSTNLNVNKYEHLVLLELLNKGHPEPEKKIGKGVGG  534
            V LGPK F SSVEMFDYFY LLH W+T+LN+NKYEH+VLLELL KGH EP+KKIGKG+ G
Sbjct  89   VRLGPKEFGSSVEMFDYFYNLLHYWATHLNLNKYEHMVLLELLKKGHEEPDKKIGKGIKG  148

Query  535  FQVRFHPKYKSRCFFITGEDGSSDDFSFRKCVDNILPLPENM  660
            FQVR HP +KS+CFF+  +D + DDFSFRKCVD+ILPLP+ M
Sbjct  149  FQVRIHPVWKSKCFFVIKDDDTFDDFSFRKCVDHILPLPDEM  190



>ref|NP_001145212.1| uncharacterized protein LOC100278469 [Zea mays]
 gb|ACG45819.1| hypothetical protein [Zea mays]
Length=261

 Score =   152 bits (385),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 66/105 (63%), Positives = 79/105 (75%), Gaps = 0/105 (0%)
 Frame = +1

Query  352  PVTLGPKTFVSSVEMFDYFYKLLHSWSTNLNVNKYEHLVLLELLNKGHPEPEKKIGKGVG  531
            PV LGPK F S+++MF+YFY LLHSW+  L  NKYE +VL +LL KGH EP KKIG GV 
Sbjct  117  PVKLGPKEFASAIDMFNYFYALLHSWTPQLEFNKYEQMVLEDLLRKGHAEPAKKIGAGVE  176

Query  532  GFQVRFHPKYKSRCFFITGEDGSSDDFSFRKCVDNILPLPENMPI  666
             F++  HP ++S CFF+   DGS DDFSFRKCVDNILPLPE+  I
Sbjct  177  AFEIGNHPVWRSHCFFVRRTDGSVDDFSFRKCVDNILPLPEDFKI  221



>gb|KHG30737.1| DNA-directed RNA polymerase D subunit 1 -like protein [Gossypium 
arboreum]
Length=197

 Score =   150 bits (380),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 74/102 (73%), Positives = 87/102 (85%), Gaps = 0/102 (0%)
 Frame = +1

Query  355  VTLGPKTFVSSVEMFDYFYKLLHSWSTNLNVNKYEHLVLLELLNKGHPEPEKKIGKGVGG  534
            V LGPK F SSVEMFDYFY LLH W+T+LN+NKYEH+VLLELL KGH EP+KKIGKG+ G
Sbjct  70   VRLGPKEFGSSVEMFDYFYNLLHYWATHLNLNKYEHMVLLELLKKGHEEPDKKIGKGIKG  129

Query  535  FQVRFHPKYKSRCFFITGEDGSSDDFSFRKCVDNILPLPENM  660
            FQVR HP +KS+CFF+  +D + DDFSFRKCVD+ILPLP+ M
Sbjct  130  FQVRIHPVWKSKCFFVINDDDTFDDFSFRKCVDHILPLPDEM  171



>ref|XP_002319542.1| hypothetical protein POPTR_0013s02340g [Populus trichocarpa]
 gb|EEE95465.1| hypothetical protein POPTR_0013s02340g [Populus trichocarpa]
Length=232

 Score =   151 bits (381),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 71/110 (65%), Positives = 89/110 (81%), Gaps = 0/110 (0%)
 Frame = +1

Query  352  PVTLGPKTFVSSVEMFDYFYKLLHSWSTNLNVNKYEHLVLLELLNKGHPEPEKKIGKGVG  531
            PV+LGPK+F S+VEMFDYFY  LH W  N+ VNKYEH+VL++LL  GH EP+KKIG G+ 
Sbjct  90   PVSLGPKSFGSAVEMFDYFYNFLHQWPPNIKVNKYEHMVLVDLLKTGHSEPDKKIGSGIQ  149

Query  532  GFQVRFHPKYKSRCFFITGEDGSSDDFSFRKCVDNILPLPENMPIKHDTY  681
             FQVRFHP++KSRC F+  +D S DDFSFRKCVD+ILPLPE++ +K D +
Sbjct  150  AFQVRFHPRFKSRCLFLIRDDDSVDDFSFRKCVDHILPLPEDLKVKSDNF  199



>ref|XP_003550782.1| PREDICTED: protein DCL, chloroplastic-like [Glycine max]
Length=208

 Score =   150 bits (378),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 69/109 (63%), Positives = 82/109 (75%), Gaps = 0/109 (0%)
 Frame = +1

Query  352  PVTLGPKTFVSSVEMFDYFYKLLHSWSTNLNVNKYEHLVLLELLNKGHPEPEKKIGKGVG  531
            PV LG K+F SS+EMFDYFY LLH+W    N+N+YEH++LLELL  GH EP+ KIG G+ 
Sbjct  61   PVKLGFKSFASSLEMFDYFYNLLHAWPPFQNLNQYEHMMLLELLKNGHTEPDTKIGGGIC  120

Query  532  GFQVRFHPKYKSRCFFITGEDGSSDDFSFRKCVDNILPLPENMPIKHDT  678
             FQVR HP +KSRCFF+  E  S DDFSF KCVD+ILPLPE M +K D 
Sbjct  121  VFQVRKHPMWKSRCFFLVREGESVDDFSFHKCVDHILPLPEEMQVKPDA  169



>ref|XP_010091522.1| hypothetical protein L484_015949 [Morus notabilis]
 gb|EXB44692.1| hypothetical protein L484_015949 [Morus notabilis]
Length=227

 Score =   149 bits (377),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 93/208 (45%), Positives = 128/208 (62%), Gaps = 19/208 (9%)
 Frame = +1

Query  76   MAEQ-TPEVPDTVAEK--ASSENMDVETNSPEDLAAENGGAAKrpreegdepdnddngdA  246
            MAEQ  PE+ +  +E+  A +E+M++E   P   + +NG    +   E  +  +++N  +
Sbjct  1    MAEQNAPELSEANSEQQNAVTEDMELEATEPVQESNDNGETNSKRAREEGDGSSEENDVS  60

Query  247  SKK----TKVQNPEEEQKVETLegkesaaegekkedksgPVTLGPKTFVSSVEMFDYFYK  414
            S++    +K Q   +E+ VE         E +  +++SG V+LGPK+F SSVEMFDYFYK
Sbjct  61   SEENEGVSKKQKVGDEKSVEE-----ERLEKKLADEESGRVSLGPKSFGSSVEMFDYFYK  115

Query  415  LLHSWSTNLNVNKYEHLVLLELLNKGHPEPEKKIGKGVGGFQVRFHPKYKSRCFFITGED  594
             LH W  NLNVNK+       L    H EP+KKIG G+  FQVR+HP +KSRCFF+   D
Sbjct  116  FLHYWPPNLNVNKF-------LFFARHAEPDKKIGGGIRAFQVRYHPMFKSRCFFLIRND  168

Query  595  GSSDDFSFRKCVDNILPLPENMPIKHDT  678
             S DDFSFRKCVD ILPLPE+M +K D 
Sbjct  169  ESYDDFSFRKCVDRILPLPEDMKVKSDA  196



>ref|XP_008795182.1| PREDICTED: protein DCL, chloroplastic-like [Phoenix dactylifera]
Length=100

 Score =   143 bits (361),  Expect = 1e-38, Method: Composition-based stats.
 Identities = 59/94 (63%), Positives = 77/94 (82%), Gaps = 0/94 (0%)
 Frame = +1

Query  355  VTLGPKTFVSSVEMFDYFYKLLHSWSTNLNVNKYEHLVLLELLNKGHPEPEKKIGKGVGG  534
            V+LGPK F SS EMFDY++ LL  WS NL++N+YEH+VLL++L +GHPEP+KKIG+G+  
Sbjct  3    VSLGPKVFDSSKEMFDYYFNLLRHWSLNLDINEYEHMVLLDILQRGHPEPDKKIGEGIRA  62

Query  535  FQVRFHPKYKSRCFFITGEDGSSDDFSFRKCVDN  636
            FQVR+ P +KSRCFFI   DG+ DDFSFRKC+ +
Sbjct  63   FQVRYRPAWKSRCFFIVWVDGADDDFSFRKCISD  96



>gb|KHN32529.1| Protein DCL, chloroplastic [Glycine soja]
Length=136

 Score =   144 bits (363),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 66/95 (69%), Positives = 74/95 (78%), Gaps = 0/95 (0%)
 Frame = +1

Query  394  MFDYFYKLLHSWSTNLNVNKYEHLVLLELLNKGHPEPEKKIGKGVGGFQVRFHPKYKSRC  573
            MF YFY  LH+W   LNVNKYEHL+LLELL  GH EP+KKIG GV  FQVR HP +KSRC
Sbjct  1    MFHYFYNFLHTWPQYLNVNKYEHLMLLELLKNGHAEPDKKIGGGVRAFQVRKHPTFKSRC  60

Query  574  FFITGEDGSSDDFSFRKCVDNILPLPENMPIKHDT  678
            FF+  ED S+DDFSFRKCVD+ILPLPE M +K D 
Sbjct  61   FFLIREDDSADDFSFRKCVDHILPLPEEMHLKSDA  95



>gb|KHN26248.1| DNA-directed RNA polymerase E subunit 1 [Glycine soja]
Length=139

 Score =   144 bits (363),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 66/95 (69%), Positives = 74/95 (78%), Gaps = 0/95 (0%)
 Frame = +1

Query  394  MFDYFYKLLHSWSTNLNVNKYEHLVLLELLNKGHPEPEKKIGKGVGGFQVRFHPKYKSRC  573
            MF YFY  LH+W   LNVNKYEHL+LLELL  GH EP+KKIG GV  FQVR HP +KSRC
Sbjct  1    MFHYFYNFLHTWPQYLNVNKYEHLMLLELLKNGHAEPDKKIGGGVRAFQVRKHPTFKSRC  60

Query  574  FFITGEDGSSDDFSFRKCVDNILPLPENMPIKHDT  678
            FF+  ED S+DDFSFRKCVD+ILPLPE M +K D 
Sbjct  61   FFLIREDDSADDFSFRKCVDHILPLPEEMHLKFDA  95



>emb|CBI15220.3| unnamed protein product [Vitis vinifera]
Length=128

 Score =   142 bits (357),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 62/92 (67%), Positives = 75/92 (82%), Gaps = 0/92 (0%)
 Frame = +1

Query  394  MFDYFYKLLHSWSTNLNVNKYEHLVLLELLNKGHPEPEKKIGKGVGGFQVRFHPKYKSRC  573
            MFD+F+K LH W  NL+VNKYEH++LL+LL KGH EP+KKIG G+  FQVR+HP +KSRC
Sbjct  1    MFDHFFKFLHYWPANLDVNKYEHMMLLDLLKKGHTEPDKKIGGGIHAFQVRYHPVFKSRC  60

Query  574  FFITGEDGSSDDFSFRKCVDNILPLPENMPIK  669
            FF+  +D S DDFSFRKCVD+I PLPENM  K
Sbjct  61   FFVIRDDESVDDFSFRKCVDHISPLPENMKAK  92



>gb|ABF94367.1| expressed protein [Oryza sativa Japonica Group]
Length=132

 Score =   138 bits (348),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 59/91 (65%), Positives = 74/91 (81%), Gaps = 0/91 (0%)
 Frame = +1

Query  394  MFDYFYKLLHSWSTNLNVNKYEHLVLLELLNKGHPEPEKKIGKGVGGFQVRFHPKYKSRC  573
            MFDYF+ LLHSW+  L +NKYEH+VL +LL KGH E ++KIG G+  F++R HP ++SRC
Sbjct  1    MFDYFFALLHSWAPQLEINKYEHMVLEDLLKKGHAESDRKIGAGIEAFEIRNHPVFQSRC  60

Query  574  FFITGEDGSSDDFSFRKCVDNILPLPENMPI  666
            FF+   DGSSDDFSFRKCVD+ILPLPE+M I
Sbjct  61   FFVRRVDGSSDDFSFRKCVDSILPLPEDMKI  91



>gb|KHN48689.1| DNA-directed RNA polymerase E subunit 1 [Glycine soja]
Length=128

 Score =   137 bits (346),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 60/95 (63%), Positives = 74/95 (78%), Gaps = 0/95 (0%)
 Frame = +1

Query  394  MFDYFYKLLHSWSTNLNVNKYEHLVLLELLNKGHPEPEKKIGKGVGGFQVRFHPKYKSRC  573
            MFDYFY LLH+W   LN+N+YEH++LLELL  GH EP+ KIG G+  FQVR HP +KSRC
Sbjct  1    MFDYFYNLLHAWPAYLNLNQYEHMMLLELLKNGHTEPDTKIGGGIRVFQVRKHPMWKSRC  60

Query  574  FFITGEDGSSDDFSFRKCVDNILPLPENMPIKHDT  678
            FF+  +D S DDFSFRKCVD+ILPLP+ M ++ D 
Sbjct  61   FFLVRDDESVDDFSFRKCVDHILPLPQEMQVRPDA  95



>ref|XP_001753803.1| predicted protein [Physcomitrella patens]
 gb|EDQ81555.1| predicted protein [Physcomitrella patens]
Length=141

 Score =   134 bits (338),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 57/103 (55%), Positives = 81/103 (79%), Gaps = 3/103 (3%)
 Frame = +1

Query  352  PVTLGPKTFVSSVEMFDYFYKLLHSWSTNLNVNKYEHLVLLELLNKGHPEPEKKIGKGVG  531
            P  LGPK F ++VEMF YFY LLH W+ NL+VNKYE++VL EL+ +G+P+   KIG G+ 
Sbjct  9    PKKLGPKVFNTAVEMFIYFYDLLHEWTLNLSVNKYEYMVLSELVAQGNPQ---KIGDGIA  65

Query  532  GFQVRFHPKYKSRCFFITGEDGSSDDFSFRKCVDNILPLPENM  660
             FQ+R HP++KSRC+++  +DGS +DFS+RKCVD ++PLP ++
Sbjct  66   AFQIRNHPQWKSRCYYLIRKDGSEEDFSYRKCVDALMPLPASI  108



>ref|XP_002977413.1| hypothetical protein SELMODRAFT_417447 [Selaginella moellendorffii]
 gb|EFJ21417.1| hypothetical protein SELMODRAFT_417447 [Selaginella moellendorffii]
Length=248

 Score =   137 bits (344),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 56/103 (54%), Positives = 79/103 (77%), Gaps = 1/103 (1%)
 Frame = +1

Query  355  VTLGPKTFVSSVEMFDYFYKLLHSWSTNLNVNKYEHLVLLELLNKGHPEPEKKIG-KGVG  531
            V LGP TF S  EMF YFY+LLH W+ + ++N+YEH+VLL+LLNKGH +PE K+G  G  
Sbjct  94   VKLGPMTFSSGKEMFMYFYELLHGWAADYDMNEYEHMVLLDLLNKGHNDPEAKMGPGGAK  153

Query  532  GFQVRFHPKYKSRCFFITGEDGSSDDFSFRKCVDNILPLPENM  660
             FQ+R HP ++SRC+++   DG++ DFS+RKCVD ++PLP+ +
Sbjct  154  AFQIRVHPVWRSRCYYLVRADGTAVDFSYRKCVDKLMPLPQEI  196



>ref|XP_002974996.1| hypothetical protein SELMODRAFT_442719 [Selaginella moellendorffii]
 gb|EFJ23781.1| hypothetical protein SELMODRAFT_442719 [Selaginella moellendorffii]
Length=249

 Score =   136 bits (343),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 56/103 (54%), Positives = 79/103 (77%), Gaps = 1/103 (1%)
 Frame = +1

Query  355  VTLGPKTFVSSVEMFDYFYKLLHSWSTNLNVNKYEHLVLLELLNKGHPEPEKKIG-KGVG  531
            V LGP TF S  EMF YFY+LLH W+ + ++N+YEH+VLL+LLNKGH +PE K+G  G  
Sbjct  95   VKLGPMTFSSGKEMFMYFYELLHGWAADYDMNEYEHMVLLDLLNKGHNDPEAKMGPGGAK  154

Query  532  GFQVRFHPKYKSRCFFITGEDGSSDDFSFRKCVDNILPLPENM  660
             FQ+R HP ++SRC+++   DG++ DFS+RKCVD ++PLP+ +
Sbjct  155  AFQIRVHPVWRSRCYYLVRADGTAVDFSYRKCVDKLMPLPQEI  197



>ref|XP_001753605.1| predicted protein [Physcomitrella patens]
 gb|EDQ81828.1| predicted protein, partial [Physcomitrella patens]
Length=171

 Score =   134 bits (336),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 56/100 (56%), Positives = 78/100 (78%), Gaps = 3/100 (3%)
 Frame = +1

Query  361  LGPKTFVSSVEMFDYFYKLLHSWSTNLNVNKYEHLVLLELLNKGHPEPEKKIGKGVGGFQ  540
            LGPK F + V+MF YFY LLH W  N+NVNKYE+LVL EL+ +G+P+   K+G G+  FQ
Sbjct  39   LGPKVFETPVKMFSYFYNLLHDWQFNVNVNKYEYLVLSELVAQGNPQ---KVGDGIAAFQ  95

Query  541  VRFHPKYKSRCFFITGEDGSSDDFSFRKCVDNILPLPENM  660
            +R HP++KSRC+++  +DGS +DFS+RKCVD ++PLP N+
Sbjct  96   IRNHPEWKSRCYYLIRKDGSEEDFSYRKCVDALMPLPANL  135



>ref|XP_003609061.1| hypothetical protein MTR_4g108450 [Medicago truncatula]
 gb|KEH16585.1| DUF3223 family protein [Medicago truncatula]
Length=195

 Score =   122 bits (305),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 57/95 (60%), Positives = 66/95 (69%), Gaps = 13/95 (14%)
 Frame = +1

Query  394  MFDYFYKLLHSWSTNLNVNKYEHLVLLELLNKGHPEPEKKIGKGVGGFQVRFHPKYKSRC  573
            +FDYF   LH+W  NLNVNKYEH +LLELL KGHPEP++KIG  +  FQVR         
Sbjct  82   LFDYFNSFLHAWGPNLNVNKYEHTMLLELLMKGHPEPDQKIGGKIRAFQVR---------  132

Query  574  FFITGEDGSSDDFSFRKCVDNILPLPENMPIKHDT  678
                 ED S+DDFSFRKCVD+ILPLPE M +KHD 
Sbjct  133  ----KEDESADDFSFRKCVDHILPLPEAMQVKHDA  163



>ref|XP_004497728.1| PREDICTED: uncharacterized protein LOC101504695 [Cicer arietinum]
Length=125

 Score =   116 bits (291),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 52/78 (67%), Positives = 62/78 (79%), Gaps = 0/78 (0%)
 Frame = +1

Query  445  VNKYEHLVLLELLNKGHPEPEKKIGKGVGGFQVRFHPKYKSRCFFITGEDGSSDDFSFRK  624
            V +YEH +LLEL+ KGHPEP KKIG  +  FQVR HP +KS+CFF+  ED S+DDFSFRK
Sbjct  18   VWQYEHKMLLELIMKGHPEPHKKIGGEICAFQVRRHPMWKSKCFFLIREDESADDFSFRK  77

Query  625  CVDNILPLPENMPIKHDT  678
            CVD+ILPLPE M +KHD 
Sbjct  78   CVDHILPLPEAMQVKHDA  95



>ref|XP_004492623.1| PREDICTED: uncharacterized protein LOC101492280 [Cicer arietinum]
Length=161

 Score =   117 bits (293),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 51/75 (68%), Positives = 60/75 (80%), Gaps = 0/75 (0%)
 Frame = +1

Query  454  YEHLVLLELLNKGHPEPEKKIGKGVGGFQVRFHPKYKSRCFFITGEDGSSDDFSFRKCVD  633
            YEH +LLEL+ KGHPEP KKIG  +  FQVR HP +KS+CFF+  ED S+DDFSFRKCVD
Sbjct  57   YEHKMLLELIMKGHPEPHKKIGGEICAFQVRMHPMWKSKCFFLIREDESADDFSFRKCVD  116

Query  634  NILPLPENMPIKHDT  678
            +ILPLPE M +KHD 
Sbjct  117  HILPLPEAMQVKHDA  131



>ref|XP_002500133.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO61391.1| predicted protein [Micromonas sp. RCC299]
Length=218

 Score =   112 bits (281),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 48/98 (49%), Positives = 66/98 (67%), Gaps = 0/98 (0%)
 Frame = +1

Query  352  PVTLGPKTFVSSVEMFDYFYKLLHSWSTNLNVNKYEHLVLLELLNKGHPEPEKKIGKGVG  531
            PV LGPKTF S  EM  YF  LL++ + N ++N YE +V+   L   HPE EKKIG G+ 
Sbjct  53   PVKLGPKTFNSPDEMIKYFSWLLNAMTMNQDMNDYERMVVEACLRDAHPEAEKKIGCGIK  112

Query  532  GFQVRFHPKYKSRCFFITGEDGSSDDFSFRKCVDNILP  645
             FQ+R HP++ SRC+ +   DG+ +DFS+RKCV+ + P
Sbjct  113  SFQIRTHPEHDSRCYMVVRTDGTCEDFSYRKCVEKLFP  150



