BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c8071_g1_i2 len=1571 path=[1:0-260 262:261-1570]

Length=1571
                                                                      Score     E

dbj|BAC02435.1|  alpha-amylase                                          542   0.0      Ipomoea nil [qian niu]
emb|CDP01359.1|  unnamed protein product                                539   0.0      
ref|XP_009758535.1|  PREDICTED: alpha-amylase                           538   0.0      
ref|XP_009586775.1|  PREDICTED: alpha-amylase                           537   0.0      
ref|XP_004235226.1|  PREDICTED: alpha-amylase                           528   0.0      
gb|AFO84070.1|  alpha-amylase                                           524   1e-179   
gb|AAA16513.1|  alpha amylase precursor                                 523   3e-179   Cuscuta reflexa [giant dodder]
ref|XP_006354888.1|  PREDICTED: alpha-amylase-like                      522   8e-179   
ref|XP_003589186.1|  Alpha-amylase                                      522   8e-179   
gb|AFK42146.1|  unknown                                                 520   3e-178   
ref|XP_011083843.1|  PREDICTED: alpha-amylase                           521   5e-178   
gb|EYU25422.1|  hypothetical protein MIMGU_mgv1a006910mg                520   7e-178   
dbj|BAC76729.1|  alpha-amylase                                          518   2e-177   Vigna angularis [azuki bean]
ref|XP_004238157.1|  PREDICTED: alpha-amylase isoform X1                518   2e-177   
prf||1803517A  alpha amylase                                            517   6e-177
ref|XP_002301186.2|  hypothetical protein POPTR_0002s12790g             516   1e-176   Populus trichocarpa [western balsam poplar]
ref|XP_006387871.1|  hypothetical protein POPTR_0515s00220g             516   1e-176   
ref|XP_004499059.1|  PREDICTED: alpha-amylase-like                      516   1e-176   
sp|P17859.1|AMYA_VIGMU  RecName: Full=Alpha-amylase; AltName: Ful...    515   3e-176   Vigna mungo [urad dal]
ref|XP_007134076.1|  hypothetical protein PHAVU_010G017600g             514   1e-175   
ref|XP_011017206.1|  PREDICTED: alpha-amylase isoform X2                512   6e-175   
ref|XP_002285213.1|  PREDICTED: alpha-amylase                           509   5e-174   Vitis vinifera
ref|XP_007017240.1|  Alpha-amylase-like isoform 1                       509   6e-174   
ref|XP_004499063.1|  PREDICTED: alpha-amylase-like isoform X1           508   3e-173   
ref|XP_011017205.1|  PREDICTED: alpha-amylase isoform X1                506   1e-172   
ref|XP_004499060.1|  PREDICTED: alpha-amylase-like                      506   2e-172   
gb|KHG27234.1|  Uncharacterized protein F383_11580                      505   2e-172   
ref|XP_009783973.1|  PREDICTED: alpha-amylase-like                      504   7e-172   
gb|AHL44839.1|  alpha-amylase-like protein                              503   3e-171   
ref|XP_010108609.1|  hypothetical protein L484_006340                   501   2e-170   
ref|XP_009350378.1|  PREDICTED: alpha-amylase-like                      501   2e-170   
ref|XP_006387870.1|  alpha amylase family protein                       500   2e-170   
ref|XP_006374943.1|  alpha amylase family protein                       500   2e-170   
ref|XP_002510218.1|  alpha-amylase, putative                            500   3e-170   Ricinus communis
ref|XP_010690292.1|  PREDICTED: alpha-amylase-like                      499   8e-170   
ref|XP_010061754.1|  PREDICTED: alpha-amylase-like isoform X1           499   8e-170   
ref|XP_007199844.1|  hypothetical protein PRUPE_ppa006152mg             499   8e-170   
ref|XP_008236505.1|  PREDICTED: alpha-amylase-like                      499   8e-170   
ref|XP_010061756.1|  PREDICTED: alpha-amylase-like isoform X3           497   4e-169   
ref|XP_002282184.1|  PREDICTED: alpha-amylase                           497   5e-169   Vitis vinifera
ref|XP_003550340.1|  PREDICTED: alpha-amylase-like                      496   5e-169   
ref|XP_006434774.1|  hypothetical protein CICLE_v10001266mg             496   1e-168   
emb|CAN77038.1|  hypothetical protein VITISV_004485                     495   4e-168   Vitis vinifera
ref|XP_010690291.1|  PREDICTED: alpha-amylase-like                      494   5e-168   
gb|KDP38338.1|  hypothetical protein JCGZ_04263                         493   2e-167   
ref|XP_007017239.1|  Alpha-amylase-like                                 493   3e-167   
ref|XP_004294806.1|  PREDICTED: alpha-amylase-like                      493   4e-167   
ref|XP_008373147.1|  PREDICTED: alpha-amylase-like                      491   1e-166   
ref|XP_008236504.1|  PREDICTED: alpha-amylase-like                      490   2e-166   
ref|XP_010061755.1|  PREDICTED: alpha-amylase-like isoform X2           490   3e-166   
ref|XP_010061752.1|  PREDICTED: alpha-amylase-like                      489   7e-166   
ref|XP_010108610.1|  hypothetical protein L484_006341                   486   7e-165   
gb|KHG00963.1|  Uncharacterized protein F383_22263                      484   3e-164   
gb|KHG23972.1|  Uncharacterized protein F383_31428                      484   4e-164   
gb|KHG14183.1|  Uncharacterized protein F383_17328                      483   2e-163   
ref|XP_008373148.1|  PREDICTED: alpha-amylase-like                      482   6e-163   
ref|XP_010690299.1|  PREDICTED: alpha-amylase-like                      481   1e-162   
ref|XP_010274277.1|  PREDICTED: pentatricopeptide repeat-containi...    502   1e-161   
ref|XP_002510219.1|  pentatricopeptide repeat-containing protein,...    499   5e-161   Ricinus communis
ref|XP_010943052.1|  PREDICTED: alpha-amylase isozyme 3D-like           476   6e-161   
ref|XP_011042248.1|  PREDICTED: pentatricopeptide repeat-containi...    502   9e-161   
gb|AAA98615.1|  alpha-amylase                                           476   2e-160   Hordeum vulgare [barley]
ref|XP_009349497.1|  PREDICTED: alpha-amylase-like                      474   5e-160   
emb|CAX51373.1|  alpha-amylase                                          473   2e-159   Hordeum vulgare subsp. vulgare [barley]
ref|XP_010690290.1|  PREDICTED: alpha-amylase-like                      471   8e-159   
ref|XP_008811408.1|  PREDICTED: alpha-amylase isozyme 3D-like           471   1e-158   
ref|XP_004499064.1|  PREDICTED: alpha-amylase-like isoform X2           467   1e-157   
gb|AAO11776.1|  alpha-amylase precursor                                 468   2e-157   Musa acuminata [banana]
emb|CAX51374.1|  alpha-amylase                                          467   3e-157   Hordeum vulgare subsp. vulgare [barley]
dbj|BAE47517.2|  alpha-amylase                                          466   5e-157   Hyacinthus orientalis [common hyacinth]
ref|XP_006647962.1|  PREDICTED: alpha-amylase-like                      466   6e-157   
sp|P04063.3|AMY2_HORVU  RecName: Full=Alpha-amylase type B isozym...    466   7e-157   Hordeum vulgare [barley]
ref|XP_006659494.1|  PREDICTED: alpha-amylase isozyme 3D-like           466   1e-156   
gb|AEO09337.4|  alpha-amylase                                           465   1e-156   
gb|ADP88919.1|  alpha-amylase                                           464   2e-156   
sp|P27933.2|AMY3D_ORYSJ  RecName: Full=Alpha-amylase isozyme 3D; ...    465   3e-156   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009410104.1|  PREDICTED: alpha-amylase isozyme 3D-like           464   3e-156   
pdb|1AVA|A  Chain A, Amy2BASI PROTEIN-Protein Complex From Barley...    463   4e-156   
ref|XP_004973671.1|  PREDICTED: alpha-amylase isozyme 3D-like           464   5e-156   
ref|NP_001062024.1|  Os08g0473900                                       465   9e-156   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004294808.1|  PREDICTED: alpha-amylase-like                      462   1e-155   
gb|EMT32633.1|  Alpha-amylase type B isozyme                            463   1e-155   
emb|CAA33298.1|  alpha-amylase                                          462   3e-155   Hordeum vulgare [barley]
ref|XP_004954023.1|  PREDICTED: alpha-amylase-like                      462   3e-155   
gb|EMS50638.1|  Alpha-amylase type B isozyme                            461   7e-155   
