BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c80741_g1_i1 len=2302 path=[2280:0-2301]

Length=2302
                                                                      Score     E

ref|XP_009609513.1|  PREDICTED: uncharacterized protein LOC104103318    785   0.0      
ref|XP_009800615.1|  PREDICTED: uncharacterized protein LOC104246501    780   0.0      
ref|XP_004250967.1|  PREDICTED: uncharacterized protein LOC101257925    766   0.0      
ref|XP_004241239.1|  PREDICTED: uncharacterized protein LOC101251992    761   0.0      
ref|XP_009628121.1|  PREDICTED: uncharacterized protein LOC104118556    759   0.0      
ref|XP_006349124.1|  PREDICTED: uncharacterized protein LOC102605636    757   0.0      
ref|XP_006350911.1|  PREDICTED: uncharacterized protein LOC102585389    747   0.0      
ref|XP_009793175.1|  PREDICTED: uncharacterized protein LOC104240093    746   0.0      
emb|CDP09027.1|  unnamed protein product                                686   0.0      
ref|XP_011082333.1|  PREDICTED: uncharacterized protein LOC105165136    681   0.0      
ref|XP_002531370.1|  conserved hypothetical protein                     669   0.0      Ricinus communis
ref|XP_006424787.1|  hypothetical protein CICLE_v10030119mg             663   0.0      
ref|XP_006488660.1|  PREDICTED: uncharacterized protein LOC102613508    662   0.0      
ref|XP_007016476.1|  P-hydroxybenzoic acid efflux pump subunit aaeB     655   0.0      
ref|XP_002313448.2|  hypothetical protein POPTR_0009s03390g             654   0.0      Populus trichocarpa [western balsam poplar]
gb|KDO72909.1|  hypothetical protein CISIN_1g004796mg                   650   0.0      
gb|EYU23295.1|  hypothetical protein MIMGU_mgv1a001533mg                647   0.0      
ref|XP_011042678.1|  PREDICTED: uncharacterized protein LOC105138325    639   0.0      
gb|KDP44214.1|  hypothetical protein JCGZ_05681                         638   0.0      
ref|XP_002298367.2|  hypothetical protein POPTR_0001s24390g             635   0.0      Populus trichocarpa [western balsam poplar]
emb|CAN80549.1|  hypothetical protein VITISV_019389                     624   0.0      Vitis vinifera
ref|XP_002281216.1|  PREDICTED: uncharacterized protein LOC100243247    625   0.0      Vitis vinifera
ref|XP_011000275.1|  PREDICTED: uncharacterized protein LOC105107893    623   0.0      
ref|XP_006379012.1|  hypothetical protein POPTR_0009s03390g             619   0.0      
emb|CBI16165.3|  unnamed protein product                                617   0.0      
ref|XP_010092784.1|  hypothetical protein L484_001852                   615   0.0      
ref|XP_007207606.1|  hypothetical protein PRUPE_ppa019452mg             613   0.0      
ref|XP_008223255.1|  PREDICTED: uncharacterized protein LOC103323069    600   0.0      
ref|XP_004295927.1|  PREDICTED: uncharacterized protein LOC101293764    598   0.0      
ref|XP_010685806.1|  PREDICTED: uncharacterized protein LOC104900148    591   0.0      
ref|XP_010253831.1|  PREDICTED: uncharacterized protein LOC104594975    584   0.0      
ref|XP_009353707.1|  PREDICTED: uncharacterized protein LOC103944948    582   0.0      
ref|XP_010046403.1|  PREDICTED: uncharacterized protein LOC104435330    582   0.0      
ref|XP_004295928.1|  PREDICTED: uncharacterized protein LOC101294054    580   0.0      
ref|XP_009358382.1|  PREDICTED: uncharacterized protein LOC103949017    575   0.0      
ref|XP_008357535.1|  PREDICTED: uncharacterized protein LOC103421...    574   0.0      
gb|KHN30186.1|  hypothetical protein glysoja_010564                     555   0.0      
ref|XP_003542023.2|  PREDICTED: uncharacterized protein LOC100785658    555   0.0      
ref|XP_003597353.1|  p-hydroxybenzoic acid efflux pump subunit aaeB     544   1e-178   
ref|XP_010557280.1|  PREDICTED: uncharacterized protein LOC104826334    534   1e-174   
ref|XP_010470050.1|  PREDICTED: uncharacterized protein LOC104750019    533   3e-174   
gb|AAC79583.1|  hypothetical protein                                    528   2e-172   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010510581.1|  PREDICTED: uncharacterized protein LOC104786...    528   2e-172   
ref|NP_180444.2|  uncharacterized protein                               528   2e-172   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009140941.1|  PREDICTED: uncharacterized protein LOC103864919    528   3e-172   
ref|XP_006293705.1|  hypothetical protein CARUB_v10022663mg             526   2e-171   
emb|CDY31731.1|  BnaA04g16670D                                          525   2e-171   
ref|XP_002881008.1|  hypothetical protein ARALYDRAFT_320665             525   3e-171   
ref|XP_010414485.1|  PREDICTED: uncharacterized protein LOC104700645    525   3e-171   
ref|XP_004487244.1|  PREDICTED: uncharacterized protein LOC101504850    524   3e-170   
emb|CDX77206.1|  BnaC04g40010D                                          522   4e-170   
ref|XP_006409909.1|  hypothetical protein EUTSA_v10016268mg             516   1e-167   
ref|XP_009103713.1|  PREDICTED: uncharacterized protein LOC103829768    515   2e-167   
gb|KFK32261.1|  hypothetical protein AALP_AA6G219200                    513   9e-167   
emb|CDY04585.1|  BnaA07g14110D                                          510   1e-165   
emb|CDY15786.1|  BnaC04g15380D                                          509   6e-165   
ref|XP_002269811.1|  PREDICTED: uncharacterized protein LOC100266589    509   8e-165   Vitis vinifera
emb|CDP18496.1|  unnamed protein product                                471   2e-153   
ref|XP_010922978.1|  PREDICTED: uncharacterized protein LOC105046152    471   6e-150   
ref|XP_007150309.1|  hypothetical protein PHAVU_005G142600g             462   4e-147   
ref|XP_004150188.1|  PREDICTED: uncharacterized protein LOC101219035    452   3e-143   
ref|XP_008242655.1|  PREDICTED: uncharacterized protein LOC103340961    452   5e-143   
ref|XP_007207662.1|  hypothetical protein PRUPE_ppa022399mg             451   1e-142   
ref|XP_010543050.1|  PREDICTED: uncharacterized protein LOC104816079    444   3e-142   
ref|XP_004169648.1|  PREDICTED: uncharacterized protein LOC101229105    450   3e-142   
ref|XP_010037845.1|  PREDICTED: uncharacterized protein LOC104426477    447   8e-141   
ref|XP_004305213.1|  PREDICTED: uncharacterized protein LOC101292821    437   8e-138   
gb|KDP35612.1|  hypothetical protein JCGZ_09050                         439   8e-138   
ref|XP_002527740.1|  hypothetical protein RCOM_1248440                  437   3e-137   Ricinus communis
ref|XP_007027061.1|  Uncharacterized protein TCM_021965                 432   4e-137   
ref|XP_008457497.1|  PREDICTED: uncharacterized protein LOC103497174    432   1e-135   
ref|XP_003625490.1|  p-hydroxybenzoic acid efflux pump subunit aaeB     431   6e-135   
ref|XP_008355687.1|  PREDICTED: uncharacterized protein LOC103419345    427   1e-133   
ref|XP_009338779.1|  PREDICTED: uncharacterized protein LOC103931090    421   2e-131   
ref|XP_009374702.1|  PREDICTED: uncharacterized protein LOC103963596    412   4e-128   
ref|XP_010418812.1|  PREDICTED: uncharacterized protein LOC104704415    404   5e-127   
emb|CAN79695.1|  hypothetical protein VITISV_023936                     402   7e-119   Vitis vinifera
ref|XP_011077457.1|  PREDICTED: uncharacterized protein LOC105161462    387   2e-118   
gb|KDO72910.1|  hypothetical protein CISIN_1g045253mg                   383   6e-118   
ref|XP_010543320.1|  PREDICTED: uncharacterized protein LOC104816285    384   2e-117   
ref|XP_004249813.2|  PREDICTED: uncharacterized protein LOC101254551    379   2e-115   
gb|KHN09420.1|  hypothetical protein glysoja_016519                     377   4e-115   
emb|CDP06631.1|  unnamed protein product                                379   7e-115   
ref|XP_006339286.1|  PREDICTED: uncharacterized protein LOC102599972    377   1e-114   
gb|KGN65700.1|  hypothetical protein Csa_1G502880                       375   5e-114   
ref|XP_002308144.2|  hypothetical protein POPTR_0006s08200g             359   2e-109   Populus trichocarpa [western balsam poplar]
ref|XP_009611529.1|  PREDICTED: uncharacterized protein LOC104105004    362   6e-109   
ref|XP_009787993.1|  PREDICTED: uncharacterized protein LOC104235863    356   9e-107   
gb|EYU26578.1|  hypothetical protein MIMGU_mgv1a001712mg                355   1e-106   
ref|XP_006429029.1|  hypothetical protein CICLE_v10011084mg             355   4e-106   
gb|KDO43708.1|  hypothetical protein CISIN_1g003403mg                   354   1e-105   
ref|XP_009787557.1|  PREDICTED: uncharacterized protein LOC104235477    353   1e-105   
ref|XP_006480768.1|  PREDICTED: uncharacterized protein LOC102627...    354   1e-105   
ref|XP_009388259.1|  PREDICTED: uncharacterized protein LOC103975...    351   6e-105   
ref|XP_009388258.1|  PREDICTED: uncharacterized protein LOC103975...    352   1e-104   
ref|XP_008803432.1|  PREDICTED: uncharacterized protein LOC103716990    347   1e-102   
ref|XP_009627438.1|  PREDICTED: uncharacterized protein LOC104117985    342   2e-101   
ref|XP_007162655.1|  hypothetical protein PHAVU_001G169100g             341   3e-101   
ref|XP_002527739.1|  conserved hypothetical protein                     323   2e-98    Ricinus communis
ref|XP_009622735.1|  PREDICTED: uncharacterized protein LOC104114081    318   3e-97    
gb|KFK38331.1|  hypothetical protein AALP_AA3G100300                    330   6e-97    
ref|XP_010464592.1|  PREDICTED: uncharacterized protein LOC104745116    324   6e-95    
emb|CDY44709.1|  BnaA05g28970D                                          314   3e-91    
ref|XP_010486516.1|  PREDICTED: uncharacterized protein LOC104764643    306   4e-88    
ref|XP_009146927.1|  PREDICTED: uncharacterized protein LOC103870541    304   1e-87    
emb|CDY41607.1|  BnaC05g43440D                                          303   3e-87    
gb|EYU41707.1|  hypothetical protein MIMGU_mgv1a021165mg                301   8e-87    
ref|XP_010473184.1|  PREDICTED: uncharacterized protein LOC104752651    301   2e-86    
ref|NP_187556.1|  uncharacterized protein                               298   4e-85    Arabidopsis thaliana [mouse-ear cress]
ref|XP_008360241.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    290   7e-84    
ref|XP_004142207.1|  PREDICTED: uncharacterized protein LOC101207339    291   1e-82    
ref|XP_008447690.1|  PREDICTED: uncharacterized protein LOC103490100    290   3e-82    
ref|XP_004493888.1|  PREDICTED: uncharacterized protein LOC101495526    285   5e-82    
ref|XP_006846140.1|  hypothetical protein AMTR_s00012p00168340          281   2e-81    
ref|XP_008369966.1|  PREDICTED: uncharacterized protein LOC103433480    288   2e-81    
ref|XP_007208085.1|  hypothetical protein PRUPE_ppa001489mg             288   3e-81    
ref|XP_008357539.1|  PREDICTED: uncharacterized protein LOC103421...    285   6e-81    
ref|XP_009621205.1|  PREDICTED: uncharacterized protein LOC104112869    280   6e-81    
ref|XP_008369859.1|  PREDICTED: uncharacterized protein LOC103433384    285   2e-80    
ref|XP_008457499.1|  PREDICTED: uncharacterized protein LOC103497...    271   2e-79    
gb|KDO36970.1|  hypothetical protein CISIN_1g006621mg                   276   1e-78    
ref|XP_008242666.1|  PREDICTED: uncharacterized protein LOC103340970    280   2e-78    
gb|EYU41708.1|  hypothetical protein MIMGU_mgv1a002024mg                278   4e-78    
ref|XP_008351151.1|  PREDICTED: uncharacterized protein LOC103414556    275   4e-77    
ref|XP_006341043.1|  PREDICTED: uncharacterized protein LOC102581...    270   2e-76    
ref|XP_009374700.1|  PREDICTED: uncharacterized protein LOC103963591    274   3e-76    
ref|XP_004246876.2|  PREDICTED: uncharacterized protein LOC101256621    266   2e-73    
ref|XP_008387761.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    265   7e-72    
ref|XP_009766746.1|  PREDICTED: uncharacterized protein LOC104218043    259   1e-71    
ref|XP_006299591.1|  hypothetical protein CARUB_v10015769mg             254   1e-69    
ref|XP_002882620.1|  hypothetical protein ARALYDRAFT_341087             253   6e-69    
ref|XP_006407674.1|  hypothetical protein EUTSA_v10020118mg             249   2e-67    
ref|XP_008350431.1|  PREDICTED: uncharacterized protein LOC103413770    228   1e-60    
gb|EPS72651.1|  hypothetical protein M569_02108                         217   2e-56    
ref|XP_006664967.1|  PREDICTED: uncharacterized protein LOC102716927    211   1e-54    
ref|XP_003577182.2|  PREDICTED: uncharacterized protein LOC100831379    192   4e-48    
gb|EMT12500.1|  hypothetical protein F775_52162                         192   4e-48    
dbj|BAK01191.1|  predicted protein                                      191   8e-48    
ref|XP_008675554.1|  PREDICTED: uncharacterized protein LOC103651649    187   2e-46    
emb|CBI30577.3|  unnamed protein product                                180   3e-45    
ref|XP_010111491.1|  hypothetical protein L484_021316                   174   5e-45    
ref|XP_004978393.1|  PREDICTED: uncharacterized protein LOC101756990    180   6e-44    
ref|XP_002489081.1|  hypothetical protein SORBIDRAFT_0120s002040        179   1e-43    Sorghum bicolor [broomcorn]
ref|XP_004978409.1|  PREDICTED: uncharacterized protein LOC101778611    176   7e-43    
gb|KHN02426.1|  hypothetical protein glysoja_002450                     166   1e-42    
ref|NP_001176293.1|  Os11g0100300                                       163   2e-38    
gb|EAY86138.1|  hypothetical protein OsI_07511                          163   2e-38    Oryza sativa Indica Group [Indian rice]
ref|XP_004152908.1|  PREDICTED: uncharacterized protein LOC101209654    154   3e-38    
ref|XP_008350433.1|  PREDICTED: uncharacterized protein LOC103413773    146   9e-35    
ref|XP_002962665.1|  hypothetical protein SELMODRAFT_404621             136   9e-30    
ref|XP_002967786.1|  hypothetical protein SELMODRAFT_409072             134   7e-29    
ref|XP_008457498.1|  PREDICTED: uncharacterized protein LOC103497...    130   8e-29    
ref|XP_002992632.1|  hypothetical protein SELMODRAFT_430799             130   6e-28    
ref|XP_002967785.1|  hypothetical protein SELMODRAFT_409071             127   7e-27    
ref|XP_002992633.1|  hypothetical protein SELMODRAFT_430800             126   1e-26    
emb|CDP18497.1|  unnamed protein product                                118   7e-26    
ref|XP_010529077.1|  PREDICTED: uncharacterized protein LOC104806054    105   8e-22    
gb|KHN33399.1|  hypothetical protein glysoja_005441                   98.6    8e-19    
ref|XP_002980426.1|  hypothetical protein SELMODRAFT_419949           93.2    4e-16    
ref|XP_007027059.1|  Uncharacterized protein TCM_021963               78.2    2e-12    
gb|EWM22996.1|  p-hydroxybenzoic acid efflux pump subunit aaeb        77.4    2e-11    
gb|KHN02427.1|  hypothetical protein glysoja_002451                   72.4    7e-11    
gb|EAY86136.1|  hypothetical protein OsI_07509                        75.5    1e-10    Oryza sativa Indica Group [Indian rice]
gb|KHG18122.1|  Myosin-binding C, fast-type                           62.0    2e-07    
ref|XP_005822282.1|  hypothetical protein GUITHDRAFT_146606           63.9    4e-07    
ref|XP_002508823.1|  predicted protein                                63.5    7e-07    Micromonas commoda
gb|EWM30522.1|  hypothetical protein Naga_100013g27                   63.2    1e-06    
ref|XP_002308143.2|  hypothetical protein POPTR_0006s08190g           58.2    3e-06    Populus trichocarpa [western balsam poplar]
ref|WP_017243767.1|  hypothetical protein                             60.5    4e-06    
ref|WP_020000881.1|  MULTISPECIES: hypothetical protein               58.2    1e-05    
ref|WP_015905171.1|  hypothetical protein                             57.8    2e-05    
ref|XP_006846139.1|  hypothetical protein AMTR_s00012p00168110        55.5    2e-05    
ref|WP_031482228.1|  hypothetical protein                             57.0    4e-05    
ref|XP_006829045.1|  hypothetical protein AMTR_s00001p00255730        53.5    4e-05    
emb|CCB92218.1|  putative membrane protein                            56.6    5e-05    
ref|WP_013182808.1|  hypothetical protein                             56.6    5e-05    
ref|WP_010758751.1|  hypothetical protein                             53.9    8e-05    
ref|WP_012978035.1|  hypothetical protein                             56.2    9e-05    
ref|WP_011793147.1|  hypothetical protein                             55.1    1e-04    
ref|XP_001732153.1|  hypothetical protein MGL_0746                    54.7    3e-04    Malassezia globosa CBS 7966
ref|XP_002538341.1|  conserved hypothetical protein                   51.2    4e-04    Ricinus communis
ref|WP_010937388.1|  hypothetical protein                             53.1    6e-04    
ref|WP_011366277.1|  hypothetical protein                             52.8    8e-04    
ref|WP_027182570.1|  hypothetical protein                             52.4    0.001    



>ref|XP_009609513.1| PREDICTED: uncharacterized protein LOC104103318 [Nicotiana tomentosiformis]
Length=803

 Score =   785 bits (2026),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 453/741 (61%), Positives = 563/741 (76%), Gaps = 21/741 (3%)
 Frame = +1

Query  4     LRGCWYAIYATCLGVCPAILSLWLIGPahlttgtaaaavaitaFIVVLPQNTHVVAKRIA  183
             LR CW A YAT  GVCPAILSLWLIGPA LT  T A AVA++AF+VVLP+NTH++AKRIA
Sbjct  70    LRCCWLAFYATVQGVCPAILSLWLIGPARLTASTTAIAVALSAFVVVLPENTHLIAKRIA  129

Query  184   LGQTVLVYALA---GPRTQPIMHPlrvaastaiavaacvlalllpypslassKVKHNCHL  354
             LGQ V+VY +    G +T+P+MHP+ VAASTA+ V ACVLALLLPYP+LA  +VK    L
Sbjct  130   LGQLVIVYVIGYINGGKTEPVMHPVHVAASTAVGVGACVLALLLPYPNLACCEVKEKSRL  189

Query  355   FAENVSQRLNLLVKAFSAEDNASALSLVSQAKSLNASGAKFLQNIKSKQESMQWERYPIK  534
             F EN S+R+NL VKAFSAED  SAL+L+SQAKSL  +G K LQ IKSKQESM+WER+P K
Sbjct  190   FVENASERINLFVKAFSAEDRESALALISQAKSLVNNGPKLLQAIKSKQESMKWERFPFK  249

Query  535   FFRPYCKNPGERLQEYETPLRGMEMGLVDNNPPQFPVTVLLSSSEVKDSLDSLTGHISKQ  714
             F RPY + PG + QE +TPLRGME+ L + +PP FP+ +L  +SE+KD L+ L+ HISKQ
Sbjct  250   FLRPYGEKPGNKFQEIQTPLRGMEIAL-EKSPP-FPLDIL--NSELKDGLEKLSEHISKQ  305

Query  715   VKGRLFDLATVPESNAQNAVKFLH--QKLQPVTLQdlssffflfslklllikpsssilkd  888
             VK    + ATVPESNA+NA KFL   Q +QP T  DL S FFLF LKLLL KP     K 
Sbjct  306   VKNISLESATVPESNAENAEKFLQTLQTIQP-TKNDLPSLFFLFCLKLLLNKPIFLSSKK  364

Query  889   kdGSKEQEERFLDKIYSNFVGQMNNKRFVASLKYALALGLAVFFGSIYSKPDGFWAGLTV  1068
             +   +++EE ++ K ++N    +N++RF+A+ K +L+LGLA+FFGSIYSK +GFWAGL V
Sbjct  365   ESKKQDEEEGYMRKTWTNLAVTINSRRFMAAFKLSLSLGLAIFFGSIYSKENGFWAGLPV  424

Query  1069  AISYVSAREATFRIANVKAQGTVLGSIYGVLGCFVFAKYEELRFISLIPWFIVCSFLRRS  1248
             AIS  + REATF++ANVKAQGTVLG++YGVLGCF+F ++ ++RF+SL+PWFIV SFL RS
Sbjct  425   AISLAATREATFKVANVKAQGTVLGTVYGVLGCFLFERFVQIRFLSLLPWFIVSSFLSRS  484

Query  1249  RMYGPAGGISACIGAVLILGREGFGPPREFAMARIMETFIGLACSITVELLFRPTRASSL  1428
             RMYG AGGISA IGAVLILGR+GFGPP EFA+ARI ETFIGL+CSI VE+L +PTRAS+L
Sbjct  485   RMYGQAGGISAVIGAVLILGRKGFGPPSEFAIARITETFIGLSCSIMVEILLQPTRASTL  544

Query  1429  AKIQLSKSLQLLNQCIISIDYSSNNQSKLEETQKILKSSVTQLGKFIGEAEVEPNFWFLP  1608
             AKIQLSKS  +L+ CI +I +SS ++  LEE+QK LK  V +LGKFI EAE EPNFWF P
Sbjct  545   AKIQLSKSFGILHDCIDNISFSSYSKYSLEESQKKLKFHVNELGKFIAEAEAEPNFWFFP  604

Query  1609  FHSACYGKLMGSLSKVVEYLHFVAQALRFLEQES---------ALMGRLDSDHLSLFRDH  1761
             F SACYGKLMGSLSK+VEYL F +QALRFLEQES          ++ +LD+D + LF+D 
Sbjct  605   FSSACYGKLMGSLSKMVEYLLFGSQALRFLEQESEKIDSNVWKTIVKKLDAD-IMLFKDL  663

Query  1762  VGPSIKSFEEIISLVGSVSVLDKEFEKKKSSIDPELGKLPTSNNITGLSDEEIDNKLKSF  1941
             +G   K FEE +SLV S+ VLDKEFEKKK ++D ELGKLPT   I   S+EEI+  L SF
Sbjct  664   IGSYTKCFEE-VSLVKSLVVLDKEFEKKKVAVDLELGKLPTPYTIRSSSEEEIEKNLVSF  722

Query  1942  MEDSRQFVDQKdeddddeVMMNSQVALSLSALAFCMRGIVRETKEIDKAIKELVQWENPS  2121
             ++ S + V+   +    +  +  Q+ LSLSA  FCM  +V+ETKEI+  IKELVQWENPS
Sbjct  723   LQHSNEVVELIVKGGKSDEKLKGQLVLSLSAFGFCMDNLVKETKEIENGIKELVQWENPS  782

Query  2122  SPVNLHEISCKIRALAHTVTN  2184
               V L++ISCK+RALA+T TN
Sbjct  783   CHVKLYDISCKVRALANTETN  803



>ref|XP_009800615.1| PREDICTED: uncharacterized protein LOC104246501 [Nicotiana sylvestris]
Length=803

 Score =   780 bits (2015),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 459/741 (62%), Positives = 574/741 (77%), Gaps = 21/741 (3%)
 Frame = +1

Query  4     LRGCWYAIYATCLGVCPAILSLWLIGPahlttgtaaaavaitaFIVVLPQNTHVVAKRIA  183
             LR CW A+YAT  GVCPAILSLWLIGPA LT  T A AVA++AF+VVLP+NTH++AKRIA
Sbjct  70    LRCCWLALYATVQGVCPAILSLWLIGPARLTASTTAIAVALSAFVVVLPENTHLIAKRIA  129

Query  184   LGQTVLVYALA---GPRTQPIMHPlrvaastaiavaacvlalllpypslassKVKHNCHL  354
             LGQ V+VY +    G +T+P+MHP+ VAASTA+ V ACVLALLLPYP+LA  +VK    L
Sbjct  130   LGQLVIVYVIGYINGGKTEPVMHPVHVAASTAVGVGACVLALLLPYPNLACCEVKEKSRL  189

Query  355   FAENVSQRLNLLVKAFSAEDNASALSLVSQAKSLNASGAKFLQNIKSKQESMQWERYPIK  534
             F EN S+R+NL VKAFSAED  SAL+L+SQAKSL  +G K LQ IKSKQESM+WER+P K
Sbjct  190   FVENASERINLFVKAFSAEDKESALALISQAKSLVKNGPKLLQAIKSKQESMKWERFPFK  249

Query  535   FFRPYCKNPGERLQEYETPLRGMEMGLVDNNPPQFPVTVLLSSSEVKDSLDSLTGHISKQ  714
             F RPY  NPG + QE +TPLRGME+ L + +PP FP+ +L  +SE+K+ L+ L+ HISKQ
Sbjct  250   FLRPYGDNPGNKFQEIQTPLRGMEIAL-EKSPP-FPLDIL--NSELKNGLEKLSDHISKQ  305

Query  715   VKGRLFDLATVPESNAQNAVKFLH--QKLQPVTLQdlssffflfslklllikpsssilkd  888
             VK    + ATVPESNA+NA KFL   Q +QP T +DL S FFLF LKLLL KP     K 
Sbjct  306   VKNISLESATVPESNAENAEKFLQTLQTIQP-TKKDLPSLFFLFCLKLLLNKPIFLSSKK  364

Query  889   kdGSKEQEERFLDKIYSNFVGQMNNKRFVASLKYALALGLAVFFGSIYSKPDGFWAGLTV  1068
             +   +E+EE F+ K ++N    +N++RF+A+ K +L+LGLA+FFGSIYSK +GFWAGL V
Sbjct  365   ESKKQEEEEGFMSKTWTNLAVTINSRRFMAAFKLSLSLGLAIFFGSIYSKENGFWAGLPV  424

Query  1069  AISYVSAREATFRIANVKAQGTVLGSIYGVLGCFVFAKYEELRFISLIPWFIVCSFLRRS  1248
             AIS  + REATF++ANVKAQGTVLG++YGV+GCF+F ++ ++RF+SL+PWFIV SFL RS
Sbjct  425   AISLAATREATFKVANVKAQGTVLGTVYGVIGCFLFERFVQIRFLSLLPWFIVSSFLSRS  484

Query  1249  RMYGPAGGISACIGAVLILGREGFGPPREFAMARIMETFIGLACSITVELLFRPTRASSL  1428
             +MYG AGGISA IGAVLILGR+GFGPP EFA+ARI ETFIGL+CSI VE+L +PTRAS+L
Sbjct  485   KMYGQAGGISAVIGAVLILGRQGFGPPSEFAIARITETFIGLSCSIMVEILLQPTRASTL  544

Query  1429  AKIQLSKSLQLLNQCIISIDYSSNNQSKLEETQKILKSSVTQLGKFIGEAEVEPNFWFLP  1608
             AKIQLSKS  +L+ CI SI +SS +++ LEE+QK LK  V +LGKFI EAE EPNFWFLP
Sbjct  545   AKIQLSKSFGILHDCIDSISFSSYSKNSLEESQKKLKFHVNELGKFIAEAEAEPNFWFLP  604

Query  1609  FHSACYGKLMGSLSKVVEYLHFVAQALRFLEQES---------ALMGRLDSDHLSLFRDH  1761
             F +ACYGKLMGSLSK+VEYL F +QALRFLEQES         A++ +LD+D L LF+D 
Sbjct  605   FSNACYGKLMGSLSKMVEYLLFGSQALRFLEQESEKIDSNMWKAIVKKLDAD-LMLFKDL  663

Query  1762  VGPSIKSFEEIISLVGSVSVLDKEFEKKKSSIDPELGKLPTSNNITGLSDEEIDNKLKSF  1941
             +G   K FEE +SLV S+ VLDKEFEKKK +ID ELGKLPT  NI  L++EEI+  L SF
Sbjct  664   IGSYTKCFEE-VSLVKSLVVLDKEFEKKKVAIDLELGKLPTPYNIRSLNEEEIEENLVSF  722

Query  1942  MEDSRQFVDQKdeddddeVMMNSQVALSLSALAFCMRGIVRETKEIDKAIKELVQWENPS  2121
             ++ S + VD   +  +++  +  ++ LSLSA  FCM  +V+ETKEI+K IKEL+QWENPS
Sbjct  723   LQHSNEVVDVILKGGENDEKLKGELVLSLSAFGFCMDNLVKETKEIEKGIKELLQWENPS  782

Query  2122  SPVNLHEISCKIRALAHTVTN  2184
               VNL++ISCK+RALA+T TN
Sbjct  783   CHVNLYDISCKVRALANTETN  803



>ref|XP_004250967.1| PREDICTED: uncharacterized protein LOC101257925 [Solanum lycopersicum]
Length=810

 Score =   766 bits (1978),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 442/747 (59%), Positives = 558/747 (75%), Gaps = 25/747 (3%)
 Frame = +1

Query  1     ALRGCWYAIYATCLGVCPAILSLWLIGPahlttgtaaaavaitaFIVVLPQNTHVVAKRI  180
              LR CW A+YAT  GVCPAILSLWLIGP  LT  T A AVA++AF+VVLP+ TH++AKRI
Sbjct  70    TLRSCWLALYATIQGVCPAILSLWLIGPGRLTASTTATAVALSAFVVVLPEKTHLIAKRI  129

Query  181   ALGQTVLVYALA---GPRTQPIMHPlrvaastaiavaacvlalllpypslassKVKHNCH  351
             ALGQ V+VY +A   G +T+PIMHP+RVAASTA+ V ACVLALLLPYP+LA  +VK    
Sbjct  130   ALGQLVIVYVIAYINGAKTEPIMHPVRVAASTAVGVVACVLALLLPYPNLACCEVKEKSK  189

Query  352   LFAENVSQRLNLLVKAFSAEDNASALSLVSQAKSLNASGAKFLQNIKSKQESMQWERYPI  531
             LF EN ++R+NL VKAFSAEDN SAL+L+S+AKSL  +G K LQ IKSKQESM+WER+P 
Sbjct  190   LFVENATERINLFVKAFSAEDNTSALALISKAKSLVNNGPKLLQAIKSKQESMKWERFPF  249

Query  532   KFFRPYCKNPGERLQEYETPLRGMEMGLVDNNPPQFPVTVLLSSSEVKDSLDSLTGHISK  711
             KF RPY +NPG++ QE +TPLRGME+ L +N+   FP+++L  + E+KD L+ L  HISK
Sbjct  250   KFLRPYGENPGDKFQEIQTPLRGMEIAL-ENSSSIFPISIL--NIELKDGLEKLGDHISK  306

Query  712   QVKGRLFD--LATVPESNAQNAVKFLH--QKLQPV--TLQdlssffflfslklllikpss  873
             Q+     D   ATVPESNA +A KFL   Q +QP    L  L   F L  L      P S
Sbjct  307   QINNMSIDEWSATVPESNAHDAEKFLQTLQLIQPTKKDLPSLFFLFCLKLLLHKPTFPLS  366

Query  874   silkdkdGSKEQ----EERFLDKIYSNFVGQMNNKRFVASLKYALALGLAVFFGSIYSKP  1041
             S      GS +Q    +E F+ K ++N    +N++RF+ S + +L+LGLA+FFGSIYSK 
Sbjct  367   SKKGVDIGSNKQVDDDQEGFVKKTWNNLSMTINSRRFMTSFRCSLSLGLAIFFGSIYSKE  426

Query  1042  DGFWAGLTVAISYVSAREATFRIANVKAQGTVLGSIYGVLGCFVFAKYEELRFISLIPWF  1221
             +GFWAGL VAIS  + REATF++ANVKAQGTVLG++YGVLGCF+F K+ ++RF+SL+PWF
Sbjct  427   NGFWAGLPVAISLAATREATFKVANVKAQGTVLGTVYGVLGCFLFEKFVQIRFLSLLPWF  486

Query  1222  IVCSFLRRSRMYGPAGGISACIGAVLILGREGFGPPREFAMARIMETFIGLACSITVELL  1401
             IV SFL RSRMYG AGGISA IGAVLILGR GFGPP EFA+ARI ETFIGL+CSI VE+L
Sbjct  487   IVSSFLSRSRMYGQAGGISAVIGAVLILGRNGFGPPSEFAIARITETFIGLSCSIMVEIL  546

Query  1402  FRPTRASSLAKIQLSKSLQLLNQCIISIDYSSNNQSKLEETQKILKSSVTQLGKFIGEAE  1581
             F PTRAS+LAKIQLS + ++L++C+ SI +SS+N++  EE QK LK  V +LGKFI EAE
Sbjct  547   FHPTRASTLAKIQLSNTFKILHECVDSIAFSSSNKNNSEEIQKNLKFHVNELGKFIAEAE  606

Query  1582  VEPNFWFLPFHSACYGKLMGSLSKVVEYLHFVAQALRFLEQESAL---MGRLDSDHLSLF  1752
              EPNFWFLPF+S CYGK++GSLSK++EYL F +QALRFL+Q S        +D+D L LF
Sbjct  607   AEPNFWFLPFNSGCYGKVLGSLSKMMEYLLFGSQALRFLQQHSTSSIDWNNIDAD-LMLF  665

Query  1753  RDHVGPSIKSFEEIISLVGSVSVLDKEFEKKKSSIDPELGKLPTSNNITGLSDEEIDNKL  1932
             +D +  S K FEE +SLV S+++LDKEFEKKK+SID ELGK  +S NI  LS  + D  L
Sbjct  666   KDLISTSTKCFEE-VSLVKSLAILDKEFEKKKNSIDLELGK-SSSYNIRSLSSNDQDGIL  723

Query  1933  KSFMEDSRQFVD---QKdeddddeVMMNSQVALSLSALAFCMRGIVRETKEIDKAIKELV  2103
              S+++ S + VD      +D +++  +  Q+ LSLSAL FCM  +V+ET+EI+KAIKELV
Sbjct  724   TSYLQHSNELVDFIINVGDDKNNDEKLKGQLVLSLSALGFCMESLVKETREIEKAIKELV  783

Query  2104  QWENPSSPVNLHEISCKIRALAHTVTN  2184
             QWENPS  VNL++ISCK+RALA+T TN
Sbjct  784   QWENPSCHVNLYDISCKVRALANTQTN  810



>ref|XP_004241239.1| PREDICTED: uncharacterized protein LOC101251992 [Solanum lycopersicum]
Length=792

 Score =   761 bits (1965),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 446/738 (60%), Positives = 559/738 (76%), Gaps = 31/738 (4%)
 Frame = +1

Query  4     LRGCWYAIYATCLGVCPAILSLWLIGPahlttgtaaaavaitaFIVVLPQNTHVVAKRIA  183
              RGCW A+YAT  GVCPA+LSLWLIGPA LT GT A AVA++AF+VV+P+NTH++AKRIA
Sbjct  70    FRGCWLALYATIQGVCPAMLSLWLIGPARLTAGTTAIAVALSAFLVVVPENTHLIAKRIA  129

Query  184   LGQTVLVYALA---GPRTQPIMHPlrvaastaiavaacvlalllpypslassKVKHNCHL  354
             LGQ VLVY +A   G +T+ IMHP+ VAAST + V ACVLAL+ PYPSLA  +VK NC L
Sbjct  130   LGQIVLVYVIAYINGGQTETIMHPVHVAASTGLGVVACVLALIFPYPSLACCEVKQNCKL  189

Query  355   FAENVSQRLNLLVKAFSAEDNASALSLVSQAKSLNASGAKFLQNIKSKQESMQWERYPIK  534
             FAEN S+R NL VKAF+AEDN+SAL+ +SQAKSL  +G+K LQ+IK+KQESM+WER+P K
Sbjct  190   FAENASERFNLFVKAFTAEDNSSALAFISQAKSLVKTGSKLLQDIKTKQESMKWERFPFK  249

Query  535   FFRPYCKNPGERLQEYETPLRGMEMGLVDNNPPQFPVTVLLSSSEVKDSLDSLTGHISKQ  714
             F RPY +NPG R Q+ + PLRGME+ L DN+PP FPV +L  +++ K  L  L  HI KQ
Sbjct  250   FLRPYGENPGSRFQDVQIPLRGMEIAL-DNSPP-FPVEIL--NTDQKSVLHMLGDHIPKQ  305

Query  715   VKG-RLFDLATVPESNAQNAVKFLHQKLQPVTLQdlssffflfslklllikpsssilkdk  891
             V    L   ATVPESN QN   F  Q LQP T +DL S FFLF L LLL KP ++     
Sbjct  306   VNSISLESSATVPESNQQNTQMFF-QTLQP-TKKDLPSLFFLFCLNLLLNKPITNSPSST  363

Query  892   dGSKEQEERFLDKIYSNFVG-QMNNKRFVASLKYALALGLAVFFGSIYSKPDGFWAGLTV  1068
             +  ++ +E F    + N++    +NKRF+A+ K +L+LGLA++FGSIYSK +GFWAGL V
Sbjct  364   NPKQQNQEGF----FQNYLSITKSNKRFMAAFKCSLSLGLAIYFGSIYSKDNGFWAGLPV  419

Query  1069  AISYVSAREATFRIANVKAQGTVLGSIYGVLGCFVFAKYEELRFISLIPWFIVCSFLRRS  1248
             AIS   +REATF++ANVKAQGTVLG+IYG+LGCFVF KY ++RF+SL+PWFIV SFLR+S
Sbjct  420   AISLAGSREATFKVANVKAQGTVLGTIYGLLGCFVFEKYVQIRFLSLLPWFIVSSFLRQS  479

Query  1249  RMYGPAGGISACIGAVLILGREGFGPPREFAMARIMETFIGLACSITVELLFRPTRASSL  1428
              MYG AGG+SA IGA+LILGR+GFGPP EFA+ARI ETFIGL+CSI VE+L +PTRA++L
Sbjct  480   TMYGQAGGLSAIIGALLILGRKGFGPPSEFAIARITETFIGLSCSIVVEILLQPTRATTL  539

Query  1429  AKIQLSKSLQLLNQCIISIDYSSNNQSKLEETQKILKSSVTQLGKFIGEAEVEPNFWFLP  1608
             AK+QLSKS Q+LN+ I  I + S     L E+Q  LK+ V ++GKFI EAEVEPNFWF+P
Sbjct  540   AKLQLSKSFQILNESISLISFGS--IGNLVESQNKLKTHVIEMGKFIAEAEVEPNFWFVP  597

Query  1609  FHSACYGKLMGSLSKVVEYLHFVAQALRFLEQESA-----LMGRLDSDHLSLFRDHVGPS  1773
             FHS CY KLMGSL+K++EYLHF +QA   LEQES       + +LD D + LF+D VG S
Sbjct  598   FHSVCYRKLMGSLTKMLEYLHFGSQAFMLLEQESGGLIDNFVHKLDGD-IKLFKDFVGSS  656

Query  1774  IKSFEEIISLVGSVSVLDKEFEKKKSSIDPELGKLPTS---NNITGLSDEEIDNKLKSFM  1944
             +K FEE +SLV S+++LDKEFEKKK S+D ELG   +S   N I   S+EEID+  +S+ 
Sbjct  657   MKCFEE-VSLVKSLAILDKEFEKKKLSVDVELGTSQSSSYCNIIRYASEEEIDDNFRSYF  715

Query  1945  EDSRQFVDQKdeddddeVMMNSQVALSLSALAFCMRGIVRETKEIDKAIKELVQWENPSS  2124
             E S++FVDQ    ++    +  QV LSLSAL FCM G+V+ETKEI+KAIKELVQWENPSS
Sbjct  716   EHSKEFVDQIVNGEE----LKGQVVLSLSALGFCMDGLVKETKEIEKAIKELVQWENPSS  771

Query  2125  PVNLHEISCKIRALAHTV  2178
              VNLH+ISCK+RALA+ +
Sbjct  772   HVNLHDISCKVRALANII  789



>ref|XP_009628121.1| PREDICTED: uncharacterized protein LOC104118556 [Nicotiana tomentosiformis]
Length=804

 Score =   759 bits (1960),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 444/745 (60%), Positives = 546/745 (73%), Gaps = 32/745 (4%)
 Frame = +1

Query  4     LRGCWYAIYATCLGVCPAILSLWLIGPahlttgtaaaavaitaFIVVLPQNTHVVAKRIA  183
              RGCW+A+YAT  GVCPAILSLWLIGPA LT  T A AVA++AF+VVLP+NTH++AKRIA
Sbjct  70    FRGCWHALYATIQGVCPAILSLWLIGPARLTATTTAIAVALSAFVVVLPENTHLLAKRIA  129

Query  184   LGQTVLVYALA---GPRTQPIMHPlrvaastaiavaacvlalllpypslassKVKHNCHL  354
             LGQ VLVY +A   G +T+ IMHP+ VAAST + V ACVLAL+ PYPSLA S+VK NC L
Sbjct  130   LGQIVLVYVIAYINGGQTETIMHPVHVAASTGLGVVACVLALIFPYPSLACSEVKQNCKL  189

Query  355   FAENVSQRLNLLVKAFSAEDNASALSLVSQAKSLNASGAKFLQNIKSKQESMQWERYPIK  534
             FAEN S+R NL VKAFSAEDN SAL+ +SQAKSL ++GAK LQ IK+KQESM+WER+P K
Sbjct  190   FAENASERFNLFVKAFSAEDNTSALAFISQAKSLVSTGAKLLQRIKTKQESMKWERFPFK  249

Query  535   FFRPYCKNPGERLQEYETPLRGMEMGLVDNNPPQFPVTVLLSSSEVKDSLDSLTGHISKQ  714
             F RPY +NPG R Q  +TPLRGME+ L   N P FP+ +   +SE+K SL  L  HISKQ
Sbjct  250   FLRPYGENPGSRFQHIQTPLRGMEIAL--ENSPSFPIEI--PNSELKSSLHMLGEHISKQ  305

Query  715   VKG-RLFDLATVPESNAQNAVKFLH--QKLQPVTLQdlssffflfslklllikpsssi-l  882
             V    L   ATVP SN +N  KF      +QP      S FF      LL    + S   
Sbjct  306   VNSISLESSATVPVSNQENTQKFFQTLHTIQPTKKHLPSLFFLFCLNLLLNKPIAPSPPK  365

Query  883   kdkdGSKEQEERFLD--KIYSNFVG-QMNNKRFVASLKYALALGLAVFFGSIYSKPDGFW  1053
             +    SK+ +E  L   K +SN++   +NNKRF+A+ K +L+LGLA+ FGSIYSK +GFW
Sbjct  366   EGSTNSKQHDEEGLSSRKTWSNYLSITINNKRFMAAFKCSLSLGLAILFGSIYSKKNGFW  425

Query  1054  AGLTVAISYVSAREATFRIANVKAQGTVLGSIYGVLGCFVFAKYEELRFISLIPWFIVCS  1233
             AGL VAIS  SAREATF++AN KAQGTVLG+IYG+LGCFVF KY ++RF+SL+PWFIV S
Sbjct  426   AGLPVAISLASAREATFKVANYKAQGTVLGTIYGILGCFVFEKYVQIRFLSLLPWFIVSS  485

Query  1234  FLRRSRMYGPAGGISACIGAVLILGREGFGPPREFAMARIMETFIGLACSITVELLFRPT  1413
             FLR+S+MYG AGGISA IGAVLILGR+GFGPP EFA+ARI ETFIGL+CSI VE+L +PT
Sbjct  486   FLRQSQMYGQAGGISAIIGAVLILGRKGFGPPSEFAIARITETFIGLSCSIMVEILLQPT  545

Query  1414  RASSLAKIQLSKSLQLLNQCIISIDYSSNNQSKLEETQKILKSSVTQLGKFIGEAEVEPN  1593
             RAS+LAK QLSKS ++L++C+ SI + S       E+Q  LK  V ++GKF+GEAE EPN
Sbjct  546   RASTLAKFQLSKSFEILHECMGSISFGS--LGNFVESQNKLKFHVNEMGKFVGEAEAEPN  603

Query  1594  FWFLPFHSACYGKLMGSLSKVVEYLHFVAQALRFLEQESA---------LMGRLDSDHLS  1746
             FWF+PFHS CY KLMGSLSK+V+ L+F +QA+ FLEQES           + +L++D   
Sbjct  604   FWFVPFHSVCYRKLMGSLSKMVDCLYFGSQAILFLEQESGEIDNFVWKETVNKLNAD-FR  662

Query  1747  LFRDHVGPSIKSFEEIISLVGSVSVLDKEFEKKKSSIDPELGKLPT-SNNITGLSDEEID  1923
             LF+D VG S+K FEE +SLV S +VLDKEFEKKK S+D ELG  PT  N I   S+EE+D
Sbjct  663   LFKDFVGSSLKCFEE-VSLVKSQAVLDKEFEKKKLSVDVELGTSPTYYNTIRSSSEEEVD  721

Query  1924  NKLKSFMEDSRQFVDQKdeddddeVMMNSQVALSLSALAFCMRGIVRETKEIDKAIKELV  2103
              K  S+ + S++ VDQ    ++       QV LSLSAL FCM  +V+ETKEI+KAIKELV
Sbjct  722   EKFSSYFQHSKELVDQIVNGEE----FKGQVVLSLSALVFCMERLVKETKEIEKAIKELV  777

Query  2104  QWENPSSPVNLHEISCKIRALAHTV  2178
             QWENPSS VNL +ISCK+RALA++V
Sbjct  778   QWENPSSHVNLLDISCKVRALANSV  802



>ref|XP_006349124.1| PREDICTED: uncharacterized protein LOC102605636 [Solanum tuberosum]
Length=816

 Score =   757 bits (1954),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 438/751 (58%), Positives = 553/751 (74%), Gaps = 29/751 (4%)
 Frame = +1

Query  4     LRGCWYAIYATCLGVCPAILSLWLIGPahlttgtaaaavaitaFIVVLPQNTHVVAKRIA  183
             LR CW A+YAT  GVCPAILSLWLIGP  LT  T + AVA++AF+VVLP+ TH++AKRIA
Sbjct  71    LRSCWLALYATIQGVCPAILSLWLIGPGRLTASTTSTAVALSAFVVVLPEKTHLIAKRIA  130

Query  184   LGQTVLVYALA---GPRTQPIMHPlrvaastaiavaacvlalllpypslassKVKHNCHL  354
             LGQ V+VY +A   G +T+P+MHP+RVAASTA+ V ACVLALLLPYP+LA  +VK    L
Sbjct  131   LGQLVIVYVIAYINGAKTEPVMHPVRVAASTAVGVVACVLALLLPYPNLACCEVKEKSKL  190

Query  355   FAENVSQRLNLLVKAFSAEDNASALSLVSQAKSLNASGAKFLQNIKSKQESMQWERYPIK  534
             F EN ++R+NL VKAFSAEDN SAL+L+SQAKSL  +G K LQ IKSKQESM+WER P K
Sbjct  191   FVENATERINLFVKAFSAEDNTSALALISQAKSLVNNGPKLLQAIKSKQESMKWERLPFK  250

Query  535   FFRPYCKNPGERLQEYETPLRGMEMGLVDNNPPQFPVTVLLSSSEVKDSLDSLTGHISKQ  714
             F RPY +NPG++ QE +TPLRGME+ L +N+P  FP+++L  + E+KD L+ L  HISKQ
Sbjct  251   FLRPYGENPGDKFQEIQTPLRGMEIAL-ENSPSIFPISIL--NIELKDGLEKLGDHISKQ  307

Query  715   VKGRLFD--LATVPESNAQNAVKFLH--QKLQPVTLQdlssffflfslkll-------li  861
             +K    D   ATVPESNA +A KFL   Q +QP      S FF      LL         
Sbjct  308   IKNMSLDESSATVPESNAYDAEKFLQTLQTIQPTKKDLPSLFFLFCLKLLLHKPSFPLSS  367

Query  862   kpsssilkdkdGSKEQ----EERFLDKIYSNFVGQMNNKRFVASLKYALALGLAVFFGSI  1029
             K    I  +  GS +Q    +E F+ K ++N    +N++RF+ S K +L+LGLA+FFGSI
Sbjct  368   KKGVDIEIESIGSNKQVDEHQEGFIKKTWNNLAITINSRRFMTSFKCSLSLGLAIFFGSI  427

Query  1030  YSKPDGFWAGLTVAISYVSAREATFRIANVKAQGTVLGSIYGVLGCFVFAKYEELRFISL  1209
             YSK +GFWAGL VAIS  + REATF++ANVKAQGTVLG++YGVLGCF+F K+ ++RF+SL
Sbjct  428   YSKENGFWAGLPVAISLAATREATFKVANVKAQGTVLGTVYGVLGCFLFEKFVQIRFLSL  487

Query  1210  IPWFIVCSFLRRSRMYGPAGGISACIGAVLILGREGFGPPREFAMARIMETFIGLACSIT  1389
             +PWFIV SFL RSRMYG AGGISA IGAVLILGR+GFGPP EFA+ARI ETFIGL+CSI 
Sbjct  488   LPWFIVSSFLSRSRMYGQAGGISAVIGAVLILGRKGFGPPSEFAIARITETFIGLSCSIM  547

Query  1390  VELLFRPTRASSLAKIQLSKSLQLLNQCIISIDYSSNNQSKLEETQKILKSSVTQLGKFI  1569
             VE+LF PTRAS+LAKIQLS + ++L++CI SI  SS+N++  EE QK LK  V +LGKFI
Sbjct  548   VEILFHPTRASTLAKIQLSNTFKILHECIDSITLSSSNKNNSEEIQKNLKLHVNELGKFI  607

Query  1570  GEAEVEPNFWFLPFHSACYGKLMGSLSKVVEYLHFVAQALRFLEQESAL---MGRLDSDH  1740
              EAE EPNFWFLPF+S CYGK++GSLSK++EYL F +QALRFL+Q S        LD+D 
Sbjct  608   AEAEAEPNFWFLPFNSGCYGKVLGSLSKMMEYLLFGSQALRFLQQHSTSSIDWNNLDAD-  666

Query  1741  LSLFRDHVGPSIKSFEEIISLVGSVSVLDKEFEKKKSSIDPELGKLPTSNNITGLSDEEI  1920
             L LF+D +  S K FEE +SLV S+++LDKEFEKKK+S+D ELGK  +S+     S    
Sbjct  667   LMLFKDLISTSTKCFEE-VSLVKSLAILDKEFEKKKNSMDLELGKKSSSSYNIRSSSSSE  725

Query  1921  DNKLKSFMEDSRQFVD---QKdeddddeVMMNSQVALSLSALAFCMRGIVRETKEIDKAI  2091
             D  L S+++ S +  D      ++ + +  +  Q+ LSLSAL FCM  +V+ETKEI+K I
Sbjct  726   DGILTSYLQHSNELGDYIVNVGDNKNSDEKLKGQLVLSLSALGFCMESLVKETKEIEKVI  785

Query  2092  KELVQWENPSSPVNLHEISCKIRALAHTVTN  2184
             K+LVQWENPS  VNL++ISCK+RALA+T TN
Sbjct  786   KDLVQWENPSCHVNLYDISCKVRALANTETN  816



>ref|XP_006350911.1| PREDICTED: uncharacterized protein LOC102585389 [Solanum tuberosum]
Length=792

 Score =   747 bits (1928),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 430/737 (58%), Positives = 539/737 (73%), Gaps = 29/737 (4%)
 Frame = +1

Query  4     LRGCWYAIYATCLGVCPAILSLWLIGPahlttgtaaaavaitaFIVVLPQNTHVVAKRIA  183
              RGCW A+YAT  GVCPAILSLWLIGPA LT GT A AVA++AF+VVLP+NTH++AKRIA
Sbjct  70    FRGCWLALYATIQGVCPAILSLWLIGPARLTAGTTAIAVALSAFVVVLPENTHLIAKRIA  129

Query  184   LGQTVLVYALA---GPRTQPIMHPlrvaastaiavaacvlalllpypslassKVKHNCHL  354
             LGQ VLVY +A   G +T+ IMHP+ VAAST + V ACVLAL+ PYP LA  +VK NC L
Sbjct  130   LGQIVLVYVIAYINGGQTETIMHPVHVAASTGLGVVACVLALIFPYPCLACCEVKQNCKL  189

Query  355   FAENVSQRLNLLVKAFSAEDNASALSLVSQAKSLNASGAKFLQNIKSKQESMQWERYPIK  534
             FAEN S+R NL VKAF+AEDN+ AL+ +SQAKSL  +G+K LQ IK+KQESM+WER+P K
Sbjct  190   FAENASERFNLFVKAFTAEDNSCALAFISQAKSLVKTGSKLLQGIKTKQESMKWERFPFK  249

Query  535   FFRPYCKNPGERLQEYETPLRGMEMGLVDNNPPQFPVTVLLSSSEVKDSLDSLTGHISKQ  714
             F RPY +NPG R ++ +TPLRGME+ L  +N P FPV +L  +S+ K  L  L  HI KQ
Sbjct  250   FLRPYGENPGSRFEDVQTPLRGMEIAL--DNSPSFPVEIL--NSDQKSVLHMLGEHIPKQ  305

Query  715   VKG-RLFDLATVPESNAQNAVKFLHQKLQPVTLQdlssffflfslklllikpsssilkdk  891
             V    L   ATVPESN +N  KF  Q LQP   +      F      LL+    +     
Sbjct  306   VNNMSLESSATVPESNQENTQKFF-QTLQPT--KKDLPSLFFLFCLNLLLNKPITNSPSS  362

Query  892   dGSKEQEERFLDKIYSNFVGQMNNKRFVASLKYALALGLAVFFGSIYSKPDGFWAGLTVA  1071
                K+Q ++   + Y +     +NKRF+A+ K +L+LGLA++FGSIYSK +GFWAGL VA
Sbjct  363   TNPKQQNQQGFFQNYLSIT--KSNKRFMAAFKCSLSLGLAIYFGSIYSKDNGFWAGLPVA  420

Query  1072  ISYVSAREATFRIANVKAQGTVLGSIYGVLGCFVFAKYEELRFISLIPWFIVCSFLRRSR  1251
             IS   +REATF++ANVKAQGTVLG+IYG+LGCFVF KY ++RF+SL+PWFIV SFLR+S 
Sbjct  421   ISLAGSREATFKVANVKAQGTVLGTIYGILGCFVFEKYVQIRFLSLLPWFIVSSFLRQST  480

Query  1252  MYGPAGGISACIGAVLILGREGFGPPREFAMARIMETFIGLACSITVELLFRPTRASSLA  1431
             MYG AGG+SA IGA+LILGR+GFG P EFA+ARI ETFIGL+CSI VE+L +PTRA++LA
Sbjct  481   MYGQAGGLSAIIGALLILGRKGFGLPSEFAIARITETFIGLSCSIIVEILLQPTRATTLA  540

Query  1432  KIQLSKSLQLLNQCIISIDYSSNNQSKLEETQKILKSSVTQLGKFIGEAEVEPNFWFLPF  1611
             K+QLSKS ++LN+ I  I + S     L E+Q  LKS + ++GKFI EAE EPNFWF+PF
Sbjct  541   KLQLSKSFEILNESISLISFGSIGN--LVESQNKLKSHIIEMGKFIAEAEAEPNFWFVPF  598

Query  1612  HSACYGKLMGSLSKVVEYLHFVAQALRFLEQESA-----LMGRLDSDHLSLFRDHVGPSI  1776
             HS CY KLMGSL+K++EYLHF +QA   LEQES       + +LD D + LF+D VG S+
Sbjct  599   HSVCYRKLMGSLTKMLEYLHFGSQAFMLLEQESGGAIDNFVHKLDGD-IKLFKDFVGSSM  657

Query  1777  KSFEEIISLVGSVSVLDKEFEKKKSSIDPELGKLPTS---NNITGLSDEEIDNKLKSFME  1947
             K FEE +SLV S+ +LDKEFEKKK S+D ELG   +S   N I   S+EEID   +S+ E
Sbjct  658   KCFEE-VSLVKSLEILDKEFEKKKLSVDVELGTSQSSSYCNIIRYASEEEIDENFRSYFE  716

Query  1948  DSRQFVDQKdeddddeVMMNSQVALSLSALAFCMRGIVRETKEIDKAIKELVQWENPSSP  2127
              S++FVDQ    ++    +  QV LSLSAL FCM G+V+ETKEI+KAIKE+VQWENPSS 
Sbjct  717   HSKEFVDQIVNGEE----LKGQVVLSLSALGFCMDGLVKETKEIEKAIKEVVQWENPSSH  772

Query  2128  VNLHEISCKIRALAHTV  2178
             VNLH+ISCK+RALA+ +
Sbjct  773   VNLHDISCKVRALANII  789



>ref|XP_009793175.1| PREDICTED: uncharacterized protein LOC104240093 [Nicotiana sylvestris]
Length=804

 Score =   746 bits (1925),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 433/745 (58%), Positives = 539/745 (72%), Gaps = 32/745 (4%)
 Frame = +1

Query  4     LRGCWYAIYATCLGVCPAILSLWLIGPahlttgtaaaavaitaFIVVLPQNTHVVAKRIA  183
              RGCW+A+YAT  GVCPAILSLWLIGPA LT  T A AVA++AF+VVLP+NTH++AKRIA
Sbjct  70    FRGCWHALYATIQGVCPAILSLWLIGPARLTASTTAMAVALSAFVVVLPENTHLLAKRIA  129

Query  184   LGQTVLVYALA---GPRTQPIMHPlrvaastaiavaacvlalllpypslassKVKHNCHL  354
             LGQ VLVY +A   G +T+ IMHP+ VA ST + V ACVLAL+ PYPSLA  +VK NC L
Sbjct  130   LGQIVLVYVIAYINGGQTETIMHPVHVATSTGLGVVACVLALIFPYPSLACCEVKKNCKL  189

Query  355   FAENVSQRLNLLVKAFSAEDNASALSLVSQAKSLNASGAKFLQNIKSKQESMQWERYPIK  534
             FAEN  +R NL VKAFSAEDN S L+ +SQAKSL ++GAK LQ IK+KQESM+WER+P K
Sbjct  190   FAENALERFNLFVKAFSAEDNISTLAFISQAKSLVSTGAKLLQRIKTKQESMKWERFPFK  249

Query  535   FFRPYCKNPGERLQEYETPLRGMEMGLVDNNPPQFPVTVLLSSSEVKDSLDSLTGHISKQ  714
             F RPY +NPG R Q  +TPLRGME+ L   N P FP+ +   +SE+K  L  L  HISKQ
Sbjct  250   FLRPYGENPGSRFQHLQTPLRGMEIAL--ENSPSFPIEI--PNSELKSGLHMLGEHISKQ  305

Query  715   VKG-RLFDLATVPESNAQNAVKFLH--QKLQPVTLQdlssffflfslklllikpsssilk  885
             V    L   ATVPES+ +N  KF       QP      S FF      LL    +    K
Sbjct  306   VNSISLESSATVPESSPENTQKFFQILHTTQPTKKHLPSLFFLFCLNLLLNKPIAPPPPK  365

Query  886   dkdGSKEQ---EERFLDKIYSNFVGQ-MNNKRFVASLKYALALGLAVFFGSIYSKPDGFW  1053
             +   + +Q   EE F  K +SN++   +NNKRF+A+ K +L+LGLA+ FGSIYSK +GFW
Sbjct  366   EGSTNSKQHDEEELFSRKTWSNYLSSTINNKRFMAAFKCSLSLGLAILFGSIYSKENGFW  425

Query  1054  AGLTVAISYVSAREATFRIANVKAQGTVLGSIYGVLGCFVFAKYEELRFISLIPWFIVCS  1233
             AGL VA+S   AREATF++AN KAQGTVLGSIYG+LGCF F KY ++RF+SL+PWFIV S
Sbjct  426   AGLPVAVSLAGAREATFKVANYKAQGTVLGSIYGILGCFAFEKYVQIRFLSLLPWFIVSS  485

Query  1234  FLRRSRMYGPAGGISACIGAVLILGREGFGPPREFAMARIMETFIGLACSITVELLFRPT  1413
             FLR+S+MYG AGGISA +GAVLILGR+GFGPP EFA+ARI ETFIGL+CSI VE+L +PT
Sbjct  486   FLRQSKMYGQAGGISAIVGAVLILGRKGFGPPSEFAIARITETFIGLSCSIMVEILLQPT  545

Query  1414  RASSLAKIQLSKSLQLLNQCIISIDYSSNNQSKLEETQKILKSSVTQLGKFIGEAEVEPN  1593
             RAS+LAK QLSKS ++L++CI S+ + S     L ETQ  LK  V ++ KF+GEAE EPN
Sbjct  546   RASTLAKFQLSKSFEILHECIGSMSFGS--LGNLVETQNKLKFHVNKMEKFVGEAEAEPN  603

Query  1594  FWFLPFHSACYGKLMGSLSKVVEYLHFVAQALRFLEQESA---------LMGRLDSDHLS  1746
             FWF+PF+SACY KLMGSLSK+V+ L+F +QA+ FLEQES           + +LD+D + 
Sbjct  604   FWFVPFNSACYRKLMGSLSKMVDCLYFGSQAILFLEQESGGIDNFVWRETVNKLDADFM-  662

Query  1747  LFRDHVGPSIKSFEEIISLVGSVSVLDKEFEKKKSSIDPELGKLPT-SNNITGLSDEEID  1923
             LF+D +G  +K FEE +SLV S++VLD EFEKKK S+D ELG  PT  N I   S+EEID
Sbjct  663   LFKDFIGSFMKCFEE-VSLVKSLTVLDNEFEKKKLSVDVELGTSPTYYNTIRSSSEEEID  721

Query  1924  NKLKSFMEDSRQFVDQKdeddddeVMMNSQVALSLSALAFCMRGIVRETKEIDKAIKELV  2103
                 S+ + S++ VDQ    ++       QV LSLSALAFCM  +V+ETKEI++AIKELV
Sbjct  722   ENFSSYFQHSKELVDQIVNGEES----KGQVVLSLSALAFCMERLVKETKEIEEAIKELV  777

Query  2104  QWENPSSPVNLHEISCKIRALAHTV  2178
             QWENPSS VN+ +IS K+RALA++V
Sbjct  778   QWENPSSHVNMQDISSKVRALANSV  802



>emb|CDP09027.1| unnamed protein product [Coffea canephora]
Length=825

 Score =   686 bits (1771),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 407/745 (55%), Positives = 526/745 (71%), Gaps = 42/745 (6%)
 Frame = +1

Query  4     LRGCWYAIYATCLGVCPAILSLWLIGPahlttgtaaaavaitaFIVVLPQNTHVVAKRIA  183
              RGCW+A+YA+  GVCPAILSLWL+GPA LT  T A AVA+TAF+VVLP+N+H+++KRIA
Sbjct  70    FRGCWHALYASVFGVCPAILSLWLMGPAQLTISTTAVAVALTAFVVVLPENSHLISKRIA  129

Query  184   LGQTVLVYALA---GPRTQPIMHPlrvaastaiavaacvlalllpypslassKVKHNCHL  354
             LGQTV++Y LA   G +T PIMHP+ V ASTA+   A VLALLLPYPSLA  +VK    L
Sbjct  130   LGQTVVLYVLAFVNGSKTDPIMHPIHVLASTAVGAVASVLALLLPYPSLACCEVKKKFKL  189

Query  355   FAENVSQRLNLLVKAFSAEDNASALSLVSQAKSLNASGAKFLQNIKSKQESMQWERYPIK  534
             +A+N S+R+ +L+KAFSA+D  SA +L+ Q+KSL  +G K L++IKSKQESM W R P+K
Sbjct  190   YAKNASERVGVLMKAFSAQDKTSAQALILQSKSLARTGTKLLRSIKSKQESMLWGRLPLK  249

Query  535   FFRPYCKNPGERLQEYETPLRGMEMGLVDNNPPQFPVTVLLSSSEVKDSLDSLTGHISKQ  714
             F +PYC NPG+ LQE ETPLRGME+ L +   P FP        E KD L  +  HIS+Q
Sbjct  250   FLKPYCMNPGQILQEIETPLRGMEIALSNGAVP-FP--------ERKDDLAGIEEHISRQ  300

Query  715   VKGRLFDLAT-VPESNAQNAVKFLHQKLQPVTLQdlssff-------flfslklllikps  870
             +K     LAT VPE+NA+N  + L Q LQ V                 L   KL+     
Sbjct  301   IKSMPLVLATTVPEANAENVAESL-QTLQTVPTDHRQLPSIFFFFCLKLLQAKLVTTSAI  359

Query  871   ssilkdkdGSKEQEERFLDKIYSNFVGQMNNKRFVASLKYALALGLAVFFGSIYSKPDGF  1050
             SSI +   G ++QE+ F  +I+ N    +N  R + + K +L+LGLAVFFGS+YSK +G 
Sbjct  360   SSIKEGSTGPEKQEKWFFIRIWRNLSININKSRLMPAFKCSLSLGLAVFFGSLYSKENGI  419

Query  1051  WAGLTVAISYVSAREATFRIANVKAQGTVLGSIYGVLGCFVFAKYEELRFISLIPWFIVC  1230
             WAGL VAIS  SAREATF++ANVKAQGTV+G++YGV GCF+F KY  ++ +SL+PWFI C
Sbjct  420   WAGLPVAISLASAREATFKVANVKAQGTVIGTVYGVFGCFIFGKYVPIQLLSLLPWFIFC  479

Query  1231  SFLRRSRMYGPAGGISACIGAVLILGREGFGPPREFAMARIMETFIGLACSITVELLFRP  1410
             SFLRRSRMYG AGGISA IGAVL+LGR+ FGPP EFA+ARI ETFIGL+CSI VEL+ +P
Sbjct  480   SFLRRSRMYGQAGGISAVIGAVLLLGRKNFGPPSEFAIARITETFIGLSCSIVVELVLQP  539

Query  1411  TRASSLAKIQLSKSLQLLNQCIISIDYSSNNQSKLEETQKILKSSVTQLGKFIGEAEVEP  1590
             TRAS+LAK+QLSK+ + +   I ++  ++ +++ LEE+ K LK  V +LGK IGEAEVEP
Sbjct  540   TRASALAKVQLSKNFEAMRNSIGAVSLTA-SKANLEESLKRLKLQVNELGKLIGEAEVEP  598

Query  1591  NFWFLPFHSACYGKLMGSLSKVVEYLHFVAQALRFLEQESALMGRLDSD-----------  1737
             NFWFLPF+SACY KL  SLS++VE+L F+ QA++FL QES   GR+D++           
Sbjct  599   NFWFLPFNSACYRKLWVSLSEMVEFLLFITQAIQFLHQES---GRVDTNLWKESMSKINA  655

Query  1738  HLSLFRDHVGPSIKSFEEIISLVGSVSVLDKEFEKKKSSIDPELGKLPTSNNITGL--SD  1911
              L  F++ V  SIK FEE +SLV S+ +LDKE E+K  S+D E GK P   ++  L  SD
Sbjct  656   DLKNFKETVDSSIKCFEE-VSLVKSLVLLDKEMERKNISLDLESGKSPKIPSMMKLPGSD  714

Query  1912  EE--IDNKLKSFMEDSRQFVDQKdeddddeVMMNSQVALSLSALAFCMRGIVRETKEIDK  2085
             EE  ID  L  +++   +F++     D  E  + S++AL+LS + FCMRG+VRET+EI+K
Sbjct  715   EEVIIDKTLSHYLQHCNEFLE-AIRADKGERELKSRIALTLSCIGFCMRGLVRETREIEK  773

Query  2086  AIKELVQWENPSSPVNLHEISCKIR  2160
             AIKELVQWENPSS VNLH+IS KIR
Sbjct  774   AIKELVQWENPSSLVNLHDISSKIR  798



>ref|XP_011082333.1| PREDICTED: uncharacterized protein LOC105165136 [Sesamum indicum]
Length=817

 Score =   681 bits (1756),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 403/758 (53%), Positives = 535/758 (71%), Gaps = 42/758 (6%)
 Frame = +1

Query  1     ALRGCWYAIYATCLGVCPAILSLWLIGPahlttgtaaaavaitaFIVVLPQNTHVVAKRI  180
              LRGCW A+YAT  GVCPAILSLWLIGPA LT  T A  VAI+AF+VVLP+NTH+++KRI
Sbjct  70    TLRGCWLALYATVQGVCPAILSLWLIGPARLTNSTTAVVVAISAFVVVLPENTHLISKRI  129

Query  181   ALGQTVLVYALA---GPRTQPIMHPlrvaastaiavaacvlalllpypslassKVKHNCH  351
             ALGQ V+VY +A   G +T+PIMHP+ VAASTA+ V ACVLALLLPYPSLA  +V+ NC 
Sbjct  130   ALGQIVIVYVIAFINGAKTEPIMHPVHVAASTAVGVVACVLALLLPYPSLACLEVRENCK  189

Query  352   LFAENVSQRLNLLVKAFSAEDNASALSLVSQAKSLNASGAKFLQNIKSKQESMQWERYPI  531
             L+ EN S+RL LLVKAFSAED     +L+SQAKSLN +G K LQ IKSKQESMQWE  P 
Sbjct  190   LYIENASERLKLLVKAFSAEDKTLPKALISQAKSLNNTGNKLLQRIKSKQESMQWEIIPG  249

Query  532   KFFRPYCKNPGERLQEYETPLRGMEMGLVDNNPPQFPVTVLLSSSEVKDSLDSLTGHISK  711
             KF + Y KNPGE LQ  ET LRGME  +   N  +FPV +L  +SE+K+ L +L   I  
Sbjct  250   KFLKSYKKNPGETLQGLETILRGMENAV--ENCSEFPVGIL--NSELKNDLTNLQEKILN  305

Query  712   QVKGRLFDLATVPESNAQNAVKFLHQKLQPVTLQdls---------------sffflfsl  846
             QVK    + + +P+S+ +   KF  Q LQ  T   +S                     S 
Sbjct  306   QVKSMALENSILPQSDIEKENKFF-QTLQTNTTPLISWKDLPSMFFIFCLKLILQAKSSA  364

Query  847   klllikpsssilkdkdGSKEQEERFLDKIYSNFVGQMNNKRFVASLKYALALGLAVFFGS  1026
                    ++S  +  + S++++  FL K++SN    ++ +R + +L+ +L+LG A+ FG 
Sbjct  365   PTTSPDTANSAKQAANDSQKKKGLFLSKLWSNSPITISRRRLMPALRCSLSLGFAILFGL  424

Query  1027  IYSKPDGFWAGLTVAISYVSAREATFRIANVKAQGTVLGSIYGVLGCFVFAKYEELRFIS  1206
             IYSK +GFW+GL VAIS  SAREATF++AN+KAQGTVLG++YGV+GCF+F KY ++RFIS
Sbjct  425   IYSKENGFWSGLPVAISLASAREATFKVANIKAQGTVLGTVYGVIGCFIFEKYVKIRFIS  484

Query  1207  LIPWFIVCSFLRRSRMYGPAGGISACIGAVLILGREGFGPPREFAMARIMETFIGLACSI  1386
             L+PWFI  SFLR+SRMYG AGGISA IGAVLILGR+ FG P++FA+ARI+ETFIGL+CSI
Sbjct  485   LLPWFIFSSFLRQSRMYGQAGGISAVIGAVLILGRKNFGTPKDFAIARIVETFIGLSCSI  544

Query  1387  TVELLFRPTRASSLAKIQLSKSLQLLNQCIISIDYSSNNQSKLEETQKILKSSVTQLGKF  1566
              V++L +P RA+ LAK+QLSK+LQ L++ + SI   S+++  LEE  K LKS VT+LGKF
Sbjct  545   MVDILLQPKRAAVLAKVQLSKTLQSLHESVSSITIGSSSRFILEERLKQLKSHVTELGKF  604

Query  1567  IGEAEVEPNFWFLPFHSACYGKLMGSLSKVVEYLHFVAQALRFLEQESALM---------  1719
             I EAEVEPNFWFLPFHSACY KL  SLS++V++L FV+ ALRFLEQES  +         
Sbjct  605   IEEAEVEPNFWFLPFHSACYSKLKLSLSRMVDFLLFVSHALRFLEQESQKLDTKSWKEAA  664

Query  1720  GRLDSDHLSLFRDHVGPSIKSFEEIISLVGSVSVLDKEFEKKKSSIDPELGK-----LPT  1884
              +L++D L L RD V   IK FEE ++L+ S++ +++E+EK+KSSID E+GK     +  
Sbjct  665   DKLETD-LKLMRDEVCSGIKCFEE-VNLIKSLATVEREYEKRKSSIDLEMGKSGKLCVIQ  722

Query  1885  SNNITGLSDEEIDNKLKSFMEDSRQFVDQKdeddddeVMMNSQVALSLSALAFCMRGIVR  2064
              ++ +  +D+EI     S ++D  + VD + + ++    M ++V LS+SA+ FCM G+++
Sbjct  723   CSSGSDDNDDEIKKSRNSVLQDLNELVDVERDGEEA---MKNEVILSVSAVVFCMDGVLK  779

Query  2065  ETKEIDKAIKELVQWENPSSPVNLHEISCKIRALAHTV  2178
             E+KEI KAIKELVQWENPS+ V+L+ I CK+RAL  +V
Sbjct  780   ESKEIGKAIKELVQWENPSTQVDLNVILCKLRALEKSV  817



>ref|XP_002531370.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF31018.1| conserved hypothetical protein [Ricinus communis]
Length=805

 Score =   669 bits (1726),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 411/746 (55%), Positives = 523/746 (70%), Gaps = 38/746 (5%)
 Frame = +1

Query  4     LRGCWYAIYATCLGVCPAILSLWLIGPahlttgtaaaavaitaFIVVLPQNTHVVAKRIA  183
             L GCW A+YAT   + PA+LSLWLIGPA  T+GT + AVA+ AF+V LP+ TH++AKRIA
Sbjct  71    LHGCWLALYATFQSLGPAMLSLWLIGPARFTSGTISLAVALGAFVVALPEGTHLIAKRIA  130

Query  184   LGQTVLVYALA---GPRTQPIMHPlrvaastaiavaacvlalllpypslassKVKHNCHL  354
             LGQ V+VY +A   G  TQPIMHPL VAASTA+ V AC+LALLLPYP LA  +VK NC L
Sbjct  131   LGQIVIVYVIAFINGVHTQPIMHPLHVAASTAVGVLACMLALLLPYPRLACWEVKENCKL  190

Query  355   FAENVSQRLNLLVKAFSAEDNASALSLVSQAKSLNASGAKFLQNIKSKQESMQWERYPIK  534
              AEN S+RL L VKAF+AED A ALS +SQAK L ++G K LQNIK  Q SM+WER P K
Sbjct  191   LAENASKRLKLYVKAFAAEDGALALSSISQAKLLASAGTKLLQNIKRYQGSMKWERLPFK  250

Query  535   FFRPYCKNPGERLQEYETPLRGMEMGLVDNNPPQFPVTVLLSSSEVKDSLDSLTGHIS--  708
             F R Y  NPGE+LQE E PL+GMEM L   +   FPV   ++  E K+SL  L  H+S  
Sbjct  251   FLRHYYMNPGEKLQELEIPLKGMEMALTGIS--SFPVK--MAEGETKESLQ-LEEHVSLT  305

Query  709   -KQVKGRL-FDLATVPESNAQNAVKFLHQKLQPV-----TLQdlssffflfslklllikp  867
              KQ+K  L  D  TVPES A+  ++ L Q LQ +      L  L   F +  L    +  
Sbjct  306   LKQIKNCLPCDSLTVPESKAETIIESL-QTLQIIPKATQDLSSLFFLFCMKLLHCKPLPK  364

Query  868   sssilkdkdGSKEQEER--FLDKIYSNFVGQMNNKRFVASLKYALALGLAVFFGSIYSKP  1041
              +S  ++ +GS    ++  FLD I++N+   + +KR + + K +L+LGLA+ FG +YSK 
Sbjct  365   QTSSKQESEGSTTSSKKNSFLDSIWTNWAMNVRSKRLMPAFKCSLSLGLAILFGLLYSKE  424

Query  1042  DGFWAGLTVAISYVSAREATFRIANVKAQGTVLGSIYGVLGCFVFAKYEELRFISLIPWF  1221
             +GFW+GL VAIS  ++REATF++ANVKAQGTVLG++YGVLGCFVF ++  +RF+SL+PWF
Sbjct  425   NGFWSGLPVAISLAASREATFKVANVKAQGTVLGTVYGVLGCFVFERFMPIRFLSLLPWF  484

Query  1222  IVCSFLRRSRMYGPAGGISACIGAVLILGREGFGPPREFAMARIMETFIGLACSITVELL  1401
             I+ SFLRRSRMYG AGGISA IGAVLILGR+GFGPP EFA+ARI ETFIGL+CSI VEL+
Sbjct  485   ILTSFLRRSRMYGQAGGISAAIGAVLILGRKGFGPPSEFAIARITETFIGLSCSIMVELI  544

Query  1402  FRPTRASSLAKIQLSKSLQLLNQCIISIDYSSNNQSKLEETQKILKSSVTQLGKFIGEAE  1581
              +PTRA+SLAK+QL+KSL  L+ CI SI   +N    L E Q+ LK  V++L KFIGEAE
Sbjct  545   LQPTRAASLAKVQLTKSLGSLSACIGSISLEAN---LLVENQRRLKLEVSELKKFIGEAE  601

Query  1582  VEPNFWFLPFHSACYGKLMGSLSKVVEYLHFVAQALRFLEQESALMG--------RLDSD  1737
             VEPNFWFLPFHSACYGKL GSLSK+V+ L F A A+ FL+QES   G        +LD D
Sbjct  602   VEPNFWFLPFHSACYGKLFGSLSKMVDLLLFSAHAVGFLQQESQKYGASWKEFVNKLDGD  661

Query  1738  HLSLFRDHVGPSIKSFEEIISLVGSVSVLDKEFEKKKSSIDPELGKLPTSN--NITGLSD  1911
              L LF++ VG  IK  E+ ++L+ S++ LDKE E +K S DPELG  P SN   I+G ++
Sbjct  662   -LELFKEMVGSLIKCLED-VTLLKSLTFLDKELENRKLSYDPELGNKPNSNIFRISGPNE  719

Query  1912  E-EIDNKLKSFMEDSRQFVDQKdeddddeVMMNSQVALSLSALAFCMRGIVRETKEIDKA  2088
             E EI + + S+++ S++ VD+    +D E    SQ+ L+L AL FCM   ++E +E+ K 
Sbjct  720   EDEIGSIMHSYLQHSKEVVDKLHAVEDKE--QKSQMVLNLGALGFCMNNFIKEARELQKG  777

Query  2089  IKELVQWENPSSPVNLHEISCKIRAL  2166
             I+ELVQWENP   VNL EISCKI AL
Sbjct  778   IQELVQWENPGKDVNLLEISCKIAAL  803



>ref|XP_006424787.1| hypothetical protein CICLE_v10030119mg [Citrus clementina]
 gb|ESR38027.1| hypothetical protein CICLE_v10030119mg [Citrus clementina]
Length=804

 Score =   663 bits (1710),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 408/743 (55%), Positives = 528/743 (71%), Gaps = 30/743 (4%)
 Frame = +1

Query  1     ALRGCWYAIYATCLGVCPAILSLWLIGPahlttgtaaaavaitaFIVVLPQNTHVVAKRI  180
              L GCW A+YAT   V PAILSL LIGPA  T+ T A AVA+ A++V LP+ TH+ AKRI
Sbjct  69    TLHGCWMALYATVQTVGPAILSLKLIGPARFTSTTTALAVALAAYVVALPEGTHMKAKRI  128

Query  181   ALGQTVLVYALA---GPRTQPIMHPlrvaastaiavaacvlalllpypslassKVKHNCH  351
             ALGQ V+ Y +    G RT+ +MHPL VAASTA+ V ACVLALLLPYP LA  +VK NC 
Sbjct  129   ALGQIVITYVIGFVNGERTEAVMHPLHVAASTAVGVFACVLALLLPYPRLACRQVKKNCK  188

Query  352   LFAENVSQRLNLLVKAFSAEDNASALSLVSQAKSLNASGAKFLQNIKSKQESMQWERYPI  531
             L +EN S+RL L VKAF AEDN SAL+ +SQAK L   G KF+QNIK  QESM+WER P+
Sbjct  189   LLSENSSERLKLYVKAFCAEDNTSALASISQAKLLTIGGTKFIQNIKRYQESMKWERLPL  248

Query  532   KFFRPYCKNPGERLQEYETPLRGMEMGLVDNNPPQFPVTVLLSSSEVKDSLDSLTGHISK  711
             KF R Y  NPGE+LQ+ E PL+GM+M +   +   FPV +L    E+K+ +  L  HIS 
Sbjct  249   KFLRSYYMNPGEKLQDLEIPLKGMQMAV--TSVTSFPVQIL--DGELKECVKKLDEHISL  304

Query  712   QVK-GRLFDLATVPESNAQNAVKFLHQKLQ--PVTLQdlssffflfslklllikpsssil  882
              +K  +  D  TVPESNA++ +KFL Q LQ  P T Q+LSS+FFLF +KLL  K S +  
Sbjct  305   TIKQAQSCDSLTVPESNAEDIMKFL-QTLQNIPTTTQELSSYFFLFCMKLLQWKSSPNQS  363

Query  883   kdkdGSKEQEER-------FLDKIYSNFVGQMNNKRFVASLKYALALGLAVFFGSIYSKP  1041
              +       +E           +++SN+  ++ +KR V + K +L+LGLAV FG +YSKP
Sbjct  364   TNCLKDDTVKEYEGSSNGFSFKEVWSNWSMKVKSKRLVPAFKCSLSLGLAVLFGLLYSKP  423

Query  1042  DGFWAGLTVAISYVSAREATFRIANVKAQGTVLGSIYGVLGCFVFAKYEELRFISLIPWF  1221
             +G W+GL VAIS+ +AREATF++AN+KAQGTVLG++YGVLGCF+F ++  +RF+SLIPWF
Sbjct  424   NGIWSGLPVAISFAAAREATFKVANIKAQGTVLGTVYGVLGCFLFERFLPIRFLSLIPWF  483

Query  1222  IVCSFLRRSRMYGPAGGISACIGAVLILGREGFGPPREFAMARIMETFIGLACSITVELL  1401
             I  +FLRRSRMYG AGGISA IGAVLILGR+ FGPP EFA+ARI+ETFIGL+CSI ++LL
Sbjct  484   IFTAFLRRSRMYGQAGGISAVIGAVLILGRKNFGPPSEFAIARIVETFIGLSCSIMIDLL  543

Query  1402  FRPTRASSLAKIQLSKSLQLLNQCIISIDYSSNNQSKLEETQKILKSSVTQLGKFIGEAE  1581
             F+PTRAS+LAK+QLSKSL  L+ CI S+   S +Q+ L E QK LK  VT+L KFIGEAE
Sbjct  544   FQPTRASTLAKVQLSKSLATLHDCIGSMSLQS-SQASLLENQKRLKMQVTELAKFIGEAE  602

Query  1582  VEPNFWFLPFHSACYGKLMGSLSKVVEYLHFVAQALRFLEQESALMG--------RLDSD  1737
             VEPNFWF PFH ACY KL+G+L+K+V+ L F A ++ FLEQ+S  +          LDSD
Sbjct  603   VEPNFWFFPFHIACYSKLLGTLTKMVDLLLFAAHSVGFLEQDSQRIATSWKNEVHELDSD  662

Query  1738  HLSLFRDHVGPSIKSFEEIISLVGSVSVLDKEFEKKKSSIDPELGKLPTSNNITGLSDEE  1917
              L L ++ VGPSIK FE++ + + S++ ++KE EK   S D ELGK    N I+ L +  
Sbjct  663   -LELLKEKVGPSIKFFEDVTT-IKSLATIEKELEKNNISYDLELGKSKNPNGISDLDEAA  720

Query  1918  IDNKLKSFMEDSRQFVDQKdeddddeVMMNSQVALSLSALAFCMRGIVRETKEIDKAIKE  2097
             +   + S+++ +++ VD K +  + E  + SQV LSLSAL +C++G++RETK I++ IKE
Sbjct  721   MGKLICSYLQHAKELVD-KIKATEGEKELRSQVVLSLSALGYCIQGLIRETKLIEEGIKE  779

Query  2098  LVQWENPSSPVNLHEISCKIRAL  2166
             LVQWENPSS VNL EISCKI AL
Sbjct  780   LVQWENPSSNVNLLEISCKINAL  802



>ref|XP_006488660.1| PREDICTED: uncharacterized protein LOC102613508 [Citrus sinensis]
Length=804

 Score =   662 bits (1708),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 407/743 (55%), Positives = 527/743 (71%), Gaps = 30/743 (4%)
 Frame = +1

Query  1     ALRGCWYAIYATCLGVCPAILSLWLIGPahlttgtaaaavaitaFIVVLPQNTHVVAKRI  180
              L GCW A+YAT   V PAILSL LIGPA  T+ T A AVA+ A++V LP+ TH+ AKRI
Sbjct  69    TLHGCWMALYATVQTVGPAILSLKLIGPARFTSTTTALAVALAAYVVALPEGTHMKAKRI  128

Query  181   ALGQTVLVYALA---GPRTQPIMHPlrvaastaiavaacvlalllpypslassKVKHNCH  351
             ALGQ V+ Y +    G RT+ +MHPL VAASTA+ V ACVLALLLPYP LA  +VK NC 
Sbjct  129   ALGQIVITYVIGFVNGERTEAVMHPLHVAASTAVGVFACVLALLLPYPRLACRQVKKNCK  188

Query  352   LFAENVSQRLNLLVKAFSAEDNASALSLVSQAKSLNASGAKFLQNIKSKQESMQWERYPI  531
             L +EN S+RL L VKAF AEDN SAL+ +SQAK L   G KF+QNIK  QESM+WER P+
Sbjct  189   LLSENSSERLKLYVKAFCAEDNTSALASISQAKLLTIGGTKFIQNIKRYQESMKWERLPL  248

Query  532   KFFRPYCKNPGERLQEYETPLRGMEMGLVDNNPPQFPVTVLLSSSEVKDSLDSLTGHISK  711
             KF R Y   PGE+LQ+ E PL+GM+M +   +   FPV +L    E+K+ +  L  HIS 
Sbjct  249   KFLRSYYMKPGEKLQDLEIPLKGMQMAV--TSVTSFPVQIL--DGELKECVKKLDEHISL  304

Query  712   QVK-GRLFDLATVPESNAQNAVKFLHQKLQ--PVTLQdlssffflfslklllikpsssil  882
              +K  +  D  TVPESNA++ +KFL Q LQ  P T Q+LSS+FFLF +KLL  K S +  
Sbjct  305   TIKQAQSCDSLTVPESNAEDIMKFL-QTLQNIPTTTQELSSYFFLFCMKLLQWKSSPNQS  363

Query  883   kdkdGSKEQEER-------FLDKIYSNFVGQMNNKRFVASLKYALALGLAVFFGSIYSKP  1041
              +       +E           +++SN+  ++ +KR V + K +L+LGLAV FG +YSKP
Sbjct  364   TNCLKDDTVKEYEGSSNGFSFKEVWSNWSMKVKSKRLVPAFKCSLSLGLAVLFGLLYSKP  423

Query  1042  DGFWAGLTVAISYVSAREATFRIANVKAQGTVLGSIYGVLGCFVFAKYEELRFISLIPWF  1221
             +G W+GL VAIS+ +AREATF++AN+KAQGTVLG++YGVLGCF+F ++  +RF+SLIPWF
Sbjct  424   NGIWSGLPVAISFAAAREATFKVANIKAQGTVLGTVYGVLGCFLFERFLPIRFLSLIPWF  483

Query  1222  IVCSFLRRSRMYGPAGGISACIGAVLILGREGFGPPREFAMARIMETFIGLACSITVELL  1401
             I  +FLRRSRMYG AGGISA IGAVLILGR+ FGPP EFA+ARI+ETFIGL+CSI ++LL
Sbjct  484   IFTAFLRRSRMYGQAGGISAVIGAVLILGRKNFGPPSEFAIARIVETFIGLSCSIMIDLL  543

Query  1402  FRPTRASSLAKIQLSKSLQLLNQCIISIDYSSNNQSKLEETQKILKSSVTQLGKFIGEAE  1581
             F+PTRAS+LAK+QLSKSL  L+ CI S+   S +Q+ L E QK LK  VT+L KFIGEAE
Sbjct  544   FQPTRASTLAKVQLSKSLATLHDCIGSMSLQS-SQASLLENQKRLKMQVTELAKFIGEAE  602

Query  1582  VEPNFWFLPFHSACYGKLMGSLSKVVEYLHFVAQALRFLEQESALMG--------RLDSD  1737
             VEPNFWF PFH ACY KL+G+L+K+V+ L F A ++ FLEQ+S  +          LDSD
Sbjct  603   VEPNFWFFPFHIACYSKLLGTLTKMVDLLLFAAHSVGFLEQDSQRIATSWKNEVHELDSD  662

Query  1738  HLSLFRDHVGPSIKSFEEIISLVGSVSVLDKEFEKKKSSIDPELGKLPTSNNITGLSDEE  1917
              L L ++ VGPSIK FE++ + + S++ ++KE EK   S D ELGK    N I+ L +  
Sbjct  663   -LELLKEKVGPSIKCFEDVTT-IKSLATIEKELEKNNISYDLELGKSKNPNGISDLDEAA  720

Query  1918  IDNKLKSFMEDSRQFVDQKdeddddeVMMNSQVALSLSALAFCMRGIVRETKEIDKAIKE  2097
             +   + S+++ +++ VD K +  + E  + SQV LSLSAL +C++G++RETK I++ IKE
Sbjct  721   MGKLICSYLQHAKELVD-KIKATEGEKELRSQVVLSLSALGYCIQGLIRETKLIEEGIKE  779

Query  2098  LVQWENPSSPVNLHEISCKIRAL  2166
             LVQWENPSS VNL EISCKI AL
Sbjct  780   LVQWENPSSNVNLLEISCKINAL  802



>ref|XP_007016476.1| P-hydroxybenzoic acid efflux pump subunit aaeB [Theobroma cacao]
 gb|EOY34095.1| P-hydroxybenzoic acid efflux pump subunit aaeB [Theobroma cacao]
Length=815

 Score =   655 bits (1690),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 414/750 (55%), Positives = 528/750 (70%), Gaps = 38/750 (5%)
 Frame = +1

Query  1     ALRGCWYAIYATCLGVCPAILSLWLIGPahlttgtaaaavaitaFIVVLPQNTHVVAKRI  180
              L GCW A+YA+   + PA+LSLWLIGPA LT GT A AVA+   +VVLP++TH+VAKRI
Sbjct  69    TLHGCWLALYASVQSLGPAMLSLWLIGPAKLTDGTTALAVALGGMVVVLPESTHLVAKRI  128

Query  181   ALGQTVLVYALA---GPRTQPIMHPlrvaastaiavaacvlalllpypslassKVKHNCH  351
             ALGQ V+VY +    G +T+PIMHP+ VAASTA  V ACVLALLLPYP LA  + K NC 
Sbjct  129   ALGQIVIVYVIGFINGGQTEPIMHPVHVAASTAAGVLACVLALLLPYPRLACCEAKRNCK  188

Query  352   LFAENVSQRLNLLVKAFSAEDNASALSLVSQAKSLNASGAKFLQNIKSKQESMQWERYPI  531
             L AEN SQRL L VKA  AEDNA+A + +SQAK L A+G K LQ IK  Q SM+WE+ P 
Sbjct  189   LLAENGSQRLKLFVKALCAEDNAAASASISQAKMLTAAGTKLLQRIKRFQGSMKWEKLPF  248

Query  532   KFFRPYCKNPGERLQEYETPLRGMEMGLVDNNPPQFPVTVLLSSSEVKDSLDSLTGHIS-  708
             KF RPY  N GE+LQ+ E  LRGMEM L   + P FP  +     E+KD L  L  HIS 
Sbjct  249   KFLRPYYMNSGEKLQDIEIALRGMEMAL--ESTPSFPGRMF--DGELKDGLLKLEEHISL  304

Query  709   --KQVKGRL-FDLATVPESNAQNAVKFLHQKLQ--PVTLQdlssffflfslklllikpss  873
               KQ K  L  D  T+PESNA++  KFL Q LQ  P T QDL  FFFLF +KLL  K   
Sbjct  305   TIKQAKSFLPGDSLTIPESNAEDITKFL-QTLQTIPPTHQDLHFFFFLFCMKLLHSKSLP  363

Query  874   silkdkdGSKE--------QEERFLDKIYSNFVGQMNNKRFVASLKYALALGLAVFFGSI  1029
             +        K+        +E  F  K  S+  G +  KR + + K++L+LG +V FG I
Sbjct  364   NPTTKNPVQKDGGSSPISSKENGFSSKEVSSSCG-LKIKRLIPAFKFSLSLGFSVLFGLI  422

Query  1030  YSKPDGFWAGLTVAISYVSAREATFRIANVKAQGTVLGSIYGVLGCFVFAKYEELRFISL  1209
             YSKP+GFW+GL+VA+S+ +AREATF++ANVKAQGTVLG++YGV+GCF+F ++  +RF+SL
Sbjct  423   YSKPNGFWSGLSVAVSFAAAREATFKVANVKAQGTVLGTVYGVIGCFLFERFLAIRFLSL  482

Query  1210  IPWFIVCSFLRRSRMYGPAGGISACIGAVLILGREGFGPPREFAMARIMETFIGLACSIT  1389
             +PWF+  SFLR+S+MYG AGGISA IGAVLILGRE FGPP +FA+ARIMETFIGL+CSI 
Sbjct  483   LPWFLFSSFLRQSKMYGQAGGISAVIGAVLILGRENFGPPSDFAIARIMETFIGLSCSIV  542

Query  1390  VELLFRPTRASSLAKIQLSKSLQLLNQCIISIDYSSNNQSKLEETQKILKSSVTQLGKFI  1569
             VELLF+PTRAS+LAKI+LSKSL+ L++C+ S+     +++ L E QK LK  V QLGKFI
Sbjct  543   VELLFQPTRASTLAKIELSKSLETLHECVGSVSLQV-SEANLVENQKKLKIHVNQLGKFI  601

Query  1570  GEAEVEPNFWFLPFHSACYGKLMGSLSKVVEYLHFVAQALRFLEQES--------ALMGR  1725
             GEAEVEPNFWF PFHSACYG+L+GSLSK+V+ L F A A+ FLEQES          + +
Sbjct  602   GEAEVEPNFWFWPFHSACYGRLLGSLSKMVDLLLFGAHAIGFLEQESQKLETSWKETVNK  661

Query  1726  LDSDHLSLFRDHVGPSIKSFEEIISLVGSVSVLDKEFEKKKSSIDPELGKLPTSN--NIT  1899
             L+ D L+LF++ VG S+  +   IS + S+++LDKE EK   S D E+GK P+ N   ++
Sbjct  662   LNGD-LNLFKESVG-SLVQYLAKISSIKSLTILDKELEKNNISYDIEMGKSPSPNFFRVS  719

Query  1900  GLS-DEEIDNKLKSFMEDSRQFVDQKdeddddeVMMNSQVALSLSALAFCMRGIVRETKE  2076
             G   D+E++  L SF++ S++ VD      +    + SQ+ LSLSAL +CM  ++RET++
Sbjct  720   GSDEDDEMNKILSSFLQHSQEVVD-IIHGIEGGKELKSQMVLSLSALGYCMESLIRETRQ  778

Query  2077  IDKAIKELVQWENPSSPVNLHEISCKIRAL  2166
             I++ I+ELVQWENPSS VNLHEISCKIRAL
Sbjct  779   IEEGIRELVQWENPSSHVNLHEISCKIRAL  808



>ref|XP_002313448.2| hypothetical protein POPTR_0009s03390g [Populus trichocarpa]
 gb|EEE87403.2| hypothetical protein POPTR_0009s03390g [Populus trichocarpa]
Length=807

 Score =   654 bits (1686),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 401/746 (54%), Positives = 509/746 (68%), Gaps = 30/746 (4%)
 Frame = +1

Query  1     ALRGCWYAIYATCLGVCPAILSLWLIGPahlttgtaaaavaitaFIVVLPQNTHVVAKRI  180
             AL GCW A+YAT   V PA+LSLWLIGPA LT+GT + AVA+ AF+VV P+ TH+VAKRI
Sbjct  66    ALHGCWLALYATVQSVGPALLSLWLIGPAMLTSGTISLAVALGAFVVVFPEGTHLVAKRI  125

Query  181   ALGQTVLVYALA---GPRTQPIMHPlrvaastaiavaacvlalllpypslassKVKHNCH  351
             ALGQ V+VY +A   G  T+ IMH L VAASTAI V ACVLALLLPYP LA  ++K NC 
Sbjct  126   ALGQIVIVYVIAFINGVHTEAIMHTLHVAASTAIGVLACVLALLLPYPRLACWELKLNCE  185

Query  352   LFAENVSQRLNLLVKAFSAEDNASALSLVSQAKSLNASGAKFLQNIKSKQESMQWERYPI  531
               AENVS RLNL VKAF AED+A AL+ +SQAK L  +GAK LQ+IK  QES++WER P+
Sbjct  186   RLAENVSARLNLYVKAFCAEDSALALTSISQAKPLAVAGAKLLQSIKRYQESVKWERLPL  245

Query  532   KFFRPYCKNPGERLQEYETPLRGMEMGLVDNNPPQFPVTVLLSSSEVKDSLDSLTGHIS-  708
             +F R    NPGERLQE E PLRGMEM L        PV +L    E K  L  L  ++S 
Sbjct  246   RFLRNLYLNPGERLQELEIPLRGMEMALTSCTT-SLPVRIL--DGETKHGLVQLVENVSL  302

Query  709   --KQVKGRL-FDLATVPESNAQNAVKFLHQKLQPVTLQdlssfff----lfslklllikp  867
               KQ+K  L  D  TVPESNA N V+  HQ  Q ++ +      F       L       
Sbjct  303   IQKQIKNCLPRDSLTVPESNADNIVES-HQTPQTISTRHQDLPSFFFLFCMKLLHCKSLG  361

Query  868   sssilkdkdGSK---EQEERFLDKIYSNFVGQMNNKRFVASLKYALALGLAVFFGSIYSK  1038
                    + GS    +Q   F     SN+   +++KR + + K +L+LGLAV FG IYSK
Sbjct  362   KPITPTQQKGSSTPSKQTGFFKSTWMSNWSTSVSSKRLMPAFKCSLSLGLAVLFGLIYSK  421

Query  1039  PDGFWAGLTVAISYVSAREATFRIANVKAQGTVLGSIYGVLGCFVFAKYEELRFISLIPW  1218
              DG+W+GL VAIS  +AREATF++ANVKAQGTVLG++YGV GCFVF +Y  +RFISL+PW
Sbjct  422   KDGYWSGLPVAISLAAAREATFKVANVKAQGTVLGTVYGVFGCFVFERYLSIRFISLLPW  481

Query  1219  FIVCSFLRRSRMYGPAGGISACIGAVLILGREGFGPPREFAMARIMETFIGLACSITVEL  1398
             F++ SFLR S+ YG AGGISA IGAVL+LGR+ FGPPREFA+ARI+ETFIGL+CSI V+L
Sbjct  482   FVITSFLRHSKTYGQAGGISAVIGAVLVLGRKNFGPPREFAIARIVETFIGLSCSIMVDL  541

Query  1399  LFRPTRASSLAKIQLSKSLQLLNQCIISIDYSSNNQSKLEETQKILKSSVTQLGKFIGEA  1578
             L +PTRASSLAK QLSK  + L+ CI SI  ++NN++ L E Q+ LK  V++LGKFIGEA
Sbjct  542   LLQPTRASSLAKAQLSKCFETLSACIGSISLAANNKTSLLENQRRLKLDVSELGKFIGEA  601

Query  1579  EVEPNFWFLPFHSACYGKLMGSLSKVVEYLHFVAQALRFLEQESALMG--------RLDS  1734
             EVEPNFWFLPF S CY KL+GSLS++V+ L F A A+  LE ES   G        +LD 
Sbjct  602   EVEPNFWFLPFPSPCYFKLLGSLSRLVDLLLFSADAVGLLEHESQKFGASWKEYVTKLDG  661

Query  1735  DHLSLFRDHVGPSIKSFEEIISLVGSVSVLDKEFEKKKSSIDPELGKLPTSN--NITGLS  1908
             D L +F++  G  +K FE++  L+ S+  L+KE E K  S D E+GK    N   ++G +
Sbjct  662   D-LEIFKEMSGSLVKCFEDVTMLL-SLEFLEKELENKNISHDLEMGKSSNRNIFKVSGSN  719

Query  1909  DEEIDNKLKSFMEDSRQFVDQKdeddddeVMMNSQVALSLSALAFCMRGIVRETKEIDKA  2088
             +++ID+   S+++ S++ VD+    D+ E  + SQV L LSAL FCM  +++ETKEI+K 
Sbjct  720   EDKIDSVTSSYLQHSKEMVDKFHAADEGERELKSQVVLCLSALGFCMSNLIKETKEIEKG  779