>dbj|BAB11494.1| unnamed protein product [Arabidopsis thaliana]
Length=100

 Score =   105 bits (263),  Expect = 2e-24, Method: Composition-based stats.
 Identities = 47/66 (71%), Positives = 55/66 (83%), Gaps = 0/66 (0%)
 Frame = +1

Query  463  LVLLELLNKGHPEPEKKIGKGVGGFQVRFHPKYKSRCFFITGEDGSSDDFSFRKCVDNIL  642
            +VLL+L+ KGH EPEKKIG G+  FQVR HP +KSRCFF+  ED ++DDFSFRKCVD IL
Sbjct  1    MVLLDLIKKGHSEPEKKIGGGIKTFQVRTHPMWKSRCFFLVREDDTADDFSFRKCVDQIL  60

Query  643  PLPENM  660
            PLPENM
Sbjct  61   PLPENM  66



>emb|CAN70579.1| hypothetical protein VITISV_004014 [Vitis vinifera]
Length=101

 Score =   104 bits (259),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 46/69 (67%), Positives = 56/69 (81%), Gaps = 0/69 (0%)
 Frame = +1

Query  463  LVLLELLNKGHPEPEKKIGKGVGGFQVRFHPKYKSRCFFITGEDGSSDDFSFRKCVDNIL  642
            ++LL+LL KGH EP+KKIG G+  FQVR+HP +KSRCFF+  +D S DDFSFRKCVD+I 
Sbjct  1    MMLLDLLKKGHTEPDKKIGGGIHAFQVRYHPVFKSRCFFVIRDDESVDDFSFRKCVDHIS  60

Query  643  PLPENMPIK  669
            PLPENM  K
Sbjct  61   PLPENMKAK  69



>ref|XP_009615031.1| PREDICTED: protein DCL, chloroplastic-like [Nicotiana tomentosiformis]
Length=96

 Score =   102 bits (255),  Expect = 2e-23, Method: Composition-based stats.
 Identities = 46/70 (66%), Positives = 54/70 (77%), Gaps = 0/70 (0%)
 Frame = +1

Query  463  LVLLELLNKGHPEPEKKIGKGVGGFQVRFHPKYKSRCFFITGEDGSSDDFSFRKCVDNIL  642
            +VLL+LL KGH EPEKKI  GV  FQ+RF P++KS CFF+  ED S DDFSFRKC+D I 
Sbjct  1    MVLLDLLKKGHSEPEKKIRTGVRAFQIRFQPQFKSCCFFVVREDDSVDDFSFRKCLDQIQ  60

Query  643  PLPENMPIKH  672
            PLP NM +KH
Sbjct  61   PLPANMQVKH  70



>emb|CEF98737.1| Copper amine oxidase, N2/N3-terminal, partial [Ostreococcus tauri]
Length=218

 Score =   102 bits (255),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 48/98 (49%), Positives = 61/98 (62%), Gaps = 0/98 (0%)
 Frame = +1

Query  352  PVTLGPKTFVSSVEMFDYFYKLLHSWSTNLNVNKYEHLVLLELLNKGHPEPEKKIGKGVG  531
            PVTLGPKTF S  ++  YF KL +  + + N+N+YE  V   LL  GH E EKK G G+ 
Sbjct  55   PVTLGPKTFTSGDDLMKYFGKLRNELTLDQNMNEYEQSVTEALLRLGHAEAEKKFGAGLR  114

Query  532  GFQVRFHPKYKSRCFFITGEDGSSDDFSFRKCVDNILP  645
             FQVR HP + SRCF I   D + +DFS+RKC   + P
Sbjct  115  SFQVRNHPTHGSRCFMIVRVDNTVEDFSYRKCAGRLFP  152



>ref|XP_007514553.1| predicted protein [Bathycoccus prasinos]
 emb|CCO14793.1| predicted protein [Bathycoccus prasinos]
Length=240

 Score = 91.7 bits (226),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 41/99 (41%), Positives = 64/99 (65%), Gaps = 1/99 (1%)
 Frame = +1

Query  352  PVTLGPKTFVSSVEMFDYFYKLLHSWSTNLNVNKYEHLVLLELLNKGHPEPEKKIGK-GV  528
            PV LGPKTF +  +   Y   LL++ + + ++N YE LV+  +L +GH + EKKIG+ G+
Sbjct  100  PVKLGPKTFDTPEDAIKYISWLLNTVTMHQDLNDYERLVVEGMLRRGHEDAEKKIGESGI  159

Query  529  GGFQVRFHPKYKSRCFFITGEDGSSDDFSFRKCVDNILP  645
               QV+ H ++ S+C+++   DGS  DFS+RKCV+   P
Sbjct  160  KSIQVKVHQEHDSKCYYVVRNDGSRSDFSYRKCVEGCFP  198



>ref|XP_003057804.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH57755.1| predicted protein [Micromonas pusilla CCMP1545]
Length=156

 Score = 89.4 bits (220),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 35/84 (42%), Positives = 58/84 (69%), Gaps = 0/84 (0%)
 Frame = +1

Query  394  MFDYFYKLLHSWSTNLNVNKYEHLVLLELLNKGHPEPEKKIGKGVGGFQVRFHPKYKSRC  573
            M  YF  +L++ + N ++N YE +V+   L   HP+ EKKIG G+  FQ+R HP++++RC
Sbjct  1    MVKYFSWILNNMTINQDMNDYERMVVEPCLRTAHPDAEKKIGSGIKAFQIRTHPEHETRC  60

Query  574  FFITGEDGSSDDFSFRKCVDNILP  645
            + +   DG+++DFS+RKCV+ + P
Sbjct  61   YTVIRTDGTTEDFSYRKCVEVLFP  84



>ref|XP_005646811.1| hypothetical protein COCSUDRAFT_47805 [Coccomyxa subellipsoidea 
C-169]
 gb|EIE22267.1| hypothetical protein COCSUDRAFT_47805 [Coccomyxa subellipsoidea 
C-169]
Length=350

 Score = 90.1 bits (222),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 44/98 (45%), Positives = 57/98 (58%), Gaps = 0/98 (0%)
 Frame = +1

Query  352  PVTLGPKTFVSSVEMFDYFYKLLHSWSTNLNVNKYEHLVLLELLNKGHPEPEKKIGKGVG  531
            P  +G K F    E   YF  LL++ +    +N+YE  ++LELL  GHPEPEKK+G GV 
Sbjct  133  PKKIGYKLFKDGKEAATYFRTLLNALTQRQPLNEYEFHMVLELLKNGHPEPEKKMGSGVK  192

Query  532  GFQVRFHPKYKSRCFFITGEDGSSDDFSFRKCVDNILP  645
               VR H    S CFF+   DGS DDFS  KC++ + P
Sbjct  193  AIIVRKHQTEDSNCFFLLRTDGSMDDFSVFKCINRLFP  230



>ref|XP_001774741.1| predicted protein [Physcomitrella patens]
 gb|EDQ60412.1| predicted protein [Physcomitrella patens]
Length=50

 Score = 78.6 bits (192),  Expect = 3e-15, Method: Composition-based stats.
 Identities = 29/50 (58%), Positives = 40/50 (80%), Gaps = 0/50 (0%)
 Frame = +1

Query  511  KIGKGVGGFQVRFHPKYKSRCFFITGEDGSSDDFSFRKCVDNILPLPENM  660
            K+  G+  FQVR HP ++SRC+F+  +DGS DDFSFRKCV+ ++PLPEN+
Sbjct  1    KVAGGIVAFQVRIHPDWQSRCYFLIRKDGSDDDFSFRKCVNTLMPLPENL  50



>ref|XP_005848324.1| hypothetical protein CHLNCDRAFT_145004 [Chlorella variabilis]
 gb|EFN56222.1| hypothetical protein CHLNCDRAFT_145004 [Chlorella variabilis]
Length=230

 Score = 81.6 bits (200),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 44/128 (34%), Positives = 66/128 (52%), Gaps = 2/128 (2%)
 Frame = +1

Query  265  QNPEEEQKVETLegkesaaegekkedksgPVTLGPKTFVSSVEMFDYFYKLLHSWSTNLN  444
            Q P + QK E  E           +    PVT+G +TF +  + +DYF+ L+       N
Sbjct  49   QPPAKVQKTEGDEQVAGKEGEAAAKAPQEPVTIGYRTFATGKQCYDYFHSLMTKLRKYQN  108

Query  445  VNKYEHLVLLELLNKGHPEPEKKIGKGVGGFQVR--FHPKYKSRCFFITGEDGSSDDFSF  618
            +N YE  ++ +L+ KGHPE  +K+  GV   Q+R        S CFF+  EDGS +D S+
Sbjct  109  LNDYEFHMVHDLIKKGHPEAARKLEGGVRAIQLRDVDMGHAVSSCFFLIHEDGSDEDVSY  168

Query  619  RKCVDNIL  642
            RKC+  + 
Sbjct  169  RKCLAGLF  176



>ref|XP_002957335.1| tRNA pseudouridine synthase mitochondrial precursor [Volvox carteri 
f. nagariensis]
 gb|EFJ41544.1| tRNA pseudouridine synthase mitochondrial precursor [Volvox carteri 
f. nagariensis]
Length=642

 Score = 84.0 bits (206),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 39/99 (39%), Positives = 62/99 (63%), Gaps = 1/99 (1%)
 Frame = +1

Query  352  PVTLGPKTFVSSVEMFDYFYKLLHSWSTNLNVNKYEHLVLLELLNKGHPEPEKKIGKGVG  531
            P+TLG ++F +     DY   LL +   + ++N+YE+ VLL+L+ KGHP    KIG G+ 
Sbjct  513  PLTLGYRSFETGKACADYLKALLSTSPLDTDMNEYEYRVLLDLIQKGHPSAASKIGCGLR  572

Query  532  GFQVR-FHPKYKSRCFFITGEDGSSDDFSFRKCVDNILP  645
             FQVR ++   ++R FF   +DG+ +DFS+ KC+  + P
Sbjct  573  AFQVRHYNADGEARAFFAIRKDGTREDFSYVKCLGQLYP  611



>ref|XP_001418710.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABO97003.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=200

 Score = 75.9 bits (185),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 34/81 (42%), Positives = 47/81 (58%), Gaps = 0/81 (0%)
 Frame = +1

Query  403  YFYKLLHSWSTNLNVNKYEHLVLLELLNKGHPEPEKKIGKGVGGFQVRFHPKYKSRCFFI  582
            YF  L +  + + N+N+YE      LL  GH +  KK G G+  FQVR HP + +RCF I
Sbjct  3    YFGALRNELTLDQNMNEYEAATTEALLRLGHEDAAKKFGSGLRAFQVRNHPVHNTRCFMI  62

Query  583  TGEDGSSDDFSFRKCVDNILP  645
               DG+ +DFS+RKC   + P
Sbjct  63   VRTDGTMEDFSYRKCAARLFP  83



>ref|XP_003597253.1| hypothetical protein MTR_2g094530 [Medicago truncatula]
 gb|AES67504.1| hypothetical protein MTR_2g094530 [Medicago truncatula]
Length=144

 Score = 72.4 bits (176),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 32/46 (70%), Positives = 38/46 (83%), Gaps = 0/46 (0%)
 Frame = +1

Query  355  VTLGPKTFVSSVEMFDYFYKLLHSWSTNLNVNKYEHLVLLELLNKG  492
            V LGPKTF SS++MF YF+K LH+W  NLNVNKYEH++LLELL  G
Sbjct  91   VNLGPKTFGSSLDMFYYFHKFLHAWLQNLNVNKYEHMMLLELLKNG  136



>gb|KFM25263.1| Guanine nucleotide-binding protein subunit beta-like protein 
1-like protein [Auxenochlorella protothecoides]
Length=465

 Score = 74.3 bits (181),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 36/99 (36%), Positives = 60/99 (61%), Gaps = 4/99 (4%)
 Frame = +1

Query  352  PVTLGPKTFVSSVEMFDYFYKLLHSWSTNLNVNKYEHLVLLELLNKGHPEPEKKIGKGVG  531
            PVT+G +TF +   + +Y+  L     +  N+N YE  ++LEL+ KGHP+ E+K+  GV 
Sbjct  52   PVTVGYRTFENGAALHEYYQGLHSKLRSYQNLNDYEFHMVLELIKKGHPDAERKVPGGVA  111

Query  532  GFQVRFHPKYKSR---CFFITGEDGSSDDFSFRKCVDNI  639
              Q++ + +Y  R   CF +   DGS +D S+RKC+ ++
Sbjct  112  AIQLQ-NKEYDGRQTSCFHLIRPDGSVEDVSYRKCIASL  149



>gb|KDD73790.1| hypothetical protein H632_c1835p1, partial [Helicosporidium sp. 
ATCC 50920]
Length=177

 Score = 68.6 bits (166),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 36/90 (40%), Positives = 53/90 (59%), Gaps = 3/90 (3%)
 Frame = +1

Query  355  VTLGPKTFVSSVEMFDYFYKLLHSWSTNLNVNKYEHLVLLELLNKGHPEPEKKIGKGVGG  534
            VT+G KT +S  +   YF  LL +     ++N+YEH ++ EL+  GHP+ E+K+  GV  
Sbjct  89   VTIGYKT-MSGAQTQAYFQDLLSNLRRYQSLNEYEHHMVCELVKLGHPDAERKLAGGVRA  147

Query  535  FQVR--FHPKYKSRCFFITGEDGSSDDFSF  618
             QVR   H    S+CFF+  EDG  +D S+
Sbjct  148  VQVRDTEHEGATSKCFFLIHEDGKVEDVSY  177



>ref|XP_004348505.1| RNA binding motif protein [Acanthamoeba castellanii str. Neff]
 gb|ELR22047.1| RNA binding motif protein [Acanthamoeba castellanii str. Neff]
Length=308

 Score = 68.9 bits (167),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 36/97 (37%), Positives = 59/97 (61%), Gaps = 3/97 (3%)
 Frame = +1

Query  355  VTLGPKTFVSSVEMFDYFYKLLHSWSTNLNVNKYEHLVLLELLNKGHPEPEKKIGKGVGG  534
            VTLG KT+  S  +      +L  ++ N  + + E  ++L+LL +GH + ++KIG GV  
Sbjct  7    VTLGGKTYNRSDTLARAVKDIL--FNLNAKLKQEEENLVLDLLRQGHAKADEKIGSGVKH  64

Query  535  FQVRFHPKY-KSRCFFITGEDGSSDDFSFRKCVDNIL  642
             +V  HP+Y +SRCF +   D ++ DFS+RKCV+ + 
Sbjct  65   IKVGSHPEYPESRCFHVVRTDDTTADFSYRKCVETLF  101



>emb|CDY16774.1| BnaA09g06080D [Brassica napus]
Length=62

 Score = 63.5 bits (153),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 26/34 (76%), Positives = 31/34 (91%), Gaps = 0/34 (0%)
 Frame = +1

Query  559  YKSRCFFITGEDGSSDDFSFRKCVDNILPLPENM  660
            +KSRCFF+  ED S+DDFS+RKCVD+ILPLPENM
Sbjct  2    WKSRCFFLVREDDSADDFSYRKCVDHILPLPENM  35



>emb|CDX87249.1| BnaC09g05640D [Brassica napus]
Length=64

 Score = 62.8 bits (151),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 26/34 (76%), Positives = 31/34 (91%), Gaps = 0/34 (0%)
 Frame = +1

Query  559  YKSRCFFITGEDGSSDDFSFRKCVDNILPLPENM  660
            +KSRCFF+  ED S+DDFS+RKCVD+ILPLPENM
Sbjct  2    WKSRCFFLVREDDSADDFSYRKCVDHILPLPENM  35



>ref|XP_002504634.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO65892.1| predicted protein [Micromonas sp. RCC299]
Length=861

 Score = 64.7 bits (156),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 39/100 (39%), Positives = 53/100 (53%), Gaps = 5/100 (5%)
 Frame = +1

Query  355  VTLG--PKTFVSSVEMFDYFYKLLHSWSTNLN--VNKYEHLVLLELLNKGHPEPEKKIGK  522
            VTLG    TF S  +   +F +LL +   + +  V    H VLL+ L + HP+   K+G 
Sbjct  76   VTLGDGAVTFGSPDDAMRFFNRLLETSPVDEDWPVAGETHAVLLDALGR-HPDARDKMGD  134

Query  523  GVGGFQVRFHPKYKSRCFFITGEDGSSDDFSFRKCVDNIL  642
            GV  F+V  HP    R F  T  DG++ DFS RKCVD + 
Sbjct  135  GVATFRVSLHPTEGYRSFVATRVDGTAVDFSLRKCVDAMF  174



>ref|WP_038069582.1| hypothetical protein [Thioclava dalianensis]
 gb|KEP68039.1| hypothetical protein DL1_15285 [Thioclava dalianensis]
Length=95

 Score = 59.7 bits (143),  Expect = 8e-08, Method: Composition-based stats.
 Identities = 31/92 (34%), Positives = 50/92 (54%), Gaps = 2/92 (2%)
 Frame = +1

Query  352  PVTLGPKTFVSSVEMFDYFYKLLHSWSTNLNVNKYEHLVLLELLNKGHPEPEKKIGKGVG  531
            PV +G  +F    +  D+F  +L+ +     V   +  +L  L++  HPE  +KIG G+ 
Sbjct  5    PVEIGSLSFARKGDANDFFRDMLYKYELGDKVTSKDAEILTHLMHM-HPEATEKIGPGIE  63

Query  532  GFQVRFHPKYKSRCFFITGEDGSSDDFSFRKC  627
             F VR    Y +RCF++   DG+++ FSFR C
Sbjct  64   SFSVR-TADYGTRCFWVNRVDGTTEKFSFRAC  94



>ref|WP_007120620.1| MULTISPECIES: hypothetical protein [Rhodobacteraceae]
 gb|EDQ03861.1| hypothetical protein OIHEL45_17746 [Oceanibulbus indolifex HEL-45]
 gb|KGB80891.1| hypothetical protein JT55_16175 [Rhodovulum sp. NI22]
Length=95

 Score = 59.3 bits (142),  Expect = 9e-08, Method: Composition-based stats.
 Identities = 31/92 (34%), Positives = 50/92 (54%), Gaps = 2/92 (2%)
 Frame = +1

Query  352  PVTLGPKTFVSSVEMFDYFYKLLHSWSTNLNVNKYEHLVLLELLNKGHPEPEKKIGKGVG  531
            PV +G  +F    +  D+F  +L+ +     V   +  +L  L++  HPE  +KIG G+ 
Sbjct  5    PVEIGSLSFARKGDANDFFRDMLYKYELGDKVTNEDAEILTHLMHM-HPEAAEKIGPGIE  63

Query  532  GFQVRFHPKYKSRCFFITGEDGSSDDFSFRKC  627
             F VR    Y +RCF++   DG+++ FSFR C
Sbjct  64   SFSVR-TADYGTRCFWVNRVDGTTEKFSFRAC  94



>ref|XP_003063587.1| predicted protein, partial [Micromonas pusilla CCMP1545]
 gb|EEH51960.1| predicted protein, partial [Micromonas pusilla CCMP1545]
Length=628

 Score = 63.5 bits (153),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 36/103 (35%), Positives = 55/103 (53%), Gaps = 6/103 (6%)
 Frame = +1

Query  352  PVTLGPK----TFVSSVEMFDYFYKLLHSWSTNLNVNKYEHLVLLELLNKGHPEPEKKIG  519
            PVT+ P+    TF +  EM  YF  +L        ++      +  +L + HP+  +K+G
Sbjct  84   PVTIPPRDGGATFATPHEMMGYFSGVLKDAKLCRYLDGEARDAVASVL-RAHPDASRKMG  142

Query  520  KGV-GGFQVRFHPKYKSRCFFITGEDGSSDDFSFRKCVDNILP  645
            +G   GFQVR  P+   R F +  EDG+++DFS RK VD + P
Sbjct  143  RGAPRGFQVRQDPEKGYRYFVVIREDGTAEDFSVRKGVDALFP  185



>ref|XP_001755235.1| predicted protein [Physcomitrella patens]
 gb|EDQ80179.1| predicted protein [Physcomitrella patens]
Length=527

 Score = 62.8 bits (151),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 26/67 (39%), Positives = 42/67 (63%), Gaps = 3/67 (4%)
 Frame = +1

Query  445  VNKYEHLVLLELLNKGHPEPEKKIGKGVGGFQVRFHPKYKSRCFFITGEDGSSDDFSFRK  624
            +  YE++VL+EL+ +       K+  G+  FQV  +P  +SRCF +  EDGS ++FSF+K
Sbjct  408  IQNYEYMVLIELIAQSDSN---KVAGGITAFQVHINPNCQSRCFILIREDGSKEEFSFKK  464

Query  625  CVDNILP  645
             V  ++P
Sbjct  465  YVKTLMP  471



>ref|XP_007136687.1| hypothetical protein PHAVU_009G065400g [Phaseolus vulgaris]
 gb|ESW08681.1| hypothetical protein PHAVU_009G065400g [Phaseolus vulgaris]
Length=217

 Score = 60.8 bits (146),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 34/102 (33%), Positives = 57/102 (56%), Gaps = 5/102 (5%)
 Frame = +1

Query  385  SVEMFDYFYKLLHS--WSTNLNVNKYEHLVLLELLNKGHPEPEKKIGKGVGGFQVRFHPK  558
            +V +  +   +LHS  + +   +++     ++E L   HPE EKKIG GV    + +HP 
Sbjct  106  TVPLVGFVRMILHSGQYESGDRLSEEHEKTIIEKLLPFHPESEKKIGCGVDYITIGYHPD  165