ref|XP_009381896.1|  PREDICTED: alpha-amylase isozyme 3D-like           461   9e-155   
ref|XP_009399983.1|  PREDICTED: alpha-amylase isozyme 3C-like           460   9e-155   
ref|XP_004973672.1|  PREDICTED: alpha-amylase isozyme 3D-like           461   9e-155   
gb|AHY18982.1|  high PI alpha-amylase 1                                 460   1e-154   
ref|XP_002454601.1|  hypothetical protein SORBIDRAFT_04g034140          460   2e-154   Sorghum bicolor [broomcorn]
ref|NP_001150278.1|  alpha-amylase precursor                            459   3e-154   Zea mays [maize]
pir||JC7137  alpha-amylase (EC 3.2.1.1) isozyme I - rice                459   9e-154
gb|AFW73583.1|  putative alpha-amylase family protein                   460   1e-153   
gb|AAA33895.1|  alpha-amylase                                           457   3e-153   Oryza sativa Japonica Group [Japonica rice]
ref|XP_003589191.1|  Alpha amylase                                      456   4e-153   
ref|NP_001062023.1|  Os08g0473600                                       456   1e-152   Oryza sativa Japonica Group [Japonica rice]
ref|NP_567714.1|  alpha-amylase 1                                       455   1e-152   Arabidopsis thaliana [mouse-ear cress]
pir||JC7138  alpha-amylase (EC 3.2.1.1) isozyme III - rice              456   1e-152
gb|EMS54110.1|  Alpha-amylase type B isozyme                            455   2e-152   
gb|AAM64582.1|  alpha-amylase-like protein                              455   2e-152   Arabidopsis thaliana [mouse-ear cress]
sp|P04750.2|AMY6_HORVU  RecName: Full=Alpha-amylase type B isozym...    455   2e-152   Hordeum vulgare [barley]
ref|NP_001048220.1|  Os02g0765600                                       455   2e-152   Oryza sativa Japonica Group [Japonica rice]
gb|ACZ72923.1|  alpha-amylase isoform                                   454   2e-152   Dactylis glomerata [cocksfoot]
gb|AAA33885.1|  alpha-amylase (EC 3.2.1.1)                              454   4e-152   Oryza sativa Japonica Group [Japonica rice]
emb|CAA34516.1|  alpha-amylase                                          454   4e-152   Oryza sativa Japonica Group [Japonica rice]
pdb|3WN6|A  Chain A, Crystal Structure Of Alpha-amylase Amyi-1 Fr...    453   5e-152   
gb|EAY87654.1|  hypothetical protein OsI_09066                          454   5e-152   Oryza sativa Indica Group [Indian rice]
ref|XP_002460331.1|  hypothetical protein SORBIDRAFT_02g026610          454   5e-152   Sorghum bicolor [broomcorn]
ref|XP_010320333.1|  PREDICTED: alpha-amylase isoform X2                451   5e-152   
ref|NP_001105539.1|  alpha-amylase precursor                            454   7e-152   Zea mays [maize]
dbj|BAD17123.1|  putative alpha-amylase precursor                       453   7e-152   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010061758.1|  PREDICTED: alpha-amylase-like                      453   7e-152   
ref|XP_004957016.1|  PREDICTED: alpha-amylase isozyme 3C-like           454   8e-152   
ref|XP_002867631.1|  hypothetical protein ARALYDRAFT_492338             453   1e-151   
gb|AAA33886.1|  alpha-amylase (EC 3.2.1.1)                              453   1e-151   Oryza sativa Japonica Group [Japonica rice]
gb|ACF88424.1|  unknown                                                 453   2e-151   Zea mays [maize]
ref|XP_007017242.1|  Alpha-amylase-like                                 452   2e-151   
gb|ADH43281.1|  alpha amylase                                           452   2e-151   
ref|XP_006660698.1|  PREDICTED: alpha-amylase isozyme 3B-like iso...    452   3e-151   
ref|XP_004957017.1|  PREDICTED: alpha-amylase isozyme 3C-like           452   5e-151   
gb|AAA32925.1|  alpha-amylase 1                                         450   1e-150   Hordeum vulgare [barley]
ref|XP_004957015.1|  PREDICTED: alpha-amylase isozyme 3C-like           451   1e-150   
gb|AAN01149.1|  alpha-amylase precursor                                 450   1e-150   Musa acuminata [banana]
ref|XP_009348705.1|  PREDICTED: alpha-amylase-like                      449   2e-150   
emb|CAB36742.1|  alpha-amylase-like protein                             449   3e-150   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008347138.1|  PREDICTED: alpha-amylase-like                      448   5e-150   
ref|NP_001169611.1|  uncharacterized protein LOC100383492 precursor     449   6e-150   Zea mays [maize]
ref|XP_006660697.1|  PREDICTED: alpha-amylase isozyme 3A-like           448   9e-150   
gb|EMT15942.1|  Alpha-amylase isozyme 3D                                448   1e-149   
ref|XP_009148429.1|  PREDICTED: alpha-amylase 1                         448   1e-149   
gb|AAM09952.1|  alpha-amylase                                           446   2e-149   Eleusine coracana subsp. coracana [caracan millet]
ref|XP_006659493.1|  PREDICTED: alpha-amylase isozyme 3E-like           447   3e-149   
ref|XP_004960025.1|  PREDICTED: alpha-amylase type A isozyme-like       446   3e-149   
gb|KDP29720.1|  hypothetical protein JCGZ_18655                         446   3e-149   
ref|XP_007222445.1|  hypothetical protein PRUPE_ppa006160mg             446   6e-149   
ref|XP_006413356.1|  hypothetical protein EUTSA_v10025232mg             446   8e-149   
ref|NP_001276156.1|  alpha-amylase-like precursor                       445   1e-148   
ref|XP_010236079.1|  PREDICTED: alpha-amylase type B isozyme-like       444   3e-148   
gb|EAZ09376.1|  hypothetical protein OsI_31649                          444   4e-148   Oryza sativa Indica Group [Indian rice]
emb|CAA09323.1|  alpha amylase                                          444   5e-148   Avena fatua
ref|XP_010448491.1|  PREDICTED: alpha-amylase 1-like                    442   9e-148   
pdb|2QPU|A  Chain A, Sugar Tongs Mutant S378p In Complex With Aca...    441   2e-147   
ref|XP_003578230.1|  PREDICTED: alpha-amylase isozyme 3A-like           442   2e-147   
gb|AAA32926.1|  alpha-amylase 1                                         442   2e-147   Hordeum vulgare [barley]
gb|ADC54362.1|  alpha amylase                                           441   3e-147   Hordeum vulgare subsp. spontaneum [wild barley]
ref|XP_002452881.1|  hypothetical protein SORBIDRAFT_04g034150          441   3e-147   Sorghum bicolor [broomcorn]
gb|ADC54320.1|  alpha amylase                                           441   4e-147   Hordeum vulgare subsp. spontaneum [wild barley]
ref|NP_001063369.1|  Os09g0457800                                       442   4e-147   Oryza sativa Japonica Group [Japonica rice]
pdb|2QPS|A  Chain A, "sugar Tongs" Mutant Y380a In Complex With A...    440   4e-147   
pdb|3BSG|A  Chain A, Barley Alpha-Amylase Isozyme 1 (Amy1) H395a ...    441   5e-147   
ref|XP_003563559.1|  PREDICTED: alpha-amylase type A isozyme            442   5e-147   
gb|ADC54366.1|  alpha amylase                                           440   6e-147   Hordeum vulgare subsp. spontaneum [wild barley]
gb|ADC54373.1|  alpha amylase                                           440   6e-147   Hordeum vulgare subsp. spontaneum [wild barley]
ref|NP_001063367.1|  Os09g0457400                                       441   6e-147   Oryza sativa Japonica Group [Japonica rice]
gb|ADC54359.1|  alpha amylase                                           440   8e-147   Hordeum vulgare subsp. spontaneum [wild barley]
gb|EEC84703.1|  hypothetical protein OsI_31647                          441   8e-147   Oryza sativa Indica Group [Indian rice]
ref|XP_006446537.1|  hypothetical protein CICLE_v10018086mg             439   9e-147   
gb|ADC54357.1|  alpha amylase                                           440   1e-146   Hordeum vulgare subsp. spontaneum [wild barley]
gb|ADC54365.1|  alpha amylase                                           439   1e-146   Hordeum vulgare subsp. spontaneum [wild barley]
ref|XP_010438943.1|  PREDICTED: alpha-amylase 1                         440   1e-146   
gb|KFK29029.1|  hypothetical protein AALP_AA7G079500                    440   1e-146   
pdb|3BSH|A  Chain A, Barley Alpha-Amylase Isozyme 1 (Amy1) Double...    439   1e-146   
gb|ADC54344.1|  alpha amylase                                           439   1e-146   Hordeum vulgare subsp. spontaneum [wild barley]
gb|ADC54353.1|  alpha amylase                                           439   1e-146   Hordeum vulgare subsp. spontaneum [wild barley]
