BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c80839_g1_i1 len=1640 path=[1:0-1639]

Length=1640
                                                                      Score     E

ref|XP_009620725.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    649   0.0      
ref|XP_009794621.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    644   0.0      
emb|CDP20135.1|  unnamed protein product                                610   0.0      
ref|XP_002270329.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    608   0.0      Vitis vinifera
ref|XP_004250074.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    604   0.0      
ref|XP_011077121.1|  PREDICTED: LOW QUALITY PROTEIN: omega-hydrox...    594   0.0      
emb|CAN73821.1|  hypothetical protein VITISV_014805                     587   0.0      Vitis vinifera
ref|XP_006353264.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    588   0.0      
ref|XP_002514787.1|  Anthranilate N-benzoyltransferase protein, p...    587   0.0      Ricinus communis
gb|KDP26918.1|  hypothetical protein JCGZ_18076                         580   0.0      
ref|XP_006425205.1|  hypothetical protein CICLE_v10010861mg             575   0.0      
ref|XP_006480697.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    575   0.0      
gb|KDO45315.1|  hypothetical protein CISIN_1g012689mg                   575   0.0      
ref|XP_007028077.1|  HXXXD-type acyl-transferase family protein         567   0.0      
ref|XP_010673872.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    566   0.0      
ref|XP_004493124.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    562   0.0      
ref|XP_011014891.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    562   0.0      
ref|XP_010038444.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    561   0.0      
ref|XP_002316174.2|  hypothetical protein POPTR_0010s18710g             561   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_007151622.1|  hypothetical protein PHAVU_004G062600g             554   0.0      
gb|KHG26258.1|  Omega-hydroxypalmitate O-feruloyl transferase -li...    552   0.0      
ref|XP_003548796.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    550   0.0      
ref|XP_003548930.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    549   0.0      
ref|XP_003553994.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    548   0.0      
gb|KHN46377.1|  Omega-hydroxypalmitate O-feruloyl transferase           545   0.0      
ref|XP_009361568.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    543   0.0      
ref|XP_008370853.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    541   0.0      
ref|XP_008218487.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    540   0.0      
ref|XP_003519943.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    538   0.0      
ref|XP_004138891.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    538   0.0      
ref|NP_564853.2|  dual transcription unit and alternative splicin...    537   0.0      Arabidopsis thaliana [mouse-ear cress]
gb|KHN46812.1|  Omega-hydroxypalmitate O-feruloyl transferase           535   0.0      
ref|XP_007205121.1|  hypothetical protein PRUPE_ppa004875mg             535   0.0      
ref|XP_002886918.1|  hypothetical protein ARALYDRAFT_315582             533   0.0      
ref|XP_006301983.1|  hypothetical protein CARUB_v10022464mg             531   0.0      
ref|XP_003624566.1|  Anthranilate N-benzoyltransferase protein          528   2e-180   
ref|XP_006391555.1|  hypothetical protein EUTSA_v10018535mg             527   5e-180   
ref|XP_010415082.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    526   7e-180   
gb|KHN13415.1|  Omega-hydroxypalmitate O-feruloyl transferase           526   1e-179   
ref|XP_010556190.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    525   2e-179   
ref|XP_010511440.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    522   3e-178   
ref|XP_010241521.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    523   4e-178   
gb|EYU39480.1|  hypothetical protein MIMGU_mgv1a027110mg                517   7e-177   
ref|XP_010470417.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    519   8e-177   
emb|CDY39285.1|  BnaC06g27060D                                          518   2e-176   
emb|CDY16408.1|  BnaA02g12120D                                          517   5e-176   
ref|XP_009127402.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    516   1e-175   
gb|AHA84252.1|  omega-hydroxypalmitate O-feruloyl transferase           516   2e-175   
ref|XP_010268237.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    515   4e-175   
ref|XP_003624564.1|  Omega-hydroxypalmitate O-feruloyl transferase      487   2e-164   
ref|XP_011075071.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    484   3e-163   
ref|XP_010912121.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    479   4e-161   
gb|EYU17601.1|  hypothetical protein MIMGU_mgv1a006316mg                473   9e-159   
ref|XP_011100415.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    471   4e-158   
gb|EYU34269.1|  hypothetical protein MIMGU_mgv1a006390mg                470   1e-157   
ref|XP_011100416.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    464   2e-155   
gb|EYU39979.1|  hypothetical protein MIMGU_mgv1a005557mg                462   3e-154   
gb|EYU17599.1|  hypothetical protein MIMGU_mgv1a006131mg                461   4e-154   
ref|XP_011078800.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    461   5e-154   
gb|EYU20701.1|  hypothetical protein MIMGU_mgv1a023965mg                460   2e-153   
gb|EYU17598.1|  hypothetical protein MIMGU_mgv1a006131mg                457   1e-152   
ref|XP_010255141.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    447   9e-149   
gb|EYU17594.1|  hypothetical protein MIMGU_mgv1a006220mg                446   2e-148   
ref|XP_006858654.1|  hypothetical protein AMTR_s00066p00062130          432   1e-141   
gb|EYU34268.1|  hypothetical protein MIMGU_mgv1a005307mg                425   1e-139   
emb|CAT00084.1|  hydroxycinnamoyl-CoA shikimate/quinate hydroxyci...    419   3e-139   Coffea arabica [arabica coffee]
gb|EYU34266.1|  hypothetical protein MIMGU_mgv1a023386mg                400   4e-131   
ref|XP_011016099.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    381   2e-125   
gb|EPS57259.1|  hypothetical protein M569_17562                         374   3e-122   
gb|KGN61333.1|  hypothetical protein Csa_2G091770                       371   4e-121   
ref|XP_006858657.1|  hypothetical protein AMTR_s00066p00063330          370   2e-118   
ref|XP_010110380.1|  Omega-hydroxypalmitate O-feruloyl transferase      363   5e-118   
ref|XP_010093570.1|  Omega-hydroxypalmitate O-feruloyl transferase      362   2e-117   
emb|CDY07450.1|  BnaA07g25290D                                          358   2e-116   
ref|XP_007161775.1|  hypothetical protein PHAVU_001G097400g             355   3e-115   
ref|NP_001185319.1|  dual transcription unit and alternative spli...    350   4e-113   
gb|EYU20679.1|  hypothetical protein MIMGU_mgv1a006412mg                352   6e-112   
gb|EYU24129.1|  hypothetical protein MIMGU_mgv1a020263mg                352   7e-112   
ref|XP_008802387.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    343   8e-110   
gb|KHN00653.1|  Omega-hydroxypalmitate O-feruloyl transferase           333   5e-107   
gb|EYU34262.1|  hypothetical protein MIMGU_mgv1a025490mg                320   2e-101   
gb|EYU17596.1|  hypothetical protein MIMGU_mgv1a021071mg                311   9e-97    
gb|ABK24776.1|  unknown                                                 303   1e-92    Picea sitchensis
ref|XP_002992378.1|  BAHD family acyltransferase, clade V               292   2e-88    
ref|XP_002967754.1|  BAHD family acyltransferase, clade V               291   2e-88    
ref|XP_010930413.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    289   2e-87    
ref|XP_011071659.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    284   2e-85    
ref|XP_007035554.1|  BAHD family acyltransferase, clade V, putative     281   2e-84    
ref|XP_008786402.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    280   6e-84    
gb|EYU17590.1|  hypothetical protein MIMGU_mgv1a026424mg                268   1e-81    
gb|ACU13324.1|  unknown                                                 267   2e-81    Glycine max [soybeans]
ref|XP_009415665.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    268   2e-79    
gb|ACU13347.1|  unknown                                                 257   4e-78    Glycine max [soybeans]
ref|XP_010248037.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    264   6e-78    
gb|EYU45561.1|  hypothetical protein MIMGU_mgv1a005829mg                263   2e-77    
ref|XP_001752413.1|  predicted protein                                  253   4e-74    
ref|XP_010666009.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    253   6e-74    
ref|XP_010259678.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    249   3e-72    
ref|XP_007140651.1|  hypothetical protein PHAVU_008G130300g             248   5e-72    
gb|KDP26368.1|  hypothetical protein JCGZ_17526                         245   9e-71    
ref|XP_004491723.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    244   2e-70    
gb|ABR16192.1|  unknown                                                 243   4e-70    Picea sitchensis
gb|KEH22614.1|  HXXXD-type acyl-transferase family protein              239   1e-68    
ref|XP_003551391.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    239   1e-68    
emb|CBI33005.3|  unnamed protein product                                236   3e-67    
gb|KHN41391.1|  Omega-hydroxypalmitate O-feruloyl transferase           235   5e-67    
gb|ADL62856.1|  acyltransferase                                         234   1e-66    
gb|AAT72495.1|  AT1G65450                                               224   3e-66    Arabidopsis lyrata subsp. petraea
ref|XP_004511192.1|  PREDICTED: pentatricopeptide repeat-containi...    242   4e-66    
ref|XP_001755199.1|  predicted protein                                  232   7e-66    
emb|CAN63569.1|  hypothetical protein VITISV_043430                     228   6e-65    Vitis vinifera
ref|XP_007031933.1|  HXXXD-type acyl-transferase family protein         229   3e-64    
ref|XP_010652628.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    226   9e-64    
ref|XP_002303052.1|  hypothetical protein POPTR_0002s24610g             226   1e-63    Populus trichocarpa [western balsam poplar]
ref|XP_011045747.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    226   2e-63    
gb|KDO64448.1|  hypothetical protein CISIN_1g013997mg                   225   2e-63    
ref|XP_011073101.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    224   3e-63    
ref|XP_003549071.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    224   5e-63    
gb|AGJ03151.1|  hydroxycinnamoyltransferase                             224   6e-63    
ref|XP_006436888.1|  hypothetical protein CICLE_v10031592mg             224   7e-63    
ref|XP_002298644.2|  hypothetical protein POPTR_0001s33390g             224   8e-63    Populus trichocarpa [western balsam poplar]
ref|XP_003553956.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    223   9e-63    
ref|XP_011073100.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    224   1e-62    
ref|XP_011024641.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    223   2e-62    
ref|XP_009378002.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    223   2e-62    
emb|CAT00082.1|  hydroxycinnamoyl-CoA shikimate/quinate hydroxyci...    222   3e-62    Coffea arabica [arabica coffee]
ref|XP_009381343.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    222   3e-62    
ref|XP_004134484.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    222   5e-62    
ref|XP_004169053.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    222   6e-62    
ref|XP_002970966.1|  BAHD family acyltransferase, clade V               221   7e-62    
emb|CDO98678.1|  unnamed protein product                                221   9e-62    
ref|XP_002962120.1|  BAHD family acyltransferase, clade V               220   2e-61    
ref|XP_004503772.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    220   2e-61    
gb|ADD62404.1|  fatty omega-hydroxyacid/fatty alcohol 0-hydroxyci...    219   2e-61    
ref|XP_003634222.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    219   2e-61    
ref|XP_008804093.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    219   3e-61    
ref|XP_008778437.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    219   3e-61    
ref|XP_009344220.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    219   4e-61    
ref|XP_007038058.1|  HXXXD-type acyl-transferase family protein i...    219   4e-61    
ref|XP_010086996.1|  Omega-hydroxypalmitate O-feruloyl transferase      218   6e-61    
ref|XP_007161685.1|  hypothetical protein PHAVU_001G089700g             218   1e-60    
ref|XP_006347627.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    217   1e-60    
ref|XP_008438874.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    218   2e-60    
ref|XP_010250620.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    217   2e-60    
ref|XP_002992754.1|  BAHD family acyltransferase, clade V               218   2e-60    
ref|XP_007200675.1|  hypothetical protein PRUPE_ppa015918mg             217   3e-60    
ref|XP_008464403.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    216   3e-60    
ref|XP_007038057.1|  HXXXD-type acyl-transferase family protein, ...    219   4e-60    
ref|XP_007215405.1|  hypothetical protein PRUPE_ppa005943mg             216   4e-60    
ref|XP_010249109.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    216   5e-60    
ref|NP_001275190.1|  feruloyl transferase                               216   6e-60    
ref|XP_004138033.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    215   8e-60    
dbj|BAJ89613.1|  predicted protein                                      216   8e-60    
ref|XP_009600109.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    215   9e-60    
ref|XP_004235315.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    215   1e-59    
ref|XP_002962552.1|  BAHD family acyltransferase, clade V               215   1e-59    
ref|XP_002512898.1|  Anthranilate N-benzoyltransferase protein, p...    215   1e-59    Ricinus communis
gb|KDO63871.1|  hypothetical protein CISIN_1g014029mg                   215   1e-59    
gb|ACN28372.1|  unknown                                                 215   1e-59    Zea mays [maize]
gb|KDP41799.1|  hypothetical protein JCGZ_26817                         214   2e-59    
ref|XP_006447016.1|  hypothetical protein CICLE_v10015302mg             214   3e-59    
ref|XP_006470104.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    214   3e-59    
ref|XP_009383405.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    214   4e-59    
ref|XP_008231077.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    214   4e-59    
ref|XP_009770247.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    213   5e-59    
ref|XP_004304536.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    213   6e-59    
ref|XP_002982104.1|  BAHD family acyltransferase, clade V               215   6e-59    
ref|XP_002511135.1|  Taxadien-5-alpha-ol O-acetyltransferase, put...    213   6e-59    Ricinus communis
ref|XP_004304535.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    213   7e-59    
ref|XP_010929588.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    213   8e-59    
ref|XP_001772486.1|  predicted protein                                  213   8e-59    
ref|XP_010926850.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    214   1e-58    
ref|XP_002992205.1|  BAHD family acyltransferase, clade V               214   1e-58    
ref|XP_008341279.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    212   1e-58    
gb|EYU23064.1|  hypothetical protein MIMGU_mgv1a006699mg                212   1e-58    
ref|XP_004516455.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    212   2e-58    
ref|XP_008791113.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    211   2e-58    
ref|XP_004979328.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    211   4e-58    
ref|XP_003525421.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    211   4e-58    
ref|XP_008239515.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    211   4e-58    
ref|XP_003580168.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    210   1e-57    
ref|XP_008379094.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    210   1e-57    
ref|XP_007209159.1|  hypothetical protein PRUPE_ppa006018mg             209   1e-57    
gb|KCW60630.1|  hypothetical protein EUGRSUZ_H03354                     209   2e-57    
ref|XP_002991188.1|  BAHD family acyltransferase, clade V               210   2e-57    
ref|XP_003532502.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    209   2e-57    
gb|KDP22581.1|  hypothetical protein JCGZ_26412                         209   2e-57    
gb|KHN28276.1|  Omega-hydroxypalmitate O-feruloyl transferase           207   2e-57    
gb|KDP32472.1|  hypothetical protein JCGZ_13397                         209   2e-57    
ref|XP_006844599.1|  hypothetical protein AMTR_s00016p00213830          209   2e-57    
ref|XP_010024179.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    209   2e-57    
ref|XP_009379971.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    209   3e-57    
gb|EPS64002.1|  hypothetical protein M569_10778                         208   4e-57    
ref|XP_002321725.2|  hypothetical protein POPTR_0015s11290g             207   8e-57    Populus trichocarpa [western balsam poplar]
gb|ADL37203.1|  At1g65450-like protein                                  199   8e-57    
gb|ACY79409.1|  omega-hydroxyacid hydroxycinnamoyltransferase           207   9e-57    
ref|XP_009346788.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    207   1e-56    
gb|EYU31840.1|  hypothetical protein MIMGU_mgv1a019044mg                207   1e-56    
ref|XP_011023948.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    206   2e-56    
ref|XP_002973250.1|  BAHD family acyltransferase, clade V               206   2e-56    
ref|XP_009375174.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    206   2e-56    
ref|XP_002991251.1|  BAHD family acyltransferase, clade V               207   3e-56    
gb|ADL37205.1|  At1g65450-like protein                                  197   3e-56    
gb|ADL37207.1|  At1g65450-like protein                                  197   3e-56    
ref|XP_002993631.1|  BAHD family acyltransferase, clade V               206   4e-56    
gb|ACN57286.1|  At1g65450-like protein                                  197   4e-56    Capsella rubella
gb|KEH21000.1|  omega-hydroxypalmitate O-feruloyl transferase           206   4e-56    
gb|ABA93921.1|  transferase family protein, putative, expressed         206   4e-56    Oryza sativa Japonica Group [Japonica rice]
gb|ADL37208.1|  At1g65450-like protein                                  197   4e-56    
ref|NP_001067952.2|  Os11g0507200                                       206   5e-56    Oryza sativa Japonica Group [Japonica rice]
gb|ADL37212.1|  At1g65450-like protein                                  197   5e-56    
gb|KHG11495.1|  Omega-hydroxypalmitate O-feruloyl transferase -li...    205   5e-56    
gb|ACN57299.1|  At1g65450-like protein                                  196   6e-56    Capsella grandiflora
gb|ADL37221.1|  At1g65450-like protein                                  196   6e-56    
gb|ACN57300.1|  At1g65450-like protein                                  196   7e-56    Capsella grandiflora
gb|ADL37204.1|  At1g65450-like protein                                  196   8e-56    
ref|XP_006373237.1|  hypothetical protein POPTR_0017s09970g             203   1e-55    
gb|ADL37211.1|  At1g65450-like protein                                  195   2e-55    
gb|ADL37213.1|  At1g65450-like protein                                  195   2e-55    
ref|XP_009125170.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    204   2e-55    
gb|ADL37209.1|  At1g65450-like protein                                  195   3e-55    
ref|XP_002969985.1|  BAHD family acyltransferase, clade V               204   3e-55    
ref|XP_010554116.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    203   3e-55    
ref|XP_006662951.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    203   4e-55    
gb|EMS51970.1|  Omega-hydroxypalmitate O-feruloyl transferase           203   4e-55    
gb|ACN57301.1|  At1g65450-like protein                                  194   4e-55    Capsella grandiflora
gb|ACN57306.1|  At1g65450-like protein                                  194   5e-55    Capsella grandiflora
gb|ACN57307.1|  At1g65450-like protein                                  194   5e-55    Capsella grandiflora
ref|NP_001150426.1|  transferase                                        202   6e-55    Zea mays [maize]
emb|CDY68497.1|  BnaCnng59260D                                          202   9e-55    
ref|XP_003602785.1|  Hydroxycinnamoyl CoA shikimate/quinate hydro...    202   9e-55    
emb|CDX67482.1|  BnaA07g15220D                                          202   1e-54    
ref|XP_002981455.1|  BAHD family acyltransferase, clade V               202   1e-54    
ref|XP_008235736.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    202   2e-54    
gb|KFK33037.1|  hypothetical protein AALP_AA6G322400                    202   2e-54    
emb|CDY11732.1|  BnaC06g13400D                                          201   2e-54    
gb|ADL37307.1|  At1g65450-like protein                                  192   2e-54    
ref|XP_009140062.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    201   2e-54    
gb|EYU24113.1|  hypothetical protein MIMGU_mgv1a019465mg                193   2e-54    
ref|XP_003522443.2|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    201   2e-54    
ref|XP_008672444.1|  PREDICTED: uncharacterized protein LOC100273...    201   3e-54    
ref|XP_010436043.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    202   3e-54    
dbj|BAJ90980.1|  predicted protein                                      201   3e-54    
gb|EAY81037.1|  hypothetical protein OsI_36216                          201   4e-54    Oryza sativa Indica Group [Indian rice]
ref|XP_002870657.1|  transferase family protein                         200   4e-54    
gb|EMT29891.1|  Taxadien-5-alpha-ol O-acetyltransferase                 200   5e-54    
gb|KEH21938.1|  omega-hydroxypalmitate O-feruloyl transferase           200   5e-54    
ref|XP_007216058.1|  hypothetical protein PRUPE_ppa017691mg             200   5e-54    
ref|XP_009405177.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    200   7e-54    
ref|NP_001141054.1|  uncharacterized protein LOC100273135               199   7e-54    Zea mays [maize]
ref|XP_010528158.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    199   1e-53    
ref|XP_010528157.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    199   1e-53    
ref|NP_568587.2|  omega-hydroxypalmitate O-feruloyl transferase         199   1e-53    Arabidopsis thaliana [mouse-ear cress]
emb|CDY48963.1|  BnaA04g10770D                                          199   1e-53    
ref|XP_008228829.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    199   1e-53    
ref|XP_010441266.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    200   2e-53    
ref|XP_010112404.1|  Omega-hydroxypalmitate O-feruloyl transferase      200   2e-53    
ref|NP_851111.1|  omega-hydroxypalmitate O-feruloyl transferase         199   2e-53    Arabidopsis thaliana [mouse-ear cress]
ref|XP_006283644.1|  hypothetical protein CARUB_v10004701mg             199   2e-53    
ref|XP_010244666.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    198   2e-53    
gb|ABR16860.1|  unknown                                                 198   3e-53    Picea sitchensis
ref|XP_008374212.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    197   3e-53    
ref|XP_006405403.1|  hypothetical protein EUTSA_v10027756mg             198   3e-53    
ref|XP_006581855.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    197   3e-53    
gb|ADL37215.1|  At1g65450-like protein                                  189   4e-53    
gb|ACN57305.1|  At1g65450-like protein                                  189   4e-53    Capsella grandiflora
ref|XP_010550744.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    198   4e-53    
gb|ACN57304.1|  At1g65450-like protein                                  189   4e-53    Capsella grandiflora
ref|XP_010679985.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    197   5e-53    
ref|XP_003528100.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    197   5e-53    
gb|ACN57302.1|  At1g65450-like protein                                  189   6e-53    Capsella grandiflora
ref|XP_010026248.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    196   8e-53    
ref|XP_010450574.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    197   1e-52    
gb|KHN32561.1|  Omega-hydroxypalmitate O-feruloyl transferase           197   1e-52    
ref|XP_004297519.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    196   1e-52    
dbj|BAJ14794.1|  hydroxycinnamoyl-CoA shikimate/quinate hydroxyci...    195   3e-52    
ref|XP_007137866.1|  hypothetical protein PHAVU_009G162300g             195   3e-52    
ref|XP_002521072.1|  Anthranilate N-benzoyltransferase protein, p...    195   4e-52    Ricinus communis
ref|XP_002988757.1|  BAHD family acyltransferase, clade V               194   5e-52    
ref|XP_002986294.1|  BAHD family acyltransferase, clade V               194   7e-52    
gb|ACB41560.1|  At1g65450-like protein                                  184   2e-51    
gb|ACB41562.1|  At1g65450-like protein                                  184   3e-51    
ref|XP_011082506.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    192   3e-51    
ref|NP_001289240.1|  shikimate O-hydroxycinnamoyltransferase-like       192   3e-51    
gb|ACB41561.1|  At1g65450-like protein                                  183   4e-51    
gb|ACB41559.1|  At1g65450-like protein                                  183   5e-51    
ref|XP_009150410.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    191   5e-51    
emb|CDG56249.1|  hydroxycinnamoyl-CoA:shikimate hydroxycinnamoylt...    191   5e-51    
emb|CDY62885.1|  BnaC03g74670D                                          190   1e-50    
ref|XP_010063583.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    191   1e-50    
gb|ADG46003.1|  hydroxycinnamoyl transferase                            190   1e-50    
ref|XP_002966887.1|  BAHD family acyltransferase, clade V               190   1e-50    
gb|ACI16630.1|  shikimate O-hydroxycinnamoyltransferase                 190   2e-50    
ref|XP_002961124.1|  BAHD family acyltransferase, clade V               190   2e-50    
gb|ACA64049.1|  hydroxycinnamoyl-CoA shikimate/quinate hydroxycin...    190   2e-50    
emb|CAJ40778.1|  hydroxycinnamoyl transferase                           190   2e-50    
emb|CDY41518.1|  BnaA06g22710D                                          189   2e-50    
ref|XP_004507045.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    190   2e-50    
gb|KDP41953.1|  hypothetical protein JCGZ_26971                         190   2e-50    
ref|XP_004507046.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    189   3e-50    
gb|AAZ80046.1|  hydroxycinnamoyl-CoA:quinate hydroxycinnamoyltran...    189   3e-50    
emb|CDG56248.1|  hydroxycinnamoyl-CoA:shikimate hydroxycinnamoylt...    189   3e-50    
ref|XP_008342823.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    189   4e-50    
emb|CDO98242.1|  unnamed protein product                                189   4e-50    
ref|XP_004971119.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    189   4e-50    
ref|XP_009615699.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    189   4e-50    
ref|XP_008777439.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    189   4e-50    
emb|CBI83579.1|  hydroxycinnamoyl transferase                           189   4e-50    
gb|ACI28534.1|  shikimate O-hydroxycinnamoyl transferase                189   4e-50    
gb|KCW53914.1|  hypothetical protein EUGRSUZ_J03126                     191   4e-50    
ref|XP_010034043.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    190   5e-50    
gb|ABO47805.1|  hydroxycinnamoyl-CoA shikimate/quinate hydroxycin...    189   5e-50    
pdb|4G0B|A  Chain A, Structure Of Native Hct From Coffea Canephora      189   5e-50    
ref|XP_010678277.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    189   5e-50    
ref|XP_009409797.1|  PREDICTED: uncharacterized protein LOC103991972    195   6e-50    
emb|CDY08092.1|  BnaA06g16340D                                          189   6e-50    
gb|ABO40491.1|  hydroxycinnamoyl-CoA shikimate/quinate hydroxycin...    189   6e-50    
ref|XP_009149801.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    188   7e-50    
ref|XP_010252750.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    188   1e-49    
gb|KFK34173.1|  hypothetical protein AALP_AA5G109900                    187   1e-49    
ref|XP_011010199.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    188   1e-49    
ref|XP_007011895.1|  Hydroxycinnamoyl CoA shikimate/quinate hydro...    188   2e-49    
ref|XP_010094061.1|  Hydroxycinnamoyl-Coenzyme A shikimate/quinat...    188   2e-49    
dbj|BAJ89730.1|  predicted protein                                      187   2e-49    
pdb|4G2M|A  Chain A, Structure Of A Lys-Hct Mutant From Coffea Ca...    187   2e-49    
gb|ABO77955.1|  hydroxycinnamoyl-CoA shikimate/quinate hydroxycin...    187   2e-49    
ref|XP_002962972.1|  BAHD family acyltransferase, clade V               187   2e-49    
gb|KHG19404.1|  Hydroxycinnamoyl-Coenzyme A shikimate/quinate hyd...    187   2e-49    
ref|XP_010063586.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    187   2e-49    
gb|KHN17483.1|  Omega-hydroxypalmitate O-feruloyl transferase           185   2e-49    
gb|ACB41564.1|  At1g65450-like protein                                  178   3e-49    
gb|AEK80405.1|  HQT                                                     187   3e-49    
dbj|BAJ91746.1|  predicted protein                                      187   3e-49    
ref|XP_008228811.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    187   3e-49    
emb|CDY05866.1|  BnaC08g20430D                                          186   4e-49    
dbj|BAF49305.1|  putative acyltransferase                               186   4e-49    
ref|XP_007215401.1|  hypothetical protein PRUPE_ppa005910mg             186   4e-49    
gb|AEM63675.1|  hydroxycinnamoyl CoA shikimate/quinate hydroxycin...    186   4e-49    
ref|XP_007150819.1|  hypothetical protein PHAVU_005G183200g             187   4e-49    
ref|XP_004964655.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    187   4e-49    
dbj|BAD88037.1|  putative hydroxyanthranilate hydroxycinnamoyltra...    186   5e-49    
gb|AFL93686.1|  hydroxycinnamoyl-CoA shikimate/quinate hydroxycin...    186   6e-49    
ref|XP_004303231.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    186   6e-49    
ref|XP_004235891.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    186   7e-49    
gb|AGA20364.1|  hydroxycinnamoyl CoA shikimate/quinate hydroxycin...    186   9e-49    
ref|XP_003543709.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    186   9e-49    
ref|XP_010023900.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    185   1e-48    
ref|XP_006341413.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    185   1e-48    
ref|XP_010110379.1|  Omega-hydroxypalmitate O-feruloyl transferase      177   1e-48    
gb|ACZ52698.1|  hydroxycinnamoyl-CoA quinate hydroxycinnamoyltran...    185   1e-48    
gb|AFN85668.1|  putative hydroxycinnamoyl CoA shikimate/quinate h...    185   1e-48    
gb|AAM62785.1|  acyltransferase-like protein                            185   1e-48    
gb|AFF57839.1|  hydroxycinnamoyl-coenzyme A shikimate/quinate hyd...    185   1e-48    
gb|AIG20957.1|  hydroxycinnamoyl-CoA shikimate/quinate hydroxycin...    185   1e-48    
ref|XP_008353756.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    185   1e-48    
ref|XP_010500346.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    186   1e-48    
ref|NP_201161.1|  HXXXD-type acyl-transferase-like protein              184   2e-48    
ref|XP_009354208.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    185   2e-48    
ref|XP_010063590.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    185   2e-48    
ref|XP_004158793.1|  PREDICTED: LOW QUALITY PROTEIN: shikimate O-...    184   2e-48    
gb|EMT14263.1|  Taxadien-5-alpha-ol O-acetyltransferase                 184   2e-48    
gb|ADB44897.1|  hydroxycinnamoyl transferase                            184   2e-48    
ref|XP_007023475.1|  Hydroxycinnamoyl-CoA shikimate/quinate hydro...    184   2e-48    
ref|XP_010023898.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    185   2e-48    
gb|KHN31873.1|  Hydroxycinnamoyl-Coenzyme A shikimate/quinate hyd...    184   2e-48    
ref|XP_002512739.1|  Anthranilate N-benzoyltransferase protein, p...    184   3e-48    
ref|XP_010479239.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    184   3e-48    
emb|CAN61656.1|  hypothetical protein VITISV_017126                     184   4e-48    
ref|XP_002864855.1|  transferase family protein                         183   4e-48    
gb|AFS68800.1|  hydroxycinnamoyl transferase                            183   4e-48    
gb|KFK22279.1|  hypothetical protein AALP_AAs48576U000100               175   4e-48    
ref|XP_010026821.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    184   5e-48    
ref|XP_010023888.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    183   5e-48    
gb|ACB41569.1|  At1g65450-like protein                                  174   6e-48    
ref|XP_004135880.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    183   6e-48    
pdb|4G22|A  Chain A, Structure Of A Lys-Hct Mutant From Coffea Ca...    183   6e-48    
ref|XP_002268922.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    183   6e-48    
gb|AHG97388.1|  putative hydroxycinnamoyl CoA shikimate/quinate h...    184   9e-48    
gb|ACF17657.1|  putative hydroxycinnamoyl transferase                   182   9e-48    
gb|AHA14500.1|  hydroxycinnamoyl-coenzyme A quinate transperase         182   9e-48    
ref|XP_009614241.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    182   9e-48    
ref|XP_010023884.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    182   1e-47    
gb|KEH28560.1|  shikimate/quinate hydroxycinnamoyltransferase           182   1e-47    
gb|AEJ88365.1|  hydroxycinnamoyltransferase                             182   1e-47    
ref|XP_010479240.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    182   1e-47    
ref|XP_007215406.1|  hypothetical protein PRUPE_ppa005955mg             182   2e-47    
ref|XP_008228810.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    182   2e-47    
ref|NP_001062400.1|  Os08g0543400                                       182   2e-47    
ref|XP_008223321.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    182   2e-47    
ref|XP_010063596.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    182   2e-47    
ref|XP_007215395.1|  hypothetical protein PRUPE_ppa005872mg             182   2e-47    
ref|XP_010031392.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    182   2e-47    
emb|CDY05770.1|  BnaC07g00330D                                          181   2e-47    
ref|XP_008228828.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    182   2e-47    
ref|XP_011073311.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    181   2e-47    
ref|XP_002875921.1|  transferase family protein                         181   2e-47    
gb|KFK28037.1|  hypothetical protein AALP_AA8G463700                    181   2e-47    
gb|KHN04193.1|  Hydroxycinnamoyl-Coenzyme A shikimate/quinate hyd...    181   2e-47    
dbj|BAK06725.1|  predicted protein                                      181   3e-47    
ref|XP_007161776.1|  hypothetical protein PHAVU_001G097500g             174   3e-47    
ref|XP_007216677.1|  hypothetical protein PRUPE_ppa1027182mg            181   4e-47    
ref|XP_002452435.1|  hypothetical protein SORBIDRAFT_04g025760          181   4e-47    
ref|XP_007215396.1|  hypothetical protein PRUPE_ppa005873mg             181   5e-47    
ref|XP_011069456.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    172   5e-47    
ref|NP_001280198.1|  shikimate O-hydroxycinnamoyltransferase-like       181   6e-47    
ref|XP_002894568.1|  transferase family protein                         180   6e-47    
ref|XP_010110923.1|  Omega-hydroxypalmitate O-feruloyl transferase      179   7e-47    
gb|AFZ78609.1|  hydroxycinnamoyl-CoA:shikimate/quinate hydroxycin...    180   7e-47    
dbj|BAF49306.1|  putative acyltransferase                               180   7e-47    
ref|XP_006307576.1|  hypothetical protein CARUB_v10009198mg             180   8e-47    
ref|XP_006856294.1|  hypothetical protein AMTR_s00047p00102350          180   9e-47    
gb|AGV54440.1|  shikimate O-hydroxycinnamoyltransferase                 180   9e-47    
ref|XP_009396442.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    180   9e-47    
ref|XP_010460517.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    180   9e-47    
ref|XP_002300751.1|  transferase family protein                         180   9e-47    
ref|XP_007135841.1|  hypothetical protein PHAVU_010G162700g             179   1e-46    
ref|XP_006303737.1|  hypothetical protein CARUB_v10011876mg             179   1e-46    
ref|XP_002277474.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    179   1e-46    
ref|XP_002991534.1|  probable hydroxycinnamoyl transferase              180   1e-46    
ref|XP_010501253.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    179   1e-46    
ref|XP_010462493.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    179   1e-46    
ref|XP_002268988.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    179   1e-46    
gb|EAZ07852.1|  hypothetical protein OsI_30111                          179   1e-46    
ref|XP_010479238.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    179   1e-46    
emb|CDG56253.1|  hydroxycinnamoyltransferase 2                          179   2e-46    
emb|CDY31956.1|  BnaA07g00390D                                          179   2e-46    
ref|NP_001185318.1|  dual transcription unit and alternative spli...    171   2e-46    
emb|CAN82918.1|  hypothetical protein VITISV_023290                     179   2e-46    
ref|XP_009798536.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    179   2e-46    
ref|XP_009102018.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    179   2e-46    
ref|XP_010480194.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    179   2e-46    
ref|XP_008381122.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    179   2e-46    
gb|EEC72066.1|  hypothetical protein OsI_04996                          179   3e-46    
ref|XP_007033659.1|  Hydroxycinnamoyl CoA shikimate/quinate hydro...    178   3e-46    
gb|ABO52899.1|  hydroxycinnamoyl-CoA:shikimate hydroxycinnamoyltr...    178   3e-46    
ref|XP_010023896.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    177   3e-46    
ref|XP_010023890.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    178   3e-46    
ref|XP_006368492.1|  transferase family protein                         178   4e-46    
gb|ABR17170.1|  unknown                                                 178   4e-46    
ref|XP_011092043.1|  PREDICTED: spermidine hydroxycinnamoyl trans...    179   4e-46    
ref|XP_007042945.1|  HXXXD-type acyl-transferase family protein, ...    178   4e-46    
ref|XP_009409799.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    178   5e-46    
gb|AAQ62868.1|  At3g48720                                               177   5e-46    
ref|XP_010478102.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    178   6e-46    
ref|XP_003578136.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    177   6e-46    
ref|XP_010031397.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    177   6e-46    
ref|XP_010113235.1|  Hydroxycinnamoyl-Coenzyme A shikimate/quinat...    177   7e-46    
ref|XP_010031398.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    177   7e-46    
ref|XP_007214866.1|  hypothetical protein PRUPE_ppa019948mg             178   7e-46    
ref|XP_003560989.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    177   7e-46    
ref|NP_190441.1|  HXXXD-type acyl-transferase family protein            177   7e-46    
ref|XP_002979061.1|  probable hydroxycinnamoyltransferase               177   9e-46    
ref|XP_008237042.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    177   1e-45    
ref|XP_006392548.1|  hypothetical protein EUTSA_v10011497mg             177   1e-45    
ref|XP_002457339.1|  hypothetical protein SORBIDRAFT_03g005840          177   1e-45    
ref|XP_011011266.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    177   1e-45    
ref|XP_009375480.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    177   1e-45    
ref|XP_006583082.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    177   1e-45    
ref|XP_002454696.1|  hypothetical protein SORBIDRAFT_04g035780          177   1e-45    
ref|XP_010023895.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    176   2e-45    
gb|KFK35521.1|  hypothetical protein AALP_AA4G001700                    176   2e-45    
gb|AGM90558.1|  hydroxycinnamoyl-CoA shikimate/quinate hydroxycin...    176   2e-45    
gb|EMT23329.1|  Taxadien-5-alpha-ol O-acetyltransferase                 176   2e-45    
ref|XP_009365251.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    176   2e-45    
emb|CCC55431.1|  hydroxycinnamoyl CoA shikimate/quinate hydroxyci...    176   2e-45    
ref|XP_010499244.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    176   2e-45    
ref|NP_199704.1|  hydroxycinnamoyl-CoA shikimate/quinate hydroxyc...    176   2e-45    
gb|AAM61215.1|  anthranilate N-benzoyltransferase                       176   2e-45    
ref|XP_006583083.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    177   2e-45    
ref|XP_009789449.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    176   2e-45    
ref|XP_003530223.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    176   3e-45    
ref|XP_008779984.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...    176   3e-45    
gb|EYU21745.1|  hypothetical protein MIMGU_mgv1a006579mg                176   3e-45    
ref|XP_006493385.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    176   3e-45    
ref|XP_009626781.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    175   4e-45    
ref|XP_009626780.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    176   4e-45    
ref|XP_002320517.1|  hypothetical protein POPTR_0014s16460g             176   4e-45    
ref|XP_006304467.1|  hypothetical protein CARUB_v10011142mg             176   4e-45    
ref|XP_010031389.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    175   4e-45    
ref|XP_010265527.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    175   4e-45    
gb|ACG29714.1|  anthranilate N-benzoyltransferase protein 1             175   5e-45    
ref|XP_004956853.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    175   5e-45    
gb|ABK79689.1|  hydroxycinnamoyl-CoA:quinate hydroxycinnamoyltran...    175   6e-45    
gb|AEM63676.1|  hydroxycinnamoyl CoA quinate hydroxycinnamoyl tra...    175   7e-45    
ref|XP_010942060.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    174   7e-45    
ref|NP_174083.1|  HXXXD-type acyl-transferase-like protein              174   8e-45    
gb|AAM65707.1|  unknown                                                 166   8e-45    
ref|XP_009760608.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    174   9e-45    
ref|XP_010023889.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    174   9e-45    
ref|XP_004293649.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    174   9e-45    
ref|NP_001132890.1|  LOC100194386                                       174   1e-44    
ref|XP_010244683.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    174   1e-44    
ref|XP_002462397.1|  hypothetical protein SORBIDRAFT_02g024990          174   1e-44    
gb|KHG20214.1|  Hydroxycinnamoyl-Coenzyme A shikimate/quinate hyd...    174   1e-44    
ref|XP_009113746.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    174   1e-44    
gb|EPS61293.1|  hypothetical protein M569_13504                         173   1e-44    
dbj|BAC78634.1|  hydroxyanthranilate hydroxycinnamoyltransferase 2      174   1e-44    
ref|XP_004953073.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    175   2e-44    
dbj|BAC78633.1|  hydroxyanthranilate hydroxycinnamoyltransferase 1      174   2e-44    
ref|XP_002890739.1|  transferase family protein                         173   2e-44    



>ref|XP_009620725.1| PREDICTED: omega-hydroxypalmitate O-feruloyl transferase [Nicotiana 
tomentosiformis]
Length=456

 Score =   649 bits (1674),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 311/457 (68%), Positives = 374/457 (82%), Gaps = 5/457 (1%)
 Frame = -3

Query  1548  MGALYLKPETLHEDLKVTILDSGLIFPSQETTKHTMFLSNIDKVLNFDVQTVHFFPASPG  1369
             MG LY   E+  ++LKVTI D+ L+FPS+ET K  MFLSNID+VLNFDVQT+HFFPA+  
Sbjct  1     MGTLYQPHESTIQELKVTIQDTSLVFPSEETQKKPMFLSNIDQVLNFDVQTLHFFPANSE  60

Query  1368  FPPEIVAGKIKNAFRRLLVANTYDFLAGRLKKNKESERVEIECNAAGAGFTVASSEFALE  1189
             FPPEIV  K++NA  ++LV   YDFLAGRLK N +  R+EI+CNA GA F VASSE  L+
Sbjct  61    FPPEIVKEKLRNALSKVLVP--YDFLAGRLKMNHQIGRLEIDCNAEGAVFVVASSELTLK  118

Query  1188  DIGDLVYPNPAFRQLVTMSFDFVAKEDQPLCFLQVTSFKCGGFALGTSMNHISFDGSGFK  1009
             +IGDLVYPNP FRQL+T S D + K+D+PLC +QVTSFKCGGFA+GTS NHI+FDG+ +K
Sbjct  119   EIGDLVYPNPGFRQLITQSIDLLEKDDKPLCIIQVTSFKCGGFAMGTSTNHITFDGTSYK  178

Query  1008  MFLENLAALSFNDDGPLAVVPCNDRSLLAARSPPQVTFPHPELLKVNLPAGEEMAPPVFD  829
             +FL+NLA+ +F DD PLA+VPCNDRSLLAARSPP+V FPHPELLK+ +P GEE+ P VF+
Sbjct  179   IFLQNLASQAFGDDKPLAIVPCNDRSLLAARSPPRVDFPHPELLKLEVPIGEELNPTVFE  238

Query  828   SLKDDLAFEIFQLSSADIERLKDKAKAPDNVKTKVTGFNVLTAAIWRCKALSCLGGENNS  649
             +L+++L F+IF+L+S+DI  LKDKAK  +    KVT FNV+TA +W+CKALS    ENNS
Sbjct  239   TLEEELVFKIFKLNSSDISSLKDKAKDENAPHAKVTSFNVVTAYVWKCKALS-FDVENNS  297

Query  648   DRLSTVLFAVDIRRRLNPPLPDSYSGNAVLTGYGSAKCAELEEGPFWKTVQMVYEGAARM  469
             +R+STVLFAVDIR RLNPPLP SY+GNAVLT Y SA C ELEE PF K V MV +GA RM
Sbjct  298   ERISTVLFAVDIRPRLNPPLPKSYTGNAVLTSYASATCHELEEWPFCKIVAMVSKGAMRM  357

Query  468   TDEYARSAIDWGELYKGFPHGEFLVSSWWRLGFEGVQFPWGKPKYSCPVVYHRKDIILLF  289
             TDEYARSAIDWGE YKGFP+GEFL+SSWWRLGF  V++PWGKPKYSCPVV HRKDIILLF
Sbjct  358   TDEYARSAIDWGEFYKGFPNGEFLISSWWRLGFSEVEYPWGKPKYSCPVVSHRKDIILLF  417

Query  288   PDIDNG--GKSNSGVNVLVALPPKEMEKFKSLFHKFL  184
             P+ID+G    SN GVN+LVALP K+MEKF+S F+KFL
Sbjct  418   PNIDDGITSSSNDGVNILVALPIKQMEKFESYFNKFL  454



>ref|XP_009794621.1| PREDICTED: omega-hydroxypalmitate O-feruloyl transferase [Nicotiana 
sylvestris]
Length=455

 Score =   644 bits (1662),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 309/456 (68%), Positives = 372/456 (82%), Gaps = 4/456 (1%)
 Frame = -3

Query  1548  MGALYLKPETLHEDLKVTILDSGLIFPSQETTKHTMFLSNIDKVLNFDVQTVHFFPASPG  1369
             MG LY   E+  ++LKVTI D+ L+FPS++T K  MFLSNID+VLNFDVQT+HFFPA+  
Sbjct  1     MGTLYQPLESTIQELKVTIQDTSLVFPSEKTQKKPMFLSNIDQVLNFDVQTLHFFPANSE  60

Query  1368  FPPEIVAGKIKNAFRRLLVANTYDFLAGRLKKNKESERVEIECNAAGAGFTVASSEFALE  1189
             FPPEIV  K++NA  ++LV   YDFLAGRLK N +  R+EI+CNA GA F VASSE  L+
Sbjct  61    FPPEIVTEKLRNALSKVLVP--YDFLAGRLKMNHQIGRLEIDCNAEGAVFVVASSELTLK  118

Query  1188  DIGDLVYPNPAFRQLVTMSFDFVAKEDQPLCFLQVTSFKCGGFALGTSMNHISFDGSGFK  1009
             +IGDLVYPNP F+QLVT S D + K+D+PLC +QVTSFKCGGFA+GTS NHI+FDG+ +K
Sbjct  119   EIGDLVYPNPGFKQLVTQSIDHLEKDDKPLCIIQVTSFKCGGFAMGTSTNHITFDGTSYK  178

Query  1008  MFLENLAALSFNDDGPLAVVPCNDRSLLAARSPPQVTFPHPELLKVNLPAGEEMAPPVFD  829
             +FL+NLA+ +F DD PLA+VPCNDRSLLAARSPP+V FPHPELLK+ +P G E+ P VF+
Sbjct  179   IFLQNLASQAFGDDKPLAIVPCNDRSLLAARSPPRVDFPHPELLKLEVPIGVELNPTVFE  238

Query  828   SLKDDLAFEIFQLSSADIERLKDKAKAPDNVKTKVTGFNVLTAAIWRCKALSCLGGENNS  649
             +L+++L F+IF+LSS+DI  LKDKAK  +    KVT FN +TA +W+CKALS    ENNS
Sbjct  239   TLQEELVFKIFKLSSSDITSLKDKAKDENAPHAKVTSFNAVTAHVWKCKALS-FDVENNS  297

Query  648   DRLSTVLFAVDIRRRLNPPLPDSYSGNAVLTGYGSAKCAELEEGPFWKTVQMVYEGAARM  469
             +R+STVLFAVDIR RLNPPLP SY+GNAVLT Y SA C ELEE PF K V MV +GA RM
Sbjct  298   ERISTVLFAVDIRPRLNPPLPKSYTGNAVLTSYASATCHELEEWPFSKIVAMVSKGAMRM  357

Query  468   TDEYARSAIDWGELYKGFPHGEFLVSSWWRLGFEGVQFPWGKPKYSCPVVYHRKDIILLF  289
             TDEYARSAIDWGE YKGFP+GEFL+SSWWRLGF  V++PWGKPKYSCPVV HRKDIIL F
Sbjct  358   TDEYARSAIDWGEFYKGFPNGEFLISSWWRLGFSEVEYPWGKPKYSCPVVSHRKDIILFF  417

Query  288   PDIDNGGKSNS-GVNVLVALPPKEMEKFKSLFHKFL  184
             P+ID+G  SN+ GVN+LVALP K+MEKF+S FHKFL
Sbjct  418   PNIDDGISSNNDGVNILVALPAKQMEKFESYFHKFL  453



>emb|CDP20135.1| unnamed protein product [Coffea canephora]
Length=461

 Score =   610 bits (1572),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 303/464 (65%), Positives = 361/464 (78%), Gaps = 15/464 (3%)
 Frame = -3

Query  1548  MGALYL-KPETLHEDLKVTILDSGLIFPSQETTKHTMFLSNIDKVLNFDVQTVHFFPASP  1372
             MG LY   P+T   DLKVTI +S L+FP+QET   +MFLSNID+VLNF+VQTVHFFPA+ 
Sbjct  1     MGTLYQGPPDTAIHDLKVTIQESQLVFPAQETQSKSMFLSNIDQVLNFNVQTVHFFPANL  60

Query  1371  GFPPEIVAGKIKNAFRRLLVANTYDFLAGRLKKNKESERVEIECNAAGAGFTVASSEFAL  1192
              FPP+IVA +++ A   +LV   YDFLAGR+K N  S R+EI+CN+AGA F VASSEFAL
Sbjct  61    EFPPKIVADRLRTALSNVLVP--YDFLAGRIKLNPHSGRLEIDCNSAGAVFAVASSEFAL  118

Query  1191  EDIGDLVYPNPAFRQLVTMSFDFVAKEDQPLCFLQVTSFKCGGFALGTSMNHISFDGSGF  1012
             +DIGDLVYPNPAF QL+    D +  +DQPLC +Q+TSFKCGGFA+G S NH   DG  F
Sbjct  119   DDIGDLVYPNPAFGQLIVEKVDAIGSDDQPLCIIQLTSFKCGGFAMGVSTNHAMLDGLSF  178

Query  1011  KMFLENLAALSFNDDGPLAVVPCNDRSLLAARSPPQVTFPHPELLKVNLPAGEEMAPPVF  832
             K+FL+NLA  +F DD PLA+VP NDR++LAARSPPQVTFPHPELLK+ +P GEE + P F
Sbjct  179   KIFLQNLATQAF-DDKPLAIVPYNDRTVLAARSPPQVTFPHPELLKLKIPIGEEPSHPTF  237

Query  831   DSLKDDLAFEIFQLSSADIERLKDKAKAP--------DNVKTKVTGFNVLTAAIWRCKAL  676
             D  +++LAF+IF+LSS  I  LK+KAKA              ++TGFNV+TA +WRCKAL
Sbjct  238   DCPQEELAFKIFRLSSDHISYLKEKAKASGPAAAAATATTNYRITGFNVVTAHVWRCKAL  297

Query  675   SCLGGENNSDRLSTVLFAVDIRRRLNPPLPDSYSGNAVLTGYGSAKCAELEEGPFWKTVQ  496
             SC   E   +RLSTVL+AVDIR R+ PPLP SY+GNAVLT Y +AKC ELEE PF K V 
Sbjct  298   SC-DSEEGLERLSTVLYAVDIRPRMKPPLPASYTGNAVLTAYATAKCRELEEVPFSKLVA  356

Query  495   MVYEGAARMTDEYARSAIDWGELYKGFPHGEFLVSSWWRLGFEGVQFPWGKPKYSCPVVY  316
             MV EGAARMTDEYARSAIDWGE+YKGFPHGEFL+SSWWRLGF  +++PWGKP+YSCPVV+
Sbjct  357   MVSEGAARMTDEYARSAIDWGEVYKGFPHGEFLISSWWRLGFAEMEYPWGKPRYSCPVVH  416

Query  315   HRKDIILLFPDIDNGGKSNSGVNVLVALPPKEMEKFKSLFHKFL  184
              RKDIILLFPDID    + + VNVLVALP KEMEKF+SLFHK L
Sbjct  417   QRKDIILLFPDID--AANANAVNVLVALPGKEMEKFQSLFHKLL  458



>ref|XP_002270329.1| PREDICTED: omega-hydroxypalmitate O-feruloyl transferase [Vitis 
vinifera]
 emb|CBI38342.3| unnamed protein product [Vitis vinifera]
Length=448

 Score =   608 bits (1568),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 306/456 (67%), Positives = 361/456 (79%), Gaps = 8/456 (2%)
 Frame = -3

Query  1548  MGALYLKPETLHEDLKVTILDSGLIFPSQETTKHTMFLSNIDKVLNFDVQTVHFFPASPG  1369
             MGA++  P  L +DLKV +  S L+ PS ET + +MFLSNIDKVLNF+VQTVHFF A P 
Sbjct  1     MGAIFQDPPPLIQDLKVAVHSSSLVLPSSETERKSMFLSNIDKVLNFNVQTVHFFQAHPD  60

Query  1368  FPPEIVAGKIKNAFRRLLVANTYDFLAGRLKKNKESERVEIECNAAGAGFTVASSEFALE  1189
             FPP  V  K++ A +++LV   YDFLAGRLK N +  R+E++CNAAGAGF VASSEF L+
Sbjct  61    FPPPTVVEKLETALQKILVP--YDFLAGRLKMNPKLGRLEVDCNAAGAGFVVASSEFTLD  118

Query  1188  DIGDLVYPNPAFRQLVTMSFDFVAKEDQPLCFLQVTSFKCGGFALGTSMNHISFDGSGFK  1009
             +IGDLVYPNPAF+QLV MS D +A +DQPLC LQVTSFKCGGFA+G + NH +FDG  FK
Sbjct  119   EIGDLVYPNPAFQQLVVMSMDNLAPDDQPLCILQVTSFKCGGFAMGVTNNHATFDGLSFK  178

Query  1008  MFLENLAALSFNDDGPLAVVPCNDRSLLAARSPPQVTFPHPELLKVNLPAGEEMAPPVFD  829
             MFLENLA+L+   D PL + PCNDR LLAARSPP+VTFPHPELLK+ +P GEE   PVFD
Sbjct  179   MFLENLASLA--ADKPLVITPCNDRQLLAARSPPRVTFPHPELLKLKIPIGEESITPVFD  236

Query  828   SLKDDLAFEIFQLSSADIERLKDKAKAPDNVKTKVTGFNVLTAAIWRCKALSCLGGENNS  649
             ++ ++L F+IF+L   DI  LK KAK  D  KTKVTGFNV+   +WRCKALSC  G N+ 
Sbjct  237   AIPEELDFKIFRLMPGDISNLKAKAKTGD-AKTKVTGFNVVATHVWRCKALSCDTG-NDL  294

Query  648   DRLSTVLFAVDIRRRLNPPLPDSYSGNAVLTGYGSAKCAELEEGPFWKTVQMVYEGAARM  469
             DRLST+L+AVDIR RL PPLP SY+GN VLT Y +A C +L+E PF + V MV EGA RM
Sbjct  295   DRLSTILYAVDIRPRLVPPLPPSYTGNGVLTAYATASCRDLQEEPFSRLVGMVAEGANRM  354

Query  468   TDEYARSAIDWGELYKGFPHGEFLVSSWWRLGFEGVQFPWGKPKYSCPVVYHRKDIILLF  289
             TDEYARSAIDWGELYKGFPHGEFL+SSWWRLGF  V++PWGK KYSCPVVYHRKDIIL F
Sbjct  355   TDEYARSAIDWGELYKGFPHGEFLISSWWRLGFAEVEYPWGKAKYSCPVVYHRKDIILFF  414

Query  288   PDIDNGGKSNSGVNVLVALPPKEMEKFKSLFHKFLA  181
             PDID    +N+GVN+LVALP KEMEKF++LFHKFLA
Sbjct  415   PDID--AVNNNGVNILVALPSKEMEKFQTLFHKFLA  448



>ref|XP_004250074.1| PREDICTED: omega-hydroxypalmitate O-feruloyl transferase [Solanum 
lycopersicum]
Length=461

 Score =   604 bits (1558),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 295/462 (64%), Positives = 366/462 (79%), Gaps = 10/462 (2%)
 Frame = -3

Query  1548  MGALYLKPETLHEDLKVTILDSGLIFPSQETTKHTMFLSNIDKVLNFDVQTVHFFPASPG  1369
             MG LY   E+  +DLKVTI ++ L+FPSQET K  MFL NID+VLNFDVQT+HFF A+P 
Sbjct  1     MGTLYQPLESTIQDLKVTIHNTSLVFPSQETPKKPMFLPNIDQVLNFDVQTLHFFNANPE  60

Query  1368  FPPEIVAGKIKNAFRRLLVANTYDFLAGRLKKNKESERVEIECNA-AGAGFTVASSEFAL  1192
             FPPEIV  +++ A  R+LV   YDFLAGRL+ N+ES+R+E +CN+ AGA F VASSE  L
Sbjct  61    FPPEIVTERLRIALSRVLVP--YDFLAGRLRMNQESKRLEFDCNSDAGAVFMVASSELTL  118

Query  1191  EDIGDLVYPNPAFRQLVTM-SFDFVAKEDQPLCFLQVTSFKCGGFALGTSMNHISFDGSG  1015
              +IGDLVYPNP FRQL+   + D + K+D+PLC LQVTSFKCGGFA+G S NHI+FDG  
Sbjct  119   NEIGDLVYPNPGFRQLIVHENIDILEKDDKPLCILQVTSFKCGGFAMGFSTNHITFDGIS  178

Query  1014  FKMFLENLAALSFNDDG----PLAVVPCNDRSLLAARSPPQVTFPHPELLKVNLPAGEEM  847
             FK FL+NLA+ +F+DD     PLA+VPCNDR+LLAAR PP+VTFPH ELLK+++P GEE+
Sbjct  179   FKTFLQNLASQAFDDDNNNPKPLAIVPCNDRTLLAARRPPRVTFPHVELLKLDVPIGEEL  238

Query  846   APPVFDSLKDDLAFEIFQLSSADIERLKDKAKAPDNVKTKVTGFNVLTAAIWRCKALSCL  667
                VF++L+++L F+IF+ + +DI  LK+KAK  +    K+T FNV+T+ +WRCKALS  
Sbjct  239   NAKVFETLQEELDFKIFKFNPSDINSLKEKAKDENTPNAKITSFNVVTSYVWRCKALS-Y  297

Query  666   GGENNSDRLSTVLFAVDIRRRLNPPLPDSYSGNAVLTGYGSAKCAELEEGPFWKTVQMVY  487
               ENNS+R+STVLFAVDIR RLNPPLP SY+GNAVLT Y SA C ELEEGPF K V +V 
Sbjct  298   DDENNSERVSTVLFAVDIRPRLNPPLPQSYAGNAVLTSYASATCHELEEGPFSKIVDLVS  357

Query  486   EGAARMTDEYARSAIDWGELYKGFPHGEFLVSSWWRLGFEGVQFPWGKPKYSCPVVYHRK  307
             +G  RM DEYARSAIDWGE+ KGFP+GEFL+SSWW+LGF  V++PWGKPKYSCPVV HRK
Sbjct  358   QGGKRMDDEYARSAIDWGEINKGFPNGEFLLSSWWKLGFSQVEYPWGKPKYSCPVVCHRK  417

Query  306   DIILLFPDIDNG-GKSNSGVNVLVALPPKEMEKFKSLFHKFL  184
             +IILLFP+ID+G   +N GVN+ VALPPK+M KF+S F+KFL
Sbjct  418   EIILLFPNIDDGKSNNNDGVNIFVALPPKQMNKFESYFNKFL  459



>ref|XP_011077121.1| PREDICTED: LOW QUALITY PROTEIN: omega-hydroxypalmitate O-feruloyl 
transferase [Sesamum indicum]
Length=448

 Score =   594 bits (1531),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 297/460 (65%), Positives = 359/460 (78%), Gaps = 16/460 (3%)
 Frame = -3

Query  1548  MGALYLKPETLHEDLKVTILDSGLIFPSQETT--KHTMFLSNIDKVLNFDVQTVHFFPAS  1375
             MG L LKP    +DLKV I ++ LI PS   T    ++FLSNID+VLNF VQTVHFFPA+
Sbjct  1     MGTLDLKPAI--QDLKVAIQETTLIHPSSHGTLENKSIFLSNIDQVLNFHVQTVHFFPAN  58

Query  1374  PGFPPEIVAGKIKNAFRRLLVANTYDFLAGRLKKNKESERVEIECNAAGAGFTVASSEFA  1195
             P FPPE    ++KNA  +++VA  YDFL GRLK N ++ R+EIEC+ +G GF VA++E++
Sbjct  59    PDFPPETTVARLKNALEKVMVA--YDFLGGRLKFNHQTGRLEIECSQSGVGFVVATTEYS  116

Query  1194  LEDIGDLVYPNPAFRQLVTMSFDFVAKEDQPLCFLQVTSFKCGGFALGTSMNHISFDGSG  1015
             L+++GDLVYPNPAF QL+  + D    +DQPLC LQVTSFKCGGFA+G S NH+ FDG  
Sbjct  117   LDEVGDLVYPNPAFMQLIVQALD--KFDDQPLCVLQVTSFKCGGFAMGLSTNHVLFDGLS  174

Query  1014  FKMFLENLAALSFNDDGPLAVVPCNDRSLLAARSPPQVTFPHPELLKVNLPAGEE-MAPP  838
             FK+FLENLA+ +F DD PL + PCNDR LLAARSPPQVTFPHPELLK+  P GEE   PP
Sbjct  175   FKIFLENLASQAF-DDKPLPLSPCNDRRLLAARSPPQVTFPHPELLKLKPPIGEEEQNPP  233

Query  837   VFDSLKDDLAFEIFQLSSADIERLKDKAKAPD-NVKTKVTGFNVLTAAIWRCKALSCLGG  661
             VFDS ++DL F+IF LS  DI  LK+KAKA + N  TK+TGFNV+TA +WRCKALS   G
Sbjct  234   VFDSKQEDLDFKIFSLSPNDISYLKEKAKAGEINTNTKITGFNVVTAHVWRCKALSYDVG  293

Query  660   ENNSDRLSTVLFAVDIRRRLNPPLPDSYSGNAVLTGYGSAKCAELEEGPFWKTVQMVYEG  481
              N  D    VL+AVDIR +L PPLP SY GNAVL+ Y SAKC+ELE+ PF K V+MV  G
Sbjct  294   NNRED---XVLYAVDIRSKLKPPLPVSYCGNAVLSAYASAKCSELEDEPFSKLVEMVSAG  350

Query  480   AARMTDEYARSAIDWGELYKGFPHGEFLVSSWWRLGFEGVQFPWGKPKYSCPVVYHRKDI  301
             + RMTDEYARSAIDWGE+YKGFP+GEFL+SSWWRLGF+ V +PWGKP+YSCPVVYHRKDI
Sbjct  351   STRMTDEYARSAIDWGEVYKGFPNGEFLISSWWRLGFDEVVYPWGKPRYSCPVVYHRKDI  410

Query  300   ILLFPDIDNGGKSNSGVNVLVALPPKEMEKFKSLFHKFLA  181
             ILLFP+I  GG S++GVNVLVALP KEMEKF++LFHK++ 
Sbjct  411   ILLFPEI--GGASSNGVNVLVALPHKEMEKFQALFHKYMT  448



>emb|CAN73821.1| hypothetical protein VITISV_014805 [Vitis vinifera]
Length=435

 Score =   587 bits (1513),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 299/456 (66%), Positives = 353/456 (77%), Gaps = 21/456 (5%)
 Frame = -3

Query  1548  MGALYLKPETLHEDLKVTILDSGLIFPSQETTKHTMFLSNIDKVLNFDVQTVHFFPASPG  1369
             MGA++  P  L +DLKV +  S L+ PS ET + +MFLSNIDKVLNF+VQTVHFF A P 
Sbjct  1     MGAIFQDPPPLIQDLKVAVHSSSLVLPSSETERKSMFLSNIDKVLNFNVQTVHFFQAHPD  60

Query  1368  FPPEIVAGKIKNAFRRLLVANTYDFLAGRLKKNKESERVEIECNAAGAGFTVASSEFALE  1189
             FPP  V  K++ A +++LV   YDFLAGRLK N +  R+E++CNAAGAGF VASSEF L+
Sbjct  61    FPPPTVVEKLETALQKILVP--YDFLAGRLKMNPKLGRLEVDCNAAGAGFVVASSEFTLD  118

Query  1188  DIGDLVYPNPAFRQLVTMSFDFVAKEDQPLCFLQVTSFKCGGFALGTSMNHISFDGSGFK  1009
             +IGDLVYPNPAF+QLV MS D +A +DQPLC LQVTSFKCGGFA+G + NH +FDG  FK
Sbjct  119   EIGDLVYPNPAFQQLVVMSMDNLAPDDQPLCILQVTSFKCGGFAMGVTNNHATFDGLSFK  178

Query  1008  MFLENLAALSFNDDGPLAVVPCNDRSLLAARSPPQVTFPHPELLKVNLPAGEEMAPPVFD  829
             MFLENLA+L+   D PL + PCNDR LLAARSPP+VTFPHPELLK+ +P GEE   PVFD
Sbjct  179   MFLENLASLA--ADKPLVITPCNDRQLLAARSPPRVTFPHPELLKLKIPIGEESITPVFD  236

Query  828   SLKDDLAFEIFQLSSADIERLKDKAKAPDNVKTKVTGFNVLTAAIWRCKALSCLGGENNS  649
             ++ ++L F             K KAK  D  KTKVTGFNV+   +WRCKALSC  G N+ 
Sbjct  237   AIPEELDF-------------KAKAKTGD-AKTKVTGFNVVATHVWRCKALSCDTG-NDL  281

Query  648   DRLSTVLFAVDIRRRLNPPLPDSYSGNAVLTGYGSAKCAELEEGPFWKTVQMVYEGAARM  469
             DRLST+L+AVDIR RL PPLP SY+GN VLT Y +A C +L+E PF + V MV EGA RM
Sbjct  282   DRLSTILYAVDIRPRLVPPLPPSYTGNGVLTAYATASCRDLQEEPFSRLVGMVAEGANRM  341

Query  468   TDEYARSAIDWGELYKGFPHGEFLVSSWWRLGFEGVQFPWGKPKYSCPVVYHRKDIILLF  289
             TDEYARSAIDWGELYKGFPHGEFL+SSWWRLGF  V++PWGK KYSCPVVYHRKDIIL F
Sbjct  342   TDEYARSAIDWGELYKGFPHGEFLISSWWRLGFAEVEYPWGKAKYSCPVVYHRKDIILFF  401

Query  288   PDIDNGGKSNSGVNVLVALPPKEMEKFKSLFHKFLA  181
             PDID    +++GVN+LVALP KEMEKF++LFHKFLA
Sbjct  402   PDID--AVNBNGVNILVALPSKEMEKFQTLFHKFLA  435



>ref|XP_006353264.1| PREDICTED: omega-hydroxypalmitate O-feruloyl transferase-like 
[Solanum tuberosum]
Length=461

 Score =   588 bits (1515),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 292/462 (63%), Positives = 365/462 (79%), Gaps = 10/462 (2%)
 Frame = -3

Query  1548  MGALYLKPETLHEDLKVTILDSGLIFPSQETTKHTMFLSNIDKVLNFDVQTVHFFPASPG  1369
             MG LY   E+  +DLKVTI ++ L+FPSQET K  MFL NID+VLNFDVQT+HFF A+P 
Sbjct  1     MGTLYQPLESTIQDLKVTIHNTSLVFPSQETPKKPMFLPNIDQVLNFDVQTLHFFNANPE  60

Query  1368  FPPEIVAGKIKNAFRRLLVANTYDFLAGRLKKNKESERVEIECNA-AGAGFTVASSEFAL  1192
             FPPEIV  +++ A  R++V   YDFLAGRL+ N+ES+R+E +CN+ AGA F VASSE  L
Sbjct  61    FPPEIVTERLRIALSRVVVH--YDFLAGRLRMNQESKRLEFDCNSDAGAVFMVASSELTL  118

Query  1191  EDIGDLVYPNPAFRQLVTM-SFDFVAKEDQPLCFLQVTSFKCGGFALGTSMNHISFDGSG  1015
              +IGDLVYPNP FRQL+   + D + K+D+PL  LQVTSFKCGGF +G S NHI+FDG  
Sbjct  119   NEIGDLVYPNPGFRQLIVHENIDILEKDDKPLFILQVTSFKCGGFVMGFSTNHITFDGIS  178

Query  1014  FKMFLENLAALSFNDDG----PLAVVPCNDRSLLAARSPPQVTFPHPELLKVNLPAGEEM  847
             FK FL+NLA+ +F+DD     PLA+VPCNDR+LLAAR+PP+VTFPH ELLK+++P GEE+
Sbjct  179   FKTFLQNLASQAFDDDNNNPKPLAIVPCNDRTLLAARTPPRVTFPHVELLKLDVPIGEEL  238

Query  846   APPVFDSLKDDLAFEIFQLSSADIERLKDKAKAPDNVKTKVTGFNVLTAAIWRCKALSCL  667
                VF++L+++L F+IF+L+S+DI  LK+KAK  +   +K+T FNV+T+ +WRCKALS  
Sbjct  239   NAKVFETLQEELDFKIFKLNSSDINSLKEKAKDENTPNSKITSFNVVTSYVWRCKALS-Y  297

Query  666   GGENNSDRLSTVLFAVDIRRRLNPPLPDSYSGNAVLTGYGSAKCAELEEGPFWKTVQMVY  487
               ENNS+R+STVLFAVDIR RLNPPLP SY+GNAVLT Y SA C ELEEGPF K V +V 
Sbjct  298   DDENNSERVSTVLFAVDIRPRLNPPLPQSYAGNAVLTSYASATCHELEEGPFSKIVDLVS  357

Query  486   EGAARMTDEYARSAIDWGELYKGFPHGEFLVSSWWRLGFEGVQFPWGKPKYSCPVVYHRK  307
             +G  RM DEYARSAIDWGE+ KGFP+GEFL+SSWW+LGF  V++PWGKPKYSCPVV HRK
Sbjct  358   QGGKRMNDEYARSAIDWGEINKGFPNGEFLLSSWWKLGFSQVEYPWGKPKYSCPVVCHRK  417

Query  306   DIILLFP-DIDNGGKSNSGVNVLVALPPKEMEKFKSLFHKFL  184
             +IILLFP   D    +N GVN+ VALPPK+M+KF+S F+KFL
Sbjct  418   EIILLFPNIDDGINNNNDGVNIFVALPPKQMKKFESYFNKFL  459



>ref|XP_002514787.1| Anthranilate N-benzoyltransferase protein, putative [Ricinus 
communis]
 gb|EEF47341.1| Anthranilate N-benzoyltransferase protein, putative [Ricinus 
communis]
Length=450

 Score =   587 bits (1512),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 287/459 (63%), Positives = 352/459 (77%), Gaps = 13/459 (3%)
 Frame = -3

Query  1548  MGALYLKPETLHEDLKVTILDSGLIFPSQETTKHTMFLSNIDKVLNFDVQTVHFFPASPG  1369
             MGA+Y +P  L +DLKVTI D+ L+FP Q+T + TMFLSNID+VLNFDVQT+HFF +   
Sbjct  1     MGAIYQEPPPLLQDLKVTIKDTSLVFPPQDTGRRTMFLSNIDQVLNFDVQTLHFFASHED  60

Query  1368  FPPEIVAGKIKNAFRRLLVANTYDFLAGRLKKNKESERVEIECNAAGAGFTVASSEFALE  1189
             FP  +VA K+K +F +LL+   YDFLAGRLK N E+ R E +CN AGAGF VASSE  LE
Sbjct  61    FPSHVVAEKLKTSFEKLLLP--YDFLAGRLKMNTEAGRFEFDCNGAGAGFVVASSERRLE  118

Query  1188  DIGDLVYPNPAFRQLVTMSFDFVAKEDQPLCFLQVTSFKCGGFALGTSMNHISFDGSGFK  1009
             ++GDLVYPNPAF QL+  S D + KEDQPLC +QVTSFKCGGF +G S NH +FDG  FK
Sbjct  119   EVGDLVYPNPAFDQLIVKSLDILEKEDQPLCIIQVTSFKCGGFVMGISTNHATFDGISFK  178

Query  1008  MFLENLAALSFNDDGPLAVVPCNDRSLLAARSPPQVTFPHPELLKVNLPAGEEMAPPVFD  829
              FLENLAA+    D PLAV+PCNDR LLAARSPP V FPHPE+LK+N   G+E    VFD
Sbjct  179   TFLENLAAVL--ADKPLAVIPCNDRQLLAARSPPHVAFPHPEMLKLNTALGQESNSQVFD  236

Query  828   SLKDDLAFEIFQLSSADIERLKDKAKAPDNVKTKVTGFNVLTAAIWRCKALSCLGGENNS  649
               K+ L F++FQL+S DI  LK+KAK   + + +V+GFNV+TA +WRCKALS     N  
Sbjct  237   LTKEALDFKVFQLTSGDIFNLKEKAKT--DAEARVSGFNVVTAHVWRCKALSYDESNNKG  294

Query  648   ---DRLSTVLFAVDIRRRLNPPLPDSYSGNAVLTGYGSAKCAELEEGPFWKTVQMVYEGA  478
                +R+ST+L+AV+IR RL PPLP SY+GNAVLT Y SAKC +L+EGP  + V+MV EGA
Sbjct  295   QDLERVSTLLYAVNIRARLIPPLPASYAGNAVLTAYASAKCRDLKEGPLSRLVEMVREGA  354

Query  477   ARMTDEYARSAIDWGELYKGFPHGEFLVSSWWRLGFEGVQFPWGKPKYSCPVVYHRKDII  298
              RM DEYA+S IDWGE+ KGFP+GEFLVSSWW+LGF+ V++PWG PKYSCP+VYHRKDII
Sbjct  355   KRMNDEYAKSVIDWGEINKGFPNGEFLVSSWWKLGFDEVEYPWGYPKYSCPLVYHRKDII  414

Query  297   LLFPDIDNGGKSNSGVNVLVALPPKEMEKFKSLFHKFLA  181
             LLFPD  +     +GVNVLVALP K+M KF++LFH+FL+
Sbjct  415   LLFPDTVD----KNGVNVLVALPSKQMNKFQTLFHEFLS  449



>gb|KDP26918.1| hypothetical protein JCGZ_18076 [Jatropha curcas]
Length=450

 Score =   580 bits (1494),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 290/460 (63%), Positives = 357/460 (78%), Gaps = 17/460 (4%)
 Frame = -3

Query  1548  MGALYLK-PETLHEDLKVTILDSGLIFPSQETTKHTMFLSNIDKVLNFDVQTVHFFPASP  1372
             MGA+Y + P  L +DLK+TI DS ++FP QE+ + ++FLSNID+VLNF+VQT+HFF +  
Sbjct  1     MGAMYQESPSDLLQDLKITIRDSCMVFPPQESKRQSLFLSNIDQVLNFNVQTLHFFASHK  60

Query  1371  GFPPEIVAGKIKNAFRRLLVANTYDFLAGRLKKNKESERVEIECNAAGAGFTVASSEFAL  1192
              FPP +VA K+K   ++LLV   YDFLAGRLK N ++ R+EI+CN AGAGF VASS+  L
Sbjct  61    DFPPHLVAEKLKRTLQKLLVP--YDFLAGRLKMNLQTGRLEIDCNGAGAGFVVASSDRRL  118

Query  1191  EDIGDLVYPNPAFRQLVTMSFDFVAK--EDQPLCFLQVTSFKCGGFALGTSMNHISFDGS  1018
             E++GDLVYPNPAF++L+    D +    +DQPLC +QVTSF+CGGF +G S NH +FDG 
Sbjct  119   EELGDLVYPNPAFQELILKGMDILQDKLDDQPLCIVQVTSFRCGGFVIGLSTNHTAFDGL  178

Query  1017  GFKMFLENLAALSFNDDGPLAVVPCNDRSLLAARSPPQVTFPHPELLKVN-LPAGEEMAP  841
              FK FL+NLAA++   D PLAV PCNDR LLAARSPP+VTFPHPELLK+N  P G+E   
Sbjct  179   SFKTFLDNLAAVA--ADKPLAVNPCNDRQLLAARSPPRVTFPHPELLKLNNSPLGQESKA  236

Query  840   PVFDSLKDDLAFEIFQLSSADIERLKDKAKAPDNVKTKVTGFNVLTAAIWRCKALSCLGG  661
              VFD  K+ L F+IFQL+S DI  LK+K K   N   +V+GFNV+TA +WRCKALS    
Sbjct  237   AVFDVSKEALDFKIFQLTSGDISGLKEKGKRHAN--GRVSGFNVVTAHVWRCKALS-YED  293

Query  660   ENNSDRLSTVLFAVDIRRRLNPPLPDSYSGNAVLTGYGSAKCAELEEGPFWKTVQMVYEG  481
              NN +R+ST+L+AV+IR R+ P LPDSY+GNAVLT Y SAKC ELEEGP W+ V+MV EG
Sbjct  294   NNNLERVSTILYAVNIRPRVMPALPDSYAGNAVLTAYASAKCKELEEGPLWRVVEMVAEG  353

Query  480   AARMTDEYARSAIDWGELYKGFPHGEFLVSSWWRLGFEGVQFPWGKPKYSCPVVYHRKDI  301
             A RMTDEYA+SAIDWGE+ KGFP+GEFLVSSWWRLGFE V++PWG PKYSCP+VYHRKDI
Sbjct  354   AKRMTDEYAKSAIDWGEINKGFPNGEFLVSSWWRLGFEEVEYPWGCPKYSCPLVYHRKDI  413

Query  300   ILLFPD-IDNGGKSNSGVNVLVALPPKEMEKFKSLFHKFL  184
             ILLFPD +D      +GVNVLVALP  +M KF+SLFHKFL
Sbjct  414   ILLFPDPVD-----KNGVNVLVALPSNQMNKFESLFHKFL  448



>ref|XP_006425205.1| hypothetical protein CICLE_v10010861mg [Citrus clementina]
 gb|ESR38445.1| hypothetical protein CICLE_v10010861mg [Citrus clementina]
Length=458

 Score =   575 bits (1483),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 287/453 (63%), Positives = 357/453 (79%), Gaps = 15/453 (3%)
 Frame = -3

Query  1518  LHEDLKVTILDSGLIFPSQETTKHTMFLSNIDKVLNFDVQTVHFFPASPGFPPEIVAGKI  1339
             L +DLKVTI  S L+FPSQET K ++FLSNID+VLNF V+TVHFF +   FPP +VA K+
Sbjct  14    LPQDLKVTIQHSSLVFPSQETEKKSLFLSNIDQVLNFSVETVHFFASHKDFPPHVVAEKL  73

Query  1338  KNAFRRLLVANTYDFLAGRLKKNKESERVEIECNAAGAGFTVASSEFALEDIGDLVYPNP  1159
             +N   ++LV   YDFLAGRLK N ++ ++EI+CNAAGA F VASSE+ L+DIGDLVYPNP
Sbjct  74    RNTLGKILVP--YDFLAGRLKANAKTGKMEIDCNAAGAVFIVASSEYKLDDIGDLVYPNP  131

Query  1158  AFRQLV-TMSFD--FVAKEDQPLCFLQVTSFKCGGFALGTSMNHISFDGSGFKMFLENLA  988
              F+QL+   SFD   + ++D+PLC  QVTSFKCGGF++GTS NH +FDG  FK+FL+NLA
Sbjct  132   GFKQLIINSSFDDNLLEQDDKPLCIFQVTSFKCGGFSIGTSTNHATFDGLSFKVFLDNLA  191

Query  987   ALSFNDDGPLAVVPCNDRSLLAARSPPQVTFPHPELLKVNLPAGEEMA-PPVFDSLKDDL  811
             AL+   D PLA++PCNDR LLAARSPP+VTF HPE+LK+ +P GEE    P+FD  ++DL
Sbjct  192   ALA--ADKPLAIIPCNDRRLLAARSPPRVTFDHPEMLKLKMPFGEESNNAPIFDITQEDL  249

Query  810   AFEIFQLSSADIERLKDKAKAPDNVKTK--VTGFNVLTAAIWRCKALSCLGGENNS-DRL  640
              F+IF+L+  DI  LK+KAKA    +    +TGFNV++A IWRCKALS    +  + +R 
Sbjct  250   DFKIFRLTPDDIANLKEKAKATVEYENSRYITGFNVVSALIWRCKALSYDHAKGKTPERE  309

Query  639   STVLFAVDIRRRLNPPLPDSYSGNAVLTGYGSAKCAELEEGPFWKTVQMVYEGAARMTDE  460
             S +L+AVDIR RLNPPLP SY GNAVL+ Y +AKC EL+E PF + V+MV EGA RM+DE
Sbjct  310   SRMLYAVDIRPRLNPPLPASYVGNAVLSAYANAKCEELKEKPFSRLVEMVSEGAKRMSDE  369

Query  459   YARSAIDWGELYKGFPHGEFLVSSWWRLGFEGVQFPWGKPKYSCPVVYHRKDIILLFPDI  280
             YARSAIDWGE YKGFPHGEFLVSSWW+LGF  V++PWGKPKYSCPVVYH+KDIILLFP+I
Sbjct  370   YARSAIDWGETYKGFPHGEFLVSSWWKLGFSKVEYPWGKPKYSCPVVYHKKDIILLFPNI  429

Query  279   DNGGKSNSGVNVLVALPPKEMEKFKSLFHKFLA  181
             DN    ++GVNVLV+LP KEM +F+SLF+KFLA
Sbjct  430   DN----DNGVNVLVSLPSKEMVEFESLFNKFLA  458



>ref|XP_006480697.1| PREDICTED: omega-hydroxypalmitate O-feruloyl transferase-like 
[Citrus sinensis]
Length=458

 Score =   575 bits (1483),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 287/453 (63%), Positives = 357/453 (79%), Gaps = 15/453 (3%)
 Frame = -3

Query  1518  LHEDLKVTILDSGLIFPSQETTKHTMFLSNIDKVLNFDVQTVHFFPASPGFPPEIVAGKI  1339
             L +DLKVTI  S L+FPSQET K ++FLSNID+VLNF V+TVHFF +   FPP +VA K+
Sbjct  14    LPQDLKVTIQHSSLVFPSQETEKKSLFLSNIDQVLNFSVETVHFFASHKDFPPRVVAEKL  73

Query  1338  KNAFRRLLVANTYDFLAGRLKKNKESERVEIECNAAGAGFTVASSEFALEDIGDLVYPNP  1159
             +N   ++LV   YDFLAGRLK N ++ ++EI+CNAAGA F VASSE+ L+DIGDLVYPNP
Sbjct  74    RNTLGKILVP--YDFLAGRLKANAKTGKMEIDCNAAGAVFIVASSEYKLDDIGDLVYPNP  131

Query  1158  AFRQLV-TMSFD--FVAKEDQPLCFLQVTSFKCGGFALGTSMNHISFDGSGFKMFLENLA  988
              F+QL+   SFD   + ++D+PLC  QVTSFKCGGF++GTS NH +FDG  FK+FL+NLA
Sbjct  132   GFKQLIINSSFDDNLLEQDDKPLCIFQVTSFKCGGFSIGTSTNHATFDGLSFKVFLDNLA  191

Query  987   ALSFNDDGPLAVVPCNDRSLLAARSPPQVTFPHPELLKVNLPAGEEMA-PPVFDSLKDDL  811
             AL+   D PLA++PCNDR LLAARSPP+VTF HPE+LK+ +P GEE    P+FD  ++DL
Sbjct  192   ALA--ADKPLAIIPCNDRRLLAARSPPRVTFDHPEMLKLKMPFGEESNNAPIFDITQEDL  249

Query  810   AFEIFQLSSADIERLKDKAKAPDNVKTK--VTGFNVLTAAIWRCKALSCLGGENNS-DRL  640
              F+IF+L+  DI  LK+KAKA    +    +TGFNV++A IWRCKALS    +  + +R 
Sbjct  250   DFKIFRLTPDDIANLKEKAKATVEYENSRYITGFNVVSALIWRCKALSYDHAKGKTPERE  309

Query  639   STVLFAVDIRRRLNPPLPDSYSGNAVLTGYGSAKCAELEEGPFWKTVQMVYEGAARMTDE  460
             S +L+AVDIR RLNPPLP SY GNAVL+ Y +AKC EL+E PF + V+MV EGA RM+DE
Sbjct  310   SRMLYAVDIRPRLNPPLPASYVGNAVLSAYANAKCEELKEKPFSRLVEMVSEGAKRMSDE  369

Query  459   YARSAIDWGELYKGFPHGEFLVSSWWRLGFEGVQFPWGKPKYSCPVVYHRKDIILLFPDI  280
             YARSAIDWGE YKGFPHGEFLVSSWW+LGF  V++PWGKPKYSCPVVYH+KDIILLFP+I
Sbjct  370   YARSAIDWGETYKGFPHGEFLVSSWWKLGFSKVEYPWGKPKYSCPVVYHKKDIILLFPNI  429

Query  279   DNGGKSNSGVNVLVALPPKEMEKFKSLFHKFLA  181
             DN    ++GVNVLV+LP KEM +F+SLF+KFLA
Sbjct  430   DN----DNGVNVLVSLPSKEMVEFESLFNKFLA  458



>gb|KDO45315.1| hypothetical protein CISIN_1g012689mg [Citrus sinensis]
Length=458

 Score =   575 bits (1482),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 287/453 (63%), Positives = 357/453 (79%), Gaps = 15/453 (3%)
 Frame = -3

Query  1518  LHEDLKVTILDSGLIFPSQETTKHTMFLSNIDKVLNFDVQTVHFFPASPGFPPEIVAGKI  1339
             L +DLKVTI  S L+FPSQET K ++FLSNID+VLNF V+TVHFF +   FPP +VA K+
Sbjct  14    LPQDLKVTIHHSSLVFPSQETEKKSLFLSNIDQVLNFSVETVHFFESHKDFPPHVVAEKL  73

Query  1338  KNAFRRLLVANTYDFLAGRLKKNKESERVEIECNAAGAGFTVASSEFALEDIGDLVYPNP  1159
             +N   ++LV   YDFLAGRLK N ++ ++EI+CNAAGA F VASSE+ L+DIGDLVYPNP
Sbjct  74    RNTLGKILVP--YDFLAGRLKANAKTGKMEIDCNAAGAVFIVASSEYKLDDIGDLVYPNP  131

Query  1158  AFRQLV-TMSFD--FVAKEDQPLCFLQVTSFKCGGFALGTSMNHISFDGSGFKMFLENLA  988
              F+QL+   SFD   + ++D+PLC  QVTSFKCGGF++GTS NH +FDG  FK+FL+NLA
Sbjct  132   GFKQLIINSSFDDNLLEQDDKPLCIFQVTSFKCGGFSIGTSTNHATFDGLSFKVFLDNLA  191

Query  987   ALSFNDDGPLAVVPCNDRSLLAARSPPQVTFPHPELLKVNLPAGEEMA-PPVFDSLKDDL  811
             AL+   D PLA++PCNDR LLAARSPP+VTF HPE+LK+ +P GEE    P+FD  ++DL
Sbjct  192   ALA--ADKPLAIIPCNDRRLLAARSPPRVTFDHPEMLKLKMPFGEESNNAPIFDITQEDL  249

Query  810   AFEIFQLSSADIERLKDKAKAPDNVKTK--VTGFNVLTAAIWRCKALSCLGGENNS-DRL  640
              F+IF+L+  DI  LK+KAKA    +    +TGFNV++A IWRCKALS    +  + +R 
Sbjct  250   DFKIFRLTPDDIANLKEKAKATVEYENSRYITGFNVVSALIWRCKALSYDHAKGKTPERE  309

Query  639   STVLFAVDIRRRLNPPLPDSYSGNAVLTGYGSAKCAELEEGPFWKTVQMVYEGAARMTDE  460
             S +L+AVDIR RLNPPLP SY GNAVL+ Y +AKC EL+E PF + V+MV EGA RM+DE
Sbjct  310   SRMLYAVDIRPRLNPPLPASYVGNAVLSAYANAKCEELKEKPFSRLVEMVSEGAKRMSDE  369

Query  459   YARSAIDWGELYKGFPHGEFLVSSWWRLGFEGVQFPWGKPKYSCPVVYHRKDIILLFPDI  280
             YARSAIDWGE YKGFPHGEFLVSSWW+LGF  V++PWGKPKYSCPVVYH+KDIILLFP+I
Sbjct  370   YARSAIDWGETYKGFPHGEFLVSSWWKLGFSKVEYPWGKPKYSCPVVYHKKDIILLFPNI  429

Query  279   DNGGKSNSGVNVLVALPPKEMEKFKSLFHKFLA  181
             DN    ++GVNVLV+LP KEM +F+SLF+KFLA
Sbjct  430   DN----DNGVNVLVSLPSKEMVEFESLFNKFLA  458



>ref|XP_007028077.1| HXXXD-type acyl-transferase family protein [Theobroma cacao]
 gb|EOY08579.1| HXXXD-type acyl-transferase family protein [Theobroma cacao]
Length=452

 Score =   567 bits (1461),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 278/463 (60%), Positives = 353/463 (76%), Gaps = 18/463 (4%)
 Frame = -3

Query  1548  MGALYLKPETLHEDLKVTILDSGLIFPSQETTKHTMFLSNIDKVLNFDVQTVHFFPASPG  1369
             MG + ++P +L +DLK+TI +  L+FPSQ+T + +MFLSNIDKVLNF V+TVHFFP+   
Sbjct  1     MGTICVEPPSLLQDLKITIQNVSLVFPSQQTERKSMFLSNIDKVLNFPVETVHFFPSHKD  60

Query  1368  FPPEIVAGKIKNAFRRLLVANTYDFLAGRLKKNKESERVEIECNAAGAGFTVASSEFALE  1189
             FPP +VA K+K+   RLLV   YDFLAGRL+ N E+ R+EI+CNAAG GF VASSE+ ++
Sbjct  61    FPPHLVAEKLKSTLARLLVP--YDFLAGRLRSNPETGRLEIDCNAAGIGFAVASSEYTMD  118

Query  1188  DIGDLVYPNPAFRQLVTMSFDFVAKEDQPLCFLQVTSFKCGGFALGTSMNHISFDGSGFK  1009
              +G+LVYPNPAF QL+    D + ++DQPLC +QVTSF+CGGFA+G   NH++FDG  FK
Sbjct  119   SLGELVYPNPAFGQLILKRMDNLEQDDQPLCIVQVTSFRCGGFAMGMFTNHVTFDGLSFK  178

Query  1008  MFLENLAALSFNDDGPLAVVPCNDRSLLAARSPPQVTFPHPELLKVNLPAGEEMAPPVFD  829
             +FL+NL AL+   D PLAV+PCNDR LLAARSPP V+FPH EL K        +  PVFD
Sbjct  179   IFLDNLGALA--ADKPLAVIPCNDRELLAARSPPCVSFPHLELAKF---LDSNVNHPVFD  233

Query  828   SLKDDLAFEIFQLSSADIERLKDKAKAPDNVK--TKVTGFNVLTAAIWRCKALS-----C  670
             +  + L F++F+L+S +I  LK+KAKA        ++TGFNV+TA +W CKALS      
Sbjct  234   ATSEALDFKVFRLTSGNIADLKEKAKASGGTHKDARITGFNVVTALVWLCKALSWDEETT  293

Query  669   LGGENNSDRLSTVLFAVDIRRRLNPPLPDSYSGNAVLTGYGSAKCAELEEGPFWKTVQMV  490
                 NN+DR ST+L+AV+IR RL PPLP SY+GNAVLT Y +AKC E+EE PF + V+MV
Sbjct  294   QERNNNADRESTLLYAVNIRPRLIPPLPRSYTGNAVLTAYATAKCKEIEEWPFSRLVEMV  353

Query  489   YEGAARMTDEYARSAIDWGELYKGFPHGEFLVSSWWRLGFEGVQFPWGKPKYSCPVVYHR  310
              EGA RMTDEYARSAIDWGE+Y+GFP+GEFLVSSWW+LGF+ V +PWG+P+YSCPVV+HR
Sbjct  354   SEGAKRMTDEYARSAIDWGEIYQGFPNGEFLVSSWWKLGFDEVDYPWGRPRYSCPVVFHR  413

Query  309   KDIILLFPDIDNGGKSNSGVNVLVALPPKEMEKFKSLFHKFLA  181
             KDIILLFPD+D     N+GVNVLV+LP KEM KF+SLF  +LA
Sbjct  414   KDIILLFPDVD----ENNGVNVLVSLPSKEMSKFQSLFLNYLA  452



>ref|XP_010673872.1| PREDICTED: omega-hydroxypalmitate O-feruloyl transferase [Beta 
vulgaris subsp. vulgaris]
Length=454

 Score =   566 bits (1460),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 282/462 (61%), Positives = 346/462 (75%), Gaps = 15/462 (3%)
 Frame = -3

Query  1548  MGALYLKPETLHEDLKVTILDSGLIFPSQETTKHTMFLSNIDKVLNFDVQTVHFFPASPG  1369
             MG LY  P  L +DLKVTILDS LI+  QE+ + +MFLSNID+VLNFDVQT+HFF ++P 
Sbjct  1     MGTLYQVPPPLLKDLKVTILDSSLIYSPQESEEKSMFLSNIDQVLNFDVQTLHFFTSNPE  60

Query  1368  FPPEIVAGKIKNAFRRLLVANTYDFLAGRLKKNKESERVEIECNAAGAGFTVASSEFALE  1189
             FPP+I   K+KNA ++LLV   Y FL+GR+K N ++ R+EI+C   G GF +ASSE+ L+
Sbjct  61    FPPKIAFEKLKNALQKLLVP--YYFLSGRVKLNHKNGRIEIDCKNGGIGFVIASSEYTLD  118

Query  1188  DIGDLVYPNPAFRQLVTMSFDFVAKED-QPLCFLQVTSFKCGGFALGTSMNHISFDGSGF  1012
             ++GDLVYPNP+F QL+T   D + + D  PLC +Q+T+FKCGGF +G   NH +FDG+  
Sbjct  119   ELGDLVYPNPSFEQLLTKKMDDLLEVDGHPLCIVQMTAFKCGGFVMGLQTNHATFDGTSI  178

Query  1011  KMFLENLAALSFNDDGPLAVVPCNDRSLLAARSPPQVTFPHPELLKVNLPAGE----EMA  844
             K  L+NLAAL+   D PLAV+PCN+R LLAARSPP VTFPHPELLK+ +P G+    E  
Sbjct  179   KYLLQNLAALA--GDKPLAVIPCNNRELLAARSPPLVTFPHPELLKLKIPIGQDGESEQN  236

Query  843   PPVFDSLKDDLAFEIFQLSSADIERLKDKAKA-PDNVKTKVTGFNVLTAAIWRCKALSCL  667
               VFD+   DL F+IF LS  DI  LK KAK+ P N K K+TGFNV++A +WRCKALS  
Sbjct  237   CNVFDTTCQDLDFKIFNLSGDDISNLKAKAKSGPPNWKGKITGFNVVSALVWRCKALS--  294

Query  666   GGENNSDRLSTVLFAVDIRRRLNPPLPDSYSGNAVLTGYGSAKCAELEEGPFWKTVQMVY  487
               EN    LST+LFAVDIR +LNPPLP S+ GNAVLT Y +  C  LEE    + V +V 
Sbjct  295   NSENEEKSLSTMLFAVDIRPKLNPPLPTSFVGNAVLTAYATTDCKTLEEASLSELVHLVS  354

Query  486   EGAARMTDEYARSAIDWGELYKGFPHGEFLVSSWWRLGFEGVQFPWGKPKYSCPVVYHRK  307
             EG ARM DEYA+SAIDWGE+YKGFPHGEFL+SSWWRLGF+  ++PWGKPKY CP+VYHRK
Sbjct  355   EGGARMNDEYAKSAIDWGEVYKGFPHGEFLMSSWWRLGFDQAEYPWGKPKYCCPLVYHRK  414

Query  306   DIILLFPDIDNGGKSNSGVNVLVALPPKEMEKFKSLFHKFLA  181
             DIILLFPDID   +SNSGVNVLV LP KEM KF+SLFH FL+
Sbjct  415   DIILLFPDID---ESNSGVNVLVTLPHKEMAKFQSLFHNFLS  453



>ref|XP_004493124.1| PREDICTED: omega-hydroxypalmitate O-feruloyl transferase-like 
[Cicer arietinum]
Length=447

 Score =   562 bits (1448),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 276/456 (61%), Positives = 346/456 (76%), Gaps = 12/456 (3%)
 Frame = -3

Query  1548  MGALYLKPETLHEDLKVTILDSGLIFPSQETTKHTMFLSNIDKVLNFDVQTVHFFPASPG  1369
             MG    +   L +DLKVTI  + +IFPS++T + ++FLSNIDKVLNF+V+T+HFF A+  
Sbjct  1     MGTTCQETPPLLQDLKVTIHKTSMIFPSKQTERQSLFLSNIDKVLNFNVETIHFFEANKD  60

Query  1368  FPPEIVAGKIKNAFRRLLVANTYDFLAGRLKKNKESERVEIECNAAGAGFTVASSEFALE  1189
             FPP+IV  K+K A   +LV   YDFLAGRLK N E+ R+EI+CNA GAGF VASS++ L+
Sbjct  61    FPPQIVVEKLKKALEDVLVV--YDFLAGRLKMNSETNRLEIDCNAEGAGFVVASSDYKLD  118

Query  1188  DIGDLVYPNPAFRQLVTMSFDFVAKEDQPLCFLQVTSFKCGGFALGTSMNHISFDGSGFK  1009
              IGDL YPNPAF Q V  + DF+   D PLC  Q+TSFKCGGF +G + +H +FDG  FK
Sbjct  119   QIGDLTYPNPAFEQFVHKTKDFLKLGDLPLCVFQLTSFKCGGFTIGITTSHATFDGLSFK  178

Query  1008  MFLENLAALSFNDDGPLAVVPCNDRSLLAARSPPQVTFPHPELLKVN-LPAGEEMAPPVF  832
              FL+NLA+L+ N    LAV+P N+R  LAARSPP+V FPHPE++K+N LP+G E    VF
Sbjct  179   TFLDNLASLAANKQ--LAVIPFNERQFLAARSPPRVKFPHPEMIKLNNLPSGIESG--VF  234

Query  831   DSLKDDLAFEIFQLSSADIERLKDKAKAPDNVKTKVTGFNVLTAAIWRCKALSCLGGENN  652
             ++  ++L F+IF+LSS +I+ LK+KAK  D+   +VTGFNV+ A +WRCKALS   G ++
Sbjct  235   ETSSEELDFKIFRLSSNNIKNLKEKAK--DSSTARVTGFNVVAALLWRCKALS---GPSD  289

Query  651   SDRLSTVLFAVDIRRRLNPPLPDSYSGNAVLTGYGSAKCAELEEGPFWKTVQMVYEGAAR  472
              DR ST+L+AVDIR RLNPPLP SY GNAVLT Y +AKC ELE+G F + V+MV EG+ R
Sbjct  290   PDRSSTILYAVDIRSRLNPPLPKSYVGNAVLTAYATAKCEELEKGKFSRLVEMVCEGSIR  349

Query  471   MTDEYARSAIDWGELYKGFPHGEFLVSSWWRLGFEGVQFPWGKPKYSCPVVYHRKDIILL  292
             M DEYARS IDWGELY GFP+GE LVSSWWRLGFE VQ+PWGKPKY CP+VYHRKDIILL
Sbjct  350   MNDEYARSIIDWGELYDGFPNGEVLVSSWWRLGFEEVQYPWGKPKYCCPMVYHRKDIILL  409

Query  291   FPDIDNGGKSNSGVNVLVALPPKEMEKFKSLFHKFL  184
             FP    G   + GVN++VALPPKEM+KF++LFH FL
Sbjct  410   FPPFHEGDARDDGVNIIVALPPKEMDKFQTLFHNFL  445



>ref|XP_011014891.1| PREDICTED: omega-hydroxypalmitate O-feruloyl transferase-like 
[Populus euphratica]
Length=468

 Score =   562 bits (1448),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 278/446 (62%), Positives = 350/446 (78%), Gaps = 13/446 (3%)
 Frame = -3

Query  1512  EDLKVTILDSGLIFPSQETT-KHTMFLSNIDKVLNFDVQTVHFFPASPGFPPEIVAGKIK  1336
             +DLKVTI +S L+FP+QET  + +MFLSNID+VLNF+V+TVHFF +   FPP+ VA KIK
Sbjct  33    QDLKVTIQNSSLVFPNQETAQRKSMFLSNIDQVLNFNVETVHFFASHEDFPPQTVAEKIK  92

Query  1335  NAFRRLLVANTYDFLAGRLKKNKESERVEIECNAAGAGFTVASSEFALEDIGDLVYPNPA  1156
             +A  ++LV   YDFLAGRLK N  + R+E++CN AGAGF VASSE  L++IGDLVYPN A
Sbjct  93    DALEKILVP--YDFLAGRLKLNARTGRLEVDCNGAGAGFVVASSECTLDEIGDLVYPNAA  150

Query  1155  FRQLVTMSFDF-VAKEDQPLCFLQVTSFKCGGFALGTSMNHISFDGSGFKMFLENLAALS  979
             F +LV  S D  + K+ + LC +QVTSFKCGGFA+G S +H +FDG  FK FL+NLAAL+
Sbjct  151   FAKLVVNSSDHSLEKDGKLLCIIQVTSFKCGGFAMGISTSHATFDGISFKTFLQNLAALA  210

Query  978   FNDDGPLAVVPCNDRSLLAARSPPQVTFPHPELLKVNLPAGEEMAPPVFDSLKDDLAFEI  799
                  PLAV PCNDR LLAARSPP+VTFPHPEL+K+    G+E+  PVFD+  + L F+I
Sbjct  211   --GGKPLAVTPCNDRELLAARSPPRVTFPHPELVKLQTHLGQELNAPVFDAAHEALDFKI  268

Query  798   FQLSSADIERLKDKAKAPDNVKTKVTGFNVLTAAIWRCKALSCLGGENNSDRLSTVLFAV  619
             F+L+S ++  +K+KAK   +   +V+GFNV+TA IWRCKALS    ++  DR+ST+L+AV
Sbjct  269   FRLTSGNVSDMKEKAKT--SPSARVSGFNVVTAHIWRCKALSQPEAQD-PDRVSTILYAV  325

Query  618   DIRRRLNPPLPDSYSGNAVLTGYGSAKCAELEEGPFWKTVQMVYEGAARMTDEYARSAID  439
             +IR RL PPLP+SY+GNAVLT Y +A C EL+EGP  K V+ V EG+ RMTDEY RSAID
Sbjct  326   NIRPRLIPPLPESYAGNAVLTAYANATCKELQEGPISKLVERVAEGSKRMTDEYVRSAID  385

Query  438   WGELYKGFPHGEFLVSSWWRLGFEGVQFPWGKPKYSCPVVYHRKDIILLFPDIDNGGKSN  259
             WGE++KGFPHG+FLVSSWW+LGF+ V++PWG P+YSCPVVYHRKDIILLFPDID+     
Sbjct  386   WGEIHKGFPHGDFLVSSWWKLGFDEVEYPWGCPRYSCPVVYHRKDIILLFPDIDD----K  441

Query  258   SGVNVLVALPPKEMEKFKSLFHKFLA  181
             + VNVLVALP KEMEKF+SLFHKFL+
Sbjct  442   NSVNVLVALPSKEMEKFESLFHKFLS  467



>ref|XP_010038444.1| PREDICTED: omega-hydroxypalmitate O-feruloyl transferase [Eucalyptus 
grandis]
 gb|KCW84609.1| hypothetical protein EUGRSUZ_B01441 [Eucalyptus grandis]
Length=463

 Score =   561 bits (1445),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 286/467 (61%), Positives = 345/467 (74%), Gaps = 15/467 (3%)
 Frame = -3

Query  1548  MGALYLKPETLHEDLKVTILDSGLIFPSQETTKHTMFLSNIDKVLNFDVQTVHFFPASPG  1369
             MG LY +P  L +DL+VT+ D+ L+FPS+       FLSNIDKVLNFDVQT+HFFPA   
Sbjct  1     MGTLYQEPPRLIQDLRVTVHDTSLVFPSKPVPNKPFFLSNIDKVLNFDVQTIHFFPAHVE  60

Query  1368  FPPEIVAGKIKNAFRRLLVANTYDFLAGRLKKNKESERVEIECNAAGAGFTVASSEFALE  1189
             FPP+ V   +K A  ++LV   Y+FL+GRLK N  S R+EIECN+ G GF VASSE +L+
Sbjct  61    FPPDKVTETLKVALAKILVH--YEFLSGRLKFNAASGRLEIECNSEGVGFVVASSECSLD  118

Query  1188  DIGDLVYPNPAFRQLVTMSFDFVAKEDQPLCFLQVTSFKCGGFALGTSMNHISFDGSGFK  1009
             D+GDLVYPNPAF +LVT S D +  ++QPLC +QVTSF CGGF +G S NH +FDG  FK
Sbjct  119   DVGDLVYPNPAFERLVTKSMDILQPDNQPLCIVQVTSFTCGGFVMGISTNHGTFDGLSFK  178

Query  1008  MFLENLAALSFNDDGPLAVVPCNDRSLLAARSPPQVTFPHPELLKVNLPAGEEMAPP-VF  832
             MFL+NLAAL+   D PLAV PCNDR LLAARSPPQ++FPHPELLK+++  G++ + P VF
Sbjct  179   MFLQNLAALA--ADKPLAVDPCNDRRLLAARSPPQISFPHPELLKLDVAPGQDSSRPLVF  236

Query  831   DSLKDDLAFEIFQLSSADIERLKDKAK----APDNV--KTKVTGFNVLTAAIWRCKALS-  673
                 +DL F+IF+LS  DI  LK+KA      P +   K +VTGFNV+TA IWRCKALS 
Sbjct  237   KDTPEDLDFKIFKLSPKDIAHLKEKAAKDAGGPGSPYPKARVTGFNVVTAHIWRCKALSS  296

Query  672   CLGGENNSD--RLSTVLFAVDIRRRLNPPLPDSYSGNAVLTGYGSAKCAELEEGPFWKTV  499
             C G ++ S   R ST+L+AVDIR RL PPLP  Y+GNAVLT Y +  C ELEE P  + V
Sbjct  297   CDGTDDGSSKSRSSTLLYAVDIRPRLEPPLPRGYAGNAVLTAYATVTCGELEEWPLGRLV  356

Query  498   QMVYEGAARMTDEYARSAIDWGELYKGFPHGEFLVSSWWRLGFEGVQFPWGKPKYSCPVV  319
             +MV EGA RMTD+YARS IDWGE+  GFPHGE LVSSWWRLGF  V++PWG+P+YSCP+V
Sbjct  357   EMVTEGAGRMTDKYARSVIDWGEVNVGFPHGEVLVSSWWRLGFTDVEYPWGRPRYSCPLV  416

Query  318   YHRKDIILLFPD-IDNGGKSNSGVNVLVALPPKEMEKFKSLFHKFLA  181
             YHRKDIILLFPD I        GVNVLVALP  EM KF+SLFHKFLA
Sbjct  417   YHRKDIILLFPDMITTSPNGGDGVNVLVALPGPEMAKFQSLFHKFLA  463



>ref|XP_002316174.2| hypothetical protein POPTR_0010s18710g [Populus trichocarpa]
 gb|EEF02345.2| hypothetical protein POPTR_0010s18710g [Populus trichocarpa]
Length=468

 Score =   561 bits (1445),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 281/459 (61%), Positives = 351/459 (76%), Gaps = 13/459 (3%)
 Frame = -3

Query  1551  IMGALYLKPETLHEDLKVTILDSGLIFPSQETT-KHTMFLSNIDKVLNFDVQTVHFFPAS  1375
             IMG    +     +DLKVTI +S L+FP+ ET  + +MFLSNID+VLNF+V+TVHFF + 
Sbjct  20    IMGIQCQETPPPLQDLKVTIQNSSLVFPNHETAQRKSMFLSNIDQVLNFNVETVHFFASH  79

Query  1374  PGFPPEIVAGKIKNAFRRLLVANTYDFLAGRLKKNKESERVEIECNAAGAGFTVASSEFA  1195
               FPP+ VA KIK+A  ++LV   YDFLAGRLK N  + R+E++CN AGAGF VASSE  
Sbjct  80    EDFPPQTVAEKIKDALEKILVP--YDFLAGRLKSNARTGRLEVDCNGAGAGFVVASSECT  137

Query  1194  LEDIGDLVYPNPAFRQLVTMSFDF-VAKEDQPLCFLQVTSFKCGGFALGTSMNHISFDGS  1018
             L++IGDLVYPN AF +LV  S D  + K+ + LC +QVTSFKCGGFA+G S +H +FDG 
Sbjct  138   LDEIGDLVYPNAAFAKLVVNSSDHSLEKDGKLLCIIQVTSFKCGGFAMGISTSHATFDGI  197

Query  1017  GFKMFLENLAALSFNDDGPLAVVPCNDRSLLAARSPPQVTFPHPELLKVNLPAGEEMAPP  838
              FK+FL+NLAAL+     PLAV PCNDR LLAARSPP+VTFPHPEL+K+    G+E+  P
Sbjct  198   SFKIFLQNLAALA--GGKPLAVTPCNDRELLAARSPPRVTFPHPELVKLQTHLGQELNAP  255

Query  837   VFDSLKDDLAFEIFQLSSADIERLKDKAKAPDNVKTKVTGFNVLTAAIWRCKALSCLGGE  658
             VFD  ++ L F+IF+L+S +   +K+KAK   +   +V+GFNV+TA IWRCKALS     
Sbjct  256   VFDDAQEALDFKIFRLTSGNFSDMKEKAKT--SPSARVSGFNVVTAHIWRCKALS-QSEA  312

Query  657   NNSDRLSTVLFAVDIRRRLNPPLPDSYSGNAVLTGYGSAKCAELEEGPFWKTVQMVYEGA  478
              + DR+ST+L+AV+IR RL PPLP+SYSGNAVLT Y +A C EL EGP  K V+ V EG+
Sbjct  313   QDPDRVSTILYAVNIRPRLTPPLPESYSGNAVLTAYANATCKELREGPISKLVERVAEGS  372