Query  559  Y-KSRCFFITGEDGSSDDFSFRKCVDNILPLPENMPIKHDTY  681
            + +SRC FI  +DG   DFS+ KC+  +  + +N P+  DT+
Sbjct  166  FERSRCLFIVRQDGQVVDFSYWKCIKGL--IRKNYPLYADTF  205



>ref|WP_011805632.1| hypothetical protein [Acidovorax sp. JS42]
 ref|YP_986664.1| hypothetical protein Ajs_2427 [Acidovorax sp. JS42]
 gb|ABM42588.1| conserved hypothetical protein [Acidovorax sp. JS42]
Length=99

 Score = 58.5 bits (140),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 36/93 (39%), Positives = 50/93 (54%), Gaps = 2/93 (2%)
 Frame = +1

Query  352  PVTLGPKTFVSSVEMFDYFYKLLHSWSTNLNVNKYEHLVLLELLNKGHPEPEKKIGKGVG  531
            PV LG  TF S      +F  +L  ++    V+  E  VLLE L   HPE   KIG+G+ 
Sbjct  6    PVVLGDVTFKSESAARTFFKAMLRKYAPGDRVSD-EDAVLLERLLGRHPEVHGKIGEGID  64

Query  532  GFQVRFHPKYKSRCFFITGEDGSSDDFSFRKCV  630
             F+V  H  + S+CF +   DGS +DFS+  C+
Sbjct  65   HFEVMSH-TFNSQCFAVHRTDGSFEDFSYTWCI  96



>emb|CAD12248.1| DCL protein [Coffea arabica]
Length=224

 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 33/102 (32%), Positives = 57/102 (56%), Gaps = 5/102 (5%)
 Frame = +1

Query  385  SVEMFDYFYKLLHS--WSTNLNVNKYEHLVLLELLNKGHPEPEKKIGKGVGGFQVRFHPK  558
            +V + ++   +LHS  + +   ++      +LE +   HP+ EKKIG GV    + +HP 
Sbjct  113  TVPLVNFVRMILHSGKYESGDRLSPEHERTILERVLPYHPQCEKKIGSGVDYITIGYHPD  172

Query  559  Y-KSRCFFITGEDGSSDDFSFRKCVDNILPLPENMPIKHDTY  681
            + +SRC FI  +DG   DFS+ KC+  +  + +N P+  DT+
Sbjct  173  FDRSRCLFIVRKDGELVDFSYWKCIKGL--IRKNYPLYADTF  212



>ref|XP_002991942.1| hypothetical protein SELMODRAFT_448611 [Selaginella moellendorffii]
 gb|EFJ07053.1| hypothetical protein SELMODRAFT_448611 [Selaginella moellendorffii]
Length=312

 Score = 61.6 bits (148),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 34/86 (40%), Positives = 47/86 (55%), Gaps = 8/86 (9%)
 Frame = +1

Query  397  FDYFYKLL----HSWSTNLNVNKY----EHLVLLELLNKGHPEPEKKIGKGVGGFQVRFH  552
            FD F  L+    H      N+ +     + L+LLE     HPE E K+G G+   +V  H
Sbjct  148  FDMFEHLVLTIRHILHLRYNIGERLGNEDELILLEEAIPYHPEREIKVGCGISYIKVDVH  207

Query  553  PKYKSRCFFITGEDGSSDDFSFRKCV  630
            P++ SRCFFI  +D S  DFS+RKC+
Sbjct  208  PEFGSRCFFIVRQDQSEIDFSYRKCM  233



>ref|XP_009393664.1| PREDICTED: protein DCL, chloroplastic isoform X1 [Musa acuminata 
subsp. malaccensis]
Length=223

 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 35/102 (34%), Positives = 56/102 (55%), Gaps = 5/102 (5%)
 Frame = +1

Query  385  SVEMFDYFYKLLHS--WSTNLNVNKYEHLVLLELLNKGHPEPEKKIGKGVGGFQVRFHPK  558
            +V +  +   +LHS  + +   ++      +LE L   HPE EKKIG G+    + FHP 
Sbjct  112  TVPLVGFVRMILHSGKYESGDRLSPEHEKAILERLLPYHPEFEKKIGCGIDYITIGFHPD  171

Query  559  YK-SRCFFITGEDGSSDDFSFRKCVDNILPLPENMPIKHDTY  681
            ++ SRC FI  +DG  +DFS+ KC+     + +N P+  DT+
Sbjct  172  FENSRCLFIVRKDGELEDFSYWKCIKGF--IRKNYPLYADTF  211



>emb|CDP01368.1| unnamed protein product [Coffea canephora]
Length=224

 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 33/102 (32%), Positives = 57/102 (56%), Gaps = 5/102 (5%)
 Frame = +1

Query  385  SVEMFDYFYKLLHS--WSTNLNVNKYEHLVLLELLNKGHPEPEKKIGKGVGGFQVRFHPK  558
            +V + ++   +LHS  + +   ++      +LE +   HP+ EKKIG GV    + +HP 
Sbjct  113  TVPLVNFVRMILHSGKYESGDRLSPEHERTILERVLPYHPQCEKKIGSGVDYITIGYHPD  172

Query  559  Y-KSRCFFITGEDGSSDDFSFRKCVDNILPLPENMPIKHDTY  681
            + +SRC FI  +DG   DFS+ KC+  +  + +N P+  DT+
Sbjct  173  FDRSRCLFIVRKDGELVDFSYWKCIKGL--IRKNYPLYADTF  212



>ref|XP_007225808.1| hypothetical protein PRUPE_ppa011355mg [Prunus persica]
 ref|XP_008220232.1| PREDICTED: protein DCL, chloroplastic [Prunus mume]
 gb|EMJ27007.1| hypothetical protein PRUPE_ppa011355mg [Prunus persica]
Length=214

 Score = 59.7 bits (143),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 34/107 (32%), Positives = 58/107 (54%), Gaps = 5/107 (5%)
 Frame = +1

Query  370  KTFVSSVEMFDYFYKLLHS--WSTNLNVNKYEHLVLLELLNKGHPEPEKKIGKGVGGFQV  543
            K    +V +  +   +LHS  + +   ++      +LE L   HPE +KKIG G+    V
Sbjct  98   KILEDTVPLVGFVRMILHSGKYESGDRLSPEHEKTVLERLLPFHPEAQKKIGSGIDYITV  157

Query  544  RFHPKYK-SRCFFITGEDGSSDDFSFRKCVDNILPLPENMPIKHDTY  681
             +HP ++ SRC FI  +DG+  DFS+ KC+  +  + +N P+  D++
Sbjct  158  GYHPDFESSRCLFIVQKDGTLVDFSYWKCIKGL--IRKNYPLYADSF  202



>tpg|DAA43777.1| TPA: hypothetical protein ZEAMMB73_746378 [Zea mays]
Length=169

 Score = 58.9 bits (141),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 25/51 (49%), Positives = 33/51 (65%), Gaps = 0/51 (0%)
 Frame = +1

Query  352  PVTLGPKTFVSSVEMFDYFYKLLHSWSTNLNVNKYEHLVLLELLNKGHPEP  504
            PV LGPK F S+++MF+YFY LLHSW+  L  NK    V++ +  K  P P
Sbjct  117  PVKLGPKEFASAIDMFNYFYALLHSWTPQLEFNKVRVRVVILVAKKIVPLP  167



>ref|XP_002962468.1| hypothetical protein SELMODRAFT_404272 [Selaginella moellendorffii]
 gb|EFJ35931.1| hypothetical protein SELMODRAFT_404272 [Selaginella moellendorffii]
Length=188

 Score = 59.3 bits (142),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 32/87 (37%), Positives = 51/87 (59%), Gaps = 8/87 (9%)
 Frame = +1

Query  376  FVSSVEMFDYF-YKLLHSWSTNLNVNKYEHLVLLELLNKGHPEPEKKIGKGVGGFQVRFH  552
             VS+V+   +F Y++ H+      +++Y+  ++ E + + HP   +KIG GV    V +H
Sbjct  75   LVSTVQCILHFKYRVGHT------LDEYDAKLIQEEVLRFHPRAAEKIGCGVASIMVNYH  128

Query  553  PKY-KSRCFFITGEDGSSDDFSFRKCV  630
            P Y +SRCF I   D S  DFS+RKC+
Sbjct  129  PDYNRSRCFMINRLDESVCDFSYRKCM  155



>ref|XP_011074428.1| PREDICTED: protein DCL, chloroplastic [Sesamum indicum]
 ref|XP_011074429.1| PREDICTED: protein DCL, chloroplastic [Sesamum indicum]
Length=225

 Score = 59.7 bits (143),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 34/102 (33%), Positives = 57/102 (56%), Gaps = 5/102 (5%)
 Frame = +1

Query  385  SVEMFDYFYKLLHS--WSTNLNVNKYEHLVLLELLNKGHPEPEKKIGKGVGGFQVRFHPK  558
            +V +  +   +LHS  + +   ++     ++LE L   HPE EKKIG GV    + +HP 
Sbjct  114  TVPLVGFVRMILHSGKYESGDRLSPEHERMILERLLPYHPESEKKIGCGVDYITIGYHPN  173

Query  559  YK-SRCFFITGEDGSSDDFSFRKCVDNILPLPENMPIKHDTY  681
            ++ SRC FI  +DG   DFS+ KC+  +  + +N P+  D++
Sbjct  174  FESSRCLFIVRKDGELVDFSYWKCIKGL--IRKNYPLYADSF  213



>ref|NP_001235407.1| uncharacterized protein LOC100306718 [Glycine max]
 gb|ACU15025.1| unknown [Glycine max]
 gb|KHN04497.1| Protein DCL, chloroplastic [Glycine soja]
Length=212

 Score = 59.3 bits (142),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 34/102 (33%), Positives = 55/102 (54%), Gaps = 5/102 (5%)
 Frame = +1

Query  385  SVEMFDYFYKLLHS--WSTNLNVNKYEHLVLLELLNKGHPEPEKKIGKGVGGFQVRFHPK  558
            +V +  +   +LHS  +     ++      ++E L   HPE EKKIG GV    + +HP 
Sbjct  101  TVPLVGFVRMILHSGQYDNGDRLSAEHEKTIIEKLLPFHPEFEKKIGSGVDYITIGYHPD  160

Query  559  Y-KSRCFFITGEDGSSDDFSFRKCVDNILPLPENMPIKHDTY  681
            + +SRC FI  EDG   DFS+ KC+  +  + +N P+  D++
Sbjct  161  FERSRCLFIVREDGELVDFSYWKCIKGL--IRKNYPLYADSF  200



>gb|KHG04572.1| Protein DCL, chloroplastic [Gossypium arboreum]
Length=217

 Score = 59.3 bits (142),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 34/107 (32%), Positives = 57/107 (53%), Gaps = 5/107 (5%)
 Frame = +1

Query  370  KTFVSSVEMFDYFYKLLHS--WSTNLNVNKYEHLVLLELLNKGHPEPEKKIGKGVGGFQV  543
            +    +V +  +   +LHS  + +   ++      +LE L   HPE EKKIG G+    V
Sbjct  101  RILQDTVPLVGFVRMILHSGKYGSGDRLSPEHEKTILERLLPYHPESEKKIGCGIDYITV  160

Query  544  RFHPKY-KSRCFFITGEDGSSDDFSFRKCVDNILPLPENMPIKHDTY  681
             +HP++  SRC FI  +DG   DFS+ KC+  +  + +N P+  D++
Sbjct  161  GYHPEFVGSRCLFIVRKDGELVDFSYWKCIKGL--IRKNYPLYADSF  205



>gb|EYU36304.1| hypothetical protein MIMGU_mgv1a013445mg [Erythranthe guttata]
Length=220

 Score = 59.3 bits (142),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 33/102 (32%), Positives = 55/102 (54%), Gaps = 5/102 (5%)
 Frame = +1

Query  385  SVEMFDYFYKLLHS--WSTNLNVNKYEHLVLLELLNKGHPEPEKKIGKGVGGFQVRFHPK  558
            +V +  +   +LHS  + +   ++      +L+ L   HPE EKKIG GV    + +HP 
Sbjct  109  TVPLVGFVRMILHSGKYESGTRLSPEHERTILDRLLAYHPESEKKIGCGVDYITIGYHPN  168

Query  559  YK-SRCFFITGEDGSSDDFSFRKCVDNILPLPENMPIKHDTY  681
            ++ SRC FI  +DG   DFS+ KC+  +  +  N P+  D++
Sbjct  169  FETSRCLFIVRKDGELVDFSYWKCIKGL--IRTNYPLYADSF  208



>gb|ABC47855.1| defective chloroplast and leaves protein [Glycine max]
Length=204

 Score = 58.9 bits (141),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 34/102 (33%), Positives = 55/102 (54%), Gaps = 5/102 (5%)
 Frame = +1

Query  385  SVEMFDYFYKLLHS--WSTNLNVNKYEHLVLLELLNKGHPEPEKKIGKGVGGFQVRFHPK  558
            +V +  +   +LHS  +     ++      ++E L   HPE EKKIG GV    + +HP 
Sbjct  93   TVPLVGFVRMILHSGQYDNGDRLSAEHEKTIIEKLLPFHPEFEKKIGSGVDYITIGYHPD  152

Query  559  Y-KSRCFFITGEDGSSDDFSFRKCVDNILPLPENMPIKHDTY  681
            + +SRC FI  EDG   DFS+ KC+  +  + +N P+  D++
Sbjct  153  FERSRCLFIVREDGELVDFSYWKCIKGL--IRKNYPLYADSF  192



>ref|XP_006434757.1| hypothetical protein CICLE_v10002377mg [Citrus clementina]
 gb|ESR47997.1| hypothetical protein CICLE_v10002377mg [Citrus clementina]
Length=227

 Score = 59.3 bits (142),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 34/107 (32%), Positives = 58/107 (54%), Gaps = 5/107 (5%)
 Frame = +1

Query  370  KTFVSSVEMFDYFYKLLHS--WSTNLNVNKYEHLVLLELLNKGHPEPEKKIGKGVGGFQV  543
            K    +V +  +   +LHS  + + + ++      +LE L   HPE EKKIG G+    +
Sbjct  107  KILEDTVPLVGFVRMILHSGRYESGVRLSPEHERTILERLLPYHPEFEKKIGCGIDYITI  166

Query  544  RFHPKYK-SRCFFITGEDGSSDDFSFRKCVDNILPLPENMPIKHDTY  681
             +HP ++ SRC FI  +DG   DFS+ KC+  +  + +N P+  D++
Sbjct  167  GYHPDFESSRCLFIVRKDGELVDFSYWKCIKGL--IRKNYPLYADSF  211



>ref|XP_008378043.1| PREDICTED: protein DCL, chloroplastic [Malus domestica]
Length=214

 Score = 58.9 bits (141),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 34/107 (32%), Positives = 58/107 (54%), Gaps = 5/107 (5%)
 Frame = +1

Query  370  KTFVSSVEMFDYFYKLLHS--WSTNLNVNKYEHLVLLELLNKGHPEPEKKIGKGVGGFQV  543
            K    +V +  +   +LHS  + +   ++      +LE L   HPE +KKIG G+    V
Sbjct  98   KILEDTVPLVGFVRMILHSGKYESGDRLSPEHQKTVLERLLPFHPEAKKKIGSGIDYITV  157

Query  544  RFHPKYK-SRCFFITGEDGSSDDFSFRKCVDNILPLPENMPIKHDTY  681
             +HP ++ SRC FI  +DG+  DFS+ KC+  +  + +N P+  D++
Sbjct  158  GYHPDFESSRCLFIVQKDGTLVDFSYWKCIKGL--IRKNYPLYADSF  202



>ref|XP_008367666.1| PREDICTED: protein DCL, chloroplastic-like [Malus domestica]
Length=214

 Score = 58.9 bits (141),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 34/107 (32%), Positives = 58/107 (54%), Gaps = 5/107 (5%)
 Frame = +1

Query  370  KTFVSSVEMFDYFYKLLHS--WSTNLNVNKYEHLVLLELLNKGHPEPEKKIGKGVGGFQV  543
            K    +V +  +   +LHS  + +   ++      +LE L   HPE +KKIG G+    V
Sbjct  98   KILEDTVPLVGFVRMILHSGKYESGDRLSPEHQKTVLERLLPFHPEAKKKIGSGIDYITV  157

Query  544  RFHPKYK-SRCFFITGEDGSSDDFSFRKCVDNILPLPENMPIKHDTY  681
             +HP ++ SRC FI  +DG+  DFS+ KC+  +  + +N P+  D++
Sbjct  158  GYHPDFESSRCLFIVQKDGTLVDFSYWKCIKGL--IRKNYPLYADSF  202



>gb|AFK33859.1| unknown [Lotus japonicus]
Length=224

 Score = 59.3 bits (142),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 29/72 (40%), Positives = 45/72 (63%), Gaps = 3/72 (4%)
 Frame = +1

Query  469  LLELLNKGHPEPEKKIGKGVGGFQVRFHPKY-KSRCFFITGEDGSSDDFSFRKCVDNILP  645
            +LE L   HPE EKKIG G+    + +HP++ +SRC FI  +DG   DFS+ KC+  +  
Sbjct  143  ILEKLLPFHPESEKKIGCGIDYITIGYHPQFDRSRCLFIVRKDGELVDFSYWKCIKGL--  200

Query  646  LPENMPIKHDTY  681
            + +N P+  D++
Sbjct  201  IRKNYPLYADSF  212



>dbj|BAB11495.1| unnamed protein product [Arabidopsis thaliana]
Length=135

 Score = 57.8 bits (138),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 25/38 (66%), Positives = 29/38 (76%), Gaps = 0/38 (0%)
 Frame = +1

Query  352  PVTLGPKTFVSSVEMFDYFYKLLHSWSTNLNVNKYEHL  465
            PV LGPK FV+SV MFDYF K LH W T+L+VNK  H+
Sbjct  66   PVKLGPKEFVTSVAMFDYFVKFLHFWPTDLDVNKVIHI  103



>ref|XP_006354878.1| PREDICTED: protein DCL, chloroplastic-like [Solanum tuberosum]
Length=224

 Score = 58.9 bits (141),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 34/102 (33%), Positives = 57/102 (56%), Gaps = 5/102 (5%)
 Frame = +1

Query  385  SVEMFDYFYKLLHS--WSTNLNVNKYEHLVLLELLNKGHPEPEKKIGKGVGGFQVRFHPK  558
            +V +  +   +LHS  ++    ++      +L+ L   HPE +KKIG GV    V +HP 
Sbjct  113  TVPLVGFVRMILHSGKYAIGDRLSPDHQRTILQRLLPYHPECDKKIGPGVDYITVGYHPD  172

Query  559  YK-SRCFFITGEDGSSDDFSFRKCVDNILPLPENMPIKHDTY  681
            ++ SRC FI  +DG S DFS+ KC+  +  + +N P+  D++
Sbjct  173  FENSRCLFIVRKDGESVDFSYWKCIKGL--IRKNYPLYADSF  212



>ref|XP_008797270.1| PREDICTED: protein DCL, chloroplastic [Phoenix dactylifera]
Length=227

 Score = 58.9 bits (141),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 31/72 (43%), Positives = 45/72 (63%), Gaps = 3/72 (4%)
 Frame = +1

Query  469  LLELLNKGHPEPEKKIGKGVGGFQVRFHPKYK-SRCFFITGEDGSSDDFSFRKCVDNILP  645
            +LE L   HP+ EKKIG G+    V FHP+++ SRC FI  +DG   DFS+ KC+  +  
Sbjct  146  ILERLLPYHPQFEKKIGCGIDFITVGFHPEFENSRCLFIVRKDGEMVDFSYWKCIKGL--  203

Query  646  LPENMPIKHDTY  681
            + +N P+  DT+
Sbjct  204  IRKNYPLHADTF  215



>ref|XP_002459901.1| hypothetical protein SORBIDRAFT_02g014000 [Sorghum bicolor]
 gb|EER96422.1| hypothetical protein SORBIDRAFT_02g014000 [Sorghum bicolor]
Length=195

 Score = 58.5 bits (140),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 27/59 (46%), Positives = 36/59 (61%), Gaps = 0/59 (0%)
 Frame = +1

Query  466  VLLELLNKGHPEPEKKIGKGVGGFQVRFHPKYKSRCFFITGEDGSSDDFSFRKCVDNIL  642
            V+ E L   HP  E+KIG G+ G  V  HP++KSRC F    +G  +DFS+RKC+   L
Sbjct  94   VVTEKLLSHHPRAEEKIGCGLDGIMVDRHPEFKSRCLFAVRTNGDLEDFSYRKCLRAYL  152



>ref|NP_001148729.1| LOC100282345 [Zea mays]
 gb|ACG32671.1| DCL protein [Zea mays]
 tpg|DAA60612.1| TPA: DCL protein [Zea mays]
Length=191

 Score = 58.2 bits (139),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 26/59 (44%), Positives = 36/59 (61%), Gaps = 0/59 (0%)
 Frame = +1

Query  466  VLLELLNKGHPEPEKKIGKGVGGFQVRFHPKYKSRCFFITGEDGSSDDFSFRKCVDNIL  642
            V+ E L   HP  E+KIG G+ G  V  HP++KSRC F+   +G  +DFS+ KC+   L
Sbjct  94   VVREKLLSHHPRAEEKIGCGLDGIMVDRHPEFKSRCLFVVRTNGDWEDFSYHKCLRAYL  152