pdb|1HT6|A  Chain A, Crystal Structure At 1.5a Resolution Of The ...    439   1e-146   
gb|ADC54351.1|  alpha amylase                                           439   2e-146   Hordeum vulgare subsp. spontaneum [wild barley]
emb|CAN74301.1|  hypothetical protein VITISV_028383                     445   2e-146   Vitis vinifera
emb|CAX51372.1|  alpha-amylase                                          439   2e-146   Hordeum vulgare subsp. vulgare [barley]
ref|NP_001175871.1|  Os09g0457500                                       439   3e-146   
gb|ADC54347.1|  alpha amylase                                           439   3e-146   Hordeum vulgare subsp. spontaneum [wild barley]
gb|ADC54371.1|  alpha amylase                                           439   3e-146   Hordeum vulgare subsp. spontaneum [wild barley]
gb|ADC54372.1|  alpha amylase                                           438   3e-146   Hordeum vulgare subsp. spontaneum [wild barley]
gb|ADC54282.1|  alpha amylase                                           438   3e-146   Hordeum vulgare subsp. spontaneum [wild barley]
gb|ADC54328.1|  alpha amylase                                           438   4e-146   Hordeum vulgare subsp. spontaneum [wild barley]
gb|ADC54307.1|  alpha amylase                                           438   5e-146   Hordeum vulgare subsp. spontaneum [wild barley]
gb|ADC54340.1|  alpha amylase                                           438   5e-146   Hordeum vulgare subsp. spontaneum [wild barley]
gb|ADC54277.1|  alpha amylase                                           438   5e-146   Hordeum vulgare subsp. spontaneum [wild barley]
gb|ADC54358.1|  alpha amylase                                           438   6e-146   Hordeum vulgare subsp. spontaneum [wild barley]
gb|ADC54286.1|  alpha amylase                                           437   6e-146   Hordeum vulgare subsp. spontaneum [wild barley]
gb|ADC54339.1|  alpha amylase                                           437   7e-146   Hordeum vulgare subsp. spontaneum [wild barley]
gb|ADC54370.1|  alpha amylase                                           437   7e-146   Hordeum vulgare subsp. spontaneum [wild barley]
gb|ADC54322.1|  alpha amylase                                           437   8e-146   Hordeum vulgare subsp. spontaneum [wild barley]
sp|P00693.1|AMY1_HORVU  RecName: Full=Alpha-amylase type A isozym...    438   8e-146   Hordeum vulgare [barley]
emb|CDY29753.1|  BnaA01g19130D                                          438   8e-146   
gb|ADC54283.1|  alpha amylase                                           437   9e-146   Hordeum vulgare subsp. spontaneum [wild barley]
gb|ADC54308.1|  alpha amylase                                           437   9e-146   Hordeum vulgare subsp. spontaneum [wild barley]
ref|XP_004966428.1|  PREDICTED: alpha-amylase type A isozyme-like       438   1e-145   
gb|ADC54352.1|  alpha amylase                                           437   1e-145   Hordeum vulgare subsp. spontaneum [wild barley]
emb|CAA72144.1|  alpha-amylase                                          438   1e-145   Hordeum vulgare [barley]
gb|ADC54346.1|  alpha amylase                                           437   1e-145   Hordeum vulgare subsp. spontaneum [wild barley]
gb|ADC54281.1|  alpha amylase                                           437   1e-145   Hordeum vulgare subsp. spontaneum [wild barley]
gb|ADC54369.1|  alpha amylase                                           437   1e-145   Hordeum vulgare subsp. spontaneum [wild barley]
gb|ADO63831.1|  alpha amylase                                           438   1e-145   
gb|ADC54367.1|  alpha amylase                                           437   2e-145   Hordeum vulgare subsp. spontaneum [wild barley]
gb|ADC54316.1|  alpha amylase                                           437   2e-145   Hordeum vulgare subsp. spontaneum [wild barley]
gb|ADC54363.1|  alpha amylase                                           437   2e-145   Hordeum vulgare subsp. spontaneum [wild barley]
pdb|1RP8|A  Chain A, Crystal Structure Of Barley Alpha-Amylase Is...    436   2e-145   
gb|ADC54324.1|  alpha amylase                                           436   2e-145   Hordeum vulgare subsp. spontaneum [wild barley]
gb|ADC54318.1|  alpha amylase                                           436   2e-145   Hordeum vulgare subsp. spontaneum [wild barley]
gb|ADC54296.1|  alpha amylase                                           436   2e-145   Hordeum vulgare subsp. spontaneum [wild barley]
ref|XP_004965680.1|  PREDICTED: alpha-amylase type A isozyme-like       437   2e-145   
gb|ADC54323.1|  alpha amylase                                           436   2e-145   Hordeum vulgare subsp. spontaneum [wild barley]
gb|ADC54337.1|  alpha amylase                                           436   2e-145   Hordeum vulgare subsp. spontaneum [wild barley]
emb|CAA39776.1|  alpha-amylase                                          437   2e-145   Oryza sativa Japonica Group [Japonica rice]
gb|ADC54319.1|  alpha amylase                                           436   2e-145   Hordeum vulgare subsp. spontaneum [wild barley]
gb|ADC54364.1|  alpha amylase                                           436   3e-145   Hordeum vulgare subsp. spontaneum [wild barley]
gb|ADC54332.1|  alpha amylase                                           436   3e-145   Hordeum vulgare subsp. spontaneum [wild barley]
gb|ADC54313.1|  alpha amylase                                           436   3e-145   Hordeum vulgare subsp. spontaneum [wild barley]
gb|ADC54301.1|  alpha amylase                                           436   4e-145   Hordeum vulgare subsp. spontaneum [wild barley]
gb|ADC54330.1|  alpha amylase                                           436   4e-145   Hordeum vulgare subsp. spontaneum [wild barley]
gb|ADC54285.1|  alpha amylase                                           436   4e-145   Hordeum vulgare subsp. spontaneum [wild barley]
gb|AAA32927.1|  alpha-amylase 2                                         436   4e-145   Hordeum vulgare [barley]
gb|ADC54306.1|  alpha amylase                                           436   4e-145   Hordeum vulgare subsp. spontaneum [wild barley]
gb|ADC54338.1|  alpha amylase                                           436   5e-145   Hordeum vulgare subsp. spontaneum [wild barley]
gb|ADC54356.1|  alpha amylase                                           435   5e-145   Hordeum vulgare subsp. spontaneum [wild barley]
gb|ADC54326.1|  alpha amylase                                           435   5e-145   Hordeum vulgare subsp. spontaneum [wild barley]
gb|ADC54349.1|  alpha amylase                                           435   6e-145   Hordeum vulgare subsp. spontaneum [wild barley]
gb|ADC54327.1|  alpha amylase                                           435   6e-145   Hordeum vulgare subsp. spontaneum [wild barley]
gb|ADC54314.1|  alpha amylase                                           435   6e-145   Hordeum vulgare subsp. spontaneum [wild barley]
emb|CAA39778.1|  alpha-amylase                                          436   6e-145   Oryza sativa Japonica Group [Japonica rice]
gb|AAA33894.1|  alpha-amylase                                           436   7e-145   Oryza sativa Japonica Group [Japonica rice]
gb|ADC54276.1|  alpha amylase                                           435   8e-145   Hordeum vulgare subsp. spontaneum [wild barley]
sp|A2YGY2.1|AMY2A_ORYSI  RecName: Full=Alpha-amylase isozyme 2A; ...    436   9e-145   Oryza sativa Indica Group [Indian rice]
gb|ADC54368.1|  alpha amylase                                           434   1e-144   Hordeum vulgare subsp. spontaneum [wild barley]
gb|ADC54284.1|  alpha amylase                                           434   1e-144   Hordeum vulgare subsp. spontaneum [wild barley]
ref|XP_008651084.1|  PREDICTED: uncharacterized protein LOC100273...    435   1e-144   
gb|ADC54321.1|  alpha amylase                                           434   1e-144   Hordeum vulgare subsp. spontaneum [wild barley]
gb|AAA91883.1|  alpha-amylase                                           432   1e-144   Solanum tuberosum [potatoes]
gb|ADC54348.1|  alpha amylase                                           434   1e-144   Hordeum vulgare subsp. spontaneum [wild barley]