Query  477   ARMTDEYARSAIDWGELYKGFPHGEFLVSSWWRLGFEGVQFPWGKPKYSCPVVYHRKDII  298
              RMTDEYARSAIDWGE++KGFPHG+FL+SSWW+LGF+ V +PWG P+YSCPVVYHRKDII
Sbjct  373   KRMTDEYARSAIDWGEIHKGFPHGDFLLSSWWKLGFDEVDYPWGCPRYSCPVVYHRKDII  432

Query  297   LLFPDIDNGGKSNSGVNVLVALPPKEMEKFKSLFHKFLA  181
             LLFPDID+     + VNVLVALP KEMEKF+SLFHKFL+
Sbjct  433   LLFPDIDD----KNSVNVLVALPCKEMEKFESLFHKFLS  467



>ref|XP_007151622.1| hypothetical protein PHAVU_004G062600g [Phaseolus vulgaris]
 gb|ESW23616.1| hypothetical protein PHAVU_004G062600g [Phaseolus vulgaris]
Length=449

 Score =   554 bits (1427),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 274/452 (61%), Positives = 346/452 (77%), Gaps = 16/452 (4%)
 Frame = -3

Query  1527  PETLHEDLKVTILDSGLIFPSQETTKHTMFLSNIDKVLNFDVQTVHFFPASPGFPPEIVA  1348
             P  L EDLKVTI +  +IFPS+E  + +MF+SNIDKVL FDV+TVHFF A   FPP +V+
Sbjct  10    PTPLLEDLKVTIENCSMIFPSKEIQRKSMFVSNIDKVLTFDVETVHFFGAHRDFPPHLVS  69

Query  1347  GKIKNAFRRLLVANTYDFLAGRLKKNKESERVEIECNAAGAGFTVASSEFALEDIGDLVY  1168
              ++KNA    LV   Y+FL GRLK   ES+R+EI+C++ GAGF VASSE+ L+ IGDL Y
Sbjct  70    ERLKNALEDALV--VYEFLGGRLKVCHESKRLEIDCSSEGAGFVVASSEYKLDQIGDLDY  127

Query  1167  PNPAFRQLVTMSFDFVAKEDQPLCFLQVTSFKCGGFALGTSMNHISFDGSGFKMFLENLA  988
             PN AF QLV  +  F+ ++D PLC +QVTSFKCGGFA+G S +H +FDG  FK FLEN+A
Sbjct  128   PNTAFAQLVHKNKSFLREDDDPLCVVQVTSFKCGGFAIGISTSHTTFDGLSFKSFLENIA  187

Query  987   ALSFNDDGPLAVVPCNDRSLLAARSPPQVTFPHPELLKVN-LPAGEEMAPPVFDSLKDDL  811
             AL+ N   PLAV PCNDR LLAARSPP+VTFPHPE+LK+N LP        +F++  ++L
Sbjct  188   ALAANK--PLAVTPCNDRHLLAARSPPRVTFPHPEMLKLNDLPNSN-----IFEASTEEL  240

Query  810   AFEIFQLSSADIERLKDKAK--APDNVKTKVTGFNVLTAAIWRCKALSCLGGENNSDRLS  637
              F++F+L+S DI +LK++A+     +  T++TGFN +TA IWRCKALSC  G++N +++S
Sbjct  241   RFKVFKLTSNDIAKLKEEARDSVGGDTTTRITGFNAITAHIWRCKALSC-DGDSNPNKVS  299

Query  636   TVLFAVDIRRRLNPPLPDSYSGNAVLTGYGSAKCAELEEGPFWKTVQMVYEGAARMTDEY  457
             T+L+AVDIR RL PPLP SY+GNAVLT Y +A C ELEE PF + V+ V EGA RM++EY
Sbjct  300   TILYAVDIRSRLEPPLPKSYTGNAVLTAYATATCRELEEWPFMRLVERVVEGATRMSNEY  359

Query  456   ARSAIDWGELYKGFPHGEFLVSSWWRLGFEGVQFPWGKPKYSCPVVYHRKDIILLFPDID  277
             ARS IDWGE+ KGFP+GE LVSSWWRLGFE V++PWGKPKY CP+VYHRKDIILLFP +D
Sbjct  360   ARSIIDWGEINKGFPNGEVLVSSWWRLGFEEVEYPWGKPKYCCPLVYHRKDIILLFPPVD  419

Query  276   NGGKSNSGVNVLVALPPKEMEKFKSLFHKFLA  181
              GG    GV+V+VALPPKEM+KF  LF+KFL 
Sbjct  420   GGG---DGVSVIVALPPKEMDKFYGLFNKFLG  448



>gb|KHG26258.1| Omega-hydroxypalmitate O-feruloyl transferase -like protein [Gossypium 
arboreum]
Length=449

 Score =   552 bits (1423),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 273/451 (61%), Positives = 344/451 (76%), Gaps = 18/451 (4%)
 Frame = -3

Query  1527  PETLHEDLKVTILDSGLIFPSQET-TKHTMFLSNIDKVLNFDVQTVHFFPASPGFPPEIV  1351
             P TL +DLK+T  +  LIFPS++T  K +MFLSNID+VLNF V+TVHFF +   FPP + 
Sbjct  9     PATLIQDLKITTQNVSLIFPSRKTERKKSMFLSNIDRVLNFPVETVHFFRSHEDFPPHVA  68

Query  1350  AGKIKNAFRRLLVANTYDFLAGRLKKNKESERVEIECNAAGAGFTVASSEFALEDIGDLV  1171
             A K+K A   LLV   YDFLAGRL+ N E+ R+EI+CN+AG GF VASS++AL+D+GDLV
Sbjct  69    AEKLKTALSELLVP--YDFLAGRLRSNPETGRLEIDCNSAGIGFAVASSDYALDDVGDLV  126

Query  1170  YPNPAFRQLVTMSFDFVAKEDQPLCFLQVTSFKCGGFALGTSMNHISFDGSGFKMFLENL  991
             YPNPAF QL+  S D + ++DQPLC +QVTSF+CGGFA G   NH++FDG  FK+FL+NL
Sbjct  127   YPNPAFGQLICKSVDSLEQDDQPLCIVQVTSFRCGGFATGIVTNHVTFDGLSFKIFLDNL  186

Query  990   AALSFNDDGPLAVVPCNDRSLLAARSPPQVTFPHPELLKVNLPAGEEMAPPVFDSLKDDL  811
             AA++   + PLAV PCNDR LLAARSPP VTFPH EL K +     +  PPV D+    L
Sbjct  187   AAVT--AEKPLAVTPCNDRLLLAARSPPCVTFPHHELDKFH-----DSNPPVIDATSQAL  239

Query  810   AFEIFQLSSADIERLKDKAKAP----DNVKTKVTGFNVLTAAIWRCKALSCLGGENNSDR  643
              F++F+L+S +I  LK+KAKA          ++TGFNV+TA +W CKALS    E+N DR
Sbjct  240   DFKVFRLTSDNIANLKEKAKASAIGSHVSDARITGFNVVTALVWHCKALSWDNKESNLDR  299

Query  642   LSTVLFAVDIRRRLNPPLPDSYSGNAVLTGYGSAKCAELEEGPFWKTVQMVYEGAARMTD  463
             +ST+L+AV+IR RL PPLP SY+GNAVLT Y  A C E++E PF + V++V EGA RMTD
Sbjct  300   VSTLLYAVNIRPRLIPPLPMSYTGNAVLTAYARATCKEIDEAPFSRLVELVTEGAKRMTD  359

Query  462   EYARSAIDWGELYKGFPHGEFLVSSWWRLGFEGVQFPWGKPKYSCPVVYHRKDIILLFPD  283
             EYARSAIDWG++Y+GFP+GEFLVSSWW+LGF+ V++PWG+PKYSCPVV+ RKDIIL FPD
Sbjct  360   EYARSAIDWGDIYQGFPNGEFLVSSWWKLGFDEVEYPWGRPKYSCPVVFQRKDIILFFPD  419

Query  282   IDNGGKSNSGVNVLVALPPKEMEKFKSLFHK  190
             ID+    N+GVNVLV+LP KEM KFK+LFHK
Sbjct  420   IDD----NNGVNVLVSLPSKEMSKFKTLFHK  446



>ref|XP_003548796.1| PREDICTED: omega-hydroxypalmitate O-feruloyl transferase-like 
[Glycine max]
Length=447

 Score =   550 bits (1417),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 271/456 (59%), Positives = 342/456 (75%), Gaps = 11/456 (2%)
 Frame = -3

Query  1548  MGALYLKPETLHEDLKVTILDSGLIFPSQETTKHTMFLSNIDKVLNFDVQTVHFFPASPG  1369
             MG   L+   + +D +VTIL++ ++FPS+ET K ++FLSNIDKVLNF+V+TVHFF A+  
Sbjct  1     MGTTCLESPPILQDPRVTILETSMVFPSKETEKRSLFLSNIDKVLNFEVETVHFFGANED  60

Query  1368  FPPEIVAGKIKNAFRRLLVANTYDFLAGRLKKNKESERVEIECNAAGAGFTVASSEFALE  1189
             FPP  VA   KNA    LV   YDFL GRL  N E++R+EI+CN  GAGF VASSE+ L 
Sbjct  61    FPPAKVAKMFKNALEEALV--VYDFLGGRLNLNPETKRLEIDCNGKGAGFVVASSEYKLS  118

Query  1188  DIGDLVYPNPAFRQLVTMSFDFVAKEDQPLCFLQVTSFKCGGFALGTSMNHISFDGSGFK  1009
             +IGDLVYPNPAF Q V  S DFV + DQPLC  Q+TSFKCGGFA+G + +H +FDG  FK
Sbjct  119   EIGDLVYPNPAFAQFVQKSKDFVQQNDQPLCVAQLTSFKCGGFAIGFTTSHTTFDGLSFK  178

Query  1008  MFLENLAALSFNDDGPLAVVPCNDRSLLAARSPPQVTFPHPELLKVN-LPAGEEMAPPVF  832
              FL+NLAAL+ N   PLAV+PC+DR LLAARSPP+V+FPHPEL+K++ LP G   +  VF
Sbjct  179   TFLDNLAALAANK--PLAVIPCHDRHLLAARSPPRVSFPHPELIKLDKLPTGSTESG-VF  235

Query  831   DSLKDDLAFEIFQLSSADIERLKDKAKAPDNVKTKVTGFNVLTAAIWRCKALSCLGGENN  652
             ++  ++L F++FQL+S +I  LK+KAK   N +   TGFNV+TA +WRCKALS      +
Sbjct  236   EATNEELNFKVFQLTSHNILSLKEKAKGSTNARA--TGFNVITAHLWRCKALS---APYD  290

Query  651   SDRLSTVLFAVDIRRRLNPPLPDSYSGNAVLTGYGSAKCAELEEGPFWKTVQMVYEGAAR  472
               R S +L+A+DIR RL PPLP S++GNAVLT Y  AKC ELE+  F + V+MV EGA R
Sbjct  291   PSRSSIILYAMDIRPRLKPPLPKSFAGNAVLTAYAIAKCEELEKEEFSRLVEMVTEGAKR  350

Query  471   MTDEYARSAIDWGELYKGFPHGEFLVSSWWRLGFEGVQFPWGKPKYSCPVVYHRKDIILL  292
             M+DEYARS IDWGE++ GFPHGE LVSSWWRLGFE V++PWGKPKY CPVVYHRKDIIL+
Sbjct  351   MSDEYARSMIDWGEVHSGFPHGEVLVSSWWRLGFEEVEYPWGKPKYCCPVVYHRKDIILV  410

Query  291   FPDIDNGGKSNSGVNVLVALPPKEMEKFKSLFHKFL  184
             FP        + G+N++VALPPKEM+KF++LF+ FL
Sbjct  411   FPPFGGSSGDDDGINIIVALPPKEMDKFENLFYMFL  446



>ref|XP_003548930.1| PREDICTED: omega-hydroxypalmitate O-feruloyl transferase [Glycine 
max]
Length=457

 Score =   549 bits (1415),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 277/455 (61%), Positives = 343/455 (75%), Gaps = 17/455 (4%)
 Frame = -3

Query  1527  PETLHEDLKVTILDSGLIFPSQETTKHTMFLSNIDKVLNFDVQTVHFFPASPGFPPEIVA  1348
             P  L +DLKVTI ++ +IFPS+E  + ++FLSNIDKVLNFDV+TVHFF A   FPP +V 
Sbjct  12    PPPLLKDLKVTIHNASMIFPSKEIERKSLFLSNIDKVLNFDVETVHFFGAHKDFPPHVVN  71

Query  1347  GKIKNAFRRLLVANTYDFLAGRLKKNKESERVEIECNAAGAGFTVASSEFALEDIGDLVY  1168
              ++KNA    LV   YDFL GRLK N +++R+E++CN  GAGF VASSE+ L+ IGDL Y
Sbjct  72    ERLKNALEDALVV--YDFLGGRLKLNYDTKRLEMDCNPEGAGFVVASSEYNLDQIGDLDY  129

Query  1167  PNPAFRQLVTMSFDFVAKEDQPLCFLQVTSFKCGGFALGTSMNHISFDGSGFKMFLENLA  988
             PNPAF QLV  + DF+   D PLC  QVTSFKCGGFA+G S +H +FDG  FK FL+N+A
Sbjct  130   PNPAFAQLVHQNKDFLKDGDVPLCVAQVTSFKCGGFAIGISTSHTTFDGLSFKTFLDNIA  189

Query  987   ALSFNDDGPLAVVPCNDRSLLAARSPPQVTFPHPELLKVN--LPAGEEMAPPVFDSLKDD  814
             +++     PLAV PC+DR LLAARSPP+VTFPHPE+LK++  LP   E    +F++  + 
Sbjct  190   SIAAKK--PLAVTPCHDRHLLAARSPPRVTFPHPEMLKLSDQLPTCPESN--IFEASTEQ  245

Query  813   LAFEIFQLSSADIERLKDKAKAPD---NVKTK-VTGFNVLTAAIWRCKALSCLGGENNSD  646
             L F++F+L+S DI +LK++A+       + TK VTGFNV+TA IWRCKALSC   EN  +
Sbjct  246   LDFKVFKLTSNDITKLKEEARNSSISGGLSTKCVTGFNVITAYIWRCKALSCYNDEN-PN  304

Query  645   RLSTVLFAVDIRRRLNPPLPDSYSGNAVLTGYGSAKCAELEEGPFWKTVQMVYEGAARMT  466
             R ST+L+AVDIR RLNPPLP SY+GNAVLT Y +AKC ELEE PF K V+MV EGA RMT
Sbjct  305   RSSTILYAVDIRSRLNPPLPKSYAGNAVLTAYATAKCKELEEWPFMKLVEMVREGATRMT  364

Query  465   DEYARSAIDWGELYKGFPHGEFLVSSWWRLGFEGVQFPWGKPKYSCPVVYHRKDIILLFP  286
             +EYARS IDWGE+  GFP+GE LVSSWWRLGFE V++PWGKPKY CPVVYH+KDIILLFP
Sbjct  365   NEYARSIIDWGEINNGFPNGEVLVSSWWRLGFEEVEYPWGKPKYCCPVVYHKKDIILLFP  424

Query  285   DIDNGGKSNSGVNVLVALPPKEMEKFKSLFHKFLA  181
              +  G     GV+++VALPPKEMEKF  LF+KFL 
Sbjct  425   PVGGG----EGVSIIVALPPKEMEKFHGLFNKFLT  455



>ref|XP_003553994.1| PREDICTED: omega-hydroxypalmitate O-feruloyl transferase-like 
[Glycine max]
Length=444

 Score =   548 bits (1412),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 275/456 (60%), Positives = 344/456 (75%), Gaps = 14/456 (3%)
 Frame = -3

Query  1548  MGALYLKPETLHEDLKVTILDSGLIFPSQETTKHTMFLSNIDKVLNFDVQTVHFFPASPG  1369
             MG    +   L +DL+VTI ++ ++FPS+ET K ++FLSNIDKVLNF+V+TVHFF A+  
Sbjct  1     MGTTCPESPPLLQDLRVTIHETSMVFPSKETEKRSLFLSNIDKVLNFEVETVHFFGANKD  60

Query  1368  FPPEIVAGKIKNAFRRLLVANTYDFLAGRLKKNKESERVEIECNAAGAGFTVASSEFALE  1189
             FPP+ VA   KNA    LV   YDFL GRL  N E++R+EI+CNA GAGF VASSE+ L 
Sbjct  61    FPPQKVAKMFKNALEDALV--VYDFLGGRLNLNPETKRLEIDCNAKGAGFVVASSEYKLS  118

Query  1188  DIGDLVYPNPAFRQLVTMSFDFVAKEDQPLCFLQVTSFKCGGFALGTSMNHISFDGSGFK  1009
             +IG LVYPNP+F Q V  S DF+ + DQPLC  Q+TSFKCGGFA+G + +H +FDG  FK
Sbjct  119   EIGHLVYPNPSFAQFVHKSKDFLQQNDQPLCVAQLTSFKCGGFAIGFTTSHTTFDGLSFK  178

Query  1008  MFLENLAALSFNDDGPLAVVPCNDRSLLAARSPPQVTFPHPELLKV-NLPAGEEMAPPVF  832
              FL+NLAAL+ N   PLAV+PC+DR LLAARSPP+V+FPH EL+K+ NLP G   +  VF
Sbjct  179   TFLDNLAALAANK--PLAVIPCHDRHLLAARSPPRVSFPHHELIKLDNLPTGSTESS-VF  235

Query  831   DSLKDDLAFEIFQLSSADIERLKDKAKAPDNVKTKVTGFNVLTAAIWRCKALSCLGGENN  652
             ++ K++L F++FQL+S +I  LK+KAK   N +   TGFNV+TA IWRCKALS      N
Sbjct  236   EASKEELDFKVFQLTSHNILSLKEKAKGSTNAR--ATGFNVITAHIWRCKALS---APYN  290

Query  651   SDRLSTVLFAVDIRRRLNPPLPDSYSGNAVLTGYGSAKCAELEEGPFWKTVQMVYEGAAR  472
               R ST+L+AVDIR RLNPPLP S++GNAVLT Y +AK  ELE+G F   V MV EGA R
Sbjct  291   PSRSSTILYAVDIRPRLNPPLPKSFAGNAVLTAYATAKWEELEKGEFSSLVGMVTEGAKR  350

Query  471   MTDEYARSAIDWGELYKGFPHGEFLVSSWWRLGFEGVQFPWGKPKYSCPVVYHRKDIILL  292
             M+DEY RS IDWGE++ GFPHGE LVSSWWRLGFE V++PWGKPKY CPVVYHRKDIIL+
Sbjct  351   MSDEYTRSMIDWGEVHSGFPHGEVLVSSWWRLGFEEVEYPWGKPKYCCPVVYHRKDIILV  410

Query  291   FPDIDNGGKSNSGVNVLVALPPKEMEKFKSLFHKFL  184
             FP   +G   + G+N++VALPPKEM+KF++LF+ FL
Sbjct  411   FPPFGSG---DDGINIIVALPPKEMDKFETLFYMFL  443



>gb|KHN46377.1| Omega-hydroxypalmitate O-feruloyl transferase [Glycine soja]
Length=444

 Score =   545 bits (1405),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 274/456 (60%), Positives = 343/456 (75%), Gaps = 14/456 (3%)
 Frame = -3

Query  1548  MGALYLKPETLHEDLKVTILDSGLIFPSQETTKHTMFLSNIDKVLNFDVQTVHFFPASPG  1369
             MG    +   L +DL+VTI ++ ++FPS+ET K ++FLSNIDKVLNF+V+TVHFF A+  
Sbjct  1     MGTTCPESPPLLQDLRVTIHETSMVFPSKETEKRSLFLSNIDKVLNFEVETVHFFGANKD  60

Query  1368  FPPEIVAGKIKNAFRRLLVANTYDFLAGRLKKNKESERVEIECNAAGAGFTVASSEFALE  1189
             FPP+ VA   KNA    LV   YDFL GRL  N E++R+EI+CNA GAGF VASSE+ L 
Sbjct  61    FPPQKVAKMFKNALEDALVV--YDFLGGRLNLNPETKRLEIDCNAKGAGFVVASSEYKLS  118

Query  1188  DIGDLVYPNPAFRQLVTMSFDFVAKEDQPLCFLQVTSFKCGGFALGTSMNHISFDGSGFK  1009
             +IG LVYPNP+F Q V  S DF+ + DQPLC  Q+TSFKCGGFA+G + +H +FDG  FK
Sbjct  119   EIGHLVYPNPSFAQFVHKSKDFLQQNDQPLCVAQLTSFKCGGFAIGFTTSHTTFDGLSFK  178

Query  1008  MFLENLAALSFNDDGPLAVVPCNDRSLLAARSPPQVTFPHPELLKV-NLPAGEEMAPPVF  832
              FL+NLAAL+ N   PL V+PC+DR LLAARSPP+V+FPH EL+K+ NLP G   +  VF
Sbjct  179   TFLDNLAALAANK--PLPVIPCHDRHLLAARSPPRVSFPHHELIKLDNLPTGSTESS-VF  235

Query  831   DSLKDDLAFEIFQLSSADIERLKDKAKAPDNVKTKVTGFNVLTAAIWRCKALSCLGGENN  652
             ++ K++L F++FQL+S +I  LK+KAK   N +   TGFNV+TA IWRCKALS      N
Sbjct  236   EASKEELDFKVFQLTSHNILSLKEKAKGSTNAR--ATGFNVITAHIWRCKALS---APYN  290

Query  651   SDRLSTVLFAVDIRRRLNPPLPDSYSGNAVLTGYGSAKCAELEEGPFWKTVQMVYEGAAR  472
               R ST+L+AVDIR RLNPPLP S++GNAVLT Y +AK  ELE+G F   V MV EGA R
Sbjct  291   PSRSSTILYAVDIRPRLNPPLPKSFAGNAVLTAYATAKWEELEKGEFSSLVGMVTEGAKR  350

Query  471   MTDEYARSAIDWGELYKGFPHGEFLVSSWWRLGFEGVQFPWGKPKYSCPVVYHRKDIILL  292
             M+DEY RS IDWGE++ GFPHGE LVSSWWRLGFE V++PWGKPKY CPVVYHRKDIIL+
Sbjct  351   MSDEYTRSMIDWGEVHSGFPHGEVLVSSWWRLGFEEVEYPWGKPKYCCPVVYHRKDIILV  410

Query  291   FPDIDNGGKSNSGVNVLVALPPKEMEKFKSLFHKFL  184
             FP   +G   + G+N++VALPPKEM+KF++LF+ FL
Sbjct  411   FPPFGSG---DDGINIIVALPPKEMDKFETLFYMFL  443



>ref|XP_009361568.1| PREDICTED: omega-hydroxypalmitate O-feruloyl transferase [Pyrus 
x bretschneideri]
Length=499

 Score =   543 bits (1398),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 278/483 (58%), Positives = 350/483 (72%), Gaps = 39/483 (8%)
 Frame = -3

Query  1527  PETLHEDLKVTILDSGLIFPSQETTKHTMFLSNIDKVLNFDVQTVHFFPASPGFPP-EIV  1351
             P +L +DLKVT+  S L+FPSQ+T K TMFLSNID+VLNFDV +VHFF A   FP  +I 
Sbjct  19    PHSLLQDLKVTVHHSSLVFPSQQTQKRTMFLSNIDQVLNFDVHSVHFFGAHKDFPDGQIA  78

Query  1350  AGKIKNAFRRLLVANTYDFLAGRLKKNKESERVEIECNAAGAGFTVASSEFALEDIGDLV  1171
             A K++++  ++LV   YDFLAGRLK N  + R+EIECN AGAGF VASSE+AL++IGDLV
Sbjct  79    AEKLRDSLAKILVP--YDFLAGRLKVNPNTGRLEIECNGAGAGFVVASSEYALDEIGDLV  136

Query  1170  YPNPAFRQLVTMSFDF---------VAKED-----QPLCFLQVTSFKCGGFALGTSMNHI  1033
             YPN AF QLV  + D             +D     QPL  LQVT+FKCGGFA+G S NH 
Sbjct  137   YPNSAFAQLVCSAMDHDQLLKLTAGAVGDDHDGLRQPLFILQVTTFKCGGFAMGISNNHA  196

Query  1032  SFDGSGFKMFLENLAALSFNDDGPLAVVPCNDRSLLAARSPPQVTFPHPELLKV-NLP--  862
             +FDG  F++FL+NLAAL+ N   PLAV+P NDR +LAARSPP+VTF HPEL ++ N+   
Sbjct  197   TFDGISFRLFLDNLAALAANK--PLAVIPYNDRQILAARSPPRVTFIHPELQELENISTL  254

Query  861   ----------AGEEMAPPVFDSLKDDLAFEIFQLSSADIERLKDKAKA---PDNVKTKVT  721
                        G +  P VF++ +++L F+IF+L+++DI  LK+KAK+       + K+T
Sbjct  255   ERKQEDELEVGGHDTHPTVFEATQEELDFKIFRLTASDIAHLKEKAKSVASSTKERVKIT  314

Query  720   GFNVLTAAIWRCKALS--CLGGENNSDRLSTVLFAVDIRRRLNPPLPDSYSGNAVLTGYG  547
              F+V+TA IWRCKALS      ++   R S +L+AVDIR+RLNPPLP  Y+GN VLT Y 
Sbjct  315   SFSVVTALIWRCKALSSSTYVDDHGESRESRILYAVDIRQRLNPPLPQGYTGNGVLTAYA  374

Query  546   SAKCAELEEGPFWKTVQMVYEGAARMTDEYARSAIDWGELYKGFPHGEFLVSSWWRLGFE  367
             SA C ELEEGPF + V+MV EGAARMTDEYARS IDWGEL KGFP+GE LVSSWWRLGF 
Sbjct  375   SAGCRELEEGPFSRAVEMVSEGAARMTDEYARSVIDWGELRKGFPNGEVLVSSWWRLGFA  434

Query  366   GVQFPWGKPKYSCPVVYHRKDIILLFP--DIDNGGKSNSGVNVLVALPPKEMEKFKSLFH  193
              V++PWGKP+YSCPVVYHRKDIIL FP  D+ + G + +GVN+LVALP +EM+KF++LF 
Sbjct  435   DVEYPWGKPRYSCPVVYHRKDIILFFPEQDVPDNGTNGTGVNILVALPHREMQKFQALFQ  494

Query  192   KFL  184
             KFL
Sbjct  495   KFL  497



>ref|XP_008370853.1| PREDICTED: omega-hydroxypalmitate O-feruloyl transferase [Malus 
domestica]
Length=499

 Score =   541 bits (1394),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 279/483 (58%), Positives = 348/483 (72%), Gaps = 39/483 (8%)
 Frame = -3

Query  1527  PETLHEDLKVTILDSGLIFPSQETTKHTMFLSNIDKVLNFDVQTVHFFPASPGFPP-EIV  1351
             P +L +DLKVT+  S L+FPSQ+T K TMFLSNID+VLNFDV +VHFF A   FP  +I 
Sbjct  19    PHSLLQDLKVTVHHSSLVFPSQQTQKRTMFLSNIDQVLNFDVHSVHFFGAHKDFPDGQIA  78

Query  1350  AGKIKNAFRRLLVANTYDFLAGRLKKNKESERVEIECNAAGAGFTVASSEFALEDIGDLV  1171
             A K++++  ++LV   YDFLAGRLK N  + R+EIECN AGAGF VASSE+AL++IGDLV
Sbjct  79    AEKLRDSLAKILVP--YDFLAGRLKVNPNTGRLEIECNGAGAGFVVASSEYALDEIGDLV  136

Query  1170  YPNPAFRQLVTMSFDF---------VAKED-----QPLCFLQVTSFKCGGFALGTSMNHI  1033
             YPN AF QLV  + D             +D     QPL  LQVT+FKCGGFA+G S NH 
Sbjct  137   YPNSAFAQLVCSAMDHDQLLKLTDGAVGDDHDGLRQPLFILQVTTFKCGGFAMGISNNHA  196

Query  1032  SFDGSGFKMFLENLAALSFNDDGPLAVVPCNDRSLLAARSPPQVTFPHPELLKV-NLP--  862
             +FDG  F++FL+NLAAL+ N   PLAV+P NDR +LAARSPP VTF HPEL ++ N+   
Sbjct  197   TFDGISFRLFLDNLAALAANK--PLAVIPYNDRQILAARSPPXVTFIHPELQELENISTL  254

Query  861   ----------AGEEMAPPVFDSLKDDLAFEIFQLSSADIERLKDKAKA---PDNVKTKVT  721
                        G +  P VF++ +++L F+IF+L+++DI  LK+KAK+       + K+T
Sbjct  255   ERKQEDELEVGGHDXRPTVFEATQEELDFKIFRLTASDIAHLKEKAKSIASSTKERVKIT  314

Query  720   GFNVLTAAIWRCKALS--CLGGENNSDRLSTVLFAVDIRRRLNPPLPDSYSGNAVLTGYG  547
              FNV+TA IWRCKALS      ++   R S +L+AVDIR+RLNPPLP  Y+GN VLT Y 
Sbjct  315   SFNVVTALIWRCKALSSSTYVDDHGESRESRILYAVDIRQRLNPPLPQGYTGNGVLTAYA  374

Query  546   SAKCAELEEGPFWKTVQMVYEGAARMTDEYARSAIDWGELYKGFPHGEFLVSSWWRLGFE  367
             SA C ELEEGPF + V+MV EGAARMTDEYARS IDWGEL KGFP+GE LVSSWWRLGF 
Sbjct  375   SAGCRELEEGPFSRAVEMVSEGAARMTDEYARSVIDWGELRKGFPNGEVLVSSWWRLGFA  434

Query  366   GVQFPWGKPKYSCPVVYHRKDIILLFP--DIDNGGKSNSGVNVLVALPPKEMEKFKSLFH  193
              V++PWGKP YSCPVVYHRKDIIL FP  D+ + G + +GVN+LVALP +EM+KF++LF 
Sbjct  435   DVEYPWGKPXYSCPVVYHRKDIILFFPEQDVPDNGTNGTGVNILVALPHQEMQKFQALFQ  494

Query  192   KFL  184
             KFL
Sbjct  495   KFL  497



>ref|XP_008218487.1| PREDICTED: omega-hydroxypalmitate O-feruloyl transferase [Prunus 
mume]
Length=488

 Score =   540 bits (1390),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 281/494 (57%), Positives = 351/494 (71%), Gaps = 48/494 (10%)
 Frame = -3

Query  1548  MGALYLKPETLHEDLKVTILDSGLIFPSQETTKHTMFLSNIDKVLNFDVQTVHFFPASPG  1369
             MG+L+    TL +DLKVT+  S LIFPSQ+T K T+FLSNID+VLNFDVQTVHFF A   
Sbjct  1     MGSLH-DQLTLLQDLKVTVHHSCLIFPSQQTQKKTVFLSNIDQVLNFDVQTVHFFGAHKD  59

Query  1368  FP-PEIVAGKIKNAFRRLLVANTYDFLAGRLKKNKESERVEIECNAAGAGFTVASSEFAL  1192
             FP  +IVA K+++A  ++LV   YDFLAGRLK N  + R+EI+CNAAGAGF VASSE+AL
Sbjct  60    FPQSQIVAEKVQDALAQILVP--YDFLAGRLKLNPNTSRLEIDCNAAGAGFVVASSEYAL  117

Query  1191  EDIGDLVYPNPAFRQLVTMSFDFVA-------KEDQPLCFLQVTSFKCGGFALGTSMNHI  1033
             ++IGDLVYPN AF QLV  + D            DQPL  LQVT+FKCGGFA+G S NH 
Sbjct  118   DEIGDLVYPNSAFAQLVCTAMDSRILNPAAGDDHDQPLFILQVTTFKCGGFAMGISNNHT  177

Query  1032  SFDGSGFKMFLENLAALSFNDDGPLAVVPCNDRSLLAARSPPQVTFPHPELLKV-NLPAG  856
             +FDG  F++FL+NLAA++ N   PL  +P NDR +LAARSPP V F HPEL ++ N+   
Sbjct  178   TFDGLSFRLFLDNLAAVAANK--PLVAIPYNDRHILAARSPPHVPFLHPELQELKNMSTL  235

Query  855   EEMAPPVFDSLKDDLAFEIFQLSSADIERLKDKAKAPDNVKTKVTGFNVLTAAIWRCKAL  676
             +++ P VF++ +++L F IF+L++ D+ RLKDKAK+     T  + FNV+TA IWRCKAL
Sbjct  236   DDLNPTVFEATQEELDFNIFRLTATDVARLKDKAKS----TTASSSFNVVTALIWRCKAL  291

Query  675   SCLGGENNSDRLS-------------TVLFAVDIRRRLNPPLPDSYSGNAVLTGYGSAKC  535
             S     ++ + ++              +L+AVDIR RL PPLP +Y+GNAVLT Y SAKC
Sbjct  292   SSSSSSDDDEDVNYKRAASSSSSRESRILYAVDIRPRLKPPLPKAYTGNAVLTAYASAKC  351

Query  534   AELEEGPFWKTVQMVYEGAARMTDEYARSAIDWGELYKGFPHGEFLVSSWWRLGFEGVQF  355
              ELEE PF + V+MV EGA RMTDEYARS IDWGEL+KGFPHGE LVSSWWRLGF  V++
Sbjct  352   RELEEVPFSRMVEMVSEGATRMTDEYARSVIDWGELHKGFPHGEVLVSSWWRLGFADVEY  411

Query  354   PWGKPKYSCPVVYHRKDIILLFPDIDN-----------------GGKSNSGVNVLVALPP  226
             PWGKP+YSCPVVYHRKDIILLFP+  +                 G    +GVN+LVALP 
Sbjct  412   PWGKPRYSCPVVYHRKDIILLFPEQQDMHEYSSSASPTNTTTMAGRAGAAGVNILVALPH  471

Query  225   KEMEKFKSLFHKFL  184
             KEM+KF++LFHKFL
Sbjct  472   KEMQKFQALFHKFL  485



>ref|XP_003519943.1| PREDICTED: omega-hydroxypalmitate O-feruloyl transferase isoform 
X1 [Glycine max]
Length=456

 Score =   538 bits (1386),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 270/449 (60%), Positives = 337/449 (75%), Gaps = 17/449 (4%)
 Frame = -3

Query  1512  EDLKVTILDSGLIFPSQETTKHTMFLSNIDKVLNFDVQTVHFFPASPGFPPEIVAGKIKN  1333
             +DLKV I ++ +IFPS+E  + ++FLSNIDKVL+FDV+TVHFF A   FPP +V  ++KN
Sbjct  18    QDLKVIIHNASMIFPSKEIERKSLFLSNIDKVLSFDVETVHFFGAHKDFPPRVVNERLKN  77

Query  1332  AFRRLLVANTYDFLAGRLKKNKESERVEIECNAAGAGFTVASSEFALEDIGDLVYPNPAF  1153
             A    LV   YDFL GRLK N +++R+E++CN+ GAGF VASSE+ L+ IGDL YPNPAF
Sbjct  78    ALEDALVV--YDFLGGRLKLNFDTKRLEMDCNSEGAGFVVASSEYNLDQIGDLDYPNPAF  135

Query  1152  RQLVTMSFDFVAKEDQPLCFLQVTSFKCGGFALGTSMNHISFDGSGFKMFLENLAALSFN  973
              QLV  + DF+   D PLC  QVTSFKCGGFA+G S +H +FDG  FK FL+N+A+++  
Sbjct  136   AQLVQKNKDFLKHGDVPLCVAQVTSFKCGGFAIGISTSHTTFDGLSFKTFLDNIASIA--  193

Query  972   DDGPLAVVPCNDRSLLAARSPPQVTFPHPELLKV-NLPAGEEMAPPVFDSLKDDLAFEIF  796
                PL V+PC+DR LLAARSPP VTFPHPE+LK+ +LP   +    +F++  + L F++F
Sbjct  194   SKKPLVVMPCHDRHLLAARSPPCVTFPHPEMLKLSDLPTCPDSN--IFEASTEQLDFKVF  251

Query  795   QLSSADIERLKDKAKAPDNVKTK----VTGFNVLTAAIWRCKALSCLGGENNSDRLSTVL  628
             +L+S DI +LK++AK            VTGFNV+TA IWRCKALSC   ++N +R ST+L
Sbjct  252   KLTSNDITKLKEEAKNSSTSGGTSTTCVTGFNVITAHIWRCKALSC--EDDNPNRSSTIL  309

Query  627   FAVDIRRRLNPPLPDSYSGNAVLTGYGSAKCAELEEGPFWKTVQMVYEGAARMTDEYARS  448
             +AVDIR RLNPPLP SY+GNA+LT Y + KC ELEE PF K V+MV EGA RMT+EYARS
Sbjct  310   YAVDIRSRLNPPLPKSYAGNAMLTAYATTKCKELEELPFMKLVEMVREGATRMTNEYARS  369

Query  447   AIDWGELYKGFPHGEFLVSSWWRLGFEGVQFPWGKPKYSCPVVYHRKDIILLFPDIDNGG  268
              IDWGE  KG P+ E LVSSWWRLGFE V++PWGKPKY CPVVYHRKDIILLFP ID GG
Sbjct  370   IIDWGETNKGCPNREVLVSSWWRLGFEEVEYPWGKPKYCCPVVYHRKDIILLFPPIDGGG  429

Query  267   KSNSGVNVLVALPPKEMEKFKSLFHKFLA  181
                 GV+++VALPPKEMEKF  LF+KFL 
Sbjct  430   ----GVSIIVALPPKEMEKFYGLFNKFLT  454



>ref|XP_004138891.1| PREDICTED: omega-hydroxypalmitate O-feruloyl transferase-like 
[Cucumis sativus]
 ref|XP_004155115.1| PREDICTED: omega-hydroxypalmitate O-feruloyl transferase-like 
[Cucumis sativus]
Length=469

 Score =   538 bits (1385),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 273/474 (58%), Positives = 345/474 (73%), Gaps = 23/474 (5%)
 Frame = -3

Query  1548  MGALYLK-PETLHEDLKVTILDSGLIFPSQETT-----KHTMFLSNIDKVLNFDVQTVHF  1387
             MG+ + K P  L +DLKV+I +  ++FPSQ  T      + +FL+NID+VLNF V+T+ F
Sbjct  1     MGSFHQKSPILLPQDLKVSIKECSVVFPSQLETDQKKKSNVLFLTNIDQVLNFSVETLQF  60

Query  1386  FPASPGFPPEIVAGKIKNAFRRLLVANTYDFLAGRLKKNKESERVEIECNAAGAGFTVAS  1207
             F     FP  ++  K+K  F +LLV   Y+ LAGRLK + E+ R+EI+CN AGAGF VAS
Sbjct  61    FSPHTKFPSHVIIEKMKTTFSKLLVP--YELLAGRLKVSHENGRLEIDCNGAGAGFVVAS  118

Query  1206  SEFALEDIGDLVYPNPAFRQLVTMSFDFVAK-EDQPLCFLQVTSFKCGGFALGTSMNHIS  1030
             S++ L++IGDLVYPNPAF QLVT S   + K  DQPL  LQVT FKCGGFA+G S NH +
Sbjct  119   SDYCLDEIGDLVYPNPAFHQLVTKSLAALFKPHDQPLVILQVTLFKCGGFAMGFSTNHCA  178

Query  1029  FDGSGFKMFLENLAALSFNDDGPLAVVPCNDRSLLAARSPPQVTFPHPELLKVN--LPAG  856
             FDG  FK FL+N AAL+  D+ PL V PC+DR LL ARSPP+VTFPH ELLK++  LP+ 
Sbjct  179   FDGLSFKQFLDNFAALA--DNKPLVVTPCHDRRLLTARSPPRVTFPHHELLKIDTPLPSP  236

Query  855   EEMAPPVFDSLKDDLAFEIFQLSSADIERLKDKAKAPDNVKT---------KVTGFNVLT  703
             +     VF++   DL F+IF+LS  DI  LK KA+     K          ++TGFNV+T
Sbjct  237   DSSNTSVFEATPQDLDFKIFKLSGTDIATLKQKAQPLTTSKQDDGHGGKKLRITGFNVVT  296

Query  702   AAIWRCKALSCLGGENNSDRLSTVLFAVDIRRRLNPPLPDSYSGNAVLTGYGSAKCAELE  523
             A +WRCKALS    ++N +R ST+L+AVDIR R++PPLP SY GNAVLT Y +AKC EL+
Sbjct  297   ALVWRCKALS-FEAKDNYERQSTLLYAVDIRSRMDPPLPTSYCGNAVLTVYATAKCKELK  355

Query  522   EGPFWKTVQMVYEGAARMTDEYARSAIDWGELYKGFPHGEFLVSSWWRLGFEGVQFPWGK  343
             +GPF + V+MV E A RMTDEYARSAIDWGELYKGFP+GEFLVSSWWRLG E V++PWGK
Sbjct  356   DGPFSRVVEMVSEAATRMTDEYARSAIDWGELYKGFPNGEFLVSSWWRLGLEDVEYPWGK  415

Query  342   PKYSCPVVYHRKDIILLFPDIDNGGKSNSGVNVLVALPPKEMEKFKSLFHKFLA  181
             P+ SCPVV HRKDIILLFPDI+   K+NSG+N+LVALP  +M KF++LF +F+A
Sbjct  416   PRSSCPVVNHRKDIILLFPDINESEKTNSGLNILVALPETQMVKFQTLFKEFMA  469



>ref|NP_564853.2| dual transcription unit and alternative splicing protein GLAUCE 
[Arabidopsis thaliana]
 gb|AAC27152.1| Similar to gb|Z84386 anthranilate N-hydroxycinnamoyl/benzoyltransferase 
from Dianthus caryophyllus [Arabidopsis thaliana]
 gb|AEE34376.1| dual transcription unit and alternative splicing protein GLAUCE 
[Arabidopsis thaliana]
Length=450

 Score =   537 bits (1383),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 270/461 (59%), Positives = 336/461 (73%), Gaps = 16/461 (3%)
 Frame = -3

Query  1548  MGALYLK-PETLHEDLKVTILDSGLIFPSQETT-KHTMFLSNIDKVLNFDVQTVHFFPAS  1375
             MG+ Y + P  L EDLKVTI +S LIFPS+ET+ + +MFLSN+D++LNFDVQTVHFF  +
Sbjct  1     MGSSYQESPPLLLEDLKVTIKESTLIFPSEETSERKSMFLSNVDQILNFDVQTVHFFRPN  60

Query  1374  PGFPPEIVAGKIKNAFRRLLVANTYDFLAGRLKKNKESERVEIECNAAGAGFTVASSEFA  1195
               FPPE+V+ K++ A  +L+  + Y+FLAGRL+ +  S R++++CN AGAGF  A+S++ 
Sbjct  61    KEFPPEMVSEKLRKALVKLM--DAYEFLAGRLRVDPSSGRLDVDCNGAGAGFVTAASDYT  118

Query  1194  LEDIGDLVYPNPAFRQLVTMSFDFVAKEDQPLCFLQVTSFKCGGFALGTSMNHISFDGSG  1015
             LE++GDLVYPNPAF QLVT     + K+DQPL   Q+TSFKCGGFA+G S NH +FDG  
Sbjct  119   LEELGDLVYPNPAFAQLVTSQLQSLPKDDQPLFVFQITSFKCGGFAMGISTNHTTFDGLS  178

Query  1014  FKMFLENLAALSFNDDGPLAVVPCNDRSLLAARSPPQVTFPHPELLKVNLPAGEEMAPPV  835
             FK FLENLA+L    + PL+  PCNDR+LL AR PP V FPH EL+K      +     V
Sbjct  179   FKTFLENLASLL--HEKPLSTPPCNDRTLLKARDPPSVAFPHHELVKFQ----DCETTTV  232

Query  834   FDSLKDDLAFEIFQLSSADIERLKDKAKAPDNVKTKVTGFNVLTAAIWRCKALSCL---G  664
             F++  + L F+IF+LSS  I++LK++A    N   +VTGFNV+TA +WRCKALS     G
Sbjct  233   FEATSEHLDFKIFKLSSEQIKKLKERASETSNGNVRVTGFNVVTALVWRCKALSVAAEEG  292

Query  663   GENNSDRLSTVLFAVDIRRRLNPPLPDSYSGNAVLTGYGSAKCAELEEGPFWKTVQMVYE  484
              E N +R ST+L+AVDIR RLNP LP SY+GNAVLT Y   KC  L E PF + V+MV E
Sbjct  293   EETNLERESTILYAVDIRGRLNPELPPSYTGNAVLTAYAKEKCKALLEEPFGRIVEMVGE  352

Query  483   GAARMTDEYARSAIDWGELYKGFPHGEFLVSSWWRLGFEGVQFPWGKPKYSCPVVYHRKD  304
             G+ R+TDEYARSAIDWGELYKGFPHGE LVSSWW+LGF  V++PWGKPKYSCPVVYHRKD
Sbjct  353   GSKRITDEYARSAIDWGELYKGFPHGEVLVSSWWKLGFAEVEYPWGKPKYSCPVVYHRKD  412

Query  303   IILLFPDIDNGGKSNSGVNVLVALPPKEMEKFKSLFHKFLA  181
             I+LLFPDID   K   GV VL ALP KEM KF+  F   L 
Sbjct  413   IVLLFPDIDGDSK---GVYVLAALPSKEMSKFQHWFEDTLC  450



>gb|KHN46812.1| Omega-hydroxypalmitate O-feruloyl transferase [Glycine soja]
Length=424

 Score =   535 bits (1377),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 263/433 (61%), Positives = 328/433 (76%), Gaps = 11/433 (3%)
 Frame = -3

Query  1479  LIFPSQETTKHTMFLSNIDKVLNFDVQTVHFFPASPGFPPEIVAGKIKNAFRRLLVANTY  1300
             ++FPS+ET K ++FLSNIDKVLNF+V+TVHFF A+  FPP  VA   KNA    LV   Y
Sbjct  1     MVFPSKETEKRSLFLSNIDKVLNFEVETVHFFGANEDFPPAKVAKMFKNALEEALV--VY  58

Query  1299  DFLAGRLKKNKESERVEIECNAAGAGFTVASSEFALEDIGDLVYPNPAFRQLVTMSFDFV  1120
             DFL GRL  N E++R+EI+CN  GAGF VASSE+ L +IGDLVYPNPAF Q V  S DFV
Sbjct  59    DFLGGRLNLNPETKRLEIDCNGKGAGFVVASSEYKLSEIGDLVYPNPAFAQFVQKSKDFV  118

Query  1119  AKEDQPLCFLQVTSFKCGGFALGTSMNHISFDGSGFKMFLENLAALSFNDDGPLAVVPCN  940
              + DQPLC  Q+TSFKCGGFA+G + +H +FDG  FK FL+NLAAL+ N   PLAV+PC+
Sbjct  119   QQNDQPLCVAQLTSFKCGGFAIGFTTSHTTFDGLSFKTFLDNLAALAANK--PLAVIPCH  176

Query  939   DRSLLAARSPPQVTFPHPELLKVN-LPAGEEMAPPVFDSLKDDLAFEIFQLSSADIERLK  763
             DR LLAARSPP+V+FPHPEL+K++ LP G   +  VF++  ++L F++FQL+S +I  LK
Sbjct  177   DRHLLAARSPPRVSFPHPELIKLDKLPTGSTESG-VFEATNEELNFKVFQLTSHNILSLK  235

Query  762   DKAKAPDNVKTKVTGFNVLTAAIWRCKALSCLGGENNSDRLSTVLFAVDIRRRLNPPLPD  583
             +KAK   N +   TGFNV+TA +WRCKALS      +  R S +L+A+DIR RL PPLP 
Sbjct  236   EKAKGSTNARA--TGFNVITAHLWRCKALS---APYDPSRSSIILYAMDIRPRLKPPLPK  290

Query  582   SYSGNAVLTGYGSAKCAELEEGPFWKTVQMVYEGAARMTDEYARSAIDWGELYKGFPHGE  403
             S++GNAVLT Y  AKC ELE+  F + V+MV EGA RM+DEYARS IDWGE++ GFPHGE
Sbjct  291   SFAGNAVLTAYAIAKCEELEKEEFSRLVEMVTEGAKRMSDEYARSMIDWGEVHSGFPHGE  350

Query  402   FLVSSWWRLGFEGVQFPWGKPKYSCPVVYHRKDIILLFPDIDNGGKSNSGVNVLVALPPK  223
              LVSSWWRLGFE V++PWGKPKY CPVVYHRKDIIL+FP        + G+N++VALPPK
Sbjct  351   VLVSSWWRLGFEEVEYPWGKPKYCCPVVYHRKDIILVFPPFGGSSGDDDGINIIVALPPK  410

Query  222   EMEKFKSLFHKFL  184
             EM+KF++LF+ FL
Sbjct  411   EMDKFENLFYMFL  423



>ref|XP_007205121.1| hypothetical protein PRUPE_ppa004875mg [Prunus persica]
 gb|EMJ06320.1| hypothetical protein PRUPE_ppa004875mg [Prunus persica]
Length=487

 Score =   535 bits (1379),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 279/493 (57%), Positives = 351/493 (71%), Gaps = 47/493 (10%)
 Frame = -3

Query  1548  MGALYLKPETLHEDLKVTILDSGLIFPSQETTKHTMFLSNIDKVLNFDVQTVHFFPASPG  1369
             MG+L+    TL +DLKVT+  S L+FPSQ+T K T+FLSNID+VL FDVQTVHFF A   
Sbjct  1     MGSLH-DQLTLLQDLKVTVHHSCLVFPSQQTQKKTVFLSNIDQVLKFDVQTVHFFGAHKD  59

Query  1368  FP-PEIVAGKIKNAFRRLLVANTYDFLAGRLKKNKESERVEIECNAAGAGFTVASSEFAL  1192
             FP  +IVA K+K+A  ++LV   YDFLAGRLK N  + R+EI+CNAAGAGF VASSE+AL
Sbjct  60    FPESQIVAEKVKDALAKILVP--YDFLAGRLKLNPNTSRLEIDCNAAGAGFVVASSEYAL  117

Query  1191  EDIGDLVYPNPAFRQLVTMSFDF-----VAKEDQPLCFLQVTSFKCGGFALGTSMNHISF  1027
             ++IGDLVYPN AF QLV  + D       A +D+PL  LQVT+FKCGGFA+G S NH +F
Sbjct  118   DEIGDLVYPNSAFAQLVCTAMDSRILNPAAGDDRPLFILQVTTFKCGGFAMGISNNHATF  177

Query  1026  DGSGFKMFLENLAALSFNDDGPLAVVPCNDRSLLAARSPPQVTFPHPELLKV-NLPAGEE  850
             DG  F++FL+NLAA++ N   PL  +P NDR +LAARSPP   F HPEL ++ N+   ++
Sbjct  178   DGLSFRLFLDNLAAVAANK--PLVAIPYNDRHILAARSPPHAPFLHPELQELKNMSTLDD  235

Query  849   MAPPVFDSLKDDLAFEIFQLSSADIERLKDKAKAPDNVKTKVTGFNVLTAAIWRCKALSC  670
             + P VF++ +++L F IF+L++ D+ RLKDKAK+     T  + FNV+TA IWRCKALS 
Sbjct  236   LNPTVFEATQEELDFNIFRLTATDVARLKDKAKS----TTASSSFNVVTALIWRCKALSS  291

Query  669   LGGENNSDRLS--------------TVLFAVDIRRRLNPPLPDSYSGNAVLTGYGSAKCA  532
                 ++ + ++               +L+AVDIR RL PPLP +Y+GNAVLT Y SAKC 
Sbjct  292   SSSSDDDEDVNYKRAASSSSSSRESRILYAVDIRPRLKPPLPKAYTGNAVLTAYASAKCR  351

Query  531   ELEEGPFWKTVQMVYEGAARMTDEYARSAIDWGELYKGFPHGEFLVSSWWRLGFEGVQFP  352
             ELEE PF + V+MV EGA RMTDEYARS IDWGEL+KGFPHGE LVSSWWRLGF  V++P
Sbjct  352   ELEEVPFSRMVEMVSEGATRMTDEYARSVIDWGELHKGFPHGEVLVSSWWRLGFADVEYP  411

Query  351   WGKPKYSCPVVYHRKDIILLFPDIDN-----------------GGKSNSGVNVLVALPPK  223
             WGKP+YSCPVVYHRKDIILLFP+  +                 G    +GVN+LVALP K
Sbjct  412   WGKPRYSCPVVYHRKDIILLFPEQRDMHEYSSSATTTSTTTMAGRAGGAGVNILVALPHK  471

Query  222   EMEKFKSLFHKFL  184
             EM+KF++LFHKFL
Sbjct  472   EMQKFQALFHKFL  484



>ref|XP_002886918.1| hypothetical protein ARALYDRAFT_315582 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH63177.1| hypothetical protein ARALYDRAFT_315582 [Arabidopsis lyrata subsp. 
lyrata]
Length=450

 Score =   533 bits (1372),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 271/460 (59%), Positives = 335/460 (73%), Gaps = 16/460 (3%)
 Frame = -3

Query  1548  MGALYLK-PETLHEDLKVTILDSGLIFPSQETT-KHTMFLSNIDKVLNFDVQTVHFFPAS  1375
             MG+ Y + P  L +DLKVTI +S LIFPS ET+ + +MFLSN+D++LNFDVQTVHFF  +
Sbjct  1     MGSSYQESPPLLLQDLKVTIKESSLIFPSDETSERKSMFLSNVDQILNFDVQTVHFFRPN  60

Query  1374  PGFPPEIVAGKIKNAFRRLLVANTYDFLAGRLKKNKESERVEIECNAAGAGFTVASSEFA  1195
               FPPE+V+ K++ A  + +  + Y+FLAGRL+ +  S R++++CN AGAGF  A+SE+ 
Sbjct  61    KDFPPEMVSEKLRKALVKAM--DAYEFLAGRLRVDPSSGRLDVDCNGAGAGFVTAASEYT  118

Query  1194  LEDIGDLVYPNPAFRQLVTMSFDFVAKEDQPLCFLQVTSFKCGGFALGTSMNHISFDGSG  1015
             LE++GDLVYPNPAF QLVT     + K+DQPL   QVTSFKCGGFA+G S NH +FDG  
Sbjct  119   LEELGDLVYPNPAFAQLVTSQLPSLPKDDQPLFAFQVTSFKCGGFAMGISTNHTTFDGLS  178

Query  1014  FKMFLENLAALSFNDDGPLAVVPCNDRSLLAARSPPQVTFPHPELLKVNLPAGEEMAPPV  835
             FK FLENLA+L    + PL+  PCNDR+LL AR PP VTFPH EL+K      +     V
Sbjct  179   FKTFLENLASLL--HEKPLSTPPCNDRTLLKARHPPSVTFPHHELVKFQ----DCETTTV  232

Query  834   FDSLKDDLAFEIFQLSSADIERLKDKAKAPDNVKTKVTGFNVLTAAIWRCKALSCL---G  664
             F++    L F+IF+LSS  I++LK++A    +   +VTGFNV+TA +WRCKALS     G
Sbjct  233   FEATSQHLDFKIFKLSSEQIKKLKERASETSSGYVRVTGFNVVTALVWRCKALSVAAEEG  292

Query  663   GENNSDRLSTVLFAVDIRRRLNPPLPDSYSGNAVLTGYGSAKCAELEEGPFWKTVQMVYE  484
              E N +R ST+L+AVDIR RLNP LP SY+GNAVLT Y  AKC  L E PF + V++V E
Sbjct  293   EETNLERESTILYAVDIRGRLNPELPPSYTGNAVLTAYAKAKCKALLEEPFGRIVEIVGE  352

Query  483   GAARMTDEYARSAIDWGELYKGFPHGEFLVSSWWRLGFEGVQFPWGKPKYSCPVVYHRKD  304
             GA R+TDEYARSAIDWGELYKGFPHGE LVSSWW+LGF  V++PWGKPKYSCPVVYHRKD
Sbjct  353   GANRITDEYARSAIDWGELYKGFPHGEVLVSSWWKLGFAEVEYPWGKPKYSCPVVYHRKD  412

Query  303   IILLFPDIDNGGKSNSGVNVLVALPPKEMEKFKSLFHKFL  184
             I+LLFPDID   K   GV VL ALP KEM KF+  F   L
Sbjct  413   IVLLFPDIDGDSK---GVYVLAALPSKEMTKFQHWFEDTL  449



>ref|XP_006301983.1| hypothetical protein CARUB_v10022464mg [Capsella rubella]
 gb|EOA34881.1| hypothetical protein CARUB_v10022464mg [Capsella rubella]
Length=451

 Score =   531 bits (1367),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 273/462 (59%), Positives = 338/462 (73%), Gaps = 17/462 (4%)
 Frame = -3

Query  1548  MGALYLK-PETLHEDLKVTILDSGLIFPSQETT--KHTMFLSNIDKVLNFDVQTVHFFPA  1378
             MG+LY + P  L +DLKVTI +S LIFPS+ETT  K +MFLSN+D++LNFDVQTVHFF  
Sbjct  1     MGSLYQESPPLLLQDLKVTIKESTLIFPSEETTSEKKSMFLSNVDQILNFDVQTVHFFRP  60

Query  1377  SPGFPPEIVAGKIKNAFRRLLVANTYDFLAGRLKKNKESERVEIECNAAGAGFTVASSEF  1198
             +  FPPE+V+ K++ A  + +  + Y+FLAGRL+ +  S R++++CN AGAGF +A+SE+
Sbjct  61    NKDFPPEMVSEKLRKALVKAM--DAYEFLAGRLRVDPSSGRLDVDCNGAGAGFVIAASEY  118

Query  1197  ALEDIGDLVYPNPAFRQLVTMSFDFVAKEDQPLCFLQVTSFKCGGFALGTSMNHISFDGS  1018
              LE++GDLVYPNPAF QLVT   + + K+DQPL   Q+TSFKCGGFA+G S NH +FDG 
Sbjct  119   TLEELGDLVYPNPAFAQLVTSQLESLPKDDQPLFAFQMTSFKCGGFAMGISTNHTTFDGL  178

Query  1017  GFKMFLENLAALSFNDDGPLAVVPCNDRSLLAARSPPQVTFPHPELLKVNLPAGEEMAPP  838
              FK FLENLA+L   ++ PL+  PCNDR+LL AR+PP VTFPH EL+K      +     
Sbjct  179   SFKTFLENLASLL--NEKPLSTPPCNDRTLLKARTPPSVTFPHHELVKFL----DCETTT  232

Query  837   VFDSLKDDLAFEIFQLSSADIERLKDKAKAPDNVKTKVTGFNVLTAAIWRCKALSCLGGE  658
             VF++    L F+IF+LSS  I++LK++A    +   +VTGFNV+TA +WRCKALS    E
Sbjct  233   VFEATSQKLDFKIFKLSSDQIKKLKERASETSSGDVRVTGFNVVTALVWRCKALSVTTEE  292

Query  657   NNSDRL---STVLFAVDIRRRLNPPLPDSYSGNAVLTGYGSAKCAELEEGPFWKTVQMVY  487
                  L   ST+L+AVDIR RLNP LP SY+GNAVLT Y  AKC  L E PF + V MV 
Sbjct  293   EEEANLERESTILYAVDIRGRLNPELPSSYTGNAVLTAYAKAKCNALLEEPFGEIVDMVG  352

Query  486   EGAARMTDEYARSAIDWGELYKGFPHGEFLVSSWWRLGFEGVQFPWGKPKYSCPVVYHRK  307
             EGA RMT+EYARSAIDWGELYKGFPHGE LVSSWW+LGF  V++PWGKPKYSCPVVYHRK
Sbjct  353   EGAKRMTNEYARSAIDWGELYKGFPHGEVLVSSWWKLGFAEVEYPWGKPKYSCPVVYHRK  412

Query  306   DIILLFPDIDNGGKSNSGVNVLVALPPKEMEKFKSLFHKFLA  181
             DI+LLFPDID  GK   GV VL ALP KEM KF+  F   L 
Sbjct  413   DIVLLFPDIDGDGK---GVYVLAALPSKEMIKFQHWFEDTLC  451



>ref|XP_003624566.1| Anthranilate N-benzoyltransferase protein [Medicago truncatula]
 gb|AES80784.1| HXXXD-type acyl-transferase family protein [Medicago truncatula]
Length=445

 Score =   528 bits (1359),  Expect = 2e-180, Method: Compositional matrix adjust.
 Identities = 266/443 (60%), Positives = 326/443 (74%), Gaps = 12/443 (3%)
 Frame = -3

Query  1509  DLKVTILDSGLIFPSQETTKHTMFLSNIDKVLNFDVQTVHFFPASPGFPPEIVAGKIKNA  1330
             D+KVTI  + +IFPS++T   +MFLSNIDKVLNF V+TVHFF A+  FPP+IV  K+K A
Sbjct  13    DMKVTIHKTSMIFPSKQTENKSMFLSNIDKVLNFYVKTVHFFEANKDFPPQIVTEKLKKA  72

Query  1329  FRRLLVANTYDFLAGRLKKNKESERVEIECNAAGAGFTVASSEFALEDIGDLVYPNPAFR  1150
                 LVA  YDFLAGRLK N E+ R+EI+CNA G GF VASSE+ L  IGDL YPN AF 
Sbjct  73    LEDALVA--YDFLAGRLKMNTETNRLEIDCNAEGVGFVVASSEYKLNQIGDLAYPNQAFA  130

Query  1149  QLVTMSFDFVAKEDQPLCFLQVTSFKCGGFALGTSMNHISFDGSGFKMFLENLAALSFND  970
             Q V  + DF+   D PLC +Q+TSFKCGGFA+G + +H++FDG  FK FL+NLA+L+ N 
Sbjct  131   QFVHNAKDFLKIGDLPLCVVQLTSFKCGGFAIGFTTSHVTFDGLSFKNFLDNLASLATN-  189

Query  969   DGPLAVVPCNDRSLLAARSPPQVTFPHPELLKV-NLPAGEEMAPPVFDSLKDDLAFEIFQ  793
                L   P +DR LLAARSPP V FPHPE++K+ NLP G  +   VF++  ++  F +FQ
Sbjct  190   -MKLTATPFHDRQLLAARSPPHVNFPHPEMIKLDNLPLG--IKSGVFEASSEEFDFMVFQ  246

Query  792   LSSADIERLKDKAKAPDNVKTKVTGFNVLTAAIWRCKALSCLGGENNSDRLSTVLFAVDI  613
             L+  DI  LK+KAK   N  ++V  FNV+ A IWRCKALS      + +R S +L+AVDI
Sbjct  247   LTYEDINNLKEKAKG--NNTSRVISFNVVAAHIWRCKALS---KSYDPNRSSIILYAVDI  301

Query  612   RRRLNPPLPDSYSGNAVLTGYGSAKCAELEEGPFWKTVQMVYEGAARMTDEYARSAIDWG  433
             R RLNPPLP +Y+GNAVLT Y SAKC EL+EG F + V+MV EG+ RM+DEYARS IDWG
Sbjct  302   RSRLNPPLPRAYTGNAVLTAYASAKCEELKEGEFSRLVEMVEEGSRRMSDEYARSIIDWG  361

Query  432   ELYKGFPHGEFLVSSWWRLGFEGVQFPWGKPKYSCPVVYHRKDIILLFPDIDNGGKSNSG  253
             ELY GFP+G+ LVSSWWRLGFE V++PWGKPKY CPVVYHRKDIILLFP  + G     G
Sbjct  362   ELYNGFPNGDVLVSSWWRLGFEEVEYPWGKPKYCCPVVYHRKDIILLFPSFNGGEGGGDG  421

Query  252   VNVLVALPPKEMEKFKSLFHKFL  184
             VN++VALP  EMEKFKSLF+ FL
Sbjct  422   VNIIVALPRDEMEKFKSLFYTFL  444



>ref|XP_006391555.1| hypothetical protein EUTSA_v10018535mg [Eutrema salsugineum]
 gb|ESQ28841.1| hypothetical protein EUTSA_v10018535mg [Eutrema salsugineum]
Length=452

 Score =   527 bits (1358),  Expect = 5e-180, Method: Compositional matrix adjust.
 Identities = 273/458 (60%), Positives = 333/458 (73%), Gaps = 18/458 (4%)
 Frame = -3

Query  1548  MGALYLKPETLH-EDLKVTILDSGLIFPSQET---TKHTMFLSNIDKVLNFDVQTVHFFP  1381
             MGA Y +P +L  +DLKVTI +S LIFPS++T    + +MFLSN+D++LNFDVQTVHFF 
Sbjct  1     MGASYQEPSSLLLQDLKVTIKESSLIFPSEQTLTNKRKSMFLSNVDQILNFDVQTVHFFR  60

Query  1380  ASPGFPPEIVAGKIKNAFRRLLVANTYDFLAGRLKKNKESERVEIECNAAGAGFTVASSE  1201
              +  FPPEIV G ++ A   +   + Y+FLAGRL+ N  S R++++CN AGAGF  A+SE
Sbjct  61    QNKEFPPEIVTGILRKAL--VSAIDVYEFLAGRLRLNHSSGRLDVDCNGAGAGFVTAASE  118

Query  1200  FALEDIGDLVYPNPAFRQLVTMSFDFVAKEDQPLCFLQVTSFKCGGFALGTSMNHISFDG  1021
             + LED+GDLVYPNPAF QLVT   +   K+DQPL   Q+TSFKCGGFA+G S NH +FDG
Sbjct  119   YTLEDLGDLVYPNPAFAQLVTSQLESFPKDDQPLFAFQLTSFKCGGFAMGISTNHTTFDG  178

Query  1020  SGFKMFLENLAALSFNDDGPLAVVPCNDRSLLAARSPPQVTFPHPELLKVNLPAGEEMAP  841
               FK FLENLA L    + PL+  PCNDR+LL AR+PP+VTFPH EL  V L   E+   
Sbjct  179   LSFKTFLENLATLL--SEKPLSTPPCNDRTLLKARTPPRVTFPHHEL--VQLQNSEKTT-  233

Query  840   PVFDSLKDDLAFEIFQLSSADIERLKDKA-KAPDNVKTKVTGFNVLTAAIWRCKALSCLG  664
              VF++  + L F IF+LSS  I RLK+KA +   +   +VTGFNV+TA +WRCKALS + 
Sbjct  234   -VFETTAEHLDFNIFKLSSQQIMRLKEKASECLSSECVRVTGFNVVTALVWRCKALSLVE  292

Query  663   GENNSDRL--STVLFAVDIRRRLNPPLPDSYSGNAVLTGYGSAKCAELEEGPFWKTVQMV  490
              E   D    ST+L+AVDIR RLNP LP SY+GNAVLT Y  AK   L E PF + V+MV
Sbjct  293   EEEEKDLERESTILYAVDIRGRLNPQLPSSYTGNAVLTAYAKAKRKALHEEPFGRIVEMV  352

Query  489   YEGAARMTDEYARSAIDWGELYKGFPHGEFLVSSWWRLGFEGVQFPWGKPKYSCPVVYHR  310
              EG+ R+TDEYARSAIDWGE+YKGFPHGE LVSSWW+LGF  V++PWGKPKYSCPVVYHR
Sbjct  353   GEGSKRITDEYARSAIDWGEMYKGFPHGEVLVSSWWKLGFAEVEYPWGKPKYSCPVVYHR  412

Query  309   KDIILLFPDIDNGGKSNSGVNVLVALPPKEMEKFKSLF  196
             KDI+LLFPDID   K   GVNVL ALP KEM KF+  F
Sbjct  413   KDIVLLFPDIDGDSK---GVNVLAALPSKEMCKFQKWF  447



>ref|XP_010415082.1| PREDICTED: omega-hydroxypalmitate O-feruloyl transferase-like 
[Camelina sativa]
Length=451

 Score =   526 bits (1356),  Expect = 7e-180, Method: Compositional matrix adjust.
 Identities = 268/462 (58%), Positives = 334/462 (72%), Gaps = 17/462 (4%)
 Frame = -3

Query  1548  MGALYLK-PETLHEDLKVTILDSGLIFPSQETT-KHTMFLSNIDKVLNFDVQTVHFFPAS  1375
             MG+LY + P  L +DLKVTI +S LIFPS+ET+ K +MFLSN+D++LNFDVQTVHFF  +
Sbjct  1     MGSLYQESPPLLLQDLKVTIKESTLIFPSEETSEKKSMFLSNVDQILNFDVQTVHFFRPN  60

Query  1374  PGFPPEIVAGKIKNAFRRLLVANTYDFLAGRLKKNKESERVEIECNAAGAGFTVASSEFA  1195
               FPPEIV+ K++ A  + +  + Y+FLAGRL+ +  S R++++CN AGAGF  A+SE+ 
Sbjct  61    KDFPPEIVSEKLRKALVKAM--DAYEFLAGRLRVDPSSGRLDVDCNGAGAGFVTAASEYT  118

Query  1194  LEDIGDLVYPNPAFRQLVTMSFDFVAKEDQPLCFLQVTSFKCGGFALGTSMNHISFDGSG  1015
             LE++GDLVYPNPAF QLVT     + K+DQPL   Q+TSFKCGGFA+G S NH +FDG  
Sbjct  119   LEELGDLVYPNPAFAQLVTSQLQSLPKDDQPLFAFQMTSFKCGGFAMGISTNHTTFDGLS  178

Query  1014  FKMFLENLAALSFNDDGPLAVVPCNDRSLLAARSPPQVTFPHPELLKVNLPAGEEMAPPV  835
             FK FLENLA+L    + PL+  PCNDR+LL AR+PP VTFPH EL+K      +     V
Sbjct  179   FKTFLENLASLL--SEKPLSTPPCNDRTLLKARTPPSVTFPHHELVKFQ----DCETTTV  232

Query  834   FDSLKDDLAFEIFQLSSADIERLKDKAKAPDNVKTKVTGFNVLTAAIWRCKALSCLGGEN  655
             F++    L F+IF+LSS  I +LK++A    +   +V+GFNV+TA +WRCKALS    + 
Sbjct  233   FEATSQHLDFKIFKLSSDQINKLKERASETSSGYVRVSGFNVVTALVWRCKALSVTSEKE  292

Query  654   NSDRL----STVLFAVDIRRRLNPPLPDSYSGNAVLTGYGSAKCAELEEGPFWKTVQMVY  487
               +      ST+L+AVDIR RLNP LP SY+GNAVLT Y  AKC  L E PF + V++V 
Sbjct  293   EEEANLERESTILYAVDIRGRLNPELPPSYTGNAVLTAYAKAKCKALLEEPFGRIVEIVG  352

Query  486   EGAARMTDEYARSAIDWGELYKGFPHGEFLVSSWWRLGFEGVQFPWGKPKYSCPVVYHRK  307
             EGA R+TDEYARSAIDWGELYKGFPHGE LVSSWW+LGF  V++PWGKPKYSCPVVYHRK
Sbjct  353   EGAKRITDEYARSAIDWGELYKGFPHGEVLVSSWWKLGFAEVEYPWGKPKYSCPVVYHRK  412

Query  306   DIILLFPDIDNGGKSNSGVNVLVALPPKEMEKFKSLFHKFLA  181
             DI+LLFPDID   K   GV VL ALP KEM KF+  F   L 
Sbjct  413   DIVLLFPDIDGDSK---GVYVLAALPSKEMTKFQHWFEDTLC  451



>gb|KHN13415.1| Omega-hydroxypalmitate O-feruloyl transferase [Glycine soja]
Length=447

 Score =   526 bits (1354),  Expect = 1e-179, Method: Compositional matrix adjust.
 Identities = 268/455 (59%), Positives = 334/455 (73%), Gaps = 27/455 (6%)
 Frame = -3

Query  1527  PETLHEDLKVTILDSGLIFPSQETTKHTMFLSNIDKVLNFDVQTVHFFPASPGFPPEIVA  1348
             P  L +DLKVTI ++ +IFPS+E  + ++FLSNIDKVLNFDV+TVHFF A   FPP +V 
Sbjct  12    PPPLLKDLKVTIHNASMIFPSKEIERKSLFLSNIDKVLNFDVETVHFFGAHKDFPPHVVN  71

Query  1347  GKIKNAFRRLLVANTYDFLAGRLKKNKESERVEIECNAAGAGFTVASSEFALEDIGDLVY  1168
              ++KNA    LV   YDFL GRLK N +++R+E++CN  GAGF VASSE+ L+ IGDL Y
Sbjct  72    ERLKNALEDALVV--YDFLGGRLKLNYDTKRLEMDCNPEGAGFVVASSEYNLDQIGDLDY  129

Query  1167  PNPAFRQLVTMSFDFVAKEDQPLCFLQVTSFKCGGFALGTSMNHISFDGSGFKMFLENLA  988
             PNPAF QLV  + DF+   D PLC  QVTSFKCGGFA+G S +H +FDG  FK FL+N+A
Sbjct  130   PNPAFAQLVHQNKDFLKDGDVPLCVAQVTSFKCGGFAIGISTSHTTFDGLSFKTFLDNIA  189

Query  987   ALSFNDDGPLAVVPCNDRSLLAARSPPQVTFPHPELLKVN--LPAGEEMAPPVFDSLKDD  814
             +++              +  LAARSPP+VTFPHPE+LK++  LP   E    +F++  + 
Sbjct  190   SIA------------AKKPALAARSPPRVTFPHPEMLKLSDQLPTCPESN--IFEASTEQ  235

Query  813   LAFEIFQLSSADIERLKDKAKAPD---NVKTK-VTGFNVLTAAIWRCKALSCLGGENNSD  646
             L F++F+L+S DI +LK++A+       + TK VTGFNV+TA IWRCKALSC   EN  +
Sbjct  236   LDFKVFKLTSNDITKLKEEARNSSISGGLSTKCVTGFNVITAYIWRCKALSCYNDEN-PN  294

Query  645   RLSTVLFAVDIRRRLNPPLPDSYSGNAVLTGYGSAKCAELEEGPFWKTVQMVYEGAARMT  466
             R ST+L+AVDIR RLNPPLP SY+GNAVLT Y +AKC ELEE PF K V+MV EGA RMT
Sbjct  295   RSSTILYAVDIRSRLNPPLPKSYAGNAVLTAYATAKCKELEEWPFMKLVEMVREGATRMT  354

Query  465   DEYARSAIDWGELYKGFPHGEFLVSSWWRLGFEGVQFPWGKPKYSCPVVYHRKDIILLFP  286
             +EYARS IDWGE+  GFP+GE LVSSWWRLGFE V++PWGKPKY CPVVYH+KDIILLFP
Sbjct  355   NEYARSIIDWGEINNGFPNGEVLVSSWWRLGFEEVEYPWGKPKYCCPVVYHKKDIILLFP  414

Query  285   DIDNGGKSNSGVNVLVALPPKEMEKFKSLFHKFLA  181
              +  G     GV+++VALPPKEMEKF  LF+KFL 
Sbjct  415   PVGGG----EGVSIIVALPPKEMEKFHGLFNKFLT  445



>ref|XP_010556190.1| PREDICTED: omega-hydroxypalmitate O-feruloyl transferase [Tarenaya 
hassleriana]
Length=443

 Score =   525 bits (1353),  Expect = 2e-179, Method: Compositional matrix adjust.
 Identities = 262/455 (58%), Positives = 331/455 (73%), Gaps = 20/455 (4%)
 Frame = -3

Query  1524  ETLHEDLKVTILDSGLIFPSQETTKHTMFLSNIDKVLNFDVQTVHFFPASPGFPPEIVAG  1345
             E+L +DLK T+ ++ L+FPS   TK TMFLSN+D+VLNFDVQT+HFF  S  FPPEIV+ 
Sbjct  2     ESLCQDLKFTVQETSLVFPSH-GTKKTMFLSNVDQVLNFDVQTLHFFRPSKDFPPEIVSE  60

Query  1344  KIKNAFRRLLVANTYDFLAGRLKKNKESERVEIECNAAGAGFTVASSEFALEDIGDLVYP  1165
              +K+   R +   +Y+F+AGRL+ N  S R+E+ECN AGAGF  A SE  L+++GDLVYP
Sbjct  61    MLKDGVGRAM--ESYEFVAGRLRTNPSSGRLEVECNGAGAGFVRARSECTLDELGDLVYP  118

Query  1164  NPAFRQLVTMSFDFVAKEDQPLCFLQVTSFKCGGFALGTSMNHISFDGSGFKMFLENLAA  985
             NPAF  LVT   + + ++DQP+C  Q+TSFKCGGF +G S NH +FDG  F+ FL NLA+
Sbjct  119   NPAFANLVTSRLENLPEDDQPICTFQITSFKCGGFVMGVSTNHAAFDGLSFRNFLGNLAS  178

Query  984   LSFNDDGPLAVVPCNDRSLLAARSPPQVTFPHPELLKVNLPAGEEMAPPVFDSLKDDLAF  805
             L  N+   L+V PCNDR LL ARSPPQVTF H EL+++     ++    VF++   DL  
Sbjct  179   LISNNS--LSVTPCNDRRLLQARSPPQVTFTHHELVQI-----QDSTSQVFEATSQDLDI  231

Query  804   EIFQLSSADIERLKDKAKAPDNVKTKVTGFNVLTAAIWRCKALSCLGG-------ENNSD  646
             EI +L S +I++LK+KA   ++   ++T FNV+TA IW+CKALS   G       E+  +
Sbjct  232   EILKLGSREIDKLKEKAGRGESSCVRITSFNVVTALIWKCKALSVPVGTDRDPRNEDLDE  291

Query  645   RLSTVLFAVDIRRRLNPPLPDSYSGNAVLTGYGSAKCAELEEGPFWKTVQMVYEGAARMT  466
             + ST+L+AVDIR RLNPPLP SY+GNAVLT Y  AK  EL   PFW+ V+ V  GA RMT
Sbjct  292   KESTILYAVDIRSRLNPPLPFSYTGNAVLTAYARAKRKELLREPFWRIVEKVEGGAKRMT  351

Query  465   DEYARSAIDWGELYKGFPHGEFLVSSWWRLGFEGVQFPWGKPKYSCPVVYHRKDIILLFP  286
             DEYARS IDWGE++KGFPHGE LVSSWW+LGF  V+FPWG+PKYSCPVVYHRKDIIL  P
Sbjct  352   DEYARSVIDWGEMHKGFPHGEVLVSSWWKLGFADVEFPWGRPKYSCPVVYHRKDIILFLP  411

Query  285   DIDNGGKSNSGVNVLVALPPKEMEKFKSLFHKFLA  181
             DID    S+ GVNVLVALPPKEME F++LF +FLA
Sbjct  412   DID---PSSKGVNVLVALPPKEMEIFQALFQEFLA  443



>ref|XP_010511440.1| PREDICTED: omega-hydroxypalmitate O-feruloyl transferase-like 
isoform X1 [Camelina sativa]
 ref|XP_010511441.1| PREDICTED: omega-hydroxypalmitate O-feruloyl transferase-like 
isoform X2 [Camelina sativa]
Length=451

 Score =   522 bits (1345),  Expect = 3e-178, Method: Compositional matrix adjust.
 Identities = 265/462 (57%), Positives = 332/462 (72%), Gaps = 17/462 (4%)
 Frame = -3

Query  1548  MGALYLK-PETLHEDLKVTILDSGLIFPSQETT-KHTMFLSNIDKVLNFDVQTVHFFPAS  1375
             MG+LY + P  L +DLKVTI +S LIFPS ET+ + +MFLSN+D++LNFDVQTVHFF ++
Sbjct  1     MGSLYQESPPLLLQDLKVTINESTLIFPSDETSERKSMFLSNVDQILNFDVQTVHFFRSN  60

Query  1374  PGFPPEIVAGKIKNAFRRLLVANTYDFLAGRLKKNKESERVEIECNAAGAGFTVASSEFA  1195
               FPPE+V+ K++ A  + +  + Y+FLAGRL+ +  S R++++CN AGAGF    SE+ 
Sbjct  61    KDFPPEMVSEKLRRALVKAM--DAYEFLAGRLRVDPSSGRLDVDCNGAGAGFVTGESEYT  118

Query  1194  LEDIGDLVYPNPAFRQLVTMSFDFVAKEDQPLCFLQVTSFKCGGFALGTSMNHISFDGSG  1015
             LE++GDLVYPNPAF QLVT     + K+DQPL   Q+TSFKCGGFA+G S NH +FDG  
Sbjct  119   LEELGDLVYPNPAFAQLVTSQLKSLRKDDQPLFAFQMTSFKCGGFAMGISTNHTTFDGLS  178

Query  1014  FKMFLENLAALSFNDDGPLAVVPCNDRSLLAARSPPQVTFPHPELLKVNLPAGEEMAPPV  835
             FK FLENLA+L    + PL+  PCNDR+LL AR+PP VTFPH EL+K      +     V
Sbjct  179   FKTFLENLASLL--SEKPLSTPPCNDRTLLKARTPPSVTFPHHELVKFQ----DCETTTV  232

Query  834   FDSLKDDLAFEIFQLSSADIERLKDKAKAPDNVKTKVTGFNVLTAAIWRCKALSCLGGEN  655
             F++    L F+IF+LSS  I +LK++A    +   +V+GFNV+TA +WRCKALS    + 
Sbjct  233   FEATSQHLDFKIFKLSSDQINKLKERASETSSGYVRVSGFNVVTALVWRCKALSVTSEKE  292

Query  654   NSDRL----STVLFAVDIRRRLNPPLPDSYSGNAVLTGYGSAKCAELEEGPFWKTVQMVY  487
               +      ST+L+AVDIR RLNP LP SY+GNAVLT Y  AKC  L E PF + V++V 
Sbjct  293   EEEANLERESTILYAVDIRGRLNPELPPSYTGNAVLTAYAKAKCKALLEEPFGRIVEIVG  352

Query  486   EGAARMTDEYARSAIDWGELYKGFPHGEFLVSSWWRLGFEGVQFPWGKPKYSCPVVYHRK  307
             EGA R+TDEYARSAIDWGELYKGFPHGE LVSSWW+LGF  V++PWGKPKYSCPVVYHRK
Sbjct  353   EGAKRITDEYARSAIDWGELYKGFPHGEVLVSSWWKLGFAEVEYPWGKPKYSCPVVYHRK  412

Query  306   DIILLFPDIDNGGKSNSGVNVLVALPPKEMEKFKSLFHKFLA  181
             DI+LLFPDID   K   GV VL ALP KEM KF+  F   L 
Sbjct  413   DIVLLFPDIDGDSK---GVYVLAALPSKEMTKFQHWFEDTLC  451



>ref|XP_010241521.1| PREDICTED: omega-hydroxypalmitate O-feruloyl transferase-like 
[Nelumbo nucifera]
Length=459

 Score =   523 bits (1346),  Expect = 4e-178, Method: Compositional matrix adjust.
 Identities = 251/458 (55%), Positives = 339/458 (74%), Gaps = 16/458 (3%)
 Frame = -3

Query  1527  PETLHEDLKVTILDSGLIFPSQETTKHTMFLSNIDKVLNFDVQTVHFFPASPGFPPEIVA  1348
             P +L  DLKV    S  I P ++T + ++FLSN+D+VLNF+V+TVHFFPA+P FPPE V 
Sbjct  9     PLSLITDLKVRRQRSSRIIPPEKTERRSLFLSNMDQVLNFNVETVHFFPANPDFPPETVV  68

Query  1347  GKIKNAFRRLLVANTYDFLAGRLKKNKESERVEIECNAAGAGFTVASSEFALEDIGDLVY  1168
               ++ AF+++L+   YDFLAGRL+ N +  R+EI+CN+AG GF VASSE +L++IGDLVY
Sbjct  69    DILEAAFQKILMP--YDFLAGRLRFNPQQRRLEIDCNSAGIGFWVASSELSLDEIGDLVY  126

Query  1167  PNPAFRQLVTMSFDFVAKEDQPLCFLQVTSFKCGGFALGTSMNHISFDGSGFKMFLENLA  988
             PNPAFRQL+    D +  +D PLC +QVT+FKCGGFALG   NH++FDG   K+FLENLA
Sbjct  127   PNPAFRQLIMDKVDNLDADDSPLCVVQVTTFKCGGFALGLCTNHVTFDGISVKLFLENLA  186

Query  987   ALSFNDDGPLAVVPCNDRSLLAARSPPQVTFPHPELLKVNLPAG-----EEMAPPVFDSL  823
             +L+  D+ PL + PCNDR LLAARSPP+VT  HPEL+K+ +P G     ++   PVF   
Sbjct  187   SLT--DNKPLVLTPCNDRQLLAARSPPRVTCSHPELVKLEIPQGNVDEFDQSHTPVFAPA  244

Query  822   KDDLAFEIFQLSSADIERLKDKAKAPDNVKTKVTG-FNVLTAAIWRCKALSC---LGGEN  655
              +DL F+IF+L+ +DI  LK KA      +++++  FNV+TA +WRCKAL+    +   +
Sbjct  245   PEDLDFKIFRLTESDIYNLKQKAAKLGVGESRISSSFNVVTAHVWRCKALAAAADITQND  304

Query  654   NSDRLSTVLFAVDIRRRLNPPLPDSYSGNAVLTGYGSAKCAELEEGPFWKTVQMVYEGAA  475
              S+++STVL+AVD+R +L PPLP SY+GNAVLT Y  A C ELE  PF   V+ V+EGA 
Sbjct  305   ISEKMSTVLYAVDVRSKLTPPLPPSYTGNAVLTAYAMASCHELENAPFSSLVEKVFEGAT  364

Query  474   RMTDEYARSAIDWGELYKGFPHGEFLVSSWWRLGFEGVQFPWGKPKYSCPVVYHRKDIIL  295
             RMTDEY RSAIDWGELY+G+P  + L+SSWW+LGF  V++PWG+PKY CP+++H+KD+IL
Sbjct  365   RMTDEYIRSAIDWGELYQGYPLCDLLISSWWKLGFSEVKYPWGRPKYCCPIIHHKKDVIL  424

Query  294   LFPDIDNGGKSNSGVNVLVALPPKEMEKFKSLFHKFLA  181
              FPDI+ G    + +N+ VALP KEM+KF++LF+KFLA
Sbjct  425   FFPDIERG---QNALNIFVALPHKEMDKFQALFNKFLA  459



>gb|EYU39480.1| hypothetical protein MIMGU_mgv1a027110mg [Erythranthe guttata]
Length=399

 Score =   517 bits (1331),  Expect = 7e-177, Method: Compositional matrix adjust.
 Identities = 266/426 (62%), Positives = 322/426 (76%), Gaps = 38/426 (9%)
 Frame = -3

Query  1446  TMFLSNIDKVLNFDVQTVHFFPASPGFPPEIVAGKIKNAFRRLLVANTYDFLAGRLKKNK  1267
             ++FLSNID+VLNF VQTVHFFPA+  FPPEIVA ++KNA  +++V   YDFLAG+L  N 
Sbjct  6     SIFLSNIDQVLNFHVQTVHFFPANVDFPPEIVAARLKNALEKVMVP--YDFLAGKLTLNH  63

Query  1266  ESERVEIECNAAGAGFTVASSEFALEDIGDLVYPNPAFRQLVTMSFDFVAKEDQPLCFLQ  1087
             ++ R+EIECN++      A++EF+L++IGDLVY NPAF QL+  + +    EDQPLC  Q
Sbjct  64    QTGRLEIECNSSSG----AAAEFSLDEIGDLVYLNPAFMQLIVHALE--KFEDQPLCVFQ  117

Query  1086  V----TSFKCGGFALGTSMNHISFDGSGFKMFLENLAALSFNDD-GPLAVVPCNDRSLLA  922
             V    TSFKCGGFALG S NH+ FDG  FK+FLENLA+ +F+DD  PL++ PCNDR LLA
Sbjct  118   VCTKVTSFKCGGFALGISTNHVLFDGMSFKIFLENLASQAFDDDYKPLSIPPCNDRRLLA  177

Query  921   ARSPPQVTFPHPELLKVNLPAGEEMAPPVFDSLKDDLAFEIFQLSSADIERLKDKAKAPD  742
             ARSPPQVTFPHPELLK+N P GEE APP       DL F+IF LS  +I RLK++AKA  
Sbjct  178   ARSPPQVTFPHPELLKLNPPVGEENAPP-------DLDFKIFNLSQDEIGRLKEEAKA--  228

Query  741   NVKTKVTGFNVLTAAIWRCKALSCLGGENNSDRLSTVLFAVDIRRRLNPPLPDSYSGNAV  562
                TK TGFNV+TA IWRCK LSC G     DR+STVL+AV IR RL PPLP SY GNAV
Sbjct  229   --ATKATGFNVVTAHIWRCKTLSCGGSR---DRVSTVLYAVVIRGRLEPPLPASYCGNAV  283

Query  561   LTGYGSAKCAELEEGPFWKTVQMVYEGAARMTDEYARSAIDWGELYKGFPHGEFLVSSWW  382
             L+ Y SAKC+ LEE PF + V MVYEGA RM DEYARSA+DWGE+YKGFP+GEFL+SSWW
Sbjct  284   LSAYTSAKCSALEEEPFSRVVDMVYEGAERMNDEYARSAVDWGEIYKGFPNGEFLISSWW  343

Query  381   RLGFEGVQFPWGKPKYSCPVVYHRKDIILLFPDIDNGGKSNSGVNVLVALPPKEMEKFKS  202
             RL          +P+YSCPVVYHRKDI+L+FP+I  GG  ++GVN+LVALP  EM+KF+S
Sbjct  344   RL---------IRPRYSCPVVYHRKDIVLIFPEI--GGAGSNGVNILVALPANEMDKFES  392

Query  201   LFHKFL  184
             LF K+L
Sbjct  393   LFRKYL  398



>ref|XP_010470417.1| PREDICTED: omega-hydroxypalmitate O-feruloyl transferase-like 
[Camelina sativa]
Length=451

 Score =   519 bits (1336),  Expect = 8e-177, Method: Compositional matrix adjust.
 Identities = 264/462 (57%), Positives = 333/462 (72%), Gaps = 17/462 (4%)
 Frame = -3

Query  1548  MGALYLKPE-TLHEDLKVTILDSGLIFPSQETT-KHTMFLSNIDKVLNFDVQTVHFFPAS  1375
             MG+LY +    L +DLKVTI +S LIFPS+ET+ K +MFLSN+D++LNFDVQTVHFF  +
Sbjct  1     MGSLYQESSPLLLQDLKVTIKESTLIFPSEETSEKKSMFLSNVDQILNFDVQTVHFFRPN  60

Query  1374  PGFPPEIVAGKIKNAFRRLLVANTYDFLAGRLKKNKESERVEIECNAAGAGFTVASSEFA  1195
               F PEIV+ K++ A  + +  + Y+FLAGRL+ +  S R++++CN +GAGF  A+SE+ 
Sbjct  61    KDFLPEIVSEKLRKALVKAM--DAYEFLAGRLRVDPSSGRLDVDCNGSGAGFVTAASEYT  118

Query  1194  LEDIGDLVYPNPAFRQLVTMSFDFVAKEDQPLCFLQVTSFKCGGFALGTSMNHISFDGSG  1015
             LE++GDLVYPNPAF QLVT     + K++QPL   Q+TSFKCGGFA+G S NH +FDG  
Sbjct  119   LEELGDLVYPNPAFAQLVTSQLQSLPKDNQPLFAFQMTSFKCGGFAMGISTNHTTFDGLS  178

Query  1014  FKMFLENLAALSFNDDGPLAVVPCNDRSLLAARSPPQVTFPHPELLKVNLPAGEEMAPPV  835
             FK FLENLA+L   ++ PL+  PCNDRSLL AR+PP VTFPH EL+K      +     V
Sbjct  179   FKTFLENLASLL--NEKPLSTPPCNDRSLLKARTPPSVTFPHHELVKFQ----DCETTTV  232

Query  834   FDSLKDDLAFEIFQLSSADIERLKDKAKAPDNVKTKVTGFNVLTAAIWRCKALSCLGGEN  655
             F++    L F+IF+LSS  I +LK++A    +   +V+GFNV+TA +WRCKALS    + 
Sbjct  233   FEATSQHLDFKIFKLSSDQINKLKERASETSSGYVRVSGFNVVTALVWRCKALSVTSEKE  292

Query  654   NSDRL----STVLFAVDIRRRLNPPLPDSYSGNAVLTGYGSAKCAELEEGPFWKTVQMVY  487
               +      ST+L+AVDIR RLNP LP SY+GNAVLT Y  AKC  L E PF + V++V 
Sbjct  293   EEEANLERESTILYAVDIRGRLNPELPPSYTGNAVLTAYAKAKCKALLEEPFGRIVEIVG  352

Query  486   EGAARMTDEYARSAIDWGELYKGFPHGEFLVSSWWRLGFEGVQFPWGKPKYSCPVVYHRK  307
             EGA R+TDEYARSAIDWGELYKGFPHG+ LVSSWW+LGF  V++PWGKPKYSCPVVYHRK
Sbjct  353   EGAKRITDEYARSAIDWGELYKGFPHGQVLVSSWWKLGFAEVEYPWGKPKYSCPVVYHRK  412

Query  306   DIILLFPDIDNGGKSNSGVNVLVALPPKEMEKFKSLFHKFLA  181
             DI+LLFPDID   K   GV VL ALP KEM KF+  F   L 
Sbjct  413   DIVLLFPDIDGDSK---GVYVLAALPSKEMTKFQHWFEDTLC  451



>emb|CDY39285.1| BnaC06g27060D [Brassica napus]
Length=451

 Score =   518 bits (1333),  Expect = 2e-176, Method: Compositional matrix adjust.
 Identities = 262/451 (58%), Positives = 327/451 (73%), Gaps = 16/451 (4%)
 Frame = -3

Query  1518  LHEDLKVTILDSGLIFPSQETTKH---TMFLSNIDKVLNFDVQTVHFFPASPGFPPEIVA  1348
             L +DLKVT  ++ LIFPSQET  H   TMFLSN+D+VLNFDVQTVHFF  +  FPPEIV+
Sbjct  12    LLQDLKVTSKEASLIFPSQETLTHERKTMFLSNVDQVLNFDVQTVHFFRPNKDFPPEIVS  71

Query  1347  GKIKNAFRRLLVANTYDFLAGRLKKNKESERVEIECNAAGAGFTVASSEFALEDIGDLVY  1168
               ++ A  R +  + Y+FLAGRL+ N  S R++++CN AGAGF  A+SE+ LE++GDLVY
Sbjct  72    EMLRKALVRAM--DVYEFLAGRLRLNPSSGRLDVDCNGAGAGFVTAASEYTLEELGDLVY  129

Query  1167  PNPAFRQLVTMSFDFVAKEDQPLCFLQVTSFKCGGFALGTSMNHISFDGSGFKMFLENLA  988
             PNPA+ +LVT     + K+DQPL   QVTSFKCGGFA+G S NH +FDG  FK FL NLA
Sbjct  130   PNPAYVKLVTSQLQSLPKDDQPLFAFQVTSFKCGGFAMGISTNHTTFDGLSFKTFLANLA  189

Query  987   ALSFNDDGPLAVVPCNDRSLLAARSPPQVTFPHPELLKVNLPAGEEMAPPVFDSLKDDLA  808
             +L    + PL+  PCNDR+LL ARSPP+VTFPH EL+++      E    VF++  + L 
Sbjct  190   SLL--SEKPLSTPPCNDRTLLKARSPPRVTFPHHELVQLQ---DSETTTAVFEATSEQLD  244

Query  807   FEIFQLSSADIERLKDKAKAPDNVK--TKVTGFNVLTAAIWRCKALSCLGGENNSDRLST  634
             F IF+LSS  I RLK+KA    +     + TGFNV+TA +WRCKALS +  E + ++ ST
Sbjct  245   FNIFKLSSQQILRLKEKASESMSSTGCVRATGFNVVTALVWRCKALSYVE-EEDLEKEST  303

Query  633   VLFAVDIRRRLNPPLPDSYSGNAVLTGYGSAKCAELEEGPFWKTVQMVYEGAARMTDEYA  454
             +L+AVDIR RL+P LP SY+GNAVLT Y  AK   L E PF + V+MV EGA R+TDEYA
Sbjct  304   ILYAVDIRGRLDPQLPSSYTGNAVLTAYAKAKRKALLEEPFGRIVEMVGEGANRITDEYA  363

Query  453   RSAIDWGELYKGFPHGEFLVSSWWRLGFEGVQFPWGKPKYSCPVVYHRKDIILLFPDIDN  274
             RSAIDWGE+YKGFPHGE LVSSWW+LGF  V++PWGKPKY CPVVYHRKDI+LLFP+ID 
Sbjct  364   RSAIDWGEMYKGFPHGEVLVSSWWKLGFAEVEYPWGKPKYCCPVVYHRKDIVLLFPEIDG  423

Query  273   GGKSNSGVNVLVALPPKEMEKFKSLFHKFLA  181
               K   GV VL ALP +EM KF++ F   L+
Sbjct  424   DSK---GVYVLAALPAEEMAKFQNWFEDTLS  451



>emb|CDY16408.1| BnaA02g12120D [Brassica napus]
Length=451

 Score =   517 bits (1331),  Expect = 5e-176, Method: Compositional matrix adjust.
 Identities = 269/463 (58%), Positives = 335/463 (72%), Gaps = 19/463 (4%)
 Frame = -3

Query  1548  MGALYLKPETLH-EDLKVTILDSGLIFPSQETTKH---TMFLSNIDKVLNFDVQTVHFFP  1381
             MGA Y +  +L  ++LKVTI +S LIFPS+ET  H   +MFLSN+D++LNFDVQTVHFF 
Sbjct  1     MGASYQECSSLLLQNLKVTIKESYLIFPSEETLTHESKSMFLSNVDQILNFDVQTVHFFR  60

Query  1380  ASPGFPPEIVAGKIKNAFRRLLVANTYDFLAGRLKKNKESERVEIECNAAGAGFTVASSE  1201
              +  +PPEIV+  ++ A  R +  + Y+FLAGRL+ N  S R+ I+CN AGAGF  A SE
Sbjct  61    PNKDYPPEIVSEMLRMALVRAM--DVYEFLAGRLRLNPSSGRLNIDCNGAGAGFVTAESE  118

Query  1200  FALEDIGDLVYPNPAFRQLVTMSFDFVAKEDQPLCFLQVTSFKCGGFALGTSMNHISFDG  1021
             + LE++GDLVYPNPAF +LVT     + K+DQPL   QVTSFKCGGFA+G S NH +FDG
Sbjct  119   YTLEELGDLVYPNPAFAELVTSQLQSLPKDDQPLFAFQVTSFKCGGFAMGISTNHTTFDG  178

Query  1020  SGFKMFLENLAALSFNDDGPLAVVPCNDRSLLAARSPPQVTFPHPELLKVNLPAGEEMAP  841
               FK FL+NLA+L    D PL+  PCNDR+LL AR+PP+VTFPH EL+++     ++   
Sbjct  179   LSFKTFLDNLASLL--SDKPLSTPPCNDRTLLKARTPPRVTFPHHELVQL-----QDSDT  231

Query  840   PVFDSLKDDLAFEIFQLSSADIERLKDKA-KAPDNVKTKVTGFNVLTAAIWRCKALSCLG  664
              VF++  + L F IF+LSS  I RLK+KA ++  +V  +VTGFNV+TA +WRCKALS + 
Sbjct  232   TVFEATSEHLDFNIFKLSSQQISRLKEKASESVSSVCVRVTGFNVVTALVWRCKALSLVE  291

Query  663   GENNSD--RLSTVLFAVDIRRRLNPPLPDSYSGNAVLTGYGSAKCAELEEGPFWKTVQMV  490
              E   D  + ST+L+AVDIR RL+P LP SY+GNAVLT YG AK   L E PF   V+MV
Sbjct  292   EEEVDDLEKESTILYAVDIRGRLDPQLPSSYTGNAVLTAYGKAKRKALLEEPFGTIVEMV  351

Query  489   YEGAARMTDEYARSAIDWGELYKGFPHGEFLVSSWWRLGFEGVQFPWGKPKYSCPVVYHR  310
              EGA R+TDEYARSAIDWGE+YKGFPHG+ LVSSWW+LGF  V++PWGKPKY CPVVYHR
Sbjct  352   GEGANRITDEYARSAIDWGEMYKGFPHGDVLVSSWWKLGFAEVEYPWGKPKYCCPVVYHR  411

Query  309   KDIILLFPDIDNGGKSNSGVNVLVALPPKEMEKFKSLFHKFLA  181
             KDI+LLFPDID   K   GV VL ALP KEM KF+  F   L 
Sbjct  412   KDIVLLFPDIDGDSK---GVYVLAALPSKEMTKFQKWFEDTLC  451



>ref|XP_009127402.1| PREDICTED: omega-hydroxypalmitate O-feruloyl transferase [Brassica 
rapa]
Length=451

 Score =   516 bits (1328),  Expect = 1e-175, Method: Compositional matrix adjust.
 Identities = 269/463 (58%), Positives = 335/463 (72%), Gaps = 19/463 (4%)
 Frame = -3

Query  1548  MGALYLKPETLH-EDLKVTILDSGLIFPSQETTKH---TMFLSNIDKVLNFDVQTVHFFP  1381
             MGA Y +  +L  ++LKVTI +S LIFPS+ET  H   +MFLSN+D++LNFDVQTVHFF 
Sbjct  1     MGASYQECSSLLLQNLKVTIKESYLIFPSEETLTHESKSMFLSNVDQILNFDVQTVHFFR  60

Query  1380  ASPGFPPEIVAGKIKNAFRRLLVANTYDFLAGRLKKNKESERVEIECNAAGAGFTVASSE  1201
              +  FPPEIV+  ++ A  R +  + Y+FLAGRL+ N  S R+ I+CN AGAGF  A SE
Sbjct  61    PNKDFPPEIVSEMLRMALVRAM--DVYEFLAGRLRLNPSSGRLNIDCNGAGAGFVTAESE  118

Query  1200  FALEDIGDLVYPNPAFRQLVTMSFDFVAKEDQPLCFLQVTSFKCGGFALGTSMNHISFDG  1021
             + LE++GDLVYPNPAF +LVT     + K+DQPL   QVTSFKCGGFA+G S NH +FDG
Sbjct  119   YTLEELGDLVYPNPAFAELVTSQLQSLPKDDQPLFAFQVTSFKCGGFAMGISTNHTTFDG  178

Query  1020  SGFKMFLENLAALSFNDDGPLAVVPCNDRSLLAARSPPQVTFPHPELLKVNLPAGEEMAP  841
               FK FL+NLA+L    + PL+  PCNDR+LL AR+PP+VTFPH EL+++     ++   
Sbjct  179   LSFKTFLDNLASLL--SEEPLSTPPCNDRTLLKARTPPRVTFPHHELVQL-----QDSDT  231

Query  840   PVFDSLKDDLAFEIFQLSSADIERLKDKA-KAPDNVKTKVTGFNVLTAAIWRCKALSCLG  664
              VF++  + L F IF+LSS  I RLK+KA ++  +V  +VTGFNV+TA +WRCKALS + 
Sbjct  232   TVFEATSEHLDFNIFKLSSQQISRLKEKASESVSSVCVRVTGFNVVTALVWRCKALSLVE  291

Query  663   GENNSD--RLSTVLFAVDIRRRLNPPLPDSYSGNAVLTGYGSAKCAELEEGPFWKTVQMV  490
              E   D  + ST+L+AVDIR RL+P LP SY+GNAVLT YG AK   L E PF   V+MV
Sbjct  292   EEEVDDLEKESTILYAVDIRGRLDPQLPSSYTGNAVLTAYGKAKRKALFEEPFGTIVEMV  351

Query  489   YEGAARMTDEYARSAIDWGELYKGFPHGEFLVSSWWRLGFEGVQFPWGKPKYSCPVVYHR  310
              EGA R+TDEYARSAIDWGE+YKGFPHG+ LVSSWW+LGF  V++PWGKPKY CPVVYHR
Sbjct  352   GEGANRITDEYARSAIDWGEMYKGFPHGDVLVSSWWKLGFAEVEYPWGKPKYCCPVVYHR  411

Query  309   KDIILLFPDIDNGGKSNSGVNVLVALPPKEMEKFKSLFHKFLA  181
             KDI+LLFPDID   K   GV VL ALP KEM KF+  F   L 
Sbjct  412   KDIVLLFPDIDGDSK---GVYVLAALPSKEMTKFQKWFEDTLC  451



>gb|AHA84252.1| omega-hydroxypalmitate O-feruloyl transferase [Phaseolus vulgaris]
Length=457

 Score =   516 bits (1328),  Expect = 2e-175, Method: Compositional matrix adjust.
 Identities = 261/453 (58%), Positives = 332/453 (73%), Gaps = 14/453 (3%)
 Frame = -3

Query  1527  PETLHEDLKVTILDSGLIFPSQETTKHTMFLSNIDKVLNFDVQTVHFFPASPGFPPEIVA  1348
             P  L EDLKVTI +  +IFPS+E  + +MF+SNIDKVL FDV+TVHFF A   FPP +V+
Sbjct  12    PTPLLEDLKVTIENCSMIFPSKEIQRKSMFVSNIDKVLTFDVETVHFFGAHRDFPPHLVS  71

Query  1347  GKIKNAFRRLLVANTYDFLAGRLKKNKESERVEIECNAAGAGFTVASSEFALEDIGDLVY  1168
              ++KNA    LV   Y+FL GRLK   ES+R+EI+C++ GAGF VASSE+ L+ IGDL Y
Sbjct  72    ERLKNALEDALV--VYEFLGGRLKVCHESKRLEIDCSSEGAGFVVASSEYKLDQIGDLDY  129

Query  1167  PNPAFRQLVTMSFDFVAKEDQPLCFLQVTSFKCGGFALGTSMNHISFDGSGFKMFLENLA  988
             PN AF QLV  +  F+ ++D PLC +QV S K GGF +  S +H +FDG  FK  L N+A
Sbjct  130   PNTAFAQLVHKNKSFLREDDDPLCVVQVASAKFGGFPISISAHHSTFDGLSFKSLLGNIA  189

Query  987   ALSFNDDGPLAVVPCNDRSLLAARSPPQVTFPHPELLKVNLPAGEEMAPPVFDSLKDDLA  808
             +L+ N   PLAV PCNDR LLAARSPP+V FPHPE+LK+N          + ++  ++L 
Sbjct  190   SLAANK--PLAVTPCNDRHLLAARSPPRVPFPHPEMLKLNDQLPTSPNSNILEASTEELR  247

Query  807   FEIFQLSSADIERLKDKAKAPDNVKTKVTG----FNVLTAAIWRCKALSCLGGENNSDRL  640
             F++F+L+S DI +LK++A+  D+V    T     FN +TA IWRCKALSC  G++N +++
Sbjct  248   FKVFKLTSNDIAKLKEEAR--DSVGGGTTTRITGFNAITAHIWRCKALSC-DGDSNPNKV  304

Query  639   STVLFAVDIRRRLNPPLPDSYSGNAVLTGYGSAKCAELEEGPFWKTVQMVYEGAARMTDE  460
             ST+L+AVDIR RL PPLP  Y+GNAVLT Y +A C ELEE PF + V+ V EGA RM++E
Sbjct  305   STILYAVDIRSRLEPPLPKFYTGNAVLTAYATATCRELEEWPFMRLVERVVEGATRMSNE  364

Query  459   YARSAIDWGELYKGFPHGEFLVSSWWRLGFEGVQFPWGKPKYSCPVVYHRKDIILLFPDI  280
             YARS IDWGE+ KGFP+GE LVSSWWRLGFE V++PWGKPKY CP+VYHRKDIILLFP +
Sbjct  365   YARSIIDWGEINKGFPNGEVLVSSWWRLGFEEVEYPWGKPKYCCPLVYHRKDIILLFPPV  424

Query  279   DNGGKSNSGVNVLVALPPKEMEKFKSLFHKFLA  181
             D GG    GV+V+VALPPKEM+KF  LF+KFL 
Sbjct  425   DGGG---DGVSVIVALPPKEMDKFYGLFNKFLG  454



>ref|XP_010268237.1| PREDICTED: omega-hydroxypalmitate O-feruloyl transferase-like 
[Nelumbo nucifera]
Length=458

 Score =   515 bits (1326),  Expect = 4e-175, Method: Compositional matrix adjust.
 Identities = 258/462 (56%), Positives = 331/462 (72%), Gaps = 19/462 (4%)
 Frame = -3

Query  1524  ETLHED-------LKVTILDSGLIFPSQETTKHTMFLSNIDKVLNFDVQTVHFFPASPGF  1366
             E LHED       LKV++     I P+++T + ++FLSNID+VLNF V++VHFF A+P F
Sbjct  2     EPLHEDVPPLSTDLKVSLQRCSTILPAEKTQRRSIFLSNIDQVLNFTVESVHFFLANPAF  61

Query  1365  PPEIVAGKIKNAFRRLLVANTYDFLAGRLKKNKESERVEIECNAAGAGFTVASSEFALED  1186
             PPE VA  ++ A ++LLV   YDFLAGRL+ N +  R+EI+CN+AG GF+VA+SE +LE+
Sbjct  62    PPETVAQMLERALQKLLVE--YDFLAGRLRFNPQQGRLEIDCNSAGVGFSVATSELSLEE  119