>ref|NP_001235676.1| uncharacterized protein LOC100527410 [Glycine max]
 gb|ACU16500.1| unknown [Glycine max]
 gb|KHN22324.1| Protein DCL, chloroplastic [Glycine soja]
Length=206

 Score = 58.5 bits (140),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 29/72 (40%), Positives = 44/72 (61%), Gaps = 3/72 (4%)
 Frame = +1

Query  469  LLELLNKGHPEPEKKIGKGVGGFQVRFHPKY-KSRCFFITGEDGSSDDFSFRKCVDNILP  645
            ++E L   HPE EKKIG GV    + +HP + +SRC FI  +DG   DFS+ KC+  +  
Sbjct  125  IIEKLLPFHPEFEKKIGSGVDYITIGYHPDFERSRCLFIVRQDGELVDFSYWKCIKGL--  182

Query  646  LPENMPIKHDTY  681
            + +N P+  D++
Sbjct  183  IRKNYPLYADSF  194



>ref|XP_004291102.1| PREDICTED: protein DCL, chloroplastic-like [Fragaria vesca subsp. 
vesca]
Length=204

 Score = 58.2 bits (139),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 34/107 (32%), Positives = 57/107 (53%), Gaps = 5/107 (5%)
 Frame = +1

Query  370  KTFVSSVEMFDYFYKLLHS--WSTNLNVNKYEHLVLLELLNKGHPEPEKKIGKGVGGFQV  543
            K    +V +  +   +LHS  + +   ++      +LE L   HPE  KKIG G+    V
Sbjct  87   KILEDTVPLVGFVRMILHSGKYESGDRLSPEHQKTVLERLLPFHPEAAKKIGCGIDYVTV  146

Query  544  RFHPKYKS-RCFFITGEDGSSDDFSFRKCVDNILPLPENMPIKHDTY  681
             +HP ++S RC FI  +DG+  DFS+ KC+  +  + +N P+  D++
Sbjct  147  GYHPDFESSRCLFIVQKDGTLVDFSYWKCIKGL--IRKNYPLYADSF  191



>ref|XP_009359615.1| PREDICTED: protein DCL, chloroplastic [Pyrus x bretschneideri]
Length=214

 Score = 58.2 bits (139),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 33/107 (31%), Positives = 58/107 (54%), Gaps = 5/107 (5%)
 Frame = +1

Query  370  KTFVSSVEMFDYFYKLLHS--WSTNLNVNKYEHLVLLELLNKGHPEPEKKIGKGVGGFQV  543
            K    +V +  +   +LHS  + +   ++      +L+ L   HPE +KKIG G+    V
Sbjct  98   KILEETVPLVGFVRMILHSGKYESGDRLSPEHQKTVLQRLLPFHPEAKKKIGSGIDYITV  157

Query  544  RFHPKYK-SRCFFITGEDGSSDDFSFRKCVDNILPLPENMPIKHDTY  681
             +HP ++ SRC FI  +DG+  DFS+ KC+  +  + +N P+  D++
Sbjct  158  GYHPDFESSRCLFIVQKDGTLVDFSYWKCIKGL--IRKNYPLYADSF  202



>ref|XP_002454603.1| hypothetical protein SORBIDRAFT_04g034170 [Sorghum bicolor]
 gb|EES07579.1| hypothetical protein SORBIDRAFT_04g034170 [Sorghum bicolor]
Length=236

 Score = 58.5 bits (140),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 34/102 (33%), Positives = 55/102 (54%), Gaps = 5/102 (5%)
 Frame = +1

Query  385  SVEMFDYFYKLLHS--WSTNLNVNKYEHLVLLELLNKGHPEPEKKIGKGVGGFQVRFHPK  558
            +V +  +   +LHS  + +   ++      +LE L   HPE +KKIG G+    V  HP+
Sbjct  126  TVPLVGFVRMILHSGKYESGDRLSPEHEKAILERLLPYHPEYDKKIGCGIDYITVGLHPE  185

Query  559  YK-SRCFFITGEDGSSDDFSFRKCVDNILPLPENMPIKHDTY  681
            ++ SRC FI  +DG   DFSF KCV  +  + +  P+  D++
Sbjct  186  FENSRCLFIVRKDGEQVDFSFWKCVKGL--IRQKYPMYADSF  225



>ref|XP_006838071.1| hypothetical protein AMTR_s00091p00171300 [Amborella trichopoda]
 gb|ERN00640.1| hypothetical protein AMTR_s00091p00171300 [Amborella trichopoda]
Length=108

 Score = 56.2 bits (134),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 26/60 (43%), Positives = 39/60 (65%), Gaps = 1/60 (2%)
 Frame = +1

Query  466  VLLELLNKGHPEPEKKIGKGVGGFQVRFHPKYK-SRCFFITGEDGSSDDFSFRKCVDNIL  642
            ++LE L   HPE +KKIG GV    + +HP ++ SRC F+  +DG+  DFSF KC+  ++
Sbjct  26   IILEKLLPYHPEADKKIGPGVEFITIDYHPDFENSRCLFLMRKDGTEVDFSFWKCIKGLI  85



>ref|XP_010919205.1| PREDICTED: DNA-directed RNA polymerase IV subunit 1 [Elaeis guineensis]
Length=1569

 Score = 60.1 bits (144),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 30/87 (34%), Positives = 52/87 (60%), Gaps = 2/87 (2%)
 Frame = +1

Query  373   TFVSSVEMFDYFYKLLHSWSTNLNVNKYEHLVLLELLNKGHPEPEKKIGKGVGGFQVRFH  552
             ++ + V+M      +LH +  N  +N+ +   L+E L+  HP+ E K+G GV G ++   
Sbjct  1461  SWANIVDMCSNLRTILHEYPINGYLNETDKSCLMEALSY-HPKREAKMGTGVQGIKIGHS  1519

Query  553   PKY-KSRCFFITGEDGSSDDFSFRKCV  630
             P +  SRCF +   DG+++DFS+RKC+
Sbjct  1520  PLHPGSRCFVLVRNDGTTEDFSYRKCI  1546



>ref|NP_001233874.1| protein DCL, chloroplastic [Solanum lycopersicum]
 sp|Q42463.1|DCL_SOLLC RecName: Full=Protein DCL, chloroplastic; AltName: Full=Defective 
chloroplasts and leaves protein; Flags: Precursor [Solanum 
lycopersicum]
 gb|AAC49433.1| defective chloroplasts and leaves; required for chloroplast development 
and palisade cell differentiation in leaves [Solanum 
lycopersicum]
 gb|AAC49434.1| DCL [Solanum lycopersicum]
Length=224

 Score = 58.2 bits (139),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 33/102 (32%), Positives = 57/102 (56%), Gaps = 5/102 (5%)
 Frame = +1

Query  385  SVEMFDYFYKLLHS--WSTNLNVNKYEHLVLLELLNKGHPEPEKKIGKGVGGFQVRFHPK  558
            +V +  +   +LHS  ++    ++      +L+ L   HPE +KKIG GV    V +HP 
Sbjct  113  TVPLVGFVRMILHSGKYAIGDRLSPDHQRTILQRLLPYHPECDKKIGPGVDYITVGYHPD  172

Query  559  YK-SRCFFITGEDGSSDDFSFRKCVDNILPLPENMPIKHDTY  681
            ++ SRC FI  +DG + DFS+ KC+  +  + +N P+  D++
Sbjct  173  FENSRCLFIVRKDGETVDFSYWKCIKGL--IRKNYPLYADSF  212



>ref|XP_010552513.1| PREDICTED: protein DCL, chloroplastic-like [Tarenaya hassleriana]
Length=222

 Score = 57.8 bits (138),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 34/107 (32%), Positives = 57/107 (53%), Gaps = 5/107 (5%)
 Frame = +1

Query  370  KTFVSSVEMFDYFYKLLHS--WSTNLNVNKYEHLVLLELLNKGHPEPEKKIGKGVGGFQV  543
            K    +V +  +   +LHS  + +   ++     +++E L   HPE EKKIG G+    V
Sbjct  106  KILEVTVPLVGFVRMILHSGKYGSGDRLSPEHERMVVERLLPYHPEYEKKIGPGIDHIMV  165

Query  544  RFHPKY-KSRCFFITGEDGSSDDFSFRKCVDNILPLPENMPIKHDTY  681
              HP + +SRC FI  +DG   DFS+ KC+  +  + +N P+  D++
Sbjct  166  GHHPDFERSRCLFIARKDGEIVDFSYWKCIKGL--IRKNYPLYADSF  210



>ref|XP_010112190.1| hypothetical protein L484_009556 [Morus notabilis]
 gb|EXC32856.1| hypothetical protein L484_009556 [Morus notabilis]
Length=233

 Score = 57.8 bits (138),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 35/107 (33%), Positives = 57/107 (53%), Gaps = 5/107 (5%)
 Frame = +1

Query  370  KTFVSSVEMFDYFYKLLHS--WSTNLNVNKYEHLVLLELLNKGHPEPEKKIGKGVGGFQV  543
            K    +V +  +   +LHS  + +   ++      +LE L   HPE EKKIG G+    V
Sbjct  116  KILEDTVPLVGFVRMILHSEKYESGDRLSPEHEKTILERLLPFHPEFEKKIGCGIDYITV  175

Query  544  RFHPKY-KSRCFFITGEDGSSDDFSFRKCVDNILPLPENMPIKHDTY  681
             +HP + +SRC FI  +DG   DFS+ KC+  +  + +N P+  D++
Sbjct  176  GYHPDFERSRCLFIVQKDGKLVDFSYWKCIKGL--IRKNYPLYADSF  220



>ref|XP_003603048.1| Protein DCL [Medicago truncatula]
 gb|AES73299.1| DCL protein [Medicago truncatula]
Length=224

 Score = 57.8 bits (138),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 28/73 (38%), Positives = 44/73 (60%), Gaps = 3/73 (4%)
 Frame = +1

Query  466  VLLELLNKGHPEPEKKIGKGVGGFQVRFHPKY-KSRCFFITGEDGSSDDFSFRKCVDNIL  642
             ++E L   HPE +KKIG G+    V +HP + +SRC FI  +DG   DFS+ KC+  + 
Sbjct  142  TIVEKLLPFHPESQKKIGCGIDYITVGYHPNFDRSRCMFIVRQDGELVDFSYWKCIKGL-  200

Query  643  PLPENMPIKHDTY  681
             + +N P+  D++
Sbjct  201  -IRKNYPLYADSF  212



>gb|AFK49399.1| unknown [Medicago truncatula]
Length=224

 Score = 57.8 bits (138),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 28/73 (38%), Positives = 44/73 (60%), Gaps = 3/73 (4%)
 Frame = +1

Query  466  VLLELLNKGHPEPEKKIGKGVGGFQVRFHPKY-KSRCFFITGEDGSSDDFSFRKCVDNIL  642
             ++E L   HPE +KKIG G+    V +HP + +SRC FI  +DG   DFS+ KC+  + 
Sbjct  142  TIVEKLLPFHPESQKKIGCGIDYITVGYHPNFDRSRCMFIVRQDGELVDFSYWKCIKGL-  200

Query  643  PLPENMPIKHDTY  681
             + +N P+  D++
Sbjct  201  -IRKNYPLYADSF  212



>ref|XP_006473317.1| PREDICTED: protein DCL, chloroplastic-like [Citrus sinensis]
 gb|KDO84151.1| hypothetical protein CISIN_1g027145mg [Citrus sinensis]
Length=227

 Score = 57.8 bits (138),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 33/107 (31%), Positives = 58/107 (54%), Gaps = 5/107 (5%)
 Frame = +1

Query  370  KTFVSSVEMFDYFYKLLHS--WSTNLNVNKYEHLVLLELLNKGHPEPEKKIGKGVGGFQV  543
            K    +V +  +   +LHS  + + + ++      +LE L   HPE +KKIG G+    +
Sbjct  107  KILEDTVPLVGFVRMILHSGRYESGVRLSPEHERTILERLLPYHPEFKKKIGCGIDYITI  166

Query  544  RFHPKYK-SRCFFITGEDGSSDDFSFRKCVDNILPLPENMPIKHDTY  681
             +HP ++ SRC FI  +DG   DFS+ KC+  +  + +N P+  D++
Sbjct  167  GYHPDFESSRCLFIVRKDGELVDFSYWKCIKGL--IRKNYPLYADSF  211



>dbj|BAD17127.1| DCL protein-like [Oryza sativa Japonica Group]
 dbj|BAD17315.1| DCL protein-like [Oryza sativa Japonica Group]
Length=107

 Score = 55.8 bits (133),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 29/72 (40%), Positives = 43/72 (60%), Gaps = 3/72 (4%)
 Frame = +1

Query  469  LLELLNKGHPEPEKKIGKGVGGFQVRFHPKYK-SRCFFITGEDGSSDDFSFRKCVDNILP  645
            +LE L   HP+ EKKIG G+    V  HP+++ SRC FI  +DG   DFSF KC+  +  
Sbjct  22   ILERLLPYHPQYEKKIGCGIDYLTVGLHPEFENSRCLFIVRKDGEQVDFSFWKCIKGL--  79

Query  646  LPENMPIKHDTY  681
            + +  P+  D++
Sbjct  80   IRQKYPMYADSF  91



>ref|XP_004501564.1| PREDICTED: protein DCL, chloroplastic-like [Cicer arietinum]
Length=211

 Score = 57.4 bits (137),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 29/72 (40%), Positives = 44/72 (61%), Gaps = 3/72 (4%)
 Frame = +1

Query  469  LLELLNKGHPEPEKKIGKGVGGFQVRFHPKY-KSRCFFITGEDGSSDDFSFRKCVDNILP  645
            +LE L   HPE +KKIG G+    + +HP + +SRC FI  +DG   DFS+ KCV  +  
Sbjct  130  ILEKLLPFHPEFQKKIGCGIDYITIGYHPDFDRSRCMFIVRQDGEHVDFSYWKCVKGL--  187

Query  646  LPENMPIKHDTY  681
            + +N P+  D++
Sbjct  188  IRKNYPLYADSF  199



>ref|XP_008352141.1| PREDICTED: protein DCL, chloroplastic-like [Malus domestica]
Length=209

 Score = 57.4 bits (137),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 32/107 (30%), Positives = 58/107 (54%), Gaps = 5/107 (5%)
 Frame = +1

Query  370  KTFVSSVEMFDYFYKLLHS--WSTNLNVNKYEHLVLLELLNKGHPEPEKKIGKGVGGFQV  543
            K    +V +  +   +LHS  + +   ++      +L+ L   HP+ +KKIG G+    V
Sbjct  93   KILEDTVPLVGFVRMILHSGKYESGDRLSPEHQKTVLQRLLPFHPDAKKKIGSGIDYITV  152

Query  544  RFHPKYKS-RCFFITGEDGSSDDFSFRKCVDNILPLPENMPIKHDTY  681
             +HP ++S RC FI  +DG+  DFS+ KC+  +  + +N P+  D++
Sbjct  153  GYHPDFESSRCLFIVXKDGTLVDFSYWKCIKGL--IRKNYPLYADSF  197



>dbj|BAJ93491.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ93665.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=230

 Score = 57.4 bits (137),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 33/102 (32%), Positives = 55/102 (54%), Gaps = 5/102 (5%)
 Frame = +1

Query  385  SVEMFDYFYKLLHS--WSTNLNVNKYEHLVLLELLNKGHPEPEKKIGKGVGGFQVRFHPK  558
            +V +  +   +LHS  +S+   ++      +LE L   HP+ EKKIG G+    +  HP+
Sbjct  120  TVPLVGFVRMILHSGKYSSGERLSPEHEKAILERLLPYHPQYEKKIGCGIDYITLGLHPE  179

Query  559  YK-SRCFFITGEDGSSDDFSFRKCVDNILPLPENMPIKHDTY  681
            ++ SRC FI   DG   DFSF KC+  +  + +  P+  D++
Sbjct  180  FENSRCLFIVRTDGEQVDFSFWKCIKGL--IRQKYPLYADSF  219



>ref|XP_009793573.1| PREDICTED: protein DCL, chloroplastic [Nicotiana sylvestris]
Length=232

 Score = 57.4 bits (137),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 33/102 (32%), Positives = 56/102 (55%), Gaps = 5/102 (5%)
 Frame = +1

Query  385  SVEMFDYFYKLLHS--WSTNLNVNKYEHLVLLELLNKGHPEPEKKIGKGVGGFQVRFHPK  558
            +V +  +   +LHS  ++    ++      +L+ L   HPE E+KIG GV    V +HP 
Sbjct  121  TVPLVGFVRMILHSGKYAVGDRLSPDHQRTILQRLLPYHPECEEKIGSGVDYITVGYHPD  180

Query  559  YK-SRCFFITGEDGSSDDFSFRKCVDNILPLPENMPIKHDTY  681
            ++ SRC FI  +DG   DFS+ KC+  +  + +N P+  D++
Sbjct  181  FESSRCLFIVRKDGELVDFSYWKCIKGL--IRKNYPLYADSF  220



>ref|XP_011083836.1| PREDICTED: protein DCL, chloroplastic-like [Sesamum indicum]
Length=225

 Score = 57.4 bits (137),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 33/102 (32%), Positives = 55/102 (54%), Gaps = 5/102 (5%)
 Frame = +1

Query  385  SVEMFDYFYKLLHS--WSTNLNVNKYEHLVLLELLNKGHPEPEKKIGKGVGGFQVRFHPK  558
            +V +  +   +LHS  + +   ++      +LE L   HP+ EKKIG GV    + +HP 
Sbjct  114  TVPLVGFVRMILHSGEYESGDRLSPEHERTILERLLPYHPDCEKKIGSGVDYITIGYHPN  173

Query  559  YK-SRCFFITGEDGSSDDFSFRKCVDNILPLPENMPIKHDTY  681
            +  SRC FI  EDG   DFS+ KC++ +  + +  P+  D++
Sbjct  174  FNNSRCLFIVREDGELVDFSYWKCMEGL--IRKTYPLYADSF  213



>ref|XP_004954026.1| PREDICTED: protein DCL, chloroplastic-like [Setaria italica]
Length=241

 Score = 57.4 bits (137),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 34/102 (33%), Positives = 55/102 (54%), Gaps = 5/102 (5%)
 Frame = +1

Query  385  SVEMFDYFYKLLHS--WSTNLNVNKYEHLVLLELLNKGHPEPEKKIGKGVGGFQVRFHPK  558
            +V +  +   +LHS  + +   ++      +LE L   HP+ EKKIG G+    V  HP+
Sbjct  131  TVPLVGFVRMILHSGKYESGDRLSPEHEKAILERLLPYHPQYEKKIGCGIDYITVGLHPE  190

Query  559  YK-SRCFFITGEDGSSDDFSFRKCVDNILPLPENMPIKHDTY  681
            ++ SRC FI  +DG   DFSF KCV  +  + +  P+  D++
Sbjct  191  FENSRCLFIVRKDGERVDFSFWKCVKGL--IRQKYPMYADSF  230



>gb|KDP38331.1| hypothetical protein JCGZ_04256 [Jatropha curcas]
Length=208

 Score = 57.0 bits (136),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 34/102 (33%), Positives = 55/102 (54%), Gaps = 5/102 (5%)
 Frame = +1

Query  385  SVEMFDYFYKLLHS--WSTNLNVNKYEHLVLLELLNKGHPEPEKKIGKGVGGFQVRFHPK  558
            +V +  +   +LHS  +     ++      ++E L   HPE EKKIG G+    VR HP 
Sbjct  98   TVPLVGFVRMILHSGKYENGDRLSPGHERTIVEKLLPYHPEYEKKIGCGIDYITVRNHPD  157

Query  559  Y-KSRCFFITGEDGSSDDFSFRKCVDNILPLPENMPIKHDTY  681
            + +SRC FI  +DG   DFS+ KC+  +  + +N P+  D++
Sbjct  158  FERSRCLFIVRKDGELVDFSYWKCIKGL--IRKNYPLYADSF  197



>ref|XP_006649071.1| PREDICTED: protein DCL, chloroplastic-like [Oryza brachyantha]
Length=161

 Score = 56.2 bits (134),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 29/73 (40%), Positives = 43/73 (59%), Gaps = 3/73 (4%)
 Frame = +1

Query  466  VLLELLNKGHPEPEKKIGKGVGGFQVRFHPKYK-SRCFFITGEDGSSDDFSFRKCVDNIL  642
             +LE L   HP+ EKKIG G+    V  HP+++ SRC FI  +DG   DFSF KC+  + 
Sbjct  75   AILERLLPYHPQYEKKIGCGIDYITVGLHPEFENSRCLFIVRKDGEQVDFSFWKCIKGL-  133

Query  643  PLPENMPIKHDTY  681
             + +  P+  D++
Sbjct  134  -IRQKYPLYADSF  145



>ref|NP_001048223.1| Os02g0766000 [Oryza sativa Japonica Group]
 dbj|BAF10137.1| Os02g0766000, partial [Oryza sativa Japonica Group]
Length=139

 Score = 55.8 bits (133),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 29/73 (40%), Positives = 43/73 (59%), Gaps = 3/73 (4%)
 Frame = +1