ref|NP_001058568.1|  Os06g0713800                                       435   1e-144   Oryza sativa Japonica Group [Japonica rice]
gb|ADC54278.1|  alpha amylase                                           434   2e-144   Hordeum vulgare subsp. spontaneum [wild barley]
gb|ADC54334.1|  alpha amylase                                           434   2e-144   Hordeum vulgare subsp. spontaneum [wild barley]
ref|XP_008220223.1|  PREDICTED: LOW QUALITY PROTEIN: pentatricope...    456   2e-144   
gb|KDO66103.1|  hypothetical protein CISIN_1g045962mg                   434   3e-144   
emb|CDY16261.1|  BnaC01g22960D                                          434   3e-144   
emb|CAA72143.1|  alpha-amylase                                          434   3e-144   Hordeum vulgare [barley]
emb|CAA09324.1|  alpha-amylase                                          434   3e-144   Avena fatua
ref|XP_006282624.1|  hypothetical protein CARUB_v10004897mg             433   5e-144   
gb|ADC54329.1|  alpha amylase                                           433   5e-144   Hordeum vulgare subsp. spontaneum [wild barley]
gb|EMT10056.1|  Alpha-amylase type A isozyme                            434   6e-144   
gb|ADC54361.1|  alpha amylase                                           432   6e-144   Hordeum vulgare subsp. spontaneum [wild barley]
gb|ADC54350.1|  alpha amylase                                           432   1e-143   Hordeum vulgare subsp. spontaneum [wild barley]
ref|XP_010943051.1|  PREDICTED: alpha-amylase isozyme 3D-like           432   2e-143   
gb|ADC54336.1|  alpha amylase                                           431   2e-143   Hordeum vulgare subsp. spontaneum [wild barley]
gb|ADC54333.1|  alpha amylase                                           431   2e-143   Hordeum vulgare subsp. spontaneum [wild barley]
gb|KDO84181.1|  hypothetical protein CISIN_1g014447mg                   427   7e-143   
gb|EPS60632.1|  alpha-amylase                                           427   9e-143   
gb|AAX33232.1|  secreted alpha-amylase                                  428   2e-142   Malus domestica [apple tree]
emb|CAA28803.1|  alpha-amylase type A                                   425   5e-141   Hordeum vulgare [barley]
gb|EPS57430.1|  hypothetical protein M569_17388                         426   6e-141   
ref|XP_006826844.1|  hypothetical protein AMTR_s00010p00102390          425   9e-141   
emb|CAA45903.1|  alpha-amylase                                          422   2e-139   Oryza sativa Indica Group [Indian rice]
gb|ACY38052.1|  alpha-amylase precursor                                 417   4e-138   Dactylis glomerata [cocksfoot]
gb|EAZ07323.1|  hypothetical protein OsI_29572                          418   4e-138   Oryza sativa Indica Group [Indian rice]
ref|XP_004980703.1|  PREDICTED: alpha-amylase type B isozyme-like       420   6e-138   
gb|AAA32928.1|  alpha-amylase 2                                         417   2e-137   Hordeum vulgare [barley]
ref|XP_004973670.1|  PREDICTED: alpha-amylase isozyme 3B-like           416   3e-137   
ref|XP_002462321.1|  hypothetical protein SORBIDRAFT_02g023790          414   2e-136   Sorghum bicolor [broomcorn]
gb|ABK24287.1|  unknown                                                 413   6e-136   Picea sitchensis
ref|XP_002984168.1|  hypothetical protein SELMODRAFT_119619             410   2e-135   
ref|XP_006657340.1|  PREDICTED: LOW QUALITY PROTEIN: alpha-amylas...    410   1e-134   
ref|XP_002972254.1|  hypothetical protein SELMODRAFT_97625              409   1e-134   
gb|ABK24434.1|  unknown                                                 409   2e-134   Picea sitchensis
ref|XP_002444507.1|  hypothetical protein SORBIDRAFT_07g023010          408   8e-134   Sorghum bicolor [broomcorn]
gb|ABR16554.1|  unknown                                                 407   2e-133   Picea sitchensis
gb|EMT14206.1|  Alpha-amylase AMY3                                      402   4e-132   
sp|P08117.1|AMY3_WHEAT  RecName: Full=Alpha-amylase AMY3; AltName...    401   1e-131   Triticum aestivum [Canadian hard winter wheat]
ref|XP_007017241.1|  Alpha-amylase-like isoform 2                       398   3e-131   
sp|P04747.1|AMY3_HORVU  RecName: Full=Alpha-amylase type B isozym...    396   2e-130   Hordeum vulgare [barley]
ref|XP_002460139.1|  hypothetical protein SORBIDRAFT_02g023250          408   5e-129   Sorghum bicolor [broomcorn]
ref|XP_001754460.1|  predicted protein                                  390   1e-127   
gb|KCW68749.1|  hypothetical protein EUGRSUZ_F02347                     389   1e-127   
gb|KCW68751.1|  hypothetical protein EUGRSUZ_F02347                     388   4e-127   
ref|XP_008393808.1|  PREDICTED: LOW QUALITY PROTEIN: pentatricope...    409   2e-126   
ref|XP_008351999.1|  PREDICTED: LOW QUALITY PROTEIN: pentatricope...    408   2e-126   
gb|KDO84180.1|  hypothetical protein CISIN_1g014447mg                   384   6e-126   
ref|XP_001777583.1|  predicted protein                                  383   1e-124   
gb|EMT33741.1|  Alpha-amylase isozyme 3A                                384   2e-124   
gb|EMS49001.1|  Alpha-amylase isozyme 3A                                389   3e-124   
dbj|BAD73797.1|  putative alpha-amylase isozyme 3E precursor            375   2e-122   
gb|EEC83728.1|  hypothetical protein OsI_29570                          373   8e-122   
ref|XP_002962512.1|  hypothetical protein SELMODRAFT_79072              365   2e-116   
ref|XP_002962777.1|  hypothetical protein SELMODRAFT_404058             361   4e-115   
gb|EMT32632.1|  hypothetical protein F775_52311                         361   4e-113   
ref|XP_002989346.1|  hypothetical protein SELMODRAFT_129632             358   4e-113   
ref|XP_002980855.1|  hypothetical protein SELMODRAFT_33940              352   1e-112   
gb|AHO49118.1|  alpha amylase                                           336   5e-108   
ref|XP_001772280.1|  predicted protein                                  338   2e-107   
gb|AFV30465.1|  alpha-amylase 1                                         336   2e-107   
gb|AFV30573.1|  alpha-amylase 1                                         335   4e-107   
ref|XP_005649456.1|  glycoside hydrolase                                341   4e-107   
gb|AFV30575.1|  alpha-amylase 1                                         335   5e-107   
gb|AFV30577.1|  alpha-amylase 1                                         334   9e-107   
gb|AFV30585.1|  alpha-amylase 1                                         334   1e-106   
gb|AFV30588.1|  alpha-amylase 1                                         333   2e-106   
gb|AFV30431.1|  alpha-amylase 1                                         334   2e-106   
gb|AFV30516.1|  alpha-amylase 1                                         333   2e-106   
gb|AFV30448.1|  alpha-amylase 1                                         333   2e-106   
gb|AFV30554.1|  alpha-amylase 1                                         333   2e-106   
gb|AFV30434.1|  alpha-amylase 1                                         333   2e-106   
gb|AFV30430.1|  alpha-amylase 1                                         333   2e-106   
gb|AFV30579.1|  alpha-amylase 1                                         333   3e-106   
gb|AFV30444.1|  alpha-amylase 1                                         333   3e-106   
gb|AFV30492.1|  alpha-amylase 1                                         333   3e-106   
gb|AFV30439.1|  alpha-amylase 1                                         332   4e-106   
gb|AFV30450.1|  alpha-amylase 1                                         332   4e-106   
gb|AFV30506.1|  alpha-amylase 1                                         332   4e-106   
gb|AFV30500.1|  alpha-amylase 1                                         332   4e-106   
gb|AFV30438.1|  alpha-amylase 1                                         333   4e-106   
gb|AFV30576.1|  alpha-amylase 1                                         332   5e-106   
gb|AFV30458.1|  alpha-amylase 1                                         332   5e-106   
gb|AFV30447.1|  alpha-amylase 1                                         332   6e-106   
gb|AFV30436.1|  alpha-amylase 1                                         332   8e-106   