Query  2089  IKELVQWENPSSPVNLHEISCKIRAL  2166
             I E++QWENPS  +NL+EISCKIRAL
Sbjct  780   IIEILQWENPSKHINLYEISCKIRAL  805



>gb|KDO72909.1| hypothetical protein CISIN_1g004796mg [Citrus sinensis]
Length=730

 Score =   650 bits (1677),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 403/736 (55%), Positives = 521/736 (71%), Gaps = 30/736 (4%)
 Frame = +1

Query  22    AIYATCLGVCPAILSLWLIGPahlttgtaaaavaitaFIVVLPQNTHVVAKRIALGQTVL  201
             A+YAT   V PAILSL LIGPA  T+ T A AVA+ A++V LP+ TH+ AKRIALGQ V+
Sbjct  2     ALYATVQTVGPAILSLKLIGPARFTSTTTALAVALAAYVVALPEGTHMKAKRIALGQIVI  61

Query  202   VYALA---GPRTQPIMHPlrvaastaiavaacvlalllpypslassKVKHNCHLFAENVS  372
              Y +    G RT+ +MHPL VAASTA+ V ACVLAL LPYP LA  +VK NC L +EN S
Sbjct  62    TYVIGFVNGERTEAVMHPLHVAASTAVGVFACVLALSLPYPRLACCQVKKNCKLLSENSS  121

Query  373   QRLNLLVKAFSAEDNASALSLVSQAKSLNASGAKFLQNIKSKQESMQWERYPIKFFRPYC  552
             +RL L VKAF AEDN SAL+ +SQAK L   G KF+QNIK  QESM+WER P+KF R Y 
Sbjct  122   ERLKLYVKAFCAEDNTSALASISQAKLLTIGGTKFIQNIKRYQESMKWERLPLKFLRSYY  181

Query  553   KNPGERLQEYETPLRGMEMGLVDNNPPQFPVTVLLSSSEVKDSLDSLTGHISKQVK-GRL  729
              NPGE+LQ+ E PL+GM+M +   +   FPV +L    E+K+ +  L  HIS  +K  + 
Sbjct  182   MNPGEKLQDLEIPLKGMQMAV--TSVTSFPVQIL--DGELKECVKKLDEHISLTIKQAQS  237

Query  730   FDLATVPESNAQNAVKFLHQKLQ--PVTLQdlssffflfslklllikpsssilkdkdGSK  903
              D  TVPESNA++ +KFL Q LQ  P T Q+LSS+FFLF +KLL  K S +   +     
Sbjct  238   CDSLTVPESNAEDIMKFL-QTLQNIPTTTQELSSYFFLFCMKLLQWKSSPNQSTNCLKDD  296

Query  904   EQEER-------FLDKIYSNFVGQMNNKRFVASLKYALALGLAVFFGSIYSKPDGFWAGL  1062
               +E           +++SN+  ++ +KR V + K +L+LGLAV FG +YSKP+G W+GL
Sbjct  297   TVKEYEGSSNGFSFKEVWSNWSMKVKSKRLVPAFKCSLSLGLAVLFGLLYSKPNGIWSGL  356

Query  1063  TVAISYVSAREATFRIANVKAQGTVLGSIYGVLGCFVFAKYEELRFISLIPWFIVCSFLR  1242
              VAIS+ +AREATF++AN+KAQGTVLG++YGVLGCF+F ++  +RF+SLIPWFI  +FLR
Sbjct  357   PVAISFAAAREATFKVANIKAQGTVLGTVYGVLGCFLFERFLPIRFLSLIPWFIFTAFLR  416

Query  1243  RSRMYGPAGGISACIGAVLILGREGFGPPREFAMARIMETFIGLACSITVELLFRPTRAS  1422
             RSRMYG AGGISA IGAVLILGR+ FGPP EFA+ARI+ETFIGL+CSI ++LLF+PTRAS
Sbjct  417   RSRMYGQAGGISAVIGAVLILGRKNFGPPSEFAIARIVETFIGLSCSIMIDLLFQPTRAS  476

Query  1423  SLAKIQLSKSLQLLNQCIISIDYSSNNQSKLEETQKILKSSVTQLGKFIGEAEVEPNFWF  1602
             +LAK+QLSKSL  L+ CI S+   S+  S L E QK LK  VT+L KFIGEAEVEPNFWF
Sbjct  477   TLAKVQLSKSLATLHDCIGSMSLQSSQASWL-ENQKRLKMQVTELAKFIGEAEVEPNFWF  535

Query  1603  LPFHSACYGKLMGSLSKVVEYLHFVAQALRFLEQESALMG--------RLDSDHLSLFRD  1758
              PFH ACY KL+G+L+K+V+ L F A ++ FLEQ+S  +          LDSD L L ++
Sbjct  536   FPFHIACYSKLLGTLTKMVDLLLFAAHSVGFLEQDSQRIATSWKNEVHELDSD-LELLKE  594

Query  1759  HVGPSIKSFEEIISLVGSVSVLDKEFEKKKSSIDPELGKLPTSNNITGLSDEEIDNKLKS  1938
              VG SIK FE++ + + S++ ++KE EK   S D ELGK    N I+ L +  +   + S
Sbjct  595   KVGSSIKCFEDVTT-IKSLATIEKELEKNNISYDLELGKSKNPNGISDLDEAAMGKLICS  653

Query  1939  FMEDSRQFVDQKdeddddeVMMNSQVALSLSALAFCMRGIVRETKEIDKAIKELVQWENP  2118
             +++ +++ VD K +  + E  + SQV LSLSAL +CM+G++RETK I++ IKELVQWENP
Sbjct  654   YLQHAKELVD-KIKATEGEKELRSQVVLSLSALGYCMQGLIRETKLIEEGIKELVQWENP  712

Query  2119  SSPVNLHEISCKIRAL  2166
             SS VNL EISCKI AL
Sbjct  713   SSNVNLLEISCKINAL  728



>gb|EYU23295.1| hypothetical protein MIMGU_mgv1a001533mg [Erythranthe guttata]
Length=801

 Score =   647 bits (1668),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 389/739 (53%), Positives = 515/739 (70%), Gaps = 33/739 (4%)
 Frame = +1

Query  4     LRGCWYAIYATCLGVCPAILSLWLIGPahlttgtaaaavaitaFIVVLPQNTHVVAKRIA  183
             LRGCW A+YAT  GVCPAILSLWLIGP  LT  T +  VAI+ F+V LP+NTH+++KRIA
Sbjct  72    LRGCWMAVYATVQGVCPAILSLWLIGPERLTATTTSVVVAISGFVVALPENTHLISKRIA  131

Query  184   LGQTVLVYALA---GPRTQPIMHPlrvaastaiavaacvlalllpypslassKVKHNCHL  354
             LGQ V+VY +A   G  T+PIMHP+RVAASTA+ VAACVLALLLPYPSLA  +V+ NC L
Sbjct  132   LGQIVIVYVIAFINGAETEPIMHPIRVAASTALGVAACVLALLLPYPSLAFCEVRENCKL  191

Query  355   FAENVSQRLNLLVKAFSAEDNASALSLVSQAKSLNASGAKFLQNIKSKQESMQWERYPIK  534
             + EN S+RL L VKAFSAED +S  +L+SQAKSLN +G K L +IKSKQESM+WE  P +
Sbjct  192   YIENASERLKLFVKAFSAEDKSSPKALISQAKSLNKTGNKLLHSIKSKQESMKWEIIPTR  251

Query  535   FFRPYCKNPGERLQEYETPLRGMEMGLVDNNPPQFPVTVLLSSSEVKDSLDSLTGHISKQ  714
             FF+ + +NPGE LQ  ET LRGME GL   N  +F V +L  +SE+K  L  L   I  Q
Sbjct  252   FFKSHDENPGETLQGLETILRGMENGL--ENCSEFQVGLL--NSELKKDLIGLEEQILNQ  307

Query  715   VKG---RLFDLATVPESNAQNAVKFLHQKLQPVTLQdlssffflfslklllikpsssilk  885
             VK    +  +     + N    ++ LH      ++         F   L L++  SS   
Sbjct  308   VKSMSPKNSNEEAELKGNNNKFLQTLHANTIIPSISFKDLPSLFFIFCLKLLQTKSSQAP  367

Query  886   dkdGSKEQEERFLDKIYSNFVG-QMNNKRFVASLKYALALGLAVFFGSIYSKPDGFWAGL  1062
             +   S +++E      +SN+    +N KR + +LK AL+LG AVFFGSIYSK DGFW+GL
Sbjct  368   NNINSPKKKES-----WSNYNPITINKKRLMPALKCALSLGFAVFFGSIYSKEDGFWSGL  422

Query  1063  TVAISYVSAREATFRIANVKAQGTVLGSIYGVLGCFVFAKYEELRFISLIPWFIVCSFLR  1242
              VAIS  ++REATF++AN+KAQGTV+G++YGV+GCFVF KY ++R +SL PWFI CSFLR
Sbjct  423   PVAISLAASREATFKVANIKAQGTVIGTVYGVIGCFVFEKYVKIRIVSLFPWFIFCSFLR  482

Query  1243  RSRMYGPAGGISACIGAVLILGREGFGPPREFAMARIMETFIGLACSITVELLFRPTRAS  1422
             +S+MYG AGG+SA IGAVLILGR+ FG P +FA+ARI+ETFIGL CSI V++L +PTRAS
Sbjct  483   QSKMYGQAGGVSAVIGAVLILGRKNFGTPSDFAIARIVETFIGLTCSIMVDILLQPTRAS  542

Query  1423  SLAKIQLSKSLQLLNQCIISIDYSSNNQSKLEETQKILKSSVTQLGKFIGEAEVEPNFWF  1602
              LAK+QL+KSL+ L+  +  +D S +N+   EET K LK  V++LGKFI EA+VEPNFWF
Sbjct  543   VLAKVQLTKSLKALHDSVGFVDLSFSNKFSFEETTKKLKFEVSELGKFIEEADVEPNFWF  602

Query  1603  LPFHSACYGKLMGSLSKVVEYLHFVAQALRFLEQESALM---------GRLDSDHLSLFR  1755
             LPFHS  Y KL  SLSK V+ L F + AL+FLE ES  +          +++SD L++ +
Sbjct  603   LPFHSGGYSKLKASLSKTVDLLLFGSCALKFLENESKAIDGGVWKVAAAKMESD-LNMLK  661

Query  1756  DHVGPSIKSFEEIISLVGSVSVLDKEFEKKKSSIDPELGKLPTSNNI--TGLSDEEIDNK  1929
             D V   IK FEE +SLV S++ ++KE+ K+KS++D E+GK      +  T  SD+EI   
Sbjct  662   DAVCSGIKCFEE-VSLVNSIAAIEKEYGKRKSAVDLEMGKSGRRYAMQWTEASDDEIKKS  720

Query  1930  LKSFMEDSRQFVDQKdeddddeVMMNSQVALSLSALAFCMRGIVRETKEIDKAIKELVQW  2109
             + SF+E+    +D       ++ ++ +QV LSLS++ FCM GI++ET+EI+KA+KE+VQW
Sbjct  721   VDSFLEN----LDGLVGCIGEDYLLKNQVILSLSSVVFCMHGILKETREIEKAVKEVVQW  776

Query  2110  ENPSSPVNLHEISCKIRAL  2166
             ENPS  V+L +ISCK+RAL
Sbjct  777   ENPSCRVDLRDISCKLRAL  795



>ref|XP_011042678.1| PREDICTED: uncharacterized protein LOC105138325 [Populus euphratica]
Length=807

 Score =   639 bits (1648),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 399/746 (53%), Positives = 509/746 (68%), Gaps = 30/746 (4%)
 Frame = +1

Query  1     ALRGCWYAIYATCLGVCPAILSLWLIGPahlttgtaaaavaitaFIVVLPQNTHVVAKRI  180
             AL GCW A+YAT   V PA+LSLWLIGPA LT GT + AVA+ AF+VV P+ TH+VAKRI
Sbjct  66    ALHGCWLALYATVQSVGPALLSLWLIGPAMLTGGTISLAVAVGAFVVVFPEGTHLVAKRI  125

Query  181   ALGQTVLVYALA---GPRTQPIMHPlrvaastaiavaacvlalllpypslassKVKHNCH  351
             ALGQ V+VY +A   G  T+ IMH L VAASTAI V ACVLALLLPYP LA  ++K NC 
Sbjct  126   ALGQIVIVYVVAFINGVHTEAIMHALHVAASTAIGVLACVLALLLPYPRLACWELKLNCE  185

Query  352   LFAENVSQRLNLLVKAFSAEDNASALSLVSQAKSLNASGAKFLQNIKSKQESMQWERYPI  531
               AENVS+RLNL VKAF AEDNA AL+ +SQA+SL  +GAK LQ I   QES++WER P+
Sbjct  186   RLAENVSERLNLYVKAFCAEDNALALTSISQARSLAVAGAKLLQCITRYQESVKWERLPL  245

Query  532   KFFRPYCKNPGERLQEYETPLRGMEMGLVDNNPPQFPVTVLLSSSEVKDSLDSLTGHIS-  708
             +F R    NPGERLQE E PLRGMEM L        PV +L    E K  L  L  ++S 
Sbjct  246   RFLRNLYLNPGERLQELEIPLRGMEMALTSCTT-SLPVRIL--DGETKHGLVQLVENVSL  302

Query  709   --KQVKGRLF-DLATVPESNAQNAVKFLHQKLQPVTLQdlssfff----lfslklllikp  867
               KQ+K  L  D  TVPESNA N V+  HQ LQ ++ +      F       L L     
Sbjct  303   AQKQIKNCLSRDSLTVPESNADNIVES-HQTLQTISTRHQDLPSFFFLFCMKLLLCKSLG  361

Query  868   sssilkdkdGSKE--QEERFLDKIY-SNFVGQMNNKRFVASLKYALALGLAVFFGSIYSK  1038
                    + GS    ++  F    + SN+   +++KR + + K +L+LGLAV FG IYSK
Sbjct  362   KPITPTQQKGSSTPCKQTGFSKSTWMSNWSTSVSSKRLMPAFKCSLSLGLAVLFGLIYSK  421

Query  1039  PDGFWAGLTVAISYVSAREATFRIANVKAQGTVLGSIYGVLGCFVFAKYEELRFISLIPW  1218
              DG+W+GL VAIS  +AREATF++AN KAQGTVLG++YGV GCFVF ++  +RFISL+PW
Sbjct  422   NDGYWSGLPVAISLAAAREATFKVANAKAQGTVLGTVYGVFGCFVFERHLSIRFISLLPW  481

Query  1219  FIVCSFLRRSRMYGPAGGISACIGAVLILGREGFGPPREFAMARIMETFIGLACSITVEL  1398
             F+V SFLR S+ YG AGGISA IGAVL+LGR+ FGPP EFA+ARI+ETFIGL+CSI V+L
Sbjct  482   FVVTSFLRHSKTYGQAGGISAVIGAVLVLGRKNFGPPSEFAIARIVETFIGLSCSIMVDL  541

Query  1399  LFRPTRASSLAKIQLSKSLQLLNQCIISIDYSSNNQSKLEETQKILKSSVTQLGKFIGEA  1578
             L +PTRASSLAK QLSK  + L+ CI SI  ++NN++ L E Q+ LK  V++LGKFIGEA
Sbjct  542   LLQPTRASSLAKTQLSKCFETLSACIGSISLAANNKTNLLENQRRLKLDVSELGKFIGEA  601

Query  1579  EVEPNFWFLPFHSACYGKLMGSLSKVVEYLHFVAQALRFLEQESALMG--------RLDS  1734
             EVEPNFWFLPF S CY  L+GSLS++V+ L F A A+  LE ES   G        +LD 
Sbjct  602   EVEPNFWFLPFPSPCYFNLLGSLSRLVDLLIFSADAVGLLEHESQKFGASWKEYVTKLDG  661

Query  1735  DHLSLFRDHVGPSIKSFEEIISLVGSVSVLDKEFEKKKSSIDPELGKLPTSN--NITGLS  1908
             D L +F++  G  +K FE++  L+ S+  L+KE E K  S D E+GK    N   ++GL 
Sbjct  662   D-LEIFKEMAGSLVKCFEDVTMLL-SLEFLEKELENKNISHDLEMGKSSNRNIFKVSGLD  719

Query  1909  DEEIDNKLKSFMEDSRQFVDQKdeddddeVMMNSQVALSLSALAFCMRGIVRETKEIDKA  2088
             +++ID+   S+++ S++ VD+   DD+ E  + SQV L +SAL FCM  +++ETK+I+K 
Sbjct  720   EDKIDSVTSSYLQHSKEMVDKFHADDEGERELKSQVVLCMSALGFCMNNLIKETKKIEKG  779

Query  2089  IKELVQWENPSSPVNLHEISCKIRAL  2166
             I E++QWENPS  +NL+EISCKIRAL
Sbjct  780   IIEILQWENPSKHINLYEISCKIRAL  805



>gb|KDP44214.1| hypothetical protein JCGZ_05681 [Jatropha curcas]
Length=811

 Score =   638 bits (1645),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 386/749 (52%), Positives = 510/749 (68%), Gaps = 35/749 (5%)
 Frame = +1

Query  1     ALRGCWYAIYATCLGVCPAILSLWLIGPahlttgtaaaavaitaFIVVLPQNTHVVAKRI  180
             AL GCW A+YAT   V PA+LSLWLIGPA  + GT + A A+ AF VV+P+ TH++AKRI
Sbjct  69    ALYGCWLAMYATVQTVGPAMLSLWLIGPARFSIGTISVAAALAAFTVVIPEGTHLIAKRI  128

Query  181   ALGQTVLVYALA---GPRTQPIMHPlrvaastaiavaacvlalllpypslassKVKHNCH  351
             ALGQ V++Y +A   G  T+PIMHPL VA STAI V A +LALLLPYP LA  +VK NC 
Sbjct  129   ALGQIVILYVVAFINGVHTEPIMHPLNVAVSTAIGVLASILALLLPYPRLACWEVKENCK  188

Query  352   LFAENVSQRLNLLVKAFSAEDNASALSLVSQAKSLNASGAKFLQNIKSKQESMQWERYPI  531
             L  EN S+RL L VKAF  +D+A ALS +SQ+KSL  +G K LQ+IK  Q SM+WER+P+
Sbjct  189   LLVENASERLKLYVKAFCEQDSALALSSISQSKSLAIAGTKLLQSIKRYQGSMKWERFPL  248

Query  532   KFFRPYCKNPGERLQEYETPLRGMEMGLVDNNPPQFPVTVLLSSSEVKDSLDSLTGHIS-  708
              F RP  KNPG +LQE E PL+GMEM L  N+   FPV  +L     K+ L  L  H++ 
Sbjct  249   DFLRPSYKNPGAKLQELEIPLKGMEMAL--NSMTSFPVR-MLGGETTKEKLK-LEDHVNL  304

Query  709   --KQVKGRL--FDLATVPESNAQNAVKFLHQKLQPVTLQdlssffflfslklllikpsss  876
               +Q+K      +  TVPES A+  ++   Q LQ +          LF L  + +     
Sbjct  305   TVEQIKNCFPCDNSLTVPESKAETIIQSF-QTLQTIPTNHNDHLSSLFFLFCINLLHCKP  363

Query  877   ilkdkdGSKE-------QEERFLDKIYSNFVGQMNNKRFVASLKYALALGLAVFFGSIYS  1035
             +   K  +KE       ++E     ++SN    +N KR + ++K +L+LG A  FG +YS
Sbjct  364   LPNPKQENKEGASNNSRKQESHFKNVWSNCTMNVNTKRVLPAVKCSLSLGFATLFGLLYS  423

Query  1036  KPDGFWAGLTVAISYVSAREATFRIANVKAQGTVLGSIYGVLGCFVFAKYEELRFISLIP  1215
             K +GFW+ L VAIS+ +AREATF++ANVKAQGTVLGS+YG +GCFVF ++  +RF+SL+P
Sbjct  424   KENGFWSALPVAISFAAAREATFKVANVKAQGTVLGSVYGAIGCFVFERFLPIRFLSLLP  483

Query  1216  WFIVCSFLRRSRMYGPAGGISACIGAVLILGREGFGPPREFAMARIMETFIGLACSITVE  1395
             WFI+ SFLRRSRMYG AGG+SA IGAVLILGR+ FGPP EFAMARI ETFIGL+CSI VE
Sbjct  484   WFILTSFLRRSRMYGQAGGLSAAIGAVLILGRKNFGPPSEFAMARITETFIGLSCSIMVE  543

Query  1396  LLFRPTRASSLAKIQLSKSLQLLNQCIISIDYSSNNQSKLEETQKILKSSVTQLGKFIGE  1575
             L+ +PTRA+SLAKI L+KSL  L  CI SI   SN  + +++ QKILK  V++L K IGE
Sbjct  544   LILQPTRAASLAKIHLNKSLGSLFACIGSISLDSNKDNVVDK-QKILKLEVSELKKSIGE  602

Query  1576  AEVEPNFWFLPFHSACYGKLMGSLSKVVEYLHFVAQALRFLEQES------ALMGRLD--  1731
             AEVEPNFWFLPF+S CY KL+ SLSK+V+ L F A A+ FLEQES      +L G L+  
Sbjct  603   AEVEPNFWFLPFYSGCYSKLLVSLSKMVDLLLFSAHAVGFLEQESQKVEGISLKGYLNKL  662

Query  1732  SDHLSLFRDHVGPSIKSFEEIISLVGSVSVLDKEFEKKKSSIDPELGKLPTSNNITGLS-  1908
             SD + LF++ VG  IK  E+ +SL+ S++ LDKE E K  + DPELGK P     +G+S 
Sbjct  663   SDDVQLFKEMVGGLIKCLED-LSLLKSLTFLDKELENKNINYDPELGKSPNPKMFSGISG  721

Query  1909  ---DEEIDNKLKSFMEDSRQFVDQKdeddddeVMMNSQVALSLSALAFCMRGIVRETKEI  2079
                ++E++  + SF++DS + VD K ++ ++     SQ+ L L AL FCM+ +++E +EI
Sbjct  722   SDEEDEMEKIMNSFLQDSNEVVD-KFQELEENEKQKSQLVLCLGALGFCMKNLIKEAREI  780

Query  2080  DKAIKELVQWENPSSPVNLHEISCKIRAL  2166
             +K I+EL+Q+ENP + ++LHEISCKI AL
Sbjct  781   EKGIQELIQYENPGNDISLHEISCKIHAL  809



>ref|XP_002298367.2| hypothetical protein POPTR_0001s24390g [Populus trichocarpa]
 gb|EEE83172.2| hypothetical protein POPTR_0001s24390g [Populus trichocarpa]
Length=808

 Score =   635 bits (1637),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 390/748 (52%), Positives = 508/748 (68%), Gaps = 35/748 (5%)
 Frame = +1

Query  4     LRGCWYAIYATCLGVCPAILSLWLIGPahlttgtaaaavaitaFIVVLPQNTHVVAKRIA  183
             L GCW A+YAT   V PA+LSLWL+GP   T GT + AVA+ AF+V  P+ TH++AKRIA
Sbjct  67    LHGCWLALYATIQSVGPALLSLWLVGPGRFTNGTISLAVALAAFVVAFPEGTHLIAKRIA  126

Query  184   LGQTVLVYALA---GPRTQPIMHPlrvaastaiavaacvlalllpypslassKVKHNCHL  354
             LGQ V+VY +A   G   + IMHPL VAASTAI V ACV+ALLLPYP LA  ++K +C  
Sbjct  127   LGQIVIVYVIAFINGVDAEAIMHPLNVAASTAIGVLACVIALLLPYPRLACWELKQDCGK  186

Query  355   FAENVSQRLNLLVKAFSAEDNASALSLVSQAKSLNASGAKFLQNIKSKQESMQWERYPIK  534
              AENVS+RLNL VKAF AEDNA AL+ +SQAK L  +GAK LQ+IK  QES++WER P+K
Sbjct  187   LAENVSERLNLYVKAFCAEDNALALTSISQAKPLTIAGAKLLQSIKRYQESVKWERLPLK  246

Query  535   FFRPYCKNPGERLQEYETPLRGMEMGLVDNNPPQFPVTVLLSSSEVKDSLDSLTGHIS--  708
             F R +  NPGERLQE E PLRGME+ L   +   FP+ +L   +E K  L  L  H+S  
Sbjct  247   FLRNFYLNPGERLQELEIPLRGMEIALTSTS--SFPIRML--EAETKQGLVQLEEHVSLT  302

Query  709   -KQVKGRL-FDLATVPESNAQNAVKFLHQKLQPVTLQdlssffflfslklllikpsssil  882
              KQ+K     D  TVPESNA   ++FL Q LQ  T+         F     +       L
Sbjct  303   LKQIKNCFPRDSFTVPESNADKIIEFL-QTLQ-ATIPTNHEDLPSFFFLFCMKLLQRKSL  360

Query  883   kdkdGSKEQEER--------FLDKIY-SNFVGQMNNKRFVASLKYALALGLAVFFGSIYS  1035
                  S +Q+E         F   ++ SN+   +N KR + + K +L+LGLAV FG IYS
Sbjct  361   AKPITSIQQKESSTPCQKNGFFKSMWMSNWSTSVNCKRLMPAFKCSLSLGLAVLFGLIYS  420

Query  1036  KPDGFWAGLTVAISYVSAREATFRIANVKAQGTVLGSIYGVLGCFVFAKYEELRFISLIP  1215
             K   +W+GL VAIS  +AREATF++ANVKAQGTVLG++YGV GCFVF +Y  +RFISL+P
Sbjct  421   KKYSYWSGLPVAISMAAAREATFKVANVKAQGTVLGTVYGVFGCFVFERYFPIRFISLLP  480

Query  1216  WFIVCSFLRRSRMYGPAGGISACIGAVLILGREGFGPPREFAMARIMETFIGLACSITVE  1395
             WF+V SFLR S+MYG AGGISA IGAV+ILGR+ FGPP EFA+ARI+ETFIGL+CSI V+
Sbjct  481   WFVVISFLRHSQMYGQAGGISAVIGAVIILGRKDFGPPSEFAIARIVETFIGLSCSIMVD  540

Query  1396  LLFRPTRASSLAKIQLSKSLQLLNQCIISIDYSSNNQSKLEETQKILKSSVTQLGKFIGE  1575
             LL +PTR+ SLAK+QLSK    L+ C+ S+  ++N+++ L E Q+ LK  V++LGKFIGE
Sbjct  541   LLLQPTRSCSLAKVQLSKCFGTLSACVGSMSLAANSKTNLLEKQRRLKLDVSELGKFIGE  600

Query  1576  AEVEPNFWFLPFHSACYGKLMGSLSKVVEYLHFVAQALRFLEQESALMG--------RLD  1731
             AEVEPNFWFLPFHSACY KL+ SLSK+V+   F A A+  LEQES  +G        +L 
Sbjct  601   AEVEPNFWFLPFHSACYCKLLASLSKLVDLFLFSADAVGLLEQESQKLGASWKESVNKLH  660

Query  1732  SDHLSLFRDHVGPSIKSFEEIISLVGSVSVLDKEFEKKKSSIDPELGKLPTSN--NITGL  1905
              D + +F++  G  +K FE+ ++L+ S++ L+K+ E K  S D ELGK    N    + L
Sbjct  661   GD-VEIFKEMAGSLVKCFED-VTLLKSLTFLEKKLENKNISYDLELGKSSNWNIFKASSL  718

Query  1906  SDEEIDNKLKSFMEDSRQFVDQ-KdeddddeVMMNSQVALSLSALAFCMRGIVRETKEID  2082
              D++ID+ + S+++ S++ VD+    D + E  + SQV L LSAL FCM  +++ET+EI+
Sbjct  719   KDDKIDSIISSYLQHSKEIVDKFHAADHEGERELKSQVVLCLSALGFCMSNLIKETREIE  778

Query  2083  KAIKELVQWENPSSPVNLHEISCKIRAL  2166
             K I EL+QWENPS  +NL+EISCKI AL
Sbjct  779   KGIIELLQWENPSKHINLYEISCKIHAL  806



>emb|CAN80549.1| hypothetical protein VITISV_019389 [Vitis vinifera]
Length=801

 Score =   624 bits (1610),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 384/755 (51%), Positives = 515/755 (68%), Gaps = 46/755 (6%)
 Frame = +1

Query  4     LRGCWYAIYATCLGVCPAILSLWLIGPahlttgtaaaavaitaFIVVLPQNTHVVAKRIA  183
             +R CW A YAT LGVCPAILSLW+IGP  L+ G  AAAVA++AF+V LP+ + +V +RIA
Sbjct  57    VRACWQAAYATVLGVCPAILSLWVIGPTRLSIGNMAAAVALSAFVVGLPEWSGLVVERIA  116

Query  184   LGQTVLVYALA---GPRTQPIMHPlrvaastaiavaacvlalllpypslassKVKHNCHL  354
             LGQ V+VY LA   G  T  +MHP+ VAASTA+ V ACVLALL PYP LAS +VK  C L
Sbjct  117   LGQIVIVYLLALLKGGETDAVMHPVHVAASTAVGVLACVLALLFPYPRLASYEVKQKCKL  176

Query  355   FAENVSQRLNLLVKAFSAEDNASALSLVSQAKSLNASGAKFLQNIKSKQESMQWERYPIK  534
             FAEN S+RL L VKAF AED+ASALS ++QAK    +GAK   ++K +Q SMQWER P+K
Sbjct  177   FAENASERLKLFVKAFCAEDHASALSSIAQAKRFAVAGAKLHHSVKRRQGSMQWERLPLK  236

Query  535   FFRPYCKNPGERLQEYETPLRGMEMGLVDNNPPQFPVTVLLSSSEVKDSLDSLTGHIS--  708
              F+P  KNPGERLQ  + PLRGME+ L  +  P FPV ++    E+K  L  L  H+S  
Sbjct  237   MFKPCYKNPGERLQCIQMPLRGMEIALTSS--PSFPVRIM--DGELKQGLVQLEEHLSLT  292

Query  709   -KQVKGRLF---DLATVPESNAQNAVKFLH--QKLQPV-----------TLQdlssfffl  837
              KQ++ +     D +TVPES A+N VK L   Q + P             ++ L S    
Sbjct  293   LKQLELKCSSPSDSSTVPESTAENVVKSLQNFQTIPPTHKELPYFFFLFCMKLLHSESMA  352

Query  838   fslklllikpsssilkdkdGSKEQEERFLDKIYSNFVGQMNNKRFVASLKYALALGLAVF  1017
                   L   S    +  D S +Q+  FL+ + S +  +++  R + +LK +L+LGLAV 
Sbjct  353   KPFNSCLQPNSVGKNEGVDDSGKQKGSFLEGVSSXWSMKVDRSRLMPALKCSLSLGLAVL  412

Query  1018  FGSIYSKPDGFWAGLTVAISYVSAREATFRIANVKAQGTVLGSIYGVLGCFVFAKYEELR  1197
             FG IYSK +GFWAGL VAI++ SAREATF++AN+K QGTVLG++YGVLGCFVF ++ +L 
Sbjct  413   FGMIYSKENGFWAGLPVAITFSSAREATFKVANLKVQGTVLGTVYGVLGCFVFERFVKLW  472

Query  1198  FISLIPWFIVCSFLRRSRMYGPAGGISACIGAVLILGREGFGPPREFAMARIMETFIGLA  1377
             FISL PWFI  SFL+RS++YG AGG+SA I AVLILGR+ FG P EFA+ARI+ETFIGL+
Sbjct  473   FISLFPWFIFTSFLQRSQIYGQAGGLSAVISAVLILGRKNFGSPSEFAIARIVETFIGLS  532

Query  1378  CSITVELLFRPTRASSLAKIQLSKSLQLLNQCIISIDYSSNNQSKLEETQKILKSSVTQL  1557
             CS+ V++  +PTRAS+LAK+QLSK L+ L+ CI SI   + ++S LEE  K+LKS + +L
Sbjct  533   CSVLVDIALQPTRASTLAKVQLSKCLEALHDCICSISLCA-SKSNLEENHKVLKSHLNEL  591

Query  1558  GKFIGEAEVEPNFWFLPFHSACYGKLMGSLSKVVEYLHFVAQALRFLEQESA--------  1713
             GKFIGEAEVEPNF FLP HSA Y +L+ SLSK+ + L  VA ALRFLEQE++        
Sbjct  592   GKFIGEAEVEPNFLFLPLHSAAYSRLLVSLSKMADLLVHVAHALRFLEQETSKPEASWKD  651

Query  1714  LMGRLDSDHLSLFRDHVGPSIKSFEEIISLVGSVSVLDKEFEKKKSSIDPELGKLPTSN-  1890
              + ++D D L  F++ +   IKSFEE+ S + S+  L+KE E+K  S D E+GK PT+N 
Sbjct  652   AVDKVDGD-LKPFKEMLASLIKSFEEVAS-IKSLPALEKELEEKNISYDLEMGKSPTTNL  709

Query  1891  ---NITGLSDEEIDNKLKSFMEDSRQFVDQKdeddddeVMMNSQVALSLSALAFCMRGIV  2061
                  +G  ++E++  +  ++++S++ V+  + ++   +M+     LSLS L FCM G++
Sbjct  710   SRLAGSGNREDEMEKMISCYLQNSKEIVEGVEGEEVRSLMV-----LSLSGLGFCMSGLM  764

Query  2062  RETKEIDKAIKELVQWENPSSPVNLHEISCKIRAL  2166
             RET+EI++ IK++VQWEN SS VNL+EISCK  AL
Sbjct  765   RETREIEQGIKDIVQWENHSSHVNLYEISCKAHAL  799



>ref|XP_002281216.1| PREDICTED: uncharacterized protein LOC100243247 [Vitis vinifera]
Length=817

 Score =   625 bits (1611),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 384/755 (51%), Positives = 516/755 (68%), Gaps = 46/755 (6%)
 Frame = +1

Query  4     LRGCWYAIYATCLGVCPAILSLWLIGPahlttgtaaaavaitaFIVVLPQNTHVVAKRIA  183
             +R CW A YAT LGVCPAILSLW+IGP  L+ G  AAAVA++AF+V LP+ + +V +RIA
Sbjct  73    VRACWQAAYATVLGVCPAILSLWVIGPTRLSIGNMAAAVALSAFVVGLPEWSGLVVERIA  132

Query  184   LGQTVLVYALA---GPRTQPIMHPlrvaastaiavaacvlalllpypslassKVKHNCHL  354
             LGQ V+VY LA   G  T  +MHP+ VAASTA+ V ACVLALL PYP LAS +VK  C L
Sbjct  133   LGQIVIVYLLALLKGGETDAVMHPVHVAASTAVGVLACVLALLFPYPRLASYEVKQKCKL  192

Query  355   FAENVSQRLNLLVKAFSAEDNASALSLVSQAKSLNASGAKFLQNIKSKQESMQWERYPIK  534
             FAEN S+RL L VKAF AED+ASALS ++QAK    +GAK   ++K +Q SMQWER P+K
Sbjct  193   FAENASERLKLFVKAFCAEDHASALSSIAQAKRFAVAGAKLHHSVKRRQGSMQWERLPLK  252

Query  535   FFRPYCKNPGERLQEYETPLRGMEMGLVDNNPPQFPVTVLLSSSEVKDSLDSLTGHIS--  708
              F+P  KNPGERLQ  + PLRGME+ L  +  P FPV ++    E+K  L  L  H+S  
Sbjct  253   MFKPCYKNPGERLQCIQMPLRGMEIALTSS--PSFPVRIM--DGELKQGLVQLEEHLSLT  308

Query  709   -KQVKGRLF---DLATVPESNAQNAVKFLH--QKLQPV-----------TLQdlssfffl  837
              KQ++ +     D +TVPES A+N VK L   Q + P             ++ L S    
Sbjct  309   LKQLELKCSSPSDSSTVPESTAENVVKSLQNFQTIPPTHKELPYFFFLFCMKLLHSESMA  368

Query  838   fslklllikpsssilkdkdGSKEQEERFLDKIYSNFVGQMNNKRFVASLKYALALGLAVF  1017
                   L   S    +  D S +Q+  FL+ + S++  +++  R + +LK +L+LGLAV 
Sbjct  369   KPFNSCLQPNSVGKNEGVDDSGKQKGSFLEGVSSSWSMKVDRSRLMPALKCSLSLGLAVL  428

Query  1018  FGSIYSKPDGFWAGLTVAISYVSAREATFRIANVKAQGTVLGSIYGVLGCFVFAKYEELR  1197
             FG IYSK +GFWAGL VAI++ SAREATF++AN+K QGTVLG++YGVLGCFVF ++ +L 
Sbjct  429   FGMIYSKENGFWAGLPVAITFSSAREATFKVANLKVQGTVLGTVYGVLGCFVFERFVKLW  488

Query  1198  FISLIPWFIVCSFLRRSRMYGPAGGISACIGAVLILGREGFGPPREFAMARIMETFIGLA  1377
             FISL PWFI  SFL+RS++YG AGG+SA I AVLILGR+ FG P EFA+ARI+ETFIGL+
Sbjct  489   FISLFPWFIFTSFLQRSQIYGQAGGLSAVISAVLILGRKNFGSPSEFAIARIVETFIGLS  548

Query  1378  CSITVELLFRPTRASSLAKIQLSKSLQLLNQCIISIDYSSNNQSKLEETQKILKSSVTQL  1557
             CS+ V++  +PTRAS+LAK+QLSK L+ L+ CI SI   + ++S LEE  K+LKS + +L
Sbjct  549   CSVLVDIALQPTRASTLAKVQLSKCLEALHDCICSISLCA-SKSNLEENHKVLKSHLNEL  607

Query  1558  GKFIGEAEVEPNFWFLPFHSACYGKLMGSLSKVVEYLHFVAQALRFLEQESA--------  1713
             GKFIGEAEVEPNF FLP HSA Y +L+ SLSK+ + L  VA ALRFLEQE++        
Sbjct  608   GKFIGEAEVEPNFLFLPLHSAAYSRLLVSLSKMADLLVHVAHALRFLEQETSKPEASWKD  667

Query  1714  LMGRLDSDHLSLFRDHVGPSIKSFEEIISLVGSVSVLDKEFEKKKSSIDPELGKLPTSN-  1890
              + ++D D L  F++ +   IKSFEE+ S + S+  L+KE E+K  S D E+GK PT+N 
Sbjct  668   AVDKVDGD-LKPFKEMLASLIKSFEEVAS-IKSLPALEKELEEKNISYDLEMGKSPTTNL  725

Query  1891  ---NITGLSDEEIDNKLKSFMEDSRQFVDQKdeddddeVMMNSQVALSLSALAFCMRGIV  2061
                  +G  ++E++  +  ++++S++ V+  + ++   +M+     LSLS L FCM G++
Sbjct  726   SRLAGSGNREDEMEKMISCYLQNSKEIVEGVEGEEVRSLMV-----LSLSGLGFCMSGLM  780

Query  2062  RETKEIDKAIKELVQWENPSSPVNLHEISCKIRAL  2166
             RET+EI++ IK++VQWEN SS VNL+EISCK  AL
Sbjct  781   RETREIEQGIKDIVQWENHSSHVNLYEISCKAHAL  815



>ref|XP_011000275.1| PREDICTED: uncharacterized protein LOC105107893 [Populus euphratica]
Length=823

 Score =   623 bits (1607),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 388/749 (52%), Positives = 503/749 (67%), Gaps = 35/749 (5%)
 Frame = +1

Query  1     ALRGCWYAIYATCLGVCPAILSLWLIGPahlttgtaaaavaitaFIVVLPQNTHVVAKRI  180
             AL GCW A+YAT   V PA+ SLWLIGP   T GT + AVA+ AF+V  P+ TH++AKRI
Sbjct  81    ALHGCWLALYATIQSVGPALPSLWLIGPGRFTNGTVSLAVALGAFVVAFPEGTHLIAKRI  140

Query  181   ALGQTVLVYALA---GPRTQPIMHPlrvaastaiavaacvlalllpypslassKVKHNCH  351
             ALGQ V+VY +A   G  T+ I+HPL V ASTAI V ACVLALLLPYP LA  ++K NC 
Sbjct  141   ALGQIVIVYVIAFINGVDTEAIVHPLNVVASTAIGVFACVLALLLPYPRLACWELKQNCG  200

Query  352   LFAENVSQRLNLLVKAFSAEDNASALSLVSQAKSLNASGAKFLQNIKSKQESMQWERYPI  531
               AENVS+RLNL VKAF AEDNA AL+ +SQAKSL  +GAK LQ+IK  QES++WER P 
Sbjct  201   RLAENVSERLNLYVKAFCAEDNALALTSISQAKSLTIAGAKLLQSIKQYQESVKWERLPS  260

Query  532   KFFRPYCKNPGERLQEYETPLRGMEMGLVDNNPPQFPVTVLLSSSEVKDSLDSLTGHIS-  708
             K+ R    NPGERLQE E PLRGME+ L   +   FP+ +L   +E K  L  L  H+S 
Sbjct  261   KYLRNSYLNPGERLQELEIPLRGMEIALTSAS--SFPMRML--EAETKQGLVQLEEHVSL  316

Query  709   --KQVKGRL-FDLATVPESNAQNAVKFLHQKLQPVTLQdlssffflfslklllikpsssi  879
               KQ+K     D   VPESNA   ++FL Q LQ  T+         F     +    S  
Sbjct  317   TLKQIKNCFPGDSLIVPESNADKIIEFL-QILQ-ATIPTNHEDLPSFFFLFCMKLLQSKS  374

Query  880   lkdkdGSKEQEER--------FLDKIY-SNFVGQMNNKRFVASLKYALALGLAVFFGSIY  1032
             L     S +Q+E         F   ++ SN+   +N KR + + K +L+LGLAV FG IY
Sbjct  375   LAKPITSTQQKESSAPCQKNGFFKSMWMSNWSTSVNCKRLMPAFKCSLSLGLAVLFGLIY  434

Query  1033  SKPDGFWAGLTVAISYVSAREATFRIANVKAQGTVLGSIYGVLGCFVFAKYEELRFISLI  1212
             SK   +W+GL VAIS  +AREATF++ANVKAQGTVLG++YGV GCFVF +Y  +RFISL+
Sbjct  435   SKKYSYWSGLPVAISIAAAREATFKVANVKAQGTVLGTVYGVFGCFVFERYFPIRFISLL  494

Query  1213  PWFIVCSFLRRSRMYGPAGGISACIGAVLILGREGFGPPREFAMARIMETFIGLACSITV  1392
             PWF+V SFLR S+MYG AGGISA IGA++ILGR+ FGPP EFA+ARI+ETFIGL+CSI V
Sbjct  495   PWFVVTSFLRHSQMYGQAGGISAVIGALIILGRKDFGPPSEFAIARIVETFIGLSCSIMV  554

Query  1393  ELLFRPTRASSLAKIQLSKSLQLLNQCIISIDYSSNNQSKLEETQKILKSSVTQLGKFIG  1572
             +LL +P R+ +LAK+QLSK    L+ C+ S++ ++N+++ L E Q+ LK  V++LGK IG
Sbjct  555   DLLLQPARSCTLAKVQLSKCFGTLSACVGSMNLAANSKTNLLEKQRRLKLDVSELGKVIG  614

Query  1573  EAEVEPNFWFLPFHSACYGKLMGSLSKVVEYLHFVAQALRFLEQESALMG--------RL  1728
             EAEVEPNFWFLPFHSACY KL+ SLSK+ + L F A A+  LEQ S  +G        +L
Sbjct  615   EAEVEPNFWFLPFHSACYCKLLASLSKLGDLLLFSADAVGLLEQVSQKLGASWKESVNKL  674

Query  1729  DSDHLSLFRDHVGPSIKSFEEIISLVGSVSVLDKEFEKKKSSIDPELGKLPTSNNITG--  1902
               D + LF++  G   K FE+ ++L+ S++ L+K+ E K  S D ELGK    N  T   
Sbjct  675   HGD-VELFKEMAGSLGKCFED-VTLLKSLTFLEKKLENKNISYDLELGKSSNWNIFTASS  732

Query  1903  LSDEEIDNKLKSFMEDSRQFVDQ-KdeddddeVMMNSQVALSLSALAFCMRGIVRETKEI  2079
             L D++ID  + S+++ S++ V++    D + E  + SQV L LSAL FCM  +++ET+EI
Sbjct  733   LKDDKIDGIISSYLQHSKEIVEKFHAPDHEGERELKSQVVLCLSALGFCMSNLIKETREI  792

Query  2080  DKAIKELVQWENPSSPVNLHEISCKIRAL  2166
             +K I EL+QWENPS  +NL+EISCKI AL
Sbjct  793   EKGIIELLQWENPSKNINLYEISCKIHAL  821



>ref|XP_006379012.1| hypothetical protein POPTR_0009s03390g [Populus trichocarpa]
 gb|ERP56809.1| hypothetical protein POPTR_0009s03390g [Populus trichocarpa]
Length=790

 Score =   619 bits (1597),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 392/746 (53%), Positives = 495/746 (66%), Gaps = 47/746 (6%)
 Frame = +1

Query  1     ALRGCWYAIYATCLGVCPAILSLWLIGPahlttgtaaaavaitaFIVVLPQNTHVVAKRI  180
             AL GCW A+YAT   V PA+LSLWLIGPA LT+GT + AVA+ AF+VV P+ TH+VAKRI
Sbjct  66    ALHGCWLALYATVQSVGPALLSLWLIGPAMLTSGTISLAVALGAFVVVFPEGTHLVAKRI  125

Query  181   ALGQTVLVYALA---GPRTQPIMHPlrvaastaiavaacvlalllpypslassKVKHNCH  351
             ALGQ V+VY +A   G  T+ IMH L VAASTAI V ACVLALLLPYP LA  ++K NC 
Sbjct  126   ALGQIVIVYVIAFINGVHTEAIMHTLHVAASTAIGVLACVLALLLPYPRLACWELKLNCE  185

Query  352   LFAENVSQRLNLLVKAFSAEDNASALSLVSQAKSLNASGAKFLQNIKSKQESMQWERYPI  531
               AENVS RLNL VKAF AED+A AL+ +SQAK L  +GAK LQ+IK  QES++WER P+
Sbjct  186   RLAENVSARLNLYVKAFCAEDSALALTSISQAKPLAVAGAKLLQSIKRYQESVKWERLPL  245

Query  532   KFFRPYCKNPGERLQEYETPLRGMEMGLVDNNPPQFPVTVLLSSSEVKDSLDSLTGHIS-  708
             +F R    NPGERLQE E PLRGMEM L        PV +L    E K  L  L  ++S 
Sbjct  246   RFLRNLYLNPGERLQELEIPLRGMEMALTSCTT-SLPVRIL--DGETKHGLVQLVENVSL  302

Query  709   --KQVKGRL-FDLATVPESNAQNAVKFLHQKLQPVTLQdlssfff----lfslklllikp  867
               KQ+K  L  D  TVPESNA N V+  HQ  Q ++ +      F       L       
Sbjct  303   IQKQIKNCLPRDSLTVPESNADNIVES-HQTPQTISTRHQDLPSFFFLFCMKLLHCKSLG  361

Query  868   sssilkdkdGSK---EQEERFLDKIYSNFVGQMNNKRFVASLKYALALGLAVFFGSIYSK  1038
                    + GS    +Q   F     SN+   +++KR + + K +L+LGLAV FG IYSK
Sbjct  362   KPITPTQQKGSSTPSKQTGFFKSTWMSNWSTSVSSKRLMPAFKCSLSLGLAVLFGLIYSK  421

Query  1039  PDGFWAGLTVAISYVSAREATFRIANVKAQGTVLGSIYGVLGCFVFAKYEELRFISLIPW  1218
              DG+W+GL VAIS  +AREATF++ANVKAQGTVLG++YGV GCFVF              
Sbjct  422   KDGYWSGLPVAISLAAAREATFKVANVKAQGTVLGTVYGVFGCFVFE-------------  468

Query  1219  FIVCSFLRRSRMYGPAGGISACIGAVLILGREGFGPPREFAMARIMETFIGLACSITVEL  1398
                 SFLR S+ YG AGGISA IGAVL+LGR+ FGPPREFA+ARI+ETFIGL+CSI V+L
Sbjct  469   ----SFLRHSKTYGQAGGISAVIGAVLVLGRKNFGPPREFAIARIVETFIGLSCSIMVDL  524

Query  1399  LFRPTRASSLAKIQLSKSLQLLNQCIISIDYSSNNQSKLEETQKILKSSVTQLGKFIGEA  1578
             L +PTRASSLAK QLSK  + L+ CI SI  ++NN++ L E Q+ LK  V++LGKFIGEA
Sbjct  525   LLQPTRASSLAKAQLSKCFETLSACIGSISLAANNKTSLLENQRRLKLDVSELGKFIGEA  584

Query  1579  EVEPNFWFLPFHSACYGKLMGSLSKVVEYLHFVAQALRFLEQESALMG--------RLDS  1734
             EVEPNFWFLPF S CY KL+GSLS++V+ L F A A+  LE ES   G        +LD 
Sbjct  585   EVEPNFWFLPFPSPCYFKLLGSLSRLVDLLLFSADAVGLLEHESQKFGASWKEYVTKLDG  644

Query  1735  DHLSLFRDHVGPSIKSFEEIISLVGSVSVLDKEFEKKKSSIDPELGKLPTSN--NITGLS  1908
             D L +F++  G  +K FE++  L+ S+  L+KE E K  S D E+GK    N   ++G +
Sbjct  645   D-LEIFKEMSGSLVKCFEDVTMLL-SLEFLEKELENKNISHDLEMGKSSNRNIFKVSGSN  702

Query  1909  DEEIDNKLKSFMEDSRQFVDQKdeddddeVMMNSQVALSLSALAFCMRGIVRETKEIDKA  2088
             +++ID+   S+++ S++ VD+    D+ E  + SQV L LSAL FCM  +++ETKEI+K 
Sbjct  703   EDKIDSVTSSYLQHSKEMVDKFHAADEGERELKSQVVLCLSALGFCMSNLIKETKEIEKG  762

Query  2089  IKELVQWENPSSPVNLHEISCKIRAL  2166
             I E++QWENPS  +NL+EISCKIRAL
Sbjct  763   IIEILQWENPSKHINLYEISCKIRAL  788



>emb|CBI16165.3| unnamed protein product [Vitis vinifera]
Length=783

 Score =   617 bits (1590),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 382/751 (51%), Positives = 509/751 (68%), Gaps = 56/751 (7%)
 Frame = +1

Query  4     LRGCWYAIYATCLGVCPAILSLWLIGPahlttgtaaaavaitaFIVVLPQNTHVVAKRIA  183
             +R CW A YAT LGVCPAILSLW+IGP  L+ G  AAAVA++AF+V LP+ + +V +RIA
Sbjct  57    VRACWQAAYATVLGVCPAILSLWVIGPTRLSIGNMAAAVALSAFVVGLPEWSGLVVERIA  116

Query  184   LGQTVLVYALA---GPRTQPIMHPlrvaastaiavaacvlalllpypslassKVKHNCHL  354
             LGQ V+VY LA   G  T  +MHP+ VAASTA+ V ACVLALL PYP LAS +VK  C L
Sbjct  117   LGQIVIVYLLALLKGGETDAVMHPVHVAASTAVGVLACVLALLFPYPRLASYEVKQKCKL  176

Query  355   FAENVSQRLNLLVKAFSAEDNASALSLVSQAKSLNASGAKFLQNIKSKQESMQWERYPIK  534
             FAEN S+RL L VKAF AED+ASALS ++QAK    +GAK   ++K +Q SMQWER P+K
Sbjct  177   FAENASERLKLFVKAFCAEDHASALSSIAQAKRFAVAGAKLHHSVKRRQGSMQWERLPLK  236

Query  535   FFRPYCKNPGERLQEYETPLRGMEMGLVDNNPPQFPVTVLLSSSEVKDSLDSLTGHIS--  708
              F+P  KNPGERLQ  + PLRGME+ L  +  P FPV ++    E+K  L  L  H+S  
Sbjct  237   MFKPCYKNPGERLQCIQMPLRGMEIALTSS--PSFPVRIM--DGELKQGLVQLEEHLSLT  292

Query  709   -KQVKGRLF---DLATVPESNAQNAVKFLH--QKLQPVTLQdlssffflfslklllikps  870
              KQ++ +     D +TVPES A+N VK L   Q + P   +    FF      L      
Sbjct  293   LKQLELKCSSPSDSSTVPESTAENVVKSLQNFQTIPPTHKELPYFFFLFCMKLLH-----  347

Query  871   ssilkdkdGSKEQEERFLDKIYSNFVGQ-------MNNKRFVASLKYALALGLAVFFGSI  1029
                      S+   + F   +  N VG+       ++  R + +LK +L+LGLAV FG I
Sbjct  348   ---------SESMAKPFNSCLQPNSVGKNEGVDDSVDRSRLMPALKCSLSLGLAVLFGMI  398

Query  1030  YSKPDGFWAGLTVAISYVSAREATFRIANVKAQGTVLGSIYGVLGCFVFAKYEELRFISL  1209
             YSK +GFWAGL VAI++ SAREATF++AN+K QGTVLG++YGVLGCFVF ++ +L FISL
Sbjct  399   YSKENGFWAGLPVAITFSSAREATFKVANLKVQGTVLGTVYGVLGCFVFERFVKLWFISL  458

Query  1210  IPWFIVCSFLRRSRMYGPAGGISACIGAVLILGREGFGPPREFAMARIMETFIGLACSIT  1389
              PWFI  SFL+RS++YG AGG+SA I AVLILGR+ FG P EFA+ARI+ETFIGL+CS+ 
Sbjct  459   FPWFIFTSFLQRSQIYGQAGGLSAVISAVLILGRKNFGSPSEFAIARIVETFIGLSCSVL  518

Query  1390  VELLFRPTRASSLAKIQLSKSLQLLNQCIISIDYSSNNQSKLEETQKILKSSVTQLGKFI  1569
             V++  +PTRAS+LAK+QLSK L+ L+ CI SI   + ++S LEE  K+LKS + +LGKFI
Sbjct  519   VDIALQPTRASTLAKVQLSKCLEALHDCICSISLCA-SKSNLEENHKVLKSHLNELGKFI  577

Query  1570  GEAEVEPNFWFLPFHSACYGKLMGSLSKVVEYLHFVAQALRFLEQESA--------LMGR  1725
             GEAEVEPNF FLP HSA Y +L+ SLSK+ + L  VA ALRFLEQE++         + +
Sbjct  578   GEAEVEPNFLFLPLHSAAYSRLLVSLSKMADLLVHVAHALRFLEQETSKPEASWKDAVDK  637

Query  1726  LDSDHLSLFRDHVGPSIKSFEEIISLVGSVSVLDKEFEKKKSSIDPELGKLPTSN----N  1893
             +D D L  F++ +   IKSFEE+ S + S+  L+KE E+K  S D E+GK PT+N     
Sbjct  638   VDGD-LKPFKEMLASLIKSFEEVAS-IKSLPALEKELEEKNISYDLEMGKSPTTNLSRLA  695

Query  1894  ITGLSDEEIDNKLKSFMEDSRQFVDQKdeddddeVMMNSQVALSLSALAFCMRGIVRETK  2073
              +G  ++E++  +  ++++S++ V+  + ++   +M+     LSLS L FCM G++RET+
Sbjct  696   GSGNREDEMEKMISCYLQNSKEIVEGVEGEEVRSLMV-----LSLSGLGFCMSGLMRETR  750

Query  2074  EIDKAIKELVQWENPSSPVNLHEISCKIRAL  2166
             EI++ IK++VQWEN SS VNL+EISCK  AL
Sbjct  751   EIEQGIKDIVQWENHSSHVNLYEISCKAHAL  781



>ref|XP_010092784.1| hypothetical protein L484_001852 [Morus notabilis]
 gb|EXB52249.1| hypothetical protein L484_001852 [Morus notabilis]
Length=808

 Score =   615 bits (1586),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 378/749 (50%), Positives = 503/749 (67%), Gaps = 39/749 (5%)
 Frame = +1

Query  1     ALRGCWYAIYATCLGVCPAILSLWLIGPahlttgtaaaavaitaFIVVLPQNTHVVAKRI  180
              LRGCW A+YAT   + PA+LSLWLI P+ LT    + AVA+ AF+V LP++TH+V+KR+
Sbjct  70    TLRGCWLALYATAQSLGPAMLSLWLIDPSRLTRSVTSLAVALGAFVVALPESTHLVSKRV  129

Query  181   ALGQTVLVYALA---GPRTQPIMHPlrvaastaiavaacvlalllpypslassKVKHNCH  351
             ALGQ V+VY +    G +T+ +MH LRVAAST + V ACVLALLLP+P LA  +VK N H
Sbjct  130   ALGQIVIVYVIGFINGDKTEAVMHTLRVAASTGVGVLACVLALLLPFPRLACKEVKDNSH  189

Query  352   LFAENVSQRLNLLVKAFSAEDNASALSLVSQAKSLNASGAKFLQNIKSKQESMQWERYPI  531
             LFAEN S+RL   VKAF+A D  SAL  +SQAK++ A+G K LQ +K  QESM WER P+
Sbjct  190   LFAENASERLKHFVKAFTAGDKNSALESISQAKAMAATGTKLLQTVKRFQESMLWERPPL  249

Query  532   KFFRP-YCKNPGERLQEYETPLRGMEMGLVDNNPPQFPVTV-LLSSSEVKDSLDSL--TG  699
             K  +P YC NPG+R+QE E PLRG+EM L   N   FPVT   L+  ++KD L       
Sbjct  250   KCLKPRYCTNPGDRMQELEVPLRGLEMAL--TNTRSFPVTFSTLNGDQLKDGLQITVENN  307

Query  700   HISKQVKGRLFD--LATVPESNA-QNAVKFLH--QKLQPVT---LQdlssffflfslkll  855
             +    V G   D  ++TVPES        FLH  Q   P T   L      F +  +   
Sbjct  308   NTINLVTGIQNDSSISTVPESTELDQQTAFLHTLQDNMPQTHKNLPSFFFLFCVNLVLPT  367

Query  856   likpsssilkdkdGSKEQEERFLDK-IYSNFVGQM---NNKRFVASLKYALALGLAVFFG  1023
                         D  +EQ +   DK I+++ +  +   NN+R + + K +L+LGLAVFFG
Sbjct  368   KTPIVPPTKSTTDQDQEQNDSAFDKTIWTSVIPTLKLANNQRLMYAFKSSLSLGLAVFFG  427

Query  1024  SIYSKPDGFWAGLTVAISYVSAREATFRIANVKAQGTVLGSIYGVLGCFVFAKYEELRFI  1203
               YSKPDG+WAGL VAIS  + REATFR+AN+KAQGTVLG++YGVLG F+F K    R  
Sbjct  428   LTYSKPDGYWAGLPVAISLSAGREATFRVANLKAQGTVLGTVYGVLGWFLFEKSLPTRLF  487

Query  1204  SLIPWFIVCSFLRRSRMYGPAGGISACIGAVLILGREGFGPPREFAMARIMETFIGLACS  1383
             SL+PWF+  SFL+RS+MY  AG ISA IGA+L+LGR+GFGPP +FA+ARI ETFIGL+CS
Sbjct  488   SLVPWFVFTSFLQRSKMYSQAGSISAVIGAILVLGRKGFGPPSKFAIARIAETFIGLSCS  547

Query  1384  ITVELLFRPTRASSLAKIQLSKSLQLLNQCIISIDYSSNNQ-SKLEETQKILKSSVTQLG  1560
             I V+LLF+PTRAS+L+KI LS+S+Q L +C+ S+ + SN + S L+  +K L   V +LG
Sbjct  548   IIVDLLFQPTRASALSKIHLSRSIQTLQECVNSLTFQSNAKLSNLDANRKKLNMCVNELG  607

Query  1561  KFIGEAEVEPNFWFLPFHSACYGKLMGSLSKVVEYLHFVAQALRFLEQ-------ESALM  1719
             KF+GEAE+EPNFWF+PF S CYGK++ SLSK+V+ L F ++A+ FL+Q       + +++
Sbjct  608   KFVGEAELEPNFWFMPFPSDCYGKILESLSKMVDLLDFCSRAMGFLDQRGRILINQESII  667

Query  1720  GRLDSDHLSLFRDHVGPSIKSFEEIISLVGSVSVLDKEFEKKKSSIDPELGKLPTSNNIT  1899
               LD D L LF++ VG S+K  EE +S + S+++L+KE EK K+S D ELGK    +   
Sbjct  668   TSLDGD-LELFKELVGSSLKYAEE-VSRIKSLALLEKELEKSKTSYDIELGK----SGKL  721

Query  1900  GLSDEEIDNKLKSFMEDSRQFVDQKdeddddeVMMNSQVALSLSALAFCMRGIVRETKEI  2079
              L ++EID  + S++  SR+ V++ D+D +    +  Q+ L LSAL FCM G +RET+EI
Sbjct  722   SLDEDEIDKVVGSYVHHSREVVEKIDDDRE----LKRQMVLCLSALGFCMSGFMRETREI  777

Query  2080  DKAIKELVQWENPSSPVNLHEISCKIRAL  2166
             + AIKELVQ ENPSS VNL+EISC I AL
Sbjct  778   EDAIKELVQRENPSSRVNLYEISCMIHAL  806



>ref|XP_007207606.1| hypothetical protein PRUPE_ppa019452mg [Prunus persica]
 gb|EMJ08805.1| hypothetical protein PRUPE_ppa019452mg [Prunus persica]
Length=796

 Score =   613 bits (1581),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 384/745 (52%), Positives = 493/745 (66%), Gaps = 44/745 (6%)
 Frame = +1

Query  4     LRGCWYAIYATCLGVCPAILSLWLIGPahlttgtaaaavaitaFIVVLPQNTHVVAKRIA  183
             L G W  +YAT   + PA+LSLWLIGPA L++G  A AV + AF+V LP+ TH+V KRIA
Sbjct  70    LCGLWLGLYATAQTIGPAMLSLWLIGPARLSSGITALAVGLAAFVVALPEFTHLVCKRIA  129

Query  184   LGQTVLVYALA---GPRTQPIMHPlrvaastaiavaacvlalllpypslassKVKHNCHL  354
             LGQ V+VY +A   G   Q IMHP+ VAAST I V ACVLA L+P+P LAS +VK N  L
Sbjct  130   LGQIVIVYVIAYIKGGEVQAIMHPVHVAASTGIGVLACVLAFLVPFPRLASREVKQNAKL  189

Query  355   FAENVSQRLNLLVKAFSAEDNASALSLVSQAKSLNASGAKFLQNIKSKQESMQWERYPIK  534
               EN S+RL L VKAF AEDN SAL+ +SQAKSL A+  K  Q IK  QESM+WE+ P+K
Sbjct  190   LGENASERLKLFVKAFCAEDNTSALASISQAKSLAATATKLFQTIKRHQESMEWEKLPLK  249

Query  535   FFRPYCKNPGERLQEYETPLRGMEMGLVDNNPPQFPVTVLLSSSEVKDSLDSLTGHISKQ  714
             F R    NPG+RLQ +E PL+GMEM L     P FP+ V+  + E KD L  L  ++S  
Sbjct  250   FSRYKYANPGDRLQGFEIPLKGMEMALTST--PSFPIKVV--NGEHKDGL--LRVNLSAP  303

Query  715   VKGRLFDLATVPESNAQNAVKFLH---------QKLQPVTLQdlssffflfslklllikp  867
                   D  TVPESNA+N V+FL          Q L P+        F          + 
Sbjct  304   C-----DSTTVPESNAEN-VRFLQTLKTIPQTQQDLPPIFFLFCIKLFHGKLSATSPTEQ  357

Query  868   sssilkdkdG---SKEQEERFLDKIYSNFVGQMNNKRFVASLKYALALGLAVFFGSIYSK  1038
                ++   +G   S++Q      ++ SN   +  +KR + + K +L+LGLAVFFG +YSK
Sbjct  358   GKLLVHQNEGAIDSRKQNGFCFKEVLSNLSIKARSKRLMIAFKCSLSLGLAVFFGLVYSK  417

Query  1039  PDGFWAGLTVAISYVSAREATFRIANVKAQGTVLGSIYGVLGCFVFAKYEELRFISLIPW  1218
              +GFW+GL VAIS+ SAREA F++ANVKAQGTVLG++YGVLGCF+F ++  +R +SLIPW
Sbjct  418   KNGFWSGLPVAISFASAREAAFKVANVKAQGTVLGTVYGVLGCFLFQRFLSIRLLSLIPW  477

Query  1219  FIVCSFLRRSRMYGPAGGISACIGAVLILGREGFGPPREFAMARIMETFIGLACSITVEL  1398
             FI  SFL+RSRMYG AGGISA IGAVLILGR  FGPP EFA+ARI ETFIGL+CSI V+L
Sbjct  478   FIFTSFLQRSRMYGQAGGISAVIGAVLILGRANFGPPSEFAIARITETFIGLSCSIMVDL  537

Query  1399  LFRPTRASSLAKIQLSKSLQLLNQCIISIDYSSNNQSKLEETQKILKSSVTQLGKFIGEA  1578
             L +PTRAS+LAK QLS++L  L +CI S+   S  ++ LEE QK LK+ V +LGK IGEA
Sbjct  538   LLQPTRASTLAKAQLSRTLDTLQECINSVSLQS-GRALLEENQKRLKNHVEELGKLIGEA  596

Query  1579  EVEPNFWFLPFHSACYGKLMGSLSKVVEYLHFVAQALRFLEQESALMGRLDSD-------  1737
             E EPNFWF PFHSACYGKL+ SLSK+++ L F A A+  LEQ S ++     D       
Sbjct  597   EAEPNFWFWPFHSACYGKLLRSLSKMMDLLLFSAHAVEVLEQNSQMLEASWKDIVHTVEC  656

Query  1738  HLSLFRDHVGPSIKSFEEIISLVGSVSVLDKEFEKKKSSIDPELGKL--PTSNNITGLSD  1911
              L LF+  VG  I+ F+E I+L+ S++VLD   +K   + D ELGK   PT   I G  D
Sbjct  657   DLELFKKMVGSLIECFKE-ITLIKSITVLD---QKSDIAHDLELGKSGNPTIFRICGSKD  712

Query  1912  EEIDNKLKSFMEDSRQFVDQKdeddddeVMMNSQVALSLSALAFCMRGIVRETKEIDKAI  2091
             EE+D  + S+++ S++ VD+     ++   + SQ+ L LSAL FC+  I+R TKEI++ I
Sbjct  713   EEMDTIISSYLQHSKEVVDKIHVQSEE---LKSQMVLCLSALGFCISSIIRATKEIEEEI  769

Query  2092  KELVQWENPSSPVNLHEISCKIRAL  2166
             KEL QWENPSS +NL+EISCK+ AL
Sbjct  770   KELAQWENPSSHINLYEISCKVHAL  794



>ref|XP_008223255.1| PREDICTED: uncharacterized protein LOC103323069 [Prunus mume]
Length=796

 Score =   600 bits (1547),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 383/745 (51%), Positives = 495/745 (66%), Gaps = 44/745 (6%)
 Frame = +1

Query  4     LRGCWYAIYATCLGVCPAILSLWLIGPahlttgtaaaavaitaFIVVLPQNTHVVAKRIA  183
             L G W  +YAT   + PA+LSLWLIGPA L++G  A AV + AF+V LP+ TH+V +RIA
Sbjct  70    LCGLWLGLYATAQTIGPAMLSLWLIGPARLSSGITALAVGLAAFVVALPEFTHLVCRRIA  129

Query  184   LGQTVLVYALA---GPRTQPIMHPlrvaastaiavaacvlalllpypslassKVKHNCHL  354
             LGQ V+VY +A   G   Q IMHP+ VAAST I V ACVLA L+P+P LAS +VK N  L
Sbjct  130   LGQIVIVYVIAYIKGAEIQAIMHPVHVAASTGIGVLACVLAFLVPFPRLASREVKQNAKL  189

Query  355   FAENVSQRLNLLVKAFSAEDNASALSLVSQAKSLNASGAKFLQNIKSKQESMQWERYPIK  534
               EN S+RL L VKAF AED+ SAL+ +SQAKSL A+  K  Q IK  QESM+WE+ P+K
Sbjct  190   LGENASERLKLFVKAFCAEDSTSALASISQAKSLAATATKLFQTIKRHQESMEWEKLPLK  249

Query  535   FFRPYCKNPGERLQEYETPLRGMEMGLVDNNPPQFPVTVLLSSSEVKDSLDSLTGHISKQ  714
             F R    NPG+RLQ +E PLRGMEM L     P FP+ V+  + E KD L  L  ++S  
Sbjct  250   FSRYKYANPGDRLQGFEIPLRGMEMALTST--PSFPIKVV--NGEHKDGL--LRVNLSAP  303

Query  715   VKGRLFDLATVPESNAQNAVKFLH---------QKLQPVTLQdlssffflfslklllikp  867
                   D  TVPESNA+N V+FL          Q L P+        F          + 
Sbjct  304   C-----DSTTVPESNAEN-VRFLQTLKTIPQTQQDLPPIFFLFCIKLFHGKLAATSPTEQ  357

Query  868   sssilkdkdG---SKEQEERFLDKIYSNFVGQMNNKRFVASLKYALALGLAVFFGSIYSK  1038
                ++   +G   S +Q      ++ SN   ++ +KR + +   +L+LGLAVFFG +YSK
Sbjct  358   GKLLVHQNEGAIDSHKQNGFCFKEVLSNLSIRVRSKRLMIAFNCSLSLGLAVFFGLVYSK  417

Query  1039  PDGFWAGLTVAISYVSAREATFRIANVKAQGTVLGSIYGVLGCFVFAKYEELRFISLIPW  1218
              +GFW+GL VAIS+ SAREA F++ANVKAQGTVLG++YGVLGCF+F ++  +R +SLIPW
Sbjct  418   ENGFWSGLPVAISFASAREAAFKVANVKAQGTVLGTVYGVLGCFLFQRFLSIRLLSLIPW  477

Query  1219  FIVCSFLRRSRMYGPAGGISACIGAVLILGREGFGPPREFAMARIMETFIGLACSITVEL  1398
             FI  SFL+RSRMYG AGGISA IGAVLILGR  FGPP EFA+ARI ETFIGL+CSI V++
Sbjct  478   FIFTSFLQRSRMYGQAGGISAVIGAVLILGRANFGPPSEFAIARITETFIGLSCSIMVDV  537

Query  1399  LFRPTRASSLAKIQLSKSLQLLNQCIISIDYSSNNQSKLEETQKILKSSVTQLGKFIGEA  1578
             L +PTRAS+LAK QLS++L  L +CI S+   S  ++ LEE QK LK+ V +LGK IGEA
Sbjct  538   LLQPTRASTLAKAQLSRTLDTLQECINSVSLQS-GRALLEENQKRLKNHVEELGKLIGEA  596

Query  1579  EVEPNFWFLPFHSACYGKLMGSLSKVVEYLHFVAQALRFLEQESALM--GRLDSDH----  1740
             E EPNFWF PFHSACYGKL+ SLSK+++ L F A A+  LEQ S ++     D+ H    
Sbjct  597   EAEPNFWFWPFHSACYGKLLRSLSKMMDLLLFSAHAVEVLEQNSQMLEASWKDTVHTVEC  656

Query  1741  -LSLFRDHVGPSIKSFEEIISLVGSVSVLDKEFEKKKSSIDPELGKL--PTSNNITGLSD  1911
              L LF+  VG  I+ F+E I+L+ S++VLD   +K   + D ELGK   PT   I G  D
Sbjct  657   DLELFKKMVGSLIECFKE-ITLIKSITVLD---QKSDIAHDLELGKSGNPTIFQICGSKD  712

Query  1912  EEIDNKLKSFMEDSRQFVDQKdeddddeVMMNSQVALSLSALAFCMRGIVRETKEIDKAI  2091
             EE+D  + S+++ S++ VD+     ++   + SQ+ L LSAL FC+  I+RETKEI++ I
Sbjct  713   EEMDTIISSYLQHSKEVVDKIHVQSEE---LKSQMVLCLSALGFCISSIIRETKEIEEEI  769

Query  2092  KELVQWENPSSPVNLHEISCKIRAL  2166
             KEL QWENPSS +NL+EISCK+ AL
Sbjct  770   KELAQWENPSSHINLYEISCKMHAL  794



>ref|XP_004295927.1| PREDICTED: uncharacterized protein LOC101293764 [Fragaria vesca 
subsp. vesca]
Length=811

 Score =   598 bits (1541),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 381/749 (51%), Positives = 503/749 (67%), Gaps = 39/749 (5%)
 Frame = +1

Query  4     LRGCWYAIYATCLGVCPAILSLWLIGPahlttgtaaaavaitaFIVVLP-QNTHVVAKRI  180
             LRG W A+YAT   V PAILSLWLIGPA LTT T A AV + AF+VVLP + TH+V+KRI
Sbjct  70    LRGFWLALYATIQSVGPAILSLWLIGPARLTTSTTALAVGLAAFVVVLPGEATHLVSKRI  129

Query  181   ALGQTVLVYALA---GPRTQPIMHPlrvaastaiavaacvlalllpypslassKVKHNCH  351
             ALGQ VLVY +A   G     IMHP+ VAASTA+ V ACVLALL+P+P LA  +VK N  
Sbjct  130   ALGQIVLVYVIAFIKGGSADAIMHPVHVAASTAVGVLACVLALLVPFPRLACREVKQNSK  189

Query  352   LFAENVSQRLNLLVKAFSAEDNASALSLVSQAKSLNASGAKFLQNIKSKQESMQWERYPI  531
             +  +N S+RL L +KAF AEDNASAL+ VSQ KSL ++  K  Q I+  QESMQWER P+
Sbjct  190   VLVDNASERLKLFMKAFCAEDNASALASVSQTKSLASTATKLFQTIRCHQESMQWERLPL  249

Query  532   KFFRPYCKNPGERLQEYETPLRGMEMGLVDNNPPQFPVTVLLSSSEVKDSLDSLTG-HIS  708
                R    NPG RLQ  E PL+GMEM L  ++ P FPV V+    EVK +L  L    +S
Sbjct  250   TLLRHSNVNPGSRLQGLEIPLKGMEMAL--SSTPSFPVGVV--DGEVKSALLKLVEEQMS  305

Query  709   KQVKGRLFDLATVPESNAQNAVKFLHQKLQ--PVTLQdl-----ssffflfslklllikp  867
                     D  T+PES  +  ++ L Q LQ  P TLQDL          L    L     
Sbjct  306   LNRSIHCEDAITIPESKPEIDIRCL-QTLQTIPQTLQDLPPFFFLFCISLLHGNLSATSS  364

Query  868   sssilkdkdGSKEQEERFLD----KIYSNFVGQMNNKRFVASLKYALALGLAVFFGSIYS  1035
             S++I +DK  +  ++E         ++SNF  ++N+KR +A+ K +L++GLAVFFG I+S
Sbjct  365   SATIAQDKLVTHPKKEALTSCKQSVVWSNFSMKVNSKRIMAAFKCSLSVGLAVFFGLIFS  424

Query  1036  KPDGFWAGLTVAISYVSAREATFRIANVKAQGTVLGSIYGVLGCFVFAKYEELRFISLIP  1215
             K +G W+GL VA+S+ + REATF++ANVKAQGTVLG++YGV GCF+F K   +R +SL+P
Sbjct  425   KENGHWSGLPVAVSFAATREATFKVANVKAQGTVLGTVYGVFGCFLFHKVLPIRILSLVP  484

Query  1216  WFIVCSFLRRSRMYGPAGGISACIGAVLILGREGFGPPREFAMARIMETFIGLACSITVE  1395
             WFI  SFL+RS++YG AGGISA IGAVLILGR  FG P EFA+ARI ETFIGL+CSI VE
Sbjct  485   WFIFTSFLQRSKLYGQAGGISAVIGAVLILGRTKFGTPSEFAIARITETFIGLSCSIFVE  544

Query  1396  LLFRPTRASSLAKIQLSKSLQLLNQCIISIDYSSNNQSKLEETQKILKSSVTQLGKFIGE  1575
             LL +PTRAS+LAK+QLS++L  L++CI S+   S  +++LE++QK LK  V +LGKFI E
Sbjct  545   LLLQPTRASTLAKVQLSRTLGALHECIDSVSLQS-GRAQLEDSQKCLKLHVEELGKFIAE  603

Query  1576  AEVEPNFWFLPFHSACYGKLMGSLSKVVEYLHFVAQALRFLEQES--------ALMGRLD  1731
             A+VEPNFWFLP H+A YGKLM S+SK++E L F   A+  LEQ S         ++ +++
Sbjct  604   ADVEPNFWFLPLHTASYGKLMSSISKMMELLVFSGHAIGVLEQNSQFLEGSWKGIVAKME  663

Query  1732  SDHLSLFRDHVGPSIKSFEEIISLVGSVSVLDKEF---EKKKSSIDPELGKLPT--SNNI  1896
              D L LF+  VG  I  F + I+L+ SV+VL++E    ++   S D ELGK  T  +  +
Sbjct  664   CD-LELFKKMVGSLIICFRD-ITLLKSVTVLEREGLDDQESGKSCDLELGKPQTLKAFRV  721

Query  1897  TGLSDEEIDNKLKSFMEDSRQFVDQKdeddddeVMMNSQVALSLSALAFCMRGIVRETKE  2076
              GL D E+D  + S++  S++ VD+     ++E  +  Q+ L LSA+ FC+ G++R T+E
Sbjct  722   CGLEDAEMDKIVSSYLLHSKEAVDKIHCQQNEE--LKGQIVLCLSAIGFCVSGLIRATRE  779

Query  2077  IDKAIKELVQWENPSSPVNLHEISCKIRA  2163
             I++ IKELVQWENPSS VNL+EISCK+ A
Sbjct  780   IEEGIKELVQWENPSSHVNLYEISCKMHA  808



>ref|XP_010685806.1| PREDICTED: uncharacterized protein LOC104900148 [Beta vulgaris 
subsp. vulgaris]
Length=820

 Score =   591 bits (1523),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 358/758 (47%), Positives = 501/758 (66%), Gaps = 48/758 (6%)
 Frame = +1

Query  1     ALRGCWYAIYATCLGVCPAILSLWLIG-PahlttgtaaaavaitaFIVVLPQNTHVVAKR  177
              +RG W A YAT   VCPAIL LW++G P  L+  + +  +AI AF +  PQ+TH VAKR
Sbjct  73    TIRGLWLAFYATLQTVCPAILCLWMMGGPTSLSVVSTSVVLAIAAFFIAFPQSTHAVAKR  132

Query  178   IALGQTVLVYALA---GPRTQPIMHPlrvaastaiavaacvlalllpypslassKVKHNC  348
             IALGQ V++Y +      +   +MHP+RVAASTA+   AC LALLLPYP LASS+VK N 
Sbjct  133   IALGQLVIIYVIGYINAHQLDAVMHPMRVAASTAVGAFACFLALLLPYPHLASSQVKENS  192

Query  349   HLFAENVSQRLNLLVKAFSAEDNASALSLVSQAKSLNASGAKFLQNIKSKQESMQWERYP  528
              LFAEN S+RL L VKAF AED  ++ +L+SQAKSL     K+LQ IKSKQESM WER+ 
Sbjct  193   KLFAENASERLKLFVKAFCAEDITTSQALISQAKSLAGKARKYLQCIKSKQESMHWERFF  252

Query  529   IKFFRPYCKNPGERLQEYETPLRGMEMGLVDNNPPQFPVTVLLSSSEVKDSLDSLTGHIS  708
             I++ R YCKNPG+R QE ETPLRGME+ L++    + PV++L     VKD +D   G IS
Sbjct  253   IQYLRNYCKNPGDRFQELETPLRGMEIALMN---ARVPVSIL--DQRVKDGMDITQGEIS  307

Query  709   K---QVKGRL-FDLATVPESNAQNAVKFLHQKLQPVTLQdlssffflfslklllikpsss  876
             +   Q++  +  +  T PES     + FL QKL+ +   + +   + F   + L+   S 
Sbjct  308   QNLYQLRSHMPCETLTFPESGEGQVMNFL-QKLETLPSNESNLPSYFFFFCMKLLHSQSR  366

Query  877   ilkdkdGSKEQEERFLDK-----------------IYSNFVGQMNNKRFVASLKYALALG  1005
              +     S + +++ L K                 +++N+   +  +R + +L+ +L+LG
Sbjct  367   AMTIPQNSPKLDQKTLKKQPYDKTIEHQNGFSFKLVWANWPTSLFKERLIIALRCSLSLG  426

Query  1006  LAVFFGSIYSKPDGFWAGLTVAISYVSAREATFRIANVKAQGTVLGSIYGVLGCFVFAKY  1185
              AV FG  YSKP+GFW+GL VA+S+ +AREATF++ANVK QGTV+G++YGVLGCF+F ++
Sbjct  427   FAVLFGLYYSKPNGFWSGLPVAVSFAAAREATFKVANVKFQGTVIGNVYGVLGCFIFERF  486

Query  1186  EELRFISLIPWFIVCSFLRRSRMYGPAGGISACIGAVLILGREGFGPPREFAMARIMETF  1365
              ++RFI+LIPWFI  SFL++S+MYG AG +SA IGA+LILGR  FGPP +FA+ARI+ETF
Sbjct  487   VQIRFIALIPWFIFTSFLQQSKMYGQAGAVSAVIGAILILGRRNFGPPSDFAIARIVETF  546

Query  1366  IGLACSITVELLFRPTRASSLAKIQLSKSLQLLNQCIISIDYSSNNQSKLEETQKILKSS  1545
             IGL+CSI ++LL  PTR ++L K+QL+K+L  L+   ISID  + ++++L  + K +K  
Sbjct  547   IGLSCSIVIDLLLHPTRGATLGKVQLAKTLGALHGSFISIDLFTMSKNELLVSAKNIKVQ  606

Query  1546  VTQLGKFIGEAEVEPNFWFLPFHSACYGKLMGSLSKVVEYLHFVAQALRFLEQESALMGR  1725
             V +L K++GEAE EPNFW+LPF++ CY KLMGS S + + L FVA A+ FLE++   + R
Sbjct  607   VKELEKYVGEAEAEPNFWYLPFNTPCYKKLMGSFSNMGDLLLFVANAIGFLEEQ---IQR  663

Query  1726  LDS-------DHLSLFRDHVGPSI----KSFEEIISLVGSVSVLDKEFEKKKSSIDPELG  1872
             LD        D ++    HVG  I    KSF+E  S V S+ VL+K+F K   + D ELG
Sbjct  664   LDVIGIKDELDKINGDVKHVGKIIATLMKSFQETTS-VKSLLVLEKDFTKSGKTFDLELG  722

Query  1873  KLPTSNNITGLSDEEIDNKLKSFMEDSRQFVDQKdeddddeVMMNSQVALSLSALAFCMR  2052
             K  T+  +  + D++++  +  ++E  +   D K +  +DE  M SQ+ +S SA+ FC+ 
Sbjct  723   K-STNFALMIVEDKDVEKIISLYLEHLKDVFD-KIQFPEDEEEMKSQIVMSFSAIGFCLS  780

Query  2053  GIVRETKEIDKAIKELVQWENPSSPVNLHEISCKIRAL  2166
              ++RETKEI+K IKELVQWENP+S VNLHEISCKI AL
Sbjct  781   CLMRETKEIEKGIKELVQWENPTSHVNLHEISCKIHAL  818



>ref|XP_010253831.1| PREDICTED: uncharacterized protein LOC104594975 [Nelumbo nucifera]
Length=830

 Score =   584 bits (1506),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 365/769 (47%), Positives = 496/769 (64%), Gaps = 57/769 (7%)
 Frame = +1

Query  4     LRGCWYAIYATCLGVCPAILSLWLIGPahlttgtaaaavaitaFIVVLPQNTHVVAKRIA  183
             LRGC YA+YAT LGV PAIL LW IGPA L+  T + AVA++AF++VLP++TH++ KRIA
Sbjct  69    LRGCCYALYATILGVLPAILCLWAIGPARLSAITMSLAVALSAFVIVLPESTHLITKRIA  128

Query  184   LGQTVLVYALA---GPRTQPIMHPlrvaastaiavaacvlalllpypslassKVKHNCHL  354
             L Q VLVY +A   G  T  I HP+ VAASTAI   A V+ALLLPYP LA  +V+  C L
Sbjct  129   LAQVVLVYVVAYINGVHTGAITHPVHVAASTAIGALASVVALLLPYPRLACHEVRKKCKL  188

Query  355   FAENVSQRLNLLVKAFSAEDNASALSLVSQAKSLNASGAKFLQNIKSKQESMQWERYPIK  534
             FAE  S+RLN LV AF A++  S L+ +SQAKSL+ + AK LQ+IK KQESMQWER  I 
Sbjct  189   FAETASERLNHLVHAFCADEKTSTLASLSQAKSLSKTEAKLLQSIKLKQESMQWERPRIS  248

Query  535   FFRPYCKNPGERLQEYETPLRGMEMGLVDNNPPQFPVTVLLSSSEVKDSLDSLTGHISKQ  714
             FF+ +C + G+RLQ  E  LRGME+ L   + P F V VL +  E K  L +L  H+S  
Sbjct  249   FFQHHCTSRGDRLQGIEISLRGMEIAL--TSCPSFSVKVL-ADEEHKSFLHALQKHVSLT  305

Query  715   VK-GRLF----DLATVPESNAQNAV--KFLHQKLQPV---------------TLQdlssf  828
             +K   L+    D +T PE     AV  KF+ Q LQ V                    +  
Sbjct  306   LKRANLYLPSCDSSTTPEIKGSEAVDDKFM-QILQVVFPTYKDLPSLFFLFCLKLLHNEL  364

Query  829   fflfslklllikpsssilkdkdGSKEQEERFLDKIYSNFVGQMNNKRFVASLKYALALGL  1008
                 +    +   +SS    + G++  ++ +   I S++  ++  +R + + K AL+LGL
Sbjct  365   TGTPTPSNGISLGNSSAPCTQYGTRSSKQSW-GAILSHWPVKIGKRRLILAFKRALSLGL  423

Query  1009  AVFFGSIYSKPDGFWAGLTVAISYVSAREATFRIANVKAQGTVLGSIYGVLGCFVFAKYE  1188
             +V FG+++SK DG+W+GLTVA+     REATF++ANVKAQGTVLG++YGVLGCF+F ++E
Sbjct  424   SVLFGTMFSKEDGYWSGLTVAVGMAWGREATFKVANVKAQGTVLGTVYGVLGCFIFQRFE  483

Query  1189  ELRFISLIPWFIVCSFLRRSRMYGPAGGISACIGAVLILGREGFGPPREFAMARIMETFI  1368
             ++RF+S +PW I  SFL RSRMYG AGGISA I A++ILGR+ +GPP  FA+ RIMETFI
Sbjct  484   DIRFLSFLPWIIFTSFLGRSRMYGQAGGISAVIAALIILGRKNYGPPSAFAIVRIMETFI  543

Query  1369  GLACSITVELLFRPTRASSLAKIQLSKSLQLLNQCIISIDYSSNNQS-------KLEETQ  1527
             GL+CSI VELL +PTRA +LAK++  +SL  L+ CI  I +SS++ +       +L E Q
Sbjct  544   GLSCSIMVELLLQPTRAVTLAKVEFCRSLGTLHDCIQCISFSSSHTNDDYPCLQELNEKQ  603

Query  1528  KILKSSVTQLGKFIGEAEVEPNFWFLPFHSACYGKLMGSLSKVVEYLHFVAQALRFLEQE  1707
             K L + VT+L  FI EAEVEPNFWFLPFHS CYGKL+ SLSK+V++L F + A+ F+ Q 
Sbjct  604   KKLTTHVTELANFIAEAEVEPNFWFLPFHSICYGKLLKSLSKMVDFLLFGSHAMGFIVQA  663

Query  1708  S--------ALMGRLDSDHLSLFRDHVGPSIKSFEEIISLVGSVSVLDKEFEKKKSSIDP  1863
             S         +   +D D L LF+D +G +IK FE+  S + S++ L+KE  K     D 
Sbjct  664   SQRCRVPWKEIQEHIDED-LQLFKDKIGCAIKCFEQATS-IKSLAALEKELWKNIPR-DL  720

Query  1864  ELGKLPTSNNITGLSDEEIDNK--------LKSFMEDSRQFVDQKdeddddeVMMNSQVA  2019
             E GK P  +    L  +  +++        L SF++ SR+ +D K    + E  + SQ+ 
Sbjct  721   EFGKSPKPDGFRVLDADTDEDEDEDKVEEMLTSFLQHSREIID-KFHAAEAEEGLKSQMI  779

Query  2020  LSLSALAFCMRGIVRETKEIDKAIKELVQWENPSSPVNLHEISCKIRAL  2166
             L LSAL FC+ G+++ET+E++  I+ELVQWENPSS +NL+EISCKI AL
Sbjct  780   LCLSALGFCLGGLIKETREMENGIRELVQWENPSSRINLYEISCKIHAL  828



>ref|XP_009353707.1| PREDICTED: uncharacterized protein LOC103944948 [Pyrus x bretschneideri]
Length=791

 Score =   582 bits (1501),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 372/747 (50%), Positives = 480/747 (64%), Gaps = 40/747 (5%)
 Frame = +1

Query  4     LRGCWYAIYATCLGVCPAILSLWLIGPahlttgtaaaavaitaFIVVLPQNTHVVAKRIA  183
             L G W  +YAT   +  A+LSLWLIGPA L+T T A  V + AF+V LP+ TH+V KRIA
Sbjct  57    LCGFWLGLYATAQTIGLAVLSLWLIGPARLSTSTTALVVGLAAFVVALPEFTHLVTKRIA  116

Query  184   LGQTVLVYALA---GPRTQPIMHPlrvaastaiavaacvlalllpypslassKVKHNCHL  354
             LGQ V++Y +A   G  T  IMHP+ VAASTAI V ACVLALL+P+P LAS +VK N  L
Sbjct  117   LGQIVIMYVIAYINGGHTDAIMHPVHVAASTAIGVLACVLALLIPFPRLASREVKQNSEL  176

Query  355   FAENVSQRLNLLVKAFSAEDNASALSLVSQAKSLNASGAKFLQNIKSKQESMQWERYPIK  534
             FA+N S+RL + VKAF AED+ SAL+ +SQA S+ ++  K  Q IKS QESM+WER P+K
Sbjct  177   FAKNASERLKIFVKAFCAEDSTSALASISQANSMASTATKLFQTIKSHQESMKWERVPLK  236

Query  535   FF-RPYCKNPGERLQEYETPLRGMEMGLVDNNPPQFPVTVLLSSSEVKDSLDSLT-GHIS  708
              F R    NPG RLQ  E P RGMEM L     P FPV V+ +    KD+L  L   H+S
Sbjct  237   LFSRHGYVNPGNRLQGLEIPFRGMEMAL--TCIPSFPVKVV-NGELNKDALLRLVEQHMS  293

Query  709   KQVKGRLFDLATVPESNAQNAVKFL---------HQKLQPVTLQdlssffflfslkllli  861
               +     D  TVPES A+N V FL         HQ L P+      +           I
Sbjct  294   LNLSPPC-DSITVPESKAEN-VGFLQTLQTIPNIHQDLPPIFFLFCINLLQGKLSSRSSI  351

Query  862   kpsssilkdkdGS--KEQEERFLDKIYSNFVGQMNNKRFVASLKYALALGLAVFFGSIYS  1035
              P   ++   +G+    ++      I+SN   +++ KR  A+ K AL+LGLAVFFG  YS
Sbjct  352   LPEKLLVHQNEGAINSSKQNGLYFTIWSNLSTKVSGKRLTAAFKCALSLGLAVFFGLKYS  411

Query  1036  KPDGFWAGLTVAISYVSAREATFRIANVKAQGTVLGSIYGVLGCFVFAKYEELRFISLIP  1215
             K DG+WAGL VAIS  S REATF+++NVK QGTVLG++YGVLG F+F ++  +R +SLIP
Sbjct  412   KDDGYWAGLPVAISLASTREATFKVSNVKVQGTVLGTVYGVLGWFLFQRFMSMRLLSLIP  471

Query  1216  WFIVCSFLRRSRMYGPAGGISACIGAVLILGREGFGPPREFAMARIMETFIGLACSITVE  1395
             WFI  SFL+RSRMYG AGGISA IGAVL+LGR  FGPP EFA+ARI ETFIGL+CSI V+
Sbjct  472   WFIFTSFLQRSRMYGQAGGISAVIGAVLVLGRTNFGPPSEFAIARITETFIGLSCSIIVD  531

Query  1396  LLFRPTRASSLAKIQLSKSLQLLNQCIISIDYSSNNQSKLEETQKILKSSVTQLGKFIGE  1575
             LL +PTRAS L+K+QLS++L  L +CI S+      ++ L+E QK LK  + +LGK IGE
Sbjct  532   LLLQPTRASVLSKVQLSRTLGTLQECINSVSLQP-GRANLKENQKRLKMHIEELGKLIGE  590

Query  1576  AEVEPNFWFLPFHSACYGKLMGSLSKVVEYLHFVAQALRFLEQE--------SALMGRLD  1731
             AE EPNFWFLPFHSACYGKL+GS SK+++ L   A A  FLEQ           +   +D
Sbjct  591   AEAEPNFWFLPFHSACYGKLLGSFSKMMDLLVLSAHAAGFLEQNFQRFEASWKDIGHAVD  650

Query  1732  SDHLSLFRDHVGPSIKSFEEIISLVGSVSVLDKEFEKKKSSIDPELGK--LPTSNNITGL  1905
              D L  F+  V   I  F+E+ S +  +SVLD   +K   + D ELGK   P    +   
Sbjct  651   CD-LESFKKMVDSLITFFKEVTS-IKLLSVLD---QKSDIAHDLELGKSRAPNMFGVCSS  705

Query  1906  SDEEIDNKLKSFMEDSRQFVDQKdeddddeVMMNSQVALSLSALAFCMRGIVRETKEIDK  2085
              DEE D  + S+++ SR+ V++ D   ++   + SQ+ L LS L FCM  ++RET+EI++
Sbjct  706   EDEETDKIISSYLQHSREVVEKIDAKSEE---LKSQMVLCLSGLGFCMSSLIRETREIEE  762

Query  2086  AIKELVQWENPSSPVNLHEISCKIRAL  2166
              IKELVQWENPSS ++L+EISCK+  L
Sbjct  763   GIKELVQWENPSSHISLYEISCKLYDL  789



>ref|XP_010046403.1| PREDICTED: uncharacterized protein LOC104435330 [Eucalyptus grandis]
 gb|KCW85592.1| hypothetical protein EUGRSUZ_B02385 [Eucalyptus grandis]
Length=829

 Score =   582 bits (1500),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 363/776 (47%), Positives = 480/776 (62%), Gaps = 74/776 (10%)
 Frame = +1

Query  4     LRGCWYAIYATCLGVCPAILSLWLIGPahlttgtaaaavaitaFIVVLPQNTHVVAKRIA  183
             LRGCW A+YAT   + PAILSLWLIGPA L+TGT A AVA+ +F+V LP  TH  A+RIA
Sbjct  71    LRGCWLALYATAQSIGPAILSLWLIGPARLSTGTTALAVALASFVVALPGATHGTARRIA  130

Query  184   LGQTVLVYALA---GPRTQPIMHPlrvaastaiavaacvlalllpypslassKVKHNCHL  354
             LGQ VLVY +      R + +MHPL VAASTA+   A  LAL LP+P  A  ++K NC  
Sbjct  131   LGQVVLVYVIGYIEKERIEAVMHPLHVAASTAVGALAGPLALSLPFPRTACHEIKENCKA  190

Query  355   FAENVSQRLNLLVKAFSAEDNASALSLVSQAKSLNASGAKFLQNIKSKQESMQWERYPIK  534
             +AEN S RL L  +AF AED  SAL+L+S+AK L+ +G   L+NIK  QES  WER P  
Sbjct  191   YAENASNRLKLFAEAFLAEDEESALALISRAKCLSRAGNILLRNIKCHQESALWERVPFT  250

Query  535   FFRPYCKNPGERLQE-YETPLRGMEMGLVDNNPPQFPVTVLLSSSEVKDSLDSLTGHIS-  708
               RPY  +P +RLQE  ET LRGME  L       FPVT+      +K+   +L  HI+ 
Sbjct  251   SSRPYHMSPRDRLQESLETQLRGMETALTSIT--SFPVTLSGDDGPLKNCKLALDEHIAL  308

Query  709   --KQVKGRLF---DLATVPESNAQNAV-------------------------KFLHQKLQ  798
               +Q K  L      +TVPES ++N +                         K LH K  
Sbjct  309   IMRQSKSWLSPGDSTSTVPESVSKNIIGFFDSIRKVPASPEHLPSIFFLFCMKLLHGKTT  368

Query  799   PVTLQdlssffflfslklllikpsssilkdkdGSKEQEERFLDKIYSNFVGQMNNKRFVA  978
             P+T                         +   G +        ++++ +  +M+ KR V 
Sbjct  369   PLT---------------SPQDDPLRKDEQSTGKESGLSHCFGRVWNEWGFKMSPKRLVP  413

Query  979   SLKYALALGLAVFFGSIYSKPDGFWAGLTVAISYVSAREATFRIANVKAQGTVLGSIYGV  1158
             +L+ +L+LGLAV FG +YSK DG+WAGL +A+SY SAREATF++ANVKAQGTVLGS+YGV
Sbjct  414   ALRCSLSLGLAVLFGLMYSKEDGYWAGLPLAVSYSSAREATFKVANVKAQGTVLGSVYGV  473

Query  1159  LGCFVFAKYEELRFISLIPWFIVCSFLRRSRMYGPAGGISACIGAVLILGREGFGPPREF  1338
             +GCF+F ++  +R +SL+PWF+ CSFLR+S+MYG AGGISA IGA+LILGR+ FGPP EF
Sbjct  474   IGCFLFQRFLPVRVLSLVPWFVFCSFLRKSKMYGQAGGISAVIGALLILGRKNFGPPSEF  533

Query  1339  AMARIMETFIGLACSITVELLFRPTRASSLAKIQLSKSLQLLNQCIISID----YSSNNQ  1506
             A+ARI+ETFIG +C + VELL +PTRASSLAK QL+     L +CI ++       +   
Sbjct  534   AIARIVETFIGFSCLVAVELLMQPTRASSLAKRQLTDCFMALRECIATVTTLGGLDNTKM  593

Query  1507  SKLEETQKILKSSVTQLGKFIGEAEVEPNFWFLPFHSACYGKLMGSLSKVVEYLHFVAQA  1686
             S LEE QK +K SV +LGKFI EA VEPNFWF+PFHSACY +L+GSLSK+ + L+F   A
Sbjct  594   SNLEEKQKRVKMSVLELGKFIEEANVEPNFWFVPFHSACYSRLLGSLSKMADLLYFCGLA  653

Query  1687  LRFLEQ-----------ESALMGRLDSDHLSLFRDHVGPSIKSFEEIISLVGSVSVLDKE  1833
              +FLEQ               + +L SD L L+RD    S+K FEEI S + SVS+L+K+
Sbjct  654   RKFLEQELSALEAAAASSEEALDKLHSD-LELYRDLASSSLKCFEEINS-IKSVSLLEKQ  711

Query  1834  FEKKKSSIDPELGKLPTSNNITGLSDE-EIDNKLKSFMEDSRQFVDQKdeddddeVMMN-  2007
              ++   S D ELGK   SN +    DE +++  + S+++ SR+ + +     D     N 
Sbjct  712   LQETSVSCDLELGKATKSNLLRPRFDEGDVEKMVGSYLQHSREVLHKISSGGDGVEAENA  771

Query  2008  --SQVALSLSALAFCMRGIVRETKEIDKAIKELVQWENPSSPV-NLHEISCKIRAL  2166
               S++ LSL AL FCM  ++RE +EI+KA+KELVQW NP+S + NLH+ S KI AL
Sbjct  772   IKSEMVLSLGALGFCMSSLLREVREIEKAMKELVQWHNPTSQIANLHDFSRKIHAL  827



>ref|XP_004295928.1| PREDICTED: uncharacterized protein LOC101294054 [Fragaria vesca 
subsp. vesca]
Length=820

 Score =   580 bits (1495),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 377/756 (50%), Positives = 494/756 (65%), Gaps = 44/756 (6%)
 Frame = +1

Query  4     LRGCWYAIYATCLGVCPAILSLWLIGPahlttgtaaaavaitaFIVVLP-QNTHVVAKRI  180
             LRG W A+YAT   V P ILSLWLI PA LTT T   AV + AF+VVLP + TH+V+KRI
Sbjct  70    LRGFWLALYATIQSVGPGILSLWLIRPARLTTSTTVVAVGLAAFVVVLPGEATHLVSKRI  129

Query  181   ALGQTVLVYALA---GPRTQPIMHPlrvaastaiavaacvlalllpypslassKVKHNCH  351
             ALGQ VLVY +A   G     IMHP+ VAASTA+ V ACVLALL+P+P LAS +VK N  
Sbjct  130   ALGQIVLVYVIAFIKGGSVDAIMHPVHVAASTAVGVLACVLALLVPFPRLASREVKQNSK  189

Query  352   LFAENVSQRLNLLVKAFSAEDNASALSLVSQAKSLNASGAKFLQNIKSKQESMQWERYPI  531
             L  EN S+RL L VKAF AEDN+SAL+ +SQ KSL ++  K  Q IK  QESMQWER+P+
Sbjct  190   LLVENASERLKLFVKAFCAEDNSSALASISQTKSLASTAIKLFQTIKRHQESMQWERFPL  249