Query  466  VLLELLNKGHPEPEKKIGKGVGGFQVRFHPKYK-SRCFFITGEDGSSDDFSFRKCVDNIL  642
             +LE L   HP+ EKKIG G+    V  HP+++ SRC FI  +DG   DFSF KC+  + 
Sbjct  53   AILERLLPYHPQYEKKIGCGIDYLTVGLHPEFENSRCLFIVRKDGEQVDFSFWKCIKGL-  111

Query  643  PLPENMPIKHDTY  681
             + +  P+  D++
Sbjct  112  -IRQKYPMYADSF  123



>ref|XP_002989419.1| hypothetical protein SELMODRAFT_29281, partial [Selaginella moellendorffii]
 gb|EFJ09510.1| hypothetical protein SELMODRAFT_29281, partial [Selaginella moellendorffii]
Length=70

 Score = 54.7 bits (130),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 25/63 (40%), Positives = 39/63 (62%), Gaps = 1/63 (2%)
 Frame = +1

Query  445  VNKYEHLVLLELLNKGHPEPEKKIGKGVGGFQVRFHPKY-KSRCFFITGEDGSSDDFSFR  621
            +++Y+  ++ E + + HP   +KIG GV    + +HP Y +SRCF I   D S  DFS+R
Sbjct  8    LDEYDAKLIQEEVLRFHPRAAEKIGCGVASIMINYHPDYNRSRCFMINRLDESVCDFSYR  67

Query  622  KCV  630
            KC+
Sbjct  68   KCM  70



>emb|CBI21428.3| unnamed protein product [Vitis vinifera]
Length=103

 Score = 55.1 bits (131),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 28/73 (38%), Positives = 44/73 (60%), Gaps = 3/73 (4%)
 Frame = +1

Query  466  VLLELLNKGHPEPEKKIGKGVGGFQVRFHPKYK-SRCFFITGEDGSSDDFSFRKCVDNIL  642
            ++LE L   HP  E+KIG G+    V +HP+++ SRC FI  +DG   DFS+ KC+    
Sbjct  21   IILERLLPYHPGYERKIGSGIDYITVGYHPEFESSRCLFIVRKDGELVDFSYWKCIKGF-  79

Query  643  PLPENMPIKHDTY  681
             + +N P+  D++
Sbjct  80   -IRKNYPLYADSF  91



>ref|XP_010688879.1| PREDICTED: protein DCL, chloroplastic [Beta vulgaris subsp. vulgaris]
Length=229

 Score = 57.0 bits (136),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 31/102 (30%), Positives = 56/102 (55%), Gaps = 5/102 (5%)
 Frame = +1

Query  385  SVEMFDYFYKLLHS--WSTNLNVNKYEHLVLLELLNKGHPEPEKKIGKGVGGFQVRFHPK  558
            +V +  +   +LHS  + + + ++      +L+ L   HPE + KIG GV    + +HP+
Sbjct  118  TVPLVGFVRMILHSGKYQSGVRLSDEHERTILDRLLPFHPECDNKIGCGVDYITIGYHPQ  177

Query  559  YK-SRCFFITGEDGSSDDFSFRKCVDNILPLPENMPIKHDTY  681
            ++ SRC FI  +DG   DFS+ KC+     + +N P+  D++
Sbjct  178  FQDSRCLFIVRKDGELVDFSYWKCIKGF--IRQNYPLYADSF  217



>ref|XP_009107447.1| PREDICTED: protein DCL, chloroplastic [Brassica rapa]
Length=210

 Score = 56.6 bits (135),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 33/107 (31%), Positives = 57/107 (53%), Gaps = 5/107 (5%)
 Frame = +1

Query  370  KTFVSSVEMFDYFYKLLHS--WSTNLNVNKYEHLVLLELLNKGHPEPEKKIGKGVGGFQV  543
            K    +V +  +   LLHS  ++    ++      ++E+L   HPE +KKIG G+    V
Sbjct  94   KILEVTVPLVGFVRMLLHSGKYANQDRLSPEHERTIVEMLLPYHPEVDKKIGCGIDFIMV  153

Query  544  RFHPKY-KSRCFFITGEDGSSDDFSFRKCVDNILPLPENMPIKHDTY  681
              HP++ +SRC FI  +DG   DFS+ KC+  +  + +  P+  D++
Sbjct  154  GHHPEFERSRCLFIVRKDGEVVDFSYWKCIKGL--IKKKYPLYADSF  198



>ref|XP_008803255.1| PREDICTED: DNA-directed RNA polymerase IV subunit 1 [Phoenix 
dactylifera]
Length=1567

 Score = 58.9 bits (141),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 28/87 (32%), Positives = 52/87 (60%), Gaps = 2/87 (2%)
 Frame = +1

Query  373   TFVSSVEMFDYFYKLLHSWSTNLNVNKYEHLVLLELLNKGHPEPEKKIGKGVGGFQVRFH  552
             ++ + V+M      +LH +  N  +N+ +   L+E L+  HP+ + K+G G+ G ++   
Sbjct  1459  SWANIVDMCSNLRTILHEYPINGYLNETDKSCLMEALSY-HPKRDAKMGTGIQGIKIGHS  1517

Query  553   PKY-KSRCFFITGEDGSSDDFSFRKCV  630
             P +  SRCF +   DG+++DFS+RKC+
Sbjct  1518  PLHPGSRCFVLVRNDGTTEDFSYRKCI  1544



>ref|XP_008452556.1| PREDICTED: protein DCL, chloroplastic [Cucumis melo]
Length=225

 Score = 57.0 bits (136),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 28/59 (47%), Positives = 37/59 (63%), Gaps = 1/59 (2%)
 Frame = +1

Query  469  LLELLNKGHPEPEKKIGKGVGGFQVRFHPKYK-SRCFFITGEDGSSDDFSFRKCVDNIL  642
            +LE L   HPE EKKIG GV    V +HP ++ SRC FI  +DG   DFS+ KC+  ++
Sbjct  142  ILERLLPYHPESEKKIGCGVDYITVGYHPDFESSRCLFIVRKDGELVDFSYWKCIKGLI  200



>emb|CDY17057.1| BnaA08g04210D [Brassica napus]
Length=210

 Score = 56.6 bits (135),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 32/102 (31%), Positives = 56/102 (55%), Gaps = 5/102 (5%)
 Frame = +1

Query  385  SVEMFDYFYKLLHS--WSTNLNVNKYEHLVLLELLNKGHPEPEKKIGKGVGGFQVRFHPK  558
            +V +  +   LLHS  ++    ++      ++E+L   HPE +KKIG G+    V  HP+
Sbjct  99   TVPLVGFVRMLLHSGKYANQDRLSPEHERTIVEMLLPYHPEVDKKIGCGIDFIMVGHHPE  158

Query  559  Y-KSRCFFITGEDGSSDDFSFRKCVDNILPLPENMPIKHDTY  681
            + +SRC FI  +DG   DFS+ KC+  +  + +  P+  D++
Sbjct  159  FERSRCLFIVRKDGEVVDFSYWKCIKGL--IKKKYPLYADSF  198



>ref|XP_009627784.1| PREDICTED: protein DCL, chloroplastic [Nicotiana tomentosiformis]
Length=234

 Score = 57.0 bits (136),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 33/102 (32%), Positives = 56/102 (55%), Gaps = 5/102 (5%)
 Frame = +1

Query  385  SVEMFDYFYKLLHS--WSTNLNVNKYEHLVLLELLNKGHPEPEKKIGKGVGGFQVRFHPK  558
            +V +  +   +LHS  ++    ++      +L+ L   HPE E+KIG GV    V +HP 
Sbjct  123  TVPLVGFVRMILHSGKYAVGDRLSPDHQRTILQRLLPYHPECEEKIGSGVDYITVGYHPD  182

Query  559  YK-SRCFFITGEDGSSDDFSFRKCVDNILPLPENMPIKHDTY  681
            ++ SRC FI  +DG   DFS+ KC+  +  + +N P+  D++
Sbjct  183  FESSRCLFIVRKDGELIDFSYWKCIKGL--IRKNYPLYADSF  222



>ref|XP_006393639.1| hypothetical protein EUTSA_v10011763mg [Eutrema salsugineum]
 gb|ESQ30925.1| hypothetical protein EUTSA_v10011763mg [Eutrema salsugineum]
Length=221

 Score = 56.6 bits (135),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 33/107 (31%), Positives = 57/107 (53%), Gaps = 5/107 (5%)
 Frame = +1

Query  370  KTFVSSVEMFDYFYKLLHS--WSTNLNVNKYEHLVLLELLNKGHPEPEKKIGKGVGGFQV  543
            K    +V +  +   +LHS  ++    ++      ++E+L   HPE EKKIG G+    V
Sbjct  105  KILEVTVPLVGFVRMILHSGKYANRDRLSPEHERTIIEMLLPYHPEVEKKIGCGIDYIMV  164

Query  544  RFHPKYK-SRCFFITGEDGSSDDFSFRKCVDNILPLPENMPIKHDTY  681
              HP+++ SRC FI  +DG   DFS+ KC+  +  + +  P+  D++
Sbjct  165  GHHPEFESSRCMFIVRKDGEVVDFSYWKCIKGL--IKKKYPLYADSF  209



>gb|KHG15662.1| Protein DCL, chloroplastic [Gossypium arboreum]
Length=217

 Score = 56.6 bits (135),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 30/72 (42%), Positives = 43/72 (60%), Gaps = 3/72 (4%)
 Frame = +1

Query  469  LLELLNKGHPEPEKKIGKGVGGFQVRFHPKY-KSRCFFITGEDGSSDDFSFRKCVDNILP  645
            +LE L   HPE EKKIG G+    V +HP +  SRC FI  +DG   DFS+ KC+  +  
Sbjct  137  ILERLLPYHPEFEKKIGCGIDYITVGYHPDFVGSRCLFIVRKDGELVDFSYWKCIKGL--  194

Query  646  LPENMPIKHDTY  681
            + +N P+  D++
Sbjct  195  IRKNYPLYADSF  206



>ref|XP_004141259.1| PREDICTED: protein DCL, chloroplastic-like [Cucumis sativus]
 ref|XP_004166695.1| PREDICTED: protein DCL, chloroplastic-like [Cucumis sativus]
 gb|KGN55194.1| hypothetical protein Csa_4G639820 [Cucumis sativus]
Length=225

 Score = 56.6 bits (135),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 28/59 (47%), Positives = 37/59 (63%), Gaps = 1/59 (2%)
 Frame = +1

Query  469  LLELLNKGHPEPEKKIGKGVGGFQVRFHPKYK-SRCFFITGEDGSSDDFSFRKCVDNIL  642
            +LE L   HPE EKKIG GV    V +HP ++ SRC FI  +DG   DFS+ KC+  ++
Sbjct  142  ILERLLPYHPESEKKIGCGVDYITVGYHPDFESSRCLFIVRKDGEMVDFSYWKCIKGLI  200



>gb|EMT07000.1| hypothetical protein F775_07046 [Aegilops tauschii]
Length=218

 Score = 56.2 bits (134),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 32/102 (31%), Positives = 55/102 (54%), Gaps = 5/102 (5%)
 Frame = +1

Query  385  SVEMFDYFYKLLHS--WSTNLNVNKYEHLVLLELLNKGHPEPEKKIGKGVGGFQVRFHPK  558
            +V +  +   +LHS  +S+   ++      +LE L   HP+ +KKIG G+    +  HP+
Sbjct  108  TVPLVGFVRMILHSGKYSSGERLSPEHEKAILERLLPYHPQYKKKIGCGIDYITLGLHPE  167

Query  559  YK-SRCFFITGEDGSSDDFSFRKCVDNILPLPENMPIKHDTY  681
            ++ SRC FI   DG   DFSF KC+  +  + +  P+  D++
Sbjct  168  FENSRCLFIVRTDGEQVDFSFWKCIKGL--IRQKYPVYADSF  207



>ref|XP_002282478.1| PREDICTED: protein DCL, chloroplastic [Vitis vinifera]
 emb|CAN69898.1| hypothetical protein VITISV_032063 [Vitis vinifera]
Length=205

 Score = 56.2 bits (134),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 32/102 (31%), Positives = 56/102 (55%), Gaps = 5/102 (5%)
 Frame = +1

Query  385  SVEMFDYFYKLLHS--WSTNLNVNKYEHLVLLELLNKGHPEPEKKIGKGVGGFQVRFHPK  558
            +V +  +   +LHS  + +   ++     ++LE L   HP  E+KIG G+    V +HP+
Sbjct  94   TVPLVGFVRMILHSGKYRSGERLSPEHEKIILERLLPYHPGYERKIGSGIDYITVGYHPE  153

Query  559  YK-SRCFFITGEDGSSDDFSFRKCVDNILPLPENMPIKHDTY  681
            ++ SRC FI  +DG   DFS+ KC+     + +N P+  D++
Sbjct  154  FESSRCLFIVRKDGELVDFSYWKCIKGF--IRKNYPLYADSF  193



>ref|WP_012647889.1| hypothetical protein [Geobacter daltonii]
 ref|YP_002538262.1| hypothetical protein Geob_2812 [Geobacter daltonii FRC-32]
 gb|ACM21161.1| protein of unknown function, DUF3223-containing [Geobacter daltonii 
FRC-32]
Length=216

 Score = 56.2 bits (134),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 33/102 (32%), Positives = 52/102 (51%), Gaps = 1/102 (1%)
 Frame = +1

Query  355  VTLGPKTFVSSVEMFDYFYKLLHSWSTNLNVNKYEHLVLLELLNKGHPEPEKKIGKGVGG  534
            V L  K F +     ++F  +L+++S    +N  +  +L ELL + HPE E KIG+G+  
Sbjct  5    VELTSKYFRTQKAAMEFFKDMLNTYSDGQVLNSDDTRLLSELLQR-HPEAEYKIGEGIKY  63

Query  535  FQVRFHPKYKSRCFFITGEDGSSDDFSFRKCVDNILPLPENM  660
            F     P+Y + CFFI   D    +FS+  C+    P  E +
Sbjct  64   FYRGTSPEYHTPCFFIMRADNVPTEFSYISCIKANPPTTEQL  105



>emb|CDY43215.1| BnaC08g04880D [Brassica napus]
Length=209

 Score = 56.2 bits (134),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 32/107 (30%), Positives = 57/107 (53%), Gaps = 5/107 (5%)
 Frame = +1

Query  370  KTFVSSVEMFDYFYKLLHS--WSTNLNVNKYEHLVLLELLNKGHPEPEKKIGKGVGGFQV  543
            K    +V +  +   +LHS  ++    ++      ++++L   HPE EKKIG G+    V
Sbjct  93   KILEVTVPLVGFVRMILHSGKYANQDRLSPEHERTIVQMLLPYHPEVEKKIGCGIDFIMV  152

Query  544  RFHPKY-KSRCFFITGEDGSSDDFSFRKCVDNILPLPENMPIKHDTY  681
              HP++ +SRC FI  +DG   DFS+ KC+  +  + +  P+  D++
Sbjct  153  GHHPEFERSRCLFIVRKDGEVVDFSYWKCIKGL--IKKKYPLYADSF  197



>ref|XP_010236078.1| PREDICTED: protein DCL, chloroplastic [Brachypodium distachyon]
Length=235

 Score = 56.6 bits (135),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 30/89 (34%), Positives = 49/89 (55%), Gaps = 3/89 (3%)
 Frame = +1

Query  385  SVEMFDYFYKLLHS--WSTNLNVNKYEHLVLLELLNKGHPEPEKKIGKGVGGFQVRFHPK  558
            +V +  +   +LHS  +++   +       +LE L   HP+ EKKIG G+    +  HP+
Sbjct  125  TVPLVGFVRMILHSGKYTSGDRLTPEHEKAILERLLPYHPQYEKKIGCGIDYITLGLHPE  184

Query  559  YK-SRCFFITGEDGSSDDFSFRKCVDNIL  642
            ++ SRC FI  +DG   DFSF KC+  ++
Sbjct  185  FENSRCLFIVRKDGEEVDFSFWKCIKGLI  213



>ref|WP_011388268.1| hypothetical protein [Rhodospirillum rubrum]
 ref|YP_425601.1| hypothetical protein Rru_A0510 [Rhodospirillum rubrum ATCC 11170]
 ref|YP_006046790.1| hypothetical protein F11_02615 [Rhodospirillum rubrum F11]
 gb|ABC21314.1| conserved hypothetical protein [Rhodospirillum rubrum ATCC 11170]
 gb|AEO46993.1| hypothetical protein F11_02615 [Rhodospirillum rubrum F11]
Length=98

 Score = 54.3 bits (129),  Expect = 6e-06, Method: Composition-based stats.
 Identities = 28/93 (30%), Positives = 49/93 (53%), Gaps = 2/93 (2%)
 Frame = +1

Query  352  PVTLGPKTFVSSVEMFDYFYKLLHSWSTNLNVNKYEHLVLLELLNKGHPEPEKKIGKGVG  531
            P+ LGP  F    +   Y +K+LH +     V+  + ++L   L   H + E K+G G+ 
Sbjct  5    PIDLGPMHFEKKEDAVAYLHKMLHRYDLGDKVSDDDAIILRAALAH-HRDAEVKVGCGIT  63

Query  532  GFQVRFHPKYKSRCFFITGEDGSSDDFSFRKCV  630
             F VR    + +RCF++   DG+++ FS + C+
Sbjct  64   YFSVR-TADFGTRCFWLNRNDGTTEKFSHKTCI  95



>ref|NP_001031151.1| uncharacterized protein [Arabidopsis thaliana]
 gb|AEE32114.1| uncharacterized protein AT1G45230 [Arabidopsis thaliana]
Length=219

 Score = 56.2 bits (134),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 32/102 (31%), Positives = 55/102 (54%), Gaps = 5/102 (5%)
 Frame = +1

Query  385  SVEMFDYFYKLLHS--WSTNLNVNKYEHLVLLELLNKGHPEPEKKIGKGVGGFQVRFHPK  558
            +V +  +   +LHS  ++    ++      ++E+L   HPE EKKIG G+    V  HP 
Sbjct  108  TVPLVGFVRMILHSGKYANRDRLSPEHERTIIEMLLPYHPECEKKIGCGIDYIMVWHHPD  167

Query  559  YK-SRCFFITGEDGSSDDFSFRKCVDNILPLPENMPIKHDTY  681
            ++ SRC FI  +DG   DFS+ KC+  +  + +  P+  D++
Sbjct  168  FESSRCMFIVRKDGEVVDFSYWKCIKGL--IKKKYPLYADSF  207



>ref|XP_007017215.1| Uncharacterized protein isoform 1 [Theobroma cacao]
 ref|XP_007017216.1| Uncharacterized protein isoform 1 [Theobroma cacao]
 ref|XP_007017217.1| Uncharacterized protein isoform 1 [Theobroma cacao]
 ref|XP_007017219.1| Uncharacterized protein isoform 1 [Theobroma cacao]
 gb|EOY14440.1| Uncharacterized protein isoform 1 [Theobroma cacao]
 gb|EOY14441.1| Uncharacterized protein isoform 1 [Theobroma cacao]
 gb|EOY14442.1| Uncharacterized protein isoform 1 [Theobroma cacao]
 gb|EOY14444.1| Uncharacterized protein isoform 1 [Theobroma cacao]
Length=215

 Score = 55.8 bits (133),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 32/102 (31%), Positives = 56/102 (55%), Gaps = 5/102 (5%)
 Frame = +1

Query  385  SVEMFDYFYKLLHS--WSTNLNVNKYEHLVLLELLNKGHPEPEKKIGKGVGGFQVRFHPK  558
            +V +  +   ++HS  + +   ++      +L+ L   HPE EKKIG G+    V +HP 
Sbjct  105  TVPLVGFVRMIIHSGKYESGDRLSPEHEKTILDRLLPYHPECEKKIGCGIDYITVGYHPD  164

Query  559  YK-SRCFFITGEDGSSDDFSFRKCVDNILPLPENMPIKHDTY  681
            ++ SRC FI  +DG   DFS+ KC+  +  + +N P+  D++
Sbjct  165  FEGSRCLFIVRKDGELIDFSYWKCIKGL--IRKNYPLYADSF  204



>ref|XP_004308588.1| PREDICTED: DNA-directed RNA polymerase E subunit 1-like [Fragaria 
vesca subsp. vesca]
Length=1991

 Score = 58.2 bits (139),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 25/63 (40%), Positives = 39/63 (62%), Gaps = 1/63 (2%)
 Frame = +1

Query  457   EHLVLLELLNKGHPEPEKKIGKGVGGFQVRFHPKYK-SRCFFITGEDGSSDDFSFRKCVD  633
             +H  +L+ +   HPE E K+G G+  F V  H  ++ SRC F+   DG  +DFS+RKC+ 
Sbjct  1890  DHSFILDKVFNFHPEKEAKMGSGIDYFTVDRHGSFQESRCLFVISTDGRKEDFSYRKCLQ  1949

Query  634   NIL  642
             N++
Sbjct  1950  NMI  1952



>ref|WP_018646984.1| MULTISPECIES: hypothetical protein [Bradyrhizobium]
 gb|KGJ67387.1| hypothetical protein BJA5080_07751 [Bradyrhizobium diazoefficiens 
SEMIA 5080]
Length=98

 Score = 53.9 bits (128),  Expect = 7e-06, Method: Composition-based stats.
 Identities = 28/93 (30%), Positives = 46/93 (49%), Gaps = 2/93 (2%)
 Frame = +1