Query  1185  IGDLVYPNPAFRQLVTMSFDFVAKEDQPLCFLQVTSFKCGGFALGTSMNHISFDGSGFKM  1006
             +GDLVYPNPAF QL+      +  +DQPLC LQVTSF+CGGFA+G   NH+ FDG GFKM
Sbjct  120   VGDLVYPNPAFGQLMMDKLCSLETDDQPLCALQVTSFRCGGFAMGVCTNHVLFDGIGFKM  179

Query  1005  FLENLAALSFNDDGPLAVVPCNDRSLLAARSPPQVTFPHPELLKVNLPAG--EEMAPPVF  832
             FL NLA+L  N   PLAV PCNDR LLAARSPP + FPHPEL++  +P G  +     + 
Sbjct  180   FLHNLASLVGNK--PLAVTPCNDRQLLAARSPPTINFPHPELVRFEIPNGIDQSHTTALL  237

Query  831   DSLKDDLAFEIFQLSSADIERLKDKAKAPDN----VKTKVTGFNVLTAAIWRCKALSCLG  664
              S   DL F+IF LS+ DI  LK+KAK   +      T  T FNV+TA +WRC AL+   
Sbjct  238   QSTYGDLEFKIFPLSTDDIYHLKEKAKLGQSKNGPTPTHATSFNVVTAHVWRCMALAKDV  297

Query  663   GENNSDR-LSTVLFAVDIRRRLNPPLPDSYSGNAVLTGYGSAKCAELEEGPFWKTVQMVY  487
             G++   +  STVL+A DIRRRL+PPLP SY GNAV+  Y +A  +E+E GPF   V+MV 
Sbjct  298   GQSPEKKSTSTVLYAADIRRRLSPPLPPSYGGNAVVMAYATASFSEIEGGPFSHLVEMVS  357

Query  486   EGAARMTDEYARSAIDWGELYKGFPHGEFLVSSWWRLGFEGVQFPWGKPKYSCPVVYHRK  307
             +GA R+ DEY RS IDWGEL KGFP G+ L+SSWWRLGF  V++PWG+PKY CP+V+H+K
Sbjct  358   DGARRLEDEYIRSVIDWGELNKGFPMGDVLISSWWRLGFSQVEYPWGRPKYCCPIVHHKK  417

Query  306   DIILLFPDIDNGGKSNSGVNVLVALPPKEMEKFKSLFHKFLA  181
             D+ILL PDI+   K N GVNVLVALP KE++KF+SLF++ LA
Sbjct  418   DLILLLPDINEDTKGN-GVNVLVALPIKELKKFQSLFNELLA  458



>ref|XP_003624564.1| Omega-hydroxypalmitate O-feruloyl transferase [Medicago truncatula]
 gb|AES80782.1| HXXXD-type acyl-transferase family protein [Medicago truncatula]
Length=435

 Score =   487 bits (1253),  Expect = 2e-164, Method: Compositional matrix adjust.
 Identities = 248/433 (57%), Positives = 307/433 (71%), Gaps = 28/433 (6%)
 Frame = -3

Query  1518  LHEDLKVTILDSGLIFPSQETTKHTMFLSNIDKVLNFDVQTVHFFPASPGFPPEIVAGKI  1339
             L +D+KVTI  + +IFPS++  K ++FLSNID+VLNF V+TVHFF A+  FPP+IV  K+
Sbjct  11    LLQDMKVTIHKTSMIFPSKQIEKKSLFLSNIDRVLNFHVKTVHFFEANKDFPPQIVTEKL  70

Query  1338  KNAFRRLLVANTYDFLAGRLKKNKESERVEIECNAAGAGFTVASSEFALEDIGDLVYPNP  1159
             K A    LVA  YDFLAGRLK N E+ R+EI+CNA G GF VASSE+ L  IGDL YPN 
Sbjct  71    KKALEDALVA--YDFLAGRLKMNTETNRLEIDCNAEGVGFVVASSEYKLNQIGDLAYPNQ  128

Query  1158  AFRQLVTMSFDFVAKEDQPLCFLQVTSFKCGGFALGTSMNHISFDGSGFKMFLENLAALS  979
             AF Q V  + DF+   D PLC +QVTSFKCGGFA G + +H + DG   K+FL+NLAAL+
Sbjct  129   AFAQFVHNAKDFLKIGDLPLCVVQVTSFKCGGFAFGITRSHAAIDGHSLKIFLDNLAALA  188

Query  978   FNDDGPLAVVPCNDRSLLAARSPPQVTFPHPELLKVN--LPAGEEMAPPVFDSLKDDLAF  805
              N   PL + P NDR LLAARSPP V FPHPE++K++  LP G E    VF++  ++L F
Sbjct  189   AN--MPLIMTPFNDRQLLAARSPPHVDFPHPEMIKLDNLLPLGNESG--VFEASSEELDF  244

Query  804   EIFQLSSADIERLKDKAKAPDNVKTKVTGFNVLTAAIWRCKALSCLGGENNSDRLSTVLF  625
             ++FQL+S +I +LK+KAK   N   +VT FNV+T  +WRCKALS   G  + +R ST+L+
Sbjct  245   KVFQLTSKNINKLKEKAKI--NSIARVTSFNVITTHLWRCKALS---GPYDPNRSSTILY  299

Query  624   AVDIRRRLNPPLPDSYSGNAVLTGYGSAKCAELEEGPFWKTVQMVYEGAARMTDEYARSA  445
             AVDIR RLNPPLP  Y+GN               EG F + V+MV+EG  RM DEYARS 
Sbjct  300   AVDIRSRLNPPLPREYAGN---------------EGEFSRLVEMVWEGTKRMGDEYARSI  344

Query  444   IDWGELYKGFPHGEFLVSSWWRLGFEGVQFPWGKPKYSCPVVYHRKDIILLFPDIDNGGK  265
             IDWGELY GFP+GE LVSSWWRLGFE V++PWGKPKY CPVVYH+KDIILLFP       
Sbjct  345   IDWGELYNGFPNGELLVSSWWRLGFEEVEYPWGKPKYCCPVVYHKKDIILLFPSFHGVEG  404

Query  264   SNSGVNVLVALPP  226
              + GVN++VALPP
Sbjct  405   GDDGVNIIVALPP  417



>ref|XP_011075071.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Sesamum 
indicum]
Length=453

 Score =   484 bits (1247),  Expect = 3e-163, Method: Compositional matrix adjust.
 Identities = 247/459 (54%), Positives = 324/459 (71%), Gaps = 22/459 (5%)
 Frame = -3

Query  1536  YLKPETLHEDLKVTILDSGLIFPSQETT----KHTMFLSNIDKVLNFDVQTVHFFPASPG  1369
             ++ P    +DLK+T  +S L+ PS++T       ++FLSNID++LN+++ TVHFF A+P 
Sbjct  3     FILPIPPMQDLKITFQESILVSPSKQTDDDDPNKSIFLSNIDQILNYNIPTVHFFKANPD  62

Query  1368  FPPEIVAGKIKNAFRRLLVANTYDFLAGRLKKNKESERVEIECNAAGAGFTVASSEFALE  1189
             FPP+IV  ++K A +R+L  + Y F+AGR K N++  R+EI+CN+AGAGF VASS+++L+
Sbjct  63    FPPQIVPKRLKMALQRVLQVH-YHFMAGRFKLNQQLGRLEIDCNSAGAGFVVASSDYSLD  121

Query  1188  DIGDLVYPNPAFRQLVTMSFDFVAKE-DQPLCFLQVTSFKCGGFALGTSMNHISFDGSGF  1012
             D+GD VYPN  FRQL   + D +  E +QPLC  QVTSFKCGGF +G S NH+  DG+  
Sbjct  122   DLGDFVYPNLGFRQLAVQTLDNLGPEVEQPLCVFQVTSFKCGGFCIGMSTNHVLLDGASA  181

Query  1011  KMFLENLAALSFNDDGPLAVVPCNDRSLLAARSPPQVTFPHPELLKVNLPAGEEMAPPVF  832
             ++F+ENLA  +F DD PLAV+PCN+R LLAARSPP V FPHPE  K +LP  E + PPVF
Sbjct  182   QIFIENLATQAF-DDKPLAVIPCNNRHLLAARSPPHVEFPHPEFFKPDLP--EVVGPPVF  238

Query  831   DSLKDDLAFEIFQLSSADIERLKDKAKAPDNVK---TKVTGFNVLTAAIWRCKALSCLGG  661
             D  +++L +  F L+S  I  LK KAK  +N+    TK+T FNV+ A IWRCKALS    
Sbjct  239   DCKREELDYTTFSLTSKAINYLKGKAK--ENISYSTTKITSFNVVAALIWRCKALSN-DA  295

Query  660   ENNSDRLSTVLFAVDIRRRLNPPLPDSYSGNAVLTGYGSAKCAELEEGPFWKTVQMVYEG  481
             E N DR+ST+L  VD+R RLNPPLPDSYSGNAVL  Y SA C ++E+ PF K V+MV E 
Sbjct  296   EYNKDRVSTLLNVVDLRSRLNPPLPDSYSGNAVLVAYSSATCEDIEKWPFSKLVEMVSEA  355

Query  480   AARMTDEYARSAIDWGELYKGFPHGEFLVSSWWRLGFEGVQFPWGKPKYSCPVVYHRKDI  301
               R++DEY++S IDW E+ KG P GE++VSSW RL F  V +PWGKP YS PVV HRKDI
Sbjct  356   PKRVSDEYSKSVIDWLEINKGLPCGEYMVSSWLRLRFGEVVYPWGKPVYSGPVVSHRKDI  415

Query  300   ILLFPDIDNGGKSNSGVNVLVALPPKEMEKFKSLFHKFL  184
               +FP +D       GVN LV+LP KEME+F +LF +F 
Sbjct  416   CWIFPGVD-------GVNALVSLPAKEMERFVALFREFF  447



>ref|XP_010912121.1| PREDICTED: omega-hydroxypalmitate O-feruloyl transferase [Elaeis 
guineensis]
Length=452

 Score =   479 bits (1232),  Expect = 4e-161, Method: Compositional matrix adjust.
 Identities = 254/459 (55%), Positives = 328/459 (71%), Gaps = 16/459 (3%)
 Frame = -3

Query  1548  MGALYLKPETLHEDLKVTILDSGLIFPSQETTKHTMFLSNIDKVLNFDVQTVHFFPASPG  1369
             MG L   P    +DLKVTIL S  ++P+++T   +MFLSNID++LNFDV+T+HFF A+  
Sbjct  1     MGPLPQGPTL--QDLKVTILSSTTLYPAEKTEGRSMFLSNIDQILNFDVETIHFFAANLE  58

Query  1368  FPPEIVAGKIKNAFRRLLVANTYDFLAGRLKKNKESERVEIECNAAGAGFTVASSEFALE  1189
             FP  +V  ++ +A  ++LV   YDFLAGRLK      R+ I+CNAAG    VASSE  LE
Sbjct  59    FPAAVVVERLSSALEKVLVP--YDFLAGRLKLEPGDGRLVIDCNAAGVKLVVASSELKLE  116

Query  1188  DIGDLVYPNPAFRQLVTMSFDF-VAKEDQPLCFLQVTSFKCGGFALGTSMNHISFDGSGF  1012
             ++GDL  PNPAFRQLV  + D  +A ED+PLC  QVTSFKCGGFALG   NHI+FDG  F
Sbjct  117   EVGDLQCPNPAFRQLVAANPDNGLALEDRPLCSFQVTSFKCGGFALGICNNHITFDGLSF  176

Query  1011  KMFLENLAALSFNDDGPLAVVPCNDRSLLAARSPPQVTFPHPELL-KVNLPAGEEMAPP-  838
             + FL+NLAA++ N   PLA  PCNDR LLAARSPP+VTFPHPEL+   ++P   +  P  
Sbjct  177   QAFLQNLAAVASNR--PLATTPCNDRHLLAARSPPRVTFPHPELITHPSIPHPNQHPPST  234

Query  837   VFDSLKDDLAFEIFQLSSADIERLKDKAKAPDNVKTKVTGFNVLTAAIWRCKALSCLGGE  658
             + DSL   L F +F L   DI  LK+KAK   +     + FNV+ A +WRCKAL+    +
Sbjct  235   LLDSLSSYLQFHLFHLGPDDISTLKNKAKT--SSPPAASSFNVVAAHLWRCKALA--SSK  290

Query  657   NNSDRLSTVLFAVDIRRRLNPPLPDSYSGNAVLTGYGSAKCAELEEGPFWKTVQMVYEGA  478
              NS++ ST+L+AVD+R RL PPLP+SY+GNAVL+ Y +A C +LE+GPF + V++VY+GA
Sbjct  291   CNSNKSSTILYAVDLRSRLKPPLPNSYAGNAVLSAYATAPCGDLEKGPFARIVELVYKGA  350

Query  477   ARMTDEYARSAIDWGELYKGFPHGEFLVSSWWRLGFEGVQFPWGKPKYSCPVVYHRKDII  298
              RMTDEYARS IDWG+L +GFP G+ +VSSW RLGF  V++PWG+PK+SCPV   + DII
Sbjct  351   ERMTDEYARSVIDWGQLNQGFPWGDVVVSSWLRLGFSEVEYPWGRPKHSCPVGNPQWDII  410

Query  297   LLFPDIDNGGKSNSGVNVLVALPPKEMEKFKSLFHKFLA  181
             LLFP I   GK   G+N LVALP +++EKF+SLF+KFLA
Sbjct  411   LLFPTI---GKEGKGMNALVALPIEDVEKFRSLFYKFLA  446



>gb|EYU17601.1| hypothetical protein MIMGU_mgv1a006316mg [Erythranthe guttata]
Length=448

 Score =   473 bits (1216),  Expect = 9e-159, Method: Compositional matrix adjust.
 Identities = 246/458 (54%), Positives = 315/458 (69%), Gaps = 14/458 (3%)
 Frame = -3

Query  1548  MGALYLKPETLHEDLKVTILDSGLIFPSQETTKHTMFLSNIDKVLNFDVQTVHFFPASPG  1369
             M AL   P    EDLKV   +S LIFP +ET K ++FLSNID++LN+D+ T HFF A+P 
Sbjct  1     MAALSAVPSM--EDLKVKFQESSLIFPYKETPKKSIFLSNIDQILNYDIPTAHFFKANPA  58

Query  1368  FPPEIVAGKIKNAFRRLLVANTYDFLAGRLKKNKESERVEIECNAAGAGFTVASSEFALE  1189
             FPPEIVA + K A  ++LV   YDF+AGRLK N+E  R+EI+CNAAGAGF VA S+ +L+
Sbjct  59    FPPEIVAKRFKFALEKVLVP--YDFMAGRLKLNRELGRLEIDCNAAGAGFVVAKSDVSLD  116

Query  1188  DIGD-LVYPNPAFRQLVTMSFDFVAKE-DQPLCFLQVTSFKCGGFALGTSMNHISFDGSG  1015
             +IG+ LVYPN  +RQL     D +  E DQPLC  Q+TSFKCGGFA+G S NHI FDG G
Sbjct  117   EIGENLVYPNLGYRQLAVQRLDSLPPEVDQPLCVFQITSFKCGGFAIGMSTNHILFDGIG  176

Query  1014  FKMFLENLAALSFNDDGPLAVVPCNDRSLLAARSPPQVTFPHPELLKVNLPAGEEMAPPV  835
              K+F+ENLA+ SF ++ PLA VP  DR +LAARSPP V+FPHPE LK++LP G    PPV
Sbjct  177   AKVFIENLASQSF-ENKPLASVPYIDRRILAARSPPHVSFPHPEFLKLDLPVGPGSNPPV  235

Query  834   FDSLKDDLAFEIFQLSSADIERLKDKAKAPDNVKTKVTGFNVLTAAIWRCKALSCLGGEN  655
             FD   + L F+IF+L++  I ++KD       +  K++ F V+ A IWRCKA S    E 
Sbjct  236   FDCSVEKLDFKIFKLTTTQISQIKDNISKSSKI-AKISTFAVVAALIWRCKAFSG-NIEY  293

Query  654   NSDRLSTVLFAVDIRRRLNPPLPDSYSGNAVLTGYGSAKCAELEEGPFWKTVQMVYEGAA  475
             N DR+ST+L  +DIR R+NP LP SYS NAVL    S  C E++ GPF K V+++ EGA 
Sbjct  294   NKDRVSTLLNVIDIRPRVNPQLPSSYSANAVLPLGVSETCEEIKNGPFSKLVEIITEGAK  353

Query  474   RMTDEYARSAIDWGELYKGFPHGEFLVSSWWRLGFEGVQFPWGKPKYSCPVVYHRKDIIL  295
              +T EY +SA D  EL +G PHG+++VSSW RLGF+ V++ WGKP YSCPVV HRKDI  
Sbjct  354   EITHEYVKSAFDLLELNRGIPHGDYMVSSWLRLGFDEVEYAWGKPMYSCPVVNHRKDICW  413

Query  294   LFPDIDNGGKSNSGVNVLVALPPKEMEKFKSLFHKFLA  181
             +F D  +G     GV  +VALP  EM+ F++ FH F A
Sbjct  414   VFRDAVDG-----GVGAMVALPAHEMDIFEAAFHDFFA  446



>ref|XP_011100415.1| PREDICTED: omega-hydroxypalmitate O-feruloyl transferase-like 
[Sesamum indicum]
Length=448

 Score =   471 bits (1212),  Expect = 4e-158, Method: Compositional matrix adjust.
 Identities = 243/453 (54%), Positives = 309/453 (68%), Gaps = 15/453 (3%)
 Frame = -3

Query  1536  YLKPETLHEDLKVTILDSGLIFPSQETTKHTMFLSNIDKVLNFDVQTVHFFPASPGFPPE  1357
             ++ P    +DLK+ +  S L+ P+++T     FLSNID+ LNFDV TVHFF A+P FPPE
Sbjct  3     FVLPVPSMQDLKLKLQQSTLVSPAKQTENKVFFLSNIDQFLNFDVVTVHFFKANPDFPPE  62

Query  1356  IVAGKIKNAFRRLLVANTYDFLAGRLKKNKESERVEIECNAAGAGFTVASSEFALEDIGD  1177
              VA ++K A  R+LV   YDFLAGRLK N  S R+EI+CN+AG GF VASSE +L ++GD
Sbjct  63    TVAKRLKMALERVLVP--YDFLAGRLKLNLHSGRLEIDCNSAGVGFVVASSECSLAEVGD  120

Query  1176  LVYPNPAFRQLVTMSFDFVAKE-DQPLCFLQVTSFKCGGFALGTSMNHISFDGSGFKMFL  1000
             LV PN  FRQL   + D +  E DQ LC  QVTSFKCGGF++G S NH+ FDG+  ++F+
Sbjct  121   LVSPNLGFRQLAIQTLDNLGPEVDQLLCVFQVTSFKCGGFSIGMSTNHVLFDGASAQIFI  180

Query  999   ENLAALSFNDDGPLAVVPCNDRSLLAARSPPQVTFPHPELLKVNLPAGEEMAPPVFDSLK  820
             ENLA  +F DD PLA++PCNDR +LAARSPP   FPHPE  K +LPAG  + PP FD  +
Sbjct  181   ENLATQAF-DDKPLAIIPCNDRHILAARSPPHAEFPHPEFFKPDLPAG--LGPPAFDCER  237

Query  819   DDLAFEIFQLSSADIERLKDKAK-APDNVKTKVTGFNVLTAAIWRCKALSCLGGENNSDR  643
             ++L + +F L+   I  LKDKA+ +  +  TK+T F V+ A IWRCKALS    E N D 
Sbjct  238   EELDYTVFSLTLNAINYLKDKARESISSTSTKITSFIVVAALIWRCKALSNYT-EYNKDT  296

Query  642   LSTVLFAVDIRRRLNPPLPDSYSGNAVLTGYGSAKCAELEEGPFWKTVQMVYEGAARMTD  463
             +ST+   VDIR RLNPPLP+SY GNAVL  Y SA C ++E+ PF K V++V EG  RMTD
Sbjct  297   VSTLFNIVDIRSRLNPPLPNSYCGNAVLAAYSSATCDDIEKWPFSKLVELVAEGPKRMTD  356

Query  462   EYARSAIDWGELYKGFPHGEFLVSSWWRLGFEGVQFPWGKPKYSCPVVYHRKDIILLFPD  283
             EY +S IDW E+ KG P GE+ VSSW R+ F  V +PWGKP +S PVV +RKDI  +FP 
Sbjct  357   EYVKSTIDWLEINKGRPRGEYTVSSWLRMRFGEVVYPWGKPMHSGPVVSYRKDICWIFPG  416

Query  282   IDNGGKSNSGVNVLVALPPKEMEKFKSLFHKFL  184
              D        VN LV+LP KEME+F + F +F 
Sbjct  417   FDR-------VNALVSLPAKEMERFVACFREFF  442



>gb|EYU34269.1| hypothetical protein MIMGU_mgv1a006390mg [Erythranthe guttata]
Length=445

 Score =   470 bits (1209),  Expect = 1e-157, Method: Compositional matrix adjust.
 Identities = 238/454 (52%), Positives = 314/454 (69%), Gaps = 17/454 (4%)
 Frame = -3

Query  1533  LKPETLHEDLKVTILDSGLIFPSQETTKHTMFLSNIDKVLNFDVQTVHFFPASPGFPPEI  1354
             L P    EDLKV   +S LIFP +ET K ++FLSN+D++LN+D+ T HFF  +P FPPE 
Sbjct  4     LSPVPSMEDLKVMFQESSLIFPYKETPKKSIFLSNMDQILNYDIPTAHFFGPNPDFPPET  63

Query  1353  VAGKIKNAFRRLLVANTYDFLAGRLKKNKESERVEIECNAAGAGFTVASSEFALEDIGD-  1177
             VA +++ A  ++LV   YDF+AGRLK+N+E  R+EI CNAAGAGF VA S+ +L++IG+ 
Sbjct  64    VAERLRTALEKVLVP--YDFMAGRLKQNRELGRLEINCNAAGAGFVVAKSDVSLDEIGNE  121

Query  1176  -LVYPNPAFRQLVTMSFDFVAKE-DQPLCFLQVTSFKCGGFALGTSMNHISFDGSGFKMF  1003
              LV PN  +RQL     D +  E DQPLC  QVTSFKCGGFA+G S NHI FDG G K+F
Sbjct  122   NLVCPNLGYRQLAVQRLDSLPPEVDQPLCVFQVTSFKCGGFAIGMSTNHILFDGLGAKVF  181

Query  1002  LENLAALSFNDDGPLAVVPCNDRSLLAARSPPQVTFPHPELLKVNLPAGEEMAPPVFDSL  823
             L NLA+ SF ++ PLA++P NDR +LAARSPPQV+FPHPE LK +LP G    PP FD +
Sbjct  182   LLNLASQSF-ENKPLAIIPYNDRRILAARSPPQVSFPHPEFLKFDLPVGPGSTPPKFDCI  240

Query  822   KDDLAFEIFQLSSADIERLKDKAKAPDNVKTKVTGFNVLTAAIWRCKALSCLGGENNSDR  643
              ++L F+IF+L++  I  LKD       +  +++ F V+ A IWRCKA S     ++ +R
Sbjct  241   IEELDFKIFKLTTTQISHLKDNITKTSKIH-RISTFAVVAALIWRCKAFS-----DDKNR  294

Query  642   LSTVLFAVDIRRRLNPPLPDSYSGNAVLTGYGSAKCAELEEGPFWKTVQMVYEGAARMTD  463
             +ST+L  +DIR R+NP LP SYS NAVL    S  C E++ G F K V+++ EGA  MT 
Sbjct  295   VSTLLNVIDIRPRVNPQLPSSYSANAVLPLGVSETCEEIQNGAFSKLVEIITEGAKEMTH  354

Query  462   EYARSAIDWGELYKGFPHGEFLVSSWWRLGFEGVQFPWGKPKYSCPVVYHRKDIILLFPD  283
             EY +SA DW EL +G PHG+++VSSW RLGF+ V++ WGKP YSCPVV HRKDI  +F D
Sbjct  355   EYVKSAFDWLELNRGIPHGDYMVSSWLRLGFDEVEYAWGKPMYSCPVVNHRKDICWVFRD  414

Query  282   IDNGGKSNSGVNVLVALPPKEMEKFKSLFHKFLA  181
               +G     GV+ +VALP +EM  F+++FH F A
Sbjct  415   AVDG-----GVSAMVALPSQEMNIFEAVFHDFFA  443



>ref|XP_011100416.1| PREDICTED: omega-hydroxypalmitate O-feruloyl transferase-like 
[Sesamum indicum]
Length=448

 Score =   464 bits (1194),  Expect = 2e-155, Method: Compositional matrix adjust.
 Identities = 238/452 (53%), Positives = 311/452 (69%), Gaps = 15/452 (3%)
 Frame = -3

Query  1536  YLKPETLHEDLKVTILDSGLIFPSQETTKHTMFLSNIDKVLNFDVQTVHFFPASPGFPPE  1357
             ++ P    +DLK+ +  S L+ P+++T     FLSNID+ LN+D+ TVHFF A+P FPPE
Sbjct  3     FVLPVPPMQDLKLKLQQSTLVSPAKQTENQAFFLSNIDQFLNYDILTVHFFKANPDFPPE  62

Query  1356  IVAGKIKNAFRRLLVANTYDFLAGRLKKNKESERVEIECNAAGAGFTVASSEFALEDIGD  1177
              VA ++K A  R+LV   YDFLAGRLK N  S R+EI+CN+AG GF VASSE +L+++GD
Sbjct  63    TVAKRLKMALERVLVP--YDFLAGRLKLNLHSGRLEIDCNSAGVGFVVASSECSLDELGD  120

Query  1176  LVYPNPAFRQLVTMSFDFVAKE-DQPLCFLQVTSFKCGGFALGTSMNHISFDGSGFKMFL  1000
             LV PN  FRQL   + D +  E DQ LC  +VTSFKCGGF++G S NH+ FDG   ++F+
Sbjct  121   LVCPNLGFRQLSVQTLDNLGPEVDQLLCVFKVTSFKCGGFSIGMSTNHVLFDGVSAQIFI  180

Query  999   ENLAALSFNDDGPLAVVPCNDRSLLAARSPPQVTFPHPELLKVNLPAGEEMAPPVFDSLK  820
             ENLA  +F DD PLA++PCNDR LLAAR+PP V FPHPE  K +LPAG  + PPVFD  +
Sbjct  181   ENLATQAF-DDKPLAIIPCNDRHLLAARAPPHVEFPHPEFFKPDLPAG--LGPPVFDCER  237

Query  819   DDLAFEIFQLSSADIERLKDKAK-APDNVKTKVTGFNVLTAAIWRCKALSCLGGENNSDR  643
             ++L + +F L+   +  LKDKA+ +  +  TK+T F V+ A IWRCKALS    E N DR
Sbjct  238   EELDYTVFSLTLNAVNYLKDKARESISSTSTKITSFIVVAALIWRCKALSNYT-EYNKDR  296

Query  642   LSTVLFAVDIRRRLNPPLPDSYSGNAVLTGYGSAKCAELEEGPFWKTVQMVYEGAARMTD  463
             +ST+   VD+R RLNP LP+SY GNAVL  Y SA C ++++ PF K V++V E   RMTD
Sbjct  297   VSTLFNIVDLRSRLNPSLPNSYCGNAVLGAYSSATCDDIKKWPFSKLVELVAEEPKRMTD  356

Query  462   EYARSAIDWGELYKGFPHGEFLVSSWWRLGFEGVQFPWGKPKYSCPVVYHRKDIILLFPD  283
             EYA+S IDW E+ KG P GE+ VSSW R+ F  V +PWGKP +S PVV +RKDI  +FP 
Sbjct  357   EYAKSTIDWLEINKGLPRGEYTVSSWLRMRFGEVVYPWGKPMHSGPVVSYRKDICWIFPG  416

Query  282   IDNGGKSNSGVNVLVALPPKEMEKFKSLFHKF  187
             +D        VN LV+LP KEME+F +   +F
Sbjct  417   VDR-------VNALVSLPAKEMERFVACCREF  441



>gb|EYU39979.1| hypothetical protein MIMGU_mgv1a005557mg [Erythranthe guttata]
Length=479

 Score =   462 bits (1189),  Expect = 3e-154, Method: Compositional matrix adjust.
 Identities = 231/446 (52%), Positives = 310/446 (70%), Gaps = 13/446 (3%)
 Frame = -3

Query  1512  EDLKVTILDSGLIFPSQETTKHTMFLSNIDKVLNFDVQTVHFFPASPGFPPEIVAGKIKN  1333
             +DLK+T  +S L+ P Q+T K + FLSNID++LN+ + TV FF A+P +PP++V+ ++K 
Sbjct  12    QDLKITFQESSLVLPLQQTEKRSFFLSNIDQILNYRIPTVSFFSANPDYPPQLVSERLKL  71

Query  1332  AFRRLLVANTYDFLAGRLKKNKESERVEIECNAAGAGFTVASSEFALEDIGDLVYPNPAF  1153
             A +++LV   YDF+AGR K N+E+ R+EI+CN+AG GF VASSEF+L +IGDL+ PN  F
Sbjct  72    ALQKVLVP--YDFIAGRFKLNQETGRLEIDCNSAGVGFVVASSEFSLAEIGDLLSPNLGF  129

Query  1152  RQLVTMSF-DFVAKEDQ--PLCFLQVTSFKCGGFALGTSMNHISFDGSGFKMFLENLAAL  982
             +QL   +  D +A  D   P   LQVTSFKCG FA+G S+NHI  DG   K F +NLA+ 
Sbjct  130   QQLAVHTLTDNLAPNDHANPPFILQVTSFKCGSFAIGMSVNHILLDGLSAKAFSQNLASQ  189

Query  981   SFNDDGPLAVVPCNDRSLLAARSPPQVTFPHPELLKVNLPAGEEMAPPVFDSLKDDLAFE  802
             +F  D P AV+P  DR L++ARSPP V F HPE  K +LP G    PPVFD  K++L F+
Sbjct  190   AFEGDKPFAVIPFFDRRLMSARSPPLVAFTHPEFFKPDLPTGTS-GPPVFDCKKEELEFK  248

Query  801   IFQLSSADIERLKDKAKAPDNVKTKVTGFNVLTAAIWRCKALSCLGGENNSDRLSTVLFA  622
             +F+L++ DI  LK+KAK P+   T+++ FN     IW+CKALS    + + +R+ST L  
Sbjct  249   VFKLTTTDINFLKEKAKRPE---TRISSFNAAATLIWQCKALSYGENQKDEERVSTFLNV  305

Query  621   VDIRRRLNPPLPDSYSGNAVLTGYGSAKCAELEEGPFWKTVQMVYEGAARMTDEYARSAI  442
             VD+R RL+PPLP+ Y GNA+L  Y S KC  LE+ PF + V+MV E  AR++DEYARS I
Sbjct  306   VDLRSRLSPPLPEPYCGNAILVAYTSEKCQNLEKMPFSELVKMVAESPARVSDEYARSVI  365

Query  441   DWGELYKGFPHGEFLVSSWWRLGFEGVQFPWGKPKYSCPVVYHRKDIILLFPDIDNGGKS  262
             DW E+ +G P GE++VSSW RLGFE V FPWGKP++S PVV HRKDI  +FP  +N G  
Sbjct  366   DWLEINRGLPCGEYMVSSWLRLGFEEVVFPWGKPQHSGPVVNHRKDICWIFPSSNNDG--  423

Query  261   NSGVNVLVALPPKEMEKFKSLFHKFL  184
                +N LV+LP KEME+F+S F  F 
Sbjct  424   --AINALVSLPAKEMERFESHFCNFF  447



>gb|EYU17599.1| hypothetical protein MIMGU_mgv1a006131mg [Erythranthe guttata]
Length=450

 Score =   461 bits (1185),  Expect = 4e-154, Method: Compositional matrix adjust.
 Identities = 242/460 (53%), Positives = 316/460 (69%), Gaps = 20/460 (4%)
 Frame = -3

Query  1548  MGALYLKPETLHEDLKVTILDSGLIFPSQETTKHTMFLSNIDKVLNFDVQTVHFFPASPG  1369
             M AL   P    EDLK+   +S LIFP +ET K ++FLSNID++LN+D+ T HFF A+P 
Sbjct  1     MAALSAVPSM--EDLKIKFQESSLIFPYKETPKKSIFLSNIDQILNYDIPTAHFFKANPD  58

Query  1368  FPPEIVAGKIKNAFRRLLVANTYDFLAGRLKKNKESERVEIECNAAGAGFTVASSEFALE  1189
             FPPEI+A ++K A  ++LV   YDF+AGRLK N+E  R+EI CNAAGAGF VA S+ +L+
Sbjct  59    FPPEIMAKRLKIALEKVLVP--YDFMAGRLKLNRELGRLEINCNAAGAGFVVAKSDVSLD  116

Query  1188  DIGD--LVYPNPAFRQLVTMSFDFVAKE-DQPLCFLQVTSFKCGGFALGTSMNHISFDGS  1018
             +IGD  LV PN  +RQL     D +  E DQPLC  QVTSFKCGGFA+G S NHI FDG 
Sbjct  117   EIGDENLVCPNLGYRQLAVQRLDSLPPEVDQPLCVFQVTSFKCGGFAIGMSTNHILFDGL  176

Query  1017  GFKMFLENLAALSFNDDGPLAVVPCNDRSLLAARSPPQVTFPHPELLKVNLPAGEEMAPP  838
             G K+FL NLA+ SF ++ PLA+VP NDR +L ARSPP V++PH E LK +LP G    PP
Sbjct  177   GAKVFLLNLASQSF-ENKPLAIVPYNDRRILCARSPPHVSYPHREFLKFDLPVGLGSTPP  235

Query  837   VFDSLKDDLAFEIFQLSSADIERLKDKAKAPDNVKTKVTGFNVLTAAIWRCKALSCLGGE  658
              FD + ++L F+I +L++  I  LKD       +  K++ F V+ A IWRCKA S     
Sbjct  236   NFDCIIEELDFKIVKLTTTQISNLKDNITKTSKID-KISTFAVVAALIWRCKAFS-----  289

Query  657   NNSDRLSTVLFAVDIRRRLNPPLPDSYSGNAVLTGYGSAKCAELEEGPFWKTVQMVYEGA  478
             ++ +++ST+L A+DIR  +NPPLP SYS NAVL    S  C E++ GPF K V+++ EGA
Sbjct  290   DDKNKVSTLLNAIDIRPIVNPPLPYSYSANAVLPLGVSETCEEIKNGPFSKLVEIITEGA  349

Query  477   ARMTDEYARSAIDWGELYKGFPHGE-FLVSSWWRLGFEGVQFPWGKPKYSCPVVYHRKDI  301
               MT EY +SA DW EL +G PHG+ F VSSW RLGF+ V++ WGKP YSCPVV HRKDI
Sbjct  350   KEMTHEYVKSAFDWLELNRGIPHGDYFKVSSWLRLGFDEVEYAWGKPIYSCPVVNHRKDI  409

Query  300   ILLFPDIDNGGKSNSGVNVLVALPPKEMEKFKSLFHKFLA  181
               +F D  +G     GV+ +VALP +EM+ F+++FH F+A
Sbjct  410   CWVFRDAVDG-----GVSAMVALPSQEMDIFEAVFHDFIA  444



>ref|XP_011078800.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Sesamum 
indicum]
Length=452

 Score =   461 bits (1185),  Expect = 5e-154, Method: Compositional matrix adjust.
 Identities = 232/452 (51%), Positives = 312/452 (69%), Gaps = 21/452 (5%)
 Frame = -3

Query  1533  LKPETLHEDLKVTILDSGLIFPSQETTKH-TMFLSNIDKVLNFDVQTVHFFPASPGFPPE  1357
             L P    +DLK+T   S L+FP+Q+T  H T+FLSNID+ LNF+VQ ++FF  +P FPP+
Sbjct  10    LSPNPAMQDLKLTFQLSTLVFPAQQTDDHKTLFLSNIDQSLNFNVQILYFFSPNPDFPPD  69

Query  1356  IVAGKIKNAFRRLLVANTYDFLAGRLKKNKESERVEIECNAAGAGFTVASSEFALEDIGD  1177
              V  ++K A  ++LV   YDF+AGRLK N  S R+++ CNAAGAGF  ASS F+L++IGD
Sbjct  70    TVVTRLKLAVEKVLVP--YDFMAGRLKWNHHSARLDLHCNAAGAGFMAASSTFSLDEIGD  127

Query  1176  LVYPNPAFRQLVTMSFDFVAKEDQPLCFLQVTSFKCGGFALGTSMNHISFDGSGFKMFLE  997
             LV PNP FRQLV  + + +  EDQPLC  QVTSFKCGGFA+G S+NHI  DG   +MFLE
Sbjct  128   LVCPNPGFRQLVVQTLNNLEDEDQPLCVFQVTSFKCGGFAIGVSLNHILLDGLAGRMFLE  187

Query  996   NLAALSFNDDGPLAVVPCNDRSLLAARSPPQVTFPHPELLKVNLPAGEEMAPPVFDSLKD  817
             NLA+ +F +D PLA++PC++R LLAARSPP ++FPHPELLK   P    +  PV  S K+
Sbjct  188   NLASQAF-EDKPLAIIPCHNRRLLAARSPPLISFPHPELLKPQFPV---LGRPVSGSEKE  243

Query  816   DLAFEIFQLSSADIERLK----DKAKAPDNVKTKVTGFNVLTAAIWRCKALSCLGGENNS  649
              L F++F++SS+D+  LK     +A A +    K+T FNV+ A IWRC+ALS    E N 
Sbjct  244   -LDFKVFKISSSDVNFLKAMVAKQAAADNATAVKITSFNVMAALIWRCRALSLCDVEGNK  302

Query  648   DRLSTVLFAVDIRRRLNPPLPDSYSGNAVLTGYGSAKCAELEEGPFWKTVQMVYEGAARM  469
             DR+ T+ +AVD+R RLNPPLP  Y GNA+L  Y SAKC ++E+ P  K V+M+ EG  R+
Sbjct  303   DRVFTMCYAVDLRSRLNPPLPPEYCGNAILPAYASAKCRDIEKWPLLKLVEMISEGIERL  362

Query  468   TDEYARSAIDWGELYKGFPHGEFLVSSWWRLGFEGVQFPWGKPKYSCPVVYHRKDIILLF  289
             +DEY +SAIDW E+ KG P+G+ +++SW RLG   V FPWGK  Y C VV + + +  +F
Sbjct  363   SDEYVKSAIDWLEINKGIPYGDCVLTSWLRLGLNEVVFPWGKSLYCCHVVNNLERLCWMF  422

Query  288   PDIDNGGKSNSGVNVLVALPPKEMEKFKSLFH  193
             P +D       GVN+L+  P +EME+F+  FH
Sbjct  423   PYVD-------GVNILIQRPAEEMERFQ--FH  445



>gb|EYU20701.1| hypothetical protein MIMGU_mgv1a023965mg [Erythranthe guttata]
Length=460

 Score =   460 bits (1183),  Expect = 2e-153, Method: Compositional matrix adjust.
 Identities = 237/461 (51%), Positives = 312/461 (68%), Gaps = 18/461 (4%)
 Frame = -3

Query  1533  LKPETLHEDLKVTILDSGLIFPSQETTKHTMFLSNIDKVLNFDVQTVHFFPASPGFPPEI  1354
             + P+   +DLK+T  +S L+FPSQ+T K ++FLSNID+ LNF+VQT HFF A+P FPPEI
Sbjct  4     ISPDPSMQDLKITFQESTLVFPSQQTQKKSLFLSNIDQFLNFNVQTAHFFKANPHFPPEI  63

Query  1353  VAGKIKNAFRRLLVANTYDFLAGRLKKNKESERVEIECNAAGAGFTVASSEFALEDIGDL  1174
              A ++K A  ++LV   YDF+AGRL  N   +R +I+CNAAGAGF VASSEF+L+++GDL
Sbjct  64    AAKRLKMALEKVLVP--YDFMAGRLNWNHHLDRFKIDCNAAGAGFVVASSEFSLDELGDL  121

Query  1173  VYPNPAFRQLVTMSFDFVAKEDQPLCFLQVTSFKCGGFALGTSMNHISFDGSGFKMFLEN  994
               PN  FRQL       +  + QPLC  QVT+FKCGGFA+G S+NH+ FDG    MF +N
Sbjct  122   FRPNLGFRQLAVEKLRNLDDDKQPLCVFQVTAFKCGGFAIGVSLNHMLFDGLAAIMFQQN  181

Query  993   LAALSFN--DDGPLAVVPCNDRSLLAARSPPQVTFPHPELLKVNLPAGEEMAPPVFDSLK  820
             LA+L+F+  D+ PLA++PC+DR LLAARSPP VTF HPE LK++        PPV D  +
Sbjct  182   LASLAFDDVDNKPLALIPCHDRRLLAARSPPLVTFQHPEFLKLDRRPFLS-PPPVSDDSE  240

Query  819   DDLAFEIFQLSSADIERLKDKAK---APDNVKT----KVTGFNVLTAAIWRCKALSCLGG  661
             + L F + +LSS D+  LK KA    A D   T    K T FNV  A +WRC+ALS    
Sbjct  241   EQLDFRLLKLSSRDLNFLKMKANEAAAEDGKSTTTAIKATTFNVAAALVWRCRALSAHDF  300

Query  660   ENNSDRLSTVLFAVDIRRRLNPPLPDSYSGNAVLTGYGSAKCAELEEGPFWKTVQMVYEG  481
             ++N DR+ST+L+ VD+R RLNPPLP  YSGNA+L  Y SAKC ++E+ PF K V+M+ +G
Sbjct  301   DHNKDRVSTILYVVDLRSRLNPPLPAGYSGNALLVAYASAKCEDIEKWPFRKMVEMISQG  360

Query  480   AARMTDEYARSAIDWGELYKGF-PHGEFLVSSWWRLGFEGVQFPWGKPKYSCPVVYHRKD  304
               R++DEY +S  D+ E+ KG  P G+ +VSSW RLG++ V+FPWGKP    PVV   + 
Sbjct  361   VTRISDEYVKSVTDFLEINKGMIPRGDCIVSSWLRLGYDQVEFPWGKPVCCTPVVNKLER  420

Query  303   IILLFPDIDNGGKSNSGVNVLVALPPKEMEKFKSLFHKFLA  181
             I  +FPD+D     + GVNVLV  P  EME F+  FH F A
Sbjct  421   IFWIFPDVD-----SDGVNVLVQRPAAEMETFQFHFHNFFA  456



>gb|EYU17598.1| hypothetical protein MIMGU_mgv1a006131mg [Erythranthe guttata]
Length=456

 Score =   457 bits (1176),  Expect = 1e-152, Method: Compositional matrix adjust.
 Identities = 243/466 (52%), Positives = 318/466 (68%), Gaps = 26/466 (6%)
 Frame = -3

Query  1548  MGALYLKPETLHEDLKVTILDSGLIFPSQETTKHTMFLSNIDKVLNFDVQTVHFFPASPG  1369
             M AL   P    EDLK+   +S LIFP +ET K ++FLSNID++LN+D+ T HFF A+P 
Sbjct  1     MAALSAVPSM--EDLKIKFQESSLIFPYKETPKKSIFLSNIDQILNYDIPTAHFFKANPD  58

Query  1368  FPPEIVAGKIKNAFRRLLVANTYDFLAGRLKKNKESERVEIECNAAGAGFTVASSEFALE  1189
             FPPEI+A ++K A  ++LV   YDF+AGRLK N+E  R+EI CNAAGAGF VA S+ +L+
Sbjct  59    FPPEIMAKRLKIALEKVLVP--YDFMAGRLKLNRELGRLEINCNAAGAGFVVAKSDVSLD  116

Query  1188  DIGD--LVYPNPAFRQLVTMSFDFVAKE-DQPLC------FLQVTSFKCGGFALGTSMNH  1036
             +IGD  LV PN  +RQL     D +  E DQPLC      +LQVTSFKCGGFA+G S NH
Sbjct  117   EIGDENLVCPNLGYRQLAVQRLDSLPPEVDQPLCVFQFKHYLQVTSFKCGGFAIGMSTNH  176

Query  1035  ISFDGSGFKMFLENLAALSFNDDGPLAVVPCNDRSLLAARSPPQVTFPHPELLKVNLPAG  856
             I FDG G K+FL NLA+ SF ++ PLA+VP NDR +L ARSPP V++PH E LK +LP G
Sbjct  177   ILFDGLGAKVFLLNLASQSF-ENKPLAIVPYNDRRILCARSPPHVSYPHREFLKFDLPVG  235

Query  855   EEMAPPVFDSLKDDLAFEIFQLSSADIERLKDKAKAPDNVKTKVTGFNVLTAAIWRCKAL  676
                 PP FD + ++L F+I +L++  I  LKD       +  K++ F V+ A IWRCKA 
Sbjct  236   LGSTPPNFDCIIEELDFKIVKLTTTQISNLKDNITKTSKID-KISTFAVVAALIWRCKAF  294

Query  675   SCLGGENNSDRLSTVLFAVDIRRRLNPPLPDSYSGNAVLTGYGSAKCAELEEGPFWKTVQ  496
             S     ++ +++ST+L A+DIR  +NPPLP SYS NAVL    S  C E++ GPF K V+
Sbjct  295   S-----DDKNKVSTLLNAIDIRPIVNPPLPYSYSANAVLPLGVSETCEEIKNGPFSKLVE  349

Query  495   MVYEGAARMTDEYARSAIDWGELYKGFPHGE-FLVSSWWRLGFEGVQFPWGKPKYSCPVV  319
             ++ EGA  MT EY +SA DW EL +G PHG+ F VSSW RLGF+ V++ WGKP YSCPVV
Sbjct  350   IITEGAKEMTHEYVKSAFDWLELNRGIPHGDYFKVSSWLRLGFDEVEYAWGKPIYSCPVV  409

Query  318   YHRKDIILLFPDIDNGGKSNSGVNVLVALPPKEMEKFKSLFHKFLA  181
              HRKDI  +F D  +G     GV+ +VALP +EM+ F+++FH F+A
Sbjct  410   NHRKDICWVFRDAVDG-----GVSAMVALPSQEMDIFEAVFHDFIA  450



>ref|XP_010255141.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Nelumbo 
nucifera]
Length=465

 Score =   447 bits (1151),  Expect = 9e-149, Method: Compositional matrix adjust.
 Identities = 233/454 (51%), Positives = 321/454 (71%), Gaps = 9/454 (2%)
 Frame = -3

Query  1509  DLKVTILDSGLIFPSQETTKHTMFLSNIDKVLNFDVQTVHFFPASPGFPPEIVAGKIKNA  1330
             DLKVTI  S  + P+++T +  MFLSNID+ LNF  + + FF  +  +PP  V   ++ A
Sbjct  14    DLKVTIQRSFTVSPTEKTERRFMFLSNIDQGLNFRSEGLQFFKPNANYPPNTVIDILETA  73

Query  1329  FRRLLVANTYDFLAGRLKKNKESERVEIECNAAGAGFTVASSEFALEDIGDLVYPNPAFR  1150
              +++LV   YDFLAGRL+ N   +R+EI+CN+AG GF VA+S+ ++ +IGDL+YP+P F+
Sbjct  74    CQKILVP--YDFLAGRLRLNPHQDRLEIDCNSAGVGFVVATSDVSVAEIGDLLYPSPVFK  131

Query  1149  QLVTMSFDFVAKEDQPLCFLQVTSFKCGGFALGTSMNHISFDGSGFKMFLENLAALSFND  970
             QL+  + D +  +DQPLC LQVTSFKCGGFALG S NH  FDG  F++F+ENL+ ++   
Sbjct  132   QLIAEALDTLGADDQPLCVLQVTSFKCGGFALGVSCNHALFDGISFRIFIENLSCVAAGK  191

Query  969   DGPLAVVPCNDRSLLAARSPPQVTFPHPELLKVNLPAGEE--MAPPVFDSLKDDLAFEIF  796
               PLAV P N+R LLAARSPP+VTF HPE +K+ +    E  +   +F+ + ++L  +IF
Sbjct  192   --PLAVNPYNNRQLLAARSPPRVTFSHPERVKLEITRNVEPSITKTLFEPMPENLVPKIF  249

Query  795   QLSSADIERLKDKAKAPDNVKTKVTGFNVLTAAIWRCKALSCLGGENNSDRLSTVLFAVD  616
             +LS+ DI +LK KAK   +     T FNV+ A IWRCKALS   GEN+ D++STVL+AVD
Sbjct  250   RLSADDISKLKQKAKHEGSNPHVTTSFNVVAAHIWRCKALSEDVGENDLDQMSTVLYAVD  309

Query  615   IRRRLNPPLPDSYSGNAVLTGYGSAKCAELEEGPFWKTVQMVYEGAARMTDEYARSAIDW  436
             IR R+ PPLP SY+GNA+L GY +A   +++E PF + V+MV  GA RMTDEYARS IDW
Sbjct  310   IRPRIRPPLPPSYTGNAILPGYATASFRDIKEAPFSRLVEMVSVGARRMTDEYARSVIDW  369

Query  435   GELYKGFPHGEFLVSSWWRLGFEGVQFPWGKPKYSCPVVYHRKDIILLFPDIDNGGKSNS  256
              ELYKG P+G+ L+ SWWRL F  V++PWG+P YS P V +RK +ILL PDI+  G S+S
Sbjct  370   IELYKGIPYGDLLIVSWWRLRFSEVEYPWGRPSYSFPAVKYRKGLILLIPDIECEGASSS  429

Query  255   G---VNVLVALPPKEMEKFKSLFHKFLA*SSSSS  163
                 ++V ++LP K+MEKF++LF +FL+  +S S
Sbjct  430   SDQELSVFLSLPIKKMEKFQALFREFLSPDTSRS  463



>gb|EYU17594.1| hypothetical protein MIMGU_mgv1a006220mg [Erythranthe guttata]
Length=452

 Score =   446 bits (1148),  Expect = 2e-148, Method: Compositional matrix adjust.
 Identities = 238/464 (51%), Positives = 316/464 (68%), Gaps = 25/464 (5%)
 Frame = -3

Query  1548  MGALYLKPETLHEDLKVTILDSGLIFPSQETTKHTMFLSNIDKVLNFDVQTVHFFPASPG  1369
             M AL   P    EDLK+   +S LIFP +ET K ++FLSNID++LN+D+ T HFF A+P 
Sbjct  1     MAALSAVPSM--EDLKIKFQESSLIFPYKETPKKSIFLSNIDQILNYDIPTAHFFKANPD  58

Query  1368  FPPEIVAGKIKNAFRRLLVANTYDFLAGRLKKNKESERVEIECNAAGAGFTVASSEFALE  1189
             FPPEI+A ++K A  ++LV   YDF+AGRLK N+E  R+EI CNAAGAGF VA S+ +L+
Sbjct  59    FPPEIMAKRLKIALEKVLVP--YDFMAGRLKLNRELGRLEINCNAAGAGFVVAKSDVSLD  116

Query  1188  DIGD--LVYPNPAFRQLVTMSFDFVAKE-DQPLCFLQVTSFKCGGFALGTSMNHISFDGS  1018
             +IGD  LV PN  +RQL     D +  E DQPL   QVTSFKCGGFA+G S NHI FDG 
Sbjct  117   EIGDENLVCPNLGYRQLAVQRLDSLPPEVDQPLSVFQVTSFKCGGFAIGMSTNHILFDGL  176

Query  1017  GFKMFLENLAALSFNDDGPLAVVPCNDRSLLAARSPPQVTFPHPELLKVNLPAGEEMAPP  838
             G K+FL NLA+ SF ++ PLA+VP N+R +L ARSPP V+FPHPE LK +LP G    PP
Sbjct  177   GAKVFLLNLASQSF-ENKPLAIVPYNNRRILTARSPPHVSFPHPEFLKFDLPVGPGSTPP  235

Query  837   VFDSLKDDLAFEIFQLSSADIERLKDKAKAPDNVKTKVTGFNVLTAAIWRCKALSCLGGE  658
              FD + ++L  +IF+L++  I  LKD       +  +++ F V+ A IWRCKA S     
Sbjct  236   KFDCIIEELDLKIFKLTTTQISHLKDNITKTSKID-RISTFAVVAALIWRCKAFS-----  289

Query  657   NNSDRLSTVLFAVDIRRRLNPPLPDSYSGNAVLTGYGSAKCAELEEGPFWKTVQMVYEGA  478
             ++ +++ST+L A+DIR  +NPPLP SYS NAVL    S  C E+++GPF K V+++ +GA
Sbjct  290   DDKNKVSTMLNAIDIRPIVNPPLPYSYSANAVLPLGVSETCEEIKKGPFSKFVEIITKGA  349

Query  477   ARMTDEYARSAIDWGELYKGFPHGEFL-VSS---WWRLGFEGVQFPWGKPKYSCPVVYHR  310
               MT EY +SA DW EL +G P G++  VSS   W RLGF+ V++ WGKP YSCPVV HR
Sbjct  350   KEMTHEYMKSAFDWLELNRGIPQGDYYKVSSDIKWLRLGFDEVEYAWGKPIYSCPVVNHR  409

Query  309   KDIILLFPD-IDNGGKSNSGVNVLVALPPKEMEKFKSLFHKFLA  181
             K+I  +F D +DN      GV  +VALP +EM+ F+++FH F+A
Sbjct  410   KNICWVFRDAVDN------GVCAMVALPSQEMDIFEAVFHDFIA  447



>ref|XP_006858654.1| hypothetical protein AMTR_s00066p00062130 [Amborella trichopoda]
 gb|ERN20121.1| hypothetical protein AMTR_s00066p00062130 [Amborella trichopoda]
Length=549

 Score =   432 bits (1111),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 230/441 (52%), Positives = 298/441 (68%), Gaps = 19/441 (4%)
 Frame = -3

Query  1518  LHEDLKVTILDSGLIFPSQETTKHTMFLSNIDKVLNFDVQTVHFFPASPGFPPEIVAGKI  1339
             L EDLKVTI  S ++ P ++T + +MFLSNID++L F+V+TVHFFPA+P +  +IV    
Sbjct  11    LVEDLKVTIERSSIVLPFEKTPRSSMFLSNIDQILTFNVETVHFFPANPEYHQKIVVELF  70

Query  1338  KNAFRRLLVANTYDFLAGRLKKNKESERVEIECNAAGAGFTVASSEFALEDIGDLVYPNP  1159
             ++A  RLLV   YDF+AGRL  N+ S R EI+CN+AGA F VASS+    +IGDLVYPNP
Sbjct  71    ESALSRLLVP--YDFMAGRLHFNEHSRRFEIDCNSAGAEFIVASSDLTFLEIGDLVYPNP  128

Query  1158  AFRQLVTMSFDFVAKEDQPLCFLQVTSFKCGGFALGTSMNHISFDGSGFKMFLENLAALS  979
             AFRQ V    +     D PLC LQVT FKCGGF +G S NH +FDG   K F++NLA+L+
Sbjct  129   AFRQFVPQLSNSKDLADLPLCLLQVTWFKCGGFVMGLSTNHATFDGISAKTFIQNLASLT  188

Query  978   FNDDGPLAVVPCNDRSLLAARSPPQVTFPHPELLK---VNLPAGEE---MAPPVFDSLKD  817
              +    LAV P  +R  L ARSPP V+FPHPEL +   ++ PA  +   + PP   ++ +
Sbjct  189   ASTT--LAVQPYTNREPLRARSPPLVSFPHPELFEFPSLHSPANLDNGLIGPP---AVAE  243

Query  816   DLAFEIFQLSSADIERLKDKAKAPDNVKTKVTGFNVLTAAIWRCKALSCLGGENNSDRLS  637
             D  F++F+L+  DI+ LK KA+    +++  T FNV+ A +WRCK L+   G  N    S
Sbjct  244   DHHFKVFRLTGEDIDSLKQKARQGGALES-CTSFNVVAAHLWRCKTLAT--GRGNEQ--S  298

Query  636   TVLFAVDIRRRLNPPLPDSYSGNAVLTGYGSAKCAELEEGPFWKTVQMVYEGAARMTDEY  457
             T+L+AVDIRR+L PPLP  Y+GNAVL  Y  A+ +EL  G F   V+ V+EG  R+ DEY
Sbjct  299   TLLYAVDIRRKLKPPLPHEYAGNAVLAAYAIAELSELRYGTFSNIVEKVWEGPRRIDDEY  358

Query  456   ARSAIDWGELYKGFPHGEFLVSSWWRLGFEGVQFPWGKPKYSCPVVYHRKDIILLFPDID  277
             ARS IDWGE ++G P G+  VSSWWRLG   V + WG+PKY+CPVV+  KDIILLFPDI 
Sbjct  359   ARSVIDWGEEHRGVPRGDVFVSSWWRLGLSEVDYVWGRPKYTCPVVHATKDIILLFPDI-  417

Query  276   NGGKSNSGVNVLVALPPKEME  214
              G  S+ GVN LVALP KEME
Sbjct  418   QGMSSSKGVNCLVALPEKEME  438



>gb|EYU34268.1| hypothetical protein MIMGU_mgv1a005307mg [Erythranthe guttata]
Length=489

 Score =   425 bits (1093),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 213/409 (52%), Positives = 284/409 (69%), Gaps = 12/409 (3%)
 Frame = -3

Query  1533  LKPETLHEDLKVTILDSGLIFPSQETTKHTMFLSNIDKVLNFDVQTVHFFPASPGFPPEI  1354
             L P    EDL +   +S LIFP +ET K  +FLSNID++LN+++ T HFF A+P FPPE 
Sbjct  4     LSPVPSMEDLNIKFQESSLIFPYKETPKKLIFLSNIDQILNYNIPTAHFFKANPDFPPET  63

Query  1353  VAGKIKNAFRRLLVANTYDFLAGRLKKNKESERVEIECNAAGAGFTVASSEFALEDIG--  1180
             VA +++ A  ++LV   YDF+AGRLK N+E  R+EI+CNAAGAGF VA S+ +L++IG  
Sbjct  64    VAERLRTALEKVLVP--YDFMAGRLKLNRELGRLEIDCNAAGAGFVVAKSDVSLDEIGGE  121

Query  1179  DLVYPNPAFRQLVTMSFDFVAKE-DQPLCFLQVTSFKCGGFALGTSMNHISFDGSGFKMF  1003
             +LV PN  +RQL     D +  E DQPLC  QVTSFKCGGFA+G S NHI FDG G K+F
Sbjct  122   NLVCPNLGYRQLAVQRLDNLPPEVDQPLCVFQVTSFKCGGFAIGMSTNHILFDGLGAKVF  181

Query  1002  LENLAALSFNDDGPLAVVPCNDRSLLAARSPPQVTFPHPELLKVNLPAGEEMAPPVFDSL  823
             L NLA+ SF ++ PLA++P NDR +LAARSPP V+FPHPE LK +LP G    PP FD +
Sbjct  182   LLNLASQSF-ENKPLAILPYNDRRILAARSPPHVSFPHPEFLKFDLPVGPGSTPPKFDCI  240

Query  822   KDDLAFEIFQLSSADIERLKDKAKAPDNVKTKVTGFNVLTAAIWRCKALSCLGGENNSDR  643
              ++L F+IF+L++  I  LKD       ++ +++   V+ A IWRCKA S     ++ +R
Sbjct  241   IEELDFKIFKLNTTQISHLKDDITKNSKIE-RISTLAVVAALIWRCKAFS-----DDKNR  294

Query  642   LSTVLFAVDIRRRLNPPLPDSYSGNAVLTGYGSAKCAELEEGPFWKTVQMVYEGAARMTD  463
             +ST+L  +DIR R+ PPLP SYS NAVL       C E++ GPF K V+++ EGA  MT 
Sbjct  295   VSTLLNVIDIRPRVKPPLPYSYSANAVLPLGVLETCDEIKNGPFSKLVEIITEGAKEMTH  354

Query  462   EYARSAIDWGELYKGFPHGEFLVSSWWRLGFEGVQFPWGKPKYSCPVVY  316
             EY +SA DW EL +G PHG+++VSSW RLGF+ V++ WGKP YSCPV++
Sbjct  355   EYVKSAFDWLELNRGIPHGDYMVSSWLRLGFDEVEYAWGKPMYSCPVLH  403



>emb|CAT00084.1| hydroxycinnamoyl-CoA shikimate/quinate hydroxycinnamoyl transferase 
[Coffea arabica]
Length=343

 Score =   419 bits (1076),  Expect = 3e-139, Method: Compositional matrix adjust.
 Identities = 211/347 (61%), Positives = 262/347 (76%), Gaps = 13/347 (4%)
 Frame = -3

Query  1548  MGALYL-KPETLHEDLKVTILDSGLIFPSQETTKHTMFLSNIDKVLNFDVQTVHFFPASP  1372
             MG LY   P+T   DLKVTI +S L+FP+QET   +MFLSNID+VLNF+VQTVHFFPA+ 
Sbjct  1     MGTLYQGPPDTAIHDLKVTIQESQLVFPAQETQSKSMFLSNIDQVLNFNVQTVHFFPANL  60

Query  1371  GFPPEIVAGKIKNAFRRLLVANTYDFLAGRLKKNKESERVEIECNAAGAGFTVASSEFAL  1192
              FPP+IVA +++ A   +LV   YDFLAGR++ N  S R+EI+CN+AGA F VASSEFAL
Sbjct  61    EFPPKIVADRLRTALSNVLVP--YDFLAGRIQLNPHSGRLEIDCNSAGAVFAVASSEFAL  118

Query  1191  EDIGDLVYPNPAFRQLVTMSFDFVAKEDQPLCFLQVTSFKCGGFALGTSMNHISFDGSGF  1012
             +DIGDLVYPNPAF QL+    D +  +DQPLC +Q+TSFKCGGFA+G S NH   DG  F
Sbjct  119   DDIGDLVYPNPAFGQLIVEKVDAIGSDDQPLCIIQLTSFKCGGFAMGVSTNHAMLDGLSF  178

Query  1011  KMFLENLAALSFNDDGPLAVVPCNDRSLLAARSPPQVTFPHPELLKVNLPAGEEMAPPVF  832
             K+FL+NLA+ +F DD PLA+VP +DR++LAARSPPQVTFPHPELLK+ +P GEE + P F
Sbjct  179   KIFLQNLASQAF-DDKPLAIVPYDDRTVLAARSPPQVTFPHPELLKLKIPIGEEPSHPTF  237

Query  831   DSLKDDLAFEIFQLSSADIERLKDKAKAP--------DNVKTKVTGFNVLTAAIWRCKAL  676
             D  +++LAF+IF+LSS  I  LK+KAKA              ++TGFNV+TA +WRCKAL
Sbjct  238   DCPQEELAFKIFRLSSDHISYLKEKAKASGPAAAAATATTNYRITGFNVVTAHVWRCKAL  297

Query  675   SCLGGENNSDRLSTVLFAVDIRRRLNPPLPDSYSGNAVLTGYGSAKC  535
             SC   E   +RLSTVL+AVDIR R+ PPLP SY+GNAVLT Y +AKC
Sbjct  298   SC-DSEEGLERLSTVLYAVDIRPRMKPPLPASYTGNAVLTAYATAKC  343



>gb|EYU34266.1| hypothetical protein MIMGU_mgv1a023386mg, partial [Erythranthe 
guttata]
Length=403

 Score =   400 bits (1028),  Expect = 4e-131, Method: Compositional matrix adjust.
 Identities = 215/426 (50%), Positives = 279/426 (65%), Gaps = 29/426 (7%)
 Frame = -3

Query  1467  SQETTKHTMFLSNIDKVLNFDVQTVHFFPASPGFPPEIVAGKIKNAFRRLLVANTYDFLA  1288
             S +T K ++FLSNID++LN+D+ T HFF A+P FPPE VA +++ A  ++LV   YDF+A
Sbjct  3     SFQTPKKSIFLSNIDQILNYDIPTAHFFKANPDFPPETVAERLRTALEKVLVP--YDFMA  60

Query  1287  GRLKKNKESERVEIECNAAGAGFTVASSEFALEDIG--DLVYPNPAFRQLVTMSFDFVAK  1114
             GRLK N+E  R+EI+CNAAGAGF VA S+ +L++IG  +LV PN  +RQL     D +  
Sbjct  61    GRLKLNRELGRLEIDCNAAGAGFVVAKSDVSLDEIGGENLVCPNLGYRQLAVQRLDSLPP  120

Query  1113  E-DQPLCFLQVTSFKCGGFALGTSMNHISFDGSGFKMFLENLAALSFNDDGPLAVVPCND  937
             + DQPLC  QVTSFKCGGFA+G S NHI FDG G K+FL NLA+ SF +  PLA+VP ND
Sbjct  121   DVDQPLCVFQVTSFKCGGFAIGMSTNHILFDGLGAKVFLLNLASQSF-ETKPLAIVPYND  179

Query  936   RSLLAARSPPQVTFPHPELLKVNLPAGEEMAPPVFDSLKDDLAFEIFQLSSADIERLKDK  757
             R +LAARSPP V+FPHPE LK + P G    PP FD + ++L  +IF+L++  I  LKD 
Sbjct  180   RRILAARSPPHVSFPHPEFLKFDFPVGPGSTPPKFDCIIEELDLKIFKLTTTQISHLKDN  239

Query  756   AKAPDNVKTKVTGFNVLTAAIWRCKALSCLGGENNSDRLSTVLFAVDIRRRLNPPLPDSY  577
                   +  +++ F V+ A IWRCKA S      NS+                PPLP SY
Sbjct  240   ITKTSKID-RISTFAVVAALIWRCKAFSDDKNRANSE----------------PPLPYSY  282

Query  576   SGNAVLTGYGSAKCAELEEGPFWKTVQMVYEGAARMTDEYARSAIDWGELYKGFPHGE-F  400
             S NAVL    S  C E+  G F K V+++ EGA  MT +YA+SA DW EL +G PHG+ F
Sbjct  283   SANAVLPLGVSETCEEIINGLFSKLVEIITEGAKEMTHDYAKSAFDWLELNRGIPHGDYF  342

Query  399   LVSSWWRLGFEGVQFPWGKPKYSCPVVYHRKDIILLFPDIDNGGKSNSGVNVLVALPPKE  220
              VSSW RLGF+ V++ WGKP YSCPVV HRK I  +F D  +G     GV  +VALP +E
Sbjct  343   KVSSWLRLGFDEVEYAWGKPIYSCPVVNHRKAISWVFRDAVDG-----GVCAMVALPAQE  397

Query  219   MEKFKS  202
             M+ F++
Sbjct  398   MDIFEA  403



>ref|XP_011016099.1| PREDICTED: omega-hydroxypalmitate O-feruloyl transferase-like 
[Populus euphratica]
Length=284

 Score =   381 bits (978),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 185/292 (63%), Positives = 231/292 (79%), Gaps = 9/292 (3%)
 Frame = -3

Query  1056  LGTSMNHISFDGSGFKMFLENLAALSFNDDGPLAVVPCNDRSLLAARSPPQVTFPHPELL  877
             +G S +H +FDG  FK FL+NLAAL+     PLAV PCNDR LLAARSPP+VTFPHPEL+
Sbjct  1     MGISTSHATFDGISFKTFLQNLAALA--GGKPLAVTPCNDRELLAARSPPRVTFPHPELV  58

Query  876   KVNLPAGEEMAPPVFDSLKDDLAFEIFQLSSADIERLKDKAKAPDNVKTKVTGFNVLTAA  697
             K+    G+E+  PVFD+  + L F+IF+L+S +I  +K+KAK   +   +V+GFNV+TA 
Sbjct  59    KLQTHLGQELNAPVFDAAHEALDFKIFRLTSGNISDMKEKAKT--SPSARVSGFNVVTAH  116

Query  696   IWRCKALSCLGGENNSDRLSTVLFAVDIRRRLNPPLPDSYSGNAVLTGYGSAKCAELEEG  517
             IWRCKALS    ++  DR+ST+L+AV+IR RL PPLP+SY+GNAVLT Y +A C EL+EG
Sbjct  117   IWRCKALSQPEAQD-PDRVSTILYAVNIRPRLIPPLPESYAGNAVLTAYANATCKELQEG  175

Query  516   PFWKTVQMVYEGAARMTDEYARSAIDWGELYKGFPHGEFLVSSWWRLGFEGVQFPWGKPK  337
             P  K V+ V EG+ RMTDEY RSAIDWGE++KGFPHG+FLVSSWW+LGF+ V++PWG P+
Sbjct  176   PISKLVERVAEGSKRMTDEYVRSAIDWGEIHKGFPHGDFLVSSWWKLGFDEVEYPWGCPR  235

Query  336   YSCPVVYHRKDIILLFPDIDNGGKSNSGVNVLVALPPKEMEKFKSLFHKFLA  181
             YSCPVVYHRKDIILLFPDID+     + VNVLVALP KEMEKF+SLFHKFL+
Sbjct  236   YSCPVVYHRKDIILLFPDIDD----KNSVNVLVALPSKEMEKFESLFHKFLS  283



>gb|EPS57259.1| hypothetical protein M569_17562, partial [Genlisea aurea]
Length=307

 Score =   374 bits (960),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 196/311 (63%), Positives = 237/311 (76%), Gaps = 9/311 (3%)
 Frame = -3

Query  1101  LCFL-QVTSFKCGGFALGTSMNHISFDGSGFKMFLENLAALSFNDDGPLAVVPCNDRSLL  925
             LC + QVTSFKCGGFA+G S NH  FDG  FK+FL+N+A+ +F+D  P  V+PC+DR LL
Sbjct  1     LCVVRQVTSFKCGGFAVGVSTNHALFDGLSFKIFLQNVASQAFDDFRPFPVIPCHDRLLL  60

Query  924   AARSPPQVTFPHPELLKVNLPA-GEEMAPPVFDSLKDDLAFEIFQLSSADIERLKDKAKA  748
             AARSPPQVTFPHPELLKV  P  GE+    VF   +++L F+IF+LS  DI  LK + ++
Sbjct  61    AARSPPQVTFPHPELLKVKPPENGEKEKGSVFAWEEEELDFKIFRLSPEDIADLKKRVES  120

Query  747   PDNVKTKVTGFNVLTAAIWRCKALSCLGGENNS--DRLSTVLFAVDIRRRLNPPLPDSYS  574
                   KV+GFN +TA +WRCKALSC G EN    DR S VL+AVDIR RL+PPLP SY 
Sbjct  121   SQPKPAKVSGFNAITAHVWRCKALSC-GAENGGGRDRESVVLYAVDIRNRLSPPLPSSYC  179

Query  573   GNAVLTGYGSAKCAELEEGPFWKTVQMVYEGAARMTDEYARSAIDWGELYKGFPHGEFLV  394
             GNAV+T Y +AKC ELEE P  K  + V EGAAR+TDEYARS IDWG++ KGFP+GEFL+
Sbjct  180   GNAVVTAYAAAKCWELEEEPLEKLTERVAEGAARITDEYARSVIDWGQINKGFPNGEFLI  239

Query  393   SSWWRLGFEGVQFPWGKPKYSCPVVYHRKDIILLFPDIDNGGKSNSGVNVLVALPPKEME  214
             SSWWRLGF+ V++PWG+PKYSCPVVY RKDIILLFPDI +    + GVNVL ALPP EM 
Sbjct  240   SSWWRLGFDEVEYPWGRPKYSCPVVYRRKDIILLFPDIGD----SHGVNVLAALPPNEMP  295

Query  213   KFKSLFHKFLA  181
             KF+SLF+K+LA
Sbjct  296   KFESLFYKYLA  306



>gb|KGN61333.1| hypothetical protein Csa_2G091770 [Cucumis sativus]
Length=300

 Score =   371 bits (952),  Expect = 4e-121, Method: Compositional matrix adjust.
 Identities = 182/303 (60%), Positives = 227/303 (75%), Gaps = 14/303 (5%)
 Frame = -3

Query  1056  LGTSMNHISFDGSGFKMFLENLAALSFNDDGPLAVVPCNDRSLLAARSPPQVTFPHPELL  877
             +G S NH +FDG  FK FL+N AAL+  D+ PL V PC+DR LL ARSPP+VTFPH ELL
Sbjct  1     MGFSTNHCAFDGLSFKQFLDNFAALA--DNKPLVVTPCHDRRLLTARSPPRVTFPHHELL  58

Query  876   KVN--LPAGEEMAPPVFDSLKDDLAFEIFQLSSADIERLKDKAK---------APDNVKT  730
             K++  LP+ +     VF++   DL F+IF+LS  DI  LK KA+              K 
Sbjct  59    KIDTPLPSPDSSNTSVFEATPQDLDFKIFKLSGTDIATLKQKAQPLTTSKQDDGHGGKKL  118

Query  729   KVTGFNVLTAAIWRCKALSCLGGENNSDRLSTVLFAVDIRRRLNPPLPDSYSGNAVLTGY  550
             ++TGFNV+TA +WRCKALS    ++N +R ST+L+AVDIR R++PPLP SY GNAVLT Y
Sbjct  119   RITGFNVVTALVWRCKALS-FEAKDNYERQSTLLYAVDIRSRMDPPLPTSYCGNAVLTVY  177

Query  549   GSAKCAELEEGPFWKTVQMVYEGAARMTDEYARSAIDWGELYKGFPHGEFLVSSWWRLGF  370
              +AKC EL++GPF + V+MV E A RMTDEYARSAIDWGELYKGFP+GEFLVSSWWRLG 
Sbjct  178   ATAKCKELKDGPFSRVVEMVSEAATRMTDEYARSAIDWGELYKGFPNGEFLVSSWWRLGL  237

Query  369   EGVQFPWGKPKYSCPVVYHRKDIILLFPDIDNGGKSNSGVNVLVALPPKEMEKFKSLFHK  190
             E V++PWGKP+ SCPVV HRKDIILLFPDI+   K+NSG+N+LVALP  +M KF++LF +
Sbjct  238   EDVEYPWGKPRSSCPVVNHRKDIILLFPDINESEKTNSGLNILVALPETQMVKFQTLFKE  297

Query  189   FLA  181
             F+A
Sbjct  298   FMA  300



>ref|XP_006858657.1| hypothetical protein AMTR_s00066p00063330 [Amborella trichopoda]
 gb|ERN20124.1| hypothetical protein AMTR_s00066p00063330 [Amborella trichopoda]
Length=493

 Score =   370 bits (951),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 211/492 (43%), Positives = 295/492 (60%), Gaps = 47/492 (10%)
 Frame = -3

Query  1566  LSFTAIMGALYLKPETLHEDLKVTILDSGLIFPSQETTKHTMFLSNIDKVLNFDVQTVHF  1387
             +S ++ + +L   P T    L +++     I+PS      T+FLSNID+ L F V+TVHF
Sbjct  1     MSSSSHIVSLKTPPTTRFPSLNLSLKPPTTIYPSSPARHETIFLSNIDQTLAFTVETVHF  60

Query  1386  FPASPGFPPEIVAGKIKNAFRRLLVANTYDFLAGRLKKNKESERVEIECNAAGAGFTVAS  1207
             F  +PGF P +V+  +K +  RLLV   Y F+AGRL+ N+++ R+E++ N+AGA F+ A 
Sbjct  61    FAPNPGFSPSLVSSILKTSLSRLLV--FYPFMAGRLRFNQDN-RLELDSNSAGAIFSEAF  117

Query  1206  SEFALEDIGDLVYPNPAFRQLVTMSFDFVAKEDQPLCFLQVTSFKCGGFALGTSMNHISF  1027
              +  L D+GDL YP+P FRQL     + +A ED PLC +Q+T+FKCGGF++G   NH + 
Sbjct  118   CDLNLSDVGDLTYPDPIFRQLFHRP-ENLAIEDLPLCQIQLTTFKCGGFSIGLGTNHTTL  176

Query  1026  DGSGFKMFLENLAALSFNDDGPLAVVPCNDRSLLAARSPPQVTFPHPELLKVN-------  868
             DG G   F++NLA+L+  +   L   P N+R LL++R+P  + F HPEL+ ++       
Sbjct  177   DGIGASTFIKNLASLASGEG--LKAEPYNNRRLLSSRNPANIQFEHPELVVLDGIQTGAN  234

Query  867   -------LPAGEEMAPPVFDSLKDDLAFEIFQLSSADIERLKDKAKAPDNVKT-----KV  724
                     PA +E AP   + L + L F++F+LS+ DI+ LK  A   +  +        
Sbjct  235   GFRRCTPNPAPQE-AP---EGLPEKLGFKLFRLSAEDIDLLKKVAMQGERDRNGGGAHNC  290

Query  723   TGFNVLTAAIWRCKALSCLGGEN-----------NSDRLSTVLFAVDIRRRLNPPLPDSY  577
             T F V+TA +WRC+A++    +            + D LS VLFAVDIR+R+ PPLP  Y
Sbjct  291   TSFEVVTAHLWRCRAIATSLSKTPDDLDISSDGVDLDSLSMVLFAVDIRKRVKPPLPTGY  350

Query  576   SGNAVLTGYGSAKCAELEEGPFWKTVQMVYEGAARMTDEYARSAIDWGELYKGFP--HGE  403
              GNAVL GYG A+  EL E     +V  V EG  RM DEY RS IDWGE++KG P   G 
Sbjct  351   CGNAVLAGYGRARVRELRERGLGFSVSKVREGVERMDDEYVRSVIDWGEIHKGVPGGKGS  410

Query  402   FLVSSWWRLGFEGVQFPWGKPKYSCPVVYHRKDIILLFPDI---DNGGKSNSGVNVLVAL  232
             F VSSWW+LGFE  ++PWGK  YS P V+ R D +LL PD     NGGK   GVN+ +AL
Sbjct  411   FFVSSWWKLGFEEAEYPWGKALYSGPSVHRRDDAVLLLPDTVSRRNGGK--EGVNIFMAL  468

Query  231   PPKEMEKFKSLF  196
             PP +M+KF+ L 
Sbjct  469   PPFQMDKFQELL  480



>ref|XP_010110380.1| Omega-hydroxypalmitate O-feruloyl transferase [Morus notabilis]
 gb|EXC26166.1| Omega-hydroxypalmitate O-feruloyl transferase [Morus notabilis]
Length=309

 Score =   363 bits (931),  Expect = 5e-118, Method: Compositional matrix adjust.
 Identities = 184/310 (59%), Positives = 226/310 (73%), Gaps = 23/310 (7%)
 Frame = -3

Query  1056  LGTSMNHISFDGSGFKMFLENLAALSFNDDGPLAVVPCNDRSLLAARSPPQVTFPHPELL  877
             +G + NH++FDG  FK+FL+NLA ++ N   PLAV PC+DR LLAARSPP+VTFPHPELL
Sbjct  1     MGFTTNHVTFDGLSFKLFLQNLAFVAANK--PLAVTPCHDRRLLAARSPPRVTFPHPELL  58

Query  876   KV----NLPAGEEMAPPVFDSLKDDLAFEIFQLSSADIERLKDKAKAPDNVKTKVTGFNV  709
             K+    +L   +     VF +  ++L F+IF+LS  D   LK++AK+ D  +  +T FNV
Sbjct  59    KLPPVTDLGQLDPNPTHVFKATDEELVFKIFRLSPDDFSALKERAKSGDGDRV-ITSFNV  117

Query  708   LTAAIWRCKALSCLGGENNSDRLSTVLFAVDIRRRLNPPLPDSYSGNAVLTGYGSAKCAE  529
             +TA IWRCKALSC    N+ +R S +L+AVDIRRR++PPLP SY+GNAVLT Y +    E
Sbjct  118   VTAFIWRCKALSC-DASNDMERQSRILYAVDIRRRVDPPLPQSYTGNAVLTAYATRYYKE  176

Query  528   LEEGPFWKTVQMVYEGAARMTDEYARSAIDWGELYKGFPHGEFLVSSWWRLGFEGVQFPW  349
             LEEGPF K V+ V EGA RMT+EYARSAIDWGELYKGFPHGE LVSSWWRLGF  V++PW
Sbjct  177   LEEGPFSKIVETVAEGARRMTNEYARSAIDWGELYKGFPHGEVLVSSWWRLGFAEVEYPW  236

Query  348   GKPKYSCPVVYHRKDIILLFPDID---------------NGGKSNSGVNVLVALPPKEME  214
             GKPKYSCPVV HRKDIIL FPDI+                G +   GVNVL+ALP KEME
Sbjct  237   GKPKYSCPVVCHRKDIILFFPDIEDRDDHDEPDDLNGKQEGRERKDGVNVLLALPAKEME  296

Query  213   KFKSLFHKFL  184
             KF++LFHK+L
Sbjct  297   KFETLFHKYL  306



>ref|XP_010093570.1| Omega-hydroxypalmitate O-feruloyl transferase [Morus notabilis]
 gb|EXC38958.1| Omega-hydroxypalmitate O-feruloyl transferase [Morus notabilis]
Length=309

 Score =   362 bits (928),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 183/310 (59%), Positives = 225/310 (73%), Gaps = 23/310 (7%)
 Frame = -3

Query  1056  LGTSMNHISFDGSGFKMFLENLAALSFNDDGPLAVVPCNDRSLLAARSPPQVTFPHPELL  877
             +G + NH++FDG  FK+FL+NLA ++ N   PLAV PC+DR LLAARSPP+VTFPHPELL
Sbjct  1     MGFTTNHVTFDGLSFKLFLQNLAFVAANK--PLAVTPCHDRRLLAARSPPRVTFPHPELL  58

Query  876   KV----NLPAGEEMAPPVFDSLKDDLAFEIFQLSSADIERLKDKAKAPDNVKTKVTGFNV  709
             K+    +L   +     VF +  ++L F+IF+LS  D   LK++AK+ D  +  +T FNV
Sbjct  59    KLPPVTDLGQLDPNPTHVFKATDEELVFKIFRLSPDDFSALKERAKSGDGDRV-ITSFNV  117

Query  708   LTAAIWRCKALSCLGGENNSDRLSTVLFAVDIRRRLNPPLPDSYSGNAVLTGYGSAKCAE  529
             +TA IWRCKALSC    N+ +R S +L+AVDIRRR++PPLP SY+GNAVLT Y +    E
Sbjct  118   VTAFIWRCKALSC-DASNDMERQSRILYAVDIRRRVDPPLPQSYTGNAVLTAYATRYYKE  176

Query  528   LEEGPFWKTVQMVYEGAARMTDEYARSAIDWGELYKGFPHGEFLVSSWWRLGFEGVQFPW  349
             LEEGPF K V+   EGA RMT+EYARSAIDWGELYKGFPHGE LVSSWWRLGF  V++PW
Sbjct  177   LEEGPFSKIVETAAEGARRMTNEYARSAIDWGELYKGFPHGEVLVSSWWRLGFAEVEYPW  236

Query  348   GKPKYSCPVVYHRKDIILLFPDID---------------NGGKSNSGVNVLVALPPKEME  214
             GKPKYSCPVV HRKDIIL FPDI+                G +   GVNVL+ALP KEME
Sbjct  237   GKPKYSCPVVCHRKDIILFFPDIEDRDDHDEPDDLNGKQEGRERKDGVNVLLALPAKEME  296

Query  213   KFKSLFHKFL  184
             KF++LFHK+L
Sbjct  297   KFETLFHKYL  306



>emb|CDY07450.1| BnaA07g25290D [Brassica napus]
Length=298

 Score =   358 bits (920),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 181/307 (59%), Positives = 221/307 (72%), Gaps = 11/307 (4%)
 Frame = -3

Query  1095  FLQVTSFKCGGFALGTSMNHISFDGSGFKMFLENLAALSFNDDGPLAVVPCNDRSLLAAR  916
              + VTSFKCGGFA+G S NH +FDG  FK FL+NLA+L    + PL+  PCNDR+LL AR
Sbjct  1     MVTVTSFKCGGFAMGISTNHTTFDGLSFKTFLDNLASLL--SEKPLSTPPCNDRTLLKAR  58

Query  915   SPPQVTFPHPELLKVNLPAGEEMAPPVFDSLKDDLAFEIFQLSSADIERLKDKAKAPDNV  736
             SPP+VTFPH EL+K+      E    VF++  + L F IF++SS  I RLK+KA    + 
Sbjct  59    SPPRVTFPHHELVKIQ---DSETTTTVFEATSEHLDFNIFKISSQQILRLKEKASESISS  115

Query  735   K--TKVTGFNVLTAAIWRCKALSCLGGENNSDRLSTVLFAVDIRRRLNPPLPDSYSGNAV  562
                 + TGFNV+TA +WRCKALS +  E + ++ ST+L+AVDIR RLNP LP SY+GNAV
Sbjct  116   TGCVRATGFNVVTALVWRCKALSFVE-EEDLEKESTILYAVDIRGRLNPQLPSSYTGNAV  174

Query  561   LTGYGSAKCAELEEGPFWKTVQMVYEGAARMTDEYARSAIDWGELYKGFPHGEFLVSSWW  382
             LT Y  AK   L E PF + V+MV EG  R+TDEYARSAIDWGE+YKGFPHGE LVSSWW
Sbjct  175   LTAYAKAKRKALLEEPFGRIVEMVGEGGNRITDEYARSAIDWGEMYKGFPHGEVLVSSWW  234

Query  381   RLGFEGVQFPWGKPKYSCPVVYHRKDIILLFPDIDNGGKSNSGVNVLVALPPKEMEKFKS  202
             +LGF  V++PWGKPKY CPVVYHRKDI+LLFPDI   G  + GV VL ALP KEM KF++
Sbjct  235   KLGFAEVEYPWGKPKYCCPVVYHRKDIVLLFPDI---GGDSKGVYVLAALPSKEMAKFQN  291

Query  201   LFHKFLA  181
              F   L+
Sbjct  292   WFEDTLS  298



>ref|XP_007161775.1| hypothetical protein PHAVU_001G097400g, partial [Phaseolus vulgaris]
 gb|ESW33769.1| hypothetical protein PHAVU_001G097400g, partial [Phaseolus vulgaris]
Length=294

 Score =   355 bits (912),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 180/302 (60%), Positives = 230/302 (76%), Gaps = 12/302 (4%)
 Frame = -3

Query  1086  VTSFKCGGFALGTSMNHISFDGSGFKMFLENLAALSFNDDGPLAVVPCNDRSLLAARSPP  907
             +TSF+CGGFA+G S +H++FDG  FK FL+NLAAL+ N   P AV+PCNDR LLAARSPP
Sbjct  1     LTSFECGGFAMGFSTSHMAFDGLSFKTFLDNLAALAANK--PFAVIPCNDRHLLAARSPP  58

Query  906   QVTFPHPELLKVN-LPAGEEMAPPVFDSLKDDLAFEIFQLSSADIERLKDKAKAPDNVKT  730
             +VTFPHPEL++++ LP G E    VFD+  ++L F + +L+S DI  LK+KAK   N + 
Sbjct  59    RVTFPHPELIQLDYLPTGIEST--VFDASNEELDFRVLKLTSEDILSLKEKAKGSTNARA  116

Query  729   KVTGFNVLTAAIWRCKALSCLGGENNSDRLSTVLFAVDIRRRLNPPLPDSYSGNAVLTGY  550
               TGFNV+TA +WRCKALS      + +R ST+LFAVDIR +L PPLP  ++GNAVLT Y
Sbjct  117   --TGFNVITAHVWRCKALS---APYDPNRSSTILFAVDIRSKLIPPLPKGFAGNAVLTAY  171

Query  549   GSAKCAELEEGPFWKTVQMVYEGAARMTDEYARSAIDWGELYKGFPHGEFLVSSWWRLGF  370
              +A C ELE+G F + V+MV EGA RM+DEYARS ID GE++ GFP G+ LVS+WWRLGF
Sbjct  172   AAATCEELEKGEFSRLVEMVKEGAERMSDEYARSIIDRGEVHDGFPRGDVLVSTWWRLGF  231

Query  369   EGVQFPWGKPKYSCPVVYHRKDIILLFPDIDNGGKSNSGVNVLVALPPKEMEKFKSLFHK  190
             E V++PWGKPKY CPVV+HRKDIILL      GG  + G+N++VALPPKEM+KF++LF+ 
Sbjct  232   EEVEYPWGKPKYCCPVVHHRKDIILL--FPPFGGGGDDGINIIVALPPKEMQKFETLFYM  289

Query  189   FL  184
             FL
Sbjct  290   FL  291



>ref|NP_001185319.1| dual transcription unit and alternative splicing protein GLAUCE 
[Arabidopsis thaliana]
 gb|AAM62927.1| Similar to gb|Z84386 anthranilate N-hydroxycinnamoyl/benzoyltransferase 
from Dianthus caryophyllus [Arabidopsis thaliana]
 gb|AEE34378.1| dual transcription unit and alternative splicing protein GLAUCE 
[Arabidopsis thaliana]
Length=286

 Score =   350 bits (897),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 176/295 (60%), Positives = 209/295 (71%), Gaps = 12/295 (4%)
 Frame = -3

Query  1056  LGTSMNHISFDGSGFKMFLENLAALSFNDDGPLAVVPCNDRSLLAARSPPQVTFPHPELL  877
             +G S NH +FDG  FK FLENLA+L    + PL+  PCNDR+LL AR PP V FPH EL+
Sbjct  1     MGISTNHTTFDGLSFKTFLENLASLL--HEKPLSTPPCNDRTLLKARDPPSVAFPHHELV  58

Query  876   KVNLPAGEEMAPPVFDSLKDDLAFEIFQLSSADIERLKDKAKAPDNVKTKVTGFNVLTAA  697
             K      +     VF++  + L F+IF+LSS  I++LK++A    N   +VTGFNV+TA 
Sbjct  59    KFQ----DCETTTVFEATSEHLDFKIFKLSSEQIKKLKERASETSNGNVRVTGFNVVTAL  114

Query  696   IWRCKALSCL---GGENNSDRLSTVLFAVDIRRRLNPPLPDSYSGNAVLTGYGSAKCAEL  526
             +WRCKALS     G E N +R ST+L+AVDIR RLNP LP SY+GNAVLT Y   KC  L
Sbjct  115   VWRCKALSVAAEEGEETNLERESTILYAVDIRGRLNPELPPSYTGNAVLTAYAKEKCKAL  174

Query  525   EEGPFWKTVQMVYEGAARMTDEYARSAIDWGELYKGFPHGEFLVSSWWRLGFEGVQFPWG  346
              E PF + V+MV EG+ R+TDEYARSAIDWGELYKGFPHGE LVSSWW+LGF  V++PWG
Sbjct  175   LEEPFGRIVEMVGEGSKRITDEYARSAIDWGELYKGFPHGEVLVSSWWKLGFAEVEYPWG  234

Query  345   KPKYSCPVVYHRKDIILLFPDIDNGGKSNSGVNVLVALPPKEMEKFKSLFHKFLA  181
             KPKYSCPVVYHRKDI+LLFPDID   K   GV VL ALP KEM KF+  F   L 
Sbjct  235   KPKYSCPVVYHRKDIVLLFPDIDGDSK---GVYVLAALPSKEMSKFQHWFEDTLC  286



>gb|EYU20679.1| hypothetical protein MIMGU_mgv1a006412mg [Erythranthe guttata]
Length=445

 Score =   352 bits (904),  Expect = 6e-112, Method: Compositional matrix adjust.
 Identities = 204/457 (45%), Positives = 280/457 (61%), Gaps = 25/457 (5%)
 Frame = -3

Query  1533  LKPETLHEDLKVTILDSGLIFPSQETTKHTMFLSNIDKVLNFDVQTVHFFPASPGFPPEI  1354
             + P    +DLKV I +S L+FPSQ+T K + FLS++D  L +++QT +FF A+P +PPE 
Sbjct  4     ISPNPAMKDLKVKIEESKLVFPSQQTQKRSFFLSDVDHFLCYNIQTAYFFKANPDYPPES  63

Query  1353  VAGKIKNAFRRLLVANTYDFLAGRLKKNKESERVEIECNAAGAGFTVASSEFALEDIGDL  1174
             +A ++K A  ++LV   YDF+AGRLK N +S R+EI+CN+ GAGF  ASSEF LE++GDL
Sbjct  64    IARRLKMAVEKVLVP--YDFMAGRLKWNHQSGRLEIDCNSQGAGFVFASSEFTLEELGDL  121

Query  1173  VYPNPAFRQLVTMSFDFVAKEDQPLCFLQVTSFKCGGFALGTSMNHISFDGSGFKMFLEN  994
             + PNPAF+QL       +  + QPLC  QVTSF CGGFA G S +H+  DG   KMF EN
Sbjct  122   LSPNPAFQQLAVDKLPGLDDDKQPLCVFQVTSFNCGGFAFGMSNDHVLLDGLAAKMFREN  181

Query  993   LAALSFNDDGPLAVVPCNDRSLLAARSPPQVTFPHPELLKVNLPAGEEMAPPVFDSLKDD  814
             LA+ +F+DD PL  VP NDR LL  R PP V           LP      PP  D   D+
Sbjct  182   LASQAFDDDRPLPFVPINDRRLLPVRLPPHVP----------LPQPSPPPPPPNDQNIDN  231

Query  813   LAFEIFQLSSADIERLKDKAKAPDNVKT-KVTGFNVLTAAIWRCKALSCLGGENNSDRLS  637
             + F++ +LSS+DI  LK KA A DN+++ K++ FNV+ A +WRC+ALS     +N D  S
Sbjct  232   VDFKVVKLSSSDINLLKAKAAA-DNIESGKISTFNVVAALLWRCRALSSPCINDNKD--S  288

Query  636   TVLFAVDIRRRLNPPLPDSYSGNAVLTGYGSAKCAELEEGPFWKTVQMVYEGAARMTDEY  457
             T++  +D+R R+ PPLP  Y GNAV   Y SAKC ++E+  F K V+MV EG  R  +EY
Sbjct  289   TIVTVLDVRSRVKPPLPPEYCGNAVGVAYASAKCEDIEKWAFSKLVEMVGEGINRANEEY  348

Query  456   ARSA----IDWGELYKGFPHGE-FLVSSWWRLGFEGVQFPWGKPKYSCPVVYH-RKDIIL  295
                +    IDW E+ +    GE  L++ W  LGF+ V FPWGK  +  P+V   +   ++
Sbjct  349   GVESGGVTIDWWEIKRKVLCGEDVLLTPWSGLGFDRVVFPWGKSVHFGPLVDPLQMCFVI  408

Query  294   LFPDIDNGGKSNSGVNVLVALPPKEMEKFKSLFHKFL  184
             L  + D+ G    GVNVL   P + M++     H F 
Sbjct  409   LNGEADDDG---VGVNVLCVQPAQLMDRILFHLHHFF  442



>gb|EYU24129.1| hypothetical protein MIMGU_mgv1a020263mg [Erythranthe guttata]
Length=447

 Score =   352 bits (903),  Expect = 7e-112, Method: Compositional matrix adjust.
 Identities = 206/456 (45%), Positives = 277/456 (61%), Gaps = 34/456 (7%)
 Frame = -3

Query  1512  EDLKVTILDSG-LIFPSQETTKHTMFLSNIDKVLNFDVQTVHFFPASPGFPPEIVAGKIK  1336
             +DLKV + +   L+ P+++T + ++FLSNID++ N+ V T HFF  +  FPP +VA ++K
Sbjct  11    QDLKVRVEEPIILVSPNEKTERRSIFLSNIDQMHNYYVCTAHFFNGNADFPPAVVAERLK  70

Query  1335  NAFRRLLVANTYDFLAGRLKKNK---ESERVEIECNAAGAGFTVASSEFALEDIGD-LVY  1168
                 ++LV   YDF AGRLK N+      R+EI+C AAG GF VASSE++L D+GD  V+
Sbjct  71    MGLEKVLVP--YDFAAGRLKTNELDSTDRRLEIDCTAAGVGFVVASSEYSLHDLGDDFVF  128

Query  1167  PNPAFRQLVTMSFDFVAKEDQPLCFLQVTSFKCGGFALGTSMNHISFDGSGFKMFLENLA  988
              N  F  L   +      ED+PLC  QVTSFKCGGFA+G   NH+ FDG G   F+ NLA
Sbjct  129   SNLGFHYLALDNLWPGDDEDRPLCIFQVTSFKCGGFAIGFVWNHVLFDGMGAGKFMANLA  188

Query  987   ALSFNDDGPLAVVPCNDRSLLAARSPPQVTFPHPELLKVNLPAGEEMAPPVFDS----LK  820
               +F D+ P   +PCNDR LLAARSPP V F HPE  K          P  +D     + 
Sbjct  189   TQAFVDEKPPEAIPCNDRHLLAARSPPVVAFKHPEFSK---------KPDNYDGDGGLVG  239

Query  819   DDLAFEIFQLSSADIERLKDKAKAPDNVKTKVTGFNVLTAAIWRCKALS--CLGGENNSD  646
             D L  +IF+L+ + +  LKDKA      + K+T +NV+ A IWRCKALS  C+  E    
Sbjct  240   DSLDSKIFKLNPSAVNYLKDKANNGTRTEGKITTYNVVAALIWRCKALSSNCMDRE----  295

Query  645   RLSTVLFAVDIRRRLNPPLPDSYSGNAVLTGYGSAKCAELEEGPFWKTVQMVYEGAARMT  466
             R+ST+L ++DIR+RLNPPLP SY GNAVL    SA+C  LE  PF + V++V +G     
Sbjct  296   RVSTLLTSIDIRQRLNPPLPASYCGNAVLFAPASAECKHLENWPFLELVKVVSDGIKGFN  355

Query  465   DEYARSAIDWGELYKG--FPHGEFLVSSWWRLGFEGVQFPWGKPKYSCPVVYHRKDIILL  292
             DEYARS ID   + +G   P+ E+ VSSW +LGF+ V +PWGKP    P +    +   L
Sbjct  356   DEYARSMIDLLGINRGKVQPYIEYNVSSWMKLGFDEVVYPWGKPICFGP-LRTVTETCFL  414

Query  291   FPDIDNGGKSNSGVNVLVALPPKEMEKFKSLFHKFL  184
             FP + +G      VN LV+LP  EME+F++ F  F 
Sbjct  415   FPGVVDG-----DVNALVSLPTVEMERFQAYFLDFF  445



>ref|XP_008802387.1| PREDICTED: omega-hydroxypalmitate O-feruloyl transferase-like 
[Phoenix dactylifera]
Length=331

 Score =   343 bits (879),  Expect = 8e-110, Method: Compositional matrix adjust.
 Identities = 175/305 (57%), Positives = 217/305 (71%), Gaps = 11/305 (4%)
 Frame = -3

Query  1089  QVTSFKCGGFALGTSMNHISFDGSGFKMFLENLAALSFNDDGPLAVVPCNDRSLLAARSP  910
             QVTSFKCGGFALG   NHI+FDG  F+ FL+NLAA++ N   PLA  PCNDR LLAARSP
Sbjct  31    QVTSFKCGGFALGICNNHITFDGLSFQTFLQNLAAVASNR--PLATTPCNDRRLLAARSP  88

Query  909   PQVTFPHPELLKVNLPAGEEMAPP--VFDSLKDDLAFEIFQLSSADIERLKDKAKAPDNV  736
             PQV+FPHPEL+ +         PP  + DSL   L   +F LS  DI  LKDKAK   + 
Sbjct  89    PQVSFPHPELITLQSIPHPNQHPPSTLLDSLSSYLHSHLFHLSPDDISALKDKAKT--SP  146

Query  735   KTKVTGFNVLTAAIWRCKALSCLGGENNSDRLSTVLFAVDIRRRLNPPLPDSYSGNAVLT  556
                 + FNV  A +WRCKAL+      +S++LSTVL+AVD+R RL PPLP SY+GNAVL+
Sbjct  147   PPAASSFNVAAAHLWRCKALA--SSTRSSNKLSTVLYAVDLRSRLKPPLPRSYAGNAVLS  204

Query  555   GYGSAKCAELEEGPFWKTVQMVYEGAARMTDEYARSAIDWGELYKGFPHGEFLVSSWWRL  376
              Y +A C+ELE GPF + V++VY+GA RMTDEYARS IDWG+L +GFP G+ +VSSW RL
Sbjct  205   AYATAACSELEAGPFARIVELVYKGAERMTDEYARSVIDWGQLNQGFPRGDVVVSSWLRL  264

Query  375   GFEGVQFPWGKPKYSCPVVYHRKDIILLFPDIDNGGKSNSGVNVLVALPPKEMEKFKSLF  196
             GF  V++PWG+PK+S PV   + DIILLFP     GK   G+N LV LP +++EKF+SLF
Sbjct  265   GFGEVEYPWGRPKHSFPVGNPQWDIILLFPA---SGKEGKGMNALVPLPTEDVEKFRSLF  321

Query  195   HKFLA  181
             +KFLA
Sbjct  322   YKFLA  326



>gb|KHN00653.1| Omega-hydroxypalmitate O-feruloyl transferase [Glycine soja]
Length=256

 Score =   333 bits (853),  Expect = 5e-107, Method: Compositional matrix adjust.
 Identities = 167/262 (64%), Positives = 201/262 (77%), Gaps = 13/262 (5%)
 Frame = -3

Query  951  VPCNDRSLLAARSPPQVTFPHPELLKV-NLPAGEEMAPPVFDSLKDDLAFEIFQLSSADI  775
            +PC+DR LLAARSPP VTFPHPE+LK+ +LP   +    +F++  + L F++F+L+S DI
Sbjct  1    MPCHDRHLLAARSPPCVTFPHPEMLKLSDLPTCPDSN--IFEASTEQLDFKVFKLTSNDI  58

Query  774  ERLKDKAKAPDNVKTK----VTGFNVLTAAIWRCKALSCLGGENNSDRLSTVLFAVDIRR  607
             +LK++AK            VTGFNV+TA IWRCKALSC   ++N +R ST+L+AVDIR 
Sbjct  59   TKLKEEAKNSSTSGGTSTTCVTGFNVITAHIWRCKALSC--EDDNPNRSSTILYAVDIRS  116

Query  606  RLNPPLPDSYSGNAVLTGYGSAKCAELEEGPFWKTVQMVYEGAARMTDEYARSAIDWGEL  427
            RLNPPLP SY+GNAVLT Y + KC ELEE PF K V+MV EGA RMT+EYARS IDWGE 
Sbjct  117  RLNPPLPKSYAGNAVLTAYATTKCKELEELPFMKLVEMVREGATRMTNEYARSIIDWGET  176

Query  426  YKGFPHGEFLVSSWWRLGFEGVQFPWGKPKYSCPVVYHRKDIILLFPDIDNGGKSNSGVN  247
             KG P+GE LVSSWWRLGFE V++PWGKPKY CPVVYHRKDIILLFP ID GG    GV+
Sbjct  177  NKGCPNGEVLVSSWWRLGFEEVEYPWGKPKYCCPVVYHRKDIILLFPPIDGGG----GVS  232

Query  246  VLVALPPKEMEKFKSLFHKFLA  181
            ++VALPPKEMEKF  LF+KFL 
Sbjct  233  IIVALPPKEMEKFYGLFNKFLT  254



>gb|EYU34262.1| hypothetical protein MIMGU_mgv1a025490mg [Erythranthe guttata]
Length=314

 Score =   320 bits (821),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 161/306 (53%), Positives = 210/306 (69%), Gaps = 14/306 (5%)
 Frame = -3

Query  1095  FLQVTSFKCGGFALGTSMNHISFDGSGFKMFLENLAALSFNDDGPLAVVPCNDRSLLAAR  916
             +LQVTSFKCGGFA+G S NHI FDG G K+FL NLA+ SF ++ PLA+VP NDR +LAAR
Sbjct  17    YLQVTSFKCGGFAIGMSTNHILFDGLGAKVFLINLASQSF-ENKPLAIVPYNDRRVLAAR  75

Query  915   SPPQVTFPHPELLKVNLPAGEEMAPPVFDSLKDDLAFEIFQLSSADIERLKDKAKAPDNV  736
             SPP V+FPHPE LK +LP G    PP FD + ++L  +IF+L++  I  LKD       +
Sbjct  76    SPPHVSFPHPEFLKFDLPVGPGSTPPKFDCIIEELDLKIFKLTTTQISHLKDNITKTSKI  135

Query  735   KTKVTGFNVLTAAIWRCKALSCLGGENNSDRLSTVLFAVDIRRRLNPPLPDSYSGNAVLT  556
             + +++   V+ A IWRCKA S     ++ +R+ST+L  +DIR R+NPPLP SYS NAVL 
Sbjct  136   E-RISTLAVVAALIWRCKAFS-----DDKNRVSTLLSVIDIRPRVNPPLPYSYSANAVLP  189

Query  555   GYGSAKCAELEEGPFWKTVQMVYEGAARMTDEYARSAIDWGELYKGFPHGEFLVSSWWRL  376
                S  C E+  GPF K V+++ EGA  MT EY +SA DW EL +G PHG+++VSSW R 
Sbjct  190   LGVSETCEEIRNGPFSKLVEIITEGAKEMTHEYVKSAFDWLELNRGIPHGDYMVSSWLRF  249

Query  375   GFEGVQFPWGKPKYSCPVVYHRKDIILLFPD-IDNGGKSNSGVNVLVALPPKEMEKFKSL  199
             GF+ V++ WGKP YSCPVV HRKDI  +F D +DN      GV  +VALP +EM+ F+ +
Sbjct  250   GFDEVEYAWGKPMYSCPVVNHRKDICWVFRDAVDN------GVCAMVALPSQEMDIFEGV  303

Query  198   FHKFLA  181
             FH F A
Sbjct  304   FHDFFA  309



>gb|EYU17596.1| hypothetical protein MIMGU_mgv1a021071mg [Erythranthe guttata]
Length=383

 Score =   311 bits (796),  Expect = 9e-97, Method: Compositional matrix adjust.
 Identities = 158/311 (51%), Positives = 207/311 (67%), Gaps = 14/311 (5%)
 Frame = -3

Query  1110  DQPLCFLQVTSFKCGGFALGTSMNHISFDGSGFKMFLENLAALSFNDDGPLAVVPCNDRS  931
             D       VTSFKCGGFA+G S NHI FDG G K+FL NLA+ S  ++ PLA+VP NDR 
Sbjct  81    DYTWVLFAVTSFKCGGFAIGMSTNHILFDGLGAKVFLLNLASQSL-ENKPLAIVPYNDRR  139

Query  930   LLAARSPPQVTFPHPELLKVNLPAGEEMAPPVFDSLKDDLAFEIFQLSSADIERLKDKAK  751
             +LAARSPP V+FPHPE LK +LP G    PP FD + +++ F+IF+L++  I  LKD   
Sbjct  140   ILAARSPPHVSFPHPEFLKFDLPVGPGSTPPKFDCIIEEIDFKIFKLTTTHISHLKDNIT  199

Query  750   APDNVKTKVTGFNVLTAAIWRCKALSCLGGENNSDRLSTVLFAVDIRRRLNPPLPDSYSG  571
                 +  +++   V+ A IWRCKA       ++ +R+ST+L  +DIR R+NPPLP SYS 
Sbjct  200   KTSKID-RISTLAVVAALIWRCKAFF-----DDKNRVSTLLSVIDIRPRVNPPLPYSYSA  253

Query  570   NAVLTGYGSAKCAELEEGPFWKTVQMVYEGAARMTDEYARSAIDWGELYKGFPHGEFLVS  391
             NAVL    S  C E++ GPF K V+++ EGA  MT E  +SA DW EL +G PHG+++VS
Sbjct  254   NAVLPLGVSETCEEIKNGPFSKLVEIITEGAKEMTHESVKSAFDWLELNRGIPHGDYMVS  313

Query  390   SWWRLGFEGVQFPWGKPKYSCPVVYHRKDIILLFPD-IDNGGKSNSGVNVLVALPPKEME  214
             SW RLGF+ V++ WGKP YSCPVV HRKDI  +F D +DN      GV  +VALP +EM+
Sbjct  314   SWLRLGFDEVEYAWGKPMYSCPVVNHRKDICWVFRDAVDN------GVCAMVALPSQEMD  367

Query  213   KFKSLFHKFLA  181
              F+ +FH F A
Sbjct  368   IFEGVFHDFFA  378


 Score = 74.7 bits (182),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 36/67 (54%), Positives = 47/67 (70%), Gaps = 2/67 (3%)
 Frame = -3

Query  1548  MGALYLKPETLHEDLKVTILDSGLIFPSQETTKHTMFLSNIDKVLNFDVQTVHFFPASPG  1369
             M AL   P    EDLK+   +S LIFP +ET K ++FLSNID++LN+D+ T HFF A+P 
Sbjct  1     MAALSAVPSM--EDLKIKFQESSLIFPYKETPKKSIFLSNIDQILNYDIPTAHFFKANPA  58

Query  1368  FPPEIVA  1348
             FPPEI+ 
Sbjct  59    FPPEIMG  65



>gb|ABK24776.1| unknown [Picea sitchensis]
Length=463

 Score =   303 bits (775),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 178/469 (38%), Positives = 260/469 (55%), Gaps = 29/469 (6%)
 Frame = -3