Query  532   KFFRPYCKNPGERLQEYETPLRGMEMGLVDNNPPQFPVTVLLSSSEVKDSLDSLTG-HIS  708
                R    NPG RL+  E PL+GMEM L  +  P FPV V+    E+K +L  L    +S
Sbjct  250   TLLRHSNFNPGNRLRGLEIPLKGMEMAL--SITPSFPVGVVDGDGELKSALLKLVEEQMS  307

Query  709   KQVKGRLFDLATVPESNAQNAVKFLHQKLQ--PVTLQdl-----ssffflfslklllikp  867
                     D  TVPES  +  ++ L Q LQ  P TLQ+L          L    L     
Sbjct  308   LNTSIPCEDAITVPESKPEIDIRCL-QTLQTIPQTLQNLPPFFFLFCISLLHGNLSATSS  366

Query  868   sssilkdkdGSKEQEERFLD----KIYSNFVGQMNNKRFVASLKYALALGLAVFFGSIYS  1035
             S++  +DK  +  ++E         ++SNF  ++N+KR +A+ K +L++GLAVFFG I+S
Sbjct  367   SATTAQDKLVTHPKKEALTSCKQSVVWSNFYMKVNSKRVMAAFKCSLSVGLAVFFGLIFS  426

Query  1036  KPDGFWAGLTVAISYVSAREATFRIANVKAQGTVLGSIYGVLGCFVFAKYEELRFISLIP  1215
             K +G W+GL VA+S+ +AREATF++ANVKAQGTVLG++YGV GCF+F K   +R +SL+P
Sbjct  427   KENGHWSGLPVAVSFTAAREATFKVANVKAQGTVLGTVYGVFGCFLFHKVLPIRILSLVP  486

Query  1216  WFIVCSFLRRSRMYGPAG-------GISACIGAVLILGREGFGPPREFAMARIMETFIGL  1374
             WFI  SFL+R ++YG AG        IS  IGAVLILGR  FG P EFA+ARI ETFIGL
Sbjct  487   WFIFTSFLQRRKLYGQAGRILYGILHISTVIGAVLILGRTKFGTPSEFAIARITETFIGL  546

Query  1375  ACSITVELLFRPTRASSLAKIQLSKSLQLLNQCIISIDYSSNNQSKLEETQKILKSSVTQ  1554
             +CSI VELL +PTRAS+LAK+QLS++L  L++CI S+      +++LE++QK LK  V +
Sbjct  547   SCSIFVELLLQPTRASTLAKVQLSRTLGALHECIDSVSL-QFGRAQLEDSQKCLKLHVEE  605

Query  1555  LGKFIGEAEVEPNFWFLPFHSACYGKLMGSLSKVVEYLHFVAQALRFLEQES--------  1710
             LGKFI EA+VEPNFWFLPFH+A YGKLM SLSK++E L F   A+  +EQ S        
Sbjct  606   LGKFIAEADVEPNFWFLPFHTASYGKLMSSLSKMMELLVFSGHAIGVVEQNSQFLEGSWK  665

Query  1711  ALMGRLDSDHLSLFRDHVGPSIKSFEEIISLVGSVSVLDKEF---EKKKSSIDPELGKLP  1881
              ++ +++ D L LF+  VG  I  F + I+L+ SV+VL+KE    ++   S D ELGK  
Sbjct  666   CIVAKMECD-LELFKKMVGSLIICFRD-ITLLKSVTVLEKEGLDDQESGKSCDLELGKPQ  723

Query  1882  T--SNNITGLSDEEIDNKLKSFMEDSRQFVDQKdeddddeVMMNSQVALSLSALAFCMRG  2055
             T  +  I GL DEE+D  + S++  S++ V            +  Q+ L LSA+ FC+ G
Sbjct  724   TLKAFRICGLVDEEMDKIVSSYLLHSKEAVG--IIHCQQTEELKGQIVLCLSAIGFCVSG  781

Query  2056  IVRETKEIDKAIKELVQWENPSSPVNLHEISCKIRA  2163
             ++R T+EI++ IKELVQWENPSS VNL+EISCK+ A
Sbjct  782   LIRATREIEEGIKELVQWENPSSHVNLYEISCKMHA  817



>ref|XP_009358382.1| PREDICTED: uncharacterized protein LOC103949017 [Pyrus x bretschneideri]
Length=784

 Score =   575 bits (1482),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 361/746 (48%), Positives = 476/746 (64%), Gaps = 47/746 (6%)
 Frame = +1

Query  1     ALRGCWYAIYATCLGVCPAILSLWLIGPahlttgtaaaavaitaFIVVLPQNTHVVAKRI  180
              L GCW  +YAT   + PA+LSLWLIGPA L+T T A AV + AF+V LP+ TH V KRI
Sbjct  56    TLCGCWLGVYATAQTIGPAVLSLWLIGPARLSTSTTALAVGLAAFVVALPEFTHFVTKRI  115

Query  181   ALGQTVLVYALA---GPRTQPIMHPlrvaastaiavaacvlalllpypslassKVKHNCH  351
             ALGQ V++Y +A   G  T  IMHP+ VA ST I V ACVLALL+P+P LAS +VK N  
Sbjct  116   ALGQIVIMYVIAYINGGHTDAIMHPVHVATSTGIGVLACVLALLIPFPRLASREVKQNAE  175

Query  352   LFAENVSQRLNLLVKAFSAEDNASALSLVSQAKSLNASGAKFLQNIKSKQESMQWERYPI  531
             L  EN S+RL + V+AF AED+ SAL+ +SQA SL ++     Q I++ QESM+WER P+
Sbjct  176   LLTENASERLKIFVEAFCAEDSTSALASLSQANSLASTATMLFQTIENHQESMKWERVPL  235

Query  532   KFF-RPYCKNPGERLQEYETPLRGMEMGLVDNNPPQFPVTV---------LLSSSEVKDS  681
             K   R    NPG+RLQ  E P RGMEM L     P FPV V         LL   E   S
Sbjct  236   KLISRCNYVNPGDRLQGLEIPFRGMEMAL--TCIPSFPVKVVNGELSKDGLLRLVEQHMS  293

Query  682   LDSLTGHISKQV---KGRLFDLATVPESNAQNAVKFLHQKLQPVTLQdlssffflfslkl  852
             LD +T   S  V   KG L  L T+P+         +HQ L P+      +      L  
Sbjct  294   LDLITPCDSVTVPESKGFLQTLQTIPQ---------IHQDLPPIFFLFCINLLQGKLLSR  344

Query  853   llikpsssilkdkdGSKEQEER--FLDKIYSNFVGQMNNKRFVASLKYALALGLAVFFGS  1026
                     ++    G+    ++     KI+SN   ++++KR +++ K +L+LGLAVFFG 
Sbjct  345   SKTVQEKFLVHQNGGATNSSKQNGLYFKIWSNLSTKVSSKRLMSAFKCSLSLGLAVFFGL  404

Query  1027  IYSKPDGFWAGLTVAISYVSAREATFRIANVKAQGTVLGSIYGVLGCFVFAKYEELRFIS  1206
             +YSK DG+WAGL VAIS+ S REATF+++NVK QGTVLG++YGVLG F+F ++  +R +S
Sbjct  405   MYSKDDGYWAGLPVAISFASTREATFKVSNVKIQGTVLGTVYGVLGWFLFQRFLSMRLLS  464

Query  1207  LIPWFIVCSFLRRSRMYGPAGGISACIGAVLILGREGFGPPREFAMARIMETFIGLACSI  1386
             LIPWFI  SFL+RSRMYG AGGISA IGAVL+LGR  FGPP EFA+ARI ETFIGL+ SI
Sbjct  465   LIPWFIFTSFLQRSRMYGQAGGISAVIGAVLVLGRRNFGPPSEFAIARITETFIGLSSSI  524

Query  1387  TVELLFRPTRASSLAKIQLSKSLQLLNQCIISIDYSSNNQSKLEETQKILKSSVTQLGKF  1566
              V+L+ +PTRAS+LAK+QLS++L  L +CI S+   S  ++ LE+ QK LK    +LGK 
Sbjct  525   IVDLILQPTRASALAKVQLSRTLGTLQECINSVSLQS-GRANLEDNQKRLKMHTEELGKL  583

Query  1567  IGEAEVEPNFWFLPFHSACYGKLMGSLSKVVEYLHFVAQALRFLEQES--------ALMG  1722
             IGEAE EPNFWFLPFH ACYGKL+ S S++++ L   A A+  LE+ S         ++ 
Sbjct  584   IGEAEGEPNFWFLPFHGACYGKLLRSFSRMMDLLVLSAHAVGILEENSQTLEASWKEIVH  643

Query  1723  RLDSDHLSLFRDHVGPSIKSFEEIISLVGSVSVLDKEFEKKKSSIDPELGKLPTSNNITG  1902
              L+ D L  F+  VG  +  F+E I+LV S++VLD   +K   S D ELGK   S NI  
Sbjct  644   TLECD-LEHFKKMVGSLMTCFKE-ITLVKSITVLD---QKSNISPDSELGK-SRSPNIFR  697

Query  1903  LSDEEIDNKLKSFMEDSRQFVDQKdeddddeVMMNSQVALSLSALAFCMRGIVRETKEID  2082
                 E+D  + S+++ S + V + D   ++   + SQ+ L LS L FC+  ++RET+EI+
Sbjct  698   ACSSEMDKIMSSYLQHSEEVVGKIDAKSEE---LKSQMILCLSGLGFCISSLIRETREIE  754

Query  2083  KAIKELVQWENPSSPVNLHEISCKIR  2160
             + IKELVQWENPSS +NL+EISCK+ 
Sbjct  755   EGIKELVQWENPSSHINLYEISCKLH  780



>ref|XP_008357535.1| PREDICTED: uncharacterized protein LOC103421286 isoform X1 [Malus 
domestica]
Length=801

 Score =   574 bits (1480),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 363/744 (49%), Positives = 478/744 (64%), Gaps = 39/744 (5%)
 Frame = +1

Query  1     ALRGCWYAIYATCLGVCPAILSLWLIGPahlttgtaaaavaitaFIVVLPQNTHVVAKRI  180
              L G    +YAT   + PA+LSLWLIGPA L+T T A AV + AF+V LP+ TH+V KRI
Sbjct  69    TLCGFRLGLYATAQTIGPAMLSLWLIGPAQLSTSTTAVAVGLAAFVVALPEFTHLVTKRI  128

Query  181   ALGQTVLVYALA---GPRTQPIMHPlrvaastaiavaacvlalllpypslassKVKHNCH  351
             ALGQ V++Y +A   G  T  IMHP+ VAAST + V ACVLALL+P+P LAS +VK N  
Sbjct  129   ALGQIVIMYVIACINGGHTDAIMHPVHVAASTGVGVLACVLALLIPFPRLASREVKQNLK  188

Query  352   LFAENVSQRLNLLVKAFSAEDNASALSLVSQAKSLNASGAKFLQNIKSKQESMQWERYPI  531
             L A+N S+ L + V AF AED+ SAL+ +SQA  L ++  K  Q IKS QESM+WER P+
Sbjct  189   LLAKNASEMLKIFVNAFCAEDSTSALASISQANFLASTATKLFQTIKSHQESMKWERVPL  248

Query  532   KFF--RPYCKNPGERLQEYETPLRGMEMGLVDNNPPQFPVTVLLSSSEVKDSLDSLTGHI  705
             K F  R Y  NPG+RLQ  E P RGMEM L     P FPV V+ +    KD+L  L  H 
Sbjct  249   KLFSRRGYV-NPGDRLQGLEIPFRGMEMAL--TCIPSFPVKVV-NGELSKDALLRLVEHN  304

Query  706   SKQVKGRLFDLATVPESNAQNAVKFL---------HQKLQPVTLQdlssffflfslklll  858
                     F   TVPES A+N V FL         HQ L P+      +      L    
Sbjct  305   MSLNLSTPFCSITVPESKAEN-VSFLQTLQNIPQIHQDLPPIFFLFCINLLQGKLLSRSK  363

Query  859   ikpsssilkdkdGSKEQEER--FLDKIYSNFVGQMNNKRFVASLKYALALGLAVFFGSIY  1032
                   ++    G+    ++     KI+SN   ++++KR +++ K +L+LGLAVFFG IY
Sbjct  364   TVQEKFLVHQNGGATNSSKQNGLYFKIWSNLSTKVSSKRLMSAFKCSLSLGLAVFFGLIY  423

Query  1033  SKPDGFWAGLTVAISYVSAREATFRIANVKAQGTVLGSIYGVLGCFVFAKYEELRFISLI  1212
             SK DG+WAGL VAIS+ S REATF+++NVK QGTVLG++YGVLG F+F ++  +R +SLI
Sbjct  424   SKDDGYWAGLPVAISFASTREATFKVSNVKVQGTVLGTVYGVLGWFLFQRFLSMRLLSLI  483

Query  1213  PWFIVCSFLRRSRMYGPAGGISACIGAVLILGREGFGPPREFAMARIMETFIGLACSITV  1392
             PWFI  +FL+RSRMYG AGGISA IGAVL+LGR  FGPP EFA+ARI ETFIGL+ SI V
Sbjct  484   PWFIFTNFLQRSRMYGQAGGISAVIGAVLVLGRTNFGPPSEFAIARITETFIGLSSSIIV  543

Query  1393  ELLFRPTRASSLAKIQLSKSLQLLNQCIISIDYSSNNQSKLEETQKILKSSVTQLGKFIG  1572
              L+ +P RAS+LAK+QLS++L  L +CI S+   S  ++ LE+ QK LK    +LG+ IG
Sbjct  544   HLILQPKRASALAKVQLSRTLGTLQECINSVSLQS-GRANLEDNQKRLKMHTEELGQLIG  602

Query  1573  EAEVEPNFWFLPFHSACYGKLMGSLSKVVEYLHFVAQALRFLEQES--------ALMGRL  1728
             EAE EPNFWFLPFHSACYGKL+ S S++++ L   A A+  LE+ S         ++  L
Sbjct  603   EAEGEPNFWFLPFHSACYGKLLRSFSRMMDLLVLSAHAVGILEENSQTLEASWKEIVHTL  662

Query  1729  DSDHLSLFRDHVGPSIKSFEEIISLVGSVSVLDKEFEKKKSSIDPELGKLPTSNNITGLS  1908
             + D L  F+  VG  +  FEE I+L+ S++VLD   +K   S D ELGK  T N     S
Sbjct  663   ECD-LEHFKKMVGSLMTCFEE-ITLIKSIAVLD---QKSNISPDHELGKSRTPNIFRACS  717

Query  1909  DEEIDNKLKSFMEDSRQFVDQKdeddddeVMMNSQVALSLSALAFCMRGIVRETKEIDKA  2088
               E+D  + S+++ S + VD+ D   ++   + SQ+ L LS L FC+  ++RET+EI++ 
Sbjct  718   S-EMDKIMSSYLQHSEEVVDKIDAKSEE---LKSQMVLCLSGLGFCISSLIRETREIEEG  773

Query  2089  IKELVQWENPSSPVNLHEISCKIR  2160
             IKELVQWENPSS +NL+EISCK+ 
Sbjct  774   IKELVQWENPSSHINLYEISCKLH  797



>gb|KHN30186.1| hypothetical protein glysoja_010564 [Glycine soja]
Length=782

 Score =   555 bits (1431),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 358/739 (48%), Positives = 480/739 (65%), Gaps = 44/739 (6%)
 Frame = +1

Query  1     ALRGCWYAIYATCLGVCPAILSLWLIGPahlttgtaaaavaitaFIVVLP--QNTHVVAK  174
             ALRGCW A+YAT   + PA+LSLW +GP   +  T+AAAVA+ AF+VVLP  Q+TH++AK
Sbjct  60    ALRGCWLALYATFQSMGPAMLSLWAVGPGRFSKATSAAAVALAAFVVVLPWPQSTHLIAK  119

Query  175   RIALGQTVLVYALA---GPRTQPIMHPlrvaastaiavaacvlalllpypslassKVKHN  345
             R++LGQ VLVY +A   G  T PIMHP+ +AASTA+ V ACV+ALLLPYP LASS++  +
Sbjct  120   RVSLGQIVLVYVVAYANGVHTDPIMHPISLAASTALGVLACVVALLLPYPRLASSQMNQS  179

Query  346   CHLFAENVSQRLNLLVKAFSAEDNASALSLVSQAKSLNASGAKFLQNIKSKQESMQWERY  525
                  +N+ +RL LLVK    ED  +A+ L+S AKSL     K L  I    E MQWER 
Sbjct  180   YKRLTKNILKRLKLLVKVICEEDKITAVGLMSHAKSLVTKRTKLLSIIIRYNEGMQWERL  239

Query  526   PIKFFRPYCKNPGERLQEYETPLRGMEMGLVDNNPPQFPVTVLLSSSEVKDSLDSLTGHI  705
             PIK FR +C +  ERLQE +T LRGME+ L   N   FP+ +L    + K  L+SL  H+
Sbjct  240   PIKIFRSHCLSLIERLQEVDTNLRGMELALACTN--SFPINIL--DQDFKHGLNSLEEHV  295

Query  706   S---KQVKGRLFDLA-TVPESNAQNAVKFLHQKLQ--PVTLQdls-------sffflfsl  846
             +   KQ K  L D + TVPESNA+    FL Q L   P T Q+LS       +       
Sbjct  296   TLTIKQAKQSLRDGSLTVPESNAKTTTHFL-QSLHTIPTTYQELSICFFLFCAKLLHKKS  354

Query  847   klllikpsssilkdkdGSKEQEERFLDKIYSNFVGQMNNKRFVASLKYALALGLAVFFGS  1026
                    +  +L  K+G+  +E+       +N +  + N   + ++K++L+LGL+VF G 
Sbjct  355   LTEPPTCTQDLLVKKNGNSPKEK------LANLIATLRNTNLMPAIKFSLSLGLSVFMGL  408

Query  1027  IYSKPDGFWAGLTVAISYVSAREATFRIANVKAQGTVLGSIYGVLGCFVFAKYEELRFIS  1206
             IYSK +GFWAGL VA+SYVS REATFR ANVKAQGTVLG++YGVLGCFVF ++  +RF+S
Sbjct  409   IYSKENGFWAGLPVAVSYVSGREATFRAANVKAQGTVLGTVYGVLGCFVFERFLPIRFLS  468

Query  1207  LIPWFIVCSFLRRSRMYGPAGGISACIGAVLILGREGFGPPREFAMARIMETFIGLACSI  1386
             L+PWFI  SFL+RS+MYGPAGGISA IGA+LILGR+ FGPP EFA+ARI+ETFIGL+CSI
Sbjct  469   LLPWFIFTSFLQRSKMYGPAGGISAVIGAILILGRKNFGPPSEFALARIIETFIGLSCSI  528

Query  1387  TVELLFRPTRASSLAKIQLSKSLQLLNQCIISIDYSSNNQSKLEETQKILKSSVTQLGKF  1566
              V+L+F P RAS+ +K +LS+ L  L + I S+      ++ LE+ Q+ LK  V +L KF
Sbjct  529   FVDLIFWPKRASTCSKTELSQCLATLGESIGSLSLLVAGKTNLEDNQRKLKMQVNELRKF  588

Query  1567  IGEAEVEPNFWFLPFHSACYGKLMGSLSKVVEYLHFVAQALRFLEQESALMGRLDSDHLS  1746
             + EAE+EPN WFLPF+S CY KL+GSLS+VV+ + F   AL+FL+QE    G  + + ++
Sbjct  589   VVEAEMEPNLWFLPFNSVCYNKLLGSLSRVVDLMRFGEHALKFLQQEFQRCGACEKEDVN  648

Query  1747  LF-------RDHVGPSIKSFEEIISLVGSVSVLDKEFEKKKSSIDPELGKLPTSNN---I  1896
             +        +D +  SIK+ EEI     S   + KE EK  +S D E GK    NN   I
Sbjct  649   MLEGELGHVKDLICSSIKNIEEI----SSTKFVAKEVEKNNNSCDLEAGKSNWGNNTCMI  704

Query  1897  TGLSDEEIDNKLKSFMEDSRQFVDQKdeddddeVMMNSQVALSLSALAFCMRGIVRETKE  2076
             + L ++ I+  + SF++ SR  VD    D+ +   M S V LSLSA+ FC+   ++ T E
Sbjct  705   SRLGEDGIEQTIGSFLQRSRIVVDNLYGDEGEN-EMKSHVVLSLSAVGFCLSACIQGTME  763

Query  2077  IDKAIKELVQWENPSSPVN  2133
             I++AIKELVQWENPSS ++
Sbjct  764   IEEAIKELVQWENPSSEID  782



>ref|XP_003542023.2| PREDICTED: uncharacterized protein LOC100785658 [Glycine max]
Length=787

 Score =   555 bits (1431),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 358/739 (48%), Positives = 480/739 (65%), Gaps = 44/739 (6%)
 Frame = +1

Query  1     ALRGCWYAIYATCLGVCPAILSLWLIGPahlttgtaaaavaitaFIVVLP--QNTHVVAK  174
             ALRGCW A+YAT   + PA+LSLW +GP   +  T+AAAVA+ AF+VVLP  Q+TH++AK
Sbjct  65    ALRGCWLALYATFQSMGPAMLSLWAVGPGRFSKATSAAAVALAAFVVVLPWPQSTHLIAK  124

Query  175   RIALGQTVLVYALA---GPRTQPIMHPlrvaastaiavaacvlalllpypslassKVKHN  345
             R++LGQ VLVY +A   G  T PIMHP+ +AASTA+ V ACV+ALLLPYP LASS++  +
Sbjct  125   RVSLGQIVLVYVVAYANGVHTDPIMHPISLAASTALGVLACVVALLLPYPRLASSQMNQS  184

Query  346   CHLFAENVSQRLNLLVKAFSAEDNASALSLVSQAKSLNASGAKFLQNIKSKQESMQWERY  525
                  +N+ +RL LLVK    ED  +A+ L+S AKSL     K L  I    E MQWER 
Sbjct  185   YKRLTKNILKRLKLLVKVICEEDKITAVGLMSHAKSLVTKRTKLLSIIIRYNEGMQWERL  244

Query  526   PIKFFRPYCKNPGERLQEYETPLRGMEMGLVDNNPPQFPVTVLLSSSEVKDSLDSLTGHI  705
             PIK FR +C +  ERLQE +T LRGME+ L   N   FP+ +L    + K  L+SL  H+
Sbjct  245   PIKIFRSHCLSLIERLQEVDTNLRGMELALACTN--SFPINIL--DQDFKHGLNSLEEHV  300

Query  706   S---KQVKGRLFDLA-TVPESNAQNAVKFLHQKLQ--PVTLQdls-------sffflfsl  846
             +   KQ K  L D + TVPESNA+    FL Q L   P T Q+LS       +       
Sbjct  301   TLTIKQAKQSLRDGSLTVPESNAKTTTHFL-QSLHTIPTTYQELSICFFLFCAKLLHKKS  359

Query  847   klllikpsssilkdkdGSKEQEERFLDKIYSNFVGQMNNKRFVASLKYALALGLAVFFGS  1026
                    +  +L  K+G+  +E+       +N +  + N   + ++K++L+LGL+VF G 
Sbjct  360   LTEPPTCTQDLLVKKNGNSPKEK------LANLIATLRNTNLMPAIKFSLSLGLSVFMGL  413

Query  1027  IYSKPDGFWAGLTVAISYVSAREATFRIANVKAQGTVLGSIYGVLGCFVFAKYEELRFIS  1206
             IYSK +GFWAGL VA+SYVS REATFR ANVKAQGTVLG++YGVLGCFVF ++  +RF+S
Sbjct  414   IYSKENGFWAGLPVAVSYVSGREATFRAANVKAQGTVLGTVYGVLGCFVFERFLPIRFLS  473

Query  1207  LIPWFIVCSFLRRSRMYGPAGGISACIGAVLILGREGFGPPREFAMARIMETFIGLACSI  1386
             L+PWFI  SFL+RS+MYGPAGGISA IGA+LILGR+ FGPP EFA+ARI+ETFIGL+CSI
Sbjct  474   LLPWFIFTSFLQRSKMYGPAGGISAVIGAILILGRKNFGPPSEFALARIIETFIGLSCSI  533

Query  1387  TVELLFRPTRASSLAKIQLSKSLQLLNQCIISIDYSSNNQSKLEETQKILKSSVTQLGKF  1566
              V+L+F P RAS+ +K +LS+ L  L + I S+      ++ LE+ Q+ LK  V +L KF
Sbjct  534   FVDLIFWPKRASTCSKTELSQCLATLGESIGSLSLLVAGKTNLEDNQRKLKMQVNELRKF  593

Query  1567  IGEAEVEPNFWFLPFHSACYGKLMGSLSKVVEYLHFVAQALRFLEQESALMGRLDSDHLS  1746
             + EAE+EPN WFLPF+S CY KL+GSLS+VV+ + F   AL+FL+QE    G  + + ++
Sbjct  594   VVEAEMEPNLWFLPFNSVCYNKLLGSLSRVVDLMRFGEHALKFLQQEFQRCGACEKEDVN  653

Query  1747  LF-------RDHVGPSIKSFEEIISLVGSVSVLDKEFEKKKSSIDPELGKLPTSNN---I  1896
             +        +D +  SIK+ EEI     S   + KE EK  +S D E GK    NN   I
Sbjct  654   MLEGELGHVKDLICSSIKNIEEI----SSTKFVAKEVEKNNNSCDLEAGKSNWGNNTCMI  709

Query  1897  TGLSDEEIDNKLKSFMEDSRQFVDQKdeddddeVMMNSQVALSLSALAFCMRGIVRETKE  2076
             + L ++ I+  + SF++ SR  VD    D+ +   M S V LSLSA+ FC+   ++ T E
Sbjct  710   SRLGEDGIEQTIGSFLQRSRIVVDNLYGDEGEN-EMKSHVVLSLSAVGFCLSACIQGTME  768

Query  2077  IDKAIKELVQWENPSSPVN  2133
             I++AIKELVQWENPSS ++
Sbjct  769   IEEAIKELVQWENPSSEID  787



>ref|XP_003597353.1| p-hydroxybenzoic acid efflux pump subunit aaeB [Medicago truncatula]
 gb|AES67604.1| fusaric acid resistance-like protein [Medicago truncatula]
Length=794

 Score =   544 bits (1401),  Expect = 1e-178, Method: Compositional matrix adjust.
 Identities = 363/730 (50%), Positives = 481/730 (66%), Gaps = 29/730 (4%)
 Frame = +1

Query  1     ALRGCWYAIYATCLGVCPAILSLWLIGPahlttgtaaaavaitaFIVVLP-QNTHVVAKR  177
             +LRGCW  +YAT   + PA+LSLW IGP H + GTA+ AVA+ AF+VVLP Q+TH++AKR
Sbjct  74    SLRGCWLGLYATIQSLGPAMLSLWAIGPNHFSKGTASIAVALAAFVVVLPSQSTHLIAKR  133

Query  178   IALGQTVLVYALA---GPRTQPIMHPlrvaastaiavaacvlalllpypslassKVKHNC  348
             I+LGQ VLVY LA   G    PIMHP+ +AASTA+ V ACVLALLLPYP  A  +V  N 
Sbjct  134   ISLGQIVLVYVLAYSNGAHIDPIMHPIHLAASTALGVIACVLALLLPYPRFACYQVNKNY  193

Query  349   HLFAENVSQRLNLLVKAFSAEDNASALSLVSQAKSLNASGAKFLQNIKSKQESMQWERYP  528
              L   NV +RL LLVK  S E+N SA  L+S+AKSL     K L  I    + M+WER P
Sbjct  194   KLLTNNVLKRLKLLVKVISEEENTSAFGLISRAKSLATKRTKLLFTIMRYLDGMKWERLP  253

Query  529   IKFFRPYCKNPGERLQEYETPLRGMEMGLVDNNPPQFPVTVLLSSSEVKDSLDSLTGHIS  708
             I FF+P+    GE+LQE +T L GME+ L  +    FP+ +L    ++K  L++L  H+S
Sbjct  254   INFFKPHYNKLGEKLQEVDTNLIGMELAL--SCYKSFPINIL--DQDLKHGLNTLEEHVS  309

Query  709   KQVKGRLFDLA-----TVPESNAQNAVKFLHQKLQ--PVTLQdlssffflfslklllikp  867
               +K            TVPESNA+N   FL Q L   P T Q+L  FFFLF  KLL +KP
Sbjct  310   LTIKNAKHTFLGSGSLTVPESNAKNITHFL-QSLHTIPTTHQELPIFFFLFCAKLLHMKP  368

Query  868   sssilkdkdG----SKEQEERFLDKIYSNFVGQMNNKRFVASLKYALALGLAVFFGSIYS  1035
             S+    +        KE      DK ++N+  ++ +   + ++KY+ ALGL+VF G +YS
Sbjct  369   STEGPTNVQAQPIHKKEISHEDKDK-WANWATKLKSSNLLPAIKYSFALGLSVFMGLLYS  427

Query  1036  KPDGFWAGLTVAISYVSAREATFRIANVKAQGTVLGSIYGVLGCFVFAKYEELRFISLIP  1215
             K  GFW+GL VA+SYVS REATFR ANVKAQGTV+G++YGVLGCFVF +   +RF+SL+P
Sbjct  428   KESGFWSGLPVAVSYVSGREATFRAANVKAQGTVIGTVYGVLGCFVFNRLLSIRFLSLLP  487

Query  1216  WFIVCSFLRRSRMYGPAGGISACIGAVLILGREGFGPPREFAMARIMETFIGLACSITVE  1395
             WFI  SFL+RSRMYGPAGGISA IGAVLILGR+  GPP EFA+ RI+ETFIGL+CSI V+
Sbjct  488   WFIFTSFLQRSRMYGPAGGISAVIGAVLILGRKNIGPPSEFAIERIIETFIGLSCSIFVD  547

Query  1396  LLFRPTRASSLAKIQLSKSLQLLNQCIISIDYSSNNQSKLEETQKILKSSVTQLGKFIGE  1575
             LLF P RAS+ AK +LS+ L  L + I ++       S+LEE Q+ LK+ V +L KF+ E
Sbjct  548   LLFWPKRASTCAKYELSQCLFTLVETIGTLSLVGKTDSQLEENQRKLKAQVNELRKFVVE  607

Query  1576  AEVEPNFWFLPFHSACYGKLMGSLSKVVEYLHFVAQALRFLEQE----SALMGRLDSDHL  1743
             AE EPNFWFLPFHS CY +L+GSLSK+V+ LHF  +AL+ L+QE       +  L S+ L
Sbjct  608   AEAEPNFWFLPFHSGCYNRLLGSLSKLVDVLHFGERALKSLQQEFQRSDNFVNMLQSELL  667

Query  1744  SLFRDHVGPSIKSFEEIISLVGSVSVLDKEFEKKKSSIDPELGKLPTSNN-ITGLSDEEI  1920
              + ++ +  SIK  EE IS + S   ++KE EKK  S D E+GK    +  ++GL ++  
Sbjct  668   HV-KEIICSSIKGLEE-ISKMKSFKFVEKEIEKKNMSSDVEMGKSREDDTWLSGLGEDGT  725

Query  1921  DNKLKSFMEDSRQFVDQKdeddddeVMMNSQVALSLSALAFCMRGIVRETKEIDKAIKEL  2100
                +++F++ SR  V+ K   D+ E  + S+V L+LS + FC+   +  T EI+KA++EL
Sbjct  726   REIIETFLQRSRDVVE-KLYSDEGEKEVKSEVVLNLSVVGFCLNVCMHGTIEIEKAMREL  784

Query  2101  VQWENPSSPV  2130
             VQWENPSS +
Sbjct  785   VQWENPSSSI  794



>ref|XP_010557280.1| PREDICTED: uncharacterized protein LOC104826334 [Tarenaya hassleriana]
Length=804

 Score =   534 bits (1376),  Expect = 1e-174, Method: Compositional matrix adjust.
 Identities = 358/748 (48%), Positives = 484/748 (65%), Gaps = 42/748 (6%)
 Frame = +1

Query  4     LRGCWYAIYATCLGVCPAILSLWLIGPahlttgtaaaavaitaFIVVLPQN-THVVAKRI  180
             LRGCW A+YATC  V PA++SL LIGPAHL+ GT A AVA+   +VVLP + TH+VAKRI
Sbjct  70    LRGCWLALYATCQSVGPALISLRLIGPAHLSAGTTAVAVALAGLVVVLPSDSTHLVAKRI  129

Query  181   ALGQTVLVYALA---GPRTQPIMHPlrvaastaiavaacvlalllpypslassKVKHNCH  351
             ALGQ V+ Y +    G  T P MHP+RVAASTA+ VAACVLALLLPYP LAS +VK +C 
Sbjct  130   ALGQIVITYVIGYIKGAETDPFMHPVRVAASTAVGVAACVLALLLPYPRLASREVKQSCK  189

Query  352   LFAENVSQRLNLLVKAFSAEDNASALSLVSQAKSLNASGAKFLQNIKSKQESMQWERYPI  531
               A+N+S RL L   AF AED  SA + VSQA+ L  S ++  Q IK  Q SM+WER P 
Sbjct  190   GIAQNISDRLKLYTNAFCAEDATSATASVSQARLLARSSSRLYQAIKRYQPSMKWERLPF  249

Query  532   KFFRPYC--KNPGERLQEYETPLRGMEMGLVDNNPPQFPVTVLLSSSEVKDSLDSLTGHI  705
             K +R     +N G++L+  E  LRGMEM L   N   FP T+L  S EVKD L  +   +
Sbjct  250   KLWRSQHLEENTGDKLRSMEIALRGMEMAL--TNTYSFPATLL--SGEVKDGLTKIQEGV  305

Query  706   SKQVKGRLFDL--ATVPESNAQNAVKF---------LHQKLQPVTLQdlssffflfslkl  852
             +  +K     L  +  PES+  +A            +HQ L             L     
Sbjct  306   TLAIKRANNSLQPSVNPESDPDSAAGCFQTLQEFPGMHQDL---PFYFFLFCMKLLENIS  362

Query  853   llikpsssilkdkdGSKEQEERFLDKIYSNFVGQMNNKRFVASLKYALALGLAVFFGSIY  1032
             +    +S   K +  SKE++ RF      ++   +N+KR + ++K +L+LGLAV FGS+Y
Sbjct  363   MANPDNSKDKKPEVSSKEEKSRF----SIHWRSALNSKRIMPAIKLSLSLGLAVLFGSMY  418

Query  1033  SKPDGFWAGLTVAISYVSAREATFRIANVKAQGTVLGSIYGVLGCFVFAKYEELRFISLI  1212
             SKP+G+WAGL VAIS+ +AREATF++ANVKAQGTV+G++YGV+GCFVF ++  +RF+SL+
Sbjct  419   SKPNGYWAGLPVAISFAAAREATFKVANVKAQGTVIGTVYGVMGCFVFERFLPIRFLSLL  478

Query  1213  PWFIVCSFLRRSRMYGPAGGISACIGAVLILGREGFGPPREFAMARIMETFIGLACSITV  1392
             PWF+  SFL +SRMYG AG ISA IGAVLILGR  FG P EFA+ARI+ETFIGL+CS+ V
Sbjct  479   PWFVFSSFLGKSRMYGQAGAISAAIGAVLILGRRNFGAPSEFAIARIVETFIGLSCSLMV  538

Query  1393  ELLFRPTRASSLAKIQLSKSLQLLNQCIISIDYSSNNQSKLEETQKILKSSVTQLGKFIG  1572
             EL+ +PTR S+LAK+ LS+S   L++C   +  +  + S + E+QK LK+ +  L KF+ 
Sbjct  539   ELVLQPTRGSTLAKLTLSRSFHSLHEC-ARLSGAKASSSDIIESQKKLKTHLIDLNKFVQ  597

Query  1573  EAEVEPNFWFLPFHSACYGKLMGSLSKVVEYLHFVAQALRFLEQESA-------LMGRLD  1731
             EA+ EP+FWFLPF+ +CY KL GSLSK+ + L F A A+ FL  E         ++ ++D
Sbjct  598   EAQAEPSFWFLPFNGSCYDKLHGSLSKMADLLQFSAHAIGFLGDEETNKALCKEVLNKVD  657

Query  1732  SDHLSLFRDHVGPSIKSFEEIISLVGSVSVLDKEFEKKKSSIDPELG--KLPTSNNITGL  1905
              D L    + +G   KSFEE I+L+ S+  L+K   K   S D E+G  K P+ + + G 
Sbjct  658   ED-LENLTESIGAVAKSFEE-ITLLKSLKALEKALVKNDVSWDIEMGKSKSPSFSRVEG-  714

Query  1906  SDEEIDNKLKSFMEDSRQFVD-QKdeddddeVMMNSQVALSLSALAFCMRGIVRETKEID  2082
             S  E +  ++S+++ S   +     E+D+ EV+  S+V LSL AL FCM  + +E +EI+
Sbjct  715   SKSEQEKVVESYLQHSADVITLHDSEEDEVEVVDKSEVVLSLGALGFCMENMTKEMREIE  774

Query  2083  KAIKELVQWENPSSPVNLHEISCKIRAL  2166
             + +KELVQWENPSS V+LHEISCKIR+L
Sbjct  775   ERVKELVQWENPSSHVDLHEISCKIRSL  802



>ref|XP_010470050.1| PREDICTED: uncharacterized protein LOC104750019 [Camelina sativa]
Length=797

 Score =   533 bits (1372),  Expect = 3e-174, Method: Compositional matrix adjust.
 Identities = 341/744 (46%), Positives = 481/744 (65%), Gaps = 37/744 (5%)
 Frame = +1

Query  4     LRGCWYAIYATCLGVCPAILSLWLIGPahlttgtaaaavaitaFIVVLPQN-THVVAKRI  180
             LRGCW A+YATC  V PAI++L LIGPA LT  T A A A+ AF+VVLP + TH+VAKRI
Sbjct  66    LRGCWLALYATCQSVGPAIVTLKLIGPARLTAETTALAAALAAFVVVLPNSSTHLVAKRI  125

Query  181   ALGQTVLVYALA---GPRTQPIMHPlrvaastaiavaacvlalllpypslassKVKHNCH  351
             ALGQ VL+Y +    G  T P+MHPLRVAASTA+ V ACVLALL+P P LA+ +VK +  
Sbjct  126   ALGQIVLIYVIGYIKGAETDPVMHPLRVAASTALGVIACVLALLVPLPRLATCEVKQSSK  185

Query  352   LFAENVSQRLNLLVKAFSAEDNASALSLVSQAKSLNASGAKFLQNIKSKQESMQWERYPI  531
                +N++ R+ L +KAF  ED  SA + VSQA+ L  + +K  Q IK  Q SM WER P 
Sbjct  186   ELGQNITTRVKLYMKAFCTEDAMSATASVSQARVLARTSSKLYQTIKRYQPSMTWERLPF  245

Query  532   KFFR--PYCKNPGERLQEYETPLRGMEMGLVDNNPPQFPVTVLLSSSEVKDSLDSLTGHI  705
             K +R      N GE+LQ  E  LRGMEM +   +P   P ++L    EVKDSL ++   +
Sbjct  246   KIWRWQNVNDNKGEKLQSMEIALRGMEMVVASKSP--IPTSLL--EGEVKDSLKNIQERV  301

Query  706   SKQVK--GRLFDLATVPESNAQNAVKFLHQKLQPVTLQdlssffflfslklllikpsssi  879
                +K        +  PES+ + + +   Q     TLQ++            L       
Sbjct  302   ILSIKRANNSPQPSVTPESDPKKSDEECLQ-----TLQEIPGTSQDLPFYFFLFCLRLLE  356

Query  880   lkdkdGSKEQEERFLDKIYS-NFVGQMNNKRFVASLKYALALGLAVFFGSIYSKPDGFWA  1056
                    +E + + L+K  + +++   ++K+ + +LK +L+LG A+F GS++SKP+G+WA
Sbjct  357   TITMAKPEENKVKVLEKSKTRSWINDWDSKKVMPALKLSLSLGFAIFLGSMFSKPNGYWA  416

Query  1057  GLTVAISYVSAREATFRIANVKAQGTVLGSIYGVLGCFVFAKYEELRFISLIPWFIVCSF  1236
             GL VA+S+ +AREATF++ANVKAQGTV+G++YGV+GCFVF K+  +RF+SL+PWF+  SF
Sbjct  417   GLPVAVSFAAAREATFKVANVKAQGTVIGTVYGVMGCFVFQKFLSVRFLSLLPWFLFSSF  476

Query  1237  LRRSRMYGPAGGISACIGAVLILGREGFGPPREFAMARIMETFIGLACSITVELLFRPTR  1416
             L RSRMYG AGGISA IGAVLILGR+ FGPP EFA+ RI+ETFIGL+C+I VEL+F+PTR
Sbjct  477   LSRSRMYGQAGGISAAIGAVLILGRKNFGPPSEFAIERIIETFIGLSCAIMVELIFQPTR  536

Query  1417  ASSLAKIQLSKSLQLLNQCIISIDYSSNNQSKLEETQKILKSSVTQLGKFIGEAEVEPNF  1596
             A+++AK++LS+S   L +C  S+  +  +++++ E+QK L+S + +L KF  EA  EP+F
Sbjct  537   AANIAKLELSRSFHALYEC-ASLFGAKASKAEIMESQKKLRSHLNELKKFTAEAHAEPSF  595

Query  1597  WFLPFHSACYGKLMGSLSKVVEYLHFVAQALRFLEQESA--------LMGRLDSDHLSLF  1752
             WF PF+ +CY KL  SLSK+ + L F   A+ FL ++          ++  +D D  SL 
Sbjct  596   WFSPFNFSCYEKLFKSLSKMADLLQFSGYAIGFLGEQGKTKSPQCKEILSNVDKDLKSL-  654

Query  1753  RDHVGPSIKSFEEIISLVGSVSVLDKEFEK-KKSSIDPELGKLPTSNNITGLSDEEIDNK  1929
                +G   KS+EE I+L+ S+  L+K   K   +S D ELGK P  +  T +S+ E    
Sbjct  655   TGSIGLLAKSYEE-ITLLKSLDALEKALAKSDNTSWDIELGKTPNPSFSTAVSEPE--KI  711

Query  1930  LKSFMEDSRQFVD-----QKdeddddeVMMNSQVALSLSALAFCMRGIVRETKEIDKAIK  2094
             L+++++  R   D     Q+ +D ++  +  S+V LSLSAL FC+  I +ET+EI++ +K
Sbjct  712   LETYLQHCRSVADGIFRVQEGDDGEEVKVDKSEVVLSLSALGFCVEKIGKETREIEEMVK  771

Query  2095  ELVQWENPSSPVNLHEISCKIRAL  2166
             E+VQ ENPSS VNLHEISCKIR+L
Sbjct  772   EVVQSENPSSHVNLHEISCKIRSL  795



>gb|AAC79583.1| hypothetical protein [Arabidopsis thaliana]
Length=794

 Score =   528 bits (1361),  Expect = 2e-172, Method: Compositional matrix adjust.
 Identities = 335/744 (45%), Positives = 481/744 (65%), Gaps = 38/744 (5%)
 Frame = +1

Query  4     LRGCWYAIYATCLGVCPAILSLWLIGPahlttgtaaaavaitaFIVVLPQN-THVVAKRI  180
             LRGCW A+YATC  V PAI++L LI PA LT  T A A A+ AF+VVLP + TH+VAKRI
Sbjct  64    LRGCWLALYATCQSVGPAIVTLKLIRPARLTAETTALAAALAAFVVVLPNSSTHLVAKRI  123

Query  181   ALGQTVLVYALA---GPRTQPIMHPlrvaastaiavaacvlalllpypslassKVKHNCH  351
             ALGQ VL+Y +    G +T P+MHPL+VAASTA+ V ACVLALL+P P LA+ +VK +C 
Sbjct  124   ALGQIVLIYVIGYIKGAKTDPVMHPLQVAASTALGVVACVLALLVPLPRLATCEVKQSCK  183

Query  352   LFAENVSQRLNLLVKAFSAEDNASALSLVSQAKSLNASGAKFLQNIKSKQESMQWERYPI  531
                +NV+ R+ L +KAF ++D+ SA + VSQA+ L  S +K  Q +K  Q SM WER P 
Sbjct  184   ELGQNVTTRVKLYMKAFCSDDSMSATASVSQARVLARSSSKLYQTLKRYQPSMTWERLPF  243

Query  532   KFFR--PYCKNPGERLQEYETPLRGMEMGLVDNNPPQFPVTVLLSSSEVKDSLDSLTGHI  705
             K +R      N GE+LQ  E  LRGMEM +   +P   P ++L  + EVK+ L ++   +
Sbjct  244   KIWRWQNVNDNKGEKLQSMEIALRGMEMVVASKSP--IPSSLL--AGEVKEDLKNIQERV  299

Query  706   SKQVK--GRLFDLATVPESNAQNAVKFLHQKLQPVTLQdlssffflfslklllikpsssi  879
                +K        +  PES+ +N  + L       TLQ++            L       
Sbjct  300   ILSIKRVNNSSQPSVTPESDPKNPDECLQ------TLQEIPGTPQDLPFYFFLFCIRLLE  353

Query  880   lkdkdGSKEQEERFLDKIYS--NFVGQMNNKRFVASLKYALALGLAVFFGSIYSKPDGFW  1053
                    +E + + L+  +   +++   ++K+ + +LK +L+LGLA+  GS++SKP+G+W
Sbjct  354   TIIIAKPEENKVKVLENKFKTRSWISDWDSKKIMPALKLSLSLGLAILLGSMFSKPNGYW  413

Query  1054  AGLTVAISYVSAREATFRIANVKAQGTVLGSIYGVLGCFVFAKYEELRFISLIPWFIVCS  1233
             AGL VA+S+ +AREATF++ NVKAQGTV+G++YGV+GCFVF K+  +RF+SL+PWF+  S
Sbjct  414   AGLPVAVSFAAAREATFKVTNVKAQGTVIGTVYGVMGCFVFQKFLTVRFLSLLPWFLFSS  473

Query  1234  FLRRSRMYGPAGGISACIGAVLILGREGFGPPREFAMARIMETFIGLACSITVELLFRPT  1413
             FL RS+MYG AGGISA IGAVLILGR+ FGPP EFA+ RI+ETFIGL+CSI VEL+F+PT
Sbjct  474   FLSRSKMYGQAGGISAAIGAVLILGRKNFGPPSEFAIERIIETFIGLSCSIMVELVFQPT  533

Query  1414  RASSLAKIQLSKSLQLLNQCIISIDYSSNNQSKLEETQKILKSSVTQLGKFIGEAEVEPN  1593
             RA+++AK++LS+S   L +C  S+  +  +++ + E+QK L+S + +L KF  EA  EP+
Sbjct  534   RAANIAKLELSRSFHALYEC-ASLFGAKASKADIMESQKKLRSHLNELKKFTAEAHAEPS  592

Query  1594  FWFLPFHSACYGKLMGSLSKVVEYLHFVAQALRFLEQESA--------LMGRLDSDHLSL  1749
             FWF PF+ +CY KL  SLSK+ + L F   A+ FL ++          ++  +D D  SL
Sbjct  593   FWFSPFNFSCYEKLFKSLSKMADLLQFSGYAIGFLGEQGKTKSPQCKEILSNVDKDLKSL  652

Query  1750  FRDHVGPSIKSFEEIISLVGSVSVLDKEFEK-KKSSIDPELGKLPTSNNITGLSDEEIDN  1926
               + +G   KSFEE I+L+ S+  L+K   K   +S D ELGK P  +  T +S+ E   
Sbjct  653   -TESIGLLAKSFEE-ITLLKSLDALEKALAKSDNTSWDIELGKTPNPSFSTAVSEPE--K  708

Query  1927  KLKSFMEDSRQFVD----QKdeddddeVMMNSQVALSLSALAFCMRGIVRETKEIDKAIK  2094
              L+++++  R   D     +++ +++  +  S+V LSL AL FC+  I +ET+EI++ +K
Sbjct  709   ILETYLQHCRSVADGLFRVEEDGEEEVEVDKSEVVLSLCALGFCVERIGKETREIEEMVK  768

Query  2095  ELVQWENPSSPVNLHEISCKIRAL  2166
             E+VQ ENPSS VNLHEISCKIR+L
Sbjct  769   EVVQSENPSSHVNLHEISCKIRSL  792



>ref|XP_010510581.1| PREDICTED: uncharacterized protein LOC104786823 isoform X1 [Camelina 
sativa]
 ref|XP_010510583.1| PREDICTED: uncharacterized protein LOC104786823 isoform X2 [Camelina 
sativa]
Length=797

 Score =   528 bits (1360),  Expect = 2e-172, Method: Compositional matrix adjust.
 Identities = 348/746 (47%), Positives = 490/746 (66%), Gaps = 41/746 (5%)
 Frame = +1

Query  4     LRGCWYAIYATCLGVCPAILSLWLIGPahlttgtaaaavaitaFIVVLPQN-THVVAKRI  180
             LRGCW A+YATC  V PAI++L LIGPA LT  T A A A+ AF+VVLP + TH+VAKRI
Sbjct  66    LRGCWLALYATCQSVGPAIVTLKLIGPARLTAETTALAAALAAFVVVLPNSSTHLVAKRI  125

Query  181   ALGQTVLVYALA---GPRTQPIMHPlrvaastaiavaacvlalllpypslassKVKHNCH  351
             ALGQ VL+Y +    G  T P+MHPLRVAASTA+ V ACVLALL+P P LA+ +VK +  
Sbjct  126   ALGQIVLIYVIGYIKGAETDPVMHPLRVAASTALGVIACVLALLVPLPRLATCEVKQSSK  185

Query  352   LFAENVSQRLNLLVKAFSAEDNASALSLVSQAKSLNASGAKFLQNIKSKQESMQWERYPI  531
                +N++ R+ L +KAF  ED  SA + VSQA+ L  + +K  Q IK  Q SM WER P 
Sbjct  186   ELGQNITTRVKLYMKAFCTEDAMSATASVSQARVLARTSSKLYQTIKRYQPSMTWERLPF  245

Query  532   KFFR--PYCKNPGERLQEYETPLRGMEMGLVDNNPPQFPVTVLLSSSEVKDSLDSLTGHI  705
             K +R      N GE+LQ  E  LRGMEM +   +P   P ++L    EVKD L ++   +
Sbjct  246   KIWRWQNVNDNKGEKLQSMEIALRGMEMVVASKSP--IPTSLL--EGEVKDGLKNIQERV  301

Query  706   SKQVK--GRLFDLATVPESNAQNAVKFLHQKLQ--PVTLQdlssffflfslklllikpss  873
                +K        +  PES+ + + +   Q LQ  P T QDL  +FFLF L+LL     +
Sbjct  302   ILSIKRANNSPQPSVTPESDPKKSDEECLQTLQEIPGTPQDLPFYFFLFCLRLLETITMA  361

Query  874   silkdkdGSKEQEERFLDKIYS-NFVGQMNNKRFVASLKYALALGLAVFFGSIYSKPDGF  1050
                     S+E + + L+K  + +++   ++K+ + +LK +L+LG A+F GS++SKP+G+
Sbjct  362   K-------SEENKVKVLEKSKTRSWINDWDSKKVMPALKLSLSLGFAIFLGSMFSKPNGY  414

Query  1051  WAGLTVAISYVSAREATFRIANVKAQGTVLGSIYGVLGCFVFAKYEELRFISLIPWFIVC  1230
             WAGL VA+S+ +AREATF++ANVKAQGTV+G++YGV+GCFVF K+  +RF+SL+PWF+  
Sbjct  415   WAGLPVAVSFAAAREATFKVANVKAQGTVIGTVYGVMGCFVFQKFLSVRFLSLLPWFLFS  474

Query  1231  SFLRRSRMYGPAGGISACIGAVLILGREGFGPPREFAMARIMETFIGLACSITVELLFRP  1410
             SFL RS+MYG AGGISA IGAVLILGR+ FGPP EFA+ RI+ETFIGL+C+I VEL+F+P
Sbjct  475   SFLSRSKMYGQAGGISAAIGAVLILGRKNFGPPSEFAIERIIETFIGLSCAIMVELIFQP  534

Query  1411  TRASSLAKIQLSKSLQLLNQCIISIDYSSNNQSKLEETQKILKSSVTQLGKFIGEAEVEP  1590
             TRA+++AK++LS+S   L +C      +  +++++ E+QK L+S + +L KF  EA  EP
Sbjct  535   TRAANIAKLELSRSFHALYECACLFG-AKASKAEIMESQKKLRSHLNELKKFTAEAHAEP  593

Query  1591  NFWFLPFHSACYGKLMGSLSKVVEYLHFVAQALRFLEQESA--------LMGRLDSDHLS  1746
             +FWF PF+ +CY KL  SLSK+ + L F   A+ FL ++          ++  +D D  S
Sbjct  594   SFWFSPFNFSCYEKLFKSLSKMADLLQFSGYAIGFLGEQGKTKSPQCKEILSNVDKDLKS  653

Query  1747  LFRDHVGPSIKSFEEIISLVGSVSVLDKEFEKKKS-SIDPELGKLPTSNNITGLSDEEID  1923
             L    +G   KS+EE I+L+ S+  L+K   K  + S D ELGK P  +  T +S+ E  
Sbjct  654   L-TGSIGLLAKSYEE-ITLLKSLDALEKALAKSDNISWDIELGKTPNPSFSTAVSEPE--  709

Query  1924  NKLKSFMEDSRQFVD-----QKdeddddeVMMNSQVALSLSALAFCMRGIVRETKEIDKA  2088
               L+++++  R   D     ++ +D ++  +  S+V LSLSAL FC+  I +ET+EI++ 
Sbjct  710   KILETYLQHCRSVADGIFRVEEGDDGEEVKVDKSEVVLSLSALGFCVEKIGKETREIEEM  769

Query  2089  IKELVQWENPSSPVNLHEISCKIRAL  2166
             +KE+VQ ENPSS VNLHEISCKIR+L
Sbjct  770   VKEVVQSENPSSHVNLHEISCKIRSL  795



>ref|NP_180444.2| uncharacterized protein [Arabidopsis thaliana]
 gb|AAO42117.1| unknown protein [Arabidopsis thaliana]
 gb|AAP40430.1| unknown protein [Arabidopsis thaliana]
 gb|AEC08170.1| uncharacterized protein AT2G28780 [Arabidopsis thaliana]
Length=796

 Score =   528 bits (1360),  Expect = 2e-172, Method: Compositional matrix adjust.
 Identities = 335/744 (45%), Positives = 481/744 (65%), Gaps = 38/744 (5%)
 Frame = +1

Query  4     LRGCWYAIYATCLGVCPAILSLWLIGPahlttgtaaaavaitaFIVVLPQN-THVVAKRI  180
             LRGCW A+YATC  V PAI++L LI PA LT  T A A A+ AF+VVLP + TH+VAKRI
Sbjct  66    LRGCWLALYATCQSVGPAIVTLKLIRPARLTAETTALAAALAAFVVVLPNSSTHLVAKRI  125

Query  181   ALGQTVLVYALA---GPRTQPIMHPlrvaastaiavaacvlalllpypslassKVKHNCH  351
             ALGQ VL+Y +    G +T P+MHPL+VAASTA+ V ACVLALL+P P LA+ +VK +C 
Sbjct  126   ALGQIVLIYVIGYIKGAKTDPVMHPLQVAASTALGVVACVLALLVPLPRLATCEVKQSCK  185

Query  352   LFAENVSQRLNLLVKAFSAEDNASALSLVSQAKSLNASGAKFLQNIKSKQESMQWERYPI  531
                +NV+ R+ L +KAF ++D+ SA + VSQA+ L  S +K  Q +K  Q SM WER P 
Sbjct  186   ELGQNVTTRVKLYMKAFCSDDSMSATASVSQARVLARSSSKLYQTLKRYQPSMTWERLPF  245

Query  532   KFFR--PYCKNPGERLQEYETPLRGMEMGLVDNNPPQFPVTVLLSSSEVKDSLDSLTGHI  705
             K +R      N GE+LQ  E  LRGMEM +   +P   P ++L  + EVK+ L ++   +
Sbjct  246   KIWRWQNVNDNKGEKLQSMEIALRGMEMVVASKSP--IPSSLL--AGEVKEDLKNIQERV  301

Query  706   SKQVK--GRLFDLATVPESNAQNAVKFLHQKLQPVTLQdlssffflfslklllikpsssi  879
                +K        +  PES+ +N  + L       TLQ++            L       
Sbjct  302   ILSIKRVNNSSQPSVTPESDPKNPDECLQ------TLQEIPGTPQDLPFYFFLFCIRLLE  355

Query  880   lkdkdGSKEQEERFLDKIYS--NFVGQMNNKRFVASLKYALALGLAVFFGSIYSKPDGFW  1053
                    +E + + L+  +   +++   ++K+ + +LK +L+LGLA+  GS++SKP+G+W
Sbjct  356   TIIIAKPEENKVKVLENKFKTRSWISDWDSKKIMPALKLSLSLGLAILLGSMFSKPNGYW  415

Query  1054  AGLTVAISYVSAREATFRIANVKAQGTVLGSIYGVLGCFVFAKYEELRFISLIPWFIVCS  1233
             AGL VA+S+ +AREATF++ NVKAQGTV+G++YGV+GCFVF K+  +RF+SL+PWF+  S
Sbjct  416   AGLPVAVSFAAAREATFKVTNVKAQGTVIGTVYGVMGCFVFQKFLTVRFLSLLPWFLFSS  475

Query  1234  FLRRSRMYGPAGGISACIGAVLILGREGFGPPREFAMARIMETFIGLACSITVELLFRPT  1413
             FL RS+MYG AGGISA IGAVLILGR+ FGPP EFA+ RI+ETFIGL+CSI VEL+F+PT
Sbjct  476   FLSRSKMYGQAGGISAAIGAVLILGRKNFGPPSEFAIERIIETFIGLSCSIMVELVFQPT  535

Query  1414  RASSLAKIQLSKSLQLLNQCIISIDYSSNNQSKLEETQKILKSSVTQLGKFIGEAEVEPN  1593
             RA+++AK++LS+S   L +C  S+  +  +++ + E+QK L+S + +L KF  EA  EP+
Sbjct  536   RAANIAKLELSRSFHALYEC-ASLFGAKASKADIMESQKKLRSHLNELKKFTAEAHAEPS  594

Query  1594  FWFLPFHSACYGKLMGSLSKVVEYLHFVAQALRFLEQESA--------LMGRLDSDHLSL  1749
             FWF PF+ +CY KL  SLSK+ + L F   A+ FL ++          ++  +D D  SL
Sbjct  595   FWFSPFNFSCYEKLFKSLSKMADLLQFSGYAIGFLGEQGKTKSPQCKEILSNVDKDLKSL  654

Query  1750  FRDHVGPSIKSFEEIISLVGSVSVLDKEFEK-KKSSIDPELGKLPTSNNITGLSDEEIDN  1926
               + +G   KSFEE I+L+ S+  L+K   K   +S D ELGK P  +  T +S+ E   
Sbjct  655   -TESIGLLAKSFEE-ITLLKSLDALEKALAKSDNTSWDIELGKTPNPSFSTAVSEPE--K  710

Query  1927  KLKSFMEDSRQFVD----QKdeddddeVMMNSQVALSLSALAFCMRGIVRETKEIDKAIK  2094
              L+++++  R   D     +++ +++  +  S+V LSL AL FC+  I +ET+EI++ +K
Sbjct  711   ILETYLQHCRSVADGLFRVEEDGEEEVEVDKSEVVLSLCALGFCVERIGKETREIEEMVK  770

Query  2095  ELVQWENPSSPVNLHEISCKIRAL  2166
             E+VQ ENPSS VNLHEISCKIR+L
Sbjct  771   EVVQSENPSSHVNLHEISCKIRSL  794



>ref|XP_009140941.1| PREDICTED: uncharacterized protein LOC103864919 [Brassica rapa]
Length=802

 Score =   528 bits (1359),  Expect = 3e-172, Method: Compositional matrix adjust.
 Identities = 352/746 (47%), Positives = 496/746 (66%), Gaps = 36/746 (5%)
 Frame = +1

Query  4     LRGCWYAIYATCLGVCPAILSLWLIGPahlttgtaaaavaitaFIVVLPQ-NTHVVAKRI  180
             LRGCW A+YATC  V PAI++L LIGPA LT GT A A A+ AF+VVLP  +TH+VAKRI
Sbjct  66    LRGCWLALYATCQSVAPAIITLKLIGPARLTAGTTALAAALAAFVVVLPNGSTHLVAKRI  125

Query  181   ALGQTVLVYALA---GPRTQPIMHPlrvaastaiavaacvlalllpypslassKVKHNCH  351
             ALGQ VL+Y +    G  T P+MHPLRVAASTA+ V ACVLALL+P P LA+S+VK +C 
Sbjct  126   ALGQIVLIYVIGYINGAETDPVMHPLRVAASTALGVIACVLALLVPLPRLATSEVKQSCK  185

Query  352   LFAENVSQRLNLLVKAFSAEDNASALSLVSQAKSLNASGAKFLQNIKSKQESMQWERYPI  531
                +NV+ R+ L +KAF AED  +A++ VSQA+ L+   +K  Q IK  Q SM+WER P 
Sbjct  186   EIGQNVTTRVKLYMKAFCAEDAMTAMASVSQARELSRISSKLYQTIKRYQPSMKWERLPF  245

Query  532   KFFR--PYCKNPGERLQEYETPLRGMEMGLVDNNPPQFPVTVLLSSSEVKDSLDSLTGHI  705
             K +R      N GE+LQ  E  LRGM+M L   +P   P ++L  + EVKD L ++   +
Sbjct  246   KIWRWQNVNDNKGEKLQSMEIALRGMDMVLASKSP--IPASLL--AGEVKDDLKNVQERV  301

Query  706   SKQVKGRLFDL---ATVPESNAQNAVKFLHQKLQPVTLQdlssffflfslklllikpsss  876
             +  +K R+ ++   +  PE++ Q   + L Q LQ V        F+ F   L L++  S+
Sbjct  302   NLSIK-RVNNVPQPSVTPETDLQKPDECL-QTLQQVPETPQDLPFYFFLFCLRLLETIST  359

Query  877   ilkdkdGSKEQEERFLDKIYS---NFVGQMNNKRFVASLKYALALGLAVFFGSIYSKPDG  1047
                ++   K +E +   K  S   ++    ++K+ + + K +L+LGLA+F GS+YSKP+G
Sbjct  360   AKPEETKVKPEENKGSVKTKSRSWSWFSDWDSKKVMPATKLSLSLGLAIFLGSLYSKPNG  419

Query  1048  FWAGLTVAISYVSAREATFRIANVKAQGTVLGSIYGVLGCFVFAKYEELRFISLIPWFIV  1227
             +WAGL VAIS+ +AREATF++ANVKAQGTV+G++YGV+GCFVF ++  +RF+SL+PWFI 
Sbjct  420   YWAGLPVAISFAAAREATFKVANVKAQGTVIGTVYGVMGCFVFQRFLTVRFLSLLPWFIF  479

Query  1228  CSFLRRSRMYGPAGGISACIGAVLILGREGFGPPREFAMARIMETFIGLACSITVELLFR  1407
              SFL +SRMYG AGGISA IGAVLILGR+ FG PR+FA+ RI+ETFIGLACSI VEL+ +
Sbjct  480   SSFLSKSRMYGQAGGISAAIGAVLILGRKNFGQPRDFAIDRIIETFIGLACSIMVELILQ  539

Query  1408  PTRASSLAKIQLSKSLQLLNQCIISIDYSSNNQSKLEETQKILKSSVTQLGKFIGEAEVE  1587
             PTRA+++AK++LS+S   L  C  S+  +  ++ ++ E+QK L+S +  L KF  EA+ E
Sbjct  540   PTRAANVAKLELSRSFHALYGC-ASLFGAKASKGEIMESQKKLRSHLNLLKKFTEEAQAE  598

Query  1588  PNFWFLPFHSACYGKLMGSLSKVVEYLHFVAQALRFLEQES--------ALMGRLDSDHL  1743
             P+FWF PF+++CY KL  SLSK+ + L F   A+ FL+++          ++  +DSD  
Sbjct  599   PSFWFTPFNASCYEKLFKSLSKLADLLQFSGYAIGFLDEQGRWKSPQCKEILSDIDSDLK  658

Query  1744  SLFRDHVGPSIKSFEEIISLVGSVSVLDKEFEKK-KSSIDPELGKLPTSNNITGLSDEEI  1920
             SL +  +    KSFEE I+L+ S+  L+K   K   +S D ELGK P  N      + E 
Sbjct  659   SLTQS-ISLLAKSFEE-ITLLKSLDALEKALTKNGNTSWDIELGKTP--NPSFSSPESEP  714

Query  1921  DNKLKSFMEDSRQFVD---QKdeddddeVMMN-SQVALSLSALAFCMRGIVRETKEIDKA  2088
                L ++++  R   D   + D+++ +EV ++ S+V LSLSAL FC+  + +ET+EI++ 
Sbjct  715   GKILNTYLQHCRGVSDGIFRADDEEGEEVKVDKSEVVLSLSALGFCVEKMGKETREIEEM  774

Query  2089  IKELVQWENPSSPVNLHEISCKIRAL  2166
             +KE+VQ ENPSS VNLHEISCKIR+L
Sbjct  775   VKEVVQSENPSSHVNLHEISCKIRSL  800



>ref|XP_006293705.1| hypothetical protein CARUB_v10022663mg [Capsella rubella]
 gb|EOA26603.1| hypothetical protein CARUB_v10022663mg [Capsella rubella]
Length=795

 Score =   526 bits (1354),  Expect = 2e-171, Method: Compositional matrix adjust.
 Identities = 341/744 (46%), Positives = 482/744 (65%), Gaps = 39/744 (5%)
 Frame = +1

Query  4     LRGCWYAIYATCLGVCPAILSLWLIGPahlttgtaaaavaitaFIVVLPQN-THVVAKRI  180
             LRGCW A+YATC  V PAI++L LIGPA LT  T A A A+ AF+VVLP + TH+VAKRI
Sbjct  66    LRGCWLALYATCQSVGPAIVTLKLIGPARLTAETTALAAALAAFVVVLPNSSTHLVAKRI  125

Query  181   ALGQTVLVYALA---GPRTQPIMHPlrvaastaiavaacvlalllpypslassKVKHNCH  351
             ALGQ VL+Y +    G  T P+MHPLRVAASTA+ V ACVLALLLP P LA+ +VK +C 
Sbjct  126   ALGQIVLIYVIGYIKGAETDPVMHPLRVAASTALGVLACVLALLLPLPRLATCEVKQSCK  185

Query  352   LFAENVSQRLNLLVKAFSAEDNASALSLVSQAKSLNASGAKFLQNIKSKQESMQWERYPI  531
                +NV+ R+ L +KAF  ED  SA + VSQA+ L  S +K  Q +K  + SM WER P 
Sbjct  186   EVGQNVTTRVKLYMKAFCTEDAMSATASVSQARVLARSSSKLYQKLKRYEPSMTWERLPF  245

Query  532   KFFR--PYCKNPGERLQEYETPLRGMEMGLVDNNPPQFPVTVLLSSSEVKDSLDSLTGHI  705
             K +R      N GE+LQ  E  LRGMEM +   +P   P ++L    EVK+ L ++   +
Sbjct  246   KIWRWQNVNDNKGEKLQSMEIALRGMEMVVASKSP--IPSSLL--EGEVKEDLKNIQERV  301

Query  706   SKQVKGRLFDL---ATVPESNAQNAVKFLHQKLQPVTLQdlssffflfslklllikpsss  876
                +K R+ +    +  PES+ + + + L       TLQ++            L      
Sbjct  302   ILSIK-RVNNSPQPSVTPESDTEKSDECLQ------TLQEIPGTPQDLPFYFFLFCLRLL  354

Query  877   ilkdkdGSKEQEERFLDKIYSNF-VGQMNNKRFVASLKYALALGLAVFFGSIYSKPDGFW  1053
                     +E + + L+K  + F +   ++K+ + +LK +L+LGLA+  GSI+SKP+G+W
Sbjct  355   ETIIIAKPEENKVKVLEKSKTKFWLSDWDSKKVMPALKLSLSLGLAILLGSIFSKPNGYW  414

Query  1054  AGLTVAISYVSAREATFRIANVKAQGTVLGSIYGVLGCFVFAKYEELRFISLIPWFIVCS  1233
             AGL VA+S+ +AREATF++ANVKAQGTV+G++YGV+GCFVF K+  +RF+SL+PWF+  S
Sbjct  415   AGLPVAVSFAAAREATFKVANVKAQGTVIGTVYGVMGCFVFQKFLPVRFLSLLPWFLFSS  474

Query  1234  FLRRSRMYGPAGGISACIGAVLILGREGFGPPREFAMARIMETFIGLACSITVELLFRPT  1413
             FL RS+MYG AGGISA IGAVLILGR+ FGPP EFA+ RI+ETFIGL+CSI VEL+F+PT
Sbjct  475   FLSRSKMYGQAGGISAAIGAVLILGRKNFGPPSEFAIERIIETFIGLSCSIMVELVFQPT  534

Query  1414  RASSLAKIQLSKSLQLLNQCIISIDYSSNNQSKLEETQKILKSSVTQLGKFIGEAEVEPN  1593
             RA+++AK++LS+S   L +C  S+  +  +++++ E+QK L+S + +L KF  EA  EP+
Sbjct  535   RAANIAKLELSRSFHALYEC-ASLFGAKASKAEIMESQKKLRSHLNELKKFTAEAHAEPS  593

Query  1594  FWFLPFHSACYGKLMGSLSKVVEYLHFVAQALRFLEQESA--------LMGRLDSDHLSL  1749
             FWF PF+ +CY KL  SLSK+ + L F   A+ FL ++          ++  +D D  SL
Sbjct  594   FWFSPFNFSCYEKLFKSLSKMADLLQFSGYAIGFLGEQGKDKSPQCKEILSTVDKDLKSL  653

Query  1750  FRDHVGPSIKSFEEIISLVGSVSVLDKEFEK-KKSSIDPELGKLPTSNNITGLSDEEIDN  1926
                 +G   KS+EE I+L+ S+  L++   K   +S D ELGK P  +  T +S+ E   
Sbjct  654   -TGSIGLLAKSYEE-ITLLKSLDALEQALAKSDNTSWDIELGKTPNPSFSTAVSEPE--K  709

Query  1927  KLKSFMEDSRQFVDQ----KdeddddeVMMNSQVALSLSALAFCMRGIVRETKEIDKAIK  2094
              L+++++  R   +     ++ + D+  +  S+V LSLSAL FC+  I +ET+EI++ +K
Sbjct  710   ILETYLQHCRSVAEGIFRVEEGEGDEVKVDKSEVVLSLSALGFCVERIGKETREIEEMVK  769

Query  2095  ELVQWENPSSPVNLHEISCKIRAL  2166
             E+VQ ENPSS VNLHEISCKIR+L
Sbjct  770   EVVQSENPSSHVNLHEISCKIRSL  793



>emb|CDY31731.1| BnaA04g16670D [Brassica napus]
Length=802

 Score =   525 bits (1353),  Expect = 2e-171, Method: Compositional matrix adjust.
 Identities = 351/746 (47%), Positives = 495/746 (66%), Gaps = 36/746 (5%)
 Frame = +1

Query  4     LRGCWYAIYATCLGVCPAILSLWLIGPahlttgtaaaavaitaFIVVLPQ-NTHVVAKRI  180
             LRGCW A+YATC  V PAI++L LIGPA LT GT A A A+ AF+VVLP  +TH+VAKRI
Sbjct  66    LRGCWLALYATCQSVAPAIITLKLIGPARLTAGTTALAAALAAFVVVLPNGSTHLVAKRI  125

Query  181   ALGQTVLVYALA---GPRTQPIMHPlrvaastaiavaacvlalllpypslassKVKHNCH  351
             ALGQ VL+Y +    G  T P+MHPLRVAASTA+ V ACVLALL+P P LA+S+VK +C 
Sbjct  126   ALGQIVLIYVIGYINGAETDPVMHPLRVAASTALGVIACVLALLVPLPRLATSEVKQSCK  185

Query  352   LFAENVSQRLNLLVKAFSAEDNASALSLVSQAKSLNASGAKFLQNIKSKQESMQWERYPI  531
                +NV+ R+ L +KAF AED  +A++ VSQA+ L+   +K  Q IK  Q SM+WER P 
Sbjct  186   EIGQNVTTRVKLYMKAFCAEDAMTAMASVSQARELSRISSKLYQTIKRYQPSMKWERLPF  245

Query  532   KFFR--PYCKNPGERLQEYETPLRGMEMGLVDNNPPQFPVTVLLSSSEVKDSLDSLTGHI  705
             K +R      N GE+LQ  E  LRGM+M L   +P   P ++L  + EVKD L ++   +
Sbjct  246   KIWRWQNVNDNKGEKLQSMEIALRGMDMVLASKSP--IPASLL--AGEVKDDLKNVQERV  301

Query  706   SKQVKGRLFDL---ATVPESNAQNAVKFLHQKLQPVTLQdlssffflfslklllikpsss  876
                +K R+ ++   +  PE++ Q   + L Q LQ V        F+ F   L L++  S+
Sbjct  302   ILSIK-RVNNVPQPSVTPETDLQKPDECL-QTLQQVPETPQDLPFYFFLFCLRLLETIST  359

Query  877   ilkdkdGSKEQEERFLDKIYS---NFVGQMNNKRFVASLKYALALGLAVFFGSIYSKPDG  1047
                ++   K +E +   K  S   ++    ++K+ + + K +L+LGLA+F GS+YSKP+G
Sbjct  360   AKPEETKVKPEENKGSVKTKSRSWSWFSDWDSKKVMPATKLSLSLGLAIFLGSLYSKPNG  419

Query  1048  FWAGLTVAISYVSAREATFRIANVKAQGTVLGSIYGVLGCFVFAKYEELRFISLIPWFIV  1227
             +WAGL VAIS+ +AREATF++ANVKAQGTV+G++YGV+GCFVF ++  +RF+SL+PWFI 
Sbjct  420   YWAGLPVAISFAAAREATFKVANVKAQGTVIGTVYGVMGCFVFQRFLTVRFLSLLPWFIF  479

Query  1228  CSFLRRSRMYGPAGGISACIGAVLILGREGFGPPREFAMARIMETFIGLACSITVELLFR  1407
              SFL +SRMYG AGGISA IGAVLILGR+ FG PR+FA+ RI+ETFIGLACSI VEL+ +
Sbjct  480   SSFLSKSRMYGQAGGISAAIGAVLILGRKNFGQPRDFAIDRIIETFIGLACSIMVELILQ  539

Query  1408  PTRASSLAKIQLSKSLQLLNQCIISIDYSSNNQSKLEETQKILKSSVTQLGKFIGEAEVE  1587
             PTRA+++AK++LS+S   L  C  S+  +  ++ ++ E+QK L+S +  L KF  EA+ E
Sbjct  540   PTRAANVAKLELSRSFHALYGC-ASLFGAKASKGEIMESQKKLRSHLNLLKKFTEEAQAE  598

Query  1588  PNFWFLPFHSACYGKLMGSLSKVVEYLHFVAQALRFLEQES--------ALMGRLDSDHL  1743
             P+FWF PF+++CY KL  SLSK+ + L F   A+ FL+++          ++  +D+D  
Sbjct  599   PSFWFTPFNASCYEKLFKSLSKLADLLQFSGYAIGFLDEQGRWKSPQCKEILSDIDNDLK  658

Query  1744  SLFRDHVGPSIKSFEEIISLVGSVSVLDKEFEKK-KSSIDPELGKLPTSNNITGLSDEEI  1920
             SL +  +    KSFEE I+L+ S+  L+K   K   +S D ELGK P  N      + E 
Sbjct  659   SLTQS-ISLLAKSFEE-ITLLKSLDALEKALTKNGNTSWDIELGKTP--NPSFSSPESEP  714

Query  1921  DNKLKSFMEDSRQFVD---QKdeddddeVMMN-SQVALSLSALAFCMRGIVRETKEIDKA  2088
                L ++++  R   D   + D+++ +EV ++ S+V LSLSAL FC+  + +ET+EI++ 
Sbjct  715   GKILNTYLQHCRGVSDGIFRADDEEGEEVKVDKSEVVLSLSALGFCVEKMGKETREIEEM  774

Query  2089  IKELVQWENPSSPVNLHEISCKIRAL  2166
             +KE+VQ ENPSS VNLHEISCKIR+L
Sbjct  775   VKEVVQSENPSSHVNLHEISCKIRSL  800



>ref|XP_002881008.1| hypothetical protein ARALYDRAFT_320665 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH57267.1| hypothetical protein ARALYDRAFT_320665 [Arabidopsis lyrata subsp. 
lyrata]
Length=795

 Score =   525 bits (1352),  Expect = 3e-171, Method: Compositional matrix adjust.
 Identities = 336/743 (45%), Positives = 480/743 (65%), Gaps = 37/743 (5%)
 Frame = +1

Query  4     LRGCWYAIYATCLGVCPAILSLWLIGPahlttgtaaaavaitaFIVVLPQN-THVVAKRI  180
             LRGCW A+YATC  V PAI++L LIGPA LT  T A A A+ AF+VVLP + TH+VAKRI
Sbjct  66    LRGCWLALYATCQSVGPAIITLKLIGPARLTAETTALAAALAAFVVVLPNSSTHLVAKRI  125

Query  181   ALGQTVLVYALA---GPRTQPIMHPlrvaastaiavaacvlalllpypslassKVKHNCH  351
             ALGQ VL+Y +    G  T P+MHPL+VAASTA+ V ACVLALL+P P LA+ +VK +C 
Sbjct  126   ALGQIVLIYVIGYIKGAETDPVMHPLQVAASTALGVVACVLALLVPLPRLATCEVKQSCK  185

Query  352   LFAENVSQRLNLLVKAFSAEDNASALSLVSQAKSLNASGAKFLQNIKSKQESMQWERYPI  531
                +NV+ R+ L +KAF ++D  SA + VSQA+ L  S +K  Q +K  Q SM WER P 
Sbjct  186   ELGQNVTTRVKLYMKAFCSDDAMSATASVSQARVLARSSSKLYQTLKRYQPSMTWERLPF  245

Query  532   KFFR--PYCKNPGERLQEYETPLRGMEMGLVDNNPPQFPVTVLLSSSEVKDSLDSLTGHI  705
             K +R      N GE+LQ  E  LRGMEM +   +P   P ++L  + EVK+ L ++   +
Sbjct  246   KIWRWQNVNDNKGEKLQSMEIALRGMEMVVASKSP--IPSSLL--AGEVKEDLKNIQERV  301

Query  706   SKQVK--GRLFDLATVPESNAQNAVKFLHQKLQPVTLQdlssffflfslklllikpsssi  879
                +K        +  PES+ +   + L       TLQ++            L       
Sbjct  302   ILSIKRVNNSRQPSVTPESDPKKPDECLQ------TLQEIPETPQDLPFYFFLFCIRLLE  355

Query  880   lkdkdGSKEQEERFLDKIYS-NFVGQMNNKRFVASLKYALALGLAVFFGSIYSKPDGFWA  1056
             +      +E + + L+K  + +++   ++K+ + +LK +L+LGLA+  GS++SKP+G+WA
Sbjct  356   IITMAKPEENKVKVLEKSKTRSWISDWDSKKVMPALKLSLSLGLAIMLGSMFSKPNGYWA  415

Query  1057  GLTVAISYVSAREATFRIANVKAQGTVLGSIYGVLGCFVFAKYEELRFISLIPWFIVCSF  1236
             GL VAIS+ +AREATF++ANVKAQGTV+G++YGV+GCFVF K+  +RF+SL+PWF+  SF
Sbjct  416   GLPVAISFAAAREATFKVANVKAQGTVIGTVYGVMGCFVFQKFLTVRFLSLLPWFLFSSF  475

Query  1237  LRRSRMYGPAGGISACIGAVLILGREGFGPPREFAMARIMETFIGLACSITVELLFRPTR  1416
             L +SRMYG AGGISA IGAVLILGR+  GPP EFA+ RI+ETFIGL+CSI VEL+F+PTR
Sbjct  476   LSKSRMYGQAGGISAAIGAVLILGRKNIGPPSEFAIERIIETFIGLSCSIMVELVFQPTR  535

Query  1417  ASSLAKIQLSKSLQLLNQCIISIDYSSNNQSKLEETQKILKSSVTQLGKFIGEAEVEPNF  1596
             A+++AK++LS+S   L +C  S+  +  +++++ E+QK L+S + +L KF  EA  EP+F
Sbjct  536   AANIAKLELSRSFHALYEC-ASLFGAKASKAEIMESQKKLRSHLNELKKFTAEAHAEPSF  594

Query  1597  WFLPFHSACYGKLMGSLSKVVEYLHFVAQALRFLEQESA--------LMGRLDSDHLSLF  1752
             WF PF+ +CY KL  SLSK+ + L F   A+ FL ++          ++  +D D  SL 
Sbjct  595   WFSPFNFSCYEKLFKSLSKMADLLQFSGYAIGFLGEQGKTKSPQCKEILSNVDKDLKSL-  653

Query  1753  RDHVGPSIKSFEEIISLVGSVSVLDKEFEK-KKSSIDPELGKLPTSNNITGLSDEEIDNK  1929
              + +    KSFEE I+L+ S+  L K   K   +S D ELGK P  +  T +S+ E    
Sbjct  654   TESIALLAKSFEE-ITLLKSLDALGKALAKSDNTSWDIELGKTPNPSFSTAVSEPE--KI  710

Query  1930  LKSFMEDSRQFVD----QKdeddddeVMMNSQVALSLSALAFCMRGIVRETKEIDKAIKE  2097
             L+++++  R   D     ++  +++  +  S+V LSLSAL FC+  I +ET+EI++ +KE
Sbjct  711   LETYLQHCRSVADGIFRVEEGGEEEVKVDKSEVVLSLSALGFCVERIGKETREIEEMVKE  770

Query  2098  LVQWENPSSPVNLHEISCKIRAL  2166
             ++Q ENPSS VNLHEISCKIR+L
Sbjct  771   VLQSENPSSHVNLHEISCKIRSL  793



>ref|XP_010414485.1| PREDICTED: uncharacterized protein LOC104700645 [Camelina sativa]
Length=797

 Score =   525 bits (1352),  Expect = 3e-171, Method: Compositional matrix adjust.
 Identities = 338/744 (45%), Positives = 478/744 (64%), Gaps = 37/744 (5%)
 Frame = +1

Query  4     LRGCWYAIYATCLGVCPAILSLWLIGPahlttgtaaaavaitaFIVVLPQN-THVVAKRI  180
             LRGCW A+YATC  V PAI++L LIGPA LT  T A A A+ AF+VVLP + TH+VAKRI
Sbjct  66    LRGCWLALYATCQSVGPAIVTLKLIGPARLTAETTALAAALAAFVVVLPNSSTHLVAKRI  125

Query  181   ALGQTVLVYALA---GPRTQPIMHPlrvaastaiavaacvlalllpypslassKVKHNCH  351
             ALGQ VL+Y +    G  T P+MHPLRVAASTA+ V ACVLALL+P P LA+ +VK +  
Sbjct  126   ALGQIVLIYVIGYIKGAETDPVMHPLRVAASTALGVIACVLALLVPLPRLATCEVKQSSK  185

Query  352   LFAENVSQRLNLLVKAFSAEDNASALSLVSQAKSLNASGAKFLQNIKSKQESMQWERYPI  531
                +N++ R+ L +KAF  ED  SA + VSQA+ L  + +K  Q IK  Q SM WER P 
Sbjct  186   ELGQNITTRVKLYMKAFCTEDAMSATASVSQARVLARTSSKLYQTIKRYQPSMTWERLPF  245

Query  532   KFFR--PYCKNPGERLQEYETPLRGMEMGLVDNNPPQFPVTVLLSSSEVKDSLDSLTGHI  705
             K +R      N GE+LQ  E  LRGMEM +   +P   P ++L    EVKD L ++   +
Sbjct  246   KIWRWQNVNDNKGEKLQSMEIALRGMEMVVASKSP--IPTSLL--EGEVKDGLKNIQERV  301

Query  706   SKQVK--GRLFDLATVPESNAQNAVKFLHQKLQPVTLQdlssffflfslklllikpsssi  879
                +K        +  PES+ + + +   Q     TLQ++            L       
Sbjct  302   ILSIKRANNSPQPSVTPESDPKKSDEECLQ-----TLQEIPGTSQDLPFYFFLFCLRLLE  356

Query  880   lkdkdGSKEQEERFLDKIYS-NFVGQMNNKRFVASLKYALALGLAVFFGSIYSKPDGFWA  1056
                    +E + + L+K  + +++   ++K+ +  LK +L+LG A+  GS++SKP+G+WA
Sbjct  357   TITMAKPEENKVKVLEKSKTRSWINDWDSKKVMPVLKLSLSLGFAILLGSMFSKPNGYWA  416

Query  1057  GLTVAISYVSAREATFRIANVKAQGTVLGSIYGVLGCFVFAKYEELRFISLIPWFIVCSF  1236
             GL VA+S+ +AREATF++ANVKAQGTV+G++YGV+GCFVF K+  +RF+SL+PWF+  SF
Sbjct  417   GLPVAVSFAAAREATFKVANVKAQGTVIGTVYGVMGCFVFQKFLSVRFLSLLPWFLFSSF  476

Query  1237  LRRSRMYGPAGGISACIGAVLILGREGFGPPREFAMARIMETFIGLACSITVELLFRPTR  1416
             L RSRMYG AGGISA IGAVLILGR+ FGPP EFA+ RI+ETFIGL+C+I VEL+F+PTR
Sbjct  477   LSRSRMYGQAGGISAAIGAVLILGRKNFGPPSEFAIERIIETFIGLSCAIMVELIFQPTR  536

Query  1417  ASSLAKIQLSKSLQLLNQCIISIDYSSNNQSKLEETQKILKSSVTQLGKFIGEAEVEPNF  1596
             A+++AK++LS+S   L +C  S+  +  +++++ E+QK L+S + +L KF  EA  EP+F
Sbjct  537   AANIAKLELSRSFHALYEC-ASLFGAKASKAEIMESQKKLRSHLNELKKFTAEAHAEPSF  595

Query  1597  WFLPFHSACYGKLMGSLSKVVEYLHFVAQALRFLEQESA--------LMGRLDSDHLSLF  1752
             WF PF+ +CY KL  SLSK+ + L F   A+ FL ++          ++  +D D  SL 
Sbjct  596   WFSPFNFSCYEKLFKSLSKMADLLQFSGYAIGFLGEQGKTKSPQCKEILSNVDKDLKSL-  654

Query  1753  RDHVGPSIKSFEEIISLVGSVSVLDKEFEK-KKSSIDPELGKLPTSNNITGLSDEEIDNK  1929
                +G   KS+EE I+L+ S+  L+K   K   +S D ELGK P  +  T +S+ E    
Sbjct  655   TGSIGLLAKSYEE-ITLLKSLDALEKALAKSDNTSWDIELGKTPNPSFSTVVSEPE--KI  711

Query  1930  LKSFMEDSRQFVD-----QKdeddddeVMMNSQVALSLSALAFCMRGIVRETKEIDKAIK  2094
             L+++++  R   D     ++ +D ++  +  S+V LSLSAL FC+  I +ET+EI++ +K
Sbjct  712   LETYLQHCRSVADGIFRVEEGDDGEEVKVDKSEVVLSLSALGFCVEKIGKETREIEEMVK  771

Query  2095  ELVQWENPSSPVNLHEISCKIRAL  2166
             E+VQ ENPSS VNLHEISCKIR+L
Sbjct  772   EVVQSENPSSHVNLHEISCKIRSL  795



>ref|XP_004487244.1| PREDICTED: uncharacterized protein LOC101504850 [Cicer arietinum]
Length=829

 Score =   524 bits (1349),  Expect = 3e-170, Method: Compositional matrix adjust.
 Identities = 344/733 (47%), Positives = 468/733 (64%), Gaps = 30/733 (4%)
 Frame = +1

Query  1     ALRGCWYAIYATCLGVCPAILSLWLIGPahlttgtaaaavaitaFIVVLP--QNTHVVAK  174
              LRGCW  +YAT   + PA+L LW IGP   + GT + AVA+ AF+VVLP  ++TH++AK
Sbjct  104   TLRGCWLGVYATIQSLGPAMLILWAIGPNKFSKGTTSIAVAVGAFVVVLPSGESTHLIAK  163

Query  175   RIALGQTVLVYALA---GPRTQPIMHPlrvaastaiavaacvlalllpypslassKVKHN  345
             RI+LGQ VLVY LA   G    PIMHP+ +AASTA+A+ ACVLALLLPYP  A  +V  N
Sbjct  164   RISLGQIVLVYVLAYVNGVNCDPIMHPIHLAASTALALLACVLALLLPYPRFACYQVNKN  223

Query  346   CHLFAENVSQRLNLLVKAFSAEDNASALSLVSQAKSLNASGAKFLQNIKSKQESMQWERY  525
             C L   N+ +RL LLVK    ++N SAL L++  KSL     K L  I    + M+WER 
Sbjct  224   CKLLINNILKRLKLLVKIIDEDENTSALELLTHVKSLATKRNKLLSTIMRYIDGMKWERL  283

Query  526   PIKFFRPYCKNPGERLQEYETPLRGMEMGLVDNNPPQFPVTVLLSSSEVKDSLDSLTGHI  705
             PI FF+P+  N GERLQE +  L+GME+ L  +    FP+  L    ++K  L++L  H+
Sbjct  284   PINFFKPHYMNLGERLQEVDINLKGMELAL--SCTKSFPINTL--DQDLKHGLNTLEEHV  339

Query  706   SKQVKGRLFDLA-----TVPESNAQNAVKFLHQKLQ--PVTLQdlssffflfslklllik  864
             +  +K    +       TVPESN +N   FL Q L   P TLQ+L  FFFLF  KLL +K
Sbjct  340   NLTLKNAKHNYLGGGSLTVPESNEKNITHFL-QSLHSIPTTLQELPIFFFLFCAKLLHMK  398

Query  865   psssilkdkdGSKE-QEERFLD--KIYSNFVGQMNNKRFVASLKYALALGLAVFFGSIYS  1035
               +            + E  L+  + +SN+   + +   + ++K++ ALGL+VF G +YS
Sbjct  399   SLTESPNSPQAQPSIKNENCLEGKRKWSNWATTLRSPNILPAIKFSFALGLSVFMGLLYS  458

Query  1036  KPDGFWAGLTVAISYVSAREATFRIANVKAQGTVLGSIYGVLGCFVFAKYEELRFISLIP  1215
             K  GFW+GL VA+S+VS REATFR ANVKAQGTV+G++YGVLGCFVF +   +RF+SL+P
Sbjct  459   KESGFWSGLPVAVSFVSGREATFRSANVKAQGTVIGTVYGVLGCFVFERLLPIRFLSLLP  518

Query  1216  WFIVCSFLRRSRMYGPAGGISACIGAVLILGREGFGPPREFAMARIMETFIGLACSITVE  1395
             WFI  SFL+RSRMYGPAGGISA IGAVLILGR+  GPP EFA+ RI+ETFIGL+CSI V+
Sbjct  519   WFIFTSFLQRSRMYGPAGGISAVIGAVLILGRKNIGPPSEFAIERIIETFIGLSCSIFVD  578

Query  1396  LLFRPTRASSLAKIQLSKSLQLLNQCIISIDYSSNNQSKLEETQKILKSSVTQLGKFIGE  1575
             LLF P RASS AK +LS+      + I  +        +LEE Q+     V +L KF+ E
Sbjct  579   LLFWPKRASSCAKFELSQCFSTFIESIGPLSLVGKTDLQLEENQRKFNVQVNELKKFVIE  638

Query  1576  AEVEPNFWFLPFHSACYGKLMGSLSKVVEYLHFVAQALRFLEQESALMGRLDSDHLSLF-  1752
             AE EPNFWFLPFHS CY +L+ SL+K+V+ LHF A+AL  L+QE    G   ++ + +  
Sbjct  639   AEAEPNFWFLPFHSGCYNRLLVSLTKLVDILHFGARALISLQQEFQRSGNFVNEEVKMLE  698

Query  1753  ------RDHVGPSIKSFEEIISLVGSVSVLDKEFEKKKSSIDPELGKLPTSNN-ITGLSD  1911
                   ++ +  SIKS EE IS + S   ++K+ EKK  S D ELGK       ++ + +
Sbjct  699   SELIHVKELICSSIKSLEE-ISKMKSFKFVEKDLEKKNISCDIELGKSKECGMWLSDMGE  757

Query  1912  EEIDNKLKSFMEDSRQFVDQKdeddddeVMMNSQVALSLSALAFCMRGIVRETKEIDKAI  2091
             + I   ++SF++ SR F+D    D+ ++  + S+V LSLSA+ FC+   ++ T EI++A+
Sbjct  758   DGIRETIESFLQGSRDFIDNLYSDEGEK-EVKSEVVLSLSAVGFCLNVCMQGTIEIEEAM  816

Query  2092  KELVQWENPSSPV  2130
             +ELVQWENPS  +
Sbjct  817   RELVQWENPSCNI  829



>emb|CDX77206.1| BnaC04g40010D [Brassica napus]
Length=801

 Score =   522 bits (1345),  Expect = 4e-170, Method: Compositional matrix adjust.
 Identities = 352/745 (47%), Positives = 496/745 (67%), Gaps = 35/745 (5%)
 Frame = +1

Query  4     LRGCWYAIYATCLGVCPAILSLWLIGPahlttgtaaaavaitaFIVVLPQ-NTHVVAKRI  180
             LRGCW A+YATC  V PAI++L LIGPA LT GT A A A+ AF+VVLP  +TH+VAKRI
Sbjct  66    LRGCWLALYATCQSVAPAIITLKLIGPARLTAGTTALAAALAAFVVVLPNGSTHLVAKRI  125

Query  181   ALGQTVLVYALA---GPRTQPIMHPlrvaastaiavaacvlalllpypslassKVKHNCH  351
             ALGQ VL+Y +    G  T P+MHPLRVAASTA+ V ACVLALL+P P LA+S+VK +C 
Sbjct  126   ALGQIVLIYVIGYINGAETDPVMHPLRVAASTALGVIACVLALLVPLPRLATSEVKQSCK  185

Query  352   LFAENVSQRLNLLVKAFSAEDNASALSLVSQAKSLNASGAKFLQNIKSKQESMQWERYPI  531
                +NV+ R+ L +KAF AED  +A++ VSQA+ L+   +K  Q IK  Q SM+WER P 
Sbjct  186   GIGQNVTTRVKLYMKAFCAEDAMTAMASVSQARELSRISSKLYQTIKRYQPSMKWERLPF  245

Query  532   KFFR--PYCKNPGERLQEYETPLRGMEMGLVDNNPPQFPVTVLLSSSEVKDSLDSLTGHI  705
             K +R      N GE+LQ  E  LRGM+M L   +P    +   L + EVKD L ++   +
Sbjct  246   KIWRWQNVNDNKGEKLQSMEIALRGMDMVLASKSP----IPARLLAGEVKDDLKNVQERV  301

Query  706   SKQVKGRLFDL---ATVPESNAQNAVKFLHQKLQ--PVTLQdlssffflfslklllikps  870
                +K R+ ++   +  PE++ Q   + L Q LQ  P T QDL  +FFLF L+LL    +
Sbjct  302   ILSIK-RVNNIPQPSVTPETDLQKPDECL-QTLQEVPETPQDLPFYFFLFCLRLLETIST  359

Query  871   ssilkdkdGSKEQEERFLDKIYSNFVGQMNNKRFVASLKYALALGLAVFFGSIYSKPDGF  1050
             +   + K   +E  +  +     ++    ++K+ + + K +L+LGLA+F GS+YSKP+G+
Sbjct  360   AKPEETKVKPEENNKGSVKTKSRSWFSDWDSKKVLPATKLSLSLGLAIFLGSLYSKPNGY  419

Query  1051  WAGLTVAISYVSAREATFRIANVKAQGTVLGSIYGVLGCFVFAKYEELRFISLIPWFIVC  1230
             WAGL VAIS+ +AREATF++ANVKAQGTV+G++YGV+GCFVF ++  +RF+SL+PWFI  
Sbjct  420   WAGLPVAISFAAAREATFKVANVKAQGTVIGTVYGVMGCFVFQRFLTVRFLSLLPWFIFS  479

Query  1231  SFLRRSRMYGPAGGISACIGAVLILGREGFGPPREFAMARIMETFIGLACSITVELLFRP  1410
             SFL +SRMYG AGGISA IGAVLILGR+ FG PR+FA+ RI+ETFIGLACSI VEL+ +P
Sbjct  480   SFLSKSRMYGQAGGISAAIGAVLILGRKNFGQPRDFAIDRIIETFIGLACSIMVELILQP  539

Query  1411  TRASSLAKIQLSKSLQLLNQCIISIDYSSNNQSKLEETQKILKSSVTQLGKFIGEAEVEP  1590
             TRA+++AK++LS+S   L  C  S+  +  ++ ++ E+QK L++ +  L KF  EA+ EP
Sbjct  540   TRAANVAKLELSRSFHALYGC-ASLFGAKASKGEIMESQKKLRNHLNLLKKFTEEAQAEP  598

Query  1591  NFWFLPFHSACYGKLMGSLSKVVEYLHFVAQALRFLEQES--------ALMGRLDSDHLS  1746
             +FWF PF+++CY KL  SLSK+ + L F   A+ FL+++          ++  +D+D  S
Sbjct  599   SFWFTPFNASCYEKLFKSLSKLADLLQFSGYAIGFLDEQGRWKSPQCKEILSDIDNDLKS  658

Query  1747  LFRDHVGPSIKSFEEIISLVGSVSVLDKEFEKK-KSSIDPELGKLPTSNNITGLSDEEID  1923
             L +  +    KSFEE I+L+ S+  L+K   K   +S D ELGK P  N      + E  
Sbjct  659   LTQS-ISLLAKSFEE-ITLLKSLDALEKALTKNGNTSWDIELGKTP--NPSFSCPESEPG  714

Query  1924  NKLKSFMEDSRQFVD---QKdeddddeVMMN-SQVALSLSALAFCMRGIVRETKEIDKAI  2091
               L ++++  R   D   + D+++ +EV ++ S+V LSLSAL FC+  + +ET+EI++ +
Sbjct  715   KILNTYLQHCRGVSDGIFRADDEEGEEVKVDKSEVVLSLSALGFCVEKMGKETREIEEMV  774

Query  2092  KELVQWENPSSPVNLHEISCKIRAL  2166
             KE+VQ ENPSS VNLHEI CKIR+L
Sbjct  775   KEVVQSENPSSHVNLHEIFCKIRSL  799



>ref|XP_006409909.1| hypothetical protein EUTSA_v10016268mg [Eutrema salsugineum]
 gb|ESQ51362.1| hypothetical protein EUTSA_v10016268mg [Eutrema salsugineum]
Length=800

 Score =   516 bits (1328),  Expect = 1e-167, Method: Compositional matrix adjust.
 Identities = 342/745 (46%), Positives = 493/745 (66%), Gaps = 35/745 (5%)
 Frame = +1

Query  4     LRGCWYAIYATCLGVCPAILSLWLIGPahlttgtaaaavaitaFIVVLPQN-THVVAKRI  180
             LRGCW ++YATC  V PAI++L LIGPA LT  T A A  + AF+VVLP   TH+VAKR+
Sbjct  66    LRGCWLSLYATCQSVGPAIITLKLIGPARLTAETTALAAGLAAFVVVLPNGLTHLVAKRV  125

Query  181   ALGQTVLVYALA---GPRTQPIMHPlrvaastaiavaacvlalllpypslassKVKHNCH  351
             ALGQ VL+Y +A   G  T+P+MHPL+VAASTA+ V +CVLALL+P P LA+ +VK +C 
Sbjct  126   ALGQIVLIYVIAYIKGAETEPVMHPLQVAASTALGVISCVLALLVPLPRLATCEVKQSCK  185

Query  352   LFAENVSQRLNLLVKAFSAEDNASALSLVSQAKSLNASGAKFLQNIKSKQESMQWERYPI  531
                +NV+ R+ L +KAF ++D  SA++ VSQA+ L    +K  Q IK  Q SM+WER P 
Sbjct  186   EIGQNVTTRVKLYMKAFCSDDTTSAMASVSQARELARISSKLYQTIKRYQPSMKWERLPF  245

Query  532   KFFR--PYCKNPGERLQEYETPLRGMEMGLVDNNPPQFPVTVLLSSSEVKDSLDSLTGHI  705
             K +R      N GE+LQ  E  LRGMEM L   +P   P ++L  + EVKD L ++   +
Sbjct  246   KVWRWQNVNDNKGEKLQSMEIALRGMEMVLASKSP--IPASLL--AGEVKDGLKNIQERV  301

Query  706   SKQVKGRLFDL---ATVPESNAQNAVKFLHQKLQPVTLQdlssffflfslklllikpsss  876
                VK R+ ++      PE + +   + L Q LQ +        F+ F   L L++  S 
Sbjct  302   ILSVK-RVNNIPQPTVTPEIDLEKPDECL-QTLQEIPETPQDLPFYFFLFCLRLLETISI  359