Query  352  PVTLGPKTFVSSVEMFDYFYKLLHSWSTNLNVNKYEHLVLLELLNKGHPEPEKKIGKGVG  531
            P+ LGP  F    +   Y   +LH +     V   + ++L   L   HP+ E K G G+ 
Sbjct  5    PIDLGPLHFAKRGDAVAYLNDMLHRYDVGDRVGANDTVILRAALEH-HPDAEAKKGCGIT  63

Query  532  GFQVRFHPKYKSRCFFITGEDGSSDDFSFRKCV  630
             F VR    + ++CF++   DG+++ FS R C+
Sbjct  64   HFNVR-TADFGTKCFWLNRTDGATEKFSHRACI  95



>ref|WP_008891939.1| hypothetical protein [Thalassospira profundimaris]
 gb|EKF06792.1| hypothetical protein TH2_18219 [Thalassospira profundimaris WP0211]
Length=96

 Score = 53.9 bits (128),  Expect = 7e-06, Method: Composition-based stats.
 Identities = 30/93 (32%), Positives = 49/93 (53%), Gaps = 2/93 (2%)
 Frame = +1

Query  352  PVTLGPKTFVSSVEMFDYFYKLLHSWSTNLNVNKYEHLVLLELLNKGHPEPEKKIGKGVG  531
            PV +G   F    +  +Y   +L+S++    V++ +   L + L K HP+   K G GV 
Sbjct  6    PVKIGEVDFAKKGDALEYLRVMLNSYALEERVSRDDENFLRDAL-KNHPDANDKFGDGVD  64

Query  532  GFQVRFHPKYKSRCFFITGEDGSSDDFSFRKCV  630
             F VR    Y +RCF++   DG+ + FS++ CV
Sbjct  65   HFFVR-RADYGTRCFWVRRLDGTEERFSYKSCV  96



>ref|NP_683398.1| uncharacterized protein [Arabidopsis thaliana]
 gb|AAG50632.1|AC083835_17 defective chloroplasts and leaves (DCL) protein, putative [Arabidopsis 
thaliana]
 gb|AAM91086.1| At1g45261/F2G19.1 [Arabidopsis thaliana]
 gb|AAT41860.1| At1g45261 [Arabidopsis thaliana]
 dbj|BAD95026.1| defective chloroplasts and leaves (DCL) protein [Arabidopsis 
thaliana]
 gb|AEE32113.1| uncharacterized protein AT1G45230 [Arabidopsis thaliana]
Length=219

 Score = 55.8 bits (133),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 33/107 (31%), Positives = 56/107 (52%), Gaps = 5/107 (5%)
 Frame = +1

Query  370  KTFVSSVEMFDYFYKLLHS--WSTNLNVNKYEHLVLLELLNKGHPEPEKKIGKGVGGFQV  543
            K    +V +  +   +LHS  ++    ++      ++E+L   HPE EKKIG G+    V
Sbjct  103  KILEVTVPLVGFVRMILHSGKYANRDRLSPEHERTIIEMLLPYHPECEKKIGCGIDYIMV  162

Query  544  RFHPKYK-SRCFFITGEDGSSDDFSFRKCVDNILPLPENMPIKHDTY  681
              HP ++ SRC FI  +DG   DFS+ KC+  +  + +  P+  D++
Sbjct  163  GHHPDFESSRCMFIVRKDGEVVDFSYWKCIKGL--IKKKYPLYADSF  207



>ref|WP_011084973.1| MULTISPECIES: hypothetical protein [Bradyrhizobium]
 ref|NP_768823.1| hypothetical protein bsl2183 [Bradyrhizobium diazoefficiens USDA 
110]
 ref|YP_005612502.1| hypothetical protein BJ6T_76690 [Bradyrhizobium japonicum USDA 
6]
 dbj|BAC47448.1| bsl2183 [Bradyrhizobium diazoefficiens USDA 110]
 dbj|BAL12914.1| hypothetical protein BJ6T_76690 [Bradyrhizobium japonicum USDA 
6]
 gb|AHY48789.1| hypothetical protein BJS_07507 [Bradyrhizobium japonicum SEMIA 
5079]
 gb|KGT73128.1| hypothetical protein MA20_46270 [Bradyrhizobium japonicum]
 gb|AJA65305.1| hypothetical protein RN69_37225 [Bradyrhizobium japonicum]
Length=98

 Score = 53.9 bits (128),  Expect = 8e-06, Method: Composition-based stats.
 Identities = 28/93 (30%), Positives = 46/93 (49%), Gaps = 2/93 (2%)
 Frame = +1

Query  352  PVTLGPKTFVSSVEMFDYFYKLLHSWSTNLNVNKYEHLVLLELLNKGHPEPEKKIGKGVG  531
            P+ LGP  F    +   Y   +LH +     V   + ++L   L   HP+ E K G G+ 
Sbjct  5    PIDLGPLHFAKRGDAVAYLNDMLHRYDVGDRVGANDTVILRAALEH-HPDAEAKKGCGIT  63

Query  532  GFQVRFHPKYKSRCFFITGEDGSSDDFSFRKCV  630
             F VR    + ++CF++   DG+++ FS R C+
Sbjct  64   HFNVR-TADFGTKCFWLNRTDGTTEKFSHRACI  95



>ref|XP_010263539.1| PREDICTED: protein DCL, chloroplastic [Nelumbo nucifera]
Length=232

 Score = 55.8 bits (133),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 32/102 (31%), Positives = 56/102 (55%), Gaps = 5/102 (5%)
 Frame = +1

Query  385  SVEMFDYFYKLLHS--WSTNLNVNKYEHLVLLELLNKGHPEPEKKIGKGVGGFQVRFHPK  558
            +V +  +   +LHS  + +   ++      +L+ L   HP+ EKKIG G+    V +HP 
Sbjct  121  TVPLVGFVRMILHSGKYGSGDRLSPEHEKTILDRLLPYHPQYEKKIGCGINYITVGYHPD  180

Query  559  YK-SRCFFITGEDGSSDDFSFRKCVDNILPLPENMPIKHDTY  681
            ++ SRC FI  +DG   DFS+ KC+  +  + +N P+  D++
Sbjct  181  FEGSRCLFIVRKDGELVDFSYWKCIKGL--IKKNYPLYADSF  220



>gb|EMT19779.1| hypothetical protein F775_42610 [Aegilops tauschii]
Length=164

 Score = 54.7 bits (130),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 28/75 (37%), Positives = 43/75 (57%), Gaps = 3/75 (4%)
 Frame = +1

Query  415  LLHS--WSTNLNVNKYEHLVLLELLNKGHPEPEKKIGKGVGGFQVRFHPKY-KSRCFFIT  585
            +LHS  ++    +   + +V+ E +   HP  E KIG G+ G  V  HP++ KSRC F+ 
Sbjct  81   ILHSDRYADGECLGPADEIVVAEKILAYHPRAEDKIGCGLDGIMVDRHPQFRKSRCLFVV  140

Query  586  GEDGSSDDFSFRKCV  630
              DG   DFS++KC+
Sbjct  141  RTDGVWIDFSYQKCL  155



>ref|WP_011388568.1| hypothetical protein [Rhodospirillum rubrum]
 ref|YP_425901.1| hypothetical protein Rru_A0810 [Rhodospirillum rubrum ATCC 11170]
 ref|YP_006047102.1| hypothetical protein F11_04175 [Rhodospirillum rubrum F11]
 gb|ABC21614.1| conserved hypothetical protein [Rhodospirillum rubrum ATCC 11170]
 gb|AEO47305.1| hypothetical protein F11_04175 [Rhodospirillum rubrum F11]
Length=96

 Score = 53.9 bits (128),  Expect = 9e-06, Method: Composition-based stats.
 Identities = 30/93 (32%), Positives = 48/93 (52%), Gaps = 2/93 (2%)
 Frame = +1

Query  352  PVTLGPKTFVSSVEMFDYFYKLLHSWSTNLNVNKYEHLVLLELLNKGHPEPEKKIGKGVG  531
            P+ +    F    +   +   +L+ +     V+  +   L+E L K HP+   KIG GV 
Sbjct  6    PIEIAGHEFARKADALAFMKVMLNRYRPGDIVSTVDGAFLVEAL-KRHPDATSKIGPGVR  64

Query  532  GFQVRFHPKYKSRCFFITGEDGSSDDFSFRKCV  630
             F+VR    Y ++CF+I   DGS + FS++KCV
Sbjct  65   NFEVR-SADYGTQCFWILRTDGSEERFSYKKCV  96



>ref|XP_011029161.1| PREDICTED: DNA-directed RNA polymerase IV subunit 1 [Populus 
euphratica]
 ref|XP_011029162.1| PREDICTED: DNA-directed RNA polymerase IV subunit 1 [Populus 
euphratica]
 ref|XP_011029163.1| PREDICTED: DNA-directed RNA polymerase IV subunit 1 [Populus 
euphratica]
 ref|XP_011029164.1| PREDICTED: DNA-directed RNA polymerase IV subunit 1 [Populus 
euphratica]
 ref|XP_011029165.1| PREDICTED: DNA-directed RNA polymerase IV subunit 1 [Populus 
euphratica]
 ref|XP_011029166.1| PREDICTED: DNA-directed RNA polymerase IV subunit 1 [Populus 
euphratica]
 ref|XP_011029168.1| PREDICTED: DNA-directed RNA polymerase IV subunit 1 [Populus 
euphratica]
 ref|XP_011029169.1| PREDICTED: DNA-directed RNA polymerase IV subunit 1 [Populus 
euphratica]
 ref|XP_011029170.1| PREDICTED: DNA-directed RNA polymerase IV subunit 1 [Populus 
euphratica]
Length=1488

 Score = 57.4 bits (137),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 33/102 (32%), Positives = 57/102 (56%), Gaps = 9/102 (9%)
 Frame = +1

Query  367   PKTFVSSVEMFD-------YFYKLLHSWSTNLNVNKYEHLVLLELLNKGHPEPEKKIGKG  525
             P++F+  +  +D          K+L  +S +  +N+ +  VL+  L   HP  ++KIG G
Sbjct  1355  PRSFLRRLLTYDDIQRMSYTVRKILKKYSVDQQLNERDKSVLMMTL-YFHPRRDEKIGIG  1413

Query  526   VGGFQVRFHPKYK-SRCFFITGEDGSSDDFSFRKCVDNILPL  648
                 +V  HP+Y+ +RCF +   DG+ +DFS+RKC+ N L +
Sbjct  1414  AKDIKVINHPEYQDTRCFSLVRTDGTIEDFSYRKCLHNALEI  1455



>ref|XP_010939420.1| PREDICTED: protein DCL, chloroplastic [Elaeis guineensis]
Length=227

 Score = 55.8 bits (133),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 32/102 (31%), Positives = 55/102 (54%), Gaps = 5/102 (5%)
 Frame = +1

Query  385  SVEMFDYFYKLLHS--WSTNLNVNKYEHLVLLELLNKGHPEPEKKIGKGVGGFQVRFHPK  558
            +V +  +   +LHS  +     ++      +LE +   HP+ EKKIG G+    + FHP+
Sbjct  116  TVPLVSFVRMILHSGKYENGDRLSPEHEKTILERVLPYHPQFEKKIGCGIDFITIGFHPE  175

Query  559  YK-SRCFFITGEDGSSDDFSFRKCVDNILPLPENMPIKHDTY  681
            ++ SRC FI  +DG   DFS+ KC+  +  + +N P+  D +
Sbjct  176  FENSRCLFIVRKDGEMVDFSYWKCIKGL--IRKNYPLYADGF  215



>ref|WP_027516036.1| hypothetical protein [Bradyrhizobium sp. WSM1417]
Length=98

 Score = 53.5 bits (127),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 28/93 (30%), Positives = 46/93 (49%), Gaps = 2/93 (2%)
 Frame = +1

Query  352  PVTLGPKTFVSSVEMFDYFYKLLHSWSTNLNVNKYEHLVLLELLNKGHPEPEKKIGKGVG  531
            P+ LGP  F    +   Y   +LH +     V   + ++L   L   HP+ E K G G+ 
Sbjct  5    PIDLGPLHFAKRGDAVAYLNDMLHRYDVGDRVGADDTVILRTALEH-HPDAEAKKGCGIT  63

Query  532  GFQVRFHPKYKSRCFFITGEDGSSDDFSFRKCV  630
             F VR    + ++CF++   DG+++ FS R C+
Sbjct  64   HFSVR-TADFGTKCFWLNRTDGTTEKFSHRACI  95



>ref|XP_011014513.1| PREDICTED: DNA-directed RNA polymerase IV subunit 1-like [Populus 
euphratica]
 ref|XP_011014514.1| PREDICTED: DNA-directed RNA polymerase IV subunit 1-like [Populus 
euphratica]
 ref|XP_011014516.1| PREDICTED: DNA-directed RNA polymerase IV subunit 1-like [Populus 
euphratica]
 ref|XP_011014517.1| PREDICTED: DNA-directed RNA polymerase IV subunit 1-like [Populus 
euphratica]
 ref|XP_011014518.1| PREDICTED: DNA-directed RNA polymerase IV subunit 1-like [Populus 
euphratica]
 ref|XP_011014519.1| PREDICTED: DNA-directed RNA polymerase IV subunit 1-like [Populus 
euphratica]
 ref|XP_011014520.1| PREDICTED: DNA-directed RNA polymerase IV subunit 1-like [Populus 
euphratica]
 ref|XP_011014522.1| PREDICTED: DNA-directed RNA polymerase IV subunit 1-like [Populus 
euphratica]
Length=1488

 Score = 57.4 bits (137),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 33/102 (32%), Positives = 57/102 (56%), Gaps = 9/102 (9%)
 Frame = +1

Query  367   PKTFVSSVEMFD-------YFYKLLHSWSTNLNVNKYEHLVLLELLNKGHPEPEKKIGKG  525
             P++F+  +  +D          K+L  +S +  +N+ +  VL+  L   HP  ++KIG G
Sbjct  1355  PRSFLRRLLTYDDIQRMSYTVRKILKKYSVDQQLNERDKSVLMMTL-YFHPRRDEKIGIG  1413

Query  526   VGGFQVRFHPKYK-SRCFFITGEDGSSDDFSFRKCVDNILPL  648
                 +V  HP+Y+ +RCF +   DG+ +DFS+RKC+ N L +
Sbjct  1414  AKDIKVINHPEYQDTRCFSLVRTDGTIEDFSYRKCLHNALEI  1455



>pdb|2K0M|A Chain A, Solution Nmr Structure Of The Uncharacterized Protein 
From Rhodospirillum Rubrum Gene Locus Rru_a0810. Northeast 
Structural Genomics Target Rrr43
Length=104

 Score = 53.9 bits (128),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 30/93 (32%), Positives = 48/93 (52%), Gaps = 2/93 (2%)
 Frame = +1

Query  352  PVTLGPKTFVSSVEMFDYFYKLLHSWSTNLNVNKYEHLVLLELLNKGHPEPEKKIGKGVG  531
            P+ +    F    +   +   +L+ +     V+  +   L+E L K HP+   KIG GV 
Sbjct  6    PIEIAGHEFARKADALAFMKVMLNRYRPGDIVSTVDGAFLVEAL-KRHPDATSKIGPGVR  64

Query  532  GFQVRFHPKYKSRCFFITGEDGSSDDFSFRKCV  630
             F+VR    Y ++CF+I   DGS + FS++KCV
Sbjct  65   NFEVR-SADYGTQCFWILRTDGSEERFSYKKCV  96



>gb|KFK36162.1| hypothetical protein AALP_AA4G086100 [Arabis alpina]
Length=220

 Score = 55.5 bits (132),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 32/102 (31%), Positives = 55/102 (54%), Gaps = 5/102 (5%)
 Frame = +1

Query  385  SVEMFDYFYKLLHS--WSTNLNVNKYEHLVLLELLNKGHPEPEKKIGKGVGGFQVRFHPK  558
            +V +  +   +LHS  ++    ++      ++E+L   HPE EKKIG G+    V  HP+
Sbjct  109  TVPLVGFVRMILHSGKYANRDRLSPEHERTIVEMLLPYHPEFEKKIGCGIDYIMVGHHPE  168

Query  559  YK-SRCFFITGEDGSSDDFSFRKCVDNILPLPENMPIKHDTY  681
            ++ SRC FI   DG   DFS+ KC+  +  + +  P+  D++
Sbjct  169  FESSRCLFIVRRDGEVVDFSYWKCIKGL--IRKKYPLYADSF  208



>ref|XP_006304196.1| hypothetical protein CARUB_v10010275mg [Capsella rubella]
 gb|EOA37094.1| hypothetical protein CARUB_v10010275mg [Capsella rubella]
Length=216

 Score = 55.1 bits (131),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 31/94 (33%), Positives = 50/94 (53%), Gaps = 3/94 (3%)
 Frame = +1

Query  370  KTFVSSVEMFDYFYKLLHS--WSTNLNVNKYEHLVLLELLNKGHPEPEKKIGKGVGGFQV  543
            K    +V +  +   +LHS  ++    ++     +++E+L   HPE EKKIG G+    V
Sbjct  100  KILEVTVPLVGFVRMILHSGKYANQDRLSPEHERMIVEMLLPYHPEFEKKIGCGIDYIMV  159

Query  544  RFHPKYK-SRCFFITGEDGSSDDFSFRKCVDNIL  642
              HP ++ SRC FI   DG   DFS+ KC+  ++
Sbjct  160  GHHPDFESSRCMFIVRRDGEVVDFSYWKCIKGLI  193



>ref|XP_002894020.1| hypothetical protein ARALYDRAFT_473852 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH70279.1| hypothetical protein ARALYDRAFT_473852 [Arabidopsis lyrata subsp. 
lyrata]
Length=218

 Score = 55.1 bits (131),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 32/102 (31%), Positives = 55/102 (54%), Gaps = 5/102 (5%)
 Frame = +1

Query  385  SVEMFDYFYKLLHS--WSTNLNVNKYEHLVLLELLNKGHPEPEKKIGKGVGGFQVRFHPK  558
            +V +  +   +LHS  ++    ++      ++E+L   HPE EKKIG G+    V  HP 
Sbjct  107  TVPLVGFVRMILHSGKYANRDRLSPEHERTIVEMLLPYHPEFEKKIGCGIDYIMVWHHPD  166

Query  559  YK-SRCFFITGEDGSSDDFSFRKCVDNILPLPENMPIKHDTY  681
            ++ SRC FI  +DG   DFS+ KC+  +  + +  P+  D++
Sbjct  167  FESSRCMFIVRKDGEVVDFSYWKCIKGL--IKKKYPLYADSF  206



>ref|XP_006573757.1| PREDICTED: DNA-directed RNA polymerase IV subunit 1-like isoform 
X4 [Glycine max]
Length=1381

 Score = 57.0 bits (136),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 29/73 (40%), Positives = 46/73 (63%), Gaps = 2/73 (3%)
 Frame = +1

Query  415   LLHSWSTNLNVNKYEHLVLLELLNKGHPEPEKKIGKGVGGFQVRFHPKYK-SRCFFITGE  591
             +L+ +S +  +++ +   +L +LN  HP   +K G G    +V +HPKYK SRCF I   
Sbjct  1285  ILNKYSIDELLSESDRSTMLRVLNF-HPHKSEKFGIGPQDIKVGWHPKYKDSRCFHIIRT  1343

Query  592   DGSSDDFSFRKCV  630
             DG+ +DFS+RKC+
Sbjct  1344  DGTVEDFSYRKCI  1356



>ref|XP_003611164.1| DNA-directed RNA polymerase subunit beta [Medicago truncatula]
Length=1687

 Score = 57.0 bits (136),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 29/92 (32%), Positives = 57/92 (62%), Gaps = 4/92 (4%)
 Frame = +1

Query  415   LLHSWSTNLNVNKYEHLVLLELLNKGHPEPEKKIGKGVGGFQVRFHPKYK-SRCFFITGE  591
             +L+ +  +  +++ + L ++++L+  HP  ++K G G    +V +HP++  SRCFFI  +
Sbjct  1542  ILNKYQIDETLSETDKLTIMKVLH-FHPRRDEKFGSGPQNIKVGWHPEFTDSRCFFIIRK  1600

Query  592   DGSSDDFSFRKCVDNILPL--PENMPIKHDTY  681
             DGS +DFS+RKC+   L +  P+   I+ + +
Sbjct  1601  DGSVEDFSYRKCILGALDIIDPKKSKIQRNRW  1632



>gb|AES94122.2| DNA-directed RNA polymerase [Medicago truncatula]
Length=1519

 Score = 57.0 bits (136),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 29/92 (32%), Positives = 57/92 (62%), Gaps = 4/92 (4%)
 Frame = +1

Query  415   LLHSWSTNLNVNKYEHLVLLELLNKGHPEPEKKIGKGVGGFQVRFHPKYK-SRCFFITGE  591
             +L+ +  +  +++ + L ++++L+  HP  ++K G G    +V +HP++  SRCFFI  +
Sbjct  1374  ILNKYQIDETLSETDKLTIMKVLH-FHPRRDEKFGSGPQNIKVGWHPEFTDSRCFFIIRK  1432

Query  592   DGSSDDFSFRKCVDNILPL--PENMPIKHDTY  681
             DGS +DFS+RKC+   L +  P+   I+ + +
Sbjct  1433  DGSVEDFSYRKCILGALDIIDPKKSKIQRNRW  1464