Query  1542  ALYLKPETLHEDLKVTILDSGLIFPSQETTKHTMFLSNIDKVLNFDVQTVHFFPASPGFP  1363
             A+ L  E    DL++T+     ++P++ T + +MFLSNID+ L   V T+ FFPA     
Sbjct  2     AMALTQEDFVGDLEITMEAPFAVYPAEPTPRRSMFLSNIDQTLVSTVATITFFPACKQMS  61

Query  1362  PEIVAGKIKNAFRRLLVANTYDFLAGRLKKNKESERVEIECNAAGAGFTVASSEFALEDI  1183
              + +  +  +A  +LLV   YDF+AGRL  N+E +R+EI+CN AG  F V +++  LE++
Sbjct  62    FDEIVQRYVDALGKLLVH--YDFVAGRLTLNEEDDRLEIDCNGAGVFFGVGTTDLTLEEL  119

Query  1182  GDLVYPNPAFRQLVTMSFDFVAK---EDQPLCFLQVTSFKCGGFALGTSMNHISFDGSGF  1012
              DL +PNPAFRQL+    D+V+    +D PL  LQ T FKCGGF +G  +NH  FDG   
Sbjct  120   KDLKFPNPAFRQLILQ--DYVSHSHLQDLPLLTLQATRFKCGGFTVGAGLNHCLFDGISS  177

Query  1011  KMFLENLAALSFNDDGPLAVVPCNDRSLLAARSPPQVTFPHPELLK-VNLPAGEEMA---  844
               F  NLA++   +   L V P  DR++L AR P ++ + H E  K  ++P G   A   
Sbjct  178   FDFTVNLASIIRGES--LKVTPDLDRTILKARVPQRIDYEHLEYTKFCDIPRGIITAFRG  235

Query  843   ----------PPVFDSLKDDLAFEIFQLSSADIERLKDKAKAPDNVKTKVTGFNVLTAAI  694
                        P+    +  L  ++F +S   + RLK+KA   D    K T F V+TA +
Sbjct  236   RGGDVEPIESEPIKIPPRPKLVLKLFPVSVEMLNRLKEKAME-DGKIMKCTSFEVVTAHL  294

Query  693   WRCKALSCLGGENNSDRLSTVLFAVDIRRRLNPPLPDSYSGNAVLTGYGSAKCAELEEGP  514
             WR ++ +    E  S+  STVLF V+ R RL PP+   Y+GNAV+ GY  A   EL + P
Sbjct  295   WRARSQAL---EMQSNETSTVLFPVECRSRLEPPISREYAGNAVVPGYARATVKELRDEP  351

Query  513   FWKTVQMVYEGAARMTDEYARSAIDWGELYKGFPHG--EFLVSSWWRLGFEGVQFPWGKP  340
             F   VQ V +G +R+ ++Y RS IDW E++KG P     F V +WWRLG E  ++PWG P
Sbjct  352   FSVLVQKVQQGLSRLGNDYVRSMIDWLEVHKGIPCAVNSFSVVAWWRLGLEDAEYPWGNP  411

Query  339   KYSCPVVYHRKDIILLFPDIDNGGKSNSGVNVLVALPPKEMEKFKSLFH  193
              +  P + H  ++++L  +    G    G NV +AL P +  +F  LF 
Sbjct  412   LHLSPAISHCAELVMLLHNPSQQGGGGGGFNVAIALQPHQFPRFHQLFQ  460



>ref|XP_002992378.1| BAHD family acyltransferase, clade V [Selaginella moellendorffii]
 gb|EFJ06528.1| BAHD family acyltransferase, clade V [Selaginella moellendorffii]
Length=450

 Score =   292 bits (747),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 178/467 (38%), Positives = 255/467 (55%), Gaps = 40/467 (9%)
 Frame = -3

Query  1533  LKPETLHEDLKVTILDSGLIFPSQETTKHTMFLSNIDKVLNFDVQTVHFFPASPGFPPEI  1354
             L+ E    DLKV +     + P+ ET + T+F+SNID+VL + V+TV+F+        E+
Sbjct  3     LQGEVRLSDLKVKVHKISTVVPAGETEQCTLFMSNIDQVLAYYVETVYFYDKGGDAAVEL  62

Query  1353  VAGKIKNAFRRLLVANTYDFLAGRLKKNKESERVEIECNAAGAGFTVASSEFALEDIGDL  1174
                 ++ A  R+LV   Y FLAGR K N +  R+E+ECN  G  F  AS E  + D+GD+
Sbjct  63    ----LQEALGRVLVP--YHFLAGRFKLNPKLGRMELECNREGVSFAAASCELRVSDLGDI  116

Query  1173  VYPNPAFRQLVTMSFDFVAKEDQPLCFLQVTSFKCGGFALGTSMNHISFDGSGFKMFLEN  994
               PNP FR LV +  +  A  D PL  +QVT F CGGFA+G  M+H S DG G   F  N
Sbjct  117   SVPNPLFRNLVLLPDEGKALNDAPLITIQVTKFSCGGFAMGVYMSHASLDGIGALEFFMN  176

Query  993   LAALSFNDDGPLAVVPCNDRSLLAARSPPQVTFPHPELLKVNLPAGEEMAPPVFDSLKDD  814
               +++  D   + V+P  DR++LAARSPPQVTF H E +K++       A         D
Sbjct  177   YCSVARGDG--MQVIPKPDRTMLAARSPPQVTFDHTEYVKLSDLMAAAAAAKATAFTTPD  234

Query  813   LA-----------FEIFQLSSADIERLKDKAKAPDNVKT--KVTGFNVLTAAIWRCKALS  673
              A           ++ F  +   I +LK KA   ++  T  K + F V+ A +W+ +  +
Sbjct  235   SANATTRAPQKHVYKSFSFTPDRIAQLK-KAVVDESTATIDKCSSFEVIVAHLWQARTRA  293

Query  672   CLGGENNSDRLSTVLFAVDIRRRLNPPLPDSYSGNAVLTGYGSAKCA-----ELEEGPFW  508
                 E + D  S + FAVDIR +++PPLP  ++GN VL    SA C      ++ E    
Sbjct  294   V---EMDPDSPSKLFFAVDIRNKVDPPLPKGFAGNGVL----SAPCVKTLARDVRENSLG  346

Query  507   KTVQMVYEGAARMTDEYARSAIDWGELYKGFP--HGEFLVSSWWRLGFEGVQFPWGKPKY  334
               V+ V E  A +TDEY RS+ID GELY+G P  HG   +S WW++ F+ + F WG+P Y
Sbjct  347   YCVRKVQEAIASVTDEYVRSSIDHGELYRGVPALHGGIFISPWWKIPFQELDFGWGRPLY  406

Query  333   SCPVVYHRKDIILLFPDIDNGGKSNSGVNVLVALPPKEMEKFKSLFH  193
             + PVV  R + +LL     + GK + G+N  +AL P EM+KF+ L  
Sbjct  407   AGPVVNDRVEFVLLL----HNGKQDGGLNAYLALEPAEMDKFEKLLQ  449



>ref|XP_002967754.1| BAHD family acyltransferase, clade V [Selaginella moellendorffii]
 gb|EFJ31101.1| BAHD family acyltransferase, clade V [Selaginella moellendorffii]
Length=450

 Score =   291 bits (746),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 178/467 (38%), Positives = 255/467 (55%), Gaps = 40/467 (9%)
 Frame = -3

Query  1533  LKPETLHEDLKVTILDSGLIFPSQETTKHTMFLSNIDKVLNFDVQTVHFFPASPGFPPEI  1354
             L+ E    DLKV +     + P+ ET + T+F+SNID+VL + V+TV+F+        E+
Sbjct  3     LQGEVRLSDLKVKVHKISTVVPAGETEQCTLFMSNIDQVLAYYVETVYFYDKGGDAAAEL  62

Query  1353  VAGKIKNAFRRLLVANTYDFLAGRLKKNKESERVEIECNAAGAGFTVASSEFALEDIGDL  1174
                 ++ A  R+LV   Y FLAGR K N +  R+E+ECN  G  F  AS E  + D+GD+
Sbjct  63    ----LQEALGRVLV--PYHFLAGRFKLNPKLGRMELECNREGVSFAAASCELRVSDLGDI  116

Query  1173  VYPNPAFRQLVTMSFDFVAKEDQPLCFLQVTSFKCGGFALGTSMNHISFDGSGFKMFLEN  994
               PNP FR LV +  +  A  D PL  +QVT F CGGFA+G  M+H S DG G   F  N
Sbjct  117   SVPNPLFRNLVLLPDEGKALNDAPLITIQVTKFSCGGFAMGVYMSHASLDGIGALEFFMN  176

Query  993   LAALSFNDDGPLAVVPCNDRSLLAARSPPQVTFPHPELLKVNLPAGEEMAPPVFDSLKDD  814
               +++  D   + V+P  DR++LAARSPPQVTF H E +K++       A         D
Sbjct  177   YCSVARGDG--MQVIPKPDRTMLAARSPPQVTFDHTEYVKLSDLMAAAAAAKATAFTTPD  234

Query  813   LA-----------FEIFQLSSADIERLKDKAKAPDNVKT--KVTGFNVLTAAIWRCKALS  673
              A           ++ F  +   I +LK KA   ++  T  K + F V+ A +W+ +  +
Sbjct  235   SANAATRAPQKHVYKSFSFTPDRIAQLK-KAVLDESTATIDKCSSFEVIVAHLWQARTRA  293

Query  672   CLGGENNSDRLSTVLFAVDIRRRLNPPLPDSYSGNAVLTGYGSAKCA-----ELEEGPFW  508
                 E + D  S + FAVDIR +++PPLP  ++GN VL    SA C      ++ E    
Sbjct  294   V---EMDPDSPSKLFFAVDIRNKVDPPLPKGFAGNGVL----SAPCVKTLARDVRENSLG  346

Query  507   KTVQMVYEGAARMTDEYARSAIDWGELYKGFP--HGEFLVSSWWRLGFEGVQFPWGKPKY  334
               V+ V E  A +TDEY RS+ID GELY+G P  HG   +S WW++ F+ + F WG+P Y
Sbjct  347   YCVRKVQEAIAAVTDEYVRSSIDHGELYRGVPALHGGIFISPWWKIPFQELDFGWGRPLY  406

Query  333   SCPVVYHRKDIILLFPDIDNGGKSNSGVNVLVALPPKEMEKFKSLFH  193
             + PVV  R + +LL     + GK + G+N  +AL P EM+KF+ L  
Sbjct  407   AGPVVNDRVEFVLLL----HNGKQDGGLNAYLALEPAEMDKFEKLLQ  449



>ref|XP_010930413.1| PREDICTED: omega-hydroxypalmitate O-feruloyl transferase-like 
[Elaeis guineensis]
Length=452

 Score =   289 bits (739),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 173/438 (39%), Positives = 242/438 (55%), Gaps = 26/438 (6%)
 Frame = -3

Query  1479  LIFPSQETTKHTMFLSNIDKVLNFDVQTVHFFPASPG--FPPEIVAGKIKNAFRRLLVAN  1306
             L+ P   T   T++LSNID+ + F VQTV F+   PG   P   V  +++ +   +L+  
Sbjct  20    LVSPRNPTPTKTVYLSNIDQTVAFPVQTVFFYEVPPGGGIPTFDVTERVRISVSEVLLIP  79

Query  1305  TYDFLAGRLKKNKESERVEIECNAAGAGFTVASSEFALEDIGDLVYPNPAFRQLVTMSFD  1126
              Y F+AGRL  N +++R+E+ CN AG  F  A+S   L ++G+L  PNP+FR LV  +  
Sbjct  80    YY-FMAGRLNFNLQTKRLELVCNNAGVLFVGATSHLRLNELGNLSLPNPSFRHLVLQTEG  138

Query  1125  FVAKEDQPLCFLQVTSFKCGGFALGTSMNHISFDGSGFKMFLENLAALSFNDDGPLAVVP  946
             F +  + P+  +QVT FKCGGF++G   NH   DG       ENLA++    +G      
Sbjct  139   FESFAETPIFTIQVTRFKCGGFSIGFVTNHSILDGRSAAEMFENLASIC-RGEGMKTHEL  197

Query  945   CNDRSLLAARSPPQVTFPHPELLKVNLPAG------EEMAPPVFDSLKD---DLAFEIFQ  793
               DRS + AR PPQ+ F H E  K+             + PP   +L     D  F +F 
Sbjct  198   NIDRSCIRARDPPQIKFKHTEYTKLAEATSLASSFTSPIQPPTSTTLTGLLPDHEFRMFS  257

Query  792   LSSADIERLKDKAKAPDNVKTKVTGFNVLTAAIWRCKALSCLGGENNSDRLSTVLFAVDI  613
              +   I  LK+KA       TK + F  + A IWR +  +     +N D +S+VLFAVDI
Sbjct  258   FNPDMIRCLKEKAM------TKCSSFEAIVAHIWRARTKAIF---DNLDEISSVLFAVDI  308

Query  612   RRRLNPPLPDSYSGNAVLTGYGSAKCAELEEGPFWKTVQMVYEGAARMTDEYARSAIDWG  433
             R R++PPLP  +SGNAV+T   SAK A+L E PF   V+MV E   R+TDEY RS IDW 
Sbjct  309   RSRMSPPLPQGFSGNAVITASASAKVADLGEKPFSFCVEMVKEAIERVTDEYVRSGIDWL  368

Query  432   ELYKGFP---HGEFLVSSWWRLGFEGVQFPWGKPKYSCPVVYHRKDIILLFPDIDNGGKS  262
             E+YKG P   +G F +S+WW+L F  + F +GKP Y  PV     + +LL    ++ GK 
Sbjct  369   EVYKGMPSTLNGNFFLSAWWKLPFYELDFGYGKPLYGGPVAGGMGEFVLLLSSGNDMGK-  427

Query  261   NSGVNVLVALPPKEMEKF  208
               GVNV +AL   +ME+F
Sbjct  428   RGGVNVWIALEKDKMERF  445



>ref|XP_011071659.1| PREDICTED: omega-hydroxypalmitate O-feruloyl transferase-like 
[Sesamum indicum]
Length=463

 Score =   284 bits (727),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 168/442 (38%), Positives = 241/442 (55%), Gaps = 27/442 (6%)
 Frame = -3

Query  1479  LIFPSQETTKHTMFLSNIDKVLNFDVQTVHFFPASPGFPPEI----VAGKIKNAFRRLLV  1312
             L+ P       T+FLSNID+ + F V+TV F+   P          +AGK+K A   +L+
Sbjct  24    LMSPRNPVPTETIFLSNIDQAVTFPVETVFFYEVPPNMASAASTVGIAGKVKKAVEEVLL  83

Query  1311  ANTYDFLAGRLKKNKESERVEIECNAAGAGFTVASSEFALEDIGDLVYPNPAFRQLVTMS  1132
                Y F+AGRL  + E++R+E+ CN AGA F  A S F L+D+G+L +PNP+F   V   
Sbjct  84    VPYY-FMAGRLNFSDETKRLELVCNNAGALFVSAKSRFCLKDLGNLSHPNPSFHHFVLRP  142

Query  1131  FDFVAKEDQPLCFLQVTSFKCGGFALGTSMNHISFDGSGFKMFLENLAALSFNDDGPLAV  952
               + +  +  L  +QVT F+CGGFALG + NH   DG        NLA++    +G    
Sbjct  143   GIYKSLAETALFTIQVTRFECGGFALGFTTNHAILDGKSASEMFHNLASIC-RGEGLKTN  201

Query  951   VPCNDRSLLAARSPPQVTFPHPELLKV-------NLPAGEEMAPPVFDSLKDDLAFEIFQ  793
                NDR+ + AR+PPQ+ FPH E +K+       +    ++   P      D    ++F 
Sbjct  202   HINNDRTCMKARTPPQILFPHTEYVKLARTSSLLSSFTSQKRPSPSPHIFSDKYTHKLFS  261

Query  792   LSSADIERLKDKAKAPDNVKTKVTGFNVLTAAIWRCKALSCLGGE--NNSDRLSTVLFAV  619
              +   ++ LK KA        + + F  + A IWR +  + LG +   + D+ STVLFAV
Sbjct  262   FTPQMLKLLKQKAM------IECSTFEAILAHIWRARTRAILGHDCDQHQDQDSTVLFAV  315

Query  618   DIRRRLNPPLPDSYSGNAVLTGYGSAKCAELEEGPFWKTVQMVYEGAARMTDEYARSAID  439
             DIR  ++PPLP S+ GNAV+TGY   K  +L  GP    V+MV EG  R+T EY RS ID
Sbjct  316   DIRDTISPPLPSSFIGNAVITGYARTKARDLVGGPLSYGVEMVREGRERVTSEYIRSVID  375

Query  438   WGELYKGFPHG---EFLVSSWWRLGFEGVQFPWGKPKYSCPVVYHRKDIILLFP--DIDN  274
             W E+YKG P      F VS+WW+LGF  V   +G+ K++ P+V    + +LL    D D 
Sbjct  376   WLEVYKGTPATCGCAFYVSAWWKLGFGEVDLGFGRAKHAGPIVSGNDEFVLLLDGGDCDE  435

Query  273   GGKSNSGVNVLVALPPKEMEKF  208
             GGK   G+NV + L   +ME+F
Sbjct  436   GGK-GLGINVWIGLEKDKMERF  456



>ref|XP_007035554.1| BAHD family acyltransferase, clade V, putative [Theobroma cacao]
 gb|EOY06480.1| BAHD family acyltransferase, clade V, putative [Theobroma cacao]
Length=451

 Score =   281 bits (719),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 162/435 (37%), Positives = 246/435 (57%), Gaps = 32/435 (7%)
 Frame = -3

Query  1446  TMFLSNIDKVLNFDVQTVHFFPASPGFPPEI--VAGKIKNAFRRLLVANTYDFLAGRLKK  1273
             T+FLSNID+ + F V+TV FF   P        ++ ++K A   +L+   Y F+AGRL+ 
Sbjct  32    TIFLSNIDQAVCFAVETVFFFDLPPDKSSSTLGISLRVKQAVAEVLLGPYY-FMAGRLRF  90

Query  1272  NKESERVEIECNAAGAGFTVASSEFALEDIGDLVYPNPAFRQLVTMSFDFVAKEDQPLCF  1093
             NK++ R+++ CN AG  F  A+S   L+D+G+L  PN  F   V     + + ++  L  
Sbjct  91    NKQTNRLQLLCNNAGVLFVSATSRLRLKDLGNLSLPNSTFHHFVHRPGLYKSLDETALLT  150

Query  1092  LQVTSFKCGGFALGTSMNHISFDGSGFKMFLENLAALSFNDDGPLAVVPCNDRSLLAARS  913
             +QVT F CGGF++G   NH   DG       ENLA++    +G    V  NDR+ L AR+
Sbjct  151   IQVTRFACGGFSIGFVTNHAILDGKSASEMFENLASIC-RGEGLQTKVIYNDRTSLKARN  209

Query  912   PPQVTFPHPELLKVN--------LPAGEEMAPP--VFDSLKDDLAFEIFQLSSADIERLK  763
             P  +++PH E +K+N          A E+ +PP  +F  +      +++  +   I  L+
Sbjct  210   PLLISYPHKEYVKLNKKSSRASCFTAPEQSSPPRLIFSKI---YTHKLYSFTPEMITTLR  266

Query  762   DKAKAPDNVKTKVTGFNVLTAAIWRCKALSCLGGENNSDRLSTVLFAVDIRRRLNPPLPD  583
              KA       T+ + F  + A IWR ++ +      N D LSTVLFAVDIR +++PPLP+
Sbjct  267   KKAM------TRCSSFEAIVAHIWRARSKAIF---TNLDDLSTVLFAVDIRSKISPPLPN  317

Query  582   SYSGNAVLTGYGSAKCAELEEGPFWKTVQMVYEGAARMTDEYARSAIDWGELYKGFP---  412
              ++GNA++T +  AK  +L E PF   V+ + EG  R+TDEYARS IDW E+++GFP   
Sbjct  318   GFAGNAIITAFADAKVVDLIEKPFSFCVEKIKEGRERITDEYARSVIDWLEVHRGFPATC  377

Query  411   HGEFLVSSWWRLGFEGVQFPWGKPKYSCPVVYHRKDIILLFPDIDNGGKSNSGVNVLVAL  232
             +G F VS+WW+LGF  + F +GKP +  PVV    + +LL  D    G S  G+NV + L
Sbjct  378   NGTFYVSAWWKLGFNELDFGYGKPAHGGPVVSGNDEFVLLLSDA-KCGDSGGGINVWLGL  436

Query  231   PPKEMEKFKSLFHKF  187
              P++M++   + H F
Sbjct  437   EPEKMKRL--ILHIF  449



>ref|XP_008786402.1| PREDICTED: omega-hydroxypalmitate O-feruloyl transferase-like 
[Phoenix dactylifera]
Length=452

 Score =   280 bits (715),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 172/446 (39%), Positives = 244/446 (55%), Gaps = 30/446 (7%)
 Frame = -3

Query  1479  LIFPSQETTKHTMFLSNIDKVLNFDVQTVHFFPASPG--FPPEIVAGKIKNAFRRLLVAN  1306
             L+ P   T   T++LSNID+ + F VQTV F+   PG   P      +++ +   +L+  
Sbjct  20    LVSPRNPTPIKTVYLSNIDQTVAFPVQTVFFYEVPPGGGTPRFDATDRVRRSVSEVLLIP  79

Query  1305  TYDFLAGRLKKNKESERVEIECNAAGAGFTVASSEFALEDIGDLVYPNPAFRQLVTMSFD  1126
              Y F+AGRL  N +++R+E+ CN AG  F  A+S  +L ++G+L  PNP+FR LV  +  
Sbjct  80    YY-FMAGRLNFNLQTKRLELVCNNAGVLFAGATSSLSLNELGNLSLPNPSFRHLVLQTEG  138

Query  1125  FVAKEDQPLCFLQVTSFKCGGFALGTSMNHISFDGSGFKMFLENLAALSFNDDGPLAVVP  946
             F +  + P+  +QVT FKCGGF++G   NH   DG       ENLA++    +G    + 
Sbjct  139   FESLPETPIFTIQVTRFKCGGFSIGFVTNHSILDGRSAAEMFENLASIC-RGEGMKTHLL  197

Query  945   CNDRSLLAARSPPQVTFPHPELLKV----------NLPAGEEMAPPVFDSLKDDLAFEIF  796
               DRS + AR PPQ+ F H E  K+            P     + P+  SL+ D  F + 
Sbjct  198   NIDRSCIRARDPPQIKFQHTEYTKLAEATSLASSFTSPIQPSTSTPL-PSLQLDHDFRML  256

Query  795   QLSSADIERLKDKAKAPDNVKTKVTGFNVLTAAIWRCKALSCLGGENNSDRLSTVLFAVD  616
               S   I  LK+KA       TK + F  + A IWR +  +     ++ D +S+VLFA D
Sbjct  257   SFSPDMIRCLKEKA------ATKCSSFEAIVAHIWRARTKAVF---DDPDGISSVLFAAD  307

Query  615   IRRRLNPPLPDSYSGNAVLTGYGSAKCAELEEGPFWKTVQMVYEGAARMTDEYARSAIDW  436
             IR R++PPLP  + GNAV+T   SAK A L E PF   V MV E   R+TDEY RS IDW
Sbjct  308   IRSRVSPPLPHGFGGNAVITASASAKVAVLGEKPFSFCVGMVKEAIERVTDEYVRSVIDW  367

Query  435   GELYKGFP---HGEFLVSSWWRLGFEGVQFPWGKPKYSCPVVYHRKDIILLFPDIDNGGK  265
              E+Y+G P   +G F +S+WW+L F  + F +GKP Y  PVV    + +LL    ++ G+
Sbjct  368   LEVYRGVPSTVNGNFFLSAWWKLPFHELDFGYGKPLYGGPVVGGMGEFVLLLSSGNDMGR  427

Query  264   SNSGVNVLVALPPKEMEKFKSLFHKF  187
                GVNV +AL   +ME+F  L H F
Sbjct  428   -RGGVNVWIALEKDKMERF--LCHVF  450



>gb|EYU17590.1| hypothetical protein MIMGU_mgv1a026424mg [Erythranthe guttata]
Length=265

 Score =   268 bits (684),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 137/289 (47%), Positives = 185/289 (64%), Gaps = 27/289 (9%)
 Frame = -3

Query  1047  SMNHISFDGSGFKMFLENLAALSFNDDGPLAVVPCNDRSLLAARSPPQVTFPHPELLKVN  868
             S NHI FDG G K+FL NLA+ SF ++ PLA++P NDR +LAARSPPQV+FPHPE LK +
Sbjct  2     STNHILFDGLGAKVFLLNLASQSF-ENKPLAIIPYNDRRILAARSPPQVSFPHPEFLKFD  60

Query  867   LPAGEEMAPPVFDSLKDDLAFEIFQLSSADIERLKDKAKAPDNVKTKVTGFNVLTAAIWR  688
             LP G    PP FD + ++L F+IF+L++  I  LKD       +  +++ F V+ A IWR
Sbjct  61    LPVGPGSTPPKFDCIIEELDFKIFKLTTTQISHLKDNITKTSKIH-RISTFAVVAALIWR  119

Query  687   CKALSCLGGENNSDRLSTVLFAVDIRRRLNPPLPDSYSGNAVLTGYGSAKCAELEEGPFW  508
             CKA S     ++ +R+ST+L  +DIR R+NP LP SYS NAVL    S  C E++ G F 
Sbjct  120   CKAFS-----DDKNRVSTLLNVIDIRPRVNPQLPSSYSANAVLPLGVSETCEEIQNGAFS  174

Query  507   KTVQMVYEGAARMTDEYARSAIDWGELYKGFPHGEFLVSSWWRLGFEGVQFPWGKPKYSC  328
             K V+++ EGA  MT EY +SA DW EL +G PHG+++VSSW RLGF+ V++ WGKP YS 
Sbjct  175   KLVEIITEGAKEMTHEYVKSAFDWLELNRGIPHGDYMVSSWLRLGFDEVEYAWGKPMYSY  234

Query  327   PVVYHRKDIILLFPDIDNGGKSNSGVNVLVALPPKEMEKFKSLFHKFLA  181
              V                    + GV+ +VALP +EM  F+++FH F A
Sbjct  235   AV--------------------DGGVSAMVALPSQEMNIFEAVFHDFFA  263



>gb|ACU13324.1| unknown [Glycine max]
Length=260

 Score =   267 bits (682),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 131/220 (60%), Positives = 167/220 (76%), Gaps = 4/220 (2%)
 Frame = -3

Query  1527  PETLHEDLKVTILDSGLIFPSQETTKHTMFLSNIDKVLNFDVQTVHFFPASPGFPPEIVA  1348
             P +L +DLKVTI ++ +IFPS+E  + ++FLSNIDKVLNFDV+TVHFF A   FPP +V 
Sbjct  12    PPSLLKDLKVTIHNASMIFPSKEIERKSLFLSNIDKVLNFDVETVHFFGAHKDFPPHVVN  71

Query  1347  GKIKNAFRRLLVANTYDFLAGRLKKNKESERVEIECNAAGAGFTVASSEFALEDIGDLVY  1168
              ++KNA    LV   YDFL GRLK N +++R+E++CN  GAGF VASSE+ L+ IGDL Y
Sbjct  72    ERLKNALEDALVV--YDFLGGRLKLNYDTKRLEMDCNPEGAGFVVASSEYNLDQIGDLDY  129

Query  1167  PNPAFRQLVTMSFDFVAKEDQPLCFLQVTSFKCGGFALGTSMNHISFDGSGFKMFLENLA  988
             PNPAF QLV  + DF+   D PLC  QVTSFKCGGFA+G S +H +FDG  FK FL+N+A
Sbjct  130   PNPAFAQLVHQNKDFLKDGDVPLCVAQVTSFKCGGFAIGISTSHTTFDGLSFKTFLDNIA  189

Query  987   ALSFNDDGPLAVVPCNDRSLLAARSPPQVTFPHPELLKVN  868
             +++     PLAV PC+DR LLAARSPP+VTFPHPE+LK++
Sbjct  190   SIAAK--KPLAVTPCHDRHLLAARSPPRVTFPHPEMLKLS  227



>ref|XP_009415665.1| PREDICTED: omega-hydroxypalmitate O-feruloyl transferase-like 
[Musa acuminata subsp. malaccensis]
Length=451

 Score =   268 bits (685),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 165/446 (37%), Positives = 249/446 (56%), Gaps = 32/446 (7%)
 Frame = -3

Query  1482  GLIFPSQETTKHTMFLSNIDKVLNFDVQTVHFFPASPGFPP---EIVAGKIKNAFRRLLV  1312
              L+ P       T+ LSNID+   F V+TV F+  +P       +I+    ++    LLV
Sbjct  24    ALLSPRNPMPLKTIHLSNIDQTAAFPVETVFFYETTPDGAESTFDIIERVKRSVSEELLV  83

Query  1311  ANTYDFLAGRLKKNKESERVEIECNAAGAGFTVASSEFALEDIGDLVYPNPAFRQLVTMS  1132
                Y F+AGR+  N E++R+E+ CN AGA F  A+S  +L+++GDL  PNP+F++LV  +
Sbjct  84    P--YYFMAGRVHFNVETKRLELVCNNAGALFAGATSSLSLKELGDLSAPNPSFQRLVLRA  141

Query  1131  FDFVAKEDQPLCFLQ---VTSFKCGGFALGTSMNHISFDGSGFKMFLENLAALSFNDDGP  961
              +F +  + P+  +Q   VT F+CGGF++G   NH   DG      L+NLAA+   ++ P
Sbjct  142   EEFGSLPETPIFTIQSVKVTRFRCGGFSIGFMTNHSILDGKSAVEMLDNLAAICRGEE-P  200

Query  960   LAVVPCNDRSLLAARSPPQVTFPHPELLK----VNLPAGEEMAPPVFDS-LKDDLAFEIF  796
               V    DRS + AR PPQ+ F H E +K     +L + ++ +P  F S L  +  +E+ 
Sbjct  201   RNVKLHVDRSCIRARDPPQIQFEHAEYMKPTEASSLVSPDQPSPSSFVSMLSKNYEYEVA  260

Query  795   QLSSADIERLKDKAKAPDNVKTKVTGFNVLTAAIWRCKALSCLGGENNSDRLSTVLFAVD  616
              LS   I+ LK++A A        + F  + A +WR +  +     ++    S+VLFAVD
Sbjct  261   SLSLDMIDGLKERATA------GCSSFQAVVAHLWRARTRAVF---DDPSETSSVLFAVD  311

Query  615   IRRRLNPPLPDSYSGNAVLTGYGSAKCAELEEGPFWKTVQMVYEGAARMTDEYARSAIDW  436
             +R ++ P +PD + GNAV+    SA+ AEL E P    V+ V E   R+TDEY RSA+DW
Sbjct  312   VRSKMTPRVPDGFVGNAVVMAMASARVAELTEQPLGFAVKRVREAIERVTDEYIRSAVDW  371

Query  435   GELYKGFP---HGEFLVSSWWRLGFEGVQFPWGKPKYSCPVVYHRKDIILLFPDIDNGGK  265
              E  KG P   HG F+VS+WW+L F  + F WGKP Y+ PVV    + +LL  D    GK
Sbjct  372   LEANKGMPAIGHGNFIVSAWWKLPFHELDFGWGKPIYAGPVVSVMHECVLLLSD----GK  427

Query  264   SNSGVNVLVALPPKEMEKFKSLFHKF  187
                G+N+ +AL  ++M+ F S  ++ 
Sbjct  428   --GGINIWLALEEEKMKSFLSYVYEL  451



>gb|ACU13347.1| unknown [Glycine max]
Length=238

 Score =   257 bits (657),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 125/215 (58%), Positives = 163/215 (76%), Gaps = 4/215 (2%)
 Frame = -3

Query  1512  EDLKVTILDSGLIFPSQETTKHTMFLSNIDKVLNFDVQTVHFFPASPGFPPEIVAGKIKN  1333
             +DLKV I ++ +IFPS+E  + ++FLSNIDKVL+FDV+TVHFF A   FPP +V  ++KN
Sbjct  18    QDLKVIIHNASMIFPSKEIERKSLFLSNIDKVLSFDVETVHFFGAHKDFPPRVVNERLKN  77

Query  1332  AFRRLLVANTYDFLAGRLKKNKESERVEIECNAAGAGFTVASSEFALEDIGDLVYPNPAF  1153
             A    L+   YDFL GRLK N +++R+E++CN+ GAGF VASSE+ L+ IGDL YPNPAF
Sbjct  78    ALEDALM--VYDFLGGRLKLNFDTKRLEMDCNSEGAGFVVASSEYNLDQIGDLDYPNPAF  135

Query  1152  RQLVTMSFDFVAKEDQPLCFLQVTSFKCGGFALGTSMNHISFDGSGFKMFLENLAALSFN  973
              QLV  + DF+   D PLC  QVTSFKCGGFA+G S +H +FDG  FK FL+N+A+++  
Sbjct  136   AQLVQKNKDFLKHGDVPLCVAQVTSFKCGGFAIGISTSHTTFDGLSFKTFLDNIASIA--  193

Query  972   DDGPLAVVPCNDRSLLAARSPPQVTFPHPELLKVN  868
                PL V+PC+DR LLAARSPP VTFPHPE+LK++
Sbjct  194   SKKPLVVMPCHDRHLLAARSPPCVTFPHPEMLKLS  228



>ref|XP_010248037.1| PREDICTED: omega-hydroxypalmitate O-feruloyl transferase-like 
isoform X1 [Nelumbo nucifera]
 ref|XP_010248038.1| PREDICTED: omega-hydroxypalmitate O-feruloyl transferase-like 
isoform X2 [Nelumbo nucifera]
Length=443

 Score =   264 bits (674),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 169/455 (37%), Positives = 244/455 (54%), Gaps = 40/455 (9%)
 Frame = -3

Query  1500  VTILDSGLIFPSQETTKHTMFLSNIDKVLNFDVQTVHFF-PASPGFPPEIVAGKIKNAFR  1324
             VT++D  +I P   T    +FLSNID  L    + V FF P +     E V    K+A R
Sbjct  6     VTMVDKAVIVPETPTEHRRVFLSNIDLTLVLYDEAVSFFEPPATEISFEEVCRCFKDALR  65

Query  1323  RLLVANTYDFLAGRLKKNKE-SERVEIECNAAGAGFTVASSEFALEDIGDLVYPNPAFRQ  1147
             R+LV   YDFLAGRL+   E   R+EI CN AG  F  A++   L  +GDL  P P F+Q
Sbjct  66    RMLVE--YDFLAGRLEPALEDGSRLEINCNGAGVVFVAATTSCKLCQLGDLRTPKPEFKQ  123

Query  1146  LVTMSFDFVAKEDQ--------PLCFLQVTSFKCGGFALGTSMNHISFDGSGFKMFLENL  991
             LVT    F+ +E++        PL  LQ+T F+CGG A     NH + DG G + F  N 
Sbjct  124   LVT----FLRQEEEKVLEFTEKPLILLQLTRFQCGGLAFANRSNHCTLDGVGVREFQINF  179

Query  990   AALSFNDDGPLAVVPCNDRSLLAARSPPQVTFPHPELLKVNLPAGEEMAPPVFDSLKDDL  811
             A+L+  +D    + P  DR+L  AR+PPQ++ PH E  K   P G E++  V  ++   L
Sbjct  180   ASLTRGED--FVIRPSCDRTLFKARNPPQISHPHLEYSK---PIGAEISFTVCGTVGSTL  234

Query  810   AFEI------FQLSSADIERLKDKAKAPDNVKTKVTGFNVLTAAIWRCKALSCLGGENNS  649
                I        LS   I   K KA   D      + F  + A IW+ ++L+ +G ++  
Sbjct  235   KKSIPDDTHLVYLSPERIASFK-KAALKDGQLMSCSSFQAVAAKIWKARSLA-MGLQD--  290

Query  648   DRLSTVLFAVDIRRRLNPPLPDSYSGNAVLTGYGSAKCAELEEGPFWKTVQMVYEGAARM  469
             +R+STVLF VD+RRR+ PP P+ + GNA++ G+  A+  EL++      V  V EG  R+
Sbjct  291   ERISTVLFPVDVRRRIAPPAPNGFVGNALVPGFARARVEELKKAEDSFLVGKVKEGLERL  350

Query  468   TDEYARSAIDWGELYKGFPH--GEFLVSSWWRLGFEG--VQFPWGKPKYSCPVVYHRKDI  301
              DEY RS  DW E+++G P     F V SWWRLG EG  ++F WG  K   P++  +  +
Sbjct  351   DDEYIRSGNDWLEVHRGIPCCVDSFSVVSWWRLGLEGEELEFKWGAVKCVTPIMV-KPGL  409

Query  300   ILLFPDIDNGGKSNSGVNVLVALPPKEMEKFKSLF  196
             ++L PD     K + G+N+ + LP  ++++F  L 
Sbjct  410   VILLPD----SKDDGGINICLELPSDQIKEFHKLM  440



>gb|EYU45561.1| hypothetical protein MIMGU_mgv1a005829mg [Erythranthe guttata]
Length=468

 Score =   263 bits (673),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 162/451 (36%), Positives = 239/451 (53%), Gaps = 34/451 (8%)
 Frame = -3

Query  1479  LIFPSQETTKHTMFLSNIDKVLNFDVQTVHFFPASPGFPPEI---VAGKIKNAFRRLLVA  1309
             L  PS      T+FLSNID+ L+F V+TV F+   P  P      +A +++ A  ++L+ 
Sbjct  22    LFSPSNPKPIKTIFLSNIDQTLSFPVETVFFYKVPPNMPSSSTADIAERVRKAVEKVLLI  81

Query  1308  NTYDFLAGRLKKNKESERVEIECNAAGAGFTVASSEFALEDIGDLVYPNPAFRQLVTMSF  1129
               Y F+AGRL  N +++R+E+ CN AGA F  A S F+++D+G L  PNP+F +LV    
Sbjct  82    PYY-FMAGRLNFNGDTKRLELICNNAGALFVSAESRFSVDDLGSLSQPNPSFHRLVHRQG  140

Query  1128  DFVAKEDQPLCF-LQVTSFKCGGFALGTSMNHISFDGSGFKMFLENLAALSFNDDGPLAV  952
              +     +   F +QVT F+CGGFALG   NH   DG        NLA++   +     +
Sbjct  141   LYQKSLAETAVFTIQVTRFECGGFALGFMTNHAILDGKSASEMFNNLASICRGEALKPNI  200

Query  951   VPCNDRSLLAARSPPQVTFPHPELLKVNLPAGEEMAPPVFDS----------LKDDLAFE  802
             +  NDR+ + AR+PPQ+ FPH E +              F S            D    +
Sbjct  201   IN-NDRTCIRARTPPQIHFPHNEYVNPTTKTSSRSIASSFTSRERTSPSPLIFSDKYKHK  259

Query  801   IFQLSSADIERLKDKAKAPDNVKTKVTGFNVLTAAIWRCKALSCLGGENNSDRLSTVLFA  622
             +F  +S  +++LK K+        K + F+ + A IW+ +  +      + D+ S VLFA
Sbjct  260   LFSFTSEMLKKLKQKSTV------KCSTFDAILAHIWKARTKANFN-HKDQDQESRVLFA  312

Query  621   VDIRRRLNPPLPDSYSGNAVLTGYGSAKCAELEEGPFWKTVQMVYEGAARMTDEYARSAI  442
             VDIR +++PPL +S++GNAV+TG+ +AK  +L E P    V MV EG  R+T EY RS I
Sbjct  313   VDIRDKISPPLLNSFTGNAVVTGFATAKARDLIEKPLSFGVGMVKEGVERVTSEYVRSVI  372

Query  441   DWGELYKGFPH---GEFLVSSWWRLGFEGVQFPWGKPKYSCPVVYHRKDIILLFPDIDNG  271
             DW E+YKG P    G F  S+WW+L F  V F +GKP++  PVV    + +L   D D  
Sbjct  373   DWLEVYKGIPATSGGGFYASAWWKLPFGEVDFGFGKPRHVGPVVSGNDEFVLFLSDYDYD  432

Query  270   GK--------SNSGVNVLVALPPKEMEKFKS  202
                          G+NV + L  ++M+KF S
Sbjct  433   YDYDYDKSCCEGKGINVWMGLEKEKMDKFLS  463



>ref|XP_001752413.1| predicted protein [Physcomitrella patens]
 gb|EDQ82652.1| predicted protein [Physcomitrella patens]
Length=411

 Score =   253 bits (645),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 148/417 (35%), Positives = 229/417 (55%), Gaps = 25/417 (6%)
 Frame = -3

Query  1419  VLNFDVQTVHFFPASPGFPPEIVAGKIKNAFRRLLVANTYDFLAGRLKKNKESERVEIEC  1240
             +L F V+T +F+ ++P    + VA  +K A  +LLV   YDFLAGR++ N++  R+EI+ 
Sbjct  1     MLAFTVETHYFYASNPEKSSDTVADTLKEALSKLLVH--YDFLAGRVRLNEQLMRMEIDR  58

Query  1239  NAAGAGFTVASSEFALEDIGDLVYPNPAFRQLVTMSFDFVAKEDQPLCFLQVTSFKCGGF  1060
             N AGA F+ A+ +  L ++GD+  PNP FR+ V  +       D PL  +QVT+FKCGG 
Sbjct  59    NYAGAQFSTATCDLTLAELGDVSVPNPLFRKFVPQAHKATTIADIPLMMIQVTTFKCGGH  118

Query  1059  ALGTSMNHISFDGSGFKMFLENLAALSFNDDGPLAVVPCNDRSLLAARSPPQVTFPHPEL  880
              +G  M+H+ +DG G   FL NL  +S    GPL   P  +R +  AR PP  TF HPE 
Sbjct  119   CVGFGMSHLVWDGHGVVEFLFNL--MSVAQGGPLIFQPKPEREMFKARDPPTPTFDHPEY  176

Query  879   LKVN-LP---AGEEMAPPVFDSLKDDLA------FEIFQLSSADIERLKDKAKAPDNVKT  730
             L+++ LP   +G    P V DS  + ++       +I   S+ D+  LK +A   D   +
Sbjct  177   LRLDELPPSLSGAFTTPDVVDSGFEGISASSKHITKIVSFSAEDLAILKRRAME-DGKLS  235

Query  729   KVTGFNVLTAAIWRCKALSCLGGENNSDRLSTVLFAVDIRRRLNPPLPDSYSGNAVLTGY  550
             KV+ F+ L+  +W+ +  +      +  +L    +AVDIR RL+PPLP  + GNA+ +  
Sbjct  236   KVSTFDALSGHVWQARIKAIDAKPTDVAQLQ---YAVDIRDRLDPPLPKGFVGNAIYSAC  292

Query  549   GSAKCAELEEGPFWKTVQMVYEGAARMTDEYARSAIDWGELYKGFPH--GEFLVSSWWRL  376
               A C E+  G     V+ V +   R+T+++ RS IDW E+Y+G P       +SSW ++
Sbjct  293   ARATCEEVRSGSLSFCVEQVQKANERVTNDFIRSGIDWWEVYRGIPAVPSGIFISSWQKM  352

Query  375   GFEGVQFPWGKPKYSCPVVYHRKDIILLFPDIDNGGKSNSGVNVLVALPPKEMEKFK  205
              F  +   WGKP Y+ P V    + ++  P  +       G+NV++AL P+ M KF+
Sbjct  353   PFYSIDLGWGKPMYAGPAVSPMVEFVVFLPTPE-----QQGLNVILALQPEVMTKFE  404



>ref|XP_010666009.1| PREDICTED: omega-hydroxypalmitate O-feruloyl transferase-like 
[Beta vulgaris subsp. vulgaris]
Length=451

 Score =   253 bits (647),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 156/442 (35%), Positives = 233/442 (53%), Gaps = 31/442 (7%)
 Frame = -3

Query  1479  LIFPSQETTKHTMFLSNIDKVLNFDVQTVHFFPASPGFPPEI--VAGKIKNAFRRLLVAN  1306
             L+ P     + TMFLSNID+ ++F V+T+ FF            +  +IK A   LL+  
Sbjct  20    LVSPKHPFPQETMFLSNIDQAVSFPVETLFFFNVQEDKKSSTSDITERIKKATSELLIP-  78

Query  1305  TYDFLAGRLKKNKESERVEIECNAAGAGFTVASSEFALEDIGDLVYPNPAFRQLVTMSFD  1126
              Y F++GRL  N E++R+E+ CN AG  F   +S  AL D+G+L  PNP F   +     
Sbjct  79    -YYFMSGRLSFNSETKRLELICNNAGISFVSGTSRLALTDLGNLSLPNPTFGHFLHRPGL  137

Query  1125  FVAKEDQPLCFLQVTSFKCGGFALGTSMNHISFDGSGFKMFLENLAALSFNDDGPLAV-V  949
             +    +  L  +QVT F CGGF +G   NH   DG        NLA+L    DG L    
Sbjct  138   YKNLAETTLLTIQVTRFSCGGFCVGFLTNHAILDGKAASQMFLNLASLC--RDGSLKFPF  195

Query  948   PCNDRSLLAARSPPQVTFPHPELLKVNLPAGEEMAPPV---FDSLKDDLAF------EIF  796
               +DR+ + AR+PP + FPH E +K  LP    +A      ++S    L F      ++F
Sbjct  196   IHHDRTYIRARNPPMINFPHKEYIK--LPKISSLATAFTTSYESSPSPLIFAKKYCQKLF  253

Query  795   QLSSADIERLKDKAKAPDNVKTKVTGFNVLTAAIWRCKALSCLGGENNSDRLSTVLFAVD  616
               ++  I RLK  A A  N  T    F  + A IW+ +        N+ +  STVLFAVD
Sbjct  254   NFNAKSISRLK--ANAIVNCST----FEAIVAHIWKERTKVIF---NDPNDFSTVLFAVD  304

Query  615   IRRRLNPPLPDSYSGNAVLTGYGSAKCAELEEGPFWKTVQMVYEGAARMTDEYARSAIDW  436
             IR +++P LPD + GNA++T + +++  +L   P    V+++  G  R+T+EY RS IDW
Sbjct  305   IRSKISPTLPDEFVGNAIITAFATSRVIDLVSNPISFGVKLIKGGKERVTEEYVRSVIDW  364

Query  435   GELYKGFP---HGEFLVSSWWRLGFEGVQFPWGKPKYSCPVVYHRKDIILLFPDIDNGGK  265
              ELYKG P   +G F VS+WW+L F  + F +G P +  P+V    + +LL  + +N   
Sbjct  365   LELYKGIPATSNGNFYVSAWWKLPFGDLDFGYGMPTHVSPIVSGNDEFVLLLSEGNNCQH  424

Query  264   SN-SGVNVLVALPPKEMEKFKS  202
                 GVN  ++L P++M +F++
Sbjct  425   GEGGGVNAWISLEPEKMNQFET  446



>ref|XP_010259678.1| PREDICTED: omega-hydroxypalmitate O-feruloyl transferase-like 
[Nelumbo nucifera]
Length=447

 Score =   249 bits (635),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 148/437 (34%), Positives = 233/437 (53%), Gaps = 29/437 (7%)
 Frame = -3

Query  1479  LIFPSQETTKHTMFLSNIDKVLNFDVQTVHFF---PASPGFPPEIVAGKIKNAFRRLLVA  1309
             L  P   T    +FLSNID+ + F V+TV FF   P    +  +I     K+    LL+ 
Sbjct  20    LFSPKNPTPVEKVFLSNIDQAVAFPVETVFFFEVPPCKTSWTLDISERMKKSVSEVLLIP  79

Query  1308  NTYDFLAGRLKKNKESERVEIECNAAGAGFTVASSEFALEDIGDLVYPNPAFRQLVTMSF  1129
               Y F+AGRL  N E++R+E+ C+ AG  F  A S   L+++G+L  PN  F  L+    
Sbjct  80    --YYFMAGRLNFNLETKRLELVCSNAGVPFVSAKSRLTLQELGNLSLPNSTFHHLIHRPD  137

Query  1128  DFVAKEDQPLCFLQVTSFKCGGFALGTSMNHISFDGSGFKMFLENLAALSFNDDGPLAVV  949
               ++  ++P+  +QVT F+CGGF++G   NH   DG       +NLA++  + +G     
Sbjct  138   RSLSLSEKPIFTIQVTRFECGGFSIGFMTNHSVLDGKSAGEMFQNLASIC-SGEGLNTQA  196

Query  948   PCNDRSLLAARSPPQVTFPHPE------LLKVNLPAGEEMAPPVFDSLKDDLAFEIFQLS  787
               NDR+ L AR+PPQ+ +PH E      +  V         P          + ++F  +
Sbjct  197   IYNDRTCLKARNPPQIKYPHTEYTEKLEIASVTSSFSSPNQPTRLLQFSSKYSHKLFCFT  256

Query  786   SADIERLKDKAKAPDNVKTKVTGFNVLTAAIWRCKALSCLGGENNSDRLSTVLFAVDIRR  607
             S+ +  LK KA        K + F  + A +WR ++ +     ++ D  ST+LFAVDIR 
Sbjct  257   SSMLSILKGKAMV------KCSNFEAIVAHLWRARSKAVF---DDPDETSTILFAVDIRS  307

Query  606   RLNPPLPDSYSGNAVLTGYGSAKCAELEEGPFWKTVQMVYEGAARMTDEYARSAIDWGEL  427
             +++PPLP  ++GNAV+T + +AK  +L E P    V++V     R++D+Y RS IDW E+
Sbjct  308   KISPPLPHGFTGNAVVTAFANAKVVDLAEKPLSFCVELVKGAMDRVSDDYVRSVIDWLEI  367

Query  426   YKGFP---HGEFLVSSWWRLGFEGVQFPWGKPKYSCPVVYHRKDIILLFPD-IDNGGKSN  259
             +KG P   +G F +S+WW+L F  + F  GK  +  P+V    + +LL  D + NGG   
Sbjct  368   HKGVPATINGNFYLSAWWKLPFHDLNFGCGKLIHCGPIVSGTDEFVLLLSDFMGNGG---  424

Query  258   SGVNVLVALPPKEMEKF  208
              G+NV + L  ++M++F
Sbjct  425   -GINVWMGLEKEKMQRF  440



>ref|XP_007140651.1| hypothetical protein PHAVU_008G130300g [Phaseolus vulgaris]
 gb|ESW12645.1| hypothetical protein PHAVU_008G130300g [Phaseolus vulgaris]
Length=440

 Score =   248 bits (633),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 154/450 (34%), Positives = 242/450 (54%), Gaps = 29/450 (6%)
 Frame = -3

Query  1503  KVTILDSGLIFPSQETTKHTMFLSNIDKVLNFDVQTVHFF-PASPGFPPEIVAGKIKNAF  1327
             K+ +++  +I P Q T +  MFLSNID  L     +  FF P S       +  K+  A 
Sbjct  3     KIELVEKIVIVPEQPTPRKRMFLSNIDLSLVVYQDSASFFDPPSTQMSFSEICNKLYTAL  62

Query  1326  RRLLVANTYDFLAGRLKKN-KESERVEIECNAAGAGFTVASSEFALEDIGDLVYPNPAFR  1150
              ++L+   YDF+AGRL  + +E++R EI+CN AG     A ++  L D G +  PNP  +
Sbjct  63    SKMLM--QYDFMAGRLVPSLEETQRFEIDCNGAGIVVAAARTDRKLSDFGVISAPNPELK  120

Query  1149  QLVTMSFDFVAKE----DQPLCFLQVTSFKCGGFALGTSMNHISFDGSGFKMFLENLAAL  982
             +LV    +   +E    ++PL  LQ+T F CG  AL +  NH + DG   + F  NL AL
Sbjct  121   ELVVFLHEGCDQETDLKEKPLASLQLTQFGCGSLALASHYNHCTLDGFAIRDFEVNLGAL  180

Query  981   SFNDDGPLAVVPCNDRSLLAARSPPQVTFPHPELLKVNLP------AGEEMAPPVFDSLK  820
             +  +D  L +VP  DR+LL AR+PP VT PH E  K  +        G+     +   L+
Sbjct  181   TRGED--LIIVPNADRTLLRARNPPTVTHPHFEYSKATVTHNLFTLRGKSDTNVIQSVLE  238

Query  819   DDLAFEIFQLSSADIERLKDKAKAPDNVKTKVTGFNVLTAAIWRCKALSCLGGENNSDRL  640
             + +   +  L    I   K KA     +K+ +T F V+ A IW+ ++++    E   +++
Sbjct  239   NQI--HVLHLPPQSIASFKKKALEDKTLKS-ITTFQVVAAKIWKARSIAIGMSE---EKV  292

Query  639   STVLFAVDIRRRLNPPLPDSYSGNAVLTGYGSAKCAELEEGPFWKTVQMVYEGAARMTDE  460
             ST+LF VD+R+R+ P LP+S++GNA++ G+  A   EL+E      ++ V EG  R+ DE
Sbjct  293   STMLFPVDVRKRVVPELPNSFAGNALVPGFARATVKELKELEDGCHIRKVQEGVERLDDE  352

Query  459   YARSAIDWGELYKGFPHGE--FLVSSWWRLGFEGVQFPWGKPKYSCPVVYHRKDIILLFP  286
             Y +S IDW E+ KG P  E  F + +WWRLG E   F WG+ K + P+   +  +++L P
Sbjct  353   YIKSGIDWLEVNKGAPCMEDSFSLVAWWRLGLEEQLFAWGRLKSATPLEV-KPGLVMLLP  411

Query  285   DIDNGGKSNSGVNVLVALPPKEMEKFKSLF  196
                 G +   G+N+ + LP  +M++F  + 
Sbjct  412   ----GPQDQGGINISLDLPQDQMQEFSRIM  437



>gb|KDP26368.1| hypothetical protein JCGZ_17526 [Jatropha curcas]
Length=451

 Score =   245 bits (626),  Expect = 9e-71, Method: Compositional matrix adjust.
 Identities = 161/460 (35%), Positives = 236/460 (51%), Gaps = 37/460 (8%)
 Frame = -3

Query  1503  KVTILDSGLIFPSQETTKHTMFLSNIDKVLNFDVQTVHFF-PASPGFPPEIVAGKIKNAF  1327
             K+ +L+  ++ P + T +  +FLSNID  L    ++V FF P             + NA 
Sbjct  3     KLKLLEKVMVVPERPTNRKRIFLSNIDLSLVVYQESVSFFDPPKNKKSFSESCNSLYNAL  62

Query  1326  RRLLVANTYDFLAGRLKKNKESE-RVEIECNAAGAGFTVASSEFALEDIGDLVYPNPAFR  1150
             R+LLV   YDF AGRL    E++ R +IECN AG     A ++ AL  +G+L+ P P +R
Sbjct  63    RQLLVP--YDFFAGRLVTALENDNRFQIECNGAGVVVAAAKTDSALIQLGELLEPKPEYR  120

Query  1149  QLVTMSFDFVAKE----DQPLCFLQVTSFKCGGFALGTSMNHISFDGSGFKMFLENLAAL  982
             QLV    +   +E    D+PL +LQ+T F CG  AL +  NH   DG     F +NLAAL
Sbjct  121   QLVAFLHEEGEEEMKIQDKPLLYLQLTEFACGCLALASRYNHCVVDGIAVGEFQKNLAAL  180

Query  981   SFNDDGPLAVVPCNDRSLLAARSPPQVTFPHPELLKVNLPAGEEMAPPVFDSLKDDLAFE  802
             +  D   + ++P  DR+L  AR+PP++T PH E   V   A +     +F          
Sbjct  181   TRGDQ--IVMLPNPDRALFKARNPPEITHPHYEYSTVVAEAMKMETADLFTVCGTTGVKS  238

Query  801   I----------------FQLSSADIERLKDKAKAPDNVKTKVTGFNVLTAAIWRCKALSC  670
             I                  +S+  I  LK KA   D      T F V+ A IW+ + ++ 
Sbjct  239   INNCSTYSTKTRTTTRSIHISAKQISILK-KAVLQDGNLENCTTFQVVAAKIWKARTIAV  297

Query  669   LGGENNSDRLSTVLFAVDIRRRLNPPLPDSYSGNAVLTGYGSAKCAELEEGPFWKTVQMV  490
                E  +   +T+LF V++RR ++PP P  ++GNA++ G+   K  E++E      V+ V
Sbjct  298   KMKEETN---TTMLFPVNVRRIISPPAPSGFAGNALIPGFARVKVKEVKEREVSYLVKKV  354

Query  489   YEGAARMTDEYARSAIDWGELYKGFPHGE--FLVSSWWRLGFEGVQFPWGKPKYSCPVVY  316
              EG  R+ DEY RS+IDW E+YKG P  E  F + +W+RLG EG  F WGK K + PVV 
Sbjct  355   QEGVKRLDDEYVRSSIDWLEVYKGVPCRENSFSLVAWFRLGLEGEVFSWGKIKCTAPVVV  414

Query  315   HRKDIILLFPDIDNGGKSNSGVNVLVALPPKEMEKFKSLF  196
              +  ++ L P    G     G++V + LP +EM +F  L 
Sbjct  415   -KPGLVFLLP----GTLEEGGIHVCLELPDEEMNEFCRLL  449



>ref|XP_004491723.1| PREDICTED: omega-hydroxypalmitate O-feruloyl transferase-like 
[Cicer arietinum]
Length=437

 Score =   244 bits (623),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 153/439 (35%), Positives = 237/439 (54%), Gaps = 21/439 (5%)
 Frame = -3

Query  1500  VTILDSGLIFPSQETTKHTMFLSNIDKVLNFDVQTVHFF-PASPGFPPEIVAGKIKNAFR  1324
             + +++  +I P + T    MFLSNID  L     +  FF P S       +  K+ +A  
Sbjct  5     IELIEKVVIVPEKPTPCKRMFLSNIDLSLVVYQDSASFFDPPSNQMQFSEICNKLYSALG  64

Query  1323  RLLVANTYDFLAGRLKKN-KESERVEIECNAAGAGFTVASSEFALEDIGDLVYPNPAFRQ  1147
             ++LV   YDF+AGRL  + +E  R EI+CN AG     A ++  L + G +  PNP  R+
Sbjct  65    KMLVH--YDFMAGRLVPSFEEKNRFEIDCNDAGIVVAAAKTDRRLCEFGVISAPNPELRE  122

Query  1146  LVTMSFDFVAKEDQPLCFLQVTSFKCGGFALGTSMNHISFDGSGFKMFLENLAALSFNDD  967
             LV    +    ++ PL  LQ+T F CG  AL +  NH   DG   + F  NLA+L+  DD
Sbjct  123   LVVFLHEETDLKETPLVSLQLTQFGCGSLALSSHYNHCILDGIAVREFEANLASLTRGDD  182

Query  966   GPLAVVPCNDRSLLAARSPPQVTFPHPELLK-VNLPAGEEMAPPVFDSLKDDLA---FEI  799
               + ++P  DR+LL AR+ P++T PH E  K  N+     M      ++K DL      +
Sbjct  183   --MIIIPNADRTLLKARNSPKITHPHFEYSKSANIENLFTMRGTSGTNVKKDLTENQTHV  240

Query  798   FQLSSADIERLKDKAKAPDNVKTKVTGFNVLTAAIWRCKALSCLGGENNSDRLSTVLFAV  619
               LS   I   K KA     +K  +T F V+ A IW+ +AL+    + + +++ST+LF V
Sbjct  241   LYLSQQKIASYKKKALENTALKN-ITTFQVVAAKIWKARALA---TKMSHEKVSTMLFPV  296

Query  618   DIRRRLNPPLPDSYSGNAVLTGYGSAKCAELEEGPFWKTVQMVYEGAARMTDEYARSAID  439
             D+R+R+ P LP+S++GNA++ G+  A   EL E      ++ V EG  R+ DEY +S ID
Sbjct  297   DVRKRVVPELPNSFAGNALVPGFARATVKELMELEDDFHIRKVQEGIERLDDEYIKSGID  356

Query  438   WGELYKGFPHGE--FLVSSWWRLGFEGVQFPWGKPKYSCPVVYHRKDIILLFPDIDNGGK  265
             W EL +G P  E  F + +WWRLG E   F WG+ K + P++  +  +++L P    G  
Sbjct  357   WLELNRGVPCKEDSFSLVAWWRLGLENEVFAWGRLKCATPLIV-KPGLVMLLP----GAN  411

Query  264   SNSGVNVLVALPPKEMEKF  208
                G+N+ ++LP  ++++F
Sbjct  412   DEGGLNICLSLPQDQLQEF  430



>gb|ABR16192.1| unknown [Picea sitchensis]
Length=440

 Score =   243 bits (620),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 150/443 (34%), Positives = 234/443 (53%), Gaps = 25/443 (6%)
 Frame = -3

Query  1506  LKVTILDSGLIFPSQETTKHTMFLSNIDKVLNFDVQTVHFFPASPGFPPEIVAGKIKNAF  1327
             L VT  +  ++ P++ T  H  FLSN+D+ +   VQTV+ F AS     E  +  I+ A 
Sbjct  17    LNVTRHEPTMVAPAEATENHVYFLSNLDQNIAVTVQTVYCFKASEEMGKERPSEVIREAL  76

Query  1326  RRLLVANTYDFLAGRLKKNKESERVEIECNAAGAGFTVASSEFALEDIGDLVYPNPAFRQ  1147
             R++LVA  Y  LAGR+  + E  ++ I C   GA F  A ++  +EDIGD+  P+P+  +
Sbjct  77    RKVLVA--YYPLAGRIGISPEG-KLNIHCTGEGAVFVEADADCVIEDIGDMTKPDPS--K  131

Query  1146  LVTMSFDFVAKE---DQPLCFLQVTSFKCGGFALGTSMNHISFDGSGFKMFLENLAALSF  976
             L  + ++    +   + P   +QVT+FKCGGF LG  MNH  FDG G   F+ + A  + 
Sbjct  132   LECLVYNIPGAKNILEVPPLVVQVTTFKCGGFVLGLGMNHCMFDGIGAMEFVNSWAETA-  190

Query  975   NDDGPLAVVPCNDRSLLAARSPPQVTFPHPELLKVNLPAGEEMAPPVFDSLKDDLAFEIF  796
                 PL+V P  DRSLL ARSPP++ +PH E  ++     +E++    +   ++L +  F
Sbjct  191   -RGLPLSVPPFMDRSLLRARSPPKMEYPHLEFAEI-----KEISSESTELHSEELVYRSF  244

Query  795   QLSSADIERLKDKAKAPDNVKTKVTGFNVLTAAIWRCKALSCLGGENNSDRLSTVLFAVD  616
               ++  ++ LK +A   D V TK + F  L+A +WR ++ +     N   +L   LFAVD
Sbjct  245   CFTAEKLDELKKEAME-DGVLTKCSTFEALSALVWRSRSKALNMAPNQEAKL---LFAVD  300

Query  615   IRRRLNPPLPDSYSGNAVLTGYGSAKCAELEEGPFWKTVQMVYEGAARMTDEYARSAIDW  436
              R +  PPLP  Y GN ++      K  EL E P    V  + +    +TD++ RSAID+
Sbjct  301   GRAKFEPPLPRGYFGNGIVLTSAIGKAGELAEKPLSFGVGRIQKAIGMITDKFMRSAIDY  360

Query  435   GELYKGFPH--GEFLVSSWWRLGFEGVQFPWGKPKYSCPVVYHRKDIILLFPDIDNGGKS  262
              E+ +  P      L+++W RL F    F WG+P  S PV    ++++L      + GK 
Sbjct  361   FEITRSRPSLTATLLITTWSRLSFHTTDFGWGEPVQSVPVTLPAREVVLFL----SHGKE  416

Query  261   NSGVNVLVALPPKEMEKFKSLFH  193
                +NVL+ LP   M++F+    
Sbjct  417   RKSINVLLGLPESAMDRFQGFLQ  439



>gb|KEH22614.1| HXXXD-type acyl-transferase family protein [Medicago truncatula]
Length=438

 Score =   239 bits (610),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 152/443 (34%), Positives = 236/443 (53%), Gaps = 25/443 (6%)
 Frame = -3

Query  1503  KVTILDSGLIFPSQETTKHTMFLSNIDKVLNFDVQTVHFF-PASPGFPPEIVAGKIKNAF  1327
             ++ +++  +I P Q T +  MFLSNID  L     +  FF P S       +  K+  A 
Sbjct  3     RIELVEKVVIVPEQPTPRKRMFLSNIDLSLVVYQDSSSFFDPPSNQMSFSEICSKLYGAL  62

Query  1326  RRLLVANTYDFLAGRLKKN-KESERVEIECNAAGAGFTVASSEFALEDIGDLVYPNPAFR  1150
              ++LV   YDF+AGRL  + +E  R EI+CN AG     A ++  L + G +  PNP  R
Sbjct  63    GKMLVH--YDFMAGRLVPSLEEHNRFEIDCNDAGIVVVAAKTDRKLSEFGVISAPNPELR  120

Query  1149  QLVTMSF---DFVAKEDQPLCFLQVTSFKCGGFALGTSMNHISFDGSGFKMFLENLAALS  979
             +LV       D   KE +PL  LQ+T F CG  AL +  NH   DG   + F  NLA+L+
Sbjct  121   ELVVFLHGDEDTNLKE-KPLASLQLTQFGCGSLALASHYNHCILDGKAVREFEANLASLT  179

Query  978   FNDDGPLAVVPCNDRSLLAARSPPQVTFPHPELLK-VNLPAGEEMAPPVFDSLKDDLA--  808
               DD  L  VP  DR+LL AR+PP+++ PH E  K  N+     +      ++K+  A  
Sbjct  180   RGDD--LITVPNADRTLLRARNPPKISHPHFEYSKSTNIENLFTIRGTTSTNVKNSAAEN  237

Query  807   -FEIFQLSSADIERLKDKAKAPDNVKTKVTGFNVLTAAIWRCKALSCLGGENNSDRLSTV  631
                +  LS   I   K KA+    +K  +T F V+ A IW+ + ++    + + D++ST+
Sbjct  238   QIHVLHLSPQKIASFKKKAQENKTLKN-ITTFQVVAAKIWKARTIAT---KMDDDKVSTM  293

Query  630   LFAVDIRRRLNPPLPDSYSGNAVLTGYGSAKCAELEEGPFWKTVQMVYEGAARMTDEYAR  451
             LF VD+R+ + P L + ++GNA++ G+  A   EL E      ++ V EG  R+ DEY +
Sbjct  294   LFPVDVRKMVVPELQNGFAGNALVPGFARATVKELIELEDDFLIRKVQEGIERLNDEYIK  353

Query  450   SAIDWGELYKGFPHGE--FLVSSWWRLGFEGVQFPWGKPKYSCPVVYHRKDIILLFPDID  277
             S IDW E+ +G P  E  F + +WWRLG E   F WG  K + P++  +  ++++ P   
Sbjct  354   SGIDWLEVNRGVPCKEDGFSLVAWWRLGLENEVFAWGTLKCATPLIV-KPGLVIMLP---  409

Query  276   NGGKSNSGVNVLVALPPKEMEKF  208
              G K   G+N+ ++LP  ++++F
Sbjct  410   -GTKDEGGINICLSLPQDQLQEF  431



>ref|XP_003551391.1| PREDICTED: omega-hydroxypalmitate O-feruloyl transferase-like 
[Glycine max]
Length=441

 Score =   239 bits (610),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 151/448 (34%), Positives = 236/448 (53%), Gaps = 24/448 (5%)
 Frame = -3

Query  1503  KVTILDSGLIFPSQETTKHTMFLSNIDKVLNFDVQTVHFF-PASPGFPPEIVAGKIKNAF  1327
             ++ +++  +I P Q T +  MFLSNID  L     +  FF P S       + GK+ +A 
Sbjct  3     EIELVEKVVIAPEQPTPRKRMFLSNIDLSLVVYQDSASFFDPPSTQMSFGEICGKLYSAL  62

Query  1326  RRLLVANTYDFLAGRLKKN-KESERVEIECNAAGAGFTVASSEFALEDIGDLVYPNPAFR  1150
              ++LV   YDF+AGRL  + +E+ R EI+CN AG     A ++  L + G +  PNP  R
Sbjct  63    GKMLV--QYDFMAGRLVPSLEETHRFEIDCNGAGIVVVAARTDRKLSEFGVISAPNPELR  120

Query  1149  QLVTMSFDFVAKE----DQPLCFLQVTSFKCGGFALGTSMNHISFDGSGFKMFLENLAAL  982
             +LV    +   +E    ++ L  LQ+T F CG  AL +  NH + DGS  + F  NL AL
Sbjct  121   ELVVFLQEEGDQETDMKERSLASLQLTQFGCGSLALASRYNHCTLDGSAIRDFEVNLGAL  180

Query  981   SFNDDGPLAVVPCNDRSLLAARSPPQVTFPHPELLKV----NLPAGEEMAPPVFDSLKDD  814
             +   D  L +VP  DR+LL AR+PP+++ PH E  K     NL   +  +          
Sbjct  181   TRGGD--LIIVPNADRTLLRARNPPKISHPHFEYSKSTETHNLFTIQGKSGTNATQSAPQ  238

Query  813   LAFEIFQLSSADIERLKDKAKAPDNVKTKVTGFNVLTAAIWRCKALSCLGGENNSDRLST  634
                 +  LS   I   K KA   +     +T F V+ A IW+ ++++    E   +++ST
Sbjct  239   NQIRVLHLSPEKIASFKKKALKENTTLKNITTFQVVAAKIWKARSIATKMLE---EKVST  295

Query  633   VLFAVDIRRRLNPPLPDSYSGNAVLTGYGSAKCAELEEGPFWKTVQMVYEGAARMTDEYA  454
             +LF VD+R+R+ P LP+ ++GNA++ G+  A   +L E      ++ V EG  R+ DEY 
Sbjct  296   MLFPVDVRKRVVPELPNGFAGNALVPGFARASVRDLIELEDACHIRKVQEGVERLDDEYI  355

Query  453   RSAIDWGELYKGFPHGE--FLVSSWWRLGFEGVQFPWGKPKYSCPVVYHRKDIILLFPDI  280
             +S IDW E+ KG P  E  F + +WWRLG E   F WG+ K + P+   +  +++L P  
Sbjct  356   KSGIDWLEVNKGAPCMEDSFSLVAWWRLGLEEQLFAWGRLKCATPLAV-KAGLVMLLP--  412

Query  279   DNGGKSNSGVNVLVALPPKEMEKFKSLF  196
               G +   G+N+ + LP  +M++F  + 
Sbjct  413   --GPQDEGGLNICLDLPEDQMQEFSRIM  438



>emb|CBI33005.3| unnamed protein product [Vitis vinifera]
Length=457

 Score =   236 bits (602),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 157/453 (35%), Positives = 234/453 (52%), Gaps = 37/453 (8%)
 Frame = -3

Query  1500  VTILDSGLIFPSQETTKHTMFLSNIDKVLNFDVQTVHFFPASPGFPPEIVAGKIKNAFRR  1321
             V +++  ++ P   T +  +FLSNID  L    ++V FF       P      +  AF R
Sbjct  21    VKLVERMMVLPETPTPRRRVFLSNIDLTLVAYQESVSFFD------PPANQMSLSEAFHR  74

Query  1320  LL-----VANTYDFLAGRLKKNKE-SERVEIECNAAGAGFTVASSEFALEDIGDLVYPNP  1159
             L      V  +YDFLAGRL  + E S R+EI+CN AG     A+++  +  +G+L+ P P
Sbjct  75    LCRAISQVLVSYDFLAGRLVPSLEASNRLEIDCNNAGFVVAAATTKTTVSQLGELMAPKP  134

Query  1158  AFRQLVTM----SFDFVAKEDQPLCFLQVTSFKCGGFALGTSMNHISFDGSGFKMFLENL  991
              F +LV      + D +  +D+PL F Q+T F CGG ALG+   H   DG        NL
Sbjct  135   EFERLVAFLREEAEDELELKDKPLGFFQLTQFGCGGLALGSRYYHCILDGVAIHDLEMNL  194

Query  990   AALSFNDDGPLAVVPCNDRSLLAARSPPQVTFPHPEL---LKVNLP---AGEEMAPPVFD  829
             A+L+  +   L VVP  DRS+  AR+PPQ++ PH E    +  + P    G   AP    
Sbjct  195   ASLTRGEG--LVVVPNPDRSIFRARNPPQISHPHFEYSRAIDTDSPFTLRGTSDAPIEKS  252

Query  828   SLKDDLAFEIFQLSSADIERLKDKAKAPDNVKTKVTGFNVLTAAIWRCKALSCLGGENNS  649
                D +   +  LS  +I+ LK KA   D      T F  + A IW+ ++++    E   
Sbjct  253   GRHDQI--HLIHLSPINIQGLK-KAALRDGKLKNCTTFQAVAAKIWKARSIAV---EMAE  306

Query  648   DRLSTVLFAVDIRRRLNPPLPDSYSGNAVLTGYGSAKCAELEEGPFWKTVQMVYEGAARM  469
              ++ST+LF VD R R+ P  P  ++GNA++ G+  A   EL+E  +   V+ V EG  R+
Sbjct  307   GKISTMLFPVDTRTRVVPQAPVGFAGNALVPGFARASVKELKEEEYSSLVRRVQEGIERL  366

Query  468   TDEYARSAIDWGELYKGFPHGE--FLVSSWWRLGFEGVQFPWGKPKYSCPVVYHRKDIIL  295
              DEY RS IDW E+ +G P  E  F + +WWRLG E  +F WG+ K + PVV  +  I+ 
Sbjct  367   DDEYVRSGIDWLEVNRGVPCREDSFSLVAWWRLGLEEEEFAWGRLKCASPVVV-KPGIVF  425

Query  294   LFPDIDNGGKSNSGVNVLVALPPKEMEKFKSLF  196
             L P    G  +  G+N+ + L   ++ +F+ L 
Sbjct  426   LLP----GPTAEGGLNIFLELEGDQVVEFRRLM  454



>gb|KHN41391.1| Omega-hydroxypalmitate O-feruloyl transferase [Glycine soja]
Length=442

 Score =   235 bits (599),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 151/449 (34%), Positives = 236/449 (53%), Gaps = 25/449 (6%)
 Frame = -3

Query  1503  KVTILDSGLIFPSQETTKHTMFLSNIDKVLNFDVQTVHFF-PASPGFPPEIVAGKIKNAF  1327
             ++ +++  +I P Q T +  MFLSNID  L     +  FF P S       + GK+ +A 
Sbjct  3     EIELVEKVVIAPEQPTPRKRMFLSNIDLSLVVYQDSASFFDPPSTQMSFGEICGKLYSAL  62

Query  1326  RRLLVANTYDFLAGRLKKN-KESERVEIECNAAGAGFTVASSEFALEDIGDLVYPNPAFR  1150
              ++LV   YDF+AGRL  + +E+ R EI+CN AG     A ++  L + G +  PNP  R
Sbjct  63    GKMLV--QYDFMAGRLVPSLEETHRFEIDCNGAGIVVVAARTDRKLSEFGVISAPNPELR  120

Query  1149  QLVTMSFDFVAKE----DQPLCFLQVTSFKCGGFALGTSMNHISFDGSGFKMFLENLAAL  982
             +LV    +   +E    ++ L  LQ+T F CG  AL +  NH + DGS  + F  NL AL
Sbjct  121   ELVVFLQEEGDQETDMKERSLASLQLTQFGCGSLALASRYNHCTLDGSAIRDFEVNLGAL  180

Query  981   SFNDDGPLAVVPCNDRSLLAARSPPQVTFPHPELLKV----NLPAGEEMAPPVFDSLKDD  814
             +   D  L +VP  DR+LL AR+PP+++ PH E  K     NL   +  +          
Sbjct  181   TRGGD--LIIVPNADRTLLRARNPPKISHPHFEYSKSTETHNLFTIQGKSGTNATQSAPQ  238

Query  813   LAFEIFQLSSADIERLKDKAKAPDNVKTKVTGFNVLTAAIWRCKALSCLGGENNSDRLST  634
                 +  LS   I   K KA   +     +T F V+ A IW+ ++++    E   +++ST
Sbjct  239   NQIRVLHLSPEKIASFKKKALKENTTLKNITTFQVVAAKIWKARSIATKMLE---EKVST  295

Query  633   VLFAVDIRRRLNPPLPDSYSG-NAVLTGYGSAKCAELEEGPFWKTVQMVYEGAARMTDEY  457
             +LF VD+R+R+ P LP+ ++G NA++ G+  A   +L E      ++ V EG  R+ DEY
Sbjct  296   MLFPVDVRKRVVPELPNGFAGSNALVPGFARASVRDLIELEDACHIRKVQEGVERLDDEY  355

Query  456   ARSAIDWGELYKGFPHGE--FLVSSWWRLGFEGVQFPWGKPKYSCPVVYHRKDIILLFPD  283
              +S IDW E+ KG P  E  F + +WWRLG E   F WG+ K + P+   +  +++L P 
Sbjct  356   IKSGIDWLEVNKGAPCMEDSFSLVAWWRLGLEEQLFAWGRLKCATPLAV-KAGLVMLLP-  413

Query  282   IDNGGKSNSGVNVLVALPPKEMEKFKSLF  196
                G +   G+N+ + LP  +M++F  + 
Sbjct  414   ---GPQDEGGLNICLDLPEDQMQEFSRIM  439



>gb|ADL62856.1| acyltransferase [Cynara cardunculus var. scolymus]
Length=438

 Score =   234 bits (596),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 158/434 (36%), Positives = 230/434 (53%), Gaps = 29/434 (7%)
 Frame = -3

Query  1479  LIFPSQETTKHTMFLSNIDKVLNFDVQTVHFFPASPGFPPEIVAGKIKNAFRRLLVANTY  1300
             L+ P +ET K   FLSN+D+ +   V+T++ F +      E+ A  IK+A  ++L    Y
Sbjct  25    LVQPFEETEKGLYFLSNLDQNIAVIVRTIYCFKSEEK-GNEMAAEVIKDALSKVLAH--Y  81

Query  1299  DFLAGRLKKNKESERVEIECNAAGAGFTVASSEFALEDIGDLVYPNPAFRQLVTMSFDFV  1120
              F AGRL  + E + + ++C   GA F  A +   +EDIGD   P+P    L  + +D  
Sbjct  82    HFAAGRLTISSEGKLI-VDCTNEGAVFVEAEANGNIEDIGDHTKPDPM--TLGKLVYDVP  138

Query  1119  AKE---DQPLCFLQVTSFKCGGFALGTSMNHISFDGSGFKMFLENLAALSFNDDG-PLAV  952
               +   + P   +QVT FKCGGF LG  MNH  FDG      +E +++ S    G PL V
Sbjct  139   GAKNILEIPPLVVQVTKFKCGGFVLGLGMNHNLFDGIAA---MEFISSWSRTARGLPLEV  195

Query  951   VPCNDRSLLAARSPPQVTFPHPELLKVNLPAGEEMAPPVFDSLKDDLAFEIFQLSSADIE  772
              P  DR++L AR+PP V FPH E  ++     E+++  V D  K++LA+  F  S  DI+
Sbjct  196   PPFLDRTILNARNPPLVEFPHDEFAEI-----EDVSNTV-DLYKEELAYRSFCFSPDDIQ  249

Query  771   RLKDKAKAPDNVKTKVTGFNVLTAAIWRCKALSCLGGENNSDRLSTVLFAVDIRRRLNPP  592
             RLK KA A  ++ T  T F  L+A +W+ +  +    +   D+ + +LFAVD R R  PP
Sbjct  250   RLKIKATADGDMPT-CTSFEALSAFVWKARTEAL---QMKPDQKTKLLFAVDGRSRFEPP  305

Query  591   LPDSYSGNAVLTGYGSAKCAELEEGPFWKTVQMVYEGAARMTDEYARSAIDWGELYKGFP  412
             LP+ YSGN ++      K  E  E P   TV++V+E     TD Y RSAID+ E+    P
Sbjct  306   LPEGYSGNGIVLTNSICKAGEQIENPLSFTVKLVHEAVKMTTDGYMRSAIDYFEVTGARP  365

Query  411   H--GEFLVSSWWRLGFEGVQFPWGKPKYSCPVVYHRKDIILLFPDIDNGGKSNSGVNVLV  238
                   L+++W +L F    F WG+P  S PV    K++IL      + GK    VNVL+
Sbjct  366   SLASTLLITTWSKLSFHAQDFGWGEPIMSGPVALPEKEVILFL----SHGKQRKSVNVLL  421

Query  237   ALPPKEMEKFKSLF  196
              LP   M+ F+ L 
Sbjct  422   GLPVSAMKTFEELM  435



>gb|AAT72495.1| AT1G65450 [Arabidopsis lyrata subsp. petraea]
Length=185

 Score =   224 bits (571),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 112/187 (60%), Positives = 135/187 (72%), Gaps = 7/187 (4%)
 Frame = -3

Query  921  ARSPPQVTFPHPELLKVNLPAGEEMAPPVFDSLKDDLAFEIFQLSSADIERLKDKAKAPD  742
            AR+PP VTFPH EL+K      +     VF++    L F+IF+LSS  I++LK++A    
Sbjct  1    ARNPPSVTFPHHELVKFQ----DCETTTVFEATSQHLDFKIFKLSSEQIKKLKERASETS  56

Query  741  NVKTKVTGFNVLTAAIWRCKALSCL---GGENNSDRLSTVLFAVDIRRRLNPPLPDSYSG  571
            N   +VTGFNV+TA +WRCKALS     G E N +R ST+L+AVDIR RLNP LP SY+G
Sbjct  57   NGYVRVTGFNVVTALVWRCKALSVAAEEGEETNLERESTILYAVDIRGRLNPELPPSYTG  116

Query  570  NAVLTGYGSAKCAELEEGPFWKTVQMVYEGAARMTDEYARSAIDWGELYKGFPHGEFLVS  391
            NAVLT Y  AKC  L E PF + V++V EGA R+TDEYARSAIDWGELYKGFPHGE LVS
Sbjct  117  NAVLTAYAKAKCKALLEEPFGRIVEIVSEGANRITDEYARSAIDWGELYKGFPHGEVLVS  176

Query  390  SWWRLGF  370
            SWW+LGF
Sbjct  177  SWWKLGF  183



>ref|XP_004511192.1| PREDICTED: pentatricopeptide repeat-containing protein At1g06145-like 
[Cicer arietinum]
Length=1049

 Score =   242 bits (618),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 152/439 (35%), Positives = 237/439 (54%), Gaps = 21/439 (5%)
 Frame = -3

Query  1500  VTILDSGLIFPSQETTKHTMFLSNIDKVLNFDVQTVHFF-PASPGFPPEIVAGKIKNAFR  1324
             + +++  +I P + T    MFLSNID  L     +  FF P S       +  K+ +A  
Sbjct  5     IELIEKVVIVPEKPTPCKRMFLSNIDLSLVVYQDSASFFDPPSNQMQFSEICNKLYSALG  64

Query  1323  RLLVANTYDFLAGRLKKN-KESERVEIECNAAGAGFTVASSEFALEDIGDLVYPNPAFRQ  1147
             ++LV   YDF+AGRL  + +E  R EI+CN AG     A ++  L + G +  PNP  R+
Sbjct  65    KMLVH--YDFMAGRLVPSFEEKNRFEIDCNDAGIVVAAAKTDRRLCEFGVISAPNPELRE  122

Query  1146  LVTMSFDFVAKEDQPLCFLQVTSFKCGGFALGTSMNHISFDGSGFKMFLENLAALSFNDD  967
             LV    +    ++ PL  LQ+T F CG  AL +  NH   DG   + F  NLA+L+  DD
Sbjct  123   LVVFLHEETDLKETPLVSLQLTQFGCGSLALSSHYNHCILDGIAVREFEANLASLTRGDD  182

Query  966   GPLAVVPCNDRSLLAARSPPQVTFPHPELLK-VNLPAGEEMAPPVFDSLKDDLA---FEI  799
               + ++P  DR+LL AR+ P++T PH E  K  N+     M      ++K DL      +
Sbjct  183   --MIIIPNADRTLLKARNSPKITHPHFEYSKSTNIENLFTMRGTSGTNVKKDLTENQTHV  240

Query  798   FQLSSADIERLKDKAKAPDNVKTKVTGFNVLTAAIWRCKALSCLGGENNSDRLSTVLFAV  619
               LS   I   K KA     +K  +T F V+ A IW+ +AL+    + + +++ST+LF V
Sbjct  241   LYLSQQKIASYKKKALENTALKN-ITTFQVVAAKIWKARALA---TKMSHEKVSTMLFPV  296

Query  618   DIRRRLNPPLPDSYSGNAVLTGYGSAKCAELEEGPFWKTVQMVYEGAARMTDEYARSAID  439
             D+R+R+ P LP+S++GNA++ G+  A   EL E      ++ V EG  R+ +EY +S ID
Sbjct  297   DVRKRVVPELPNSFAGNALVPGFARATVKELMELEDDFHIRKVQEGIERLDNEYIKSGID  356

Query  438   WGELYKGFPHGE--FLVSSWWRLGFEGVQFPWGKPKYSCPVVYHRKDIILLFPDIDNGGK  265
             W EL +G P  E  F + +WWRLG E   F WG+ K + P++  +  +++L P    G  
Sbjct  357   WLELNRGVPCKEDSFSLVAWWRLGLENEVFAWGRLKCATPLIV-KPGLVMLLP----GAN  411

Query  264   SNSGVNVLVALPPKEMEKF  208
                G+N+ ++LP  ++++F
Sbjct  412   DEGGLNICLSLPQDQLQEF  430



>ref|XP_001755199.1| predicted protein [Physcomitrella patens]
 gb|EDQ80143.1| predicted protein [Physcomitrella patens]
Length=460

 Score =   232 bits (592),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 155/452 (34%), Positives = 238/452 (53%), Gaps = 22/452 (5%)
 Frame = -3

Query  1500  VTILDSGLIFPSQETTKHTMFLSNIDKVLNFDVQTVHFFPASPGFPPEIVAGKIKNAFRR  1321
             V + D  ++ P + T K T++LSNID +L   + T   +  +     E +   ++ AF +
Sbjct  25    VQVHDVKVLNPIEPTEKATLYLSNIDLLLVQPIDTFFVYAPNEERDTESLFAVLEEAFLK  84

Query  1320  LLVANTYDFLAGRLKKNKESERVEIECNAAGAGFTVASSEFALEDIGDLVYPNPAFRQLV  1141
             LLV   Y F+AGR+++++E  R++++CN AGAGF  ASS   L DIGDL   NP FR+L+
Sbjct  85    LLVP--YHFMAGRIEESEEG-RLQLKCNRAGAGFVTASSPQTLADIGDLRVMNPDFRKLM  141

Query  1140  TMSFDFVA-KEDQPLCFLQVTSFKCGGFALGTSMNHISFDGSGFKMFLENLAALSFNDDG  964
                        D+ L  +QVT F+CGGF +G  MNH   DG    +   +  AL+  +  
Sbjct  142   PAPKGVQGVMNDEFLLRVQVTRFRCGGFTVGFRMNHAMCDGVSTTLLFRSFCALARGEA-  200

Query  963   PLAVVPCNDRSLLAARSPPQVTFPHPELLKVN-LPAGEEMAPPVFDSLKDDLAFEIFQLS  787
              L   P  DR++LA R PP   FPH E  K++ LP+      P   +L  +   +   LS
Sbjct  201   -LTTFPDPDRTILAPREPPTPEFPHSECFKLSELPSVIAHKTP---ALGPEYTTKHIPLS  256

Query  786   SADIERLKDKAKAPDNVKTKVTGFNVLTAAIWRCKALSCLGGENNSDRLSTVLFAVDIRR  607
               +IE LK    A  N+ TK + F  + A  WR +   CL  +   + +S +L AVD R 
Sbjct  257   QIEIETLKAITMADGNI-TKCSSFEAVIAHFWRSRT-RCL--DFAPEEISNILIAVDFRT  312

Query  606   RLNPPLPDSYSGNAVLTGYGSAKCAELEEGPFWKTVQMVYEGAARMTDEYARSAIDWGEL  427
             R+ PP+P ++ GN++++ + SA   E+ + P    V  + +  AR+ + Y RSAIDW ++
Sbjct  313   RIQPPIPPTFCGNSIISAHVSAPAGEILQEPLSFCVDKIQQAVARINERYVRSAIDWLQI  372

Query  426   YKGFP----HGEFLVSSWWRLGFEGVQFPWGKPKYSCPVVYHRKDIILLFPDIDNGGKSN  259
             +KG P      + LVS+WW++ F    + WGKP +S P      + +L+  D    G   
Sbjct  373   HKGLPAVRTTKDCLVSAWWKIPFYEHDYGWGKPVHSGPPFPGTSEYVLIVTDPAEDG---  429

Query  258   SGVNVLVALPPKEMEKFKSLFHKFLA*SSSSS  163
              G+ +LV L P EM KF   F    + S+S +
Sbjct  430   -GLLLLVTLLPHEMVKFNKYFKDISSGSNSGT  460



>emb|CAN63569.1| hypothetical protein VITISV_043430 [Vitis vinifera]
Length=392

 Score =   228 bits (581),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 142/390 (36%), Positives = 204/390 (52%), Gaps = 44/390 (11%)
 Frame = -3

Query  1479  LIFPSQETTKHTMFLSNIDKVLNFDVQTVHFF--PASPGFPPEIVAGKIKNAFRRLLVAN  1306
             L+ P       T+FLSNID  + F V+T+ FF  P S     E ++ ++K A   +L+  
Sbjct  42    LVSPKNPIPFETVFLSNIDLAVTFPVETLFFFEVPPSKCSSTEDISERVKRAVAEVLLV-  100

Query  1305  TYDFLAGRLKKNKESERVEIECNAAGAGFTVASSEFALEDIGDLVYPNPAFRQLVTMSFD  1126
              Y FLAGRL  N ES+R+E+ CN AG  F  A+S   L+D+G+   PNP FR  V     
Sbjct  101   LYYFLAGRLYFNHESKRLELLCNNAGVLFVRATSGLMLKDLGNHSLPNPIFRYFVHWP--  158

Query  1125  FVAKEDQPLCFLQVTSFKCGGFALGTSMNHISFDGSGFKMFLENLAALSFNDDGPLAVVP  946
                          VT F+CGGF++G   NH   DG      L+NLA++    +G      
Sbjct  159   -------------VTRFRCGGFSIGIVTNHGVLDGRSAVEMLQNLASIC-RGEGLKPQXV  204

Query  945   CNDRSLLAARSPPQVTFPHPELLKVNLPAGEEMAPPVFDSLKDDLAFEIFQLSSADIERL  766
             CNDR  + AR+PPQ+ +PH E +K+              +    +A     L+ + I  L
Sbjct  205   CNDRRCMRARNPPQIKYPHQEYVKL--------------AETSCIASSFTFLNQSSIGFL  250

Query  765   KDKAKAPDNVKTKVTGFNVLTAAIWRCKALSCLGGENNSDRLSTVLFAVDIRRRLNPPLP  586
             K      +    K +    + A +WR +  +      N D  STVLFAVDIR +L+PPLP
Sbjct  251   KQ-----EKTMNKYSTLEAIVAHLWRARTRAVF---ENPDDFSTVLFAVDIRSKLSPPLP  302

Query  585   DSYSGNAVLTGYGSAKCAELEEGPFWKTVQMVYEGAARMTDEYARSAIDWGELYKGFP--  412
               +SGNAV+T + +A+ + L + PF   V+MV E   R+TD+Y +SAIDW E+ KG P  
Sbjct  303   HGFSGNAVITAFATAQVSHLVQKPFSFCVEMVKEAVDRVTDDYVKSAIDWLEVSKGIPAT  362

Query  411   -HGEFLVSSWWRLGFEGVQFPWGKPKYSCP  325
              +G F +S+W +L F  + F +GKP +  P
Sbjct  363   CNGNFYISAWRKLPFGELDFGFGKPIHGGP  392



>ref|XP_007031933.1| HXXXD-type acyl-transferase family protein [Theobroma cacao]
 gb|EOY02859.1| HXXXD-type acyl-transferase family protein [Theobroma cacao]
Length=506

 Score =   229 bits (584),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 150/433 (35%), Positives = 224/433 (52%), Gaps = 31/433 (7%)
 Frame = -3

Query  1479  LIFPSQETTKHTMFLSNIDKVLNFDVQTVHFFPASPGFPPEIVAGKIKNAFRRLLVANTY  1300
             L+ P++ET K   FLSN+D+ +   V+T++ F +      E     +K+A R++LV   Y
Sbjct  31    LVCPAEETEKGLYFLSNLDQNIAVIVRTIYCFKSDEK-GNENAGEVVKDALRKVLVH--Y  87

Query  1299  DFLAGRLKKNKESERVEIECNAAGAGFTVASSEFALEDIGDLVYPNPAFRQLVTMSFDFV  1120
               LAGRL  + E + + ++CN  GA F  A +   +E+IGD+  P+P    L  + +D  
Sbjct  88    YPLAGRLTISSEGKLI-VDCNGEGAVFVEAEANCKMEEIGDITKPDP--ETLGKLVYDIP  144

Query  1119  AKE---DQPLCFLQVTSFKCGGFALGTSMNHISFDGSGFKMFLENLAALSFNDDGPLAVV  949
               +   + P    QVT F+CGGF LG  MNH  FDG G   F+ +    +     PL + 
Sbjct  145   GAKNILEIPPLVAQVTKFQCGGFVLGLCMNHCMFDGIGAMEFVNSWGETARGL--PLTIP  202

Query  948   PCNDRSLLAARSPPQVTFPHPELLKVNLPAGEEMAPPVFDSLKDDLAFEIFQLSSADIER  769
             P +DR++L ARSPP++ + H E  ++      E      D  KD++ +  F      +E 
Sbjct  203   PFSDRAILKARSPPKIEYLHQEFAEI------EDRSRTGDLYKDEMLYRSFCFEPEKLES  256

Query  768   LKDKAKAPDNVKTKVTGFNVLTAAIWRC--KALSCLGGENNSDRLSTVLFAVDIRRRLNP  595
             LK KA   D V  K T F  L+A +WR   KALS L     SD+ + +LFAVD R + NP
Sbjct  257   LKKKA-MEDGVLEKCTTFEALSAFVWRARTKALSML-----SDQQTKLLFAVDGRPKFNP  310

Query  594   PLPDSYSGNAVLTGYGSAKCAELEEGPFWKTVQMVYEGAARMTDEYARSAIDWGELYKGF  415
             PLP+ Y GN ++      +  EL + PF   V ++ +    +TD Y RSAID+ E+ +  
Sbjct  311   PLPNGYFGNGIVLTNSICQAGELLDKPFSHAVGLIQDAIKMVTDGYMRSAIDYFEVTRAR  370

Query  414   P--HGEFLVSSWWRLGFEGVQFPWGKPKYSCPVVYHRKDIILLFPDIDNGGKSNSGVNVL  241
             P      L+++W RL F    F WG+P  S PV    K++IL      + GK    +NVL
Sbjct  371   PSLSSTLLITTWSRLSFHTTDFGWGEPVLSGPVALPEKEVILFL----SHGKERKSINVL  426

Query  240   VALPPKEMEKFKS  202
             + LP   M+   +
Sbjct  427   LGLPASSMKSMAT  439



>ref|XP_010652628.1| PREDICTED: omega-hydroxypalmitate O-feruloyl transferase-like 
[Vitis vinifera]
Length=454

 Score =   226 bits (577),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 160/471 (34%), Positives = 237/471 (50%), Gaps = 53/471 (11%)
 Frame = -3

Query  1512  EDLKVTILDSGLIFPSQETTKHTMFLSNIDKVLNFDVQTVHFFPASPGFPPEIVAGKIKN  1333
             ED+K  +++  ++ P   T +  +FLSNID  L    ++V FF       P      +  
Sbjct  2     EDVK--LVERMMVLPETPTPRRRVFLSNIDLTLVAYQESVSFFD------PPANQMSLSE  53

Query  1332  AFRRLL-----VANTYDFLAGRLKKNKE-SERVEIECNAAGAGFTVASSEFALEDIGDLV  1171
             AF RL      V  +YDFLAGRL  + E S R+EI+CN AG     A+++  +  +G+L+
Sbjct  54    AFHRLCRAISQVLVSYDFLAGRLVPSLEASNRLEIDCNNAGFVVAAATTKTTVSQLGELM  113

Query  1170  YPNPAFRQLVTM----SFDFVAKEDQPLCFLQV--------------TSFKCGGFALGTS  1045
              P P F +LV      + D +  +D+PL F QV              T F CGG ALG+ 
Sbjct  114   APKPEFERLVAFLREEAEDELELKDKPLGFFQVLSVFWFRVYVSWQLTQFGCGGLALGSR  173

Query  1044  MNHISFDGSGFKMFLENLAALSFNDDGPLAVVPCNDRSLLAARSPPQVTFPHPEL---LK  874
               H   DG        NLA+L+  +   L VVP  DRS+  AR+PPQ++ PH E    + 
Sbjct  174   YYHCILDGVAIHDLEMNLASLTRGEG--LVVVPNPDRSIFRARNPPQISHPHFEYSRAID  231

Query  873   VNLP---AGEEMAPPVFDSLKDDLAFEIFQLSSADIERLKDKAKAPDNVKTKVTGFNVLT  703
              + P    G   AP       D +   +  LS  +I+ LK KA   D      T F  + 
Sbjct  232   TDSPFTLRGTSDAPIEKSGRHDQI--HLIHLSPINIQGLK-KAALRDGKLKNCTTFQAVA  288

Query  702   AAIWRCKALSCLGGENNSDRLSTVLFAVDIRRRLNPPLPDSYSGNAVLTGYGSAKCAELE  523
             A IW+ ++++    E    ++ST+LF VD R R+ P  P  ++GNA++ G+  A   EL+
Sbjct  289   AKIWKARSIAV---EMAEGKISTMLFPVDTRTRVVPQAPVGFAGNALVPGFARASVKELK  345

Query  522   EGPFWKTVQMVYEGAARMTDEYARSAIDWGELYKGFPHGE--FLVSSWWRLGFEGVQFPW  349
             E  +   V+ V EG  R+ DEY RS IDW E+ +G P  E  F + +WWRLG E  +F W
Sbjct  346   EEEYSSLVRRVQEGIERLDDEYVRSGIDWLEVNRGVPCREDSFSLVAWWRLGLEEEEFAW  405

Query  348   GKPKYSCPVVYHRKDIILLFPDIDNGGKSNSGVNVLVALPPKEMEKFKSLF  196
             G+ K + PVV  +  I+ L P    G  +  G+N+ + L   ++ +F+ L 
Sbjct  406   GRLKCASPVVV-KPGIVFLLP----GPTAEGGLNIFLELEGDQVVEFRRLM  451



>ref|XP_002303052.1| hypothetical protein POPTR_0002s24610g [Populus trichocarpa]
 gb|EEE82325.1| hypothetical protein POPTR_0002s24610g [Populus trichocarpa]
Length=441

 Score =   226 bits (575),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 149/449 (33%), Positives = 229/449 (51%), Gaps = 27/449 (6%)
 Frame = -3

Query  1500  VTILDSGLIFPSQETTKHTMFLSNIDKVLNFDVQTVHFF-PASPGFPPEIVAGKIKNAFR  1324
             V +++  +I P   T +  +FLSN+D  L    ++V F+ P             +  A R
Sbjct  4     VKLVEKVVIVPEMPTNRRRIFLSNLDLPLVAYQESVSFYDPPENKISFSESYNTLYRALR  63

Query  1323  RLLVANTYDFLAGRLKKNKE-SERVEIECNAAGAGFTVASSEFALEDIGDLVYPNPAFRQ  1147
              LLV   YDF AGRL    E + R+EI+CN AG     A +E  L  +G L  P P F+Q
Sbjct  64    SLLVP--YDFFAGRLVPALEDNSRLEIDCNGAGIVVAAARTETRLSQLGGLFAPKPDFKQ  121

Query  1146  LVTM----SFDFVAKEDQPLCFLQVTSFKCGGFALGTSMNHISFDGSGFKMFLENLAALS  979
             LV        D +  +D+PL ++Q+T F CG  AL +  NH   DG+  + F +NLAA +
Sbjct  122   LVAFLREEGEDEMEFKDKPLLYIQLTQFGCGSLALASRYNHCVLDGAAARDFEKNLAAFT  181

Query  978   FNDDGPLAVVPCNDRSLLAARSPPQVTFPHPELLKVN------LPAGEEMAPPVFDSLKD  817
               DD  L +VP  DR++  AR+PP+++ PH E  K +         G +    V      
Sbjct  182   RGDD--LVIVPNPDRTIFKARNPPRISHPHHEYSKPSETRDNFFSVGGKRCTNVMHFSTP  239

Query  816   DLAFEIFQLSSADIERLKDKAKAPDNVKTKVTGFNVLTAAIWRCKALSCLGGENNSDRLS  637
                  +  +    I  LK  A   D    K T F+ + A +W+ ++++    + + +  S
Sbjct  240   HNTTHLIHIPPQRIASLK-MAALKDGKLKKCTTFHAIAAKVWKARSIAT---KIHDEVCS  295

Query  636   TVLFAVDIRRRLNPPLPDSYSGNAVLTGYGSAKCAELEEGPFWKTVQMVYEGAARMTDEY  457
             T+LF VD+RR + PP+   ++GNA++ G   A   EL++      V+ V EG  R  DEY
Sbjct  296   TMLFPVDVRRIVVPPVQIGFAGNALVPGCARASLRELKDKEDSYIVRKVQEGVERFDDEY  355

Query  456   ARSAIDWGELYKGFPHGE--FLVSSWWRLGFEGVQFPWGKPKYSCPVVYHRKDIILLFPD  283
              RS IDW E+++G P  E  F + +W+RLG E   F WGK KY+ PVV  +  ++ L P 
Sbjct  356   VRSGIDWLEVHRGTPCNENSFSLVAWFRLGLEEDVFSWGKLKYATPVVL-KPGLVFLLPG  414

Query  282   IDNGGKSNSGVNVLVALPPKEMEKFKSLF  196
             ++  G    G+N+ + LP  ++++F  L 
Sbjct  415   LEGDG----GLNICLDLPDDQVDEFHRLL  439



>ref|XP_011045747.1| PREDICTED: omega-hydroxypalmitate O-feruloyl transferase [Populus 
euphratica]
Length=442

 Score =   226 bits (575),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 153/434 (35%), Positives = 222/434 (51%), Gaps = 27/434 (6%)
 Frame = -3

Query  1479  LIFPSQETTKHTMFLSNIDKVLNFDVQTVHFFPASPGFPPEIVAGKIKNAFRRLLVANTY  1300
             L+ P++ET K   FLSN+D+ +   V+T++ F +      E     IKNA +++LV   Y
Sbjct  30    LVPPAEETEKGLYFLSNLDQNIAVIVRTIYCFKSEEK-GNENAGEVIKNALKKVLVH--Y  86

Query  1299  DFLAGRLKKNKESERVEIECNAAGAGFTVASSEFALEDIGDLVYPNP-AFRQLVTMSFDF  1123
               LAGRL  + E++ + I C   GA F  A +  A+++IGD+  P+P    +LV    D 
Sbjct  87    YPLAGRLTISSEAKLI-INCTGEGAVFVEAEANCAMKEIGDITKPDPETLGKLVYEIPDA  145

Query  1122  VAKEDQPLCFLQVTSFKCGGFALGTSMNHISFDGSGFKMFLENLAALSFNDDGPLAVVPC  943
                 + P    QVT F CGGFALG  MNH  FDG G   F+ +    +     PL V P 
Sbjct  146   KNILEMPPLVAQVTKFTCGGFALGLCMNHCMFDGIGAMEFVNSWGETA--RGLPLCVPPF  203

Query  942   NDRSLLAARSPPQVTFPHPELLKVNLPAGEEMAPPVFDSLKDDLAFEIFQLSSADIERLK  763
              DRS+L AR+PP++ +PH E  ++      E      D  KD++ +  F   S  +E++K
Sbjct  204   IDRSILKARNPPEIEYPHQEFAEI------EDKSSTNDLYKDEMLYSSFCFDSEMLEKIK  257

Query  762   DKAKAPDNVKTKVTGFNVLTAAIWRC--KALSCLGGENNSDRLSTVLFAVDIRRRLNPPL  589
              KA   D V  K T F  L+A +WR   KAL  L      D+ + +LFAVD R + NPPL
Sbjct  258   MKAME-DGVLGKCTTFEGLSAFVWRARTKALKML-----PDQQTKLLFAVDGRPKFNPPL  311

Query  588   PDSYSGNAVLTGYGSAKCAELEEGPFWKTVQMVYEGAARMTDEYARSAIDWGELYKGFPH  409
             P  Y GN ++      +  EL + P    V +V +    +TD Y RSA+D+ E  +  P 
Sbjct  312   PKGYFGNGIVLTNSMCEAGELLDRPLSHAVGLVQDAIKMVTDSYMRSAVDYFEATRVRPS  371

Query  408   --GEFLVSSWWRLGFEGVQFPWGKPKYSCPVVYHRKDIILLFPDIDNGGKSNSGVNVLVA  235
                  L+++W RL F    F WG+P  S PV    K++IL      + GK    +NVL+ 
Sbjct  372   LASTLLITTWSRLSFYTTDFGWGEPVLSGPVALPEKEVILFL----SHGKERKSINVLLG  427

Query  234   LPPKEMEKFKSLFH  193
             LP   M+ F+ +  
Sbjct  428   LPALAMKTFQEMIQ  441



>gb|KDO64448.1| hypothetical protein CISIN_1g013997mg [Citrus sinensis]
Length=432

 Score =   225 bits (574),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 153/454 (34%), Positives = 227/454 (50%), Gaps = 47/454 (10%)
 Frame = -3

Query  1509  DLKVTILDSGLIFPSQETTKHTMFLSNIDKVLNFDVQTVHFFPA-SPGFPPEIVAGKIKN  1333
             +L V   +  L+ P++ET K   FL+N+D+ +   V+T + F + S G   E  A  +KN
Sbjct  10    ELTVKQGEPTLVLPAEETPKGLYFLNNLDQNIAVIVRTCYCFKSDSKG--NEDAAEVVKN  67

Query  1332  AFRRLLVANTYDFLAGRLKKNKESERVEIECNAAGAGFTVASSEFALEDIGDLVYPNPAF  1153
             A  +LLV   Y  LAGRL  +   + + + C   GA F  A + F +EDIGDL  P+P  
Sbjct  68    ALSKLLV-QCYP-LAGRLTISSAGKLI-VNCTGEGAVFVEAEASFGIEDIGDLTKPDPLI  124

Query  1152  RQLVTMSFDFVAKE---DQPLCFLQVTSFKCGGFALGTSMNHISFDGSGFKMFLENLAAL  982
               L  + ++    +     P   +QVT FKCG F +G SMNH   DG         LAA+
Sbjct  125   --LGKLVYEIPGAQHILQIPPLVVQVTKFKCGAFVIGMSMNHCMLDG---------LAAM  173

Query  981   SFNDDG-------PLAVVPCNDRSLLAARSPPQVTFPHPELLKVNLPAGEEMAPPVFDSL  823
              F +         PL V P  DR++L +R P ++ FPHPE  ++      E         
Sbjct  174   EFMNSWGETARGLPLKVRPVLDRTILKSRDPTKIEFPHPEFDEI------EDVSNTNKLY  227

Query  822   KDDLAFEIFQLSSADIERLKDKAKAPDNVKTKVTGFNVLTAAIWR--CKALSCLGGENNS  649
             ++++ +  F      +E+LK  A   D V  K T F  L+A +WR  C+AL         
Sbjct  228   EEEMLYRYFCFGPEKLEQLKQIAMQ-DKVLNKCTTFEALSAFVWRARCEALGM-----QP  281

Query  648   DRLSTVLFAVDIRRRLNPPLPDSYSGNAVLTGYGSAKCAELEEGPFWKTVQMVYEGAARM  469
             D+ + +LFAVD R R  PPLP+ + GN ++  Y  +K  EL   P   TV +V    + +
Sbjct  282   DQQTKLLFAVDGRSRFEPPLPEGFFGNGIVLTYSLSKAGELLTNPLSFTVGLVQNAVSMV  341

Query  468   TDEYARSAIDWGELYKGFPH--GEFLVSSWWRLGFEGVQFPWGKPKYSCPVVYHRKDIIL  295
             TD Y RSAID+ E+ +  P      L+++W+RL F  + F WG+P +S PV    K++IL
Sbjct  342   TDSYMRSAIDYFEITRARPSLAATMLITTWYRLSFHTIDFGWGEPIFSGPVALPEKEVIL  401

Query  294   LFPDIDNGGKSNSGVNVLVALPPKEMEKFKSLFH  193
                   + G     +NVL+ LP   M+ F+ L  
Sbjct  402   FL----SHGTQRKNINVLLGLPASAMKIFEQLME  431