gb|AFV30453.1|  alpha-amylase 1                                         332   8e-106   
gb|AFV30562.1|  alpha-amylase 1                                         332   9e-106   
gb|AFV30582.1|  alpha-amylase 1                                         332   1e-105   
gb|AFV30542.1|  alpha-amylase 1                                         331   1e-105   
gb|AFV30466.1|  alpha-amylase 1                                         331   1e-105   
gb|AFV30512.1|  alpha-amylase 1                                         331   1e-105   
gb|AFV30484.1|  alpha-amylase 1                                         331   1e-105   
gb|AFV30488.1|  alpha-amylase 1                                         331   2e-105   
gb|AFV30527.1|  alpha-amylase 1                                         331   2e-105   
gb|AFV30442.1|  alpha-amylase 1                                         331   2e-105   
gb|AFV30478.1|  alpha-amylase 1                                         331   2e-105   
gb|AFV30514.1|  alpha-amylase 1                                         330   2e-105   
gb|AFV30560.1|  alpha-amylase 1                                         330   3e-105   
gb|AFV30548.1|  alpha-amylase 1                                         330   3e-105   
gb|AFV30570.1|  alpha-amylase 1                                         330   3e-105   
gb|AFV30571.1|  alpha-amylase 1                                         330   3e-105   
gb|AFV30520.1|  alpha-amylase 1                                         330   3e-105   
gb|AFV30538.1|  alpha-amylase 1                                         330   4e-105   
gb|AFV30587.1|  alpha-amylase 1                                         330   4e-105   
gb|AFV30540.1|  alpha-amylase 1                                         330   5e-105   
gb|AFV30476.1|  alpha-amylase 1                                         329   7e-105   
gb|AFV30572.1|  alpha-amylase 1                                         329   8e-105   
gb|AFV30449.1|  alpha-amylase 1                                         329   1e-104   
gb|AFV30452.1|  alpha-amylase 1                                         328   1e-104   
gb|AFV30529.1|  alpha-amylase 1                                         328   2e-104   
gb|AFV30480.1|  alpha-amylase 1                                         328   2e-104   
gb|AFV30566.1|  alpha-amylase 1                                         328   2e-104   
ref|XP_002954444.1|  hypothetical protein VOLCADRAFT_82772              333   3e-104   
gb|AFV30546.1|  alpha-amylase 1                                         327   5e-104   
gb|AFV30586.1|  alpha-amylase 1                                         327   6e-104   
gb|AFV30435.1|  alpha-amylase 1                                         327   7e-104   
gb|KFM28969.1|  Alpha-amylase type B isozyme                            330   4e-103   
ref|XP_001782830.1|  predicted protein                                  327   7e-103   
ref|XP_010667402.1|  PREDICTED: alpha-amylase-like                      321   2e-101   
ref|XP_002991426.1|  hypothetical protein SELMODRAFT_133553             322   3e-101   
ref|XP_002988323.1|  hypothetical protein SELMODRAFT_127605             321   7e-101   
ref|XP_001768202.1|  predicted protein                                  320   1e-100   
ref|XP_002504668.1|  glycoside hydrolase family 13 protein              318   1e-99    
ref|XP_008807825.1|  PREDICTED: uncharacterized protein LOC103720069    333   2e-99    
ref|XP_009391375.1|  PREDICTED: alpha-amylase isozyme 3C-like           312   6e-99    
ref|XP_010925057.1|  PREDICTED: alpha-amylase 3, chloroplastic          330   1e-98    
ref|XP_009412382.1|  PREDICTED: alpha-amylase 3, chloroplastic          330   2e-98    
ref|XP_006837124.1|  hypothetical protein AMTR_s00110p00125590          330   2e-98    
ref|XP_007221942.1|  hypothetical protein PRUPE_ppa001575mg             326   3e-98    
ref|XP_004489509.1|  PREDICTED: rootletin-like isoform X2               328   3e-98    
ref|XP_010551510.1|  PREDICTED: alpha-amylase 3, chloroplastic          328   3e-98    
gb|KDD74952.1|  hypothetical protein H632_c966p0                        315   9e-98    
ref|XP_006363428.1|  PREDICTED: uncharacterized protein LOC102579717    328   1e-97    
ref|XP_008221657.1|  PREDICTED: alpha-amylase 3, chloroplastic          327   2e-97    
ref|NP_001281020.1|  alpha-amylase 3, chloroplastic-like                327   2e-97    
ref|XP_001696014.1|  alpha-amylase                                      313   2e-97    
ref|XP_010939367.1|  PREDICTED: uncharacterized protein LOC105058203    328   2e-97    
ref|NP_001044062.2|  Os01g0715400                                       318   2e-97    
ref|XP_004489508.1|  PREDICTED: rootletin-like isoform X1               328   2e-97    
ref|XP_005644225.1|  alpha-amylase                                      313   2e-97    
ref|XP_001694202.1|  alpha-amylase                                      313   2e-97    
gb|KDO82806.1|  hypothetical protein CISIN_1g002585mg                   320   3e-97    
ref|XP_005850743.1|  hypothetical protein CHLNCDRAFT_29945              315   3e-97    
gb|AES77651.2|  alpha amylase domain protein                            327   5e-97    
ref|XP_006438621.1|  hypothetical protein CICLE_v10030661mg             321   9e-97    
ref|XP_008455663.1|  PREDICTED: uncharacterized protein LOC103495777    326   1e-96    
ref|XP_004137176.1|  PREDICTED: uncharacterized protein LOC101217339    326   1e-96    
tpg|DAA57879.1|  TPA: hypothetical protein ZEAMMB73_547031              320   3e-96    
ref|XP_004514772.1|  PREDICTED: alpha-amylase 3, chloroplastic-like     323   3e-96    
ref|XP_004490000.1|  PREDICTED: alpha-amylase 3, chloroplastic-li...    321   3e-96    
emb|CDP00291.1|  unnamed protein product                                323   3e-96    
gb|AAX33233.1|  plastid alpha-amylase                                   323   3e-96    
ref|XP_010256483.1|  PREDICTED: alpha-amylase 3, chloroplastic-like     323   4e-96    
ref|XP_010066950.1|  PREDICTED: alpha-amylase 3, chloroplastic          323   4e-96    
ref|XP_002526120.1|  alpha-amylase, putative                            324   4e-96    
gb|KDP21224.1|  hypothetical protein JCGZ_21695                         323   4e-96    
ref|XP_004233383.1|  PREDICTED: uncharacterized protein LOC101249...    324   5e-96    
gb|AFO84072.1|  alpha-amylase                                           322   5e-96    
ref|XP_010317126.1|  PREDICTED: uncharacterized protein LOC101249...    324   5e-96    
ref|XP_002276872.2|  PREDICTED: uncharacterized protein LOC100254959    324   6e-96    
gb|EYU22438.1|  hypothetical protein MIMGU_mgv1a001104mg                322   6e-96    
ref|XP_002456247.1|  hypothetical protein SORBIDRAFT_03g032830          320   6e-96    
ref|XP_007160611.1|  hypothetical protein PHAVU_001G001900g             308   8e-96    
emb|CDP02311.1|  unnamed protein product                                323   1e-95    
ref|XP_009360394.1|  PREDICTED: alpha-amylase 3, chloroplastic          322   1e-95    
gb|KEH19825.1|  alpha amylase domain protein                            318   1e-95    
gb|KDO82805.1|  hypothetical protein CISIN_1g002585mg                   319   1e-95    
gb|AIU94748.1|  alpha-amylase                                           322   2e-95    
ref|XP_010683251.1|  PREDICTED: alpha-amylase 3, chloroplastic is...    321   2e-95    
ref|XP_010683252.1|  PREDICTED: alpha-amylase 3, chloroplastic is...    320   3e-95    
ref|XP_010089625.1|  Alpha-amylase isozyme 2A                           321   3e-95    
ref|XP_008808375.1|  PREDICTED: alpha-amylase 3, chloroplastic is...    321   3e-95    
ref|XP_006438622.1|  hypothetical protein CICLE_v10030661mg             320   4e-95    
ref|XP_005846402.1|  hypothetical protein CHLNCDRAFT_35990              308   4e-95    
ref|XP_008675104.1|  PREDICTED: alpha-amylase 3, chloroplastic          320   4e-95    
ref|XP_004489999.1|  PREDICTED: alpha-amylase 3, chloroplastic-li...    320   6e-95    
ref|XP_006483229.1|  PREDICTED: alpha-amylase 3, chloroplastic          320   6e-95    
ref|XP_010652415.1|  PREDICTED: alpha-amylase 3, chloroplastic is...    319   6e-95    