Query  877   ilkdkdGSKEQEERFLDKIYS-NFVGQMNNKRFVASLKYALALGLAVFFGSIYSKPDGFW  1053
                +++  K +E +   K  S +++   ++K+ + ++K +L+LGLA+F GS+YSKP+G+W
Sbjct  360   AKPEENKVKPEENKGSAKSKSRSWISDWDSKKLMPAVKLSLSLGLAIFLGSLYSKPNGYW  419

Query  1054  AGLTVAISYVSAREATFRIANVKAQGTVLGSIYGVLGCFVFAKYEELRFISLIPWFIVCS  1233
             AGL VAIS+ +AREATF++ANVKAQGTV+G++YGV+GCFVF ++  +RF+SL+PWFI  S
Sbjct  420   AGLPVAISFAAAREATFKVANVKAQGTVIGTVYGVMGCFVFQRFLTVRFLSLLPWFIFSS  479

Query  1234  FLRRSRMYGPAGGISACIGAVLILGREGFGPPREFAMARIMETFIGLACSITVELLFRPT  1413
             FL +S+MYG AGGISA IGAVLILGR+ FG P +FA+ RI+ETFIGL+CSI VEL+F+PT
Sbjct  480   FLNKSQMYGQAGGISAAIGAVLILGRKNFGQPSDFAIDRIIETFIGLSCSIMVELIFQPT  539

Query  1414  RASSLAKIQLSKSLQLLNQCIISIDYSSNNQSKLEETQKILKSSVTQLGKFIGEAEVEPN  1593
             RA+++AK++LS+S   L +C  S+  +  +++ + E+QK L+S +  L KF  EA+ EPN
Sbjct  540   RAANVAKLELSRSFHALYEC-ASLFGAKASKADIMESQKKLRSHLNMLKKFTEEAQAEPN  598

Query  1594  FWFLPFHSACYGKLMGSLSKVVEYLHFVAQALRFLEQESA--------LMGRLDSDHLSL  1749
             FWF PF+++CY KL  SLSK+ + L F   A+ FL ++          ++  +D D  SL
Sbjct  599   FWFSPFNASCYEKLFKSLSKMADLLQFSGHAIGFLGKQGKAKSPQCKEILSAVDKDLKSL  658

Query  1750  FRDHVGPSIKSFEEIISLVGSVSVLDKEFEKK-KSSIDPELGKLPTSNNITGLSDEEIDN  1926
               + +G   KSFEE I+L+ S+  L+K   K   SS D ELGK P   + +G + E  + 
Sbjct  659   -TESIGLLAKSFEE-ITLLKSLDALEKALTKNGNSSWDIELGKTPNP-SFSGPATEP-EK  714

Query  1927  KLKSFMEDSRQFVD-----QKdeddddeVMMNSQVALSLSALAFCMRGIVRETKEIDKAI  2091
              L+++++  R   D     +++ D ++  +  S+V LSLSAL FC+  + +ET+E+++ +
Sbjct  715   ILETYLQHCRGVADGMFLVEEEGDQEEVKVDKSEVVLSLSALGFCVEKMGKETREVEEMV  774

Query  2092  KELVQWENPSSPVNLHEISCKIRAL  2166
             KE+VQ ENPSS VNLHEISCKIR+L
Sbjct  775   KEVVQSENPSSHVNLHEISCKIRSL  799



>ref|XP_009103713.1| PREDICTED: uncharacterized protein LOC103829768 [Brassica rapa]
Length=801

 Score =   515 bits (1326),  Expect = 2e-167, Method: Compositional matrix adjust.
 Identities = 348/745 (47%), Positives = 497/745 (67%), Gaps = 35/745 (5%)
 Frame = +1

Query  4     LRGCWYAIYATCLGVCPAILSLWLIGPahlttgtaaaavaitaFIVVLPQN-THVVAKRI  180
             LRGCW A+YATC  V PAI++L LIGPA LT GT A A A+ AF+VVLP N TH+VAKRI
Sbjct  66    LRGCWLALYATCQSVAPAIITLRLIGPARLTAGTTALAAALAAFVVVLPNNLTHLVAKRI  125

Query  181   ALGQTVLVYALA---GPRTQPIMHPlrvaastaiavaacvlalllpypslassKVKHNCH  351
             ALGQ VL+Y +    G  T+P+MHPLRVAASTA+ V ACVLALL+P+P LA+ +VK +  
Sbjct  126   ALGQIVLIYVIGYINGAETEPVMHPLRVAASTALGVIACVLALLVPFPRLATCEVKQSFK  185

Query  352   LFAENVSQRLNLLVKAFSAEDNASALSLVSQAKSLNASGAKFLQNIKSKQESMQWERYPI  531
                +NV+ R+ L +KAF AED  SA++ VSQA+ L+   +K  Q IK  Q SM+WER P 
Sbjct  186   EIGQNVTTRVKLYMKAFCAEDATSAMASVSQARELSRMSSKLYQTIKRYQPSMRWERLPF  245

Query  532   KFFR--PYCKNPGERLQEYETPLRGMEMGLVDNNPPQFPVTVLLSSSEVKDSLDSLTGHI  705
             K +R      N GE+LQ  E  LRGMEM L    P   P ++L  + EVKD + ++   +
Sbjct  246   KIWRWQNVNDNKGEKLQSMEIALRGMEMVLASKTP--IPSSLL--AGEVKDGIKNMQERV  301

Query  706   SKQVKGRLFDL---ATVPESNAQNAVKFLHQKLQ--PVTLQdlssffflfslklllikps  870
                +K R+ ++   +  PE++ +   + L QKLQ  P T QDL  +FFLF L+LL    +
Sbjct  302   ILAIK-RVNNIPQPSVTPETDLEKPNECL-QKLQEIPETSQDLPFYFFLFCLRLLETIST  359

Query  871   ssilkdkdGSKEQEERFLDKIYSNFVGQMNNKRFVASLKYALALGLAVFFGSIYSKPDGF  1050
             +   ++K   +E+ +  +     +++   ++K+ + ++K +L+LGLA+F GS+YSKP+G+
Sbjct  360   AKPEENKAKPEEKNKGSVKSKSRSWISDWDSKKVMPAIKLSLSLGLAIFLGSLYSKPNGY  419

Query  1051  WAGLTVAISYVSAREATFRIANVKAQGTVLGSIYGVLGCFVFAKYEELRFISLIPWFIVC  1230
             WAGL VAIS+ +AREATF++ANVKAQGTV+G++YGV+GCFVF ++  +RF+SL+PWFI  
Sbjct  420   WAGLPVAISFAAAREATFKVANVKAQGTVIGTVYGVMGCFVFQRFLTVRFLSLLPWFIFS  479

Query  1231  SFLRRSRMYGPAGGISACIGAVLILGREGFGPPREFAMARIMETFIGLACSITVELLFRP  1410
             +FL +SRMYG AGGISA IGAVLILGR+ FG P +FA+ RI+ETFIGL+CSI VEL+ +P
Sbjct  480   AFLSKSRMYGQAGGISAAIGAVLILGRKNFGEPSDFAIDRIIETFIGLSCSIMVELVLQP  539

Query  1411  TRASSLAKIQLSKSLQLLNQCIISIDYSSNNQSKLEETQKILKSSVTQLGKFIGEAEVEP  1590
             TRA+++AK++LS+S   L +C  S+  +  +++++ E+QK L+S +  L K   EA+ EP
Sbjct  540   TRAANVAKLELSRSFHALYEC-ASLFGAKPSKAEIVESQKKLRSHLNSLKKSTEEAQAEP  598

Query  1591  NFWFLPFHSACYGKLMGSLSKVVEYLHFVAQALRFLEQESA---------LMGRLDSDHL  1743
             +FWF PF+++ Y KL  SL ++ + L F + A+ FL ++           L+  +D D  
Sbjct  599   SFWFSPFNASQYEKLFKSLCRMADLLQFSSHAIGFLGEQGKGKSPQCKEILIRDVDKDLK  658

Query  1744  SLFRDHVGPSIKSFEEIISLVGSVSVLDKEFEKK-KSSIDPELGKLPTSNNITGLSDEEI  1920
             SL +  +G   KSFEE I+L+ S+  L+K   K   SS D ELGK P  N      + E 
Sbjct  659   SLTQS-IGLLAKSFEE-ITLLKSLDALEKALVKNDNSSWDIELGKTP--NPSFSSPESEP  714

Query  1921  DNKLKSFMEDSRQFVD---QKdeddddeVMMNSQVALSLSALAFCMRGIVRETKEIDKAI  2091
             +  L ++++  R   D   + +E+ ++  +  S+V LSLSAL FC+  + +E  EI++ +
Sbjct  715   EKILNTYLQHCRGVADGMFRAEEEREEVEVDKSEVVLSLSALGFCVEKMGQEAIEIEEMV  774

Query  2092  KELVQWENPSSPVNLHEISCKIRAL  2166
             KE+VQ ENPSS VNLHEISCKIR+L
Sbjct  775   KEVVQSENPSSHVNLHEISCKIRSL  799



>gb|KFK32261.1| hypothetical protein AALP_AA6G219200 [Arabis alpina]
Length=785

 Score =   513 bits (1321),  Expect = 9e-167, Method: Compositional matrix adjust.
 Identities = 349/747 (47%), Positives = 488/747 (65%), Gaps = 46/747 (6%)
 Frame = +1

Query  4     LRGCWYAIYATCLGVCPAILSLWLIGPahlttgtaaaavaitaFIVVLPQN-THVVAKRI  180
             LR CW A+YATC  V PAIL+L LIGPA L+  T A A  + AF+VVLP + TH+VAKRI
Sbjct  57    LRACWLALYATCQSVGPAILTLRLIGPARLSAATTALAATLAAFVVVLPNSSTHLVAKRI  116

Query  181   ALGQTVLVYALA---GPRTQPIMHPlrvaastaiavaacvlalllpypslassKVKHNCH  351
             ALGQ VL+Y +A   G  T+P+MHPL+VAASTA+ V ACVLAL++P P LA+ +VK +  
Sbjct  117   ALGQIVLIYVIAYIKGAETEPLMHPLQVAASTALGVIACVLALVVPLPRLATCEVKQSSK  176

Query  352   LFAENVSQRLNLLVKAFSAEDNASALSLVSQAKSLNASGAKFLQNIKSKQESMQWERYPI  531
                +NV+ R+ L +KAF AED  SA++ VSQA+ L  S +K  Q IK  Q SM+WER P 
Sbjct  177   EIGQNVTTRVKLYMKAFCAEDATSAMASVSQARELARSSSKLYQTIKRYQPSMKWERLPF  236

Query  532   KFFRPYCKN---PGERLQEYETPLRGMEMGLVDNNPPQFPVTVLLSSSEVKDSLDSLTGH  702
             K +R    N    G++LQ  E  LRGMEM L      ++ +   L   EVKD L ++   
Sbjct  237   KLWRWQNVNDNKKGDKLQSMEIALRGMEMVLAS----KYLIPASLLPGEVKDGLKNIQER  292

Query  703   ISKQVKGRLFDL---ATVPESNAQNAVKFLHQKLQ--PVTLQdlssffflfslklllikp  867
             +   ++ R+ +    +  PE++ +   + L Q LQ  P T QDL  +FFLF L+LL    
Sbjct  293   VILSIR-RVNNSPQPSVTPETDPEQPDECL-QTLQEIPGTPQDLPFYFFLFCLRLLETIS  350

Query  868   sssilkdkdGSKEQEERFLDKIYS---NFVGQMNNKRFVASLKYALALGLAVFFGSIYSK  1038
                       +K +E +      S   +++   + KR + +LK +L+LGLA+  GS+YSK
Sbjct  351   M---------AKPEENKVKGPANSKSRSWISDWDRKRVMPALKLSLSLGLAILLGSVYSK  401

Query  1039  PDGFWAGLTVAISYVSAREATFRIANVKAQGTVLGSIYGVLGCFVFAKYEELRFISLIPW  1218
             P+G+WAGL VAIS+ +AREATF++ NVKAQGTV+G++YGV+GCFVF ++  +RF+SL+PW
Sbjct  402   PNGYWAGLPVAISFAAAREATFKVGNVKAQGTVIGTVYGVMGCFVFQRFLPVRFLSLLPW  461

Query  1219  FIVCSFLRRSRMYGPAGGISACIGAVLILGREGFGPPREFAMARIMETFIGLACSITVEL  1398
             FI  S L +SRMYG AGGISA IGAVLILGR+ FG P EFA+ RI+ETFIGL+CSI VEL
Sbjct  462   FIFSSLLSKSRMYGQAGGISAAIGAVLILGRKNFGQPSEFAIDRIIETFIGLSCSIMVEL  521

Query  1399  LFRPTRASSLAKIQLSKSLQLLNQCIISIDYSSNNQSKLEETQKILKSSVTQLGKFIGEA  1578
             +F+PTRA+++AK++LS+S   L +C  S+  +  +++++ E+QK LKS + +L KF  EA
Sbjct  522   IFQPTRAANVAKLELSRSFHALYEC-ASLFGAKASKAEIMESQKKLKSHLNKLKKFTEEA  580

Query  1579  EVEPNFWFLPFHSACYGKLMGSLSKVVEYLHFVAQALRFL-EQESA-------LMGRLDS  1734
             + EP+FWF PF+  CY KL  SLSK+ + L F   A+ FL EQ  A       ++  +D 
Sbjct  581   QAEPSFWFSPFNVTCYEKLFKSLSKMADLLQFSGHAIGFLGEQGKAKSSQCKEILSDVDK  640

Query  1735  DHLSLFRDHVGPSIKSFEEIISLVGSVSVLDKEFEKKKSSIDPELGKLPTSNNITGLSDE  1914
             D  SL  + +G   KSFEE I+L+ S+  L+K   K   S D ELGK P   + +G + E
Sbjct  641   DLKSL-TESIGLLAKSFEE-ITLLKSLDALEKALIKNDISWDIELGKTPNP-SFSGPATE  697

Query  1915  EIDNKLKSFMEDSRQFVD---QKdeddddeVMMNSQVALSLSALAFCMRGIVRETKEIDK  2085
               +  L+++++  R  +D   + +E+ ++  +  S+V LSLSAL FC+  + +E  EI++
Sbjct  698   P-EKILETYLQHCRGVMDGIFRVEEEGEEHKVDKSEVVLSLSALGFCVERMGKEAIEIEE  756

Query  2086  AIKELVQWENPSSPVNLHEISCKIRAL  2166
              +KE+VQ ENPSS VNLHEISCKIR+L
Sbjct  757   IVKEVVQSENPSSHVNLHEISCKIRSL  783



>emb|CDY04585.1| BnaA07g14110D [Brassica napus]
Length=800

 Score =   510 bits (1314),  Expect = 1e-165, Method: Compositional matrix adjust.
 Identities = 347/744 (47%), Positives = 495/744 (67%), Gaps = 34/744 (5%)
 Frame = +1

Query  4     LRGCWYAIYATCLGVCPAILSLWLIGPahlttgtaaaavaitaFIVVLPQN-THVVAKRI  180
             LRGCW A+YATC  V PAI++L LIGPA LT GT A A A+ AF+VVLP N TH+VAKRI
Sbjct  66    LRGCWLALYATCQSVAPAIITLRLIGPARLTAGTTALAAALAAFVVVLPNNLTHLVAKRI  125

Query  181   ALGQTVLVYALA---GPRTQPIMHPlrvaastaiavaacvlalllpypslassKVKHNCH  351
             ALGQ VL+Y +    G  T+P+MHPLRVAASTA+ V ACVLALL+P+P LA+ +VK +  
Sbjct  126   ALGQIVLIYVIGYINGAETEPVMHPLRVAASTALGVIACVLALLVPFPRLATCEVKQSFK  185

Query  352   LFAENVSQRLNLLVKAFSAEDNASALSLVSQAKSLNASGAKFLQNIKSKQESMQWERYPI  531
                +NV+ R+ L +KAF AED  SA++ VSQA+ L+   +K  Q IK  Q SM+WER P 
Sbjct  186   EIGQNVTTRVKLYMKAFCAEDATSAMASVSQARELSRMSSKLYQTIKRYQPSMRWERLPF  245

Query  532   KFFR--PYCKNPGERLQEYETPLRGMEMGLVDNNPPQFPVTVLLSSSEVKDSLDSLTGHI  705
             K +R      N GE+LQ  E  LRGMEM L    P   P ++L  + EVKD + ++   +
Sbjct  246   KIWRWQNVNDNKGEKLQSMEIALRGMEMVLASKTP--IPSSLL--AGEVKDGIKNMQERV  301

Query  706   SKQVKGRLFDL---ATVPESNAQNAVKFLHQKLQ--PVTLQdlssffflfslklllikps  870
                +K R+ ++   +  PE++ +   + L QKLQ  P T QDL  +FFLF L+LL    +
Sbjct  302   ILAIK-RVNNIPQPSVTPETDLEKPNECL-QKLQEIPETSQDLPFYFFLFCLRLLETIST  359

Query  871   ssilkdkdGSKEQEERFLDKIYSNFVGQMNNKRFVASLKYALALGLAVFFGSIYSKPDGF  1050
             +   ++K   +E+ +  +     +++   ++K  + ++K +L+LGLA+F GS+YSKP+G+
Sbjct  360   AKPEENKAKPEEKNKGSVKSKSRSWISCRDSKNVMPAIKLSLSLGLAIFLGSLYSKPNGY  419

Query  1051  WAGLTVAISYVSAREATFRIANVKAQGTVLGSIYGVLGCFVFAKYEELRFISLIPWFIVC  1230
             WAGL VAIS+ +AREATF++ANVKAQGTV+G++YGV+GCFVF ++  +RF+SL+PWFI  
Sbjct  420   WAGLPVAISFAAAREATFKVANVKAQGTVIGTVYGVMGCFVFQRFLTVRFLSLLPWFIFS  479

Query  1231  SFLRRSRMYGPAGGISACIGAVLILGREGFGPPREFAMARIMETFIGLACSITVELLFRP  1410
             +FL +SRMYG AGGISA IGAVLILGR+ FG P +FA+ RI+ETFIGL+CSI VEL+ +P
Sbjct  480   AFLSKSRMYGQAGGISAAIGAVLILGRKNFGGPSDFAIDRIIETFIGLSCSIMVELVLQP  539

Query  1411  TRASSLAKIQLSKSLQLLNQCIISIDYSSNNQSKLEETQKILKSSVTQLGKFIGEAEVEP  1590
             TRA+++AK++LS+S   L +C  S+  +  +++++ E+QK L+S +  L K   EA+ EP
Sbjct  540   TRAANVAKLELSRSFHALYEC-ASLFGAKPSKAEIVESQKKLRSHLNALKKSTEEAQAEP  598

Query  1591  NFWFLPFHSACYGKLMGSLSKVVEYLHFVAQALRFLEQESA--------LMGRLDSDHLS  1746
             +FWF PF+++ Y KL  SL ++ + L F + A+ FL ++           +  +D D  S
Sbjct  599   SFWFSPFNASRYEKLFKSLCRMADLLEFSSHAIGFLGEQGKGKSPQCKENLRDVDKDLKS  658

Query  1747  LFRDHVGPSIKSFEEIISLVGSVSVLDKEFEKK-KSSIDPELGKLPTSNNITGLSDEEID  1923
             L +  +G   KSFEE I+L+ S+  L+K   K   SS D ELGK P  N      + E +
Sbjct  659   LTQS-IGILAKSFEE-ITLLKSLDALEKALVKNDNSSWDIELGKTP--NPSFSSPESEPE  714

Query  1924  NKLKSFMEDSRQFVD---QKdeddddeVMMNSQVALSLSALAFCMRGIVRETKEIDKAIK  2094
               L ++++  R   D   + +E+ ++  +  S+V LSLSAL FC+  + +E  EI++ +K
Sbjct  715   KILNTYLQHCRGVADGMFRAEEEREEVEVDKSEVVLSLSALGFCVEKMGQEAIEIEEMVK  774

Query  2095  ELVQWENPSSPVNLHEISCKIRAL  2166
             E+VQ ENPSS VNLHEISCKIR+L
Sbjct  775   EVVQSENPSSHVNLHEISCKIRSL  798



>emb|CDY15786.1| BnaC04g15380D [Brassica napus]
Length=792

 Score =   509 bits (1310),  Expect = 6e-165, Method: Compositional matrix adjust.
 Identities = 338/742 (46%), Positives = 479/742 (65%), Gaps = 38/742 (5%)
 Frame = +1

Query  4     LRGCWYAIYATCLGVCPAILSLWLIGPahlttgtaaaavaitaFIVVLPQN-THVVAKRI  180
             LRGCW A+YATC  V PAI++L LIGPA LT GT A A A+ AF+VVLP N TH+VAKRI
Sbjct  66    LRGCWLALYATCQSVAPAIITLRLIGPARLTAGTTALAAALAAFLVVLPNNLTHLVAKRI  125

Query  181   ALGQTVLVYALA---GPRTQPIMHPlrvaastaiavaacvlalllpypslassKVKHNCH  351
             ALGQ VL+Y +    G  T+P+MHPLRVAASTA+ V ACVLALL+P+P LA+ +VK +  
Sbjct  126   ALGQIVLIYVIGYINGAETEPVMHPLRVAASTALGVIACVLALLVPFPRLATCEVKQSSK  185

Query  352   LFAENVSQRLNLLVKAFSAEDNASALSLVSQAKSLNASGAKFLQNIKSKQESMQWERYPI  531
                +NV+ R+ L +KAF AED  SA++ VSQA+ L+   +K  Q IK  Q SM+WER P 
Sbjct  186   EIGQNVTTRVKLYMKAFCAEDATSAMASVSQARELSRMSSKLYQTIKRYQPSMRWERLPF  245

Query  532   KFFR--PYCKNPGERLQEYETPLRGMEMGLVDNNPPQFPVTVLLSSSEVKDSLDSLTGHI  705
             K +R      N GE+LQ  E  LRGMEM L   +P   P ++L  + EVKD + ++   +
Sbjct  246   KIWRWQNVNDNKGEKLQSMEIALRGMEMVLASKSP--IPSSLL--AGEVKDGIKNMQERV  301

Query  706   SKQVKGRLFDL---ATVPESNAQNAVKFLHQKLQPVTLQdlssffflfslklllikpsss  876
                +K R+ ++   +  PE++ +   + L       TLQ++            L      
Sbjct  302   ILSIK-RVNNIPQPSVTPETDLEKPDECLQ------TLQEIPETSQELPFYFFLFCLRLL  354

Query  877   ilkdkdGSKEQEERFLDKIYSNFVGQMNNKRFVASLKYALALGLAVFFGSIYSKPDGFWA  1056
                     +E +     K  S +V   ++K+ + ++K +L+LGLA+F GS+YSKP+G+WA
Sbjct  355   ETISTAKPEENKGSVKSKSRS-WVSDWDSKKVMPAIKLSLSLGLAIFLGSLYSKPNGYWA  413

Query  1057  GLTVAISYVSAREATFRIANVKAQGTVLGSIYGVLGCFVFAKYEELRFISLIPWFIVCSF  1236
             GL VAIS+ +AREATF++ANVKAQGTV+G++YGV+GCFVF ++  +RF+SL+PWFI  +F
Sbjct  414   GLPVAISFAAAREATFKVANVKAQGTVIGTVYGVMGCFVFQRFLTVRFLSLLPWFIFSTF  473

Query  1237  LRRSRMYGPAGGISACIGAVLILGREGFGPPREFAMARIMETFIGLACSITVELLFRPTR  1416
             L +SRMYG AGGISA IGAVLILGR+ FG P +FA+ RI+ETFIGL+CSI VEL+ +PTR
Sbjct  474   LSKSRMYGQAGGISAAIGAVLILGRKNFGEPSDFAIDRIVETFIGLSCSIMVELVLQPTR  533

Query  1417  ASSLAKIQLSKSLQLLNQCIISIDYSSNNQSKLEETQKILKSSVTQLGKFIGEAEVEPNF  1596
             A+++AK++LS+S   L +   S+  +  +++++ E+QK L+S +T L K   EA+ EP+F
Sbjct  534   AANVAKLELSRSFHALYEW-ASLFGAKPSKAEIVESQKKLRSHLTALKKCTEEAQAEPSF  592

Query  1597  WFLPFHSACYGKLMGSLSKVVEYLHFVAQALRFLEQESA--------LMGRLDSDHLSLF  1752
             WF PF+++ Y KL  SL  + + L F + A+ FLE++          ++  +D D  SL 
Sbjct  593   WFSPFNASRYEKLFKSLCIMADLLQFSSHAIGFLEEQGKGNSPQCKEILRDVDQDLKSLT  652

Query  1753  RDHVGPSIKSFEEIISLVGSVSVLDKEFEKK-KSSIDPELGKLPTSNNITGLSDEEIDNK  1929
             +  +G   KSFEE I+L+ S+   +K   K   SS D ELGK P  N      + E +  
Sbjct  653   QS-IGLLAKSFEE-ITLLKSLDAFEKALVKNDNSSWDIELGKTP--NPSFSSPESEPEKI  708

Query  1930  LKSFMEDSRQFVD---QKdeddddeVMMNSQVALSLSALAFCMRGIVRETKEIDKAIKEL  2100
             L ++++  R   D   + +E+ ++  +  SQV LSLSAL FC+  + +E  EI++ +KE+
Sbjct  709   LNTYLQHCRGVADGMFRAEEEREEVKVDKSQVVLSLSALGFCVEKMGQEAIEIEEMVKEV  768

Query  2101  VQWENPSSPVNLHEISCKIRAL  2166
             VQ ENPSS VNLHEISCKIR+L
Sbjct  769   VQSENPSSHVNLHEISCKIRSL  790



>ref|XP_002269811.1| PREDICTED: uncharacterized protein LOC100266589 [Vitis vinifera]
Length=823

 Score =   509 bits (1311),  Expect = 8e-165, Method: Compositional matrix adjust.
 Identities = 337/762 (44%), Positives = 467/762 (61%), Gaps = 52/762 (7%)
 Frame = +1

Query  4     LRGCWYAIYATCLGVCPAILSLWLIGPahlttgtaaaavaitaFIVVLPQNTHVVAKRIA  183
             LRGCW+ + AT   V PA+LSLWLIG   L+TG AAA VA++ F+V LP+ TH++AKRIA
Sbjct  71    LRGCWHVLCATVQVVVPAMLSLWLIGAGQLSTGLAAAVVALSVFVVGLPEWTHLMAKRIA  130

Query  184   LGQTVLVYALAG----PRTQPIMHPlrvaastaiavaacvlalllpypslassKVKHNCH  351
              GQ V+VY  A           MH L VA+STA+   A VLALLLPYP LASS+V     
Sbjct  131   FGQIVIVYVGASIIHEEGAGAFMHLLHVASSTALGALASVLALLLPYPRLASSEVNEIWK  190

Query  352   LFAENVSQRLNLLVKAFSAEDNASALSLVSQAKSLNASGAKFLQNIKSKQESMQWERYPI  531
              +AEN S+RLNL ++AFSA DN++AL  +SQAK  +  G K LQ I+  ++ + WER   
Sbjct  191   SYAENASERLNLFLEAFSAPDNSAALDSISQAKFFSERGDKLLQTIRLVEDGILWERPWT  250

Query  532   KFFRPYCKNPGERLQEYETPLRGMEMGLVDNNPPQFPVTVLLSSSEVKDSLDSLTGHISK  711
             +FF+P+C +PG+RLQ  E PLRGME+ L  ++    P  +  +  E+ D+L  +T + S 
Sbjct  251   RFFKPHCFDPGDRLQAIEIPLRGMEIAL--SSFTSLPTAI--ADDELGDALQRVTLNTSL  306

Query  712   QVK----GRLFDLATVPESNAQNAVKFLHQKLQPVTLQdlssffflfslklllikpsssi  879
             +++     +     TVP S      KFL + LQ +     +         L  ++     
Sbjct  307   RLEQAKCSQPLASTTVPNSTG----KFLDKPLQALKTISPAHAAPSAFFFLSCMQLLQDG  362

Query  880   lkdkdG----------SKEQEERFLDK--------IYSNFVGQMNNKRFVASLKYALALG  1005
             L               S  +E R   K        ++S++   + + R V + K +L+LG
Sbjct  363   LPSPQNPEPISNIGHKSNTEESRNSKKPVTYSFKMMWSSWNMSLASGRLVFAFKCSLSLG  422

Query  1006  LAVFFGSIYSKPDGFWAGLTVAISYVSAREATFRIANVKAQGTVLGSIYGVLGCFVFAKY  1185
             LAV FG +Y+K + +W+GLT+AIS+ + R+A F +AN +AQGT +GS++G+LGCFVF   
Sbjct  423   LAVLFGLMYNKENAYWSGLTIAISFATGRQAMFTVANARAQGTAMGSVFGILGCFVFQSS  482

Query  1186  EELRFISLIPWFIVCSFLRRSRMYGPAGGISACIGAVLILGREGFGPPREFAMARIMETF  1365
               +RF+ L+PW I  SFL  SRMYG AGGISA IGA+LILGR+ +G P EFA+ARI E F
Sbjct  483   MVIRFLLLLPWIIFASFLMHSRMYGQAGGISAVIGALLILGRKNYGSPSEFAIARITEAF  542

Query  1366  IGLACSITVELLFRPTRASSLAKIQLSKSLQLLNQCIISI-------DYSSNNQSKLEET  1524
             IGL+C I VE+L RP RA++LAKIQLS+SL  L +CI  +       D        + E 
Sbjct  543   IGLSCFIMVEILLRPRRAATLAKIQLSQSLATLQECIKEMVVCVGQTDSPHFVLPAMREK  602

Query  1525  QKILKSSVTQLGKFIGEAEVEPNFWFLPFHSACYGKLMGSLSKVVEYLHFVAQALRFLEQ  1704
             Q  LK +V +L KFIGEA++EPNFWFLPF  ACY KL  SLSKV + L FVA  + FL Q
Sbjct  603   QNKLKMNVNELNKFIGEAKLEPNFWFLPFQGACYSKLWESLSKVEDLLLFVAHNIDFLLQ  662

Query  1705  ES--------ALMGRLDSDHLSLFRDHVGPSIKSFEEIISLVGSVSVLDKEFEKKKSSID  1860
              S         +   + SD L LF++ V  S+K   +I S + S+++L+KE +KK  + D
Sbjct  663   ASQKFEVSWKEIQKNIHSD-LELFKETVASSLKYLVKITS-IESLTLLEKELQKKIIAHD  720

Query  1861  PELGKLPTSNNITGLSDEEIDNKLKSFMEDSRQFVDQKdeddddeVMMNSQVALSLSALA  2040
              ELG+ P ++ +    DEEI+  L SF++ S + +++   + D E  + SQ+ LSL AL 
Sbjct  721   LELGRPPNAHWVWSTDDEEIEKILASFLQHSEEIINEIHTNKDKE-ELKSQMVLSLGALG  779

Query  2041  FCMRGIVRETKEIDKAIKELVQWENPSSPVNLHEISCKIRAL  2166
             FCM  ++RET++I+K I+ELVQWENPSS ++  EISCKI AL
Sbjct  780   FCMGSLMRETRKIEKGIQELVQWENPSSYIDFSEISCKINAL  821



>emb|CDP18496.1| unnamed protein product [Coffea canephora]
Length=558

 Score =   471 bits (1212),  Expect = 2e-153, Method: Compositional matrix adjust.
 Identities = 270/549 (49%), Positives = 364/549 (66%), Gaps = 43/549 (8%)
 Frame = +1

Query  601   MEMGLVDNNPPQFPVTVLLSSSEVKDSLDSLTGHISKQVKGRLFDLATVPESNAQNAVKF  780
             ME+ L +   P FP        E KD L  + G IS+ +K       TVPE+NA+N  + 
Sbjct  1     MEIALSNGTVP-FP--------ERKDDLAGIEGLISRHIKSMPL---TVPEANAENVAES  48

Query  781   LHQKLQPVTLQdlssffflfslklllikpsssilkdkdGSKE-------QEERFLDKIYS  939
             L Q L+ V           F   L L++   +        KE       QE+ F  +I+ 
Sbjct  49    L-QTLRTVPTDHRQLPSIFFLFCLKLLQAKLATTSAISSIKEGSTDPGKQEKWFFIRIWR  107

Query  940   NFVGQMNNKRFVASLKYALALGLAVFFGSIYSKPDGFWAGLTVAISYVSAREATFRIANV  1119
             +    +N  R + + K +L+LGLAVFFGS+YSK +GFWAGL VAIS  SARE  F++ANV
Sbjct  108   SLSTNINKSRLMPAFKCSLSLGLAVFFGSLYSKENGFWAGLPVAISLASAREPAFKVANV  167

Query  1120  KAQGTVLGSIYGVLGCFVFAKYEELRFISLIPWFIVCSFLRRSRMYGPAGGISACIGAVL  1299
             KAQGTVLG +YGV GCF+F KY  ++ +SL+PWFI CSFLRRS MYG AGGISA IGAVL
Sbjct  168   KAQGTVLGMVYGVFGCFIFGKYVPIQLLSLLPWFIFCSFLRRSHMYGQAGGISAVIGAVL  227

Query  1300  ILGREGFGPPREFAMARIMETFIGLACSITVELLFRPTRASSLAKIQLSKSLQLLNQCII  1479
             +LGR+ FGPP EFA+ARI ETFIG++CSI VEL+ +PTRA +LAK+QLSK+ +++   I 
Sbjct  228   LLGRKDFGPPSEFAIARITETFIGISCSIVVELVLQPTRAFALAKVQLSKNFKVMRNSIG  287

Query  1480  SIDYSSNNQSKLEETQKILKSSVTQLGKFIGEAEVEPNFWFLPFHSACYGKLMGSLSKVV  1659
             +I  ++ +++ L+E+ K +K  V +LGKFIGEAEVEPNFWFLPF+SACY KL  SLS++V
Sbjct  288   AISLTA-SEANLQESLKKVKLQVNELGKFIGEAEVEPNFWFLPFYSACYSKLSVSLSEMV  346

Query  1660  EYLHFVAQALRFLEQESALMGRLDSD-----------HLSLFRDHVGPSIKSFEEIISLV  1806
             E+LHF+  A++FL QES   GR+D++            L +F++ V  SIK FEE +SLV
Sbjct  347   EFLHFITHAIQFLHQES---GRMDTNLWKESMSKINADLKIFKEIVDSSIKCFEE-VSLV  402

Query  1807  GSVSVLDKEFEKKKSSIDPELG---KLPTSNNITGLSDEE--IDNKLKSFMEDSRQFVDQ  1971
              S+ +LDKE E+K  S+D E G   K+P++  + G S+EE  I+  L  +++   +F++ 
Sbjct  403   KSLVLLDKEMERKNISLDLESGKSPKIPSTMKLPG-SEEEVTIEKTLSYYLQHCNEFLEA  461

Query  1972  KdeddddeVMMNSQVALSLSALAFCMRGIVRETKEIDKAIKELVQWENPSSPVNLHEISC  2151
                D  ++  + S++AL LS + FCM G+VRET+EI+KAIKELVQWENPSS VNLH+IS 
Sbjct  462   IHADKGEK-ELKSRIALILSCIGFCMSGLVRETREIEKAIKELVQWENPSSLVNLHDISS  520

Query  2152  KIRALAHTV  2178
             KI ALA  V
Sbjct  521   KIHALAAAV  529



>ref|XP_010922978.1| PREDICTED: uncharacterized protein LOC105046152 [Elaeis guineensis]
Length=833

 Score =   471 bits (1212),  Expect = 6e-150, Method: Compositional matrix adjust.
 Identities = 321/756 (42%), Positives = 449/756 (59%), Gaps = 50/756 (7%)
 Frame = +1

Query  1     ALRGCWYAIYATCLGVCPAILSL-WLIGPahlttgtaaaavaitaFIVVLPQNTHVVAKR  177
             +L G   A+Y T LGV PA+L+L +L+ P   +  T   AV +++F V L  +T ++AKR
Sbjct  90    SLHGAASALYGTLLGVLPAMLTLLFLLRPDGFSITTTTLAVVLSSFAVALLGSTDLIAKR  149

Query  178   IALGQTVLVYAL----AGPR-TQPIMHPlrvaastaiavaacvlalllpypslassKVKH  342
             IALGQ V++YA      GP   + + HP+ VAASTA+ V A VLALL PYP LA  +V+ 
Sbjct  150   IALGQIVIIYAAPFEQVGPHDVKAVWHPIHVAASTAVGVVASVLALLFPYPRLACYEVRE  209

Query  343   NCHLFAENVSQRLNLLVKAFSAEDNASALSLVSQAKSLNASGAKFLQNIKSKQESMQWER  522
                L+ E   +RL LLV AF A+++A   +L+SQA+ L A   K L NIK KQ S QWER
Sbjct  210   KSKLYMEMAMERLRLLVNAFYADNSACMAALISQARCLTAESTKLLHNIKLKQASSQWER  269

Query  523   YPIKFFRPYCKNPGERLQEYETPLRGMEMGLVDNNPPQFPVTVLLSSSEVKDSLDSLTGH  702
              P +F   + K P +RLQ  ETPL+GME+ L       FPV    S  ++K +L SL  H
Sbjct  270   PPFRFIPLHPKEPSDRLQNIETPLKGMEIALSSTK--SFPVK--FSDQQLKGNLLSLRDH  325

Query  703   ISKQVKGRLFDLATVPESNAQNAVKFLHQK--LQPVTLQdlssffflfslklllikpsss  876
             I  +++     +A   + N     + L Q     PV  Q+L  F  L      +    + 
Sbjct  326   IILRLRQENI-MANTKQENFVARREPLDQPHLALPVIPQNLKDFSPLLFFLFCIDLLYNG  384

Query  877   ilkdkdGSKEQEERFLDKIYSNFVGQMNN------------------KRFVASLKYALAL  1002
              L +      QE R +       V   ++                  +R V +LK +L+L
Sbjct  385   TLTNPSADGAQENRVMPTTEQATVASKDDPSTKRRNSKNPCCVNGNSERLVVALKCSLSL  444

Query  1003  GLAVFFGSIYSKPDGFWAGLTVAISYVSAREATFRIANVKAQGTVLGSIYGVLGCFVFAK  1182
             GLAV FG ++SK +G+W+GLTVAI+    R+ATF++AN +AQGT +GS+YGVLG  +   
Sbjct  445   GLAVLFGVLFSKSNGYWSGLTVAITITPWRQATFKLANDRAQGTAIGSVYGVLGSVISQN  504

Query  1183  YEELRFISLIPWFIVCSFLRRSRMYGPAGGISACIGAVLILGREGFGPPREFAMARIMET  1362
               ELRF++L+PW I  SFLRRSRMYG AGGI+A I  ++ILGR  +GPP  FA+AR+ ET
Sbjct  505   LMELRFLALLPWIIFTSFLRRSRMYGHAGGIAAVISTLIILGRRHYGPPTVFAIARLTET  564

Query  1363  FIGLACSITVELLFRPTRASSLAKIQLSKSLQLLNQCIISIDYSSNNQSKLEETQKILKS  1542
             FIGL+CS+ VELL +PTRAS+LA+ QLS SL+ LN+CI S+  S+     L+E QK L+ 
Sbjct  565   FIGLSCSVLVELLLQPTRASTLARAQLSGSLRTLNECIESLILST-GPVPLKEKQKKLEQ  623

Query  1543  SVTQLGKFIGEAEVEPNFWFLPFHSACYGKLMGSLSKVVEYLHFVAQALRFLEQESALMG  1722
              V  L K+I EA++EPNFWFLPF  ACY KL GSLSK+VE L F+   + FL +ES  +G
Sbjct  624   QVNALRKYIDEAQMEPNFWFLPFPVACYYKLHGSLSKLVELLCFLVHGIEFLAEESHGLG  683

Query  1723  RLDSD-------HLSLFRDHVGPSIKSFEEIISLVGSVSVLDKEFEKKKSSIDPELGKLP  1881
                 +        L  F+  +G  +K+FEE+I  V S+  L+KE  ++    D ELG   
Sbjct  684   AARKEIQETIGGDLEQFKIIIGSPLKNFEEVIR-VKSLGKLEKELPRRSEPNDLELG---  739

Query  1882  TSNNITGLS--DEEIDNKLKSFMEDSRQFVDQKdeddddeVMMNSQVALSLSALAFCMRG  2055
                N   LS  +EE +  +  F++ + + V + D D  ++  + SQV L L+   FC  G
Sbjct  740   ---NYGSLSAGEEESEKVVALFLQHAIEVVKRHDVDVGED--LKSQVVLCLATFGFCTGG  794

Query  2056  IVRETKEIDKAIKELVQWENPSSPVNLHEISCKIRA  2163
             +++ET+EI+  I EL+QWENP S +NL+EISC+++A
Sbjct  795   LMKETREIENGILELLQWENPGSHINLYEISCELKA  830



>ref|XP_007150309.1| hypothetical protein PHAVU_005G142600g [Phaseolus vulgaris]
 gb|ESW22303.1| hypothetical protein PHAVU_005G142600g [Phaseolus vulgaris]
Length=774

 Score =   462 bits (1188),  Expect = 4e-147, Method: Compositional matrix adjust.
 Identities = 341/730 (47%), Positives = 457/730 (63%), Gaps = 37/730 (5%)
 Frame = +1

Query  1     ALRGCWYAIYATCLGVCPAILSLWLIGPahlttgtaaaavaitaFIVVLP--QNTHVVAK  174
             ALRGC  A+YAT   + PAI SLWLIGP  L+    A AVA+ AF+VVLP   +  ++ K
Sbjct  60    ALRGCCLALYATVQTMGPAIFSLWLIGPGRLSRLGTAGAVAVAAFVVVLPWPYSGDLMVK  119

Query  175   RIALGQTVLVYALA---GPRTQPIMHPlrvaastaiavaacvlalllpypslassKVKHN  345
             R+ALGQ VLVY +A   G  T P+MHPLR+ ASTA+ V ACVLALLLPYP LA S++K +
Sbjct  120   RLALGQIVLVYVVAYDNGVHTDPVMHPLRLGASTALGVLACVLALLLPYPRLACSQMKES  179

Query  346   CHLFAENVSQRLNLLVKAFSAEDNASALSLVSQAKSLNASGAKFLQNIKSKQESMQWERY  525
               L  +N+  RL +  K  S ED A+A+ L+S+ K L     K    I   QE M+WE  
Sbjct  180   YKLLTKNMLTRLKIFKKLISEEDKANAIRLISEVKFLRTKRTKLFSLIALYQEGMKWEIV  239

Query  526   PIKFFRPYCKNPGERLQEYETPLRGMEMGLVDNNPPQFPVTVLLSSSEVKDSLDSLTGHI  705
             P K  + +  +  ER++E +T LRGME+ L   N   F   ++  + ++K  L+ L  H+
Sbjct  240   PFKNLKSHWLSLIERVEEVDTNLRGMELALTCTN--SFTNNII--NQDLKHGLNCLEEHV  295

Query  706   SKQVK----GRLFDLATVPESNAQNAVKFLHQKLQ--PVTLQdlssffflfslklllikp  867
             S  +K    G      TVPESNA++   FL Q  Q  P T ++L  FFFLF  +LL  KP
Sbjct  296   SLTIKQPKQGLRGASLTVPESNAKDITLFL-QSFQTIPTTHKELPIFFFLFCAQLLHKKP  354

Query  868   sssilkdkdGSKEQEERFLDK-IYSNFVGQMNNKRFVASLKYALALGLAVFFGSIYSKPD  1044
              +        S   E     K  ++N +  + N  F+  +K +L+LGLAVF G +YSK +
Sbjct  355   FTQAPTSSHHSNRNENSHKGKQKWANLIATLRNTNFIPPIKSSLSLGLAVFLGLVYSKEN  414

Query  1045  GFWAGLTVAISYVSAREATFRIANVKAQGTVLGSIYGVLGCFVFAKYEELRFISLIPWFI  1224
             G WAGL VA+SYVS REATFR AN+KAQGTVLG++YGVLGCF+F ++  +R +SL+PWFI
Sbjct  415   GLWAGLPVAVSYVSGREATFRAANLKAQGTVLGTVYGVLGCFLFERFLPVRLLSLLPWFI  474

Query  1225  VCSFLRRSRMYGPAGGISACIGAVLILGREGFGPPREFAMARIMETFIGLACSITVELLF  1404
               SFL+RS+ YGPAG ISA IGAVLILGRE FGPP EFA+ARI+ETFIGL+CSI V+L+F
Sbjct  475   FTSFLQRSKTYGPAGAISAVIGAVLILGRENFGPPSEFAIARIVETFIGLSCSIFVDLIF  534

Query  1405  RPTRASSLAKIQLSKSLQLLNQCIISIDYSSNNQSKLEETQKILKSSVTQLGKFIGEAEV  1584
              P RAS+ AK +LS+ L  L + I S+   +  ++ L E  K LK+ V +L K + EAEV
Sbjct  535   GPKRASTCAKRKLSQCLGPLGESIGSLSLLA-GETDLGENLKRLKTQVNELKKLVVEAEV  593

Query  1585  EPNFWFLPFHSACYGKLMGSLSKVVEYLHFVAQALRFLEQESALMGRLDSDHLSLF----  1752
             EPNFWFLPF+S  Y KL+GSLS+VVE L F   AL+FL+QE    G  + + +++     
Sbjct  594   EPNFWFLPFNSVSYNKLLGSLSRVVELLWFGEHALKFLQQEFKRCGAYEKEDVNMLNGKL  653

Query  1753  ---RDHVGPSIKSFEEIISLVGSVSVLDKEFEKKKSSIDPELGKLPTSNNI---TGLSDE  1914
                ++ +  S+K+ EEI  +        K  EKK +  D E GK    N     +GL ++
Sbjct  654   EHAKELICSSMKNLEEISRM--------KFVEKKNNPCDLEAGKSSECNTCMVSSGLGED  705

Query  1915  EIDNKLKSFMEDSRQFVDQKdeddddeVMMNSQVALSLSALAFCMRGIVRETKEIDKAIK  2094
              I+  +  F++  R  VD    D+ ++  + SQV LSLSAL FC+   +RET EI++AI 
Sbjct  706   GIEETIGCFLQVCRIVVDNLHGDESEK-EVKSQVVLSLSALGFCLFSCIRETIEIEEAIT  764

Query  2095  ELVQWENPSS  2124
             E+VQWENPSS
Sbjct  765   EIVQWENPSS  774



>ref|XP_004150188.1| PREDICTED: uncharacterized protein LOC101219035 [Cucumis sativus]
 gb|KGN65702.1| hypothetical protein Csa_1G503390 [Cucumis sativus]
Length=798

 Score =   452 bits (1164),  Expect = 3e-143, Method: Compositional matrix adjust.
 Identities = 314/752 (42%), Positives = 465/752 (62%), Gaps = 39/752 (5%)
 Frame = +1

Query  1     ALRGCWYAIYATCLGVCPAILSLWLIGPahlttgtaaaavaitaFIVVLPQNTHVVAKRI  180
              +RGCW A+YAT   VCPA+   W IGP   +  T A  VA+ + +VVLP ++HV+AKRI
Sbjct  59    TVRGCWLALYATLQTVCPAMAVFWFIGPTKFSYETIALTVALASIVVVLPSSSHVLAKRI  118

Query  181   ALGQTVLVYA---LAGPRTQPIMHPlrvaastaiavaacvlalllpypslassKVKHNCH  351
             ALGQ V++Y    + G +T P+MHP+ VA++TA+ VAA  LA LLP+P LAS +VK    
Sbjct  119   ALGQIVIIYVVGFIGGVQTHPLMHPVHVASTTAMGVAASFLATLLPFPRLASLEVKEKSK  178

Query  352   LFAENVSQRLNLLVKAFSAEDNASALSLVSQAKSLNASGAKFLQNIKSKQESMQWERYPI  531
                ENV++RL +LVKAF A+++  A+  +S+A  L+ S  K LQ IK  QESM+WE  P+
Sbjct  179   AMVENVAERLRVLVKAFLADNDTVAVGSLSKAALLSTSATKLLQPIKQYQESMKWEWIPL  238

Query  532   KFFRPYCKNPGERLQEYETPLRGMEMGLVDNNPPQFPVTVLLSSSEVKDSLDSLTGHISK  711
             K  +       ++LQ+ E P+RGME+ L  +N P +P+   L    +++ ++SL   I +
Sbjct  239   KVCKLGWLGNSQKLQDLERPIRGMELAL--SNIPSYPILQPLQIESLQNGINSLENQIVQ  296

Query  712   QV-KGRLF---DLATVPESNA------QNAVKFLHQKLQPVTLQdlssffflfslkllli  861
              + +G  +   D  T PESN       Q+ V    Q + P   ++L SFFF+F LKLL  
Sbjct  297   SLNQGIAYSPSDSHTFPESNPYDEDQDQDPVMNTIQLINPTNHKNLPSFFFIFCLKLLQE  356

Query  862   kpsssilkdkdGSKEQEERFLDKIYSNFVGQMNNKRFVASLKYALALGLAVFFGSIYSKP  1041
             K  ++ L +   S+EQ++      ++   G +++K+ + +LK A++LG++V+ G IYSK 
Sbjct  357   KSQNNKLPNPQKSEEQKQTPNTTKWAIPSGILSSKKVMGALKSAISLGISVYLGLIYSKE  416

Query  1042  DGFWAGLTVAISYVSAREATFRIANVKAQGTVLGSIYGVLGCFVFAKYEELRFISLIPWF  1221
             +GFWA L VA+S    REATF+I+NVK QGTV+GS+YGVL   +F K+   R + L+P F
Sbjct  417   NGFWASLGVAVSIACTREATFKISNVKLQGTVIGSVYGVLCFVIFEKFLIGRLLCLLPCF  476

Query  1222  IVCSFLRRSRMYGPAGGISACIGAVLILGREGFGPPREFAMARIMETFIGLACSITVELL  1401
             +  SFL+RS+MYG AGG+SA IGAV+ILGR  +G P+E A ARI+ET IG++ SI V+++
Sbjct  477   VFTSFLQRSKMYGAAGGVSAIIGAVIILGRTNYGSPKELAFARIVETIIGVSSSIMVDII  536

Query  1402  FRPTRASSLAKIQLSKSLQLLNQCIISIDYSSNNQSKLEETQKILKSSVTQLGKFIGEAE  1581
               PTRAS LAK QL+ +L++L +CI S+ +   +   L+ + K L S V +L K I EA 
Sbjct  537   LHPTRASKLAKFQLTSTLRVLLKCIDSMSFQPPD---LKGSLKELGSHVVELKKLIDEAN  593

Query  1582  VEPNFWFLPFHSACYGKLMGSLSKVVEYLHFVAQALRFLEQESALMGRLDSDHLSLFR--  1755
             VEPNFWFLPF S CYGKL+ SL K V+   FV +++  + Q   ++     D LS  +  
Sbjct  594   VEPNFWFLPFQSGCYGKLLKSLLKTVDLFAFVNRSVEGIGQNLLVL----EDPLSWAKIG  649

Query  1756  DHVGPSIKSFEEI----------ISLVGSVSVLDKEFEKK-KSSIDPELGKLPTSNNITG  1902
             +++   ++ F+E+          +S + S+ VL+KE EKK K   D E  ++  S  +  
Sbjct  650   ENLEEDVEDFKEMASGLVRCCVDVSSLKSLKVLEKEVEKKNKGEGDFEDVEMGESKMVIE  709

Query  1903  LSDEEIDNKLKSFMEDSRQFVDQKdeddddeVMMNSQVALSLSALAFCMRGIVRETKEID  2082
             + + E +  L SFM+   + ++Q  E +D       +  LS SALAFC+  +++E +EI 
Sbjct  710   MEEMEKEKLLCSFMKHYVEVIEQSGESEDG----KREALLSFSALAFCLSSLMKEIEEIG  765

Query  2083  KAIKELVQWENPSSPVNLHEISCKIRALAHTV  2178
             KA +EL+Q ENPSS V+ +EIS KI  +   V
Sbjct  766   KATRELIQRENPSSHVDFNEISSKIHVVQKGV  797



>ref|XP_008242655.1| PREDICTED: uncharacterized protein LOC103340961 [Prunus mume]
Length=813

 Score =   452 bits (1163),  Expect = 5e-143, Method: Compositional matrix adjust.
 Identities = 310/761 (41%), Positives = 438/761 (58%), Gaps = 55/761 (7%)
 Frame = +1

Query  4     LRGCWYAIYATCLGVCPAILSLWLIGPahlttgtaaaavaitaFIVVLPQNTHVVAKRIA  183
             LR CW+ +YAT   + P++L+LWL+GP +     AA AVA+ AF+V LP++TH+++KRIA
Sbjct  71    LRSCWHVMYATVQVMVPSVLTLWLVGPKNFDILLAAVAVAVGAFVVALPESTHLMSKRIA  130

Query  184   LGQTVLVYA---LAGPRTQPIMHPlrvaastaiavaacvlalllpypslassKVKHNCHL  354
              GQ V VY    + G +T  +MHPL VAASTA+   A VLALLLPYP LA  +VK +  +
Sbjct  131   FGQLVNVYVGTVVHGAQTGVVMHPLGVAASTALGALASVLALLLPYPRLAYFEVKKSWRM  190

Query  355   FAENVSQRLNLLVKAFSAEDNASALSLVSQAKSLNASGAKFLQNIKSKQESMQWERYPIK  534
             +AEN SQRL   V+A SA+D   AL  +SQ +SL+ + AK  Q+I +    M WER  +K
Sbjct  191   YAENASQRLTHFVEAVSAQDKRGALEFISQEQSLSKAAAKLHQSISNNLVGMVWERPQMK  250

Query  535   FFRPYCKNPGERLQEYETPLRGMEMGLVDNNPPQFPVTVL-------LSSSEVKDSLDSL  693
             F +P     GE+LQE E PLRGME+ L  ++   FP+ ++       L  SEV+ SL  L
Sbjct  251   FLKPNYMKLGEQLQETEIPLRGMEIAL--SSYSSFPLNLIDEELRGHLQRSEVQISLRLL  308

Query  694   TGHISKQVKGRLFDLATVPESNAQNAVKFLHQKL---QPVTLQdlssfff----------  834
                 S        D  T PE+N +     L   L   +P T    +              
Sbjct  309   QSRYSMPS-----DATTAPETNTE----ILDSALWIGKPTTTNHDNMAASFFLYCMDLLL  359

Query  835   --lfslklllikpsssilkdkdGSKEQEERFLDKIYSNFVGQMNNKRFVASLKYALALGL  1008
                   +       S+  ++  G++ Q      +++ N +  +  +  V +LK +LALGL
Sbjct  360   ENQPIARNPGNTLKSNPNQEPSGAQNQAHCNFKRVWKNIMPSL--RSLVFALKCSLALGL  417

Query  1009  AVFFGSIYSKPDGFWAGLTVAISYVSAREATFRIANVKAQGTVLGSIYGVLGCFVFAKYE  1188
             AV FG IY+K +G+WAGLT+AI +V+ R+ATF + N +AQGT +GS+YGV+  F+F   E
Sbjct  418   AVLFGLIYNKENGYWAGLTIAIGFVTGRQATFTVTNARAQGTAMGSVYGVIWLFLFQGIE  477

Query  1189  ELRFISLIPWFIVCSFLRRSRMYGPAGGISACIGAVLILGREGFGPPREFAMARIMETFI  1368
               R + LIPW     FLR SRMYG AGGISA IGA+LILGRE +GPP +FA+AR+ E  I
Sbjct  478   HFRLLPLIPWIFFTHFLRHSRMYGQAGGISAAIGALLILGRENYGPPSDFAIARMTEACI  537

Query  1369  GLACSITVELLFRPTRASSLAKIQLSKSLQLLNQCIISIDYSSNNQSKLEETQKILKSSV  1548
             GL C + VE +F P RA +LA+ +LSKS+  L  CI  I+      + L E ++ LKS +
Sbjct  538   GLICFVLVETVFYPMRAVTLARNELSKSMGALRDCIKDINLCVPASAGLREKKRKLKSHL  597

Query  1549  TQLGKFIGEAEVEPNFWFLPFHSACYGKLMGSLSKVVEYLHFVAQALRFLEQESALMG--  1722
              +L  F+ EAE EPNFWFLPF  A Y K++GSLSK+ + L FVA    FL Q +  +G  
Sbjct  598   KKLENFLQEAETEPNFWFLPFKGASYSKVLGSLSKMADLLLFVACETEFLSQVTQKLGGA  657

Query  1723  ------RLDSDHLSLFRDHVGPSIKSFEEIISLVGSVSVLDKEFEKKKSSIDPELGKLPT  1884
                    +++D L L ++ +  S+K  EE+ S + SV+V   E E +    D ELGK   
Sbjct  658   SEELRQHMNAD-LELLKEKINSSLKCLEEVTS-IKSVAVF--ETEAQDDYHDSELGKPAN  713

Query  1885  SNNITGLSDEEIDNKLKSFMEDSRQFVDQKdeddddeVMMNSQVALSLSALAFCMRGIVR  2064
                I G  DEE++  ++  ++   +  D     D +E    SQ+ L L++L FC+R +  
Sbjct  714   PFRILGEGDEEVEIIVRILLQHFEEVADNVHNSDSEE-KRKSQMVLCLASLGFCIRILTS  772

Query  2065  ETKEIDKAIKELVQWENPSSPVNLHEISCKIRAL----AHT  2175
             ET E++K +++LV+WE+PS       I CK  AL    AHT
Sbjct  773   ETMEMEKQVRKLVKWESPSRHKQFLNICCKADALDALDAHT  813



>ref|XP_007207662.1| hypothetical protein PRUPE_ppa022399mg [Prunus persica]
 gb|EMJ08861.1| hypothetical protein PRUPE_ppa022399mg [Prunus persica]
Length=804

 Score =   451 bits (1160),  Expect = 1e-142, Method: Compositional matrix adjust.
 Identities = 306/760 (40%), Positives = 431/760 (57%), Gaps = 56/760 (7%)
 Frame = +1

Query  4     LRGCWYAIYATCLGVCPAILSLWLIGPahlttgtaaaavaitaFIVVLPQNTHVVAKRIA  183
             LR CW+ +YAT   + P++L+LWL+GP +     AA AVA++AF+V LP++TH+++KRIA
Sbjct  65    LRSCWHVMYATVQVMVPSVLTLWLVGPKNFDILLAAVAVAVSAFVVALPESTHLMSKRIA  124

Query  184   LGQTVLVYA---LAGPRTQPIMHPlrvaastaiavaacvlalllpypslassKVKHNCHL  354
              GQ V VY    + G +T  +MHPL VAASTA+   A VLALL PYP LA  +VK +  +
Sbjct  125   FGQLVNVYVGTVVHGAQTGVVMHPLGVAASTALGALASVLALLFPYPRLAYFEVKKSWRM  184

Query  355   FAENVSQRLNLLVKAFSAEDNASALSLVSQAKSLNASGAKFLQNIKSKQESMQWERYPIK  534
             +AEN SQRL   V+A SA+D   AL  +SQ +SL+ + AK  Q+I +    M WER  +K
Sbjct  185   YAENASQRLTHFVEAVSAQDKRGALEFISQEQSLSKAAAKLHQSISNNLVGMVWERPHMK  244

Query  535   FFRPYCKNPGERLQEYETPLRGMEMGLVDNNPPQFPVTVL-------LSSSEVKDSLDSL  693
             F +P     GE+LQE E PLRGME+ L  ++   FP+ ++       L SSEV+ SL  L
Sbjct  245   FLKPNYMKLGEQLQETEIPLRGMEIAL--SSCSSFPLNLIDEELRGHLQSSEVQISLRLL  302

Query  694   TGHISKQVKGRLFDLATVPE-----------------SNAQNAVKFLHQKLQPVTLQdls  822
                 S        D  T PE                 +N  N           + L++  
Sbjct  303   QSRYSMPS-----DATTAPETNREILDNAPWIGKPTTTNHDNMAASFFLYCMELLLENQP  357

Query  823   sffflfslklllikpsssilkdkdGSKEQEERFLDKIYSNFVGQMNNKRFVASLKYALAL  1002
                   +          S      G++ Q      +++ N +  +  +  V +LK +LAL
Sbjct  358   IARNPGNTLKSNPNQEPS------GAQNQAHCNFQRVWKNIMPSL--RSLVFALKCSLAL  409

Query  1003  GLAVFFGSIYSKPDGFWAGLTVAISYVSAREATFRIANVKAQGTVLGSIYGVLGCFVFAK  1182
             GLAV FG IY+K +G+WAGLT+AI +V+ R+ATF + N +AQGT +GS+YGV+  F+F  
Sbjct  410   GLAVLFGLIYNKENGYWAGLTIAIGFVTGRQATFTVTNARAQGTAMGSVYGVICLFLFQG  469

Query  1183  YEELRFISLIPWFIVCSFLRRSRMYGPAGGISACIGAVLILGREGFGPPREFAMARIMET  1362
              E  R + LIPW     FLR S+MYG AGGISA IGA+LILGRE +GPP EFA+AR+ E 
Sbjct  470   IEHFRLLPLIPWIFFTHFLRHSKMYGQAGGISAAIGALLILGRENYGPPSEFAIARMTEA  529

Query  1363  FIGLACSITVELLFRPTRASSLAKIQLSKSLQLLNQCIISIDYSSNNQSKLEETQKILKS  1542
              IGL C + VE++F P RA +LA+ +LSKS+  L  CI  I+      + L E Q+ LKS
Sbjct  530   CIGLICFVLVEIVFYPLRAVTLARNELSKSMGALRDCIKDINLCVPASAGLREKQRKLKS  589

Query  1543  SVTQLGKFIGEAEVEPNFWFLPFHSACYGKLMGSLSKVVEYLHFVAQALRFLEQESALMG  1722
              + +L  F+ EAE EPNFWFLPF  A Y K++GSLSK+ + L FVA    FL Q +  +G
Sbjct  590   HLKKLENFLQEAETEPNFWFLPFKGASYSKVLGSLSKMADLLLFVACETEFLSQVTQKLG  649

Query  1723  --------RLDSDHLSLFRDHVGPSIKSFEEIISLVGSVSVLDKEFEKKKSSIDPELGKL  1878
                      +++D + L ++ +  S+K  EE+ S+    SV   E + +    D ELGK 
Sbjct  650   GASEELRQHMNAD-VELLKEKINSSLKCLEEVTSI---KSVAAFETQAQDDYHDSELGKP  705

Query  1879  PTSNNITGLSDEEIDNKLKSFMEDSRQFVDQKdeddddeVMMNSQVALSLSALAFCMRGI  2058
                  I G  DEE++  +   ++   +  D    + D E    SQ  L L++L FC+R +
Sbjct  706   ANPFRILGAGDEEVEIIVSILLQHFEEVAD-NVHNSDSEAKRKSQTVLCLASLGFCIRSL  764

Query  2059  VRETKEIDKAIKELVQWENPSSPVNLHEISCKIRAL-AHT  2175
               ET E++K +++LV+WE+PS       I CK  AL AHT
Sbjct  765   TSETMEMEKQVRKLVKWESPSRHKKFLNICCKADALDAHT  804



>ref|XP_010543050.1| PREDICTED: uncharacterized protein LOC104816079 [Tarenaya hassleriana]
Length=611

 Score =   444 bits (1141),  Expect = 3e-142, Method: Compositional matrix adjust.
 Identities = 278/629 (44%), Positives = 390/629 (62%), Gaps = 40/629 (6%)
 Frame = +1

Query  331   KVKHNCHLFAENVSQRLNLLVKAFSAEDNASALSLVSQAKSLNASGAKFLQNIKSKQESM  510
             +VK +C    +N+S+RL L +KAFSA+D  SA + +SQA+ L    +K  Q IK  Q SM
Sbjct  4     QVKQSCKEIGQNISERLKLYIKAFSADDATSATTSISQARLLAPPSSKLYQTIKRYQPSM  63

Query  511   QWERYPIKFFRP--YCKNPGERLQEYETPLRGMEMGLVDNNPPQFPVTVLLSSSEVKDSL  684
             +WER P K  R   + +N G++LQ  E  LRGMEM L   N   FP T+L  + EVKD L
Sbjct  64    KWERLPFKLCRSQHFNENTGDKLQNMEIALRGMEMALT--NTSSFPATLL--AGEVKDGL  119

Query  685   DSLTGHISKQVK--GRLFDLATVPESNAQNAVKFLHQKLQPVTLQdlssffflfslklll  858
               +   ++  +K        +  PES+  NA   L Q LQ    +     F+ F   L L
Sbjct  120   IKIQEGVTLTIKRINNCLQPSVNPESDPDNASGCL-QTLQEFPGKHQDLPFYFFLFCLKL  178

Query  859   ikpsssilkdkdGSKEQEERFL-DKIY--SNFVGQMNNKRFVASLKYALALGLAVFFGSI  1029
             ++  S    + D  K+ E     DK +   N+   + +KR + ++K +L+LGLAV FGS+
Sbjct  179   LENISMAEPENDEDKKPESSLEEDKSWFSINWRSALGSKRMMPAIKLSLSLGLAVLFGSM  238

Query  1030  YSKPDGFWAGLTVAISYVSAREATFRIANVKAQGTVLGSIYGVLGCFVFAKYEELRFISL  1209
             YSKP+G+W+GL VAIS+ +AREATF++ANVKAQGTV+G++YGV+GCFVF ++  +RF+SL
Sbjct  239   YSKPNGYWSGLPVAISFAAAREATFKVANVKAQGTVIGTVYGVMGCFVFERFLPIRFLSL  298

Query  1210  IPWFIVCSFLRRSRMYGPAGGISACIGAVLILGREGFGPPREFAMARIMETFIGLACSIT  1389
             +PWF+  SFL +SRMYG AG ISA IGAVLILGR+ FGPP EFA+ARI+ETFIGL+CSI 
Sbjct  299   LPWFVFSSFLGKSRMYGQAGAISAAIGAVLILGRKNFGPPSEFAIARIVETFIGLSCSIM  358

Query  1390  VELLFRPTRASSLAKIQLSKSLQLLNQCIISIDYSSNNQSKLEETQKILKSSVTQLGKFI  1569
             +EL+ +PTR S+LAK+ LS+S   L++C  S+      ++++  +QK +K+ + +L KF 
Sbjct  359   IELILQPTRGSTLAKLTLSRSFHALHEC-ASLFGEKGGKAEIIRSQKKVKTHLIELKKFT  417

Query  1570  GEAEVEPNFWFLPFHSACYGKLMGSLSKVVEYLHFVAQALRFLEQESALMGRLDS-----  1734
              EA+ EP+FWFLPF+ +CY KL  SLS++ + L F A A+ FL  +     RL S     
Sbjct  418   EEAQAEPSFWFLPFNCSCYDKLFRSLSEMADLLQFSAHAIGFLGAQET--DRLQSKKVLI  475

Query  1735  ---DHLSLFRDHVGPSIKSFEEIISLVGSVSVLDKEFEKKKSSIDPELGKLPTSNNITGL  1905
                + L    + +    KSFEEII L+ S++ L+    +   S D E+GK  T N     
Sbjct  476   EAEEDLKNLTESIASVAKSFEEII-LLKSINALENALVENNVSWDIEVGK--TKNPSFSR  532

Query  1906  SDEEIDNKLKSFM--EDSRQFVDQKdeddddeVMMNSQVALSLSALAFCMRGIVRETKEI  2079
             ++ + D  L S++  E   + VD+            S   L L AL FCM  +V+E +EI
Sbjct  533   AENDTDKVLGSYLRREGEVEEVDK------------SDAVLGLGALGFCMERMVKEMREI  580

Query  2080  DKAIKELVQWENPSSPVNLHEISCKIRAL  2166
             ++ IKELVQWENPSS V+LHEISCKIR+L
Sbjct  581   EERIKELVQWENPSSHVDLHEISCKIRSL  609



>ref|XP_004169648.1| PREDICTED: uncharacterized protein LOC101229105 [Cucumis sativus]
Length=798

 Score =   450 bits (1157),  Expect = 3e-142, Method: Compositional matrix adjust.
 Identities = 313/752 (42%), Positives = 464/752 (62%), Gaps = 39/752 (5%)
 Frame = +1

Query  1     ALRGCWYAIYATCLGVCPAILSLWLIGPahlttgtaaaavaitaFIVVLPQNTHVVAKRI  180
              +RGCW A+YAT   VCPA+   W IGP   +  T A  VA+ + +VVLP ++HV+AKRI
Sbjct  59    TVRGCWLALYATLQTVCPAMAVFWFIGPTKFSYETIALTVALASIVVVLPSSSHVLAKRI  118

Query  181   ALGQTVLVYA---LAGPRTQPIMHPlrvaastaiavaacvlalllpypslassKVKHNCH  351
             ALGQ V++Y    + G +T P+MHP+ VA++TA+ VAA  LA LLP+P LAS +VK    
Sbjct  119   ALGQIVIIYVVGFIGGVQTHPLMHPVHVASTTAMGVAASFLATLLPFPRLASLEVKEKSK  178

Query  352   LFAENVSQRLNLLVKAFSAEDNASALSLVSQAKSLNASGAKFLQNIKSKQESMQWERYPI  531
                ENV++RL +LVKAF A+++  A+  +S+A  L+ S  K LQ I   QESM+WE  P+
Sbjct  179   AMVENVAERLRVLVKAFLADNDTVAVGSLSKAALLSTSATKLLQPIIQYQESMKWEWIPL  238

Query  532   KFFRPYCKNPGERLQEYETPLRGMEMGLVDNNPPQFPVTVLLSSSEVKDSLDSLTGHISK  711
             K  +       ++LQ+ E P+RGME+ L  +N P +P+   L    +++ ++SL   I +
Sbjct  239   KVCKLGWLGNSQKLQDLERPIRGMELAL--SNIPSYPILQPLQIESLQNGINSLENQIVQ  296

Query  712   QV-KGRLF---DLATVPESNA------QNAVKFLHQKLQPVTLQdlssffflfslkllli  861
              + +G  +   D  T PESN       Q+ V    Q + P   ++L SFFF+F LKLL  
Sbjct  297   SLNQGIAYSPSDSHTFPESNPYDEDQDQDPVMNTIQLINPTNHKNLPSFFFIFCLKLLQE  356

Query  862   kpsssilkdkdGSKEQEERFLDKIYSNFVGQMNNKRFVASLKYALALGLAVFFGSIYSKP  1041
             K  ++ L +   S+EQ++      ++   G +++K+ + +LK A++LG++V+ G IYSK 
Sbjct  357   KSQNNKLPNPQKSEEQKQTPNTTKWAIPSGILSSKKVMGALKSAISLGISVYLGLIYSKE  416

Query  1042  DGFWAGLTVAISYVSAREATFRIANVKAQGTVLGSIYGVLGCFVFAKYEELRFISLIPWF  1221
             +GFWA L VA+S    REATF+I+NVK QGTV+GS+YGVL   +F K+   R + L+P F
Sbjct  417   NGFWASLGVAVSIACTREATFKISNVKLQGTVIGSVYGVLCFVIFEKFLIGRLLCLLPCF  476

Query  1222  IVCSFLRRSRMYGPAGGISACIGAVLILGREGFGPPREFAMARIMETFIGLACSITVELL  1401
             +  SFL+RS+MYG AGG+SA IGAV+ILGR  +G P+E A ARI+ET IG++ SI V+++
Sbjct  477   VFTSFLQRSKMYGAAGGVSAIIGAVIILGRTNYGSPKELAFARIVETIIGVSSSIMVDII  536

Query  1402  FRPTRASSLAKIQLSKSLQLLNQCIISIDYSSNNQSKLEETQKILKSSVTQLGKFIGEAE  1581
               PTRAS LAK QL+ +L++L +CI S+ +   +   L+ + K L S V +L K I EA 
Sbjct  537   LHPTRASKLAKFQLTSTLRVLLKCIDSMSFQPPD---LKGSLKELGSHVVELKKLIDEAN  593

Query  1582  VEPNFWFLPFHSACYGKLMGSLSKVVEYLHFVAQALRFLEQESALMGRLDSDHLSLFR--  1755
             VEPNFWFLPF S CYGKL+ SL K V+   FV +++  + Q   ++     D LS  +  
Sbjct  594   VEPNFWFLPFQSGCYGKLLKSLLKTVDLFAFVNRSVEGIGQNLLVL----EDPLSWAKIG  649

Query  1756  DHVGPSIKSFEEI----------ISLVGSVSVLDKEFEKK-KSSIDPELGKLPTSNNITG  1902
             +++   ++ F+E+          +S + S+ VL+KE EKK K   D E  ++  S  +  
Sbjct  650   ENLEEDVEDFKEMASGLVRCCVDVSSLKSLKVLEKEVEKKNKGEGDFEDVEMGESKMVIE  709

Query  1903  LSDEEIDNKLKSFMEDSRQFVDQKdeddddeVMMNSQVALSLSALAFCMRGIVRETKEID  2082
             + + E +  L SFM+   + ++Q  E +D       +  LS SALAFC+  +++E +EI 
Sbjct  710   MEEMEKEKLLCSFMKHYVEVIEQSGESEDG----KREALLSFSALAFCLSSLMKEIEEIG  765

Query  2083  KAIKELVQWENPSSPVNLHEISCKIRALAHTV  2178
             KA +EL+Q ENPSS V+ +EIS KI  +   V
Sbjct  766   KATRELIQRENPSSHVDFNEISSKIHVVQKGV  797



>ref|XP_010037845.1| PREDICTED: uncharacterized protein LOC104426477 [Eucalyptus grandis]
 gb|KCW49625.1| hypothetical protein EUGRSUZ_K03147 [Eucalyptus grandis]
Length=823

 Score =   447 bits (1149),  Expect = 8e-141, Method: Compositional matrix adjust.
 Identities = 300/778 (39%), Positives = 450/778 (58%), Gaps = 81/778 (10%)
 Frame = +1

Query  1     ALRGCWYAIYATCLGVCPAILSLWLIGPah-lttgtaaaavaitaFIVVLPQNTHVVAKR  177
             ALRG W A YAT   +  ++LSLWL GPA   T G AAA V++  F+V LP++T ++AKR
Sbjct  69    ALRGVWNAFYATTQVMLFSVLSLWLAGPARFATHGLAAAVVSLGTFLVALPESTDLMAKR  128

Query  178   IALGQTVLVY---ALAGPRTQPIMHPlrvaastaiavaacvlalllpypslassKVKHNC  348
             IA GQ V+++   A+ G  T  +MHP+ VA+STA+   A VLALL PYP LA S+++  C
Sbjct  129   IAFGQLVIIFVGAAIGGASTGVVMHPVHVASSTALGALASVLALLFPYPWLACSEIRKTC  188

Query  349   HLFAENVSQRLNLLVKAFSAEDNASALSLVSQAKSLNASGAKFLQNIKSKQESMQWERYP  528
              L+ EN S+RLNL +  F A+   +A+ L+S+A        K LQ+IK  +  + WER  
Sbjct  189   RLYVENASERLNLYLDGFFAKGRPAAVDLISRASCFARVAKKLLQSIKEHERGVSWERPG  248

Query  529   IKFFRPYCKNPGERLQEYETPLRGMEMGLVDNNPPQFPVTVLLSSSEVKDSLDSLTGHIS  708
             I+F +P   N G+RLQE E PLRGMEM L  N+   FP++  ++  E++ +   +  H+ 
Sbjct  249   IRFLKPNYVNLGKRLQEIELPLRGMEMAL--NSCSSFPIS--MADQELQKASPKIKLHLR  304

Query  709   KQV-KGRLF---DLATVPES---NAQNAVK----------------FLH-----------  786
             +++ + + F   D  T PE+   + +NA++                FLH           
Sbjct  305   QKLEQAKCFTPCDATTAPETKGDDIENALRPFTTMPASQEGLPALFFLHCVEILQHDLIF  364

Query  787   -QKLQPVTLQdlssffflfslklllikpsssilkdkdGSKEQEERFLDKIYSNFVGQMNN  963
              Q ++PV  +   S                       G K+Q +       +    + + 
Sbjct  365   GQPVKPVDFKSQDSVTQQS------------------GEKDQAKYCFGGRRTRLNLKPSC  406

Query  964   KRFVASLKYALALGLAVFFGSIYSKPDGFWAGLTVAISYVSAREATFRIANVKAQGTVLG  1143
             +  + +LK +++LGLAV FG +Y+K +G+W+GLT+AIS+V+ R+ TF +AN +AQGT +G
Sbjct  407   QSLIFALKCSVSLGLAVLFGLLYNKENGYWSGLTIAISFVTGRQPTFTVANARAQGTAMG  466

Query  1144  SIYGVLGCFVFAKYEELRFISLIPWFIVCSFLRRSRMYGPAGGISACIGAVLILGREGFG  1323
             S+YG+LG F+  K+  LRF+ L+PW I  SFLR SRMYG AGGISA IGA+LILGR  +G
Sbjct  467   SVYGLLGYFICGKFVHLRFLPLLPWIIFASFLRHSRMYGQAGGISAVIGALLILGRRDYG  526

Query  1324  PPREFAMARIMETFIGLACSITVELLFRPTRASSLAKIQLSKSLQLLNQ-------CIIS  1482
             PP +FA+ARI E  IGL C ITVELL+ P RAS+LAK++LS SL+ L +       C+  
Sbjct  527   PPAQFAIARIAEASIGLICFITVELLWEPARASTLAKVELSTSLRKLGESIEGIVLCLEE  586

Query  1483  IDYSSNNQSKLEETQKILKSSVTQLGKFIGEAEVEPNFWFLPFHSACYGKLMGSLSKVVE  1662
               +  +    L+E  + L+S  ++ G    EA  EPNFWFLPF   C+ K++  LSK+V+
Sbjct  587   KQWPDSKFHTLQEKLEDLRSRTSKYGVLTEEAVSEPNFWFLPFPGDCHLKILECLSKMVD  646

Query  1663  YLHFVAQALRFLEQESALMG--------RLDSDHLSLFRDHVGPSIKSFEEIISLVGSVS  1818
              + F +  L  L++ S  +G         L+ D L LF++ +G SI+    + SL  S+S
Sbjct  647   LIQFTSFQLESLQRLSVSIGVAWKEIQKPLEQD-LELFKEMIGTSIQFLGAVTSL-KSLS  704

Query  1819  VLDKEFEKKKSSIDPELGKLPTSN--NITGLSDEEIDNKLKSFMEDSRQFVDQKdedddd  1992
              +D E +K K + D ELGK  + N    +G +DE++     SF+  S + V  +    + 
Sbjct  705   AIDTELQKTKVACDMELGKSQSGNLTTFSGTNDEDVAKVTSSFLCRSNE-VATRIHAQEG  763

Query  1993  eVMMNSQVALSLSALAFCMRGIVRETKEIDKAIKELVQWENPSSPVNLHEISCKIRAL  2166
                + SQ+ L +  L FC+  ++RET  +++ ++EL+Q ENP+  VN+ EIS K++AL
Sbjct  764   LEELKSQMVLCIGGLGFCLSRLMRETMIMEEILRELLQRENPTCLVNISEISSKLKAL  821



>ref|XP_004305213.1| PREDICTED: uncharacterized protein LOC101292821 [Fragaria vesca 
subsp. vesca]
Length=772

 Score =   437 bits (1125),  Expect = 8e-138, Method: Compositional matrix adjust.
 Identities = 288/721 (40%), Positives = 421/721 (58%), Gaps = 32/721 (4%)
 Frame = +1

Query  4     LRGCWYAIYATCLGVCPAILSLWLIGPahlttgtaaaavaitaFIVVLPQNTHVVAKRIA  183
             L  CW+ +YATC  +  ++ +LWLIGPA  T   AA AVA++ F+V LP +TH++ KRIA
Sbjct  64    LMSCWHVLYATCQVMASSVPALWLIGPARFTNEVAAGAVAVSVFMVALPGSTHLMTKRIA  123

Query  184   LGQTVLVYA---LAGPRTQPIMHPlrvaastaiavaacvlalllpypslassKVKHNCHL  354
              GQ V VY    + G  T  ++HP  V ASTA+   A VLA++ PYP LA  +VK +  L
Sbjct  124   FGQFVNVYVGTVVQGAGTNIVLHPTEVVASTALGALASVLAMMFPYPRLAYYEVKKSWRL  183

Query  355   FAENVSQRLNLLVKAFSAEDNASALSLVSQAKSLNASGAKFLQNIKSKQESMQWERYPIK  534
             +AEN S+RL+L V+A SA+DN  AL  +SQ KSL+ + AK LQ+I    E M WER  IK
Sbjct  184   YAENASKRLSLFVEAISADDNRVALDSISQGKSLSKAAAKLLQSINHNLEGMLWERPDIK  243

Query  535   FFRPYCKNPGERLQEYETPLRGMEMGLVDNNPPQFPVTVLLSSSEVKDSLDSLTGHISKQ  714
             F RP  ++ G RLQE E P+RGMEM L  ++   FP  ++     ++D L +    IS +
Sbjct  244   FLRPNHRDLGLRLQEMEIPIRGMEMALSSSS--SFPPDMI--DEGLRDHLRNSQLQISLK  299

Query  715   VKGRLF---DLATVPESNAQNAVKFL---------HQKLQPVTLQdlssffflfslklll  858
             ++ +     +  TVPE   +   K L         HQ L  +                  
Sbjct  300   LQSKYSVPSEATTVPEGEREVLDKPLLTNKTTTTTHQDLPALFFLYCMELLLGDLPIARS  359

Query  859   ikpsssilkdkdGSKEQEERFLDKIYSNFVGQMNNKRFVASLKYALALGLAVFFGSIYSK  1038
                + +       S+ Q +    +++ +    + N  F+ +LK ++ALG AV  G IY+K
Sbjct  360   PGNNPNCKGKTGDSQTQAQCICKRVWRSISPSLPN--FIFALKCSIALGFAVLLGLIYNK  417

Query  1039  PDGFWAGLTVAISYVSAREATFRIANVKAQGTVLGSIYGVLGCFVFAKYEELRFISLIPW  1218
               G+W+GLT+AIS+V+ R+ATF +AN +AQGT LGS+YG++  ++F    ELR ++++PW
Sbjct  418   RQGYWSGLTIAISFVTGRQATFTVANARAQGTALGSVYGIICFYLFHSVSELRLLAILPW  477

Query  1219  FIVCSFLRRSRMYGPAGGISACIGAVLILGREGFGPPREFAMARIMETFIGLACSITVEL  1398
              +   FLR S+MYG AGGISA IGA+LILGRE +G P  FA+AR+ E  IGL C   VE+
Sbjct  478   VVFTHFLRHSKMYGQAGGISAAIGALLILGREHYGQPSGFAIARLAEACIGLICFTVVEV  537

Query  1399  LFRPTRASSLAKIQLSKSLQLLNQCIISIDYSSNNQSKLEETQKILKSSVTQLGKFIGEA  1578
             LF P RA++LAK Q ++SL  L  C+  I+      + L E  K LKS V +L  FI EA
Sbjct  538   LFYPMRAATLAKNQFAQSLGALRDCVQDINLCVPASTGLREKHKKLKSHVNKLENFIEEA  597

Query  1579  EVEPNFWFLPFHSACYGKLMGSLSKVVEYLHFVAQALRFLEQESA-----LMGRLDSDHL  1743
             + EPNFWFLPF   CYG+++ S+SK+ + L FVA    F+ Q+S      L    ++D L
Sbjct  598   KTEPNFWFLPFEGDCYGRILESMSKMADLLPFVAHNADFISQKSGGASLELKQHSNTD-L  656

Query  1744  SLFRDHVGPSIKSFEEIISLVGSVSVLDKEFEKKKSSIDPELGKLPTSNNITGLSDEEID  1923
                ++ +G S+K  E++ S+  SV+  D E    +S  D E+G  P    I G  D+  +
Sbjct  657   QHLKEKIGNSLKCLEQLTSM-KSVAAFDTE---AQSVYDSEMGVSPNPFMILGTYDDHAE  712

Query  1924  NKLKSFMEDSRQFVDQKdeddddeVMMNSQVALSLSALAFCMRGIVRETKEIDKAIKELV  2103
               + +F++  ++ V  K  + DDEV   +Q+ L LS+LAFC+R +  ET +I + +++LV
Sbjct  713   ATVSTFVQHIQEAV-VKVRNGDDEVKDVTQMVLCLSSLAFCIRSLSEETMKIKEEVRKLV  771

Query  2104  Q  2106
             +
Sbjct  772   K  772



>gb|KDP35612.1| hypothetical protein JCGZ_09050 [Jatropha curcas]
Length=809

 Score =   439 bits (1128),  Expect = 8e-138, Method: Compositional matrix adjust.
 Identities = 297/747 (40%), Positives = 445/747 (60%), Gaps = 43/747 (6%)
 Frame = +1

Query  4     LRGCWYAIYATCLGVCPAILSLWLIGPahlttgtaaaavaitaFIVVLPQNTHVVAKRIA  183
             LRG ++A+YA+   + P++L LW+IGPA  T   AAA+VAIT+  V  P +T ++AKRIA
Sbjct  69    LRGSFHALYASIQAIIPSMLILWVIGPARFTVALAAASVAITSLAVAFPASTPLMAKRIA  128

Query  184   LGQTVLVYALA---GPRTQPIMHPlrvaastaiavaacvlalllpypslassKVKHNCHL  354
               Q V VY  A   G RT+ +MHPL VA+STA+   A VLALLLPYP LA  +V   C L
Sbjct  129   FAQIVTVYVGAVIYGTRTEGVMHPLHVASSTALGALASVLALLLPYPRLAYCEVNKTCRL  188

Query  355   FAENVSQRLNLLVKAFSAEDNASALSLVSQAKSLNASGAKFLQNIKSKQESMQWERYPIK  534
             + EN S+R+NL ++AF+A+DN +A   +SQA+ L+ +G K LQ IK+ Q  + WE+  I 
Sbjct  189   YVENASKRINLFMEAFNAQDNQTARHFISQAELLSETGIKHLQTIKNAQRGIIWEKPQIN  248

Query  535   FFRPYCKNPGERLQEYETPLRGMEMGLVDNNPPQFPVTVLLSSSEVKDSLDSLTGHISKQ  714
             F +P C +P + LQ+ E P++GME+ L   +   FPV+V+  +  + + L S+ G I  +
Sbjct  249   FSKPNCIDPVQVLQQLEIPIKGMEIALTSRSA--FPVSVI--NEGLTEVLLSMKGKIGLK  304

Query  715   VKGRL----FDLATVPESNAQ---------NAVKFLHQKLQP---VTLQdlssffflfsl  846
             ++       FD  T PE+  +           +   H++L     +   +L  +    S 
Sbjct  305   LEQAKCFAPFDATTEPETTGEFSDNPLWSRTTIAANHEELPDFFFLYCMELLQWDSHISR  364

Query  847   klllikpsssilkdkdGSKEQEERFLDKIYSNFVGQMNNKRFVASLKYALALGLAVFFGS  1026
                    +   ++  +G  +  +  L +I+      ++ +R++ ++K +L+LG AV FG 
Sbjct  365   SPECTVRNKQKVEINNGKDQVIKGILQRIWKGTGMILSRERWMFAVKCSLSLGFAVLFGL  424

Query  1027  IYSKPDGFWAGLTVAISYVSAREATFRIANVKAQGTVLGSIYGVLGCFVFAKYEELRFIS  1206
             I+ K + +W+GLT+AI++   RE TF +AN +AQGT +GS+YG+L  F+F +  +LRF+ 
Sbjct  425   IFDKENAYWSGLTIAITFAEGREPTFTLANARAQGTAMGSVYGILCSFIFRRSLDLRFLL  484

Query  1207  LIPWFIVCSFLRRSRMYGPAGGISACIGAVLILGREGFGPPREFAMARIMETFIGLACSI  1386
             L+PW I  SFLR SRMYG AGGISA  GA+LILGR+ +G P +FA+ARI E  IGL C I
Sbjct  485   LLPWIIFTSFLRHSRMYGQAGGISAVTGAMLILGRQNYGSPSQFAIARITEACIGLICFI  544

Query  1387  TVELLFRPTRASSLAKIQLSKSLQLLNQCIISIDYSSNNQS-------KLEETQKILKSS  1545
             T+E+L +P RA++LAK +L  SL+ +  CI  I   S+ +S        L E QK L S 
Sbjct  545   TIEILLQPARAATLAKTELVCSLRAIRDCIEDIALLSDKRSISSSLPLDLREKQKTLDSR  604

Query  1546  VTQLGKFIGEAEVEPNFWFLPFHSACYGKLMGSLSKVVEYLHFVAQALRFLEQESALMGR  1725
             + Q+ KFI EA +EPNFWFLPFH  CY K++ SL K+ +   F A       + S  +G 
Sbjct  605   INQMEKFIVEAALEPNFWFLPFHDVCYDKVLRSLRKMQDLWLFSAYNTEIFSEISEKLG-  663

Query  1726  LD----SDHLSLFRDH----VGPSIKSFEEIISLVGSVSVLDKEFEKKKSSIDPELGKLP  1881
             LD    ++H+    DH    + PS++  EE+IS + S++ L+ E +KK  + D ELGK  
Sbjct  664   LDWEELAEHIEYDLDHFQRKICPSLRCLEELIS-IKSMAALENERQKKSMTHDIELGKST  722

Query  1882  TSNNITGLSDEE--IDNKLKSFMEDSRQFVDQKdeddddeVMMNSQVALSLSALAFCMRG  2055
               N  T  S EE  +   + SF+E+SR+ + +K      E  + S + L L+ L FC++ 
Sbjct  723   KINVSTNQSLEEFAVPEIVNSFLENSRE-IARKVNASKGEQKLKSWMILCLNGLGFCIKN  781

Query  2056  IVRETKEIDKAIKELVQWENPSSPVNL  2136
             ++RET EI+K I +L+ WENP+  +N 
Sbjct  782   LLRETIEIEKEIDKLIAWENPTRHINF  808



>ref|XP_002527740.1| hypothetical protein RCOM_1248440 [Ricinus communis]
 gb|EEF34653.1| hypothetical protein RCOM_1248440 [Ricinus communis]
Length=819

 Score =   437 bits (1125),  Expect = 3e-137, Method: Compositional matrix adjust.
 Identities = 305/765 (40%), Positives = 451/765 (59%), Gaps = 54/765 (7%)
 Frame = +1

Query  1     ALRGCWYAIYATCLGVCPAILSLWLIGPahlttgtaaaavaitaFIVVLPQNTHVVAKRI  180
              LRG  YA+YAT   +  +IL LW IGPA   +G  A AVA+TAF+V LP++T ++ KRI
Sbjct  68    TLRGTLYALYATIQVMILSILPLWAIGPARFNSGVGAVAVAVTAFVVALPESTPLMTKRI  127

Query  181   ALGQTVLVYALA---GPRTQPIMHPlrvaastaiavaacvlalllpypslassKVKHNCH  351
             A GQ V+VY  A   G  T  +MHPL VA+ TA+   A VLA+L+P+P LA ++V+  C 
Sbjct  128   AFGQIVIVYVGAVIHGAETGIVMHPLHVASCTALGAFASVLAMLVPFPHLAYNEVRKACR  187

Query  352   LFAENVSQRLNLLVKAFSAEDNASALSLVSQAKSLNASGAKFLQNIKSKQESMQWERYPI  531
             L+ EN S+RLNL + AF+A+DN +A   +SQAK L   G + +Q IK  Q  M WE+  I
Sbjct  188   LYVENASERLNLFMDAFTAQDNRAATDSISQAKFLTKIGMRHIQRIKEVQGGMTWEKPQI  247

Query  532   KFFRPYCKNPGERLQEYETPLRGMEMGLVDNNPPQFPVTVLLSSSEVKDSLDSLTGHIS-  708
              F +  C   G+ LQ+ E  +RGM++ +   + P FPV+++  + E++  L S+ G I  
Sbjct  248   LFLKHNCMELGQVLQDLEIMIRGMKIAV--TSCPAFPVSMI--NEELRQVLISMKGKIRL  303

Query  709   --KQVKGRL-FDLATVPESNAQNAVKFLHQKLQPVTLQdlssffflfslklllikpsssi  879
               +Q K  + FD  T PE+  +     L   L+           F F   L LI+  S +
Sbjct  304   KLEQAKCFVPFDATTAPETIEEEVSDKLLWTLETSATTQEELPAFFFFYCLELIRGESPV  363

Query  880   lkdkdGS---------------KEQEERFLDKIYSNFVG-QMNNKRFVASLKYALALGLA  1011
                 +GS               K Q    L +I++  +  ++ ++R+  ++K +L+LG A
Sbjct  364   SPCLEGSGRNTKEIEGEETNDVKNQANGSLRRIWNGLMMIRLGSERWNFAVKCSLSLGFA  423

Query  1012  VFFGSIYSKPDGFWAGLTVAISYVSAREATFRIANVKAQGTVLGSIYGVLGCFVFAKYEE  1191
             V FG I++K +G+W+GLT+AIS+V+ R+ATF +AN +AQ T +GS+YG+LG F+F ++E+
Sbjct  424   VLFGLIFNKQNGYWSGLTIAISFVTGRQATFVVANSRAQATAMGSVYGILGSFIFQRFED  483

Query  1192  LRFISLIPWFIVCSFLRRSRMYGPAGGISACIGAVLILGREGFGPPREFAMARIMETFIG  1371
             LR I L+PW I  SFLR SRMYG AGG SA IGA+LILGR+ +  P EFA+ARI E  IG
Sbjct  484   LRVILLLPWIIFTSFLRHSRMYGQAGGTSAVIGALLILGRKNYSNPNEFAIARITEACIG  543

Query  1372  LACSITVELLFRPTRASSLAKIQLSKSLQLLNQCIISIDYSSNNQS-------KLEETQK  1530
             L C + VE+LF+P RA++LAK QL+ SL+ L  CI  I + +  +S        L   QK
Sbjct  544   LICFVVVEILFQPARAATLAKTQLAWSLRALQGCIEDIVHFTRRKSMSLSVPPDLRGKQK  603

Query  1531  ILKSSVTQLGKFIGEAEVEPNFWFLPFHSACYGKLMGSLSKVVEYLHFVAQALRFLEQES  1710
             +LKS + Q+ KFI EA +EPNFWFLPF  A Y K + SL K+ + + F    +  L + S
Sbjct  604   VLKSHINQMEKFIAEATLEPNFWFLPFQEASYEKFLRSLRKIQDLILFAVYDVEILSRIS  663

Query  1711  ALMG----------RLDSDHLSLFRDHVGPSIKSFEEIISLVGSVSVLDKEFEKKKSSID  1860
               +G           +D DH   F++ V  S++  EE++  + S++ L+ +++K+ +  D
Sbjct  664   EKLGLKWEELEEHINIDLDH---FQEKVYSSLRCLEEVLC-IKSLADLENKWQKRSTDHD  719

Query  1861  PELGKLPTSNNITGLSDEEIDNKLKSFMEDSRQFVDQKdeddddeVMMNSQVALSLSALA  2040
              E GK        GL +E I   + SF+++S++ V  K      E    +Q+ + LS L 
Sbjct  720   VESGKFQNK----GLDEEAILEIVSSFIKNSKEVVG-KVNASKGEQKFKNQMKICLSGLG  774

Query  2041  FCMRGIVRETKEIDKAIKELVQWENPSSPVNLHEISCKIRALAHT  2175
             FC+  ++ E  EI+K +KEL+  ENP+  +NL+EI  KI+ L HT
Sbjct  775   FCISNLMGEIIEIEKEVKELIIMENPTMQINLNEILFKIKNL-HT  818



>ref|XP_007027061.1| Uncharacterized protein TCM_021965 [Theobroma cacao]
 gb|EOY07563.1| Uncharacterized protein TCM_021965 [Theobroma cacao]
Length=673

 Score =   432 bits (1112),  Expect = 4e-137, Method: Compositional matrix adjust.
 Identities = 255/643 (40%), Positives = 379/643 (59%), Gaps = 38/643 (6%)
 Frame = +1

Query  331   KVKHNCHLFAENVSQRLNLLVKAFSAEDNASALSLVSQAKSLNASGAKFLQNIKSKQESM  510
             +V+  C  +AEN S RLNLLV+AF A DN +AL L+++A+  + +GAK L++IK K E M
Sbjct  33    QVRKTCRSYAENASNRLNLLVEAFCARDNVAALDLIAEARLFSKTGAKLLRSIKGKHEGM  92

Query  511   QWERYPIKFFRPYCKNPGERLQEYETPLRGMEMGLVDNNPPQFPVTVLLSSSEVKDSLDS  690
              WE+   +F +P   +PGE+LQE E P+RGME+ L  +    FPV +L    E++  L  
Sbjct  93    LWEKPRFRFLKPKRSDPGEKLQEMEMPIRGMEVAL--STCISFPVRML--DEELQGVLQI  148

Query  691   LTGHIS---KQVKGRL-FDLATVPESNA---------QNAVKFLHQKLQPVTLQdlssff  831
                 I+   +Q K  + FD AT PE+           Q A+   H+ L P          
Sbjct  149   SKKQIALKLEQAKCSVPFDAATAPETKGEYTDRSSWTQKAISTSHEDLSPFFFLYCMELL  208

Query  832   flfslklllikpsssilkdkdGSKEQEERFLDKIYSN---FVGQMNNKRFVASLKYALAL  1002
                   ++  +   S  ++    K+Q +  ++ I+ +   F  +++++R V ++K + +L
Sbjct  209   QDDPECIVENEEGKSKKQESSQPKKQGKSRVELIWCSLLSFSRRLSSERLVFAIKCSFSL  268

Query  1003  GLAVFFGSIYSKPDGFWAGLTVAISYVSAREATFRIANVKAQGTVLGSIYGVLGCFVFAK  1182
             GLAV  G IY+K +G+W+GLT+AIS+ + R+ATF +AN +AQGT +GS+YG+L CF+F K
Sbjct  269   GLAVLLGLIYNKENGYWSGLTIAISFATGRQATFTMANARAQGTAMGSVYGILCCFIFQK  328

Query  1183  YEELRFISLIPWFIVCSFLRRSRMYGPAGGISACIGAVLILGREGFGPPREFAMARIMET  1362
               +LRF  L+PW I  SFLR SRMYG AGGISA IGA+LILGR+ +G P EFA+ARI E 
Sbjct  329   LADLRFFLLLPWIIFTSFLRHSRMYGQAGGISAVIGALLILGRKNYGTPSEFAIARITEA  388

Query  1363  FIGLACSITVELLFRPTRASSLAKIQLSKSLQLLNQCIISID-YSSNNQSKLEETQKI--  1533
              IGL C ITVE+L  P R+++LAK +LS+++  L  C   I  Y+   +   E+ +K+  
Sbjct  389   TIGLICFITVEILLHPARSATLAKTELSRTIGALQDCFEVIGLYNRQKEISTEQREKLQK  448

Query  1534  LKSSVTQLGKFIGEAEVEPNFWFLPFHSACYGKLMGSLSKVVEYLHFVAQALRFLEQESA  1713
             LK  V++L  FI EAE+EPNFWFLPFH +CY KL+ SLSK+ + L F    + FL Q S 
Sbjct  449   LKYHVSKLENFIAEAELEPNFWFLPFHCSCYKKLLSSLSKMADLLPFAIHQIEFLSQASQ  508

Query  1714  LMG--------RLDSDHLSLFRDHVGPSIKSFEEIISLVGSVSVLDKEFEKKKSSIDPEL  1869
              +G        ++++D L   RD +G  +K  +E++ L+ S+  L+ E +K+ +S D EL
Sbjct  509   RLGIHWEEIQEQINND-LEHLRDKIGSLVKCLDEVL-LIKSLEELENELQKENASHDLEL  566

Query  1870  GKLPTSNNITGLSDEEIDNKLKSFMEDSRQF---VDQKdeddddeVMMNSQVALSLSALA  2040
             GK    +    L  E   N +   +  S Q    V  + E ++ E  + SQV L L +L 
Sbjct  567   GKSANGDFSIRLGHER--NSIAEIVWPSLQHMMEVANETEGNEVEAKLKSQVLLCLCSLG  624

Query  2041  FCMRGIVRETKEIDKAIKELVQWENPSSPVNLHEISCKIRALA  2169
             FC+  + RE  E +  I EL++W  P+  VNLHE+  K++ L 
Sbjct  625   FCINNMNREAIETEGTIGELLKWVYPARHVNLHELLPKLKKLG  667



>ref|XP_008457497.1| PREDICTED: uncharacterized protein LOC103497174 [Cucumis melo]
Length=794

 Score =   432 bits (1111),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 316/756 (42%), Positives = 463/756 (61%), Gaps = 51/756 (7%)
 Frame = +1

Query  1     ALRGCWYAIYATCLGVCPAILSLWLIGPahlttgtaaaavaitaFIVVLPQNTHVVAKRI  180
              +RGCW A+YAT   VCPA+   W IGP   +  T A  VA+ + +VVLP ++HV+AKRI
Sbjct  59    TVRGCWLALYATLQTVCPAMAVFWFIGPTKFSYETIALTVALASVVVVLPSSSHVLAKRI  118

Query  181   ALGQTVLVYA---LAGPRTQPIMHPlrvaastaiavaacvlalllpypslassKVKHNCH  351
             ALGQ V++Y    + G +T P+MHP+ VA++TA+ VAA  LA LLP+P LAS +VK    
Sbjct  119   ALGQIVIIYVVGFIGGVQTNPLMHPVHVASTTAMGVAASFLATLLPFPRLASLEVKEKSK  178

Query  352   LFAENVSQRLNLLVKAFSAEDNASALSLVSQAKSLNASGAKFLQNIKSKQESMQWERYPI  531
                E V +RL +LVKAF A+++  A+  +S+A  L+ S  K LQ IK  QESM+WE  P+
Sbjct  179   AMVEMVGERLRVLVKAFLADNDTVAVGSLSKASLLSTSATKLLQPIKQYQESMKWEWIPL  238