>ref|XP_011073101.1| PREDICTED: omega-hydroxypalmitate O-feruloyl transferase isoform 
X2 [Sesamum indicum]
 ref|XP_011073102.1| PREDICTED: omega-hydroxypalmitate O-feruloyl transferase isoform 
X2 [Sesamum indicum]
Length=432

 Score =   224 bits (572),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 152/445 (34%), Positives = 226/445 (51%), Gaps = 29/445 (7%)
 Frame = -3

Query  1509  DLKVTILDSGLIFPSQETTKHTMFLSNIDKVLNFDVQTVHFFPASPGFPPEIVAGKIKNA  1330
             +L V      L+ P++ET K   FLSN+D+ +   V+T++ F +      + V   IKNA
Sbjct  10    ELSVKQGQPTLVPPAEETMKGFYFLSNLDQNIAVIVRTIYCFKSEERGNEDAVE-VIKNA  68

Query  1329  FRRLLVANTYDFLAGRLKKNKESERVEIECNAAGAGFTVASSEFALEDIGDLVYPNPAFR  1150
               ++LV   Y  LAGRL  + E + + ++C   GA F  A +E  L+ +GD+  P+P   
Sbjct  69    LSKVLVH--YYPLAGRLTISPEMKLI-VDCTGEGAVFVEAEAECELQKLGDITKPDPV--  123

Query  1149  QLVTMSFDFVAKEDQ---PLCFLQVTSFKCGGFALGTSMNHISFDGSGFKMFLENLAALS  979
              L  + +D    E+    P    QVT FKCGGF LG  MNH  FDG G   F+ +   ++
Sbjct  124   TLGKLVYDIPGAENVLQIPPLVAQVTKFKCGGFVLGLCMNHCMFDGIGAMEFVNSWGEIA  183

Query  978   FNDDGPLAVVPCNDRSLLAARSPPQVTFPHPELLKV-NLPAGEEMAPPVFDSLKDDLAFE  802
                  PL V P  DR++L AR+PP+  FPH E  ++ +L    E+        K+++ + 
Sbjct  184   --RGLPLKVPPFMDRTILKARNPPKWEFPHHEFAEIEDLSNTSEL-------YKEEMLYR  234

Query  801   IFQLSSADIERLKDKAKAPDNVKTKVTGFNVLTAAIWRCKALSCLGGENNSDRLSTVLFA  622
              F      +E L+ +A   D    K T F  L+A +WR ++ +    +   D+ + +LFA
Sbjct  235   SFCFDPDKLEHLRKQA-LEDRTLEKCTTFEALSAFVWRARSEAL---DLKPDQQTKLLFA  290

Query  621   VDIRRRLNPPLPDSYSGNAVLTGYGSAKCAELEEGPFWKTVQMVYEGAARMTDEYARSAI  442
             VD R R  PP+P  Y GNA++         EL E P   TV++V E    +TD Y RSAI
Sbjct  291   VDGRSRFEPPIPQKYFGNAIVLTNSLCNSGELVENPLSFTVKLVQEAVKMVTDGYMRSAI  350

Query  441   DWGELYKGFPH--GEFLVSSWWRLGFEGVQFPWGKPKYSCPVVYHRKDIILLFPDIDNGG  268
             D+ E  +  P      L+++W RL F    F WG+P  S PV    K++IL      + G
Sbjct  351   DYFEATRARPSLAATLLITTWSRLSFHTTDFGWGEPVLSGPVALPEKEVILFL----SHG  406

Query  267   KSNSGVNVLVALPPKEMEKFKSLFH  193
             K    +NVL+ LP   M+KF+ L  
Sbjct  407   KERKSINVLLGLPAPAMKKFEQLME  431



>ref|XP_003549071.1| PREDICTED: omega-hydroxypalmitate O-feruloyl transferase-like 
[Glycine max]
Length=434

 Score =   224 bits (571),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 151/436 (35%), Positives = 224/436 (51%), Gaps = 30/436 (7%)
 Frame = -3

Query  1479  LIFPSQETTKHTMFLSNIDKVLNFDVQTVHFFPASPGFPPEIVAGKIKNAFRRLLVANTY  1300
             L+ P++ET K   FLSN+D+ +   V+TV+ F        E     +KNA R++LV   Y
Sbjct  21    LVPPAEETKKGLYFLSNLDQNIAVIVRTVYCFKTDER-GNEKAGEVMKNALRKVLVH--Y  77

Query  1299  DFLAGRLKKNKESERVEIECNAAGAGFTVASSEFALEDIGDLVYPNPAFRQLVTMSFDFV  1120
               LAGRL  + E + + ++C   GA F  A +  ++E+IGD+  P+P    L  + +D  
Sbjct  78    YPLAGRLTISSEGKLI-VDCTGEGALFVEAEANCSMEEIGDITKPDPG--TLGMLVYDIP  134

Query  1119  AKE---DQPLCFLQVTSFKCGGFALGTSMNHISFDGSGFKMFLENLAALSFNDDGPLAVV  949
               +     P    QVT FKCGGFALG  MNH  FDG G   F+ +    +   D PL++ 
Sbjct  135   EAKHILQMPPLVAQVTKFKCGGFALGLCMNHCMFDGIGAMEFVNSWGEAA--RDLPLSIP  192

Query  948   PCNDRSLLAARSPPQVTFPHPELLKVNLPAGEEMAPPVFDSLKDDLAFEIFQLSSADIER  769
             P  DRS+L AR+PP++   H E   +     E+ +      ++D++ +  F      +++
Sbjct  193   PVLDRSMLKARNPPKIEHLHQEFADI-----EDKSSTNSLYVEDEMVYRSFCFEPERLKQ  247

Query  768   LKDKAKAPDNVKTKVTGFNVLTAAIW--RCKALSCLGGENNSDRLSTVLFAVDIRRRLNP  595
             LK KA   D    K T F VL+A +W  R KAL  L      D+ + +LFAVD R + NP
Sbjct  248   LKMKA-MEDGALEKCTTFEVLSAFVWIARTKALKLL-----PDQQTKLLFAVDGRAKFNP  301

Query  594   PLPDSYSGNAVLTGYGSAKCAELEEGPFWKTVQMVYEGAARMTDEYARSAIDWGELYKGF  415
             PLP  Y GN ++      +  EL E PF   V+++ +    +TD Y RSAID+ E+ +  
Sbjct  302   PLPKGYFGNGIVLTNSVCQAGELTEKPFSFGVRLIQDAIKMVTDSYMRSAIDYFEVTRAR  361

Query  414   PH--GEFLVSSWWRLGFEGVQFPWGKPKYSCPVVYHRKDIILLFPDIDNGGKSNSGVNVL  241
             P      L+++W RL F    F WG P  S PV    K++IL      + G+    +NVL
Sbjct  362   PSLACTLLITTWSRLSFHTTDFGWGDPVLSGPVSLPEKEVILFL----SHGQERRNINVL  417

Query  240   VALPPKEMEKFKSLFH  193
             + LP   M+ F+ L  
Sbjct  418   LGLPAPVMKIFQDLMQ  433



>gb|AGJ03151.1| hydroxycinnamoyltransferase [Populus trichocarpa]
Length=432

 Score =   224 bits (570),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 152/436 (35%), Positives = 222/436 (51%), Gaps = 31/436 (7%)
 Frame = -3

Query  1479  LIFPSQETTKHTMFLSNIDKVLNFDVQTVHFFPASPGFPPEIVAGKIKNAFRRLLVANTY  1300
             L+ P++ET K   FLSN+D+ +   V+T++ F +      E     IKNA +++LV   Y
Sbjct  20    LVPPAEETEKGLYFLSNLDQNIAVIVRTIYCFKSEEK-GNENAGEVIKNALKKVLVH--Y  76

Query  1299  DFLAGRLKKNKESERVEIECNAAGAGFTVASSEFALEDIGDLVYPNPAFRQLVTMSFDFV  1120
               LAGRL  + E++ + I C   GA F  A +  ALE+IGD+  P+P    L  + +D  
Sbjct  77    YPLAGRLTISSEAKLI-INCTGEGAVFVEAEANCALEEIGDITKPDP--DTLGKLVYDIP  133

Query  1119  AKE---DQPLCFLQVTSFKCGGFALGTSMNHISFDGSGFKMFLENLAALSFNDDGPLAVV  949
               +   + P    QVT F CGGFALG  MNH  FDG G   F+ +    +     PL V 
Sbjct  134   GAKNILEMPPLVAQVTKFTCGGFALGLCMNHCMFDGIGAMEFVNSWGETA--RGLPLCVP  191

Query  948   PCNDRSLLAARSPPQVTFPHPELLKVNLPAGEEMAPPVFDSLKDDLAFEIFQLSSADIER  769
             P  DRS+L AR+PP++ +PH E  ++   +         D  KD++ +  F   S  +E+
Sbjct  192   PFIDRSILKARNPPKIEYPHQEFAEIKDKSSTN------DLYKDEMLYSSFCFDSEMLEK  245

Query  768   LKDKAKAPDNVKTKVTGFNVLTAAIWRC--KALSCLGGENNSDRLSTVLFAVDIRRRLNP  595
             +K KA   D V  K T F  L+A +WR   KAL  L      D+ + +LFAVD R +  P
Sbjct  246   IKMKA-MEDGVLGKCTTFEGLSAFVWRARTKALKML-----PDQQTKLLFAVDGRPKFKP  299

Query  594   PLPDSYSGNAVLTGYGSAKCAELEEGPFWKTVQMVYEGAARMTDEYARSAIDWGELYKGF  415
             PLP  Y GN ++      +  EL + P    V +V +    +TD Y RSA+D+ E  +  
Sbjct  300   PLPKGYFGNGIVLTNSMCQAGELLDRPLSHAVGLVQDAIKMVTDSYMRSAMDYFEATRVR  359

Query  414   PH--GEFLVSSWWRLGFEGVQFPWGKPKYSCPVVYHRKDIILLFPDIDNGGKSNSGVNVL  241
             P      L+++W RL F    F WG+P  S PV    K++IL      + GK    +NVL
Sbjct  360   PSLASTLLITTWSRLSFYTTDFGWGEPVLSGPVALPEKEVILFL----SHGKERKSINVL  415

Query  240   VALPPKEMEKFKSLFH  193
             + LP   M+ F+ +  
Sbjct  416   LGLPALAMKTFQEMIQ  431



>ref|XP_006436888.1| hypothetical protein CICLE_v10031592mg [Citrus clementina]
 ref|XP_006493245.1| PREDICTED: omega-hydroxypalmitate O-feruloyl transferase-like 
[Citrus sinensis]
 gb|ESR50128.1| hypothetical protein CICLE_v10031592mg [Citrus clementina]
Length=432

 Score =   224 bits (570),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 152/454 (33%), Positives = 227/454 (50%), Gaps = 47/454 (10%)
 Frame = -3

Query  1509  DLKVTILDSGLIFPSQETTKHTMFLSNIDKVLNFDVQTVHFFPA-SPGFPPEIVAGKIKN  1333
             +L V   +  L+ P++ET K   FL+N+D+ +   V+T + F + S G   E  A  +KN
Sbjct  10    ELTVKQGEPTLVLPAEETPKGLYFLNNLDQNIAVIVRTCYCFKSDSKG--NEDAAEVVKN  67

Query  1332  AFRRLLVANTYDFLAGRLKKNKESERVEIECNAAGAGFTVASSEFALEDIGDLVYPNPAF  1153
             A  +LLV   Y  LAGRL  +   + + + C   GA F  A + F +EDIGDL  P+P  
Sbjct  68    ALSKLLV-QCYP-LAGRLTISSAGKLI-VNCTGEGAVFVEAEASFGIEDIGDLTKPDPLV  124

Query  1152  RQLVTMSFDFVAKE---DQPLCFLQVTSFKCGGFALGTSMNHISFDGSGFKMFLENLAAL  982
               L  + ++    +     P   +QVT FKCG F +G SMNH   DG         LAA+
Sbjct  125   --LGKLVYEIPGAQHILQIPPLVVQVTKFKCGAFVIGMSMNHCMLDG---------LAAM  173

Query  981   SFNDDG-------PLAVVPCNDRSLLAARSPPQVTFPHPELLKVNLPAGEEMAPPVFDSL  823
              F +         PL V P  DR++L +R P ++ FPHPE  ++      E         
Sbjct  174   EFMNSWGETARGLPLKVGPVLDRTILKSRDPTKIEFPHPEFDEI------EDVSNTNKLY  227

Query  822   KDDLAFEIFQLSSADIERLKDKAKAPDNVKTKVTGFNVLTAAIWR--CKALSCLGGENNS  649
             ++++ +  F      +E+LK  A   D V  K T F  L+A +WR  C+AL         
Sbjct  228   EEEMLYRYFCFGPEKLEQLKQIAMQ-DKVLNKCTTFEALSAFVWRARCEALGM-----QP  281

Query  648   DRLSTVLFAVDIRRRLNPPLPDSYSGNAVLTGYGSAKCAELEEGPFWKTVQMVYEGAARM  469
             D+ + +LFAVD R R  PPLP+ + GN ++  Y  +K  EL   P   TV +V    + +
Sbjct  282   DQQTKLLFAVDGRSRFEPPLPEGFFGNGIVLTYSLSKAGELLTNPLSFTVGLVQNAVSMV  341

Query  468   TDEYARSAIDWGELYKGFPH--GEFLVSSWWRLGFEGVQFPWGKPKYSCPVVYHRKDIIL  295
             TD Y RSAID+ E+ +  P      ++++W+RL F  + F WG+P +S PV    K++IL
Sbjct  342   TDSYMRSAIDYFEITRARPSLAATMVITTWYRLSFHTIDFGWGEPIFSGPVALPEKEVIL  401

Query  294   LFPDIDNGGKSNSGVNVLVALPPKEMEKFKSLFH  193
                   + G     +NVL+ LP   M+ F+ L  
Sbjct  402   FL----SHGTQRKNINVLLGLPASAMKIFEQLME  431



>ref|XP_002298644.2| hypothetical protein POPTR_0001s33390g [Populus trichocarpa]
 gb|EEE83449.2| hypothetical protein POPTR_0001s33390g [Populus trichocarpa]
Length=442

 Score =   224 bits (570),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 152/436 (35%), Positives = 222/436 (51%), Gaps = 31/436 (7%)
 Frame = -3

Query  1479  LIFPSQETTKHTMFLSNIDKVLNFDVQTVHFFPASPGFPPEIVAGKIKNAFRRLLVANTY  1300
             L+ P++ET K   FLSN+D+ +   V+T++ F +      E     IKNA +++LV   Y
Sbjct  30    LVPPAEETEKGLYFLSNLDQNIAVIVRTIYCFKSEEK-GNENAGEVIKNALKKVLVH--Y  86

Query  1299  DFLAGRLKKNKESERVEIECNAAGAGFTVASSEFALEDIGDLVYPNPAFRQLVTMSFDFV  1120
               LAGRL  + E++ + I C   GA F  A +  ALE+IGD+  P+P    L  + +D  
Sbjct  87    YPLAGRLTISSEAKLI-INCTGEGAVFVEAEANCALEEIGDITKPDP--DTLGKLVYDIP  143

Query  1119  AKE---DQPLCFLQVTSFKCGGFALGTSMNHISFDGSGFKMFLENLAALSFNDDGPLAVV  949
               +   + P    QVT F CGGFALG  MNH  FDG G   F+ +    +     PL V 
Sbjct  144   GAKNILEMPPLVAQVTKFTCGGFALGLCMNHCMFDGIGAMEFVNSWGETA--RGLPLCVP  201

Query  948   PCNDRSLLAARSPPQVTFPHPELLKVNLPAGEEMAPPVFDSLKDDLAFEIFQLSSADIER  769
             P  DRS+L AR+PP++ +PH E  ++   +         D  KD++ +  F   S  +E+
Sbjct  202   PFIDRSILKARNPPKIEYPHQEFAEIKDKSSTN------DLYKDEMLYSSFCFDSEMLEK  255

Query  768   LKDKAKAPDNVKTKVTGFNVLTAAIWRC--KALSCLGGENNSDRLSTVLFAVDIRRRLNP  595
             +K KA   D V  K T F  L+A +WR   KAL  L      D+ + +LFAVD R +  P
Sbjct  256   IKMKA-MEDGVLGKCTTFEGLSAFVWRARTKALKML-----PDQQTKLLFAVDGRPKFKP  309

Query  594   PLPDSYSGNAVLTGYGSAKCAELEEGPFWKTVQMVYEGAARMTDEYARSAIDWGELYKGF  415
             PLP  Y GN ++      +  EL + P    V +V +    +TD Y RSA+D+ E  +  
Sbjct  310   PLPKGYFGNGIVLTNSMCQAGELLDRPLSHAVGLVQDAIKMVTDSYMRSAMDYFEATRVR  369

Query  414   PH--GEFLVSSWWRLGFEGVQFPWGKPKYSCPVVYHRKDIILLFPDIDNGGKSNSGVNVL  241
             P      L+++W RL F    F WG+P  S PV    K++IL      + GK    +NVL
Sbjct  370   PSLASTLLITTWSRLSFYTTDFGWGEPVLSGPVALPEKEVILFL----SHGKERKSINVL  425

Query  240   VALPPKEMEKFKSLFH  193
             + LP   M+ F+ +  
Sbjct  426   LGLPALAMKTFQEMIQ  441



>ref|XP_003553956.1| PREDICTED: omega-hydroxypalmitate O-feruloyl transferase-like 
[Glycine max]
Length=432

 Score =   223 bits (569),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 153/447 (34%), Positives = 229/447 (51%), Gaps = 33/447 (7%)
 Frame = -3

Query  1509  DLKVTILDSGLIFPSQETTKHTMFLSNIDKVLNFDVQTVHFFPASPGFPPEIVAGKIKNA  1330
              L V + +  L+ P++ET K   FLSN+D+ +   V+TV+ F  +     E     IKNA
Sbjct  10    QLSVKLSEPTLVPPAEETKKGLYFLSNLDQNIAVIVRTVYCFKTAER-GNEKAGEVIKNA  68

Query  1329  FRRLLVANTYDFLAGRLKKNKESERVEIECNAAGAGFTVASSEFALEDIGDLVYPNPAFR  1150
              +++LV   Y  LAGRL  + E + + ++C   GA    A +  ++E+IGD+  P+P   
Sbjct  69    LKKVLV--YYYPLAGRLTISSEGKLI-VDCTGEGALLVEAEANCSMEEIGDITKPDPG--  123

Query  1149  QLVTMSFDFVAKE---DQPLCFLQVTSFKCGGFALGTSMNHISFDGSGFKMFLENLAALS  979
              L  + +D    +     P    QVT FKCGGFALG  MNH  FDG G   F+ +    +
Sbjct  124   TLGKLVYDIPGAKHILQMPPLVAQVTKFKCGGFALGLCMNHCMFDGIGAMEFVNSWGEAA  183

Query  978   FNDDGPLAVVPCNDRSLLAARSPPQVTFPHPELLKVNLPAGEEMAPPVFDSL-KDDLAFE  802
                D PL++ P  DRS+L ARSPP++   H E   +   +         +SL +D++ + 
Sbjct  184   --RDLPLSIPPVIDRSILKARSPPKIEHLHQEFADIEDKSNT-------NSLYEDEMVYR  234

Query  801   IFQLSSADIERLKDKAKAPDNVKTKVTGFNVLTAAIW--RCKALSCLGGENNSDRLSTVL  628
              F +    +++LK KA   D    K T F VL+A +W  R KAL  L      D+ + +L
Sbjct  235   SFCIEPERLKQLKMKA-MEDGALEKCTTFEVLSAFVWIARTKALKML-----PDQQTKLL  288

Query  627   FAVDIRRRLNPPLPDSYSGNAVLTGYGSAKCAELEEGPFWKTVQMVYEGAARMTDEYARS  448
             FAVD R + NP LP  Y GN ++      +  EL E PF   V+++ +    +TD Y RS
Sbjct  289   FAVDGRAKFNPTLPKGYFGNGIVLTNSVCQAGELTEKPFSFGVRLIQDAIKMVTDSYMRS  348

Query  447   AIDWGELYKGFPH--GEFLVSSWWRLGFEGVQFPWGKPKYSCPVVYHRKDIILLFPDIDN  274
             AID+ E+ +  P      L+++W RL F    F WG+P  S PV    K++IL      +
Sbjct  349   AIDYFEVTRARPSLACTLLITTWSRLSFHTTDFGWGEPALSGPVSLPEKEVILFL----S  404

Query  273   GGKSNSGVNVLVALPPKEMEKFKSLFH  193
              G+    +NVL+ LP   M+ F+ L  
Sbjct  405   HGQERRNINVLLGLPAPVMKIFQDLMQ  431



>ref|XP_011073100.1| PREDICTED: omega-hydroxypalmitate O-feruloyl transferase isoform 
X1 [Sesamum indicum]
Length=490

 Score =   224 bits (572),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 150/435 (34%), Positives = 223/435 (51%), Gaps = 29/435 (7%)
 Frame = -3

Query  1479  LIFPSQETTKHTMFLSNIDKVLNFDVQTVHFFPASPGFPPEIVAGKIKNAFRRLLVANTY  1300
             L+ P++ET K   FLSN+D+ +   V+T++ F +      + V   IKNA  ++LV   Y
Sbjct  78    LVPPAEETMKGFYFLSNLDQNIAVIVRTIYCFKSEERGNEDAVE-VIKNALSKVLVH--Y  134

Query  1299  DFLAGRLKKNKESERVEIECNAAGAGFTVASSEFALEDIGDLVYPNPAFRQLVTMSFDFV  1120
               LAGRL  + E + + ++C   GA F  A +E  L+ +GD+  P+P    L  + +D  
Sbjct  135   YPLAGRLTISPEMKLI-VDCTGEGAVFVEAEAECELQKLGDITKPDPV--TLGKLVYDIP  191

Query  1119  AKEDQ---PLCFLQVTSFKCGGFALGTSMNHISFDGSGFKMFLENLAALSFNDDGPLAVV  949
               E+    P    QVT FKCGGF LG  MNH  FDG G   F+ +   ++     PL V 
Sbjct  192   GAENVLQIPPLVAQVTKFKCGGFVLGLCMNHCMFDGIGAMEFVNSWGEIA--RGLPLKVP  249

Query  948   PCNDRSLLAARSPPQVTFPHPELLKV-NLPAGEEMAPPVFDSLKDDLAFEIFQLSSADIE  772
             P  DR++L AR+PP+  FPH E  ++ +L    E+        K+++ +  F      +E
Sbjct  250   PFMDRTILKARNPPKWEFPHHEFAEIEDLSNTSEL-------YKEEMLYRSFCFDPDKLE  302

Query  771   RLKDKAKAPDNVKTKVTGFNVLTAAIWRCKALSCLGGENNSDRLSTVLFAVDIRRRLNPP  592
              L+ +A   D    K T F  L+A +WR ++ +    +   D+ + +LFAVD R R  PP
Sbjct  303   HLRKQA-LEDRTLEKCTTFEALSAFVWRARSEAL---DLKPDQQTKLLFAVDGRSRFEPP  358

Query  591   LPDSYSGNAVLTGYGSAKCAELEEGPFWKTVQMVYEGAARMTDEYARSAIDWGELYKGFP  412
             +P  Y GNA++         EL E P   TV++V E    +TD Y RSAID+ E  +  P
Sbjct  359   IPQKYFGNAIVLTNSLCNSGELVENPLSFTVKLVQEAVKMVTDGYMRSAIDYFEATRARP  418

Query  411   H--GEFLVSSWWRLGFEGVQFPWGKPKYSCPVVYHRKDIILLFPDIDNGGKSNSGVNVLV  238
                   L+++W RL F    F WG+P  S PV    K++IL      + GK    +NVL+
Sbjct  419   SLAATLLITTWSRLSFHTTDFGWGEPVLSGPVALPEKEVILFL----SHGKERKSINVLL  474

Query  237   ALPPKEMEKFKSLFH  193
              LP   M+KF+ L  
Sbjct  475   GLPAPAMKKFEQLME  489



>ref|XP_011024641.1| PREDICTED: omega-hydroxypalmitate O-feruloyl transferase-like 
[Populus euphratica]
Length=441

 Score =   223 bits (568),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 146/449 (33%), Positives = 230/449 (51%), Gaps = 27/449 (6%)
 Frame = -3

Query  1500  VTILDSGLIFPSQETTKHTMFLSNIDKVLNFDVQTVHFF-PASPGFPPEIVAGKIKNAFR  1324
             V +++  +I P   T +  +FLSN+D  L    ++V F+ P             +  A R
Sbjct  4     VKLVEKVVIVPEMLTNRRRIFLSNLDLPLVAYQESVSFYDPPENKISFSESYNTLYRALR  63

Query  1323  RLLVANTYDFLAGRLKKNKE-SERVEIECNAAGAGFTVASSEFALEDIGDLVYPNPAFRQ  1147
              LLV   YDF AGRL    E + R+EI+CN AG     A ++  L  +G L  P P F+Q
Sbjct  64    SLLVP--YDFFAGRLVPALEDNSRLEIDCNGAGIVVAAARTDTRLSQLGGLFAPKPDFKQ  121

Query  1146  LVTM----SFDFVAKEDQPLCFLQVTSFKCGGFALGTSMNHISFDGSGFKMFLENLAALS  979
             LV        D +  +D+PL ++Q+T F CG  AL +  NH   DG+  + F +NLAA +
Sbjct  122   LVAFLREEGEDEMEFKDKPLLYIQLTQFGCGSLALASRYNHCVLDGAAARDFEKNLAAFT  181

Query  978   FNDDGPLAVVPCNDRSLLAARSPPQVTFPHPELLKVN------LPAGEEMAPPVFDSLKD  817
               DD  L +VP  DR++  AR+PP+++ PH E  K +         G +    V      
Sbjct  182   RGDD--LVIVPNPDRTIFKARNPPRISHPHHEYSKPSETRDNFFSVGGKRCTDVMHFGTP  239

Query  816   DLAFEIFQLSSADIERLKDKAKAPDNVKTKVTGFNVLTAAIWRCKALSCLGGENNSDRLS  637
                  +  +    I  LK  A     +K + T F+ + A +W+ ++++    + + +  S
Sbjct  240   HNTTHLIHIPPQRIASLKMAALKEGKLK-RCTTFHAIAAKVWKARSIAT---KIHDEVCS  295

Query  636   TVLFAVDIRRRLNPPLPDSYSGNAVLTGYGSAKCAELEEGPFWKTVQMVYEGAARMTDEY  457
             T+LF VD+R+ + PP+   ++GNA++ G   A   EL++      V+ V EG  R  DEY
Sbjct  296   TMLFPVDVRKIVVPPVQIGFAGNALVPGCARASVRELKDKEDSYIVRKVQEGVERFDDEY  355

Query  456   ARSAIDWGELYKGFPHGE--FLVSSWWRLGFEGVQFPWGKPKYSCPVVYHRKDIILLFPD  283
              RS IDW E+++G P  E  F + +W+RLG E   F WGK KY+ PVV  +  ++ L P 
Sbjct  356   VRSGIDWLEVHRGMPCNENSFSLVAWFRLGLEEDVFSWGKLKYATPVVL-KPGLVFLLPG  414

Query  282   IDNGGKSNSGVNVLVALPPKEMEKFKSLF  196
             ++  G    G+N+ + LP  ++++F  L 
Sbjct  415   LEGDG----GLNICLDLPDDQVDEFHRLL  439



>ref|XP_009378002.1| PREDICTED: omega-hydroxypalmitate O-feruloyl transferase-like 
[Pyrus x bretschneideri]
Length=444

 Score =   223 bits (567),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 148/446 (33%), Positives = 231/446 (52%), Gaps = 32/446 (7%)
 Frame = -3

Query  1506  LKVTILDSGLIFPSQETTKHTMFLSNIDKVLNFDVQTVHFFPASPGFPPEIVAGK-IKNA  1330
             L+V   +  L+ P+ ET K   FLSN+D+ +   V+T++ F +      +  AG+ IK+A
Sbjct  22    LRVKQGEPTLVSPAVETEKGLYFLSNLDQNIAVTVRTIYCFKSDDKGNDQ--AGEVIKDA  79

Query  1329  FRRLLVANTYDFLAGRLKKNKESERVEIECNAAGAGFTVASSEFALEDIGDLVYPNPAFR  1150
              +++LV   Y  LAGRL  + E + + ++C   GA F  A ++ A+E+IGD+  P+P   
Sbjct  80    LKKVLVH--YYPLAGRLSISAEGKLI-VDCTGEGAIFVEAEADCAIEEIGDITKPDP--E  134

Query  1149  QLVTMSFDFVAKE---DQPLCFLQVTSFKCGGFALGTSMNHISFDGSGFKMFLENLAALS  979
              L  + +D    +   + P   +QVT FKCGGF+LG  MNH  FDG G   F+ +   ++
Sbjct  135   TLGRLVYDVPGAKNILEMPPLVVQVTKFKCGGFSLGLCMNHCMFDGIGAMEFVNSWGKIA  194

Query  978   FNDDGPLAVVPCNDRSLLAARSPPQVTFPHPELLKVNLPAGEEMAPPVFDSLKDDLAFEI  799
                  PL V P  DRS+L AR+PP++ +PH E  ++   +         D  ++ + +  
Sbjct  195   IGL--PLTVPPFLDRSILKARNPPRIEYPHQEFSEITGTSCTNN-----DLCEEKMQYRS  247

Query  798   FQLSSADIERLKDKAKAPDNVKTKVTGFNVLTAAIW--RCKALSCLGGENNSDRLSTVLF  625
             F   S  +E+LK KA+  D      T F  L+A +W  R +AL+ L      ++   +LF
Sbjct  248   FSFDSEKLEKLKMKARE-DGALENCTTFEALSAFVWKARTRALNLL-----PEQQIKLLF  301

Query  624   AVDIRRRLNPPLPDSYSGNAVLTGYGSAKCAELEEGPFWKTVQMVYEGAARMTDEYARSA  445
             AVD RR+  PPLP  Y GN ++      +  +L + P    V +V +    +TD Y RSA
Sbjct  302   AVDGRRKFRPPLPKGYFGNGIVLTNSVCQAGDLLDKPLSNAVGLVQDAIKMVTDSYMRSA  361

Query  444   IDWGELYKGFPH--GEFLVSSWWRLGFEGVQFPWGKPKYSCPVVYHRKDIILLFPDIDNG  271
             ID+ EL +  P      L+++W +L F    F WG+P  S PV    K++IL   +    
Sbjct  362   IDYFELTRARPSLASTLLITTWSKLSFYTTDFGWGEPVLSGPVALPEKEVILFLSN----  417

Query  270   GKSNSGVNVLVALPPKEMEKFKSLFH  193
             G     +NVL+ LP   M  F+ L +
Sbjct  418   GTEKKNINVLLGLPASAMNVFQELMN  443



>emb|CAT00082.1| hydroxycinnamoyl-CoA shikimate/quinate hydroxycinnamoyl transferase 
[Coffea arabica]
Length=432

 Score =   222 bits (565),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 148/434 (34%), Positives = 220/434 (51%), Gaps = 27/434 (6%)
 Frame = -3

Query  1479  LIFPSQETTKHTMFLSNIDKVLNFDVQTVHFFPASPGFPPEIVAGKIKNAFRRLLVANTY  1300
             LI P++ET K   FLSN+D+ +   V+T++ F +      E V G I++A  ++LV   Y
Sbjct  20    LIPPAEETQKGLYFLSNLDQNIAVIVRTIYCFKSGEKGNEEAV-GMIRDALSKVLV--QY  76

Query  1299  DFLAGRLKKNKESERVEIECNAAGAGFTVASSEFALEDIGDLVYPNPAFRQLVTMSFDFV  1120
               LAGRL  + E + + ++C   GA F  A ++  +EDIGD   P+P    L  + +D  
Sbjct  77    HPLAGRLTISPEGKLI-VDCTGEGAVFVEAEADCTIEDIGDNTKPDPV--TLGKLVYDVP  133

Query  1119  AKEDQ---PLCFLQVTSFKCGGFALGTSMNHISFDGSGFKMFLENLAALSFNDDGPLAVV  949
               ++    P    QVT FKCGGF LG  MNH  FDG G   F+ +   ++     PL V 
Sbjct  134   GAKNVLEIPPLAAQVTKFKCGGFVLGLCMNHCIFDGIGAMEFVNSWGEVA--RGLPLKVP  191

Query  948   PCNDRSLLAARSPPQVTFPHPELLKVNLPAGEEMAPPVFDSLKDDLAFEIFQLSSADIER  769
             P  DR++L AR+PP++ FPH E  ++      E      +  K+++ +  F      +E+
Sbjct  192   PFMDRTILKARNPPKIEFPHHEFAEI------EDTSNTAELYKEEMHYRSFCFGPEKLEK  245

Query  768   LKDKAKAPDNVKTKVTGFNVLTAAIWRCKALSCLGGENNSDRLSTVLFAVDIRRRLNPPL  589
             LK KA   D    K T F  L+A IWR ++ +    +   D+ + +LFAVD R R +PP+
Sbjct  246   LKRKA-LEDGALAKCTTFEALSAFIWRSRSQAL---KMKPDQKTKLLFAVDGRSRFDPPI  301

Query  588   PDSYSGNAVLTGYGSAKCAELEEGPFWKTVQMVYEGAARMTDEYARSAIDWGELYKGFPH  409
             P+ Y GN ++         EL   P    V++V E    + D Y RSAID+ E  +  P 
Sbjct  302   PEGYFGNGIVLTNSLCSAGELVGNPLSFAVKLVQESVQIVKDSYMRSAIDYFEATRVRPS  361

Query  408   --GEFLVSSWWRLGFEGVQFPWGKPKYSCPVVYHRKDIILLFPDIDNGGKSNSGVNVLVA  235
                  L+++W RL F    F WG+P  S PV    K++ L      + GK    VNVL+ 
Sbjct  362   LTATLLITTWSRLSFHTTDFGWGEPVLSGPVALPEKEVSLFL----SHGKERKSVNVLLG  417

Query  234   LPPKEMEKFKSLFH  193
             LP   M+ F+ L  
Sbjct  418   LPAAAMKTFEELMQ  431



>ref|XP_009381343.1| PREDICTED: omega-hydroxypalmitate O-feruloyl transferase-like 
isoform X1 [Musa acuminata subsp. malaccensis]
Length=442

 Score =   222 bits (566),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 150/443 (34%), Positives = 220/443 (50%), Gaps = 27/443 (6%)
 Frame = -3

Query  1509  DLKVTILDSGLIFPSQETTKHTMFLSNIDKVLNFDVQTVHFFPASPGFPPEIVAGKIKNA  1330
              L V   ++ L+ P +ET +   FLSN+D+ +   V+TV+ F  SP    E     I+ A
Sbjct  20    QLSVEQGEASLVPPEKETERVLYFLSNLDQNIAVIVRTVYCF-KSPDQGNEKAGDVIREA  78

Query  1329  FRRLLVANTYDFLAGRLKKNKESERVEIECNAAGAGFTVASSEFALEDIGDLVYPNPAFR  1150
               ++LV   Y  LAGRL  + E + + ++C   GA F  A ++  +E IGD+  P+P+  
Sbjct  79    LSKVLVH--YYPLAGRLTVSSERKLI-VDCTGEGAVFVEAIADCEMEQIGDIAKPDPSM-  134

Query  1149  QLVTMSFDFVAKEDQ---PLCFLQVTSFKCGGFALGTSMNHISFDGSGFKMFLENLAALS  979
              L  + +D    ++    P    QVT FKCGGF LG +MNH  FDG G   F+ +    +
Sbjct  135   -LGKLVYDVPGAKNMLEIPPLVAQVTKFKCGGFILGLAMNHCMFDGLGAMEFVNSWCETA  193

Query  978   FNDDGPLAVVPCNDRSLLAARSPPQVTFPHPELLKVNLPAGEEMAPPVFDSLKDDLAFEI  799
                  PL+V P  DR++L AR PP + FPH E  ++        +P      ++++ ++ 
Sbjct  194   --RGLPLSVPPFMDRTVLEARDPPLLEFPHHEFREI------PDSPRTISLYQEEMLYKS  245

Query  798   FQLSSADIERLKDKAKAPDNVKTKVTGFNVLTAAIWRCKALSCLGGENNSDRLSTVLFAV  619
             F      IE LK +A   D V    T F  L+A +WR +  +        D+ + +LFAV
Sbjct  246   FYFDPHRIEHLKSRATG-DGVLHSCTTFEALSALVWRARTAAL---RVEHDQQTKLLFAV  301

Query  618   DIRRRLNPPLPDSYSGNAVLTGYGSAKCAELEEGPFWKTVQMVYEGAARMTDEYARSAID  439
             D R R +PPLP  Y GN ++         EL E PF   V +V +    +TD Y RSAID
Sbjct  302   DGRSRFDPPLPKGYFGNGIVLTSALCDAGELLEKPFSFAVGLVQKAVRMITDGYMRSAID  361

Query  438   WGELYKGFP--HGEFLVSSWWRLGFEGVQFPWGKPKYSCPVVYHRKDIILLFPDIDNGGK  265
             + E+ +  P      L+++W RL F    F WGKP  S PV    K++IL      + GK
Sbjct  362   YFEVTRVRPPLTATLLITTWSRLTFHATDFGWGKPVQSGPVALPEKEVILFL----SHGK  417

Query  264   SNSGVNVLVALPPKEMEKFKSLF  196
                  NVL+ LP   M  F+ L 
Sbjct  418   ERRSTNVLLGLPDSAMVAFQELI  440



>ref|XP_004134484.1| PREDICTED: omega-hydroxypalmitate O-feruloyl transferase-like 
[Cucumis sativus]
 gb|KGN57097.1| hypothetical protein Csa_3G153710 [Cucumis sativus]
Length=458

 Score =   222 bits (565),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 161/448 (36%), Positives = 237/448 (53%), Gaps = 41/448 (9%)
 Frame = -3

Query  1479  LIFPSQETTKHTMFLSNIDKVLNFDVQTVHFFPASPGFPPEIVAGKIKNAFRRLLVANTY  1300
             L+ PS  T + T+FLSNID  + F V+TV+FF    G   E+ +  +K A   LLV   Y
Sbjct  21    LLSPSNPTPEETIFLSNIDVAVAFTVETVYFF--EDGSAAEM-SRIVKRALAILLVP--Y  75

Query  1299  DFLAGRLKKNKESERVEIECNAAGAGFTVASSEFALEDIGDLVYPNPAFRQLVTMSFDFV  1120
              FLAGR + N+ES R+E+ CN AG  F  A S+  + D+GDL  PNP+F + V       
Sbjct  76    YFLAGRFQTNRESGRLELACNNAGVVFVNAKSKVRMRDLGDLSLPNPSFGRFVHRPGLHT  135

Query  1119  AKEDQPLCFLQVTSFKCGGFALGTSMNHISFDGSGFKMFLENLAALSFNDDGPLAVVPCN  940
                ++ L  +QVT F CGG+A+G   NH   DG       +NLA++             N
Sbjct  136   NLHERALFTVQVTEFVCGGYAIGMVTNHGVLDGKSAAEMFQNLASICRGGGDLKPQTIFN  195

Query  939   DRSLLAARSPPQVTFPHPELLKVNLPAGEEMAPPVFDSLKD------------DLAFEIF  796
             DR++  AR+PP ++ PH E    + P  +++ P  F +L              +    + 
Sbjct  196   DRTIFRARNPPLISHPHQEYTPFS-PTLKQL-PSSFTALNKPSPTPSPPMSASNHLHSLI  253

Query  795   QLSSADIERLKDKAKAPDNVKTKVTGFNVLTAAIWRCKALSCLGGENNSDR---LSTVLF  625
               + + I  LK+ A AP    T    F  + + +WR +  +       SDR    S VLF
Sbjct  254   PFTPSTIATLKNAA-APIPCST----FEAILSQLWRARTRAVY-----SDRPGETSMVLF  303

Query  624   AVDIRRRLNPPLPDSYSGNAVLTGYGSAKCAELEEGPFWKTVQMVYEGAARMT-DEYARS  448
             AVD+R ++ P LPD + GNAV+TG+ +A+ AE+ E PF   V+ V EG  R++ +EY RS
Sbjct  304   AVDVRSKIRPVLPDGFVGNAVVTGFAAARAAEVVERPFSFCVERVKEGIERVSGEEYVRS  363

Query  447   AIDWGELYKGFPHG----EFLVSSWWRLGFEGVQFPWGKPKYSCPVVYHRKDIILLFPDI  280
             AIDW E+Y+G P       F VS+WW+L F+ + F +GKP +  PV     + +LL    
Sbjct  364   AIDWLEVYRGIPATCNGKSFYVSAWWKLPFKELDFGFGKPVHVSPVANGNDEFVLLLSPA  423

Query  279   D----NGGKSNSGVNVLVALPPKEMEKF  208
             +     GG+S   VNV ++L  ++M+KF
Sbjct  424   NGGESGGGRSRGSVNVWISLEKEKMKKF  451



>ref|XP_004169053.1| PREDICTED: omega-hydroxypalmitate O-feruloyl transferase-like 
[Cucumis sativus]
Length=458

 Score =   222 bits (565),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 163/450 (36%), Positives = 240/450 (53%), Gaps = 45/450 (10%)
 Frame = -3

Query  1479  LIFPSQETTKHTMFLSNIDKVLNFDVQTVHFFPASPGFPPEIVAGKIKNAFRRLLVANTY  1300
             L+ PS  T + T+FLSNID  + F V+TV+FF    G   E+ +  +K A   LLV   Y
Sbjct  21    LLSPSNPTPEETIFLSNIDLAVAFTVETVYFF--EDGSAAEM-SRIVKRALAILLVP--Y  75

Query  1299  DFLAGRLKKNKESERVEIECNAAGAGFTVASSEFALEDIGDLVYPNPAFRQLVTMSFDFV  1120
              FLAGR + N+ES R+E+ CN AG  F  A S+  + D+GDL  PNP+F + V       
Sbjct  76    YFLAGRFQTNRESGRLELACNNAGVVFVNAKSKVRMRDLGDLSLPNPSFGRFVHRPGLHT  135

Query  1119  AKEDQPLCFLQVTSFKCGGFALGTSMNHISFDGSGFKMFLENLAALSFN--DDGPLAVVP  946
                ++ L  +QVT F CGG+A+G   NH   DG       +NLA++     D  P  +  
Sbjct  136   NLHERALFTVQVTEFVCGGYAIGMVTNHGVLDGKSAAEMFQNLASICRGGGDLKPQTIF-  194

Query  945   CNDRSLLAARSPPQVTFPHPELLKVNLPAGEEMAPPVFDSLKD------------DLAFE  802
              NDR++  AR+PP ++ PH E    + P  +++ P  F +L              +    
Sbjct  195   -NDRTIFRARNPPLISHPHQEYTPFS-PTLKQL-PSSFTALNKPSPTPSPPMSASNHLHS  251

Query  801   IFQLSSADIERLKDKAKAPDNVKTKVTGFNVLTAAIWRCKALSCLGGENNSDR---LSTV  631
             +   + + I  LK+ A AP    T    F  + + +WR +  +       SDR    S V
Sbjct  252   LIPFTPSTIATLKNAA-APIPCST----FEAILSQLWRARTRAVY-----SDRPGETSMV  301

Query  630   LFAVDIRRRLNPPLPDSYSGNAVLTGYGSAKCAELEEGPFWKTVQMVYEGAARMT-DEYA  454
             LFAVD+R ++ P LPD + GNAV+TG+ +A+ AE+ E PF   V+ V EG  R++ +EY 
Sbjct  302   LFAVDVRSKIRPVLPDGFVGNAVVTGFAAARAAEVVERPFSFCVERVKEGIERVSEEEYV  361

Query  453   RSAIDWGELYKGFPHG----EFLVSSWWRLGFEGVQFPWGKPKYSCPVVYHRKDIILLFP  286
             RSAIDW E+Y+G P       F VS+WW+L F+ + F +GKP +  PV     + +LL  
Sbjct  362   RSAIDWLEVYRGIPATCNGKSFYVSAWWKLPFKELDFGFGKPVHVSPVANGNDEFVLLLS  421

Query  285   DID----NGGKSNSGVNVLVALPPKEMEKF  208
               +     GG+S   VNV ++L  ++M+KF
Sbjct  422   PANGGESGGGRSRGSVNVWISLEKEKMKKF  451



>ref|XP_002970966.1| BAHD family acyltransferase, clade V [Selaginella moellendorffii]
 gb|EFJ27564.1| BAHD family acyltransferase, clade V [Selaginella moellendorffii]
Length=439

 Score =   221 bits (563),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 144/436 (33%), Positives = 231/436 (53%), Gaps = 28/436 (6%)
 Frame = -3

Query  1476  IFPSQETTKHTMFLSNIDKVLNFDVQTVHFFPASPGFPPEIVAGKIKNAFRRLLVANTYD  1297
             I P++ T   T+FLSN+D+ L F V+ +  +        ++V   ++NA    LV   Y 
Sbjct  15    IKPARPTKNQTIFLSNLDQQLFFHVEMLFMYDVQSPDTGDVV-DNVRNALAEALVP--YY  71

Query  1296  FLAGRLKKNKESERVEIECNAAGAGFTVASSEFALEDIGDLVYPNPAFRQLVTMSFDFVA  1117
             F AGR + N++ +R+E+ECN AGA F  A  +  + ++GDL  PNP FR+L+    D   
Sbjct  72    FAAGRFRVNEQEKRLEVECNGAGADFAGAYCDSTIAELGDLRIPNPDFRKLLVYPVDVKR  131

Query  1116  KEDQPLCFLQVTSFKCGGFALGTSMNHISFDGSGFKMFLENLAALSFNDDGPLAVVPCND  937
              ED PL  +QVT FKCGGF +G   +HI FDG     F  ++  +S  +          D
Sbjct  132   IEDIPLFSIQVTRFKCGGFIVGIYTSHIVFDGISGCQFFSDIGRISRGESIAAKATMTPD  191

Query  936   RSLLAARSPPQVTFPHPELLKV-NLPAGEEMAPPVFDSLKDDL-AFEIFQLSSADIERLK  763
             R+ L +RSPP++++ HPEL+ + ++PA     P  +D  K  + AF+ F  S A ++ LK
Sbjct  192   RTTLRSRSPPRISYAHPELMSLPDIPARLLFNPASYDVSKPPVHAFKTFSFSLAQLDLLK  251

Query  762   DKAKAPDNVKTKVTGFNVLTAAIWRCKALSCLGGENNSDRLSTVLFAVDIRRRL-NPPLP  586
              +A     V ++ + F  LT  +W+ +  +   G + S R + +  A++IR +L +P LP
Sbjct  252   KRAIEGGEV-SRCSTFEALTGHVWKARTTAL--GMDPSSR-AKLFVAMNIRDKLKSPALP  307

Query  585   DSYSGNAVLTGYGSAKCAE-----LEEGPFWKTVQMVYEGAARMTDEYARSAIDWGEL--  427
             D ++GNAV+    +A C +     +  G     V+ V +  A + +EY RS IDW E+  
Sbjct  308   DGFTGNAVV----AAPCVDTTVDSVVNGSLSLCVRKVRDAIASVNEEYIRSEIDWCEVNG  363

Query  426   --YKGFPHGEFLVSSWWRLGFEGVQFPWGKPKYSCPVVYHRKDIILLFPDIDNGGKSNSG  253
                   P G  +++ W +L F+GV F WG P Y    V  R + +L+     +  K + G
Sbjct  364   HGIIDLPGG-MIITPWSKLPFDGVDFGWGAPTYIAAPVNDRPEYVLVL----SSCKGDGG  418

Query  252   VNVLVALPPKEMEKFK  205
             V+V +A+   +M K +
Sbjct  419   VDVFMAMEFHKMRKLE  434



>emb|CDO98678.1| unnamed protein product [Coffea canephora]
Length=432

 Score =   221 bits (562),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 147/434 (34%), Positives = 220/434 (51%), Gaps = 27/434 (6%)
 Frame = -3

Query  1479  LIFPSQETTKHTMFLSNIDKVLNFDVQTVHFFPASPGFPPEIVAGKIKNAFRRLLVANTY  1300
             LI P++ET K   FLSN+D+ +   V+T++ F +      E V   IK+A  ++LV   Y
Sbjct  20    LIPPAEETQKGLYFLSNLDQNIAVIVRTIYCFKSGEKGNEEAVR-MIKDALSKVLV--QY  76

Query  1299  DFLAGRLKKNKESERVEIECNAAGAGFTVASSEFALEDIGDLVYPNPAFRQLVTMSFDFV  1120
               LAGRL  + E + + ++C   GA F  A ++  +EDIGD   P+P    L  + +D  
Sbjct  77    HPLAGRLTISPEGKLI-VDCTGEGAVFVEAEADCTIEDIGDNTKPDPV--TLGKLVYDVP  133

Query  1119  AKEDQ---PLCFLQVTSFKCGGFALGTSMNHISFDGSGFKMFLENLAALSFNDDGPLAVV  949
               ++    P    QVT FKCGGF LG  MNH  FDG G   F+ +   ++     PL V 
Sbjct  134   GAKNVLEIPPLAAQVTKFKCGGFVLGLCMNHCMFDGIGAMEFVNSWGEVA--RGLPLKVP  191

Query  948   PCNDRSLLAARSPPQVTFPHPELLKVNLPAGEEMAPPVFDSLKDDLAFEIFQLSSADIER  769
             P  DR++L AR+PP++ FPH E  ++      E      +  K+++ +  F      +E+
Sbjct  192   PFMDRTILKARNPPKIEFPHHEFAEI------EDTSNTAELYKEEMHYRSFCFDPEKLEK  245

Query  768   LKDKAKAPDNVKTKVTGFNVLTAAIWRCKALSCLGGENNSDRLSTVLFAVDIRRRLNPPL  589
             LK KA   D    K T F  L+A IWR ++ +    +   D+ + +LFAVD R R +PP+
Sbjct  246   LKRKA-LEDGALAKCTTFEALSAFIWRSRSQAL---KMKPDQKTKLLFAVDGRSRFDPPI  301

Query  588   PDSYSGNAVLTGYGSAKCAELEEGPFWKTVQMVYEGAARMTDEYARSAIDWGELYKGFPH  409
             P+ Y GN ++         EL   P    V++V E    +TD Y RSAID+ E  +  P 
Sbjct  302   PEGYFGNGIVLTNSFCSAGELVGNPLSFAVKLVQESVQIVTDSYMRSAIDYFEATRVRPS  361

Query  408   --GEFLVSSWWRLGFEGVQFPWGKPKYSCPVVYHRKDIILLFPDIDNGGKSNSGVNVLVA  235
                  L+++W RL F    F WG+P  S PV    K++ L      + G+    +NVL+ 
Sbjct  362   LTATLLITTWSRLSFHTTDFGWGEPVLSGPVALPEKEVSLFL----SHGRERKSINVLLG  417

Query  234   LPPKEMEKFKSLFH  193
             LP   M+ F+ L  
Sbjct  418   LPAAAMKTFEELMQ  431



>ref|XP_002962120.1| BAHD family acyltransferase, clade V [Selaginella moellendorffii]
 gb|EFJ37380.1| BAHD family acyltransferase, clade V [Selaginella moellendorffii]
Length=439

 Score =   220 bits (560),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 140/436 (32%), Positives = 234/436 (54%), Gaps = 28/436 (6%)
 Frame = -3

Query  1476  IFPSQETTKHTMFLSNIDKVLNFDVQTVHFFPASPGFPPEIVAGKIKNAFRRLLVANTYD  1297
             I P++ T   T+FLSN+D+ + F V+ +  +        ++V   ++NA    LV   Y 
Sbjct  15    IKPARPTKNQTIFLSNMDQQVFFHVEMLFMYDVQSPDTGDVV-DNVRNALAEALVP--YY  71

Query  1296  FLAGRLKKNKESERVEIECNAAGAGFTVASSEFALEDIGDLVYPNPAFRQLVTMSFDFVA  1117
             F AGR + N++ +R+E+ECN AGA F  A  +  + ++GDL  PNP FR+L+    D   
Sbjct  72    FAAGRFRVNEQEKRLEVECNGAGAHFAGAYCDSTIAELGDLRIPNPDFRKLLVYPVDVKK  131

Query  1116  KEDQPLCFLQVTSFKCGGFALGTSMNHISFDGSGFKMFLENLAALSFNDDGPLAVVPCND  937
              ED PL  +QVT FKCGGF +G   +H+ FDG     F  ++  +S  +          D
Sbjct  132   IEDIPLFSIQVTRFKCGGFIVGIYTSHVVFDGISGCQFFSDIGRISRGESIAAKATMTPD  191

Query  936   RSLLAARSPPQVTFPHPELLKV-NLPAGEEMAPPVFDSLKDDL-AFEIFQLSSADIERLK  763
             R+ L +RSPP +++ HPEL+++ ++PA     P  +D  K  + AF+ F  S A ++ LK
Sbjct  192   RTTLRSRSPPSISYAHPELMRLPDIPARLLFNPASYDVSKPPVHAFKTFSFSLAQLDLLK  251

Query  762   DKAKAPDNVKTKVTGFNVLTAAIWRCKALSCLGGENNSDRLSTVLFAVDIRRRL-NPPLP  586
              +A     V ++ + F  LT  +W+ +  + LG + ++  ++ +  A+++R +L +P LP
Sbjct  252   KRAIEGGEV-SRCSTFEALTGHVWKART-TALGMDPSA--MAKLFVAMNLRDKLKSPALP  307

Query  585   DSYSGNAVLTGYGSAKCAE-----LEEGPFWKTVQMVYEGAARMTDEYARSAIDWGEL--  427
             D ++GNAV+    +A C +     +  G     V+ V +  A + +EY RS IDW E+  
Sbjct  308   DGFTGNAVV----AAPCVDTTVDSVVNGSLSLCVRKVRDAIASVNEEYIRSEIDWCEVNG  363

Query  426   --YKGFPHGEFLVSSWWRLGFEGVQFPWGKPKYSCPVVYHRKDIILLFPDIDNGGKSNSG  253
                   P G  +++ W +L F+GV F WG+P Y    V  R + +L+     +  K + G
Sbjct  364   HGIIDLPGG-MIITPWSKLPFDGVDFGWGRPTYIAAPVNDRPEYVLVL----SSCKGDGG  418

Query  252   VNVLVALPPKEMEKFK  205
             V+V +A+   +M K +
Sbjct  419   VDVFMAMEFHKMRKLE  434



>ref|XP_004503772.1| PREDICTED: omega-hydroxypalmitate O-feruloyl transferase-like 
[Cicer arietinum]
Length=430

 Score =   220 bits (560),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 139/447 (31%), Positives = 230/447 (51%), Gaps = 23/447 (5%)
 Frame = -3

Query  1518  LHEDLKVTILDSGLIFPSQETTKHTMFLSNIDKVLNFDVQTVHFFPASPGFPPEIVAGKI  1339
             + + + + I +  L+ P++ET K   FLSN+D+ + + V+T++ + +S     E  A  +
Sbjct  1     MAKKVNIRIGEPSLVVPAEETKKGLYFLSNLDQNIAYPVRTIYCYKSSSK-GNENAAQVM  59

Query  1338  KNAFRRLLVANTYDFLAGRLKKNKESERVEIECNAAGAGFTVASSEFALEDIGDLVYPNP  1159
             K++  ++LV   Y  +AGRLK + E + + ++C   G  F    +   +ED+GD+  PN 
Sbjct  60    KDSLSKILVH--YYPMAGRLKISSEGKLI-VDCTEEGVVFVEGEANCMMEDLGDMTKPN-  115

Query  1158  AFRQLVTMSFDFVAKEDQ---PLCFLQVTSFKCGGFALGTSMNHISFDGSGFKMFLENLA  988
                 L  + +D  + ++    P   +QVT FKCGGF LG ++NH   DG     F+ +  
Sbjct  116   -LEILGKLVYDMPSAKNMLEIPPLLIQVTKFKCGGFVLGVNVNHCMNDGISAMQFVNSWG  174

Query  987   ALSFNDDGPLAVVPCNDRSLLAARSPPQVTFPHPELLKVNLPAGEEMAPPVFDSLKDDLA  808
               +   D  +   P  DR++L  R+PPQ+ FPH E  ++   + +     +    ++++ 
Sbjct  175   ETARGLD--IKTPPFLDRTILKPRNPPQIEFPHNEFAEIEDLSSD--TNKLIHVEEEEIL  230

Query  807   FEIFQLSSADIERLKDKAKAPDNVKTKVTGFNVLTAAIWRCKALSCLGGENNSDRLSTVL  628
             ++ F  +   +E LK KA   D V  K + F  L+  IWR +  +     N   +L   L
Sbjct  231   YKSFYFNENKLEFLKKKA-TEDGVLKKCSTFEALSGFIWRARTKASKLHPNQEVKL---L  286

Query  627   FAVDIRRRLNPPLPDSYSGNAVLTGYGSAKCAELEEGPFWKTVQMVYEGAARMTDEYARS  448
             FAVD R +  P +P  Y GNA++      K +EL + P   +V ++      +TDEY RS
Sbjct  287   FAVDGRSKFVPEIPKGYFGNAIVLSNAMCKASELLKNPLSFSVGLIERAIEMVTDEYVRS  346

Query  447   AIDWGELYKGFPH--GEFLVSSWWRLGFEGVQFPWGKPKYSCPVVYHRKDIILLFPDIDN  274
             AID+ E+ +  P      L+++W RL F    F WGKPK  CPV    K+++L  P    
Sbjct  347   AIDYFEVQRSKPSLTATLLITTWTRLSFHEADFGWGKPKCFCPVTLPEKEVVLFLPH---  403

Query  273   GGKSNSGVNVLVALPPKEMEKFKSLFH  193
              G++N  VNVL+ LP   M++F+ L  
Sbjct  404   -GENNKSVNVLLGLPASVMKRFEMLLE  429



>gb|ADD62404.1| fatty omega-hydroxyacid/fatty alcohol 0-hydroxycinnamoyl transferase 
1 [Quercus suber]
Length=419

 Score =   219 bits (558),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 152/439 (35%), Positives = 224/439 (51%), Gaps = 33/439 (8%)
 Frame = -3

Query  1479  LIFPSQETTKHTMFLSNIDKVLNFDVQTVHFFPASPGFPPEIVAGKIKNAFRRLLVANTY  1300
             L+ P++ET K   FLSN+D+ +   V+T++ F  S     E     I+NA  ++LV   Y
Sbjct  6     LVPPAEETEKGLYFLSNLDQNIAVIVRTIYCF-KSDEIGNEKAWEVIRNALEKVLVH--Y  62

Query  1299  DFLAGRLKKNKESERVEIECNAAGAGFTVASSEFALEDIGDLVYPNP-AFRQLVTMSFDF  1123
               LAGRL  + E + + ++CN  GA F  A +  ++++IGD+  P+P   R+LV   +D 
Sbjct  63    YPLAGRLTISSEGKLI-VDCNGEGAIFVEAEANCSMKEIGDITKPDPETLRKLV---YDI  118

Query  1122  VAKE---DQPLCFLQVTSFKCGGFALGTSMNHISFDGSGFKMFLENLAALSFNDDGPLAV  952
                +   + P    QVT FKCGGF LG  MNH  FDG G   F+ +    +     P+AV
Sbjct  119   PGAKNILEVPPLVAQVTKFKCGGFVLGLCMNHCMFDGIGAMEFVNSWGETA--RGLPIAV  176

Query  951   VPCNDRSLLAARSPPQVTFPHPELLKVNLPAGEEMAPPVFDSLKDDLAFEIFQLSSADIE  772
              P  +RSLL AR+PP++   H E  ++      E    + D   D+L +  F      +E
Sbjct  177   PPFLNRSLLKARNPPEIEHQHQEFAEI------EDKSCISDIYNDELVYRSFCFDPEKLE  230

Query  771   RLKDKAKAPDNVKTKVTGFNVLTAAIW--RCKALSCLGGENNSDRLSTVLFAVDIRRRLN  598
             +LK KA   + V  K T F V++A +W  R +AL  L      D+ + +LFAVD R + N
Sbjct  231   KLKMKAME-NGVLDKCTTFEVVSAFVWKARTEALGFL-----PDQKTKLLFAVDGRPKFN  284

Query  597   PPLPDSYSGNAVLTGYGSAKCAELEEGPFWKTVQMVYEGAARMTDEYARSAIDWGELYKG  418
             PPLP  Y GN ++      +  EL E P    V +V      +TD Y RSAID+ E+ + 
Sbjct  285   PPLPKGYFGNGIVLTNSICQAGELLEKPLSFAVGLVKNAIKMVTDSYMRSAIDYFEITRA  344

Query  417   FP--HGEFLVSSWWRLGFEGVQFPWGKPKYSCPVVYHRKDIILLFPDIDNGGKSNSGVNV  244
              P      L+++W RL F    F WG+P  S PV    K++ L      + GK    +NV
Sbjct  345   RPSLSSTLLITTWSRLSFHTTDFGWGEPVLSGPVALPEKEVTLFL----SHGKERKSINV  400

Query  243   LVALPPKEMEKFKSLFHKF  187
             L+ LP   M+ F+ L   +
Sbjct  401   LMGLPASSMKIFQELVQIY  419



>ref|XP_003634222.1| PREDICTED: omega-hydroxypalmitate O-feruloyl transferase [Vitis 
vinifera]
Length=433

 Score =   219 bits (559),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 150/444 (34%), Positives = 222/444 (50%), Gaps = 27/444 (6%)
 Frame = -3

Query  1509  DLKVTILDSGLIFPSQETTKHTMFLSNIDKVLNFDVQTVHFFPASPGFPPEIVAGKIKNA  1330
             +L V   +  L+ P+++T K   FLSN+D+ +   V+T++ F  S     E  A  IK+A
Sbjct  11    ELSVKQEEPTLVPPAEDTEKGLYFLSNLDQNIAVIVRTIYCF-KSEAKGNERAAEIIKDA  69

Query  1329  FRRLLVANTYDFLAGRLKKNKESERVEIECNAAGAGFTVASSEFALEDIGDLVYPNPAFR  1150
               ++LV   Y  LAGRL  + E + + ++C   GA F  A +  A+E+IGD+  P+P   
Sbjct  70    LSKVLVH--YYPLAGRLTISSEGKLI-VDCTGEGAVFVEAEANCAVEEIGDITKPDPV--  124

Query  1149  QLVTMSFDFVAKE---DQPLCFLQVTSFKCGGFALGTSMNHISFDGSGFKMFLENLAALS  979
              L  + +D        + P    QVT FKCGGF LG  MNH  FDG G   F+ +    +
Sbjct  125   TLGKLVYDIPGARNILETPPLVAQVTKFKCGGFVLGLCMNHCIFDGLGAMEFVNSWGETA  184

Query  978   FNDDGPLAVVPCNDRSLLAARSPPQVTFPHPELLKVNLPAGEEMAPPVFDSLKDDLAFEI  799
                  PL V P  DRS+L AR+PP++ FPH E  ++      E         ++++ +  
Sbjct  185   --RGLPLKVPPFLDRSILRARNPPKIEFPHHEFAEI------EDVSNTMKLYEEEMLYRS  236

Query  798   FQLSSADIERLKDKAKAPDNVKTKVTGFNVLTAAIWRCKALSCLGGENNSDRLSTVLFAV  619
             F      +++LK  A   D V  K T F  L+A +WR ++   LG     ++ + +LFAV
Sbjct  237   FCFDPEKLDQLKMIAME-DGVLPKCTTFEALSAFVWRARS-KALG--MKPEQQTKLLFAV  292

Query  618   DIRRRLNPPLPDSYSGNAVLTGYGSAKCAELEEGPFWKTVQMVYEGAARMTDEYARSAID  439
             D R R  PP+P  Y GN ++         EL E P    V +V E    +TD + RSAID
Sbjct  293   DGRSRFQPPIPTGYCGNGIVLTNSLCSAGELLENPLSFAVGLVQEAVKMVTDSFMRSAID  352

Query  438   WGELYKGFPH--GEFLVSSWWRLGFEGVQFPWGKPKYSCPVVYHRKDIILLFPDIDNGGK  265
             + E+ +  P      LV++W RL F    F WG+P  S PV    K++IL      + GK
Sbjct  353   YFEITRARPSLAATLLVTTWSRLSFHTTDFGWGEPILSGPVALPEKEVILFL----SHGK  408

Query  264   SNSGVNVLVALPPKEMEKFKSLFH  193
                 +NVL+ LP   M+ F+ L  
Sbjct  409   ERKSINVLLGLPASAMKVFEELMQ  432



>ref|XP_008804093.1| PREDICTED: omega-hydroxypalmitate O-feruloyl transferase-like 
[Phoenix dactylifera]
Length=442

 Score =   219 bits (559),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 151/447 (34%), Positives = 224/447 (50%), Gaps = 39/447 (9%)
 Frame = -3

Query  1509  DLKVTILDSGLIFPSQETTKHTMFLSNIDKVLNFDVQTVHFFPASPGFPPEIVAGKIKNA  1330
             +L V   +  L+ P++ET K   FLSN+D+ +   VQT++ F A      E  A  IK A
Sbjct  20    ELSVKQGEPTLVPPAEETEKGLYFLSNLDQNIAVLVQTIYCFRAEDR-GNERAAEVIKEA  78

Query  1329  FRRLLVANTYDFLAGRLKKNKESERVEIECNAAGAGFTVASSEFALEDIGDLVYPNPAFR  1150
               ++LV   Y  LAGRL  + E + + ++C   GA F  A ++  LEDIGD+  P+P+  
Sbjct  79    LSKVLVH--YHPLAGRLTMSSEGKLI-VDCMGEGAVFVEAEADCRLEDIGDIAKPDPSM-  134

Query  1149  QLVTMSFDFVAKE---DQPLCFLQVTSFKCGGFALGTSMNHISFDGSGFKMFLENLAALS  979
              L  + ++    +   + P    QVT F+CGGF LG +MNH  FDG G   F+ +   ++
Sbjct  135   -LGKLVYNVPGAKNILEIPPLVAQVTKFQCGGFILGLTMNHCMFDGLGAMEFVNSWGEIA  193

Query  978   FNDDGPLAVVPCNDRSLLAARSPPQVTFPHPELLKVNLPAGEEMAPPVFDSL------KD  817
                  PL+V P  DR++L +RSPP + FPH E  ++             DSL      ++
Sbjct  194   --RGLPLSVPPFLDRTILKSRSPPMIDFPHYEFKEIE------------DSLESAALYQE  239

Query  816   DLAFEIFQLSSADIERLKDKAKAPDNVKTKVTGFNVLTAAIWRCKALSCLGGENNSDRLS  637
             ++ +  F   +  +E+LK K    D    K T F  L+A +WR +  +     N   +L 
Sbjct  240   EMIYRSFYFDTDKLEQLK-KLAMQDGSLDKCTTFEALSAFVWRARTKALQFQPNQQTKL-  297

Query  636   TVLFAVDIRRRLNPPLPDSYSGNAVLTGYGSAKCAELEEGPFWKTVQMVYEGAARMTDEY  457
               LFAVD R R NPPLP  Y GN ++      K A+L E P    V ++ +     TD Y
Sbjct  298   --LFAVDGRSRFNPPLPKGYFGNGIVLTNSLCKAADLLESPLSFAVGLIQKAVKMATDSY  355

Query  456   ARSAIDWGELYKGFP--HGEFLVSSWWRLGFEGVQFPWGKPKYSCPVVYHRKDIILLFPD  283
              RSA+D+ E+ +  P      L+++W RL F    F WG+P  S PV    K++IL    
Sbjct  356   MRSAMDYFEVTRVRPSLSATLLITTWSRLAFHTTDFGWGEPLQSGPVALPEKEVILFL--  413

Query  282   IDNGGKSNSGVNVLVALPPKEMEKFKS  202
               + GK    +NVL+ LP   M  F+ 
Sbjct  414   --SHGKERRNINVLLGLPTSAMLTFQQ  438



>ref|XP_008778437.1| PREDICTED: omega-hydroxypalmitate O-feruloyl transferase-like 
[Phoenix dactylifera]
Length=432

 Score =   219 bits (558),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 150/434 (35%), Positives = 220/434 (51%), Gaps = 27/434 (6%)
 Frame = -3

Query  1479  LIFPSQETTKHTMFLSNIDKVLNFDVQTVHFFPASPGFPPEIVAGKIKNAFRRLLVANTY  1300
             L+ P++ET K   +LSN+D+ +   VQTV+ F  S     E VA  IK A  ++LV   Y
Sbjct  20    LVPPAEETDKGLYYLSNLDQNIAVIVQTVYCF-KSDDKGKERVAEVIKEALAKVLVQ--Y  76

Query  1299  DFLAGRLKKNKESERVEIECNAAGAGFTVASSEFALEDIGDLVYPNPAFRQLVTMSFDFV  1120
               LAGRL  + + + + + C   GA F  A+++  +EDIGD+  P+P    L  + ++  
Sbjct  77    YPLAGRLTISSKGKLI-VNCTGEGAVFVEATADCEMEDIGDITKPDPM--TLGKLVYNIP  133

Query  1119  AKE---DQPLCFLQVTSFKCGGFALGTSMNHISFDGSGFKMFLENLAALSFNDDGPLAVV  949
               +   + P    QVT FKCGGF LG +MNH  FDG G   F+ +    +     PLAV 
Sbjct  134   GAKNILEIPPLVAQVTKFKCGGFILGLAMNHCMFDGLGAMEFVNSWGETA--RGLPLAVP  191

Query  948   PCNDRSLLAARSPPQVTFPHPELLKVNLPAGEEMAPPVFDSLKDDLAFEIFQLSSADIER  769
             P  DR +L AR+PP +TFPH E  ++      E      +  ++++ ++ F      +ER
Sbjct  192   PFTDRRVLEARNPPLITFPHHEFAEI------EDISDTCNLYQEEMLYKSFCFEPDKLER  245

Query  768   LKDKAKAPDNVKTKVTGFNVLTAAIWRCKALSCLGGENNSDRLSTVLFAVDIRRRLNPPL  589
             LK KA     +K K T F  L+  +W+ +  +    +   D+ + +LFAVD R R NPPL
Sbjct  246   LKRKAMEEGALK-KCTTFEALSGFVWKARTGAL---KLQPDQKTKLLFAVDGRSRFNPPL  301

Query  588   PDSYSGNAVLTGYGSAKCAELEEGPFWKTVQMVYEGAARMTDEYARSAIDWGELYKGFPH  409
             P  Y GN ++         EL E P    V +V +    +TDE  RSAID+ E  +  P 
Sbjct  302   PKGYFGNGIVLTNSLCSAGELMERPLSFAVGLVQKAVNMVTDECMRSAIDYFEATRARPS  361

Query  408   --GEFLVSSWWRLGFEGVQFPWGKPKYSCPVVYHRKDIILLFPDIDNGGKSNSGVNVLVA  235
                  L+++W RL F    F WG+P  S PV    K++ L      + GK    +NVL+ 
Sbjct  362   LTSTLLITTWSRLSFHTTDFGWGEPIQSGPVSLPEKEVTLFL----SHGKERKSINVLLG  417

Query  234   LPPKEMEKFKSLFH  193
             LP   M KF+ L  
Sbjct  418   LPGPAMLKFQELME  431



>ref|XP_009344220.1| PREDICTED: omega-hydroxypalmitate O-feruloyl transferase-like 
[Pyrus x bretschneideri]
Length=444

 Score =   219 bits (558),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 148/446 (33%), Positives = 230/446 (52%), Gaps = 32/446 (7%)
 Frame = -3

Query  1506  LKVTILDSGLIFPSQETTKHTMFLSNIDKVLNFDVQTVHFFPASPGFPPEIVAGK-IKNA  1330
             L+V   +  L+ P+ ET K   FLSN+D+ +   V+T++ F +      +  AG+ IK+A
Sbjct  22    LRVKQGEPTLVSPAVETEKGLYFLSNLDQNIAVTVRTIYCFKSDDKENDQ--AGEVIKDA  79

Query  1329  FRRLLVANTYDFLAGRLKKNKESERVEIECNAAGAGFTVASSEFALEDIGDLVYPNPAFR  1150
              +++LV   Y  LAGRL  + E + + ++C   GA F  A ++ A+E IGD+  P+P   
Sbjct  80    LKKVLVH--YFPLAGRLAISAEGKLI-VDCTGEGAVFVEAEADCAIEQIGDITKPDP--E  134

Query  1149  QLVTMSFDFVAKE---DQPLCFLQVTSFKCGGFALGTSMNHISFDGSGFKMFLENLAALS  979
              L  + +D    +   + P   +QVT FKCGGF+LG  MNH  FDG G   F+ +   ++
Sbjct  135   TLGRLVYDVPGAKNILEMPPLVVQVTKFKCGGFSLGLCMNHCMFDGIGAMEFVNSWGKIA  194

Query  978   FNDDGPLAVVPCNDRSLLAARSPPQVTFPHPELLKVNLPAGEEMAPPVFDSLKDDLAFEI  799
                  PL V P  DRS+L AR+PP++ +PH E L++   +         D  ++ + +  
Sbjct  195   --RGLPLTVPPFLDRSILKARNPPRIEYPHQEFLEITGTSCINN-----DLCEEKMQYRS  247

Query  798   FQLSSADIERLKDKAKAPDNVKTKVTGFNVLTAAIW--RCKALSCLGGENNSDRLSTVLF  625
             F   S  +E+LK KA+  D      T F  L+A +W  R +AL+ L      ++   +LF
Sbjct  248   FSFDSEKLEKLKMKARE-DGALENCTTFEALSAFVWKARTRALNLL-----PEQQIKLLF  301

Query  624   AVDIRRRLNPPLPDSYSGNAVLTGYGSAKCAELEEGPFWKTVQMVYEGAARMTDEYARSA  445
             AVD R +  PPLP  Y GN ++      +  +L + P    V +V +    +TD Y RSA
Sbjct  302   AVDGRPKFRPPLPKGYFGNGIVLTNSVCQAGDLLDKPLSNAVGLVQDAIKMVTDSYMRSA  361

Query  444   IDWGELYKGFPH--GEFLVSSWWRLGFEGVQFPWGKPKYSCPVVYHRKDIILLFPDIDNG  271
             ID+ EL +  P      L+++W +L F    F WG+P  S PV    K++IL   +    
Sbjct  362   IDYFELTRARPSLASTLLITTWSKLSFYTTDFGWGEPVLSGPVALPEKEVILFLSN----  417

Query  270   GKSNSGVNVLVALPPKEMEKFKSLFH  193
             G     +NVL+ LP   M  F+ L +
Sbjct  418   GTEKKNINVLLGLPASAMNIFQELMN  443



>ref|XP_007038058.1| HXXXD-type acyl-transferase family protein isoform 2 [Theobroma 
cacao]
 gb|EOY22559.1| HXXXD-type acyl-transferase family protein isoform 2 [Theobroma 
cacao]
Length=433

 Score =   219 bits (557),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 146/443 (33%), Positives = 222/443 (50%), Gaps = 46/443 (10%)
 Frame = -3

Query  1476  IFPSQETTKHTMFLSNIDKVLNFDVQTVHFFPASPGFPPEIVAGKIKNAFRRLLVANTYD  1297
             + P++ET K   +LSN+D+ +   ++T++FF +      + V   +KN   ++LV   Y 
Sbjct  21    VLPAEETEKGLYYLSNLDQNIAVIIRTIYFFRSESKGNEDAVE-VVKNGLSKILV---YH  76

Query  1296  F-LAGRLKKNKESERVEIECNAAGAGFTVASSEFALEDIGDLVYPNPAFRQLVTMSFDFV  1120
             + LAGRL  + E + + ++C   GA F  A +   LE+IGD+  P+PA   L  + ++  
Sbjct  77    YPLAGRLTISSEGKLI-VDCTEEGAVFVEAEANCGLEEIGDITKPDPA--TLGKLVYEIP  133

Query  1119  AKEDQ---PLCFLQVTSFKCGGFALGTSMNHISFDGSGFKMFLENLAALSFNDDGPLAVV  949
               ++    PL  +QVT FKCGGFA+G SMNH   DG     F+     ++     PL + 
Sbjct  134   GAQNLLEIPLLVIQVTKFKCGGFAIGMSMNHCMLDGISAMEFMNGWGEVA--RGLPLKIP  191

Query  948   PCNDRSLLAARSPPQVTFPHPELLKV-------NLPAGEEMAPPVFDSLKDDLAFEIFQL  790
             P  DR +L AR PP++ F H E  ++        L  GEEM             +  F  
Sbjct  192   PFLDRGILKARIPPKMEFSHHEFDEIEDISNTSKLYEGEEML------------YRSFLF  239

Query  789   SSADIERLKDKAKAPDNVKTKVTGFNVLTAAIWR--CKALSCLGGENNSDRLSTVLFAVD  616
                 + +LK+KA   D V ++ T F VL   +WR  C+AL+ L      ++L+ +LFAVD
Sbjct  240   DPDKLRQLKEKA-TEDGVVSQCTTFEVLAGFVWRARCQALNLL-----PEQLTKLLFAVD  293

Query  615   IRRRLNPPLPDSYSGNAVLTGYGSAKCAELEEGPFWKTVQMVYEGAARMTDEYARSAIDW  436
              R+R  PPLP  Y+GN ++     A   EL E P    V ++ +     TD Y RSAID+
Sbjct  294   GRKRFIPPLPQGYAGNGIVLTNSIATAGELIEKPLSFAVGLIQQAVGLATDSYMRSAIDY  353

Query  435   GELYKGFPH--GEFLVSSWWRLGFEGVQFPWGKPKYSCPVVYHRKDIILLFPDIDNGGKS  262
              E+ +  P   G  L+++W +L F  + F WG+   S PV    K +IL  P      K 
Sbjct  354   FEVTRARPSLAGTVLLTTWAKLSFYSIDFGWGETISSGPVALPEKPVILFLPS----QKD  409

Query  261   NSGVNVLVALPPKEMEKFKSLFH  193
                +N+L+ LP   M  F+ L  
Sbjct  410   KKSINLLLGLPASAMNIFEELMQ  432



>ref|XP_010086996.1| Omega-hydroxypalmitate O-feruloyl transferase [Morus notabilis]
 gb|EXB25275.1| Omega-hydroxypalmitate O-feruloyl transferase [Morus notabilis]
Length=428

 Score =   218 bits (556),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 147/440 (33%), Positives = 221/440 (50%), Gaps = 41/440 (9%)
 Frame = -3

Query  1479  LIFPSQETTKHTMFLSNIDKVLNFDVQTVHFFPASPGFPPEIVAGKIKNAFRRLLVANTY  1300
             ++ P++ET K   FLSN+D+ +   V+T++ F  S     E  A  IK A   +LV   Y
Sbjct  16    VVLPAEETPKGLYFLSNLDQNIAVTVRTIYCF-KSDSRGNEEAAEVIKKALSDILVH--Y  72

Query  1299  DFLAGRLKKNKESERVEIECNAAGAGFTVASSEFALEDIGDLVYPNPAFRQLVTMSFDFV  1120
               +AGRL  + E + + + C   GA F  A ++ ++E+IGD+  P+P    L  + +D  
Sbjct  73    YPVAGRLTISSEGKLI-VNCTGEGAVFVEAEADCSVEEIGDITKPDPV--TLGKLVYDIP  129

Query  1119  AKE---DQPLCFLQVTSFKCGGFALGTSMNHISFDGSGFKMFLENLAALSF-NDDG----  964
               +   + P    QVT FKCGGF LG  MNH  FDG         LAA+ F N  G    
Sbjct  130   GAKNILEIPPLVAQVTKFKCGGFVLGLCMNHCMFDG---------LAAMEFVNSWGNTAR  180

Query  963   --PLAVVPCNDRSLLAARSPPQVTFPHPELLKVNLPAGEEMAPPVFDSLKDDLAFEIFQL  790
               PL V P  DRS+L AR+PP++   H E  ++      E         ++++ +  F  
Sbjct  181   GLPLKVSPFIDRSILKARNPPKIESAHDEFAEI------EDISETSKLYEEEMQYRSFCF  234

Query  789   SSADIERLKDKAKAPDNVKTKVTGFNVLTAAIWRCKALSCLGGENNSDRLSTVLFAVDIR  610
                 +E+LK KA   D V  K T F  L+A +WR +  +        D+ + +LFAVD R
Sbjct  235   GPEKLEQLKKKAMT-DGVLQKCTTFQALSAFVWRARTEAL---RMQPDQKTKLLFAVDGR  290

Query  609   RRLNPPLPDSYSGNAVLTGYGSAKCAELEEGPFWKTVQMVYEGAARMTDEYARSAIDWGE  430
              R  PP+P+ Y GNA++      +  EL E P    V++V +    + D Y RSAID+ E
Sbjct  291   PRFEPPIPEGYCGNAIVLTNSLCRAGELVENPLSYAVELVQKAVNMVNDSYMRSAIDYFE  350

Query  429   LYKGFPH--GEFLVSSWWRLGFEGVQFPWGKPKYSCPVVYHRKDIILLFPDIDNGGKSNS  256
             + +  P      ++++W RL F    F WG+P+ S PV    K++IL      + GK   
Sbjct  351   ITRARPSLAATLVITTWSRLSFHTTDFGWGEPRLSGPVALPEKEVILFL----SHGKERK  406

Query  255   GVNVLVALPPKEMEKFKSLF  196
              +NVL+ LP   M+ F++L 
Sbjct  407   SINVLLGLPESAMKIFENLM  426



>ref|XP_007161685.1| hypothetical protein PHAVU_001G089700g [Phaseolus vulgaris]
 gb|ESW33679.1| hypothetical protein PHAVU_001G089700g [Phaseolus vulgaris]
Length=430

 Score =   218 bits (554),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 151/448 (34%), Positives = 229/448 (51%), Gaps = 35/448 (8%)
 Frame = -3

Query  1509  DLKVTILDSGLIFPSQETTKHTMFLSNIDKVLNFDVQTVHFFPASPGFPPEIVAGKI-KN  1333
              L V + +  L+ P++ET K   FLSN+D+ +   V+TV+ F    G      AGK+ KN
Sbjct  8     QLSVKLGEPTLVPPAEETKKGLYFLSNLDQNIAVIVRTVYCFKT--GERGNEKAGKVLKN  65

Query  1332  AFRRLLVANTYDFLAGRLKKNKESERVEIECNAAGAGFTVASSEFALEDIGDLVYPNPAF  1153
             A +++LV   Y  LAGRL  + E + + ++C   GA F  A +  ++E+IGD+  P+P  
Sbjct  66    ALKKVLVH--YYPLAGRLTISSEGKLI-VDCTGEGALFVEAEANCSMEEIGDITKPDPG-  121

Query  1152  RQLVTMSFDFVAKE---DQPLCFLQVTSFKCGGFALGTSMNHISFDGSGFKMFLENLAAL  982
               L  + +D    +     P    QVT FKCGGFALG  MNH  FDG G   F+ +   +
Sbjct  122   -TLGKLVYDIPGAKHILQMPPLVAQVTKFKCGGFALGLCMNHCMFDGIGAMEFVNSWGQV  180

Query  981   SFNDDGPLAVVPCNDRSLLAARSPPQVTFPHPELLKVNLPAGEEMAPPVFDSL-KDDLAF  805
             +   D PL++ P  DRS+L AR+PP++   H E   +   +         +SL ++++ +
Sbjct  181   A--RDLPLSIPPVLDRSILKARNPPKIEHLHQEFADIEDKSNS-------NSLYEEEMVY  231

Query  804   EIFQLSSADIERLKDKAKAPDNVKTKVTGFNVLTAAIW--RCKALSCLGGENNSDRLSTV  631
               F      ++ LK KA   D      T F VL+A +W  R KAL     + + D+ + +
Sbjct  232   RSFCFDPEKLKELKMKAMQ-DGALDACTTFEVLSAFVWIARTKAL-----KMSPDQQTKL  285

Query  630   LFAVDIRRRLNPPLPDSYSGNAVLTGYGSAKCAELEEGPFWKTVQMVYEGAARMTDEYAR  451
             LFAVD R + NPPLP  Y GN ++      +  EL + P    V ++ +    +TD Y R
Sbjct  286   LFAVDGRAKFNPPLPKGYFGNGIVITNSVCRAGELTQKPLSFAVGLIQDAIKMVTDTYMR  345

Query  450   SAIDWGELYKGFPH--GEFLVSSWWRLGFEGVQFPWGKPKYSCPVVYHRKDIILLFPDID  277
             SAID+ E+ +  P      L+++W RL F    F WG P  S PV    K++IL      
Sbjct  346   SAIDYFEVTRTRPSLTCTLLITTWSRLSFHTTDFGWGDPVLSGPVSLPEKEVILFL----  401

Query  276   NGGKSNSGVNVLVALPPKEMEKFKSLFH  193
             + G+    +NVL+ LP   M+ F+ L  
Sbjct  402   SHGQERRNINVLLGLPATVMKIFQDLMQ  429



>ref|XP_006347627.1| PREDICTED: omega-hydroxypalmitate O-feruloyl transferase [Solanum 
tuberosum]
Length=433

 Score =   217 bits (553),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 145/437 (33%), Positives = 223/437 (51%), Gaps = 33/437 (8%)
 Frame = -3

Query  1479  LIFPSQETTKHTMFLSNIDKVLNFDVQTVHFFPASPGFPPEIVAGKIKNAFRRLLVANTY  1300
             L+ P++ET K   +LSN+D+ +   V+T++ F  S     E  A  +K+A  ++LV   Y
Sbjct  21    LVAPAEETEKGQYYLSNLDQNIAVPVRTIYCF-KSEEKGNENAAEVMKDALSKVLVH--Y  77

Query  1299  DFLAGRLKKNKESERVEIECNAAGAGFTVASSEFALEDIGDLVYPNPAFRQLVTMSFDFV  1120
               LAGRL  ++E + + ++C+  GA F  A +   +EDIGD   P+P    L  + +D  
Sbjct  78    YPLAGRLTISQEMKLI-VDCSGEGAVFVEAEANCNIEDIGDNTKPDPV--TLGKLVYDIP  134

Query  1119  AKE---DQPLCFLQVTSFKCGGFALGTSMNHISFDGSGFKMFLENLAALSFNDDGPLAVV  949
               +   + P    QVT FKCGGF LG  MNH  FDG G   F+ +    +     P+ V+
Sbjct  135   GAKNILEMPPLVAQVTKFKCGGFVLGLCMNHCMFDGIGAMEFVNSWGETA--RGLPIKVI  192

Query  948   PCNDRSLLAARSPPQVTFPHPELLKVNLPAGEEMAPPVFDSLK---DDLAFEIFQLSSAD  778
             P  DRS+L  R+PP+  + H E  ++           + DS K   +++ ++ F      
Sbjct  193   PFLDRSILKPRNPPKPEYTHNEFAEIE---------DISDSTKLYQEEMLYKTFCFDPEK  243

Query  777   IERLKDKAKAPDNVKTKVTGFNVLTAAIWRCKALSCLGGENNSDRLSTVLFAVDIRRRLN  598
             +E+LK KA+   NV TK T F VL+A +W+ +  +    +   D+ + +LFAVD R R +
Sbjct  244   LEQLKAKAREDGNV-TKCTSFEVLSAFVWKARTQAL---QMKPDQKTKLLFAVDGRSRFD  299

Query  597   PPLPDSYSGNAVLTGYGSAKCAELEEGPFWKTVQMVYEGAARMTDEYARSAIDWGELYKG  418
             P +P  Y GN ++        AE+ E P    V++V E    +TD Y +SAID+ E  + 
Sbjct  300   PSIPQGYFGNGIVLTNALCTAAEIVENPLSVAVKLVQEAVKLVTDSYIKSAIDYFEATRA  359

Query  417   FPH--GEFLVSSWWRLGFEGVQFPWGKPKYSCPVVYHRKDIILLFPDIDNGGKSNSGVNV  244
              P      L+++W RL F    F WG+P  S PV    K++ L      + GK    VNV
Sbjct  360   RPSLTATLLITTWSRLSFHTTDFGWGEPIVSGPVALPEKEVSLFL----SHGKERRSVNV  415

Query  243   LVALPPKEMEKFKSLFH  193
             L+ LP   M+ F+ L  
Sbjct  416   LLGLPASAMKTFEELME  432



>ref|XP_008438874.1| PREDICTED: omega-hydroxypalmitate O-feruloyl transferase-like 
[Cucumis melo]
Length=462

 Score =   218 bits (555),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 161/448 (36%), Positives = 236/448 (53%), Gaps = 37/448 (8%)
 Frame = -3

Query  1479  LIFPSQETTKHTMFLSNIDKVLNFDVQTVHFFPASPGFPPEIVAGKIKNAFRRLLVANTY  1300
             L+ PS  T + T+FLSNID  + F V+TV+FF    G   E+ +  +K A   LLV   Y
Sbjct  21    LLSPSNPTPEETIFLSNIDLAVAFTVETVYFF--EDGSAAEM-SRIVKRALAILLVP--Y  75

Query  1299  DFLAGRLKKNKESERVEIECNAAGAGFTVASSEFALEDIGDLVYPNPAFRQLVTMSFDFV  1120
              FLAGR + N+ES R+E+ CN AG  F  A S+  ++D+GDL  PNP+F + V       
Sbjct  76    YFLAGRFQTNRESGRLELACNNAGVLFVNAKSKVRMKDLGDLSLPNPSFGRFVHRPGLNT  135

Query  1119  AKEDQPLCFLQVTSFKCGGFALGTSMNHISFDGSGFKMFLENLAALSFNDDGP---LAVV  949
                ++ L  +QVT F CGG+A+G   NH   DG       +NLA++     G        
Sbjct  136   NLHERALFTVQVTEFVCGGYAIGMVTNHGVLDGKAAAEMFQNLASICRGGGGCGDLKTQT  195

Query  948   PCNDRSLLAARSPPQVTFPHPELLKVNLPAGEEMAPPVFDSLKDDLAFEIFQLSSAD---  778
               NDR++  AR+PP ++ PH E    + P  +++    F +L          +S+A+   
Sbjct  196   IFNDRTIFRARNPPLISHPHQEYTPFS-PTLKQLPSSAFTALTKPSPSPSSPMSAANHRH  254

Query  777   ---------IERLKDKAKAPDNVKTKVTGFNVLTAAIWRCKALSCLGGENNSDRLSTVLF  625
                      I  LK+ A AP    T    F  + + +WR +  +     +     S VLF
Sbjct  255   CLIPFTPSTIATLKNAA-APIPCST----FEAILSQLWRARTRAVY--SDCPGETSMVLF  307

Query  624   AVDIRRRLNPPLPDSYSGNAVLTGYGSAKCAELEEGPFWKTVQMVYEGAARMT-DEYARS  448
             AVD+R ++ P LPD + GNAV+TG+ +A+ AE+ E PF   V+ V EG  R++ +EY RS
Sbjct  308   AVDVRSKIRPVLPDGFVGNAVVTGFAAARAAEVVERPFSFCVERVKEGIERVSEEEYVRS  367

Query  447   AIDWGELYKGFPHG----EFLVSSWWRLGFEGVQFPWGKPKYSCPVVYHRKDIILLF---  289
             AIDW E+Y+G P       F VS+WW+L F+ + F +GKP +  PV     + +LL    
Sbjct  368   AIDWLEVYRGIPATCNGKSFYVSAWWKLPFKELDFGFGKPVHVGPVANGNDEFVLLLSPG  427

Query  288   -PDIDNGGKSNSGVNVLVALPPKEMEKF  208
                   GGKS S VNV ++L  ++M+K 
Sbjct  428   NGGESGGGKSRSSVNVWMSLEKEKMKKL  455



>ref|XP_010250620.1| PREDICTED: omega-hydroxypalmitate O-feruloyl transferase-like 
[Nelumbo nucifera]
Length=432

 Score =   217 bits (553),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 149/444 (34%), Positives = 222/444 (50%), Gaps = 27/444 (6%)
 Frame = -3

Query  1509  DLKVTILDSGLIFPSQETTKHTMFLSNIDKVLNFDVQTVHFFPASPGFPPEIVAGKIKNA  1330
             +L V   +  L+ P++ET +   FLSN+D+ +   V+TV+ F  S G   +     I+ A
Sbjct  10    ELSVKQGEPTLVPPAEETKRGLYFLSNLDQNIAVIVRTVYCF-KSDGKGNKQAGEIIREA  68

Query  1329  FRRLLVANTYDFLAGRLKKNKESERVEIECNAAGAGFTVASSEFALEDIGDLVYPNPAFR  1150
               ++LV   Y  LAGRL  + E + + ++C   GA    A +   L +IGD+  P+P   
Sbjct  69    LAKVLVH--YYPLAGRLTFSSEGKLI-VDCTGDGAVLVEAEANCTLGEIGDITKPDPV--  123

Query  1149  QLVTMSFDFVAKE---DQPLCFLQVTSFKCGGFALGTSMNHISFDGSGFKMFLENLAALS  979
              L  + +D    +   + P    QVT FKCGGF LG  MNH  FDG G   F+ +    +
Sbjct  124   TLGKLVYDIPGAKNILEMPPLVAQVTKFKCGGFVLGLCMNHCMFDGLGAMEFVNSWGETA  183

Query  978   FNDDGPLAVVPCNDRSLLAARSPPQVTFPHPELLKVNLPAGEEMAPPVFDSLKDDLAFEI  799
                  PL V P  DRS+L AR PP++ F H E  ++N  +         +  ++++ +  
Sbjct  184   --RGLPLTVPPVLDRSILKARCPPKMAFSHDEFSEINDVSNTA------ELYQEEMLYRS  235

Query  798   FQLSSADIERLKDKAKAPDNVKTKVTGFNVLTAAIWRCKALSCLGGENNSDRLSTVLFAV  619
             F      +E+LK KA   D V  K T F VL+A +WR +  S        D+ + +LFAV
Sbjct  236   FCFDPDKLEQLKLKA-MKDGVLEKCTTFEVLSAFVWRARTKSL---RLQPDQQTKLLFAV  291

Query  618   DIRRRLNPPLPDSYSGNAVLTGYGSAKCAELEEGPFWKTVQMVYEGAARMTDEYARSAID  439
             D R + NPPLP  Y GN ++         +L E P   TV++V +    +TD Y RSAID
Sbjct  292   DGRSKFNPPLPKGYFGNGIVLTNSLCSAGQLLENPLSFTVELVQKAVKMVTDGYMRSAID  351

Query  438   WGELYKGFPH--GEFLVSSWWRLGFEGVQFPWGKPKYSCPVVYHRKDIILLFPDIDNGGK  265
             + E+ +  P      L+++W RL F    F WG+P  S PV    K++IL      + GK
Sbjct  352   YFEVTRARPSLAATLLITTWSRLSFHITDFGWGEPLLSGPVSLPEKEVILFL----SHGK  407

Query  264   SNSGVNVLVALPPKEMEKFKSLFH  193
                 +NVL+ LP   M+ F+ L  
Sbjct  408   ERKSINVLLGLPASAMKVFEELMQ  431



>ref|XP_002992754.1| BAHD family acyltransferase, clade V [Selaginella moellendorffii]
 gb|EFJ06140.1| BAHD family acyltransferase, clade V [Selaginella moellendorffii]
Length=449

 Score =   218 bits (554),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 139/457 (30%), Positives = 230/457 (50%), Gaps = 36/457 (8%)
 Frame = -3

Query  1506  LKVTILDSGLIFPSQETTKHTMFLSNIDKVLNFDVQTVHFFPASPGFPPEIVAGKIKNAF  1327
             L V I    L  P+  T +  +FL NID  + F V +++F+ +     P+++       F
Sbjct  6     LPVAIQSCSLALPAGPTPRAKIFLPNIDLTVVFMVDSIYFYSSGAADAPKVL-------F  58

Query  1326  RRL--LVANTYDFLAGRLKKNKESERVEIECNAAGAGFTVASSEFALEDIGDLVYPNPAF  1153
             R L  ++   Y F AGRL  ++E++R+EI+ N+AG  F  A S+  + D+GDL  PN  +
Sbjct  59    RALQEVMVEFYPF-AGRLAVSEETQRLEIDANSAGVPFVEAVSDLNIADLGDLTLPNALY  117

Query  1152  RQLVTMSFDFVAKEDQPLCFLQVTSFKCGGFALGTSMNHISFDGSGFKMFLENLAALSFN  973
             R LV  + +     D PL  +QVT F CGGF+ G S+NH   DG     F+++L + +  
Sbjct  118   RNLVFTATNVKVLSDWPLATVQVTKFLCGGFSFGLSVNHALADGISIIDFMQHLTSKARG  177

Query  972   DDGPLAVVPCNDRSLLAARSPPQVTFPHPELLKVNLPAGEEMAPPVFDSLKD--------  817
              +         DR++LAAR  P    P  +   V   A E  +   F +++D        
Sbjct  178   VENFQLPELQFDRTMLAARPQPT---PKIDFADVYYKASEIPSTNSFSTMEDMVVSTNLA  234

Query  816   -------DLAFEIFQLSSADIERLKDKAKAPDNVKTKVTGFNVLTAAIWRCKALSCLGGE  658
                    DL      + ++ +E LK  A + D   T+ + F+V+   +W+ +  + +G  
Sbjct  235   SGNYVVTDLVSRAINIPASKVEYLKKLAMS-DGTITRCSTFDVVATYVWKLRT-AAMGMP  292

Query  657   NNSDRLSTVLFAVDIRRRLNPPLPDSYSGNAVLTGYGSAKCAELEEGPFWKTVQMVYEGA  478
                +  +T+  AVD+ +++ PP+P  + GN         K  EL + P    + +V E  
Sbjct  293   --LEHQATMFMAVDVSKKVTPPIPRGFVGNRAFPVAVRMKTEELLKKPLSHCLTVVREAL  350

Query  477   ARMTDEYARSAIDWGELYKGFP--HGEFLVSSWWRLGFEGVQFPWGKPKYSCPVVYHRKD  304
              R  DE+ RS IDW E+++G P  +G F +SSWW+  F  + F WGKP Y  PV+  R +
Sbjct  351   LRADDEFVRSWIDWSEIHRGIPKFNGGFYISSWWKFPFYEMDFGWGKPIYMGPVLTQRVE  410

Query  303   IILLFPDIDNGGKSNSGVNVLVALPPKEMEKFKSLFH  193
              +L+ P   +  +   GV+VL+ + P+ M +F++L +
Sbjct  411   FVLILP--VSPSRPEGGVDVLLTINPQHMARFETLVN  445



>ref|XP_007200675.1| hypothetical protein PRUPE_ppa015918mg [Prunus persica]
 gb|EMJ01874.1| hypothetical protein PRUPE_ppa015918mg [Prunus persica]
Length=439

 Score =   217 bits (552),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 153/452 (34%), Positives = 223/452 (49%), Gaps = 36/452 (8%)
 Frame = -3

Query  1500  VTILDSGLIFPSQETTKHTMFLSNIDKVLNFDVQTVHFF-PASPGFPPEIVAGKIKNAFR  1324
             V +++  +I P +      +FLSNID  L    +TV FF P S G      +    + FR
Sbjct  4     VKLVEKVVIAPEKPKQPRRLFLSNIDLGLVVYQETVIFFDPPSNGMS---FSEAYHSLFR  60

Query  1323  RL--LVANTYDFLAGRLKKNKE-SERVEIECNAAGAGFTVASSEFALEDIGDLVYPNPAF  1153
              L  L+A  YDFLAGRL  + E S R EIECN AG     A ++  L+++G+L+ P   F
Sbjct  61    TLGPLLAE-YDFLAGRLVPSLEDSNRFEIECNGAGVVVAAARTDTKLDELGELLVPKKEF  119

Query  1152  RQLVTMSFDFVAKEDQ-------PLCFLQVTSFKCGGFALGTSMNHISFDGSGFKMFLEN  994
             RQ V     F+ +ED+       PL   Q T   CG     +  NH + DG   + F  N
Sbjct  120   RQFVA----FLLQEDEEMDLKDMPLVSFQFTQLGCGSLVFASRFNHCAVDGVAVREFEAN  175

Query  993   LAALSFNDDGPLAVVPCNDRSLLAARSPPQVTFPHPELLKVNLPAG----EEMAPPVFDS  826
             LAAL+    G L + P  DR +  AR+PP ++FPH E  K     G      M+      
Sbjct  176   LAALT--RGGNLVIQPNADRIMFKARNPPNISFPHFEYSKATDRTGIFTVRGMSGTNMKL  233

Query  825   LKDDLAFEIFQLSSADIERLKDKAKAPDNVKTKVTGFNVLTAAIWRCKALSCLGGENNSD  646
                     +  LS   +  LK KA   D      T F V+ A  W+ ++++    +   +
Sbjct  234   STTLNPTRLIYLSQDRVASLK-KAALKDGRLKSCTSFQVVAAMTWKARSIAV---DMPDE  289

Query  645   RLSTVLFAVDIRRRLNPPLPDSYSGNAVLTGYGSAKCAELEEGPFWKTVQMVYEGAARMT  466
             ++ST+L  VD+R+R+ PP P  ++GNA++  +  A   EL+E      V+ V EG  R+ 
Sbjct  290   KISTILIPVDVRKRVVPPAPPGFAGNALVPAFAHATVKELKEEDDSSLVRKVQEGVERLD  349

Query  465   DEYARSAIDWGELYKGFPHGE--FLVSSWWRLGFEGVQFPWGKPKYSCPVVYHRKDIILL  292
             DEY +S IDW E+ KG P  E  F + SWW+LG E  +F WGK K +  V+     ++LL
Sbjct  350   DEYVKSGIDWLEVNKGVPCEENSFSLVSWWKLGIEHGEFSWGKVKCATSVLLKPGLVMLL  409

Query  291   FPDIDNGGKSNSGVNVLVALPPKEMEKFKSLF  196
                   G +   G+++ + LP  +ME F  L 
Sbjct  410   L-----GPEGKGGLSICLELPDDQMELFCRLM  436



>ref|XP_008464403.1| PREDICTED: omega-hydroxypalmitate O-feruloyl transferase [Cucumis 
melo]
Length=433

 Score =   216 bits (551),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 146/431 (34%), Positives = 216/431 (50%), Gaps = 26/431 (6%)
 Frame = -3

Query  1479  LIFPSQETTKHTMFLSNIDKVLNFDVQTVHFFPASPGFPPEIVAGKIKNAFRRLLVANTY  1300
             LI P++ET K   FLSN+D+ +   V+T++ F  S     E  A  IK+A  ++LV   Y
Sbjct  20    LITPAEETPKGLYFLSNLDQNIAVIVRTIYSF-KSESRGNEDAAQVIKDALSKVLVH--Y  76

Query  1299  DFLAGRLKKNKESERVEIECNAAGAGFTVASSEFALEDIGDLVYPNPAFRQLVTMSFDFV  1120
               LAGRL  + + + + ++C A GA F  A ++ ++EDIGD+  P+P    L  + +D  
Sbjct  77    YPLAGRLTISSDKKLI-VDCTAEGAVFVEAEADCSIEDIGDITKPDP--DTLGKLVYDIP  133

Query  1119  AKED---QPLCFLQVTSFKCGGFALGTSMNHISFDGSGFKMFLENLAALSFNDDGPLAVV  949
                +    P    QVT FKCGGF +G  MNH  FDG G   F+ +    +     PL V 
Sbjct  134   GATNILQMPPLVAQVTKFKCGGFVVGLCMNHCMFDGIGAMEFVNSWGETA--RGLPLTVP  191

Query  948   PCNDRSLLAARSPPQVTFPHPELLKVNLPAGEEMAPPVFDSLKDDLAFEIFQLSSADIER  769
             P  DRS+L AR PP + F H E  ++     E+++        +++ +  F      + +
Sbjct  192   PFLDRSILKAREPPVIEFSHGEFAEI-----EDVSNTFKLYGDEEMHYRSFCFEPEKLNK  246

Query  768   LKDKAKAPDNVKTKVTGFNVLTAAIWRCKALSCLGGENNSDRLSTVLFAVDIRRRLNPPL  589
             LK  A   D V  K T F  L+  +WR +  +        D+ + +LFAVD R +  P +
Sbjct  247   LKQMA-LEDGVLKKCTTFEALSGFVWRARTEAL---RMKPDQQTKLLFAVDGRSKFQPTI  302

Query  588   PDSYSGNAVLTGYGSAKCAELEEGPFWKTVQMVYEGAARMTDEYARSAIDWGELYKGFPH  409
             P  YSGNA++         EL E P    V +V +    +TD Y RSAID+ E  +  P 
Sbjct  303   PKGYSGNAIVLTNSICSAGELLENPLSYGVGLVQKAVEMITDSYMRSAIDFFETTRSRPS  362

Query  408   --GEFLVSSWWRLGFEGVQFPWGKPKYSCPVVYHRKDIILLFPDIDNGGKSNSGVNVLVA  235
                  L+++W RLGF    F WG+P +S PV    K++IL      + GK    +NVL+ 
Sbjct  363   LAATLLITTWSRLGFHTTDFGWGEPVFSGPVALPEKEVILFL----SHGKERKSINVLLG  418

Query  234   LPPKEMEKFKS  202
             LP   ME F+ 
Sbjct  419   LPASAMEIFQQ  429



>ref|XP_007038057.1| HXXXD-type acyl-transferase family protein, putative isoform 
1 [Theobroma cacao]
 gb|EOY22558.1| HXXXD-type acyl-transferase family protein, putative isoform 
1 [Theobroma cacao]
Length=519

 Score =   219 bits (557),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 146/443 (33%), Positives = 222/443 (50%), Gaps = 46/443 (10%)
 Frame = -3

Query  1476  IFPSQETTKHTMFLSNIDKVLNFDVQTVHFFPASPGFPPEIVAGKIKNAFRRLLVANTYD  1297
             + P++ET K   +LSN+D+ +   ++T++FF +      + V   +KN   ++LV   Y 
Sbjct  107   VLPAEETEKGLYYLSNLDQNIAVIIRTIYFFRSESKGNEDAVE-VVKNGLSKILV---YH  162

Query  1296  F-LAGRLKKNKESERVEIECNAAGAGFTVASSEFALEDIGDLVYPNPAFRQLVTMSFDFV  1120
             + LAGRL  + E + + ++C   GA F  A +   LE+IGD+  P+PA   L  + ++  
Sbjct  163   YPLAGRLTISSEGKLI-VDCTEEGAVFVEAEANCGLEEIGDITKPDPA--TLGKLVYEIP  219

Query  1119  AKEDQ---PLCFLQVTSFKCGGFALGTSMNHISFDGSGFKMFLENLAALSFNDDGPLAVV  949
               ++    PL  +QVT FKCGGFA+G SMNH   DG     F+     ++     PL + 
Sbjct  220   GAQNLLEIPLLVIQVTKFKCGGFAIGMSMNHCMLDGISAMEFMNGWGEVA--RGLPLKIP  277

Query  948   PCNDRSLLAARSPPQVTFPHPELLKV-------NLPAGEEMAPPVFDSLKDDLAFEIFQL  790
             P  DR +L AR PP++ F H E  ++        L  GEEM             +  F  
Sbjct  278   PFLDRGILKARIPPKMEFSHHEFDEIEDISNTSKLYEGEEML------------YRSFLF  325

Query  789   SSADIERLKDKAKAPDNVKTKVTGFNVLTAAIWR--CKALSCLGGENNSDRLSTVLFAVD  616
                 + +LK+KA   D V ++ T F VL   +WR  C+AL+ L      ++L+ +LFAVD
Sbjct  326   DPDKLRQLKEKA-TEDGVVSQCTTFEVLAGFVWRARCQALNLL-----PEQLTKLLFAVD  379

Query  615   IRRRLNPPLPDSYSGNAVLTGYGSAKCAELEEGPFWKTVQMVYEGAARMTDEYARSAIDW  436
              R+R  PPLP  Y+GN ++     A   EL E P    V ++ +     TD Y RSAID+
Sbjct  380   GRKRFIPPLPQGYAGNGIVLTNSIATAGELIEKPLSFAVGLIQQAVGLATDSYMRSAIDY  439

Query  435   GELYKGFPH--GEFLVSSWWRLGFEGVQFPWGKPKYSCPVVYHRKDIILLFPDIDNGGKS  262
              E+ +  P   G  L+++W +L F  + F WG+   S PV    K +IL  P      K 
Sbjct  440   FEVTRARPSLAGTVLLTTWAKLSFYSIDFGWGETISSGPVALPEKPVILFLPS----QKD  495

Query  261   NSGVNVLVALPPKEMEKFKSLFH  193
                +N+L+ LP   M  F+ L  
Sbjct  496   KKSINLLLGLPASAMNIFEELMQ  518



>ref|XP_007215405.1| hypothetical protein PRUPE_ppa005943mg [Prunus persica]
 gb|EMJ16604.1| hypothetical protein PRUPE_ppa005943mg [Prunus persica]
Length=436

 Score =   216 bits (550),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 150/446 (34%), Positives = 228/446 (51%), Gaps = 32/446 (7%)
 Frame = -3