>ref|XP_010461498.1| PREDICTED: protein DCL, chloroplastic-like [Camelina sativa]
Length=222

 Score = 55.1 bits (131),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 31/94 (33%), Positives = 50/94 (53%), Gaps = 3/94 (3%)
 Frame = +1

Query  370  KTFVSSVEMFDYFYKLLHS--WSTNLNVNKYEHLVLLELLNKGHPEPEKKIGKGVGGFQV  543
            K    +V +  +   +LHS  ++    ++     +++E+L   HPE EKKIG G+    V
Sbjct  106  KILEVTVPLVGFVRMILHSGKYANRDRLSPEHERMIVEMLLPYHPEFEKKIGCGIDYIMV  165

Query  544  RFHPKYK-SRCFFITGEDGSSDDFSFRKCVDNIL  642
              HP ++ SRC FI   DG   DFS+ KC+  ++
Sbjct  166  GHHPDFESSRCMFIVRRDGEVVDFSYWKCIKGLI  199



>ref|XP_010479096.1| PREDICTED: protein DCL, chloroplastic-like [Camelina sativa]
Length=220

 Score = 55.1 bits (131),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 33/107 (31%), Positives = 56/107 (52%), Gaps = 5/107 (5%)
 Frame = +1

Query  370  KTFVSSVEMFDYFYKLLHS--WSTNLNVNKYEHLVLLELLNKGHPEPEKKIGKGVGGFQV  543
            K    +V +  +   +LHS  ++    ++     +++E+L   HPE EKKIG G+    V
Sbjct  104  KILEVTVPLVGFVRMILHSGKYANRDRLSPEHERMIVEMLLPYHPEFEKKIGCGIDYIMV  163

Query  544  RFHPKYK-SRCFFITGEDGSSDDFSFRKCVDNILPLPENMPIKHDTY  681
              HP ++ SRC FI   DG   DFS+ KC+  +  + +  P+  D++
Sbjct  164  GHHPDFESSRCMFIVRRDGEVVDFSYWKCIKGL--IKKKYPLYADSF  208



>ref|XP_010500205.1| PREDICTED: protein DCL, chloroplastic [Camelina sativa]
Length=221

 Score = 55.1 bits (131),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 31/94 (33%), Positives = 50/94 (53%), Gaps = 3/94 (3%)
 Frame = +1

Query  370  KTFVSSVEMFDYFYKLLHS--WSTNLNVNKYEHLVLLELLNKGHPEPEKKIGKGVGGFQV  543
            K    +V +  +   +LHS  ++    ++     +++E+L   HPE EKKIG G+    V
Sbjct  105  KILEVTVPLVGFVRMILHSGKYANRDRLSPEHERMIVEMLLPYHPEFEKKIGCGIDYIMV  164

Query  544  RFHPKYK-SRCFFITGEDGSSDDFSFRKCVDNIL  642
              HP ++ SRC FI   DG   DFS+ KC+  ++
Sbjct  165  GHHPDFESSRCMFIVRRDGEVVDFSYWKCIKGLI  198



>ref|XP_009133402.1| PREDICTED: DNA-directed RNA polymerase V subunit 1 [Brassica 
rapa]
Length=2059

 Score = 57.0 bits (136),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 27/60 (45%), Positives = 39/60 (65%), Gaps = 2/60 (3%)
 Frame = +1

Query  466   VLLELLNKGHPEPEKKIGKGVGGFQVRFHPKY-KSRCFFITGEDGSSDDFSFRKCVDNIL  642
             VL ++LN  HPE + K+G G+    V  H  + +SRCFF+   DG+  DFS+RKC++N L
Sbjct  1895  VLEQILNY-HPEKDAKLGPGLDFITVDKHTTFTESRCFFVVSTDGTKQDFSYRKCINNYL  1953



>ref|XP_011017195.1| PREDICTED: protein DCL, chloroplastic-like [Populus euphratica]
Length=215

 Score = 54.7 bits (130),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 30/102 (29%), Positives = 56/102 (55%), Gaps = 5/102 (5%)
 Frame = +1

Query  385  SVEMFDYFYKLLHS--WSTNLNVNKYEHLVLLELLNKGHPEPEKKIGKGVGGFQVRFHPK  558
            +V +  +   +LHS  + +   +++     +++ L   HP+ + KIG G+    V +HP 
Sbjct  106  TVPLVGFVRMILHSDKYESGDRLSQEHERTIVDRLLAHHPDFDNKIGCGIDYITVGYHPD  165

Query  559  YK-SRCFFITGEDGSSDDFSFRKCVDNILPLPENMPIKHDTY  681
            +  SRC FI  +DG S DFS+ KC+  +  + +N P+  D++
Sbjct  166  FADSRCLFIVQKDGQSVDFSYWKCLKGL--IKKNYPLYADSF  205



>ref|XP_002284778.1| PREDICTED: protein DCL, chloroplastic [Vitis vinifera]
Length=215

 Score = 54.7 bits (130),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 34/89 (38%), Positives = 48/89 (54%), Gaps = 3/89 (3%)
 Frame = +1

Query  385  SVEMFDYFYKLLHSWST-NLNVNKYEH-LVLLELLNKGHPEPEKKIGKGVGGFQVRFHPK  558
            +V +  Y   ++HS    N +    EH   +LE L   HPE EKKIG G+    V +HP 
Sbjct  106  TVPLVGYVRMIIHSGKYENGDRLSLEHEKFVLEKLLAYHPECEKKIGCGIDYITVGYHPD  165

Query  559  YK-SRCFFITGEDGSSDDFSFRKCVDNIL  642
            ++ SRC FI   DG   DFS+ KC+  ++
Sbjct  166  FEGSRCLFIVRNDGELVDFSYWKCIKGLI  194



>gb|EYU25429.1| hypothetical protein MIMGU_mgv1a021420mg [Erythranthe guttata]
Length=224

 Score = 54.7 bits (130),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 30/89 (34%), Positives = 49/89 (55%), Gaps = 3/89 (3%)
 Frame = +1

Query  385  SVEMFDYFYKLLHS--WSTNLNVNKYEHLVLLELLNKGHPEPEKKIGKGVGGFQVRFHPK  558
            +V +  +   +LHS  + +   ++      +LE L   HPE E+KIG+GV    + +HP 
Sbjct  111  TVPLVGFVRMILHSGKYESGDRLSPEHEKTILERLLVYHPECEEKIGRGVDYVTIGYHPN  170

Query  559  YK-SRCFFITGEDGSSDDFSFRKCVDNIL  642
            ++ SRC FI  +DG   DFS+ KC+   +
Sbjct  171  FECSRCLFIVHKDGELVDFSYWKCIKGFI  199



>ref|XP_010059925.1| PREDICTED: protein DCL, chloroplastic [Eucalyptus grandis]
 gb|KCW66407.1| hypothetical protein EUGRSUZ_F00221 [Eucalyptus grandis]
Length=243

 Score = 55.1 bits (131),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 33/107 (31%), Positives = 54/107 (50%), Gaps = 5/107 (5%)
 Frame = +1

Query  370  KTFVSSVEMFDYFYKLLHS--WSTNLNVNKYEHLVLLELLNKGHPEPEKKIGKGVGGFQV  543
            K    +V +  +   +LHS  + +    +      +LE L   HPE EKK G G+    V
Sbjct  125  KILEDTVPLVGFVRMILHSQRYQSGDRFSPEHERTILEKLLPYHPEFEKKTGCGIDYITV  184

Query  544  RFHPKY-KSRCFFITGEDGSSDDFSFRKCVDNILPLPENMPIKHDTY  681
             +HP + +SRC FI  +DG   DFS+ KC+  +  + +  P+  D++
Sbjct  185  GYHPDFQRSRCLFIVRKDGELVDFSYWKCIKGL--IRKKYPLYADSF  229



>gb|KHN37673.1| DNA-directed RNA polymerase E subunit 1 [Glycine soja]
Length=2044

 Score = 56.6 bits (135),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 25/63 (40%), Positives = 40/63 (63%), Gaps = 1/63 (2%)
 Frame = +1

Query  457   EHLVLLELLNKGHPEPEKKIGKGVGGFQVRFHPKYK-SRCFFITGEDGSSDDFSFRKCVD  633
             + L +LE + + HP+ E K+G G+    V  H  ++ SRCF++  +DG S DFS+RKC+ 
Sbjct  1935  DQLFVLENVFEHHPDKETKMGAGIDYVMVNKHSSFQESRCFYVVCKDGQSKDFSYRKCLA  1994

Query  634   NIL  642
             N +
Sbjct  1995  NYI  1997



>ref|NP_001062578.1| Os09g0112400 [Oryza sativa Japonica Group]
 dbj|BAD17553.1| putative DCL protein [Oryza sativa Japonica Group]
 dbj|BAF24492.1| Os09g0112400 [Oryza sativa Japonica Group]
 dbj|BAG98628.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC84087.1| hypothetical protein OsI_30385 [Oryza sativa Indica Group]
 gb|EEE69194.1| hypothetical protein OsJ_28381 [Oryza sativa Japonica Group]
Length=159

 Score = 53.5 bits (127),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 24/47 (51%), Positives = 30/47 (64%), Gaps = 1/47 (2%)
 Frame = +1

Query  493  HPEPEKKIGKGVGGFQVRFHPKY-KSRCFFITGEDGSSDDFSFRKCV  630
            HP  E KIG GV    V  HP + KSRC FI   +G ++DFS+RKC+
Sbjct  84   HPTSEDKIGCGVDAIMVGKHPDFRKSRCLFIVRTNGETEDFSYRKCI  130



>ref|XP_003541591.1| PREDICTED: DNA-directed RNA polymerase V subunit 1-like [Glycine 
max]
Length=2020

 Score = 56.6 bits (135),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 25/63 (40%), Positives = 40/63 (63%), Gaps = 1/63 (2%)
 Frame = +1

Query  457   EHLVLLELLNKGHPEPEKKIGKGVGGFQVRFHPKYK-SRCFFITGEDGSSDDFSFRKCVD  633
             + L +LE + + HP+ E K+G G+    V  H  ++ SRCF++  +DG S DFS+RKC+ 
Sbjct  1911  DQLFVLENVFEHHPDKETKMGAGIDYVMVNKHSSFQESRCFYVVCKDGQSKDFSYRKCLA  1970

Query  634   NIL  642
             N +
Sbjct  1971  NYI  1973



>ref|WP_008120591.1| hypothetical protein [Phyllobacterium sp. YR531]
 gb|EJN06800.1| Protein of unknown function (DUF3223) [Phyllobacterium sp. YR531]
Length=103

 Score = 52.8 bits (125),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 26/91 (29%), Positives = 47/91 (52%), Gaps = 2/91 (2%)
 Frame = +1

Query  355  VTLGPKTFVSSVEMFDYFYKLLHSWSTNLNVNKYEHLVLLELLNKGHPEPEKKIGKGVGG  534
            + +  + F + VE  + F  +L+ +     ++  +   +   L + HPE   KIG G+  
Sbjct  8    IVIDGEVFTTQVEARERFRSILYKYRIGETIDAADSQFMTSALQR-HPEAATKIGFGIQS  66

Query  535  FQVRFHPKYKSRCFFITGEDGSSDDFSFRKC  627
            F+VR    Y +RCF++   DG+++ FSF  C
Sbjct  67   FEVR-AADYGTRCFWVIRVDGTAEKFSFNAC  96



>gb|EAZ24730.1| hypothetical protein OsJ_08502 [Oryza sativa Japonica Group]
Length=359

 Score = 55.5 bits (132),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 27/60 (45%), Positives = 37/60 (62%), Gaps = 1/60 (2%)
 Frame = +1

Query  466  VLLELLNKGHPEPEKKIGKGVGGFQVRFHPKYK-SRCFFITGEDGSSDDFSFRKCVDNIL  642
             +LE L   HP+ EKKIG G+    V  HP+++ SRC FI  +DG   DFSF KC+  ++
Sbjct  235  AILERLLPYHPQYEKKIGCGIDYLTVGLHPEFENSRCLFIVRKDGEQVDFSFWKCIKGLI  294



>ref|XP_006590533.1| PREDICTED: DNA-directed RNA polymerase IV subunit 1-like [Glycine 
max]
Length=1369

 Score = 56.2 bits (134),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 29/73 (40%), Positives = 46/73 (63%), Gaps = 2/73 (3%)
 Frame = +1

Query  415   LLHSWSTNLNVNKYEHLVLLELLNKGHPEPEKKIGKGVGGFQVRFHPKYK-SRCFFITGE  591
             +L+ +S +  +++ +   +L +LN  HP   +K G G    +V +HPKYK SRCF I   
Sbjct  1273  ILNKYSIDELLSESDRSTMLRVLNF-HPRKSEKFGIGPQDIKVGWHPKYKDSRCFHIVRI  1331

Query  592   DGSSDDFSFRKCV  630
             DG+ +DFS+RKC+
Sbjct  1332  DGTVEDFSYRKCI  1344



>gb|EMS54113.1| Protein DCL, chloroplastic [Triticum urartu]
Length=134

 Score = 53.1 bits (126),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 27/73 (37%), Positives = 42/73 (58%), Gaps = 3/73 (4%)
 Frame = +1

Query  466  VLLELLNKGHPEPEKKIGKGVGGFQVRFHPKYK-SRCFFITGEDGSSDDFSFRKCVDNIL  642
             +LE L   HP+ +KKIG G+    +  HP+++ SRC FI   DG   DFSF KC+  + 
Sbjct  53   AILERLLPYHPQYKKKIGCGIDYITLGLHPEFENSRCLFIVRTDGEQVDFSFWKCIKGL-  111

Query  643  PLPENMPIKHDTY  681
             + +  P+  D++
Sbjct  112  -IRQKYPLYADSF  123



>ref|XP_008348940.1| PREDICTED: DNA-directed RNA polymerase V subunit 1-like [Malus 
domestica]
Length=904

 Score = 55.8 bits (133),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 25/63 (40%), Positives = 39/63 (62%), Gaps = 2/63 (3%)
 Frame = +1

Query  457  EHLVLLELLNKGHPEPEKKIGKGVGGFQVRFHPKYK-SRCFFITGEDGSSDDFSFRKCVD  633
            +  +L  +LN  HP+   K+G G+G   V  H  ++ SRCFF+   DG  +DFS+RKC++
Sbjct  769  QSFILDNVLNY-HPDKAVKMGSGIGHLTVDRHGSFQDSRCFFVVTTDGHKEDFSYRKCLE  827

Query  634  NIL  642
            N +
Sbjct  828  NYI  830



>ref|XP_006573756.1| PREDICTED: DNA-directed RNA polymerase IV subunit 1-like isoform 
X3 [Glycine max]
Length=1455

 Score = 56.2 bits (134),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 29/73 (40%), Positives = 46/73 (63%), Gaps = 2/73 (3%)
 Frame = +1

Query  415   LLHSWSTNLNVNKYEHLVLLELLNKGHPEPEKKIGKGVGGFQVRFHPKYK-SRCFFITGE  591
             +L+ +S +  +++ +   +L +LN  HP   +K G G    +V +HPKYK SRCF I   
Sbjct  1359  ILNKYSIDELLSESDRSTMLRVLN-FHPHKSEKFGIGPQDIKVGWHPKYKDSRCFHIIRT  1417

Query  592   DGSSDDFSFRKCV  630
             DG+ +DFS+RKC+
Sbjct  1418  DGTVEDFSYRKCI  1430



>ref|XP_006573755.1| PREDICTED: DNA-directed RNA polymerase IV subunit 1-like isoform 
X2 [Glycine max]
Length=1457

 Score = 56.2 bits (134),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 30/81 (37%), Positives = 49/81 (60%), Gaps = 2/81 (2%)
 Frame = +1

Query  415   LLHSWSTNLNVNKYEHLVLLELLNKGHPEPEKKIGKGVGGFQVRFHPKYK-SRCFFITGE  591
             +L+ +S +  +++ +   +L +LN  HP   +K G G    +V +HPKYK SRCF I   
Sbjct  1361  ILNKYSIDELLSESDRSTMLRVLN-FHPHKSEKFGIGPQDIKVGWHPKYKDSRCFHIIRT  1419

Query  592   DGSSDDFSFRKCVDNILPLPE  654
             DG+ +DFS+RKC+   L + +
Sbjct  1420  DGTVEDFSYRKCILGALDIVD  1440



>ref|XP_006573754.1| PREDICTED: DNA-directed RNA polymerase IV subunit 1-like isoform 
X1 [Glycine max]
Length=1458

 Score = 56.2 bits (134),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 30/81 (37%), Positives = 49/81 (60%), Gaps = 2/81 (2%)
 Frame = +1

Query  415   LLHSWSTNLNVNKYEHLVLLELLNKGHPEPEKKIGKGVGGFQVRFHPKYK-SRCFFITGE  591
             +L+ +S +  +++ +   +L +LN  HP   +K G G    +V +HPKYK SRCF I   
Sbjct  1362  ILNKYSIDELLSESDRSTMLRVLN-FHPHKSEKFGIGPQDIKVGWHPKYKDSRCFHIIRT  1420

Query  592   DGSSDDFSFRKCVDNILPLPE  654
             DG+ +DFS+RKC+   L + +
Sbjct  1421  DGTVEDFSYRKCILGALDIVD  1441



>gb|KHN04477.1| Protein DCL, chloroplastic [Glycine soja]
Length=171

 Score = 53.5 bits (127),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 28/75 (37%), Positives = 42/75 (56%), Gaps = 3/75 (4%)
 Frame = +1

Query  415  LLHS--WSTNLNVNKYEHLVLLELLNKGHPEPEKKIGKGVGGFQVRFHPKYK-SRCFFIT  585
            +LHS  +     +N+ +   ++E L   HP  E KIG G+    V  HP+Y+ SRC F+ 
Sbjct  72   ILHSRRYMDGARLNEEDEKAIVEKLLAYHPHSEDKIGCGLESIMVDRHPQYRQSRCLFVV  131

Query  586  GEDGSSDDFSFRKCV  630
              DG   DFS++KC+
Sbjct  132  RTDGGWIDFSYQKCL  146



>ref|XP_004140346.1| PREDICTED: LOW QUALITY PROTEIN: DNA-directed RNA polymerase E 
subunit 1-like [Cucumis sativus]
Length=2019

 Score = 55.8 bits (133),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 25/63 (40%), Positives = 38/63 (60%), Gaps = 2/63 (3%)
 Frame = +1

Query  457   EHLVLLELLNKGHPEPEKKIGKGVGGFQVRFHPKYK-SRCFFITGEDGSSDDFSFRKCVD  633
             +  VL  + N  HP+   K+G G+  F V  H  ++ SRCF++   DG  +DFS+RKC+D
Sbjct  1902  QSFVLQSVFNF-HPDKAAKMGAGIDHFMVSRHSSFQESRCFYVVTTDGHKEDFSYRKCLD  1960

Query  634   NIL  642
             N +
Sbjct  1961  NFI  1963



>ref|XP_007158453.1| hypothetical protein PHAVU_002G153700g [Phaseolus vulgaris]
 gb|ESW30447.1| hypothetical protein PHAVU_002G153700g [Phaseolus vulgaris]
Length=1463

 Score = 55.8 bits (133),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 27/73 (37%), Positives = 47/73 (64%), Gaps = 2/73 (3%)
 Frame = +1

Query  415   LLHSWSTNLNVNKYEHLVLLELLNKGHPEPEKKIGKGVGGFQVRFHPKYK-SRCFFITGE  591
             +L+ +  +  +++++   +L +LN  HP   +K+G G    +V +HPK+K SRCF I   
Sbjct  1357  ILNKYEIDELLSEFDRSTILRVLN-FHPRRSEKLGIGPQDIKVGWHPKFKDSRCFHIVRT  1415

Query  592   DGSSDDFSFRKCV  630
             DG+ +DFS+RKC+
Sbjct  1416  DGTVEDFSYRKCI  1428



>ref|XP_007158454.1| hypothetical protein PHAVU_002G153700g [Phaseolus vulgaris]
 gb|ESW30448.1| hypothetical protein PHAVU_002G153700g [Phaseolus vulgaris]
Length=1464

 Score = 55.8 bits (133),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 27/73 (37%), Positives = 47/73 (64%), Gaps = 2/73 (3%)
 Frame = +1

Query  415   LLHSWSTNLNVNKYEHLVLLELLNKGHPEPEKKIGKGVGGFQVRFHPKYK-SRCFFITGE  591
             +L+ +  +  +++++   +L +LN  HP   +K+G G    +V +HPK+K SRCF I   
Sbjct  1358  ILNKYEIDELLSEFDRSTILRVLN-FHPRRSEKLGIGPQDIKVGWHPKFKDSRCFHIVRT  1416

Query  592   DGSSDDFSFRKCV  630
             DG+ +DFS+RKC+
Sbjct  1417  DGTVEDFSYRKCI  1429



>ref|XP_010108047.1| DNA-directed RNA polymerase D subunit 1 [Morus notabilis]
 gb|EXC17779.1| DNA-directed RNA polymerase D subunit 1 [Morus notabilis]
Length=1410

 Score = 55.8 bits (133),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 23/47 (49%), Positives = 33/47 (70%), Gaps = 1/47 (2%)
 Frame = +1