Query  532   KFFRPYCKNPGERLQEYETPLRGMEMGLVDNNPPQFPVTVLLSSSEVKDSLDSLTGHISK  711
             K  +       ++LQ+ E P+RGME+ L  +N   +P+        +++ ++SL   I +
Sbjct  239   KVCKLGWLCNSQKLQDLERPIRGMELAL--SNIASYPIL-----QPLQNGINSLENQIIQ  291

Query  712   QV-KGRLF---DLATVPESN----AQNAVKFLH--QKLQPVTLQdlssffflfslkllli  861
              + +G  +   D  T PESN    AQ+    ++  Q   P   ++L SFFF+F LKLL  
Sbjct  292   SLNQGIAYPPSDSHTFPESNPFDEAQDQDPMINTIQLFNPTNHKNLPSFFFIFCLKLLQE  351

Query  862   kpsssilkdkdGSKEQEERFLDKIYSNFV---GQMNNKRFVASLKYALALGLAVFFGSIY  1032
             K  ++ L +    K+ EER      + +    G +++K+ + +LK A++LG+AV+ G IY
Sbjct  352   KSQNNKLPNP--KKKSEERKQTPNTTKWAIPSGILSSKQVMGALKSAISLGIAVYLGLIY  409

Query  1033  SKPDGFWAGLTVAISYVSAREATFRIANVKAQGTVLGSIYGVLGCFVFAKYEELRFISLI  1212
             SK +GFWA L VA+S    REATF+IANVK QGTV+GS+YGVL   +F K+   R + L+
Sbjct  410   SKENGFWASLGVAVSIACTREATFKIANVKLQGTVIGSVYGVLCFVIFEKFLIGRLLCLL  469

Query  1213  PWFIVCSFLRRSRMYGPAGGISACIGAVLILGREGFGPPREFAMARIMETFIGLACSITV  1392
             P F+  SFL+RS+MYG AGG+SA IGAV+ILGR  +G P+E A ARI+ET IG++ SI V
Sbjct  470   PCFVFTSFLQRSKMYGAAGGVSAIIGAVIILGRTNYGSPKELAFARIVETIIGVSSSIMV  529

Query  1393  ELLFRPTRASSLAKIQLSKSLQLLNQCIISIDYSSNNQSKLEETQKILKSSVTQLGKFIG  1572
             +++  PTRAS LAK QL+ +L++L +CI S  +   +   L+ + K L   V +L K I 
Sbjct  530   DIILHPTRASKLAKFQLTSTLRVLLKCINSTSFQPED---LKGSLKELGGHVVELKKLID  586

Query  1573  EAEVEPNFWFLPFHSACYGKLMGSLSKVVEYLHFVAQALRFLEQESALMGRLDSDHLSLF  1752
             EA VEPNFWFLPF S CYGKL+ SLSK V+   FV+ ++  + Q   L+   DS   +  
Sbjct  587   EANVEPNFWFLPFQSGCYGKLLKSLSKTVDLFAFVSHSVEGIGQN--LLVLEDSSSWAKI  644

Query  1753  RDHVGPSIKSFEEI----------ISLVGSVSVLDKEFEKK---KSSI-DPELGKLPTSN  1890
              +++   ++ F+E+          +S + S+ VL+KE EKK   +S + D E+G+   S 
Sbjct  645   GENLEEDVEDFKEMMSGLVKCCADVSSLKSLKVLEKEVEKKNKGESDVGDVEMGE---SK  701

Query  1891  NITGLSDEEIDNKLKSFMEDSRQFVDQKdeddddeVMMNSQVALSLSALAFCMRGIVRET  2070
              +  + + E +  L SFM+   + V+Q  E ++       +  LS SALAFC+  +++E 
Sbjct  702   MVIEMEEMEREKLLCSFMKHYVEIVEQSSESEEG----KREALLSFSALAFCLSSLMKEI  757

Query  2071  KEIDKAIKELVQWENPSSPVNLHEISCKIRALAHTV  2178
             +EI KA +EL+QWENPSS V+ +EIS KI  +   V
Sbjct  758   EEIGKATRELIQWENPSSHVDFNEISSKIHVVQKGV  793



>ref|XP_003625490.1| p-hydroxybenzoic acid efflux pump subunit aaeB [Medicago truncatula]
 gb|ABD32899.1| P-type trefoil, putative [Medicago truncatula]
 gb|AES81708.1| fusaric acid resistance family protein [Medicago truncatula]
Length=813

 Score =   431 bits (1108),  Expect = 6e-135, Method: Compositional matrix adjust.
 Identities = 279/757 (37%), Positives = 423/757 (56%), Gaps = 50/757 (7%)
 Frame = +1

Query  1     ALRGCWYAIYATCLGVCPAILSLWLIGPahlttgtaaaavaitaFIVVLPQNTHVVAKRI  180
             A+RGCW+ + AT   +  ++LSL +I P + +   AA AVA  AF+V LP++TH++ KRI
Sbjct  70    AVRGCWHVLLATIQVMIFSLLSLQVIRPDNFSNCMAALAVATGAFVVALPKSTHLLTKRI  129

Query  181   ALGQTVLVY-------ALAGPRTQPIMHPlrvaastaiavaacvlalllpypslassKVK  339
             A GQ V+VY       A  G  T  I H     A  AIA    +L  L       +   K
Sbjct  130   AYGQLVIVYVSTVIHGAQEGVATHSI-HVACSTALGAIASVLAMLLPLPYPRFAYNEARK  188

Query  340   HNCHLFAENVSQRLNLLVKAFSAEDNASALSLVSQAKSLNASGAKFLQNIKSKQESMQWE  519
              N  L+ EN S+RLN  ++A SA DN++A+  +++AK L+ +GAK L +I +  + M WE
Sbjct  189   FN-QLYIENTSERLNCNIEAISASDNSTAVGFITKAKYLSTTGAKLLHSITTTLDGMHWE  247

Query  520   RYPIKFFRPYCKNPGERLQEYETPLRGMEMGLVDNNPPQFPVTVLLSSSEVKDSLDSLTG  699
             R         C +P E+LQ+ E P+RGM++ L  ++   FPV V+    E++  L +   
Sbjct  248   RPQTLISNSCCIDPEEKLQDLEIPIRGMDIAL--SSGMSFPVGVI--DEELRGVLLNCRE  303

Query  700   HISKQVKGRL-----FDLATVPE-------SNAQNAVKFLHQKLQPVTLQdlssffflfs  843
              IS+++  +      FD  T  E        N   A K L        +Q L     +  
Sbjct  304   QISQKLDQQAKCFVPFDTTTTQEMKQDIFNKNPSIAYKNLPTSFFLYCVQLLRDDLSISK  363

Query  844   lklllikpsssilkdkdGSKEQEERFLDKIYSNFVGQMNNKRFVASLKYALALGLAVFFG  1023
                 + K +      +  S +  ER ++ I SN       +  + + K +L+LG AVFFG
Sbjct  364   KTDHVQKKAQKNDDSQCSSNKLRERLMNLIPSN-------QSLIFAFKSSLSLGFAVFFG  416

Query  1024  SIYSKPDGFWAGLTVAISYVSAREATFRIANVKAQGTVLGSIYGVLGCFVFAKYEELRFI  1203
              IY + + +W+GLT+AIS+V+ R+ TF +AN +  GT +GSIYG++  F+F ++ +LRF+
Sbjct  417   LIYDRDNAYWSGLTIAISFVTGRQPTFSVANARGTGTAMGSIYGIICSFIFQRFVDLRFL  476

Query  1204  SLIPWFIVCSFLRRSRMYGPAGGISACIGAVLILGREGFGPPREFAMARIMETFIGLACS  1383
             +LIPW I  SFLR+SRMYG +G IS  IGA+LILGR+ +  P +F +AR+ E  IGL C 
Sbjct  477   ALIPWVIFSSFLRQSRMYGESGAISTVIGALLILGRKNYSTPTQFGVARMAEATIGLTCF  536

Query  1384  ITVELLFRPTRASSLAKIQLSKSLQLLNQCIISI--------DYSSNNQSKLEETQKILK  1539
             I +E++  P+RA++LAK +LS++L+ L  CI  I        D S ++   L E QK LK
Sbjct  537   IIMEIILSPSRAATLAKSELSQTLRTLQDCIKQIAMITPNERDTSPSSYQALREEQKKLK  596

Query  1540  SSVTQLGKFIGEAEVEPNFWFLPFHSACYGKLMGSLSKVVEYLHFVAQALRFLEQESALM  1719
             S V +L +F  EAE+EPNFWF+PFH+ CY  ++GSLS++V+ L FVA ++  + Q +   
Sbjct  597   SLVCRLREFTAEAEMEPNFWFVPFHTTCYSNMLGSLSRMVDLLLFVAYSMEHVSQLTQKD  656

Query  1720  GRL-------DSDHLSLFRDHVGPSIKSFEEIISLVGSVSVLDKEFEKKKSSIDPELGKL  1878
             G +        ++++ +F++ V P +KS EE I+   S+  L+ E E K    D E  + 
Sbjct  657   GVIWMDIQGQGNENVKIFKNRVAPILKSLEE-ITRTKSIKKLENELESKNVPRDLESQEY  715

Query  1879  PTSNNITGLS-DEEIDNKLKSFMEDSRQFVDQKdeddddeVMMNSQVALSLSALAFCMRG  2055
               ++    L+ DEE+D+   SF++   +  D K   + DE M+  Q+    S   FC   
Sbjct  716   LNADAFGILNRDEEVDSITNSFLQHLEEIAD-KTLTNKDEEMLKIQILFHYSCFGFCTGS  774

Query  2056  IVRETKEIDKAIKELVQWENPSSPVNLHEISCKIRAL  2166
             ++RE  +I+  IKEL+ WENP+S  N  EI  KI AL
Sbjct  775   LMREITKIEGEIKELLIWENPASQTNFKEIHSKINAL  811



>ref|XP_008355687.1| PREDICTED: uncharacterized protein LOC103419345 [Malus domestica]
Length=783

 Score =   427 bits (1098),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 284/726 (39%), Positives = 429/726 (59%), Gaps = 35/726 (5%)
 Frame = +1

Query  4     LRGCWYAIYATCLGVCPAILSLWLIGPahlttgtaaaavaitaFIVVLPQNTHVVAKRIA  183
             +R  W+ I+AT   +  ++L+LWL+ P + + G AAAAVA++AF+V LP++TH+++KRIA
Sbjct  65    MRSSWHVIFATAQVLVSSVLTLWLVEPKNFSVGVAAAAVALSAFVVALPESTHLMSKRIA  124

Query  184   LGQTVLVYA---LAGPRTQPIMHPlrvaastaiavaacvlalllpypslassKVKHNCHL  354
              GQ V VY    + G +T  +MHPL VA+STA+   A V+A+L PYP L+  +V  +  L
Sbjct  125   FGQFVNVYVGTVIHGAQTGVVMHPLGVASSTALGALASVVAVLFPYPRLSYYEVCKSWRL  184

Query  355   FAENVSQRLNLLVKAFSAEDNASALSLVSQAKSLNASGAKFLQNIKSKQESMQWERYPIK  534
             +A N SQRL   ++A ++ D + AL L+SQ +SL+   AK L NI +  E+M WER  IK
Sbjct  185   YAGNASQRLTRFIEAIASRDKSGALELLSQGQSLSKEAAKLLHNITNNLETMVWERPHIK  244

Query  535   FFRPYCKNPGERLQEYETPLRGMEMGLVDNNPPQFPVTVLLSSSEVKDSLDSLTGHISK-  711
             F +P   + GERLQE E PLRGME+ L  ++    PV ++    E++ +L S   H+   
Sbjct  245   FLKPKYMDLGERLQETEVPLRGMEIAL--SSCSSHPVNLI--DEELRGNLQSSEAHVRLR  300

Query  712   --QVKGRLFDLATV-PESNAQNAVKFL---------HQKLQPVTLQdlssffflfslkll  855
               Q K  L   AT+ PES+ +   K L         H+ L                    
Sbjct  301   LLQAKYSLPSDATLAPESDREIFDKPLWTKKPTTKNHEDLPAFFFLYCMELLLENQPIAR  360

Query  856   likpsssilkdkdGSKEQEERFLDKIYSNFVGQMNNKRFVASLKYALALGLAVFFGSIYS  1035
               + +    ++   S+ Q      +++ N +   + +  + +LK +LALGLAV FG +Y+
Sbjct  361   NPRNTRKPNQEPSDSQNQHLWNFKRVWRNIIP--SRRSLIFALKCSLALGLAVLFGLLYN  418

Query  1036  KPDGFWAGLTVAISYVSAREATFRIANVKAQGTVLGSIYGVLGCFVFAKYEELRFISLIP  1215
             K +G+W+GLT+AIS+V+ R+ATF + N + QGT LGSIYG+L  F+F   E+ R + L+P
Sbjct  419   KENGYWSGLTIAISFVTGRQATFTVTNARVQGTALGSIYGILWFFIFXXXEKFRLLPLLP  478

Query  1216  WFIVCSFLRRSRMYGPAGGISACIGAVLILGREGFGPPREFAMARIMETFIGLACSITVE  1395
             W I+C FLR SRMYG AGG+SA IGA+LILGR+ +G P EFA+ARI+E  IGL C +TVE
Sbjct  479   WIIICHFLRYSRMYGQAGGVSAAIGALLILGRDNYGAPSEFAIARIIEASIGLLCFLTVE  538

Query  1396  LLFRPTRASSLAKIQLSKSLQLLNQCIISIDYSSNNQSKLEETQKILKSSVTQLGKFIGE  1575
             + F P RA++LAK +LS+S+ +L   I  ++  +   + L + Q+ LKS V +L KFI E
Sbjct  539   IAFYPMRAATLAKNKLSQSMGVLRDSIEGVNLCAPASTGLRDKQRKLKSHVKELEKFIQE  598

Query  1576  AEVEPNFWFLPFHSACYGKLMGSLSKVVEYLHFVAQALRFLEQESALMG--------RLD  1731
             AE EPN WFLPF  + Y +++GSLSK+ + L FVA    FL Q     G        +++
Sbjct  599   AETEPNCWFLPFKGSGYNQVLGSLSKIADLLLFVAYKTEFLAQVEQNFGGVWEELRQQMN  658

Query  1732  SDHLSLFRDHVGPSIKSFEEIISLVGSVSVLDKEFEKKKSSIDPELGKLPTSNNITGLSD  1911
             +D L L ++ +   ++  EE  S +  + V   E + +    D ELG  P      G  D
Sbjct  659   AD-LGLLKEKINSPLRCLEEATS-IKPLQV--SETKSESDYHDSELGNPPRGFATLGTDD  714

Query  1912  EEIDNKLKSFMEDSRQFVDQKdeddddeVMMNSQVALSLSALAFCMRGIVRETKEIDKAI  2091
             EE++  + +F++  ++  D K    + E    SQ+ L L++L FC++ I RET E+ K +
Sbjct  715   EEVETIVSNFLQHLQEVAD-KVHASNSEEKHKSQMVLCLTSLGFCIQSITRETMEMKKDV  773

Query  2092  KELVQW  2109
             ++LV++
Sbjct  774   RKLVKF  779



>ref|XP_009338779.1| PREDICTED: uncharacterized protein LOC103931090 [Pyrus x bretschneideri]
 ref|XP_009338780.1| PREDICTED: uncharacterized protein LOC103931091 [Pyrus x bretschneideri]
Length=783

 Score =   421 bits (1082),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 289/724 (40%), Positives = 430/724 (59%), Gaps = 33/724 (5%)
 Frame = +1

Query  4     LRGCWYAIYATCLGVCPAILSLWLIGPahlttgtaaaavaitaFIVVLPQNTHVVAKRIA  183
             +R CW+ I+AT   +  ++L+LWL+ P + + G AAAAVA++AF+V LP++TH+++KRIA
Sbjct  65    MRSCWHVIFATAQVLVSSVLTLWLVEPKNFSVGVAAAAVALSAFVVALPESTHLMSKRIA  124

Query  184   LGQTVLVYA---LAGPRTQPIMHPlrvaastaiavaacvlalllpypslassKVKHNCHL  354
              GQ V VY    + G +T  +MHPL VA+STA+   A V+A+L PYP L+  +V  +  L
Sbjct  125   FGQFVNVYVGTVIHGAQTGVVMHPLGVASSTALGALASVVAVLFPYPRLSYYEVCKSWQL  184

Query  355   FAENVSQRLNLLVKAFSAEDNASALSLVSQAKSLNASGAKFLQNIKSKQESMQWERYPIK  534
             +A N SQRL   V+A  + D + AL L+SQ +SL+   AK L +I +  E+M WE   IK
Sbjct  185   YAGNASQRLTRFVEAIVSRDKSGALELLSQGQSLSKEAAKLLHSITNNLETMVWEGPHIK  244

Query  535   FFRPYCKNPGERLQEYETPLRGMEMGLVDNNPPQFPVTVLLSSSEVKDSLDSLTGHISK-  711
             F +P   + GERLQE E PLRG+E+ L  ++    PV ++    E++ +L S   H+   
Sbjct  245   FLKPKYMDLGERLQEMEVPLRGLEIAL--SSCSSHPVNLI--DEELRGNLQSSEAHVRLR  300

Query  712   --QVKGRLFDLATV-PESNAQNAVKFLHQKLQPVTLQdlssffflfslklllikpsssil  882
               Q K  L   AT+ PES+ +   K L  K +P T        F F   + L+  +    
Sbjct  301   LLQAKYSLPSDATLAPESDREIFDKPLWTK-KPTTKNREDVPAFFFLYCMELLLENQPTA  359

Query  883   kdkdGSKEQEERFLDKIYS---NFVGQMNN-----KRFVASLKYALALGLAVFFGSIYSK  1038
             ++   +++  +  +D       NF G   N     +  + +LK +LALGLAV FG +Y+K
Sbjct  360   RNPGNTRKPNQEPIDSQNQQRWNFKGVWRNILPSRRSSIFALKCSLALGLAVLFGLLYNK  419

Query  1039  PDGFWAGLTVAISYVSAREATFRIANVKAQGTVLGSIYGVLGCFVFAKYEELRFISLIPW  1218
              +G+W+GLT+AIS+V+ R+ATF + N + QGT LGSIYG+L  F+F   E+ R + LIPW
Sbjct  420   ENGYWSGLTIAISFVTGRQATFTVTNARVQGTALGSIYGILWFFIFHGLEKFRLLPLIPW  479

Query  1219  FIVCSFLRRSRMYGPAGGISACIGAVLILGREGFGPPREFAMARIMETFIGLACSITVEL  1398
               +C FLR SRMYG AGGISA IGA+LILGR+ +G P +FA+ARI+E  IGL C +TVE+
Sbjct  480   IFICHFLRYSRMYGQAGGISAAIGALLILGRDNYGAPSDFAIARIIEASIGLLCFLTVEI  539

Query  1399  LFRPTRASSLAKIQLSKSLQLLNQCIISIDYSSNNQSKLEETQKILKSSVTQLGKFIGEA  1578
              F P RA++LAK +LS+++ +L  CI  ++      + L + Q+ LKS V +L  FI EA
Sbjct  540   AFYPMRAATLAKNKLSRTMGVLRDCIEGVNLCVPASTGLRDKQRKLKSHVKELETFIQEA  599

Query  1579  EVEPNFWFLPFHSACYGKLMGSLSKVVEYLHFVAQALRFLEQESALMG--------RLDS  1734
             E EPN WFLPF  + Y +++GSLSK+ + L FVA    FL Q     G        +++ 
Sbjct  600   ETEPNCWFLPFKGSGYNRVLGSLSKIADLLLFVAYKTEFLAQIGQNFGGVWEELRQQMNV  659

Query  1735  DHLSLFRDHVGPSIKSFEEIISLVGSVSVLDKEFEKKKSSIDPELGKLPTSNNITGLSDE  1914
             D L L ++ +   ++  EE  S +  + V   E + +    D ELG  P      G  DE
Sbjct  660   D-LGLLKEKINSPLRCLEEATS-IKPLPV--SETKSESDYHDSELGNPPRGFATLGTDDE  715

Query  1915  EIDNKLKSFMEDSRQFVDQKdeddddeVMMNSQVALSLSALAFCMRGIVRETKEIDKAIK  2094
             E++  + +F++  ++  D K    D E    SQ+ L L++L FC++ I RET E+ K ++
Sbjct  716   EVETIVSNFLQHLQEVAD-KVHASDSEEKHKSQMVLCLTSLGFCIQSITRETMEMKKDVR  774

Query  2095  ELVQ  2106
             +LV+
Sbjct  775   KLVK  778



>ref|XP_009374702.1| PREDICTED: uncharacterized protein LOC103963596 [Pyrus x bretschneideri]
Length=776

 Score =   412 bits (1059),  Expect = 4e-128, Method: Compositional matrix adjust.
 Identities = 275/716 (38%), Positives = 409/716 (57%), Gaps = 42/716 (6%)
 Frame = +1

Query  4     LRGCWYAIYATCLGVCPAILSLWLIGPahlttgtaaaavaitaFIVVLPQNTHVVAKRIA  183
             +R CW+ I+AT   +  ++L+LWL+ P + T   A  A+A++AF+V LP++TH+++KRIA
Sbjct  65    MRSCWHVIFATAQVLLSSVLTLWLVEPKNFTVEVAVVAIALSAFVVALPESTHLMSKRIA  124

Query  184   LGQTVLVYA---LAGPRTQPIMHPlrvaastaiavaacvlalllpypslassKVKHNCHL  354
              GQ V VY    + G +T  +MHPL VA+ST +   A V+A+L PYP L+  +V  +  +
Sbjct  125   FGQFVSVYVGTVIHGAQTGVVMHPLGVASSTVLGAFASVVAMLFPYPRLSYYEVSESWRM  184

Query  355   FAENVSQRLNLLVKAFSAEDNASALSLVSQAKSLNASGAKFLQNIKSKQESMQWERYPIK  534
             +A N SQRL   V+A S+ D + AL L+SQ +SL+   AK LQ+I +  E+M WER  IK
Sbjct  185   YAGNASQRLARFVEAISSRDKSGALELLSQGQSLSKEAAKLLQSISNNLETMVWERPHIK  244

Query  535   FFRPYCKNPGERLQEYETPLRGMEMGLVDNNPPQFPVTVL-------LSSSEVKDSLDSL  693
             F +P   + GERLQE E PLRGME+ L  ++    PV ++       L SSEV+  L  L
Sbjct  245   FLKPNYLDSGERLQEIEVPLRGMEIAL--SSCSSHPVNLIDEELRRNLQSSEVQVRLRLL  302

Query  694   TGHISKQVKGRL--------FD---LATVPESN-AQNAVKFLHQKLQPVTLQdlssfffl  837
                 S      L        FD    A  P +N  +N   F       + L++       
Sbjct  303   QAKYSLPSDATLAPESYREIFDKPLWAGKPTTNNRENLPAFFFLYCMELLLENQPIARNP  362

Query  838   fslklllikpsssilkdkdGSKEQEERFLDKIYSNFVGQMNNKRFVASLKYALALGLAVF  1017
              + +    +PS         S+ Q+      ++ N +   + +  + +LK +LALGLAV 
Sbjct  363   GNTRKPNQEPS--------DSQNQQRWTFKSVWRNIIP--STRSIIFALKCSLALGLAVL  412

Query  1018  FGSIYSKPDGFWAGLTVAISYVSAREATFRIANVKAQGTVLGSIYGVLGCFVFAKYEELR  1197
             FG +Y+K +G+W+GLT+AIS+V+ R+ATF + N + QGT LGSIYG++  F+F + E+ +
Sbjct  413   FGLLYNKENGYWSGLTIAISFVTGRQATFTVTNARVQGTALGSIYGIIWLFIFQRLEKFK  472

Query  1198  FISLIPWFIVCSFLRRSRMYGPAGGISACIGAVLILGREGFGPPREFAMARIMETFIGLA  1377
              + LIPW   C FLR SRMYG AGGISA IGA+LILGRE +GPP EFA  R++E  IGL 
Sbjct  473   LVPLIPWIFFCHFLRHSRMYGQAGGISAAIGALLILGRENYGPPSEFAFTRMIEASIGLL  532

Query  1378  CSITVELLFRPTRASSLAKIQLSKSLQLLNQCIISIDYSSNNQSKLEETQKILKSSVTQL  1557
             C + VE++F P RA++LAK +LS+S++ L  C I ++      + L E ++ LKS + +L
Sbjct  533   CFLFVEIVFYPMRAATLAKNKLSQSMEALRDC-IGVNLCVPASTGLREKRRKLKSHMKEL  591

Query  1558  GKFIGEAEVEPNFWFLPFHSACYGKLMGSLSKVVEYLHFVAQALRFLEQESALMGRLDSD  1737
               FI EAE EPN WFLPF  A Y +++GSLSK+ + L FVA    FL Q     G +  +
Sbjct  592   ETFIQEAETEPNCWFLPFQGAGYNRVLGSLSKIADLLLFVAYKTEFLAQVEQNFGGVWEE  651

Query  1738  HLSLFRDHVGPSIKSFEEIISLVGSVSVLD-KEFEKKKSSIDPELGKLPTSNNITGLSDE  1914
                  R  +   ++  +  +    S+  +   E   +    D ELGK P      G +D+
Sbjct  652   ----LRQQMNADLELLKVCLEEASSIKPMPVSETMSESDYHDSELGKPPRGFATLGCTDD  707

Query  1915  -EIDNKLKSFMEDSRQFVDQKdeddddeVMMNSQVALSLSALAFCMRGIVRETKEI  2079
              E++  + SF++  ++  D K    D E    SQ+ L L++L FC+  ++RE  E+
Sbjct  708   KEVETIVSSFLQHLQEVAD-KVHTSDIEEKQKSQMILCLTSLGFCISSVMREAMEM  762



>ref|XP_010418812.1| PREDICTED: uncharacterized protein LOC104704415, partial [Camelina 
sativa]
Length=594

 Score =   404 bits (1037),  Expect = 5e-127, Method: Compositional matrix adjust.
 Identities = 255/538 (47%), Positives = 354/538 (66%), Gaps = 19/538 (4%)
 Frame = +1

Query  4     LRGCWYAIYATCLGVCPAILSLWLIGPahlttgtaaaavaitaFIVVLPQN-THVVAKRI  180
             LRGCW A+YATC  V PAI++L LIGPA LT  T A A A+ AF+VVLP + TH+VAKRI
Sbjct  66    LRGCWLALYATCQSVGPAIVTLKLIGPARLTAETTALAAALAAFVVVLPNSSTHLVAKRI  125

Query  181   ALGQTVLVYALA---GPRTQPIMHPlrvaastaiavaacvlalllpypslassKVKHNCH  351
             ALGQ VL+Y +    G  T P+MHPLRVAASTA+ V ACVLALL+P P LA+ +VK +  
Sbjct  126   ALGQIVLIYVIGYIKGAETDPVMHPLRVAASTALGVVACVLALLVPLPRLATCEVKQSSK  185

Query  352   LFAENVSQRLNLLVKAFSAEDNASALSLVSQAKSLNASGAKFLQNIKSKQESMQWERYPI  531
                +N++ R+ L +KAF  ED  SA + VSQA+ L  + +K  Q IK  Q SM WER P 
Sbjct  186   ELGQNITTRVKLYMKAFCTEDAMSATASVSQARVLARTSSKLYQTIKRYQPSMTWERLPF  245

Query  532   KFFR--PYCKNPGERLQEYETPLRGMEMGLVDNNPPQFPVTVLLSSSEVKDSLDSLTGHI  705
             K +R      N GE+LQ  E  LRGMEM +   +P   P ++L    EVKD L ++   +
Sbjct  246   KIWRWQNVNDNKGEKLQSMEIALRGMEMVVASKSP--IPTSLL--EGEVKDGLKNIQERV  301

Query  706   SKQVK--GRLFDLATVPESNAQNAVKFLHQKLQPVTLQdlssffflfslklllikpsssi  879
                +K        +  PES+ + + +   Q     TLQ++            L       
Sbjct  302   ILSIKRANNSPQPSVTPESDPKKSDEECLQ-----TLQEIPGTSQDLPFYFFLFCLRLLE  356

Query  880   lkdkdGSKEQEERFLDKIYS-NFVGQMNNKRFVASLKYALALGLAVFFGSIYSKPDGFWA  1056
                    +E + + L+K  + +++   ++K+ +  LK +L+LG A+  GS++SKP+G+WA
Sbjct  357   TITMAKPEENKVKVLEKSKTRSWINDWDSKKVMPVLKLSLSLGFAILLGSMFSKPNGYWA  416

Query  1057  GLTVAISYVSAREATFRIANVKAQGTVLGSIYGVLGCFVFAKYEELRFISLIPWFIVCSF  1236
             GL VA+S+ +AREATF++ANVKAQGTV+G++YGV+GCFVF K+  +RF+SL+PWF+  SF
Sbjct  417   GLPVAVSFAAAREATFKVANVKAQGTVIGTVYGVMGCFVFQKFLSVRFLSLLPWFLFSSF  476

Query  1237  LRRSRMYGPAGGISACIGAVLILGREGFGPPREFAMARIMETFIGLACSITVELLFRPTR  1416
             L RSRMYG AGGISA IGAVLILGR+ FGPP EFA+ RI+ETFIGL+C+I VEL+F+PTR
Sbjct  477   LSRSRMYGQAGGISAAIGAVLILGRKNFGPPSEFAIERIIETFIGLSCAIMVELIFQPTR  536

Query  1417  ASSLAKIQLSKSLQLLNQCIISIDYSSNNQSKLEETQKILKSSVTQLGKFIGEAEVEP  1590
             A+++AK++LS+S   L +C  S+  +  +++++ E+QK L+S + +L KF  EA  EP
Sbjct  537   AANIAKLELSRSFHALYEC-ASLFGAKASKAEIMESQKKLRSHLNELKKFTAEAHAEP  593



>emb|CAN79695.1| hypothetical protein VITISV_023936 [Vitis vinifera]
Length=1508

 Score =   402 bits (1034),  Expect = 7e-119, Method: Compositional matrix adjust.
 Identities = 258/650 (40%), Positives = 369/650 (57%), Gaps = 59/650 (9%)
 Frame = +1

Query  355   FAENVSQRLNLLVKAFSAEDNASALSLVSQAKSLNASGAKFLQNIKSKQESMQWERYPIK  534
             +AEN S+RLNL ++AFSA DN++AL  +SQAK  +  G K LQ I+        E Y I 
Sbjct  870   YAENASERLNLFLEAFSAPDNSAALDSISQAKFFSERGDKLLQTIR------LVESYFIL  923

Query  535   FFRPYC--------KNPGERLQEYETP-----LRGMEMGLVDNNPPQFPVTVLLSSSEVK  675
                 +C         NP    Q  +       LRGME+ L  ++    P  +  +  E+ 
Sbjct  924   NRMAFCGRDLGQDSSNPIASTQXIDCKPSKYHLRGMEIAL--SSFTSLPTAI--ADDELG  979

Query  676   DSLDSLTGHISKQVKGRLFDLATVPESNAQNAVKFLHQKLQPVTLQdlssffflf-----  840
             D+L  +T + S +++           +   +  KFL + LQ +     +           
Sbjct  980   DALQRVTLNTSLRLEQAKCSQPLASTTVXNSTGKFLDKPLQALKTISPAHAAPSAFFFLS  1039

Query  841   -----slklllikpsssilkdkdGSKEQEERFLDK--------IYSNFVGQMNNKRFVAS  981
                     L   +    I      S  +E R   K        ++S++   + + R V +
Sbjct  1040  CMQLLQDGLPSPQNPEPISNIGHKSNTEESRNSKKPVTYSFKMMWSSWNMSLASGRLVFA  1099

Query  982   LKYALALGLAVFFGSIYSKPDGFWAGLTVAISYVSAREATFRIANVKAQGTVLGSIYGVL  1161
              K +L+LGLAV FG +Y+K + +W+GLT+AIS+ + R+A F +AN +AQGT +GS++G+L
Sbjct  1100  FKCSLSLGLAVLFGLMYNKENAYWSGLTIAISFATGRQAMFTVANARAQGTAMGSVFGIL  1159

Query  1162  GCFVFAKYEELRFISLIPWFIVCSFLRRSRMYGPAGGISACIGAVLILGREGFGPPREFA  1341
             GCFVF     +RF+ L+PW I  SFL  SRMYG AGGISA IGA+LILGR+ +G P EFA
Sbjct  1160  GCFVFQSSMVIRFLLLLPWIIFASFLMHSRMYGQAGGISAVIGALLILGRKNYGSPSEFA  1219

Query  1342  MARIMETFIGLACSITVELLFRPTRASSLAKIQLSKSLQLLNQCIISI-------DYSSN  1500
             +ARI E FIGL+C I VE+L RP RA++LAKIQLS+SL  L +CI  +       D    
Sbjct  1220  IARITEAFIGLSCFIVVEILLRPRRAATLAKIQLSQSLATLQECIKEMVVCVGQTDSPDF  1279

Query  1501  NQSKLEETQKILKSSVTQLGKFIGEAEVEPNFWFLPFHSACYGKLMGSLSKVVEYLHFVA  1680
                 + E Q  LK +V +L KFIGEA++EPNFWFLPF  ACY KL   LSKV + L FVA
Sbjct  1280  VLPAMREKQNKLKMNVNELNKFIGEAKLEPNFWFLPFQGACYSKLWEXLSKVEDLLLFVA  1339

Query  1681  QALRFLEQES--------ALMGRLDSDHLSLFRDHVGPSIKSFEEIISLVGSVSVLDKEF  1836
               + FL   S         +   + SD L LF++ V  S+K   +I S + S+++L+KE 
Sbjct  1340  HNIDFLLXASQXFEVSWKEIQXNIHSD-LELFKETVASSLKYLVKITS-IESLTLLEKEL  1397

Query  1837  EKKKSSIDPELGKLPTSNNITGLSDEEIDNKLKSFMEDSRQFVDQKdeddddeVMMNSQV  2016
             +KK  + D ELG+ P ++ +    DEEI+  L SF++ S + +++    + D+  + SQ+
Sbjct  1398  QKKIIAHDLELGRPPNAHWVWXTDDEEIEKILASFLQHSEEXINE-IHXNKDKEELKSQM  1456

Query  2017  ALSLSALAFCMRGIVRETKEIDKAIKELVQWENPSSPVNLHEISCKIRAL  2166
              LSL AL FCM  ++RET++I+K I+ELVQWENPSS ++  EISCKI AL
Sbjct  1457  VLSLGALGFCMGSLMRETRKIEKGIQELVQWENPSSYIDFSEISCKINAL  1506



>ref|XP_011077457.1| PREDICTED: uncharacterized protein LOC105161462 [Sesamum indicum]
 ref|XP_011077458.1| PREDICTED: uncharacterized protein LOC105161462 [Sesamum indicum]
Length=784

 Score =   387 bits (994),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 283/747 (38%), Positives = 424/747 (57%), Gaps = 74/747 (10%)
 Frame = +1

Query  4     LRGCWYAIYATCLGVCPAILSLWLIGPah-lttgtaaaavaitaFIVVLPQNTHVVAKRI  180
             LRGCW+A  AT   V  A+L+ W++GP   L  G A+  VA+ AF+V LP+ TH+ AKRI
Sbjct  68    LRGCWHAFCATVQVVPLAMLARWIMGPTGGLQVGVASLVVAVAAFLVALPECTHLTAKRI  127

Query  181   ALGQTVLVYALA------GPRTQPIMHPlrvaastaiavaacvlalllpypslassKVKH  342
             A GQ VLV + A         T   MHP+ VAAST +   A VLALL+PYP LA SKV+ 
Sbjct  128   AFGQIVLVCSDAVIGSGASRSTAGFMHPVYVAASTGLGALASVLALLVPYPGLAHSKVRK  187

Query  343   NCHLFAENVSQRLNLLVKAFSAEDNASALSLVSQAKSLNASGAKFLQNIKSKQESMQWER  522
              C ++AEN S+R+N+ ++AF AED+ + + L+SQAK L+ +GAK LQ+I+  QESMQWE+
Sbjct  188   LCGVYAENASERMNVYLRAFRAEDDHAKMELISQAKPLSETGAKLLQSIRILQESMQWEK  247

Query  523   YPIKFFRPYCKN---PGERLQEYETPLRGMEMGLVDNNPPQFPVTVLLSSSEVKDSLDSL  693
              P  + R +  N   PG+RL+  E  +RG+E  LV +  P FPV V+      ++ L ++
Sbjct  248   -PWTWSRCFKHNLLSPGDRLESMELQMRGIEYSLVSS--PAFPVQVV-----DQEQLSNI  299

Query  694   TGHISKQVKGRLFDLATVPESNA----QNAVKFLHQKLQPVT-LQdlssffflfslklll  858
                +S Q++ +L  +  +  S +    +   +F+ + L P+  +  +  + ++      +
Sbjct  300   LKGVSVQLEQKLEQVTRLSRSRSMTEPETRGEFMEKPLLPLEPMFPILKYGWVLFYFSCI  359

Query  859   ikpsssilkdkdGSKEQEER-------FLDKIYSNFVGQMNNKRFVASLKYALALGLAVF  1017
                 +        S+E + R        +    S  +  ++ +R   + K +LALGLA+ 
Sbjct  360   DMLLNDAADTCFASRELQTRRAKTEFSIVRAFKSWILKLVSKERLRFAFKCSLALGLAML  419

Query  1018  FGSIYSKPDGFWAGLTVAISYVSAREATFRIANVKAQGTVLGSIYGVLGCFVFAKYEELR  1197
             FG I+ K +G WAGLT+AIS+V  R+A F +AN + QGT +GS+YGV+ CF+F  +EELR
Sbjct  420   FGLIFDKENGCWAGLTLAISFVQGRQAVFTVANTRGQGTAIGSVYGVIWCFLF-HHEELR  478

Query  1198  FISLIPWFIVCSFLRRSRMYGPAGGISACIGAVLILGREGFGPPREFAMARIMETFIGLA  1377
              ++L+PW I  S LR S+MYG  GG+SA IGA+LILGR+ +G P EFA+AR+ E FIGL 
Sbjct  479   LLALLPWIIFTSLLRYSKMYGQTGGVSATIGALLILGRKNYGEPNEFAIARLTEVFIGLT  538

Query  1378  CSITVELLFRPTRASSLAKIQLSKSLQLLNQCIISIDYS--SNNQS-----KLEETQKIL  1536
               + VELL +P RA++LAK  L ++L  L  CI  I       NQ+     KL + Q+ L
Sbjct  539   AFLAVELLLQPIRAATLAKNHLHQTLCSLRDCIKEIATCPMQKNQTVVKFDKLRDKQRNL  598

Query  1537  KSSVTQLGKFIGEAEVEPNFWFLPFHSACYGKLMGSLSKVVEYLHFVAQALRFLEQESAL  1716
              S V +L K + +AE+EP+FW+LPF S+CY KL+G LS +V+ L+F+      L + S  
Sbjct  599   SSLVCELKKIVADAELEPDFWYLPFCSSCYQKLVGHLSNIVDMLYFITSNFERLSELSE-  657

Query  1717  MGRLDSDHLSLFRDHVGPSIKSFEEIISLVGSVSVLDKEFE-----KKKSSIDPEL----  1869
                  S     FRD +   ++ F+E +S   SV  L+K          + ++D EL    
Sbjct  658   ----TSTICKEFRDQISSELELFQETLS--SSVEYLEKAHSIESQADSQETVDEELKDLE  711

Query  1870  -GKLPTSNN----ITGLSDEEIDNKLKSFMEDSRQFVDQKdeddddeVMMNSQVALSLSA  2034
              GKL   +     IT   + E++N+ +   ED+R+                 ++   L A
Sbjct  712   VGKLQNPDGQSALITKHKEAEMNNE-EEVGEDNRR--------------QRQKMIQCLGA  756

Query  2035  LAFCMRGIVRETKEIDKAIKELVQWEN  2115
             L FC+  +V+E  E +   +E+ QWEN
Sbjct  757   LGFCISSLVKEIDETEICRREIDQWEN  783



>gb|KDO72910.1| hypothetical protein CISIN_1g045253mg [Citrus sinensis]
Length=694

 Score =   383 bits (984),  Expect = 6e-118, Method: Compositional matrix adjust.
 Identities = 281/661 (43%), Positives = 377/661 (57%), Gaps = 80/661 (12%)
 Frame = +1

Query  148   PQNTHVVAKRIALGQTVLVYALA---GPRTQPIMHPlrvaastaiavaacvlalllpyps  318
             P+ TH+VAKRIALGQ VL Y +    G  +  +M P+RVAASTAI V ACVLALLLPYP 
Sbjct  94    PEGTHLVAKRIALGQIVLTYVMGFVNGEHSGAVMLPVRVAASTAIGVLACVLALLLPYPR  153

Query  319   lassKVKHNCHLFAENVSQRLNLLVKAFSAEDNASALSLVSQAKSLNASGAKFLQNIKSK  498
             LA  +VK NC   A+N S+RL L VKA  AED ++AL+ +S AKSL  SG K +QNIK  
Sbjct  154   LACYEVKWNCKQLADNASERLRLYVKALCAEDKSTALASISLAKSLTKSGTKHIQNIKRY  213

Query  499   QESMQWERYPIKFFRPYCKNPGERLQEYETPLRGMEMGLVDNNPPQFPVTVLLSSSEVKD  678
             QE+M+WE  P KF       P ++ Q  E PLRGMEM +   +   FP+        V +
Sbjct  214   QENMKWE-IPFKFLGSNYVKPVKKFQYLELPLRGMEMAV--TSATSFPMQTFDGLPRVLE  270

Query  679   SLDSLTGHISKQVKGR--LFDLATVPESNAQNAVKFLHQKLQPVTLQdlssffflfslkl  852
                 LT    K+VK    L +  TVPESN + ++K      Q +     +  FF F   +
Sbjct  271   EHTCLT---IKKVKSYQILCNSMTVPESNEEYSLK----NFQTIPTISQNLPFFFFLFCM  323

Query  853   llikpsssilkdkdGSKEQEERFLDKIYSNFVGQMNNKRFVASLKYALALGLAVFFGSIY  1032
              L+   +        S E+      +  ++   ++ +KRF+ + + + +LGLAV FG ++
Sbjct  324   KLLNYRTPKTDGSTNSCEEHVLSFKEACTSRACKVKSKRFMPAFQCSFSLGLAVLFGLLF  383

Query  1033  SKPDGFWAGLTVAISYVSAREATFRIANVKAQGTVLGSIYGVLGCFVFAKYEELRFISLI  1212
             SKP+G W+GL+ AIS+ +AREATF+            ++YGVLGCF+F K   +RF+ L 
Sbjct  384   SKPNGIWSGLSAAISFATAREATFK-----------RTVYGVLGCFLFEKLLPIRFLFLF  432

Query  1213  PWFIVCSFLRRSRMYGPAGGISACIGAVLILGREGFGPPREFAMARIMETFIGLACSITV  1392
             PWFI  SFLR  RMYG  GGISA IGAVLILGR+ FGPP EFA+ARI+ETFIGL C+I  
Sbjct  433   PWFIFTSFLRHGRMYGQGGGISAVIGAVLILGRKSFGPPEEFAIARIVETFIGLTCTIIG  492

Query  1393  ELLFRPTRASSLAKIQLSKSLQLLNQCIISIDYSSNNQSKLEETQKILKSSVTQLGKFIG  1572
             ELLF+ TRAS+LAK QLSK                                      FI 
Sbjct  493   ELLFQSTRASTLAKSQLSKR------------------------------------TFIR  516

Query  1573  EAEVEPNFWFLPFHSACYGKLMGSLSKVVEYLHFVAQALRFLEQESALMG---------R  1725
             EA+VEPNF FLPFHSACY KL+ SL K+V  LHF + ++ FLEQES  +          +
Sbjct  517   EADVEPNFGFLPFHSACYSKLLVSLVKMVHLLHFCSYSIGFLEQESQKIDKASWKEDVQK  576

Query  1726  LDSDHLSLFRDHVGPSIKSFEEIISLVGSVSVLDKEFEKKKSSI--DPELGKLPTSNNI-  1896
             LD D + L ++    SIK F + I+ + S+++L+K+  +K  ++  D E G  P    + 
Sbjct  577   LDGD-VKLVKEMACSSIKCFNDAITTIKSLAILEKKLGRKTFNVFRDIECGNSPIGLCVP  635

Query  1897  TGLSDEEIDNKLKSFMEDSRQF---VDQKdeddddeVMMNSQVALSLSALAFCMRGIVRE  2067
              G+ D + +NK K  +    Q    +D K +  D E   N Q+ LSLSAL +CMR ++ E
Sbjct  636   NGILDSD-ENKEKIVINTYLQHLQELDDKIKKVDVEEFKN-QIVLSLSALGYCMRSLIIE  693

Query  2068  T  2070
             T
Sbjct  694   T  694



>ref|XP_010543320.1| PREDICTED: uncharacterized protein LOC104816285 [Tarenaya hassleriana]
Length=791

 Score =   384 bits (987),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 284/742 (38%), Positives = 406/742 (55%), Gaps = 66/742 (9%)
 Frame = +1

Query  4     LRGCWYAIYATCLGVCPAILSLWLIGPa-hlttgtaaaavaitaFIVVLPQNTHVVAKRI  180
             LRGC +A YAT   +  A++SL ++ PA   ++  AAAAVA+  FIV LP++T ++AKR+
Sbjct  66    LRGCVHASYATFQMMGLALVSLRMVPPAWLSSSPVAAAAVALAVFIVALPESTSLLAKRV  125

Query  181   ALGQTVLVYA----LAGPRTQPIMHPlrvaastaiavaacvlalllpypslassKVKHNC  348
             A GQ V++Y       G    P+MHP++VAASTA+   A +LA+L+P+P LA S++K  C
Sbjct  126   AFGQIVILYVSLVIFEGEPVHPVMHPVQVAASTALGAIASLLAMLVPFPRLAHSQMKSAC  185

Query  349   HLFAENVSQRLNLLVKAFSAEDNASALSLVSQAKSLNASGAKFLQNIKSKQESMQWERYP  528
               + EN S+R+NL VKA  A DN  A  L++QA S +A+    LQ IK   E M WER  
Sbjct  186   RSYGENASERMNLFVKAVIARDNTEAQPLIAQAGSFSATARSILQTIKLHNEGMTWERPE  245

Query  529   IKFFRPYCKNP--GERLQEYETPLRGMEMGLVDNNPPQFPVTVLLSSSEVKDSLDSLTGH  702
              +FF    K    G++LQ  E PLRGME+ L   +   FP+   L   E++ SL+S    
Sbjct  246   TRFFGQKQKQTDLGQKLQGMEIPLRGMELAL--GSCRSFPI--YLRHEELRHSLESSREQ  301

Query  703   I---SKQVKGRLFDLATVPESNAQ-------------------NAVKFLHQKLQPVTLQd  816
             I   S  + G +  L T  ES  +                     V+ L   L P T   
Sbjct  302   IALGSSILPGSVSALKTKDESKPRWHLEVGSLSPPDLPVCFFWCCVELLRGDLLPCT---  358

Query  817   lssffflfslklllikpsssilkdkdGSKEQEERFLDKIYSNFVGQMNNKRFVASLKYAL  996
                              + +  K+  GS+ +      +I+ N    M  +R V +LK ++
Sbjct  359   -----------QNNQCINKANTKEVTGSENEGSFKAKRIWDNLFAWMVRERLVFALKCSV  407

Query  997   ALGLAVFFGSIYSKPDGFWAGLTVAISYVSAREATFRIANVKAQGTVLGSIYGVLGCFVF  1176
             +LGLAV FG +Y++   +W+GLT+AIS V+ R+ATF +AN + QGT +GS+Y +L C VF
Sbjct  408   SLGLAVLFGLMYNREHAYWSGLTIAISLVTGRQATFALANARLQGTAMGSVYSLLCCSVF  467

Query  1177  AKYEELRFISLIPWFIVCSFLRRSRMYGPAGGISACIGAVLILGREGFGPPREFAMARIM  1356
              + EE RF+ L+PW +   FLR SRMYG AGGISA IGAVLILGR  +  P EFA+ARI+
Sbjct  468   HRLEEFRFLPLLPWIVFTGFLRHSRMYGQAGGISAAIGAVLILGRRNYRSPTEFAIARIV  527

Query  1357  ETFIGLACSITVELLFRPTRASSLAKIQLSKSLQLLNQCIISIDYSSNNQS-------KL  1515
             E  IGL C I  ELLF P RA++LAK +LS  L+ L  CI  +   S  ++        L
Sbjct  528   EVSIGLLCFIFTELLFNPARAATLAKTELSHCLEALQDCIQCLILCSEQENGPVSVLKDL  587

Query  1516  EETQKILKSSVTQLGKFIGEAEVEPNFWFLPFHSACYGKLMGSLSKVVEYLHFVAQALRF  1695
              + Q  LK+ V  L  FI EA +EPNFWF PF++ CY +L+GS S + +   +++  L  
Sbjct  588   RKKQAKLKNHVDALENFIAEAMLEPNFWFHPFNATCYKELLGSFSNIADLCLYISDGLTN  647

Query  1696  LEQESALMG---RLDSDH----LSLFRDHVGPSIKSFEEIISLVGSVSVLDKEFEKKKSS  1854
             L +   + G       DH    L  F++ +  S K FEEIIS V S++   KE +K+K  
Sbjct  648   LSRVQPICGFAWEELQDHITHDLKSFKEKLDSSAKCFEEIIS-VNSLARFQKELQKRKIC  706

Query  1855  IDPELGKLPTSNNITGL---SDEEIDNKLKSFMEDSRQFVDQKdeddddeVMMNSQVALS  2025
              D E GK   S++  G      E+++    SF+   ++  D K      E ++ S+  L 
Sbjct  707   HDIEAGKQHNSHSRMGRMGPDQEDVERFSASFLLLLKEAAD-KISSCKAEEVLKSRTVLC  765

Query  2026  LSALAFCMRGIVRETKEIDKAI  2091
             LS+L FC   +++ET  I   +
Sbjct  766   LSSLGFCTSKLMQETIAIKTGV  787



>ref|XP_004249813.2| PREDICTED: uncharacterized protein LOC101254551 [Solanum lycopersicum]
Length=785

 Score =   379 bits (974),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 264/730 (36%), Positives = 402/730 (55%), Gaps = 38/730 (5%)
 Frame = +1

Query  4     LRGCWYAIYATCLGVCP-AILSLWLIG----PahlttgtaaaavaitaFIVVLPQNTHVV  168
             LRGCW A  AT L V P +++ LW+ G      + +   A+  VA +AF+V LP NT ++
Sbjct  69    LRGCWSACCAT-LQVMPLSMVGLWIHGFATDDNNFSPLVASVMVAGSAFLVALPGNTDLM  127

Query  169   AKRIALGQTVLVYALA---GPRTQPIMHPlrvaastaiavaacvlalllpypslassKVK  339
              KRIA  Q V+VY  A   G R   +MHPLRVA+STA+   A VLALLL +P LA  +V+
Sbjct  128   CKRIAFAQLVIVYVDAVVHGIRVNIVMHPLRVASSTALGAVASVLALLLFFPWLAYFEVR  187

Query  340   HNCHLFAENVSQRLNLLVKAFSAEDNASALSLVSQAKSLNASGAKFLQNIKSKQESMQWE  519
                 ++AEN S+RL+L +KA  + +   A+ ++SQAK ++ +G K LQ+IK  + S++WE
Sbjct  188   KLYGMYAENASERLDLYIKALHSPNEQIAMEILSQAKPISQTGTKLLQSIKLLEGSLRWE  247

Query  520   RYPIKFFRPYCKNPGERLQEYETPLRGMEMGLVDNNPPQFPVTVLLSSSEVKDSLDSLTG  699
             +  ++F  P   +PG  L + E+P++GME+ L   + P F  T+      + + L  +  
Sbjct  248   KPWLRFIVPCFTDPGNGLHDIESPMKGMEIAL--TSCPCFQTTI------IDEKLMRVFS  299

Query  700   HISKQVKGRLFDLA---------TVPESNAQNAVKFLHQKLQPVTLQdlssffflfslkl  852
             H   Q+ G   + A          V E+      +F     + ++L  L      F   +
Sbjct  300   HRVLQLLGLKLEQARCLLRTHSMIVTETEGVFENEFTIFSPESISLTSLDQPAIFFLSCI  359

Query  853   llikpsssilkdkdGSKEQEERFLDKIYSNFVGQMNNKRFVASLKYALALGLAVFFGSIY  1032
              +      + K    S   ++    ++  N+   MN +  V + K +++LGLAV  G  +
Sbjct  360   KMCINDLIMTKGSKDSGGSDKVSSKRVCINWTNLMNRESLVFACKCSISLGLAVLLGLQF  419

Query  1033  SKPDGFWAGLTVAISYVSAREATFRIANVKAQGTVLGSIYGVLGCFVFAKYEELRFISLI  1212
             +K +G+W+GLT AIS+ + + A F +AN +AQGT LGS+YGVLGC  F  +  +RFI++I
Sbjct  420   NKRNGYWSGLTTAISFETGKVAIFTVANARAQGTALGSVYGVLGCTAFQNFARIRFIAMI  479

Query  1213  PWFIVCSFLRRSRMYGPAGGISACIGAVLILGREGFGPPREFAMARIMETFIGLACSITV  1392
             PW I  S LR S+MY  AGG +A IGA+LILGR  +GPP EFA+AR+ E  IGL+C I +
Sbjct  480   PWIIFASILRHSKMYSTAGGDAAIIGALLILGRRRYGPPSEFAIARLTEALIGLSCFIII  539

Query  1393  ELLFRPTRASSLAKIQLSKSLQLLNQCIISIDYSSNNQSKLEETQKILKSSVTQLGKFIG  1572
             EL+ +PTRA+++AK  L      L  C   ID  S   +  ++ Q+ L S V +L KFI 
Sbjct  540   ELVIQPTRAATIAKNHLLLCFGTLKSCTKQIDLDSGQINGFKKKQRQLNSQVEKLQKFIV  599

Query  1573  EAEVEPNFWFLPFHSACYGKLMGSLSKVVEYLHFVAQALRFLEQ--------ESALMGRL  1728
             +AE+EP FWF PF  +CY  L  SLS VV  L+F+A ++  L Q         + +   L
Sbjct  600   DAELEPGFWFTPFPVSCYQNLQRSLSNVVHLLYFMAYSIESLIQALDSCDAERNKIQEHL  659

Query  1729  DSDHLSLFRDHVGPSIKSFEEIISLVGSVSVLDKEFEKKKSSIDPELGKLPTSNNITGLS  1908
               D   +  D +  S+K  E+ IS +G       + E  K   D E GK       T  S
Sbjct  660   KKDR-QIVNDAISSSMKCIEKTIS-IGMSRAFQDQPEDHKVVYDLEEGKSQREYTTTSTS  717

Query  1909  DEEIDNKLKSFMEDSRQFVDQKdeddddeVMMNSQVALSLSALAFCMRGIVRETKEIDKA  2088
             ++E       F+E S++ +D     +  E  + + + + L ++ FCM  ++RE K+++K 
Sbjct  718   NKEWKAS-SDFLEHSKEVIDNMTSIEGKEENIRN-IIICLCSIGFCMSSLMREVKDLEKG  775

Query  2089  IKELVQWENP  2118
             +KEL+ WE+P
Sbjct  776   VKELLNWEHP  785



>gb|KHN09420.1| hypothetical protein glysoja_016519 [Glycine soja]
Length=757

 Score =   377 bits (969),  Expect = 4e-115, Method: Compositional matrix adjust.
 Identities = 269/739 (36%), Positives = 411/739 (56%), Gaps = 39/739 (5%)
 Frame = +1

Query  1     ALRGCWYAIYATCLGVCPAILSLWLIGPahlttgtaaaavaitaFIVVLPQNTHVVAKRI  180
              +RG W+ + +    +  ++LSL LIGP    +  AA  +A +AF+V LP++TH+V K++
Sbjct  28    TVRGFWHVVCSNIQVMMLSLLSLQLIGPHRFNSCVAALTMAASAFVVGLPESTHLVTKQL  87

Query  181   ALGQTVLVYA---LAGPRTQPIMHPlrvaastaiavaacvlalllpypslassKVKHNCH  351
             A GQ V V+    + G RT   +HP+ V  STA    A VLA+LLP+P LA  + +    
Sbjct  88    AFGQLVNVFVSTVVDGGRTGVAVHPVHVVCSTAFGGVAAVLAMLLPFPRLAHYETRKFYR  147

Query  352   LFAENVSQRLNLLVKAFSAEDNASALSLVSQAKSLNASGAKFLQNIKSKQESMQWERYPI  531
             L+A+N  +R +  ++A SA DN++A+  ++QAKSL+ +GAK LQ I+SKQ+ M WE    
Sbjct  148   LYAKNTCERFDCNIEAISASDNSTAVGFIAQAKSLSTTGAKLLQIIRSKQDGMHWEWPQT  207

Query  532   KFFRPYCKNPGERLQEYETPLRGMEMGLVDNNPPQFPVTVLLSSSEVKDSLDSLTGHISK  711
             + F  +  +P + LQ  E  +R  ++ L  +    FPV V+    E++  L +  GH SK
Sbjct  208   RIFNSHWIDPEDELQHLELTMRATDIAL--STCTSFPVGVI--DEELRGVLLNCRGHFSK  263

Query  712   QV--KGRLFDL--ATVPESNAQNAVK---FLHQKLQPVTLQdlssffflfslklllikps  870
              +  + + FD   AT+     +  +     +  K  P +         L+   +      
Sbjct  264   VLGQQAKCFDSFDATITSDMKKEILTKNLSIAYKDLPTSFFLYCVHLLLYDSPIAKKTDH  323

Query  871   ssilkdkdGSKEQEERFLDKIYSNFVGQMNNKRFVASLKYALALGLAVFFGSIYSKPDGF  1050
                   K G  +   R   ++  N +   NN     + K +L+LGLAVF G  Y+K +G+
Sbjct  324   VLGKTQKRGDFKWSARKTREVVMNLIP--NNHNLAFAFKSSLSLGLAVFLGLTYNKENGY  381

Query  1051  WAGLTVAISYVSAREATFRIANVKAQGTVLGSIYGVLGCFVFAKYEELRFISLIPWFIVC  1230
             WAGL +A+ +V  R  TF +AN + QGT +GSIYG+L CFVF K  +  F+ L+PW    
Sbjct  382   WAGLLIALCFVPGRHPTFSLANARGQGTAMGSIYGILCCFVFKKIVDFSFLPLLPWIFFS  441

Query  1231  SFLRRSRMYGPAGGISACIGAVLILGREGFGPPREFAMARIMETFIGLACSITVELLFRP  1410
             SFL+ SRMYG AGGI+A  GA+L++G +   PP +FA+AR++E  IGL C + VE++F P
Sbjct  442   SFLKYSRMYGQAGGIAAVTGALLVVGMKHNDPPSQFALARMVEATIGLLCFVIVEIIFNP  501

Query  1411  TRASSLAKIQLSKSLQLLNQCI--ISIDYSSNNQ------SKLEETQKILKSSVTQLGKF  1566
              RA++LAK +LS+ L+ L  CI  I+I   +  +       +L E QK LKS V QL +F
Sbjct  502   CRAATLAKSELSQCLRSLQDCIGQIAIITPTKREMPFSSCQELREGQKKLKSLVCQLEEF  561

Query  1567  IGEAEVEPNFWFLPFHSACYGKLMGSLSKVVEYLHFVA---QALRFLEQESALMGRLDSD  1737
               EAE+EPNFWF+PFH+ACY K++ SLSK+ + L FVA   + +  L Q++        D
Sbjct  562   TAEAELEPNFWFIPFHNACYRKMLESLSKMADLLLFVAYSTENIMLLSQKNGAFWVDLHD  621

Query  1738  ----HLSLFRDHVGPSIKSFEEII--SLVGSVSVLDKEFEKKKSSIDPELGKLPTSNNIT  1899
                 ++ +F++ V P+++  EEI    + G    L  E   +    D E  + P +  + 
Sbjct  622   GVNKNVRIFKNKVSPTLEHLEEITRKKIPGK---LANEL-NRNIPCDIEAQEHPNAEALR  677

Query  1900  GLS-DEEIDNKLKSFMEDSRQFVDQKdeddddeVMMNSQVALSLSALAFCMRGIVRETKE  2076
               S DE +D+   SF++   +  + K   + DE M+ SQ+    S L FC   ++RET +
Sbjct  678   VWSGDEVVDSITGSFLKHLEEMAN-KTHTNIDEEMLKSQMLFHYSCLGFCTNNLMRETMK  736

Query  2077  IDKAIKELVQWENPSSPVN  2133
             I   +KEL+ WENPSS  N
Sbjct  737   IQSEVKELLMWENPSSQTN  755



>emb|CDP06631.1| unnamed protein product [Coffea canephora]
Length=828

 Score =   379 bits (973),  Expect = 7e-115, Method: Compositional matrix adjust.
 Identities = 268/768 (35%), Positives = 429/768 (56%), Gaps = 60/768 (8%)
 Frame = +1

Query  1     ALRGCWYAIYATCLGVCPAILSLWLIGPahlttgtaaaavaitaFIVVLPQNTHVVAKRI  180
             A+RGCW+A YAT   +  +IL L +IGPA  +   AAAA A+ +F+V LP +T +++KRI
Sbjct  67    AIRGCWHAFYATLQMLPLSILGLRIIGPARFSPSIAAAAAALASFLVALPNSTPLMSKRI  126

Query  181   ALGQTVLVYALAGPRTQPIMHPlrvaastaiavaacvlalllpyps----lassKVKHNC  348
             A GQ V+V   A    +     +      A + A    +  L        LA  +V+   
Sbjct  127   AFGQIVIVCVNAVIHGKQSSSVVVHPVHVASSTALGAASAFLALLLPYPRLAYYEVRKLS  186

Query  349   HLFAENVSQRLNLLVKAFSAEDNASALSLVSQAKSLNASGAKFLQNIK----------SK  498
              L+AEN ++R+NL + AF AE++ +A+ L+S A  L A+G K L+ I           S 
Sbjct  187   RLYAENAAERINLYMNAFLAENHLNAVELISLAHPLAATGKKLLRTITLMQVTPFCSFSS  246

Query  499   QESMQWERYPIKFFRPYCKNPGERLQEYETPLRGMEMGLVDNNPPQF-PVTVL-LSSSEV  672
             QE + WE   I+F + +  NPG+RLQ  ET + GME+ L      +F P++   L++ E+
Sbjct  247   QEGILWEMPWIRFSKLHFANPGDRLQGMETSMEGMEIAL------KFCPLSSAGLATQEL  300

Query  673   KDSLDSLTGHISKQVKG----RLFDLATVPESNAQ----------NAVKFLHQKLQPV--  804
              D++  L+  + +++K     + F+  TVP+              + +   ++ L  +  
Sbjct  301   TDTIRHLSVQLGQKLKQARCFQPFNSTTVPKPKGGCLDNLILPSCDTIPLNNKHLSALFF  360

Query  805   --TLQdlssffflfslklllikpsssilkdkdGSKEQEERFLDKIYSNFVGQMNNKRFVA  978
                L+   +   +       ++  ++  ++   S++  +    +    ++G + N+R + 
Sbjct  361   LSCLEQFLNDSTMVQKPEPNLESLAAEGEELKNSQKHAQISFKETCRKWIGNLRNERLLF  420

Query  979   SLKYALALGLAVFFGSIYSKPDGFWAGLTVAISYVSAREATFRIANVKAQGTVLGSIYGV  1158
             + K +L+LGLAV  G I++K +G+W+GLT+AIS+ + R+A F  AN +AQGT +GS+YGV
Sbjct  421   ASKCSLSLGLAVLIGLIFNKENGYWSGLTIAISFTTRRQAIFTTANARAQGTAVGSVYGV  480

Query  1159  LGCFVFAKYEELRFISLIPWFIVCSFLRRSRMYGPAGGISACIGAVLILGREGFGPPREF  1338
             LGCFVF++  E+RF++LIPW I  SFLR SRMYG AGGISA IGA+L+LGR  +GPP +F
Sbjct  481   LGCFVFSRLAEIRFVALIPWIIFTSFLRHSRMYGQAGGISAVIGALLVLGRNNYGPPDDF  540

Query  1339  AMARIMETFIGLACSITVELLFRPTRASSLAKIQLSKSLQLLNQCIISI-------DYSS  1497
             A+AR+ E FIGL C I VELL +PT AS+L K  L  +L +L +CI  +       D +S
Sbjct  541   AIARLTEAFIGLCCFILVELLLQPTGASTLVKRHLHLTLGILQECITQVITYSKGKDQAS  600

Query  1498  NNQSKLEETQKILKSSVTQLGKFIGEAEVEPNFWFLPFHSACYGKLMGSLSKVVEYLHFV  1677
              +   L+  QK LKS V +    IG+AE+EPNFWFLPF +  Y KL   LS   + LH +
Sbjct  601   MDLQALKGKQKHLKSYVHEFENLIGQAELEPNFWFLPFRNTSYWKLHNYLSNTADLLHCM  660

Query  1678  AQALRFLEQ----ESALMGRLDS---DHLSLFRDHVGPSIKSFEEIISLVGSVSVLDKEF  1836
             A +L +L Q      AL   L       L L +D++  S++  E+   +V S+ V  +E 
Sbjct  661   AYSLEYLLQVPKNHFALWKDLQEYIHHDLELCKDNLTSSLRCLEK-AKMVKSLEV-TQEV  718

Query  1837  EKKKSSIDPELGKLPTSNNITGL--SDEEIDNKLKSFMEDSRQFVDQKdeddddeVMMNS  2010
             ++     D E       N+ + L  +D++I N +   ++ S++  + + ++++ E  +  
Sbjct  719   QQGGMYNDLEKAFFARENSFSTLTTTDQQIRNIVNYLLQRSKK-GEHEIKENEGEDGVGE  777

Query  2011  QVALSLSALAFCMRGIVRETKEIDKAIKELVQWENPSSPVNLHEISCK  2154
             ++AL+L +L FC+ G +RE K+    IK++V WE   + V+  + SCK
Sbjct  778   KMALALCSLGFCISGFMREIKDTKSVIKDVVAWETKLN-VDSRQTSCK  824



>ref|XP_006339286.1| PREDICTED: uncharacterized protein LOC102599972 [Solanum tuberosum]
Length=779

 Score =   377 bits (968),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 274/727 (38%), Positives = 411/727 (57%), Gaps = 33/727 (5%)
 Frame = +1

Query  4     LRGCWYAIYATCLGVCP-AILSLWLIG----PahlttgtaaaavaitaFIVVLPQNTHVV  168
             LRGCW A  AT L V P +++ LW+ G      + +   AA  VA +AF+V LP NT ++
Sbjct  64    LRGCWSACCAT-LQVMPLSMVGLWIHGFATDDINFSPLVAAVMVAGSAFLVALPGNTDLM  122

Query  169   AKRIALGQTVLVYA---LAGPRTQPIMHPlrvaastaiavaacvlalllpypslassKVK  339
             +KRIA GQ V+VY    + G R   +MHPLRVA+STA+   A VLALLL +P LA  +V+
Sbjct  123   SKRIAFGQLVVVYVDSVIHGIRVNIVMHPLRVASSTALGAVASVLALLLFFPWLAYFEVR  182

Query  340   HNCHLFAENVSQRLNLLVKAFSAEDNASALSLVSQAKSLNASGAKFLQNIKSKQESMQWE  519
                 ++AEN S+RLNL +KA  + +   A+ ++SQAK ++ +G+K LQ+IK  + S++WE
Sbjct  183   KLYGIYAENASERLNLYLKALHSPNEQIAMEILSQAKPISVTGSKLLQSIKLLEGSLRWE  242

Query  520   RYPIKFFRPYCKNPGERLQEYETPLRGMEMGLVDNNPPQFPVTVLLSS-SEVKDSLDSLT  696
             +  ++F  P   +PG  L + E+P++GME+ L   + P F  T++      V   +  L 
Sbjct  243   KPWLRFIVPCFTDPGNGLHDIESPMKGMEIAL--TSCPCFQTTIIDEKLIRVSHRVLQLL  300

Query  697   GHISKQVKGRLFD---LATVPESNAQNAVKFLHQKLQPVTLQdlssffflfslklllikp  867
             G   +Q +  L     +AT  E    N  +F     + ++L  L      F   + +   
Sbjct  301   GLKLEQARCLLRTHSMIATETEGVFDN--EFTSLSPESISLTSLDQPAIFFLSCIKMCIN  358

Query  868   sssilkdkdGSKEQEERFLDKIYSNFVGQMNNKRFVASLKYALALGLAVFFGSIYSKPDG  1047
                + K    S   ++    ++  N+   MN +  V + K +++LGLAV  G +++K +G
Sbjct  359   DLIMTKGSKDSGGSDKASSKRVCINWTNLMNRESLVFACKCSISLGLAVLLGLLFNKRNG  418

Query  1048  FWAGLTVAISYVSAREATFRIANVKAQGTVLGSIYGVLGCFVFAKYEELRFISLIPWFIV  1227
             +W+GLT AIS+ + + A F +AN +AQGT LGS+YGVLGC VF  +  +RFI++IPW I 
Sbjct  419   YWSGLTTAISFETGKIAIFTVANARAQGTALGSVYGVLGCTVFQNFARIRFIAMIPWIIF  478

Query  1228  CSFLRRSRMYGPAGGISACIGAVLILGREGFGPPREFAMARIMETFIGLACSITVELLFR  1407
              S LR S+MY  AGG +A IGA+LILGR+ +GPP EFA+AR+ E  IGL+C I +EL+ +
Sbjct  479   ASILRHSKMYSTAGGDAAVIGALLILGRKRYGPPSEFAIARLTEALIGLSCFIIIELVIQ  538

Query  1408  PTRASSLAKIQLSKSLQLLNQCIISIDYSSNNQSKLEETQKILKSSVTQLGKFIGEAEVE  1587
             PTRA+++AK  L    + L  C   ID  S   +   + Q+ L S V +L KFI +AE+E
Sbjct  539   PTRAATIAKNHLLLCFETLKSCTKQIDLDSRKINSFMKKQRQLNSQVEKLHKFIVDAELE  598

Query  1588  PNFWFLPFHSACYGKLMGSLSKVVEYLHFVAQALRFLEQESALMGRLDSD------HLS-  1746
             P FWF PF  +CY  L  SLS VV  L+F+A ++  L Q    +   D+D      HL+ 
Sbjct  599   PGFWFTPFPVSCYQNLQRSLSNVVHLLYFMAYSIESLIQA---LDSCDADRNKIQEHLNK  655

Query  1747  ---LFRDHVGPSIKSFEEIISLVGSVSVLDKEFEKKKSSIDPELGKLPTSNNITGLSDEE  1917
                +  D +  S+K  E  IS +G       + E  K   D E GK       T  S++E
Sbjct  656   DRQIVNDAITSSMKCIETTIS-IGMSRAFQDQPEDHKIVYDLEEGKSQRDYTTTSTSNKE  714

Query  1918  IDNKLKSFMEDSRQFVDQKdeddddeVMMNSQVALSLSALAFCMRGIVRETKEIDKAIKE  2097
                    F+E S++ VD     +  E ++  ++   L ++ FCM  ++RE KE++K IKE
Sbjct  715   WKAS-SDFLEHSKEVVDNMTSLEGKEEVIR-KIIFCLCSIGFCMSCLMREVKELEKGIKE  772

Query  2098  LVQWENP  2118
             +V WE+P
Sbjct  773   MVNWEHP  779



>gb|KGN65700.1| hypothetical protein Csa_1G502880 [Cucumis sativus]
Length=782

 Score =   375 bits (963),  Expect = 5e-114, Method: Compositional matrix adjust.
 Identities = 273/738 (37%), Positives = 425/738 (58%), Gaps = 56/738 (8%)
 Frame = +1

Query  1     ALRGCWYAIYATCLGVCPAILSLWLIGPahlttgtaaaavaitaFIVVLPQNTHVVAKRI  180
             A+RGC   ++AT   VCPA+   W IGPA  +  T A  VA+ + +VVLP +TH++AK+I
Sbjct  69    AVRGCCLVVFATIQTVCPAMFLFWFIGPAKFSHITTAVTVALASVVVVLPSSTHLLAKKI  128

Query  181   ALGQTVLVYA---LAGPRTQPIMHPlrvaastaiavaacvlalllpypslassKVKHNCH  351
             ALGQ V++Y    + G  T P+MHPL VAA+TA+  AA ++A LLP+P LAS +VK    
Sbjct  129   ALGQIVIIYVVGFIGGAHTDPLMHPLHVAATTALGAAASLIATLLPFPRLASLQVKRKSK  188

Query  352   LFAENVSQRLNLLVKAFSAEDNASALSLVSQAKSLNASGAKFLQNIKSKQESMQWERYPI  531
                EN+++RL+L+VKA  AED   A + +S+A+ L++S  K L +IK  QES QWE++P+
Sbjct  189   SVVENMTERLSLMVKAILAEDRTMAAASISRAQFLSSSATKLLHSIKLYQESKQWEKFPL  248

Query  532   KFFRPYCKNPGERLQEYETPLRGMEMGL-------VDNNPPQFPVTVLLSSSEVKDSLDS  690
             +  +    +  E+L++ E  L GME+ L       + NNP  +          +K  L++
Sbjct  249   EICKMGWLSNSEKLEDLEMALNGMELALSKIPSYPIQNNPQNYQT--------LKHDLNT  300

Query  691   LTGHISKQVK--GRLF---DLATVPESNAQ-------NAVKFL------HQKLQPVTLQd  816
             L   I+  +K     F   D  T PE N         N +K +      HQ L       
Sbjct  301   LENQITLSLKQANTYFPPSDSVTFPEINVDGNTATVINTLKSIQITPTSHQDLPNFFFIF  360

Query  817   lssffflfslklllikpsssilkdkdGSKEQEERFLDKIYSNFVGQMNNKRFVASLKYAL  996
                  +  +     IK      + +  +   +E    K  S +V  MNN+R + +LK A+
Sbjct  361   CMKLLYKKTQVKTPIKFKEESKEKEIKNSTNKE----KNRSTWVSSMNNQRVITALKCAI  416

Query  997   ALGLAVFFGSIYSKPDGFWAGLTVAISYVSAREATFRIANVKAQGTVLGSIYGVLGCFVF  1176
             +LG++V  G IY+K +GFW  L VA+S  S RE TF++AN+K  GT+LGSI+G+L   +F
Sbjct  417   SLGISVILGLIYNKENGFWGSLAVAVSIASNREPTFKVANIKVHGTMLGSIFGILSFVLF  476

Query  1177  AKYEELRFISLIPWFIVCSFLRRSRMYGPAGGISACIGAVLILGREGFGPPREFAMARIM  1356
              K+   R + L+PWF+  SFL+ S MYG AGGISA +GA+++LGR  +G P+EFA  R++
Sbjct  477   KKFLIGRLLCLLPWFVFTSFLQHSTMYGSAGGISAIVGALVVLGRTNYGSPKEFAFERMI  536

Query  1357  ETFIGLACSITVELLFRPTRASSLAKIQLSKSLQLLNQCIISIDYSSNNQSKLEETQKIL  1536
             ETFIG++ S+ V+++F+P RAS L KIQL  SLQLL +C I+  +   + + +E+  + L
Sbjct  537   ETFIGISISVVVDIIFQPKRASKLVKIQLILSLQLLQKC-INDSFCYESSTIMEKDLQGL  595

Query  1537  KSSVTQLGKFIGEAEVEPNFWFL-PFHSACYGKLMGSLSKVVEYLHFVAQALRFLEQE--  1707
             ++ V ++ K I EAEVEPNF FL PFH   + K+  SLSK+V  L    +A+  L++   
Sbjct  596   RTQVIEVKKLIDEAEVEPNFLFLHPFHGDSHLKMFNSLSKMVGLLALNGEAMNNLKEGLW  655

Query  1708  SALMGRLDSDHLSLFRDHVGPSIKSFEEIISLVGSVSVLDKEFEKKKSSIDPELGKLPTS  1887
               +  +L+ D    F++ +     +F E +    S+  L  +  K+ +  D E+G+   +
Sbjct  656   RKVGEKLEGD-FEKFKEIMANGFVTFYENLR-SSSLKSLKGDESKEDNCADIEMGE---A  710

Query  1888  NNITGLSDEEIDNKLKSFMEDSRQFVDQKdeddddeVMMNSQVALSLSALAFCMRGIVRE  2067
               I  + + E +  + SF++   + V+ KD         + ++ LSLSA+AFC+  +++E
Sbjct  711   QRIEVMDEIEKEKLINSFLQHLGEIVESKDGK-------SEEIILSLSAMAFCLNSLMKE  763

Query  2068  TKEIDKAIKELVQWENPS  2121
              +E+ +AI+ELV+WE  S
Sbjct  764   MEEVGEAIRELVEWEKSS  781



>ref|XP_002308144.2| hypothetical protein POPTR_0006s08200g [Populus trichocarpa]
 gb|EEE91667.2| hypothetical protein POPTR_0006s08200g [Populus trichocarpa]
Length=639

 Score =   359 bits (921),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 226/631 (36%), Positives = 358/631 (57%), Gaps = 46/631 (7%)
 Frame = +1

Query  349   HLFAENVSQRLNLLVKAFSAEDNASALSLVSQAKSLNASGAKFLQNIKSKQESMQWERYP  528
              L+ EN S+RLN+ V+  +A++  +A  L+SQAK L+ +GA+ LQ IK  +  M  E+  
Sbjct  20    RLYVENASERLNIYVEGLTAQNKQAAADLLSQAKFLSVTGARHLQTIKDTRGGMACEKPQ  79

Query  529   IKFFRPYCKNPGERLQEYETPLRGMEMGLVDNNPPQFPVTVLLSSSEVKDSLDSLTGHIS  708
             I+       NPG+ LQ+ E  ++G+E+ L  ++ P FPV+++     +K +L  +   I 
Sbjct  80    IRKL-----NPGQNLQDIEILMKGVEIAL--DSCPSFPVSMI--DEGIKQALLDMKEKIG  130

Query  709   KQVKGRL----FDLATVPESNAQNAVKFLHQKLQPVT------------LQdlssffflf  840
              +++       FD  + PE+    +   L  K+   T            L+ LS    + 
Sbjct  131   LKLQNAKCLAPFDATSAPEAKDGESY-VLAPKIGGTTQADLPAYFFLYCLELLSRELPVG  189

Query  841   slklllikpsssilkdkdGSK-EQEERFLDKIYSNFVGQM-NNKRFVASLKYALALGLAV  1014
                    + ++        SK +QE+  L K +     ++ N +R+  + K +L++G AV
Sbjct  190   QNPECNSENTNKTDTRDVTSKRDQEKANLRKTWDCSTIKLPNMERWTLATKCSLSMGFAV  249

Query  1015  FFGSIYSKPDGFWAGLTVAISYVSAREATFRIANVKAQGTVLGSIYGVLGCFVFAKYEEL  1194
              FG I++K +G+WAGL +A S+V+ R+ATF +AN + QGT +GS+YG+L CF+F ++ +L
Sbjct  250   LFGLIFNKENGYWAGLIIATSFVTERQATFTVANARGQGTAIGSVYGILCCFIFQRFVDL  309

Query  1195  RFISLIPWFIVCSFLRRSRMYGPAGGISACIGAVLILGREGFGPPREFAMARIMETFIGL  1374
             RF+SL+PW I   FLR SRMYG AGGISA IGA+LILGR+ +GPP EFA AR++E  IGL
Sbjct  310   RFLSLLPWIIFTGFLRHSRMYGQAGGISAVIGALLILGRKNYGPPNEFATARLVEACIGL  369

Query  1375  ACSITVELLFRPTRASSLAKIQLSKSLQLLNQCIISIDYSSNNQSK--------LEETQK  1530
              C I  E+L +P RA++LAK + + SL+ L  CI         Q          L    +
Sbjct  370   ICFIMAEILLQPARAATLAKTEFAWSLRALRDCIDDTSQLCAGQKSALSSSIPALRRKHQ  429

Query  1531  ILKSSVTQLGKFIGEAEVEPNFWFLPFHSACYGKLMGSLSKVVEYLHFVAQALRFLEQES  1710
              +KS +  L KFI  AE EPNFWFLPF+ ACY KL+ SL K+   L FVA  +  L Q S
Sbjct  430   EVKSRINNLEKFIAAAESEPNFWFLPFYGACYRKLLVSLRKMECLLLFVAIEIGTLSQVS  489

Query  1711  ALMGRLDSDHLSLFRDHVGPSIKSFEEIISLVGSVSVLDKEFEK-KKSSIDPELGKLPTS  1887
               +  L +++L    + VG S+K  EE++S+  S+++L++  +K   S  D ELGK   S
Sbjct  490   DRLQVLINNYLLPLGEEVGFSLKCIEELVSM-NSLALLERGVQKISISHDDMELGKSSPS  548

Query  1888  NNI----TGLSDEEIDNKLKSFMEDSRQFVDQKdeddddeVMMNSQVALSLSALAFCMRG  2055
              ++      L +EE++N +    +     +++++   +    + S++ L + +L FC+  
Sbjct  549   ADVLYRTLSLDEEEVENSIPQHSKVEADGIEKREGAQE----LKSRLILRIYSLEFCISS  604

Query  2056  IVRETKEIDKAIKELVQWENPSSPVNLHEIS  2148
             +++ET+EI+K +KEL+  ENP S  +  E S
Sbjct  605   LIKETREIEKQVKELITRENPESQFSTKEGS  635



>ref|XP_009611529.1| PREDICTED: uncharacterized protein LOC104105004 [Nicotiana tomentosiformis]
Length=794

 Score =   362 bits (929),  Expect = 6e-109, Method: Compositional matrix adjust.
 Identities = 271/739 (37%), Positives = 413/739 (56%), Gaps = 52/739 (7%)
 Frame = +1

Query  1     ALRGCWYAIYATCLGVCP-AILSLWLIGPahltt---gtaaaavaitaFIVVLPQNTHVV  168
             ALRGCW+A  AT L V P ++L LWL G           AA  VA++AF+V LP++T+++
Sbjct  68    ALRGCWHACLAT-LQVMPLSMLGLWLHGYVTTDDFSPEVAALMVAVSAFLVALPESTNLM  126

Query  169   AKRIALGQTVLVYA---LAGPRTQ-PIMHPlrvaastaiavaacvlalllpypslassKV  336
              KRIA GQ V+VY    + G      ++HPLR+A+ST +   A +LALLLPYP LA  +V
Sbjct  127   CKRIAFGQLVIVYVDVVIHGVYVNSAVLHPLRIASSTGLGAVASILALLLPYPWLAYHEV  186

Query  337   KHNCHLFAENVSQRLNLLVKAFSAEDNASALSLVSQAKSLNASGAKFLQNIKSKQESMQW  516
             ++   ++AEN S+R+NL +KA   +D+  A+ L+SQAK    +G K L+ IK  +E +QW
Sbjct  187   RNLYKIYAENASKRINLYLKAIHTQDDQIAMELISQAKPSADTGTKLLETIKFLEEGLQW  246

Query  517   ERYPIKFFRPYCKNPGERLQEYETPLRGMEMGLVDNNPPQFPVTVLLSSSEVKDSLDSLT  696
             E+  ++F  PY  +PG  LQ  E  ++GMEM L   + P F +T ++     K S + L 
Sbjct  247   EKPWLRFLIPYFTDPGHGLQNMEVSMKGMEMAL--TSYPSF-LTRMIDDELFKVSHNVLM  303

Query  697   GHISKQVKGRLFDLATVPESNA------QNAVKFLHQKLQPVTLQdlssffflfslklll  858
                 K  + R    + +P+++       + + +  H+ + P  L   + FF         
Sbjct  304   FLGDKMGQDR----SILPQNSVTEGEFEKRSSRLPHEPILPTKLDQPAHFFLSCLKMCTS  359

Query  859   ikpsssilkdkdGSKEQE---ERFLDKIYSNFVGQMNNKRFVA-SLKYALALGLAVFFGS  1026
                + + + D+   +  E        ++  N+   M N+R V  + K + +LGLAV  G 
Sbjct  360   DSDTITPITDQRSRETMESSNNSCCKRVCINWTVPMINERMVVFAFKCSFSLGLAVLLGL  419

Query  1027  IYSKPDGFWAGLTVAISYVSAREATFRIANVKAQGTVLGSIYGVLGCFVFAKYEELRFIS  1206
             +++  +G+W+GLT+A+S+V+ ++A F  AN +AQGT +GS+YGVLGC +F K   +RF+S
Sbjct  420   LFNTENGYWSGLTIALSFVTGKQAIFTEANARAQGTAIGSVYGVLGCTIFQKAAHIRFLS  479

Query  1207  LIPWFIVCSFLRRSRMYGPAGGISACIGAVLILGREGFGPPREFAMARIMETFIGLACSI  1386
             L+PW I  +FLR SRM+  AGG +A IG++LILGR+ +GPP EFA+ R+ E FIGLAC +
Sbjct  480   LLPWIIFTTFLRHSRMFTQAGGTAAVIGSLLILGRKSYGPPSEFAIYRLTEAFIGLACFV  539

Query  1387  TVELLFRPTRASSLAKIQLSKSLQLLNQCIISIDYSSNNQSKLEETQKILKSSVTQLGKF  1566
              VEL+ +PT +++L K  L      L  C   +   S  Q  L E QK LKS V  L KF
Sbjct  540   VVELIMQPTSSATLVKKHLYLIQGTLKDCTEHMIVDS-RQKALMEKQKNLKSQVQDLEKF  598

Query  1567  IGEAEVEPNFWFLPFHSACYGKLMGSLSKVVEYLHFVAQALRFLEQ--ESALMGRLDSDH  1740
             I +A +EP+FWF PF  +CY KL  SLS + + L F+A  + FL Q  +S    R +   
Sbjct  599   IKDAVLEPSFWFSPFPISCYQKLQKSLSTMADVLFFMAYDIEFLSQAFDSYYPDRKE---  655

Query  1741  LSLFRDHVGPSIKSFEEIISLVGSVSVLDKEFEK---KKSSIDPELGKL----------P  1881
                 + ++   ++  +  +S   +VS  +K       K S I PE   L          P
Sbjct  656   ---LQQYINKDLQHLKNALS--SAVSCFEKTISNRLLKASQIQPEQNILNDLEEGNSSCP  710

Query  1882  TSNNITGLSDEEIDNKLKSFMEDSRQFVDQKdeddddeVMMNSQVALSLSALAFCMRGIV  2061
                 I+  +DEE++  L SF+E SR+   +    D   + +   +   L +L FCM  + 
Sbjct  711   NECIISSTNDEEMEMVLSSFLEHSREVCGK--VRDIAGIELRETIVGFLCSLEFCMSFLE  768

Query  2062  RETKEIDKAIKELVQWENP  2118
             RE ++ID+ IK+LV+WE+P
Sbjct  769   REVRDIDRGIKDLVRWEDP  787



>ref|XP_009787993.1| PREDICTED: uncharacterized protein LOC104235863 [Nicotiana sylvestris]
Length=790

 Score =   356 bits (914),  Expect = 9e-107, Method: Compositional matrix adjust.
 Identities = 270/735 (37%), Positives = 406/735 (55%), Gaps = 48/735 (7%)
 Frame = +1

Query  1     ALRGCWYAIYATCLGVCPAILSLWLIGPahltt---gtaaaavaitaFIVVLPQNTHVVA  171
             ALRGCW+A  AT   +  ++L LWL G           AA  VA++AF+V LP +T ++ 
Sbjct  68    ALRGCWHACLATIQVMPLSMLGLWLHGYVTTNDFSPEVAALMVAVSAFLVALPASTDLMC  127

Query  172   KRIALGQTVLVYA---LAGPRTQ-PIMHPlrvaastaiavaacvlalllpypslassKVK  339
             KRIA GQ V+VY    + G      ++HPLR+ +STA+   A +L+LLLPYP LA  +V+
Sbjct  128   KRIAFGQLVIVYVDVVIHGVYVNSAVLHPLRIGSSTALGAVASILSLLLPYPWLAYHEVR  187

Query  340   HNCHLFAENVSQRLNLLVKAFSAEDNASALSLVSQAKSLNASGAKFLQNIKSKQESMQWE  519
             +   ++AEN S+R+NL +KA   +D+  A+ L+SQAK    +G K L+ IK  +E +QWE
Sbjct  188   NLYKIYAENASKRINLYLKAIHTQDDQIAMELISQAKPSADTGTKLLETIKFLEEGLQWE  247

Query  520   RYPIKFFRPYCKNPGERLQEYETPLRGMEMGLVDNNPPQFPVTVLLSSSEVKDSLDSLTG  699
             +  ++F  PY  +PG  LQ  E  ++GMEM L   + P F +T ++     K S + L  
Sbjct  248   KPWLRFLIPY-TDPGHGLQNMEVSMKGMEMAL--TSYPSF-LTRMIDEELFKVSHNVLMF  303

Query  700   HISKQVKGRLFDLATVPESNAQNAVKFLHQKLQPVTLQdlssffflfslklllikpsssi  879
                K  + R     T  E   +++    H+ + P  L   + FF            +   
Sbjct  304   LGEKMGQDRSIFAVTEGEFEKRSS-SLPHEPILPTKLDQPALFFLSCLKMCTSDSDTIIP  362

Query  880   lkdkdGSKEQEER---FLDKIYSNFVGQMNNKRFVA-SLKYALALGLAVFFGSIYSKPDG  1047
             + D+      E       +++  N+   M N+R V  + K + +LGLAV  G +++  +G
Sbjct  363   ITDQRSGDAMESNNRSCYERVCINWTVPMINERMVIFAFKCSFSLGLAVLLGLLFNTENG  422

Query  1048  FWAGLTVAISYVSAREATFRIANVKAQGTVLGSIYGVLGCFVFAKYEELRFISLIPWFIV  1227
             +W+GLT+A+S+V+ ++A F  AN +AQGT +GS+YGVLGC +F K   +RF+SL+PW I 
Sbjct  423   YWSGLTIALSFVTGKQAIFTEANARAQGTAIGSVYGVLGCTIFQKAAHIRFLSLLPWIIF  482

Query  1228  CSFLRRSRMYGPAGGISACIGAVLILGREGFGPPREFAMARIMETFIGLACSITVELLFR  1407
              +FLR SRM+  AGG +A IG++LILGR+ +GPP EFA+ R+ E FIGLAC + VEL+ +
Sbjct  483   TTFLRHSRMFTQAGGTAAVIGSLLILGRKSYGPPSEFAIYRLTEAFIGLACFVVVELIMQ  542

Query  1408  PTRASSLAKIQLSKSLQLLNQCIISIDYSSNNQSKLEETQKILKSSVTQLGKFIGEAEVE  1587
             PT +++L K  L      L  C   +   S  Q  L E Q+ LKS V  L KFI +A +E
Sbjct  543   PTSSATLVKKHLYLIQGTLKDCTEHMIVDS-RQKGLMEKQRNLKSQVQDLEKFIKDAVLE  601

Query  1588  PNFWFLPFHSACYGKLMGSLSKVVEYLHFVAQALRFLEQ--------ESALMGRLDSDHL  1743
             P+FWF PF   CY KL  SLS + + L F+A  + FL Q           L   ++ D L
Sbjct  602   PSFWFSPFPITCYQKLQKSLSTMADVLFFMAYDIEFLSQAFDSYYPDRKELQQYINKD-L  660

Query  1744  SLFRDHVGPSIKSFEEIISLVGSVSVLDKEFEKKKSSIDPE---LGKLPTSNN-------  1893
                ++ +  ++  FE+ I    S+ +L      K S I PE   L  L   N+       
Sbjct  661   QHLKNALSSAVSCFEKTI----SIRLL------KASQIQPEQNILNDLEEGNSSCPNECI  710

Query  1894  ITGLSDEEIDNKLKSFMEDSRQFVDQKdeddddeVMMNSQVALSLSALAFCMRGIVRETK  2073
             I+  +DEE++  L SF+E SR+   +    D   + +   +   L +L FCM  + RE +
Sbjct  711   ISSTNDEEMEMVLSSFLEHSREVCGK--VRDIAGIELRETIVGFLCSLEFCMSFLEREVR  768

Query  2074  EIDKAIKELVQWENP  2118
             +ID+ IK+LV+WE+P
Sbjct  769   DIDRGIKDLVRWEDP  783



>gb|EYU26578.1| hypothetical protein MIMGU_mgv1a001712mg [Erythranthe guttata]
Length=770

 Score =   355 bits (912),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 266/742 (36%), Positives = 401/742 (54%), Gaps = 76/742 (10%)
 Frame = +1

Query  1     ALRGCWYAIYATCLGVCPAILSLWLIGPahlt-tgtaaaavaitaFIVVLPQNTHVVAKR  177
              + GCW+A  AT   V  A+L  WL+ P      G AA AV + AF+V +P+ TH+ AKR
Sbjct  68    TMSGCWHAFCATAQVVPLAVLGRWLVDPTEGLPLGYAAVAVGVAAFLVAMPECTHLTAKR  127

Query  178   IALGQTVLVYALA-----GPRTQPIMHPlrvaastaiavaacvlalllpypslassKVKH  342
             IA GQ VLV + A     G      M+P+ VAASTA+   A VLALL+PYPSLA  KV+ 
Sbjct  128   IAFGQIVLVCSDAVIGRDGKSDAAFMNPVYVAASTALGALASVLALLIPYPSLACHKVQK  187

Query  343   NCHLFAENVSQRLNLLVKAFSAEDNASALSLVSQAKSLNASGAKFLQNIKSKQESMQWER  522
              C ++ EN SQR+N+ ++AFSA DN +   L+SQ K L+ +G K LQ I   QE M+WER
Sbjct  188   LCRVYGENASQRMNIYMRAFSARDNHTKTELISQTKPLSETGDKLLQTIIILQEGMKWER  247

Query  523   YPIKFFRPYCKNPGERLQEYETPLRGMEMGLVDNNPPQFPVTVLLSSSEVKDSLDSLTGH  702
                ++  P   +PGE LQ  E  +RG+E  LV +     PV  +      ++ L ++   
Sbjct  248   PWSRYLEPNKVSPGEILQNVELQMRGIEYSLVSS-----PVQTI-----DQEHLSNVLQG  297

Query  703   ISKQVKGRLFDLATVPESNA----QNAVKFLHQ------KLQPVTLQdlssffflfslkl  852
             +S Q++ RL  L      N+    +   +F  Q       + P+     + F+F     L
Sbjct  298   LSIQLEKRLEQLTCSSPYNSSKESETRGEFTEQPSLPIEAMSPILEHGWAFFYFSCVDML  357

Query  853   llikpsssilkdkdGSKEQEERFLDKIYSNFVGQMNNKRFVASLKYALALGLAVFFGSIY  1032
             L    +S        +K ++   L K+ +     + N R   +LK +L+L LAV FG I+
Sbjct  358   LSDSSASPKYLQTQPAKTEDFSILIKLRNWISKIIKNGRLEFALKCSLSLSLAVLFGLIF  417

Query  1033  SKPDGFWAGLTVAISYVSAREATFRIANVKAQGTVLGSIYGVLGCFVFAKYEELRFISLI  1212
              K +G WAGLT+AIS+V+ R+A F +AN + QGT +GS+YGV+ CF+F   EE+R ++L+
Sbjct  418   DKENGCWAGLTIAISFVTGRQAIFTVANTRGQGTAIGSVYGVICCFLFHS-EEMRLLALL  476

Query  1213  PWFIVCSFLRRSRMYGPAGGISACIGAVLILGREGFGPPREFAMARIMETFIGLACSITV  1392
             PW +   FLR S++YG  GG+SA IGA+LI+GR+ +G P EFA+AR+ E FIGL+  I V
Sbjct  477   PWIVFTCFLRYSKLYGQTGGVSAAIGALLIVGRKNYGVPNEFAIARLTEVFIGLSAFILV  536

Query  1393  ELLFRPTRASSLAKIQLSKSLQLLNQCIISIDY---SSNNQSKLEETQKILKSSVTQLGK  1563
             EL  +P RA++LAK  LS +L  L  C+  I +     N   +L E Q+ L S V +L K
Sbjct  537   ELFLQPIRAATLAKNHLSLTLNSLEDCVKEIGFFPVQKNQFLELREKQRNLSSLVCELRK  596

Query  1564  FIGEAEVEPNFWFLPFHSACYGKLMGSLSKVVEYLHFVAQALRFLEQESALMGRLDSDHL  1743
             F+ +AE+EP+FW+LPF  + Y KL+GSLS +V  L+F+      L + S       S+  
Sbjct  597   FVADAELEPDFWYLPFRGSSYQKLVGSLSNIVHMLYFITYNFEILLELSE-----KSNVC  651

Query  1744  SLFRDHVGPSIKSFEEIIS--------LVGSVSVLDKEFEKKKSSIDPELGK--------  1875
               F++ +   ++ F+E +S         + + S  D      +   D E+GK        
Sbjct  652   KEFQEQISNELELFQETLSSLQVYLEKALSTESQADTNGSIDEKFRDLEMGKPQNREKQS  711

Query  1876  --LPTSNNITGLSDEEIDNKLKSFMEDSRQFVDQKdeddddeVMMNSQVALSLSALAFCM  2049
               +   N  T +S +E+++      E+ R+                 ++   L A  FC+
Sbjct  712   VSIIAENKETEMSSDEVES------EELRE-----------------RMIRCLGATGFCI  748

Query  2050  RGIVRETKEIDKAIKELVQWEN  2115
               +++E  + +  I+E+ QWE+
Sbjct  749   SSLMKEIDDTEMCIREIDQWES  770



>ref|XP_006429029.1| hypothetical protein CICLE_v10011084mg [Citrus clementina]
 gb|ESR42269.1| hypothetical protein CICLE_v10011084mg [Citrus clementina]
Length=823

 Score =   355 bits (912),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 194/411 (47%), Positives = 274/411 (67%), Gaps = 16/411 (4%)
 Frame = +1

Query  973   VASLKYALALGLAVFFGSIYSKPDGFWAGLTVAISYVSAREATFRIANVKAQGTVLGSIY  1152
             V +LK +L+LGLAV  G +Y+K +G+W+GLT+AIS+ + R+ATF++AN +AQGT +GS+Y
Sbjct  411   VFALKCSLSLGLAVILGLMYNKENGYWSGLTIAISFATNRQATFKVANARAQGTAMGSVY  470

Query  1153  GVLGCFVFAKYEELRFISLIPWFIVCSFLRRSRMYGPAGGISACIGAVLILGREGFGPPR  1332
             GV+  F+  K    RF+ L+PW I  SFLR SRMY  AG ISA IGA+LILGR+ +G P 
Sbjct  471   GVICSFLLQKSVNFRFLPLLPWIIFSSFLRHSRMYEEAGAISAVIGALLILGRKNYGTPS  530

Query  1333  EFAMARIMETFIGLACSITVELLFRPTRASSLAKIQLSKSLQLLNQCIISIDYSSNNQSK  1512
             EFA+ARI E  +GL C I VE+LF+P RA++LAK QL++SLQ L   I  I   ++ + K
Sbjct  531   EFAIARITEASLGLICFIIVEILFQPARAATLAKAQLAQSLQALQDGIKDIVLFADQKGK  590

Query  1513  -----LEETQKILKSSVTQLGKFIGEAEVEPNFWFLPFHSACYGKLMGSLSKVVEYLHFV  1677
                  L + QK LKS + +L KFI EAE+EPNFWFLPFH +CY K++ SLS++ + L FV
Sbjct  591   PTPTALRDKQKRLKSHINELDKFIAEAEMEPNFWFLPFHGSCYEKILASLSRMADLLLFV  650

Query  1678  AQALRFLEQESALMG-------RLDSDHLSLFRDHVGPSIKSFEEIISLVGSVSVLDKEF  1836
             A    FL Q S   G          +D L LF++ VG S+K FEE+I L+ S++VL  E 
Sbjct  651   AYKTEFLSQLSERFGVSWKQIQEPINDDLELFKEKVGYSLKCFEEVI-LIKSLAVLAPER  709

Query  1837  EKKKSSIDPELGKLPTSNNITGLSDE--EIDNKLKSFMEDSRQFVDQKdeddddeVMMNS  2010
             + +  S D E G+LP  +    LS +  EI+  L SF++ S++  +  +  D +E  + S
Sbjct  710   QNRNISHDVESGRLPNEDVPRTLSPDEEEIEEILSSFLQHSKEVANSINGYDGEEKHL-S  768

Query  2011  QVALSLSALAFCMRGIVRETKEIDKAIKELVQWENPSSPVNLHEISCKIRA  2163
             Q  L L+ L FC+  +++ET +I+K IKEL++WENP+  +NL+EISCK+ A
Sbjct  769   QTVLVLNGLGFCISSLMKETTKIEKEIKELIKWENPTRNINLYEISCKLNA  819


 Score =   177 bits (448),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 122/258 (47%), Positives = 167/258 (65%), Gaps = 11/258 (4%)
 Frame = +1

Query  4    LRGCWYAIYATCLGVCPAILSLWLIGPahlttgtaaaavaitaFIVVLPQNTHVVAKRIA  183
            LRGCW+A+YAT   + P+IL LW +GP   T   AA  V + +F+V LP++T ++AKRIA
Sbjct  70   LRGCWHALYATIQIMIPSILCLWSVGPDRFTADVAAVVVTLMSFVVALPESTPLMAKRIA  129