Query  1506  LKVTILDSGLIFPSQETTKHTMFLSNIDKVLNFDVQTVHFFPASPGFPPEIVAGK-IKNA  1330
             L+V   +  L+ P++ET K   FLSN+D+ +   V+T++ F +      +  AG+ IKN+
Sbjct  14    LRVKQGEPTLVSPAEETEKGLYFLSNLDQNIAVTVRTIYCFKSDDKGNDK--AGEVIKNS  71

Query  1329  FRRLLVANTYDFLAGRLKKNKESERVEIECNAAGAGFTVASSEFALEDIGDLVYPNPAFR  1150
              +++LV   Y  LAGRL  + E + + ++C   GA F  A ++  +EDIGD+  P+P   
Sbjct  72    LKKVLVH--YYPLAGRLTISSEGKLI-VDCTGEGAVFVEAEADCRIEDIGDITKPDP--E  126

Query  1149  QLVTMSFDFVAKE---DQPLCFLQVTSFKCGGFALGTSMNHISFDGSGFKMFLENLAALS  979
              L  + +D    +   + P    QVT FKCGGFALG  MNH  FDG G   F+ + A ++
Sbjct  127   TLGQLVYDVPGAKNILELPPLVAQVTKFKCGGFALGLCMNHCMFDGIGAMEFVNSWAKIA  186

Query  978   FNDDGPLAVVPCNDRSLLAARSPPQVTFPHPELLKVNLPAGEEMAPPVFDSLKDDLAFEI  799
                  PL V P  DRS+L AR+PP +   H E  ++   +         D  ++ + +  
Sbjct  187   --RGLPLTVPPFLDRSILKARNPPTIEHLHQEFSEIIGTSSTSN-----DLSEEKMLYNS  239

Query  798   FQLSSADIERLKDKAKAPDNVKTKVTGFNVLTAAIW--RCKALSCLGGENNSDRLSTVLF  625
             F   S  +E++K KA+  D      T F  L+A +W  R  AL  L      ++   +LF
Sbjct  240   FCFDSEKLEKVKMKARE-DRALDNCTTFEALSAFVWKARTTALKLL-----PEQQIKLLF  293

Query  624   AVDIRRRLNPPLPDSYSGNAVLTGYGSAKCAELEEGPFWKTVQMVYEGAARMTDEYARSA  445
             AVD RR+ +PPLP  Y GN ++      +  +L E P    V +V +    +TD Y RSA
Sbjct  294   AVDGRRKFSPPLPKGYFGNGIVLTNSICQAGDLLEKPLSHAVGLVQDAIKMVTDSYMRSA  353

Query  444   IDWGELYKGFPH--GEFLVSSWWRLGFEGVQFPWGKPKYSCPVVYHRKDIILLFPDIDNG  271
             ID+ EL +  P      L+++W RL F    F WG+P  S PV    K++IL   +    
Sbjct  354   IDYFELTRARPSLASTLLITTWSRLSFYTTDFGWGEPILSGPVALPEKEVILFLSN----  409

Query  270   GKSNSGVNVLVALPPKEMEKFKSLFH  193
             G     +NVL+ LP   M+ F+ L +
Sbjct  410   GTEKKNINVLLGLPASAMKVFQELMN  435



>ref|XP_010249109.1| PREDICTED: omega-hydroxypalmitate O-feruloyl transferase-like 
[Nelumbo nucifera]
 ref|XP_010249110.1| PREDICTED: omega-hydroxypalmitate O-feruloyl transferase-like 
[Nelumbo nucifera]
Length=432

 Score =   216 bits (550),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 150/444 (34%), Positives = 219/444 (49%), Gaps = 27/444 (6%)
 Frame = -3

Query  1509  DLKVTILDSGLIFPSQETTKHTMFLSNIDKVLNFDVQTVHFFPASPGFPPEIVAGKIKNA  1330
             +L V   +  L+ P +ET K   FLSN+D+ +   V+T++ F  S     E  A  IK A
Sbjct  10    ELNVKQGEPTLVPPVEETQKGLYFLSNLDQNIAVIVRTIYCF-KSEEMGNERAANIIKEA  68

Query  1329  FRRLLVANTYDFLAGRLKKNKESERVEIECNAAGAGFTVASSEFALEDIGDLVYPNPAFR  1150
               ++LV   Y  LAGRL  + E + + ++C   GA F  A +   LEDIGD   P+P   
Sbjct  69    LAKVLVH--YYPLAGRLTISSEGKLI-VDCTGDGAIFVEAEANCTLEDIGDTTKPDPV--  123

Query  1149  QLVTMSFDFVAKE---DQPLCFLQVTSFKCGGFALGTSMNHISFDGSGFKMFLENLAALS  979
              L  + +D    +   + P    QVT+FKCGGF LG  +NH  FDG G   F+      +
Sbjct  124   TLGKLVYDIPGAKNILEIPPLVAQVTTFKCGGFVLGLGINHCMFDGLGAMEFINAWGETA  183

Query  978   FNDDGPLAVVPCNDRSLLAARSPPQVTFPHPELLKVNLPAGEEMAPPVFDSLKDDLAFEI  799
                  PL V P  DRS+L +R+PP++ F H E  ++      E         ++ + +  
Sbjct  184   --RGLPLKVPPFLDRSILKSRNPPKIDFFHHEFAEI------EDISNTSKLYEEKMLYRS  235

Query  798   FQLSSADIERLKDKAKAPDNVKTKVTGFNVLTAAIWRCKALSCLGGENNSDRLSTVLFAV  619
             F      ++++K KA   D V  K T F  L+A +WR +  S        D+ + +LFAV
Sbjct  236   FCFDPEKLQQIKMKAMQ-DGVLEKCTTFEALSAFVWRARTQSL---RMEPDQKTKLLFAV  291

Query  618   DIRRRLNPPLPDSYSGNAVLTGYGSAKCAELEEGPFWKTVQMVYEGAARMTDEYARSAID  439
             D R R +PPLP  Y GN ++         EL E P   TV++V +    +TD Y RSAID
Sbjct  292   DGRSRFDPPLPKGYFGNGIVLTNSLCSAGELLENPLSFTVELVQKAVKMVTDGYMRSAID  351

Query  438   WGELYKGFPH--GEFLVSSWWRLGFEGVQFPWGKPKYSCPVVYHRKDIILLFPDIDNGGK  265
             + E+ +  P      L+++W RL F    F WG+P  S PV    K++IL      + GK
Sbjct  352   YFEVTRERPSLAATLLITTWSRLSFHTTDFGWGEPLLSGPVALPEKEVILFL----SHGK  407

Query  264   SNSGVNVLVALPPKEMEKFKSLFH  193
                 +NVL+ LP   M+ F+ L  
Sbjct  408   ERKSINVLLGLPASAMKMFEELVQ  431



>ref|NP_001275190.1| feruloyl transferase [Solanum tuberosum]
 gb|ACS70946.1| feruloyl transferase [Solanum tuberosum]
Length=433

 Score =   216 bits (549),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 143/437 (33%), Positives = 222/437 (51%), Gaps = 33/437 (8%)
 Frame = -3

Query  1479  LIFPSQETTKHTMFLSNIDKVLNFDVQTVHFFPASPGFPPEIVAGKIKNAFRRLLVANTY  1300
             L+ P++ET K   +LSN+D+ +   V+T++ F +      E  A  +K+A  ++LV   Y
Sbjct  21    LVAPAEETEKGQYYLSNLDQNIAVPVRTIYCFKSEEK-GNENAAEVMKDALSKVLVH--Y  77

Query  1299  DFLAGRLKKNKESERVEIECNAAGAGFTVASSEFALEDIGDLVYPNPAFRQLVTMSFDFV  1120
               LAGRL  ++E + + ++C+  GA F  A +   +EDIGD   P+P    L  + +D  
Sbjct  78    YPLAGRLTISQEMKLI-VDCSGEGAVFVEAEANCNIEDIGDNTKPDPV--TLGKLVYDIP  134

Query  1119  AKE---DQPLCFLQVTSFKCGGFALGTSMNHISFDGSGFKMFLENLAALSFNDDGPLAVV  949
               +   + P    QVT FKCGGF LG  MNH  FDG G   F+ +    +     P+ V+
Sbjct  135   GAKNILEMPPLVAQVTKFKCGGFVLGLCMNHCMFDGIGAMEFVNSWGETA--RGLPIKVI  192

Query  948   PCNDRSLLAARSPPQVTFPHPELLKVNLPAGEEMAPPVFDSLK---DDLAFEIFQLSSAD  778
             P  DRS+L  R+PP+  + H E  ++           + DS K   +++ ++ F      
Sbjct  193   PFLDRSILKPRNPPKPEYSHNEFAEIE---------DISDSTKLYQEEMLYKTFCFDPEK  243

Query  777   IERLKDKAKAPDNVKTKVTGFNVLTAAIWRCKALSCLGGENNSDRLSTVLFAVDIRRRLN  598
             +E+LK KA+   NV TK T F VL+A +W+ +  +    +   D+ + +LFAVD R R +
Sbjct  244   LEQLKAKAREDGNV-TKCTSFEVLSAFVWKARTQAL---QMKPDQKTKLLFAVDGRSRFD  299

Query  597   PPLPDSYSGNAVLTGYGSAKCAELEEGPFWKTVQMVYEGAARMTDEYARSAIDWGELYKG  418
             P +P  Y GN ++        AE+ E P    V++V E    +TD Y +S ID+ E  + 
Sbjct  300   PSIPQGYFGNGIVLTNALCTAAEIVENPLSVAVKLVQEAVKLVTDSYIKSTIDYFEATRA  359

Query  417   FPH--GEFLVSSWWRLGFEGVQFPWGKPKYSCPVVYHRKDIILLFPDIDNGGKSNSGVNV  244
              P      L+++W RL F    F WG+P  S PV    K++ L      + GK    VNV
Sbjct  360   RPSLTATLLITTWSRLSFHTTDFGWGEPIVSGPVALPEKEVSLFL----SHGKERRSVNV  415

Query  243   LVALPPKEMEKFKSLFH  193
             L+ LP   M+ F+ L  
Sbjct  416   LLGLPASAMKTFEELME  432



>ref|XP_004138033.1| PREDICTED: omega-hydroxypalmitate O-feruloyl transferase-like 
[Cucumis sativus]
 gb|KGN63464.1| hypothetical protein Csa_1G001360 [Cucumis sativus]
Length=433

 Score =   215 bits (548),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 146/430 (34%), Positives = 216/430 (50%), Gaps = 26/430 (6%)
 Frame = -3

Query  1479  LIFPSQETTKHTMFLSNIDKVLNFDVQTVHFFPASPGFPPEIVAGKIKNAFRRLLVANTY  1300
             LI P++ET K   FLSN+D+ +   V+T++ F  S     E  A  IK+A  ++LV   Y
Sbjct  20    LITPAEETPKGLYFLSNLDQNIAVIVRTIYSF-KSESRGNEDAAQVIKDALSQVLVH--Y  76

Query  1299  DFLAGRLKKNKESERVEIECNAAGAGFTVASSEFALEDIGDLVYPNPAFRQLVTMSFDFV  1120
               LAGRL  + + + + ++C A GA F  A ++ ++EDIGD+  P+P    L  + +D  
Sbjct  77    YPLAGRLTISSDKKLI-VDCTAEGAVFVEAEADCSIEDIGDITKPDP--DTLGKLVYDIP  133

Query  1119  AKED---QPLCFLQVTSFKCGGFALGTSMNHISFDGSGFKMFLENLAALSFNDDGPLAVV  949
                +    P    QVT FKCGGF +G  MNH  FDG G   F+ +    +     PL V 
Sbjct  134   GATNILQMPPLVAQVTKFKCGGFVVGLCMNHCMFDGIGAMEFVNSWGETA--RGLPLTVP  191

Query  948   PCNDRSLLAARSPPQVTFPHPELLKVNLPAGEEMAPPVFDSLKDDLAFEIFQLSSADIER  769
             P  DRS+L AR PP + F H E  ++     E+++        +++ +  F      + +
Sbjct  192   PFLDRSILKAREPPVIEFSHGEFAEI-----EDVSNTFKLYGDEEMHYRSFCFEPEKLNK  246

Query  768   LKDKAKAPDNVKTKVTGFNVLTAAIWRCKALSCLGGENNSDRLSTVLFAVDIRRRLNPPL  589
             LK  A   D V  K T F  L+  +W+ +  +        D+ + +LFAVD R R  P +
Sbjct  247   LKQIA-LEDGVLKKCTTFEALSGFVWKARTEAL---RMKPDQQTKLLFAVDGRSRFKPTI  302

Query  588   PDSYSGNAVLTGYGSAKCAELEEGPFWKTVQMVYEGAARMTDEYARSAIDWGELYKGFPH  409
             P  YSGNA++         EL E P    V +V +    +TD Y RSAID+ E  +  P 
Sbjct  303   PKGYSGNAIVLTNSICSAGELLENPLSYGVGLVQKAVEMITDSYMRSAIDFFETTRSRPS  362

Query  408   --GEFLVSSWWRLGFEGVQFPWGKPKYSCPVVYHRKDIILLFPDIDNGGKSNSGVNVLVA  235
                  L+++W RLGF    F WG+P +S PV    K++IL      + GK    +NVL+ 
Sbjct  363   LAATLLITTWSRLGFHTTDFGWGEPVFSGPVALPEKEVILFL----SHGKERKSINVLLG  418

Query  234   LPPKEMEKFK  205
             LP   ME F+
Sbjct  419   LPASAMEIFQ  428



>dbj|BAJ89613.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ86428.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=447

 Score =   216 bits (549),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 150/435 (34%), Positives = 219/435 (50%), Gaps = 21/435 (5%)
 Frame = -3

Query  1479  LIFPSQET-TKHTMFLSNIDKVLNFDVQTVHFFPASPGFPPEIVAGKIKNAFRRLLVANT  1303
             L+ P++ T T    +LSN+D+ +   VQTV+ F    G   E  A  +++A  R+LV   
Sbjct  30    LVSPAEATPTGKQYYLSNLDQNIAVIVQTVYCFKCPSGRGNEGAADALRSALARVLV--H  87

Query  1302  YDFLAGRLKKNKESERVEIECNAAGAGFTVASSEFALEDIGDLVYPNPA-FRQLVTMSFD  1126
             Y  LAGRL  ++E  ++ +EC   G  F  A +   L  IGDL  P+PA   QLV     
Sbjct  88    YHPLAGRLGISREM-KLTVECTGEGVPFVEAEAACDLALIGDLSTPDPAALGQLVYSVPG  146

Query  1125  FVAKEDQPLCFLQVTSFKCGGFALGTSMNHISFDGSGFKMFLENLAALSFNDDGPLAVVP  946
                  + P    QVT FKCGGF+LG  MNH  FDG G   F+ + A ++      L V P
Sbjct  147   AKNILEMPPMTAQVTRFKCGGFSLGLGMNHCMFDGLGAMEFVNSWAEMA-RGATELTVPP  205

Query  945   CNDRSLLAARSPPQVTFPHPELLKVNLPAGEEMAPPVFDSLKDDLAFEIFQLSSADIERL  766
               DR++L AR PP ++FPH E  ++   +  EMA  ++     +L +  F      +ER+
Sbjct  206   FLDRAVLRARDPPVISFPHHEFEEIADVS--EMAA-LYGG--QELVYRSFCFDPDRLERV  260

Query  765   KDKAKAPDNVKTKVTGFNVLTAAIWRCKALSCLGGENNSDRLSTVLFAVDIRRRLNPPLP  586
             +  A A  +++ + T F  L+  +WR +    LG     ++ + +LFAVD RRR  PPLP
Sbjct  261   RGLALADGDLE-RCTTFEALSGLVWRART-RALG--LAPEQQTKLLFAVDGRRRFVPPLP  316

Query  585   DSYSGNAVLTGYGSAKCAELEEGPFWKTVQMVYEGAARMTDEYARSAIDWGELYKGFPH-  409
               Y GN ++     A   +L   P  +    V E    +TDEY RSA+D+ E  +  P  
Sbjct  317   KGYFGNGIVLTNALATAGDLLSAPVSRAAGKVQEAVRMVTDEYMRSAVDYFEATRARPSL  376

Query  408   -GEFLVSSWWRLGFEGVQFPWGKPKYSCPVVYHRKDIILLFPDIDNGGKSNSGVNVLVAL  232
                 L+++W RL F G  F WG+P  S PV    K++IL        GK    +NVL+ L
Sbjct  377   ASTLLITTWSRLAFNGADFGWGEPAMSGPVTLPEKEVILFLAH----GKERKSINVLLGL  432

Query  231   PPKEMEKFKSLFHKF  187
             P   M+ F+ L  + 
Sbjct  433   PASAMDTFQELMDEI  447



>ref|XP_009600109.1| PREDICTED: omega-hydroxypalmitate O-feruloyl transferase-like 
[Nicotiana tomentosiformis]
Length=433

 Score =   215 bits (548),  Expect = 9e-60, Method: Compositional matrix adjust.
 Identities = 141/437 (32%), Positives = 222/437 (51%), Gaps = 33/437 (8%)
 Frame = -3

Query  1479  LIFPSQETTKHTMFLSNIDKVLNFDVQTVHFFPASPGFPPEIVAGKIKNAFRRLLVANTY  1300
             L+ P++ET K   +LSN+D+ +   V+T++ F +        V   IK A  ++LV   Y
Sbjct  21    LVSPAEETDKGLYYLSNLDQNIAVPVRTIYCFKSEEKRNENAVE-VIKEALSKVLVH--Y  77

Query  1299  DFLAGRLKKNKESERVEIECNAAGAGFTVASSEFALEDIGDLVYPNPAFRQLVTMSFDFV  1120
               LAGRL  ++E + + + C+  GA +  A +  ++EDIGD+  P+P    L  + +D  
Sbjct  78    YPLAGRLTISQEGKLI-VNCSGEGAVYVEAEANCSIEDIGDITKPDPV--TLGKLVYDIP  134

Query  1119  AKE---DQPLCFLQVTSFKCGGFALGTSMNHISFDGSGFKMFLENLAALSFNDDGPLAVV  949
               +   + P    QVT FKCGGF LG  MNH  FDG G   F+ +    +     P+ V 
Sbjct  135   GAKNILEMPPLIAQVTGFKCGGFVLGLCMNHCMFDGIGAMEFVNSWGETA--RGVPIKVP  192

Query  948   PCNDRSLLAARSPPQVTFPHPELLKVNLPAGEEMAPPVFDSLK---DDLAFEIFQLSSAD  778
             P  +RS+L AR+PP+  + H E  ++           + DS K   +++ ++ F      
Sbjct  193   PFLERSILKARNPPKFEYAHNEFAEIE---------DISDSTKLYQEEMLYKSFCFDPEK  243

Query  777   IERLKDKAKAPDNVKTKVTGFNVLTAAIWRCKALSCLGGENNSDRLSTVLFAVDIRRRLN  598
             +E+LK KAK   N+ TK T F  L+A +W+ +  +    +   D+ + +LFAVD R R +
Sbjct  244   LEQLKAKAKEDGNI-TKCTTFEALSAFVWKARTQAL---QMKPDQKTKLLFAVDGRSRFD  299

Query  597   PPLPDSYSGNAVLTGYGSAKCAELEEGPFWKTVQMVYEGAARMTDEYARSAIDWGELYKG  418
             P +P+ Y GN ++        AE+ E P    V++V E    +TD Y RSAID+ E  + 
Sbjct  300   PSIPEGYFGNGIVLTNALCNAAEIVENPLSVAVKLVQEAVKMVTDSYMRSAIDYFEATRV  359

Query  417   FPH--GEFLVSSWWRLGFEGVQFPWGKPKYSCPVVYHRKDIILLFPDIDNGGKSNSGVNV  244
              P      L+++W RL F    F WG+P  S PV    K++ L      + GK    +NV
Sbjct  360   RPSLTATLLITTWSRLSFHTTDFGWGEPVVSGPVALPEKEVSLFL----SHGKERRNINV  415

Query  243   LVALPPKEMEKFKSLFH  193
             L+ LP   M+ ++ L  
Sbjct  416   LLGLPASAMKTYEELME  432



>ref|XP_004235315.1| PREDICTED: omega-hydroxypalmitate O-feruloyl transferase [Solanum 
lycopersicum]
Length=433

 Score =   215 bits (547),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 146/437 (33%), Positives = 223/437 (51%), Gaps = 33/437 (8%)
 Frame = -3

Query  1479  LIFPSQETTKHTMFLSNIDKVLNFDVQTVHFFPASPGFPPEIVAGKIKNAFRRLLVANTY  1300
             L+ P++ET K   +LSN+D+ +   V+T++ F  S     +  A  +K+A  ++LV   Y
Sbjct  21    LVSPAEETEKGPYYLSNLDQNIAVPVRTIYCF-KSEEKGNDNAAEVMKDALSKVLVH--Y  77

Query  1299  DFLAGRLKKNKESERVEIECNAAGAGFTVASSEFALEDIGDLVYPNPAFRQLVTMSFDFV  1120
               LAGRL  ++E + + ++C+  GA F  A +   +EDIGD   P+P    L  + +D  
Sbjct  78    FPLAGRLTISQEMKLI-VDCSGEGAVFVEAEANCNIEDIGDNTKPDPV--TLGKLVYDIP  134

Query  1119  AKE---DQPLCFLQVTSFKCGGFALGTSMNHISFDGSGFKMFLENLAALSFNDDGPLAVV  949
               +   + P    QVT FKCGGF LG  MNH  FDG G   F+ +   ++     P+ V 
Sbjct  135   GAKNILEMPPLVAQVTKFKCGGFVLGLCMNHCMFDGIGAMEFVNSWGEIA--RGLPIKVP  192

Query  948   PCNDRSLLAARSPPQVTFPHPELLKVNLPAGEEMAPPVFDSLK---DDLAFEIFQLSSAD  778
             P  DRS+L  R+PP+  + H E  ++           + DS K   +++ ++ F      
Sbjct  193   PFLDRSILKPRNPPKPEYTHNEFAEIK---------DISDSTKLYQEEMMYKAFCFDPEK  243

Query  777   IERLKDKAKAPDNVKTKVTGFNVLTAAIWRCKALSCLGGENNSDRLSTVLFAVDIRRRLN  598
             +E+LK KAK   NV TK T F VL+A IW+ +  +    +   D+ + +LFAVD R R +
Sbjct  244   LEQLKAKAKEDGNV-TKCTSFEVLSAFIWKARTQAL---QMKPDQKTKLLFAVDGRSRFD  299

Query  597   PPLPDSYSGNAVLTGYGSAKCAELEEGPFWKTVQMVYEGAARMTDEYARSAIDWGELYKG  418
             P +P  Y GN ++        AE+ E P    V++V E    +TD Y +SAID+ E  + 
Sbjct  300   PSIPRGYFGNGIVLTNALCTAAEIVENPLSVAVKLVQEAVKLVTDSYMKSAIDYFETTRA  359

Query  417   FPH--GEFLVSSWWRLGFEGVQFPWGKPKYSCPVVYHRKDIILLFPDIDNGGKSNSGVNV  244
              P      L+++W RL F    F WG+P  S PV    K++ L      + GK    VNV
Sbjct  360   RPSLTATLLITTWSRLSFHTTDFGWGEPIVSGPVALPEKEVSLFL----SHGKERRSVNV  415

Query  243   LVALPPKEMEKFKSLFH  193
             L+ LP   M+ F+ L  
Sbjct  416   LLGLPASAMKTFEELME  432



>ref|XP_002962552.1| BAHD family acyltransferase, clade V [Selaginella moellendorffii]
 gb|EFJ36015.1| BAHD family acyltransferase, clade V [Selaginella moellendorffii]
Length=449

 Score =   215 bits (548),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 136/455 (30%), Positives = 229/455 (50%), Gaps = 32/455 (7%)
 Frame = -3

Query  1506  LKVTILDSGLIFPSQETTKHTMFLSNIDKVLNFDVQTVHFFPASPGFPPEIVAGKIKNAF  1327
             L VT+       P+  T +  +FL NID  + F V +++F+ +     P+++   ++ A 
Sbjct  6     LPVTLQSCSSALPAGPTPRAKIFLPNIDLTVVFMVDSIYFYSSGAADAPKVLFRALQEA-  64

Query  1326  RRLLVANTYDFLAGRLKKNKESERVEIECNAAGAGFTVASSEFALEDIGDLVYPNPAFRQ  1147
                 +   Y F AGRL  ++E++R+EI+ N+AG  F  A S+  + D+GDL  PN  +R 
Sbjct  65    ----MVEFYPF-AGRLAVSEETQRLEIDANSAGVPFVEAVSDLNIADLGDLTLPNALYRN  119

Query  1146  LVTMSFDFVAKEDQPLCFLQVTSFKCGGFALGTSMNHISFDGSGFKMFLENLAALSFNDD  967
             LV  + +     D PL  +QVT F CGGF+ G S+NH   DG     F+++L + +   +
Sbjct  120   LVFTATNVKVLSDWPLATVQVTKFLCGGFSFGLSVNHALADGISIIDFMQHLTSKARGVE  179

Query  966   GPLAVVPCNDRSLLAARSPPQVTFPHPELLKVNLPAGEEMAPPVFDSLKD----------  817
                      DR++LAAR  P    P  +   V   A E  +   F +++D          
Sbjct  180   NFQLPELQFDRTMLAARPQPT---PKIDFGDVYYKASEIPSTNSFSTMEDMVVSTNLASG  236

Query  816   -----DLAFEIFQLSSADIERLKDKAKAPDNVKTKVTGFNVLTAAIWRCKALSCLGGENN  652
                  DL      + ++ +E LK  A + D   T+ + F+V+   +W+ +  + +G    
Sbjct  237   NYVVTDLVSRAINIPASKVEYLKKLAMS-DGTITRCSTFDVVATYVWKLRT-AAMGMP--  292

Query  651   SDRLSTVLFAVDIRRRLNPPLPDSYSGNAVLTGYGSAKCAELEEGPFWKTVQMVYEGAAR  472
              +  +T+  AVD+ +++ PP+P  + GN         K  EL + P    + +V E   R
Sbjct  293   LEHQATMFMAVDVSKKVTPPIPRGFVGNRAFPVAVRMKTEELLKKPLSHCLTVVREALLR  352

Query  471   MTDEYARSAIDWGELYKGFP--HGEFLVSSWWRLGFEGVQFPWGKPKYSCPVVYHRKDII  298
               DE+ RS IDW E+++G P  +G F +SSWW+  F  + F WGKP Y  PV+  R + +
Sbjct  353   ADDEFVRSWIDWSEIHRGIPRFNGGFYISSWWKFPFYEMDFGWGKPIYMGPVLTQRVEFV  412

Query  297   LLFPDIDNGGKSNSGVNVLVALPPKEMEKFKSLFH  193
             L+ P   +  +   GV+VL+ + P+ M +F++L +
Sbjct  413   LILP--VSPSRPEGGVDVLLTINPQHMARFETLVN  445



>ref|XP_002512898.1| Anthranilate N-benzoyltransferase protein, putative [Ricinus 
communis]
 gb|EEF49401.1| Anthranilate N-benzoyltransferase protein, putative [Ricinus 
communis]
Length=433

 Score =   215 bits (547),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 152/435 (35%), Positives = 221/435 (51%), Gaps = 30/435 (7%)
 Frame = -3

Query  1479  LIFPSQETTKHTMFLSNIDKVLNFDVQTVHFFPASPGFPPEIVAGKIKNAFRRLLVANTY  1300
             L+ P ++T K   FLSN+D+ +   V+TV+ F +        V   IKNA +++LV   Y
Sbjct  20    LVAPEKDTEKGLYFLSNLDQNIAVIVRTVYCFKSDEKGNENSVE-VIKNALKKVLVH--Y  76

Query  1299  DFLAGRLKKNKESERVEIECNAAGAGFTVASSEFALEDIGDLVYPNPAFRQLVTMSFDFV  1120
               LAGRL  + E + + I C   GA F  A +  ALE+IGD+  P+P    L  + +D  
Sbjct  77    YPLAGRLTISSEGKLI-INCTGEGAVFVEAEANCALEEIGDITKPDP--HTLGKLVYDIP  133

Query  1119  AKED---QPLCFLQVTSFKCGGFALGTSMNHISFDGSGFKMFLENLAALSFNDDGPLAVV  949
               ++    P    QVT+FKCGGFALG  MNH  FDG G   F+ +    +     PL+V 
Sbjct  134   DAKNILQMPPLVAQVTNFKCGGFALGLCMNHCMFDGIGAMEFVNSWGETA--RGLPLSVP  191

Query  948   PCNDRSLLAARSPPQVTFPHPELLKVNLPAGEEMAPPVFDSLKDDLAFEIFQLSSADIER  769
             P  DRSLL AR+PP++ + H E  ++     E+ +       +D++ +  F      +E 
Sbjct  192   PFVDRSLLKARNPPKIEYLHQEFAEI-----EDRSDTNKLYKEDEMIYSSFCFDPEMLEN  246

Query  768   LKDKAKAPDNVKTKVTGFNVLTAAIWRC--KALSCLGGENNSDRLSTVLFAVDIRRRLNP  595
             +K KA   D V  K T F  L+A +WR   KAL  L      ++ + +LFAVD R + NP
Sbjct  247   IKTKA-LEDGVLDKCTTFESLSAFVWRARTKALKML-----PEQQTKLLFAVDGRPKFNP  300

Query  594   PLPDSYSGNAVLTGYGSAKCAELEEGPFWKTVQMVYEGAARMTDEYARSAIDWGELYKGF  415
             PLP  Y GN ++      +  EL   P    V +V +    +TD Y RSA+D+ E+ +  
Sbjct  301   PLPKGYFGNGIVLTNSICEAGELLGKPLSYGVGLVQDAIKMVTDSYMRSAMDYFEVTRAR  360

Query  414   PH--GEFLVSSWWRLGFEGVQFPWGKPKYSCPVVYHRKDIILLFPDIDNGGKSNSGVNVL  241
             P      L+++W RL F    F WG P  S PV    K++IL      + GK    +NVL
Sbjct  361   PSLASTLLITTWSRLSFHITDFGWGDPILSGPVALPEKEVILFL----SHGKERRNINVL  416

Query  240   VALPPKEMEKFKSLF  196
             + LP   M+ F+ L 
Sbjct  417   LGLPASAMKIFQELM  431



>gb|KDO63871.1| hypothetical protein CISIN_1g014029mg [Citrus sinensis]
Length=432

 Score =   215 bits (547),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 152/445 (34%), Positives = 219/445 (49%), Gaps = 31/445 (7%)
 Frame = -3

Query  1509  DLKVTILDSGLIFPSQETTKHTMFLSNIDKVLNFDVQTVHFFPASPGFPPEIVAGKIKNA  1330
             +L V   +  L+ P+++T K   FLSN+D+ +   V+T++ F +      E     IKNA
Sbjct  10    ELNVKQGEPTLVKPAEDTEKGLYFLSNLDQNIAVIVRTIYCFKSDEK-GNEKAGEVIKNA  68

Query  1329  FRRLLVANTYDFLAGRLKKNKESERVEIECNAAGAGFTVASSEFALEDIGDLVYPNPAFR  1150
               ++LV   Y  LAGRL  + E + + I C   GA F  A +   LE IGD+  P+P   
Sbjct  69    LEKVLVH--YYPLAGRLTISSEGKLI-INCTGEGAVFVEAEANCVLEKIGDITKPDP--E  123

Query  1149  QLVTMSFDFVAKE---DQPLCFLQVTSFKCGGFALGTSMNHISFDGSGFKMFLENLAALS  979
              L  + +D    +   + P    QVT FKCGGF LG  MNH  FDG G   F+   A  +
Sbjct  124   TLGKLVYDIPGAKNILEMPPLAAQVTRFKCGGFVLGLCMNHCMFDGIGAMEFVNAWAETA  183

Query  978   FNDDGPLAVVPCNDRSLLAARSPPQVTFPHPELLKVNLPAGEEMAPPVFDSLKDDLAFEI  799
                  PL + P  DRS+L ARSPP++   H E  ++   +G        +  KD++ +  
Sbjct  184   --RGLPLKIPPFLDRSILKARSPPKIEDLHQEFAEIEDKSGTS------ELYKDEMLYRS  235

Query  798   FQLSSADIERLKDKAKAPDNVKTKVTGFNVLTAAIW--RCKALSCLGGENNSDRLSTVLF  625
             F   SA +E++K  A   D V  K + F  L+A +W  R KAL  L  +      + +LF
Sbjct  236   FCFDSAKLEKIKMIA-MEDEVLDKCSTFEALSAFVWKARTKALKFLPHQQ-----TKLLF  289

Query  624   AVDIRRRLNPPLPDSYSGNAVLTGYGSAKCAELEEGPFWKTVQMVYEGAARMTDEYARSA  445
             AVD R + NPPLP  Y GN ++      +  EL E P    V  V +    + D Y RSA
Sbjct  290   AVDGRSKFNPPLPKGYFGNGIVLTNSICQAGELTEKPLSFAVGQVQDAIKMVNDSYMRSA  349

Query  444   IDWGELYKGFP--HGEFLVSSWWRLGFEGVQFPWGKPKYSCPVVYHRKDIILLFPDIDNG  271
             ID+ E+ +  P      L+++W RL F    F WG+P  S PV    K++ L      + 
Sbjct  350   IDYFEVTRARPSLSSTLLITTWSRLSFHTTDFGWGEPVLSGPVALPEKEVSLFL----SH  405

Query  270   GKSNSGVNVLVALPPKEMEKFKSLF  196
             GK    +NVL+ LP   M+ F+ L 
Sbjct  406   GKERKSINVLLGLPASAMKIFQELM  430



>gb|ACN28372.1| unknown [Zea mays]
 gb|AFW84462.1| transferase [Zea mays]
Length=453

 Score =   215 bits (548),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 155/444 (35%), Positives = 220/444 (50%), Gaps = 34/444 (8%)
 Frame = -3

Query  1479  LIFPSQET-TKHTMFLSNIDKVLNFDVQTVHFF-PASPGFPPEI----VAGKIKNAFRRL  1318
             L+ P++ T T    +LSN+D+ +   VQTV+ + P+SPG         VAG +++A  R+
Sbjct  31    LVPPAEATPTGGQYYLSNLDQNIAVIVQTVYCYKPSSPGGGEGKEDVDVAGALRDALARV  90

Query  1317  LVANTYDFLAGRLKKNKESERVEIECNAAGAGFTVASSEFALEDIGDLVYPNPA-FRQLV  1141
             LV   Y  LAGRL  + E  ++ +E    GA F  A +   L+ +GDL  P+PA   QLV
Sbjct  91    LV--HYHPLAGRLGVSPEM-KLTVELTGEGAVFVEADAACDLDAVGDLTKPDPAALGQLV  147

Query  1140  TMSFDFVAKEDQPLCFLQVTSFKCGGFALGTSMNHISFDGSGFKMFLENLAALSFNDDGP  961
                       + P    QVT FKCGGFALG +MNH  FDG G   F+ + A  +      
Sbjct  148   YSVPGAKHILEMPPMTAQVTRFKCGGFALGLAMNHCMFDGIGAMEFVNSWAETA-RGVAE  206

Query  960   LAVVPCNDRSLLAARSPPQVTFPHPELLKVNLPAGEEMAPPVFDSLK----DDLAFEIFQ  793
             L V P  DRS+L AR PP  TFPH E  ++         P V D+       +L +  F 
Sbjct  207   LTVPPFLDRSVLKARDPPVPTFPHHEFAEI---------PDVSDTAALYGAQELLYRSFC  257

Query  792   LSSADIERLKDKAKAPDNVKTKVTGFNVLTAAIWRCKALSCLGGENNSDRLSTVLFAVDI  613
                  +ER++  A A D    + T F  L+  +WR +    LG     ++ + +LFAVD 
Sbjct  258   FDPDRLERVRGLALA-DGALGRCTTFEALSGLVWRART-RALG--LAPEQRTKLLFAVDG  313

Query  612   RRRLNPPLPDSYSGNAVLTGYGSAKCAELEEGPFWKTVQMVYEGAARMTDEYARSAIDWG  433
             RRR  PPLP  Y GN ++     A   EL   P  +   +V +    +TD+Y RSA+D+ 
Sbjct  314   RRRFAPPLPRGYFGNGIVLTNALATAGELLSAPVSRAAGLVQDAVRMVTDDYMRSAVDYF  373

Query  432   ELYKGFPH--GEFLVSSWWRLGFEGVQFPWGKPKYSCPVVYHRKDIILLFPDIDNGGKSN  259
             E  +  P      L+++W RL F G  F WG+P  S PV    K++IL        GK  
Sbjct  374   EATRARPSLASTLLITTWSRLEFHGADFGWGEPVMSGPVTLPEKEVILFLAH----GKER  429

Query  258   SGVNVLVALPPKEMEKFKSLFHKF  187
               +NVL+ LP   M+ F+ L  + 
Sbjct  430   KSINVLLGLPATAMDAFQELMDEI  453



>gb|KDP41799.1| hypothetical protein JCGZ_26817 [Jatropha curcas]
Length=434

 Score =   214 bits (545),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 144/436 (33%), Positives = 223/436 (51%), Gaps = 30/436 (7%)
 Frame = -3

Query  1479  LIFPSQETTKHTMFLSNIDKVLNFDVQTVHFFPASPGFPPEIVAGKIKNAFRRLLVANTY  1300
             L+ P +ET K   FLSN+D+ +   V+TV+ F ++        A  I+NA +++LV   Y
Sbjct  21    LVTPEEETEKGLYFLSNLDQNIAVIVRTVYCFKSNEEGNAN-SAEVIRNALKKVLVH--Y  77

Query  1299  DFLAGRLKKNKESERVEIECNAAGAGFTVASSEFALEDIGDLVYPNPAFRQLVTMSFDFV  1120
               LAGRL  + E + + + CN  GA F  A +  A+E+IGD+  P+P    L  + +D  
Sbjct  78    YPLAGRLTISSEGKLI-VNCNGEGAVFVEAEANCAMEEIGDITKPDP--DTLGKLVYDIP  134

Query  1119  AKE---DQPLCFLQVTSFKCGGFALGTSMNHISFDGSGFKMFLENLAALSFNDDGPLAVV  949
               +   + P    QVT FKCGGF LG  MNH  FDG G   F+ +    +     PL++ 
Sbjct  135   GAKNILEMPPLVAQVTKFKCGGFVLGLCMNHCMFDGIGAMEFVNSWGETA--RGLPLSIP  192

Query  948   PCNDRSLLAARSPPQVTFPHPELLKVNLPAGEEMAPPVFDSLKDDLAFEIFQLSSADIER  769
             P  DR++L AR+PP+  + H E  ++     E+ +       ++++ +  F  +   + +
Sbjct  193   PFIDRTILKARNPPKTEYNHQEFAEI-----EDKSKTNTLYKEEEILYNSFCFNPEMLNK  247

Query  768   LKDKAKAPDNVKTKVTGFNVLTAAIWRC--KALSCLGGENNSDRLSTVLFAVDIRRRLNP  595
             +K KA   D +  K T F  L+A +WR   KAL+ +      D+ + +LFAVD R + NP
Sbjct  248   IKTKA-MEDGILEKCTTFETLSAFVWRARTKALNLV-----PDQETKLLFAVDGRPKFNP  301

Query  594   PLPDSYSGNAVLTGYGSAKCAELEEGPFWKTVQMVYEGAARMTDEYARSAIDWGELYKGF  415
              LP+ Y GN ++      K +EL + P    V +V      +TD Y RSAID+ E+ +  
Sbjct  302   KLPEGYFGNGIVLTNSICKVSELLDSPLSYAVGLVQNSIKMVTDSYMRSAIDYFEVTRAR  361

Query  414   PH--GEFLVSSWWRLGFEGVQFPWGKPKYSCPVVYHRKDIILLFPDIDNGGKSNSGVNVL  241
             P      L+++W RL F    F WG+P  S PV    K++IL      + G     +NVL
Sbjct  362   PSLASTLLITTWSRLSFHTTDFGWGEPILSGPVALPEKEVILFL----SHGNERKSINVL  417

Query  240   VALPPKEMEKFKSLFH  193
             + LP   M+ F+ L  
Sbjct  418   LGLPASAMKVFQELMQ  433



>ref|XP_006447016.1| hypothetical protein CICLE_v10015302mg [Citrus clementina]
 gb|ESR60256.1| hypothetical protein CICLE_v10015302mg [Citrus clementina]
Length=432

 Score =   214 bits (545),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 152/445 (34%), Positives = 219/445 (49%), Gaps = 31/445 (7%)
 Frame = -3

Query  1509  DLKVTILDSGLIFPSQETTKHTMFLSNIDKVLNFDVQTVHFFPASPGFPPEIVAGKIKNA  1330
             +L V   +  L+ P+++T K   FLSN+D+ +   V+T++ F +      E     IKNA
Sbjct  10    ELNVKQGEPTLVKPAEDTEKGLYFLSNLDQNIAVIVRTIYCFKSDEK-GNEKAGEVIKNA  68

Query  1329  FRRLLVANTYDFLAGRLKKNKESERVEIECNAAGAGFTVASSEFALEDIGDLVYPNPAFR  1150
               ++LV   Y  LAGRL  + E + + I C   GA F  A +   LE IGD+  P+P   
Sbjct  69    LEKVLVH--YYPLAGRLTISSEGKLI-INCTGEGAVFVEAEANCVLEKIGDITKPDP--E  123

Query  1149  QLVTMSFDFVAKE---DQPLCFLQVTSFKCGGFALGTSMNHISFDGSGFKMFLENLAALS  979
              L  + +D    +   + P    QVT FKCGGF LG  MNH  FDG G   F+   A  +
Sbjct  124   TLGKLVYDIPGAKNILEMPPLAAQVTRFKCGGFVLGLCMNHCMFDGIGAMEFVNAWAETA  183

Query  978   FNDDGPLAVVPCNDRSLLAARSPPQVTFPHPELLKVNLPAGEEMAPPVFDSLKDDLAFEI  799
                  PL + P  DRS+L ARSPP++   H E  ++   +G        +  KD++ +  
Sbjct  184   --RGLPLKIPPFLDRSILKARSPPKIEDLHQEFAEIEDKSGTS------ELYKDEMLYRS  235

Query  798   FQLSSADIERLKDKAKAPDNVKTKVTGFNVLTAAIW--RCKALSCLGGENNSDRLSTVLF  625
             F   SA +E++K  A   D V  K + F  L+A +W  R KAL  L  +      + +LF
Sbjct  236   FCFDSAKLEKIKMIA-MEDEVLDKCSTFEALSAFVWKARTKALKFLPHQQ-----TKLLF  289

Query  624   AVDIRRRLNPPLPDSYSGNAVLTGYGSAKCAELEEGPFWKTVQMVYEGAARMTDEYARSA  445
             AVD R + NPPLP  Y GN ++      +  EL E P    V  V +    + D Y RSA
Sbjct  290   AVDGRSKFNPPLPKGYFGNGIVLTNSICQAGELTEKPLSFAVGQVQDAIKMVNDIYMRSA  349

Query  444   IDWGELYKGFP--HGEFLVSSWWRLGFEGVQFPWGKPKYSCPVVYHRKDIILLFPDIDNG  271
             ID+ E+ +  P      L+++W RL F    F WG+P  S PV    K++ L      + 
Sbjct  350   IDYFEVTRARPSLSSTLLITTWSRLSFHTTDFGWGEPVLSGPVALPEKEVSLFL----SH  405

Query  270   GKSNSGVNVLVALPPKEMEKFKSLF  196
             GK    +NVL+ LP   M+ F+ L 
Sbjct  406   GKERKSINVLLGLPASAMKIFQELM  430



>ref|XP_006470104.1| PREDICTED: omega-hydroxypalmitate O-feruloyl transferase-like 
[Citrus sinensis]
Length=442

 Score =   214 bits (545),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 152/445 (34%), Positives = 219/445 (49%), Gaps = 31/445 (7%)
 Frame = -3

Query  1509  DLKVTILDSGLIFPSQETTKHTMFLSNIDKVLNFDVQTVHFFPASPGFPPEIVAGKIKNA  1330
             +L V   +  L+ P+++T K   FLSN+D+ +   V+T++ F +      E     IKNA
Sbjct  20    ELNVKQGEPTLVKPAEDTEKGLYFLSNLDQNIAVIVRTIYCFKSDEK-GNEKAGEVIKNA  78

Query  1329  FRRLLVANTYDFLAGRLKKNKESERVEIECNAAGAGFTVASSEFALEDIGDLVYPNPAFR  1150
               ++LV   Y  LAGRL  + E + + I C   GA F  A +   LE IGD+  P+P   
Sbjct  79    LEKVLVH--YYPLAGRLTISSEGKLI-INCTGEGAVFVEAEANCVLEKIGDITKPDP--E  133

Query  1149  QLVTMSFDFVAKE---DQPLCFLQVTSFKCGGFALGTSMNHISFDGSGFKMFLENLAALS  979
              L  + +D    +   + P    QVT FKCGGF LG  MNH  FDG G   F+   A  +
Sbjct  134   TLGKLVYDIPGAKNILEMPPLAAQVTRFKCGGFVLGLCMNHCMFDGIGAMEFVNAWAETA  193

Query  978   FNDDGPLAVVPCNDRSLLAARSPPQVTFPHPELLKVNLPAGEEMAPPVFDSLKDDLAFEI  799
                  PL + P  DRS+L ARSPP++   H E  ++   +G        +  KD++ +  
Sbjct  194   --RGLPLKIPPFLDRSILKARSPPKIEDLHQEFAEIEDKSGTS------ELYKDEMLYRS  245

Query  798   FQLSSADIERLKDKAKAPDNVKTKVTGFNVLTAAIW--RCKALSCLGGENNSDRLSTVLF  625
             F   SA +E++K  A   D V  K + F  L+A +W  R KAL  L  +      + +LF
Sbjct  246   FCFDSAKLEKIKMIA-MEDEVLDKCSTFEALSAFVWKARTKALKFLPHQQ-----TKLLF  299

Query  624   AVDIRRRLNPPLPDSYSGNAVLTGYGSAKCAELEEGPFWKTVQMVYEGAARMTDEYARSA  445
             AVD R + NPPLP  Y GN ++      +  EL E P    V  V +    + D Y RSA
Sbjct  300   AVDGRSKFNPPLPKGYFGNGIVLTNSICQAGELTEKPLSFAVGQVQDAIKMVNDIYMRSA  359

Query  444   IDWGELYKGFP--HGEFLVSSWWRLGFEGVQFPWGKPKYSCPVVYHRKDIILLFPDIDNG  271
             ID+ E+ +  P      L+++W RL F    F WG+P  S PV    K++ L      + 
Sbjct  360   IDYFEVTRARPSLSSTLLITTWSRLSFHTTDFGWGEPVLSGPVALPEKEVSLFL----SH  415

Query  270   GKSNSGVNVLVALPPKEMEKFKSLF  196
             GK    +NVL+ LP   M+ F+ L 
Sbjct  416   GKERKSINVLLGLPASAMKIFQELM  440



>ref|XP_009383405.1| PREDICTED: omega-hydroxypalmitate O-feruloyl transferase-like 
[Musa acuminata subsp. malaccensis]
Length=432

 Score =   214 bits (544),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 147/448 (33%), Positives = 224/448 (50%), Gaps = 29/448 (6%)
 Frame = -3

Query  1518  LHEDLKVTIL--DSGLIFPSQETTKHTMFLSNIDKVLNFDVQTVHFFPASPGFPPEIVAG  1345
             L E  ++T+   +  L+ P++ET K   FL+N+D+ +   VQT++ F +      E+ A 
Sbjct  5     LREKFELTVRQGEPTLVPPAEETEKGFYFLTNLDQNIAVIVQTIYCFKSEEK-GNEMAAE  63

Query  1344  KIKNAFRRLLVANTYDFLAGRLKKNKESERVEIECNAAGAGFTVASSEFALEDIGDLVYP  1165
              IK+A  ++LV   Y  LAGRL  + E + + ++C   GA F  A ++  +ED+GD+  P
Sbjct  64    VIKDALAQVLV--RYYPLAGRLTISNEGKLI-VDCTREGAVFVEAEADCKMEDVGDITKP  120

Query  1164  NP-AFRQLVTMSFDFVAKEDQPLCFLQVTSFKCGGFALGTSMNHISFDGSGFKMFLENLA  988
             +P    +LV          + PL   QVT F CGGF LG +MNH  FDG G   F+ +  
Sbjct  121   DPDTLGKLVYSVPGAKNILEMPLLAAQVTKFSCGGFILGLAMNHCMFDGLGAMEFVNSWG  180

Query  987   ALSFNDDGPLAVVPCNDRSLLAARSPPQVTFPHPELLKVNLPAGEEMAPPVFDSLKDDLA  808
               +     P++V P  DRS+L +R PP + FPH E  ++      E         ++++ 
Sbjct  181   ETARGL--PISVPPFIDRSVLRSRDPPVINFPHREFSEI------EDVSDATTLYQEEML  232

Query  807   FEIFQLSSADIERLKDKAKAPDNVKTKVTGFNVLTAAIWRCK--ALSCLGGENNSDRLST  634
             +  F   +  +ER+K KA A D      T F  L+  +WR +  AL    G+      + 
Sbjct  233   YRSFCFDTEKLERVKKKAMA-DGTLDGCTTFEALSGLVWRARTEALKLQPGQK-----TK  286

Query  633   VLFAVDIRRRLNPPLPDSYSGNAVLTGYGSAKCAELEEGPFWKTVQMVYEGAARMTDEYA  454
             +LFAVD R R +PPLP  + GN ++         EL   P    V +V +    +TDEY 
Sbjct  287   LLFAVDGRSRFDPPLPKGFFGNGIVLTNSLCTAGELLGRPLSFAVGLVQDAVGMVTDEYM  346

Query  453   RSAIDWGELYKGFPH--GEFLVSSWWRLGFEGVQFPWGKPKYSCPVVYHRKDIILLFPDI  280
             RSA+D+ E  +  P      L+++W RL F    F WG+P  S PV    K++IL     
Sbjct  347   RSAMDYFEATRARPSLTATLLITTWSRLSFHITDFGWGEPVQSGPVTLPEKEVILFL---  403

Query  279   DNGGKSNSGVNVLVALPPKEMEKFKSLF  196
              + GK +  +NVL+ LP   M  F+ L 
Sbjct  404   -SHGKESKSINVLLGLPSSAMASFQKLM  430



>ref|XP_008231077.1| PREDICTED: omega-hydroxypalmitate O-feruloyl transferase-like 
[Prunus mume]
Length=436

 Score =   214 bits (544),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 148/446 (33%), Positives = 228/446 (51%), Gaps = 32/446 (7%)
 Frame = -3

Query  1506  LKVTILDSGLIFPSQETTKHTMFLSNIDKVLNFDVQTVHFFPASPGFPPEIVAGK-IKNA  1330
             L+V   +  L+ P++ET K   FLSN+D+ +   V+T++ F +      +  AG+ IK++
Sbjct  14    LRVKQGEPTLVSPAEETEKGLYFLSNLDQNIAVTVRTIYCFKSDDKGNDK--AGEVIKDS  71

Query  1329  FRRLLVANTYDFLAGRLKKNKESERVEIECNAAGAGFTVASSEFALEDIGDLVYPNPAFR  1150
              +++LV   Y  LAGRL  + E + + ++C   GA F  A ++  +EDIGD+  P+P   
Sbjct  72    LKKVLVY--YYPLAGRLTISSEGKLI-VDCTGEGAVFVEAEADCRIEDIGDITKPDP--E  126

Query  1149  QLVTMSFDFVAKE---DQPLCFLQVTSFKCGGFALGTSMNHISFDGSGFKMFLENLAALS  979
              L  + +D    +   + P    QVT FKCGGFALG  MNH  FDG G   F+ + A ++
Sbjct  127   TLGKLVYDVPGTKNILELPPLVAQVTKFKCGGFALGLCMNHCMFDGIGAMEFVNSWAKIA  186

Query  978   FNDDGPLAVVPCNDRSLLAARSPPQVTFPHPELLKVNLPAGEEMAPPVFDSLKDDLAFEI  799
                  PL   P  DRS+L AR+PP +   H E  ++   +         D  ++ + +  
Sbjct  187   --RGLPLTAPPFLDRSILKARNPPTIEHLHQEFSEIIGTSSTSN-----DLSEEKMLYSS  239

Query  798   FQLSSADIERLKDKAKAPDNVKTKVTGFNVLTAAIW--RCKALSCLGGENNSDRLSTVLF  625
             F   S  +E++K KA+  D      T F  L+A +W  R +AL  L      ++   +LF
Sbjct  240   FCFDSEKLEKVKMKARE-DRALDNCTTFEALSAFVWKARTRALKLL-----PEQQIKLLF  293

Query  624   AVDIRRRLNPPLPDSYSGNAVLTGYGSAKCAELEEGPFWKTVQMVYEGAARMTDEYARSA  445
             AVD RR+ +PPLP  Y GN ++      +  +L E P    V +V +    +TD Y RSA
Sbjct  294   AVDGRRKFSPPLPKGYFGNGIVLTNSICQAGDLLEKPLSHAVGLVQDAIKMVTDSYMRSA  353

Query  444   IDWGELYKGFPH--GEFLVSSWWRLGFEGVQFPWGKPKYSCPVVYHRKDIILLFPDIDNG  271
             ID+ EL +  P      L+++W RL F    F WG+P  S PV    K++IL   +    
Sbjct  354   IDYFELTRARPSLASTLLITTWSRLSFYTTDFGWGEPILSGPVALPEKEVILFLSN----  409

Query  270   GKSNSGVNVLVALPPKEMEKFKSLFH  193
             G     +NVL+ LP   M+ F+ L +
Sbjct  410   GTEKKNINVLLGLPASAMKVFQELMN  435



>ref|XP_009770247.1| PREDICTED: omega-hydroxypalmitate O-feruloyl transferase-like 
[Nicotiana sylvestris]
Length=433

 Score =   213 bits (543),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 141/437 (32%), Positives = 221/437 (51%), Gaps = 33/437 (8%)
 Frame = -3

Query  1479  LIFPSQETTKHTMFLSNIDKVLNFDVQTVHFFPASPGFPPEIVAGKIKNAFRRLLVANTY  1300
             L+ P++ET     +LSN+D+ +   V+T++ F +        V   IK A  ++LV   Y
Sbjct  21    LVSPAEETDMGLYYLSNLDQNIAVPVRTIYCFKSEEKGNENAVE-VIKEALSKVLVH--Y  77

Query  1299  DFLAGRLKKNKESERVEIECNAAGAGFTVASSEFALEDIGDLVYPNPAFRQLVTMSFDFV  1120
               LAGRL  ++E + + + C+  GA +  A +  ++EDIGD+  P+P    L  + +D  
Sbjct  78    YPLAGRLTISQEGKLI-VNCSGEGAVYVEAEANCSIEDIGDITKPDPV--TLGKLVYDIP  134

Query  1119  AKE---DQPLCFLQVTSFKCGGFALGTSMNHISFDGSGFKMFLENLAALSFNDDGPLAVV  949
               +   + P    QVT FKCGGF LG  MNH  FDG G   F+ +    +     P+ V 
Sbjct  135   GAKNILEMPPLIAQVTKFKCGGFVLGLCMNHCMFDGIGAMEFVNSWGETA--RGVPIKVP  192

Query  948   PCNDRSLLAARSPPQVTFPHPELLKVNLPAGEEMAPPVFDSLK---DDLAFEIFQLSSAD  778
             P  DRS+L AR+PP+  + H E  ++           + DS K   +++ ++ F      
Sbjct  193   PFLDRSILKARNPPKFEYAHNEFAEIE---------DISDSTKLYQEEMLYKSFCFDPEK  243

Query  777   IERLKDKAKAPDNVKTKVTGFNVLTAAIWRCKALSCLGGENNSDRLSTVLFAVDIRRRLN  598
             +E+LK KAK   N+ TK T F  L+A +W+ +  +    +   D+ + +LFAVD R R +
Sbjct  244   LEQLKAKAKEDGNI-TKCTIFEALSAFVWKARTQAL---QMKPDQKTKLLFAVDGRSRFD  299

Query  597   PPLPDSYSGNAVLTGYGSAKCAELEEGPFWKTVQMVYEGAARMTDEYARSAIDWGELYKG  418
             P +P+ Y GN ++        AE+ + P    V++V E    +TD Y RSAID+ E  + 
Sbjct  300   PSIPEGYFGNGIVLTNALCNAAEIVDNPLSVAVKLVQEAVKMVTDSYMRSAIDYFEATRV  359

Query  417   FPH--GEFLVSSWWRLGFEGVQFPWGKPKYSCPVVYHRKDIILLFPDIDNGGKSNSGVNV  244
              P      L+++W RL F    F WG+P  S PV    K++ L      + GK    +NV
Sbjct  360   RPSLTATLLITTWSRLSFHTTDFGWGEPVVSGPVALPEKEVSLFL----SHGKERRNINV  415

Query  243   LVALPPKEMEKFKSLFH  193
             L+ LP   M+ F+ L  
Sbjct  416   LLGLPASAMKTFEELME  432



>ref|XP_004304536.1| PREDICTED: omega-hydroxypalmitate O-feruloyl transferase-like 
isoform 2 [Fragaria vesca subsp. vesca]
Length=435

 Score =   213 bits (543),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 149/446 (33%), Positives = 227/446 (51%), Gaps = 30/446 (7%)
 Frame = -3

Query  1506  LKVTILDSGLIFPSQETTKHTMFLSNIDKVLNFDVQTVHFFPASPGFPPEIVAGK-IKNA  1330
             L+V   +  L+ P++ET K   FLSN+D+ +   V+T++ F +      +  AG+ IK+A
Sbjct  11    LRVKQGEPTLVSPAEETDKGLYFLSNLDQNIAVIVRTIYCFKSDEKDNSK--AGEVIKDA  68

Query  1329  FRRLLVANTYDFLAGRLKKNKESERVEIECNAAGAGFTVASSEFALEDIGDLVYPNPAFR  1150
              +++LV   Y  LAGRL  + E + + ++C   GA F  A ++  +EDIGD+  P+P   
Sbjct  69    LKKVLVH--YYPLAGRLAISSEGKLI-VDCTGEGAVFVEAEADCTIEDIGDITKPDP--E  123

Query  1149  QLVTMSFDFVAKE---DQPLCFLQVTSFKCGGFALGTSMNHISFDGSGFKMFLENLAALS  979
              L  + +D    +   + P    QVT FKCGGF+LG  MNH  FDG G   F+ +    +
Sbjct  124   TLGKLVYDIPGAKNILEVPPLVAQVTKFKCGGFSLGLCMNHCMFDGIGAMEFVNSWGQTA  183

Query  978   FNDDGPLAVVPCNDRSLLAARSPPQVTFPHPELLKVNLPAGEEMAPPVFDSLKDDLAFEI  799
                  PL V P  DRS+L AR+PP++   H E  ++ +           D  +D + +  
Sbjct  184   RG--LPLQVAPFLDRSILKARNPPKIDHLHQEFSEL-IDGNSSCNSSEVD--EDKMLYRS  238

Query  798   FQLSSADIERLKDKAKAPDNVKTKVTGFNVLTAAIW--RCKALSCLGGENNSDRLSTVLF  625
             F   +  +E+LK KA+  D    K + F  L+A +W  R +AL  L      ++   +LF
Sbjct  239   FCFDTEKLEKLKAKARE-DGALDKCSTFEALSAFVWKARTRALRLL-----PEQQIKLLF  292

Query  624   AVDIRRRLNPPLPDSYSGNAVLTGYGSAKCAELEEGPFWKTVQMVYEGAARMTDEYARSA  445
             AVD R + NPPLP  Y GN ++      +  EL E P    V +V +    +TD Y RSA
Sbjct  293   AVDGRPKFNPPLPKGYFGNGIVLTNSICEAGELLEKPLSHAVGLVQDAIKMVTDGYMRSA  352

Query  444   IDWGELYKGFPH--GEFLVSSWWRLGFEGVQFPWGKPKYSCPVVYHRKDIILLFPDIDNG  271
             ID+ E  +  P      L+++W RL F    F WG+P  S PV    K++IL   +    
Sbjct  353   IDYFEATRARPSLASTLLITTWSRLSFYTTDFGWGEPILSGPVALPEKEVILFLSN----  408

Query  270   GKSNSGVNVLVALPPKEMEKFKSLFH  193
             G     +NVL+ LP   M+ F+ L +
Sbjct  409   GTEKKNINVLLGLPASAMDVFQELMN  434



>ref|XP_002982104.1| BAHD family acyltransferase, clade V [Selaginella moellendorffii]
 gb|EFJ16772.1| BAHD family acyltransferase, clade V [Selaginella moellendorffii]
Length=496

 Score =   215 bits (547),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 151/454 (33%), Positives = 225/454 (50%), Gaps = 43/454 (9%)
 Frame = -3

Query  1503  KVTILDSGLIFPSQETTKHTMFLSNIDKVLNFDVQTVHFFPASPGFPPEIVAGKIKNAFR  1324
             ++ + +  L+ P+Q T    ++LSN D+ + F++++V+F+P SP    E V   ++ A  
Sbjct  13    EINVEELCLVAPAQATDDQPLYLSNYDQQVLFNLESVYFYPPSPHRSDENVVDVLRAALS  72

Query  1323  RLLVANTYDFLAGRLKKNKESERVEIECNAAGAGFTVASSEFALEDIGDLVYPNPAFRQL  1144
             +LLV   Y F+AGRL+ N   +RVE++CN AGA F  A++   L D+ D     P    L
Sbjct  73    KLLVP--YHFMAGRLRMNAREKRVEVDCNRAGALFVAATTNVTLADLQD----GPT---L  123

Query  1143  VTMSFDFVAKE-------DQPLCFLQVTSFKCGGFALGTSMNHISFDGSGFKMFLENLAA  985
             V++  DF+          D PL  LQVT FKCGGF +G S NH    G+    FL NL A
Sbjct  124   VSLLKDFILHSPASHQVSDAPLLTLQVTKFKCGGFVVGISRNHALVGGTSGDDFLANLTA  183

Query  984   LSFNDDGPLAVVPCNDRSLLAARSPPQVTFPHPELLKVN-LPAGEEMAPP-VFDSLKDDL  811
              +   + P  V P  DR LL AR  P  ++ H E +KV+ +P       P     LK + 
Sbjct  184   AARGQEFP--VKPVADRRLLRARDLPNPSYEHFEYMKVDQVPQDSYFTTPNSLSQLKLNG  241

Query  810   AF-------EIFQLSSADIERLKDKAKAPDNVKTKVTGFNVLTAAIW--RCKALSCLGGE  658
              F       + F   +  +  LK +A A D + ++ T F  L   +W  R +ALS     
Sbjct  242   NFGAHFGLWKTFNFPTEVLNSLKARALA-DGLLSRCTTFEALATKVWQARTQALSM----  296

Query  657   NNSDRLSTVLFAVDIRRRLNPPLPDSYSGNAVLTGYGSAKCAELEEGPFWKTVQMVYEGA  478
              + D+ S ++F VD R+ L P LP  ++GN +          +L E PF   V+ V    
Sbjct  297   -DPDQTSNLVFVVDSRKVLTPSLPVGFTGNTLSLACARMPPRDLAEKPFSACVEEVQVAK  355

Query  477   ARMTDEYARSAIDWGELYKGFP--HGEFLVSSWWRLGFEGVQFPWGKPKYSCPVVYHRKD  304
             AR+TD Y RSAIDW EL    P  +    +SSW    F  V F WG P ++  +   R +
Sbjct  356   ARITDGYVRSAIDWLELNHAVPAVNSGIYLSSWANFSFHKVDFGWGPPSHTIFIPGERGN  415

Query  303   IILLFPDIDNGGKSNSGVNVLVALPPKEMEKFKS  202
               ++F        S  G++V +AL P +   F++
Sbjct  416   NCVIF------LPSKQGLDVCLALEPHQASAFQN  443



>ref|XP_002511135.1| Taxadien-5-alpha-ol O-acetyltransferase, putative [Ricinus communis]
 gb|EEF51737.1| Taxadien-5-alpha-ol O-acetyltransferase, putative [Ricinus communis]
Length=432

 Score =   213 bits (542),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 146/437 (33%), Positives = 221/437 (51%), Gaps = 33/437 (8%)
 Frame = -3

Query  1479  LIFPSQETTKHTMFLSNIDKVLNFDVQTVHFFPASPGFPPEIVAGKIKNAFRRLLVANTY  1300
             LI P++ET K   FLSN+D+ +   V+T++ F +      E     IKNA  ++LV   Y
Sbjct  20    LIPPAEETEKGLYFLSNLDQNIAVVVRTIYCFKSDVK-GNEDAMEVIKNALSKVLVH--Y  76

Query  1299  DFLAGRLKKNKESERVEIECNAAGAGFTVASSEFALEDIGDLVYPNPAFRQLVTMSFDFV  1120
               LAGRL  + E + + ++C   GA    A +   + DIGD   P+P    L  + ++  
Sbjct  77    YPLAGRLTISSEGKLI-VDCTGQGAVLVEAEANCVITDIGDTTKPDPV--TLGKLVYNIP  133

Query  1119  AKEDQ---PLCFLQVTSFKCGGFALGTSMNHISFDGSGFKMFLENLAALSFNDDGPLAVV  949
               ++    P    QVT FKCGGF LG  MNH  FDG G   F+ +    +     PL V 
Sbjct  134   GAQNILQIPPLVAQVTRFKCGGFVLGLCMNHCMFDGIGAMEFVNSWGETA--RGVPLKVP  191

Query  948   PCNDRSLLAARSPPQVTFPHPELLKV-NLPAGEEMAPPVFDSLKDDLAFEIFQLSSADIE  772
             P  DR++L AR+PP++ FPH E  ++ ++ +  ++        ++++ +  F      +E
Sbjct  192   PFADRNILKARNPPKIEFPHQEFAEIEDISSASKL-------YEEEMLYRSFCFGPEKLE  244

Query  771   RLKDKAKAPDNVKTKVTGFNVLTAAIWR--CKALSCLGGENNSDRLSTVLFAVDIRRRLN  598
             +LK KA   D V  K T F  L+A +WR  C+AL  L      D+   +LFAVD R R  
Sbjct  245   QLKRKA-TEDGVLPKCTTFEALSAFVWRARCQALKML-----PDQQIKLLFAVDGRSRFV  298

Query  597   PPLPDSYSGNAVLTGYGSAKCAELEEGPFWKTVQMVYEGAARMTDEYARSAIDWGELYKG  418
             PP+P+ Y GNA++      +  EL +      V +V +    + D Y RSAID+ E+ + 
Sbjct  299   PPIPEGYFGNAIVLTNSLCQAGELLDNQLSFAVGLVQKAVNMVNDSYMRSAIDYFEVTRA  358

Query  417   FPH--GEFLVSSWWRLGFEGVQFPWGKPKYSCPVVYHRKDIILLFPDIDNGGKSNSGVNV  244
              P      L+++W RL F    F WG+P  S PV    K++IL      + GK    +NV
Sbjct  359   RPSLAATLLITTWSRLSFHTTDFGWGEPILSGPVALPEKEVILFL----SHGKERKNINV  414

Query  243   LVALPPKEMEKFKSLFH  193
             L+ LP   M+ F+ L +
Sbjct  415   LLGLPASAMKIFEELMN  431



>ref|XP_004304535.1| PREDICTED: omega-hydroxypalmitate O-feruloyl transferase-like 
isoform 1 [Fragaria vesca subsp. vesca]
Length=445

 Score =   213 bits (543),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 149/446 (33%), Positives = 227/446 (51%), Gaps = 30/446 (7%)
 Frame = -3

Query  1506  LKVTILDSGLIFPSQETTKHTMFLSNIDKVLNFDVQTVHFFPASPGFPPEIVAGK-IKNA  1330
             L+V   +  L+ P++ET K   FLSN+D+ +   V+T++ F +      +  AG+ IK+A
Sbjct  21    LRVKQGEPTLVSPAEETDKGLYFLSNLDQNIAVIVRTIYCFKSDEKDNSK--AGEVIKDA  78

Query  1329  FRRLLVANTYDFLAGRLKKNKESERVEIECNAAGAGFTVASSEFALEDIGDLVYPNPAFR  1150
              +++LV   Y  LAGRL  + E + + ++C   GA F  A ++  +EDIGD+  P+P   
Sbjct  79    LKKVLVH--YYPLAGRLAISSEGKLI-VDCTGEGAVFVEAEADCTIEDIGDITKPDP--E  133

Query  1149  QLVTMSFDFVAKE---DQPLCFLQVTSFKCGGFALGTSMNHISFDGSGFKMFLENLAALS  979
              L  + +D    +   + P    QVT FKCGGF+LG  MNH  FDG G   F+ +    +
Sbjct  134   TLGKLVYDIPGAKNILEVPPLVAQVTKFKCGGFSLGLCMNHCMFDGIGAMEFVNSWGQTA  193

Query  978   FNDDGPLAVVPCNDRSLLAARSPPQVTFPHPELLKVNLPAGEEMAPPVFDSLKDDLAFEI  799
                  PL V P  DRS+L AR+PP++   H E  ++ +           D  +D + +  
Sbjct  194   RG--LPLQVAPFLDRSILKARNPPKIDHLHQEFSEL-IDGNSSCNSSEVD--EDKMLYRS  248

Query  798   FQLSSADIERLKDKAKAPDNVKTKVTGFNVLTAAIW--RCKALSCLGGENNSDRLSTVLF  625
             F   +  +E+LK KA+  D    K + F  L+A +W  R +AL  L      ++   +LF
Sbjct  249   FCFDTEKLEKLKAKARE-DGALDKCSTFEALSAFVWKARTRALRLL-----PEQQIKLLF  302

Query  624   AVDIRRRLNPPLPDSYSGNAVLTGYGSAKCAELEEGPFWKTVQMVYEGAARMTDEYARSA  445
             AVD R + NPPLP  Y GN ++      +  EL E P    V +V +    +TD Y RSA
Sbjct  303   AVDGRPKFNPPLPKGYFGNGIVLTNSICEAGELLEKPLSHAVGLVQDAIKMVTDGYMRSA  362

Query  444   IDWGELYKGFPH--GEFLVSSWWRLGFEGVQFPWGKPKYSCPVVYHRKDIILLFPDIDNG  271
             ID+ E  +  P      L+++W RL F    F WG+P  S PV    K++IL   +    
Sbjct  363   IDYFEATRARPSLASTLLITTWSRLSFYTTDFGWGEPILSGPVALPEKEVILFLSN----  418

Query  270   GKSNSGVNVLVALPPKEMEKFKSLFH  193
             G     +NVL+ LP   M+ F+ L +
Sbjct  419   GTEKKNINVLLGLPASAMDVFQELMN  444



>ref|XP_010929588.1| PREDICTED: omega-hydroxypalmitate O-feruloyl transferase-like 
[Elaeis guineensis]
Length=438

 Score =   213 bits (542),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 145/432 (34%), Positives = 212/432 (49%), Gaps = 23/432 (5%)
 Frame = -3

Query  1479  LIFPSQETTKHTMFLSNIDKVLNFDVQTVHFFPASPGFPPEIVAGKIKNAFRRLLVANTY  1300
             L+ P++ET K   +LSN+D+ +   VQT++ F  S     +  A  IK A  ++LV   Y
Sbjct  26    LVPPAEETEKGLYYLSNLDQNIAVIVQTIYCF-KSEDKGNDRAAEVIKEALAKVLVH--Y  82

Query  1299  DFLAGRLKKNKESERVEIECNAAGAGFTVASSEFALEDIGDLVYPNPAFRQLVTMSFDFV  1120
               LAGRL  + + + + + C   GA F  A ++  +EDIGD+   +P     +  S    
Sbjct  83    YPLAGRLTISPQGKLI-VNCTGEGAVFVEAEADCEMEDIGDISMVDPLILGKLVCSIPGA  141

Query  1119  AK-EDQPLCFLQVTSFKCGGFALGTSMNHISFDGSGFKMFLENLAALSFNDDGPLAVVPC  943
                 + P    QVT F CGGF LG +MNH  FDG G   F+ + A  +     PL+V P 
Sbjct  142   KNILEIPPVVAQVTKFSCGGFILGLAMNHCMFDGLGAMEFVNSWAETA--RGLPLSVPPF  199

Query  942   NDRSLLAARSPPQVTFPHPELLKVNLPAGEEMAPPVFDSLKDDLAFEIFQLSSADIERLK  763
              DR+LL AR+PP ++FPH E  ++      E         ++++ +  F   +  +E LK
Sbjct  200   IDRNLLKARNPPVISFPHHEFAEI------EDISDASTLYQEEMLYRNFCFDTDKLEHLK  253

Query  762   DKAKAPDNVKTKVTGFNVLTAAIWRCKALSCLGGENNSDRLSTVLFAVDIRRRLNPPLPD  583
              KA   D   +K T F  L+  +W+ +  +     N   +L   LFAVD R R NPPLP 
Sbjct  254   RKA-MEDGALSKCTTFEALSGYVWKSRTEALKLQSNQKTKL---LFAVDGRSRFNPPLPK  309

Query  582   SYSGNAVLTGYGSAKCAELEEGPFWKTVQMVYEGAARMTDEYARSAIDWGELYKGFP--H  409
              Y GN ++         EL E P    V +V +    +TDEY RSAID+ E  +  P   
Sbjct  310   GYFGNGIVLTNALCNAGELTENPLSFAVGLVQKAVHMVTDEYMRSAIDYFEATRARPSLS  369

Query  408   GEFLVSSWWRLGFEGVQFPWGKPKYSCPVVYHRKDIILLFPDIDNGGKSNSGVNVLVALP  229
                L+++W RL F    F WG+P  + PV    K++ L      + GK    +NVL+ LP
Sbjct  370   STLLITTWSRLSFHTTDFGWGEPIETGPVALPEKEVTLFL----SHGKERKSINVLLGLP  425

Query  228   PKEMEKFKSLFH  193
                M KF+ L  
Sbjct  426   TSAMLKFQELME  437



>ref|XP_001772486.1| predicted protein [Physcomitrella patens]
 gb|EDQ62768.1| predicted protein [Physcomitrella patens]
Length=459

 Score =   213 bits (543),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 144/436 (33%), Positives = 224/436 (51%), Gaps = 22/436 (5%)
 Frame = -3

Query  1506  LKVTILDSGLIFPSQETTKHTMFLSNIDKVLNFDVQTVHFFPASPGFPPEIVAGKIKNAF  1327
             L V + +  L+ P++ T     FL+N+D+ +   ++TV+FF A      E  A  IK+A 
Sbjct  13    LIVEVKEPQLVVPAESTPHLVYFLNNLDQNIAVSMRTVYFFMAREEKKHEDPAPVIKDAL  72

Query  1326  RRLLVANTYDFLAGRLKKNKESERVEIECNAAGAGFTVASSEFALEDIGDLVYPNPAFRQ  1147
              +LLV   +  +AGRL  + E  +++++C   GA F  A++   + ++G++  P P  R+
Sbjct  73    SKLLVH--FYPMAGRLGIS-EDFKLQVDCQEQGAVFVEATANKCIAELGEISSPTPFMRE  129

Query  1146  LVTMSFDFVAKEDQPLCFLQVTSFKCGGFALGTSMNHISFDGSGFKMFLENLAALSFNDD  967
             LV    +     + P   +QVT+FKCGGF+L    NH   DG     FL+    L+   D
Sbjct  130   LVYEFPNAKNILEVPPLIVQVTTFKCGGFSLSLHNNHCMMDGLSANEFLQAWGELARGVD  189

Query  966   GPLAVVPCNDRSLLAARSPPQVTFPHPELLKVNLPAGEEMAPPVFDSLKDDLAFEIFQLS  787
               +   P  DRS+L +R PP+V FPH E  ++   +G E+       + D L ++ F L+
Sbjct  190   --ITHPPHIDRSVLRSRDPPRVEFPHHEFDEIEDLSGGELL------MGDSLVYKNFILT  241

Query  786   SADIERLKDKAKAPDNVKTKVTGFNVLTAAIWRCKALSCLGGENNSDRLSTVLFAVDIRR  607
               D+E +K KA   D    KV+ F  LTA  WR +  +         RL   LFAVD R 
Sbjct  242   PDDLEAVK-KAILEDGAIQKVSTFEALTALTWRARTQAMDMPLKQKTRL---LFAVDGRS  297

Query  606   RLNPPLPDSYSGNAVLTGYGSAKCAELEEGPFWKTVQMVYEGAARMTDEYARSAIDWGEL  427
             + +PPLP+ + GN ++        AEL + P    V++V +  A + D+Y RSA+D+ EL
Sbjct  298   KFDPPLPEHFFGNGIVLTCAITTAAELTQQPLSYAVKLVQDAIAMINDDYMRSALDFYEL  357

Query  426   YKGFPH--GEFLVSSWWRLGFEGVQFPWGKPKYSCPVVYHRKDIILLFPDIDNGGKSNSG  253
              +  P      LV++W RL F  V F WG P  + P     +++IL      + GK    
Sbjct  358   TRSRPALVATLLVTTWLRLPFHTVDFGWGYPMSTSPACLPDREVILF----TSCGKGRRS  413

Query  252   VNVLVALPPKE-MEKF  208
             V +L+A+P +E MEK 
Sbjct  414   VKILLAMPSQESMEKL  429



>ref|XP_010926850.1| PREDICTED: omega-hydroxypalmitate O-feruloyl transferase-like 
[Elaeis guineensis]
Length=490

 Score =   214 bits (544),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 150/449 (33%), Positives = 222/449 (49%), Gaps = 39/449 (9%)
 Frame = -3

Query  1509  DLKVTILDSGLIFPSQETTKHTMFLSNIDKVLNFDVQTVHFFPASPGFPPEIVAGKIKNA  1330
             +L V   +  L+ P++ET K   FLSN+D+ +   VQT++ F A      E  A  IK A
Sbjct  68    ELSVKQGEPTLVPPAKETEKGLYFLSNLDQNIAVIVQTIYCFRAEDR-GNEGAAVAIKEA  126

Query  1329  FRRLLVANTYDFLAGRLKKNKESERVEIECNAAGAGFTVASSEFALEDIGDLVYPNPAFR  1150
               ++LV   Y  LAGRL    E + + ++C   GA F  A ++  LEDIGD+  P+P+  
Sbjct  127   LSKVLVH--YHPLAGRLTICSEGKLI-VDCTGEGAVFVEAEADCRLEDIGDIAKPDPSM-  182

Query  1149  QLVTMSFDFVAKE---DQPLCFLQVTSFKCGGFALGTSMNHISFDGSGFKMFLENLAALS  979
              L  + ++    +   + P    QVT F+CGGF LG +MNH  FDG G   F+ +   ++
Sbjct  183   -LGKLVYNIPGAKNILEIPPLVAQVTKFQCGGFILGLAMNHCMFDGLGAMEFVNSWGEIA  241

Query  978   FNDDGPLAVVPCNDRSLLAARSPPQVTFPHPELLKVNLPAGEEMAPPVFDSL------KD  817
                  PL+V P  DR++L +RSPP + FPH E  ++             DSL      ++
Sbjct  242   --RGLPLSVPPFLDRTILKSRSPPIIDFPHYEFKEIE------------DSLECTALYQE  287

Query  816   DLAFEIFQLSSADIERLKDKAKAPDNVKTKVTGFNVLTAAIWRCKALSCLGGENNSDRLS  637
             ++ +  F   +  +E+LK+ A   D    K T F  L+A +WR +  +     N   +L 
Sbjct  288   EMIYRSFYFDTDKLEQLKELAMQ-DGALDKCTTFEALSAFVWRARTKALRLQPNQQTKL-  345

Query  636   TVLFAVDIRRRLNPPLPDSYSGNAVLTGYGSAKCAELEEGPFWKTVQMVYEGAARMTDEY  457
               LFAVD R R NPPLP  Y GN ++         +L   P    V +V +    +TD Y
Sbjct  346   --LFAVDGRSRFNPPLPKGYFGNGIVLTNSLCNADDLLGSPLSFAVGLVQKAVKMVTDSY  403

Query  456   ARSAIDWGELYKGFP--HGEFLVSSWWRLGFEGVQFPWGKPKYSCPVVYHRKDIILLFPD  283
              RSA+D+ E  +  P      L+++W RL F    F WG+P  S PV    K++IL    
Sbjct  404   MRSAMDYFEATRVRPSLSATLLITTWSRLAFHNTDFGWGEPLQSGPVALPEKEVILFL--  461

Query  282   IDNGGKSNSGVNVLVALPPKEMEKFKSLF  196
               + GK    +NVL+ LP   M  F+ L 
Sbjct  462   --SHGKDRRNINVLLGLPTSAMLTFQQLM  488



>ref|XP_002992205.1| BAHD family acyltransferase, clade V [Selaginella moellendorffii]
 gb|EFJ06702.1| BAHD family acyltransferase, clade V [Selaginella moellendorffii]
Length=497

 Score =   214 bits (544),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 150/454 (33%), Positives = 226/454 (50%), Gaps = 43/454 (9%)
 Frame = -3

Query  1503  KVTILDSGLIFPSQETTKHTMFLSNIDKVLNFDVQTVHFFPASPGFPPEIVAGKIKNAFR  1324
             ++ + +  L+ P+Q T    ++LSN D+ + F++++V+F+P SP    E V   ++ A  
Sbjct  13    EINVEELCLVAPAQATDDQPLYLSNYDQQVLFNLESVYFYPPSPHRSAENVVDVLRAALS  72

Query  1323  RLLVANTYDFLAGRLKKNKESERVEIECNAAGAGFTVASSEFALEDIGDLVYPNPAFRQL  1144
             ++LV   Y F+AGRL+ N   +RVE++CN AGA F  A++   L D+ D     P    L
Sbjct  73    KVLVP--YHFMAGRLRMNAREKRVEVDCNRAGALFVAATTNVTLADLQD----GPT---L  123

Query  1143  VTMSFDFVAKE-------DQPLCFLQVTSFKCGGFALGTSMNHISFDGSGFKMFLENLAA  985
             V +  DF+          D PL  LQVT FKCGGF +G S NH    G+    FL NL A
Sbjct  124   VGLLKDFILHSPASHQVSDAPLLTLQVTKFKCGGFVVGISRNHALVGGASGDDFLANLTA  183

Query  984   LSFNDDGPLAVVPCNDRSLLAARSPPQVTFPHPELLKVN-LPAGEEMAPP-VFDSLKDDL  811
              +   + P  V P  DR LL AR  P  ++ H E +KV+ +P       P     LK + 
Sbjct  184   AARGQEFP--VKPVADRRLLKARDLPNPSYEHFEYMKVDQVPQDSYFTTPNSLSQLKLNG  241

Query  810   AF-------EIFQLSSADIERLKDKAKAPDNVKTKVTGFNVLTAAIW--RCKALSCLGGE  658
              F       + F   +  +  LK +A A D + ++ T F  L   +W  R +ALS     
Sbjct  242   NFGAHFGLWKTFNFPTEVLNSLKAQALA-DGLLSRCTTFEALATKVWQARTQALSM----  296

Query  657   NNSDRLSTVLFAVDIRRRLNPPLPDSYSGNAVLTGYGSAKCAELEEGPFWKTVQMVYEGA  478
              ++D+ S ++F VD R+ L P LP  ++GN +          +L E PF   V+ V    
Sbjct  297   -DADQTSNLVFVVDSRKVLTPSLPVGFTGNTLSLACARMPPRDLAEKPFSACVKEVQVAK  355

Query  477   ARMTDEYARSAIDWGELYKGFP--HGEFLVSSWWRLGFEGVQFPWGKPKYSCPVVYHRKD  304
             AR+TD+Y RSAIDW EL    P  +    +SSW    F  V F WG P ++  +   R +
Sbjct  356   ARVTDDYVRSAIDWLELNHAVPAVNSGIYLSSWANFSFHKVDFGWGPPSHTLFIPGERGN  415

Query  303   IILLFPDIDNGGKSNSGVNVLVALPPKEMEKFKS  202
               ++F        S  G++V +AL P +   F++
Sbjct  416   NCVIF------LPSKQGLDVCLALEPHQASAFQN  443



>ref|XP_008341279.1| PREDICTED: omega-hydroxypalmitate O-feruloyl transferase [Malus 
domestica]
Length=444

 Score =   212 bits (540),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 146/447 (33%), Positives = 227/447 (51%), Gaps = 32/447 (7%)
 Frame = -3

Query  1509  DLKVTILDSGLIFPSQETTKHTMFLSNIDKVLNFDVQTVHFFPASPGFPPEIVAGK-IKN  1333
             +L+V      L+ P+ ET K   FLSN+D+ +   V+T++ F +      E  AG+ IK+
Sbjct  21    ELRVKQGXPTLVSPAVETEKGLYFLSNLDQNIAVTVRTIYCFKSVDKGNDE--AGEVIKD  78

Query  1332  AFRRLLVANTYDFLAGRLKKNKESERVEIECNAAGAGFTVASSEFALEDIGDLVYPNPAF  1153
             A +++LV   Y  LAGRL  + E + + ++C   GA F  A ++ A+E+IGD   P+P  
Sbjct  79    ALKKVLVH--YYPLAGRLAISAEGKLI-VDCTGEGAVFVEAETDCAIEEIGDTTXPDP--  133

Query  1152  RQLVTMSFDFVAKE---DQPLCFLQVTSFKCGGFALGTSMNHISFDGSGFKMFLENLAAL  982
               L  + +D    +   + P   +QVT FKCGGF+LG  MNH  FDG G   F+ +   +
Sbjct  134   ETLGKLVYDVPGAKNILEMPPLVVQVTKFKCGGFSLGLCMNHCMFDGIGAMEFVNSWGKI  193

Query  981   SFNDDGPLAVVPCNDRSLLAARSPPQVTFPHPELLKVNLPAGEEMAPPVFDSLKDDLAFE  802
             +     PL   P  DRS+L AR+PP++ +PH E  ++   +         D  ++ + + 
Sbjct  194   A--RGLPLTAPPFLDRSILKARNPPRIEYPHHEFSEITGTSSTNN-----DLCEEKMLYX  246

Query  801   IFQLSSADIERLKDKAKAPDNVKTKVTGFNVLTAAIW--RCKALSCLGGENNSDRLSTVL  628
              F   S  +E+LK KA+  +      T F  L+A +W  R +AL+ L      ++   +L
Sbjct  247   SFSFDSEKLEKLKMKARE-EGALENCTTFEALSAFVWKARTRALNLL-----PEQQIKLL  300

Query  627   FAVDIRRRLNPPLPDSYSGNAVLTGYGSAKCAELEEGPFWKTVQMVYEGAARMTDEYARS  448
             FAVD R +  PPLP  Y GN ++         +L + P    V +V +    +TD Y RS
Sbjct  301   FAVDGRPKFRPPLPKGYFGNGIVLTNSICXAGDLLDKPLSNAVGLVQDAIKMVTDSYMRS  360

Query  447   AIDWGELYKGFPH--GEFLVSSWWRLGFEGVQFPWGKPKYSCPVVYHRKDIILLFPDIDN  274
             AID+ EL +  P      L+++W +L F    F WG+P  S PV    K++IL   +   
Sbjct  361   AIDYFELTRARPSLASTLLITTWSKLSFYTTDFGWGEPVLSGPVALPEKEVILFLSN---  417

Query  273   GGKSNSGVNVLVALPPKEMEKFKSLFH  193
              G     +NVL+ LP   M  F+ L +
Sbjct  418   -GTEKKIINVLLGLPASAMNVFQELMN  443



>gb|EYU23064.1| hypothetical protein MIMGU_mgv1a006699mg [Erythranthe guttata]
Length=434

 Score =   212 bits (540),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 146/435 (34%), Positives = 228/435 (52%), Gaps = 30/435 (7%)
 Frame = -3

Query  1479  LIFPSQETTKHTMFLSNIDKVLNFDVQTVHFFPASPGFPPEIVAGKIKNAFRRLLVANTY  1300
             L+  ++ET K   FLSN+D+ +   V+T++ F  S     + V G +K+A  ++LV   Y
Sbjct  23    LVPAAEETRKGLYFLSNLDQNIAVIVRTIYCF-ESGDRGNDDVFGVVKDALSKILV--YY  79

Query  1299  DFLAGRLKKNKESERVEIECNAAGAGFTVASSEFALEDIGDLVYPNPAFRQLVTMSFDFV  1120
               LAGRL  + E + + ++C   GA F  A +E  L ++GD+  P+P    L  + +DF 
Sbjct  80    YPLAGRLTVSSEMKLI-VDCTGEGAVFVEAEAECELGELGDITKPDPV--TLGKLVYDFP  136

Query  1119  AKE---DQPLCFLQVTSFKCGGFALGTSMNHISFDGSGFKMFLENLAALSFNDDGPLAVV  949
               +   + P    QVT FKCGGF LG  MNH  FDG G   F+     ++  +   L   
Sbjct  137   GAKHVLEIPPLVAQVTKFKCGGFVLGLCMNHCMFDGIGAMEFVNGWGEIARGN--LLKSP  194

Query  948   PCNDRSLLAARSPPQVTFPHPELLKVNLPAGEEMAPPVFDSLKDDLAFEIFQLSSADIER  769
             P  DR++L AR PP++ FPH E  ++     E+++       ++++ +  F+  S  +E 
Sbjct  195   PFMDRTILKARIPPKIEFPHHEFAEI-----EDIS--TSHKEENNMLYRSFRFDSEKLEH  247

Query  768   LKDKAKAPDNVKTKVTGFNVLTAAIWRCKALSCLGGENNSDRLSTVLFAVDIRRRLNPPL  589
             L++ A A   +K K T F  L+  +WR +  +    +   D+ + +LFAVD R R +PP+
Sbjct  248   LRETALADGTLK-KCTTFEALSGFVWRARTEAL---DLKPDQETKLLFAVDGRSRFDPPI  303

Query  588   PDSYSGNAVLTGYGSAKCAEL-EEGPFWKTVQMVYEGAARMTDEYARSAIDWGELYKGFP  412
             P++Y GNA++     +K   L E GP + +V +V E    +TD Y RSAID+ E  +  P
Sbjct  304   PNNYFGNAIVLTNALSKAGPLIENGPSF-SVGLVQEAVRLVTDGYMRSAIDYFEATRARP  362

Query  411   H--GEFLVSSWWRLGFEGVQFPWGKPKYSCPVVYHRKDIILLFPDIDNGGKSNSGVNVLV  238
                   L+++W RL F    F WG P  S PV    K++IL      + G+    +NVL+
Sbjct  363   SLASTLLITTWSRLSFGTTDFGWGPPVLSGPVALPEKEVILFL----SHGREKKSINVLL  418

Query  237   ALPPKEMEKFKSLFH  193
              LP   MEKF+ L  
Sbjct  419   GLPAPAMEKFEQLME  433



>ref|XP_004516455.1| PREDICTED: omega-hydroxypalmitate O-feruloyl transferase-like 
[Cicer arietinum]
Length=436

 Score =   212 bits (539),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 145/433 (33%), Positives = 218/433 (50%), Gaps = 33/433 (8%)
 Frame = -3

Query  1470  PSQETTKHTMFLSNIDKVLNFDVQTVHFF-PASPGFPPEIVAGKIKNAFRRLLVANTYDF  1294
             P +ET K   FLSN+D+ +   V+TV+ F  A  G   E     IKNA +++LV   Y  
Sbjct  26    PYEETKKGMYFLSNLDQNIAVIVRTVYCFEKAEKG--NENCFEVIKNALKKVLV--DYYP  81

Query  1293  LAGRLKKNKESERVEIECNAAGAGFTVASSEFALEDIGDLVYPNPAFRQLVTMSFDFVAK  1114
             LAGRL  ++E + + ++C   GA F  A +   +E+IGD+  P+P  R L  + +D    
Sbjct  82    LAGRLSISEEGKLI-VDCTGEGALFVEAEANCLMEEIGDITKPDP--RTLGMLVYDIPGA  138

Query  1113  E---DQPLCFLQVTSFKCGGFALGTSMNHISFDGSGFKMFLENLAALSFNDDGPLAVVPC  943
             +     P    QVT FKCGGF+LG  MNH  FDG G   F+ +   ++ N   PL++ P 
Sbjct  139   KHILQMPPLVAQVTKFKCGGFSLGLCMNHCMFDGIGAMEFVNSWGEVARN--LPLSIPPI  196

Query  942   NDRSLLAARSPPQVTFPHPELLKVNLPAGEEMAPPVFDSLKDDLAFEIFQLSSADIERLK  763
              DR +L AR+PP++   H E   +   +            +D++ +  F      ++ LK
Sbjct  197   LDRKILEARNPPKIEHLHQEFADIKDKSNTS------SLYEDEMVYRSFCFDPEKLKNLK  250

Query  762   DKAKAPDNVKTKVTGFNVLTAAIW--RCKALSCLGGENNSDRLSTVLFAVDIRRRLNPPL  589
              KA   DN     T F VL+A +W  R +AL  L      ++ + +LFAVD R +  P L
Sbjct  251   KKA-MEDNAIESCTTFEVLSAFVWIARTQALKML-----PEQETKLLFAVDGRAKFEPKL  304

Query  588   PDSYSGNAVLTGYGSAKCAELEEGPFWKTVQMVYEGAARMTDEYARSAIDWGELYKGFPH  409
             P  Y GN ++      K  E+   P   TV+++ +    + D Y RSAID+ E+ +  P 
Sbjct  305   PKGYFGNGIVLTNAVCKAGEITNKPLSCTVKVIQDAIKMVNDSYMRSAIDYFEVTRARPS  364

Query  408   --GEFLVSSWWRLGFEGVQFPWGKPKYSCPVVYHRKDIILLFPDIDNGGKSNSGVNVLVA  235
                  L+++W RLGF    F WG+P  S PV    K++IL      + G+    +NVL+ 
Sbjct  365   LACTLLITTWSRLGFHTTNFGWGEPVLSGPVSLPEKEVILFL----SHGQERRNINVLLG  420

Query  234   LPPKEMEKFKSLF  196
             LP   M+ F+ L 
Sbjct  421   LPAPVMKIFQDLM  433



>ref|XP_008791113.1| PREDICTED: omega-hydroxypalmitate O-feruloyl transferase-like 
[Phoenix dactylifera]
Length=432

 Score =   211 bits (538),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 149/449 (33%), Positives = 225/449 (50%), Gaps = 29/449 (6%)
 Frame = -3

Query  1518  LHEDLKVTIL--DSGLIFPSQETTKHTMFLSNIDKVLNFDVQTVHFFPASPGFPPEIVAG  1345
             L E+ +++I   +  L+ P++ET K   +LSN+D+ +   VQT++ F  S     E  A 
Sbjct  5     LKEEFELSIKQGEPKLVPPAEETEKGLYYLSNLDQNIAVIVQTIYCF-KSEDKGNETAAE  63

Query  1344  KIKNAFRRLLVANTYDFLAGRLKKNKESERVEIECNAAGAGFTVASSEFALEDIGDLVYP  1165
              IK A  ++LV   +  LAGRL  + E + + + C   GA F  A ++  +EDIGD+   
Sbjct  64    VIKEALAKVLVH--FYPLAGRLTISPEGKLI-VNCTGEGAVFVEAEADCEMEDIGDISKA  120

Query  1164  NPAFRQLVTMSFDF-VAKE--DQPLCFLQVTSFKCGGFALGTSMNHISFDGSGFKMFLEN  994
             +P    L  + ++   AK   + P    QVT FKCGGF LG +MNH  FDG G   F+ +
Sbjct  121   DPL--TLGKLLYNIPCAKNILEIPPLVAQVTKFKCGGFILGLAMNHCMFDGLGAMEFVNS  178

Query  993   LAALSFNDDGPLAVVPCNDRSLLAARSPPQVTFPHPELLKVNLPAGEEMAPPVFDSLKDD  814
                 +     PL++ P  DR++L AR+PP ++FPH E  ++      E         +++
Sbjct  179   WGETA--RGLPLSMPPFIDRNVLKARNPPAISFPHHEFAEI------EDISDTSTLYQEE  230

Query  813   LAFEIFQLSSADIERLKDKAKAPDNVKTKVTGFNVLTAAIWRCKALSCLGGENNSDRLST  634
             + ++ F   +  +ERLK KA   D    K T F  L+  +W+ +  +         + S 
Sbjct  231   MLYKSFCFDADKLERLKRKA-MEDGALDKCTTFEALSGFVWKARTEAL---RLQPSQKSK  286

Query  633   VLFAVDIRRRLNPPLPDSYSGNAVLTGYGSAKCAELEEGPFWKTVQMVYEGAARMTDEYA  454
             +LFAVD R R NPPLP  Y GN ++         EL E P      +V +    +TDEY 
Sbjct  287   LLFAVDGRSRFNPPLPKGYFGNGIVLTNSLCSAGELTEKPLSFAAGLVQKAVRMVTDEYM  346

Query  453   RSAIDWGELYKGFP--HGEFLVSSWWRLGFEGVQFPWGKPKYSCPVVYHRKDIILLFPDI  280
             RSAID+ E  +  P      L+++W RL F    F WG+P  + PV    K++IL     
Sbjct  347   RSAIDYFEATRARPSLSATLLITTWSRLCFHTTDFGWGEPIQTGPVALPEKEVILFL---  403

Query  279   DNGGKSNSGVNVLVALPPKEMEKFKSLFH  193
              + GK    +NVL+ LP   M KF+ L  
Sbjct  404   -SHGKERKSINVLLGLPSSAMLKFQELME  431



>ref|XP_004979328.1| PREDICTED: omega-hydroxypalmitate O-feruloyl transferase-like 
[Setaria italica]
Length=454

 Score =   211 bits (538),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 152/442 (34%), Positives = 216/442 (49%), Gaps = 32/442 (7%)
 Frame = -3

Query  1479  LIFPSQET-TKHTMFLSNIDKVLNFDVQTVHFFPASP---GFPPEIVAGKIKNAFRRLLV  1312
             L+ P+  T T    +LSN+D+ +   VQTV+ +  SP   G   + VA  +++A  R+LV
Sbjct  34    LVPPAAPTPTGEQYYLSNLDQNIAVIVQTVYCYKPSPPGDGKDKDDVATALRDALARVLV  93

Query  1311  ANTYDFLAGRLKKNKESERVEIECNAAGAGFTVASSEFALEDIGDLVYPNPA-FRQLVTM  1135
                Y  LAGRL  + E  ++ +E  A G  F    ++  L  +GDL  P+PA   QLV  
Sbjct  94    --HYHPLAGRLGISPEM-KLTVELTAEGVVFVEGDADCDLAVVGDLTKPDPAALGQLVYS  150

Query  1134  SFDFVAKEDQPLCFLQVTSFKCGGFALGTSMNHISFDGSGFKMFLENLAALSFNDDGPLA  955
                     + P    QVT F CGGFALG +MNH  FDG G   F+ + A  +      L 
Sbjct  151   VPGAKHILEMPPMTAQVTRFSCGGFALGLAMNHCMFDGIGAMEFVNSWAETA-RGAAELT  209

Query  954   VVPCNDRSLLAARSPPQVTFPHPELLKVNLPAGEEMAPPVFDSL----KDDLAFEIFQLS  787
             V P  DRSLL AR PP  TFPH E  ++         P V D+       +L +  F   
Sbjct  210   VPPFLDRSLLKARDPPAHTFPHHEFAEI---------PDVSDTAALYGSQELLYRSFCFD  260

Query  786   SADIERLKDKAKAPDNVKTKVTGFNVLTAAIWRCKALSCLGGENNSDRLSTVLFAVDIRR  607
                +ER++  A A  ++  + T F  L+  +WR +    LG     ++ + +LFAVD RR
Sbjct  261   PDRLERVRALALAGGDL-ARCTTFEALSGLVWRART-RALG--LAPEQRTKLLFAVDGRR  316

Query  606   RLNPPLPDSYSGNAVLTGYGSAKCAELEEGPFWKTVQMVYEGAARMTDEYARSAIDWGEL  427
             R  PPLP  Y GN ++     A   EL   P  +   +V +    +TDEY RSA+D+ E 
Sbjct  317   RFVPPLPRGYFGNGIVLTNAIATAGELLSAPVSRAAALVQDAVRMVTDEYMRSAVDYFEA  376

Query  426   YKGFPH--GEFLVSSWWRLGFEGVQFPWGKPKYSCPVVYHRKDIILLFPDIDNGGKSNSG  253
              +  P      L+++W RL F G  F WG+P  S PV    K++IL        GK    
Sbjct  377   TRARPSLASTLLITTWSRLEFHGADFGWGEPVMSGPVTLPEKEVILFLAH----GKERKS  432

Query  252   VNVLVALPPKEMEKFKSLFHKF  187
             +NVL+ LP   M+ F+ L  + 
Sbjct  433   INVLLGLPATAMDAFQELMDEI  454



>ref|XP_003525421.1| PREDICTED: omega-hydroxypalmitate O-feruloyl transferase isoform 
X1 [Glycine max]
 ref|XP_006580617.1| PREDICTED: omega-hydroxypalmitate O-feruloyl transferase isoform 
X2 [Glycine max]
Length=433

 Score =   211 bits (536),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 141/445 (32%), Positives = 224/445 (50%), Gaps = 24/445 (5%)
 Frame = -3

Query  1506  LKVTILDSGLIFPSQETTKHTM-FLSNIDKVLNFDVQTVHFFPASPGFPPEIVAGKIKNA  1330
             L + + +  L+ P++ET K    FLSN+D+ +   V+TV+F+  S     E  A  IK+A
Sbjct  5     LNIRLGEPTLVPPAEETEKGLYYFLSNLDQNIAHPVRTVYFYNKSACRGNEEAAQVIKDA  64

Query  1329  FRRLLVANTYDFLAGRLKKNKESERVEIECNAAGAGFTVAS-SEFALEDIGDLVYPNPAF  1153
               ++LV   Y  +AGRL  + E + + IEC   G  F  A  +   ++D+GDL    P  
Sbjct  65    LSKVLVH--YYPMAGRLAISSEGKLI-IECTGEGVVFVEAEEANCVIKDLGDLT-KQPDL  120

Query  1152  RQLVTMSFDFVAKEDQ---PLCFLQVTSFKCGGFALGTSMNHISFDGSGFKMFLENLAAL  982
               L  + +D     +    P   +QVT FKCGGF LG ++NH   DG     F+      
Sbjct  121   ETLGKLVYDIPGATNMLQIPPLLIQVTKFKCGGFVLGVNVNHCMVDGISAMQFVNAWGET  180

Query  981   SFNDDGPLAVVPCNDRSLLAARSPPQVTFPHPELLKVNLPAGEEMAPPVFDSLKDDLAFE  802
             +   D  L++ P  DR++L  R+PP++ +PH E  ++      E    V    ++++ +E
Sbjct  181   ARGMD--LSISPVLDRTILRTRNPPKIEYPHHEFDEI------EDVSNVTKVYEEEILYE  232

Query  801   IFQLSSADIERLKDKAKAPDNVKTKVTGFNVLTAAIWRCKALSCLGGENNSDRLSTVLFA  622
              F      +E LK  A + D V  K + F  LTA +WR ++   LG   + ++ + +LFA
Sbjct  233   SFCFDPDKLELLKKMATSEDGVVKKCSTFEALTAFVWRARS-EALGMHMDPNQQTKLLFA  291

Query  621   VDIRRRLNPPLPDSYSGNAVLTGYGSAKCAELEEGPFWKTVQMVYEGAARMTDEYARSAI  442
             VD R +  PP+P  Y GNA++      K  EL   P   +V +V +    +TD Y RSAI
Sbjct  292   VDGRSKFVPPIPKGYFGNAIVFSNALCKVEELVNNPLSFSVGLVGKAIDMVTDSYMRSAI  351

Query  441   DWGELYKGFPH--GEFLVSSWWRLGFEGVQFPWGKPKYSCPVVYHRKDIILLFPDIDNGG  268
             D+ E+ +  P      L+++W R+ F    F WGKP +  PV    K++IL      +  
Sbjct  352   DYFEVKRSRPSLTATLLITTWTRIPFRSADFGWGKPFFFGPVTLPGKEVILFL----SHN  407

Query  267   KSNSGVNVLVALPPKEMEKFKSLFH  193
             + +  +NVL+ LP   M++F+ L  
Sbjct  408   EESKSINVLLGLPASAMKRFERLME  432



>ref|XP_008239515.1| PREDICTED: omega-hydroxypalmitate O-feruloyl transferase [Prunus 
mume]
Length=432

 Score =   211 bits (536),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 147/447 (33%), Positives = 222/447 (50%), Gaps = 33/447 (7%)
 Frame = -3

Query  1509  DLKVTILDSGLIFPSQETTKHTMFLSNIDKVLNFDVQTVHFFPASPGFPPEIVAGKIKNA  1330
             +L V   +  L+ P++ET K   +LSN+D+ +   V+T++ F +      E V   IK+A
Sbjct  10    ELSVKKEEPTLVPPAEETEKGLYYLSNLDQNIAVIVRTIYCFKSDLKGNEEAVE-IIKSA  68

Query  1329  FRRLLVANTYDFLAGRLKKNKESERVEIECNAAGAGFTVASSEFALEDIGDLVYPNPAFR  1150
               ++LV   Y  LAGRL  + E + + ++C   GA F  A +   +E IGD+  P+P   
Sbjct  69    LSKVLVH--YYPLAGRLSISTEGKLI-VDCTGDGAVFVEAEANCEMEKIGDITKPDPL--  123

Query  1149  QLVTMSFDFVAKE---DQPLCFLQVTSFKCGGFALGTSMNHISFDGSGFKMFLENLAALS  979
              L  +  D    +   + P    QVT F+CGGF LG  +NH  FDG G   F+ +    +
Sbjct  124   TLGKLVHDIPGAKNILEIPPLVAQVTKFRCGGFVLGLCINHCMFDGLGAMEFVNSWGETA  183

Query  978   FNDDGPLAVVPCNDRSLLAARSPPQVTFPHPELLKVNLPAGEEMAPPVFDSLK---DDLA  808
                  PL V P  DRS+L AR+PPQ+ FPH E  ++           + D+ K   ++L 
Sbjct  184   --RGLPLKVPPFLDRSILKARNPPQIEFPHNEFAEIE---------DISDNTKLYEEELL  232

Query  807   FEIFQLSSADIERLKDKAKAPDNVKTKVTGFNVLTAAIWRCKALSCLGGENNSDRLSTVL  628
             +  F L    +E+LK K    D V  K T F  L+A +WR +  +        D+ + +L
Sbjct  233   YRSFFLHPESLEKLK-KMAMEDGVLDKCTTFQALSAFVWRARTQAL---RMRPDQKTKLL  288

Query  627   FAVDIRRRLNPPLPDSYSGNAVLTGYGSAKCAELEEGPFWKTVQMVYEGAARMTDEYARS  448
             FAVD R R  PP+P+ + GNA++         EL E P    V +V +    +TD Y RS
Sbjct  289   FAVDGRSRFEPPIPEGFFGNAIVLTNSLCSAGELLERPLSFAVGLVDKAVHMVTDSYMRS  348

Query  447   AIDWGELYKGFP--HGEFLVSSWWRLGFEGVQFPWGKPKYSCPVVYHRKDIILLFPDIDN  274
             AID+ E+ +  P      L+++W +L F    F WG+P  S PV    K++ L      +
Sbjct  349   AIDYFEVTRARPSLSATLLITTWSKLAFHSTDFGWGEPVLSGPVGLPEKEVSLFL----S  404

Query  273   GGKSNSGVNVLVALPPKEMEKFKSLFH  193
              GK    +NVL+ LP   M+ F+ L  
Sbjct  405   HGKDRKSINVLLGLPASAMKTFEELMQ  431



>ref|XP_003580168.1| PREDICTED: omega-hydroxypalmitate O-feruloyl transferase-like 
[Brachypodium distachyon]
Length=455

 Score =   210 bits (535),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 151/439 (34%), Positives = 220/439 (50%), Gaps = 26/439 (6%)
 Frame = -3

Query  1479  LIFPSQET-TKHTMFLSNIDKVLNFDVQTVHFFPASP-GFPPEI-VAGKIKNAFRRLLVA  1309
             L+ P++ T T    +LSN+D+ +   VQTV+ F   P G   E   A  +++A  R+LV 
Sbjct  35    LVAPAEPTPTGEHYYLSNLDQNIAVIVQTVYCFKCPPSGRGHEAGAADALRDALSRVLV-  93

Query  1308  NTYDFLAGRLKKNKESERVEIECNAAGAGFTVASSEFALEDIGDL-VYPNPA-FRQLVTM  1135
               Y  LAGRL  + E  ++ ++C   G  F  A +   L D+GDL   P+PA   QLV  
Sbjct  94    -HYHPLAGRLAISPEM-KLAVDCTGEGVVFVEADAACDLADMGDLSTTPDPAALGQLVYS  151