ref|XP_004969746.1|  PREDICTED: alpha-amylase 3, chloroplastic-like     319   6e-95    
emb|CBI32016.3|  unnamed protein product                                319   6e-95    
ref|XP_002270049.1|  PREDICTED: alpha-amylase 3, chloroplastic is...    320   6e-95    
ref|XP_006646263.1|  PREDICTED: alpha-amylase 3, chloroplastic-like     317   7e-95    
ref|XP_004297334.1|  PREDICTED: alpha-amylase 3, chloroplastic-like     319   1e-94    
gb|KDO82801.1|  hypothetical protein CISIN_1g002585mg                   319   1e-94    
gb|EYU44190.1|  hypothetical protein MIMGU_mgv1a001047mg                319   1e-94    
ref|XP_011000093.1|  PREDICTED: uncharacterized protein LOC105107752    320   1e-94    
ref|XP_009796197.1|  PREDICTED: uncharacterized protein LOC104242...    320   2e-94    
gb|KEH19823.1|  alpha amylase domain protein                            318   2e-94    
gb|KHG19882.1|  Alpha-amylase isozyme 3E                                318   2e-94    
ref|WP_002629641.1|  Cytoplasmic alpha-amylase                          305   2e-94    
gb|KCW65004.1|  hypothetical protein EUGRSUZ_G02543                     318   2e-94    
ref|XP_011021596.1|  PREDICTED: alpha-amylase 3, chloroplastic is...    318   2e-94    
emb|CDY11651.1|  BnaC06g30880D                                          318   2e-94    
gb|EMT16094.1|  Alpha-amylase                                           319   2e-94    
ref|XP_006378407.1|  alpha-amylase family protein                       318   3e-94    
ref|XP_009796199.1|  PREDICTED: uncharacterized protein LOC104242...    319   3e-94    
ref|XP_011021595.1|  PREDICTED: alpha-amylase 3, chloroplastic is...    318   3e-94    
gb|EPS68543.1|  plastid alpha-amylase                                   317   3e-94    
ref|XP_010096344.1|  Alpha-amylase isozyme 3A                           318   4e-94    
ref|XP_007153841.1|  hypothetical protein PHAVU_003G069200g             318   4e-94    
ref|XP_003531852.1|  PREDICTED: uncharacterized protein LOC100817...    318   4e-94    
ref|XP_009105650.1|  PREDICTED: alpha-amylase 3, chloroplastic          317   4e-94    
emb|CDY38763.1|  BnaA07g28350D                                          317   4e-94    
gb|EEC71386.1|  hypothetical protein OsI_03507                          317   4e-94    
ref|XP_002324108.2|  hypothetical protein POPTR_0017s12870g             318   4e-94    
gb|EEE55295.1|  hypothetical protein OsJ_03246                          317   4e-94    
ref|XP_010242368.1|  PREDICTED: alpha-amylase 3, chloroplastic-li...    315   5e-94    
ref|XP_003569677.1|  PREDICTED: alpha-amylase 3, chloroplastic          317   6e-94    
ref|XP_003589187.1|  Alpha-amylase                                      297   7e-94    
ref|WP_013314377.1|  alpha-amylase                                      304   8e-94    
ref|XP_007139489.1|  hypothetical protein PHAVU_008G033800g             318   1e-93    
ref|XP_008446314.1|  PREDICTED: LOW QUALITY PROTEIN: alpha-amylas...    316   1e-93    
ref|XP_010259589.1|  PREDICTED: uncharacterized protein LOC104598...    317   1e-93    
ref|XP_009587654.1|  PREDICTED: uncharacterized protein LOC104085...    317   1e-93    
ref|XP_009587655.1|  PREDICTED: uncharacterized protein LOC104085...    317   2e-93    
ref|XP_007157383.1|  hypothetical protein PHAVU_002G065700g             316   2e-93    
ref|XP_011086391.1|  PREDICTED: alpha-amylase 3, chloroplastic          316   3e-93    
ref|XP_006842120.1|  hypothetical protein AMTR_s00078p00105470          317   3e-93    
ref|XP_008230873.1|  PREDICTED: uncharacterized protein LOC103330100    317   3e-93    
ref|XP_007217072.1|  hypothetical protein PRUPE_ppa000951mg             315   5e-93    
ref|XP_010242366.1|  PREDICTED: alpha-amylase 3, chloroplastic-li...    315   6e-93    
ref|XP_009758348.1|  PREDICTED: alpha-amylase 3, chloroplastic is...    314   6e-93    
ref|XP_009758349.1|  PREDICTED: alpha-amylase 3, chloroplastic is...    314   7e-93    
ref|XP_008339932.1|  PREDICTED: alpha-amylase 3, chloroplastic-like     315   7e-93    
gb|KFK41403.1|  hypothetical protein AALP_AA2G126100                    313   1e-92    
ref|XP_002446386.1|  hypothetical protein SORBIDRAFT_06g015110          301   1e-92    
ref|XP_003081461.1|  alpha amylase 2 (IC)                               302   1e-92    
dbj|BAJ85499.1|  predicted protein                                      313   1e-92    
ref|WP_014625247.1|  alpha-amylase                                      301   1e-92    
ref|XP_004155323.1|  PREDICTED: LOW QUALITY PROTEIN: alpha-amylas...    313   1e-92    
ref|XP_004135194.1|  PREDICTED: alpha-amylase 3, chloroplastic-like     313   1e-92    
ref|XP_010415645.1|  PREDICTED: alpha-amylase 3, chloroplastic-like     313   1e-92    
ref|XP_010512041.1|  PREDICTED: alpha-amylase 3, chloroplastic          313   1e-92    
ref|XP_004499315.1|  PREDICTED: probable alpha-amylase 2-like iso...    300   2e-92    
emb|CAH58639.1|  alpha-amylase                                          300   2e-92    
ref|XP_004499314.1|  PREDICTED: probable alpha-amylase 2-like iso...    300   2e-92    
ref|XP_009599230.1|  PREDICTED: alpha-amylase 3, chloroplastic is...    313   2e-92    
ref|XP_001416368.1|  predicted protein                                  301   2e-92    
ref|XP_004499316.1|  PREDICTED: probable alpha-amylase 2-like iso...    300   2e-92    
ref|XP_009599231.1|  PREDICTED: alpha-amylase 3, chloroplastic is...    313   2e-92    
ref|XP_004306075.1|  PREDICTED: uncharacterized protein LOC101298534    314   2e-92    
ref|XP_004499317.1|  PREDICTED: probable alpha-amylase 2-like iso...    300   2e-92    
ref|NP_001274982.1|  alpha-amylase                                      300   2e-92    
gb|ACV30014.1|  alpha-amylase                                           300   2e-92    
ref|XP_004291317.1|  PREDICTED: probable alpha-amylase 2-like           300   3e-92    
ref|XP_010470985.1|  PREDICTED: alpha-amylase 3, chloroplastic-like     312   3e-92    
emb|CDP10408.1|  unnamed protein product                                299   5e-92    
ref|XP_001752981.1|  predicted protein                                  298   5e-92    
gb|KDO82800.1|  hypothetical protein CISIN_1g002585mg                   312   5e-92    
gb|AAG52558.1|AC010675_6  putative alpha-amylase; 60344-64829           310   5e-92    
ref|XP_002520134.1|  alpha-amylase, putative                            312   5e-92    
ref|NP_001241207.1|  uncharacterized protein LOC100813490               298   6e-92    
gb|KHN08705.1|  Alpha-amylase                                           310   9e-92    
ref|XP_008357776.1|  PREDICTED: uncharacterized protein LOC103421512    312   1e-91    
gb|KDP27239.1|  hypothetical protein JCGZ_19938                         311   1e-91    
gb|EPS66762.1|  alpha-amylase                                           298   1e-91    
ref|XP_006300708.1|  hypothetical protein CARUB_v10019759mg             310   1e-91    
ref|XP_006574559.1|  PREDICTED: alpha-amylase 3, chloroplastic-like     311   2e-91    
gb|AHI58937.1|  alpha-amylase 3                                         307   2e-91    
ref|NP_564977.1|  alpha-amylase-like 3                                  310   2e-91    
ref|XP_006357265.1|  PREDICTED: alpha-amylase 3, chloroplastic-like     310   2e-91    
ref|XP_004238402.1|  PREDICTED: probable alpha-amylase 2                297   2e-91    
ref|XP_007046219.1|  Alpha-amylase-like 3 isoform 1                     310   3e-91    
ref|XP_011099800.1|  PREDICTED: probable alpha-amylase 2                297   3e-91    
ref|XP_003062493.1|  glycoside hydrolase family 13 protein              304   4e-91    
ref|XP_006390960.1|  hypothetical protein EUTSA_v10018099mg             309   5e-91    
ref|XP_002888741.1|  hypothetical protein ARALYDRAFT_339218             308   6e-91    
gb|AAA91884.1|  alpha-amylase                                           296   8e-91    
ref|XP_006342097.1|  PREDICTED: probable alpha-amylase 2 isoform X2     295   8e-91    
ref|XP_004975500.1|  PREDICTED: probable alpha-amylase 2-like           295   1e-90    
ref|XP_004238770.1|  PREDICTED: alpha-amylase 3, chloroplastic          308   1e-90    
ref|XP_009365931.1|  PREDICTED: uncharacterized protein LOC103955752    309   1e-90    