Query  184  LGQTVLV---YALAGPRTQPIMHPlrvaastaiavaacvlalllpypslassKVKHNCHL  354
             GQ V+V     + G +T  +MHP+ VA+STA+   A V+A+LLPYP LA  +VK +  L
Sbjct  130  FGQIVIVCVGTVVHGAKTGIVMHPIHVASSTALGALASVVAMLLPYPRLAYHEVKKSSKL  189

Query  355  FAENVSQRLNLLVKAFSAEDNASALSLVSQAKSLNASGAKFLQNIKSKQESMQWERYPIK  534
            +AEN S+ LN  VKAF A+DNA+AL  +S+AKSL  +G K L +IK KQE M WER  I+
Sbjct  190  YAENASEMLNHFVKAFCAQDNAAALDSISEAKSLFKAGTKQLLSIKDKQEGMLWERPQIR  249

Query  535  FFRPYCKNPGERLQEYETPLRGMEMGLVDNNPPQFPVTVLLSSSEVKDSLDSLTGHIS--  708
            F +P  K+P E+LQE E P+RGME+ L   + P FPV ++    +++D L SL   I   
Sbjct  250  FLKPNYKDPREKLQELEIPIRGMELAL--TSCPSFPVGMI--DEDLRDVLQSLKAEIGLK  305

Query  709  -KQVKGRL-FDLATVPES  756
             +Q K    FD  T PE+
Sbjct  306  LEQAKCYASFDATTAPET  323



>gb|KDO43708.1| hypothetical protein CISIN_1g003403mg [Citrus sinensis]
Length=823

 Score =   354 bits (909),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 193/411 (47%), Positives = 273/411 (66%), Gaps = 16/411 (4%)
 Frame = +1

Query  973   VASLKYALALGLAVFFGSIYSKPDGFWAGLTVAISYVSAREATFRIANVKAQGTVLGSIY  1152
             V +LK +L+LGLAV  G +Y+K +G+W+GLT+AIS+ + R+ATF++AN +AQGT +GS+Y
Sbjct  411   VFALKCSLSLGLAVILGLMYNKENGYWSGLTIAISFATNRQATFKVANARAQGTAMGSVY  470

Query  1153  GVLGCFVFAKYEELRFISLIPWFIVCSFLRRSRMYGPAGGISACIGAVLILGREGFGPPR  1332
             GV+  F+  K    RF+ L+PW I  SFLR SRMY  AG ISA IGA+LILGR+ +G P 
Sbjct  471   GVICSFLLQKSVNFRFLPLLPWIIFSSFLRHSRMYEEAGAISAVIGALLILGRKNYGTPS  530

Query  1333  EFAMARIMETFIGLACSITVELLFRPTRASSLAKIQLSKSLQLLNQCIISIDYSSNNQSK  1512
             EFA+ARI E  +GL C I VE+LF+P RA++LAK QL++SLQ L   I  I   ++ + K
Sbjct  531   EFAIARITEASLGLICFIIVEILFQPARAATLAKAQLAQSLQALQDGIKDIVLFADQKGK  590

Query  1513  -----LEETQKILKSSVTQLGKFIGEAEVEPNFWFLPFHSACYGKLMGSLSKVVEYLHFV  1677
                  L + QK LKS + +L KFI EAE+EPNFWFLPFH +CY  ++ SLS++ + L FV
Sbjct  591   ATPTALRDKQKRLKSHINELDKFIAEAEMEPNFWFLPFHGSCYENILASLSRMADLLLFV  650

Query  1678  AQALRFLEQESALMG-------RLDSDHLSLFRDHVGPSIKSFEEIISLVGSVSVLDKEF  1836
             A    FL Q S   G          +D L LF++ VG S+K FEE+I L+ S++VL  E 
Sbjct  651   AYKTEFLSQLSERFGVSWKQIQEPINDDLELFKEKVGHSLKCFEEVI-LIKSLAVLAPER  709

Query  1837  EKKKSSIDPELGKLPTSNNITGLSDE--EIDNKLKSFMEDSRQFVDQKdeddddeVMMNS  2010
             + +  S D E G+LP  +    LS +  EI+  L SF++ S++  +  +  D +E  + S
Sbjct  710   QNRNISHDVESGRLPNEDVPRTLSPDEEEIEEILSSFLQHSKEVANSINGYDGEEKHL-S  768

Query  2011  QVALSLSALAFCMRGIVRETKEIDKAIKELVQWENPSSPVNLHEISCKIRA  2163
             Q  L L+ L FC+  +++ET +I+K IKEL++WENP+  +NL+EISCK+ A
Sbjct  769   QTVLVLNGLGFCISSLMKETTKIEKEIKELIKWENPTRNINLYEISCKLNA  819


 Score =   180 bits (456),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 123/258 (48%), Positives = 168/258 (65%), Gaps = 11/258 (4%)
 Frame = +1

Query  4    LRGCWYAIYATCLGVCPAILSLWLIGPahlttgtaaaavaitaFIVVLPQNTHVVAKRIA  183
            LRGCW+A+YAT   + P+IL LWL+GP   T   AA  V + +F+V LP++T ++AKRIA
Sbjct  70   LRGCWHALYATIQIMIPSILCLWLVGPDRFTADVAAVVVTLMSFVVALPESTALMAKRIA  129

Query  184  LGQTVLV---YALAGPRTQPIMHPlrvaastaiavaacvlalllpypslassKVKHNCHL  354
             GQ V+V     + G +T  +MHP+ VA+STA+   A V+A+LLPYP LA  +VK +  L
Sbjct  130  FGQIVIVCVGTVVHGAKTGIVMHPIHVASSTALGALASVVAMLLPYPRLAYHEVKKSSKL  189

Query  355  FAENVSQRLNLLVKAFSAEDNASALSLVSQAKSLNASGAKFLQNIKSKQESMQWERYPIK  534
            +AEN S+ LN  VKAF A+DN +AL  +S+AKSL  +GAK L +IK KQE M WER  I+
Sbjct  190  YAENASEMLNHFVKAFCAQDNTAALDSISEAKSLFKAGAKQLLSIKDKQEGMLWERPQIR  249

Query  535  FFRPYCKNPGERLQEYETPLRGMEMGLVDNNPPQFPVTVLLSSSEVKDSLDSLTGHIS--  708
            F +P  K+P E+LQE E P+RGME+ L   + P FPV ++    +++D L SL   I   
Sbjct  250  FLKPNYKDPREKLQELEIPIRGMELAL--TSCPSFPVGMI--DEDLRDVLQSLKAEIGLK  305

Query  709  -KQVKGRL-FDLATVPES  756
             +Q K    FD  T PE+
Sbjct  306  LEQAKCYASFDATTAPET  323



>ref|XP_009787557.1| PREDICTED: uncharacterized protein LOC104235477 [Nicotiana sylvestris]
Length=778

 Score =   353 bits (906),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 265/728 (36%), Positives = 415/728 (57%), Gaps = 42/728 (6%)
 Frame = +1

Query  1     ALRGCWYAIYATCLGVCPAILSLWLI--GPahlttgtaaaavaitaFIVVLPQNTHVVAK  174
              L G W+AI AT   +  ++L +W+   G   L+   +A A+A+T+ +V L + TH   K
Sbjct  71    TLSGSWHAILATVQTMPLSMLGVWIAANGSDRLSPVASALALALTSLLVALLECTHFRCK  130

Query  175   RIALGQTVLVYA---LAGPRTQPIMHPlrvaastaiavaacvlalllpypslassKVKHN  345
             +IA GQ VLV+A   + G  T  ++HPLRVA ST + + A +LAL LPYP LA  +V+  
Sbjct  131   KIAFGQLVLVFADGVIRGVHTSVVVHPLRVAWSTVLGIVASLLALSLPYPKLAYFEVRKL  190

Query  346   CHLFAENVSQRLNLLVKAFSAEDNASALSLVSQAKSLNASGAKFLQNIKSKQESMQWERY  525
               L+AEN  +R+++  +A  ++DN +A+ L+S+AK  + +GAK   + K  +  + WE  
Sbjct  191   HQLYAENSKERVDIYSRAIISQDNLNAVELLSRAKLHSQTGAKLFHSTKVLKGGLMWETP  250

Query  526   PIKFFRPYCKN-PGE-RLQEYETPLRGMEMGLVDNNPPQFPVTVLLSSSEVKDSLDSLTG  699
              ++FF+ YC + PG+  LQ  E  +RGME+ L   + P F  + +L + E+K +L     
Sbjct  251   WLRFFK-YCSDVPGDNELQNMEITIRGMEIALT--SCPSF--STVLVTEELKGALQ----  301

Query  700   HISKQVKGRLFDLATVPES--NAQNAVKFLHQK-LQPVTLQdlssffflfslklllikps  870
             H+S+Q+  R  +  T  E+  +  N    +H   + P      +S    F L    +  +
Sbjct  302   HMSEQI-CRKSEQTTHQETKVDLHNESPLIHNDTISP----SQTSLPTFFFLSCAKMLLT  356

Query  871   ssilkdkdGSKEQEERFLDKIYSNFVGQMNNKRFVA-SLKYALALGLAVFFGSIYSKPDG  1047
             +S       SK   E    +++ N   +   K  +A + K +++LGLA++ G ++ K +G
Sbjct  357   NSSPSLLKNSKPNAEVHPKRLWHNIWMKRPRKETLAFAFKCSVSLGLAMWLGLLFDKENG  416

Query  1048  FWAGLTVAISYVSAREATFRIANVKAQGTVLGSIYGVLGCFVFAKYEELRFISLIPWFIV  1227
             FWAGLTVA S    + ATF IAN +AQG   GS+YGVLGC +F   + L+F++L+PW I 
Sbjct  417   FWAGLTVASSLAQGKIATFTIANAQAQGIAFGSVYGVLGCSIFKSIDNLKFLALLPWIIF  476

Query  1228  CSFLRRSRMYGPAGGISACIGAVLILGREGFGPPREFAMARIMETFIGLACSITVELLFR  1407
              SFL+ SR+YG + GISA +GAV+ILGRE +GPP +FA+ R+ ETFIGL+C   V+ LF 
Sbjct  477   SSFLKNSRIYGQSVGISALLGAVMILGRENYGPPNDFAIIRLTETFIGLSCFTMVQFLFN  536

Query  1408  PTRASSLAKIQLSKSLQLLNQCIISIDYSSNNQSKLEETQKILKSSVTQLGKFIGEAEVE  1587
             P RA++LAK QL  ++ +L  C+  I+        L E Q+ LKS +  L K    AEVE
Sbjct  537   PKRAANLAKNQLHFTMDILKDCMNQIEQP--EVLGLMEKQRKLKSHILDLQKKSHNAEVE  594

Query  1588  PNFWFLPFHSACYGKLMGSLSKVVEYLHFVAQALRFLEQESALMGRLD--------SDHL  1743
             P+FWFLPF++ CY KL GSLSK+ +  +F+   +  + Q+    G  +        +D L
Sbjct  595   PDFWFLPFNATCYKKLQGSLSKIADLFYFMIYNINSMSQDFQSCGVDNRKELQECINDEL  654

Query  1744  SLFRDHVGPSIKSFEEIISLVGSVSVLDKEFEKKKSSIDPELGKLPT---SNNITGLSDE  1914
                ++    S+   +   SL+      D+E   +K + D E GKLPT   S+N+T  +D 
Sbjct  655   EHLKETTNSSLTFLDNKPSLIKLFPDDDQE---EKRTNDLEEGKLPTYPKSSNLTKHNDS  711

Query  1915  EIDNKLKSFMEDSRQFVDQKdeddddeVMMNSQVALSLSALAFCMRGIVRETKEIDKAIK  2094
             + +  L  F+E S++ +D +     ++     ++ +SL AL FC+  +++E K+I  A+K
Sbjct  712   KGERGLSFFLERSKKVID-RILSSQEKEEQKGKLIVSLYALGFCISSMLKEIKDIKMAMK  770

Query  2095  ELVQWENP  2118
             EL  WE+P
Sbjct  771   ELSHWESP  778



>ref|XP_006480768.1| PREDICTED: uncharacterized protein LOC102627372 isoform X1 [Citrus 
sinensis]
 ref|XP_006480769.1| PREDICTED: uncharacterized protein LOC102627372 isoform X2 [Citrus 
sinensis]
Length=823

 Score =   354 bits (908),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 193/411 (47%), Positives = 273/411 (66%), Gaps = 16/411 (4%)
 Frame = +1

Query  973   VASLKYALALGLAVFFGSIYSKPDGFWAGLTVAISYVSAREATFRIANVKAQGTVLGSIY  1152
             V +LK +L+LGLAV  G +Y+K +G+W+GLT+AIS+ + R+ATF++AN +AQGT +GS+Y
Sbjct  411   VFALKCSLSLGLAVILGLMYNKENGYWSGLTIAISFATNRQATFKVANARAQGTAMGSVY  470

Query  1153  GVLGCFVFAKYEELRFISLIPWFIVCSFLRRSRMYGPAGGISACIGAVLILGREGFGPPR  1332
             GV+  F+  K    RF+ L+PW I  SFLR SRMY  AG ISA IGA+LILGR+ +G P 
Sbjct  471   GVICSFLLQKSVNFRFLPLLPWIIFSSFLRHSRMYEEAGAISAVIGALLILGRKNYGTPS  530

Query  1333  EFAMARIMETFIGLACSITVELLFRPTRASSLAKIQLSKSLQLLNQCIISIDYSSNNQSK  1512
             EFA+ARI E  +GL C I VE+LF+P RA++LAK QL++SLQ L   I  I   ++ + K
Sbjct  531   EFAIARITEASLGLICFIIVEILFQPARAATLAKAQLAQSLQALQDGIKDIVLFADQKGK  590

Query  1513  -----LEETQKILKSSVTQLGKFIGEAEVEPNFWFLPFHSACYGKLMGSLSKVVEYLHFV  1677
                  L + QK LKS + +L KFI EAE+EPNFWFLPFH +CY  ++ SLS++ + L FV
Sbjct  591   ATPTALRDKQKRLKSHINELDKFIAEAEMEPNFWFLPFHGSCYENILASLSRMADLLLFV  650

Query  1678  AQALRFLEQESALMG-------RLDSDHLSLFRDHVGPSIKSFEEIISLVGSVSVLDKEF  1836
             A    FL Q S   G          +D L LF++ VG S+K FEE+I L+ S++VL  E 
Sbjct  651   AYKTEFLSQLSERFGVSWKQIQEPINDDLELFKEKVGHSLKCFEEVI-LIKSLAVLAPER  709

Query  1837  EKKKSSIDPELGKLPTSNNITGLSDE--EIDNKLKSFMEDSRQFVDQKdeddddeVMMNS  2010
             + +  S D E G+LP  +    LS +  EI+  L SF++ S++  +  +  D +E  + S
Sbjct  710   QNRNISHDVESGRLPNEDVPRTLSPDEEEIEEILSSFLQHSKEVANSINGYDGEEKHL-S  768

Query  2011  QVALSLSALAFCMRGIVRETKEIDKAIKELVQWENPSSPVNLHEISCKIRA  2163
             Q  L L+ L FC+  +++ET +I+K IKEL++WENP+  +NL+EISCK+ A
Sbjct  769   QTVLVLNGLGFCISSLMKETTKIEKEIKELIKWENPTRNINLYEISCKLNA  819


 Score =   177 bits (448),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 122/258 (47%), Positives = 167/258 (65%), Gaps = 11/258 (4%)
 Frame = +1

Query  4    LRGCWYAIYATCLGVCPAILSLWLIGPahlttgtaaaavaitaFIVVLPQNTHVVAKRIA  183
            LRGCW+A+YAT   + P+IL LW +GP   T   AA  V + +F+V LP++T ++AKRIA
Sbjct  70   LRGCWHALYATIQIMIPSILCLWSVGPDRFTADVAAVVVTLMSFVVALPESTPLMAKRIA  129

Query  184  LGQTVLV---YALAGPRTQPIMHPlrvaastaiavaacvlalllpypslassKVKHNCHL  354
             GQ V+V     + G +T  +MHP+ VA+STA+   A V+A+LLPYP LA  +VK +  L
Sbjct  130  FGQIVIVCVGTVVHGAKTGIVMHPIHVASSTALGALASVVAMLLPYPRLAYHEVKKSSKL  189

Query  355  FAENVSQRLNLLVKAFSAEDNASALSLVSQAKSLNASGAKFLQNIKSKQESMQWERYPIK  534
            +AEN S+ LN  VKAF A+DNA+AL  +S+AKSL  +G K L +IK KQE M WER  I+
Sbjct  190  YAENASEMLNHFVKAFCAQDNAAALDSISEAKSLFKAGTKQLLSIKDKQEGMLWERPQIR  249

Query  535  FFRPYCKNPGERLQEYETPLRGMEMGLVDNNPPQFPVTVLLSSSEVKDSLDSLTGHIS--  708
            F +P  K+P E+LQE E P+RGME+ L   + P FPV ++    +++D L SL   I   
Sbjct  250  FLKPNYKDPREKLQELEIPIRGMELAL--TSCPSFPVGMI--DEDLRDVLQSLKAEIGLK  305

Query  709  -KQVKGRL-FDLATVPES  756
             +Q K    FD  T PE+
Sbjct  306  LEQAKCYASFDATTAPET  323



>ref|XP_009388259.1| PREDICTED: uncharacterized protein LOC103975073 isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=780

 Score =   351 bits (901),  Expect = 6e-105, Method: Compositional matrix adjust.
 Identities = 188/431 (44%), Positives = 278/431 (65%), Gaps = 15/431 (3%)
 Frame = +1

Query  907   QEERFLDKIYSNFVGQMNNKRFVASLKYALALGLAVFFGSIYSKPDGFWAGLTVAISYVS  1086
             +EE    +I   +   +  +R V +LK +L+LGLAV FG +YSK +GFW+GLTVAI+   
Sbjct  354   KEEPGTKRIKIPWYTSLRRERLVVALKCSLSLGLAVLFGLVYSKENGFWSGLTVAITMTP  413

Query  1087  AREATFRIANVKAQGTVLGSIYGVLGCFVFAKYEELRFISLIPWFIVCSFLRRSRMYGPA  1266
              REATFR+ANV+AQGT +GS+YGVLG  +     ELRF+ L+PW    SFL+RSRMYGPA
Sbjct  414   WREATFRLANVRAQGTAIGSVYGVLGSLISQNLMELRFLVLLPWITFASFLQRSRMYGPA  473

Query  1267  GGISACIGAVLILGREGFGPPREFAMARIMETFIGLACSITVELLFRPTRASSLAKIQLS  1446
             GGI+A   A++ILGR  +G P  FA+AR+ ETFIG +CS  VELL +P RAS+LA+ QLS
Sbjct  474   GGIAAMFSALVILGRRNYGSPTAFAIARLTETFIGFSCSAFVELLLQPVRASTLAREQLS  533

Query  1447  KSLQLLNQCIISIDYSSNNQSKLEETQKILKSSVTQLGKFIGEAEVEPNFWFLPFHSACY  1626
             +SL++LN+C+ S+     + +  +E +K L+  VT L K++ EAE EPNFWFLPF  ACY
Sbjct  534   QSLKMLNECVESLVPCIGSMAP-KEKEKKLRVKVTALRKYVQEAEAEPNFWFLPFPVACY  592

Query  1627  GKLMGSLSKVVEYLHFVAQALRFLEQESALMGRLDSD--------HLSLFRDHVGPSIKS  1782
              KL  S++K+V+ LHF+A++   L + S  +  +  D        HL   +  +  S K 
Sbjct  593   KKLCASMTKMVDLLHFLAKSTVLLTEYSHGLADVCDDIPDSIVGEHLVHLKKLICSSAKC  652

Query  1783  FEEIISLVGSVSVLDKEFEKKKSSIDPELGKL--PTSNNITGLSDEEIDNKLKSFMEDSR  1956
             F E + LV S + L+KE+ K+K   D E GK+  P  + + G   E+    + SF++ + 
Sbjct  653   FAEAL-LVKSFARLEKEW-KRKHIPDVETGKVEGPYVDGVMGADGEDCQKVIASFLQQAN  710

Query  1957  QFVDQKdeddddeVMMNSQVALSLSALAFCMRGIVRETKEIDKAIKELVQWENPSSPVNL  2136
             + +D+ D   D+   +  Q+ L L+ + FCM G+++ET+E++  I ELVQ +NP + +NL
Sbjct  711   ELMDRLDMSIDES--LKGQLVLCLATVGFCMEGLMKETRELEMQILELVQRDNPGAHINL  768

Query  2137  HEISCKIRALA  2169
             + I CK++ ++
Sbjct  769   YAIRCKVKEIS  779


 Score = 57.0 bits (136),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 60/205 (29%), Positives = 92/205 (45%), Gaps = 50/205 (24%)
 Frame = +1

Query  1    ALRGCWYAIYATCLGVCPAILSLWLIGPahlttgtaaaavaitaFIVVLPQNTHVVAKRI  180
            +L G   A Y T LGV PA+L+L L+     +       V+++AF+V LP++T ++ KRI
Sbjct  100  SLHGTASAFYGTLLGVLPAMLTLLLLPAQGFSIAGTTLTVSLSAFVVALPESTSLITKRI  159

Query  181  ALGQTVLVYALAGPRTQPIMHPlrvaastaiavaacvlalllpypslassKVKHNCHLFA  360
            ALGQ V++Y                                        +   HN H  +
Sbjct  160  ALGQIVIIYV---------------------------------------TTFGHNAH--S  178

Query  361  ENVSQRLNLLVKAFSAEDNASALSLVSQAKSLNASGAKFLQNIKSKQESMQWERYPIKFF  540
             +    L+L   A S     +AL +V+   +L     +    + S + +++WER P+ F 
Sbjct  179  GHAKAILHLAQVAAS-----TALGVVASVIALLFPYPR----LASCEAALKWERPPLSFS  229

Query  541  RPYCKNPGERLQEYETPLRGMEMGL  615
                  P ERLQE ETPL+GMEM +
Sbjct  230  STPPVEPSERLQEIETPLKGMEMAI  254



>ref|XP_009388258.1| PREDICTED: uncharacterized protein LOC103975073 isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=836

 Score =   352 bits (902),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 188/431 (44%), Positives = 278/431 (65%), Gaps = 15/431 (3%)
 Frame = +1

Query  907   QEERFLDKIYSNFVGQMNNKRFVASLKYALALGLAVFFGSIYSKPDGFWAGLTVAISYVS  1086
             +EE    +I   +   +  +R V +LK +L+LGLAV FG +YSK +GFW+GLTVAI+   
Sbjct  410   KEEPGTKRIKIPWYTSLRRERLVVALKCSLSLGLAVLFGLVYSKENGFWSGLTVAITMTP  469

Query  1087  AREATFRIANVKAQGTVLGSIYGVLGCFVFAKYEELRFISLIPWFIVCSFLRRSRMYGPA  1266
              REATFR+ANV+AQGT +GS+YGVLG  +     ELRF+ L+PW    SFL+RSRMYGPA
Sbjct  470   WREATFRLANVRAQGTAIGSVYGVLGSLISQNLMELRFLVLLPWITFASFLQRSRMYGPA  529

Query  1267  GGISACIGAVLILGREGFGPPREFAMARIMETFIGLACSITVELLFRPTRASSLAKIQLS  1446
             GGI+A   A++ILGR  +G P  FA+AR+ ETFIG +CS  VELL +P RAS+LA+ QLS
Sbjct  530   GGIAAMFSALVILGRRNYGSPTAFAIARLTETFIGFSCSAFVELLLQPVRASTLAREQLS  589

Query  1447  KSLQLLNQCIISIDYSSNNQSKLEETQKILKSSVTQLGKFIGEAEVEPNFWFLPFHSACY  1626
             +SL++LN+C+ S+     + +  +E +K L+  VT L K++ EAE EPNFWFLPF  ACY
Sbjct  590   QSLKMLNECVESLVPCIGSMAP-KEKEKKLRVKVTALRKYVQEAEAEPNFWFLPFPVACY  648

Query  1627  GKLMGSLSKVVEYLHFVAQALRFLEQESALMGRLDSD--------HLSLFRDHVGPSIKS  1782
              KL  S++K+V+ LHF+A++   L + S  +  +  D        HL   +  +  S K 
Sbjct  649   KKLCASMTKMVDLLHFLAKSTVLLTEYSHGLADVCDDIPDSIVGEHLVHLKKLICSSAKC  708

Query  1783  FEEIISLVGSVSVLDKEFEKKKSSIDPELGKL--PTSNNITGLSDEEIDNKLKSFMEDSR  1956
             F E + LV S + L+KE+ K+K   D E GK+  P  + + G   E+    + SF++ + 
Sbjct  709   FAEAL-LVKSFARLEKEW-KRKHIPDVETGKVEGPYVDGVMGADGEDCQKVIASFLQQAN  766

Query  1957  QFVDQKdeddddeVMMNSQVALSLSALAFCMRGIVRETKEIDKAIKELVQWENPSSPVNL  2136
             + +D+ D   D+   +  Q+ L L+ + FCM G+++ET+E++  I ELVQ +NP + +NL
Sbjct  767   ELMDRLDMSIDES--LKGQLVLCLATVGFCMEGLMKETRELEMQILELVQRDNPGAHINL  824

Query  2137  HEISCKIRALA  2169
             + I CK++ ++
Sbjct  825   YAIRCKVKEIS  835


 Score =   107 bits (266),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 90/211 (43%), Positives = 129/211 (61%), Gaps = 6/211 (3%)
 Frame = +1

Query  1    ALRGCWYAIYATCLGVCPAILSLWLIGPahlttgtaaaavaitaFIVVLPQNTHVVAKRI  180
            +L G   A Y T LGV PA+L+L L+     +       V+++AF+V LP++T ++ KRI
Sbjct  100  SLHGTASAFYGTLLGVLPAMLTLLLLPAQGFSIAGTTLTVSLSAFVVALPESTSLITKRI  159

Query  181  ALGQTVLVYALA------GPRTQPIMHPlrvaastaiavaacvlalllpypslassKVKH  342
            ALGQ V++Y             + I+H  +VAASTA+ V A V+ALL PYP LAS ++  
Sbjct  160  ALGQIVIIYVTTFGHNAHSGHAKAILHLAQVAASTALGVVASVIALLFPYPRLASCEISK  219

Query  343  NCHLFAENVSQRLNLLVKAFSAEDNASALSLVSQAKSLNASGAKFLQNIKSKQESMQWER  522
               L+ E V+ RL+LLV AF  ++ +  +SL+SQ + L ++  K LQNI  KQ +++WER
Sbjct  220  KSKLYREMVTVRLSLLVNAFFVDNKSCTVSLISQVRCLTSASTKVLQNINLKQAALKWER  279

Query  523  YPIKFFRPYCKNPGERLQEYETPLRGMEMGL  615
             P+ F       P ERLQE ETPL+GMEM +
Sbjct  280  PPLSFSSTPPVEPSERLQEIETPLKGMEMAI  310



>ref|XP_008803432.1| PREDICTED: uncharacterized protein LOC103716990 [Phoenix dactylifera]
Length=860

 Score =   347 bits (890),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 196/416 (47%), Positives = 276/416 (66%), Gaps = 21/416 (5%)
 Frame = +1

Query  952   QMNNKRFVASLKYALALGLAVFFGSIYSKPDGFWAGLTVAISYVSAREATFRIANVKAQG  1131
              ++++R VA+LK +L+LGLAV FG ++SK +G+W+GLTVAI+    REATF++AN +AQG
Sbjct  455   NVSSERLVAALKCSLSLGLAVLFGVLFSKNNGYWSGLTVAITISPGREATFKLANDRAQG  514

Query  1132  TVLGSIYGVLGCFVFAKYEELRFISLIPWFIVCSFLRRSRMYGPAGGISACIGAVLILGR  1311
             T +GS+YGVL   +     ELRF++L+PW I  SFLRRSRMYG AGGI+A I  ++ILGR
Sbjct  515   TAIGSVYGVLASVISQNLMELRFLALLPWIIFTSFLRRSRMYGHAGGIAAIISTLIILGR  574

Query  1312  EGFGPPREFAMARIMETFIGLACSITVELLFRPTRASSLAKIQLSKSLQLLNQCIISIDY  1491
               +GPP  FA++R+ ETFIGL+CSI VELL +PTRAS+LA+ Q+S+ L+ LN+CI S+  
Sbjct  575   RNYGPPTVFAISRLTETFIGLSCSILVELLLQPTRASTLARAQVSRILRTLNECIESL-V  633

Query  1492  SSNNQSKLEETQKILKSSVTQLGKFIGEAEVEPNFWFLPFHSACYGKLMGSLSKVVEYLH  1671
              S     L+E QK LK  V  L K+I EA++EPNFWF+PF  A Y KL G LSK+VE L 
Sbjct  634   PSTGPVPLKEKQKKLKQEVHALRKYIDEAQMEPNFWFVPFPMASYHKLQGFLSKMVELLC  693

Query  1672  FVAQALRFLEQESALMG----------RLDSDHLSLFRDHVGPSIKSFEEIISLVGSVSV  1821
             F+   +  L +ES  +G          R D +    F+  VG S+K FEE++  V S+  
Sbjct  694   FLVHGMEILAEESHGLGAAWKEIQETIRGDMEE---FKKMVGSSLKCFEEVLQ-VNSLGK  749

Query  1822  LDKEFEKKKSSIDPELGKLPTSNNITGLSDEEIDNKLKSFMEDSRQFVDQKdeddddeVM  2001
             L+KE +++    D ELG    S       +EE    L  F++ + + V++ D D  ++  
Sbjct  750   LEKELQRRSEPNDLELG----SYRALSADEEETKKVLALFLQHAVEVVERHDVDVVED--  803

Query  2002  MNSQVALSLSALAFCMRGIVRETKEIDKAIKELVQWENPSSPVNLHEISCKIRALA  2169
               SQV L L+  AFC+ G+++ET+EI+  + EL+QWENP S +NL+EIS +I+ALA
Sbjct  804   SKSQVVLCLATFAFCVGGLMKETREIENGLLELLQWENPGSHINLYEISGEIKALA  859


 Score =   101 bits (251),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 56/130 (43%), Positives = 76/130 (58%), Gaps = 3/130 (2%)
 Frame = +1

Query  331  KVKHNCHLFAENVSQRLNLLVKAFSAEDNASALSLVSQAKSLNASGAKFLQNIKSKQESM  510
            KV+    L+ E  ++RL LLV AF A++NA   +L SQA+ L A   K LQNIK KQ S 
Sbjct  232  KVREKSKLYMEVATERLRLLVNAFYADNNACMAALTSQARCLAAESTKLLQNIKQKQGSS  291

Query  511  QWERYPIKFFRPYCKNPGERLQEYETPLRGMEMGLVDNNPPQFPVTVLLSSSEVKDSLDS  690
            QWER P +F  P+ K P + LQ+ ET L+GME+ L       FPV       + K +L S
Sbjct  292  QWERPPFRFLPPHLKEPLDSLQDIETTLKGMEIALSSTT--SFPVN-FFDQQQHKVNLLS  348

Query  691  LTGHISKQVK  720
            L  HI+ +++
Sbjct  349  LRDHITFRLR  358


 Score = 61.6 bits (148),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 36/87 (41%), Positives = 53/87 (61%), Gaps = 5/87 (6%)
 Frame = +1

Query  1    ALRGCWYAIYATCLGVCPAILSLWLIGPahlttgtaaaavaitaFIVVLPQNTHVVAKRI  180
            +L G   A+Y T LGV PA+L+L+LI P   +      AV +++F+V LP +T ++AKRI
Sbjct  83   SLHGAASALYGTVLGVLPAMLALFLIRPDGFSIAATTLAVVLSSFVVALPGSTDLIAKRI  142

Query  181  ALGQTVLVYAL----AGP-RTQPIMHP  246
            ALGQ V++Y       GP   + + HP
Sbjct  143  ALGQIVIIYVAPFEQVGPDHVKSVWHP  169



>ref|XP_009627438.1| PREDICTED: uncharacterized protein LOC104117985 [Nicotiana tomentosiformis]
Length=811

 Score =   342 bits (878),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 266/752 (35%), Positives = 411/752 (55%), Gaps = 62/752 (8%)
 Frame = +1

Query  1     ALRGCWYAIYATCLGVCPAILSLWLI--GPahlttgtaaaavaitaFIVVLPQNTHVVAK  174
              L G W+AI AT   V  +IL +W+   G   L+   +A A+A+T+ +V L + TH   K
Sbjct  76    TLSGSWHAILATVQTVPLSILGVWIAANGSDRLSPVASALALALTSLLVSLVECTHFRCK  135

Query  175   RIALGQTVLVYA---LAGPRTQPIMHPlrvaastaiavaacvlalllpypslassKVK--  339
             +IA GQ VLV+A   + G  T   +HPLRVA ST + + A +LAL LPYP LA  +V   
Sbjct  136   KIAFGQLVLVFADGVIRGLNTSAFVHPLRVAWSTVLGIVASLLALSLPYPRLAYHEVSIS  195

Query  340   ---------------------HNCH-LFAENVSQRLNLLVKAFSAEDNASALSLVSQAKS  453
                                     H L+AEN  +R+ +  +A +++ N +A+ L+S+AK 
Sbjct  196   LTFSDEAVKKYWSLSIAEFFVRKLHRLYAENSKERMEVYSRAITSQYNFNAVELLSKAKV  255

Query  454   LNASGAKFLQNIKSKQESMQWERYPIKFFRPYCKNPGE-RLQEYETPLRGMEMGLVDNNP  630
             L  +G K LQ+ K  +  + WE   + FF+   + P +  L+  E  +RGME+ L  ++ 
Sbjct  256   LAQTGPKLLQSSKVLKGGLMWETPWLLFFKCCSEVPRDNELKNMEITIRGMEIAL--SSC  313

Query  631   PQFPVTVLLSSSEVKDSLDSLTGHISKQVKGRLFDLATVPESNA---QNAVKFLHQK-LQ  798
             P F      S+  V + L     HIS+Q+ GR  D +T  E+           +H   + 
Sbjct  314   PSF------STGLVTEELKGALQHISEQI-GRKSDQSTHQETKVDFPNYESPLIHNDTIS  366

Query  799   PVTLQdlssffflfslklllikpsssilkdkdGSKEQEERFLDKIYSNFVGQMNNKRFVA  978
             P      + FF   +  LL     S     K  ++    R    I+   + +   +  V 
Sbjct  367   PTQTSLPAFFFLSCAKMLLNNSSQSLPKDSKPNAEVHSRRVCHNIW---MKRPRKETLVF  423

Query  979   SLKYALALGLAVFFGSIYSKPDGFWAGLTVAISYVSAREATFRIANVKAQGTVLGSIYGV  1158
             ++K +++LGLA++ G ++ K +GFWAGLTVA S    + ATF +AN +AQG V GS+YGV
Sbjct  424   AIKCSISLGLAMWLGLLFDKENGFWAGLTVASSLAQGKIATFTLANAQAQGIVFGSVYGV  483

Query  1159  LGCFVFAKYEELRFISLIPWFIVCSFLRRSRMYGPAGGISACIGAVLILGREGFGPPREF  1338
             LGC VF   + L+F++L+PW I  SFL+ SR+YG +GGISA +GAV+ILGR+ +GPP +F
Sbjct  484   LGCSVFKSIDNLKFLALLPWIIFSSFLKNSRIYGQSGGISALLGAVMILGRKNYGPPNDF  543

Query  1339  AMARIMETFIGLACSITVELLFRPTRASSLAKIQLSKSLQLLNQCIISIDYSSNNQ-SKL  1515
             A+ R+ ETFIGL+C I V+ LF P RA++LAK QL  ++ +L  C+  I      +   L
Sbjct  544   AIIRLTETFIGLSCFIVVQFLFNPKRAANLAKNQLHFTMDILKDCMNQIVQKEQPELLGL  603

Query  1516  EETQKILKSSVTQLGKFIGEAEVEPNFWFLPFHSACYGKLMGSLSKVVEYLHFVAQALRF  1695
              E Q+ LKS +  L K    AEVEP+FWFLPF++ CY KL GSLSK+ +  +F+   +  
Sbjct  604   MEKQRKLKSHILNLQKISHNAEVEPDFWFLPFNATCYKKLQGSLSKMADLFYFIVYNINS  663

Query  1696  LEQESALMGRLDSDHLSLFRDHVGPSIKSFEE--IISLV------GSVSVLDKEFEKKKS  1851
             + Q+    G    D+ +  ++ +   ++  +E  I+SL         + +   + +++K 
Sbjct  664   MSQDFQNSG---VDNWNELQECINDELEHLKENSILSLTFLDNKPSLIKLFPDDDQEEKR  720

Query  1852  SIDPELGKLPT---SNNITGLSDEEIDNKLKSFMEDSRQFVDQKdeddddeVMMNSQVAL  2022
               D E GKLPT   S+N+   +DE+ +  L  F+E S++ +D+      ++ +    +A 
Sbjct  721   LNDLEEGKLPTYPKSSNLIKQNDEKGERGLSFFLERSKEVIDRILSSQGNKELKGKSIA-  779

Query  2023  SLSALAFCMRGIVRETKEIDKAIKELVQWENP  2118
             SL AL FC+  +++E K I  A+KEL  WE+P
Sbjct  780   SLYALGFCISSMLKEIKNIKIAMKELSHWESP  811



>ref|XP_007162655.1| hypothetical protein PHAVU_001G169100g [Phaseolus vulgaris]
 gb|ESW34649.1| hypothetical protein PHAVU_001G169100g [Phaseolus vulgaris]
Length=770

 Score =   341 bits (874),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 249/709 (35%), Positives = 392/709 (55%), Gaps = 37/709 (5%)
 Frame = +1

Query  1     ALRGCWYAIYATCLGVCPAILSLWLIGPahlttgtaaaavaitaFIVVLP-QNTHVVAKR  177
              LRGCW+ + A+   +  +++S+ +IGP + T+  AA A+A +AF+V LP ++TH+V K+
Sbjct  69    TLRGCWHVLCASIQVMILSLVSVQVIGPQNFTSHVAALAMAASAFLVALPVESTHLVTKQ  128

Query  178   IALGQTVLVYALAGPRTQP--IMHPlrvaastaiavaacvlalllpypslassKVKHNCH  351
             IA GQ V VY             H + V   TA+  AA VLA+LLP P LA  + ++ C 
Sbjct  129   IAFGQLVNVYVRTSIDGGEGFATHTIHVVCCTALGAAASVLAMLLPCPRLAYFQTRNLCR  188

Query  352   LFAENVSQRLNLLVKAFSAEDNASALSLVSQAKSLNASGAKFLQNIKSKQESMQWERYPI  531
             L+ +N+S+RLN  +K   A +N++ +   SQAKSL+ SG K LQ+I++K  ++ WE+   
Sbjct  189   LYNDNISERLNYNIKVICASNNSAGVGYFSQAKSLSTSGVKLLQSIRNKLNALDWEQLQT  248

Query  532   KFFRPYCKNPGERLQEYETPLRGMEMGLVDNNPPQFPVTVLLSSSEVKDSLDSLTGHISK  711
             + F+    +P ++LQ +E P+R M++ L   +   FPV V+    +++  L    G  +K
Sbjct  249   RIFKSDWIDPEDKLQYFELPIRSMDIAL---STCTFPVKVI--DEDLQGILLKCIGEFNK  303

Query  712   QVKGRL-----FDLATVPESNAQNAVKFLHQKLQ--PVTLQdlssffflfslklllikps  870
             Q++ +      FD  T  E       K L    +  P +         L    ++     
Sbjct  304   QLERQSKFFTPFDATTTSEMRKDILTKNLSMAYKDLPASFFLYCMHLLLDGSPIIKKMDP  363

Query  871   ssilkdkdGSKEQEERFLDKIYSNFVGQMNNKRFVASLKYALALGLAVFFGSIYSKPDGF  1050
                   K+G+ +     +  I  +     +N   V  LK +L+LG+AVF G  Y+K +G+
Sbjct  364   MLRKTSKNGNFQWGINNIRDIVMDLFPSKSN--LVFPLKSSLSLGVAVFLGLTYNKENGY  421

Query  1051  WAGLTVAISYVSAREATFRIANVKAQGTVLGSIYGVLGCFVFAKYEELRFISLIPWFIVC  1230
             W+GLTVA+ +V+ + +TF +AN + QGT +GSIYGVL CF+F ++ ++RF  L+PW    
Sbjct  422   WSGLTVAVCFVTGQHSTFSLANARGQGTAMGSIYGVLCCFIFQRFMDIRFSLLLPWVFFS  481

Query  1231  SFLRRSRMYGPAGGISACIGAVLILGREGFGPPREFAMARIMETFIGLACSITVELLFRP  1410
             SFL  SRMYG AGGISA  GA+L++G      P +FA+ARI+E  IGL C + VE++F P
Sbjct  482   SFLMYSRMYGKAGGISAVTGALLVIGINHDEDPSKFALARIVEATIGLLCFVAVEIIFNP  541

Query  1411  TRASSLAKIQLSKSLQLLNQCIISI--------DYSSNNQSKLEETQKILKSSVTQLGKF  1566
              RAS+LAK +L++ L+ L  CI  I        D SS +    +E    LKS V+QL + 
Sbjct  542   FRASTLAKAKLAQCLRSLQHCIGHIAIIIPNEKDKSSFSYQASKEGHLKLKSMVSQLEEV  601

Query  1567  IGEAEVEPNFWFLPFHSACYGKLMGSLSKVVEYLHFVAQAL---RFLEQESA-----LMG  1722
               EAE+EPNFWF+PFH+ACY K++ SLS + + L FVA ++   + L QE       L  
Sbjct  602   TMEAELEPNFWFVPFHNACYKKMLKSLSTMADLLLFVAHSMENIKLLLQEDETFFVDLHD  661

Query  1723  RLDSDHLSLFRDHVGPSIKSFEEIISLVGSVSVLDKEFEKKKSSIDPELGKLPTSNNI-T  1899
             R++ + +S+ ++ VG ++   E+ I+ + S   L+ E    K  +D +  + P  +    
Sbjct  662   RVNENVVSV-KNKVGVTLNCIEK-ITRIKSHGELENELRNIKLPVDIDKQEYPRKDAFWI  719

Query  1900  GLSDEEIDNKLKSFMEDSRQFVDQKdeddddeVMMNSQVALSLSALAFC  2046
                DEE++N   SF+    + +  K   + +E M+  Q+      L FC
Sbjct  720   WNGDEEVNNITYSFVHHLEE-IANKICTNTNEEMLKCQMLFHYGCLGFC  767



>ref|XP_002527739.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF34652.1| conserved hypothetical protein [Ricinus communis]
Length=414

 Score =   323 bits (827),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 184/420 (44%), Positives = 270/420 (64%), Gaps = 29/420 (7%)
 Frame = +1

Query  952   QMNNKRFVASLKYALALGLAVFFGSIYSKPDGFWAGLTVAISYVSAREATFRIANVKAQG  1131
             +++++R+  +LK +L+LG AV FG I++K +G+W+GLT+A S++  R+ATF  AN +AQ 
Sbjct  3     KLSSERWNFALKCSLSLGFAVLFGLIFNKENGYWSGLTIATSFIKGRQATFTAANARAQA  62

Query  1132  TVLGSIYGVLGCFVFAKYEELRFISLIPWFIVCSFLRRSRMYGPAGGISACIGAVLILGR  1311
             T LGS+YGVL  F+F ++ + RF+ L PW I  +FL+ SRMYG AGGISA IGA+LILGR
Sbjct  63    TALGSVYGVLCSFIFQRFVDYRFLLLFPWIIFSNFLKHSRMYGQAGGISAVIGALLILGR  122

Query  1312  EGFGPPREFAMARIMETFIGLACSITVELLFRPTRASSLAKIQLSKSLQLLNQCIISIDY  1491
             + +G P EFA+ARI+ETFIGL CS+TVE+LF+P RA++LA+ Q   SL+ L  CI  I  
Sbjct  123   KNYGSPSEFAIARIVETFIGLICSVTVEILFQPARAATLAETQFIWSLRALQSCIEDIVL  182

Query  1492  SSNNQSK-------LEETQKILKSSVTQLGKFIGEAEVEPNFWFLPFHSACYGKLMGSLS  1650
              +  +S        L E QK LKS + Q+GKFIG+A +EPNFWFLPF  A Y K + SL 
Sbjct  183   LAGQKSMSESVPLGLREKQKTLKSHIDQMGKFIGDATLEPNFWFLPFQEAIYEKFLRSLR  242

Query  1651  KVVEYLHFVAQALRFLEQESALMG----------RLDSDHLSLFRDHVGPSIKSFEEIIS  1800
             K+ + + F A A+  L   S  +G           +D DH   F++ V  S+   EE++ 
Sbjct  243   KMQDLILFAAYAVEILSGISEKLGLDWEELEEYIDIDLDH---FQEKVKSSLICLEEVLC  299

Query  1801  LVGSVSVLDKEFEKKKSSIDPELGKLPTSNNITGLSDEEIDNKLKSFMEDSRQFVDQKde  1980
              V S++V + +++K   S D E GK    ++I GL  E +   + SFME+S++ V   + 
Sbjct  300   -VKSIAVFENKWQK---SPDIESGK----SDIKGLDVESVLEIVSSFMENSKEVVSMANA  351

Query  1981  ddddeVMMNSQVALSLSALAFCMRGIVRETKEIDKAIKELVQWENPSSPVNLHEISCKIR  2160
                ++ + N Q+ + LS L FC+  ++RET EI K +KEL+  E+P+  +NL+EI CK +
Sbjct  352   SKGEQRLKN-QMIIYLSGLGFCISNLMRETIEIGKGVKELIAMESPAMQINLNEILCKFK  410



>ref|XP_009622735.1| PREDICTED: uncharacterized protein LOC104114081 [Nicotiana tomentosiformis]
Length=363

 Score =   318 bits (814),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 182/320 (57%), Positives = 236/320 (74%), Gaps = 10/320 (3%)
 Frame = +1

Query  331   KVKHNCHLFAENVSQRLNLLVKAFSAEDNASALSLVSQAKSL--NASGAKFLQNIKSKQE  504
             +VK    LF EN S+R+NL VKAFSAED  SAL+L+SQAK L  +   A FL++  S  E
Sbjct  41    EVKEKSRLFVENASERINLFVKAFSAEDKESALALISQAKVLRSDTRAATFLES-PSNIE  99

Query  505   SMQWERYPIKFFRPYCKNPGERLQEYETPLRGMEMGLVDNNPPQFPVTVLLSSSEVKDSL  684
             SM+WER+P KF RPY + PG + QE +TPLRGME+ L + +PP FP+ +L  +SE+KD L
Sbjct  100   SMKWERFPFKFLRPYGEKPGNKFQEIQTPLRGMEIAL-EKSPP-FPLDIL--NSELKDGL  155

Query  685   DSLTGHISKQVKGRLFDLATVPESNAQNAVKFLH--QKLQPVTLQdlssffflfslklll  858
             + L+ HISKQVK    D ATVPESNA+NA KFL   Q +QP T +DL S FFLF LKLLL
Sbjct  156   EKLSEHISKQVKNISLDSATVPESNAENAEKFLQTLQTIQP-TKKDLPSLFFLFCLKLLL  214

Query  859   ikpsssilkdkdGSKEQEERFLDKIYSNFVGQMNNKRFVASLKYALALGLAVFFGSIYSK  1038
              KP     K +   +++EE ++ K ++N    +N++RF+A+   +L+LGLA+FFGSIYSK
Sbjct  215   NKPIFLSSKKESKKQDEEEGYMRKTWTNLTVTINSRRFMAAFNLSLSLGLAIFFGSIYSK  274

Query  1039  PDGFWAGLTVAISYVSAREATFRIANVKAQGTVLGSIYGVLGCFVFAKYEELRFISLIPW  1218
              +GFWAGL VAIS  + REATF++ANVKAQGTVLG++YGVLGCF+F ++ ++RF+SL+PW
Sbjct  275   ENGFWAGLPVAISLAATREATFKVANVKAQGTVLGTVYGVLGCFLFERFVQIRFLSLLPW  334

Query  1219  FIVCSFLRRSRMYGPAGGIS  1278
             FIV SFL  SRMYG A GIS
Sbjct  335   FIVSSFLSCSRMYGQASGIS  354



>gb|KFK38331.1| hypothetical protein AALP_AA3G100300 [Arabis alpina]
Length=777

 Score =   330 bits (845),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 265/723 (37%), Positives = 379/723 (52%), Gaps = 55/723 (8%)
 Frame = +1

Query  4     LRGCWYAIYATCLGVCPAILSLWLIGPahlttgtaa-aavaitaFIVVLPQNTHVVAKRI  180
             L+ C    YAT   +  A++S+ ++GPA L  G  A  AVAI +FIV  P +T ++ KRI
Sbjct  64    LKCCADVSYATFQTLAIALVSVLVVGPASLANGLVAPVAVAIASFIVAFPVSTSLLTKRI  123

Query  181   ALGQTVLVYALA----GPRTQPIMHPlrvaastaiavaacvlalllpypslassKVKHNC  348
             A GQ V+VY       G      M P+ VAASTA+   A ++A+LLP P LA +++  +C
Sbjct  124   AFGQIVVVYVTFVVFNGEVAHVTMLPVHVAASTALGAIASLVAVLLPLPRLAHTQMTTDC  183

Query  349   HLFAENVSQRLNLLVKAFSAEDNASALSLVSQAKSLNASGAKFLQNIKSKQESMQWERYP  528
              L+AEN  +RLNL  +   A DN +A  L++ A SL+A     L+NIK   + M WER  
Sbjct  184   KLYAENALERLNLFTEVMMARDNTTAQVLIANAASLSAEARNTLKNIKIHHDRMAWERPD  243

Query  529   IKFFRPYCKNPGERLQEYETPLRGMEMGLVDNNPPQFPVTVLLSSSEVKDSLDSLTGHIS  708
              +F R   K  GE+LQ  E  +RGMEM L       FP+ +  S  E    L+     I+
Sbjct  244   TRFLRKKQKQHGEKLQATEFLMRGMEMAL--GYCSSFPLRI--SRDEATSILEGPRTQIA  299

Query  709   KQVKGRL---FDLATVPESNAQNAVKFLHQKLQPVTLQdlssffflfslklllikpsssi  879
              +    L     L   PE+ +          L P TL        +   +          
Sbjct  300   HESASTLKPEDRLRWHPEAGS----------LSPATLPVCFFRNCVELFRGDFSSVRQDS  349

Query  880   lkdkdGSKEQE-----------ERFLDKIYSNFVGQMNNKRFVASLKYALALGLAVFFGS  1026
                  G+ E+E           +R LD I       M  +RFV +LK +++LG AV FG 
Sbjct  350   KCVDTGNTEEETHRDNKGLSMTKRVLDII----CVWMARERFVFALKCSVSLGFAVLFGI  405

Query  1027  IYSKPDGFWAGLTVAISYVSAREATFRIANVKAQGTVLGSIYGVLGCFVFAKYEELRFIS  1206
             +Y+K +G+W+GLTVAIS VS R+AT  +AN + QGT +GS+YG+L C VF   EE RF+ 
Sbjct  406   MYNKKNGYWSGLTVAISLVSGRQATLTVANSRLQGTAMGSVYGLLCCSVFQSLEEFRFLP  465

Query  1207  LIPWFIVCSFLRRSRMYGPAGGISACIGAVLILGREGFGPPREFAMARIMETFIGLACSI  1386
             L+PW  V  F+R S++YG   G++A I A+LILGR  +G P EFA+ARI+E  IGL C  
Sbjct  466   LLPWIAVTVFMRHSKVYGQPEGVTAAIAALLILGRRNYGAPTEFAIARIVEASIGLLCFA  525

Query  1387  TVELLFRPTRASSLAKIQLSKSLQLLNQCIISIDYSSNNQSK-------LEETQKILKSS  1545
               E+L  P RA++LA+ +LS  L  L  CI S+   S  +++       L + Q  LKS 
Sbjct  526   FGEILVTPARAATLARTELSHCLDALLDCIRSLVLCSEQKNQKMSVVTDLRKRQAKLKSH  585

Query  1546  VTQLGKFIGEAEVEPNFWFL-PFHSACYGKLMGSLSKVVEYLHFVAQALRFLEQESALMG  1722
             V  L +   EA  EPN  FL P ++  Y KL+GS SK+ +   +V   L+ L      +G
Sbjct  586   VEALERLTAEALTEPNIPFLRPLNAVTYNKLLGSFSKISDLCLYVCDDLKNLSGAQPTLG  645

Query  1723  RLDSDH----LSLFRDHVGPSIKSFEEIISLVGSVSVLDKEFEKKKSSIDPELGKLPTSN  1890
                 DH    L  F + +  S+K  EE  S   S++ L+KE +K+K   D E G  P  N
Sbjct  646   -FPWDHITHDLKAFEEKLQSSVKCLEENAS-TKSLARLEKELQKRKICHDVEAGTTPNDN  703

Query  1891  NIT---GLSDEEIDNKLKSFMEDSRQFVDQKdeddddeVMMNSQVALSLSALAFCMRGIV  2061
             ++    G S ++ +    SF+   ++  D K   D  E +  S+ ALSLS+L FC+  ++
Sbjct  704   HLNTELGPSQDDAEKFTVSFVMLLKEATD-KINGDTTEEVFKSETALSLSSLGFCISRLM  762

Query  2062  RET  2070
             +ET
Sbjct  763   QET  765



>ref|XP_010464592.1| PREDICTED: uncharacterized protein LOC104745116 [Camelina sativa]
Length=779

 Score =   324 bits (831),  Expect = 6e-95, Method: Compositional matrix adjust.
 Identities = 234/675 (35%), Positives = 365/675 (54%), Gaps = 43/675 (6%)
 Frame = +1

Query  133   FIVVLPQNTHVVAKRIALGQTVLVYA----LAGPRTQPIMHPlrvaastaiavaacvlal  300
             FIV  P +T ++ KRIA GQ V+VY       G      M P+ +AASTA+   A +LA+
Sbjct  108   FIVAFPVSTSLLTKRIAFGQIVVVYVTFAVFNGEVAHVFMLPVHLAASTALGAIASILAV  167

Query  301   llpypslassKVKHNCHLFAENVSQRLNLLVKAFSAEDNASALSLVSQAKSLNASGAKFL  480
             LLP+P LA S++   C L+AE   +RLNL V    A DN +A  L+++A SL+A+    L
Sbjct  168   LLPFPRLAHSQMSKGCELYAETALERLNLFVDVMMARDNTTAQVLITRAASLSAAAKNIL  227

Query  481   QNIKSKQESMQWERYPIKFFRPYCK-NPGERLQEYETPLRGMEMGLVDNNPPQFPVTVLL  657
             ++IK   + + WER   +F R   K +P E+L   E  +RG+E+ L   +   FP    +
Sbjct  228   KSIKIHHDRLAWERPDTRFLRRKQKLDPAEKLHATEFLMRGLELAL--GSCSSFPQG--M  283

Query  658   SSSEVKDSLDSLTGHISKQVKGRLFDLATVPESNAQNAVKFLHQ--KLQPVTLQdlssff  831
             +  EV   L+    HI+ Q    L          +Q+++ +  +   L    L      +
Sbjct  284   NRDEVTRLLEGPRTHIAPQSSSTL---------KSQDSLDWHLEAGSLSTAALPVCFFRY  334

Query  832   flfslklllikpsssilkdkdGSKEQEER-------FLDKIYSNFVGQMNNKRFVASLKY  990
              +   +   +            + E+E            K+ +     M  ++FV + K 
Sbjct  335   CVKIFRGDSLSVRQDSNSVNRSNTEEETHPENEGLSMTKKVLNILCVWMAREKFVFAFKC  394

Query  991   ALALGLAVFFGSIYSKPDGFWAGLTVAISYVSAREATFRIANVKAQGTVLGSIYGVLGCF  1170
             +++LGLAV FG +Y+K +G+W+GLTVAIS VS R+AT  +AN + QGT +GS+YG+L CF
Sbjct  395   SISLGLAVLFGIMYNKQNGYWSGLTVAISLVSGRQATLTVANSRLQGTAMGSVYGLLCCF  454

Query  1171  VFAKYEELRFISLIPWFIVCSFLRRSRMYGPAGGISACIGAVLILGREGFGPPREFAMAR  1350
             VF + EE RF+ L+PW I+  F+R S++YG  GG++A I A+LILGR  +G P EFA+ R
Sbjct  455   VFHRLEEFRFLPLLPWIILAVFMRHSKVYGQPGGVTAAIAALLILGRRNYGAPTEFAITR  514

Query  1351  IMETFIGLACSITVELLFRPTRASSLAKIQLSKSLQLLNQCIISIDYSSNNQSK------  1512
             I+E  IGL C +  E+L  P RA++LA+ +LS  L  L  CI S+   S  +++      
Sbjct  515   IVEASIGLLCFVFGEILVTPVRAATLARTELSHCLDALLDCIQSLVLCSEEKNQKMASVT  574

Query  1513  -LEETQKILKSSVTQLGKFIGEAEVEPNFWFL-PFHSACYGKLMGSLSKVVEYLHFVAQA  1686
              L + Q  LKS V  L +  GEA  EP   FL P ++  Y KL+GS SK+ +   +V   
Sbjct  575   DLRKRQAKLKSHVDALERLTGEALTEPKIPFLRPLNTVSYYKLLGSFSKISDLCLYVCDG  634

Query  1687  LRFLE--QESALMGRLDSDH-LSLFRDHVGPSIKSFEEIISLVGSVSVLDKEFEKKKSSI  1857
             L+ L   Q + +    +  H L  F++ + PS+K  +E I++  S + L KE +K+K   
Sbjct  635   LKNLSGVQPNLVFPWDNITHDLRAFQEKLNPSVKCLKE-INITKSQARLQKELQKRKICH  693

Query  1858  DPELGKLPTSNNIT----GLSDEEIDNKLKSFMEDSRQFVDQKdeddddeVMMNSQVALS  2025
             D E G   ++ N +    G S ++ +    SF+   ++  D+  ++  +EV+  S+ AL 
Sbjct  694   DVEAGTTTSNENYSNMELGPSQDDAERFSASFVMLLKEATDKISDNTAEEVLKKSETALC  753

Query  2026  LSALAFCMRGIVRET  2070
             LS+L FC+  +++ET
Sbjct  754   LSSLGFCISRLMQET  768



>emb|CDY44709.1| BnaA05g28970D [Brassica napus]
Length=756

 Score =   314 bits (804),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 246/706 (35%), Positives = 377/706 (53%), Gaps = 41/706 (6%)
 Frame = +1

Query  4     LRGCWYAIYATCLGVCPAILSLWLIGPahl-ttgtaaaavaitaFIVVLPQNTHVVAKRI  180
             L+ C    YAT       ++S+ ++GPA L  +  A  AVA+ +FIV  P +T ++ KRI
Sbjct  64    LKCCVDVSYATFQTAAIVLVSVLVVGPASLGISLVAPVAVAVASFIVAFPASTSLLTKRI  123

Query  181   ALGQTVLVYA----LAGPRTQPIMHPlrvaastaiavaacvlalllpypslassKVKHNC  348
             A GQ VLVY       G      M P+ VAASTA+   A +LA+LLP+P LA S++   C
Sbjct  124   AFGQIVLVYVTFAVFNGEVAHVFMLPVHVAASTALGAFASLLAVLLPFPRLAHSQMSKGC  183

Query  349   HLFAENVSQRLNLLVKAFSAEDNASALSLVSQAKSLNASGAKFLQNIKSKQESMQWERYP  528
              L+AEN  +RLNL V+   A DN +A  L+++A SL+++    L++IK   E + WER  
Sbjct  184   KLYAENALERLNLFVEVIMARDNTTAQVLITKAASLSSAARHTLKSIKIHHERLAWERPD  243

Query  529   IKFFRPYCKNPGERLQEYETPLRGMEMGLVDNNPPQFPVTVLLSSSEVKDSLDSLTGHIS  708
              +F +    + GE+LQ  E  +RGME+ L   +   FP+   +S  E+ + L++   HI+
Sbjct  244   TRFLKKKQNHQGEKLQATEFLMRGMEIAL--GSCSSFPLG--MSRDELTNLLEAPRAHIA  299

Query  709   KQVKGRL---FDLATVPESNAQNAVKFLHQKLQPVTLQdlssffflfslklllikpsssi  879
              +    L     L  +PE+ + +          PV              +  +      +
Sbjct  300   HESAPTLKPEDKLTWLPEAGSLSTTSL------PVYF-----------FRYCVELFRGDV  342

Query  880   lkdkdGSKEQEERFLDKIYSNFVG-QMNNKRFVASLKYALALGLAVFFGSIYSKPDGFWA  1056
                +  SK  +E    K   + +   M  +RFV + K +++LGLAV FG +Y+K +G+W+
Sbjct  343   SSVRQDSKRVDELSTSKTVLDVLSVWMARERFVFAFKCSISLGLAVLFGILYNKKNGYWS  402

Query  1057  GLTVAISYVSAREATFRIANVKAQGTVLGSIYGVLGCFVFAKYEELRFISLIPWFIVCSF  1236
             GLTVAIS VS R+AT  +AN + QGT +GS+YG+L C VF + EE RF+ L+PW  +  F
Sbjct  403   GLTVAISLVSGRQATLTVANSRLQGTAMGSVYGLLCCAVFQRLEEFRFLPLLPWIAITVF  462

Query  1237  LRRSRMYGPAGGISACIGAVLILGREGFGPPREFAMARIMETFIGLACSITVELLFRPTR  1416
             +R S++YG  GG+++ I A+LILGR  +G P +FA+ RI+E  IGL C +  E+L  P R
Sbjct  463   MRHSKVYGQPGGVTSAIAALLILGRRNYGAPTDFAITRIVEASIGLLCFVLGEVLVTPAR  522

Query  1417  ASSLAKIQLSKSLQLLNQCIISIDYSSNNQ----SKLEETQKILKSSVTQLGKFIGEAEV  1584
             AS+LA+ +L   L  +  CI S+   S  +    S L   Q+ L S V  L +   EA  
Sbjct  523   ASTLARAELKHCLDAVLDCIGSLVLCSEQKNMPLSDLRSKQEKLNSHVEALERLTSEALR  582

Query  1585  EPNFWFL-PFHSACYGKLMGSLSKVVEYLHFVAQALRFLEQESALMGRLDSDHLSLFRDH  1761
             EPN  FL P  +  Y K++ SLSKV +   +V   L  L         +  D L  F++ 
Sbjct  583   EPNVPFLKPLKAVSYKKVLVSLSKVSDLCLYVCDGLTNLSGAHPWDQAITHD-LKAFQEK  641

Query  1762  VGPSIKSFEEIISLVGSVSVLDKEFEKKKSSIDPELGKLPT---SNNITGLSDEEIDNKL  1932
             +  S+K  EE ++   + + L KE +K+K   D E G       SN   G S ++ +   
Sbjct  642   LHSSVKCLEE-MACTKTQARLQKELQKRKICHDVEAGTASNDNYSNMEMGPSQDDAERFS  700

Query  1933  KSFMEDSRQFVDQKdeddddeVMMNSQVALSLSALAFCMRGIVRET  2070
              SF++  ++ V +K      E ++ S+  L LS+L FC+  +++ET
Sbjct  701   VSFVKLLKE-VTEKTSGSTAEEVVKSETTLCLSSLGFCISRLMQET  745



>ref|XP_010486516.1| PREDICTED: uncharacterized protein LOC104764643 [Camelina sativa]
Length=778

 Score =   306 bits (783),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 248/718 (35%), Positives = 387/718 (54%), Gaps = 43/718 (6%)
 Frame = +1

Query  4     LRGCWYAIYATCLGVCPAILSLWLIGPahlttgtaa-aavaitaFIVVLPQNTHVVAKRI  180
             L+ C    YAT       ++S+ ++GPA L  G  A  AVA+ +FIV  P +T ++ KRI
Sbjct  64    LKCCVDVTYATFQTTAIVLVSVLVVGPASLGNGLVAPVAVALASFIVAFPVSTSLLTKRI  123

Query  181   ALGQTVLVYALA----GPRTQPIMHPlrvaastaiavaacvlalllpypslassKVKHNC  348
             A GQ V+VY       G      M P+ +AASTA+   A +LA+LLP+P LA S++   C
Sbjct  124   AFGQIVVVYVTFVVFNGEVAHVFMLPVHLAASTALGAIASILAVLLPFPRLAHSQMSKGC  183

Query  349   HLFAENVSQRLNLLVKAFSAEDNASALSLVSQAKSLNASGAKFLQNIKSKQESMQWERYP  528
              L+AE   +RLNL V    A DN +A  L+++A SL+A+    L++IK   + + WER  
Sbjct  184   KLYAETALERLNLFVDVMMARDNTTAQVLIARAASLSAAAKNTLKSIKIHHDRLAWERPD  243

Query  529   IKFFRPYCK-NPGERLQEYETPLRGMEMGLVDNNPPQFPVTVLLSSSEVKDSLDSLTGHI  705
              +F R   K +PGE+L   E  +RG+E+ L   +   FP    ++  E+   L+    HI
Sbjct  244   TRFLRRKQKLDPGEKLHATEYLMRGLELAL--GSCSSFPQG--MNRDELTRLLEGPRTHI  299

Query  706   SKQVKGRLFDLATVPESNAQNAVKFLHQ--KLQPVTLQdlssffflfslklllikpsssi  879
             + Q    L          +Q+++ +  +   L    L      + +   +   +      
Sbjct  300   APQSSSTL---------KSQDSLDWHLEAGSLSTAALPVCFFRYCVKIFRADSLSVRQDS  350

Query  880   lkdkdGSKEQEER-------FLDKIYSNFVGQMNNKRFVASLKYALALGLAVFFGSIYSK  1038
                   + E+E            K+       M  ++FV + K +++LGLAV FG +Y+K
Sbjct  351   NSVNRSNTEEETHPGNEGLSITKKVLDILCVWMAREKFVFAFKCSISLGLAVLFGIMYNK  410

Query  1039  PDGFWAGLTVAISYVSAREATFRIANVKAQGTVLGSIYGVLGCFVFAKYEELRFISLIPW  1218
              +G+W+GLTVAIS VS R+AT  +AN + QGT +GS+YG+L CF+F + EE RF+ L+PW
Sbjct  411   QNGYWSGLTVAISLVSGRQATLTVANSRLQGTAMGSVYGLLCCFLFHRLEEFRFLPLLPW  470

Query  1219  FIVCSFLRRSRMYGPAGGISACIGAVLILGREGFGPPREFAMARIMETFIGLACSITVEL  1398
              I+  F+R S++YG  GG++A I A+LILGR  +G P EFA+ARI+E  IGL C +  E+
Sbjct  471   IILAVFMRHSKVYGQPGGVTAAIAALLILGRRNYGAPTEFAIARIVEASIGLLCFVFGEI  530

Query  1399  LFRPTRASSLAKIQLSKSLQLLNQCIISIDYSSNNQSK-------LEETQKILKSSVTQL  1557
             L  P RA++LA+ +L+  L  L  CI S+   S  +++       L + Q  LKS V  L
Sbjct  531   LVTPVRAATLARTELTHCLDALLVCIQSVVLCSEQKNQKMAAVTDLRKRQAKLKSHVDAL  590

Query  1558  GKFIGEAEVEPNFWFL-PFHSACYGKLMGSLSKVVEYLHFVAQALRFLE--QESALMGRL  1728
              +  GEA  EP   FL P ++  Y KL+GS SK+ +   +V   L+ L   Q + +    
Sbjct  591   ERLTGEALTEPKIPFLRPLNTVSYYKLLGSFSKISDLCLYVCDGLKNLSGVQPNLVFPWE  650

Query  1729  DSDH-LSLFRDHVGPSIKSFEEIISLVGSVSVLDKEFEKKKSSIDPELGKLPT---SNNI  1896
             +  H L  F++ + PS+K  +E I++  S + L KE +K+K   + E G       SN  
Sbjct  651   NITHDLRAFQEKLNPSVKCLKE-ITITKSQARLQKELQKRKICHNIEAGTTSNENYSNME  709

Query  1897  TGLSDEEIDNKLKSFMEDSRQFVDQKdeddddeVMMNSQVALSLSALAFCMRGIVRET  2070
              G S ++ +    SF+   ++  D+  ++  +EV+  S+ AL LS+L FC+  +++ET
Sbjct  710   LGPSQDDAERFTVSFVRLLKEATDKISDNTGEEVLKKSETALCLSSLGFCISRLMQET  767



>ref|XP_009146927.1| PREDICTED: uncharacterized protein LOC103870541 [Brassica rapa]
Length=756

 Score =   304 bits (778),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 246/706 (35%), Positives = 377/706 (53%), Gaps = 41/706 (6%)
 Frame = +1

Query  4     LRGCWYAIYATCLGVCPAILSLWLIGPahl-ttgtaaaavaitaFIVVLPQNTHVVAKRI  180
             L+ C    YAT       ++S+ ++GPA L  +  A  AVA+ +FIV  P +T ++ KRI
Sbjct  64    LKCCVDVSYATFQTAAIVLVSVLVVGPASLGISLVAPVAVAVASFIVAFPASTSLLTKRI  123

Query  181   ALGQTVLVYA----LAGPRTQPIMHPlrvaastaiavaacvlalllpypslassKVKHNC  348
             A GQ VLVY       G      M P+ VAASTA+   A +LA+LLP+P LA S++   C
Sbjct  124   AFGQIVLVYVTFAVFNGEVAHVFMLPVHVAASTALGAIASLLAVLLPFPRLAHSQMTKGC  183

Query  349   HLFAENVSQRLNLLVKAFSAEDNASALSLVSQAKSLNASGAKFLQNIKSKQESMQWERYP  528
              L+AEN  +RLNL V+   A DN +A  L+++A SL+++    L++IK   E + WER  
Sbjct  184   KLYAENALERLNLFVEVIMARDNTTAQVLIAKAASLSSAARHTLKSIKIHHERLAWERPD  243

Query  529   IKFFRPYCKNPGERLQEYETPLRGMEMGLVDNNPPQFPVTVLLSSSEVKDSLDSLTGHIS  708
              +F +    + GE+LQ  E  +RGME+ L   +   FP+   +S  E+ + L++   HI+
Sbjct  244   TRFLKKKQNHQGEKLQATEFLMRGMEIAL--GSCSSFPLG--MSRDELTNLLEAPRAHIA  299

Query  709   KQVKGRL---FDLATVPESNAQNAVKFLHQKLQPVTLQdlssffflfslklllikpsssi  879
              +    L     L  +PE+ + +          PV              +  +      +
Sbjct  300   HESAPTLKPEDKLTWLPEAGSLSTTSL------PVYF-----------FRYCVELFRGDV  342

Query  880   lkdkdGSKEQEERFLDKIYSNFVG-QMNNKRFVASLKYALALGLAVFFGSIYSKPDGFWA  1056
                +  SK  +E    K   + +   M  +RFV + K +++LGLAV FG +Y+K +G+W+
Sbjct  343   SSVRQDSKRVDELSTSKTVLDVLSVWMARERFVFAFKCSISLGLAVLFGILYNKKNGYWS  402

Query  1057  GLTVAISYVSAREATFRIANVKAQGTVLGSIYGVLGCFVFAKYEELRFISLIPWFIVCSF  1236
             GLTVAIS VS R+AT  +AN + QGT +GS+YG+L C VF + EE RF+ L+PW  +  F
Sbjct  403   GLTVAISLVSGRQATLTVANSRLQGTAMGSVYGLLCCAVFQRLEEFRFLPLLPWIAITVF  462

Query  1237  LRRSRMYGPAGGISACIGAVLILGREGFGPPREFAMARIMETFIGLACSITVELLFRPTR  1416
             +R S++YG  GG+++ I A+LILGR  +G P +FA+ RI+E  IGL C +  E+L  P R
Sbjct  463   MRHSKVYGQPGGVTSAIAALLILGRRNYGAPTDFAITRIVEASIGLLCFVLGEVLVTPAR  522

Query  1417  ASSLAKIQLSKSLQLLNQCIISIDYSSNNQ----SKLEETQKILKSSVTQLGKFIGEAEV  1584
             AS+LA+ +L   L  +  CI S+   S  +    S L   Q+ L S V  L +   EA  
Sbjct  523   ASTLARAELKHCLDAVLDCIGSLVLCSEQKNMPLSDLRSKQEKLNSHVEALERLTSEALR  582

Query  1585  EPNFWFL-PFHSACYGKLMGSLSKVVEYLHFVAQALRFLEQESALMGRLDSDHLSLFRDH  1761
             EPN  FL P  +  Y K++ SLSKV +   +V   L  L         +  D L  F++ 
Sbjct  583   EPNVPFLKPLKAVSYKKVLVSLSKVSDLCLYVCDGLTNLSGAHPWDQAITHD-LKAFQEK  641

Query  1762  VGPSIKSFEEIISLVGSVSVLDKEFEKKKSSIDPELGKLPT---SNNITGLSDEEIDNKL  1932
             +  S+K  EE ++   + + L KE +K+K   D E G       SN   G S ++ +   
Sbjct  642   LHSSVKCLEE-MACTKTQARLQKELQKRKICHDVEAGTASNDNYSNMEMGPSQDDAERFS  700

Query  1933  KSFMEDSRQFVDQKdeddddeVMMNSQVALSLSALAFCMRGIVRET  2070
              SF++  ++ V +K      E ++ S+  L LS+L FC+  +++ET
Sbjct  701   VSFVKLLKE-VTEKTSGSTAEEVVKSETTLCLSSLGFCISRLMQET  745



>emb|CDY41607.1| BnaC05g43440D [Brassica napus]
Length=758

 Score =   303 bits (776),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 243/703 (35%), Positives = 375/703 (53%), Gaps = 33/703 (5%)
 Frame = +1

Query  4     LRGCWYAIYATCLGVCPAILSLWLIGPahl-ttgtaaaavaitaFIVVLPQNTHVVAKRI  180
             L+ C    YAT       ++S+ ++GPA L  +  A  AVA+ +FIV  P +T ++ KRI
Sbjct  64    LKCCVDVSYATFQTAAIVLVSVLVVGPASLGISLVAPVAVAVASFIVAFPASTSLLTKRI  123

Query  181   ALGQTVLVYA----LAGPRTQPIMHPlrvaastaiavaacvlalllpypslassKVKHNC  348
             A GQ VLVY       G      M P+ VAASTA+   A +LA+LLP+P LA S++   C
Sbjct  124   AFGQIVLVYVTFAVFNGEVPHVFMLPVHVAASTALGAIASLLAVLLPFPRLAHSQMSKGC  183

Query  349   HLFAENVSQRLNLLVKAFSAEDNASALSLVSQAKSLNASGAKFLQNIKSKQESMQWERYP  528
              L+AEN  +RLNL V    A DN +A  L+++A SL+A+    L++IK   + + WER  
Sbjct  184   KLYAENALERLNLFVDVIMARDNTTAQVLIAKAASLSAAARHTLKDIKIHHDRLAWERPD  243

Query  529   IKFFRPYCKNPGERLQEYETPLRGMEMGLVDNNPPQFPVTVLLSSSEVKDSLDSLTGHIS  708
              +F +    + GE+LQ  E  +RGME+ L   +   FP+   +S  EV + L++   HI+
Sbjct  244   TRFLKKKQNHQGEKLQATEFLMRGMEIAL--GSCSSFPLG--MSRDEVTNLLEAPRTHIA  299

Query  709   KQVKGRLFDLATVPESNAQNAVKFLHQKLQPVTLQdlssffflfslklllikpsssilkd  888
                          PES A         +  P      ++   ++  +  +      +   
Sbjct  300   -------------PESAAPTLKPEDRPRCLPEAGSLSTTALPVYFFRYCVELFRGDVSSV  346

Query  889   kdGSKEQEERFLDKIYSNFVGQ-MNNKRFVASLKYALALGLAVFFGSIYSKPDGFWAGLT  1065
             +  SK  +  F  K + + +   M  +RFV + K +++LGLAV FG +Y+K +G+W+GLT
Sbjct  347   RQDSKRVDGSFTSKSFLDALSVWMARERFVFAFKCSISLGLAVLFGILYNKKNGYWSGLT  406

Query  1066  VAISYVSAREATFRIANVKAQGTVLGSIYGVLGCFVFAKYEELRFISLIPWFIVCSFLRR  1245
             VAIS VS R+AT  +AN + QGT +GS+YG+L C VF + EE RF+ L+PW     F+R 
Sbjct  407   VAISLVSGRQATLTVANSRLQGTAMGSVYGLLCCAVFQRLEEFRFLPLLPWIAATVFMRH  466

Query  1246  SRMYGPAGGISACIGAVLILGREGFGPPREFAMARIMETFIGLACSITVELLFRPTRASS  1425
             S++YG  GG+++ I A+LILGR  +G P +FA+ RI+E  IGL C +  E+L  P RAS+
Sbjct  467   SKVYGQPGGVTSAIAALLILGRRNYGAPTDFAITRIVEASIGLLCFVLGEVLVTPARAST  526

Query  1426  LAKIQLSKSLQLLNQCIISIDYSSNNQS----KLEETQKILKSSVTQLGKFIGEAEVEPN  1593
             LA+ +L   L  +  CI S+   S  ++     L   Q  L S V  L +   EA  EPN
Sbjct  527   LARAELKHCLDAVLDCIGSLVLCSEQKNMPLLDLRSKQAKLNSHVEALERLTSEALREPN  586

Query  1594  FWFL-PFHSACYGKLMGSLSKVVEYLHFVAQALRFLEQESALMGRLDSDHLSLFRDHVGP  1770
               FL P ++  Y K++ SLSKV +   +V   L  L         +  D L  F++ +  
Sbjct  587   VPFLKPLNAVSYKKVLVSLSKVSDLCLYVCDGLTNLSGAHPWDQAITHD-LKAFQEKLHS  645

Query  1771  SIKSFEEIISLVGSVSVLDKEFEKKKSSIDPELGKLPT---SNNITGLSDEEIDNKLKSF  1941
             S+K  EE+ S   + + L KE +K+K   D E G       SN   G S ++ +    SF
Sbjct  646   SVKCLEEMAS-TKTRARLQKELQKRKICHDVEAGTASNDNYSNMELGPSQDDAERFSVSF  704

Query  1942  MEDSRQFVDQKdeddddeVMMNSQVALSLSALAFCMRGIVRET  2070
             ++  ++  ++       E ++ ++ +L LS+L FC+  +++ET
Sbjct  705   VKLLKEATEKTSGSTTAEEVVKNETSLCLSSLGFCISRLMQET  747



>gb|EYU41707.1| hypothetical protein MIMGU_mgv1a021165mg [Erythranthe guttata]
Length=741

 Score =   301 bits (772),  Expect = 8e-87, Method: Compositional matrix adjust.
 Identities = 249/721 (35%), Positives = 377/721 (52%), Gaps = 57/721 (8%)
 Frame = +1

Query  1     ALRGCWYAIYATCLGVCPAILSLWLIGPahlttg-taaaavaitaFIVVLPQNTHVVAKR  177
             +LRGCW+A  AT   V PA+ + WL G     +   AA A A  +F+V LP++TH++AKR
Sbjct  64    SLRGCWHAFCATAQVVPPAMAAWWLAGDGDGLSVWIAALAAAAASFVVALPESTHLMAKR  123

Query  178   IALGQTVLVYALA----GPRTQPIMHPlrvaastaiavaacvlalllpypslassKVKHN  345
             IALGQ VL    A           MHPL +AASTA+  +A V+ALLLP+P LA  +V+  
Sbjct  124   IALGQIVLTCTDAVITSDESISGYMHPLHIAASTALGASASVIALLLPFPRLAHFEVEKL  183

Query  346   CHLFAENVSQRLNLLVKAFSAEDNASALSLVSQAKSLNASGAKFLQNIKSKQESMQWERY  525
               ++A+N  +R+NL ++AF A DN +   L+ QAK    +G K L NI    E + WER 
Sbjct  184   RRVYAKNARERMNLYLRAFDANDNRTKTELLLQAKPFAQTGNKLLHNITILLEVIWWERP  243

Query  526   PIKFFRPYCKNPGERLQEYETPLRGMEMGLVDNNPP----QFPVTVLLSSSEVKDSLDSL  693
                + +    +  +RL+  E  + GME  LV +  P    QFP      SS +   +D  
Sbjct  244   WSHYSKHDLVSIKDRLRITELTMSGMEYSLVSSQTPDNQEQFPSVFDSLSSYLHHKIDQA  303

Query  694   TGHISKQVKGRLFDLATVPESNAQNAVKFLHQKLQPVTLQdlssffflfslklllikpss  873
                I K  + R    +T  E N    +  +H K Q +                + +  + 
Sbjct  304   ILPIEKAHEKR--KGSTFIEENLSLPLVPIHNKHQCICF----------FFSCIDMFINK  351

Query  874   silkdkdGSKEQEERF--LDKIYSNFVGQMNNKRFVASLKYALALGLAVFFGSIYSKPDG  1047
             +       +K Q+  F  ++KI +       + R  ++LK +L+LGLAV  G +  K +G
Sbjct  352   TAENHISQTKPQKTEFPIIEKIKNWIFKLSRSDRLESALKCSLSLGLAVVSGLMLEKENG  411

Query  1048  FWAGLTVAISYVSAREATFRIANVKAQGTVLGSIYGVLGCFVFAKYEELRFISLIPWFIV  1227
              WA LTVA  +   ++  F  AN +AQGT +GS+YGV+ CF+F  Y ELR +SL+PW + 
Sbjct  412   CWASLTVATGFSIGKQPFFTAANSRAQGTAVGSVYGVICCFLF-HYLELRLLSLLPWIVF  470

Query  1228  CSFLRRSRMYGPAGGISACIGAVLILGREGFGPPREFAMARIMETFIGLACSITVELLFR  1407
               F+R SRMYG  GG+SA  GA LILGR+ +GPP EFA+ARI   F+G+ C + VELL +
Sbjct  471   SIFIRHSRMYGQTGGMSAAAGASLILGRKKYGPPSEFAIARITSVFVGMFCFLLVELLIQ  530

Query  1408  PTRASSLAKIQLSKSLQLLNQCIISIDYSSNNQ--SKLEETQKILKSSVTQLGKFIGEAE  1581
             P RA++LAK QL  +L  L   +    +    +     E+ Q+  ++ V +L   + +A+
Sbjct  531   PNRAATLAKRQLYLTLGALENSLNGTGFRRVPKFLQAREKNQRKFETRVQELSISVADAD  590

Query  1582  VEPNFWFLPFHSACYGKLMGSLSKVVEYLHFVAQALRFLEQESALMGRLDSDHLSLFRDH  1761
              EP+FW LPF ++CY K++ SLS +V  ++F+   L  L   S    +LD++ L L ++ 
Sbjct  591   SEPDFWCLPFQTSCYKKVVASLSCIVNMVYFLEYNLETL---SEYHEQLDNE-LELLKES  646

Query  1762  VGPSIKSFEEIISLVGSVSVLDKEFEKKKSSIDPELGKLPTSNNITGLSDEEIDNKLKSF  1941
             +   +K  +  +SLV +  V   + E+K   I  E GKL  S  +  L  E  +      
Sbjct  647   IKSLLKYLK--VSLVKTPPV---DIEEKSREI--EAGKLRNSEKVNELVIEYEEK-----  694

Query  1942  MEDSRQFVDQKdeddddeVMMNSQVALSLSALAFCMRGIVRETKEIDKAIKELVQWENPS  2121
              E+ R+                  V   + A+ FC+  + +E   ++  +KE+VQWEN S
Sbjct  695   -ENERRH--------------GETVVRCMGAIEFCISSMRKEIDNVEIYVKEIVQWENYS  739

Query  2122  S  2124
             +
Sbjct  740   T  740



>ref|XP_010473184.1| PREDICTED: uncharacterized protein LOC104752651 [Camelina sativa]
Length=778

 Score =   301 bits (772),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 249/723 (34%), Positives = 383/723 (53%), Gaps = 53/723 (7%)
 Frame = +1

Query  4     LRGCWYAIYATCLGVCPAILSLWLIGPahlttgtaa-aavaitaFIVVLPQNTHVVAKRI  180
             L+ C    +AT       ++S+ ++GPA L  G  A  AVA+ +FIV  P +T ++ KRI
Sbjct  64    LKCCVDVSFATFQTTAIVLVSVLVVGPASLGNGFVAPVAVALASFIVAFPVSTSLLTKRI  123

Query  181   ALGQTVLVYALA----GPRTQPIMHPlrvaastaiavaacvlalllpypslassKVKHNC  348
             A GQ V+VY       G      M P+ +AASTA+   A +LA+LLP+P LA S++   C
Sbjct  124   AFGQIVVVYVTFVVFNGEVAHVFMLPVHLAASTALGAIASLLAVLLPFPRLAHSQMSKGC  183

Query  349   HLFAENVSQRLNLLVKAFSAEDNASALSLVSQAKSLNASGAKFLQNIKSKQESMQWERYP  528
               +AE   +RLNL V+   A DN +A  L+++A S +A+    L++IK   + + WER  
Sbjct  184   KFYAETALERLNLFVEVMMARDNTTAQVLIARAASFSAAAKNTLKSIKIHHDRLVWERPD  243

Query  529   IKFFRPYCK-NPGERLQEYETPLRGMEMGLVDNNPPQFPVTVLLSSSEVKDSLDSLTGHI  705
              +F R   K NP E+L   E  +RG+E+ L   +   FP    ++  E+   L+    HI
Sbjct  244   TRFLRRKQKLNPEEKLHATEFLMRGLELAL--GSCSSFPQG--MNHDELTRLLEGPRTHI  299

Query  706   SKQVKGRL-------FDLATVPESNAQNAVKFLHQKLQPVTLQdlssffflfslklllik  864
             + Q    L       + L T   S A   V F    ++                +   + 
Sbjct  300   APQSSSTLKSQDSLDWHLETGSLSTAALPVCFFRYCIK--------------IFRGDFLS  345

Query  865   psssilkdkdGSKEQEER-------FLDKIYSNFVGQMNNKRFVASLKYALALGLAVFFG  1023
                        + E+E            K+       M  ++FV + K +++LGLAV FG
Sbjct  346   MRQDSNSVNRSNTEEETHPGNEGLSMTKKVLDILCVWMAREKFVFAFKCSISLGLAVLFG  405

Query  1024  SIYSKPDGFWAGLTVAISYVSAREATFRIANVKAQGTVLGSIYGVLGCFVFAKYEELRFI  1203
              +Y+K +G+W+GLTVAIS VS R+AT  +AN + QGT +GS+YG+L CF+F + EE RF+
Sbjct  406   IMYNKQNGYWSGLTVAISLVSGRQATLTVANSRLQGTAMGSVYGLLCCFLFHRLEEFRFL  465

Query  1204  SLIPWFIVCSFLRRSRMYGPAGGISACIGAVLILGREGFGPPREFAMARIMETFIGLACS  1383
              L+PW I+  F+R S++YG  GG++A I A+LILGR  +G P EFA+ARI+E  IGL C 
Sbjct  466   PLLPWIILAVFMRHSKVYGQPGGVTAAIAALLILGRRNYGAPTEFAIARIVEASIGLLCF  525

Query  1384  ITVELLFRPTRASSLAKIQLSKSLQLLNQCIISIDYSSNNQSK-------LEETQKILKS  1542
             +  E+L  P RA++LA+ +L+  L  L  CI S+   S  +++       L + Q  LKS
Sbjct  526   VFGEILVTPVRAATLARTELTHCLDALLDCIQSLVLCSEQKNQKMASVADLRKRQAKLKS  585

Query  1543  SVTQLGKFIGEAEVEPNFWFL-PFHSACYGKLMGSLSKVVEYLHFVAQALRFLE--QESA  1713
              V  L +  GEA  EP   FL P ++  Y KL+GS SK+ +   +V   L+ L   Q + 
Sbjct  586   HVDVLERLTGEALTEPKIPFLRPLNTVSYYKLLGSFSKISDLCLYVCDGLKNLSGVQPNL  645

Query  1714  LMGRLDSDH-LSLFRDHVGPSIKSFEEIISLVGSVSVLDKEFEKKKSSIDPELGKLPT--  1884
             +    +  H L  F++ + PS+K  +E I++  S + L KE +K+K   D E G      
Sbjct  646   VFPWENITHDLRAFQEKLNPSVKCLKE-ITITKSQARLQKELQKRKICHDIEAGTTSNEN  704

Query  1885  -SNNITGLSDEEIDNKLKSFMEDSRQFVDQKdeddddeVMMNSQVALSLSALAFCMRGIV  2061
              SN   G S ++ +    SF+   ++  D+  ++  +EV+  S+ AL LS+L FC+  ++
Sbjct  705   YSNMELGPSQDDAERFTVSFVRLLKEATDKISDNTAEEVLKKSETALCLSSLGFCISRLM  764

Query  2062  RET  2070
             +ET
Sbjct  765   QET  767



>ref|NP_187556.1| uncharacterized protein [Arabidopsis thaliana]
 gb|AAF14039.1|AC011436_23 hypothetical protein [Arabidopsis thaliana]
 gb|AAF23277.1|AC016661_2 hypothetical protein [Arabidopsis thaliana]
 gb|AEE74769.1| uncharacterized protein AT3G09450 [Arabidopsis thaliana]
Length=775

 Score =   298 bits (762),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 249/716 (35%), Positives = 379/716 (53%), Gaps = 42/716 (6%)
 Frame = +1

Query  4     LRGCWYAIYATCLGVCPAILSLWLIGPahlttgtaa-aavaitaFIVVLPQNTHVVAKRI  180
             L+ C    YAT   +  A++S+ ++GPA L  G  A  AVA+ +FIV  P +T ++ KRI
Sbjct  64    LKCCLDVSYATFQTIAIALVSVLVVGPASLGNGLVAPVAVALASFIVAFPVSTSLLTKRI  123

Query  181   ALGQTVLVYALA----GPRTQPIMHPlrvaastaiavaacvlalllpypslassKVKHNC  348
             A GQ V+VY       G      M P+ VA STA+   A ++A+LLP+P LA S++   C
Sbjct  124   AFGQIVVVYVTFVVFNGEVAHVFMLPVHVAGSTALGAIASLIAVLLPFPRLAHSQMSKGC  183

Query  349   HLFAENVSQRLNLLVKAFSAEDNASALSLVSQAKSLNASGAKFLQNIKSKQESMQWERYP  528
              L+AEN  +RLN+ V+   A DN +A  L+++A SL+A+    L+NIK   E + WER  
Sbjct  184   KLYAENALERLNMFVEIMMARDNTTAQVLIARAASLSAAAKNTLKNIKIHHERISWERPD  243

Query  529   IKFF-RPYCKNPGERLQEYETPLRGMEMGLVDNNPPQFPVTVLLSSSEVKDSLDSLTGHI  705
              +F  R    +P E+L   +  LRG+E+ L   +   FP    +S  E+   L+    HI
Sbjct  244   TRFLSRKQKLDPAEKLHATDFLLRGLELAL--GSCSSFPQG--MSRDELTRLLEGPRTHI  299

Query  706   SKQVKGRLFDLATVPESNAQNAVKFLHQKLQPVTLQdlssffflfslklllikpsssilk  885
             + + +  L          +Q+++ + H+     T      FF            S     
Sbjct  300   APRSESTL---------KSQDSLGWHHEAESLSTAALPVCFFRYCVELFRGDFLSLRQDS  350

Query  886   dkdGSKEQEER---------FLDKIYSNFVGQMNNKRFVASLKYALALGLAVFFGSIYSK  1038
                  +  EE             K +      M  +RFV + K +++LGLAV FG +Y+K
Sbjct  351   KSVNGRTTEEEIHPANEGLSMARKFWDILCVWMARERFVFAFKCSISLGLAVLFGILYNK  410

Query  1039  PDGFWAGLTVAISYVSAREATFRIANVKAQGTVLGSIYGVLGCFVFAKYEELRFISLIPW  1218
              +G+W+GLTVAIS VS R+AT  +AN + QGT +GS+YG++ C VF + EE RF+ L+PW
Sbjct  411   NNGYWSGLTVAISLVSGRQATLTVANSRLQGTAMGSVYGLICCSVFQRLEEFRFLPLLPW  470

Query  1219  FIVCSFLRRSRMYGPAGGISACIGAVLILGREGFGPPREFAMARIMETFIGLACSITVEL  1398
              I+  F+R S++YG  GG++A I A+LILGR  +G P EFA+ARI+E  IGL C +  E+
Sbjct  471   IILAVFMRHSKVYGQPGGVTAAIAALLILGRRNYGAPTEFAIARIVEASIGLLCFVFGEI  530

Query  1399  LFRPTRASSLAKIQLSKSLQLLNQCIISIDYSSNNQSK-----LEETQKILKSSVTQLGK  1563
             L  P RA++LA+ ++S  L  L  CI S+   S  +++     L ++Q  LKS V  L +
Sbjct  531   LVTPARAATLARTEISHCLDALLDCIQSLVLCSEQKNQKVVADLRKSQVKLKSHVEALER  590

Query  1564  FIGEAEVEPNFWFL-PFHSACYGKLMGSLSKVVEYLHFVAQALRFLEQ-ESALMGRLD--  1731
             F  EA  EP   FL   ++  Y +L+GS SK+ +   +V   L+ L   +  L    D  
Sbjct  591   FAAEALTEPKIPFLRRLNTDSYNRLLGSFSKISDLCLYVCDGLKNLSGVQPTLAFPWDNI  650

Query  1732  SDHLSLFRDHVGPSIKSFEEIISLVGSVSVLDKEFEKKKSSIDPELGKLPTSNNI---TG  1902
             +  L  F++ + PS+K  +E IS   S + L KE +K+K   D E G     N      G
Sbjct  651   THELRAFQEKLHPSVKCLKE-ISQTKSQARLQKELQKRKICHDVEAGTTSNDNYSYMELG  709

Query  1903  LSDEEIDNKLKSFMEDSRQFVDQKdeddddeVMMNSQVALSLSALAFCMRGIVRET  2070
              S  +++    SF+   ++  D K   +  +    S+ AL LS+L FC+  +++ET
Sbjct  710   PSQADVERFSVSFVMLLKEATD-KISCNTADDAFKSETALCLSSLGFCISRLMQET  764



>ref|XP_008360241.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC103423947 
[Malus domestica]
Length=604

 Score =   290 bits (742),  Expect = 7e-84, Method: Compositional matrix adjust.
 Identities = 209/512 (41%), Positives = 300/512 (59%), Gaps = 32/512 (6%)
 Frame = +1

Query  4     LRGCWYAIYATCLGVCPAILSLWLIGPahlttgtaaaavaitaFIVVLPQNTHVVAKRIA  183
             +R CW+ I+AT   +  ++L+LWL+ P + T   AA AVA++AF+VVLP++TH+++KRIA
Sbjct  84    MRSCWHVIFATAQVLLSSVLTLWLVEPKNFTVEVAAVAVALSAFVVVLPESTHLLSKRIA  143

Query  184   LGQTVLVYA---LAGPRTQPIMHPlrvaastaiavaacvlalllpypslassKVKHNCHL  354
              GQ V+VY    + G +T  +MHPL VA+STA+   A V+A+L PYP L+   V  +  +
Sbjct  144   FGQFVIVYVGTVIHGAQTGVVMHPLGVASSTALGAFASVVAMLFPYPRLSYYVVSKSWRM  203

Query  355   FAENVSQRLNLLVKAFSAEDNASALSLVSQAKSLNASGAKFLQNIKSKQESMQWERYPIK  534
             +A N SQRL   V+A S+ D + AL  +S+ +SL+   AK LQ+I +  E+M WER  IK
Sbjct  204   YAGNASQRLACFVEAISSRDKSGALEFLSRGQSLSKEAAKLLQSISNNLETMVWERPHIK  263

Query  535   FFRPYCKNPGERLQEYETPLRGMEMGLVDNNPPQFPVTVL-------LSSSEVKDSLDSL  693
             F +P   + GERLQE E PLRG E+ L  ++    PV ++       L SSEV+ SL  L
Sbjct  264   FLKPNYLDSGERLQEIEVPLRGXEIAL--SSCXSHPVNLIDEDLRRNLQSSEVEVSLRLL  321

Query  694   TGHISKQVKGRL--------FD---LATVPESNAQNAVKFLHQKLQPVTLQdlssffflf  840
                 S      L        FD    A  P +N +       + L    L          
Sbjct  322   QAKYSLPSDATLAPKSYREIFDKPLWAGKPTTNNR-------ENLPAFFLLYCMELLLEN  374

Query  841   slklllikpsssilkdkdGSKEQEERFLDKIYSNFVGQMNNKRFVASLKYALALGLAVFF  1020
                      +    +    S+ Q       ++ N +   + +  + +LK +LALGLAV F
Sbjct  375   QPIAWNPLNTRKPNQQPSDSQNQRRWNFKTVWRNIIP--STRSIIFALKCSLALGLAVLF  432

Query  1021  GSIYSKPDGFWAGLTVAISYVSAREATFRIANVKAQGTVLGSIYGVLGCFVFAKYEELRF  1200
             G +Y+K +G+W+GL +A S+V+ R+ATF + N + QG  LGSIYG++  F+F + E+ + 
Sbjct  433   GLLYNKENGYWSGLAIAXSFVTGRQATFTVTNARVQGXALGSIYGIIWLFIFQRLEKFKL  492

Query  1201  ISLIPWFIVCSFLRRSRMYGPAGGISACIGAVLILGREGFGPPREFAMARIMETFIGLAC  1380
             + LIPW   C FLR SRMYG AGGISA I A+LILGRE  GPP EFA AR++E  IGL C
Sbjct  493   LPLIPWIFFCHFLRHSRMYGQAGGISAAIAALLILGRENHGPPSEFAFARMIEASIGLLC  552

Query  1381  SITVELLFRPTRASSLAKIQLSKSLQLLNQCI  1476
              + VE++F P RA++LAK +LS+S++ L  CI
Sbjct  553   FLLVEIVFYPMRAATLAKNKLSQSMEALRDCI  584



>ref|XP_004142207.1| PREDICTED: uncharacterized protein LOC101207339 [Cucumis sativus]
 ref|XP_004169723.1| PREDICTED: uncharacterized protein LOC101227239 [Cucumis sativus]
 gb|KGN54237.1| hypothetical protein Csa_4G294940 [Cucumis sativus]
Length=813

 Score =   291 bits (746),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 169/421 (40%), Positives = 264/421 (63%), Gaps = 24/421 (6%)
 Frame = +1

Query  958   NNKRFVASLKYALALGLAVFFGSIYSKPDGFWAGLTVAISYVSAREATFRIANVKAQGTV  1137
              N+    +LK ++ LGLAVF G  Y+KP+G+W+GLTVAIS+ + ++A F +AN +AQGT 
Sbjct  394   TNQSLCFALKCSITLGLAVFLGLTYTKPNGYWSGLTVAISFATEKQAVFTVANARAQGTA  453

Query  1138  LGSIYGVLGCFVFAKYEELRFISLIPWFIVCSFLRRSRMYGPAGGISACIGAVLILGREG  1317
             +GSIYGVL CF+  KYE L  + L+PW +  SFL  SRMYG +GGI++ +GA+L+LGR+ 
Sbjct  454   IGSIYGVLCCFILKKYEYLWLLPLLPWVVFTSFLVHSRMYGQSGGIASALGALLVLGRKD  513

Query  1318  FGPPREFAMARIMETFIGLACSITVELLFRPTRASSLAKIQLSKSLQLLNQCI-------  1476
             +G P EFA ARI E  IGL C +TVE++F PTR ++LAK + S +L  L   I       
Sbjct  514   YGVPSEFANARITEACIGLLCFLTVEIIFNPTRTATLAKTEFSTTLVALEDFIKRVILIP  573

Query  1477  -ISIDYSSNNQSKLEETQKILKSSVTQLGKFIGEAEVEPNFWFLPFHSACYGKLMGSLSK  1653
               ++++ ++N   L +  KIL+S V+QL KFI EA  EPNFWF PF  +CY KL+ SL K
Sbjct  574   QKNLNHETSNFVSLIQHHKILRSHVSQLEKFIVEAGFEPNFWFTPFQGSCYEKLLKSLQK  633

Query  1654  VVEYLHFVAQALRFLEQE---SALMGRLDSDHLS----LFRDHVGPSIKSFEEIISLVGS  1812
              ++ L  +   ++FL  E   S L+ +   D L+    +F   +G S+K F E +SL+ S
Sbjct  634   TLDILQIMLHEIKFLSLELNRSGLIVKELHDSLTEDMGIFSKKLGCSLK-FMEKLSLIKS  692

Query  1813  VSVLDKEFEKKKSS--IDPELGKLPTSNNIT--GLSDEEIDNKLKSFMEDSRQFVDQKde  1980
             +    KE + K  +  +D E+GK  +++      L +E+++  + SF + + + + +   
Sbjct  693   L----KELQNKNQNQCLDMEMGKKGSNDGCKAFALLEEDVEKIVGSFCQHANEILSKAYS  748

Query  1981  ddddeVMMNSQVALSLSALAFCMRGIVRETKEIDKAIKELVQWENPSSPVNLHEISCKIR  2160
             +D+ E  +  Q+ L LS++ FCM  ++RET  ++K + ++++ ENPS  +NL E+S ++ 
Sbjct  749   NDEVEGNLKGQMTLCLSSIGFCMECLMRETMVMEKEVLQVLKLENPSIHINLQELSTRVD  808

Query  2161  A  2163
             A
Sbjct  809   A  809


 Score = 96.3 bits (238),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 77/211 (36%), Positives = 123/211 (58%), Gaps = 10/211 (5%)
 Frame = +1