Query  1134  SFDFVAKEDQPLCFLQVTSFKCGGFALGTSMNHISFDGSGFKMFLENLAALSFNDDGPLA  955
                       P    QVT FKCGGF+LG +MNH  FDG G   F+ + A ++      L 
Sbjct  152   IPGAKNILQMPPITAQVTRFKCGGFSLGLAMNHCMFDGLGAMEFVNSWAEMA-RGATELT  210

Query  954   VVPCNDRS-LLAARSPPQVTFPHPELLKVNLPAGEEMAPPVFDSLKDDLAFEIFQLSSAD  778
             V P  DR+ +L AR PP ++FPH E  ++  P    MA    D    DL +  F      
Sbjct  211   VPPYLDRAAVLRARDPPLISFPHREFEEI--PDVSGMAALYGD---QDLTYRSFCFGPDR  265

Query  777   IERLKDKAKAPDNVKTKVTGFNVLTAAIWRCKALSCLGGENNSDRLSTVLFAVDIRRRLN  598
             +ER++  A++    +   T F  L+  +WR +  + LG     ++ + +LFAVD RRRL+
Sbjct  266   LERVRGLAQS--QAQASFTTFEALSGLVWRART-AALG--LAPEQQTKLLFAVDARRRLS  320

Query  597   PPLPDSYSGNAVLTGYGSAKCAELEEGPFWKTVQMVYEGAARMTDEYARSAIDWGELYKG  418
             PPLP  Y GN ++     A   +L   P      MV +    +TDEY RSA+D+ E  + 
Sbjct  321   PPLPRGYFGNGIVLTNALATAGDLLASPVSSAAAMVQDAVRMVTDEYVRSAVDYFEATRA  380

Query  417   FPH--GEFLVSSWWRLGFEGVQFPWGKPKYSCPVVYHRKDIILLFPDIDNGGKSNSGVNV  244
              P      L+++W RL F+G  F WG+P  S PV    K++IL        G+    +NV
Sbjct  381   RPSLASTLLITTWSRLAFDGADFGWGQPAMSGPVTLPEKEVILFLAH----GQERKSINV  436

Query  243   LVALPPKEMEKFKSLFHKF  187
             L+ LP   M+ F+ L  + 
Sbjct  437   LLGLPASAMDAFQELMDEI  455



>ref|XP_008379094.1| PREDICTED: omega-hydroxypalmitate O-feruloyl transferase-like 
[Malus domestica]
Length=445

 Score =   210 bits (534),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 146/446 (33%), Positives = 228/446 (51%), Gaps = 32/446 (7%)
 Frame = -3

Query  1506  LKVTILDSGLIFPSQETTKHTMFLSNIDKVLNFDVQTVHFFPASPGFPPEIVAGK-IKNA  1330
             L+V   +  L+ P+ ET K   FLSN+D+ +   V+T++ F +      +  AG+ IK+A
Sbjct  23    LRVKQGEPTLVPPAVETEKGLYFLSNLDQNIAVTVRTIYCFKSDAKGNDK--AGEVIKDA  80

Query  1329  FRRLLVANTYDFLAGRLKKNKESERVEIECNAAGAGFTVASSEFALEDIGDLVYPNPAFR  1150
              +++LV   Y  LAGRL  + E + + ++C   GA F  A ++ A+E+IGD+  P+P   
Sbjct  81    LKKVLVH--YYPLAGRLAISAEGKLI-VDCTGEGAVFVEAEADCAIEEIGDITKPDP--E  135

Query  1149  QLVTMSFDFVAKEDQ---PLCFLQVTSFKCGGFALGTSMNHISFDGSGFKMFLENLAALS  979
              L  + +D    ++    P    QVT FKCGGFALG  MNH  FDG G   F+ + A ++
Sbjct  136   TLGKLVYDVPGAKNMLEIPPLVAQVTKFKCGGFALGLCMNHCMFDGIGAMEFVNSWAKIA  195

Query  978   FNDDGPLAVVPCNDRSLLAARSPPQVTFPHPELLKVNLPAGEEMAPPVFDSLKDDLAFEI  799
                   L   P  DRS+L AR+PP++ + H E  ++   +         D   + + +  
Sbjct  196   RGLQ--LTDXPFLDRSILKARNPPKIEYLHQEFSEITGTSSTNN-----DLCDEKMLYRS  248

Query  798   FQLSSADIERLKDKAKAPDNVKTKVTGFNVLTAAIW--RCKALSCLGGENNSDRLSTVLF  625
             F  +S  +E+LK KA+  D      T F  L+A +W  R +AL+ L      ++   ++F
Sbjct  249   FCFNSEKLEKLKTKARE-DGALENCTTFEALSAFVWKARTRALNML-----PEQQIKLMF  302

Query  624   AVDIRRRLNPPLPDSYSGNAVLTGYGSAKCAELEEGPFWKTVQMVYEGAARMTDEYARSA  445
             AVD R + +PPLP  Y GN ++      +  +L + P    V +V +    +TD Y RSA
Sbjct  303   AVDGRPKFSPPLPKWYFGNGIVLTNSICQAGDLLDKPLSNAVGLVQDAIKMVTDSYMRSA  362

Query  444   IDWGELYKGFPH--GEFLVSSWWRLGFEGVQFPWGKPKYSCPVVYHRKDIILLFPDIDNG  271
             ID+ EL +  P      L+++W RL F    F WG+P  S PV    K++IL   +    
Sbjct  363   IDYFELTRARPSLASTLLITTWSRLSFYTTDFGWGEPVLSGPVALPEKEVILFLSN----  418

Query  270   GKSNSGVNVLVALPPKEMEKFKSLFH  193
             G     +NVL+ LP   M  F+ L +
Sbjct  419   GTEKKNINVLLGLPASAMNVFEELMN  444



>ref|XP_007209159.1| hypothetical protein PRUPE_ppa006018mg [Prunus persica]
 gb|EMJ10358.1| hypothetical protein PRUPE_ppa006018mg [Prunus persica]
Length=432

 Score =   209 bits (533),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 147/447 (33%), Positives = 222/447 (50%), Gaps = 33/447 (7%)
 Frame = -3

Query  1509  DLKVTILDSGLIFPSQETTKHTMFLSNIDKVLNFDVQTVHFFPASPGFPPEIVAGKIKNA  1330
             +L V   +  L+ P++ET K   +LSN+D+ +   V+T++ F +      E V   IK+A
Sbjct  10    ELSVKKEEPTLVPPAEETEKGLYYLSNLDQNIAVIVRTIYCFKSDLKGNEEAVE-IIKSA  68

Query  1329  FRRLLVANTYDFLAGRLKKNKESERVEIECNAAGAGFTVASSEFALEDIGDLVYPNPAFR  1150
               ++LV   Y  LAGRL  + E + + ++C   GA F  A +   +E IGD+  P+P   
Sbjct  69    LSKVLVH--YYPLAGRLNISTEGKLI-VDCTGDGAVFVEAEANCEMEKIGDITKPDPL--  123

Query  1149  QLVTMSFDFVAKE---DQPLCFLQVTSFKCGGFALGTSMNHISFDGSGFKMFLENLAALS  979
              L  +  D    +   + P    QVT F+CGGF LG  +NH  FDG G   F+ +    +
Sbjct  124   TLGKLVHDIPGAKNILEIPPLAAQVTKFRCGGFVLGLCINHCMFDGIGAMEFVNSWGETA  183

Query  978   FNDDGPLAVVPCNDRSLLAARSPPQVTFPHPELLKVNLPAGEEMAPPVFDSLK---DDLA  808
                  PL V P  DRS+L AR PP++ FPH E  ++           + D+ K   ++L 
Sbjct  184   --RGLPLKVPPFLDRSILKARKPPKIEFPHNEFAEIE---------DISDNTKLYEEELL  232

Query  807   FEIFQLSSADIERLKDKAKAPDNVKTKVTGFNVLTAAIWRCKALSCLGGENNSDRLSTVL  628
             +  F     +IE+LK K    D V  K T F  L+A +WR +  +        D+ + +L
Sbjct  233   YRSFFFHPENIEKLK-KMAMEDGVLDKCTTFQALSAFVWRARTQAL---RMRPDQKTKLL  288

Query  627   FAVDIRRRLNPPLPDSYSGNAVLTGYGSAKCAELEEGPFWKTVQMVYEGAARMTDEYARS  448
             FAVD R R  PP+P+ + GNA+L         EL E P    V +V +    +TD Y RS
Sbjct  289   FAVDGRSRFEPPIPEGFFGNAILLTNSLCSAGELLEKPLSFAVGLVDKAVHMVTDSYMRS  348

Query  447   AIDWGELYKGFP--HGEFLVSSWWRLGFEGVQFPWGKPKYSCPVVYHRKDIILLFPDIDN  274
             AID+ E+ +  P      L+++W +L F    F WG+P  S PV    K++ L      +
Sbjct  349   AIDYFEVTRARPSLSETLLITTWSKLAFHSTDFGWGEPVLSGPVGLPEKEVSLFL----S  404

Query  273   GGKSNSGVNVLVALPPKEMEKFKSLFH  193
              GK+   +NVL+ LP   M+ F+ L  
Sbjct  405   HGKNRKSINVLLGLPASAMKTFEELMQ  431



>gb|KCW60630.1| hypothetical protein EUGRSUZ_H03354 [Eucalyptus grandis]
Length=433

 Score =   209 bits (532),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 148/446 (33%), Positives = 221/446 (50%), Gaps = 31/446 (7%)
 Frame = -3

Query  1509  DLKVTILDSGLIFPSQETTKHTMFLSNIDKVLNFDVQTVHFFPASPGFPPEIVAGKIKNA  1330
              L VT  +  L+ P++ET     FLSN+D+ +   ++T++ F  S     E V   IK A
Sbjct  11    QLCVTQGEPTLVTPAEETENGLYFLSNLDQNIAVIIRTIYCF-KSIEKGNEHVGEVIKGA  69

Query  1329  FRRLLVANTYDFLAGRLKKNKESERVEIECNAAGAGFTVASSEFALEDIGDLVYPNPAFR  1150
              +++LV   Y  LAGRL  + E + + ++C   GA F  A +   LE+IGD+  P+P   
Sbjct  70    LKKVLVH--YYPLAGRLTISPEGKLI-VDCTGEGAIFVEAEANCTLEEIGDITKPHP--E  124

Query  1149  QLVTMSFDFVAKE---DQPLCFLQVTSFKCGGFALGTSMNHISFDGSGFKMFLENLAALS  979
              L  + +D    +   + P    QVT FKCGGF LG  MNH  FDG G   F+ +    +
Sbjct  125   TLGKLVYDVPGAKNILEMPPLVAQVTKFKCGGFVLGLCMNHCMFDGIGAMEFVNSWGETA  184

Query  978   FNDDGPLAVVPCNDRSLLAARSPPQVTFPHPELLKVNLPAGEEMAPPVFDSLKDDLAFEI  799
                  PL   P  DR++L +R+PP+V   H E  ++      E      D  KD++ +  
Sbjct  185   --RGLPLTTPPFLDRTILKSRNPPKVENLHQEFAEI------EDKSNTADLYKDEMRYSS  236

Query  798   FQLSSADIERLKDKAKAPDNVKTKVTGFNVLTAAIWRC--KALSCLGGENNSDRLSTVLF  625
             F      +E+LK KA   D V  K T F  L+A +WR   KAL+ +      D+ + +LF
Sbjct  237   FCFDPEKLEKLKAKAMK-DGVLEKCTTFEALSAFVWRARTKALNMV-----PDQQTKLLF  290

Query  624   AVDIRRRLNPPLPDSYSGNAVLTGYGSAKCAELEEGPFWKTVQMVYEGAARMTDEYARSA  445
             AVD R +  PPLP  Y GN ++      +  E+ E P    V +V +    ++D Y RSA
Sbjct  291   AVDGRPKFEPPLPKGYFGNGIVLTNSICEAGEILEKPLSYAVGLVQDAIKMVSDGYMRSA  350

Query  444   IDWGELYKGFPH--GEFLVSSWWRLGFEGVQFPWGKPKYSCPVVYHRKDIILLFPDIDNG  271
             ID+ E+ +  P      L+++W RL F    F WG+P  S PV    K++IL      + 
Sbjct  351   IDYFEITRARPSLACTLLITTWSRLSFYTTDFGWGEPILSGPVALPEKEVILFL----SH  406

Query  270   GKSNSGVNVLVALPPKEMEKFKSLFH  193
             G     +NVL+ +P   M+ F+ L  
Sbjct  407   GTGRKSINVLLGMPAPAMKIFEELMQ  432



>ref|XP_002991188.1| BAHD family acyltransferase, clade V [Selaginella moellendorffii]
 gb|EFJ07732.1| BAHD family acyltransferase, clade V [Selaginella moellendorffii]
Length=459

 Score =   210 bits (534),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 152/450 (34%), Positives = 227/450 (50%), Gaps = 30/450 (7%)
 Frame = -3

Query  1509  DLKVTILDSGLIFPSQETTKHTMFLSNIDKVLNFDVQTVHFFPASPGFPPEIVAGKIKNA  1330
             DL++ +  S ++ P+Q     T+FLSNID+   + V++V+ F A+P    +  A  I+ A
Sbjct  8     DLQIEVGSSKIVAPAQAVEHSTLFLSNIDQEAMYKVESVYVFAANPERASDDPAEVIEAA  67

Query  1329  FRRLLVANTYDFLAGRLKKNKESERVEIECNAAGAGFTVASSEFALEDIGDLVYPNPAFR  1150
               + LV  TY FLAGR   N +  R+E+ CN AG  F  A+S+  L D+GDL  PNPAFR
Sbjct  68    LAKTLV--TYYFLAGRFAPNAKEGRLEVNCNGAGVLFAAATSKLRLCDLGDLSVPNPAFR  125

Query  1149  QLVTMSFDFVAKEDQPLCFLQVTSFKCGGFALGTSMNHISFDGSGFKMFLENLAALSFND  970
              L+    D +   + P    Q+T FKCGGF  G ++ H   DG     F +NL +++   
Sbjct  126   SLLVQPSDSLGLFETPPATFQITRFKCGGFVFGMTIFHSLMDGVAITGFFDNLGSIA--R  183

Query  969   DGPLAVVPCNDRSLLAARSPPQVTFPHPELL-----KVNLPAGEEMAP--PVFDSLK---  820
              G + +VP  +R  L AR+PPQ    H E L     +V+  +   + P  P   S+    
Sbjct  184   GGGVVMVPNPNREFLKARNPPQPQ--HYEQLMCRQFRVSSFSEIPLLPFNPTTSSVNNFA  241

Query  819   -DDLAFEIFQLSSADIERLKDKAKAPDNVKTKVTGFNVLTAAIWRCKALSCLGGENNSDR  643
              +   F  F +SS  I  LK +A   D   ++ + F  +TA + R  A S     ++   
Sbjct  242   PEKHVFRSFPVSSQMISELK-QACLKDETLSRCSSFEAITAHVLRQVARS---RPSDPSA  297

Query  642   LSTVLFAVDIRRRLNPPLPDSYSGNAVLTGYGSAKCAELEEGPFWKTVQMVYEGAARMTD  463
             L +   AVD  RRL PP P ++ GNAV+    +A   EL         + V E  + + D
Sbjct  298   LVSTFLAVDFSRRLQPPPPPNFCGNAVVAACVAATRQELCTYSLGHFARRVQEVLSDVDD  357

Query  462   EYARSAIDWGELYK----GFPHGEFLVSSWWRLGFEGVQFPWGKPKYSCPVVYHRKDIIL  295
             EY RS  D+ EL++      P G  L S+WW+L F  + F WG P ++ PV       I+
Sbjct  358   EYVRSWTDFWELHRIGPARIPIGACL-SAWWKLPFYALDFGWGTPIFAGPVPNQLVGFIV  416

Query  294   LFPDIDNGGKSNSGVNVLVALPPKEMEKFK  205
             +  +    GK++ G NV + L P+EM  F+
Sbjct  417   IVAN----GKNDGGANVYLGLEPQEMAAFE  442



>ref|XP_003532502.1| PREDICTED: omega-hydroxypalmitate O-feruloyl transferase-like 
[Glycine max]
 gb|KHN16860.1| Omega-hydroxypalmitate O-feruloyl transferase [Glycine soja]
Length=430

 Score =   209 bits (532),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 142/444 (32%), Positives = 228/444 (51%), Gaps = 25/444 (6%)
 Frame = -3

Query  1506  LKVTILDSGLIFPSQETTKHTMFLSNIDKVLNFDVQTVHFFPASPGFPPEIVAGKIKNAF  1327
             L + + ++ L+ P++ET K   FLSN+D+ +   V+TV+F+  SP    E  A  IK+A 
Sbjct  5     LNIRVGEATLVPPAEETKKGIYFLSNLDQNIAHPVRTVYFYNKSPCRGNEEAAQVIKDAL  64

Query  1326  RRLLVANTYDFLAGRLKKNKESERVEIECNAAGAGFTVAS-SEFALEDIGDLVYPNPAFR  1150
              ++LV   Y  +AGRL  + E + + IEC   G  F  A  +   ++D+GDL    P  +
Sbjct  65    SKVLVH--YYPMAGRLTISSEGKLI-IECTGEGVVFVEAEEANCVIKDLGDLA-KQPDLQ  120

Query  1149  QLVTMSFDFVAKEDQ---PLCFLQVTSFKCGGFALGTSMNHISFDGSGFKMFLENLAALS  979
              L  + +D     +    P    QVT FKCGGF LG ++NH   DG     F+      +
Sbjct  121   TLGKLVYDIPGATNLLQIPPLLTQVTKFKCGGFVLGVNVNHCMSDGICAMQFVNAWGETA  180

Query  978   FNDDGPLAVVPCNDRSLLAARSPPQVTFPHPELLKVNLPAGEEMAPPVFDSLKDDLAFEI  799
                D  L++ P  DR++L AR+PP++ FPH E  ++     E+++       ++++ ++ 
Sbjct  181   RGLD--LSISPVLDRTILRARNPPKIEFPHHEFDEI-----EDVSNATKLYEEEEILYKS  233

Query  798   FQLSSADIERLKDKAKAPDNVKTKVTGFNVLTAAIWRCKALSCLGGENNSDRLSTVLFAV  619
             F      +E LK K    D V  K + F  LTA +WR ++   LG   +S++ + +LFAV
Sbjct  234   FCFDPDKLELLK-KVATEDGVVKKCSTFEALTAFVWRARS-EALG--THSNQQTKLLFAV  289

Query  618   DIRRRLNPPLPDSYSGNAVLTGYGSAKCAELEEGPFWKTVQMVYEGAARMTDEYARSAID  439
             D R +  PP+P  Y GNA++      K  EL   P   +V +V +    + D Y RSAID
Sbjct  290   DGRSKFVPPIPKGYFGNAIVFSNALCKVEELVNNPLSFSVGLVGKAIDMVKDSYMRSAID  349

Query  438   WGELYKGFPH--GEFLVSSWWRLGFEGVQFPWGKPKYSCPVVYHRKDIILLFPDIDNGGK  265
             + E+ +  P      L+++W R+ F    F WGKP +  PV    K++IL      +  +
Sbjct  350   YFEVKRSRPSLTATLLITTWTRIPFRSADFGWGKPFFFGPVTLPGKEVILFL----SHNE  405

Query  264   SNSGVNVLVALPPKEMEKFKSLFH  193
              +  +NVL+ LP   M++F+ L  
Sbjct  406   ESKSINVLLGLPASAMKRFERLME  429



>gb|KDP22581.1| hypothetical protein JCGZ_26412 [Jatropha curcas]
Length=432

 Score =   209 bits (532),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 143/436 (33%), Positives = 218/436 (50%), Gaps = 31/436 (7%)
 Frame = -3

Query  1479  LIFPSQETTKHTMFLSNIDKVLNFDVQTVHFFPASPGFPPEIVAGKIKNAFRRLLVANTY  1300
             L+ P++ET K   FLSN+D+ +   V+T++ F +      E     IK+A  ++LV   Y
Sbjct  20    LVPPAEETVKGLYFLSNLDQNIAVVVRTIYCFKSDVK-GNEDAMEVIKDALSKVLV--QY  76

Query  1299  DFLAGRLKKNKESERVEIECNAAGAGFTVASSEFALEDIGDLVYPNPAFRQLVTMSFDFV  1120
               LAGRL  + E + + ++C   GA    A +   + +IGD   P+P    L  + +D  
Sbjct  77    YPLAGRLTISSEGKLI-VDCTGEGAVLVEAEANCEITEIGDTTKPDPV--TLGKLVYDIP  133

Query  1119  AKEDQ---PLCFLQVTSFKCGGFALGTSMNHISFDGSGFKMFLENLAALSFNDDGPLAVV  949
               ++    P    QVT F CGGF LG  MNH  FDG G   F+ +    +     PL V 
Sbjct  134   GAQNILQIPPLVAQVTRFNCGGFVLGLCMNHCMFDGIGAMEFVNSWGETA--RGLPLKVP  191

Query  948   PCNDRSLLAARSPPQVTFPHPELLKVNLPAGEEMAPPVFDSLKDDLAFEIFQLSSADIER  769
             P  DRS+L AR+PP++ FPH E +++      E         ++++ +  F      +E+
Sbjct  192   PFPDRSILKARNPPKIEFPHHEFVEI------EDISNTSKLYEEEMLYRSFCFDPEKLEK  245

Query  768   LKDKAKAPDNVKTKVTGFNVLTAAIW--RCKALSCLGGENNSDRLSTVLFAVDIRRRLNP  595
             LK+ A   + V  K + F  L+A +W  RC+AL  L      D+ + +LFAVD R R  P
Sbjct  246   LKEMATE-NGVIPKCSTFEALSAFVWKARCQALRML-----PDQQTKLLFAVDGRSRFAP  299

Query  594   PLPDSYSGNAVLTGYGSAKCAELEEGPFWKTVQMVYEGAARMTDEYARSAIDWGELYKGF  415
             P+P+ Y GNA++      +  +L +      V +V E    + D Y RSAID+ E+ +  
Sbjct  300   PIPEGYFGNAIVLTNSLCRAGDLLDNHLSFAVGLVKEAVNLVNDSYMRSAIDYFEVTRAR  359

Query  414   PH--GEFLVSSWWRLGFEGVQFPWGKPKYSCPVVYHRKDIILLFPDIDNGGKSNSGVNVL  241
             P   G  L+++W RL F    F WG+P  S PV    K++IL      + GK    +NVL
Sbjct  360   PSLAGTLLITTWSRLSFHTTDFGWGEPILSGPVALPEKEVILFL----SHGKERKSINVL  415

Query  240   VALPPKEMEKFKSLFH  193
             + LP   M+ F+ L  
Sbjct  416   LGLPASAMKFFEELMQ  431



>gb|KHN28276.1| Omega-hydroxypalmitate O-feruloyl transferase [Glycine soja]
Length=369

 Score =   207 bits (527),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 136/390 (35%), Positives = 201/390 (52%), Gaps = 29/390 (7%)
 Frame = -3

Query  1341  IKNAFRRLLVANTYDFLAGRLKKNKESERVEIECNAAGAGFTVASSEFALEDIGDLVYPN  1162
             +KNA R++LV   Y  LAGRL  + E + + ++C   GA F  A +  ++E+IGD+  P+
Sbjct  1     MKNALRKVLVH--YYPLAGRLTISSEGKLI-VDCTGEGALFVEAEANCSMEEIGDITKPD  57

Query  1161  PAFRQLVTMSFDFVAKE---DQPLCFLQVTSFKCGGFALGTSMNHISFDGSGFKMFLENL  991
             P    L  + +D    +     P    QVT FKCGGFALG  MNH  FDG G   F+ + 
Sbjct  58    PG--TLGMLVYDIPEAKHILQMPPLVAQVTKFKCGGFALGLCMNHCMFDGIGAMEFVNSW  115

Query  990   AALSFNDDGPLAVVPCNDRSLLAARSPPQVTFPHPELLKVNLPAGEEMAPPVFDSLKDDL  811
                +   D PL++ P  DRS+L AR+PP++   H E   +     E+ +      ++D++
Sbjct  116   GEAA--RDLPLSIPPVLDRSMLKARNPPKIEHLHQEFADI-----EDKSSTNSLYVEDEM  168

Query  810   AFEIFQLSSADIERLKDKAKAPDNVKTKVTGFNVLTAAIW--RCKALSCLGGENNSDRLS  637
              +  F      +++LK KA   D    K T F VL+A +W  R KAL  L      D+ +
Sbjct  169   VYRSFCFEPERLKQLKMKAME-DGALEKCTTFEVLSAFVWIARTKALKLL-----PDQQT  222

Query  636   TVLFAVDIRRRLNPPLPDSYSGNAVLTGYGSAKCAELEEGPFWKTVQMVYEGAARMTDEY  457
              +LFAVD R + NPPLP  Y GN ++      +  EL E PF   V+++ +    +TD Y
Sbjct  223   KLLFAVDGRAKFNPPLPKGYFGNGIVLTNSVCQAGELTEKPFSFGVRLIQDAIKMVTDSY  282

Query  456   ARSAIDWGELYKGFPH--GEFLVSSWWRLGFEGVQFPWGKPKYSCPVVYHRKDIILLFPD  283
              RSAID+ E+ +  P      L+++W RL F    F WG P  S PV    K++IL    
Sbjct  283   MRSAIDYFEVTRARPSLACTLLITTWSRLSFHTTDFGWGDPVLSGPVSLPEKEVILFL--  340

Query  282   IDNGGKSNSGVNVLVALPPKEMEKFKSLFH  193
               + G+    +NVL+ LP   M+ F+ L  
Sbjct  341   --SHGQERRNINVLLGLPAPVMKIFQDLMQ  368



>gb|KDP32472.1| hypothetical protein JCGZ_13397 [Jatropha curcas]
Length=434

 Score =   209 bits (532),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 147/439 (33%), Positives = 218/439 (50%), Gaps = 30/439 (7%)
 Frame = -3

Query  1488  DSGLIFPSQETTKHTMFLSNIDKVLNFDVQTVHFFPASPGFPPEIVAGKIKNAFRRLLVA  1309
             D  L+ P +ET K   FLSN+D+ +   V+TV+ F ++        A  I+NA  ++LV 
Sbjct  18    DPILVTPEEETEKGLYFLSNLDQNIAAIVRTVYCFKSNEEGNAN-SAEVIRNALEKVLVH  76

Query  1308  NTYDFLAGRLKKNKESERVEIECNAAGAGFTVASSEFALEDIGDLVYPNPAFRQLVTMSF  1129
               Y  LAGRL  + E + + + CN  GA F  A +   +E IG +  P+P    L  + +
Sbjct  77    --YYPLAGRLTISSEGKLI-VNCNGEGAVFVEAEANCEMEKIGGITKPDP--HTLGKLVY  131

Query  1128  DFVAKED---QPLCFLQVTSFKCGGFALGTSMNHISFDGSGFKMFLENLAALSFNDDGPL  958
             D    ++    P    QVT FKCGGF LG  MNH  FDG G   F+ +   ++     PL
Sbjct  132   DIPGAKNFLQMPPLVAQVTKFKCGGFVLGLCMNHCMFDGIGAMEFVNSWGEIA--RGLPL  189

Query  957   AVVPCNDRSLLAARSPPQVTFPHPELLKVNLPAGEEMAPPVFDSLKDDLAFEIFQLSSAD  778
             ++ P  DRS+L AR+PP+V + H E  ++     E+ +       +++  +  F  +   
Sbjct  190   SIPPFMDRSILKARNPPKVEYLHQEFAEI-----EDKSKTNNLYKEEETLYNSFCFNPEM  244

Query  777   IERLKDKAKAPDNVKTKVTGFNVLTAAIWRC--KALSCLGGENNSDRLSTVLFAVDIRRR  604
             I ++K KA   D    K T F  LTA +WR   KAL+ +      D+ + +LFAVD R +
Sbjct  245   INKIKTKA-MEDGTVEKCTTFETLTAFVWRARTKALNLV-----PDQETKLLFAVDGRPK  298

Query  603   LNPPLPDSYSGNAVLTGYGSAKCAELEEGPFWKTVQMVYEGAARMTDEYARSAIDWGELY  424
              NP LP  Y GN ++      K  EL E P    V++V      +TD Y RSAID+ E+ 
Sbjct  299   FNPKLPKGYFGNGIVLTNSICKAGELLENPLSYAVRLVQNSVKAVTDSYMRSAIDYFEVT  358

Query  423   KGFPH--GEFLVSSWWRLGFEGVQFPWGKPKYSCPVVYHRKDIILLFPDIDNGGKSNSGV  250
             +  P      L+S+W RL F    F WG+P  S PV    K++ L      + G     +
Sbjct  359   RARPSLASTLLLSTWSRLSFHTTDFGWGEPILSGPVALPEKEVSLFL----SHGNERKSI  414

Query  249   NVLVALPPKEMEKFKSLFH  193
             +VL+ LP   M+ F+ L  
Sbjct  415   HVLLGLPASAMKVFQELMQ  433



>ref|XP_006844599.1| hypothetical protein AMTR_s00016p00213830 [Amborella trichopoda]
 gb|ERN06274.1| hypothetical protein AMTR_s00016p00213830 [Amborella trichopoda]
Length=432

 Score =   209 bits (532),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 144/449 (32%), Positives = 221/449 (49%), Gaps = 26/449 (6%)
 Frame = -3

Query  1524  ETLHE---DLKVTILDSGLIFPSQETTKHTMFLSNIDKVLNFDVQTVHFFPASPGFPPEI  1354
             E  HE   +L V   +  L+ P +E  K   FLSN+D+ +   VQTV+ F        E 
Sbjct  2     ENTHETKFELMVKKEEPTLVPPVEEREKDLYFLSNLDQNIAVIVQTVYCF-KDENKGNET  60

Query  1353  VAGKIKNAFRRLLVANTYDFLAGRLKKNKESERVEIECNAAGAGFTVASSEFALEDIGDL  1174
              +  IK A  ++LV   Y  LAGRL  + E + + ++C+  GA F  A ++  L+DIGD+
Sbjct  61    ASQVIKEALAKILV--DYYPLAGRLTISSEGKLI-VDCSGEGAVFVDAVADCELKDIGDI  117

Query  1173  VYPNP-AFRQLVTMSFDFVAKEDQPLCFLQVTSFKCGGFALGTSMNHISFDGSGFKMFLE  997
               P+P    +LV          + P    QVT FKCGGF LG +MNH  FDG G   F+ 
Sbjct  118   TKPDPLTLGKLVYTIPGAKNILEIPPLVAQVTRFKCGGFVLGLAMNHCMFDGLGAMEFVN  177

Query  996   NLAALSFNDDGPLAVVPCNDRSLLAARSPPQVTFPHPELLKVNLPAGEEMAPPVFDSLKD  817
             +    +     PL + P  DRS+L AR PP+V FPH E  ++      E      +  + 
Sbjct  178   SWGEAA--RGLPLTIKPFLDRSILKARDPPKVEFPHDEFEEI------EDISKTHELYQQ  229

Query  816   DLAFEIFQLSSADIERLKDKAKAPDNVKTKVTGFNVLTAAIWRCKALSCLGGENNSDRLS  637
             ++ +  F      ++ +K        ++ + T F  L+A +W+ +  +    +   D+ +
Sbjct  230   EMLYRSFCFGPEQLDHIKAMGMEGGGLE-RCTTFEALSAFVWKARTRAL---QLRPDQRT  285

Query  636   TVLFAVDIRRRLNPPLPDSYSGNAVLTGYGSAKCAELEEGPFWKTVQMVYEGAARMTDEY  457
              +LFAVD R R  PPLP  Y GN ++    +    E+ E P   TV++V +    +TD  
Sbjct  286   KLLFAVDGRSRFVPPLPKGYFGNGIVLTNSACNAGEILENPLSFTVELVQKAVDMVTDSC  345

Query  456   ARSAIDWGELYKGFPH--GEFLVSSWWRLGFEGVQFPWGKPKYSCPVVYHRKDIILLFPD  283
              RSAID+ E+ +  P      L+++W RL F    F WG+P+ S PV    K++IL    
Sbjct  346   MRSAIDYFEVTRARPSLTATLLITTWSRLSFHTTDFGWGEPQQSGPVTLPEKEVILFL--  403

Query  282   IDNGGKSNSGVNVLVALPPKEMEKFKSLF  196
               + G+    +NVL+ LP   M+ F+ L 
Sbjct  404   --SHGRERKSINVLLGLPASAMKTFQDLM  430



>ref|XP_010024179.1| PREDICTED: omega-hydroxypalmitate O-feruloyl transferase [Eucalyptus 
grandis]
 gb|KCW60629.1| hypothetical protein EUGRSUZ_H03354 [Eucalyptus grandis]
Length=443

 Score =   209 bits (532),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 148/446 (33%), Positives = 221/446 (50%), Gaps = 31/446 (7%)
 Frame = -3

Query  1509  DLKVTILDSGLIFPSQETTKHTMFLSNIDKVLNFDVQTVHFFPASPGFPPEIVAGKIKNA  1330
              L VT  +  L+ P++ET     FLSN+D+ +   ++T++ F  S     E V   IK A
Sbjct  21    QLCVTQGEPTLVTPAEETENGLYFLSNLDQNIAVIIRTIYCF-KSIEKGNEHVGEVIKGA  79

Query  1329  FRRLLVANTYDFLAGRLKKNKESERVEIECNAAGAGFTVASSEFALEDIGDLVYPNPAFR  1150
              +++LV   Y  LAGRL  + E + + ++C   GA F  A +   LE+IGD+  P+P   
Sbjct  80    LKKVLVH--YYPLAGRLTISPEGKLI-VDCTGEGAIFVEAEANCTLEEIGDITKPHP--E  134

Query  1149  QLVTMSFDFVAKE---DQPLCFLQVTSFKCGGFALGTSMNHISFDGSGFKMFLENLAALS  979
              L  + +D    +   + P    QVT FKCGGF LG  MNH  FDG G   F+ +    +
Sbjct  135   TLGKLVYDVPGAKNILEMPPLVAQVTKFKCGGFVLGLCMNHCMFDGIGAMEFVNSWGETA  194

Query  978   FNDDGPLAVVPCNDRSLLAARSPPQVTFPHPELLKVNLPAGEEMAPPVFDSLKDDLAFEI  799
                  PL   P  DR++L +R+PP+V   H E  ++      E      D  KD++ +  
Sbjct  195   --RGLPLTTPPFLDRTILKSRNPPKVENLHQEFAEI------EDKSNTADLYKDEMRYSS  246

Query  798   FQLSSADIERLKDKAKAPDNVKTKVTGFNVLTAAIWRC--KALSCLGGENNSDRLSTVLF  625
             F      +E+LK KA   D V  K T F  L+A +WR   KAL+ +      D+ + +LF
Sbjct  247   FCFDPEKLEKLKAKAMK-DGVLEKCTTFEALSAFVWRARTKALNMV-----PDQQTKLLF  300

Query  624   AVDIRRRLNPPLPDSYSGNAVLTGYGSAKCAELEEGPFWKTVQMVYEGAARMTDEYARSA  445
             AVD R +  PPLP  Y GN ++      +  E+ E P    V +V +    ++D Y RSA
Sbjct  301   AVDGRPKFEPPLPKGYFGNGIVLTNSICEAGEILEKPLSYAVGLVQDAIKMVSDGYMRSA  360

Query  444   IDWGELYKGFPH--GEFLVSSWWRLGFEGVQFPWGKPKYSCPVVYHRKDIILLFPDIDNG  271
             ID+ E+ +  P      L+++W RL F    F WG+P  S PV    K++IL      + 
Sbjct  361   IDYFEITRARPSLACTLLITTWSRLSFYTTDFGWGEPILSGPVALPEKEVILFL----SH  416

Query  270   GKSNSGVNVLVALPPKEMEKFKSLFH  193
             G     +NVL+ +P   M+ F+ L  
Sbjct  417   GTGRKSINVLLGMPAPAMKIFEELMQ  442



>ref|XP_009379971.1| PREDICTED: omega-hydroxypalmitate O-feruloyl transferase-like 
[Musa acuminata subsp. malaccensis]
Length=482

 Score =   209 bits (533),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 141/444 (32%), Positives = 218/444 (49%), Gaps = 27/444 (6%)
 Frame = -3

Query  1509  DLKVTILDSGLIFPSQETTKHTMFLSNIDKVLNFDVQTVHFFPASPGFPPEIVAGKIKNA  1330
             +L V   +  L+ P++ET K   FL+N+D+ +   VQT++ F  S     E     IK A
Sbjct  60    ELSVRQGEVTLVPPAEETQKGLYFLTNLDQNIAVIVQTIYCF-RSEEKGNEKAGEVIKEA  118

Query  1329  FRRLLVANTYDFLAGRLKKNKESERVEIECNAAGAGFTVASSEFALEDIGDLVYPNPAFR  1150
               ++LV   Y  LAGRL  + E + + ++C   GA F  A ++  + DIGD+  P+P   
Sbjct  119   LAKVLVH--YYPLAGRLTISNEGKLI-VDCTGEGAVFVEAEADCEMADIGDIAKPDP--N  173

Query  1149  QLVTMSFDFVAKE---DQPLCFLQVTSFKCGGFALGTSMNHISFDGSGFKMFLENLAALS  979
              L  + ++    +   + P    QVT F+CGGF LG +MNH  FDG G   F+ +    +
Sbjct  174   TLGKLVYNVPGAKNILEIPPLAAQVTRFRCGGFILGLAMNHCMFDGLGAMEFVNSWGETA  233

Query  978   FNDDGPLAVVPCNDRSLLAARSPPQVTFPHPELLKVNLPAGEEMAPPVFDSLKDDLAFEI  799
                  P++V P  DR++L  R PP ++FPH E  ++      E    V    ++++ +  
Sbjct  234   RGQ--PVSVPPFIDRTILKPREPPVISFPHHEFAEI------EDVSDVVTVYQEEMLYRS  285

Query  798   FQLSSADIERLKDKAKAPDNVKTKVTGFNVLTAAIWRCKALSCLGGENNSDRLSTVLFAV  619
             F      + R+K ++   D    K T F  L+  +WR +  + L       +L   LFAV
Sbjct  286   FCFDPEKLGRVK-RSAMDDGALDKCTTFEALSGLVWRARTEALLLQPGQQTKL---LFAV  341

Query  618   DIRRRLNPPLPDSYSGNAVLTGYGSAKCAELEEGPFWKTVQMVYEGAARMTDEYARSAID  439
             D R R +PPLP+ Y GN ++         EL   P    V +V +    +TDEY RSA+D
Sbjct  342   DGRSRFDPPLPEGYFGNGIVLTNSLCTAGELLARPLSFAVGLVQDAVKMVTDEYMRSAMD  401

Query  438   WGELYKGFPH--GEFLVSSWWRLGFEGVQFPWGKPKYSCPVVYHRKDIILLFPDIDNGGK  265
             + E  +  P      L+++W RL F    F WG+P  S PV   +K++IL      + GK
Sbjct  402   YFEATRARPSLTATLLITTWSRLSFHTTDFGWGEPVQSGPVTLPQKEVILFL----SHGK  457

Query  264   SNSGVNVLVALPPKEMEKFKSLFH  193
                 +NVL+ LP   M +F+ L  
Sbjct  458   ERKSINVLLGLPNSAMARFQELME  481



>gb|EPS64002.1| hypothetical protein M569_10778 [Genlisea aurea]
Length=431

 Score =   208 bits (529),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 141/447 (32%), Positives = 225/447 (50%), Gaps = 20/447 (4%)
 Frame = -3

Query  1518  LHEDLKVTILDSGLIFPSQETTKHTMFLSNIDKVLNFDVQTVHFFPASPGFPPEIVAGKI  1339
             +  +L V   +  LI P++ET +   FLSN+D+ +   V+TV+ F +        V   +
Sbjct  1     MEPELIVIRREPILISPAEETQRGLYFLSNLDQNIAVVVKTVYCFESGEEKVDGGVFEVM  60

Query  1338  KNAFRRLLVANTYDFLAGRLKKNKESERVEIECNAAGAGFTVASSEFALEDIGDLVYPNP  1159
             K++  ++LV   Y  LAGRL+ + E + + ++C   GA F  A + F  + +GD+  P+P
Sbjct  61    KSSLAKILV--HYYPLAGRLRISDEMKLI-VDCTGEGAVFVEADATFRFDRLGDVDRPDP  117

Query  1158  -AFRQLVTMSFDFVAKEDQPLCFLQVTSFKCGGFALGTSMNHISFDGSGFKMFLENLAAL  982
              A   LV          + P   +QVT F+CGGFA+G  MNH  FDG G   F+ +   +
Sbjct  118   IALGMLVHEIPGARNMLEIPPLVVQVTKFECGGFAVGLCMNHCMFDGVGAMEFVNSWGEI  177

Query  981   SFNDDGPLAVVPCNDRSLLAARSPPQVTFPHPELLKVNLPAGEEMAPPVFDSLKDDLAFE  802
             +     PL   P  DRS+L AR+PP+  FPH E  ++     E+++         ++ + 
Sbjct  178   A-RGMIPLKSPPFMDRSILKARNPPRPEFPHREFAEI-----EDVSDFAGVYHSSEMVYR  231

Query  801   IFQLSSADIERLKDKAKAPDNVKTKVTGFNVLTAAIWRCKALSCLGGENNSDRLSTVLFA  622
              F      ++ LK++A   D +  K T F  L+  +W+ +  +    +   D+   +LFA
Sbjct  232   SFCFGPEKLDLLKNRAME-DGILEKCTTFEALSGFVWKARTHAL---DLKPDQEVKLLFA  287

Query  621   VDIRRRLNPPLPDSYSGNAVLTGYGSAKCAELEEGPFWKTVQMVYEGAARMTDEYARSAI  442
             VD RRR  P +P++Y GNA++      K  E+   P    V++V +    + D Y RSAI
Sbjct  288   VDGRRRFTPQIPENYFGNAIVLTNSLCKAGEIRRNPLSFAVRLVQQAVRMVDDRYMRSAI  347

Query  441   DWGELYKGFPH--GEFLVSSWWRLGFEGVQFPWGKPKYSCPVVYHRKDIILLFPDIDNGG  268
             D+ E  +  P   G  L+++W RL F    F WG P  S PV    K++IL      + G
Sbjct  348   DYFEATRARPSLVGTLLITAWSRLPFHAADFGWGSPAISGPVGLPEKEVILFL----SHG  403

Query  267   KSNSGVNVLVALPPKEMEKFKSLFHKF  187
             K    +NVL+ LP   M +F++LF + 
Sbjct  404   KQRRNINVLLGLPKSAMAEFENLFSQI  430



>ref|XP_002321725.2| hypothetical protein POPTR_0015s11290g [Populus trichocarpa]
 gb|EEF05852.2| hypothetical protein POPTR_0015s11290g [Populus trichocarpa]
Length=432

 Score =   207 bits (527),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 145/450 (32%), Positives = 224/450 (50%), Gaps = 33/450 (7%)
 Frame = -3

Query  1515  HEDLKVTIL--DSGLIFPSQETTKHTMFLSNIDKVLNFDVQTVHFFPASPGFPPEIVAGK  1342
             ++ LK+T+   +  L+ P++ET K   FLSN+D+ +   V+T++ F +      + V   
Sbjct  6     NDALKLTVKQGEPTLVPPAEETKKGLYFLSNLDQNIAVIVRTIYCFKSDVKGNEDAVE-V  64

Query  1341  IKNAFRRLLVANTYDFLAGRLKKNKESERVEIECNAAGAGFTVASSEFALEDIGDLVYPN  1162
             IKNA  ++LV   Y  +AGRL  + + + + ++C   GA F  A ++  + ++GD+  P+
Sbjct  65    IKNALSKILVH--YYPIAGRLTISSKGKLI-VDCTGEGAVFVEAETDCEIAELGDITKPD  121

Query  1161  PAFRQLVTMSFDFVAKED---QPLCFLQVTSFKCGGFALGTSMNHISFDGSGFKMFLENL  991
             P    L  + ++    ++    P    QVT FKCGGF LG   NH  FDG G   F+ + 
Sbjct  122   PV--TLGKLVYEIPGAQNILQMPPVTAQVTKFKCGGFVLGLCTNHCMFDGIGAMEFVNSW  179

Query  990   AALSFNDDGPLAVVPCNDRSLLAARSPPQVTFPHPELLKVNLPAGEEMAPPVFDSLKDDL  811
              A +      L V P  DRS+L AR PP++ FPH E   +      E         ++++
Sbjct  180   GATARG--LALDVPPFLDRSILKARIPPKIEFPHHEFDDI------EDVSNTSKLYEEEM  231

Query  810   AFEIFQLSSADIERLKDKAKAPDNVKTKVTGFNVLTAAIWR--CKALSCLGGENNSDRLS  637
              +  F      +++LK+KA   D V  K T F VL+A +WR  C+AL  +      D+  
Sbjct  232   LYRSFCFDPEKLDQLKEKA-MEDGVIAKCTTFQVLSAFVWRARCQALKMV-----PDQQI  285

Query  636   TVLFAVDIRRRLNPPLPDSYSGNAVLTGYGSAKCAELEEGPFWKTVQMVYEGAARMTDEY  457
              +LFA D R R  PP+P+ Y GNA++         E+ E      V++V E    + D Y
Sbjct  286   KLLFAADGRSRFEPPIPEGYFGNAIVLTNSLCTAGEIMENQLSFAVRLVQEAVKMVDDSY  345

Query  456   ARSAIDWGELYKGFPH--GEFLVSSWWRLGFEGVQFPWGKPKYSCPVVYHRKDIILLFPD  283
              RSAID+ E+ +  P      L+++W RL F    F WG P  S PV    K++IL    
Sbjct  346   MRSAIDYFEVTRARPSLTATLLITTWSRLSFHTTDFGWGVPILSGPVALPEKEVILFL--  403

Query  282   IDNGGKSNSGVNVLVALPPKEMEKFKSLFH  193
               + G     +NVLV LP   M+ F+ L  
Sbjct  404   --SHGIERKNINVLVGLPASSMKIFEELMQ  431



>gb|ADL37203.1| At1g65450-like protein [Arabidopsis lyrata subsp. lyrata]
 gb|ADL37218.1| At1g65450-like protein [Arabidopsis lyrata subsp. lyrata]
 gb|ADL37226.1| At1g65450-like protein [Arabidopsis lyrata subsp. lyrata]
 gb|ADL37227.1| At1g65450-like protein [Arabidopsis lyrata subsp. lyrata]
 gb|ADL37228.1| At1g65450-like protein [Arabidopsis lyrata subsp. lyrata]
 gb|ADL37240.1| At1g65450-like protein [Arabidopsis lyrata subsp. lyrata]
 gb|ADL37242.1| At1g65450-like protein [Arabidopsis lyrata subsp. lyrata]
 gb|ADL37245.1| At1g65450-like protein [Arabidopsis lyrata subsp. lyrata]
 gb|ADL37252.1| At1g65450-like protein [Arabidopsis lyrata subsp. lyrata]
 gb|ADL37256.1| At1g65450-like protein [Arabidopsis lyrata subsp. lyrata]
 gb|ADL37259.1| At1g65450-like protein [Arabidopsis lyrata subsp. lyrata]
 gb|ADL37261.1| At1g65450-like protein [Arabidopsis lyrata subsp. lyrata]
 gb|ADL37262.1| At1g65450-like protein [Arabidopsis lyrata subsp. lyrata]
 gb|ADL37263.1| At1g65450-like protein [Arabidopsis lyrata subsp. lyrata]
 gb|ADL37264.1| At1g65450-like protein [Arabidopsis lyrata subsp. lyrata]
 gb|ADL37265.1| At1g65450-like protein [Arabidopsis lyrata subsp. lyrata]
 gb|ADL37266.1| At1g65450-like protein [Arabidopsis lyrata subsp. lyrata]
 gb|ADL37267.1| At1g65450-like protein [Arabidopsis lyrata subsp. lyrata]
 gb|ADL37268.1| At1g65450-like protein [Arabidopsis lyrata subsp. lyrata]
 gb|ADL37269.1| At1g65450-like protein [Arabidopsis lyrata subsp. lyrata]
 gb|ADL37270.1| At1g65450-like protein [Arabidopsis lyrata subsp. lyrata]
 gb|ADL37271.1| At1g65450-like protein [Arabidopsis lyrata subsp. lyrata]
 gb|ADL37272.1| At1g65450-like protein [Arabidopsis lyrata subsp. lyrata]
 gb|ADL37274.1| At1g65450-like protein [Arabidopsis lyrata subsp. lyrata]
 gb|ADL37275.1| At1g65450-like protein [Arabidopsis lyrata subsp. lyrata]
 gb|ADL37276.1| At1g65450-like protein [Arabidopsis lyrata subsp. lyrata]
 gb|ADL37280.1| At1g65450-like protein [Arabidopsis lyrata subsp. lyrata]
 gb|ADL37285.1| At1g65450-like protein [Arabidopsis lyrata subsp. lyrata]
 gb|ADL37286.1| At1g65450-like protein [Arabidopsis lyrata subsp. lyrata]
 gb|ADL37298.1| At1g65450-like protein [Arabidopsis lyrata subsp. lyrata]
 gb|ADL37302.1| At1g65450-like protein [Arabidopsis lyrata subsp. lyrata]
 gb|ADL37304.1| At1g65450-like protein [Arabidopsis lyrata subsp. lyrata]
 gb|ADL37305.1| At1g65450-like protein [Arabidopsis lyrata subsp. lyrata]
 gb|ADL37306.1| At1g65450-like protein [Arabidopsis lyrata subsp. lyrata]
 gb|ADL37308.1| At1g65450-like protein [Arabidopsis lyrata subsp. lyrata]
 gb|ADL37309.1| At1g65450-like protein [Arabidopsis lyrata subsp. lyrata]
 gb|ADL37310.1| At1g65450-like protein [Arabidopsis lyrata subsp. lyrata]
 gb|ADL37319.1| At1g65450-like protein [Arabidopsis lyrata subsp. lyrata]
 gb|ADL37320.1| At1g65450-like protein [Arabidopsis lyrata subsp. lyrata]
 gb|ADL37323.1| At1g65450-like protein [Arabidopsis lyrata subsp. lyrata]
 gb|ADL37324.1| At1g65450-like protein [Arabidopsis lyrata subsp. lyrata]
 gb|ADL37325.1| At1g65450-like protein [Arabidopsis lyrata subsp. lyrata]
 gb|ADL37326.1| At1g65450-like protein [Arabidopsis lyrata subsp. lyrata]
 gb|ADL37327.1| At1g65450-like protein [Arabidopsis lyrata subsp. lyrata]
 gb|ADL37328.1| At1g65450-like protein [Arabidopsis lyrata subsp. lyrata]
 gb|ADL37329.1| At1g65450-like protein [Arabidopsis lyrata subsp. lyrata]
 gb|ADL37330.1| At1g65450-like protein [Arabidopsis lyrata subsp. lyrata]
 gb|ADL37331.1| At1g65450-like protein [Arabidopsis lyrata subsp. lyrata]
 gb|ADL37335.1| At1g65450-like protein [Arabidopsis lyrata subsp. lyrata]
 gb|ADL37338.1| At1g65450-like protein [Arabidopsis lyrata subsp. lyrata]
 gb|ADL37339.1| At1g65450-like protein [Arabidopsis lyrata subsp. lyrata]
 gb|ADL37340.1| At1g65450-like protein [Arabidopsis lyrata subsp. lyrata]
 gb|ADL37341.1| At1g65450-like protein [Arabidopsis lyrata subsp. lyrata]
 gb|ADL37344.1| At1g65450-like protein [Arabidopsis lyrata subsp. lyrata]
 gb|ADL37345.1| At1g65450-like protein [Arabidopsis lyrata subsp. lyrata]
 gb|ADL37348.1| At1g65450-like protein [Arabidopsis lyrata subsp. lyrata]
 gb|ADL37349.1| At1g65450-like protein [Arabidopsis lyrata subsp. lyrata]
 gb|ADL37350.1| At1g65450-like protein [Arabidopsis lyrata subsp. lyrata]
 gb|ADL37352.1| At1g65450-like protein [Arabidopsis lyrata subsp. lyrata]
 gb|ADL37353.1| At1g65450-like protein [Arabidopsis lyrata subsp. lyrata]
 gb|ADL37357.1| At1g65450-like protein [Arabidopsis lyrata subsp. lyrata]
 gb|ADL37361.1| At1g65450-like protein [Arabidopsis lyrata subsp. lyrata]
 gb|ADL37362.1| At1g65450-like protein [Arabidopsis lyrata subsp. lyrata]
 gb|ADL37365.1| At1g65450-like protein [Arabidopsis lyrata subsp. lyrata]
 gb|ADL37367.1| At1g65450-like protein [Arabidopsis lyrata subsp. lyrata]
 gb|ADL37372.1| At1g65450-like protein [Arabidopsis lyrata subsp. lyrata]
 gb|ADL37375.1| At1g65450-like protein [Arabidopsis lyrata subsp. lyrata]
Length=170

 Score =   199 bits (505),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 101/173 (58%), Positives = 122/173 (71%), Gaps = 7/173 (4%)
 Frame = -3

Query  912  PPQVTFPHPELLKVNLPAGEEMAPPVFDSLKDDLAFEIFQLSSADIERLKDKAKAPDNVK  733
            PP VTFPH EL+K      +     VF++    L F+IF+LSS  I++LK++A    N  
Sbjct  1    PPSVTFPHHELVKFQ----DCETTTVFEATSQHLDFKIFKLSSEQIKKLKERASETSNGY  56

Query  732  TKVTGFNVLTAAIWRCKALSCL---GGENNSDRLSTVLFAVDIRRRLNPPLPDSYSGNAV  562
             +VTGFNV+TA +WRCKALS     G E N +R ST+L+AVDIR RLNP LP SY+GNAV
Sbjct  57   VRVTGFNVVTALVWRCKALSVAAEEGEETNLERESTILYAVDIRGRLNPELPPSYTGNAV  116

Query  561  LTGYGSAKCAELEEGPFWKTVQMVYEGAARMTDEYARSAIDWGELYKGFPHGE  403
            LT Y  AKC  L E PF + V++V EGA R+TDEYARSAIDWGELYKGFPHGE
Sbjct  117  LTAYAKAKCKALLEEPFGRIVEIVGEGANRITDEYARSAIDWGELYKGFPHGE  169



>gb|ACY79409.1| omega-hydroxyacid hydroxycinnamoyltransferase [Populus trichocarpa]
Length=432

 Score =   207 bits (527),  Expect = 9e-57, Method: Compositional matrix adjust.
 Identities = 145/450 (32%), Positives = 224/450 (50%), Gaps = 33/450 (7%)
 Frame = -3

Query  1515  HEDLKVTIL--DSGLIFPSQETTKHTMFLSNIDKVLNFDVQTVHFFPASPGFPPEIVAGK  1342
             ++ LK+T+   +  L+ P++ET K   FLSN+D+ +   V+T++ F +      + V   
Sbjct  6     NDALKLTVKQGEPTLVPPAEETKKGLYFLSNLDQNIAVIVRTIYCFKSDVKGNEDAVE-V  64

Query  1341  IKNAFRRLLVANTYDFLAGRLKKNKESERVEIECNAAGAGFTVASSEFALEDIGDLVYPN  1162
             IKNA  ++LV   Y  +AGRL  + + + + ++C   GA F  A ++  + ++GD+  P+
Sbjct  65    IKNALSKILVH--YYPIAGRLTISSKGKLI-VDCTGEGAVFVEAETDCEIAELGDITKPD  121

Query  1161  PAFRQLVTMSFDFVAKED---QPLCFLQVTSFKCGGFALGTSMNHISFDGSGFKMFLENL  991
             P    L  + ++    ++    P    QVT FKCGGF LG   NH  FDG G   F+ + 
Sbjct  122   PV--TLGKLVYEIPGAQNILQMPPVTAQVTKFKCGGFVLGLCTNHCMFDGIGAMEFVNSW  179

Query  990   AALSFNDDGPLAVVPCNDRSLLAARSPPQVTFPHPELLKVNLPAGEEMAPPVFDSLKDDL  811
              A +      L V P  DRS+L AR PP++ FPH E   +      E         ++++
Sbjct  180   GATARG--LALDVPPFLDRSILKARIPPKIEFPHHEFDDI------EDVSNTSKLYEEEM  231

Query  810   AFEIFQLSSADIERLKDKAKAPDNVKTKVTGFNVLTAAIWR--CKALSCLGGENNSDRLS  637
              +  F      +++LK+KA   D V  K T F VL+A +WR  C+AL  +      D+  
Sbjct  232   LYRSFCFDPEKLDQLKEKA-MEDGVIAKCTTFQVLSAFVWRARCQALRMV-----PDQQI  285

Query  636   TVLFAVDIRRRLNPPLPDSYSGNAVLTGYGSAKCAELEEGPFWKTVQMVYEGAARMTDEY  457
              +LFA D R R  PP+P+ Y GNA++         E+ E      V++V E    + D Y
Sbjct  286   KLLFAADGRSRFEPPIPEGYFGNAIVLTNSLCTAGEIMENQLSFAVRLVQEAVKMVDDSY  345

Query  456   ARSAIDWGELYKGFPH--GEFLVSSWWRLGFEGVQFPWGKPKYSCPVVYHRKDIILLFPD  283
              RSAID+ E+ +  P      L+++W RL F    F WG P  S PV    K++IL    
Sbjct  346   MRSAIDYFEVTRARPSLTATLLITTWSRLSFHTTDFGWGVPILSGPVALPEKEVILFL--  403

Query  282   IDNGGKSNSGVNVLVALPPKEMEKFKSLFH  193
               + G     +NVLV LP   M+ F+ L  
Sbjct  404   --SHGIERKNINVLVGLPASSMKIFEELMQ  431



>ref|XP_009346788.1| PREDICTED: omega-hydroxypalmitate O-feruloyl transferase-like 
[Pyrus x bretschneideri]
Length=445

 Score =   207 bits (527),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 144/446 (32%), Positives = 226/446 (51%), Gaps = 32/446 (7%)
 Frame = -3

Query  1506  LKVTILDSGLIFPSQETTKHTMFLSNIDKVLNFDVQTVHFFPASPGFPPEIVAGK-IKNA  1330
             L+V   +  L+ P+ ET K   FLSN+D+ +   V+T++ F +      +  AG+ IK+A
Sbjct  23    LRVKQGEPTLVPPAVETEKGLYFLSNLDQNIAVTVRTIYCFKSDAKGNDK--AGEVIKDA  80

Query  1329  FRRLLVANTYDFLAGRLKKNKESERVEIECNAAGAGFTVASSEFALEDIGDLVYPNPAFR  1150
              +++LV   Y  LAGRL  + E + + ++C   GA F  A ++  +E+IGD+  P+P   
Sbjct  81    LKKVLVH--YYPLAGRLAISAEGKLI-VDCTGEGAVFVEAEADCVIEEIGDITKPDP--E  135

Query  1149  QLVTMSFDFVAKE---DQPLCFLQVTSFKCGGFALGTSMNHISFDGSGFKMFLENLAALS  979
              L  + +D    +   + P    QVT FKCGGFALG  MNH  FDG G   F+ +   ++
Sbjct  136   TLGKLVYDVPGAKTILEIPPLVAQVTKFKCGGFALGLCMNHCMFDGIGAMEFVNSWGKIA  195

Query  978   FNDDGPLAVVPCNDRSLLAARSPPQVTFPHPELLKVNLPAGEEMAPPVFDSLKDDLAFEI  799
                   L  +P  DRS+L AR+PP++ + H E  ++   +     P      ++ + +  
Sbjct  196   RGLQ--LTDLPFLDRSILKARNPPRIEYLHQEFSEITATSSTNKDP-----CEEKMLYRS  248

Query  798   FQLSSADIERLKDKAKAPDNVKTKVTGFNVLTAAIW--RCKALSCLGGENNSDRLSTVLF  625
             F   S  +E+LK KA+  D      T F  L+A +W  R +AL+ L      ++   ++F
Sbjct  249   FCFDSEKLEKLKTKARE-DGALENCTTFEALSAFVWKARTRALNML-----PEQQIKLMF  302

Query  624   AVDIRRRLNPPLPDSYSGNAVLTGYGSAKCAELEEGPFWKTVQMVYEGAARMTDEYARSA  445
             AVD R + +P LP  Y GN ++      K  +L + P    V +V +    +TD Y RSA
Sbjct  303   AVDGRPKFSPSLPKGYFGNGIVLTNSICKAGDLLDKPLSNAVGLVQDAIKIVTDSYMRSA  362

Query  444   IDWGELYKGFPH--GEFLVSSWWRLGFEGVQFPWGKPKYSCPVVYHRKDIILLFPDIDNG  271
             ID+ EL +  P      L+++W RL F    F WG+P  S PV    K++IL   +    
Sbjct  363   IDYFELTRARPSLASTLLITTWSRLSFYTTDFGWGEPVLSGPVALPEKEVILFLSN----  418

Query  270   GKSNSGVNVLVALPPKEMEKFKSLFH  193
             G     +NVL+ LP   M  F+ L +
Sbjct  419   GTEKKNINVLLGLPASAMNVFEELMN  444



>gb|EYU31840.1| hypothetical protein MIMGU_mgv1a019044mg [Erythranthe guttata]
Length=436

 Score =   207 bits (526),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 150/459 (33%), Positives = 217/459 (47%), Gaps = 50/459 (11%)
 Frame = -3

Query  1509  DLKVTILDSGLIFPSQETTKHTMFLSNIDKVLNFDVQTVHFFPAS--PGFPPEIVAGKIK  1336
             +L V +    L+ P++ET K   FLSN+D+ +   V+TV+ F  +       +     IK
Sbjct  8     ELSVELGHPTLVPPAKETPKGLYFLSNLDQNIAVIVRTVYCFTGADDQNSNNKNACKTIK  67

Query  1335  NAFRRLLVANTYDFLAGRLKKNKESERVEIECNAAGAGFTVASSEFALEDIGD-------  1177
              + + +LV   Y  LAGRLK + + + + ++C   GA F  A +  A+  +GD       
Sbjct  68    ESLQHILVH--YYPLAGRLKLSSDGKLI-VDCTGEGAVFVEAEANCAIRQLGDTLKLDHS  124

Query  1176  ----LVYPNPAFRQLVTMSFDFVAKEDQPLCFLQVTSFKCGGFALGTSMNHISFDGSGFK  1009
                 LVY  P    ++ +          P    QVT FKCGGF LG  +NH  FDG    
Sbjct  125   TLCKLVYDIPGVDNILQI----------PPLVAQVTKFKCGGFILGVCVNHCMFDGVSAM  174

Query  1008  MFLENLAALSFNDDGPLAVVPCNDRSLLAARSPPQVTFPHPELLKVNLPAGEEMAPPVFD  829
              F+    A +     PLA  P  DR++L AR PP++ + H E L++           V  
Sbjct  175   EFVNAWGATA--RGLPLAEPPFLDRTILNARCPPKIEYDHREFLEIQ---------DVLS  223

Query  828   SLKDDLAFEIFQLSSADIERLKDKAKAPDN----VKTKVTGFNVLTAAIWRCKALSCLGG  661
                D+L +  F      IE+LK  A   D     V  K T F VL+A +WR +  +    
Sbjct  224   PNSDELLYGSFVFDQEKIEKLKKVAMNDDGNKRVVLKKCTSFEVLSAFVWRARTRAL---  280

Query  660   ENNSDRLSTVLFAVDIRRRLNPPLPDSYSGNAVLTGYGSAKCAELEEGPFWKTVQMVYEG  481
                 D+ + +LFAVD R +  PPLP  Y GNA++      K  EL E P    V++V E 
Sbjct  281   NFPDDQETKLLFAVDGRNKFKPPLPKGYFGNAIVLTNCICKAGELLEKPLSHGVRLVQES  340

Query  480   AARMTDEYARSAIDWGELYKGFP--HGEFLVSSWWRLGFEGVQFPWGKPKYSCPVVYHRK  307
                + D Y RSAID+ E  +  P  +   L+++W +L F    F WG+P +S PV    K
Sbjct  341   IKTVNDGYMRSAIDYFEATRARPSLNSTLLITTWCQLSFNTTDFGWGEPFFSGPVGLPEK  400

Query  306   DIILLFPDIDNGGKSNSGVNVLVALPPKEMEKFKSLFHK  190
             ++IL   +    GK   GV VLV LP   M KF+ L  +
Sbjct  401   EVILFLSN----GKDRKGVTVLVGLPVSAMNKFQELLQE  435



>ref|XP_011023948.1| PREDICTED: omega-hydroxypalmitate O-feruloyl transferase [Populus 
euphratica]
Length=432

 Score =   206 bits (525),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 141/437 (32%), Positives = 220/437 (50%), Gaps = 33/437 (8%)
 Frame = -3

Query  1479  LIFPSQETTKHTMFLSNIDKVLNFDVQTVHFFPASPGFPPEIVAGKIKNAFRRLLVANTY  1300
             L+ P++ET K   FLSN+D+ +   V+T++ F +      + V   IKNA  ++LV   Y
Sbjct  20    LVPPAEETKKGQYFLSNLDQNIAVIVRTIYCFKSDVKGNEDAVE-VIKNALSKILVH--Y  76

Query  1299  DFLAGRLKKNKESERVEIECNAAGAGFTVASSEFALEDIGDLVYPNPAFRQLVTMSFDFV  1120
               +AGRL  + + + + ++C   GA F  A ++  + ++GD+  P+P    L  + ++  
Sbjct  77    YPIAGRLTISSKGKLI-VDCTGEGAVFVEAETDCEIAELGDITKPDPV--TLGKLVYEIP  133

Query  1119  AKED---QPLCFLQVTSFKCGGFALGTSMNHISFDGSGFKMFLENLAALSFNDDGPLAVV  949
               ++    PL   QVT FKCGGF LG   NH  FDG G   F+ +  A +      L V 
Sbjct  134   GAQNILQMPLVTAQVTKFKCGGFVLGLCTNHCMFDGIGAMEFVNSWGATA--RGLALDVP  191

Query  948   PCNDRSLLAARSPPQVTFPHPELLKV-NLPAGEEMAPPVFDSLKDDLAFEIFQLSSADIE  772
             P  DRS+L AR PP++ FPH E   + ++    ++        ++++ +  F      ++
Sbjct  192   PFLDRSILNARIPPKIEFPHHEFDDIIDVSNTSKL-------YEEEMLYRSFCFDPEKLD  244

Query  771   RLKDKAKAPDNVKTKVTGFNVLTAAIW--RCKALSCLGGENNSDRLSTVLFAVDIRRRLN  598
             +LK+KA   D V  K T F VL+A +W  RC+AL  +      D+   +LFA D R R  
Sbjct  245   QLKEKA-MEDGVIAKCTKFQVLSAFVWKARCQALRMV-----PDQQIKLLFAADGRSRFE  298

Query  597   PPLPDSYSGNAVLTGYGSAKCAELEEGPFWKTVQMVYEGAARMTDEYARSAIDWGELYKG  418
             P +P+ Y GNA++         E+ E      V++V E    + D Y RSAID+ E+ + 
Sbjct  299   PRIPEGYFGNAIVLTNSMCTAGEIMENQLSFAVRLVQEAVKMVDDSYMRSAIDYFEVTRA  358

Query  417   FP--HGEFLVSSWWRLGFEGVQFPWGKPKYSCPVVYHRKDIILLFPDIDNGGKSNSGVNV  244
              P  +   L+++W RL F    F WG P  S PV    K++IL      + G     +NV
Sbjct  359   RPSLNATLLITTWSRLSFHTTDFGWGVPILSGPVALPEKEVILFL----SHGNERENINV  414

Query  243   LVALPPKEMEKFKSLFH  193
             LV LP   M+ F+ L  
Sbjct  415   LVGLPASSMKIFEELMQ  431



>ref|XP_002973250.1| BAHD family acyltransferase, clade V [Selaginella moellendorffii]
 gb|EFJ25624.1| BAHD family acyltransferase, clade V [Selaginella moellendorffii]
Length=445

 Score =   206 bits (525),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 143/455 (31%), Positives = 222/455 (49%), Gaps = 31/455 (7%)
 Frame = -3

Query  1509  DLKVTIL-DSGLIFPSQETTKHTMFLSNIDKVLNFDVQTVHFFPASPGFPPEIVAGKIKN  1333
             D KV ++ +  L+ P Q   +   FLSN+D+ +   ++T++ F +S     +  A  I+ 
Sbjct  4     DFKVELVKEPELVMPEQPVEEQHYFLSNLDQNIAVVMKTIYLFESSSARAADNPADVIRQ  63

Query  1332  AFRRLLVANTYDFLAGRLKKNKESERVEIECNAAGAG-------FTVASSEFALEDIGDL  1174
                + L  + Y  LAGRL  + E  ++E+    +G G       F  A ++  + D+GD+
Sbjct  64    GLSKAL--DHYYPLAGRLGISSEG-KLEVVMKKSGDGAEQQGVVFAEAEADARICDLGDI  120

Query  1173  VYPNPA-FRQLVTMSFDFVAKEDQPLCFLQVTSFKCGGFALGTSMNHISFDGSGFKMFLE  997
             + P      QLV          + P   +QVT FKCGGF LG  +NH  FDG G   F+ 
Sbjct  121   IRPGSTPLLQLVYAIPGAKNVLEVPPMTVQVTKFKCGGFVLGLCINHCMFDGIGAMEFVH  180

Query  996   NLAALSFNDDGPLAVVPCNDRSLLAARSPPQVTFPHPELLKVN-LPAGEEMAPPVFDSLK  820
               A LS     PL++ P  DRS+L ARSPP V FPH E  +V+ +  G +    + D   
Sbjct  181   AWAELSRG--FPLSLTPELDRSVLKARSPPLVEFPHLEYAQVDDVSGGSQQNLHLNDD--  236

Query  819   DDLAFEIFQLSSADIERLKDKAKAPDNVKTKVTGFNVLTAAIWRCKALSCLGGENNSDRL  640
             D L + +F++    +E+LK +    DN     + F  L+A +W+C+  +    +    +L
Sbjct  237   DQLVYRVFRIRGQQLEQLKSQI---DN--EMCSTFEALSALVWKCRTKALAMDDRQPSKL  291

Query  639   STVLFAVDIRRRLNPPLPDSYSGNAVLTGYGSAKCAELEEGPFWKTVQMVYEGAARMTDE  460
                LFAVD R R+ PPLP  + GN ++  Y     +ELE     + V +V E  AR+ D 
Sbjct  292   ---LFAVDYRSRIQPPLPKGFMGNGIMLTYAMTTASELESKHLSEVVSLVREAIARIHDS  348

Query  459   YARSAIDWGELYKGFPH--GEFLVSSWWRLGFEGVQFPWGKPKYSCPVVYHRKDIILLFP  286
             Y RS+ID  EL +  P      LVS+W RL F    F WG+P +S PV +   ++ L   
Sbjct  349   YIRSSIDCFELQRFCPSLFSTLLVSTWSRLSFHTTDFGWGEPLHSGPVGFSEPEVCLFL-  407

Query  285   DIDNGGKSNSGVNVLVALPPKEMEKFKSLFHKFLA  181
                + G+    +N+++      M +F     + L 
Sbjct  408   ---SHGRETKDMNLILGFRSDAMTRFHDELEQVLG  439



>ref|XP_009375174.1| PREDICTED: omega-hydroxypalmitate O-feruloyl transferase-like 
[Pyrus x bretschneideri]
 ref|XP_009344292.1| PREDICTED: omega-hydroxypalmitate O-feruloyl transferase-like 
[Pyrus x bretschneideri]
Length=434

 Score =   206 bits (524),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 142/439 (32%), Positives = 220/439 (50%), Gaps = 32/439 (7%)
 Frame = -3

Query  1479  LIFPSQETTKHTMFLSNIDKVLNFDVQTVHFFPASPGFPPEIVAGKIKNAFRRLLVANTY  1300
             L+ P  ET K   +LSN+D+ +   V+T++ F +      E  A  IKNA  ++LV + Y
Sbjct  20    LVPPESETEKGLYYLSNLDQNIAVIVRTMYCFKSDSKGNEE-AAEVIKNALSKILV-HYY  77

Query  1299  DFLAGRLKKNKESERVEIECNAAGAGFTVASSEFALEDIGDLVYPNPAFRQLVTMSFDFV  1120
              F AG+L  + E + + I+C   GA F  A +   +E IGD   P+P  + L  +  D  
Sbjct  78    PF-AGKLTISAEGKLI-IDCTGDGAVFVEAEANCEMEKIGDTTKPDP--KTLGNLVHDIP  133

Query  1119  AKE---DQPLCFLQVTSFKCGGFALGTSMNHISFDGSGFKMFLENLAALSFNDDG---PL  958
               +   + PL  +QVT F CGGFALG  +NH + DG     F+      S+ D     PL
Sbjct  134   GAKNILEIPLLTVQVTKFTCGGFALGLCINHCTSDGISVMEFIN-----SWGDTARGLPL  188

Query  957   AVVPCNDRSLLAARSPPQVTFPHPELLKVNLPAGEEMAPPVFDSLKDDLAFEIFQLSSAD  778
              V P  DR++L  R+PP++ F H E L++     E+++       +++L +  F  +   
Sbjct  189   KVEPFLDRNILKPRNPPKIEFTHDEFLQI-----EDISENSKLYEEEELLYSAFCFNPEK  243

Query  777   IERLKDKAKAPDNVKTKVTGFNVLTAAIWRCKALSCLGGENNSDRLSTVLFAVDIRRRLN  598
             +E+LK K    D V    T F  L+A +WR +  +        D+ + +LFAVD R +L 
Sbjct  244   LEKLK-KMAMEDGVLENCTTFKALSAFVWRARTKAL---RMRPDQKTKLLFAVDGRSKLK  299

Query  597   PPLPDSYSGNAVLTGYGSAKCAELEEGPFWKTVQMVYEGAARMTDEYARSAIDWGELYKG  418
             PP+P+ Y GNA+L  +      EL E P    V +V +    +T  Y RS +D+ E+ + 
Sbjct  300   PPVPEGYFGNAILLTHALCSAGELLENPLSFAVGLVDKAVKMVTSSYMRSVVDYFEVTRA  359

Query  417   FPH--GEFLVSSWWRLGFEGVQFPWGKPKYSCPVVYHRKDIILLFPDIDNGGKSNSGVNV  244
              P      L+++W +L F    F WG+P +S PV    K++ L  P     G+    +NV
Sbjct  360   RPSLAATLLITAWSKLSFHTTDFGWGEPVFSGPVGLPEKEVSLFLPR----GEDRKSINV  415

Query  243   LVALPPKEMEKFKSLFHKF  187
             L+ LP   ME F+ L  + 
Sbjct  416   LLGLPASAMEIFEDLTRQI  434



>ref|XP_002991251.1| BAHD family acyltransferase, clade V [Selaginella moellendorffii]
 gb|EFJ07679.1| BAHD family acyltransferase, clade V [Selaginella moellendorffii]
Length=459

 Score =   207 bits (526),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 150/450 (33%), Positives = 226/450 (50%), Gaps = 30/450 (7%)
 Frame = -3

Query  1509  DLKVTILDSGLIFPSQETTKHTMFLSNIDKVLNFDVQTVHFFPASPGFPPEIVAGKIKNA  1330
             DL++ +  S ++ P+Q     T+FLSNID+   + V++V+ F A+P    +  A  I+ A
Sbjct  8     DLQIEVGSSKIVAPAQAVEHSTLFLSNIDQEAMYKVESVYVFAANPERESDDPAEVIEAA  67

Query  1329  FRRLLVANTYDFLAGRLKKNKESERVEIECNAAGAGFTVASSEFALEDIGDLVYPNPAFR  1150
               + LV  TY FLAGR   N +  R+E+ CN AG  F  A+S+  L D+ DL  PNPAFR
Sbjct  68    LAKTLV--TYYFLAGRFAPNAKEGRLEVNCNGAGVLFAAATSKLRLSDLRDLSVPNPAFR  125

Query  1149  QLVTMSFDFVAKEDQPLCFLQVTSFKCGGFALGTSMNHISFDGSGFKMFLENLAALSFND  970
              L+    D +   + P    Q+T FKCGGF  G ++ H   DG     F +NL +++   
Sbjct  126   SLLVQPSDSLGLFETPPATFQITRFKCGGFVFGMTIFHSLMDGVAITGFFDNLGSIA--R  183

Query  969   DGPLAVVPCNDRSLLAARSPPQVTFPHPELL-----KVNLPAGEEMAP--PVFDSLK---  820
              G + +VP  +R  L AR+PPQ    H E L     +V+  +   + P  P   S+    
Sbjct  184   GGGVVMVPNPNREFLKARNPPQPQ--HYEQLMCRQFRVSSFSEIPLLPFNPTTSSVNNFA  241

Query  819   -DDLAFEIFQLSSADIERLKDKAKAPDNVKTKVTGFNVLTAAIWRCKALSCLGGENNSDR  643
              +   F  F +SS  I  LK +A   D   ++ + F  +TA + R  A S     ++   
Sbjct  242   PEKHVFRSFPVSSQMISELK-QACLKDETLSRCSSFEAITAHVLRQVARS---RPSDPSA  297

Query  642   LSTVLFAVDIRRRLNPPLPDSYSGNAVLTGYGSAKCAELEEGPFWKTVQMVYEGAARMTD  463
             L +   AVD  R+L PP P ++ GNAV+    +A   EL         + V E  + + D
Sbjct  298   LVSTFLAVDFSRKLQPPPPPNFCGNAVVAACVAATHQELCTYSLGHFARRVQEVLSDVDD  357

Query  462   EYARSAIDWGELYK----GFPHGEFLVSSWWRLGFEGVQFPWGKPKYSCPVVYHRKDIIL  295
             EY RS  D+ EL++      P G  L S+WW+L F  + F WG P ++ PV       I+
Sbjct  358   EYVRSWTDFWELHRIGPARIPIGACL-SAWWKLPFYALDFGWGTPIFAGPVPNQLVGFIV  416

Query  294   LFPDIDNGGKSNSGVNVLVALPPKEMEKFK  205
             +  +    GK++ G NV + L P+EM  F+
Sbjct  417   IVAN----GKNDGGANVYLGLEPQEMAAFE  442



>gb|ADL37205.1| At1g65450-like protein [Arabidopsis lyrata subsp. lyrata]
 gb|ADL37206.1| At1g65450-like protein [Arabidopsis lyrata subsp. lyrata]
Length=170

 Score =   197 bits (502),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 100/173 (58%), Positives = 122/173 (71%), Gaps = 7/173 (4%)
 Frame = -3

Query  912  PPQVTFPHPELLKVNLPAGEEMAPPVFDSLKDDLAFEIFQLSSADIERLKDKAKAPDNVK  733
            PP VTFPH EL+K      +     VF++    L F+IF+LSS  I++LK++A    +  
Sbjct  1    PPSVTFPHNELVKFQ----DCETTTVFEATSQHLDFKIFKLSSEQIKKLKERASETSSGY  56

Query  732  TKVTGFNVLTAAIWRCKALSCL---GGENNSDRLSTVLFAVDIRRRLNPPLPDSYSGNAV  562
             +VTGFNV+TA +WRCKALS     G E N +R ST+L+AVDIR RLNP LP SY+GNAV
Sbjct  57   VRVTGFNVVTALVWRCKALSVAAEEGEETNHERESTILYAVDIRGRLNPELPPSYTGNAV  116

Query  561  LTGYGSAKCAELEEGPFWKTVQMVYEGAARMTDEYARSAIDWGELYKGFPHGE  403
            LT Y  AKC  L E PF + V++V EGA R+TDEYARSAIDWGELYKGFPHGE
Sbjct  117  LTAYAKAKCKALLEEPFGRIVEIVGEGANRITDEYARSAIDWGELYKGFPHGE  169



>gb|ADL37207.1| At1g65450-like protein [Arabidopsis lyrata subsp. lyrata]
Length=170

 Score =   197 bits (501),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 100/173 (58%), Positives = 121/173 (70%), Gaps = 7/173 (4%)
 Frame = -3

Query  912  PPQVTFPHPELLKVNLPAGEEMAPPVFDSLKDDLAFEIFQLSSADIERLKDKAKAPDNVK  733
            PP VTFPH EL+K      +     VF++    L F+IF+LSS  I++LK++A    N  
Sbjct  1    PPSVTFPHHELVKFQ----DCETTTVFEATSQHLDFKIFKLSSEQIKKLKERASETSNGY  56

Query  732  TKVTGFNVLTAAIWRCKALSCL---GGENNSDRLSTVLFAVDIRRRLNPPLPDSYSGNAV  562
             +VTGFNV+TA +WRCKALS     G E N +R ST+L+AVDIR RLNP LP SY+GN V
Sbjct  57   VRVTGFNVVTALVWRCKALSVAAEEGEETNLERESTILYAVDIRGRLNPELPPSYTGNVV  116

Query  561  LTGYGSAKCAELEEGPFWKTVQMVYEGAARMTDEYARSAIDWGELYKGFPHGE  403
            LT Y  AKC  L E PF + V++V EGA R+TDEYARSAIDWGELYKGFPHGE
Sbjct  117  LTAYAKAKCKALLEEPFGRIVEIVGEGANRITDEYARSAIDWGELYKGFPHGE  169



>ref|XP_002993631.1| BAHD family acyltransferase, clade V [Selaginella moellendorffii]
 gb|EFJ05323.1| BAHD family acyltransferase, clade V [Selaginella moellendorffii]
Length=445

 Score =   206 bits (524),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 143/455 (31%), Positives = 223/455 (49%), Gaps = 31/455 (7%)
 Frame = -3

Query  1509  DLKVTIL-DSGLIFPSQETTKHTMFLSNIDKVLNFDVQTVHFFPASPGFPPEIVAGKIKN  1333
             D KV ++ +  L+ P Q   +   FLSN+D+ +   ++T++ F +S     +  A  I+ 
Sbjct  4     DFKVELVKEPELVMPEQPVEEQHYFLSNLDQNIAVVMKTIYLFESSSARAADNPADVIRQ  63

Query  1332  AFRRLLVANTYDFLAGRLKKNKESERVEIECNAAGAG-------FTVASSEFALEDIGDL  1174
                + L  + Y  LAGRL  + E  ++E+    +G G       F  A ++  + D+GD+
Sbjct  64    GLSKAL--DHYYPLAGRLGISSEG-KLEVVMKKSGDGAEQQGVVFAEAEADARICDLGDI  120

Query  1173  VYPNPA-FRQLVTMSFDFVAKEDQPLCFLQVTSFKCGGFALGTSMNHISFDGSGFKMFLE  997
             + P      QLV          + P   +QVT FKCGGF LG  +NH  FDG G   F+ 
Sbjct  121   IRPGSTPLLQLVYAIPGAKNVLEVPPMTVQVTKFKCGGFVLGLCINHCMFDGIGAMEFVH  180

Query  996   NLAALSFNDDGPLAVVPCNDRSLLAARSPPQVTFPHPELLKVN-LPAGEEMAPPVFDSLK  820
               A LS     PL++ P  DRS+L ARSPP V FPH E  +V+ +  G +    + D   
Sbjct  181   GWAELSRG--VPLSLNPELDRSVLKARSPPLVEFPHLEYAQVDDVSGGSQQNLHLNDD--  236

Query  819   DDLAFEIFQLSSADIERLKDKAKAPDNVKTKVTGFNVLTAAIWRCKALSCLGGENNSDRL  640
             D L + +F++    +E+LK +    DN     + F  L+A +W+C+  +    +    +L
Sbjct  237   DQLVYRVFRIRGQQLEQLKSQI---DN--EMCSTFEALSALVWKCRTKALAMDDRQPSKL  291

Query  639   STVLFAVDIRRRLNPPLPDSYSGNAVLTGYGSAKCAELEEGPFWKTVQMVYEGAARMTDE  460
                LFAVD R R+ PPLP  + GN ++  Y  A  +ELE     + V +V +  AR+ D 
Sbjct  292   ---LFAVDYRSRIQPPLPKGFMGNGIMLTYAMATASELESKHLSEVVSLVRDAIARIHDS  348

Query  459   YARSAIDWGELYKGFPH--GEFLVSSWWRLGFEGVQFPWGKPKYSCPVVYHRKDIILLFP  286
             Y RS+ID  EL +  P      LVS+W RL F    F WG+P +S PV +   ++ L   
Sbjct  349   YIRSSIDCFELQRFCPSLFSTLLVSTWSRLSFHTTDFGWGEPLHSGPVGFSEPEVCLFL-  407

Query  285   DIDNGGKSNSGVNVLVALPPKEMEKFKSLFHKFLA  181
                + G+    +N+++      M +F     + L 
Sbjct  408   ---SHGRETKDMNLILGFRSDAMTRFHDELEQVLG  439



>gb|ACN57286.1| At1g65450-like protein [Capsella rubella]
 gb|ACN57287.1| At1g65450-like protein [Capsella rubella]
 gb|ACN57288.1| At1g65450-like protein [Capsella rubella]
 gb|ACN57289.1| At1g65450-like protein [Capsella rubella]
 gb|ACN57290.1| At1g65450-like protein [Capsella rubella]
 gb|ACN57291.1| At1g65450-like protein [Capsella rubella]
 gb|ACN57292.1| At1g65450-like protein [Capsella rubella]
 gb|ACN57293.1| At1g65450-like protein [Capsella rubella]
 gb|ACN57294.1| At1g65450-like protein [Capsella rubella]
 gb|ACN57295.1| At1g65450-like protein [Capsella rubella]
 gb|ACN57296.1| At1g65450-like protein [Capsella rubella]
 gb|ACN57297.1| At1g65450-like protein [Capsella rubella]
 gb|ACN57298.1| At1g65450-like protein [Capsella grandiflora]
Length=169

 Score =   197 bits (501),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 101/173 (58%), Positives = 121/173 (70%), Gaps = 7/173 (4%)
 Frame = -3

Query  894  PHPELLKVNLPAGEEMAPPVFDSLKDDLAFEIFQLSSADIERLKDKAKAPDNVKTKVTGF  715
            PH EL+K      +     VF++    L F+IF+LSS  I++LK++A    +   +VTGF
Sbjct  1    PHHELVKFQ----DCETTTVFEATSQKLDFKIFKLSSDQIKKLKERASETSSGDVRVTGF  56

Query  714  NVLTAAIWRCKALSCL---GGENNSDRLSTVLFAVDIRRRLNPPLPDSYSGNAVLTGYGS  544
            NV+TA +WRCKALS     G E N +R ST+L+AVDIR RLNP LP SY+GNAVLT Y  
Sbjct  57   NVVTALVWRCKALSVTTEEGEEANLERESTILYAVDIRGRLNPELPSSYTGNAVLTAYAK  116

Query  543  AKCAELEEGPFWKTVQMVYEGAARMTDEYARSAIDWGELYKGFPHGEFLVSSW  385
            AKC  L E PF + V MV EGA RMT+EYARSAIDWGELYKGFPHGE LVSSW
Sbjct  117  AKCKALLEEPFGEIVDMVGEGAKRMTNEYARSAIDWGELYKGFPHGEVLVSSW  169



>gb|KEH21000.1| omega-hydroxypalmitate O-feruloyl transferase [Medicago truncatula]
Length=445

 Score =   206 bits (523),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 147/453 (32%), Positives = 233/453 (51%), Gaps = 53/453 (12%)
 Frame = -3

Query  1506  LKVTILDSGLIFPSQETTKHTMFLSNIDKVLNFDVQTVHFFPA-SPGFPPEIVAGKIKNA  1330
             L + + +  L+ P+Q+T K   FLSN+D+ + + V+T++ + + S G   E VA  +K++
Sbjct  5     LNIKLGEPTLVLPAQQTKKGLYFLSNLDQNIAYPVRTIYCYKSLSKG--NEDVAQVLKDS  62

Query  1329  FRRLLVANTYDFLAGRLKKNKESERVEIECNAAGAGFTVASSEFALEDIGDLVYPN-PAF  1153
               ++LV   Y  +AGRLK + E  ++ I+CN  G  F  A +   +ED+ D+  P+    
Sbjct  63    LSKILVH--YYPMAGRLKISSEG-KLTIDCNEEGVVFVEAEANCMVEDLSDVKEPDLDIL  119

Query  1152  RQLVTMSFDF-VAKE--DQPLCFLQVTSFKCGGFALGTSMNHISFDGSGFKMFLENLAAL  982
             R+LV   +D   AK   + P   +QVT FKCGGF LG ++NH   DG     F+ +    
Sbjct  120   RKLV---YDIPTAKNLLEMPPLLIQVTKFKCGGFVLGVNVNHCMNDGISAMQFVNSWGDT  176

Query  981   SFNDDGPLAVVPCNDRSLLAARSPPQVTFPHPELLKVNLPAGEEMAPPVFDSLKD-----  817
             +   D  L + P  DR++L +R+PPQ+ F H E                FD L+D     
Sbjct  177   ARGLD--LKIPPFLDRTILKSRNPPQIEFTHHE----------------FDELEDLSDTN  218

Query  816   -------DLAFEIFQLSSADIERLKDKAKAPDNVKTKVTGFNVLTAAIWRCKALSCLGGE  658
                    ++ ++ F  +   +E LK KA   D V  K + F  L+A +WR +  +    +
Sbjct  219   KLIHEEEEIIYKSFWFNQNKLELLKKKA-TEDGVVKKCSTFEALSAFVWRARTQAL---K  274

Query  657   NNSDRLSTVLFAVDIRRRLNPPLPDSYSGNAVLTGYGSAKCAELEEGPFWKTVQMVYEGA  478
              + ++L  +LFAVD R R  PP+P  Y GNA++      K  EL + P   +V+++ +  
Sbjct  275   VHPNQLVKLLFAVDGRSRFVPPIPKGYFGNAIVLSNAMCKARELLKNPLSFSVELINKAI  334

Query  477   ARMTDEYARSAIDWGELYKGFP--HGEFLVSSWWRLGFEGVQFPWGKPKYSCPVVYHRKD  304
               +TD Y RS ID+ E+ +  P      L+++W RL F    F WGKPKY CPV   +K+
Sbjct  335   EMVTDSYMRSVIDYFEVKRSKPTLTSTLLITTWTRLSFHEADFGWGKPKYFCPVTLPQKE  394

Query  303   IILLFPDIDNGGKSNSGVNVLVALPPKEMEKFK  205
             +IL  P  ++       +NV V LP   M+ F+
Sbjct  395   VILFLPHRED----TKSINVFVGLPASTMQIFE  423



>gb|ABA93921.1| transferase family protein, putative, expressed [Oryza sativa 
Japonica Group]
Length=462

 Score =   206 bits (525),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 148/448 (33%), Positives = 212/448 (47%), Gaps = 37/448 (8%)
 Frame = -3

Query  1479  LIFPSQET-TKHTMFLSNIDKVLNFDVQTVHFF--PASPGFPPEIVAGKIKNAFRRLLVA  1309
             L+ P++ T T    +LSN+D+ +   VQTV+ +  PA+ G         +++A  ++LV 
Sbjct  35    LVAPAEATPTGEKYYLSNLDQNIAVIVQTVYCYKPPAASGGDNGDAVAVLRDALAKVLV-  93

Query  1308  NTYDFLAGRLKKNKESERVEIECNAAGAGFTVASSEFALEDIGDLVYPNPAFRQLVTMSF  1129
               Y  LAGRL  + E  ++ +E    GA F  A + + L D+GDL  P+PA    +  S 
Sbjct  94    -HYHPLAGRLTISAEM-KLAVELTGEGAVFVAADAGYDLADVGDLTKPDPAALGHLVYSI  151

Query  1128  DFVAK-EDQPLCFLQVTSFKCGGFALGTSMNHISFDGSGFKMFLENLAALSFNDDGPLAV  952
                    + P    QVT FKCGGFALG +MNH  FDG G   F+ + A  +      L V
Sbjct  152   PGAKNILEMPPMTAQVTRFKCGGFALGLAMNHCMFDGLGAMEFVNSWAETA-RGAAELTV  210

Query  951   VPCNDRSLLAARSPPQVTFPHPELLKVNLPAGEEMAPPVFDSLK----DDLAFEIFQLSS  784
              P  DR+LL AR PP ++F H E          E  P V D+       DL +  F    
Sbjct  211   PPFLDRTLLRARDPPVISFEHHEF---------EEIPDVSDTAALYADQDLLYRSFCFDP  261

Query  783   ADIERLKDKA-------KAPDNVKTKVTGFNVLTAAIWRCKALSCLGGENNSDRLSTVLF  625
               +ER++  A          D V  + T F  L+  +WR +    LG     ++ + +LF
Sbjct  262   DRLERVRALALAGAGAENGDDLVGGRCTTFEALSGLVWRART-RALG--LAPEQRTKLLF  318

Query  624   AVDIRRRLNPPLPDSYSGNAVLTGYGSAKCAELEEGPFWKTVQMVYEGAARMTDEYARSA  445
             AVD RRR  PPLP  Y GN ++     A   EL   P  +   +V      +TD Y RSA
Sbjct  319   AVDGRRRFEPPLPRGYFGNGIVLTNAVATAGELLSSPPSRAAGLVQAAVRMVTDGYMRSA  378

Query  444   IDWGELYKGFPH--GEFLVSSWWRLGFEGVQFPWGKPKYSCPVVYHRKDIILLFPDIDNG  271
             +D+ E  +  P      L+++W RL F G  F WG P  S PV    K++IL        
Sbjct  379   VDYFEATRARPSLASTLLITTWSRLAFHGADFGWGAPAMSGPVTLPEKEVILFLAH----  434

Query  270   GKSNSGVNVLVALPPKEMEKFKSLFHKF  187
             G+    +NVL+ LP   M+ F+ L  + 
Sbjct  435   GEERKSINVLLGLPASAMDAFQELMDEI  462



>gb|ADL37208.1| At1g65450-like protein [Arabidopsis lyrata subsp. lyrata]
Length=170

 Score =   197 bits (501),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 100/173 (58%), Positives = 121/173 (70%), Gaps = 7/173 (4%)
 Frame = -3

Query  912  PPQVTFPHPELLKVNLPAGEEMAPPVFDSLKDDLAFEIFQLSSADIERLKDKAKAPDNVK  733
            PP VTFPH EL+K      +     VF++    L F+IF+LSS  I++LK++A    N  
Sbjct  1    PPSVTFPHHELVKFQ----DCETTTVFEATSQHLDFKIFKLSSEQIKKLKERASETSNGY  56

Query  732  TKVTGFNVLTAAIWRCKALSCL---GGENNSDRLSTVLFAVDIRRRLNPPLPDSYSGNAV  562
             +VTGFNV+TA +WRCKALS     G E N +R ST+L+AVDIR RLNP LP SY+GN V
Sbjct  57   VRVTGFNVVTALVWRCKALSVAAEEGEETNLERESTILYAVDIRGRLNPELPPSYTGNXV  116

Query  561  LTGYGSAKCAELEEGPFWKTVQMVYEGAARMTDEYARSAIDWGELYKGFPHGE  403
            LT Y  AKC  L E PF + V++V EGA R+TDEYARSAIDWGELYKGFPHGE
Sbjct  117  LTAYAKAKCKALLEEPFGRIVEIVGEGANRITDEYARSAIDWGELYKGFPHGE  169



>ref|NP_001067952.2| Os11g0507200 [Oryza sativa Japonica Group]
 dbj|BAF28315.2| Os11g0507200 [Oryza sativa Japonica Group]
Length=464

 Score =   206 bits (524),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 148/448 (33%), Positives = 212/448 (47%), Gaps = 37/448 (8%)
 Frame = -3

Query  1479  LIFPSQET-TKHTMFLSNIDKVLNFDVQTVHFF--PASPGFPPEIVAGKIKNAFRRLLVA  1309
             L+ P++ T T    +LSN+D+ +   VQTV+ +  PA+ G         +++A  ++LV 
Sbjct  37    LVAPAEATPTGEKYYLSNLDQNIAVIVQTVYCYKPPAASGGDNGDAVAVLRDALAKVLV-  95

Query  1308  NTYDFLAGRLKKNKESERVEIECNAAGAGFTVASSEFALEDIGDLVYPNPAFRQLVTMSF  1129
               Y  LAGRL  + E  ++ +E    GA F  A + + L D+GDL  P+PA    +  S 
Sbjct  96    -HYHPLAGRLTISAEM-KLAVELTGEGAVFVAADAGYDLADVGDLTKPDPAALGHLVYSI  153

Query  1128  DFVAK-EDQPLCFLQVTSFKCGGFALGTSMNHISFDGSGFKMFLENLAALSFNDDGPLAV  952
                    + P    QVT FKCGGFALG +MNH  FDG G   F+ + A  +      L V
Sbjct  154   PGAKNILEMPPMTAQVTRFKCGGFALGLAMNHCMFDGLGAMEFVNSWAETA-RGAAELTV  212

Query  951   VPCNDRSLLAARSPPQVTFPHPELLKVNLPAGEEMAPPVFDSLK----DDLAFEIFQLSS  784
              P  DR+LL AR PP ++F H E          E  P V D+       DL +  F    
Sbjct  213   PPFLDRTLLRARDPPVISFEHHEF---------EEIPDVSDTAALYADQDLLYRSFCFDP  263

Query  783   ADIERLKDKA-------KAPDNVKTKVTGFNVLTAAIWRCKALSCLGGENNSDRLSTVLF  625
               +ER++  A          D V  + T F  L+  +WR +    LG     ++ + +LF
Sbjct  264   DRLERVRALALAGAGAENGDDLVGGRCTTFEALSGLVWRART-RALG--LAPEQRTKLLF  320

Query  624   AVDIRRRLNPPLPDSYSGNAVLTGYGSAKCAELEEGPFWKTVQMVYEGAARMTDEYARSA  445
             AVD RRR  PPLP  Y GN ++     A   EL   P  +   +V      +TD Y RSA
Sbjct  321   AVDGRRRFEPPLPRGYFGNGIVLTNAVATAGELLSSPPSRAAGLVQAAVRMVTDGYMRSA  380

Query  444   IDWGELYKGFPH--GEFLVSSWWRLGFEGVQFPWGKPKYSCPVVYHRKDIILLFPDIDNG  271
             +D+ E  +  P      L+++W RL F G  F WG P  S PV    K++IL        
Sbjct  381   VDYFEATRARPSLASTLLITTWSRLAFHGADFGWGAPAMSGPVTLPEKEVILFLAH----  436

Query  270   GKSNSGVNVLVALPPKEMEKFKSLFHKF  187
             G+    +NVL+ LP   M+ F+ L  + 
Sbjct  437   GEERKSINVLLGLPASAMDAFQELMDEI  464



>gb|ADL37212.1| At1g65450-like protein [Arabidopsis lyrata subsp. lyrata]
 gb|ADL37219.1| At1g65450-like protein [Arabidopsis lyrata subsp. lyrata]
 gb|ADL37222.1| At1g65450-like protein [Arabidopsis lyrata subsp. lyrata]
 gb|ADL37223.1| At1g65450-like protein [Arabidopsis lyrata subsp. lyrata]
 gb|ADL37224.1| At1g65450-like protein [Arabidopsis lyrata subsp. lyrata]
 gb|ADL37225.1| At1g65450-like protein [Arabidopsis lyrata subsp. lyrata]
 gb|ADL37229.1| At1g65450-like protein [Arabidopsis lyrata subsp. lyrata]
 gb|ADL37230.1| At1g65450-like protein [Arabidopsis lyrata subsp. lyrata]
 gb|ADL37231.1| At1g65450-like protein [Arabidopsis lyrata subsp. lyrata]
 gb|ADL37232.1| At1g65450-like protein [Arabidopsis lyrata subsp. lyrata]
 gb|ADL37233.1| At1g65450-like protein [Arabidopsis lyrata subsp. lyrata]
 gb|ADL37234.1| At1g65450-like protein [Arabidopsis lyrata subsp. lyrata]
 gb|ADL37235.1| At1g65450-like protein [Arabidopsis lyrata subsp. lyrata]
 gb|ADL37236.1| At1g65450-like protein [Arabidopsis lyrata subsp. lyrata]
 gb|ADL37237.1| At1g65450-like protein [Arabidopsis lyrata subsp. lyrata]
 gb|ADL37238.1| At1g65450-like protein [Arabidopsis lyrata subsp. lyrata]
 gb|ADL37241.1| At1g65450-like protein [Arabidopsis lyrata subsp. lyrata]
 gb|ADL37246.1| At1g65450-like protein [Arabidopsis lyrata subsp. lyrata]
 gb|ADL37247.1| At1g65450-like protein [Arabidopsis lyrata subsp. lyrata]
 gb|ADL37248.1| At1g65450-like protein [Arabidopsis lyrata subsp. lyrata]
 gb|ADL37249.1| At1g65450-like protein [Arabidopsis lyrata subsp. lyrata]
 gb|ADL37250.1| At1g65450-like protein [Arabidopsis lyrata subsp. lyrata]
 gb|ADL37251.1| At1g65450-like protein [Arabidopsis lyrata subsp. lyrata]
 gb|ADL37253.1| At1g65450-like protein [Arabidopsis lyrata subsp. lyrata]
 gb|ADL37254.1| At1g65450-like protein [Arabidopsis lyrata subsp. lyrata]
 gb|ADL37255.1| At1g65450-like protein [Arabidopsis lyrata subsp. lyrata]
 gb|ADL37257.1| At1g65450-like protein [Arabidopsis lyrata subsp. lyrata]
 gb|ADL37258.1| At1g65450-like protein [Arabidopsis lyrata subsp. lyrata]
 gb|ADL37260.1| At1g65450-like protein [Arabidopsis lyrata subsp. lyrata]
 gb|ADL37273.1| At1g65450-like protein [Arabidopsis lyrata subsp. lyrata]
 gb|ADL37281.1| At1g65450-like protein [Arabidopsis lyrata subsp. lyrata]
 gb|ADL37282.1| At1g65450-like protein [Arabidopsis lyrata subsp. lyrata]
 gb|ADL37283.1| At1g65450-like protein [Arabidopsis lyrata subsp. lyrata]
 gb|ADL37287.1| At1g65450-like protein [Arabidopsis lyrata subsp. lyrata]
 gb|ADL37288.1| At1g65450-like protein [Arabidopsis lyrata subsp. lyrata]
 gb|ADL37289.1| At1g65450-like protein [Arabidopsis lyrata subsp. lyrata]
 gb|ADL37290.1| At1g65450-like protein [Arabidopsis lyrata subsp. lyrata]
 gb|ADL37291.1| At1g65450-like protein [Arabidopsis lyrata subsp. lyrata]
 gb|ADL37292.1| At1g65450-like protein [Arabidopsis lyrata subsp. lyrata]
 gb|ADL37293.1| At1g65450-like protein [Arabidopsis lyrata subsp. lyrata]
 gb|ADL37294.1| At1g65450-like protein [Arabidopsis lyrata subsp. lyrata]
 gb|ADL37297.1| At1g65450-like protein [Arabidopsis lyrata subsp. lyrata]
 gb|ADL37299.1| At1g65450-like protein [Arabidopsis lyrata subsp. lyrata]
 gb|ADL37311.1| At1g65450-like protein [Arabidopsis lyrata subsp. lyrata]
 gb|ADL37312.1| At1g65450-like protein [Arabidopsis lyrata subsp. lyrata]
 gb|ADL37313.1| At1g65450-like protein [Arabidopsis lyrata subsp. lyrata]
 gb|ADL37314.1| At1g65450-like protein [Arabidopsis lyrata subsp. lyrata]
 gb|ADL37315.1| At1g65450-like protein [Arabidopsis lyrata subsp. lyrata]
 gb|ADL37316.1| At1g65450-like protein [Arabidopsis lyrata subsp. lyrata]
 gb|ADL37317.1| At1g65450-like protein [Arabidopsis lyrata subsp. lyrata]
 gb|ADL37318.1| At1g65450-like protein [Arabidopsis lyrata subsp. lyrata]
 gb|ADL37321.1| At1g65450-like protein [Arabidopsis lyrata subsp. lyrata]
 gb|ADL37322.1| At1g65450-like protein [Arabidopsis lyrata subsp. lyrata]
 gb|ADL37337.1| At1g65450-like protein [Arabidopsis lyrata subsp. lyrata]
 gb|ADL37342.1| At1g65450-like protein [Arabidopsis lyrata subsp. lyrata]
 gb|ADL37343.1| At1g65450-like protein [Arabidopsis lyrata subsp. lyrata]
 gb|ADL37347.1| At1g65450-like protein [Arabidopsis lyrata subsp. lyrata]
 gb|ADL37354.1| At1g65450-like protein [Arabidopsis lyrata subsp. lyrata]
 gb|ADL37355.1| At1g65450-like protein [Arabidopsis lyrata subsp. lyrata]
 gb|ADL37356.1| At1g65450-like protein [Arabidopsis lyrata subsp. lyrata]
 gb|ADL37360.1| At1g65450-like protein [Arabidopsis lyrata subsp. lyrata]
 gb|ADL37363.1| At1g65450-like protein [Arabidopsis lyrata subsp. lyrata]
 gb|ADL37366.1| At1g65450-like protein [Arabidopsis lyrata subsp. lyrata]
 gb|ADL37368.1| At1g65450-like protein [Arabidopsis lyrata subsp. lyrata]
 gb|ADL37371.1| At1g65450-like protein [Arabidopsis lyrata subsp. lyrata]
 gb|ADL37373.1| At1g65450-like protein [Arabidopsis lyrata subsp. lyrata]
Length=170

 Score =   197 bits (500),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 100/173 (58%), Positives = 122/173 (71%), Gaps = 7/173 (4%)
 Frame = -3

Query  912  PPQVTFPHPELLKVNLPAGEEMAPPVFDSLKDDLAFEIFQLSSADIERLKDKAKAPDNVK  733
            PP VTFPH EL+K      +     VF++    L F+IF+LSS  I++LK++A    +  
Sbjct  1    PPSVTFPHHELVKFQ----DCETTTVFEATSQHLDFKIFKLSSEQIKKLKERASETSSGY  56

Query  732  TKVTGFNVLTAAIWRCKALSCL---GGENNSDRLSTVLFAVDIRRRLNPPLPDSYSGNAV  562
             +VTGFNV+TA +WRCKALS     G E N +R ST+L+AVDIR RLNP LP SY+GNAV
Sbjct  57   VRVTGFNVVTALVWRCKALSVAAEEGEETNLERESTILYAVDIRGRLNPELPPSYTGNAV  116

Query  561  LTGYGSAKCAELEEGPFWKTVQMVYEGAARMTDEYARSAIDWGELYKGFPHGE  403
            LT Y  AKC  L E PF + V++V EGA R+TDEYARSAIDWGELYKGFPHGE
Sbjct  117  LTAYAKAKCKALLEEPFGRIVEIVGEGANRITDEYARSAIDWGELYKGFPHGE  169



>gb|KHG11495.1| Omega-hydroxypalmitate O-feruloyl transferase -like protein [Gossypium 
arboreum]
Length=433

 Score =   205 bits (522),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 130/435 (30%), Positives = 221/435 (51%), Gaps = 30/435 (7%)
 Frame = -3

Query  1476  IFPSQETTKHTMFLSNIDKVLNFDVQTVHFFPASPGFPPEIVAGKIKNAFRRLLVANTYD  1297
             + P++ET K   +L N+D+ +   ++T++FF  S     E  A ++KN   ++LV +   
Sbjct  21    VLPAEETKKGLYYLGNLDQNIAVIIRTIYFF-KSESKGNEDAAEQVKNGLSKILVHHYP-  78

Query  1296  FLAGRLKKNKESERVEIECNAAGAGFTVASSEFALEDIGDLVYPNPAFRQLVTMSFDFVA  1117
              LAGRL  + E + + ++    GA F  A +   +E++GD+  P+P    L  + ++   
Sbjct  79    -LAGRLTISSEGKLI-VDSTGEGAVFVEAEANCGIEEMGDITKPDPNI--LGKLVYEISG  134

Query  1116  KEDQ---PLCFLQVTSFKCGGFALGTSMNHISFDGSGFKMFLENLAALSFNDDGPLAVVP  946
              ++    PL  +QVT FKCGGF++G SMNH   DG     F+     ++     PL   P
Sbjct  135   AQNLLEIPLLVIQVTKFKCGGFSIGMSMNHCMLDGIAAMEFVNGWGEVT--RGLPLKTPP  192

Query  945   CNDRSLLAARSPPQVTFPHPELLKVNLPAGEEMAPPVFDSLKDDLAFEIFQLSSADIERL  766
               DR++L  R+ P + F H E  ++     E+++       ++++ ++ F      + +L
Sbjct  193   FLDRTILKPRNQPMIEFEHHEFDEI-----EDISNTNKLYEEEEMVYKTFLFDPDKLGQL  247

Query  765   KDKAKAPDNVKTKVTGFNVLTAAIWR--CKALSCLGGENNSDRLSTVLFAVDIRRRLNPP  592
             K++A   D V +K T F VL   +WR  CKAL+ +       + + +LFA D R+R  PP
Sbjct  248   KEQA-LEDGVLSKCTTFEVLAGFVWRARCKALNLV-----PQQKTKLLFAADGRKRFIPP  301