>dbj|BAC02435.1| alpha-amylase [Ipomoea nil]
Length=424

 Score =   542 bits (1397),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 279/433 (64%), Positives = 340/433 (79%), Gaps = 18/433 (4%)
 Frame = +2

Query  56    YLSLFCIAFFLFPLHSSSTVLFQGFTWTSKDQPGGWWNWLITKVPDLADAGITHVWLPPP  235
             +LS FC+A    P    ST+LFQGF W S  Q GGW+N LI  +PDLA+AGITHVWLPPP
Sbjct  6     FLSCFCLACIFVPA-IGSTLLFQGFNWESNKQQGGWYNSLINSIPDLANAGITHVWLPPP  64

Query  236   SNAREGDDQGYMPKRMYDLDTSKYGNKKELKALNDAFHGRGIKSVADIVLNHRAAERANS  415
             S++     QGYMP R+YDLD SKYGNK++L+AL  A H +GIK+VADIV+NHR A+  +S
Sbjct  65    SHSVA--PQGYMPGRLYDLDASKYGNKQQLQALVAALHDKGIKAVADIVINHRCADYKDS  122

Query  416   RGVFNVFEGGTPDDKLDWGPSEICGDDAAF-EGTGNPDTGDPWGDAPDIDHRSPRVQREI  592
             RG++ +FEGGTPDD+LDWGP  IC DD  + +GTGN DTG  +G APDIDH +PRVQ+E+
Sbjct  123   RGIYCIFEGGTPDDRLDWGPGLICKDDTQYSDGTGNADTGMDFGGAPDIDHLNPRVQKEL  182

Query  593   SEWMNWLKSDVGFDGWRFDYVKGYDFVKGFAAVKIYMDNTKPEFAVGELWNALSPGSVPN  772
             SEWMNWLKS++GFDGWRFD+V+GY      +  KIYM+NT PEFAVGE W++++ GS   
Sbjct  183   SEWMNWLKSEIGFDGWRFDFVRGY----AASLTKIYMENTSPEFAVGEFWDSMAYGSDGK  238

Query  773   PDYNQDAHRNELVRWVQNaggaatafdfttKGILQAALNNTELWRLKDAAGKPSGMIGVL  952
             PDYNQD HRNEL +WVQN GGA TAFDFTTKGILQAA+ + ELWRLKD  GKP G+IG+ 
Sbjct  239   PDYNQDNHRNELSQWVQNGGGAVTAFDFTTKGILQAAVLD-ELWRLKDPNGKPPGLIGIS  297

Query  953   PQSAVTFIDNHDTWS-QRLWPFTTSTDDAVNHDRVLQGYAYILTHPGIPSVFYDHFFEWG  1129
             P++AVTFIDNHDT S Q +WPF+         D+V+QGYAYILTHPG+P VFYDHFF+WG
Sbjct  298   PKNAVTFIDNHDTGSTQSMWPFS--------KDKVIQGYAYILTHPGVPCVFYDHFFDWG  349

Query  1130  LKDAISKLISIRNKNGVSATSPVEILAADADLYIAKINGKVILKIGPNGDLKNLVPSDFM  1309
             LKD ISKL SIR++NG+S TS VEILAADAD Y+AKI+ KVI+KIG   D+ NL+P +F 
Sbjct  350   LKDEISKLTSIRSRNGISETSNVEILAADADAYVAKIDDKVIMKIGSKYDVGNLIPPNFN  409

Query  1310  LATSGKDFAVWEK  1348
             L TSG+D+AVWEK
Sbjct  410   LVTSGQDYAVWEK  422



>emb|CDP01359.1| unnamed protein product [Coffea canephora]
Length=428

 Score =   539 bits (1389),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 274/441 (62%), Positives = 345/441 (78%), Gaps = 18/441 (4%)
 Frame = +2

Query  32    ETIMKSSFYLSLFCIAFFLFPLHSSSTVLFQGFTWTSKDQPGGWWNWLITKVPDLADAGI  211
             + +M S  Y  L     F FP  ++ T+LFQGF W S ++ GGW+N+L+ ++ DLA AG+
Sbjct  2     KNLMISLAYFFLIAGVCF-FPNVAAQTLLFQGFNWESSNKQGGWYNFLLNEISDLASAGV  60

Query  212   THVWLPPPSNAREGDDQGYMPKRMYDLDTSKYGNKKELKALNDAFHGRGIKSVADIVLNH  391
             THVWLPPPS++     QGYMP R+YDLD SKYGNK++LK L  AFH +GIK VADIV+NH
Sbjct  61    THVWLPPPSHSVA--PQGYMPGRLYDLDASKYGNKQQLKTLIKAFHDKGIKCVADIVINH  118

Query  392   RAAERANSRGVFNVFEGGTPDDKLDWGPSEICGDDAAF-EGTGNPDTGDPWGDAPDIDHR  568
             R A++ +SRG++ +FEGGTPDD+LDWGPS IC DD  + +GTGNPDTGD +G APDIDH 
Sbjct  119   RCADKQDSRGIYCIFEGGTPDDRLDWGPSCICKDDVQYSDGTGNPDTGDGFGGAPDIDHL  178

Query  569   SPRVQREISEWMNWLKSDVGFDGWRFDYVKGYDFVKGFAAVKIYMDNTKPEFAVGELWNA  748
             + RVQRE+S+WMNWLKSD+GFDGWRFD+V+GY      +  KIYM NTKP FAVGELW++
Sbjct  179   NSRVQRELSDWMNWLKSDIGFDGWRFDFVRGY----APSITKIYMQNTKPGFAVGELWDS  234

Query  749   LSPGSVPNPDYNQDAHRNELVRWVQNaggaatafdfttKGILQAALNNTELWRLKDAAGK  928
             LS G    PDYNQD HRN L +WVQN GGA TAFDFTTKGILQ A+   ELWRLKD+ G 
Sbjct  235   LSYGQDGKPDYNQDGHRNRLAQWVQNGGGAVTAFDFTTKGILQVAVQG-ELWRLKDSNGN  293

Query  929   PSGMIGVLPQSAVTFIDNHDTWS-QRLWPFTTSTDDAVNHDRVLQGYAYILTHPGIPSVF  1105
             P G+IG+LPQ+AVTFIDNHDT S Q+LWPF +        D+V+QGYAYILTHPGIPS+F
Sbjct  294   PPGLIGILPQNAVTFIDNHDTGSTQKLWPFPS--------DKVMQGYAYILTHPGIPSLF  345

Query  1106  YDHFFEWGLKDAISKLISIRNKNGVSATSPVEILAADADLYIAKINGKVILKIGPNGDLK  1285
             YDH F+WGLKD I+KL ++R +NG++ATS V+ILA+D+DLY+AKI+ K+I+KIGP  DL 
Sbjct  346   YDHLFDWGLKDGITKLSTLRIRNGITATSKVQILASDSDLYVAKIDDKIIVKIGPKLDLG  405

Query  1286  NLVPSDFMLATSGKDFAVWEK  1348
             NL+P ++ ++TSG D+AVWE+
Sbjct  406   NLIPPNYQVSTSGNDYAVWER  426



>ref|XP_009758535.1| PREDICTED: alpha-amylase [Nicotiana sylvestris]
Length=422

 Score =   538 bits (1387),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 272/435 (63%), Positives = 345/435 (79%), Gaps = 19/435 (4%)
 Frame = +2