Query  1    ALRGCWYAIYATCLGVCPAILSLWLIGPah-lttgtaaaavaitaFIVVLPQNTHVVAKR  177
            A+RG W+ ++A    +  ++  LWLIGP    +  +AA AVA++ F+V LP+ TH++ KR
Sbjct  67   AVRGVWHVMWAVVFVLVSSVPCLWLIGPGRFTSAASAAIAVAVSGFVVALPERTHLLTKR  126

Query  178  IALGQTVLVYA---LAGPRTQPIMHPlrvaastaiavaacvlalllpypslassKVKHNC  348
            IA GQ V+VY    + G +   + HP+RVA+STA    A V A+++P+P LA  +++   
Sbjct  127  IAFGQLVIVYVGTVIHGGQISFVKHPIRVASSTAAGALAAVAAMMIPFPRLAFFQIRKLS  186

Query  349  HLFAENVSQRLNLLVKAFSAEDNASALSLVSQAKSLNASGAKFLQNIKSKQESMQWERYP  528
              + EN  +R+  +V+   A+    A++L+ +AKSL+ +  K LQ IKS    + WER  
Sbjct  187  KGYCENGWKRIEAMVEGVGAKTKGEAVALMVEAKSLSTNATKLLQTIKSNMRGVIWER--  244

Query  529  IKFFRPYCKNPGERLQEYETPLRGMEMGLVD  621
                R  C +  E+L+E E  ++GME  L  
Sbjct  245  ----RQTCFDVEEKLEEMEVAMKGMEAALTS  271



>ref|XP_008447690.1| PREDICTED: uncharacterized protein LOC103490100 [Cucumis melo]
Length=806

 Score =   290 bits (743),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 168/421 (40%), Positives = 263/421 (62%), Gaps = 24/421 (6%)
 Frame = +1

Query  958   NNKRFVASLKYALALGLAVFFGSIYSKPDGFWAGLTVAISYVSAREATFRIANVKAQGTV  1137
              N+    +LK ++ LGLAVF G  Y+KP+G+W+GLTVAIS+ + R+A F +AN +AQGT 
Sbjct  387   TNQSLCFALKCSITLGLAVFLGLTYTKPNGYWSGLTVAISFATERQAVFTVANARAQGTA  446

Query  1138  LGSIYGVLGCFVFAKYEELRFISLIPWFIVCSFLRRSRMYGPAGGISACIGAVLILGREG  1317
             +GSIYGVL CF+  KYE L  + L+PW +  SFL  SRMYG +GGI++ +GA+L+LGR+ 
Sbjct  447   IGSIYGVLCCFILKKYEYLWLLPLLPWVVFTSFLVHSRMYGQSGGIASALGALLVLGRKD  506

Query  1318  FGPPREFAMARIMETFIGLACSITVELLFRPTRASSLAKIQLSKSLQLLNQCI-------  1476
             +G P EFA AR+ E  IGL C +TVE++F PTR ++LAK + S +L  L   I       
Sbjct  507   YGVPSEFANARLTEACIGLLCFLTVEIIFNPTRTATLAKTEFSTTLVALEDFIKRVILVP  566

Query  1477  -ISIDYSSNNQSKLEETQKILKSSVTQLGKFIGEAEVEPNFWFLPFHSACYGKLMGSLSK  1653
               ++++ ++N   L +  KILKS V+QLGKFI EA  EPNFWF PF   CY K++ SL K
Sbjct  567   QKNLNHETSNFVSLIQHHKILKSHVSQLGKFIVEAGFEPNFWFTPFQGGCYEKILKSLQK  626

Query  1654  VVEYLHFVAQALRFLEQE---SALMGRLDSDHLS----LFRDHVGPSIKSFEEIISLVGS  1812
              ++ L  +   ++FL  E   S L+ +   D L+    +F   +G S+K F E +S + S
Sbjct  627   TLDILQIMLHEIKFLSLELNSSGLIVKELHDSLTEDMEIFSKKLGCSLK-FMEKLSSIKS  685

Query  1813  VSVLDKEFEKKKSS--IDPELGKLPTSNNIT--GLSDEEIDNKLKSFMEDSRQFVDQKde  1980
             +    KE + K  +  ++ E+GK  +++      L +E+++  + SF + + + + +   
Sbjct  686   L----KELQNKNQNQCLEMEMGKKGSNDGCKAFALIEEDVEKIVGSFCQHANEILSKAYT  741

Query  1981  ddddeVMMNSQVALSLSALAFCMRGIVRETKEIDKAIKELVQWENPSSPVNLHEISCKIR  2160
             +D+ E  +  Q+ L LS++ FCM  ++RET  ++K + ++++ ENPS  +NL E+S ++ 
Sbjct  742   NDEVEGNLKGQMTLCLSSIGFCMECLMRETMVMEKEVLQVLKLENPSIHINLQELSTRLN  801

Query  2161  A  2163
             A
Sbjct  802   A  802


 Score = 83.6 bits (205),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 77/211 (36%), Positives = 123/211 (58%), Gaps = 10/211 (5%)
 Frame = +1

Query  1    ALRGCWYAIYATCLGVCPAILSLWLIGPah-lttgtaaaavaitaFIVVLPQNTHVVAKR  177
            A+RG W+ ++A    V  ++  LWLIGP    +  +AA AVA++AF+V LP+ TH++ KR
Sbjct  60   AVRGVWHVMWAVVFVVVSSLPCLWLIGPGRFTSAASAAVAVAVSAFVVALPERTHLLTKR  119

Query  178  IALGQTVLVYA---LAGPRTQPIMHPlrvaastaiavaacvlalllpypslassKVKHNC  348
            IA GQ V+VY    + G +   + HP+RVA+STA    A V A+++P+P LA  +++   
Sbjct  120  IAFGQLVIVYVGTVIHGGQISFVKHPIRVASSTAAGALAAVAAMMIPFPRLAFFQIRKLS  179

Query  349  HLFAENVSQRLNLLVKAFSAEDNASALSLVSQAKSLNASGAKFLQNIKSKQESMQWERYP  528
              + EN  +R+  +V+   A+    A++ + +AKSL+ +  K LQ IKS    + WER  
Sbjct  180  KGYCENGWKRVEAMVEGVGAKTKGEAVAFMVEAKSLSTNATKLLQTIKSNMRGVIWERRQ  239

Query  529  IKFFRPYCKNPGERLQEYETPLRGMEMGLVD  621
            + F      +  E+L+E E  ++GME  L  
Sbjct  240  MGF------DVEEKLEEMEVAMKGMEAALTS  264



>ref|XP_004493888.1| PREDICTED: uncharacterized protein LOC101495526 [Cicer arietinum]
Length=598

 Score =   285 bits (729),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 192/506 (38%), Positives = 298/506 (59%), Gaps = 17/506 (3%)
 Frame = +1

Query  1     ALRGCWYAIYATCLGVCPAILSLWLIGPahlt-tgtaaaavaitaFIVVLPQNTHVVAKR  177
              L+GCW+ + AT   +  +++SL +I P +     TAA  +A +AF+V LP++T+++ KR
Sbjct  69    TLKGCWHVLCATIQVMTLSLISLQVIKPENFGGNRTAALTLAASAFVVALPESTNLMTKR  128

Query  178   IALGQTVLVYALAGPRTQP--IMHPlrvaastaiavaacvlalllpypslassKVKHNCH  351
             IA GQ V+VY       +    +H + VA S A+   A VLA+ LPYP LA  + +    
Sbjct  129   IAFGQLVIVYVSTVIHREDGVAVHSIHVACSAALGALASVLAMFLPYPRLAYYEARKLYR  188

Query  352   LFAENVSQRLNLLVKAFSAEDNASALSLVSQAKSLNASGAKFLQNIKSKQESMQWERYPI  531
             L+A+N S+RLN  ++A SA +N++A+  ++QAK L+ +G K  QNIK+K + M WER   
Sbjct  189   LYADNTSERLNCNIEAISASNNSTAVGFITQAKYLSTTGTKLHQNIKTKLDGMHWERPQS  248

Query  532   KFFRPYCKNPGERLQEYETPLRGMEMGLVDNNPPQFPVTVLLSSSEVKDSLDSLTGHISK  711
               F  +C +  E+LQ+ + P+RGM++ L  ++   FPV V+    E++  L +  G IS+
Sbjct  249   IIFNSHCIDTEEKLQDLDIPIRGMDIAL--SSCKSFPVGVI--DEELRSVLLNCRGQISQ  304

Query  712   QVKGRL-----FDLATVPESNAQNAVKFLHQKLQ--PVTLQdlssffflfslklllikps  870
             ++  +      FD  T   +      K+L    +  P +         L  L +     +
Sbjct  305   KLDQQAKCSDPFDSQTTRATKQNIFNKYLSIAYRDLPTSFFLYCVQLLLDDLSISDKIDN  364

Query  871   ssilkdkdGSKEQEERFLDKIYSNFVGQMNNKRFVASLKYALALGLAVFFGSIYSKPDGF  1050
                   K G  +     + ++ +N +   +N+    + K +L+LGLAVF G +Y K +  
Sbjct  365   VLKKSQKSGYCQWSYNKIRELLTNLIP--SNQSLTFAFKSSLSLGLAVFLGLMYDKENAL  422

Query  1051  WAGLTVAISYVSAREATFRIANVKAQGTVLGSIYGVLGCFVFAKYEELRFISLIPWFIVC  1230
             W+GLT+AIS+V+ R+ TF +AN + QGT +GSIYG++  F+F  +  LRF+ LIPW I  
Sbjct  423   WSGLTIAISFVTGRQPTFSVANARGQGTAMGSIYGIICAFIFRSFVNLRFLGLIPWVIFA  482

Query  1231  SFLRRSRMYGPAGGISACIGAVLILGREGFG-PPREFAMARIMETFIGLACSITVELLFR  1407
             SFLR SRMYG +GGISA IGA+LILGR  +  PP +F +AR++E  IGL C + VE+L  
Sbjct  483   SFLRHSRMYGESGGISAVIGALLILGRMNYYVPPIQFGVARMVEATIGLTCFVIVEVLLS  542

Query  1408  PTRASSLAKIQLSKSLQLLNQCIISI  1485
             P+RA++LAK +LS++L+ L  CI  I
Sbjct  543   PSRAATLAKSELSRTLRTLQDCIKQI  568



>ref|XP_006846140.1| hypothetical protein AMTR_s00012p00168340 [Amborella trichopoda]
 gb|ERN07815.1| hypothetical protein AMTR_s00012p00168340 [Amborella trichopoda]
Length=532

 Score =   281 bits (720),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 167/421 (40%), Positives = 249/421 (59%), Gaps = 36/421 (9%)
 Frame = +1

Query  934   YSNFVGQMNNKRFVASLKYALALGLAVFFGSIYSKPDGFWAGLTVAISYVSAREATFRIA  1113
             Y   +   N +  + +LK +L+L L+V  G +YSK +G+WAG+ VAIS  + RE TF++A
Sbjct  134   YCKSLSFTNKESAIWALKCSLSLALSVLLGVLYSKDNGYWAGIGVAISMGATREPTFKLA  193

Query  1114  NVKAQGTVLGSIYGVLGCFVFAKYEELRFISLIPWFIVCSFLRRSRMYGPAGGISACIGA  1293
             NV+  GTV GSIYGVLGCF+  K   +R+I+LIPW I  SFLR S+MYG AG +SA IGA
Sbjct  194   NVRTHGTVAGSIYGVLGCFLAQKIPAVRYIALIPWVIFTSFLRDSKMYGYAGSLSALIGA  253

Query  1294  VLILGREGFGPPREFAMARIMETFIGLACSITVELLFRPTRASSLAKIQLSKSLQLLNQC  1473
             V+ILGR  FG P EFA+ARI ETFIG+ C I VELL  PTRA+ LA+++L +++  L+  
Sbjct  254   VIILGRRNFGAPPEFAIARITETFIGVVCYIFVELLIEPTRATRLARLELDRAMTELSGL  313

Query  1474  IISIDYSSNNQSKLEETQKILKSSVTQLGKFIGEAEVEPNFWFLPFHSACYGKLMGSLSK  1653
             I+S+ +   N+   +E +K L+S + +L KF+ EA+ EP+FWF PF S  Y K++GSL  
Sbjct  314   ILSVLF--ENRESHKEDEKRLRSCIFRLRKFVDEAKNEPDFWFFPFPSDIYTKILGSLCT  371

Query  1654  VVEYLHFVAQALRFLEQESALMGRLDSDHLSLFRDHVGPSIKSFE----------EIISL  1803
             ++E L F A       +E A + R     +    + VG  I+ F+            +  
Sbjct  372   MLELLSFWASGF----EELAHVARAHGAQVDSLIEPVGSEIEWFKGSADSVLRCLAGVMG  427

Query  1804  VGSVSVLDKEFEKKKSSIDPELGKLPTSNNITGLSDEEIDNKLKSFMEDSRQ----FVDQ  1971
             VGS+  +  EF +  +  D E G +     +T + +EE++   KSF+E+ R+    F  +
Sbjct  428   VGSLKEMSDEFGRVGTCGDLEAGGV---TRVT-MDEEEVEKMTKSFLENGREVGVGFSGE  483

Query  1972  KdeddddeVMMNSQVALSLSALAFCMRGIVRETKEIDKAIKELVQWENPSSPVNLHEISC  2151
             +         +  Q+ L +  L FCM G++RE KE++K ++EL++ E        HE  C
Sbjct  484   E---------LKGQLVLCMGCLGFCMEGLMREMKELEKGVRELLEREGIDYS---HETCC  531

Query  2152  K  2154
             +
Sbjct  532   R  532



>ref|XP_008369966.1| PREDICTED: uncharacterized protein LOC103433480 [Malus domestica]
Length=813

 Score =   288 bits (738),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 173/405 (43%), Positives = 250/405 (62%), Gaps = 33/405 (8%)
 Frame = +1

Query  979   SLKYALALGLAVFFGSIYSKPDGFWAGLTVAISYVSAREATFRIANVKAQGTVLGSIYGV  1158
             ++K +L+LGLAV  G +++K + +WAGLT+AIS+V  R+ATF +AN +AQ T +GSIYG+
Sbjct  418   AVKCSLSLGLAVQLGFLFNKREAYWAGLTIAISFVRGRQATFTLANARAQSTAMGSIYGI  477

Query  1159  LGCFVFAKYEELRFISLIPWFIVCSFLRRSRMYGPAGGISACIGAVLILGREGFGPPREF  1338
             L CF+F K E+L F+ L+PW ++ SFLR SRMYG AGGISA +GA+LILGR  +GPP +F
Sbjct  478   LCCFIFKKVEDLSFLPLLPWLVLTSFLRHSRMYGQAGGISAAVGALLILGRRHYGPPLDF  537

Query  1339  AMARIMETFIGLACSITVELLFRPTRASSLAKIQLSKSLQLLNQCIISIDYSSNNQS---  1509
             A+ARI E  IGL C ITVE+L  P RA++LAK++LS  L  L +CI  +    N  +   
Sbjct  538   AIARITEAVIGLICFITVEILTSPVRAATLAKLKLSLGLGSLQECIKDLVLFDNKIASVG  597

Query  1510  -KLEETQKILKSSVTQLGKFIGEAEVEPNFWFLPFHSACYGKLMGSL----------SKV  1656
              KL + Q  LKS V +L KFI EA++EPNFWF+PF+ ACY KL+ SL          S +
Sbjct  598   PKLRQKQNKLKSHVNKLEKFIEEAQLEPNFWFIPFNGACYDKLLRSLSNTGNLSIIMSNI  657

Query  1657  VEYLHFVAQALRFLEQE-SALMGRLDSDHLSLFRDHVGPSIKSFEEIISLVGSVSVLDKE  1833
             +E L FV Q      +E    M  ++ D L +F+  +G S++  +E+ S   S++VL K 
Sbjct  658   IESLSFVLQCSELDSEELRKPMKGIEKD-LEIFKKKIGNSLQCLQELAS-NKSLAVLGKH  715

Query  1834  FEKKKSSIDPELGKLPTSNNITGLSD---EEIDNKLKSFMEDSRQFVDQKdedd---dde  1995
                     D E G L    N + +SD   EE +  + SF+++S +  D+        +D 
Sbjct  716   --------DIESGTLSARENGSRVSDSDKEETECLVDSFLQNSNELSDKIATMTGLIEDH  767

Query  1996  VMMNSQVALSLSALAFCMRGI--VRETKEIDKAIKELVQWENPSS  2124
               +  QV + L  L FC+  +  + E KE++K  +EL++ E+PSS
Sbjct  768   QKLRGQVTVCLGGLGFCISSLLGLGELKEMEKDFQELIKLEHPSS  812


 Score = 97.8 bits (242),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 87/238 (37%), Positives = 133/238 (56%), Gaps = 22/238 (9%)
 Frame = +1

Query  1    ALRGCWYAIYATCLGVCPAILSLWLIGPahlttgtaaaavaitaFIVVLPQNTHVVAKRI  180
            ALRG W+A+YA    +  +ILSL LIGPAH +   ++ AVA+ AF+V LP  TH+++KRI
Sbjct  68   ALRGFWHALYACIQVLILSILSLRLIGPAHFSYFVSSLAVALCAFVVALPGATHLMSKRI  127

Query  181  ALGQTVLVYA-----LAGPRTQPIMHPlrvaastaiavaac--------------vlall  303
            A GQ V+VY       A      +MHP++V+ ST +  +A                    
Sbjct  128  AFGQIVIVYVGTAIHCAEADELVLMHPIQVSLSTMLGASASVGAMLFPNLFFYQKASLAA  187

Query  304  lpypslassKVKHNCHLFAENVSQRLNLLVKAFSAEDNASALSLVSQAKSLNASGAKFLQ  483
            +  P LA  +V+  C  +AEN  +R +L + A  ++D+++AL  + QAK L   G K L+
Sbjct  188  VLSPYLAYDEVRQMCQKYAENARKRFDLYLDAILSQDSSAALDFILQAKPLAEVGEKLLR  247

Query  484  NIKSKQESMQWERYPIKFFRPYCK-NPGERLQEYETPLRGMEMGLVDNNPPQFPVTVL  654
            +I+ KQE++ WER  I+      + +  E+LQE E PLRG  + +   + P FPV ++
Sbjct  248  SIEHKQEALLWERPTIRNILNRSRFSVREKLQEVEIPLRG--IAIAATSCPSFPVAMI  303



>ref|XP_007208085.1| hypothetical protein PRUPE_ppa001489mg [Prunus persica]
 gb|EMJ09284.1| hypothetical protein PRUPE_ppa001489mg [Prunus persica]
Length=814

 Score =   288 bits (737),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 168/390 (43%), Positives = 241/390 (62%), Gaps = 35/390 (9%)
 Frame = +1

Query  1030  YSKPDGFWAGLTVAISYVSAREATFRIANVKAQGTVLGSIYGVLGCFVFAKYEELRFISL  1209
             +++ + +WAGLT+AIS+V  R+ATF IAN +AQ T +GSIYG+L CF+F K E L F+ L
Sbjct  435   FNEREAYWAGLTIAISFVRGRQATFTIANARAQSTAMGSIYGILCCFIFRKVENLSFLPL  494

Query  1210  IPWFIVCSFLRRSRMYGPAGGISACIGAVLILGREGFGPPREFAMARIMETFIGLACSIT  1389
             +PW +  SFLR SRMYG AGGISA +GA+LILGR  +GPP +FA+ARI E  IGL C IT
Sbjct  495   LPWLVFTSFLRHSRMYGQAGGISAAVGALLILGRRHYGPPLDFAIARITEAVIGLICFIT  554

Query  1390  VELLFRPTRASSLAKIQLSKSLQLLNQCIISI---DYSSNNQSKL----EETQKILKSSV  1548
             +E+L  P RA++LAK +LS SL  L +CI  +   D  +N Q+ +     + QK LKS V
Sbjct  555   MEILIYPARAATLAKHKLSLSLGTLQECIKDVVLFDNQNNMQASIFPKLRQKQKKLKSHV  614

Query  1549  TQLGKFIGEAEVEPNFWFLPFHSACYGKLMGSLSKVVEYLHFVAQALRFLEQESALMGRL  1728
              +L KFI EAE+EPNFWF+PF+ +CY KL+ SLSK+ +   F++    FL   S ++ R 
Sbjct  615   NKLQKFIEEAELEPNFWFIPFNGSCYRKLLRSLSKMGDLSLFMSNKTEFL---SVVLQRC  671

Query  1729  DSD-------------HLSLFRDHVGPSIKSFEEIISLVGSVSVLDKEFEKKKSSIDPEL  1869
             + D              + LF+  V  S++  +E+ S   S++V DK         D EL
Sbjct  672   EVDSEDLQKPLKCIKNDIELFKKKVETSLQCLQELSS-KKSLAVHDKH--------DIEL  722

Query  1870  GKLPTSNNITGLSDE--EIDNKLKSFMEDSRQFVDQ-KdeddddeVMMNSQVALSLSALA  2040
             G  P +N    L  E  E++  L SF++ S +  D+     + ++  + SQV + L+ L 
Sbjct  723   GTSPKANECRCLETEKDEMECILNSFLQHSNEVSDRVGTNTEGEDQKLKSQVIVCLAGLG  782

Query  2041  FCMRGIVRETKEIDKAIKELVQWENPSSPV  2130
             FC+  ++RE +E++K  +ELV  ENPS+ V
Sbjct  783   FCISSLLREVREMEKEFQELVNLENPSTHV  812


 Score =   106 bits (264),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 94/240 (39%), Positives = 136/240 (57%), Gaps = 26/240 (11%)
 Frame = +1

Query  1    ALRGCWYAIYATCLGVCPAILSLWLIGPahlttgtaaaavaitaFIVVLPQNTHVVAKRI  180
            +LRG W+A+ A    +  +ILSL LIGPAH +   +A AVA+  F V LP  TH++AKRI
Sbjct  68   SLRGFWHALCACVQVMTLSILSLLLIGPAHFSYFISALAVALCTFAVALPGATHLMAKRI  127

Query  181  ALGQTVLVY-------ALAGPRTQPIMHPlrvaastaiavaacvla--------------  297
            A GQ V+VY       A AG     +MHP++VA ST +  +A V+A              
Sbjct  128  AFGQIVIVYVGTAIHCAEAGELV--LMHPIQVALSTMLGASASVMAMLFPNLFFYQKASV  185

Query  298  lllpypslassKVKHNCHLFAENVSQRLNLLVKAFSAEDNASALSLVSQAKSLNASGAKF  477
                 P LA  +V+  C  +AEN  +RLN    A  ++D+++AL  + QA+ L   G K 
Sbjct  186  AAFLSPYLAYHEVRDMCQKYAENARKRLNFYSDAILSQDSSAALGFILQAQPLAQVGEKL  245

Query  478  LQNIKSKQESMQWERYPIK-FFRPYCKNPGERLQEYETPLRGMEMGLVDNNPPQFPVTVL  654
            LQ+IK KQE++ WER  ++   +P C + GE+LQ+ E PLRG  + +   + P FPV ++
Sbjct  246  LQSIKHKQEALMWERPKLRNILKPTCMDLGEKLQDIEIPLRG--IAIAATSCPSFPVALI  303



>ref|XP_008357539.1| PREDICTED: uncharacterized protein LOC103421286 isoform X2 [Malus 
domestica]
Length=705

 Score =   285 bits (728),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 158/315 (50%), Positives = 212/315 (67%), Gaps = 18/315 (6%)
 Frame = +1

Query  1240  RRSRMYGPAGGISACIGAVLILGREGFGPPREFAMARIMETFIGLACSITVELLFRPTRA  1419
             +RSRMYG AGGISA IGAVL+LGR  FGPP EFA+ARI ETFIGL+ SI V L+ +P RA
Sbjct  397   KRSRMYGQAGGISAVIGAVLVLGRTNFGPPSEFAIARITETFIGLSSSIIVHLILQPKRA  456

Query  1420  SSLAKIQLSKSLQLLNQCIISIDYSSNNQSKLEETQKILKSSVTQLGKFIGEAEVEPNFW  1599
             S+LAK+QLS++L  L +CI S+   S  ++ LE+ QK LK    +LG+ IGEAE EPNFW
Sbjct  457   SALAKVQLSRTLGTLQECINSVSLQS-GRANLEDNQKRLKMHTEELGQLIGEAEGEPNFW  515

Query  1600  FLPFHSACYGKLMGSLSKVVEYLHFVAQALRFLEQES--------ALMGRLDSDHLSLFR  1755
             FLPFHSACYGKL+ S S++++ L   A A+  LE+ S         ++  L+ D L  F+
Sbjct  516   FLPFHSACYGKLLRSFSRMMDLLVLSAHAVGILEENSQTLEASWKEIVHTLECD-LEHFK  574

Query  1756  DHVGPSIKSFEEIISLVGSVSVLDKEFEKKKSSIDPELGKLPTSNNITGLSDEEIDNKLK  1935
               VG  +  FEE I+L+ S++VLD   +K   S D ELGK  T N     S  E+D  + 
Sbjct  575   KMVGSLMTCFEE-ITLIKSIAVLD---QKSNISPDHELGKSRTPNIFRACSS-EMDKIMS  629

Query  1936  SFMEDSRQFVDQKdeddddeVMMNSQVALSLSALAFCMRGIVRETKEIDKAIKELVQWEN  2115
             S+++ S + VD+ D   ++   + SQ+ L LS L FC+  ++RET+EI++ IKELVQWEN
Sbjct  630   SYLQHSEEVVDKIDAKSEE---LKSQMVLCLSGLGFCISSLIRETREIEEGIKELVQWEN  686

Query  2116  PSSPVNLHEISCKIR  2160
             PSS +NL+EISCK+ 
Sbjct  687   PSSHINLYEISCKLH  701


 Score =   175 bits (444),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 141/282 (50%), Positives = 173/282 (61%), Gaps = 19/282 (7%)
 Frame = +1

Query  1    ALRGCWYAIYATCLGVCPAILSLWLIGPahlttgtaaaavaitaFIVVLPQNTHVVAKRI  180
             L G    +YAT   + PA+LSLWLIGPA L+T T A AV + AF+V LP+ TH+V KRI
Sbjct  69   TLCGFRLGLYATAQTIGPAMLSLWLIGPAQLSTSTTAVAVGLAAFVVALPEFTHLVTKRI  128

Query  181  ALGQTVLVYALA---GPRTQPIMHPlrvaastaiavaacvlalllpypslassKVKHNCH  351
            ALGQ V++Y +A   G  T  IMHP+ VAAST + V ACVLALL+P+P LAS +VK N  
Sbjct  129  ALGQIVIMYVIACINGGHTDAIMHPVHVAASTGVGVLACVLALLIPFPRLASREVKQNLK  188

Query  352  LFAENVSQRLNLLVKAFSAEDNASALSLVSQAKSLNASGAKFLQNIKSKQESMQWERYPI  531
            L A+N S+ L + V AF AED+ SAL+ +SQA  L ++  K  Q IKS QESM+WER P+
Sbjct  189  LLAKNASEMLKIFVNAFCAEDSTSALASISQANFLASTATKLFQTIKSHQESMKWERVPL  248

Query  532  KFF--RPYCKNPGERLQEYETPLRGMEMGLVDNNPPQFPVTVLLSSSEVKDSLDSLTGHI  705
            K F  R Y  NPG+RLQ  E P RGMEM L     P FPV V ++    KD+L  L  H 
Sbjct  249  KLFSRRGYV-NPGDRLQGLEIPFRGMEMAL--TCIPSFPVKV-VNGELSKDALLRLVEHN  304

Query  706  SKQVKGRLFDLATVPESNAQNAVKFL---------HQKLQPV  804
                    F   TVPES A+N V FL         HQ L P+
Sbjct  305  MSLNLSTPFCSITVPESKAEN-VSFLQTLQNIPQIHQDLPPI  345



>ref|XP_009621205.1| PREDICTED: uncharacterized protein LOC104112869 [Nicotiana tomentosiformis]
Length=515

 Score =   280 bits (715),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 164/406 (40%), Positives = 248/406 (61%), Gaps = 17/406 (4%)
 Frame = +1

Query  928   KIYSNFVGQMNNKRFVASLKYALALGLAVFFGSIYSKPDGFWAGLTVAISYVSAREATFR  1107
             ++ +N++  M+ KR V + K +++LGLAV  G ++++ + +W+GLT+AIS+ + + A F 
Sbjct  112   QVCNNWITAMS-KRLVFTCKCSISLGLAVLLGLLFNRENRYWSGLTLAISFETGKLAIFT  170

Query  1108  IANVKAQGTVLGSIYGVLGCFVFAKYEELRFISLIPWFIVCSFLRRSRMYGPAGGISACI  1287
             +AN + QGT LGS+YG+LGC VF  + +LRFI+LIPW I  S LR S+MY  AGG +A I
Sbjct  171   VANARTQGTALGSVYGILGCSVFQNFAKLRFIALIPWIIFTSILRHSKMYSTAGGDAAVI  230

Query  1288  GAVLILGREGFGPPREFAMARIMETFIGLACSITVELLFRPTRASSLAKIQLSKSLQLLN  1467
             GA+LILGR G+GPP EFA+AR+ E  IGL+C + +EL+F+PTR ++LAK  L   L+ L 
Sbjct  231   GALLILGRMGYGPPSEFAIARLTEALIGLSCFVIIELVFQPTRVATLAKNHLYLCLETLK  290

Query  1468  QCIISIDYSSNNQSKLEETQKILKSSVTQLGKFIGEAEVEPNFWFLPFHSACYGKLMGSL  1647
              C   I   S  Q+   E Q+ L S V  L KFI +AE+EP FWF PF ++CY KL  SL
Sbjct  291   VCTKQIVLDS-GQNDFIEKQRHLNSQVEDLRKFIVDAELEPGFWFTPFPASCYQKLHKSL  349

Query  1648  SKVVEYLHFVAQALRFLEQESALMGRLDSDHLSLFRDHVGPSIKSFEEII----SLVG--  1809
             S V+  L+F+A ++  L Q   L  R D D   + ++H+   I+  +E +    S +G  
Sbjct  350   SNVMHLLYFMANSIESLSQ--TLHSR-DDDRKDI-QEHINRDIEIIKEALSSSMSYIGKT  405

Query  1810  -SVSVLDKEFEKKKSSI--DPELGKLPTSNNITGLSDEEIDNKLKSFMEDSRQFVDQKde  1980
              S+ +L    ++ +  I  D E GK       + +SD+E    L  F+E S++  D K  
Sbjct  406   ISIRLLRASQDQPEEQICYDLEEGKSQCEYTTSSMSDKE-QKTLSYFLEHSKEVAD-KTT  463

Query  1981  ddddeVMMNSQVALSLSALAFCMRGIVRETKEIDKAIKELVQWENP  2118
               +    +  +  L   ++ FCMR ++ E K+I++ +KELV WE+P
Sbjct  464   SIEGNEELTRKTVLCWCSIGFCMRCLMSEVKDIEEGMKELVNWEDP  509



>ref|XP_008369859.1| PREDICTED: uncharacterized protein LOC103433384 [Malus domestica]
Length=814

 Score =   285 bits (730),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 173/407 (43%), Positives = 249/407 (61%), Gaps = 35/407 (9%)
 Frame = +1

Query  979   SLKYALALGLAVFFGSIYSKPDGFWAGLTVAISYVSAREATFRIANVKAQGTVLGSIYGV  1158
             +LK +L+LGLAV  G +++K + +WAGLT+AIS+V  R+ATF +AN +AQ T +GSIYG+
Sbjct  418   ALKCSLSLGLAVQLGLLFNKREAYWAGLTIAISFVRGRQATFTLANARAQSTAMGSIYGI  477

Query  1159  LGCFVFAKYEELRFISLIPWFIVCSFLRRSRMYGPAGGISACIGAVLILGREGFGPPREF  1338
             L CF+F K E+LRF+ L+PW +  SFL  SRMYG AGGISA +GA+LILGR+ +GPP +F
Sbjct  478   LCCFIFKKVEDLRFLPLLPWLVFTSFLWHSRMYGQAGGISAAVGALLILGRKHYGPPLDF  537

Query  1339  AMARIMETFIGLACSITVELLFRPTRASSLAKIQLSKSLQLLNQCIISIDYSSNNQS---  1509
             A+ARI E  IGL   IT+E+L  P RA++LAK++L   L  L +CI  +    N  +   
Sbjct  538   AIARITEAVIGLISFITIEILTSPARAATLAKLKLLLGLGSLQECIKDLVLFENQITLVG  597

Query  1510  -KLEETQKILKSSVTQLGKFIGEAEVEPNFWFLPFHSACYGKLMGSL----------SKV  1656
              KL + Q  LKS V +L KFI EA++EPNFWF+PF+ ACYGKL+ SL          S +
Sbjct  598   PKLRQKQYKLKSHVNKLEKFIEEAQLEPNFWFIPFNGACYGKLLRSLSNTGNLSIIMSNI  657

Query  1657  VEYLHFVAQALRFLEQESAL---MGRLDSDHLSLFRDHVGPSIKSFEEIISLVGSVSVLD  1827
             +E L  V Q  RF      L   M  ++ D L +F+   G S++  +E+ S   S++V D
Sbjct  658   IESLSLVLQ--RFKPDSEELQKPMKGIEKD-LEIFKKKXGNSLQCLQELAS-KKSLAVHD  713

Query  1828  KEFEKKKSSIDPELGKLPTSNNITGLSD---EEIDNKLKSFMEDSRQFVDQ---Kdeddd  1989
             K         D E G L    N + + D   EE +  + SF+++S +  D+        +
Sbjct  714   KH--------DIESGTLSARENGSRVLDSEKEETECIVDSFLQNSNELSDKIGTMTGLIE  765

Query  1990  deVMMNSQVALSLSALAFCMRGIVRETKEIDKAIKELVQWENPSSPV  2130
             D   +  QV + L  L FC+  ++RE KE+++  +EL++ E+PSS V
Sbjct  766   DHQKLRVQVTVCLGGLGFCISSLLREVKEMEREFQELIKLEDPSSHV  812


 Score = 95.9 bits (237),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 85/238 (36%), Positives = 131/238 (55%), Gaps = 22/238 (9%)
 Frame = +1

Query  1    ALRGCWYAIYATCLGVCPAILSLWLIGPahlttgtaaaavaitaFIVVLPQNTHVVAKRI  180
            ALRG W+A+YA    +  +ILSL LIGPAH +   ++ AVA+ AF+V LP  TH+++KRI
Sbjct  68   ALRGFWHALYACIQVLILSILSLQLIGPAHFSYFVSSLAVALCAFVVALPGATHLMSKRI  127

Query  181  ALGQTVLVYALAGPRTQPI-----MHPlrvaastaiavaac--------------vlall  303
            A GQ V+VY         +     MHP++V+ ST +  +A                    
Sbjct  128  AFGQIVIVYVGTAIHCAEVDELVLMHPIQVSLSTMLGASASVGAMLFPNLFLYQKASLAA  187

Query  304  lpypslassKVKHNCHLFAENVSQRLNLLVKAFSAEDNASALSLVSQAKSLNASGAKFLQ  483
            +  P LA  +V+  C  +A+N  +R +L + A  + D+++AL  + QAK L  +G K L+
Sbjct  188  VLSPYLAYDEVRQMCQKYAKNARKRFDLYLDAILSRDSSAALDFILQAKPLAEAGEKLLR  247

Query  484  NIKSKQESMQWERYPIKFFRPYCK-NPGERLQEYETPLRGMEMGLVDNNPPQFPVTVL  654
             I+ KQE++ WER  I+      + +  E+LQE E PLRG  + +   + P FPV ++
Sbjct  248  RIEHKQEALLWERPTIRSILNRSRFSVREKLQEVEIPLRG--IAIAATSCPSFPVAMI  303



>ref|XP_008457499.1| PREDICTED: uncharacterized protein LOC103497175 isoform X2 [Cucumis 
melo]
Length=384

 Score =   271 bits (694),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 153/393 (39%), Positives = 240/393 (61%), Gaps = 20/393 (5%)
 Frame = +1

Query  955   MNNKRFVASLKYALALGLAVFFGSIYSKPDGFWAGLTVAISYVSAREATFRIANVKAQGT  1134
             MN +R V +LK A++LG++V  G IY+K +GFW  L VA+S  S RE TF++AN+K  GT
Sbjct  1     MNKQRVVPALKCAISLGISVILGLIYNKKNGFWGSLAVAVSIASNREPTFKVANIKVHGT  60

Query  1135  VLGSIYGVLGCFVFAKYEELRFISLIPWFIVCSFLRRSRMYGPAGGISACIGAVLILGRE  1314
             +LGS++G+L   +F K+   R + L+PWFI  SFL+ S MYG AGGISA +GA+++LGR 
Sbjct  61    MLGSVFGILSFVLFEKFLIGRLLCLLPWFIFTSFLQHSTMYGSAGGISAIVGALVVLGRT  120

Query  1315  GFGPPREFAMARIMETFIGLACSITVELLFRPTRASSLAKIQLSKSLQLLNQCIISIDYS  1494
              +G P+EFA  R++ETFIG+  SI V+++F+P RAS L KIQ   SLQLL +C I+  +S
Sbjct  121   NYGSPKEFAFERMIETFIGIFISILVDIIFQPKRASKLVKIQFILSLQLLQKC-INDSFS  179

Query  1495  SNNQSKLEETQKILKSSVTQLGKFIGEAEVEPNFWFL-PFHSACYGKLMGSLSKVVEYLH  1671
               + + +E+  + L++ V ++ + I EAEVEPNF FL PFH   + K+  SLSK+V  L 
Sbjct  180   YESSTIMEKDLQGLRTQVIEVKQLIDEAEVEPNFLFLHPFHGDSHLKMFNSLSKMVGLLA  239

Query  1672  FVAQALRFLEQE------SALMGRLDSDHLSLFRDHVGPSIKSFEEIISLVGSVSVLDKE  1833
                +A+  L++         +  +L+ D            +  +E+  S   S+  L   
Sbjct  240   LNGEAMNNLKESLREDLWRKVGEKLEGDFEKYKEIMTSGFVTFYEDFRS--SSLKFLKGN  297

Query  1834  FEKKKSSIDPELGKLPTSNNITGLSDEEIDNKLKSFMEDSRQFVDQKdeddddeVMMNSQ  2013
               K+ +  D E+G+   +  I  + + E +  + SF++  R+ V+ KD         + +
Sbjct  298   ENKEDNCGDIEMGE---AQRIEVMDEIEKEKLINSFLQHLREIVESKDGT-------SEE  347

Query  2014  VALSLSALAFCMRGIVRETKEIDKAIKELVQWE  2112
             + LSLSA+AFC   +++E +E+ +AI+EL++WE
Sbjct  348   IILSLSAMAFCFNSLIKEMEEVGEAIRELIEWE  380



>gb|KDO36970.1| hypothetical protein CISIN_1g006621mg [Citrus sinensis]
Length=638

 Score =   276 bits (707),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 145/257 (56%), Positives = 183/257 (71%), Gaps = 11/257 (4%)
 Frame = +1

Query  1105  RIANVKAQGTVLGSIYGVLGCFVFAKYEELRFISLIPWFIVCSFLRRSRMYGPAGGISAC  1284
             ++ANVKAQGTVLG++YGVLGCF+F K   +RF+ L PWFI  SFLR  RMYG  GGISA 
Sbjct  367   KVANVKAQGTVLGTVYGVLGCFLFEKLLPIRFLFLFPWFIFTSFLRHGRMYGQGGGISAV  426

Query  1285  IGAVLILGREGFGPPREFAMARIMETFIGLACSITVELLFRPTRASSLAKIQLSKSLQLL  1464
             IGAVLILGR+  GPP EFA+ARI+ETFIGL C+I  ELLF+ TRAS+LAK QLSKSL  L
Sbjct  427   IGAVLILGRKSLGPPEEFAIARIVETFIGLTCTIIGELLFQSTRASTLAKSQLSKSLGTL  486

Query  1465  NQCIISIDYSSNNQSKLEETQKILKSSVTQLGKFIGEAEVEPNFWFLPFHSACYGKLMGS  1644
             + CI S+   + +Q+ L   QK LK  V +LG  IGEA+VEPNF FLPFHSACY KL+ S
Sbjct  487   HDCISSMTLRA-SQASLLHKQKRLKMHVNELGTLIGEADVEPNFGFLPFHSACYSKLLVS  545

Query  1645  LSKVVEYLHFVAQALRFLEQESALMG---------RLDSDHLSLFRDHVGPSIKSFEEII  1797
             L K+V  LHF + ++ FLEQES  +          +LD D + L ++    SIK F + I
Sbjct  546   LVKMVHLLHFCSYSIGFLEQESQKIDKASWKEDVQKLDGD-VKLVKEMACSSIKCFNDDI  604

Query  1798  SLVGSVSVLDKEFEKKK  1848
             + + S+++L+KE E+KK
Sbjct  605   TTIKSLAILEKELERKK  621


 Score =   149 bits (375),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 133/264 (50%), Positives = 163/264 (62%), Gaps = 27/264 (10%)
 Frame = +1

Query  1    ALRGCWYAIYATCLGVCPAILSLWLIGPahlttgtaaaavaitaFIVVLPQNTHVVAKRI  180
             L GCW A+YAT   + PA+L++WLIGPA LTTGT A AVAI AF V LP+ TH+VAKRI
Sbjct  54   TLHGCWLALYATVQSIGPALLTMWLIGPARLTTGTTALAVAIAAFFVALPEGTHLVAKRI  113

Query  181  ALGQTVLVYALA---GPRTQPIMHPlrvaastaiavaacvlalllpypslassKVKHNCH  351
            ALGQ VL Y +    G  +  +M P+RVAASTAI V ACVLAL LPYP LA  +VK N  
Sbjct  114  ALGQIVLTYVMGFVNGEHSGAVMLPVRVAASTAIGVLACVLALFLPYPRLACYEVKWNYK  173

Query  352  LFAENVSQRLNLLVKAFSAEDNASALSLVSQAKSLNASGAKFLQNIKSKQESMQWERYPI  531
              A+N S+R  L VKA  AED ++AL+ +S AKSL  SG K +QNIK  QESM+WE  P 
Sbjct  174  QLADNASERPRLYVKALCAEDKSTALASISLAKSLTKSGTKHIQNIKRYQESMKWE-IPF  232

Query  532  KFFRPYCKNPGERLQEYETPLRGMEMGLVDNNPPQFPVTVLLSSSEVKDSLDSLTGHISK  711
            KF R     P ++ Q  E PLRGMEM                  +EV + L  LT    K
Sbjct  233  KFLRSNYVKPVKKFQYLEIPLRGMEM------------------AEVLEELTCLT---IK  271

Query  712  QVKGR--LFDLATVPESNAQNAVK  777
            +VK    L +  +VPESN + ++K
Sbjct  272  KVKSYQILCNSMSVPESNEECSLK  295



>ref|XP_008242666.1| PREDICTED: uncharacterized protein LOC103340970 [Prunus mume]
Length=818

 Score =   280 bits (716),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 163/393 (41%), Positives = 234/393 (60%), Gaps = 38/393 (10%)
 Frame = +1

Query  1030  YSKPDGFWAGLTVAISYVSAREATFRIANVKAQGTVLGSIYGVLGCFVFAKYEELRFISL  1209
             +++ + +WAGLT+AIS+V  R+ATF IAN +AQ T +GSIYG+L CF+F K E L F+ L
Sbjct  436   FNEREAYWAGLTIAISFVRGRQATFTIANARAQSTAMGSIYGILCCFIFRKVENLSFLPL  495

Query  1210  IPWFIVCSFLRRSRMYGPAGGISACIGAVLILGREGFGPPREFAMARIMETFIGLACSIT  1389
             +PW +  SFLR SRMYG AGGISA +GA+LILGR  +GPP +FA+ARI E  IGL C IT
Sbjct  496   LPWLVFTSFLRHSRMYGQAGGISAAVGALLILGRRHYGPPLDFAIARITEAVIGLICFIT  555

Query  1390  VELLFRPTRASSLAKIQLSKSLQLLNQCIISIDYSSNNQSKLEETQKIL----------K  1539
             +E+L  P R+++LAK +LS SL  L  CI  +    N  ++      I           K
Sbjct  556   IEILVYPARSATLAKHKLSLSLGTLQDCIKDVVLFDNQNNQNNMQASIFPKLRQKQKKLK  615

Query  1540  SSVTQLGKFIGEAEVEPNFWFLPFHSACYGKLMGSLSKVVEYLHFVAQALRFLEQESALM  1719
             S V +L  FI EAE+EPNFWF+PF+ +CY KL+ SLSK+ +   F++  + FL   S ++
Sbjct  616   SHVNKLQMFIEEAELEPNFWFIPFYGSCYRKLLRSLSKMWDLSLFMSNKIEFL---SVVL  672

Query  1720  GRLDSD-------------HLSLFRDHVGPSIKSFEEIISLVGSVSVLDKEFEKKKSSID  1860
              R + D              + LF+  V  S++  +E+ S   S++V DK         D
Sbjct  673   QRCEVDSEDLQKPMKCIKNDIELFKKKVETSLQCLQELSS-KKSLAVHDKH--------D  723

Query  1861  PELGKLPTSNNITGL--SDEEIDNKLKSFMEDSRQFVDQ-KdeddddeVMMNSQVALSLS  2031
              ELG  P +N   GL    EE++  L SF+  S +  D+     + ++  + SQV + L+
Sbjct  724   IELGTSPKANERRGLETEKEEVECILNSFLLHSNEVSDRVGTNTEGEDKKLKSQVIVCLA  783

Query  2032  ALAFCMRGIVRETKEIDKAIKELVQWENPSSPV  2130
              L FC+  ++RE +E++K  +ELV  ENPSS +
Sbjct  784   GLGFCISSLLREVREMEKEFQELVNLENPSSHI  816


 Score =   107 bits (268),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 94/240 (39%), Positives = 137/240 (57%), Gaps = 26/240 (11%)
 Frame = +1

Query  1    ALRGCWYAIYATCLGVCPAILSLWLIGPahlttgtaaaavaitaFIVVLPQNTHVVAKRI  180
            +LRG W+A+ A    +  +ILSL LIGPAH +   +A AVA+  F+V LP  TH++AKRI
Sbjct  69   SLRGFWHALCACVQVMTLSILSLLLIGPAHFSYFISALAVALCTFVVALPGATHLMAKRI  128

Query  181  ALGQTVLVY-------ALAGPRTQPIMHPlrvaastaiavaacvla--------------  297
            A GQ V+VY       A AG     +MHP++VA ST +  +A V+A              
Sbjct  129  AFGQIVIVYVGTAIHCAEAGELV--LMHPIQVALSTMLGASASVMAMLFPNLFFYQKASV  186

Query  298  lllpypslassKVKHNCHLFAENVSQRLNLLVKAFSAEDNASALSLVSQAKSLNASGAKF  477
                 P LA  +V+  C  +AEN  +RLN    A  + D+++AL  + QA+ L   G K 
Sbjct  187  AAFLSPYLAYHEVRDMCQKYAENARKRLNFYSDAILSHDSSAALGFILQAQPLAQVGEKL  246

Query  478  LQNIKSKQESMQWERYPIK-FFRPYCKNPGERLQEYETPLRGMEMGLVDNNPPQFPVTVL  654
            L++IK KQE++ WER  ++   +P C + GE+LQ+ E PLRG+E+     + P FPV ++
Sbjct  247  LRSIKHKQEALMWERPKLRNILKPTCMDLGEKLQDIEIPLRGIEIA--ATSCPSFPVALI  304



>gb|EYU41708.1| hypothetical protein MIMGU_mgv1a002024mg [Erythranthe guttata]
Length=725

 Score =   278 bits (710),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 222/635 (35%), Positives = 345/635 (54%), Gaps = 34/635 (5%)
 Frame = +1

Query  1     ALRGCWYAIYATCLGVCPAILSLWLIGPahlttg-taaaavaitaFIVVLPQNTHVVAKR  177
             +LRGCW+A  AT   V PA+   WL G     +   AA A A  +F++VLP++TH+ AKR
Sbjct  67    SLRGCWHAFCATAQVVPPAMAGRWLAGDKAGLSIWMAALATAAASFVIVLPESTHLTAKR  126

Query  178   IALGQTVLVYALA----GPRTQPIMHPlrvaastaiavaacvlalllpypslassKVKHN  345
             IALGQ VL    A       +   MHPL +AASTA+   A V ALLLP+P LA  +V+  
Sbjct  127   IALGQLVLACTEAVITSDESSSGFMHPLHIAASTALGALASVSALLLPFPRLAHYEVEKL  186

Query  346   CHLFAENVSQRLNLLVKAFSAEDNASALSLVSQAKSLNASGAKFLQNIKSKQESMQWERY  525
               ++AEN  +R+NL ++AF A +N +   L+ QAK    +G K LQNI   QE + WER 
Sbjct  187   RRVYAENARERMNLYLRAFKANNNRTKTELLLQAKPFAETGNKLLQNITILQEVVWWERP  246

Query  526   PIKFFRPYCKNPGERLQEYETPLRGMEMGLVDNNPPQFPVTVLLSSSEVKDS-LDSLTGH  702
                +      +  +RL+  E  +RG+E  LV      +  T    + E   S LDS++  
Sbjct  247   WSHYVIHDLISIEDRLRSTELTMRGIEYSLV------YSQTCTPDNQEQLSSVLDSISCQ  300

Query  703   ISKQVKGRLFDLATVPESNAQNAV---KFLHQKLQPVTLQdlssffflfslklllikpss  873
             +  +++  +           + +    K L  +L P+  Q+   +   F     ++   +
Sbjct  301   LHHEIEHAILQTEAAAHEKRRGSTFIEKNLSSQLAPI--QNKHEWLCFFFSCKDILLNDT  358

Query  874   silkdkdGSKEQEERFLDKIYSNFVGQMN-NKRFVASLKYALALGLAVFFGSIYSKPDGF  1050
             +  +      ++ E  + +   N++ ++  + R  ++LK +++LGLAV  G +  + +G 
Sbjct  359   NENRKPQTQPQKTEFTITEKIKNWIFKLTRSDRLESALKCSISLGLAVVTGLMLERENGC  418

Query  1051  WAGLTVAISYVSAREATFRIANVKAQGTVLGSIYGVLGCFVFAKYEELRFISLIPWFIVC  1230
             WA LT+A  +   ++  F  AN +AQGT +GS+YGV+ CF+F +Y ELR +SL+PW +  
Sbjct  419   WASLTLATGFSIGKQPFFTTANSRAQGTAVGSVYGVICCFIF-RYLELRLVSLLPWIVFS  477

Query  1231  SFLRRSRMYGPAGGISACIGAVLILGREGFGPPREFAMARIMETFIGLACSITVELLFRP  1410
              F+R SRMYG  GGISA IGA LILGR+ +G P EFA+ARI   F+GL C + VELL +P
Sbjct  478   VFIRHSRMYGQTGGISAAIGASLILGRKKYGAPTEFAIARITAVFVGLLCLLLVELLMQP  537

Query  1411  TRASSLAKIQLSKSLQLLNQCIISIDYSSNNQSKL----EETQKILKSSVTQLGKFIGEA  1578
              RA++LAK QL  +L+ L   +   +  S   SK     E+ Q+ L++   +L K + +A
Sbjct  538   NRAATLAKRQLYLTLEALKNSL--NETGSRRVSKFLQAREKNQRKLETLFQELRKSVADA  595

Query  1579  EVEPNFWFLPFHSACYGKLMGSLSKVVEYLHFVAQALRFLEQESALMGRLD---SDHLSL  1749
             + EP+FW LPF + CY K++ SLS +   L+F+   L  + +   L   L+   ++ L L
Sbjct  596   DSEPDFWCLPFQTTCYKKVVASLSCIENMLYFLELNLDLVSE--TLRHELNEQVNNELEL  653

Query  1750  FRDHVGPSIKSFEEIISLVGSVSVLDKEFEKKKSS  1854
              ++ V   +K  +       S+   D E  K ++S
Sbjct  654   LQESVNSLLKYLDN----ASSIKSRDIEAGKSRNS  684



>ref|XP_008351151.1| PREDICTED: uncharacterized protein LOC103414556 [Malus domestica]
Length=761

 Score =   275 bits (704),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 189/469 (40%), Positives = 271/469 (58%), Gaps = 32/469 (7%)
 Frame = +1

Query  133   FIVVLPQNTHVVAKRIALGQTVLVYA---LAGPRTQPIMHPlrvaastaiavaacvlall  303
             F+V LP++TH+++KRIA GQ ++VY    + G +T  +MHPL VA+STA+   A V+A+L
Sbjct  284   FVVALPESTHLLSKRIAFGQFLIVYVGTVIHGAQTGVVMHPLGVASSTALGAFASVVAML  343

Query  304   lpypslassKVKHNCHLFAENVSQRLNLLVKAFSAEDNASALSLVSQAKSLNASGAKFLQ  483
              PYP L+   V  +  ++A N SQRL   V+A S+ D + AL  +S+ +SL+   AK LQ
Sbjct  344   FPYPRLSYYXVSKSWRMYAGNASQRLACFVEAISSRDKSGALEFLSRGQSLSKEAAKLLQ  403

Query  484   NIKSKQESMQWERYPIKFFRPYCKNPGERLQEYETPLRGMEMGLVDNNPPQFPVTVL---  654
             +I +  E+M WER  IKF +P   + GERLQE E PLRG+E+ L  ++    PV ++   
Sbjct  404   SISNNLETMVWERPHIKFLKPNYLDSGERLQEIEVPLRGIEIAL--SSCSSHPVNLIDED  461

Query  655   ----LSSSEVKDSLDSLTGHISKQVKGRL--------FD---LATVPESNAQNAVKFLHQ  789
                 L SSEV+ SL  L    S      L        FD    A  P +N +       +
Sbjct  462   LRRNLQSSEVEVSLRLLQAKYSLPSDATLAPKSYREIFDKPLWAGKPTTNNR-------E  514

Query  790   KLQPVTLQdlssffflfslklllikpsssilkdkdGSKEQEERFLDKIYSNFVGQMNNKR  969
              L    L                   +    +    S+ Q       ++ N +   + + 
Sbjct  515   NLPAFFLLYCMELLLENQPIAWNPXNTRKPNQQPSDSQNQRRXNFKTVWRNIIP--STRS  572

Query  970   FVASLKYALALGLAVFFGSIYSKPDGFWAGLTVAISYVSAREATFRIANVKAQGTVLGSI  1149
              + +LK +LALGLAV FG +Y+K +G+W+GL +A S+V+ R+ATF + N + QG  LGSI
Sbjct  573   IIFALKCSLALGLAVLFGLLYNKENGYWSGLAIAXSFVTGRQATFTVTNARVQGXALGSI  632

Query  1150  YGVLGCFVFAKYEELRFISLIPWFIVCSFLRRSRMYGPAGGISACIGAVLILGREGFGPP  1329
             YG++  F+F + E+ + + LIPW   C FLR SRMYG AGGISA I A+LILGRE  GPP
Sbjct  633   YGIIWLFIFQRLEKFKLLPLIPWIFFCHFLRHSRMYGQAGGISAAIAALLILGRENHGPP  692

Query  1330  REFAMARIMETFIGLACSITVELLFRPTRASSLAKIQLSKSLQLLNQCI  1476
              EFA AR++E  IGL C + VE++F P RA++LAK +LS+S++ L  CI
Sbjct  693   SEFAFARMIEASIGLLCFLLVEIVFYPMRAATLAKNKLSQSMEALRDCI  741



>ref|XP_006341043.1| PREDICTED: uncharacterized protein LOC102581148 isoform X1 [Solanum 
tuberosum]
 ref|XP_006341044.1| PREDICTED: uncharacterized protein LOC102581148 isoform X2 [Solanum 
tuberosum]
 ref|XP_006341045.1| PREDICTED: uncharacterized protein LOC102581148 isoform X3 [Solanum 
tuberosum]
Length=582

 Score =   270 bits (689),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 152/376 (40%), Positives = 228/376 (61%), Gaps = 30/376 (8%)
 Frame = +1

Query  1042  DGFWAGLTVAISYVSAREATFRIANVKAQGTVLGSIYGVLGCFVFAKYEELRFISLIPWF  1221
             +G+W+GLT+A+S+V+ ++A F  AN +AQGT +GS+YGVL C +F K  ++RF+SL+PW 
Sbjct  213   NGYWSGLTIALSFVTRKQAIFTEANARAQGTAIGSVYGVLACTIFQKVAQIRFLSLLPWI  272

Query  1222  IVCSFLRRSRMYGPAGGISACIGAVLILGREGFGPPREFAMARIMETFIGLACSITVELL  1401
             I  +FLR SRM+  AGG +A IG++LILGR+ +GPP  FA+ R+ E FIGLAC + VEL+
Sbjct  273   IFTTFLRHSRMFTQAGGTAAVIGSLLILGRKSYGPPSVFAIYRLTEAFIGLACFVVVELI  332

Query  1402  FRPTRASSLAKIQLSKSLQLLNQCIISIDYSSNNQSKLEETQKILKSSVTQLGKFIGEAE  1581
              +PT +++L K  L      LN+C   +   S  Q  L E Q+ LKS V  L KFI +A 
Sbjct  333   LQPTSSATLVKKHLYLIQGTLNECTEHMVVDS-RQKGLMEKQRNLKSQVQDLEKFIKDAV  391

Query  1582  VEPNFWFLPFHSACYGKLMGSLSKVVEYLHFVAQALRFLEQ-------ESALMGRLDSDH  1740
             +EP FWF+PF  +CY KL  SLSK+ + L F++  ++FL Q       +   + +  +++
Sbjct  392   LEPRFWFIPFPISCYQKLQMSLSKMADVLFFMSCDIKFLSQAFDRYYPDKRELQQYINNN  451

Query  1741  LSLFRDHVGPSIKSFEEIISLVGSVSVLDKEFEKKKSSIDPELGKL----------PTSN  1890
             L  F D +  S+ SFE+II    S+ +L      K S I PE   L          P  +
Sbjct  452   LQHFNDALCSSVSSFEKII----SIRLL------KTSQIQPEQNILNDLEEGNSSCPRGD  501

Query  1891  NITGLSDEEIDNKLKSFMEDSRQFVDQKdeddddeVMMNSQVALSLSALAFCMRGIVRET  2070
              +   +DEE++  L SF+++S + V+ K   D   + +   +   L +L FCM  + +E 
Sbjct  502   VMYSRNDEEMEMILSSFLQNSNE-VNGK-VRDIAGIELRGTIVGCLCSLEFCMSFLEKEV  559

Query  2071  KEIDKAIKELVQWENP  2118
             ++ID AIKELV+WE+P
Sbjct  560   RDIDNAIKELVKWEDP  575



>ref|XP_009374700.1| PREDICTED: uncharacterized protein LOC103963591 [Pyrus x bretschneideri]
Length=807

 Score =   274 bits (701),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 161/387 (42%), Positives = 233/387 (60%), Gaps = 30/387 (8%)
 Frame = +1

Query  1030  YSKPDGFWAGLTVAISYVSAREATFRIANVKAQGTVLGSIYGVLGCFVFAKYEELRFISL  1209
             +++ +  WAGL +AIS+V  R+ATF +AN +AQ T +GSIYG+L CF+F + E+L F+SL
Sbjct  429   FNEREACWAGLIIAISFVRGRQATFTVANARAQSTAMGSIYGILCCFIFKEVEDLSFLSL  488

Query  1210  IPWFIVCSFLRRSRMYGPAGGISACIGAVLILGREGFGPPREFAMARIMETFIGLACSIT  1389
             +PW +  SFLR SRMYG AGGISA +GA+LILGR+ +GPP +FA+ARI    IGL C +T
Sbjct  489   LPWLVFTSFLRHSRMYGQAGGISAAVGALLILGRKDYGPPIDFAIARITGAVIGLICFVT  548

Query  1390  VELLFRPTRASSLAKIQLSKSLQLLNQCIISIDYSSNN----QSKLEETQKILKSSVTQL  1557
             +E+L  P RA++LAK++LS  L  L +CI  +    N       KL + Q  LKS V +L
Sbjct  549   IEILTSPARAATLAKLKLSLGLGSLQECIEDLVLFDNQIASMSPKLRKKQSKLKSHVKKL  608

Query  1558  GKFIGEAEVEPNFWFLPFHSACYGKLMGSL----------SKVVEYLHFVAQALRF-LEQ  1704
              KFI EA++EPNFWF+PF+ ACYGKL+ SL          S ++E L  + Q     LE+
Sbjct  609   EKFIEEAQLEPNFWFIPFNGACYGKLLRSLSNMENLSLFMSNIIESLSLILQCFDLDLEE  668

Query  1705  ESALMGRLDSDHLSLFRDHVGPSIKSFEEIISLVGSVSVLDKEFEKKKSSIDPELGKLPT  1884
                 M  L+ D L +F+   G S+   +E+ S   SV+V +K         D E G    
Sbjct  669   LRKPMKGLEKD-LKIFKKKFGKSLHCLQELAS-KKSVAVHNKH--------DIEFGTSAR  718

Query  1885  SNNITGLSD--EEIDNKLKSFMEDSRQF---VDQKdeddddeVMMNSQVALSLSALAFCM  2049
              N+  GL    EE ++ + SF+++S +    +       +D   +  QV + L  L FC+
Sbjct  719   ENDSRGLDSEKEETESIVNSFLQNSNELSSKIAAMTGLIEDHQKLRGQVTVCLGGLGFCI  778

Query  2050  RGIVRETKEIDKAIKELVQWENPSSPV  2130
               ++RE KE++K  +EL++ E+PSS V
Sbjct  779   SSLLREVKEMEKEFQELIKLEHPSSHV  805


 Score = 99.4 bits (246),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 91/260 (35%), Positives = 136/260 (52%), Gaps = 24/260 (9%)
 Frame = +1

Query  1    ALRGCWYAIYATCLGVCPAILSLWLIGPahlttgtaaaavaitaFIVVLPQNTHVVAKRI  180
            ALRG W+A+Y     +   +LSL LIGPAH +   +A AVA+  F+V LP  TH+++KRI
Sbjct  68   ALRGFWHALYGCIQVLILTLLSLRLIGPAHFSYFVSALAVALCTFVVALPGATHLMSKRI  127

Query  181  ALGQTVLVYA-----LAGPRTQPIMHPlrvaastaiavaacv--------------lall  303
            A GQ V+VY       A      +M P++V  ST +  +A V                  
Sbjct  128  AFGQIVIVYVGTAIHCAEADELVLMRPIQVCLSTVLGASASVGAMLFPNLFFYRKPSLAA  187

Query  304  lpypslassKVKHNCHLFAENVSQRLNLLVKAFSAEDNASALSLVSQAKSLNASGAKFLQ  483
            +  P LA  +V+  C  +AEN  +R N  + A  ++D+++AL  + QAK L  +G K L+
Sbjct  188  VLSPYLAYHEVRQMCQKYAENARKRFNFYLDAILSQDSSAALDFILQAKPLAEAGEKLLR  247

Query  484  NIKSKQESMQWERYPIK-FFRPYCKNPGERLQEYETPLRGMEMGLVDNNPPQFPVTVLLS  660
            +I+ KQE++ WER  I+    P      E+LQE E PLRG  + +   + P FPV ++  
Sbjct  248  SIEHKQEALLWERPTIRNILNPSRFYVREKLQEVEIPLRG--IAIASTSCPSFPVAMM--  303

Query  661  SSEVKDSLDSLTGHISKQVK  720
                 D+L  L   I  Q++
Sbjct  304  KKLQADALHDLKRRIHDQLE  323



>ref|XP_004246876.2| PREDICTED: uncharacterized protein LOC101256621 [Solanum lycopersicum]
Length=803

 Score =   266 bits (680),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 158/405 (39%), Positives = 239/405 (59%), Gaps = 30/405 (7%)
 Frame = +1

Query  955   MNNKRFVASLKYALALGLAVFFGSIYSKPDGFWAGLTVAISYVSAREATFRIANVKAQGT  1134
             +N +  V + K + +LGLAV  G +++  +G+W+GLT+A+S+V+ ++A F  AN +AQGT
Sbjct  405   INERMVVFAFKCSFSLGLAVLLGLLFNTENGYWSGLTIALSFVTRKQAIFTEANARAQGT  464

Query  1135  VLGSIYGVLGCFVFAKYEELRFISLIPWFIVCSFLRRSRMYGPAGGISACIGAVLILGRE  1314
              +GS+YGVL C +F K  ++RF+SL+PW I  +FLR SRM+  AGG +A IG++LILGR+
Sbjct  465   AIGSVYGVLACTIFQKVAQIRFLSLLPWIIFTTFLRHSRMFTQAGGTAAVIGSLLILGRK  524

Query  1315  GFGPPREFAMARIMETFIGLACSITVELLFRPTRASSLAKIQLSKSLQLLNQCIISIDYS  1494
              +GPP  FA+ R+ E FIGLAC + VEL+ +PT +++L K  L      L +C   +   
Sbjct  525   SYGPPSVFAIYRLTEAFIGLACFVVVELILQPTSSATLVKKHLYLIQGTLKECSKHMVVD  584

Query  1495  SNNQSKLEETQKILKSSVTQLGKFIGEAEVEPNFWFLPFHSACYGKLMGSLSKVVEYLHF  1674
             S  Q  L E Q+ LKS V  L KFI +A +EP FWF+PF  +CY KL  SLSK+ + L F
Sbjct  585   S-RQKGLMEKQRNLKSQVQDLEKFIKDAVLEPRFWFIPFPISCYQKLQMSLSKMADVLFF  643

Query  1675  VAQALRFLEQ-------ESALMGRLDSDHLSLFRDHVGPSIKSFEEIISLVGSVSVLDKE  1833
             ++  + FL Q       +   + +  +++L  F D +  S+ SFE+ I    S+ +L   
Sbjct  644   MSCDIEFLSQSFDRYYPDKRELQQYINNNLQHFNDALSSSVSSFEKTI----SIRLL---  696

Query  1834  FEKKKSSIDPELGKL----------PTSNNITGLSDEEIDNKLKSFMEDSRQFVDQKded  1983
                K S I PE   L          P  + +   +DEE++  L SF+++S +   +    
Sbjct  697   ---KTSQIQPEQNILNDLEEGTSSCPRGDVMCYRNDEEMEMILSSFLQNSNEV--RGKVR  751

Query  1984  dddeVMMNSQVALSLSALAFCMRGIVRETKEIDKAIKELVQWENP  2118
             D   + +   +   L +L FCM  + RE + ID AIKELV+WE+P
Sbjct  752   DIAGIELRGTIVGCLCSLEFCMSFLEREVRNIDNAIKELVKWEDP  796


 Score =   103 bits (258),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 84/225 (37%), Positives = 130/225 (58%), Gaps = 9/225 (4%)
 Frame = +1

Query  1    ALRGCWYAIYATCLGVCPAILSLWL---IGPahlttgtaaaavaitaFIVVLPQNTHVVA  171
            ALRGCW+A  AT   +  ++L LW+   +     +   AA  VA++AF+V LP++T ++ 
Sbjct  68   ALRGCWHACLATLQTMPLSMLGLWIHNYVATDDYSPEVAALMVAVSAFLVALPESTDLMC  127

Query  172  KRIALGQTVLVYALAGPR----TQPIMHPlrvaastaiavaacvlalllpypslassKVK  339
            KRIA GQ V+VY  A         P+MHP R+A STA+ V A ++ALLLPYP LA  +VK
Sbjct  128  KRIAFGQLVIVYVDAVIHGLYVNSPMMHPFRIAFSTALGVVASIIALLLPYPWLAYHEVK  187

Query  340  HNCHLFAENVSQRLNLLVKAFSAEDNASALSLVSQAKSLNASGAKFLQNIKSKQESMQWE  519
                ++AE+ + R+NL +KA   +D+   + L+ Q K    +G K L  IK  +E +QWE
Sbjct  188  KLYQIYAESATGRINLYLKAIHTQDDQITMELIYQTKPFTDTGTKLLDTIKFLEEGLQWE  247

Query  520  RYPIKFFRPYCKNPGERLQEYETPLRGMEMGLVDNNPPQFPVTVL  654
            +  +++      +PG  LQ  +  ++GME+ +     P FP  ++
Sbjct  248  KPWLRYLNHNFTDPGLGLQNMDISMKGMELAI--TCCPIFPTRMI  290



>ref|XP_008387761.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC103450226 
[Malus domestica]
Length=1220

 Score =   265 bits (678),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 160/387 (41%), Positives = 233/387 (60%), Gaps = 34/387 (9%)
 Frame = +1

Query  1030  YSKPDGFWAGLTVAISYVSAREATFRIANVKAQGTVLGSIYGVLGCFVFAKYEELRFISL  1209
             +++ +  WAGL +AIS+V  R+ATF +AN +AQ T +GSIYG+L CF+F + E+L F+ L
Sbjct  429   FNEREACWAGLIIAISFVRGRQATFTVANARAQSTAMGSIYGILCCFIFKEVEDLSFLPL  488

Query  1210  IPWFIVCSFLRRSRMYGPAGGISACIGAVLILGREGFGPPREFAMARIMETFIGLACSIT  1389
             +PW +  SFLR SRMYG AGGISA +GA+LILGR+ +GP  +FA+ARI    IGL C +T
Sbjct  489   LPWLVFTSFLRHSRMYGQAGGISAAVGALLILGRKDYGPXIDFAIARITGAVIGLICFVT  548

Query  1390  VELLFRPTRASSLAKIQLSKSLQLLNQCIISIDYSSNNQS----KLEETQKILKSSVTQL  1557
             +E+L  P RA++LAK++LS  L  L  CI  +    N  +    KL + Q  LKS V +L
Sbjct  549   IEILTSPARAATLAKLKLSLXLXSLQACIEDLVLFDNQIASMSPKLRQKQSKLKSHVKKL  608

Query  1558  GKFIGEAEVEPNFWFLPFHSACYGKLMGSL----------SKVVEYLHFVAQALRF---L  1698
              KFI EA++EPNFWF+PF+ ACY KL+ SL          S ++E L  V Q  RF   L
Sbjct  609   EKFIEEAQLEPNFWFIPFNGACYSKLLRSLSNMENLSLFMSNIIESLSLVLQ--RFDLDL  666

Query  1699  EQESALMGRLDSDHLSLFRDHVGPSIKSFEEIISLVGSVSVLDKEFEKKKSSIDPELGKL  1878
             E+    M   + D L +F+  VG S+   +E+ S   SV+V +K         D E G  
Sbjct  667   EELRKPMKAFEKD-LEIFKKKVGKSLHCLQELAS-KKSVAVHNKH--------DIEFGTS  716

Query  1879  PTSNNITGLS--DEEIDNKLKSFMEDSRQFVDQ---KdeddddeVMMNSQVALSLSALAF  2043
                N+  GL   +EE ++ + SF+++S +  ++   +     D   +  QV + L  L F
Sbjct  717   ARENDSRGLDSEEEETESIVDSFLQNSIELSEKIAARTGLIKDHQKLRGQVTVCLGGLGF  776

Query  2044  CMRGIVRETKEIDKAIKELVQWENPSS  2124
             C+  ++RE KE++K  +EL++ E+PSS
Sbjct  777   CISSLLREVKEMEKEFQELIKLEHPSS  803


 Score = 95.9 bits (237),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 89/260 (34%), Positives = 133/260 (51%), Gaps = 24/260 (9%)
 Frame = +1

Query  1    ALRGCWYAIYATCLGVCPAILSLWLIGPahlttgtaaaavaitaFIVVLPQNTHVVAKRI  180
            ALRG W+ +Y     +   +LSL LIGPAH +   +  AVA+  F+V LP  TH+++KRI
Sbjct  68   ALRGFWHTLYGCIQVLILTLLSLRLIGPAHFSYFVSXLAVALCTFVVALPGATHLMSKRI  127

Query  181  ALGQTVLVYA-----LAGPRTQPIMHPlrvaastaiavaacv--------------lall  303
            A GQ V+VY       A      +M P++V  ST +  +A V                  
Sbjct  128  AFGQIVIVYVGTAIHCAEADELVLMRPIQVCLSTVLGASASVGAMLFPNLFFYRKPSLAA  187

Query  304  lpypslassKVKHNCHLFAENVSQRLNLLVKAFSAEDNASALSLVSQAKSLNASGAKFLQ  483
            +  P LA  +V+  C  +AEN  +R N  + A  ++D+++AL  +  AK L  +G K L+
Sbjct  188  VLSPYLAYHEVRQXCQKYAENARKRFNFYLDAILSQDSSAALDFILXAKPLAEAGEKLLR  247

Query  484  NIKSKQESMQWERYPIK-FFRPYCKNPGERLQEYETPLRGMEMGLVDNNPPQFPVTVLLS  660
            +I+ KQE++ WER  I+    P      E+LQE E PLRG  + +   + P FPV ++  
Sbjct  248  SIEHKQEALLWERPTIRNXLNPSRFYVREKLQEVEJPLRG--IAIASTSCPSFPVAMM--  303

Query  661  SSEVKDSLDSLTGHISKQVK  720
                 DSL  L   I  Q++
Sbjct  304  KKLQADSLHDLKRXIHDQLE  323



>ref|XP_009766746.1| PREDICTED: uncharacterized protein LOC104218043, partial [Nicotiana 
sylvestris]
Length=699

 Score =   259 bits (662),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 149/406 (37%), Positives = 240/406 (59%), Gaps = 40/406 (10%)
 Frame = +1

Query  928   KIYSNFVGQMNNKRFVASLKYALALGLAVFFGSIYSKPDGFWAGLTVAISYVSAREATFR  1107
             ++Y+N++  MN KR V + K +++LGLAV  G ++++ +G+W+GLT+AIS+ + + A F 
Sbjct  319   QVYNNWIKAMN-KRLVFACKCSISLGLAVLLGLLFNRENGYWSGLTLAISFETGKIAIFT  377

Query  1108  IANVKAQGTVLGSIYGVLGCFVFAKYEELRFISLIPWFIVCSFLRRSRMYGPAGGISACI  1287
             +AN +AQGT LGS+Y VLGC +F  + +LRFI+LI W I  S LR S+MY  AGG +A +
Sbjct  378   VANARAQGTALGSVYWVLGCTIFQNFAKLRFIALIHWIIFTSILRHSKMYSTAGGDAAVM  437

Query  1288  GAVLILGREGFGPPREFAMARIMETFIGLACSITVELLFRPTRASSLAKIQLSKSLQLLN  1467
             GA+LILGR+ +GPP EFA+AR+ E  IGL+C + +EL+F+PTRA++LAK  L   L+ L 
Sbjct  438   GALLILGRKAYGPPSEFAIARLTEALIGLSCFVIIELVFQPTRAATLAKNHLYMCLETLQ  497

Query  1468  QCIISIDYSSNNQSKLEETQKILKSSVTQLGKFIGEAEVEPNFWFLPFHSACYGKLMGSL  1647
              C   I   S     +E+ + +  +S+  L KF+ +AEVEP+FWF PF ++CY  L  SL
Sbjct  498   DCTKQIVLDSGQNDFIEKQRHL--NSLEDLQKFLVDAEVEPSFWFTPFPASCYQNLNKSL  555

Query  1648  SKVVEYLHFVAQALRFLEQESALMGRLDSDHLSLFRDHVGPSIKSFEE-----IISLVGS  1812
             S V+  L+F+A ++  L Q    +   D D   + ++ +   I+  +E     +I +  +
Sbjct  556   SNVMYLLYFMANSIESLSQT---LHSCDDDRKDI-QEQINKDIEILKEALSSSMICIRKT  611

Query  1813  VSV----LDKEFEKKKSSIDPELGKLPTSNNITGLSDEEIDNKLKSFMEDSRQFVDQKde  1980
             +S+      ++  +++   D E GK       + + D+E + +L                
Sbjct  612   ISIRLLRASQDQPEEQICYDLEEGKSQREYTTSSMIDKECNEEL----------------  655

Query  1981  ddddeVMMNSQVALSLSALAFCMRGIVRETKEIDKAIKELVQWENP  2118
                       +  L L ++ FC+R ++ E K+I++ IKELV WE+P
Sbjct  656   --------TRKTVLCLCSIGFCVRCLMSEVKDIEEGIKELVNWEDP  693



>ref|XP_006299591.1| hypothetical protein CARUB_v10015769mg [Capsella rubella]
 gb|EOA32489.1| hypothetical protein CARUB_v10015769mg [Capsella rubella]
Length=774

 Score =   254 bits (650),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 153/389 (39%), Positives = 230/389 (59%), Gaps = 20/389 (5%)
 Frame = +1

Query  955   MNNKRFVASLKYALALGLAVFFGSIYSKPDGFWAGLTVAISYVSAREATFRIANVKAQGT  1134
             M  ++FV + K +++LGLAV FG +Y+K +G+W+GLTVAIS VS R+AT  +AN + QGT
Sbjct  383   MAREKFVFAFKCSVSLGLAVLFGIMYNKQNGYWSGLTVAISLVSGRQATLTVANSRLQGT  442

Query  1135  VLGSIYGVLGCFVFAKYEELRFISLIPWFIVCSFLRRSRMYGPAGGISACIGAVLILGRE  1314
              +GS+YG+L C+VF + EE RF+ L+PW I+  F+R S++YG  GG++A I A+LILGR 
Sbjct  443   AMGSVYGLLCCYVFHRLEEFRFLPLLPWIILAVFMRHSKVYGQPGGVTAAIAALLILGRR  502

Query  1315  GFGPPREFAMARIMETFIGLACSITVELLFRPTRASSLAKIQLSKSLQLLNQCIISIDYS  1494
              +G P EFA+ARI+E  IGL C +  E+L  P RA++LA+ +L+  L  L  CI S+   
Sbjct  503   NYGAPTEFAIARIVEASIGLLCFVFGEILVTPVRAATLARTELTHCLDALLDCIQSLVLC  562

Query  1495  SNNQSK-------LEETQKILKSSVTQLGKFIGEAEVEPNFWFL-PFHSACYGKLMGSLS  1650
             S  +++       L + Q  LKS V  L +   EA  EPN  FL P ++  Y KL+GS S
Sbjct  563   SEQRNQKMSVVTGLRKRQAKLKSHVDALERLTAEALTEPNIPFLRPLNTVSYYKLLGSFS  622

Query  1651  KVVEYLHFVAQALRFLE--QESALMGRLDSDH-LSLFRDHVGPSIKSFEEIISLVGSVSV  1821
             K+ +   +V   L  L   Q   +    +  H L  F++ + PS+K  E+ ++L  S + 
Sbjct  623   KISDLCLYVCDGLDNLSGVQPKLVFPWENITHDLRAFQEKLNPSVKCLEK-MALTKSQAR  681

Query  1822  LDKEFEKKKSSIDPELGKLPT---SNNITGLSDEEIDNKLKSFMEDSRQFVDQKdedddd  1992
             L KE +K+K   D E G       SN   G S E+ +    SF+   ++  D+  E+   
Sbjct  682   LQKELQKRKICHDVEAGVTCNENYSNMELGPSQEDAERFSVSFVMLLKEATDKISEE---  738

Query  1993  eVMMNSQVALSLSALAFCMRGIVRETKEI  2079
               ++ S+ AL LS+L FC+  +++ET  I
Sbjct  739   --VLKSETALCLSSLGFCISRLMQETVSI  765


 Score = 73.2 bits (178),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 91/243 (37%), Positives = 135/243 (56%), Gaps = 10/243 (4%)
 Frame = +1

Query  4    LRGCWYAIYATCLGVCPAILSLWLIGPahlttgtaa-aavaitaFIVVLPQNTHVVAKRI  180
            L+ C    YAT   +  A++S+ ++GPA L     A  AVA+ +FIV  P +T ++ KRI
Sbjct  64   LKCCVDVSYATFQTIAIALVSVLVVGPASLANSLVAPVAVALASFIVAFPVSTSLLTKRI  123

Query  181  ALGQTVLVYALA----GPRTQPIMHPlrvaastaiavaacvlalllpypslassKVKHNC  348
            A GQ V+VY       G      M P+ VAASTA+   A +LA+LLP+P LA S++  +C
Sbjct  124  AFGQIVVVYVTFVVFNGEVAHVFMLPVHVAASTALGAIASLLAVLLPFPRLAHSQMSKDC  183

Query  349  HLFAENVSQRLNLLVKAFSAEDNASALSLVSQAKSLNASGAKFLQNIKSKQESMQWERYP  528
             L+AE   +RLNL V+   A DN +A  L+++A SL+A+    L++IK     + WER  
Sbjct  184  KLYAETALERLNLFVEVMMARDNTTAKVLIARAASLSAAAKSILKSIKIHHGRLAWERPD  243

Query  529  IKFFRPYCK-NPGERLQEYETPLRGMEMGLVDNNPPQFPVTVLLSSSEVKDSLDSLTGHI  705
             +F R   K +P E+L   E  +RG+E+ L   +   FP    ++  E+   L+    HI
Sbjct  244  TRFLRRKQKLDPEEKLHATEFLMRGLELAL--GSCSSFPQG--MTRDELTCLLEGPRTHI  299

Query  706  SKQ  714
            S Q
Sbjct  300  SPQ  302



>ref|XP_002882620.1| hypothetical protein ARALYDRAFT_341087 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH58879.1| hypothetical protein ARALYDRAFT_341087 [Arabidopsis lyrata subsp. 
lyrata]
Length=773

 Score =   253 bits (646),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 152/395 (38%), Positives = 229/395 (58%), Gaps = 20/395 (5%)
 Frame = +1

Query  928   KIYSNFVGQMNNKRFVASLKYALALGLAVFFGSIYSKPDGFWAGLTVAISYVSAREATFR  1107
             K++      M  +RFV + K +++LGLAV FG +Y+K +G+W+GLTVAIS VS R+AT  
Sbjct  374   KVWDILCVWMARERFVFAFKCSISLGLAVLFGIMYNKKNGYWSGLTVAISLVSGRQATLT  433

Query  1108  IANVKAQGTVLGSIYGVLGCFVFAKYEELRFISLIPWFIVCSFLRRSRMYGPAGGISACI  1287
             +AN + QGT +GS+YG++ C VF + EE RF+ L+PW I+  F+R S++YG  GG++A I
Sbjct  434   VANSRLQGTAMGSVYGLICCSVFQRLEEFRFLPLLPWIILAVFMRHSKVYGQPGGVTAAI  493

Query  1288  GAVLILGREGFGPPREFAMARIMETFIGLACSITVELLFRPTRASSLAKIQLSKSLQLLN  1467
              A+LILGR  +G P EFA+ARI+E  IGL C +  E+L  P RA++LAK +LS  L  L 
Sbjct  494   AALLILGRRNYGAPTEFAIARIVEASIGLLCFVFGEILVTPARAATLAKTELSHCLDALL  553

Query  1468  QCIISIDYSSNNQSK-------LEETQKILKSSVTQLGKFIGEAEVEPNFWFL-PFHSAC  1623
              CI S+   S  +++       L + Q  LK  V  L +   EA  EP   FL P ++  
Sbjct  554   DCIQSLVLCSEQKNQKTSVVTDLRKRQAKLKFHVEALERLTAEALTEPKIPFLCPLNAVS  613

Query  1624  YGKLMGSLSKVVEYLHFVAQALRFLEQESALMG---RLDSDHLSLFRDHVGPSIKSFEEI  1794
             Y KL+GS SK+ +   +V   L+ L +    +G      +  L  F++ + PS+K     
Sbjct  614   YNKLLGSFSKISDLCLYVCDGLKNLSRVQPTLGFPWDNITHELRAFQEKLHPSVKC----  669

Query  1795  ISLVGSVSVLDKEFEKKKSSIDPELGKLPT---SNNITGLSDEEIDNKLKSFMEDSRQFV  1965
              SL  S + L KE +K+K   D E G       SN   G S ++ +    SF+   ++  
Sbjct  670   -SLTKSQARLQKELQKRKICHDVEAGTTSNENYSNMELGPSQDDAERFSVSFVMLLKEAT  728

Query  1966  DQKdeddddeVMMNSQVALSLSALAFCMRGIVRET  2070
             D+  ++  +EV + S+ AL LS+L FC+  +++ET
Sbjct  729   DKISDNTAEEV-LKSETALCLSSLGFCISRLMQET  762


 Score = 85.9 bits (211),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 82/210 (39%), Positives = 123/210 (59%), Gaps = 6/210 (3%)
 Frame = +1

Query  4    LRGCWYAIYATCLGVCPAILSLWLIGPahlttgtaa-aavaitaFIVVLPQNTHVVAKRI  180
            L+ C    YAT   +   ++S+ ++GPA L  G  A  AVA+ +F+V  P +T ++ KRI
Sbjct  64   LKCCLDVSYATFQTIAIVLVSVLVVGPASLGNGLVAPVAVALASFLVAFPVSTSLLTKRI  123

Query  181  ALGQTVLVYALA----GPRTQPIMHPlrvaastaiavaacvlalllpypslassKVKHNC  348
            A GQ V+VY       G      M P+ VA STA+   A ++A+LLP+P LA S++   C
Sbjct  124  AFGQIVVVYVTFVVFNGEVAHVFMLPVHVAGSTALGAIASLIAVLLPFPRLAHSQMSKGC  183

Query  349  HLFAENVSQRLNLLVKAFSAEDNASALSLVSQAKSLNASGAKFLQNIKSKQESMQWERYP  528
             L+AEN  +R+N+ V+   A DN +A +L+++A SL+ +    L+NIK   E M WER  
Sbjct  184  KLYAENALERVNMFVEIMMARDNTTAQALLARAASLSVAAKNTLKNIKIHHERMAWERPD  243

Query  529  IKFFRPYCK-NPGERLQEYETPLRGMEMGL  615
             +F R   K +PGE+L   E  +RG+E+ L
Sbjct  244  TRFLRRKQKLDPGEKLHATEFLMRGLELAL  273



>ref|XP_006407674.1| hypothetical protein EUTSA_v10020118mg [Eutrema salsugineum]
 gb|ESQ49127.1| hypothetical protein EUTSA_v10020118mg [Eutrema salsugineum]
Length=769

 Score =   249 bits (635),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 151/397 (38%), Positives = 223/397 (56%), Gaps = 16/397 (4%)
 Frame = +1

Query  919   FLDKIYSNFVGQMNNKRFVASLKYALALGLAVFFGSIYSKPDGFWAGLTVAISYVSAREA  1098
              + ++       M  +RFV + K +++LGLAV FG +Y+K +G+W+GLTVAIS VS R+A
Sbjct  365   MIKRVLDTLCVWMARERFVFAFKCSVSLGLAVLFGIMYNKKNGYWSGLTVAISLVSGRQA  424

Query  1099  TFRIANVKAQGTVLGSIYGVLGCFVFAKYEELRFISLIPWFIVCSFLRRSRMYGPAGGIS  1278
             T  +AN + QGT +GS+YG+L C VF   +E RF+ L+PW  V  F+R SR+YG  GG++
Sbjct  425   TLTVANSRLQGTAMGSVYGLLCCSVFQNLQEFRFLPLLPWIAVTVFMRHSRVYGQPGGVT  484

Query  1279  ACIGAVLILGREGFGPPREFAMARIMETFIGLACSITVELLFRPTRASSLAKIQLSKSLQ  1458
             A I A+LILGR  +G P +FA+ RI+E  IGL C +  E+L  P RA++LA+ +LS+ L 
Sbjct  485   AAIAALLILGRRNYGAPTDFAITRIVEASIGLLCFVFGEILVTPARATTLARTELSRCLD  544

Query  1459  LLNQCIISIDYSSNNQ----SKLEETQKILKSSVTQLGKFIGEAEVEPNFWFL-PFHSAC  1623
              L  CI S+   S  +    S L   Q  LKS V  L +F  EA  EP   FL P ++  
Sbjct  545   ALLDCIQSLVLCSEQKNQQMSDLRSKQAKLKSHVEALERFTAEALTEPKIPFLRPLNAVS  604

Query  1624  YGKLMGSLSKVVEYLHFVAQALRFLEQESALMGRLDSDH----LSLFRDHVGPSIKSFEE  1791
             Y KL+GS SK+ +   +V   L  L      +     DH    L  F++ +  S+K  EE
Sbjct  605   YNKLLGSFSKLSDLCLYVCDGLTNLSGAQPTI-EFPWDHVTHDLKSFQEKLHSSVKCLEE  663

Query  1792  IISLVGSVSVLDKEFEKKKSSIDPELGKLPTSNNIT----GLSDEEIDNKLKSFMEDSRQ  1959
               S   S++ L KE +K+K   D E G   ++ N +    G S ++ +    SF+   ++
Sbjct  664   TAS-TSSLARLQKEMKKRKICHDVEAGTTTSNGNHSNMELGPSQDDAERFSVSFVMLLKE  722

Query  1960  FVDQKdeddddeVMMNSQVALSLSALAFCMRGIVRET  2070
                 K      E +  S+ AL LS+L FC+  +++ET
Sbjct  723   -ATGKIGGSTAEEVFKSESALCLSSLGFCISRLMQET  758


 Score = 87.0 bits (214),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 72/165 (44%), Positives = 100/165 (61%), Gaps = 4/165 (2%)
 Frame = +1

Query  133  FIVVLPQNTHVVAKRIALGQTVLVYALA----GPRTQPIMHPlrvaastaiavaacvlal  300
            FIV  P +T ++ KRIA GQ V+VY       G     +M P+ VAASTA+   A VLA+
Sbjct  108  FIVAFPASTSLLTKRIAFGQIVVVYVTFVVFNGEMAHVLMLPVNVAASTALGAFASVLAV  167

Query  301  llpypslassKVKHNCHLFAENVSQRLNLLVKAFSAEDNASALSLVSQAKSLNASGAKFL  480
            LLP+P LA +++   C L+AEN  +RLNL V+   A DN +A  L+++A SL+ +    L
Sbjct  168  LLPFPRLAHTQMNKGCKLYAENALERLNLFVEVMMARDNTTAQVLIARAASLSEAARNTL  227

Query  481  QNIKSKQESMQWERYPIKFFRPYCKNPGERLQEYETPLRGMEMGL  615
            ++IK  QE + WER   +F R   K+P E+LQ  E  +RGM M L
Sbjct  228  KSIKLHQERIAWERPDTRFLRGKQKHPVEKLQATEFLMRGMGMAL  272



>ref|XP_008350431.1| PREDICTED: uncharacterized protein LOC103413770 [Malus domestica]
Length=736

 Score =   228 bits (582),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 135/304 (44%), Positives = 186/304 (61%), Gaps = 25/304 (8%)
 Frame = +1

Query  1030  YSKPDGFWAGLTVAISYVSAREATFRIANVKAQGTVLGSIYGVLGCFVFAKYEELRFISL  1209
             +++ +  WAGL +AIS+V  R+ATF +AN +AQ T +GSIYG+L CF+F + E+L F+ L
Sbjct  429   FNEREACWAGLIIAISFVRGRQATFTVANARAQSTAMGSIYGILCCFIFKEVEDLSFLPL  488

Query  1210  IPWFIVCSFLRRSRMYGPAGGISACIGAVLILGREGFGPPREFAMARIMETFIGLACSIT  1389
             +PW +  SFLR SRMYG AGGISA +GA+LILGR+ +GP  +FA+ARI    IGL C +T
Sbjct  489   LPWLVFTSFLRHSRMYGQAGGISAAVGALLILGRKDYGPXIDFAIARITGAVIGLICFVT  548

Query  1390  VELLFRPTRASSLAKIQLSKSLQLLNQCIISIDYSSNN----QSKLEETQKILKSSVTQL  1557
             +E+L  P RA++LAK++LS  L  L  CI  +    N       KL + Q  LKS V +L
Sbjct  549   IEILTSPARAATLAKLKLSLXLXSLQACIEDLVLFDNQIASMSPKLRQKQSKLKSHVKKL  608

Query  1558  GKFIGEAEVEPNFWFLPFHSACYGKLMGSL----------SKVVEYLHFVAQALRF-LEQ  1704
              KFI EA++EPNFWF+PF+ ACY KL+ SL          S ++E L  V Q     LE+
Sbjct  609   EKFIEEAQLEPNFWFIPFNGACYSKLLRSLSNMENLSLFMSNIIESLSLVLQRFDLDLEE  668

Query  1705  ESALMGRLDSDHLSLFRDHVGPSIKSFEEIISLVGSVSVLDK---EF-----EKKKSSID  1860
                 M   + D L +F+  VG S+   +E+ S   SV+V +K   EF     E    ++D
Sbjct  669   LRKPMKAFEKD-LEIFKKKVGKSLHCLQELAS-KKSVAVHNKHDIEFGTSARENDWDTLD  726

Query  1861  PELG  1872
               LG
Sbjct  727   AGLG  730


 Score =   102 bits (254),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 88/260 (34%), Positives = 132/260 (51%), Gaps = 24/260 (9%)
 Frame = +1

Query  1    ALRGCWYAIYATCLGVCPAILSLWLIGPahlttgtaaaavaitaFIVVLPQNTHVVAKRI  180
            ALRG W+ +Y     +   +LSL  IGPAH +   +  AVA+  F+V LP  TH+++KRI
Sbjct  68   ALRGFWHTLYGCIQVLILTLLSLRXIGPAHFSYFVSXLAVALCTFVVALPGATHLMSKRI  127

Query  181  ALGQTVLVYA-----LAGPRTQPIMHPlrvaastaiavaacv--------------lall  303
            A GQ V+VY       A      +M P++V  ST +  +A V                  
Sbjct  128  AFGQIVIVYVGTAIHCAEADELVLMRPIQVCLSTVLGASASVGAMLFPNLFFYRKPSLAA  187

Query  304  lpypslassKVKHNCHLFAENVSQRLNLLVKAFSAEDNASALSLVSQAKSLNASGAKFLQ  483
            +  P LA  +V+  C  +AEN  +R N  + A  ++D+++AL  +  AK L  +G K L+
Sbjct  188  VLSPYLAYHEVRQXCQKYAENARKRFNFYLDAILSQDSSAALDFILXAKPLAEAGEKLLR  247

Query  484  NIKSKQESMQWERYPIK-FFRPYCKNPGERLQEYETPLRGMEMGLVDNNPPQFPVTVLLS  660
            +I+ KQE++ WER  I+    P      E+LQE E PLRG  + +   + P FPV ++  
Sbjct  248  SIEHKQEALLWERPTIRNXLNPSRFYVREKLQEVEJPLRG--IAIASTSCPSFPVAMM--  303

Query  661  SSEVKDSLDSLTGHISKQVK  720
                 DSL  L   I  Q++
Sbjct  304  KKLQADSLHDLKRXIHDQLE  323



>gb|EPS72651.1| hypothetical protein M569_02108 [Genlisea aurea]
Length=753

 Score =   217 bits (552),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 165/621 (27%), Positives = 283/621 (46%), Gaps = 78/621 (13%)
 Frame = +1

Query  331   KVKHNCHLFAENVSQRLNLLVKAFSAEDNASALSLVSQAKSLNASGAKFLQNIKSKQESM  510
             ++K     +A N      LL K FS+++      ++ + K ++ + AK LQ I+  +E  
Sbjct  180   RMKKLSEFYAGNACTMAKLLKKGFSSKNGTERREILLRTKPISETQAKLLQAIRVLEEES  239

Query  511   QWERYPIKFFRPYCKNPGERLQEYETPLRGMEMGLVDNNPPQFPVTVLLSSSEVKDSLDS  690
             +WER   +  R YC     +L   E  +RG+E  L  +     P + L    +   SL +
Sbjct  240   RWERAWSR--RDYCSKIVGKLNNVELAMRGIEYSLTAS-----PASPLKFDDQDGHSLSA  292

Query  691   LTGHISKQVKGRLFDLA------------TVPESNAQNAVKFLHQKLQPVTLQdlssfff  834
                 +S Q +  +   +            T  +   + A+K       P+T         
Sbjct  293   FWADVSIQFQLHVMKQSQRFPSFFSRRGRTAADDEEETAMKVNPSLSLPLTSLSQVENHE  352

Query  835   lfslklllikpsssilkdkdGSKEQEER----FLDKIYSNFVGQMNNKRFVASLKYALAL  1002
                               +  SK+ +E       D+  S F   +   R   S++ A AL
Sbjct  353   WACFLFSCADLLIHSGVPQQESKDSDEHPGGTVADRFKSCFRWLIRGGRIETSVRCAAAL  412

Query  1003  GLAVFFGSIYSKPDGFWAGLTVAISYVSAREATFRIANVKAQGTVLGSIYGVLGCFVFAK  1182
             GLAV  G + ++ DG WAG   A ++   +E     AN + QGT +GS++ ++    F +
Sbjct  413   GLAVVMGELIAQDDGRWAGFMAATAFADGKEPLLTAANARGQGTAIGSVFALICLHAFHQ  472

Query  1183  YEELRFISLIPWFIVCSFLRRSRMYGPAGGISACIGAVLILGREGFGPPREFAMARIMET  1362
                ++ ++LIPW I   FLR S++YG  GG S+ + A++ILGR+ +G    FA+AR+   
Sbjct  473   -PGIKLLALIPWVIFVRFLRHSKLYGIPGGYSSGVAALMILGRDNYGSQEGFAVARLTSV  531

Query  1363  FIGLACSITVELLFRPTRASSLAKIQLSKSLQLLNQCIISIDYSSNNQSKLEETQKILKS  1542
             FIGLAC +  E   R  RAS+ A+ QL  +L++L  CI S+    +N +     Q+ L++
Sbjct  532   FIGLACILMAEFFTRSKRASTKARKQLYVTLRILKDCIKSLQSEQHNPN--HHLQQ-LEN  588

Query  1543  SVTQLGKFIGEAEVEPNFWFLPFHSACYGKLMGSLSKVVEYLHFVAQALRFLEQESALMG  1722
             S+  L K++ +A+ EP+FWFLPF ++CY K++ SLS V + L FVA              
Sbjct  589   SIRALAKYVSDAKSEPDFWFLPFRASCYEKMIASLSTVSDMLRFVA--------------  634

Query  1723  RLDSDHLSLFRDHVGPSIKSFEEIISLVGSVSVLDKEFEKKKSSIDPEL--GKLPTSNNI  1896
                         H    +++F++  S       + KEF        PEL   +L     +
Sbjct  635   ------------HNSQMLRNFKQYFS-------VQKEF--------PELLYNELQKLEKM  667

Query  1897  TGLSDEEIDNKLKSFMEDSRQFVDQKdeddddeVMM-------NSQVALSLSALAFCMRG  2055
              G   + +D  +    +D +    QK+  +   V++         ++ + + A+ FC++ 
Sbjct  668   VGSLLQILDGSMNETCKDYQPIDTQKNGGELWSVILEMGTGSVKQRIFICVGAVEFCIKT  727

Query  2056  IVRETK-EIDKAIKELVQWEN  2115
               RE +  +D  ++E+V+WEN
Sbjct  728   CKREIRGALDVLVREIVRWEN  748



>ref|XP_006664967.1| PREDICTED: uncharacterized protein LOC102716927 [Oryza brachyantha]
Length=781

 Score =   211 bits (538),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 221/763 (29%), Positives = 358/763 (47%), Gaps = 120/763 (16%)
 Frame = +1

Query  1     ALRGCWYAIYATCLGVCPAILSLWLIGPahl--ttgtaaaavaitaFIVVLPQNTHVVAK  174
             A+R    A+ AT +G  P++L LWL        +       VA++ F V LP  +  VAK
Sbjct  64    AVRAALSAVQATAMGAVPSVLPLWLAHRTGAGESVVATTVVVALSTFAVALP-GSGAVAK  122

Query  175   RIALGQTVLVYALAGPRTQP----------IMHPlrvaastaiavaacvlalllpypsla  324
             RIALGQ +++Y +A  R +           ++HP  V A TA+ V A +LA+LLP P LA
Sbjct  123   RIALGQIIIIY-VARFRQESMRRSDGDGAVLLHPANVVACTALGVVAALLAVLLPCPRLA  181

Query  325   ssKVKHNCHLFAENVSQRLNLLVKAF------SAEDNAS------------ALSLVSQAK  450
             + +V+ N   + E  ++R+ LL  AF      +A  ++S            A  ++SQA 
Sbjct  182   TQEVRANKAAYLEVAAERVRLLAHAFRLMQLDAAAGSSSSTYCCGRRRQWVAACIISQAD  241

Query  451   SLNASGAKFLQNIKSKQESMQWERYPIKFFRPYCKNPGERLQE-------YETPLRGMEM  609
                ++ A   + I S Q  +QWER P    + +C    +  +E        E PLRGMEM
Sbjct  242   RAASAAALLRRRITSAQGDLQWERMP-ALLKRWCGGGWDDDEEDQQVHDLIEMPLRGMEM  300

Query  610   GLVD------NNPPQFPVTVLLSSSEVKDSLDSLTGHISKQVKGRLFDLA------TVPE  753
               +       N+    P   L    +  D +  LT    +   G   ++A       VPE
Sbjct  301   ACIQMHKRAPNSSSICPTPTLTWLQQATDQV-RLTLLTRRSCSG--MEMAKHGYGVVVPE  357

Query  754   SNAQNAVKF-----LHQKLQPVTLQdlssffflfslklllikpsssilkdkdGSKEQEER  918
                  A  F     LH    P                   + P+ +  +    +K+ EE+
Sbjct  358   QLPPLAFLFCMDLLLHGSSPP------------------KLPPADAASQCDGNTKDDEEQ  399

Query  919   FLDKIYSNFVGQMNNKRFVASLKYALALGLAVFFGSIYSKPDGFWAGLTVAISYVSAREA  1098
                + +  +  +    R V + K A +LGLAV  G ++S   GFWAGL VA +  + RE 
Sbjct  400   RKHRPWP-WHKEARTTRLVVAAKCAFSLGLAVLLGLLFSSDHGFWAGLIVATTMATEREW  458