Query  591   LPDSYSGNAVLTGYGSAKCAELEEGPFWKTVQMVYEGAARMTDEYARSAIDWGELYKGFP  412
             LP+ ++GN ++  Y  +   EL E P    V ++ +     TD + RSAID+ E+ +  P
Sbjct  302   LPEGFAGNGIVLTYSISTAGELAEKPLSFAVGLIQQAVKLATDSFMRSAIDYFEVTRARP  361

Query  411   H--GEFLVSSWWRLGFEGVQFPWGKPKYSCPVVYHRKDIILLFPDIDNGGKSNSGVNVLV  238
                G  L+++W +L F  + F WG+P  + PV    K ++L  P      K    +N+L+
Sbjct  362   SLDGTVLITTWSKLSFHTIDFGWGEPISTGPVALPEKPVLLFLPH----QKDKKSINLLL  417

Query  237   ALPPKEMEKFKSLFH  193
              LP   M  F+ L  
Sbjct  418   GLPASAMNSFEELMQ  432



>gb|ACN57299.1| At1g65450-like protein [Capsella grandiflora]
Length=169

 Score =   196 bits (499),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 101/173 (58%), Positives = 120/173 (69%), Gaps = 7/173 (4%)
 Frame = -3

Query  894  PHPELLKVNLPAGEEMAPPVFDSLKDDLAFEIFQLSSADIERLKDKAKAPDNVKTKVTGF  715
            PH EL+K      +     VF++    L F+IF+LSS  I++LK++A    +   +VTGF
Sbjct  1    PHHELVKFQ----DCETTTVFEATSQKLDFKIFKLSSDQIKKLKERASETSSGDVRVTGF  56

Query  714  NVLTAAIWRCKALSCLGGEN---NSDRLSTVLFAVDIRRRLNPPLPDSYSGNAVLTGYGS  544
            NV+TA +WRCKALS    E    N +R ST+L+AVDIR RLNP LP SY+GNAVLT Y  
Sbjct  57   NVVTALVWRCKALSVTTEEXEEANLERESTILYAVDIRGRLNPELPSSYTGNAVLTAYAK  116

Query  543  AKCAELEEGPFWKTVQMVYEGAARMTDEYARSAIDWGELYKGFPHGEFLVSSW  385
            AKC  L E PF + V MV EGA RMTDEYARSAIDWGELYKGFPHGE LVSSW
Sbjct  117  AKCXALLEEPFGEIVDMVGEGAKRMTDEYARSAIDWGELYKGFPHGEVLVSSW  169



>gb|ADL37221.1| At1g65450-like protein [Arabidopsis lyrata subsp. lyrata]
Length=170

 Score =   196 bits (499),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 100/173 (58%), Positives = 121/173 (70%), Gaps = 7/173 (4%)
 Frame = -3

Query  912  PPQVTFPHPELLKVNLPAGEEMAPPVFDSLKDDLAFEIFQLSSADIERLKDKAKAPDNVK  733
            PP VTFPH EL+K      +     VF++    L F+IF+LSS  I++LK++A    N  
Sbjct  1    PPSVTFPHHELVKFQ----DCETTTVFEATSQHLDFKIFKLSSEQIKKLKERASETSNGY  56

Query  732  TKVTGFNVLTAAIWRCKALSCL---GGENNSDRLSTVLFAVDIRRRLNPPLPDSYSGNAV  562
             +VTGFNV+TA +WRCKALS     G E N +R ST+L+AVD R RLNP LP SY+GNAV
Sbjct  57   VRVTGFNVVTALVWRCKALSVAAEEGEETNLERESTILYAVDXRGRLNPELPPSYTGNAV  116

Query  561  LTGYGSAKCAELEEGPFWKTVQMVYEGAARMTDEYARSAIDWGELYKGFPHGE  403
            LT Y  AKC  L E PF + V++V EGA R+TDEYARSAIDWGELYKGFPHGE
Sbjct  117  LTAYAKAKCKALLEEPFGRIVEIVGEGANRITDEYARSAIDWGELYKGFPHGE  169



>gb|ACN57300.1| At1g65450-like protein [Capsella grandiflora]
Length=169

 Score =   196 bits (499),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 101/173 (58%), Positives = 120/173 (69%), Gaps = 7/173 (4%)
 Frame = -3

Query  894  PHPELLKVNLPAGEEMAPPVFDSLKDDLAFEIFQLSSADIERLKDKAKAPDNVKTKVTGF  715
            PH EL+K      +     VF++    L F+IF+LSS  I++LK++A    +   +VTGF
Sbjct  1    PHHELVKFQ----DCETTTVFEATSQKLDFKIFKLSSDQIKKLKERASETSSGDVRVTGF  56

Query  714  NVLTAAIWRCKALSCLGGEN---NSDRLSTVLFAVDIRRRLNPPLPDSYSGNAVLTGYGS  544
            NV+TA +WRCKALS    E    N +R ST+L+AVDIR RLNP LP SY+GNAVLT Y  
Sbjct  57   NVVTALVWRCKALSVTTEEXEEANLERESTILYAVDIRGRLNPELPSSYTGNAVLTAYAK  116

Query  543  AKCAELEEGPFWKTVQMVYEGAARMTDEYARSAIDWGELYKGFPHGEFLVSSW  385
            AKC  L E PF + V MV EGA RMTDEYARSAIDWGELYKGFPHGE LVSSW
Sbjct  117  AKCKALLEEPFGEIVDMVGEGAKRMTDEYARSAIDWGELYKGFPHGEVLVSSW  169



>gb|ADL37204.1| At1g65450-like protein [Arabidopsis lyrata subsp. lyrata]
 gb|ADL37216.1| At1g65450-like protein [Arabidopsis lyrata subsp. lyrata]
 gb|ADL37239.1| At1g65450-like protein [Arabidopsis lyrata subsp. lyrata]
 gb|ADL37243.1| At1g65450-like protein [Arabidopsis lyrata subsp. lyrata]
 gb|ADL37244.1| At1g65450-like protein [Arabidopsis lyrata subsp. lyrata]
 gb|ADL37277.1| At1g65450-like protein [Arabidopsis lyrata subsp. lyrata]
 gb|ADL37278.1| At1g65450-like protein [Arabidopsis lyrata subsp. lyrata]
 gb|ADL37279.1| At1g65450-like protein [Arabidopsis lyrata subsp. lyrata]
 gb|ADL37284.1| At1g65450-like protein [Arabidopsis lyrata subsp. lyrata]
 gb|ADL37295.1| At1g65450-like protein [Arabidopsis lyrata subsp. lyrata]
 gb|ADL37296.1| At1g65450-like protein [Arabidopsis lyrata subsp. lyrata]
 gb|ADL37300.1| At1g65450-like protein [Arabidopsis lyrata subsp. lyrata]
 gb|ADL37301.1| At1g65450-like protein [Arabidopsis lyrata subsp. lyrata]
 gb|ADL37303.1| At1g65450-like protein [Arabidopsis lyrata subsp. lyrata]
 gb|ADL37332.1| At1g65450-like protein [Arabidopsis lyrata subsp. lyrata]
 gb|ADL37333.1| At1g65450-like protein [Arabidopsis lyrata subsp. lyrata]
 gb|ADL37334.1| At1g65450-like protein [Arabidopsis lyrata subsp. lyrata]
 gb|ADL37346.1| At1g65450-like protein [Arabidopsis lyrata subsp. lyrata]
 gb|ADL37351.1| At1g65450-like protein [Arabidopsis lyrata subsp. lyrata]
 gb|ADL37358.1| At1g65450-like protein [Arabidopsis lyrata subsp. lyrata]
 gb|ADL37359.1| At1g65450-like protein [Arabidopsis lyrata subsp. lyrata]
 gb|ADL37364.1| At1g65450-like protein [Arabidopsis lyrata subsp. lyrata]
 gb|ADL37369.1| At1g65450-like protein [Arabidopsis lyrata subsp. lyrata]
 gb|ADL37370.1| At1g65450-like protein [Arabidopsis lyrata subsp. lyrata]
 gb|ADL37374.1| At1g65450-like protein [Arabidopsis lyrata subsp. lyrata]
Length=170

 Score =   196 bits (499),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 100/173 (58%), Positives = 121/173 (70%), Gaps = 7/173 (4%)
 Frame = -3

Query  912  PPQVTFPHPELLKVNLPAGEEMAPPVFDSLKDDLAFEIFQLSSADIERLKDKAKAPDNVK  733
            PP VTFPH EL+K      +     VF++    L F+IF+LSS  I++LK++A       
Sbjct  1    PPSVTFPHHELVKFQ----DCETTTVFEATSQHLDFKIFKLSSEQIKKLKERASETSXGY  56

Query  732  TKVTGFNVLTAAIWRCKALSCL---GGENNSDRLSTVLFAVDIRRRLNPPLPDSYSGNAV  562
             +VTGFNV+TA +WRCKALS     G E N +R ST+L+AVDIR RLNP LP SY+GNAV
Sbjct  57   VRVTGFNVVTALVWRCKALSVAAEEGEETNLERESTILYAVDIRGRLNPELPPSYTGNAV  116

Query  561  LTGYGSAKCAELEEGPFWKTVQMVYEGAARMTDEYARSAIDWGELYKGFPHGE  403
            LT Y  AKC  L E PF + V++V EGA R+TDEYARSAIDWGELYKGFPHGE
Sbjct  117  LTAYAKAKCKALLEEPFGRIVEIVGEGANRITDEYARSAIDWGELYKGFPHGE  169



>ref|XP_006373237.1| hypothetical protein POPTR_0017s09970g [Populus trichocarpa]
 gb|ERP51034.1| hypothetical protein POPTR_0017s09970g [Populus trichocarpa]
Length=400

 Score =   203 bits (516),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 134/386 (35%), Positives = 192/386 (50%), Gaps = 22/386 (6%)
 Frame = -3

Query  1341  IKNAFRRLLVANTYDFLAGRLKKNKESERVEIECNAAGAGFTVASSEFALEDIGDLVYPN  1162
             IKNA +++LV   Y  LAGRL  + E + + + C   GA F    +  A+E+IGD+  P+
Sbjct  33    IKNALKKVLVH--YYPLAGRLTISSEGKLI-VNCTGEGAVFVEVEAYCAMEEIGDITKPD  89

Query  1161  P-AFRQLVTMSFDFVAKEDQPLCFLQVTSFKCGGFALGTSMNHISFDGSGFKMFLENLAA  985
             P    +LV +  D     D P    QVT+FKCGGF LG  MNH  FDG G   F+ + + 
Sbjct  90    PKTLGKLVYVIPDAKNILDMPPLVAQVTTFKCGGFVLGLCMNHCMFDGIGAMEFVNSWSE  149

Query  984   LSFNDDGPLAVVPCNDRSLLAARSPPQVTFPHPELLKVNLPAGEEMAPPVFDSLKDDLAF  805
              +     PL V P  DRS+L AR+PP++ + H E  ++      E      D  KD+  +
Sbjct  150   TA--RGLPLCVPPFIDRSILKARNPPKIEYLHQEFAEI------EDKSSTIDLYKDETIY  201

Query  804   EIFQLSSADIERLKDKAKAPDNVKTKVTGFNVLTAAIWRCKALSCLGGENNSDRLSTVLF  625
               F   S  +E +K KA   D V  K T F  L+A +WR +  +        D+ + +LF
Sbjct  202   SSFYFDSDMLENIKMKAME-DGVLEKCTTFEGLSAFVWRARTKAL---RIQPDQQTKLLF  257

Query  624   AVDIRRRLNPPLPDSYSGNAVLTGYGSAKCAELEEGPFWKTVQMVYEGAARMTDEYARSA  445
             AVD R + NPPLP  Y GN ++         EL + P    V +V E    +TD Y RSA
Sbjct  258   AVDGRPKYNPPLPKGYFGNGIVLTNSFCHAGELLDKPLSHAVGLVKEAIKMVTDSYMRSA  317

Query  444   IDWGELYKGFPH--GEFLVSSWWRLGFEGVQFPWGKPKYSCPVVYHRKDIILLFPDIDNG  271
             +D+ E+ +  P      L+++W RL F    F WG+P  S PV    K++IL      + 
Sbjct  318   MDYFEVTRARPSLASTLLITTWSRLSFYTTDFGWGEPVLSGPVALPEKEVILFL----SH  373

Query  270   GKSNSGVNVLVALPPKEMEKFKSLFH  193
             GK    +N L+  P   M+ F+ L  
Sbjct  374   GKERKSINELLGSPASAMKIFQELMQ  399



>gb|ADL37211.1| At1g65450-like protein [Arabidopsis lyrata subsp. lyrata]
Length=170

 Score =   195 bits (496),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 99/173 (57%), Positives = 121/173 (70%), Gaps = 7/173 (4%)
 Frame = -3

Query  912  PPQVTFPHPELLKVNLPAGEEMAPPVFDSLKDDLAFEIFQLSSADIERLKDKAKAPDNVK  733
            PP VTFPH EL+K      +     VF++    L F+IF+LSS  I++LK++A    +  
Sbjct  1    PPSVTFPHHELVKFQ----DCETTTVFEATSQHLDFKIFKLSSEQIKKLKERASETSSGY  56

Query  732  TKVTGFNVLTAAIWRCKALSCL---GGENNSDRLSTVLFAVDIRRRLNPPLPDSYSGNAV  562
             +VTGFNV+TA +WRCKALS     G E N +R ST+L+AVDIR RLNP LP SY+GN V
Sbjct  57   VRVTGFNVVTALVWRCKALSVAAEEGEETNLERESTILYAVDIRGRLNPELPPSYTGNVV  116

Query  561  LTGYGSAKCAELEEGPFWKTVQMVYEGAARMTDEYARSAIDWGELYKGFPHGE  403
            LT Y  AKC  L E PF + V++V EGA R+TDEYARSAIDWGELYKGFPHGE
Sbjct  117  LTAYAKAKCKALLEEPFGRIVEIVGEGANRITDEYARSAIDWGELYKGFPHGE  169



>gb|ADL37213.1| At1g65450-like protein [Arabidopsis lyrata subsp. lyrata]
Length=170

 Score =   195 bits (496),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 99/173 (57%), Positives = 121/173 (70%), Gaps = 7/173 (4%)
 Frame = -3

Query  912  PPQVTFPHPELLKVNLPAGEEMAPPVFDSLKDDLAFEIFQLSSADIERLKDKAKAPDNVK  733
            PP VTFPH EL+K      +     VF++    L F+IF+LSS  I++LK++A    +  
Sbjct  1    PPSVTFPHHELVKFQ----DCETTTVFEATSQHLDFKIFKLSSEQIKKLKERASETSSGY  56

Query  732  TKVTGFNVLTAAIWRCKALSCL---GGENNSDRLSTVLFAVDIRRRLNPPLPDSYSGNAV  562
             +VTGFNV+TA +WRCKALS     G E N +R ST+L+AVDIR RLNP LP SY+GN V
Sbjct  57   VRVTGFNVVTALVWRCKALSVAAEEGEETNLERESTILYAVDIRGRLNPELPPSYTGNXV  116

Query  561  LTGYGSAKCAELEEGPFWKTVQMVYEGAARMTDEYARSAIDWGELYKGFPHGE  403
            LT Y  AKC  L E PF + V++V EGA R+TDEYARSAIDWGELYKGFPHGE
Sbjct  117  LTAYAKAKCKALLEEPFGRIVEIVGEGANRITDEYARSAIDWGELYKGFPHGE  169



>ref|XP_009125170.1| PREDICTED: omega-hydroxypalmitate O-feruloyl transferase-like 
[Brassica rapa]
Length=452

 Score =   204 bits (518),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 146/449 (33%), Positives = 222/449 (49%), Gaps = 34/449 (8%)
 Frame = -3

Query  1515  HEDLKVTILDSGLIFPSQETTKHTMFLSNIDKVLNFDVQTVHFFPASPGFPPEIVAGKIK  1336
             H  L+V   +  L+ P  ET K   FLSN+D+ +   V+T++ F +      + V   IK
Sbjct  26    HIHLEVLPKEPALVKPESETPKGLYFLSNLDQNIAVIVRTIYCFKSEERGNEDAVQ-VIK  84

Query  1335  NAFRRLLVANTYDFLAGRLKKNKESERVEIECNAAGAGFTVASSEFALEDIGDLVYPNPA  1156
              A  ++LV   Y  LAGRL  + E  ++ ++C   G  F  A +   +++IGD+  P+P 
Sbjct  85    KALSQVLVH--YYPLAGRLTISPEG-KLTVDCTEEGVVFVEAEANCEMDEIGDITKPDP-  140

Query  1155  FRQLVTMSFDFVAKE---DQPLCFLQVTSFKCGGFALGTSMNHISFDGSGFKMFLENLAA  985
                L  + +D V  +   + P    QVT FKCGGF LG  MNH  FDG G   F+ +   
Sbjct  141   -ETLGKLVYDVVDAKNILEVPPVTAQVTKFKCGGFVLGLCMNHCMFDGIGAMEFVNSWGQ  199

Query  984   LSFNDDGPLAVVPCNDRSLLAARSPPQVTFPHPELLKVNLPAGEEMAPPVFDSL--KDDL  811
             ++     PL   P +DR++L+AR+PP++   H E  ++   +         +SL  K+  
Sbjct  200   VA--RGLPLTTPPFSDRTILSARNPPKIENLHQEFEEIEDKSN-------INSLYSKEPT  250

Query  810   AFEIFQLSSADIERLKDKAKAPDNVKTKVTGFNVLTAAIWRC--KALSCLGGENNSDRLS  637
                 F      I++LK +A   ++     T F  L+A +WR   K+L  L     SD+ +
Sbjct  251   LHRSFCFDPEKIKKLKLQA-TENSESLSCTTFEALSAFVWRARTKSLKML-----SDQKT  304

Query  636   TVLFAVDIRRRLNPPLPDSYSGNAVLTGYGSAKCAELEEGPFWKTVQMVYEGAARMTDEY  457
              +LFAVD R +  PPLP  Y GN ++      +  EL E P    V +V E    +TD Y
Sbjct  305   KLLFAVDGRAKFEPPLPKGYFGNGIVLTNSICEAGELTEKPLGYAVGLVREAIKMVTDGY  364

Query  456   ARSAIDWGELYKGFP--HGEFLVSSWWRLGFEGVQFPWGKPKYSCPVVYHRKDIILLFPD  283
              RSAID+ E+ +  P      L+++W RLGF    F WG+P  S PV    K++ L    
Sbjct  365   MRSAIDYFEVTRARPSLSSTLLITTWSRLGFHTTDFGWGEPVLSGPVALPEKEVTLFL--  422

Query  282   IDNGGKSNSGVNVLVALPPKEMEKFKSLF  196
               + G+    +NVL+ LP   M+ F+  F
Sbjct  423   --SHGEQRRSINVLLGLPASAMDVFQEQF  449



>gb|ADL37209.1| At1g65450-like protein [Arabidopsis lyrata subsp. lyrata]
 gb|ADL37210.1| At1g65450-like protein [Arabidopsis lyrata subsp. lyrata]
 gb|ADL37214.1| At1g65450-like protein [Arabidopsis lyrata subsp. lyrata]
Length=170

 Score =   195 bits (495),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 99/173 (57%), Positives = 120/173 (69%), Gaps = 7/173 (4%)
 Frame = -3

Query  912  PPQVTFPHPELLKVNLPAGEEMAPPVFDSLKDDLAFEIFQLSSADIERLKDKAKAPDNVK  733
            PP VTFPH EL+K      +     VF++    L F+IF+LSS  I++LK++A       
Sbjct  1    PPSVTFPHHELVKFQ----DCETTTVFEATSQHLDFKIFKLSSEQIKKLKERASETSXGY  56

Query  732  TKVTGFNVLTAAIWRCKALSCL---GGENNSDRLSTVLFAVDIRRRLNPPLPDSYSGNAV  562
             +VTGFNV+TA +WRCKALS     G E N +R ST+L+AVDIR RLNP LP SY+GN V
Sbjct  57   VRVTGFNVVTALVWRCKALSVAAEEGEETNLERESTILYAVDIRGRLNPELPPSYTGNVV  116

Query  561  LTGYGSAKCAELEEGPFWKTVQMVYEGAARMTDEYARSAIDWGELYKGFPHGE  403
            LT Y  AKC  L E PF + V++V EGA R+TDEYARSAIDWGELYKGFPHGE
Sbjct  117  LTAYAKAKCKALLEEPFGRIVEIVGEGANRITDEYARSAIDWGELYKGFPHGE  169



>ref|XP_002969985.1| BAHD family acyltransferase, clade V [Selaginella moellendorffii]
 gb|EFJ29109.1| BAHD family acyltransferase, clade V [Selaginella moellendorffii]
Length=457

 Score =   204 bits (518),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 142/445 (32%), Positives = 219/445 (49%), Gaps = 47/445 (11%)
 Frame = -3

Query  1467  SQETTKHTMFLSNIDKVLNFDVQTVHFFPAS--------PGFPPEIVAGKIKNAFRRLLV  1312
             S +      FL+N+D+ L   +QTV+F+  S        P  P ++V    K +   +L+
Sbjct  36    SAQHKDERYFLTNLDQNLAVIMQTVYFYKGSGSSELQQAPRDPVDVV----KKSLEEILI  91

Query  1311  ANTYDFLAGRLKKNKESERVEIECNAAGAGFTVASSEFALED------IGDLVYPNPAFR  1150
                Y  LAGRL  +++  ++E+ CN  GA F  A +  +LE       +G  +  N   R
Sbjct  92    --LYYPLAGRLALSRDM-KLEVLCNDQGALFVEADANVSLEQFVKDSKLGQGLDAN--LR  146

Query  1149  QLVTMSFDFVAKEDQPLCFLQVTSFKCGGFALGTSMNHISFDGSGFKMFLENLAALSFND  970
             Q V       +  D P    QVT F+CGGF LG S+NH  FDG     F+ + + L+   
Sbjct  147   QFVYSVPGAKSVLDIPPLVAQVTRFQCGGFVLGLSLNHAIFDGIAAMEFVNSWSELA--R  204

Query  969   DGPLAVVPCNDRSLLAARSPPQVTFPHPELLKVNLPAGEEMAPPVFDSLKDDLAFEIFQL  790
               PL+V PC DRS L AR+P Q+ FPHPE L+V+ P  ++ A       K +L F+    
Sbjct  205   GVPLSVPPCLDRSSLRARNPLQIEFPHPEFLEVDQPPSDQPAE------KSELVFKSIAF  258

Query  789   SSADIERLKDKAKAPDNVKTKVTGFNVLTAAIWRCKALSCLGGENNSDRLST----VLFA  622
                 +  LK+ A   + V  K + F   TA +W+C+ ++      +SDRLS+    +LFA
Sbjct  259   DEKKLSSLKE-AILREGVLDKCSSFEAFTALVWKCRTMA-----TSSDRLSSRQTKLLFA  312

Query  621   VDIRRRLNPPLPDSYSGNAVLTGYGSAKCAELEEGPFWKTVQMVYEGAARMTDEYARSAI  442
             VD R RL+P LP  Y GN +L         +L +G     ++++    A++ + Y RS I
Sbjct  313   VDARNRLSPALPRGYVGNGILLTCALTSVEDLLQGSLSHAIELIRAAIAKIDNAYLRSVI  372

Query  441   DWGELYKGFPHGE--FLVSSWWRLGFEGVQFPWGKPKYSCPVVYHRKDIILLFPDIDNGG  268
             D+ E  +  P  E   ++++W RL F    F WG P ++ P      ++ L  P     G
Sbjct  373   DFFEQTRLRPSLESTLVITTWSRLAFHTTDFGWGTPLFTAPASLPEAEVALFLPH----G  428

Query  267   KSNSGVNVLVALPPKEMEKFKSLFH  193
             +S  G  ++  LP ++M+ F SL  
Sbjct  429   ESRKGFELVHGLPERDMKTFVSLME  453



>ref|XP_010554116.1| PREDICTED: omega-hydroxypalmitate O-feruloyl transferase [Tarenaya 
hassleriana]
 ref|XP_010554117.1| PREDICTED: omega-hydroxypalmitate O-feruloyl transferase [Tarenaya 
hassleriana]
 ref|XP_010554118.1| PREDICTED: omega-hydroxypalmitate O-feruloyl transferase [Tarenaya 
hassleriana]
 ref|XP_010554119.1| PREDICTED: omega-hydroxypalmitate O-feruloyl transferase [Tarenaya 
hassleriana]
 ref|XP_010554120.1| PREDICTED: omega-hydroxypalmitate O-feruloyl transferase [Tarenaya 
hassleriana]
Length=438

 Score =   203 bits (516),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 146/443 (33%), Positives = 212/443 (48%), Gaps = 39/443 (9%)
 Frame = -3

Query  1479  LIFPSQETTKHTMFLSNIDKVLNFDVQTVHFFPASPGFPPEIVAGKIKNAFRRLLVANTY  1300
             L+ P  ET K   FLSN+D+ +   V+T++ F +      E  A  +KNA  ++LV   Y
Sbjct  23    LVKPISETQKGLYFLSNLDQNIAVIVRTIYCFKSEEKGNEE-AADVLKNALSKVLVH--Y  79

Query  1299  DFLAGRLKKNKESERVEIECNAAGAGFTVASSEFALEDIGDLVYPNP-AFRQLVTMSFDF  1123
               LAGRL    E + + ++C   G  F  A +   +++IGD+  P P    +LV    D 
Sbjct  80    YPLAGRLTICPEGKLI-VDCTEEGVVFVEAEANCTMDEIGDITKPKPETLGKLVYDVPDA  138

Query  1122  VAKEDQPLCFLQVTSFKCGGFALGTSMNHISFDGSGFKMFLENLAALSFNDDGPLAVVPC  943
                 + P    QVT FKCGGF LG  MNH  FDG G   F+ +    +     PL   P 
Sbjct  139   KNILEIPPVTAQVTKFKCGGFVLGLCMNHCMFDGIGAMEFVNSWGQTARG--LPLTTPPF  196

Query  942   NDRSLLAARSPPQVTFPHPELLKVN-------LPAGEEMAPPVFDSLKDDLAFEIFQLSS  784
             +DR++L AR+PP++   H E  +++       L AGE M             +  F    
Sbjct  197   SDRTILRARNPPKIEHLHQEFAEIDDKSNINALYAGEPML------------YRSFFFDQ  244

Query  783   ADIERLKDKAKAPDNVKTKVTGFNVLTAAIWRC--KALSCLGGENNSDRLSTVLFAVDIR  610
               I++LK KA     V    T F  L+A +WR   KAL  L     +D+ + +LFAVD R
Sbjct  245   DKIKKLKLKATEDGEVLDNCTTFEALSAFVWRARTKALKML-----NDQKTKLLFAVDGR  299

Query  609   RRLNPPLPDSYSGNAVLTGYGSAKCAELEEGPFWKTVQMVYEGAARMTDEYARSAIDWGE  430
              +  PPLP  Y GN ++      +  EL E P    V +V +    +TD Y RSAID+ E
Sbjct  300   AKFEPPLPKGYVGNGIVLTNAICEAGELLEKPLAFAVGLVRDAIKMVTDGYMRSAIDYFE  359

Query  429   LYKGFP--HGEFLVSSWWRLGFEGVQFPWGKPKYSCPVVYHRKDIILLFPDIDNGGKSNS  256
             + +  P      L+++W RL F    F WG+P  S PV    K++IL      + G+   
Sbjct  360   VTRARPSLSSTLLITAWSRLSFHTTDFGWGEPVLSGPVALPEKEVILFL----SHGEQRR  415

Query  255   GVNVLVALPPKEMEKFKSLFHKF  187
              +NVL+ LP   M+ F+    + 
Sbjct  416   SINVLLGLPGSAMDVFEEQMRQI  438



>ref|XP_006662951.1| PREDICTED: omega-hydroxypalmitate O-feruloyl transferase-like 
[Oryza brachyantha]
Length=459

 Score =   203 bits (517),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 148/448 (33%), Positives = 217/448 (48%), Gaps = 38/448 (8%)
 Frame = -3

Query  1479  LIFPSQET-TKHTMFLSNIDKVLNFDVQTVHFFPASPGFPPEIVAGK---------IKNA  1330
             L+ P++ T T    +LSN+D+ +   VQTV+ + A    P E  AG          +++A
Sbjct  33    LVAPAEATPTGEKYYLSNLDQNIAVIVQTVYCYKAKAA-PAEDGAGADADADAVAVLRDA  91

Query  1329  FRRLLVANTYDFLAGRLKKNKESERVEIECNAAGAGFTVASSEFALEDIGDLVYPNPA-F  1153
               ++LV   Y  LAGRL  + E  ++ +E    GA F  A +   L D+GDL  P+PA  
Sbjct  92    LAKVLV--HYHPLAGRLTISPEM-KLAVELTGEGALFVAADAGCDLADVGDLTKPDPAAL  148

Query  1152  RQLVTMSFDFVAKEDQPLCFLQVTSFKCGGFALGTSMNHISFDGSGFKMFLENLAALSFN  973
              QLV          + P    QVT FKCGGFALG +MNH  FDG G   F+ + A  +  
Sbjct  149   GQLVYSVPGAKNILEMPPMTAQVTRFKCGGFALGLAMNHCMFDGLGAMEFVNSWAETA-R  207

Query  972   DDGPLAVVPCNDRSLLAARSPPQVTFPHPELLKVNLPAGEEMAPPVFDSLK----DDLAF  805
                 L V P  DR++L+AR PP ++F H E          E  P + D+       +L +
Sbjct  208   GAAELPVPPFLDRTVLSARDPPVISFEHHEF---------EEIPDISDTAALYGGQELLY  258

Query  804   EIFQLSSADIERLKDKAKAPDNVKTKVTGFNVLTAAIWRCKALSCLGGENNSDRLSTVLF  625
               F      +ER++  A A  ++  + T F  L+  +WR +    LG     ++ + +LF
Sbjct  259   RSFCFDPDRLERVRGLALAGGDLGGRCTTFEALSGLVWRART-RALG--LAPEQRTKLLF  315

Query  624   AVDIRRRLNPPLPDSYSGNAVLTGYGSAKCAELEEGPFWKTVQMVYEGAARMTDEYARSA  445
             AVD RRR  PPLP  Y GN ++     A   +L   P  +   +  E    +TDEY RSA
Sbjct  316   AVDGRRRFEPPLPKGYFGNGIVLTNAVATAGDLLSSPPSRAAGLGQEAVRMVTDEYMRSA  375

Query  444   IDWGELYKGFPH--GEFLVSSWWRLGFEGVQFPWGKPKYSCPVVYHRKDIILLFPDIDNG  271
             +D+ E  +  P      L+++W RL F    F WG+P  S PV    K++IL        
Sbjct  376   VDYFEATRARPSLASTLLITTWSRLAFHDADFGWGEPAMSGPVTLPEKEVILFLAH----  431

Query  270   GKSNSGVNVLVALPPKEMEKFKSLFHKF  187
             GK    +NVL+ LP   M+ F++L  + 
Sbjct  432   GKERKSINVLLGLPASAMDAFQNLMDEI  459



>gb|EMS51970.1| Omega-hydroxypalmitate O-feruloyl transferase [Triticum urartu]
Length=447

 Score =   203 bits (516),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 150/435 (34%), Positives = 218/435 (50%), Gaps = 21/435 (5%)
 Frame = -3

Query  1479  LIFPSQET-TKHTMFLSNIDKVLNFDVQTVHFFPASPGFPPEIVAGKIKNAFRRLLVANT  1303
             L+ P++ T T    +LSN+D+ +   VQTV+ F    G   E  A  ++ A  R+LV   
Sbjct  30    LVSPAEATPTGEQYYLSNLDQNIAVIVQTVYCFKCPSGRGNEGAADALRAALARVLV--H  87

Query  1302  YDFLAGRLKKNKESERVEIECNAAGAGFTVASSEFALEDIGDLVYPNPA-FRQLVTMSFD  1126
             Y  LAGRL  + E  ++ +EC   G  F  A +   L  IGDL  P+PA   QLV     
Sbjct  88    YHPLAGRLGISPEM-KLTVECTGEGVPFVEAEAACDLALIGDLSTPDPAALGQLVYSVPG  146

Query  1125  FVAKEDQPLCFLQVTSFKCGGFALGTSMNHISFDGSGFKMFLENLAALSFNDDGPLAVVP  946
               +  + P    QVT FKCGGF+LG +MNH  FDG G   F+ + A ++      L V P
Sbjct  147   AKSILEMPPMTAQVTRFKCGGFSLGLAMNHCMFDGLGAMEFVNSWAEMA-RGATELTVPP  205

Query  945   CNDRSLLAARSPPQVTFPHPELLKVNLPAGEEMAPPVFDSLKDDLAFEIFQLSSADIERL  766
               DRS+L  R PP ++ PH E  ++   +  EMA       +++L +  F      +ER+
Sbjct  206   FLDRSVLRPRDPPVISNPHNEFEEIADVS--EMAALYG---REELMYRSFCFDPDRLERV  260

Query  765   KDKAKAPDNVKTKVTGFNVLTAAIWRCKALSCLGGENNSDRLSTVLFAVDIRRRLNPPLP  586
             +  A A  +++ K T F  L+  +WR +    LG     ++ + +LFAVD RRR  PPLP
Sbjct  261   RGLALADGDLE-KCTTFEALSGLVWRART-RALG--LAPEQQTKLLFAVDGRRRFVPPLP  316

Query  585   DSYSGNAVLTGYGSAKCAELEEGPFWKTVQMVYEGAARMTDEYARSAIDWGELYKGFPH-  409
               Y GN ++     A   +L   P  +    V E    +TDEY RSA+D+ E  +  P  
Sbjct  317   KGYFGNGIVLTNAIATAEDLLSAPVSRAAGKVQEAVRMVTDEYMRSAVDYFEATRARPSL  376

Query  408   -GEFLVSSWWRLGFEGVQFPWGKPKYSCPVVYHRKDIILLFPDIDNGGKSNSGVNVLVAL  232
                 L+++W RL F G  F WG+P  S PV    K++IL        GK    +NVL+ L
Sbjct  377   ASTLLITTWSRLAFNGADFGWGEPTMSGPVTLPEKEVILFLAH----GKERKSINVLLGL  432

Query  231   PPKEMEKFKSLFHKF  187
             P   M+ F++L  + 
Sbjct  433   PASAMDAFQALMDEI  447



>gb|ACN57301.1| At1g65450-like protein [Capsella grandiflora]
Length=169

 Score =   194 bits (494),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 99/173 (57%), Positives = 119/173 (69%), Gaps = 7/173 (4%)
 Frame = -3

Query  894  PHPELLKVNLPAGEEMAPPVFDSLKDDLAFEIFQLSSADIERLKDKAKAPDNVKTKVTGF  715
            PH EL+K      +     VF++    L F+IF+LSS  I++LK++A    +   +VTGF
Sbjct  1    PHHELVKFQ----DCETTTVFEATSQKLDFKIFKLSSDQIKKLKERASETSSGDVRVTGF  56

Query  714  NVLTAAIWRCKALSCLGGEN---NSDRLSTVLFAVDIRRRLNPPLPDSYSGNAVLTGYGS  544
            NV+TA +WRCKALS    E    N +R ST+L+AVDIR RLNP LP SY+GNAVLT Y  
Sbjct  57   NVVTALVWRCKALSVTTEEXEEANLERESTILYAVDIRGRLNPELPSSYTGNAVLTAYAK  116

Query  543  AKCAELEEGPFWKTVQMVYEGAARMTDEYARSAIDWGELYKGFPHGEFLVSSW  385
             KC  L E PF + V MV EGA RMT+EYARSAIDWGELYKGFPHGE LVSSW
Sbjct  117  XKCKALLEEPFGEIVDMVGEGAKRMTBEYARSAIDWGELYKGFPHGEVLVSSW  169



>gb|ACN57306.1| At1g65450-like protein [Capsella grandiflora]
Length=169

 Score =   194 bits (493),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 101/173 (58%), Positives = 120/173 (69%), Gaps = 7/173 (4%)
 Frame = -3

Query  894  PHPELLKVNLPAGEEMAPPVFDSLKDDLAFEIFQLSSADIERLKDKAKAPDNVKTKVTGF  715
            PH EL+K      +     VF++    L F+IF+LSS  I++LK++A    +   +VTGF
Sbjct  1    PHHELVKFQ----DCETTTVFEATSQKLDFKIFKLSSDQIKKLKERASETSSGDVRVTGF  56

Query  714  NVLTAAIWRCKALSCLGGEN---NSDRLSTVLFAVDIRRRLNPPLPDSYSGNAVLTGYGS  544
            NV+TA +WRCKALS    E    N +R ST+L+AVDIR RLNP LP SY+GNAVLT Y  
Sbjct  57   NVVTALVWRCKALSVTXEEXEEANLERESTILYAVDIRGRLNPELPSSYTGNAVLTAYAK  116

Query  543  AKCAELEEGPFWKTVQMVYEGAARMTDEYARSAIDWGELYKGFPHGEFLVSSW  385
            AKC  L E PF + V MV EGA RMTDEYARSAIDWGELYKGFPHGE LVSSW
Sbjct  117  AKCXALLEEPFGEIVDMVGEGAKRMTDEYARSAIDWGELYKGFPHGEVLVSSW  169



>gb|ACN57307.1| At1g65450-like protein [Capsella grandiflora]
Length=169

 Score =   194 bits (493),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 100/173 (58%), Positives = 119/173 (69%), Gaps = 7/173 (4%)
 Frame = -3

Query  894  PHPELLKVNLPAGEEMAPPVFDSLKDDLAFEIFQLSSADIERLKDKAKAPDNVKTKVTGF  715
            PH EL+K      +     VF++    L F+IF+LSS  I++LK++A    +   +VTGF
Sbjct  1    PHHELVKFQ----DCETTTVFEATSQKLDFKIFKLSSDQIKKLKERASETSSGDVRVTGF  56

Query  714  NVLTAAIWRCKALSCLGGEN---NSDRLSTVLFAVDIRRRLNPPLPDSYSGNAVLTGYGS  544
            NV+TA +WRCKALS    E    N +R ST+L+AVDIR RLNP LP SY+GNAVLT Y  
Sbjct  57   NVVTALVWRCKALSVTTEEXEEANLERESTILYAVDIRGRLNPELPSSYTGNAVLTAYAK  116

Query  543  AKCAELEEGPFWKTVQMVYEGAARMTDEYARSAIDWGELYKGFPHGEFLVSSW  385
            AKC  L   PF + V MV EGA RMTDEYARSAIDWGELYKGFPHGE LVSSW
Sbjct  117  AKCKALLXEPFGEIVDMVGEGAKRMTDEYARSAIDWGELYKGFPHGEVLVSSW  169



>ref|NP_001150426.1| transferase [Zea mays]
 gb|ACG39047.1| transferase [Zea mays]
Length=453

 Score =   202 bits (515),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 150/444 (34%), Positives = 209/444 (47%), Gaps = 34/444 (8%)
 Frame = -3

Query  1479  LIFPSQET-TKHTMFLSNIDKVLNFDVQTVHFFPASPGFPPEIVAGK-----IKNAFRRL  1318
             L+ P++ T T    +LSN+D+ +   VQTV+ +   P  PP    GK             
Sbjct  31    LVPPAEATPTGGQYYLSNLDQNIAVIVQTVYCY--KPSSPPGGGEGKDVDVAAALRDALA  88

Query  1317  LVANTYDFLAGRLKKNKESERVEIECNAAGAGFTVASSEFALEDIGDLVYPNPA-FRQLV  1141
              V   Y  LAGRL  + E  ++ +E    GA F  A +   L  +GDL  P+PA   QLV
Sbjct  89    RVLVHYHPLAGRLGVSPEM-KLTVELTGEGAVFVEADAACDLAAVGDLTKPDPAALGQLV  147

Query  1140  TMSFDFVAKEDQPLCFLQVTSFKCGGFALGTSMNHISFDGSGFKMFLENLAALSFNDDGP  961
                       + P    QVT FKCGGFALG +MNH  FDG G   F+ + A  +      
Sbjct  148   YSVPGAKHILEMPPMTAQVTRFKCGGFALGLAMNHCMFDGIGAMEFVNSWAETA-RGVAE  206

Query  960   LAVVPCNDRSLLAARSPPQVTFPHPELLKVNLPAGEEMAPPVFDSLK----DDLAFEIFQ  793
             L V P  DRS+L AR PP  TFPH E  ++         P V D+       +L +  F 
Sbjct  207   LTVPPFLDRSVLKARDPPVPTFPHHEFAEI---------PDVSDTAALYGAQELLYRSFC  257

Query  792   LSSADIERLKDKAKAPDNVKTKVTGFNVLTAAIWRCKALSCLGGENNSDRLSTVLFAVDI  613
                  +ER++  A A D    + T F  L+  +WR +    LG     ++ + +LFAVD 
Sbjct  258   FDPDRLERVRGLALA-DGALGRCTTFEALSGLVWRART-KALG--LAPEQRTKLLFAVDG  313

Query  612   RRRLNPPLPDSYSGNAVLTGYGSAKCAELEEGPFWKTVQMVYEGAARMTDEYARSAIDWG  433
             RRR  PPLP  Y GN ++     A   EL   P  +   +V +    +TD+Y RSA+D+ 
Sbjct  314   RRRFAPPLPRGYFGNGIVLTNALATAGELLSAPVSRAAGLVQDAVRMVTDDYMRSAVDYF  373

Query  432   ELYKGFPH--GEFLVSSWWRLGFEGVQFPWGKPKYSCPVVYHRKDIILLFPDIDNGGKSN  259
             E  +  P      L+++W RL F G  F WG+P  S PV    K++IL        GK  
Sbjct  374   EATRARPSLASTLLITTWSRLEFHGADFGWGEPVMSGPVTLPEKEVILFLAH----GKER  429

Query  258   SGVNVLVALPPKEMEKFKSLFHKF  187
               +NVL+ LP   M+ F+ L  + 
Sbjct  430   KSINVLLGLPATAMDAFQELMDEI  453



>emb|CDY68497.1| BnaCnng59260D [Brassica napus]
Length=444

 Score =   202 bits (514),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 141/437 (32%), Positives = 214/437 (49%), Gaps = 42/437 (10%)
 Frame = -3

Query  1485  SGLIFPSQETTKHTMFLSNIDKVLNFDVQTVHFFPASPGFPPEIVAGKIKNAFRRLLVAN  1306
             + L+ P  ET     FLSN+D+ +   V+T++ F +      E V   IK A  ++LV  
Sbjct  40    AALVKPESETPNGLYFLSNLDQNIAVIVRTIYCFKSEERGNEEAVQ-VIKKALSQVLVH-  97

Query  1305  TYDFLAGRLKKNKESERVEIECNAAGAGFTVASSEFALEDIGDLVYPNPAFRQLVTMSFD  1126
              Y  LAGRL  + E  ++ ++C   G  F  A +   +++IGD+  P+P    L  + +D
Sbjct  98    -YYPLAGRLTISPEG-KLTVDCTEEGVVFVEAEANCKMDEIGDITKPDP--ETLGKLVYD  153

Query  1125  FVAKE---DQPLCFLQVTSFKCGGFALGTSMNHISFDGSGFKMFLENLAALSFNDDGPLA  955
              V  +   + P    QVT FKCGGF LG  MNH  FDG G   F+ +   L+     PL 
Sbjct  154   VVEAKNILEVPPVTAQVTKFKCGGFVLGLCMNHCMFDGIGAMEFVNSWGQLA--RGLPLT  211

Query  954   VVPCNDRSLLAARSPPQVTFPHPELLKVNLPAGEEMAPPVFDSLKDDLAFEIFQLSSADI  775
               P +DR++L A++PP++   H E                F+ ++D    + F      I
Sbjct  212   TPPFSDRTILTAKNPPKIESLHQE----------------FEEIED----KSFCFDPEKI  251

Query  774   ERLKDKA--KAPDNVKTKVTGFNVLTAAIWRCKALSCLGGENNSDRLSTVLFAVDIRRRL  601
             ++LK +A   +   +    T F  L+A +WR +  S    +  SD+ + +LFAVD R + 
Sbjct  252   KKLKLQATENSESLLGNSCTTFEALSAFVWRARTKSL---KMLSDQKTKLLFAVDGRAKF  308

Query  600   NPPLPDSYSGNAVLTGYGSAKCAELEEGPFWKTVQMVYEGAARMTDEYARSAIDWGELYK  421
              PPLP  Y GN ++      +  EL E P    V +V E    +TD Y RSAID+ E+ +
Sbjct  309   EPPLPKGYFGNGIVLTNSICEAGELTEKPLSFAVGLVREAIKMVTDRYMRSAIDYFEVTR  368

Query  420   GFP--HGEFLVSSWWRLGFEGVQFPWGKPKYSCPVVYHRKDIILLFPDIDNGGKSNSGVN  247
               P      L+++W RLGF    F WG+P  S PV    K++ L      + G+    +N
Sbjct  369   ARPSLSSTLLITTWSRLGFHTTDFGWGEPVLSGPVALPEKEVTLFL----SHGEERRSIN  424

Query  246   VLVALPPKEMEKFKSLF  196
             VL+ LP   M+ F+ LF
Sbjct  425   VLLGLPASAMDVFQELF  441



>ref|XP_003602785.1| Hydroxycinnamoyl CoA shikimate/quinate hydroxycinnamoyltransferase-like 
protein [Medicago truncatula]
 gb|AES73036.1| omega-hydroxypalmitate O-feruloyl transferase [Medicago truncatula]
Length=435

 Score =   202 bits (513),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 143/443 (32%), Positives = 229/443 (52%), Gaps = 26/443 (6%)
 Frame = -3

Query  1512  EDLKVTILDSGLIFPSQETTKHTMFLSNIDKVLNFDVQTVHFFPASPGFPPEIVAGKIKN  1333
             ++L VT  +   + P++ET K   FLSN+D+ +   ++T++ F  S     E  A  IK+
Sbjct  10    DELHVTQGEPIRVQPAEETEKGLYFLSNLDQNIAVPMRTIYCF-KSESRGNEEAAHVIKD  68

Query  1332  AFRRLLVANTYDFLAGRLKKNKESERVEIECNAAGAGFTVASSEFALEDIGDLVYPNPAF  1153
             A  ++LV   Y  +AG+L  + E + + ++    GA F  A S+  ++ +GDL  P+P  
Sbjct  69    ALSKILVP--YYPMAGKLIISTEGKLI-VDNTGEGAVFVEAESDCDIDKVGDLTKPDP--  123

Query  1152  RQLVTMSFDFVAKE---DQPLCFLQVTSFKCGGFALGTSMNHISFDGSGFKMFLENLAAL  982
              +L  + +D    +   + PL  +QVT FKCGGF LG +M H   DG     F+   A  
Sbjct  124   HRLGKLVYDTPGAKNILEMPLMTVQVTKFKCGGFTLGLNMIHCMKDGLCAMEFVNAWAET  183

Query  981   SFNDDGPLAVVPCNDRSLLAARSPPQVTFPHPELLKVNLPAGEEMAPPVFDSLKDDLAFE  802
             +   D  L   P  DR++L +R PP+V F H E  ++   +  E    +++   +++  +
Sbjct  184   ARGLD--LKTPPFLDRTILKSRDPPKVEFQHHEFDEIEDLSNTE---KIYEG--ENIIHK  236

Query  801   IFQLSSADIERLKDKAKAPDNVKTKVTGFNVLTAAIWRCKALSCLGGENNSDRLSTVLFA  622
              F  +   ++ LK KA   D V  K + F  L+A +WR +  +     N   +L   LFA
Sbjct  237   SFLFNPEKLDSLKKKA-TEDGVLKKCSTFEALSAFVWRTRTSALKMHPNQQTKL---LFA  292

Query  621   VDIRRRLNPPLPDSYSGNAVLTGYGSAKCAELEEGPFWKTVQMVYEGAARMTDEYARSAI  442
             VD R R  PP+P  Y GNA++      K  EL E PF  +V +V++    +TD Y RSAI
Sbjct  293   VDGRPRFIPPIPKGYFGNAIVLTNSLCKANELLENPFSFSVGLVHKAIDMVTDSYMRSAI  352

Query  441   DWGELYKGFPH--GEFLVSSWWRLGFEGVQFPWGKPKYSCPVVYHRKDIILLFPDIDNGG  268
             D+ E+ +  P   G  L+++W +L F+   F WG+P  S PV     ++IL      + G
Sbjct  353   DYFEVTRARPSLTGTLLITTWTKLSFDTTDFGWGEPLCSGPVTLPNTEVILFL----SHG  408

Query  267   KSNSGVNVLVALPPKEMEKFKSL  199
             +   G++VL+ LP   ME+F+ L
Sbjct  409   QGRKGISVLLGLPASAMERFEEL  431



>emb|CDX67482.1| BnaA07g15220D [Brassica napus]
Length=444

 Score =   202 bits (513),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 141/437 (32%), Positives = 217/437 (50%), Gaps = 30/437 (7%)
 Frame = -3

Query  1485  SGLIFPSQETTKHTMFLSNIDKVLNFDVQTVHFFPASPGFPPEIVAGKIKNAFRRLLVAN  1306
             + L+ P  ET K   FLSN+D+ +   V+T++ F +      + V   IK A  ++LV  
Sbjct  28    AALVKPESETPKGLYFLSNLDQNIAVIVRTIYCFKSEERGNEDAVQ-VIKKALSQVLVH-  85

Query  1305  TYDFLAGRLKKNKESERVEIECNAAGAGFTVASSEFALEDIGDLVYPNPAFRQLVTMSFD  1126
              Y  LAGRL  + E  ++ ++C   G  F  A +   +++IGD+  P+P    L  + +D
Sbjct  86    -YYPLAGRLTISPEG-KLTVDCTEEGVVFVEAEANCEMDEIGDITKPDP--ETLGKLVYD  141

Query  1125  FVAKE---DQPLCFLQVTSFKCGGFALGTSMNHISFDGSGFKMFLENLAALSFNDDGPLA  955
              V  +   + P    QVT FKCGGF LG  MNH  FDG G   F+ +   ++     PL 
Sbjct  142   VVDAKNILEVPPVTAQVTKFKCGGFVLGLCMNHCMFDGIGAMEFVNSWGQVA--RGLPLT  199

Query  954   VVPCNDRSLLAARSPPQVTFPHPELLKVNLPAGEEMAPPVFDSL--KDDLAFEIFQLSSA  781
               P +DR++L+AR+PP++   H E  ++   +         +SL  K+      F     
Sbjct  200   TPPFSDRTILSARNPPKIENLHQEFEEIEDKSN-------INSLYSKEPTLHRSFCFDPE  252

Query  780   DIERLKDKAKAPDNVKTKVTGFNVLTAAIWRCKALSCLGGENNSDRLSTVLFAVDIRRRL  601
              I++LK +A   ++     T F  L+A +WR +  S    +  SD+ + +LFAVD R + 
Sbjct  253   KIKKLKLQA-TENSESLSCTTFEALSAFVWRARTKSL---KMLSDQKTKLLFAVDGRAKF  308

Query  600   NPPLPDSYSGNAVLTGYGSAKCAELEEGPFWKTVQMVYEGAARMTDEYARSAIDWGELYK  421
              PPLP  Y GN ++      +  EL E P    V +V E    +TD Y RSAID+ E+ +
Sbjct  309   EPPLPKGYFGNGIVLTNSICEAGELTEKPLGYAVGLVREAIKMVTDGYMRSAIDYFEVTR  368

Query  420   GFP--HGEFLVSSWWRLGFEGVQFPWGKPKYSCPVVYHRKDIILLFPDIDNGGKSNSGVN  247
               P      L+++W RLGF    F WG+P  S PV    K++ L      + G+    +N
Sbjct  369   ARPSLSSTLLITTWSRLGFHTTDFGWGEPVLSGPVALPEKEVTLFL----SHGEQRRSIN  424

Query  246   VLVALPPKEMEKFKSLF  196
             VL+ LP   M+ F+  F
Sbjct  425   VLLGLPASAMDVFQEQF  441



>ref|XP_002981455.1| BAHD family acyltransferase, clade V [Selaginella moellendorffii]
 gb|EFJ17643.1| BAHD family acyltransferase, clade V [Selaginella moellendorffii]
Length=458

 Score =   202 bits (514),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 142/445 (32%), Positives = 217/445 (49%), Gaps = 47/445 (11%)
 Frame = -3

Query  1467  SQETTKHTMFLSNIDKVLNFDVQTVHFFPAS--------PGFPPEIVAGKIKNAFRRLLV  1312
             S +      FL+N+D+ L   +QTV+F+  S        P  P ++V    K +   +LV
Sbjct  37    SAQHKDERYFLTNLDQNLAVIMQTVYFYKGSGSSELQQAPRDPVDVV----KKSLEEILV  92

Query  1311  ANTYDFLAGRLKKNKESERVEIECNAAGAGFTVASSEFALED------IGDLVYPNPAFR  1150
                Y  LAGRL  +++  ++E+ CN  GA F  A +  +LE       +G  +  N   R
Sbjct  93    --LYYPLAGRLALSRDM-KLEVLCNDQGALFVEADANVSLEQFVKDSKLGQGLDAN--LR  147

Query  1149  QLVTMSFDFVAKEDQPLCFLQVTSFKCGGFALGTSMNHISFDGSGFKMFLENLAALSFND  970
             Q V       +  D P    QVT F+CGGF LG S+NH  FDG     F+ + + L+   
Sbjct  148   QFVYSVPGAKSVLDIPPLVAQVTRFQCGGFVLGLSLNHAIFDGIAAMEFVNSWSELA--R  205

Query  969   DGPLAVVPCNDRSLLAARSPPQVTFPHPELLKVNLPAGEEMAPPVFDSLKDDLAFEIFQL  790
               PL+V PC DRS L AR+P Q+ FPHPE L+ + P  ++ A         +L F+    
Sbjct  206   GVPLSVPPCLDRSSLRARNPLQIEFPHPEFLEADQPPSDQPAE------NSELVFKSIAF  259

Query  789   SSADIERLKDKAKAPDNVKTKVTGFNVLTAAIWRCKALSCLGGENNSDRLST----VLFA  622
                 +  LK+ A   + V  K + F   TA +WRC+ ++      +SDRLS+    +LFA
Sbjct  260   DEKKLSSLKE-AILREGVLDKCSSFEAFTALVWRCRTMA-----TSSDRLSSRQTKLLFA  313

Query  621   VDIRRRLNPPLPDSYSGNAVLTGYGSAKCAELEEGPFWKTVQMVYEGAARMTDEYARSAI  442
             VD R RL+P LP  Y GN +L         +L +G     ++++    A++ + Y RS I
Sbjct  314   VDARNRLSPALPRGYVGNGILLTCALTSVEDLLQGSLSHAIELIRAAIAKIDNAYLRSVI  373

Query  441   DWGELYKGFPHGE--FLVSSWWRLGFEGVQFPWGKPKYSCPVVYHRKDIILLFPDIDNGG  268
             D+ E  +  P  E   ++++W RL F    F WG P ++ P      ++ L  P     G
Sbjct  374   DFFEQTRLRPSLESTLVITTWSRLAFHTTDFGWGTPLFTAPASLPEAEVALFLPH----G  429

Query  267   KSNSGVNVLVALPPKEMEKFKSLFH  193
             +S  G  ++  LP ++M+ F SL  
Sbjct  430   ESRKGFELVHGLPERDMKTFVSLLE  454



>ref|XP_008235736.1| PREDICTED: omega-hydroxypalmitate O-feruloyl transferase-like 
[Prunus mume]
Length=477

 Score =   202 bits (514),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 154/486 (32%), Positives = 228/486 (47%), Gaps = 66/486 (14%)
 Frame = -3

Query  1500  VTILDSGLIFPSQETTKHTMFLSNIDKVLNFDVQTVHFF-PASPGFPPEIVAGKIKNAFR  1324
             V +++  +I P +      +FLSNID  L    +TV FF P S G      +    + FR
Sbjct  4     VKLVEKVVIAPEKPKQPRRLFLSNIDLALVVYQETVIFFDPPSNGMS---FSEAYHSLFR  60

Query  1323  RL--LVANTYDFLAGRLKKNKE-SERVEIECNAAGAGFTVASSEFALEDIGDLVYPNPAF  1153
              L  L+A  +DFLAGRL  + E S R EIECN AG     A ++  L+++G+L+ P   F
Sbjct  61    TLGPLLAE-FDFLAGRLVPSLEDSNRFEIECNGAGVVVAAARTDTKLDELGELLVPKKEF  119

Query  1152  RQLVT----------------MSFDF---------VAKEDQPL---------------CF  1093
             RQ V                 +SF           ++  DQ L               C 
Sbjct  120   RQFVAFLPQEDEEMDLKDKPLVSFQVCCYRHFTIQISPSDQSLAVKNEQKSQIGHSNVCL  179

Query  1092  L-QVTSFKCGGFALGTSMNHISFDGSGFKMFLENLAALSFNDDGPLAVVPCNDRSLLAAR  916
             L Q T   CG     +  NH + DG   + F  NLAAL+    G L + P  DR++  AR
Sbjct  180   LCQFTQLGCGSLVFASRFNHCAVDGVAVREFEANLAALT--RGGNLVIRPNADRTMFKAR  237

Query  915   SPPQVTFPHPELLKVNLPAG----EEMAPPVFDSLKDDLAFEIFQLSSADIERLKDKAKA  748
             +PP ++FPH E  K     G      M+              +  LS   I  LK KA  
Sbjct  238   NPPNISFPHFEYSKATDRTGIFTVRGMSGTNMKLSTTLNPTRLIYLSKDRIASLK-KAAL  296

Query  747   PDNVKTKVTGFNVLTAAIWRCKALSCLGGENNSDRLSTVLFAVDIRRRLNPPLPDSYSGN  568
              D      T F V+ A  W+ ++++    +   +++ST+L  V++R+R+ PP P  ++GN
Sbjct  297   KDGKLKSCTSFQVVAAMTWKARSIAV---DMPDEKISTILIPVNVRKRVVPPAPPGFAGN  353

Query  567   AVLTGYGSAKCAELEEGPFWKTVQMVYEGAARMTDEYARSAIDWGELYKGFPHGE--FLV  394
             A++  +  A   EL+E      V+ V EG  R+ DEY RS IDW E+ KG P  E  F +
Sbjct  354   ALVPAFAHATVKELKEEDDSSLVRKVQEGVERLDDEYVRSGIDWLEVNKGVPCEEDSFSL  413

Query  393   SSWWRLGFEGVQFPWGKPKYSCPVVYHRKDIILLFPDIDNGGKSNSGVNVLVALPPKEME  214
              SWW+LG E  +F WG+ K +  V+  +  +++L P    G +   G+++ + LP  +ME
Sbjct  414   VSWWKLGIEHGEFSWGQVKCTTSVLL-KPGLVMLLP----GPEGKGGLSICLELPDDQME  468

Query  213   KFKSLF  196
              F  L 
Sbjct  469   LFCRLM  474



>gb|KFK33037.1| hypothetical protein AALP_AA6G322400 [Arabis alpina]
Length=455

 Score =   202 bits (513),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 146/448 (33%), Positives = 220/448 (49%), Gaps = 35/448 (8%)
 Frame = -3

Query  1506  LKVTILDSGLIFPSQETTKHTMFLSNIDKVLNFDVQTVHFFPASPGFPPEIVAGKIKNAF  1327
             L+V   +  L+ P  ET K   FLSN+D+ +   V+T++ F +      E V   IK A 
Sbjct  29    LEVVQKEPSLVKPESETRKGLYFLSNLDQNIAVIVRTIYCFKSEEKGNEEAVQ-VIKKAL  87

Query  1326  RRLLVANTYDFLAGRLKKNKESERVEIECNAAGAGFTVASSEFALEDIGDLVYPNPAFRQ  1147
              ++LV   Y  LAGRL  + E  ++ ++C   G  F    +   + +IGD+  P+P    
Sbjct  88    SQVLVH--YYPLAGRLTISPEG-KLTVDCTGEGVVFVEGEANCKMNEIGDITKPDP--ET  142

Query  1146  LVTMSFDFVAKE---DQPLCFLQVTSFKCGGFALGTSMNHISFDGSGFKMFLENLAALSF  976
             L  + +D V  +   + P    QVT FKCGGF LG  MNH  FDG G   F+ +   ++ 
Sbjct  143   LGKLVYDVVDAKNILEIPPVTAQVTKFKCGGFVLGLCMNHCMFDGIGAMEFVNSWGQVA-  201

Query  975   NDDGPLAVVPCNDRSLLAARSPPQVTFPHPELLKVNLPAGEEMAPPVFDSL--KDDLAFE  802
                 PLA  P +DR++L AR+PP++   H E  ++   +         +SL  K+   + 
Sbjct  202   -RGLPLATPPFSDRAILNARNPPKIENLHQEFEEIEDKSN-------INSLYTKEPTLYR  253

Query  801   IFQLSSADIERLKDKA--KAPDNVKTKVTGFNVLTAAIWRC--KALSCLGGENNSDRLST  634
              F      I++LK +A   +   +    T F  L+A +WR   K+L  L     SD+ + 
Sbjct  254   SFCFDPEKIKKLKVQAIENSESLLGNTCTTFEALSAFVWRARTKSLKML-----SDQKTK  308

Query  633   VLFAVDIRRRLNPPLPDSYSGNAVLTGYGSAKCAELEEGPFWKTVQMVYEGAARMTDEYA  454
             +LFAVD R +  PPLP  Y GN ++      +  EL E P    V +V E    +TD Y 
Sbjct  309   LLFAVDGRAKFEPPLPKGYFGNGIVLTNSICEAGELIEKPLSFAVGLVREAIKMVTDGYM  368

Query  453   RSAIDWGELYKGFP--HGEFLVSSWWRLGFEGVQFPWGKPKYSCPVVYHRKDIILLFPDI  280
             RSAID+ E+ +  P      L+++W RLGF    F WG+P  S PV    K++ L     
Sbjct  369   RSAIDYFEVTRARPSLSSTLLITTWSRLGFHTTDFGWGEPVLSGPVALPEKEVTLFL---  425

Query  279   DNGGKSNSGVNVLVALPPKEMEKFKSLF  196
              + G+    +NVL+ LP   M+ F+  F
Sbjct  426   -SHGEQRRSINVLLGLPASAMDVFQEQF  452



>emb|CDY11732.1| BnaC06g13400D [Brassica napus]
Length=432

 Score =   201 bits (511),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 141/437 (32%), Positives = 216/437 (49%), Gaps = 30/437 (7%)
 Frame = -3

Query  1485  SGLIFPSQETTKHTMFLSNIDKVLNFDVQTVHFFPASPGFPPEIVAGKIKNAFRRLLVAN  1306
             + L+ P  ET K   FLSN+D+ +   V+T++ F +      E V   IK A  ++LV  
Sbjct  16    ASLVKPESETPKGLYFLSNLDQNIAVIVRTIYCFKSEERGNEEAVQ-VIKKALSQVLVH-  73

Query  1305  TYDFLAGRLKKNKESERVEIECNAAGAGFTVASSEFALEDIGDLVYPNPAFRQLVTMSFD  1126
              Y  LAGRL  + E  ++ ++C   G  F  A +   +++IGD+  P+P    L  + +D
Sbjct  74    -YYSLAGRLTISPEG-KLTVDCTEEGVVFVEAEANCEMDEIGDITKPDP--ETLGKLVYD  129

Query  1125  FVAKE---DQPLCFLQVTSFKCGGFALGTSMNHISFDGSGFKMFLENLAALSFNDDGPLA  955
              V  +   + P    QVT FKCGGF LG  MNH  FDG G   F+ +   ++      L 
Sbjct  130   VVDAKNILEVPPVTAQVTKFKCGGFVLGLCMNHCMFDGIGAMEFVNSWGQVARGLQ--LT  187

Query  954   VVPCNDRSLLAARSPPQVTFPHPELLKVNLPAGEEMAPPVFDSL--KDDLAFEIFQLSSA  781
               P +DR++L+AR+PP++   H E  ++   +         +SL  K+      F     
Sbjct  188   TPPFSDRTILSARNPPKIENLHQEFEEIEDKSN-------INSLYRKEPTLHRSFCFDPE  240

Query  780   DIERLKDKAKAPDNVKTKVTGFNVLTAAIWRCKALSCLGGENNSDRLSTVLFAVDIRRRL  601
              I++LK +A   ++     T F  L+A +WR +  S    +  SD+ + +LFAVD R + 
Sbjct  241   KIKKLKLQA-TENSESLSCTTFEALSAFVWRARTKSL---KMLSDQRTKLLFAVDGRAKF  296

Query  600   NPPLPDSYSGNAVLTGYGSAKCAELEEGPFWKTVQMVYEGAARMTDEYARSAIDWGELYK  421
              PPLP  Y GN ++      +  EL E P    V +V E    +TD Y RSAID+ E+ +
Sbjct  297   EPPLPKGYFGNGIVLTNSICEAGELTEKPLSYAVGLVREAIKMVTDGYMRSAIDYFEVTR  356

Query  420   GFP--HGEFLVSSWWRLGFEGVQFPWGKPKYSCPVVYHRKDIILLFPDIDNGGKSNSGVN  247
               P      L+++W RLGF    F WG+P  S PV    K++ L      + G+    +N
Sbjct  357   SRPSLSSTLLITTWSRLGFHTTDFGWGEPVLSGPVALPEKEVTLFL----SHGEQRRSIN  412

Query  246   VLVALPPKEMEKFKSLF  196
             VL+ LP   M+ F+  F
Sbjct  413   VLLGLPASAMDVFQEQF  429



>gb|ADL37307.1| At1g65450-like protein [Arabidopsis lyrata subsp. lyrata]
Length=170

 Score =   192 bits (489),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 98/173 (57%), Positives = 120/173 (69%), Gaps = 7/173 (4%)
 Frame = -3

Query  912  PPQVTFPHPELLKVNLPAGEEMAPPVFDSLKDDLAFEIFQLSSADIERLKDKAKAPDNVK  733
            PP VTFPH EL+K      +     VF++    L F+IF+LSS  I++LK++A    +  
Sbjct  1    PPSVTFPHHELVKFQ----DCETTTVFEATSQHLDFKIFKLSSEQIKKLKERASETSSGY  56

Query  732  TKVTGFNVLTAAIWRCKALSCLGGE---NNSDRLSTVLFAVDIRRRLNPPLPDSYSGNAV  562
             +VTGFNV+TA +WRCKALS    E    N +R ST+L+AVDIR R NP LP SY+GNAV
Sbjct  57   VRVTGFNVVTALVWRCKALSVAAEEGEXTNLERESTILYAVDIRGRXNPELPPSYTGNAV  116

Query  561  LTGYGSAKCAELEEGPFWKTVQMVYEGAARMTDEYARSAIDWGELYKGFPHGE  403
            LT Y  AKC  L E PF + V++V EGA R+TDEYARSAIDWGELYKGFPHGE
Sbjct  117  LTAYAKAKCKALLEEPFGRIVEIVGEGANRITDEYARSAIDWGELYKGFPHGE  169



>ref|XP_009140062.1| PREDICTED: omega-hydroxypalmitate O-feruloyl transferase [Brassica 
rapa]
Length=455

 Score =   201 bits (512),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 144/441 (33%), Positives = 217/441 (49%), Gaps = 35/441 (8%)
 Frame = -3

Query  1485  SGLIFPSQETTKHTMFLSNIDKVLNFDVQTVHFFPASPGFPPEIVAGKIKNAFRRLLVAN  1306
             + L+ P  ET K   FLSN+D+ +   V+T++ F +      E V   IK A  ++LV  
Sbjct  36    AALVKPESETPKGLYFLSNLDQNIAVIVRTIYCFKSEERGNEEAVQ-VIKKALSQVLVH-  93

Query  1305  TYDFLAGRLKKNKESERVEIECNAAGAGFTVASSEFALEDIGDLVYPNPAFRQLVTMSFD  1126
              Y  LAGRL  + E  ++ ++C   G  F  A +   +++IGD+  P+P    L  + +D
Sbjct  94    -YYPLAGRLTISPEG-KLTVDCTEEGVVFVEAEANCKMDEIGDITKPDP--ETLGKLVYD  149

Query  1125  FVAKE---DQPLCFLQVTSFKCGGFALGTSMNHISFDGSGFKMFLENLAALSFNDDGPLA  955
              V  +   + P    QVT FKCGGF LG  MNH  FDG G   F+ +    +     PL 
Sbjct  150   VVEAKNILEVPPVTAQVTKFKCGGFVLGLCMNHCMFDGIGAMEFVNSWGQAA--RGLPLT  207

Query  954   VVPCNDRSLLAARSPPQVTFPHPELLKVNLPAGEEMAPPVFDSL--KDDLAFEIFQLSSA  781
               P +DR++L AR+PP++   H E  ++   +         +SL  K+      F     
Sbjct  208   TPPFSDRTILTARNPPKIENLHQEFEEIEDKSN-------INSLYSKEPTLHRSFCFDPE  260

Query  780   DIERLKDKA--KAPDNVKTKVTGFNVLTAAIWRC--KALSCLGGENNSDRLSTVLFAVDI  613
              I++LK +A   +   +    T F  L+A +WR   K+L  L     +D+ + +LFAVD 
Sbjct  261   KIKKLKLQATENSESLLGNSCTTFEALSAFVWRARTKSLKML-----NDQKTKLLFAVDG  315

Query  612   RRRLNPPLPDSYSGNAVLTGYGSAKCAELEEGPFWKTVQMVYEGAARMTDEYARSAIDWG  433
             R +  PPLP  Y GN ++      +  EL E P    V +V E    +TD Y RSAID+ 
Sbjct  316   RAKFEPPLPKGYFGNGIVLTNSICEAGELTEKPLSFAVGLVREAIKMVTDGYMRSAIDYF  375

Query  432   ELYKGFP--HGEFLVSSWWRLGFEGVQFPWGKPKYSCPVVYHRKDIILLFPDIDNGGKSN  259
             E+ +  P      L+++W RLGF    F WG+P  S PV    K++ L      + G+  
Sbjct  376   EVTRARPSLSSTLLITTWSRLGFHTTDFGWGEPVLSGPVALPEKEVTLFL----SHGEER  431

Query  258   SGVNVLVALPPKEMEKFKSLF  196
               +NVL+ LP   M+ F+ LF
Sbjct  432   RSINVLLGLPASAMDVFQELF  452



>gb|EYU24113.1| hypothetical protein MIMGU_mgv1a019465mg, partial [Erythranthe 
guttata]
Length=182

 Score =   193 bits (490),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 93/172 (54%), Positives = 127/172 (74%), Gaps = 4/172 (2%)
 Frame = -3

Query  1512  EDLKVTILDSGLIFPSQETTKHTMFLSNIDKVLNFDVQTVHFFPASPGFPPEIVAGKIKN  1333
             +DL+V   +  L+ PS++T + +MFLSNID++ N++  T HFF A+P FPP+IV  ++K 
Sbjct  11    QDLRVIFHEKVLVSPSEKTERKSMFLSNIDQMHNYNAHTAHFFTANPDFPPKIVTERLKM  70

Query  1332  AFRRLLVANTYDFLAGRLKKNKESERVEIECNAAGAGFTVASSEFALEDIG-DLVYPNPA  1156
             A  ++L   TYDF AGRL+ N+ES R+EIEC+ AGAGF  ASSE++L D+G DLV+ NP 
Sbjct  71    ALEKVLA--TYDFAAGRLRTNQESGRLEIECDGAGAGFVAASSEYSLCDLGDDLVFSNPG  128

Query  1155  FRQLVTMSFDFVAKEDQPLCFLQVTSFKCGGFALGTSMNHISFDGSGFKMFL  1000
             FRQL  + FD + ++DQPL  LQVTSFKCGGFA+GT+MNH   DG+G +  L
Sbjct  129   FRQLSVL-FDILPRDDQPLLILQVTSFKCGGFAIGTAMNHTLVDGAGAQKLL  179



>ref|XP_003522443.2| PREDICTED: omega-hydroxypalmitate O-feruloyl transferase-like 
[Glycine max]
Length=431

 Score =   201 bits (510),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 139/430 (32%), Positives = 222/430 (52%), Gaps = 22/430 (5%)
 Frame = -3

Query  1476  IFPSQETTKHTMFLSNIDKVLNFDVQTVHFFPASPGFPPEIVAGKIKNAFRRLLVANTYD  1297
             + P++ET K   FLSN+D+ +   V+TV+ F  S     E  A  IK +  ++LV   Y 
Sbjct  17    VLPAEETEKGLYFLSNLDQNIAVPVRTVYCF-KSGSRGNEDAAQVIKESLSKILVP--YY  73

Query  1296  FLAGRLKKNKESERVEIECNAAGAGFTVASSEFALEDIGDLVYPNP-AFRQLVTMSFDFV  1120
              +AG L+ + E E++ ++    GA F  A ++F +E+IGDL  P+P A  +LV       
Sbjct  74    PMAGTLRISSE-EKLIVDNPGEGAVFVEAEADFDIEEIGDLTKPDPDALGKLVYYVPGAP  132

Query  1119  AKEDQPLCFLQVTSFKCGGFALGTSMNHISFDGSGFKMFLENLAALSFNDDGPLAVVPCN  940
             +  + PL  +QVT FKCGGF LG  M H   DG     F+   + ++   +  L   P  
Sbjct  133   SILEMPLMTVQVTKFKCGGFTLGLCMIHCMKDGLCAMEFVNAWSQIARGLN--LKTPPFL  190

Query  939   DRSLLAARSPPQVTFPHPELLKVNLPAGEEMAPPVFDSLKDDLAFEIFQLSSADIERLKD  760
             DR+++ AR PP++ F H E  ++     E+++       ++++ +  F   +  ++ LK 
Sbjct  191   DRTIIKARDPPKIEFQHTEFAEI-----EDISNTKKLYEEENMLYRSFCFDTEKLDMLKK  245

Query  759   KAKAPDNVKTKVTGFNVLTAAIWRCKALSCLGGENNSDRLSTVLFAVDIRRRLNPPLPDS  580
             KA   D V  K + F  L+  +WR +  + LG +   D+ + +LFAVD R+R  PP+P  
Sbjct  246   KA-TEDGVLEKCSTFEALSGFVWRART-AALGMQ--PDQQTKLLFAVDGRKRFVPPIPKG  301

Query  579   YSGNAVLTGYGSAKCAELEEGPFWKTVQMVYEGAARMTDEYARSAIDWGELYKGFPH--G  406
             Y GNA++         EL + P   +V ++ E    +TD Y RSAID+ E+ +  P    
Sbjct  302   YFGNAIVLTNSLCNAGELLKNPLSFSVGLIREAIDMVTDSYMRSAIDYFEVTRARPSLTA  361

Query  405   EFLVSSWWRLGFEGVQFPWGKPKYSCPVVYHRKDIILLFPDIDNGGKSNSGVNVLVALPP  226
               L+++W +L F    F WG+P  S PV    K++IL      + G+    VNVL+ LP 
Sbjct  362   TLLITTWTKLSFHTADFGWGEPLCSGPVTLPEKEVILFL----SHGQERKSVNVLLGLPS  417

Query  225   KEMEKFKSLF  196
               M  F++L 
Sbjct  418   SAMVIFEALM  427



>ref|XP_008672444.1| PREDICTED: uncharacterized protein LOC100273498 isoform X1 [Zea 
mays]
 tpg|DAA56669.1| TPA: hypothetical protein ZEAMMB73_966134 [Zea mays]
Length=446

 Score =   201 bits (511),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 153/443 (35%), Positives = 210/443 (47%), Gaps = 39/443 (9%)
 Frame = -3

Query  1479  LIFPSQET-TKHTMFLSNIDKVLNFDVQTVHFFPASPGFPPEIVAGKIKNAFRRLL--VA  1309
             L+ P++ T T    +LSN+D+ +   VQTV+ +  S G       G +  A R  L  V 
Sbjct  31    LVPPAEATPTGGQYYLSNLDQNIAVIVQTVYCYKPSGG------GGDVAAALRGALARVL  84

Query  1308  NTYDFLAGRLKKNKESERVEIECNAAGAGFTVASSEFALEDIGDLVYPNPA-FRQLVTMS  1132
               Y  LAGRL  + E  ++ +E    GA F  A +   L  +GDL  P+PA   QLV   
Sbjct  85    VHYYPLAGRLGVSPEM-KLTVELTGEGAVFVEADAACELATVGDLTKPDPAALGQLVYSV  143

Query  1131  FDFVAKEDQPLCFLQVTSFKCGGFALGTSMNHISFDGSGFKMFLENLAALSFNDDGPLAV  952
                    + P    QVT FKCGGFALG +MNH  FDG G   F+ + A  +      L V
Sbjct  144   PGAKHILEMPPMTAQVTRFKCGGFALGLAMNHCMFDGIGAMEFVNSWAETA-RGVAELTV  202

Query  951   VPCNDRSLLAARSPPQVTFPHPELLKVNLPAGEEMAPPVFDSLK----DDLAFEIFQLSS  784
              P  DR +L AR PP  TFPH E  ++         P V D+       +L +  F    
Sbjct  203   PPFLDRGVLKARDPPVHTFPHHEFAEI---------PDVSDTAALYGAQELQYRSFCFDP  253

Query  783   ADIERLKDKAKAPDNVKTKVTGFNVLTAAIWRC--KALSCLGGENNSDRLSTVLFAVDIR  610
               +ER++  A A D    + T F  L+  +WR   KAL    G+      + +LFAVD R
Sbjct  254   DRLERVRGLALA-DGALGRCTTFEALSGLVWRARTKALGLAPGQR-----TKLLFAVDGR  307

Query  609   RRLNPPLPDSYSGNAVLTGYGSAKCAELEEGPFWKTVQMVYEGAARMTDEYARSAIDWGE  430
             RR  PPLP  Y GN ++     A   EL   P  +   +V E    +TD+Y RSA+D+ E
Sbjct  308   RRFVPPLPRGYFGNGIVLTNALATAGELLSAPVSRAAGLVQEAVRMVTDDYMRSAVDYFE  367

Query  429   LYKGFPH--GEFLVSSWWRLGFEGVQFPWGKPKYSCPVVYHRKDIILLFPDIDNGGKSNS  256
               +  P      L+++W RL F G  F WG+P  S PV    K++IL        GK   
Sbjct  368   ATRARPSLASTLLITTWSRLEFHGADFGWGEPVMSGPVTLPEKEVILFLAH----GKERK  423

Query  255   GVNVLVALPPKEMEKFKSLFHKF  187
              +NVL+ LP   M+ F+ L  + 
Sbjct  424   SINVLLGLPATAMDAFQELVDEI  446



>ref|XP_010436043.1| PREDICTED: omega-hydroxypalmitate O-feruloyl transferase-like 
[Camelina sativa]
Length=487

 Score =   202 bits (513),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 144/448 (32%), Positives = 222/448 (50%), Gaps = 35/448 (8%)
 Frame = -3

Query  1506  LKVTILDSGLIFPSQETTKHTMFLSNIDKVLNFDVQTVHFFPASPGFPPEIVAGKIKNAF  1327
             L+V   +  L+ P  ET K   FLSN+D+ +   V+T++ F ++     E V   IK A 
Sbjct  61    LEVHQKEPALVKPESETRKGLYFLSNLDQNIAVIVRTIYCFKSAERGNEEAVQ-VIKKAL  119

Query  1326  RRLLVANTYDFLAGRLKKNKESERVEIECNAAGAGFTVASSEFALEDIGDLVYPNPAFRQ  1147
              ++L  + Y  LAGRL  + E  ++ ++C   G  F  A +   +++IGD+  P+P    
Sbjct  120   SQVL--DHYYPLAGRLTISPEG-KLTVDCTGEGVVFVEAEANCKMDEIGDITKPDP--ET  174

Query  1146  LVTMSFDFVAKE---DQPLCFLQVTSFKCGGFALGTSMNHISFDGSGFKMFLENLAALSF  976
             L  + +D V  +   + P    QVT FKCGGF LG  MNH  FDG G   F+ +   ++ 
Sbjct  175   LGKLVYDVVDAKNILEIPPVTAQVTKFKCGGFVLGLCMNHCMFDGIGAMEFVNSWGQVA-  233

Query  975   NDDGPLAVVPCNDRSLLAARSPPQVTFPHPELLKVNLPAGEEMAPPVFDSL--KDDLAFE  802
                 PL   P +DR++L+AR+PP++   H E  ++   +         +SL  K+   + 
Sbjct  234   -RGLPLTTPPFSDRTILSARNPPKIENLHQEFEEIEDKSN-------INSLYTKEPTLYR  285

Query  801   IFQLSSADIERLKDKA--KAPDNVKTKVTGFNVLTAAIWRC--KALSCLGGENNSDRLST  634
              F      I++LK +A   +   +    T F  L+A +WR   K+L  L     SD+ + 
Sbjct  286   SFCFDPEKIKKLKIQATENSESLLGNSCTSFEALSAFVWRARTKSLKML-----SDQKTK  340

Query  633   VLFAVDIRRRLNPPLPDSYSGNAVLTGYGSAKCAELEEGPFWKTVQMVYEGAARMTDEYA  454
             +LFAVD R +  P LP  Y GN ++      +  EL E P    V +V E    +TD Y 
Sbjct  341   LLFAVDGRAKFEPQLPKGYFGNGIVLTNSICEAGELTEKPLSFAVGLVREAIKMVTDRYM  400

Query  453   RSAIDWGELYKGFP--HGEFLVSSWWRLGFEGVQFPWGKPKYSCPVVYHRKDIILLFPDI  280
             RSAID+ E+ +  P      L+++W RLGF    F WG+P  S PV    K++ L     
Sbjct  401   RSAIDYFEVTRARPSLSSTLLITTWSRLGFHTTDFGWGEPVLSGPVALPEKEVTLFL---  457

Query  279   DNGGKSNSGVNVLVALPPKEMEKFKSLF  196
              + G+    +NVL+ LP   M+ F+  F
Sbjct  458   -SHGEQRRSINVLLGLPASAMDVFQEQF  484



>dbj|BAJ90980.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=447

 Score =   201 bits (510),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 148/435 (34%), Positives = 215/435 (49%), Gaps = 21/435 (5%)
 Frame = -3

Query  1479  LIFPSQET-TKHTMFLSNIDKVLNFDVQTVHFFPASPGFPPEIVAGKIKNAFRRLLVANT  1303
             L+ P + T      +LSN+D+ +   VQTV+ F    G   E  A  ++ A  R+LV   
Sbjct  30    LVSPVEATPIGEQYYLSNLDQNIAVIVQTVYCFKCPSGRGNERAADALRAALARVLV--H  87

Query  1302  YDFLAGRLKKNKESERVEIECNAAGAGFTVASSEFALEDIGDLVYPNPA-FRQLVTMSFD  1126
             Y  LAGRL  + E  ++ +EC   G  F  A +   L  +GDL  P+PA   QLV     
Sbjct  88    YHPLAGRLGISPEM-KLTVECTGEGVPFVEAEAACDLALVGDLSTPDPAALGQLVYSVPG  146

Query  1125  FVAKEDQPLCFLQVTSFKCGGFALGTSMNHISFDGSGFKMFLENLAALSFNDDGPLAVVP  946
                  + P    QVT FKCGGF+LG  MNH  FDG G   F+ + A ++      L V P
Sbjct  147   AKNILEMPPMTAQVTRFKCGGFSLGLGMNHCMFDGLGAMEFVNSWAEMA-RGATELTVPP  205

Query  945   CNDRSLLAARSPPQVTFPHPELLKVNLPAGEEMAPPVFDSLKDDLAFEIFQLSSADIERL  766
               DR++L AR PP ++FPH E  ++   +  EMA  ++     +L +  F      +ER+
Sbjct  206   FLDRAVLRARDPPVISFPHHEFEEIADVS--EMAA-LYGG--QELVYRSFCFDPDRLERV  260

Query  765   KDKAKAPDNVKTKVTGFNVLTAAIWRCKALSCLGGENNSDRLSTVLFAVDIRRRLNPPLP  586
             +  A A  +++ + T F  L+  +WR +    LG     ++ + +LFAVD RRR  PPLP
Sbjct  261   RGLALADGDLE-RCTTFEALSGLVWRART-RALG--LAPEQQTKLLFAVDGRRRFVPPLP  316

Query  585   DSYSGNAVLTGYGSAKCAELEEGPFWKTVQMVYEGAARMTDEYARSAIDWGELYKGFPH-  409
               Y GN ++     A   +L   P  +    V E    +TDEY RSA+D+ E  +  P  
Sbjct  317   KGYFGNGIVLTNALATAGDLLSAPVSRAAGKVQEAVRMVTDEYMRSAVDYFEATRARPSL  376

Query  408   -GEFLVSSWWRLGFEGVQFPWGKPKYSCPVVYHRKDIILLFPDIDNGGKSNSGVNVLVAL  232
                 L+++W RL F G  F WG+P  S PV    K++IL        GK    +NVL+ L
Sbjct  377   ASTLLITTWSRLAFNGADFGWGEPAMSGPVTLPEKEVILFLAH----GKERKSINVLLGL  432

Query  231   PPKEMEKFKSLFHKF  187
             P   M+ F+ L  + 
Sbjct  433   PASAMDAFQELMDEI  447



>gb|EAY81037.1| hypothetical protein OsI_36216 [Oryza sativa Indica Group]
Length=460

 Score =   201 bits (510),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 150/446 (34%), Positives = 213/446 (48%), Gaps = 36/446 (8%)
 Frame = -3

Query  1479  LIFPSQET-TKHTMFLSNIDKVLNFDVQTVHFF----PASPGFPPEIVAGKIKNAFRRLL  1315
             L+ P++ T T    +LSN+D+ +   VQTV+ +     AS G     VA  +++A  ++L
Sbjct  36    LVAPAEATPTGEKYYLSNLDQNIAVIVQTVYCYKPRAAASGGENGNAVA-VLRDALAKVL  94

Query  1314  VANTYDFLAGRLKKNKESERVEIECNAAGAGFTVASSEFALEDIGDLVYPNPAFRQLVTM  1135
             V   Y  LAGRL  + E  ++ +E    GA F  A +   L D+GDL  P+PA    +  
Sbjct  95    V--HYHPLAGRLTISAEM-KLAVELTGEGAVFVAADAGCDLADVGDLTKPDPAALGHLVY  151

Query  1134  SFDFVAK-EDQPLCFLQVTSFKCGGFALGTSMNHISFDGSGFKMFLENLAALSFNDDGPL  958
             S        + P    QVT FKCGGFALG +MNH  FDG G   F+ + A  +      L
Sbjct  152   SIPGAKNILEMPPMTAQVTRFKCGGFALGLAMNHCMFDGLGAMEFVNSWAETA-RGAAEL  210

Query  957   AVVPCNDRSLLAARSPPQVTFPHPELLKVNLPAGEEMAPPVFDSLK----DDLAFEIFQL  790
              V P  DR+LL AR PP ++F H E          E  P V D+       +L +  F  
Sbjct  211   TVPPFLDRTLLRARDPPVISFEHHEF---------EEIPDVSDTAALYADQELLYRSFCF  261

Query  789   SSADIERLKDKAKA---PDNVKTKVTGFNVLTAAIWRCKALSCLGGENNSDRLSTVLFAV  619
                 +ER++  A A    D V  + T F  L+  +WR +    LG     ++ + +LFAV
Sbjct  262   DPDRLERVRALALAGAGDDLVGGRCTTFEALSGLVWRART-RALG--LAPEQRTKLLFAV  318

Query  618   DIRRRLNPPLPDSYSGNAVLTGYGSAKCAELEEGPFWKTVQMVYEGAARMTDEYARSAID  439
             D RRR  PPLP  Y GN ++     A   EL   P  +   +V      +TD Y RSA+D
Sbjct  319   DGRRRFEPPLPRGYFGNGIVLTNAVATAGELLSSPPSRAAGLVQAAVRMVTDGYMRSAVD  378

Query  438   WGELYKGFPH--GEFLVSSWWRLGFEGVQFPWGKPKYSCPVVYHRKDIILLFPDIDNGGK  265
             + E  +  P      L+++W RL F G  F WG P  S PV    K++IL        G+
Sbjct  379   YFEETRARPSLASTLLITTWSRLAFHGADFGWGAPAMSGPVTLPEKEVILFLAH----GE  434

Query  264   SNSGVNVLVALPPKEMEKFKSLFHKF  187
                 +NVL+ LP   M+ F+ L  + 
Sbjct  435   ERKSINVLLGLPVSAMDAFQELMDEI  460



>ref|XP_002870657.1| transferase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH46916.1| transferase family protein [Arabidopsis lyrata subsp. lyrata]
Length=438

 Score =   200 bits (509),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 143/446 (32%), Positives = 220/446 (49%), Gaps = 31/446 (7%)
 Frame = -3

Query  1506  LKVTILDSGLIFPSQETTKHTMFLSNIDKVLNFDVQTVHFFPASPGFPPEIVAGKIKNAF  1327
             L+V   +  L+ P  ET K   FLSN+D+ +   V+T++ F +      E V   IK A 
Sbjct  12    LEVHQKEPALVKPESETRKGLYFLSNLDQNIAVIVRTIYCFKSEERGNEEAVQ-VIKKAL  70

Query  1326  RRLLVANTYDFLAGRLKKNKESERVEIECNAAGAGFTVASSEFALEDIGDLVYPNPAFRQ  1147
              ++LV   Y  LAGRL  + E  ++ ++C   G  F  A +   +++IGD+  P+P    
Sbjct  71    SQVLVH--YYPLAGRLTISPEG-KLTVDCTEEGVVFVEAEANCKMDEIGDITKPDP--ET  125

Query  1146  LVTMSFDFVAKE---DQPLCFLQVTSFKCGGFALGTSMNHISFDGSGFKMFLENLAALSF  976
             L  + +D V  +   + P    QVT FKCGGF LG  MNH  FDG G   F+ +   ++ 
Sbjct  126   LGKLVYDVVDAKNILEIPPVTAQVTKFKCGGFVLGLCMNHCMFDGIGAMEFVNSWGQVA-  184

Query  975   NDDGPLAVVPCNDRSLLAARSPPQVTFPHPELLKVNLPAGEEMAPPVFDSL--KDDLAFE  802
                 PL   P +DR++L+AR+PP++   H E  ++   +         +SL  K+   + 
Sbjct  185   -RGLPLTTPPFSDRTILSARNPPKIENLHQEFEEIEDKSN-------INSLYTKEPTLYR  236

Query  801   IFQLSSADIERLKDKA--KAPDNVKTKVTGFNVLTAAIWRCKALSCLGGENNSDRLSTVL  628
              F      I++LK +A   +   +    T F  L+A +WR +  S    +  SD+ + +L
Sbjct  237   SFCFDPEKIKKLKHQATENSESLLGNSCTSFEALSAFVWRARTKSL---KMLSDQKTKLL  293

Query  627   FAVDIRRRLNPPLPDSYSGNAVLTGYGSAKCAELEEGPFWKTVQMVYEGAARMTDEYARS  448
             FAVD R +  P LP  Y GN ++      +  EL E P    V +V E    +TD Y RS
Sbjct  294   FAVDGRAKFEPQLPKGYFGNGIVLTNSICETGELIEKPLSFAVGLVREAIKMVTDGYMRS  353

Query  447   AIDWGELYKGFP--HGEFLVSSWWRLGFEGVQFPWGKPKYSCPVVYHRKDIILLFPDIDN  274
             AID+ E+ +  P      L+++W RLGF    F WG+P  S PV    K++ L      +
Sbjct  354   AIDYFEVTRARPSLSSTLLITTWSRLGFHTTDFGWGEPILSGPVALPEKEVTLFL----S  409

Query  273   GGKSNSGVNVLVALPPKEMEKFKSLF  196
              G+    +NVL+ LP   M+ F+  F
Sbjct  410   HGEQRRSINVLLGLPVSAMDVFQEQF  435



>gb|EMT29891.1| Taxadien-5-alpha-ol O-acetyltransferase [Aegilops tauschii]
Length=447

 Score =   200 bits (509),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 149/435 (34%), Positives = 218/435 (50%), Gaps = 21/435 (5%)
 Frame = -3

Query  1479  LIFPSQET-TKHTMFLSNIDKVLNFDVQTVHFFPASPGFPPEIVAGKIKNAFRRLLVANT  1303
             L+ P++ T T    +LSN+D+ +   VQTV+ F    G   E  A  ++ A  R+LV   
Sbjct  30    LVSPAEATPTGEQYYLSNLDQNIAVIVQTVYCFKCPSGRGNEGAADALRAALARVLV--H  87

Query  1302  YDFLAGRLKKNKESERVEIECNAAGAGFTVASSEFALEDIGDLVYPNPA-FRQLVTMSFD  1126
             Y  LAGRL  + E + + +EC   G  F  A +   L  IGDL  P+PA   QLV     
Sbjct  88    YHPLAGRLGISPEMKLI-VECTGEGVPFMEAEAACDLALIGDLSTPDPAALGQLVYSVPG  146

Query  1125  FVAKEDQPLCFLQVTSFKCGGFALGTSMNHISFDGSGFKMFLENLAALSFNDDGPLAVVP  946
                  + P    QVT F+CGGF+LG +MNH  FDG G   F+ + A ++      L V P
Sbjct  147   AKNILEMPPMTAQVTRFECGGFSLGLAMNHCMFDGLGAMEFVNSWAEMA-RGATELTVPP  205

Query  945   CNDRSLLAARSPPQVTFPHPELLKVNLPAGEEMAPPVFDSLKDDLAFEIFQLSSADIERL  766
               DRS+L AR+PP ++ PH E  ++   +  EMA  ++     +L +  F      +ER+
Sbjct  206   FLDRSVLRARNPPVISNPHHEFEEIADVS--EMAA-LYGG--QELVYRSFCFDPDRLERV  260

Query  765   KDKAKAPDNVKTKVTGFNVLTAAIWRCKALSCLGGENNSDRLSTVLFAVDIRRRLNPPLP  586
             +  A A  +++ + T F  L+  +WR +    LG     ++ + +LFAVD RRR  PPLP
Sbjct  261   RGLALADGDLE-RCTTFEALSGLVWRART-RALG--LAPEQQTKLLFAVDGRRRFVPPLP  316

Query  585   DSYSGNAVLTGYGSAKCAELEEGPFWKTVQMVYEGAARMTDEYARSAIDWGELYKGFPH-  409
               Y GN ++     A   +L   P  +    V E    +TDEY RSA+D+ E  +  P  
Sbjct  317   KGYFGNGIVLTNALATAGDLLSAPVSRAAGKVQEAVRMVTDEYMRSAVDYFEATRARPSL  376

Query  408   -GEFLVSSWWRLGFEGVQFPWGKPKYSCPVVYHRKDIILLFPDIDNGGKSNSGVNVLVAL  232
                 L+++W RL F G  F WG+P  S PV    K++IL        GK    +NVL+ L
Sbjct  377   ASTLLITTWSRLAFNGADFGWGEPTMSGPVTLPEKEVILFLAH----GKERKSINVLLGL  432

Query  231   PPKEMEKFKSLFHKF  187
             P   M+ F+ L  + 
Sbjct  433   PASAMDTFQELMDEI  447



>gb|KEH21938.1| omega-hydroxypalmitate O-feruloyl transferase [Medicago truncatula]
Length=437

 Score =   200 bits (508),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 147/440 (33%), Positives = 220/440 (50%), Gaps = 31/440 (7%)
 Frame = -3

Query  1488  DSGLIFPSQETTKHTMFLSNIDKVLNFDVQTVHFFPASPGFPPEIVAGKIKNAFRRLLVA  1309
             +  L+ PS+ET K   FLSN+D+ +   V+TV+ F        E     IK+A + +LV 
Sbjct  20    EPALVPPSEETKKGMYFLSNLDQNIAVIVRTVYCFKNQEK-GNENACEVIKDALKNVLVH  78

Query  1308  NTYDFLAGRLKKNKESERVEIECNAAGAGFTVASSEFALEDIGDLVYPNPAFRQLVTMSF  1129
               Y  LAGRL  + E + + ++C   GA F  A +  ++E+IGD+  P+P  R L  + +
Sbjct  79    --YYPLAGRLSISSEGKLI-VDCTGEGALFVEAEANCSMEEIGDITKPDP--RTLGMLVY  133

Query  1128  DFV-AKE--DQPLCFLQVTSFKCGGFALGTSMNHISFDGSGFKMFLENLAALSFNDDGPL  958
             D   AK     P    Q+T FKCGGF+LG  MNH  FDG G   F+ +   L+     PL
Sbjct  134   DIPDAKHILQMPPLVAQLTKFKCGGFSLGLCMNHCMFDGIGAMEFVNSWGELA--RGLPL  191

Query  957   AVVPCNDRSLLAARSPPQVTFPHPELLKVNLPAGEEMAPPVFDSLKDDLAFEIFQLSSAD  778
             +V P  DRS+L  R+PP++   H E   +   +            +D++ +  F      
Sbjct  192   SVPPVLDRSILKVRNPPKIEHLHQEFADIEDKSNTSTL------YEDEMVYRSFCFDPEK  245

Query  777   IERLKDKAKAPDN-VKTKVTGFNVLTAAIW--RCKALSCLGGENNSDRLSTVLFAVDIRR  607
             ++ LK KA   +  V    T F VL+A +W  R KAL  L      ++ + +LFAVD R 
Sbjct  246   LKELKKKALEDEGGVLESCTTFEVLSAFVWIARTKALKML-----PEQETKLLFAVDGRA  300

Query  606   RLNPPLPDSYSGNAVLTGYGSAKCAELEEGPFWKTVQMVYEGAARMTDEYARSAIDWGEL  427
             +  P LP  Y GN ++      K  E+   PF  TV+++ +    +TD Y RSAID+ E+
Sbjct  301   KFEPKLPKGYFGNGIILTNAVCKAGEITNKPFSYTVKVIQDAIKMVTDSYMRSAIDYFEV  360

Query  426   YKGFPH--GEFLVSSWWRLGFEGVQFPWGKPKYSCPVVYHRKDIILLFPDIDNGGKSNSG  253
              +  P      L+++W RL F    F WG+P  S PV    K++IL      + G+    
Sbjct  361   TRARPSLACTLLITTWSRLPFHTTDFGWGEPVLSGPVSLPEKEVILFL----SHGQERRS  416

Query  252   VNVLVALPPKEMEKFKSLFH  193
             +NVL+ LP   M+ F+ L  
Sbjct  417   INVLLGLPAPVMKIFQDLMQ  436



>ref|XP_007216058.1| hypothetical protein PRUPE_ppa017691mg [Prunus persica]
 gb|EMJ17257.1| hypothetical protein PRUPE_ppa017691mg [Prunus persica]
Length=443

 Score =   200 bits (508),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 146/461 (32%), Positives = 229/461 (50%), Gaps = 39/461 (8%)
 Frame = -3

Query  1518  LHEDLKVTILDSGLIFPSQETT-KHTMFLSNIDKVLN-FDVQTVHFFPASPGFPPEIVAG  1345
             + E + V+I +S ++ P++E+T + +++LSN D     F   +V+F+ +S G       G
Sbjct  1     MAEKVMVSIRESTMVRPAEESTPRGSLWLSNSDLAFPPFHTSSVYFYKSS-GEHNFFDKG  59

Query  1344  KIKNAFRRLLVANTYDFLAGRLKKNKESERVEIECNAAGAGFTVASSEFALEDIGDLVYP  1165
              +K A  + LV   +  +AGR K N ++ RVEI+CNA G  F VA S  A++D GD   P
Sbjct  60    VLKQALGKALVP--FYPMAGRFKLNDQNGRVEIDCNAEGVVFVVAESSSAVDDFGDFA-P  116

Query  1164  NPAFRQLVTMSFDFVAK-EDQPLCFLQVTSFKCGGFALGTSMNHISFDGSGFKMFLENLA  988
              P F  L+  + D+       P+  LQ+T FKCGG +LG  M+H   DG     F+   +
Sbjct  117   TPDFLTLIP-TIDYSGGISSYPILALQITYFKCGGVSLGVGMDHRVADGVSGLHFVNAWS  175

Query  987   ALSFNDDGPLAVVPCNDRSLLAARSPPQVTFPHPELLKVNLPAGEEMAPPVFDSLKD--D  814
              ++  D   +   P  DR+LL AR PPQ  FPH     +      +M P   D+LK   +
Sbjct  176   DIARGDLSNIKP-PFMDRTLLRARDPPQPAFPH-----IEYQPSPQMKPS--DNLKSTSN  227

Query  813   LAFEIFQLSSADIERLKDKAK--APDNVKT-KVTGFNVLTAAIWRCKALSCLGGENNSDR  643
             +   IF+L+   +  LKDK+K    +N+ T   + F +L   IWRC   +C   +   D+
Sbjct  228   ITTSIFKLTRKQLNILKDKSKKDGGNNINTINYSSFEMLAGHIWRC---ACKARKLPDDQ  284

Query  642   LSTVLFAVDIRRRLNPPLPDSYSGNAVLTGYGSAKCAELEEGPFWKTVQMVYEGAARMTD  463
              + +L A D R RL PPLP  + GNAV      A   +L+  P W     V++   RM D
Sbjct  285   DTKLLIATDARSRLQPPLPPYFFGNAVFRTTPIAVAGDLQSKPTWYATSFVHDALVRMDD  344

Query  462   EYARSAIDWGELYK--------GFPH---GEFLVSSWWRLGFEGVQFPWGKPKYSCPVVY  316
             +Y RS +D+ EL+         G P        ++SW R+      F WG+P +  P   
Sbjct  345   DYFRSVLDYLELHHPCLSELITGPPSICCPNLRINSWARMPIHDADFGWGRPIFMGPGAI  404

Query  315   HRKDIILLFPDIDNGGKSNSGVNVLVALPPKEMEKFKSLFH  193
                 +  L P   N G     ++++++L  ++M+ F +L +
Sbjct  405   PFDGMSFLLPSATNDGS----LSLVISLKSEDMKSFSTLLY  441



>ref|XP_009405177.1| PREDICTED: omega-hydroxypalmitate O-feruloyl transferase-like, 
partial [Musa acuminata subsp. malaccensis]
Length=471

 Score =   200 bits (509),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 151/485 (31%), Positives = 225/485 (46%), Gaps = 50/485 (10%)
 Frame = -3

Query  1560  FTAIMGALYLKPETLHEDLKVTILDSGLIFPSQETTKHTMFLSNIDKVLNFDVQTVHFFP  1381
             F  + G    +P    E L V   +  L+ P +ET K   FLSN+D+ +   V+TV+ F 
Sbjct  7     FVCVCGGQIPEPREKFE-LCVEQGEPTLVPPEEETAKGLYFLSNLDQNIAVIVRTVYCFR  65

Query  1380  ASPGFPPEIVAGKIKNAFRRLLVANTYDFLAGRLKKNKESERVEIECNAAGAGFTVASSE  1201
             +      E  A  IK A  ++LV   Y  LAGRL  + E + + ++C   GA F  A ++
Sbjct  66    SQEKGNEE-AAQVIKAALAKVLVH--YYPLAGRLAISDEGKLI-VDCTGEGAVFVKAEAD  121

Query  1200  FALEDIGDLVYPNP-----------AFRQLVTMSFDFV-AKEDQPL-------------C  1096
               +ED+GD+  PNP               L+ M    V  +   P              C
Sbjct  122   CEMEDVGDITKPNPDTLGKLVYTILGANNLLEMPPLVVQVRNSHPCSLFRSYNHRKLIAC  181

Query  1095  FLQVTSFKCGGFALGTSMNHISFDGSGFKMFLENLAALSFNDDGPLAVVPCNDRSLLAAR  916
             FLQVT+F+ GGF LG ++NH  FDG G   F+ +    +     P++V P  DR++L +R
Sbjct  182   FLQVTTFRSGGFILGLAVNHCMFDGLGAMEFVNSWGETARGL--PISVPPFVDRTVLESR  239

Query  915   SPPQVTFPHPELLKVNLPAGEEMAPPVFDSLKDDLAFEIFQLSSADIERLKDKAKAPDNV  736
             +PP V+FPH E  ++      E          +++A+  F      + R+K +A   D  
Sbjct  240   NPPLVSFPHHEFAEI------EDVSDTTALYGEEMAYRSFCFEPEKLGRVKRRA-LEDGA  292

Query  735   KTKVTGFNVLTAAIWRCK--ALSCLGGENNSDRLSTVLFAVDIRRRLNPPLPDSYSGNAV  562
               K T F  L+  +WR +  AL    G+      + +LFAVD R R +PPLP  Y GN  
Sbjct  293   LAKCTTFEALSGHVWRARTEALRLQPGQK-----TKLLFAVDGRSRFDPPLPQGYFGNGT  347

Query  561   LTGYGSAKCAELEEGPFWKTVQMVYEGAARMTDEYARSAIDWGELYKGFPH--GEFLVSS  388
             +     +   EL   P    V +V +    +TDEY RSA+D+ E  +  P      L+++
Sbjct  348   MLTGCLSTAGELLGRPLSFAVGLVQDAVKTVTDEYMRSAMDYFEATRARPSLTATLLITT  407

Query  387   WWRLGFEGVQFPWGKPKYSCPVVYHRKDIILLFPDIDNGGKSNSGVNVLVALPPKEMEKF  208
             W RL F    F WG+P  S PV    K++IL         +   G+NVL+ LP   M + 
Sbjct  408   WSRLSFHTTDFGWGEPVQSGPVTLPEKEVILFLS--HGKERKRKGINVLLGLPSSAMARL  465

Query  207   KSLFH  193
             + L  
Sbjct  466   QDLME  470



>ref|NP_001141054.1| uncharacterized protein LOC100273135 [Zea mays]
 gb|ACF85295.1| unknown [Zea mays]
Length=437

 Score =   199 bits (507),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 147/443 (33%), Positives = 215/443 (49%), Gaps = 26/443 (6%)
 Frame = -3

Query  1488  DSGLIFPSQETTKHTMFLSNIDKVLNFDVQTVHFFPASPGFPPEIVAG--KIKNAFRRLL  1315
             +  L+ P++ET     +LSN+D+ +   VQTV+ F A+ G     V+    ++ +  ++L
Sbjct  13    EPSLVTPAEETPGGLYYLSNLDQNIAVIVQTVYCFRAADGGAGGGVSACDVLRESLAKVL  72

Query  1314  VANTYDFLAGRLKKNKESERVEIECNAAGAGFTVASSEFALEDIGDLVYPNPAFRQLVTM  1135
             V   Y  LAGRL  + + + V ++C   GA F  A ++ A+ DIGD+  P+P+    +  
Sbjct  73    V--HYYPLAGRLATSGDGKLV-VDCTGEGAVFVEADADCAMADIGDVTEPDPSVLGRLVY  129

Query  1134  SFDFVAK-EDQPLCFLQVTSFKCGGFALGTSMNHISFDGSGFKMFLENLAALSFNDDGPL  958
             S        + PL   QVT FKCGGF LG ++NH  FDG G   F+ +    +     PL
Sbjct  130   SVPGAKNILEMPLLAAQVTKFKCGGFVLGLAINHCMFDGVGAMQFVNSWGETARGL--PL  187

Query  957   AVVPCNDRSLLAARSPPQVTFPHPELLKVNLPAGEEMAPPVFDSLKDDLAFEIFQLSSAD  778
             ++ P  DR++L AR PPQV FPH E  ++     +E            L    FQ + A 
Sbjct  188   SLPPALDRAVLRARDPPQVDFPHHEFAQITDDDEDEYE-------DSPLLHRSFQFTPAS  240

Query  777   IERLKDKAKAPDNVKTKVTGFNVLTAAIW--RCKALSCLGGENNSDRLSTVLFAVDIRRR  604
             I R+K  A A        T F  L   +W  R +AL        + R S +LFAVD R R
Sbjct  241   IARVKAAAAAAALEGRACTTFEALAGFVWSARTRALG-----MRASRPSKLLFAVDGRPR  295

Query  603   LNPPLPDSYSGNAVLTGYGSAKCAELEEGPFWKTVQMVYEGAARMTDEYARSAIDWGELY  424
              +PPLP+ Y GNA++    +    EL      + V++V   A  +TD Y RSA+D+ E  
Sbjct  296   FSPPLPEGYFGNAIVLTSAACPAGELARS-LPRAVRLVRGAAGAVTDAYMRSAVDYFEAT  354

Query  423   KGFPH--GEFLVSSWWRLGFEGVQFPWGKPKYSCPVVYHRKDIILLFPDIDNGGKSNSGV  250
             +  P      L+++W RL F    F WG P    P     K++ L  P     G    GV
Sbjct  355   RARPSLASTLLITAWSRLPFRAADFGWGPPAACGPAALPEKEVALFLP-CGEEGGGGGGV  413

Query  249   NVLVALPPKEMEKFKSLFHKFLA  181
              VL+ LPP  M +F+ L  +  A
Sbjct  414   RVLLGLPPAAMAEFQRLVDEVTA  436



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 4637730747328