Query  493   HPEPEKKIGKGVGGFQVRFHPKYKS-RCFFITGEDGSSDDFSFRKCV  630
             HP  ++KIG G    +V +HPK++S RCF +   DG+ +DFS+RKCV
Sbjct  1327  HPRIDEKIGTGFQDIKVAYHPKHQSSRCFVLVRADGTVEDFSYRKCV  1373



>ref|XP_006598109.1| PREDICTED: DNA-directed RNA polymerase V subunit 1-like [Glycine 
max]
Length=2082

 Score = 55.8 bits (133),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 25/63 (40%), Positives = 40/63 (63%), Gaps = 1/63 (2%)
 Frame = +1

Query  457   EHLVLLELLNKGHPEPEKKIGKGVGGFQVRFHPKYK-SRCFFITGEDGSSDDFSFRKCVD  633
             + L +LE + + HP+ E K+G G+    V  H  ++ SRCF++  +DG S DFS+RKC+ 
Sbjct  1954  DQLFVLENVFEHHPDKETKMGTGIDYVMVNKHSSFQESRCFYVVCKDGESKDFSYRKCLA  2013

Query  634   NIL  642
             N +
Sbjct  2014  NYI  2016



>gb|KHN27337.1| DNA-directed RNA polymerase E subunit 1 [Glycine soja]
Length=2094

 Score = 55.8 bits (133),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 25/63 (40%), Positives = 40/63 (63%), Gaps = 1/63 (2%)
 Frame = +1

Query  457   EHLVLLELLNKGHPEPEKKIGKGVGGFQVRFHPKYK-SRCFFITGEDGSSDDFSFRKCVD  633
             + L +LE + + HP+ E K+G G+    V  H  ++ SRCF++  +DG S DFS+RKC+ 
Sbjct  1966  DQLFVLENVFEHHPDKETKMGTGIDYVMVNKHSSFQESRCFYVVCKDGESKDFSYRKCLA  2025

Query  634   NIL  642
             N +
Sbjct  2026  NYI  2028



>ref|XP_008465860.1| PREDICTED: DNA-directed RNA polymerase V subunit 1 [Cucumis melo]
 ref|XP_008465867.1| PREDICTED: DNA-directed RNA polymerase V subunit 1 [Cucumis melo]
 ref|XP_008465874.1| PREDICTED: DNA-directed RNA polymerase V subunit 1 [Cucumis melo]
Length=1964

 Score = 55.8 bits (133),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 25/63 (40%), Positives = 38/63 (60%), Gaps = 2/63 (3%)
 Frame = +1

Query  457   EHLVLLELLNKGHPEPEKKIGKGVGGFQVRFHPKYK-SRCFFITGEDGSSDDFSFRKCVD  633
             +  VL  + N  HP+   K+G G+  F V  H  ++ SRCF++   DG  +DFS+RKC+D
Sbjct  1846  QSFVLQSVFNF-HPDKAAKMGAGIDHFMVSRHSSFQESRCFYVVTTDGHKEDFSYRKCLD  1904

Query  634   NIL  642
             N +
Sbjct  1905  NFI  1907



>gb|KGN51090.1| hypothetical protein Csa_5G435050 [Cucumis sativus]
Length=1963

 Score = 55.8 bits (133),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 25/63 (40%), Positives = 38/63 (60%), Gaps = 2/63 (3%)
 Frame = +1

Query  457   EHLVLLELLNKGHPEPEKKIGKGVGGFQVRFHPKYK-SRCFFITGEDGSSDDFSFRKCVD  633
             +  VL  + N  HP+   K+G G+  F V  H  ++ SRCF++   DG  +DFS+RKC+D
Sbjct  1846  QSFVLQSVFNF-HPDKAAKMGAGIDHFMVSRHSSFQESRCFYVVTTDGHKEDFSYRKCLD  1904

Query  634   NIL  642
             N +
Sbjct  1905  NFI  1907



>ref|XP_004155767.1| PREDICTED: DNA-directed RNA polymerase E subunit 1-like [Cucumis 
sativus]
Length=1959

 Score = 55.8 bits (133),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 25/63 (40%), Positives = 38/63 (60%), Gaps = 2/63 (3%)
 Frame = +1

Query  457   EHLVLLELLNKGHPEPEKKIGKGVGGFQVRFHPKYK-SRCFFITGEDGSSDDFSFRKCVD  633
             +  VL  + N  HP+   K+G G+  F V  H  ++ SRCF++   DG  +DFS+RKC+D
Sbjct  1842  QSFVLQSVFNF-HPDKAAKMGAGIDHFMVSRHSSFQESRCFYVVTTDGHKEDFSYRKCLD  1900

Query  634   NIL  642
             N +
Sbjct  1901  NFI  1903



>gb|KHN34995.1| DNA-directed RNA polymerase D subunit 1 [Glycine soja]
Length=1044

 Score = 55.8 bits (133),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 29/73 (40%), Positives = 46/73 (63%), Gaps = 2/73 (3%)
 Frame = +1

Query  415   LLHSWSTNLNVNKYEHLVLLELLNKGHPEPEKKIGKGVGGFQVRFHPKYK-SRCFFITGE  591
             +L+ +S +  +++ +   +L +LN  HP   +K G G    +V +HPKYK SRCF I   
Sbjct  948   ILNKYSIDELLSESDRSTMLRVLN-FHPHKSEKFGIGPQDIKVGWHPKYKDSRCFHIVRI  1006

Query  592   DGSSDDFSFRKCV  630
             DG+ +DFS+RKC+
Sbjct  1007  DGTVEDFSYRKCI  1019



>gb|KDP25521.1| hypothetical protein JCGZ_20677 [Jatropha curcas]
Length=942

 Score = 55.8 bits (133),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 29/80 (36%), Positives = 47/80 (59%), Gaps = 2/80 (3%)
 Frame = +1

Query  412  KLLHSWSTNLNVNKYEHLVLLELLNKGHPEPEKKIGKGVGGFQVRFHPKYK-SRCFFITG  588
            K+L+ +  +  +N+ +   L+  L   HP  ++KIG G    +V  HP+Y+ SRCF +  
Sbjct  845  KILNKYPVDQQLNEADKCTLMSAL-YFHPRRDEKIGSGAQDIKVVNHPEYQGSRCFSVVR  903

Query  589  EDGSSDDFSFRKCVDNILPL  648
             DG+ +DFS+RKCV   L +
Sbjct  904  TDGTIEDFSYRKCVHGALEI  923



>gb|EPS74753.1| hypothetical protein M569_00001, partial [Genlisea aurea]
Length=1380

 Score = 55.8 bits (133),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 21/52 (40%), Positives = 34/52 (65%), Gaps = 0/52 (0%)
 Frame = +1

Query  493   HPEPEKKIGKGVGGFQVRFHPKYKSRCFFITGEDGSSDDFSFRKCVDNILPL  648
             HP   +KIG G+   +V  HP+++  CF +   DG+ +DFS+RKC+++ L L
Sbjct  1324  HPRWPEKIGSGIQEIKVGLHPEHQQTCFILKRSDGTEEDFSYRKCINHALEL  1375



>gb|EPS63154.1| hypothetical protein M569_11634, partial [Genlisea aurea]
Length=125

 Score = 52.4 bits (124),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 30/75 (40%), Positives = 42/75 (56%), Gaps = 6/75 (8%)
 Frame = +1

Query  466  VLLELLNKGHPEPEKKIGKGVGGFQVRFHPKYK-SRCFFITGEDGSSDDFSFRKCVDNIL  642
            ++L  L   HP  E KIG GV  F V +HP ++ S+C FI   DG   DFS+ KC+  ++
Sbjct  47   MILNKLLPYHPHYESKIGSGVDHFVVGYHPTFESSKCLFIVRRDGEVVDFSYWKCIKGLI  106

Query  643  ----PL-PENMPIKH  672
                PL  E+  I+H
Sbjct  107  RKEYPLYAESFIIRH  121



>ref|XP_007017220.1| Uncharacterized protein isoform 6 [Theobroma cacao]
 gb|EOY14445.1| Uncharacterized protein isoform 6 [Theobroma cacao]
Length=231

 Score = 53.9 bits (128),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 26/60 (43%), Positives = 37/60 (62%), Gaps = 1/60 (2%)
 Frame = +1

Query  466  VLLELLNKGHPEPEKKIGKGVGGFQVRFHPKYK-SRCFFITGEDGSSDDFSFRKCVDNIL  642
             +L+ L   HPE EKKIG G+    V +HP ++ SRC FI  +DG   DFS+ KC+  ++
Sbjct  134  TILDRLLPYHPECEKKIGCGIDYITVGYHPDFEGSRCLFIVRKDGELIDFSYWKCIKGLI  193



>ref|XP_007133762.1| hypothetical protein PHAVU_011G206900g [Phaseolus vulgaris]
 gb|ESW05756.1| hypothetical protein PHAVU_011G206900g [Phaseolus vulgaris]
Length=2052

 Score = 55.8 bits (133),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 24/63 (38%), Positives = 41/63 (65%), Gaps = 1/63 (2%)
 Frame = +1

Query  457   EHLVLLELLNKGHPEPEKKIGKGVGGFQVRFHPKYK-SRCFFITGEDGSSDDFSFRKCVD  633
             + L +LE + + HP+ + K+G G+    V  H  ++ SRCF++  +DG  +DFS+RKC+D
Sbjct  1931  DQLFVLENVFEHHPDKDTKMGAGIDYVMVNKHSSFQDSRCFYVVLKDGRREDFSYRKCLD  1990

Query  634   NIL  642
             N +
Sbjct  1991  NWI  1993



>ref|XP_010093644.1| hypothetical protein L484_011068 [Morus notabilis]
 gb|EXB54405.1| hypothetical protein L484_011068 [Morus notabilis]
Length=210

 Score = 53.5 bits (127),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 26/60 (43%), Positives = 37/60 (62%), Gaps = 1/60 (2%)
 Frame = +1

Query  466  VLLELLNKGHPEPEKKIGKGVGGFQVRFHPKYK-SRCFFITGEDGSSDDFSFRKCVDNIL  642
            ++LE L   HPE E KIG GV    V +H ++K +RC FI  +DG   DFS+ KC+  ++
Sbjct  126  IILERLLPYHPEYEAKIGCGVESITVGYHSEFKGTRCLFIVRKDGQLVDFSYWKCMKGLI  185



>ref|XP_010512942.1| PREDICTED: DNA-directed RNA polymerase V subunit 1-like [Camelina 
sativa]
Length=1429

 Score = 55.5 bits (132),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 29/61 (48%), Positives = 38/61 (62%), Gaps = 2/61 (3%)
 Frame = +1

Query  463   LVLLELLNKGHPEPEKKIGKGVGGFQVRFHPKYK-SRCFFITGEDGSSDDFSFRKCVDNI  639
              VL ++LN  HPE EKK+G GV    V  H  +  SRCFF+   DG+  DFS+RK ++N 
Sbjct  1296  FVLEKILNF-HPEKEKKLGSGVDFITVDKHTTFSDSRCFFVVSTDGTKQDFSYRKSLNNY  1354

Query  640   L  642
             L
Sbjct  1355  L  1355



>emb|CDY60335.1| BnaC03g72290D [Brassica napus]
Length=1869

 Score = 55.5 bits (132),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 26/60 (43%), Positives = 39/60 (65%), Gaps = 2/60 (3%)
 Frame = +1

Query  466   VLLELLNKGHPEPEKKIGKGVGGFQVRFHPKY-KSRCFFITGEDGSSDDFSFRKCVDNIL  642
             VL ++LN  HP+ + K+G G+    V  H  + +SRCFF+   DG+  DFS+RKC++N L
Sbjct  1723  VLEQILNY-HPDKDAKLGPGLDFITVDKHTTFTESRCFFVVSTDGTKQDFSYRKCINNYL  1781



>ref|XP_010412959.1| PREDICTED: DNA-directed RNA polymerase V subunit 1-like [Camelina 
sativa]
Length=1920

 Score = 55.5 bits (132),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 29/61 (48%), Positives = 38/61 (62%), Gaps = 2/61 (3%)
 Frame = +1

Query  463   LVLLELLNKGHPEPEKKIGKGVGGFQVRFHPKYK-SRCFFITGEDGSSDDFSFRKCVDNI  639
              VL ++LN  HPE EKK+G GV    V  H  +  SRCFF+   DG+  DFS+RK ++N 
Sbjct  1727  FVLEKILNF-HPEKEKKLGSGVDFITVDKHTTFSDSRCFFVVSTDGTKQDFSYRKSLNNY  1785

Query  640   L  642
             L
Sbjct  1786  L  1786



>ref|XP_010509007.1| PREDICTED: LOW QUALITY PROTEIN: DNA-directed RNA polymerase V 
subunit 1-like [Camelina sativa]
Length=1834

 Score = 55.5 bits (132),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 29/61 (48%), Positives = 38/61 (62%), Gaps = 2/61 (3%)
 Frame = +1

Query  463   LVLLELLNKGHPEPEKKIGKGVGGFQVRFHPKYK-SRCFFITGEDGSSDDFSFRKCVDNI  639
              VL ++LN  HPE EKK+G GV    V  H  +  SRCFF+   DG+  DFS+RK ++N 
Sbjct  1701  FVLEKILNF-HPEKEKKLGSGVDFITVDKHTTFSDSRCFFVVSTDGTKQDFSYRKSLNNY  1759

Query  640   L  642
             L
Sbjct  1760  L  1760



>ref|XP_004511611.1| PREDICTED: DNA-directed RNA polymerase D subunit 1-like isoform 
X5 [Cicer arietinum]
Length=1474

 Score = 55.5 bits (132),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 30/88 (34%), Positives = 54/88 (61%), Gaps = 4/88 (5%)
 Frame = +1

Query  415   LLHSWSTNLNVNKYEHLVLLELLNKGHPEPEKKIGKGVGGFQVRFHPKYK-SRCFFITGE  591
             +L+ +  +  +++ + L ++++L+  HP   +K+G G    +V +HPK+  SRCFFI   
Sbjct  1369  ILNKYPIDQILSERDKLTIMKVLH-FHPRRNEKLGSGPQHIKVGWHPKFTDSRCFFIIRT  1427

Query  592   DGSSDDFSFRKCVDNILPL--PENMPIK  669
             DG+ +DFS+RKC+   L +  PE   I+
Sbjct  1428  DGTVEDFSYRKCILGALDVVDPEKSKIQ  1455



>ref|XP_004511607.1| PREDICTED: DNA-directed RNA polymerase D subunit 1-like isoform 
X1 [Cicer arietinum]
 ref|XP_004511608.1| PREDICTED: DNA-directed RNA polymerase D subunit 1-like isoform 
X2 [Cicer arietinum]
 ref|XP_004511609.1| PREDICTED: DNA-directed RNA polymerase D subunit 1-like isoform 
X3 [Cicer arietinum]
 ref|XP_004511610.1| PREDICTED: DNA-directed RNA polymerase D subunit 1-like isoform 
X4 [Cicer arietinum]
Length=1475

 Score = 55.5 bits (132),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 30/88 (34%), Positives = 54/88 (61%), Gaps = 4/88 (5%)
 Frame = +1

Query  415   LLHSWSTNLNVNKYEHLVLLELLNKGHPEPEKKIGKGVGGFQVRFHPKYK-SRCFFITGE  591
             +L+ +  +  +++ + L ++++L+  HP   +K+G G    +V +HPK+  SRCFFI   
Sbjct  1370  ILNKYPIDQILSERDKLTIMKVLH-FHPRRNEKLGSGPQHIKVGWHPKFTDSRCFFIIRT  1428

Query  592   DGSSDDFSFRKCVDNILPL--PENMPIK  669
             DG+ +DFS+RKC+   L +  PE   I+
Sbjct  1429  DGTVEDFSYRKCILGALDVVDPEKSKIQ  1456



>ref|NP_001141526.1| uncharacterized protein LOC100273638 [Zea mays]
 gb|ACF86551.1| unknown [Zea mays]
 gb|AFW64350.1| hypothetical protein ZEAMMB73_449747 [Zea mays]
Length=235

 Score = 53.5 bits (127),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 32/102 (31%), Positives = 53/102 (52%), Gaps = 5/102 (5%)
 Frame = +1

Query  385  SVEMFDYFYKLLHS--WSTNLNVNKYEHLVLLELLNKGHPEPEKKIGKGVGGFQVRFHPK  558
            +V +  +   +LHS  + +   +       +LE L   HP+  +KIG G+    V  HP+
Sbjct  125  TVPLVGFVRMILHSGKYESGDRLCPEHEKAILERLLPYHPQYNEKIGCGIDYITVGLHPE  184

Query  559  YK-SRCFFITGEDGSSDDFSFRKCVDNILPLPENMPIKHDTY  681
            ++ SRC FI  +DG   DFSF KCV  +  + +  P+  D++
Sbjct  185  FENSRCLFIVRKDGEQIDFSFWKCVKGL--IRQKYPMYADSF  224



>ref|XP_008351988.1| PREDICTED: protein DCL, chloroplastic-like isoform X2 [Malus 
domestica]
Length=196

 Score = 53.1 bits (126),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 24/56 (43%), Positives = 35/56 (63%), Gaps = 1/56 (2%)
 Frame = +1

Query  466  VLLELLNKGHPEPEKKIGKGVGGFQVRFHPKYK-SRCFFITGEDGSSDDFSFRKCV  630
            V++E L   HP+ + KIG G+    V  HP++K SRC F+   DG   DFS++KC+
Sbjct  131  VVVERLLAHHPQSKDKIGCGIDSIMVDRHPQFKHSRCLFVIRTDGVWIDFSYQKCL  186



>ref|XP_002302436.1| hypothetical protein POPTR_0002s12730g [Populus trichocarpa]
 gb|EEE81709.1| hypothetical protein POPTR_0002s12730g [Populus trichocarpa]
Length=212

 Score = 53.1 bits (126),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 29/102 (28%), Positives = 56/102 (55%), Gaps = 5/102 (5%)
 Frame = +1

Query  385  SVEMFDYFYKLLHS--WSTNLNVNKYEHLVLLELLNKGHPEPEKKIGKGVGGFQVRFHPK  558
            +V +  +   +LHS  + +   +++     +++ L   HP+ + KIG G+    V +HP 
Sbjct  106  TVPLVGFVRMILHSDKYESGDRLSQEHDRTIVDRLLAYHPDFDNKIGCGIDYITVGYHPD  165

Query  559  YK-SRCFFITGEDGSSDDFSFRKCVDNILPLPENMPIKHDTY  681
            +  SRC FI  +DG + DFS+ KC+  +  + +N P+  D++
Sbjct  166  FADSRCLFIVRKDGQAVDFSYWKCLKGL--IKKNYPLYADSF  205



>ref|XP_003573687.1| PREDICTED: protein DCL, chloroplastic-like [Brachypodium distachyon]
Length=185

 Score = 52.8 bits (125),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 27/75 (36%), Positives = 43/75 (57%), Gaps = 3/75 (4%)
 Frame = +1

Query  415  LLHS--WSTNLNVNKYEHLVLLELLNKGHPEPEKKIGKGVGGFQVRFHPKY-KSRCFFIT  585
            +LHS  ++   ++   +  +++E L   HP  E KIG G+    V  HP++ KSRC F+ 
Sbjct  88   ILHSDRYADGESLGPNDEAIIVEKLLTYHPRAEDKIGCGLDAIMVDRHPQFRKSRCLFVV  147

Query  586  GEDGSSDDFSFRKCV  630
              DG   DFS++KC+
Sbjct  148  RTDGVWIDFSYQKCL  162



>ref|WP_011975386.1| hypothetical protein [Sinorhizobium medicae]
 ref|YP_001326903.1| hypothetical protein Smed_1218 [Sinorhizobium medicae WSM419]
 gb|ABR60068.1| conserved hypothetical protein [Sinorhizobium medicae WSM419]
Length=96

 Score = 51.6 bits (122),  Expect = 5e-05, Method: Composition-based stats.
 Identities = 29/92 (32%), Positives = 48/92 (52%), Gaps = 2/92 (2%)
 Frame = +1

Query  355  VTLGPKTFVSSVEMFDYFYKLLHSWSTNLNVNKYEHLVLLELLNKGHPEPEKKIGKGVGG  534
            V +    F    +   +   +L+ +     V+  + + LL+ L K HPE   KIG GV G
Sbjct  7    VEIAGHQFPRKTDALAFLKVMLNRYRPGDIVHAEDEVFLLDAL-KRHPEAAIKIGSGVRG  65

Query  535  FQVRFHPKYKSRCFFITGEDGSSDDFSFRKCV  630
            F+VR    Y ++CF+I   DG+ + FS++ C+
Sbjct  66   FEVR-SADYGTQCFWILRVDGTDERFSYKSCI  96



>ref|XP_008231662.1| PREDICTED: DNA-directed RNA polymerase V subunit 1 [Prunus mume]
Length=1855

 Score = 55.1 bits (131),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 22/51 (43%), Positives = 33/51 (65%), Gaps = 1/51 (2%)
 Frame = +1

Query  493   HPEPEKKIGKGVGGFQVRFHPKYK-SRCFFITGEDGSSDDFSFRKCVDNIL  642
             HP+   K+G G+    V  H  ++ SRCFF+   DG ++DFS+RKC+DN +
Sbjct  1756  HPDKAAKMGCGIDHLTVNRHGSFQDSRCFFVVSTDGRTEDFSYRKCLDNYI  1806



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2108914979916