Query  1099  TFRIANVKAQGTVLGSIYGVLGCFVFAKYE--ELRFISLIPWFIVCS-FLRRSRMYGPAG  1269
             T+ +A  +A GT LGS+YG L C +  K    ELRF++L+PW I+ + FL+RSR YGPAG
Sbjct  459   TWALAIARAHGTALGSVYGALACLLIDKRRLMELRFLALLPWLILTAGFLKRSRAYGPAG  518

Query  1270  GISACIGAVLILGREGFGPPREFAMARIMETFIGLACSITVELLFRP-TRASSLAKIQLS  1446
             G++A +  ++I+GR    PP  F ++R++ETFIGLAC++  +L+F+P  R S+ A  QL+
Sbjct  519   GVAAAVSGIIIVGRRYDEPPMAFTVSRLVETFIGLACTVVADLVFQPAARPSAKATKQLA  578

Query  1447  KSLQLLNQCIISID-YSSNNQSKLEETQKILKSSVTQLGKFIGEAEVEPNF-WFLPFHSA  1620
             + L  L  C    D +     +K++  Q+     V  L +++ EA  EP+F W +PF ++
Sbjct  579   RCLATLACCFNDDDSWGGQTSTKVKAVQE----QVALLKRYVAEAAGEPHFLWSVPFPAS  634

Query  1621  CYGKLMGSLSKVVEYLHFVAQALRFLEQESALMGRLDSDHLSLFRDHVGPSIKSFEEII-  1797
             CY K+ G L ++ + L    +AL                      D    +I  F  ++ 
Sbjct  635   CYDKVAGRLDRMAQLLCLYTKALAVTPPA----------------DEAADAIHRFHGLVS  678

Query  1798  -SLVGSVSVLDKEFEKKKSSIDPELGKLPTSNNITGLSDEEIDNKLKSFMEDSRQFVDQK  1974
              SL  + ++L +  + +K   D E G   +S       DE  +  ++SF+  +       
Sbjct  679   ASLDHTSALLHRPSDDEKQRKDLEAGIRLSSCCCD--DDEAPETLVQSFLGHA-------  729

Query  1975  deddddeVMMNSQVALSLSALAFCMRGIVRETKEIDKAIKELV  2103
                   +     Q A +++++ FCM  + +E  +++  + +L 
Sbjct  730   ----LLQQPQQQQGASAMASIGFCMGEMAKEAMQMEADMLDLT  768



>ref|XP_003577182.2| PREDICTED: uncharacterized protein LOC100831379 [Brachypodium 
distachyon]
Length=820

 Score =   192 bits (488),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 124/387 (32%), Positives = 218/387 (56%), Gaps = 32/387 (8%)
 Frame = +1

Query  955   MNNKRFVASLKYALALGLAVFFGSIYSKPDGFWAGLTVAISYV-SAREATFRIANVKAQG  1131
             + + R   + K A++LGLAV  G +++   GFW+GL VA +   +AR +T+ +A  +A G
Sbjct  453   LQSSRLKMASKCAVSLGLAVLLGLLFNNDHGFWSGLIVATTMAPAARGSTWAVAVARAHG  512

Query  1132  TVLGSIYGVLGCFVFAKYE--ELRFISLIPWFIVCSFLRRSRMYGPAGGISACIGAVLIL  1305
             T +GS+YGVL C +  +    ELRF++L+PW ++ +FL+RSR YGPAGG++A +  ++I+
Sbjct  513   TAIGSVYGVLACLLSQQRHLMELRFLALLPWIVLATFLKRSRAYGPAGGVAAALSGIIIV  572

Query  1306  GREGFGPPREFAMARIMETFIGLACSITVELLFRP-TRASSLAKIQLSKSLQLLNQCIIS  1482
             GR    PP  F ++R++ETFIGL+C++  +L F+P    S+ A+ QL +    L  C+  
Sbjct  573   GRRYDEPPMAFTISRLVETFIGLSCTVATDLAFQPKAMPSARARTQLPRCFAALRDCLAR  632

Query  1483  IDYSSNNQSKLEETQKILKSSVTQLGKFIGEAEVEPNF-WFLPFHSACYGKLMGSLSKVV  1659
             +     NQ   +E  K+L   V  LGK+  EA  EPNF W  PF ++CY K+ GSLS++ 
Sbjct  633   LPSLRKNQ---QEQHKMLLEQVALLGKYAAEAGAEPNFLWMAPFPASCYAKVHGSLSRMA  689

Query  1660  EYLHFVAQALRFLEQESALMGRLDSDHLSLFRDHVGPSIKSFEEIISLVGSVSVLDKEFE  1839
             + L     A   +   ++   +L +          G  +K F   +    S S+ + E +
Sbjct  690   QLLGLYLHAQAIIVDNTSYGSQLLA----------GTDVKRFHNRL----SASLPELELD  735

Query  1840  KKKSSIDPELGKLPTSNNITGLSDEEIDNKLKSFMEDSRQFVDQKdeddddeVMMNSQVA  2019
             ++ +  D E G         G   E++   +KSF+  +R+ + Q++E+++++    +  A
Sbjct  736   EEDTDFDLEDGN--------GKWCEDMAVVVKSFIGHAREALLQEEEEEEEQHQQLN--A  785

Query  2020  LSLSALAFCMRGIVRETKEIDKAIKEL  2100
               L ++ FCM  +++E ++++  + +L
Sbjct  786   YCLGSIGFCMGEMMKEAQQLEALMLDL  812


 Score = 56.2 bits (134),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 69/233 (30%), Positives = 113/233 (48%), Gaps = 39/233 (17%)
 Frame = +1

Query  40   LGVCPAILSLWLI------GPahlttgtaaaavaitaFIVVLPQNTHVVAKRIALGQTVL  201
            +G  P++L+LWL            +    +A VA++AF V +P++   VAKRIALGQ ++
Sbjct  74   MGAVPSVLALWLAQRMGESSSTTSSVLGTSALVALSAFAVAVPESPGPVAKRIALGQIII  133

Query  202  VYALAGPRTQP---------IMHPlrvaastaiavaacvlalllpypslassKVKHNCHL  354
            +Y +A  R  P         + HP  V A TA+  AA +LA+LLP+P LA+ +V+     
Sbjct  134  IY-VAKFRQLPTTNNGLGVVVQHPANVVACTALGAAAALLAVLLPWPRLATREVEEKSVA  192

Query  355  FAENVSQRLNLLVKAFSAEDNASAL----------------------SLVSQAKSLNASG  468
            + EN ++R+ LLV AF      +A                       + +S+A  L ++ 
Sbjct  193  YMENAAERVRLLVDAFLLRATVTAEEEEDEEEEEVTSGRRRRRWCVAACMSEAHRLASAS  252

Query  469  AKFLQNIKSKQESMQWERYPIKFFRPYCKNPGERLQEYETPLRGMEMGLVDNN  627
            A  L+ I S +  +QWER  ++          +  +  E P++GME+ +   N
Sbjct  253  AALLRRITSVKGDLQWERV-VRLGAAGTMPAADEQERIEMPIKGMEIAVSSTN  304



>gb|EMT12500.1| hypothetical protein F775_52162 [Aegilops tauschii]
Length=858

 Score =   192 bits (488),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 123/383 (32%), Positives = 220/383 (57%), Gaps = 39/383 (10%)
 Frame = +1

Query  964   KRFVASLKYALALGLAVFFGSIYSKPDGFWAGLTVAISYVSAREATFRIANVKAQGTVLG  1143
             +R + + K A++LGLAV  G +++   GFW+GL VA +  + R++T+ +A  +A GT +G
Sbjct  505   ERVMTAAKCAVSLGLAVLLGLLFNNDHGFWSGLIVATTMTAGRDSTWAVAIARAHGTAIG  564

Query  1144  SIYGVLGCFVFAKYE--ELRFISLIPWFIVCSFLRRSRMYGPAGGISACIGAVLILGREG  1317
             S+YGVLGC +  +    ELRF++L+PW ++ +FL+RSR YGPAGG++A +  ++I+GR  
Sbjct  565   SVYGVLGCLLSQQPHLMELRFLALLPWIVLATFLKRSRAYGPAGGVAAALSGIIIVGRRY  624

Query  1318  FGPPREFAMARIMETFIGLACSITVELLF-RPTRASSLAKIQLSKSLQLLNQCIISIDYS  1494
                P  F + R++ETFIGL+C++  +L+F R  R ++ A+ QL + +  L +C++ +  +
Sbjct  625   DEAPMAFTITRLVETFIGLSCTVATDLVFQRKARPTARARAQLHRCIAALRECVVGLAPT  684

Query  1495  SNNQSKLEETQKILKSSVTQLGKFIGEAEVEPNF-WFLPFHSACYGKLMGSLSKVVEYLH  1671
             S+  +K ++  K L   V  L K+  EA  EPNF W  PF ++CY K+ GSLS++ + + 
Sbjct  685   SS--AKQQQQHKTLLEQVALLKKYAVEAGSEPNFLWLAPFPTSCYDKVHGSLSRIAQLIG  742

Query  1672  FVAQALRFLEQESALMGRLDSDHLSLFRDHVGPSIKSFEEIISLVGSVSVLDKEFEKKKS  1851
                 A   L   +    +L +D            +K F   +S   S+  L +E      
Sbjct  743   LYQHARATLIDTAGGSRQLGAD------------MKRFHSALS--ASLETLLEE------  782

Query  1852  SIDPELGKLPTSNNITGLSDEEIDNKLKSFMEDSRQFVDQKdeddddeVMMNSQVALSLS  2031
              +D E GK        G+  E++   +KSF+  +R+ + Q+ +++++E +     A+ L 
Sbjct  783   DVDLEAGK--------GIFCEDM-AVVKSFLGHAREALSQQQQEEEEEQL----AAVCLG  829

Query  2032  ALAFCMRGIVRETKEIDKAIKEL  2100
             ++ FCM  +++E ++++  +  L
Sbjct  830   SIGFCMGEMMKEAQQLEAHMLNL  852



>dbj|BAK01191.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=864

 Score =   191 bits (486),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 121/377 (32%), Positives = 213/377 (56%), Gaps = 36/377 (10%)
 Frame = +1

Query  964   KRFVASLKYALALGLAVFFGSIYSKPDGFWAGLTVAISYVSAREATFRIANVKAQGTVLG  1143
             +R + + K A++LGLAV  G +++   GFW+GL VA +  + R++T+ +A  +A GT +G
Sbjct  508   ERVMTAAKCAVSLGLAVLLGLLFNNDHGFWSGLIVATTMTAGRDSTWAVAIARAHGTAIG  567

Query  1144  SIYGVLGCFVFAKYE--ELRFISLIPWFIVCSFLRRSRMYGPAGGISACIGAVLILGREG  1317
             S+YGVLGC +  +    ELRF++L+PW ++ +FL+RSR YGPAGG++A +  ++I+GR  
Sbjct  568   SVYGVLGCLLSQQPHLMELRFLALLPWIVLATFLKRSRAYGPAGGVAAALSGIIIVGRRY  627

Query  1318  FGPPREFAMARIMETFIGLACSITVELLF-RPTRASSLAKIQLSKSLQLLNQCIISIDYS  1494
                P  F + R++ETFIGL+C++  +L+F R  R ++ A+ QL + +  L  C++ +  +
Sbjct  628   DEAPMAFTVTRLVETFIGLSCTVATDLVFQRKARPTARARAQLHRCIAALQDCVVGLAPT  687

Query  1495  SNNQSKLEETQKILKSSVTQLGKFIGEAEVEPNF-WFLPFHSACYGKLMGSLSKVVEYLH  1671
             S+ + + ++  K L   V  L K+  EA  EPNF W  PF ++CY K+ GSLS++ + + 
Sbjct  688   SSAKQQQQQQHKTLLEQVALLKKYAAEAGSEPNFLWLTPFPTSCYDKVHGSLSRIAQLIG  747

Query  1672  FVAQALRFLEQESALMGRLDSDHLSLFRDHVGPSIKSFEEIISLVGSVSVLDKEFEKKKS  1851
                 A       + L+G             +G  +K F   +S   S+  L  E +    
Sbjct  748   LYQHA------RAVLVGTAGGSR------QLGADMKRFHSALS--ASLEALLAEED----  789

Query  1852  SIDPELGKLPTSNNITGLSDEEIDNKLKSFMEDSRQFVDQKdeddddeVMMNSQVALSLS  2031
              +D E GK        G   E++   +KSF   +R+ + Q+ +  ++E +     A+ L 
Sbjct  790   -VDLEGGK--------GTFCEDM-AVVKSFFGHAREALSQQQQQQEEEQL----AAVCLG  835

Query  2032  ALAFCMRGIVRETKEID  2082
             ++ FCM  +++E ++++
Sbjct  836   SIGFCMGEMMKEAQQLE  852


 Score = 74.7 bits (182),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 77/238 (32%), Positives = 119/238 (50%), Gaps = 30/238 (13%)
 Frame = +1

Query  1    ALRGCWYAIYATCLGVCPAILSLWLIGPahlttg--taaaavaitaFIVVLPQNTHVVAK  174
            ALR    A++AT +G  P++L+LWL             +A VA++ F V LP++   VAK
Sbjct  91   ALRAAASALHATVMGAVPSVLALWLAHRTGTAESVLATSAVVALSTFAVALPESPGPVAK  150

Query  175  RIALGQTVLVYALA---GPRTQP---IMHPlrvaastaiavaacvlalllpypslassKV  336
            RIALGQ +++Y      G RT     + HP  V   TA+ VAA +LA+LLP P LA+ +V
Sbjct  151  RIALGQIIIIYVAKFRRGDRTSHELVLEHPANVVLCTALGVAAALLAVLLPCPRLATREV  210

Query  337  KHNCHLFAENVSQRLNLLVKAF--SAEDNASALS--------------------LVSQAK  450
            +     + E  ++R+ +LV AF  +A D+ +A +                     +SQA 
Sbjct  211  EDKSRAYMEAAAERVRVLVDAFLLTANDDGTACADDDHETAGASGRRRRWCMAACMSQAN  270

Query  451  SLNASGAKFLQNIKSKQESMQWERYPIKFFRPYCKNPGERLQEYETPLRGMEMGLVDN  624
             L ++ A  L+ + + +  +QWER P    R   + P       E P++GME+ L   
Sbjct  271  RLASASAALLRRMAAVKGDLQWERVPAVLRRWMPQQPVVDHGRIEMPIKGMEIALTST  328



>ref|XP_008675554.1| PREDICTED: uncharacterized protein LOC103651649 [Zea mays]
 tpg|DAA59124.1| TPA: hypothetical protein ZEAMMB73_446416 [Zea mays]
Length=898

 Score =   187 bits (476),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 100/253 (40%), Positives = 159/253 (63%), Gaps = 13/253 (5%)
 Frame = +1

Query  964   KRFVASLKYALALGLAVFFGSIYSKPDGFWAGLTVAISYVSAREATFRIANVKAQGTVLG  1143
             +R VA+ K   +LGLAV  G ++S   GFW+GL VA +  + RE+T+ +A  +A GT LG
Sbjct  501   RRLVAAAKCGFSLGLAVLLGLLFSNDHGFWSGLIVATTMTAGRESTWAVAVARAHGTALG  560

Query  1144  SIYGVLGCFVFAKYE----ELRFISLIPWFIVCSFLRRSRMYGPAGGISACIGAVLILGR  1311
             SIYGVLGC + ++ +    +LRF++L+PW ++ +FL+RSR YGPAGG++A +  V+I+GR
Sbjct  561   SIYGVLGCLLMSQQQLVAMDLRFVALLPWMVLATFLKRSRAYGPAGGVAAALSVVIIMGR  620

Query  1312  EGFGPPREFAMARIMETFIGLACSITVELLFRP-TRASSLAKIQLSKSLQLLNQC--IIS  1482
                 PP  F +AR++ETFIG++C +  +L+F+P  R S  A+ QL++ +  L  C  ++ 
Sbjct  621   RYDEPPMAFTIARLVETFIGISCVVLADLVFQPGARPSVQAREQLARCIAALAACSRLVV  680

Query  1483  IDYSSNNQSKLEETQKILKSSVTQLGKFIGEAEVEPNF-WFLPFHSACYGKLMGSLSKVV  1659
              D ++++     E  K ++  +  L K   EA  EP + W  PF +ACY  + GSL ++ 
Sbjct  681   ADPAASS-----ELLKRVQQELALLRKHAAEAGSEPTYLWLPPFPAACYETIQGSLGRMA  735

Query  1660  EYLHFVAQALRFL  1698
             + L    QA R++
Sbjct  736   QLLQLYHQARRYM  748



>emb|CBI30577.3| unnamed protein product [Vitis vinifera]
Length=556

 Score =   180 bits (457),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 104/226 (46%), Positives = 146/226 (65%), Gaps = 11/226 (5%)
 Frame = +1

Query  1513  LEETQKILKSSVTQLGKFIGEAEVEPNFWFLPFHSACYGKLMGSLSKVVEYLHFVAQALR  1692
             + E Q  LK +V +L KFIGEA++EPNFWFLPF  ACY KL  SLSKV + L FVA  + 
Sbjct  332   MREKQNKLKMNVNELNKFIGEAKLEPNFWFLPFQGACYSKLWESLSKVEDLLLFVAHNID  391

Query  1693  FLEQES--------ALMGRLDSDHLSLFRDHVGPSIKSFEEIISLVGSVSVLDKEFEKKK  1848
             FL Q S         +   + SD L LF++ V  S+K   +I S + S+++L+KE +KK 
Sbjct  392   FLLQASQKFEVSWKEIQKNIHSD-LELFKETVASSLKYLVKITS-IESLTLLEKELQKKI  449

Query  1849  SSIDPELGKLPTSNNITGLSDEEIDNKLKSFMEDSRQFVDQKdeddddeVMMNSQVALSL  2028
              + D ELG+ P ++ +    DEEI+  L SF++ S + +++   + D E  + SQ+ LSL
Sbjct  450   IAHDLELGRPPNAHWVWSTDDEEIEKILASFLQHSEEIINEIHTNKDKE-ELKSQMVLSL  508

Query  2029  SALAFCMRGIVRETKEIDKAIKELVQWENPSSPVNLHEISCKIRAL  2166
              AL FCM  ++RET++I+K I+ELVQWENPSS ++  EISCKI AL
Sbjct  509   GALGFCMGSLMRETRKIEKGIQELVQWENPSSYIDFSEISCKINAL  554


 Score =   149 bits (377),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 116/243 (48%), Positives = 160/243 (66%), Gaps = 8/243 (3%)
 Frame = +1

Query  4    LRGCWYAIYATCLGVCPAILSLWLIGPahlttgtaaaavaitaFIVVLPQNTHVVAKRIA  183
            LRGCW+ + AT   V PA+LSLWLIG   L+TG AAA VA++ F+V LP+ TH++AKRIA
Sbjct  71   LRGCWHVLCATVQVVVPAMLSLWLIGAGQLSTGLAAAVVALSVFVVGLPEWTHLMAKRIA  130

Query  184  LGQTVLVYALAGPRTQ----PIMHPlrvaastaiavaacvlalllpypslassKVKHNCH  351
             GQ V+VY  A    +      MH L VA+STA+   A VLALLLPYP LASS+V     
Sbjct  131  FGQIVIVYVGASIIHEEGAGAFMHLLHVASSTALGALASVLALLLPYPRLASSEVNEIWK  190

Query  352  LFAENVSQRLNLLVKAFSAEDNASALSLVSQAKSLNASGAKFLQNIKSKQESMQWERYPI  531
             +AEN S+RLNL ++AFSA DN++AL  +SQAK  +  G K LQ I+  ++ + WER   
Sbjct  191  SYAENASERLNLFLEAFSAPDNSAALDSISQAKFFSERGDKLLQTIRLVEDGILWERPWT  250

Query  532  KFFRPYCKNPGERLQEYETPLRGMEMGLVDNNPPQFPVTVLLSSSEVKDSLDSLTGHISK  711
            +FF+P+C +PG+RLQ  E PLRGME+ L  ++    P  +  +  E+ D+L  +T + S 
Sbjct  251  RFFKPHCFDPGDRLQAIEIPLRGMEIAL--SSFTSLPTAI--ADDELGDALQRVTLNTSL  306

Query  712  QVK  720
            +++
Sbjct  307  RLE  309



>ref|XP_010111491.1| hypothetical protein L484_021316 [Morus notabilis]
 gb|EXC31014.1| hypothetical protein L484_021316 [Morus notabilis]
Length=305

 Score =   174 bits (440),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 115/303 (38%), Positives = 163/303 (54%), Gaps = 21/303 (7%)
 Frame = +1

Query  1294  VLILGREGFGPPREFAMARIMETFIGLACSITVELLFRPTRASSLAKIQLSKSLQLLNQC  1473
             +LI+GR  +G P EFA+ARI+E  IGL C + VELL  P RA++LAK +LS+ + +L  C
Sbjct  7     LLIVGRRDYGSPTEFAIARIIEATIGLICFVLVELLLNPARAATLAKTELSQCIGVLRDC  66

Query  1474  IISIDYSSNNQSK-----LEETQKILKSSVTQLGKFIGEAEVEPNFWFLPFHSACYGKLM  1638
             + ++      ++      L E    LK  V  L KFI EAE+EPNFWFLPF S CY KL+
Sbjct  67    VENVSLFPTQKNVPASRVLREKHLQLKCHVDDLEKFIEEAEMEPNFWFLPFDSVCYHKLL  126

Query  1639  GSLSKVVEYLHFVAQALRFL---EQESALMGRLD------SDHLSLFRDHVGPSIKSFEE  1791
             GS S ++  L FVA  + F+   E      G L+      ++ L  F+  V   +    E
Sbjct  127   GSFSTLMNLLLFVAYEIEFVFVFEASQEQGGDLEEVLKQVNEDLEFFKMRVESMLLRCIE  186

Query  1792  IISLVGSVSVLDKEFEKKKSSIDPELGKLPTSN--NITGLSDEEIDNKLKSFMEDSRQFV  1965
               + + ++ V   E      S   ELG+L   N     G +D+E+D  L  F+    + V
Sbjct  187   KATSITTLQVSPTE----DFSHGIELGRLAHENVSKHLGSNDKEVDAILSCFLRHLVEVV  242

Query  1966  DQKdeddddeVMMNSQVALSLSALAFCMRGIVRETKEIDKAIKELVQWENPSSPVNLHEI  2145
              +K+   +       Q+ALSL+ L F    + RE  EIDK +KEL + ENPS+  NLH+I
Sbjct  243   -EKEYTCEGTEKFKRQLALSLTGLGFGTHSLAREANEIDKKVKELAKLENPSNNKNLHKI  301

Query  2146  SCK  2154
             SCK
Sbjct  302   SCK  304



>ref|XP_004978393.1| PREDICTED: uncharacterized protein LOC101756990 [Setaria italica]
Length=820

 Score =   180 bits (456),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 126/439 (29%), Positives = 215/439 (49%), Gaps = 40/439 (9%)
 Frame = +1

Query  430   SLVSQAKSLNASGAKFLQNIKSKQESMQWERYPIKFFRPYCKNPGERLQEYETPLRGME-  606
             + +S+A  L ++ A  L+ + + +E +QWER          +         ETPL GM+ 
Sbjct  243   ACISEANRLASASAALLRRMNAIKEDVQWERR---------RTIAVDYDGVETPLTGMQM  293

Query  607   ---MGLVDNNPPQFPVTVLLSSSEVKDSLDSLTGHI---------SKQVKGRLFDLATVP  750
                M ++D          LL   +    + ++  HI         +KQ          +P
Sbjct  294   ALSMMVIDGTTNDSKCNNLLQLQKHHAGIMAMRDHIRLALLTTPANKQTASFASKPPYLP  353

Query  751   ESNAQNAVK-FLHQKLQPVTLQdlssffflfslklllikpsssilkdkdGSKEQEERFLD  927
                 Q+    FL    Q   L+  +    L S                 G   Q +   D
Sbjct  354   LQTQQDPCWLFLFSLYQ---LRGAAGGLLLASDNGDANANKKIAPAADHGHGHQHKSRAD  410

Query  928   KIYSNFVGQMNNKRFVASLKYALALGLAVFFGSIYSKPDGFWAGLTVAISYVSAREATFR  1107
             +          NK+ VA+ K   +LGLAV  G +++   GFW+GL VA +  ++R++T+ 
Sbjct  411   E--QEKTATKGNKKLVAAAKCGFSLGLAVLLGLLFNNDHGFWSGLIVATTISTSRDSTWA  468

Query  1108  IANVKAQGTVLGSIYGVLGCFVFAKYE-----ELRFISLIPWFIVCSFLRRSRMYGPAGG  1272
             +A  +A GT LGS+YG +GC + ++ +     +LR ++L+PW +V +FL+RSR YGPAGG
Sbjct  469   VAAARAHGTALGSVYGAVGCLLISQQQLSGMMDLRLLALVPWMVVATFLKRSRAYGPAGG  528

Query  1273  ISACIGAVLILGREGFGPPREFAMARIMETFIGLACSITVELLFRPTRASSLAKIQLSKS  1452
             +SA +  V+I+GR     P  F +AR++ETFIG++C++  ++LF+P    S      +K+
Sbjct  529   VSAALSVVIIMGRRYDETPMAFTVARLVETFIGISCTVMADILFQPGARPS------AKA  582

Query  1453  LQLLNQCIISIDYSSNNQSKLEETQKILKSSVTQLGKFIGEAEVEPNFWFLP-FHSACYG  1629
              + L +CI +   ++++        +++  S+  L +   EA  EP++ +LP F +ACY 
Sbjct  583   REHLTRCIATTLLAASSADGPSSQSQVISKSLALLRRHAAEAGGEPSYLWLPRFPAACYE  642

Query  1630  KLMGSLSKVVEYLHFVAQA  1686
             ++ GSL ++   LH   QA
Sbjct  643   RIQGSLGRMARLLHLYRQA  661



>ref|XP_002489081.1| hypothetical protein SORBIDRAFT_0120s002040 [Sorghum bicolor]
 gb|EES20194.1| hypothetical protein SORBIDRAFT_0120s002040 [Sorghum bicolor]
Length=831

 Score =   179 bits (453),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 102/251 (41%), Positives = 157/251 (63%), Gaps = 12/251 (5%)
 Frame = +1

Query  967   RFVASLKYALALGLAVFFGSIYSKPDGFWAGLTVAISYVSAREATFRIANVKAQGTVLGS  1146
             R VA+ K   +LGLAV  G ++S   GFW+GL VA +  + RE+T+ +A  +A GT LGS
Sbjct  445   RLVAAAKCGFSLGLAVLLGLLFSNDHGFWSGLIVATTMTAGRESTWAVAVARAHGTALGS  504

Query  1147  IYGVLGCFVFAKYE-----ELRFISLIPWFIVCSFLRRSRMYGPAGGISACIGAVLILGR  1311
             IYGVL C + ++ +     +LRF++L+PW ++ +FL+RSR YGPAGG++A +  V+I+GR
Sbjct  505   IYGVLCCVLMSQQQQLLTMDLRFVALLPWMVLATFLKRSRAYGPAGGVAAALSVVIIVGR  564

Query  1312  EGFGPPREFAMARIMETFIGLACSITVELLFRP-TRASSLAKIQLSKSLQLLNQCIISID  1488
                  P  F +AR++ETFIG++C++  +L+F+P  R S  AK QL++ +  L  C ++ D
Sbjct  565   RYDEAPMAFTIARLVETFIGISCAVLADLVFQPGARPSVQAKAQLTRCIAALADCCLAAD  624

Query  1489  YSSNNQSKLEETQKILKSSVTQLGKFIGEAEVEPNF-WFLPFHSACYGKLMGSLSKVVEY  1665
              SS+     E   K ++  +  L K+  EA  EP + W LPF  ACY K+ GS+ ++ + 
Sbjct  625   LSSS-----ELLLKRVQQELALLRKYAAEAGSEPTYLWMLPFPVACYDKIQGSIGRMAQL  679

Query  1666  LHFVAQALRFL  1698
             L    QA R +
Sbjct  680   LQLYHQARRCM  690



>ref|XP_004978409.1| PREDICTED: uncharacterized protein LOC101778611 [Setaria italica]
Length=828

 Score =   176 bits (447),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 91/249 (37%), Positives = 153/249 (61%), Gaps = 14/249 (6%)
 Frame = +1

Query  958   NNKRFVASLKYALALGLAVFFGSIYSKPDGFWAGLTVAISYVSAREATFRIANVKAQGTV  1137
              NK+ VA+ K   +LGLAV  G +++   GFW+GL VA +  ++R++T+ +A  +A GT 
Sbjct  432   GNKKLVAAAKCGFSLGLAVLLGLLFNNDHGFWSGLIVATTISTSRDSTWAVAAARAHGTA  491

Query  1138  LGSIYGVLGCFVFAKYE-----ELRFISLIPWFIVCSFLRRSRMYGPAGGISACIGAVLI  1302
             LGS+YG +GC + ++ +     +LR ++L+PW +V +FL+RS  YGPAGG+SA +  V+I
Sbjct  492   LGSVYGAVGCLLISQQQLSGMMDLRLLALVPWMVVATFLKRSSAYGPAGGVSAALSVVII  551

Query  1303  LGREGFGPPREFAMARIMETFIGLACSITVELLFRPTRASSLAKIQLSKSLQLLNQCIIS  1482
             +GR     P  F +AR++ETFIG++C++  ++LF+P    S+      K+ + L +CI +
Sbjct  552   MGRRYDESPMAFTVARLVETFIGISCAVMADILFQPGARPSV------KAREHLTRCIAT  605

Query  1483  IDYSSNNQSKLEETQKILKSSVTQLGKFIGEAEVEPNF-WFLPFHSACYGKLMGSLSKVV  1659
                +S+     +   +++  S+  L +   EA  EP++ W  PF +ACY ++ GSL ++ 
Sbjct  606   TLAASSADGPSQS--QVISKSLALLRRHAAEASGEPSYLWLPPFPTACYERIQGSLGRMA  663

Query  1660  EYLHFVAQA  1686
               LH   QA
Sbjct  664   RLLHLYHQA  672



>gb|KHN02426.1| hypothetical protein glysoja_002450 [Glycine soja]
Length=292

 Score =   166 bits (421),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 107/318 (34%), Positives = 161/318 (51%), Gaps = 63/318 (20%)
 Frame = +1

Query  1018  FGSIYSKPDGFWAGLTVAISYVSAREATFRIANVKAQGTVLGSIYGVLGCFVFAKYEELR  1197
             F   Y+K +G+WAGL +A+ +V+ R  TF +AN + QG  +GSIYG+L CF+F K  +  
Sbjct  29    FIRTYNKVNGYWAGLLIALCFVTGRHPTFSLANARGQGAAMGSIYGILCCFIFKKIVDFS  88

Query  1198  FISLIPWFIVCSFLRRSRMYGPAGGISACIGAVLILGREGFGPPREFAMARIMETFIGLA  1377
             F+ L+PW    SFL+ SR+YG AGGI+A  GA+L++    +   R               
Sbjct  89    FLPLLPWIFFSSFLKYSRIYGQAGGIAAVTGALLVVDCHHYSYKR---------------  133

Query  1378  CSITVELLFRPTRASSLAKIQLSKSLQLLNQCIISIDYSSNNQSKLEETQKILKSSVTQL  1557
                               K+ +S S                    L E QK LKS V QL
Sbjct  134   ------------------KMPVSSS------------------QALREGQKRLKSLVGQL  157

Query  1558  GKFIGEAEVEPNFWFLPFHSACYGKLMGSLSKVVEYLHFVAQALR---FLEQESA-----  1713
              +F  EAE+EPNFWF+PFH+ACY K++ SLSK+ + L FVA ++     L Q++      
Sbjct  158   EEFTAEAELEPNFWFIPFHNACYRKMLESLSKMADLLLFVAYSMENMMLLSQKNEAFWVD  217

Query  1714  LMGRLDSDHLSLFRDHVGPSIKSFEEIISLVGSVSVLDKEFEKKKSSIDPELGKLPTSNN  1893
             L  R++ +++ +F+  V P++K  EE I+   +   L+ E   +    D E  + P +  
Sbjct  218   LHDRIN-ENVRIFKKKVSPTLKRLEE-ITRKKTPRKLENEL-NRNLPCDIEAPEHPNAEE  274

Query  1894  ITGLS-DEEIDNKLKSFM  1944
                 S DE +D+   SF+
Sbjct  275   FRVWSGDEVVDSITDSFL  292



>ref|NP_001176293.1| Os11g0100300 [Oryza sativa Japonica Group]
 gb|ABA91075.1| expressed protein [Oryza sativa Japonica Group]
 gb|ABA96183.1| hypothetical protein LOC_Os12g01020 [Oryza sativa Japonica Group]
 gb|EAZ17121.1| hypothetical protein OsJ_32622 [Oryza sativa Japonica Group]
 dbj|BAH95021.1| Os11g0100300 [Oryza sativa Japonica Group]
Length=845

 Score =   163 bits (413),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 126/388 (32%), Positives = 205/388 (53%), Gaps = 37/388 (10%)
 Frame = +1

Query  961   NKRFVASLKYALALGLAVFFGSIYSKPDGFWAGLTVAISYVSAREATFRIANVKAQGTVL  1140
              +R VA+ K + +LGLAV  G ++S   GFW+GL VA +  + RE T+ +A  +A GT L
Sbjct  484   RRRLVAAAKCSFSLGLAVLLGLLFSSDHGFWSGLVVATTMATGREWTWALAIARAHGTAL  543

Query  1141  GSIYGVLGCFVFAKYEELRFISLIPWFIVCS-FLRRSRMY--GPAGGISACIGAVLILGR  1311
             GS+YG L C V  +  ELRF++L+PW I+ + FL+RSR Y    AGG++A +  ++I+GR
Sbjct  544   GSVYGALACLVIDRM-ELRFLALLPWLILTAGFLKRSRAYGPAGAGGVAAAVSGIIIVGR  602

Query  1312  EGFGPPREFAMARIMETFIGLACSITVELLFRP-TRASSLAKIQLSKSLQLLNQCIISID  1488
                 PP  F +AR++ETFIGLAC I  +L+F+P  R S+ A  QL + L  L  C     
Sbjct  603   RYDEPPMAFTVARLVETFIGLACIIVADLVFQPAARPSTKATAQLDRCLAALKGC-----  657

Query  1489  YSSNNQSKLEETQKILKSSVTQLGKFIGEAEVEPNF-WFLPFHSACYGKLMGSLSKVVEY  1665
             +S   Q+  +   K ++  V  L + + EA  EP+F W  PF ++CY K+ GSL ++ + 
Sbjct  658   FSRGRQTTTKVKVKAVQEQVALLERCVAEAAGEPHFPWSPPFPASCYHKVAGSLGRMAQL  717

Query  1666  LHFVAQALRFLEQESALMGRLDSDHLSLFRDHVGPSIKSFEEIISLVGSVSVLDKEFEKK  1845
             L+   QA          +   D D    F   V  S++   +++  +  +S      E+ 
Sbjct  718   LYLYTQA------HPTPIPAADEDATQRFHCLVSASLERSADLLLRLSRISSSSSRDEE-  770

Query  1846  KSSIDPELGKLPTSNNITGLSDEEIDNKL--KSFMEDSRQFVDQKdeddddeVMMNSQVA  2019
                 D E G   +S + T   D+E   ++  +SF+                +   +  VA
Sbjct  771   ----DLEAGIRVSSGSDTCCCDDEDAPEMLVRSFLSQQ-------------QQQQDQGVA  813

Query  2020  LSLSALAFCMRGIVRETKEIDKAIKELV  2103
             L+L+++ FCM  + +E  +++  + +L+
Sbjct  814   LALASIGFCMGEMAKEALQLEAYMLDLI  841



>gb|EAY86138.1| hypothetical protein OsI_07511 [Oryza sativa Indica Group]
Length=845

 Score =   163 bits (413),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 126/388 (32%), Positives = 205/388 (53%), Gaps = 37/388 (10%)
 Frame = +1

Query  961   NKRFVASLKYALALGLAVFFGSIYSKPDGFWAGLTVAISYVSAREATFRIANVKAQGTVL  1140
              +R VA+ K + +LGLAV  G ++S   GFW+GL VA +  + RE T+ +A  +A GT L
Sbjct  484   RRRLVAAAKCSFSLGLAVLLGLLFSSDHGFWSGLVVATTMATGREWTWALAIARAHGTAL  543

Query  1141  GSIYGVLGCFVFAKYEELRFISLIPWFIVCS-FLRRSRMY--GPAGGISACIGAVLILGR  1311
             GS+YG L C V  +  ELRF++L+PW I+ + FL+RSR Y    AGG++A +  ++I+GR
Sbjct  544   GSVYGALACLVIDRM-ELRFLALLPWLILTAGFLKRSRAYGPAGAGGVAAAVSGIIIVGR  602

Query  1312  EGFGPPREFAMARIMETFIGLACSITVELLFRP-TRASSLAKIQLSKSLQLLNQCIISID  1488
                 PP  F +AR++ETFIGLAC I  +L+F+P  R S+ A  QL + L  L  C     
Sbjct  603   RYDEPPMAFTVARLVETFIGLACIIVADLVFQPAARPSTKATAQLDRCLAALKGC-----  657

Query  1489  YSSNNQSKLEETQKILKSSVTQLGKFIGEAEVEPNF-WFLPFHSACYGKLMGSLSKVVEY  1665
             +S   Q+  +   K ++  V  L + + EA  EP+F W  PF ++CY K+ GSL ++ + 
Sbjct  658   FSRGRQTTTKVKVKAVQEQVALLERCVAEAAGEPHFPWSPPFPASCYHKVAGSLGRMAQL  717

Query  1666  LHFVAQALRFLEQESALMGRLDSDHLSLFRDHVGPSIKSFEEIISLVGSVSVLDKEFEKK  1845
             L+   QA          +   D D    F   V  S++   +++  +  +S      E+ 
Sbjct  718   LYLYTQA------HPTPIPAADEDATQRFHCLVSASLERSADLLLRLSRISSSSSRDEE-  770

Query  1846  KSSIDPELGKLPTSNNITGLSDEEIDNKL--KSFMEDSRQFVDQKdeddddeVMMNSQVA  2019
                 D E G   +S + T   D+E   ++  +SF+                +   +  VA
Sbjct  771   ----DLEAGIRVSSGSDTCCCDDEDAPEMLVRSFLSQQ-------------QQQQDQGVA  813

Query  2020  LSLSALAFCMRGIVRETKEIDKAIKELV  2103
             L+L+++ FCM  + +E  +++  + +L+
Sbjct  814   LALASIGFCMGEMAKEALQLEAYMLDLI  841



>ref|XP_004152908.1| PREDICTED: uncharacterized protein LOC101209654 [Cucumis sativus]
Length=281

 Score =   154 bits (389),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 106/293 (36%), Positives = 176/293 (60%), Gaps = 16/293 (5%)
 Frame = +1

Query  1252  MYGPAGGISACIGAVLILGREGFGPPREFAMARIMETFIGLACSITVELLFRPTRASSLA  1431
             MYG AGGISA +GA+++LGR  +G P+EFA  R++ETFIG++ S+ V+++F+P RAS L 
Sbjct  1     MYGSAGGISAIVGALVVLGRTNYGSPKEFAFERMIETFIGISISVVVDIIFQPKRASKLV  60

Query  1432  KIQLSKSLQLLNQCIISIDYSSNNQSKLEETQKILKSSVTQLGKFIGEAEVEPNFWF-LP  1608
             KIQL  SLQLL +C I+  +   + + +E+  + L++ V ++ K I EAEVEPNF F  P
Sbjct  61    KIQLILSLQLLQKC-INDSFCYESSTIMEKDLQGLRTQVIEVKKLIDEAEVEPNFLFKHP  119

Query  1609  FHSACYGKLMGSLSKVVEYLHFVAQALRFLEQE--SALMGRLDSDHLSLFRDHVGPSIKS  1782
             FH   + K+  SLSK+V  L    +A+  L++     +  +L+ D    F++ +     +
Sbjct  120   FHGDSHLKMFNSLSKMVGLLALNGEAMNNLKEGLWRKVGEKLEGD-FEKFKEIMANGFVT  178

Query  1783  FEEIISLVGSVSVLDKEFEKKKSSIDPELGKLPTSNNITGLSDEEIDNKLKSFMEDSRQF  1962
             F E +    S+  L  +  K+ +  D E+G+   +  I  + + E +  + SF++   + 
Sbjct  179   FYENLR-SSSLKSLKGDESKEDNCADIEMGE---AQRIEVMDEIEKEKLINSFLQHLGEI  234

Query  1963  VDQKdeddddeVMMNSQVALSLSALAFCMRGIVRETKEIDKAIKELVQWENPS  2121
             V+ KD         + ++ LSLSA+AFC+  +++E +E+ +AI+ELV+WE  S
Sbjct  235   VESKDGK-------SEEIILSLSAMAFCLNSLMKEMEEVGEAIRELVEWEKSS  280



>ref|XP_008350433.1| PREDICTED: uncharacterized protein LOC103413773 [Malus domestica]
Length=347

 Score =   146 bits (368),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 110/303 (36%), Positives = 159/303 (52%), Gaps = 27/303 (9%)
 Frame = +1

Query  502   ESMQWERYPIKFFRPYCKNPGERLQEYETPLRGMEMGL--------------VDNNPPQF  639
             E+M WER  IKF +P   + GERLQE E PLRG E+ L              +  N    
Sbjct  54    ETMVWERPXIKFXKPNYLDSGERLQEIEVPLRGXEIALSSCXSHXVXLIDEXLRRNLQXS  113

Query  640   PVTVLLSSSEVKDSLDS---LTGHISKQVKGRLFDLATVPESNAQNAVKFLHQKLQPVTL  810
              V V L   + K SL S   L     +++  +         +N +N   F       + L
Sbjct  114   EVEVSLRLXQAKYSLPSDATLAPXSYREIFDKPLXAGKPTTNNRENLPAFFXLYCMELLL  173

Query  811   QdlssffflfslklllikpsssilkdkdGSKEQEERFLDKIYSNFVGQMNNKRFVASLKY  990
             ++    +   + +    +PS         S+ Q       ++ N +   + +  + +LK 
Sbjct  174   ENQXIAWNPXNTRKPNQQPS--------DSQNQRRXNFKTVWRNIIP--STRSIIFALKC  223

Query  991   ALALGLAVFFGSIYSKPDGFWAGLTVAISYVSAREATFRIANVKAQGTVLGSIYGVLGCF  1170
             +LAL LA  FG +Y+K +G+W+GL +A S+V+ R+ATF + N + QG  LGSIYG++  F
Sbjct  224   SLALXLAXLFGLLYNKENGYWSGLAIAXSFVTGRQATFTVTNARVQGXALGSIYGIIWLF  283

Query  1171  VFAKYEELRFISLIPWFIVCSFLRRSRMYGPAGGISACIGAVLILGREGFGPPREFAMAR  1350
             +F + E+ + + LIPW   C FLR SRMYG AGGISA I A+LILGRE  GPP EFA AR
Sbjct  284   IFQRLEKFKLLPLIPWIFFCHFLRHSRMYGQAGGISAAIAALLILGRENHGPPSEFAFAR  343

Query  1351  IME  1359
             ++E
Sbjct  344   MIE  346



>ref|XP_002962665.1| hypothetical protein SELMODRAFT_404621 [Selaginella moellendorffii]
 gb|EFJ36128.1| hypothetical protein SELMODRAFT_404621 [Selaginella moellendorffii]
Length=790

 Score =   136 bits (343),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 106/385 (28%), Positives = 185/385 (48%), Gaps = 37/385 (10%)
 Frame = +1

Query  958   NNKRFVASLKYALALGLAVFFGSIYSKPDGFWAGLTVAISYVSAREATFRIANVKAQGTV  1137
             N K  + + K AL++ +AV+ G +Y K  G+W+ +TVA+   + R  TF+  +++ QGT 
Sbjct  419   NKKMVIEAFKIALSMVIAVYLGVLYRKDYGYWSTITVALGLFNHRTGTFKSTSLRLQGTA  478

Query  1138  LGSIYGVLGCFVFAKYEELRFISLIPWFIVCSFLRRSRMYGPAGGISACIGAVLILGREG  1317
             LG++YG L      +       +++PW    SF+R+S++    G  +A   AV+I+GR  
Sbjct  479   LGTVYGYLVALTTHQALLTTIFAILPWLAFTSFMRKSKLLELTGASTAYTSAVIIVGRRR  538

Query  1318  FGPPREFAMARIMETFIGLACSITVELLFRPTRASSLAKIQLSKSLQLLNQC------II  1479
              G  ++FA+ R+    +GL   + VE L    RA+ LA+ +L  +L+ + +C      + 
Sbjct  539   PGIVQDFAVLRMAMAVLGLGAFMAVEALICSRRAARLARRELELNLKKIQECMQVIFDVH  598

Query  1480  SIDYSSNNQSKLEETQK---ILKSSVTQLGKFIGEAEVEPNFWFLPFHSACYGKLMGSLS  1650
             SI+ S   ++ + E +K    ++  V +L +   EA  EP+FW  PFH   Y KL  S S
Sbjct  599   SIECSECFKAAIPEVRKKEQTIRDGVERLRQLTAEARAEPDFWHAPFHDGIYSKLWESQS  658

Query  1651  KVVEYLHFVAQALRFLEQESALMGRLDSDHLSLFRDHVGPSIKSFEEIISLVGSVSVLDK  1830
             ++ E L +++ A      E             LF   V   +K     IS +G    L K
Sbjct  659   RITELLSYLSLATVDFRSEG-----------KLFTGGVTRQLK-----ISQIG----LSK  698

Query  1831  EFEKKKSSIDPELGKLPTSNNITGLSDEEIDNKLKSFMEDSRQFVDQKdeddddeVMMNS  2010
              FE    S+  +  K   + +I    +E       S  +D+     ++   D   V  +S
Sbjct  699   TFECTYQSLRQKRSKAQHTADIENQFEES------SIKDDADTSPPEEIYRDFQLV--HS  750

Query  2011  QVALSLSALAFCMRGIVRETKEIDK  2085
             + AL++ A+ FC   ++++   + K
Sbjct  751   EAALTIGAIGFCCHELLKQATYLKK  775



>ref|XP_002967786.1| hypothetical protein SELMODRAFT_409072 [Selaginella moellendorffii]
 gb|EFJ31133.1| hypothetical protein SELMODRAFT_409072 [Selaginella moellendorffii]
Length=784

 Score =   134 bits (336),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 79/260 (30%), Positives = 138/260 (53%), Gaps = 15/260 (6%)
 Frame = +1

Query  934   YSNFVGQMNNKRFVASLKYALALGLAVFFGSIYSKPDGFWAGLTVAISYVSAREATFRIA  1113
             +S  +   + +RF+ +LK +LA+ L  + GS Y++    W  L + + + + R+ +FR++
Sbjct  405   FSQILKLYDRERFIVALKISLAMVLGSYAGSTYNRYHINWTTLIIGMGFNAHRDGSFRVS  464

Query  1114  NVKAQGTVLGSIYGVLGCFVFAKYEEL-RFISLIPWFIVCSFLRRSRMYGPAGGISACIG  1290
             +++  G VLG+I+G L  F       +   ++L  W +  SF++ +R YGP G +SA IG
Sbjct  465   DLRLHGMVLGTIFGYLVSFYTQSSSPIFSIVALAGWIVFTSFMKHNRFYGPLGNVSALIG  524

Query  1291  AVLILGREGFGPPREFAMARIMETFIGLACSITVELLFRPTRASSLAKIQLSKSLQLLNQ  1470
             A+ ++G     P    AM R+ ++FIG+A  + VE L  P + S LAK  L+  L  L +
Sbjct  525   AIFLVGHRKRVPLDSLAMLRLTQSFIGIAAFVVVEYLVFPRKVSVLAKSTLAAGLAALER  584

Query  1471  CIISIDYSSNN----------QSKLEETQKILK--SSVTQ-LGKFIGEAEVEPNFWFLPF  1611
             C  ++  +  +           S LEE  +  +  SS+ Q LG  + EA +EP  W  PF
Sbjct  585   CAKTVVSAGVDVARCCCERCQGSALEELGQARQEASSIAQKLGVLVQEAALEPC-WTDPF  643

Query  1612  HSACYGKLMGSLSKVVEYLH  1671
                 Y K++ S +++++ L 
Sbjct  644   QEKAYAKILSSHARILDLLQ  663



>ref|XP_008457498.1| PREDICTED: uncharacterized protein LOC103497175 isoform X1 [Cucumis 
melo]
Length=403

 Score =   130 bits (326),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 107/271 (39%), Positives = 158/271 (58%), Gaps = 23/271 (8%)
 Frame = +1

Query  1    ALRGCWYAIYATCLGVCPAILSLWLIGPahlttgtaaaavaitaFIVVLPQNTHVVAKRI  180
            A+RGC   ++AT   VCPA+   W IGPA  +  T A  VA+ + +VVLP +TH++AK+I
Sbjct  71   AVRGCCLVVFATIQTVCPAMFLFWFIGPAKFSLITTAVTVALASVVVVLPSSTHLLAKKI  130

Query  181  ALGQTVLVYA---LAGPRTQPIMHPlrvaastaiavaacvlalllpypslassKVKHNCH  351
            ALGQ V++Y    + G +T P+MHPL VAA+TA+  AA ++A LLP+P LAS +VK    
Sbjct  131  ALGQIVIIYVVGFIGGAQTDPLMHPLHVAATTALGAAASLIATLLPFPRLASLQVKTKSK  190

Query  352  LFAENVSQRLNLLVKAFSAEDNASALSLVSQAKSLNASGAKFLQNIKSKQESMQWERYPI  531
               EN+++RL+L+VKA  AED   A + +S+A  L++S  K L +IK  QES +WE++P 
Sbjct  191  SVVENMTERLSLMVKAILAEDRTMAAASISRAHFLSSSATKLLHSIKLYQESKKWEKFPF  250

Query  532  KFFRPYCKNPGERLQEYETPLRGMEMGL-------VDNNPPQFPVTVLLSSSEVKDSLDS  690
            K  +    +  E+L++ E  L GME+ L       + NNP  +          +K  L++
Sbjct  251  KICKMGWLSNSEKLEDLEMALNGMELALSKIPSYPIQNNPQNY--------QTLKHDLNN  302

Query  691  LTGHISKQVK--GRLF---DLATVPESNAQN  768
            L   I+  +K     F   D  T PE N  +
Sbjct  303  LENQINLSLKQANTYFSPSDSLTFPEVNVDD  333



>ref|XP_002992632.1| hypothetical protein SELMODRAFT_430799 [Selaginella moellendorffii]
 gb|EFJ06334.1| hypothetical protein SELMODRAFT_430799 [Selaginella moellendorffii]
Length=797

 Score =   130 bits (328),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 78/262 (30%), Positives = 138/262 (53%), Gaps = 15/262 (6%)
 Frame = +1

Query  928   KIYSNFVGQMNNKRFVASLKYALALGLAVFFGSIYSKPDGFWAGLTVAISYVSAREATFR  1107
             + +S  +   + +RF+ +LK +LA+ L  + GS Y++    W  L + + + + R+ +FR
Sbjct  403   RFFSQILKLYDRERFIVALKISLAMVLGSYAGSTYNRYHINWTTLIIGMGFNAHRDGSFR  462

Query  1108  IANVKAQGTVLGSIYGVLGCFVFAKYEEL-RFISLIPWFIVCSFLRRSRMYGPAGGISAC  1284
             +++++  G VLG+I+G L  F       +   ++L  W +  SF++ +R YGP G +SA 
Sbjct  463   VSDLRLHGMVLGTIFGYLVSFYTQSSSPIFSIVALAGWIVFTSFMKHNRFYGPLGNVSAL  522

Query  1285  IGAVLILGREGFGPPREFAMARIMETFIGLACSITVELLFRPTRASSLAKIQLSKSLQLL  1464
             IGA+ ++G          AM R+ ++FIG+A  + VE L  P + S LAK  L+  L  L
Sbjct  523   IGAIFLVGHRKRVSLDSLAMLRLTQSFIGIAAFVVVEYLVFPRKVSVLAKSTLAAGLAAL  582

Query  1465  NQCIISIDYSSNN----------QSKLEETQKILK--SSVTQ-LGKFIGEAEVEPNFWFL  1605
              +C  ++  +  +           S LEE  +  +  SS+ Q LG  + EA +EP  W  
Sbjct  583   ERCAKTVVSAGVDVARCCCERCQGSALEELGQARQEASSIAQKLGVLVQEAALEPC-WTD  641

Query  1606  PFHSACYGKLMGSLSKVVEYLH  1671
             PF    Y K++ S +++++ L 
Sbjct  642   PFQEKAYAKILSSHARILDLLQ  663



>ref|XP_002967785.1| hypothetical protein SELMODRAFT_409071 [Selaginella moellendorffii]
 gb|EFJ31132.1| hypothetical protein SELMODRAFT_409071 [Selaginella moellendorffii]
Length=745

 Score =   127 bits (319),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 69/235 (29%), Positives = 127/235 (54%), Gaps = 12/235 (5%)
 Frame = +1

Query  901   KEQEERFLDKIYSNFVGQMNNKRFVASLKYALALGLAVFFGSIYSKPDGFWAGLTVAISY  1080
             K    R+L  +Y       + ++F+ +LK +LA+ L  F G +Y +    W  L + + +
Sbjct  390   KRTISRWLLDLY-------DREQFILALKISLAMVLGAFAGFMYDRSHTIWTTLIIGMGF  442

Query  1081  VSAREATFRIANVKAQGTVLGSIYGVLGCFVFAKYEEL-RFISLIPWFIVCSFLRRSRMY  1257
              + R+A+ RI++++  G VLG++YG L  F   +Y  +   ++L  W +  SF++ SR+Y
Sbjct  443   NARRDASLRISDIRLHGVVLGTLYGYLVSFYTLRYPAMISIVALAAWIVFTSFMKHSRLY  502

Query  1258  GPAGGISACIGAVLILGREGFGPPREFAMARIMETFIGLACSITVELLFRPTR-ASSLAK  1434
             GP G +SA IGA+ ++G     P    AM R+ ETF+G+A  + V+ L  P R +S++A+
Sbjct  503   GPLGNVSALIGAIFLVGHRKRVPLDRLAMLRMAETFLGIAAFVAVDYLILPRRNSSAMAR  562

Query  1435  IQLSKSLQLLNQCI---ISIDYSSNNQSKLEETQKILKSSVTQLGKFIGEAEVEP  1590
              + + S   + +C    +S      + S +E  ++    +V +L   + E ++EP
Sbjct  563   AKATASADKIKRCTRAAVSACADCEDGSTMEGAERDAGLAVAELEALVEEMKMEP  617



>ref|XP_002992633.1| hypothetical protein SELMODRAFT_430800 [Selaginella moellendorffii]
 gb|EFJ06335.1| hypothetical protein SELMODRAFT_430800 [Selaginella moellendorffii]
Length=745

 Score =   126 bits (317),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 69/235 (29%), Positives = 127/235 (54%), Gaps = 12/235 (5%)
 Frame = +1

Query  901   KEQEERFLDKIYSNFVGQMNNKRFVASLKYALALGLAVFFGSIYSKPDGFWAGLTVAISY  1080
             K    R+L  +Y       + ++F+ +LK +LA+ L  F G +Y +    W  L + + +
Sbjct  390   KRTISRWLLDLY-------DREQFILALKISLAMVLGAFAGFMYDRSHTIWTTLIIGMGF  442

Query  1081  VSAREATFRIANVKAQGTVLGSIYGVLGCFVFAKYEEL-RFISLIPWFIVCSFLRRSRMY  1257
              + R+A+ RI++++  G VLG++YG L  F   +Y  +   ++L  W +  SF++ SR+Y
Sbjct  443   NARRDASLRISDIRLHGVVLGTLYGYLVSFYTLRYPAMISIVALAAWIVFTSFMKHSRLY  502

Query  1258  GPAGGISACIGAVLILGREGFGPPREFAMARIMETFIGLACSITVELLFRPTR-ASSLAK  1434
             GP G +SA IGA+ ++G     P    AM R+ ETF+G+A  + V+ L  P R +S++A+
Sbjct  503   GPLGNVSALIGAIFLVGHRKRVPLDRLAMLRMAETFLGIAAFVAVDYLILPRRNSSAMAR  562

Query  1435  IQLSKSLQLLNQCI---ISIDYSSNNQSKLEETQKILKSSVTQLGKFIGEAEVEP  1590
              + + S   + +C    +S      + S +E  ++    +V +L   + E ++EP
Sbjct  563   AKATASADKIKRCTRAAVSACADCEDGSTMEGAERDAGLAVAELEALVEEMKMEP  617



>emb|CDP18497.1| unnamed protein product [Coffea canephora]
Length=251

 Score =   118 bits (295),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 92/158 (58%), Positives = 117/158 (74%), Gaps = 9/158 (6%)
 Frame = +1

Query  4    LRGCWYAIYATCLGVCPAILSLWLIGPahlttgtaaaavaitaFIVVLPQNTHVVAKRIA  183
             RGCW+A+YA+  GVCPAILSLWL+GPA LT  T   AVA++AF+VVLP+N+H+++KRIA
Sbjct  70   FRGCWHALYASVFGVCPAILSLWLMGPAQLTICTTPVAVALSAFVVVLPENSHLISKRIA  129

Query  184  LGQT-VLVYALA---GPRTQPIMHPlrvaastaiavaacvlalllpypslassKVKHNCH  351
            LGQ  V+VY LA   GP+T PI+HP+ V ASTAI   ACVLA LLPYPSLA  +VK    
Sbjct  130  LGQIFVVVYVLAFINGPKTDPILHPIHVLASTAIGAVACVLASLLPYPSLACYEVKKKFK  189

Query  352  LFAENVSQRLNLLVKAFSAEDNASALSLVSQAKSLNAS  465
            L+ +N S+R+ +L+KAFSA+D  SA     QA+  N S
Sbjct  190  LYTKNASERVGVLMKAFSAQDETSA-----QARFCNPS  222



>ref|XP_010529077.1| PREDICTED: uncharacterized protein LOC104806054, partial [Tarenaya 
hassleriana]
Length=222

 Score =   105 bits (263),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 95/155 (61%), Positives = 119/155 (77%), Gaps = 4/155 (3%)
 Frame = +1

Query  4    LRGCWYAIYATCLGVCPAILSLWLIGPahlttgtaaaavaitaFIVVLP-QNTHVVAKRI  180
            LRGCW A+YATC  V PA++SL LIGPAHL+ GT A AVAI   +VVLP ++TH+VAKRI
Sbjct  68   LRGCWLAVYATCQSVGPALISLHLIGPAHLSAGTCAVAVAIAGLVVVLPSESTHLVAKRI  127

Query  181  ALGQTVLVYALA---GPRTQPIMHPlrvaastaiavaacvlalllpypslassKVKHNCH  351
            ALGQ V++Y +A   G  T+P+MHPLRVAASTA+ V ACV ALLLPYP LAS +VK +C 
Sbjct  128  ALGQIVIIYVIAYIKGADTEPLMHPLRVAASTAVGVVACVFALLLPYPRLASREVKQSCK  187

Query  352  LFAENVSQRLNLLVKAFSAEDNASALSLVSQAKSL  456
               +N+S+RL L +KAFSA+D  SA + +SQA+ L
Sbjct  188  EIGQNISERLKLYIKAFSADDATSATTSISQARLL  222



>gb|KHN33399.1| hypothetical protein glysoja_005441 [Glycine soja]
Length=325

 Score = 98.6 bits (244),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 67/170 (39%), Positives = 96/170 (56%), Gaps = 15/170 (9%)
 Frame = +1

Query  1654  VVEYLHFVAQALRFLEQESALMGRLDSDHLSLFRDHVG-------PSIKSFEEIISLVGS  1812
             +V+ + F   AL+FL+QE    G  + + + +    VG        SIKS  EI     S
Sbjct  161   LVDLMWFGELALKFLQQEFQRCGACEKEDMKMLEGEVGRFKELICSSIKSLAEI----SS  216

Query  1813  VSVLDKEFEKKKSSIDPELGKLPTSNN---ITGLSDEEIDNKLKSFMEDSRQFVDQKded  1983
              + + KE EK  +S D E GK    NN   ++GL ++ I+  + SF++ SR  VD    D
Sbjct  217   TNFVAKEVEKNNNSCDLEAGKSNGGNNTCMVSGLGEDGIEQTIGSFLQLSRIVVDNLYGD  276

Query  1984  dddeVMMNSQVALSLSALAFCMRGIVRETKEIDKAIKELVQWENPSSPVN  2133
             + ++  M SQV LSLSA+ F +   +R T EI++AIKELVQWENPSS +N
Sbjct  277   EGEK-EMKSQVVLSLSAVGFSLCACIRGTMEIEEAIKELVQWENPSSEIN  325



>ref|XP_002980426.1| hypothetical protein SELMODRAFT_419949 [Selaginella moellendorffii]
 gb|EFJ18686.1| hypothetical protein SELMODRAFT_419949 [Selaginella moellendorffii]
Length=728

 Score = 93.2 bits (230),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 85/384 (22%), Positives = 154/384 (40%), Gaps = 97/384 (25%)
 Frame = +1

Query  958   NNKRFVASLKYALALGLAVFFGSIYSKPDGFWAGLTVAISYVSAREATFRIANVKAQGTV  1137
             N K  + + K AL++ +AV+ G +Y K  G+W+ +TVA+   + R  TF+  +++ QGT 
Sbjct  419   NKKMVIEAFKIALSMVIAVYLGVLYRKDYGYWSTITVALGLFNHRTGTFKSTSLRLQGTA  478

Query  1138  LGSIYGVLGCFVFAKYEELRFISLIPWFIVCSFLRRSRMYGPAGGISACIGAVLILGREG  1317
             LG++YG L      +       +++PW    SF+R+                        
Sbjct  479   LGTVYGYLVALTTHQALLTTIFAILPWLAFTSFMRK------------------------  514

Query  1318  FGPPREFAMARIMETFIGLACSITVELLFRPTRASSLAKIQLSKSLQLLNQCIISIDYSS  1497
                      ++++E   G + + T  ++F                       + SI+ S 
Sbjct  515   ---------SKLLE-LTGASTAYTSAVIFD----------------------VHSIECSE  542

Query  1498  NNQSKLEETQK---ILKSSVTQLGKFIGEAEVEPNFWFLPFHSACYGKLMGSLSKVVEYL  1668
               ++ + E +K    ++  V +L +   EA  EP+FW  PFH   Y KL  S S++ E L
Sbjct  543   CFKAAIPEVRKKEQTIRDGVERLRQLTAEARAEPDFWHAPFHDGIYSKLWESQSRITELL  602

Query  1669  HFVAQALRFLEQESALMGRLDSDHLSLFRDHVGPSIKSFEEIISLVGSVSVLDKEFEKKK  1848
              +++ A      E             LF   V   +K     IS +G    L K FE   
Sbjct  603   SYLSLATVDFRSEG-----------KLFTGGVTRQLK-----ISQIG----LSKTFECTY  642

Query  1849  SSIDPELGKLPTSNNITGLSDE-----EIDNKLKSFMEDSRQFVDQKdeddddeVMMNSQ  2013
              S+  +  K+  + +I    +E     ++D      +    Q V             +S+
Sbjct  643   QSLRQKRSKVQHTADIENQFEESSIKDDVDTSTPEEIYGDFQLV-------------HSE  689

Query  2014  VALSLSALAFCMRGIVRETKEIDK  2085
              AL++ A+ FC   ++++   + K
Sbjct  690   AALTIGAIGFCCHELLKQATYLKK  713



>ref|XP_007027059.1| Uncharacterized protein TCM_021963 [Theobroma cacao]
 gb|EOY07561.1| Uncharacterized protein TCM_021963 [Theobroma cacao]
Length=276

 Score = 78.2 bits (191),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 45/85 (53%), Positives = 62/85 (73%), Gaps = 3/85 (4%)
 Frame = +1

Query  1    ALRGCWYAIYATCLGVCPAILSLWLIGPahlttgtaaaavaitaFIVVLPQNTHVVAKRI  180
            ALRGCW+ +YA+   + P++LSLWLIGPA  + G AA AVA+++F + LP +TH++AKRI
Sbjct  159  ALRGCWHVLYASIQVLLPSMLSLWLIGPARFSHGLAAMAVALSSFAIALPDSTHLMAKRI  218

Query  181  ALGQTVLVYALA---GPRTQPIMHP  246
            A GQT++VY  A   G  T  +MHP
Sbjct  219  AFGQTLIVYVDAVIQGAETGVLMHP  243



>gb|EWM22996.1| p-hydroxybenzoic acid efflux pump subunit aaeb, partial [Nannochloropsis 
gaditana]
Length=549

 Score = 77.4 bits (189),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 71/264 (27%), Positives = 116/264 (44%), Gaps = 25/264 (9%)
 Frame = +1

Query  982   LKYALALGLAVFFGSIYSKPDGFWAGLTVAISYVSAREATFRIANVKAQGTVLGSIYGVL  1161
             LK ALA  L      I + P   W  + V  S  S   ++F+    + QGTVLG ++G++
Sbjct  111   LKVALAYVLVTLTMLILTGPRTPWGLIAVCQSLSSHPGSSFKAGLQRIQGTVLGGMFGIV  170

Query  1162  GCFVFAKYEELRFI-SLIPWFIVCSFLRRSRMYGPAGGISACIGAVL----ILGREGFGP  1326
                       L  + SL  W   C+F R S +YG    ++A    ++    ILG  G   
Sbjct  171   VLNWLQWDSNLAVVLSLTGWVFFCAFNRLSPLYGEVALMAAVTAPIILMGPILGEAG---  227

Query  1327  PREFAMARIMETFIGLACSITVELLFRPTRASSLAKIQLSKSLQLLNQCI-----ISIDY  1491
                 AM RI +T +G    + V+ +F P RA    + +L  SL L          I +  
Sbjct  228   ----AMIRIQQTILGSFIYVFVDNVFWPVRAKLDLRRELLTSLGLFRDLWGRTFSIFLQK  283

Query  1492  SSNNQSKLEETQKI---LKSSVTQLGKFIGEAEVEPNFWFLPFHSACYGKLMGSLSKVVE  1662
             + +    ++  Q++   L +S      +I  A  EP  W  PFH+  Y K+  +L++V  
Sbjct  284   TDDPVHAIQTAQRVHAALTASCAMQETYITLAVDEPELWHKPFHAQAYRKVAKALARVSL  343

Query  1663  YLHFVAQA-----LRFLEQESALM  1719
             ++  + +A     L   E++ AL+
Sbjct  344   FMAMLIRASQNFPLEISERDRALL  367



>gb|KHN02427.1| hypothetical protein glysoja_002451 [Glycine soja]
Length=176

 Score = 72.4 bits (176),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 46/157 (29%), Positives = 76/157 (48%), Gaps = 43/157 (27%)
 Frame = +1

Query  136  IVVLPQNTHVVAKRIALGQTVLVYA---LAGPRTQPIMHPlrvaastaiavaacvlalll  306
            +V LP++TH+V K++++GQ V V+    +   RT   +HP+ V                 
Sbjct  42   VVGLPESTHLVTKQLSVGQLVKVFVSTVVDSGRTGVAVHPVHV-----------------  84

Query  307  pypslassKVKHNCHLFAENVSQRLNLLVKAFSAEDNASALSLVSQAKSLNASGAKFLQN  486
                           LF  N+        +  SA DN++A   ++Q KSL+ +GAK LQ+
Sbjct  85   ---------------LFDCNI--------ETISASDNSTAAGFIAQVKSLSTTGAKLLQS  121

Query  487  IKSKQESMQWERYPIKFFRPYCKNPGERLQEYETPLR  597
            I+SKQ+ M WE    + F  +  +P ++LQ+ E  +R
Sbjct  122  IRSKQDGMHWEWPQTRIFHSHWIDPEDKLQDLELTIR  158



>gb|EAY86136.1| hypothetical protein OsI_07509 [Oryza sativa Indica Group]
Length=765

 Score = 75.5 bits (184),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 67/276 (24%), Positives = 125/276 (45%), Gaps = 36/276 (13%)
 Frame = +1

Query  1285  IGAVLILGREGFGPPREFAMARIMETFIGLACSITVELLFRPT-RASSLAKIQLSKSLQL  1461
             +   +  GRE        A+AR   T +GLAC I  +L+F+P  R S+ A  QL + L  
Sbjct  519   VATTMATGREWTW---ALAIARAHGTALGLACIIVADLVFQPAARPSTKATAQLDRCLAA  575

Query  1462  LNQCIISIDYSSNNQSKLEETQKILKSSVTQLGKFIGEAEVEPNF-WFLPFHSACYGKLM  1638
             L  C     +S   Q+  +   K ++  V  L + + EA  EP+F W  PF ++CY K+ 
Sbjct  576   LKGC-----FSRGRQTTTKVKVKAVQEQVALLERCVAEAAGEPHFPWSPPFPASCYHKVA  630

Query  1639  GSLSKVVEYLHFVAQALRFLEQESALMGRLDSDHLSLFRDHVGPSIKSFEEIISLVGSVS  1818
             GSL ++ + L+   QA          +   D D    F   V  S++   +++  +  +S
Sbjct  631   GSLGRMAQLLYLYTQA------HPTPIPAADEDATQRFHCLVSASLERSADLLLRLSRIS  684

Query  1819  VLDKEFEKKKSSIDPELGKLPTSNNITGLSDEEIDNKL-KSFMEDSRQFVDQKdedddde  1995
                ++ E  ++ I     ++ + ++     DE+    L +SF+                +
Sbjct  685   SSSRDEEDLEAGI-----RVSSGSDTCCCDDEDAPEMLVRSFLS--------------QQ  725

Query  1996  VMMNSQVALSLSALAFCMRGIVRETKEIDKAIKELV  2103
                +  VAL+L+++ FCM  + +E  +++  + +L+
Sbjct  726   QQQDQGVALALASIGFCMGEMAKEALQLEAYMLDLI  761



>gb|KHG18122.1| Myosin-binding C, fast-type [Gossypium arboreum]
Length=209

 Score = 62.0 bits (149),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 41/90 (46%), Positives = 47/90 (52%), Gaps = 0/90 (0%)
 Frame = -3

Query  1253  IRLRRRKLQTMNQGMREMNRSSSYFAKTKHPNTP*IDPSTVP*ALTLAILKVASLAET*L  1074
             +RL  RKL  M QG R  N  S  F K K  + P  DP  VP A  LA + VA  + T L
Sbjct  1     MRLCLRKLVKMIQGSRSKNLKSVSFLKIKQHSIPYTDPMAVPCARALATINVACRSVTKL  60

Query  1073  MATVSPAQNPSGLL*IDPKNTASPSASAYF  984
             MA VSP Q P  LL I P +TA P  S + 
Sbjct  61    MAIVSPDQYPFSLLYIKPNSTARPRESEHL  90



>ref|XP_005822282.1| hypothetical protein GUITHDRAFT_146606 [Guillardia theta CCMP2712]
 gb|EKX35302.1| hypothetical protein GUITHDRAFT_146606 [Guillardia theta CCMP2712]
Length=1003

 Score = 63.9 bits (154),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 53/196 (27%), Positives = 91/196 (46%), Gaps = 14/196 (7%)
 Frame = +1

Query  925   DKIYSNFVGQMNNKRFVASLKYALALGLAVFFGSIYSKPDGFWAGLTVAISYVSARE---  1095
             D+I S ++   +  R +   K  LA+ LA+  G IY    G WA   VA+  V  R    
Sbjct  484   DRIRSMWI-DFSRSRILYVFKLTLAINLALAAG-IYCTGSGMWAA--VAVCMVGPRSLME  539

Query  1096  --ATFRIANVKAQGTVLGSIYGVLGCFVF--AKYEELRFISLIPWFIVCSFLRRSRMYGP  1263
                +FR A ++  GT  G+I+  +   +      E   F+ ++PW  V  +LR +     
Sbjct  540   VGGSFRAAKLRLSGTGGGAIFAAVVMILVQSVTLEIGHFLLILPWVFVMGYLRHNVSIA-  598

Query  1264  AGGISACIGAVLILGRE--GFGPPREFAMARIMETFIGLACSITVELLFRPTRASSLAKI  1437
              G   A +   L++      +     +   RI + F+G+   I +E+L +P RA S+ ++
Sbjct  599   YGAFIAQVTPFLMMQNSLISYTSVESWVYRRISQNFLGVIIYIAIEVLIKPVRALSIFEV  658

Query  1438  QLSKSLQLLNQCIISI  1485
             QL K+L+ +   I +I
Sbjct  659   QLGKNLRNIASAIDTI  674



>ref|XP_002508823.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO70081.1| predicted protein [Micromonas sp. RCC299]
Length=946

 Score = 63.5 bits (153),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 70/284 (25%), Positives = 122/284 (43%), Gaps = 36/284 (13%)
 Frame = +1

Query  940   NFVGQMNNKRFVASLKYALALGLAVFFGSIYSKPDGFWAGLTVAISYVSAREA-----TF  1104
             NF  + N+ + + ++K + A  +A   G I S  +G WA L  A+S V  RE+     +F
Sbjct  469   NF--RANSDQVLYAMKLSTACAIAAIVGWIVSD-NGSWAAL--AVSMVGTRESHAVGGSF  523

Query  1105  RIANVKAQGTVLGSI--YGVLGCFVFAKYEEL----RFISLIPWFIVCSFLRRSRMYGPA  1266
               A ++ QGT+ G++  Y ++ C V  ++E      R I L  +  +C+FLR +  Y  A
Sbjct  524   NAALLRMQGTIFGAMFAYTIMSC-VQGEHESWAGGARLILLAVFNFLCTFLRLNAEYSYA  582

Query  1267  GGISACIGAVLILG---REGFGPPREFAMARIMETFIGLACSITVELLFRPTRASSLAKI  1437
             G ++A    V+ LG          R +A  RI +  +GL   + +E++  PT A   A+ 
Sbjct  583   GVVAAFTAYVVALGIPDGASTSEARAYAHLRIEQNLLGLVILVFIEVVLLPTFAHDAARR  642

Query  1438  QLSKSLQLL-------------NQCIISIDYSSNNQSKLEETQKILKSSVTQLGKFIGEA  1578
               S++                   CI+  D ++ +     +    L+  +  L   + +A
Sbjct  643   AASEATAAAEHAAEVIYDATVGTDCIMCRDRAAKDAGGALDD---LRDKLATLNTLLVQA  699

Query  1579  EVEPNFWFLPFHSACYGKLMGSLSKVVEYLHFVAQALRFLEQES  1710
               EP+ W   F    Y ++      V   L  +  AL  +   S
Sbjct  700   AAEPHLWSPKFPLEPYQRIATETESVRRVLGLMRAALTAMAHGS  743



>gb|EWM30522.1| hypothetical protein Naga_100013g27 [Nannochloropsis gaditana]
Length=1291

 Score = 63.2 bits (152),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 52/175 (30%), Positives = 79/175 (45%), Gaps = 14/175 (8%)
 Frame = +1

Query  979   SLKYALALGLAVFFGSIYSKPDG-------FWAGLTVAISYVSAREATFRIANVKAQGTV  1137
             + +  L + LA+   SI    D         W  +TVA +  S   + F+    + QGTV
Sbjct  746   AWRQPLKVALAILLASIVVLADDKHLGLQTIWCPITVAQTMSSHPSSAFKSGANRVQGTV  805

Query  1138  LGSIYG--VLGCFVFAKYEELRFISLIPWFIVCSFLRRSRMYGPAGGISACIGAVLILGR  1311
             LG++ G  V           + FI L  W  VC+F R SR YG A   +     ++++G 
Sbjct  806   LGAVMGMAVTTWAPVVNKVAIVFI-LTAWVFVCAFSRGSRTYGEAATSAGLTAPIIVIG-  863

Query  1312  EGFGPPREFAMARIMETFIGLACSITVELLFRPTRASSLAKIQLSKSLQLL-NQC  1473
                G     A+ RI +  +G    + V+ L  PTRA  L + QL +S++ L N C
Sbjct  864   PVVG--SSGAVVRISQVILGTVIYVGVDNLIFPTRAKILLRSQLCESVEKLGNLC  916



>ref|XP_002308143.2| hypothetical protein POPTR_0006s08190g [Populus trichocarpa]
 gb|EEE91666.2| hypothetical protein POPTR_0006s08190g [Populus trichocarpa]
Length=203

 Score = 58.2 bits (139),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 42/85 (49%), Positives = 57/85 (67%), Gaps = 4/85 (5%)
 Frame = +1

Query  4    LRGCWYAIYATCLGVCPAILSLWLIGPahlt-tgtaaaavaitaFIVVLPQNTHVVAKRI  180
            LRGCW+A+YAT   + P IL+  +IGPA  +  G AA AVAIT F+V LP++T ++AKRI
Sbjct  69   LRGCWHALYATVQVMIPCILTFRVIGPARFSNIGLAAVAVAITTFMVALPESTPLMAKRI  128

Query  181  ALGQTVLVY---ALAGPRTQPIMHP  246
            A GQ V+V+   A+ G     + HP
Sbjct  129  AFGQAVIVFVGAAIHGAEEGVVTHP  153



>ref|WP_017243767.1| hypothetical protein [Vibrio breoganii]
Length=456

 Score = 60.5 bits (145),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 64/195 (33%), Positives = 97/195 (50%), Gaps = 25/195 (13%)
 Frame = +1

Query  979   SLKYALALG----LAVFFGSIYSKPDGFWAGLTVAISYVSAREATFRIANVKAQGTVLGS  1146
             S+K ALA+     LA++FG  + KP  +WAG+TVA+  V+A E T+  +  K +  ++G+
Sbjct  13    SIKVALAISVSIVLALWFG--WEKP--YWAGITVAV--VAANE-TYSHSVRKGRNRLMGT  65

Query  1147  IYGVLGCFV---FAKYEELRFISLIPWFI-VCSFLRRSRMYGPAGGISACIGAVLILGRE  1314
             + G+    V   F   + L F+ L   F+ VC FL   R YG A  I+A + A LI    
Sbjct  66    LLGISCAMVLLGFFPQQHLMFVLLYGTFLAVCVFLASHRKYGDAFTIAATVCA-LIAAMG  124

Query  1315  GFGPPREF--AMARIMETFIGLACSITVELLFRPTR-------ASSLAKIQLSKSLQLLN  1467
              F     F  A+ RI ET +GL     V  L  PT+          +A   L++ ++ L 
Sbjct  125   SFDGATTFHVAILRIQETLLGLLVFSAVFRLLWPTKIEDGFYEVVGVAAGSLTQRIEDLA  184

Query  1468  QCIISIDYSSNNQSK  1512
                ++ID + N Q K
Sbjct  185   TGKLTIDSTQNKQQK  199



>ref|WP_020000881.1| MULTISPECIES: hypothetical protein [Desulfovibrio]
Length=349

 Score = 58.2 bits (139),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 66/324 (20%), Positives = 133/324 (41%), Gaps = 21/324 (6%)
 Frame = +1

Query  943   FVGQMNNKRFVA-SLKYALALGLAVFFGSIYSKPDGFWAGLTVAISYVSAREATFRIANV  1119
             F G      +V   +K ALA  L+ F  S+     GFWA ++  I       A+ ++   
Sbjct  3     FFGSRQRAEYVKYGIKTALAALLSYFVASLTDPNLGFWAVISAVIVMQRNVAASMQMCGY  62

Query  1120  KAQGTVLGSIYGVLGCFVFAKYEELRFISLIPWFIVCSFLRRSRMYGPAGGISACIGAVL  1299
             +  GT +G+  G+   ++    +  R    +    +C++L+R   Y     ++A    ++
Sbjct  63    RLVGTAIGATMGMTALYIVPPTDHGRLAGFLVTVGICAYLKR---YTNRFSMAAITVTIV  119

Query  1300  ILGREGFGPPREFAMARIMETFIGLACSITVELLFRPTRASSLAKIQLSKSLQLLNQCII  1479
             +L  +  G    +A+ R+ E  IG+  +  V L   P  AS   K +L +      +C +
Sbjct  120   MLAPQASGDYIHYALFRVAEISIGVCSTFIVALFVWPHHASCELKERLQEQ---FTRCAV  176

Query  1480  SIDYSSNN--QSKLEETQKILKSSVTQL--GKFIGEAEVEPNFWFLPFHSACYGKLMGSL  1647
               +   N+    K + ++ +L     ++   + +    +     F+   SA     + +L
Sbjct  177   KYESIVNSFLTLKCDSSKGMLADLEDEIHYNRELFRGYLRHERLFVDDDSAMLDIKIETL  236

Query  1648  SKVVEYLHFVAQALRFLEQESALMGRLDSDHLSLFRDHVGPSIKSFEEIISLVGSVSVLD  1827
              + VE+LH +   +R L          DS++  +    +   +K  ++++  VG   + D
Sbjct  237   VQCVEHLHAMLHVVRELN---------DSEYCIIMEAEIRKVVKESQDVMRAVGRNVIPD  287

Query  1828  -KEFEKKKSSIDPELGKLPTSNNI  1896
              ++ E+   S D  L  L     I
Sbjct  288   TRKLEQALYSADKRLETLRADGMI  311



>ref|WP_015905171.1| hypothetical protein [Desulfobacterium autotrophicum]
 ref|YP_002604573.1| hypothetical protein HRM2_33340 [Desulfobacterium autotrophicum 
HRM2]
 gb|ACN16409.1| conserved hypothetical protein [Desulfobacterium autotrophicum 
HRM2]
Length=356

 Score = 57.8 bits (138),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 47/175 (27%), Positives = 79/175 (45%), Gaps = 17/175 (10%)
 Frame = +1

Query  967   RFVASLKYALALGLAVFFGSIYSKPDGFWAGLTVAISYVSAREATFRIANVKAQGTVLGS  1146
              ++  +K ALA GL +   + Y    G+WA +T  I        + ++   +  GT++G+
Sbjct  14    HWIHGIKTALAAGLCLGITTFYHLDFGYWAVITTVIVMQVYVADSIQMCLYRFSGTIIGA  73

Query  1147  IYGVLGCFVFAKYEELRFISLIPWFIVCSFLR----RSRMYGPAGGISACIGAVLILGRE  1314
             + G+    +F       F +++    + SF+     R RM        A I AV+I+   
Sbjct  74    VLGIASILIFPDTPLYHFPAVMVPVGILSFMTHYNTRYRM--------AAITAVIII-MT  124

Query  1315  GFGPPRE--FAMARIMETFIGLACSITVELLFRPTRASSLAKIQLSKSLQLLNQC  1473
             G   P +  FA+ RI+E  IGL C+  V +L  P R   + +  L +  Q L  C
Sbjct  125   GISAPNQVSFALFRIIEITIGLFCAFLVSVLVFPVRLVDVLRENLRQ--QTLECC  177



>ref|XP_006846139.1| hypothetical protein AMTR_s00012p00168110 [Amborella trichopoda]
 gb|ERN07814.1| hypothetical protein AMTR_s00012p00168110 [Amborella trichopoda]
Length=179

 Score = 55.5 bits (132),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 35/72 (49%), Positives = 48/72 (67%), Gaps = 0/72 (0%)
 Frame = +1

Query  1    ALRGCWYAIYATCLGVCPAILSLWLIGPahlttgtaaaavaitaFIVVLPQNTHVVAKRI  180
            AL+G   A+  T  GV PA+  LW +GP  LT  T+  AVA++AF+V LP  TH++AKR+
Sbjct  64   ALQGAAAAVCGTLQGVGPAMACLWAVGPGKLTVWTSTLAVALSAFVVALPNTTHIIAKRV  123

Query  181  ALGQTVLVYALA  216
            A  Q V+VY +A
Sbjct  124  AFAQMVIVYVVA  135



>ref|WP_031482228.1| hypothetical protein [Desulfovibrio frigidus]
Length=354

 Score = 57.0 bits (136),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 32/126 (25%), Positives = 59/126 (47%), Gaps = 3/126 (2%)
 Frame = +1

Query  1045  GFWAGLTVAISYVSAREATFRIANVKAQGTVLGSIYGVLGCFVFAKYEELRFISLIPWFI  1224
             G+WA L+  I        + R+   +  GT +G+  G+L   +F +   +  +SL     
Sbjct  39    GYWAALSAVIVMQINIADSIRMCWYRFSGTAIGAFMGILCIVIFPQTPSMILLSLFLSVA  98

Query  1225  VCSFLRRSRMYGPAGGISACIGAVLILGREGFGPPREFAMARIMETFIGLACSITVELLF  1404
              C+F+ +   +     I+  I  +  LG++      EF + R++E  IG+AC+    ++ 
Sbjct  99    FCAFMTKYNEFYRMAAITVTIITLASLGQDN---RIEFGLYRVLEISIGVACAFVTSIMI  155

Query  1405  RPTRAS  1422
              P RAS
Sbjct  156   FPMRAS  161



>ref|XP_006829045.1| hypothetical protein AMTR_s00001p00255730 [Amborella trichopoda]
 gb|ERM96461.1| hypothetical protein AMTR_s00001p00255730 [Amborella trichopoda]
Length=83

 Score = 53.5 bits (127),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 31/60 (52%), Positives = 37/60 (62%), Gaps = 4/60 (7%)
 Frame = +1

Query  1252  MYGPAGGISACIGAVLILGREGFGPPREFAMARIMETFIGLACSITVELLFRPTRASSLA  1431
             MYG AG +SA +GAV+IL R       EFA+ RI ETFI     + VELL   TRA+ LA
Sbjct  1     MYGYAGSLSALLGAVIILRRRNLCASPEFAIVRITETFI----RVFVELLIETTRATRLA  56



>emb|CCB92218.1| putative membrane protein [Waddlia chondrophila 2032/99]
Length=378

 Score = 56.6 bits (135),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 49/226 (22%), Positives = 106/226 (47%), Gaps = 20/226 (9%)
 Frame = +1

Query  955   MNNKRFVASLKYALALGLAVFFGSIYSK----PD----GFWAGLTVAISYVSAREATFRI  1110
             MN      ++K  +A  ++++ G  ++K    PD    G W  L+  +   +    T+R 
Sbjct  23    MNRLELQIAMKAGVAASISLYLGVAFAKWLGRPDTLISGTWCVLSTFVVMQAHLGGTYRA  82

Query  1111  ANVKAQGTVLGSIYGVLGCFVFAKYEELRFISLIPWFIVCSFLRRSRMYGPAGGISACIG  1290
             A ++  G ++GS  G L   +F        IS++   + CS L+            AC+ 
Sbjct  83    AWIRFLGVLIGSFTGGLFTSLFGSNAITLGISVVLTVLSCSLLQIKDSIRI-----ACMS  137

Query  1291  AVLILGREGFGP---PREFAMARIMETFIGLACSITVELLFRPTRASSLAKIQLSKSLQL  1461
               +++   G  P   P +F   R +++ +G+  ++ +     PT+A+   ++ ++K++Q+
Sbjct  138   VSIVMILWGMQPSISPWQFGWYRFLDSTLGILIAVIISHTLWPTKATQKLRLSVAKTVQM  197

Query  1462  LN---QCIISIDYSSNN-QSKLEETQKILKSSVTQLGKFIGEAEVE  1587
             +N   Q  +S+   S N Q+  +   + ++ S+ Q   F+ ++E+E
Sbjct  198   INRLFQMELSLKPPSGNFQTIHKRLTREIEQSIAQAQDFLVDSELE  243



>ref|WP_013182808.1| hypothetical protein [Waddlia chondrophila]
 ref|YP_003710112.1| hypothetical protein wcw_1765 [Waddlia chondrophila WSU 86-1044]
 gb|ADI39106.1| putative membrane protein [Waddlia chondrophila WSU 86-1044]
Length=378

 Score = 56.6 bits (135),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 49/226 (22%), Positives = 106/226 (47%), Gaps = 20/226 (9%)
 Frame = +1

Query  955   MNNKRFVASLKYALALGLAVFFGSIYSK----PD----GFWAGLTVAISYVSAREATFRI  1110
             MN      ++K  +A  ++++ G  ++K    PD    G W  L+  +   +    T+R 
Sbjct  23    MNRLELQIAMKAGVAASISLYLGVAFAKWLGRPDTLISGTWCVLSTFVVMQAHLGGTYRA  82

Query  1111  ANVKAQGTVLGSIYGVLGCFVFAKYEELRFISLIPWFIVCSFLRRSRMYGPAGGISACIG  1290
             A ++  G ++GS  G L   +F        IS++   + CS L+            AC+ 
Sbjct  83    AWIRFLGVLIGSFTGGLFTSLFGSNAITLGISVVLTVLSCSLLQIKDSIRI-----ACMS  137

Query  1291  AVLILGREGFGP---PREFAMARIMETFIGLACSITVELLFRPTRASSLAKIQLSKSLQL  1461
               +++   G  P   P +F   R +++ +G+  ++ +     PT+A+   ++ ++K++Q+
Sbjct  138   VSIVMILWGMQPSISPWQFGWYRFLDSTLGILIAVIISHTLWPTKATQKLRLSVAKTVQM  197

Query  1462  LN---QCIISIDYSSNN-QSKLEETQKILKSSVTQLGKFIGEAEVE  1587
             +N   Q  +S+   S N Q+  +   + ++ S+ Q   F+ ++E+E
Sbjct  198   INRLFQMELSLKPPSGNFQTIHKRLTREIEQSIAQAQDFLVDSELE  243



>ref|WP_010758751.1| hypothetical protein [Enterococcus pallens]
 gb|EOH91242.1| hypothetical protein UAU_03781 [Enterococcus pallens ATCC BAA-351]
 gb|EOU11390.1| hypothetical protein I588_05059 [Enterococcus pallens ATCC BAA-351]
Length=193

 Score = 53.9 bits (128),  Expect = 8e-05, Method: Composition-based stats.
 Identities = 48/191 (25%), Positives = 91/191 (48%), Gaps = 10/191 (5%)
 Frame = +1

Query  970   FVASLKYALALGLAVFFGSIYSKPDGFWAGLT-VAISYVSAREATFRIANVKAQGTVLGS  1146
              + ++K A+++ L +       +     A L+ VA    S    T +       G ++G 
Sbjct  9     LIRAVKIAVSVALCILIFHFSDRGAPIAASLSAVAPLMTSDLHTTIKTGKNTVAGNIIGG  68

Query  1147  IYGVLGCFVFAKYEELRF---ISLIPWFIVCSFLRRSRMYGPAGGISACIGAVLILGREG  1317
                +L  F+  K +   F   I L+P+FI+   L    ++  +G + A    +LI     
Sbjct  69    TMALLYFFI-TKIDHANFDIEIFLLPFFIILVVLVCELLHEHSGIVPAISATILISLSVS  127

Query  1318  FGPPREFAMARIMETFIGLACSITVELLFRPTRASSLAKIQLSKSLQLLNQCIISIDYSS  1497
             +G    FA++RI++TFIG   ++ +  LF+PT++   A I+  +  ++L+Q    +D+ S
Sbjct  128   YGESFGFALSRIIDTFIGTLIAVGINTLFQPTKSEIRALIR--EDQKILSQKQTELDHLS  185

Query  1498  NNQSKLEETQK  1530
                 +LEE +K
Sbjct  186   Q---ELEEHKK  193



>ref|WP_012978035.1| hypothetical protein [Azospirillum lipoferum]
 ref|YP_003452775.1| hypothetical protein AZL_d04050 [Azospirillum sp. B510]
 dbj|BAI76231.1| hypothetical protein AZL_d04050 [Azospirillum sp. B510]
Length=659

 Score = 56.2 bits (134),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 47/170 (28%), Positives = 76/170 (45%), Gaps = 18/170 (11%)
 Frame = +1

Query  919   FLDKIYSNFVGQMNNKRFVASLKYALALGLAVFFGSIYSKPDGFWAGLTVAISYVSAREA  1098
             FLD +  N   ++     VAS+       LA+   +  S  + +WA + V +    AR  
Sbjct  6     FLDPVTRNLAIRLT----VASI-------LAMALATALSLQNPWWAAMAVWMVGQPARGL  54

Query  1099  TFRIANVKAQGTVLGSIYGVLGCFVFAKYEELRFISLIPWFIVC----SFLRRSRMYGPA  1266
                 +  +  GTVLG+  GV     +        + L+ W  VC    + +R  R YG A
Sbjct  55    LLERSLAQCLGTVLGAAAGVALVLPWPGTPAASVLGLVAWIAVCCGFANIMRHQRAYGAA  114

Query  1267  -GGISACIGAVLILGREGFGPPREFAMARIMETFIGLACSITVELLFRPT  1413
               G+++ +   L LG E    P  FA AR+++T IG+  ++ V   F P+
Sbjct  115   LCGLTSAVVVSLTLGTEV--DPLGFAAARVIDTLIGIGSALLVAFAFGPS  162



>ref|WP_011793147.1| hypothetical protein [Desulfovibrio vulgaris]
 ref|YP_968322.1| hypothetical protein Dvul_2884 [Desulfovibrio vulgaris DP4]
 gb|ABM29895.1| conserved hypothetical protein [Desulfovibrio vulgaris DP4]
Length=360

 Score = 55.1 bits (131),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 39/165 (24%), Positives = 76/165 (46%), Gaps = 7/165 (4%)
 Frame = +1

Query  976   ASLKYALALGLAVFFGSIYSK----PDGFWAGLTVAISYVSAREATFRIANVKAQGTVLG  1143
             AS+++ +  GLA     + ++      G+WA +T  I   ++   +  ++  +  GT++G
Sbjct  21    ASVRHGIKTGLAALLSYLVTEWLHLDFGYWAPITAVIVMQTSVAESIEMSLYRTVGTMIG  80

Query  1144  SIYGVLGCFVFAKYEELRFISLIPWFIVCSFLRRSRMYGPAGGISACIGAVLILGREGFG  1323
             ++ GV+   V     E     L     +C+FL R   +     ++A    ++IL   G  
Sbjct  81    ALMGVVSILVLPDTFEGNGAGLFITTGLCAFLTR---WDARYRMAAITVTIVILASVGQP  137

Query  1324  PPREFAMARIMETFIGLACSITVELLFRPTRASSLAKIQLSKSLQ  1458
                 F + R++E  +G+ C++ V L   P RA    +  L++ LQ
Sbjct  138   DRMHFGLFRVLEILVGVVCAVLVSLTLWPLRAGEALRADLARQLQ  182



>ref|XP_001732153.1| hypothetical protein MGL_0746 [Malassezia globosa CBS 7966]
 gb|EDP44939.1| hypothetical protein MGL_0746 [Malassezia globosa CBS 7966]
Length=920

 Score = 54.7 bits (130),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 53/202 (26%), Positives = 93/202 (46%), Gaps = 26/202 (13%)
 Frame = +1

Query  955   MNNKRFVASL----------KYALAL--GLAVF--FGSIYSKPDGFW---AGLTVAISYV  1083
             MN + F++++          ++AL L  G+ +F   G +Y + D +W    G  + I+Y 
Sbjct  492   MNGRIFISTVLQQVKHSSHVRFALKLASGVTLFSAIGFVYPRQDQWWRQCKGPWLLIAYT  551

Query  1084  SAREAT----FRIANVKAQGTVLGSIYGVLGCFVFAKYEELRFISLIPWFIVCSFLRRSR  1251
              + EAT    FRIA  +  GT+LGS++G L   + ++        +I +F V + L R R
Sbjct  552   WSLEATTGDSFRIAIFRIIGTILGSLFGFLTMEI-SRGNPWGISVMISFFSVIAILIRMR  610

Query  1252  ----MYGPAGGISACIGAVLILGREGFGPPREFAMARIMETFIGLACSITVELLFRPTRA  1419
                   G   G +  + A+L         P   A+ R     +G+A ++ V L+F P  A
Sbjct  611   PSLVPVGALTGFTTPLVAILAYQSPRGDAPIHEALLRGYMNLLGIAAALVVNLVFWPYHA  670

Query  1420  SSLAKIQLSKSLQLLNQCIISI  1485
              +    +LS +  LL    +++
Sbjct  671   RTQLMYKLSDTSTLLQNWYLTM  692



>ref|XP_002538341.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF24042.1| conserved hypothetical protein [Ricinus communis]
Length=131

 Score = 51.2 bits (121),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 31/87 (36%), Positives = 49/87 (56%), Gaps = 8/87 (9%)
 Frame = +1

Query  508  MQWERYPIKFFRPYCKNPGERLQEYETPLRGMEMGLVDNNPPQFPVTVLLSSSEVKDSLD  687
            M WE+  I+F +P    P E L+E E  ++GMEM L   + P FPV+++  + E+++   
Sbjct  3    MLWEKPQIRFLKPKSMEPVEILEEVEILIKGMEMAL--TSCPVFPVSLM--TDELREISM  58

Query  688  SLTGHISKQVKGR----LFDLATVPES  756
             + G I  +++      LFD AT PES
Sbjct  59   GMKGKIRLKLEQAKCVVLFDAATAPES  85



>ref|WP_010937388.1| hypothetical protein [Desulfovibrio vulgaris]
 ref|YP_009302.1| hypothetical protein DVU0077 [Desulfovibrio vulgaris str. Hildenborough]
 ref|YP_005700914.1| hypothetical protein Deval_0105 [Desulfovibrio vulgaris RCH1]
 gb|AAS94561.1| conserved hypothetical protein [Desulfovibrio vulgaris str. Hildenborough]
 gb|ADP85276.1| hypothetical protein Deval_0105 [Desulfovibrio vulgaris RCH1]
Length=360

 Score = 53.1 bits (126),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 38/165 (23%), Positives = 75/165 (45%), Gaps = 7/165 (4%)
 Frame = +1

Query  976   ASLKYALALGLAVFFGSIYSK----PDGFWAGLTVAISYVSAREATFRIANVKAQGTVLG  1143
             AS+++ +  GLA     + ++      G+WA +T  I   ++   +  ++  +  GT++G
Sbjct  21    ASVRHGIKTGLAALLSYLVTEWLHLDFGYWAPITAVIVMQTSVAESIEMSLYRTVGTMIG  80

Query  1144  SIYGVLGCFVFAKYEELRFISLIPWFIVCSFLRRSRMYGPAGGISACIGAVLILGREGFG  1323
             ++ GV+         E     L     +C+FL R   +     ++A    ++IL   G  
Sbjct  81    ALMGVVSILALPDTFEGNGAGLFITTGLCAFLTR---WDARYRMAAITVTIVILASVGQP  137

Query  1324  PPREFAMARIMETFIGLACSITVELLFRPTRASSLAKIQLSKSLQ  1458
                 F + R++E  +G+ C++ V L   P RA    +  L++ LQ
Sbjct  138   DRMHFGLFRVLEILVGVVCAVLVSLTLWPLRAGEALRADLARQLQ  182



>ref|WP_011366277.1| hypothetical protein [Desulfovibrio alaskensis]
 ref|YP_386593.1| hypothetical protein [Desulfovibrio alaskensis G20]
 gb|ABB36898.1| protein of unknown function DUF939 [Desulfovibrio alaskensis 
G20]
Length=347

 Score = 52.8 bits (125),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 36/158 (23%), Positives = 67/158 (42%), Gaps = 7/158 (4%)
 Frame = +1

Query  970   FVASLKYALALGLAVFFGSIYSKPDGFWAGLTVAISYVSAREATFRIANVKAQGTVLGSI  1149
             F   L   L+  LA +FG  +    G+WA ++  I        + ++   +  GT +G++
Sbjct  17    FKTGLAAVLSYWLAEYFGFKF----GYWAAISAVIVMQMNVADSLQMGWYRFTGTAVGAV  72

Query  1150  YGVLGCFVFAKYEELRFISLIPWFIVCSFLRRSRMYGPAGGISACIGAVLILGREGFGPP  1329
              GV     F     +  +SL      C+++ R         I+ CI   ++L   G   P
Sbjct  73    IGVFAILAFPDTLPMHLLSLFVSVAFCAYMTRYNARYRMAAITVCI---VVLASYGQPQP  129

Query  1330  REFAMARIMETFIGLACSITVELLFRPTRASSLAKIQL  1443
               F + R++E  +G+ C+  V +   P R   + + +L
Sbjct  130   VMFGLFRVLEITVGVGCAFIVSVTLWPQRVGEVLRQRL  167



>ref|WP_027182570.1| hypothetical protein [Desulfovibrio alaskensis]
Length=347

 Score = 52.4 bits (124),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 36/158 (23%), Positives = 67/158 (42%), Gaps = 7/158 (4%)
 Frame = +1

Query  970   FVASLKYALALGLAVFFGSIYSKPDGFWAGLTVAISYVSAREATFRIANVKAQGTVLGSI  1149
             F   L   L+  LA +FG  +    G+WA ++  I        + ++   +  GT +G++
Sbjct  17    FKTGLAAVLSYWLAEYFGFKF----GYWAAISAVIVMQMNVADSLQMGWYRFTGTAVGAV  72

Query  1150  YGVLGCFVFAKYEELRFISLIPWFIVCSFLRRSRMYGPAGGISACIGAVLILGREGFGPP  1329
              GV     F     +  +SL      C+++ R         I+ CI   ++L   G   P
Sbjct  73    IGVFAILAFPDTLPMHLLSLFVSVAFCAYMTRYNARYRMAAITVCI---VVLASYGQPQP  129

Query  1330  REFAMARIMETFIGLACSITVELLFRPTRASSLAKIQL  1443
               F + R++E  +G+ C+  V +   P R   + + +L
Sbjct  130   VMFGLFRVLEITVGVGCAFLVSVTLWPQRVGEVLRQRL  167



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 7111009506740