Query  62    SLF--CIAFFLFPLHSSSTVLFQGFTWTSKDQPGGWWNWLITKVPDLADAGITHVWLPPP  235
             SLF  C+   LFP+ ++ T+LFQGF W S +Q GGW+N LI  VPDLA AGITHVWLPP 
Sbjct  3     SLFPLCLILSLFPIFATPTLLFQGFNWESSNQQGGWYNSLINLVPDLAKAGITHVWLPPS  62

Query  236   SNAREGDDQGYMPKRMYDLDTSKYGNKKELKALNDAFHGRGIKSVADIVLNHRAAERANS  415
             SN+     QGYMP R+YDLDTSKYGN+++L+AL  A H +GIK+VADIV+NHR A++ +S
Sbjct  63    SNSVS--PQGYMPGRLYDLDTSKYGNQQQLQALIKALHDQGIKAVADIVINHRCADKKDS  120

Query  416   RGVFNVFEGGTPDDKLDWGPSEICGDDAAF-EGTGNPDTGDPWGDAPDIDHRSPRVQREI  592
             RG++ +FEGGT DD+LDWGP  IC  D+ + +GTGN DTG  +  APDIDH +P+VQ+E+
Sbjct  121   RGIYCIFEGGTSDDRLDWGPHMICKGDSQYSDGTGNDDTGLDFAAAPDIDHLNPQVQKEL  180

Query  593   SEWMNWLKSDVGFDGWRFDYVKGYDFVKGFAAVKIYMDNTKPEFAVGELWNALSPGSVPN  772
             S+WMNWLK+++GFDGWRFD+V+GY      +  KIYM+NT P+FAVGE WN+++ G    
Sbjct  181   SDWMNWLKTEIGFDGWRFDFVRGY----APSITKIYMENTSPDFAVGEFWNSIAYGGDGK  236

Query  773   PDYNQDAHRNELVRWVQNaggaatafdfttKGILQAALNNTELWRLKDAAGKPSGMIGVL  952
             PDYNQD HRNEL  WVQN GGA TAFDFTTKGILQAA+   ELWRLKD+ GKP G+IG+L
Sbjct  237   PDYNQDNHRNELAGWVQNGGGAVTAFDFTTKGILQAAVEG-ELWRLKDSNGKPPGLIGIL  295

Query  953   PQSAVTFIDNHDTWS-QRLWPFTTSTDDAVNHDRVLQGYAYILTHPGIPSVFYDHFFEWG  1129
             PQ+AVTFIDNHDT S Q+LWPF +        D+V+QGYAYILTHPGIPSVFYDHFF+WG
Sbjct  296   PQNAVTFIDNHDTGSTQKLWPFPS--------DKVMQGYAYILTHPGIPSVFYDHFFDWG  347

Query  1130  LKDAISKLISIRNKNGVSATSPVEILAADADLYIAKINGKVILKIGPNGDLKNLVPSDFM  1309
             LKD IS L+SIRN+NG+SATS V+I+AADADLY+A ++ K+++KIGP  DL +L+P ++ 
Sbjct  348   LKDGISTLVSIRNRNGISATSNVQIMAADADLYVAMVDQKIVVKIGPKTDLGSLIPPNYQ  407

Query  1310  LATSGKDFAVWEKPT  1354
             +ATSG+D+ VWE+ +
Sbjct  408   VATSGQDYVVWEQKS  422



>ref|XP_009586775.1| PREDICTED: alpha-amylase [Nicotiana tomentosiformis]
Length=422

 Score =   537 bits (1384),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 272/435 (63%), Positives = 343/435 (79%), Gaps = 19/435 (4%)
 Frame = +2

Query  62    SLF--CIAFFLFPLHSSSTVLFQGFTWTSKDQPGGWWNWLITKVPDLADAGITHVWLPPP  235
             SLF  C+   LFP+ ++ T+LFQGF W S +Q GGW+N LI  VPDLA AG+THVWLPP 
Sbjct  3     SLFPLCLILSLFPIFATPTLLFQGFNWESSNQQGGWYNSLINLVPDLAKAGVTHVWLPPS  62

Query  236   SNAREGDDQGYMPKRMYDLDTSKYGNKKELKALNDAFHGRGIKSVADIVLNHRAAERANS  415
             SN+     QGYMP R+YDLDTSKYGN+++L+AL  A H +GIK VADIV+NHR A++ +S
Sbjct  63    SNSVS--PQGYMPGRLYDLDTSKYGNQQQLQALIKALHDQGIKVVADIVINHRCADKKDS  120

Query  416   RGVFNVFEGGTPDDKLDWGPSEIC-GDDAAFEGTGNPDTGDPWGDAPDIDHRSPRVQREI  592
             RG++ +FEGGT DD+LDWGP  IC GD    +GTGN DTG  +  APDIDH +P+VQ+E+
Sbjct  121   RGIYCIFEGGTSDDRLDWGPHMICKGDTQYSDGTGNDDTGLDFAAAPDIDHLNPQVQKEL  180

Query  593   SEWMNWLKSDVGFDGWRFDYVKGYDFVKGFAAVKIYMDNTKPEFAVGELWNALSPGSVPN  772
             S+WMNWLK+++GFDGWRFD+V+GY      +  KIYM+NT P+FAVGE WN+++ G    
Sbjct  181   SDWMNWLKTEIGFDGWRFDFVRGY----APSITKIYMENTSPDFAVGEFWNSIAYGGDGK  236

Query  773   PDYNQDAHRNELVRWVQNaggaatafdfttKGILQAALNNTELWRLKDAAGKPSGMIGVL  952
             PDYNQD HRNEL  WVQN GGA T FDFTTKGILQAA+   ELWRLKD+ GKP G+IG+L
Sbjct  237   PDYNQDNHRNELAGWVQNGGGAVTTFDFTTKGILQAAVEG-ELWRLKDSNGKPPGLIGIL  295

Query  953   PQSAVTFIDNHDTWS-QRLWPFTTSTDDAVNHDRVLQGYAYILTHPGIPSVFYDHFFEWG  1129
             PQ+AVTFIDNHDT S Q+LWPF +        D+V+QGYAYILTHPGIPSVFYDHFF+WG
Sbjct  296   PQNAVTFIDNHDTGSTQKLWPFPS--------DKVMQGYAYILTHPGIPSVFYDHFFDWG  347

Query  1130  LKDAISKLISIRNKNGVSATSPVEILAADADLYIAKINGKVILKIGPNGDLKNLVPSDFM  1309
             LKD IS L+SIRN+NG+SATS V+I+AA+ADLY+A ++ K+I+KIGP  DL +L+P ++ 
Sbjct  348   LKDGISTLVSIRNRNGISATSNVQIMAANADLYVAMVDKKIIVKIGPKTDLGSLIPPNYQ  407

Query  1310  LATSGKDFAVWEKPT  1354
             +ATSG+D+AVWE+ +
Sbjct  408   VATSGQDYAVWEQKS  422



>ref|XP_004235226.1| PREDICTED: alpha-amylase [Solanum lycopersicum]
Length=453

 Score =   528 bits (1360),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 279/434 (64%), Positives = 336/434 (77%), Gaps = 20/434 (5%)
 Frame = +2

Query  62    SLF--CIAF-FLFPLHSSSTVLFQGFTWTSKDQPGGWWNWLITKVPDLADAGITHVWLPP  232
             SLF  C+ F F  P+ +SSTVLFQGF W S ++  GW+N LI  VPDLA AG+THVWLPP
Sbjct  12    SLFPLCLIFSFFLPMFASSTVLFQGFNWESSNKQSGWYNSLINLVPDLAHAGVTHVWLPP  71

Query  233   PSNAREGDDQGYMPKRMYDLDTSKYGNKKELKALNDAFHGRGIKSVADIVLNHRAAERAN  412
              S++     QGYMP R+YDLD SK+GN++ELKAL  A    GIKSVADIV+NHR A++ +
Sbjct  72    SSHSVS--PQGYMPGRLYDLDASKFGNQQELKALIKALRDYGIKSVADIVINHRCADKKD  129

Query  413   SRGVFNVFEGGTPDDKLDWGPSEICGDDAAF-EGTGNPDTGDPWGDAPDIDHRSPRVQRE  589
             SRG++ +FEGGT DD+LDWGPS IC DD  + +GTGN DTG  +  APDIDH + RVQ+E
Sbjct  130   SRGIYCIFEGGTTDDRLDWGPSFICKDDIQYSDGTGNLDTGLDFEPAPDIDHLNIRVQKE  189

Query  590   ISEWMNWLKSDVGFDGWRFDYVKGYDFVKGFAAVKIYMDNTKPEFAVGELWNALSPGSVP  769
             +S+WMNWLKS++GFDGWRFD+V+GY         KIYM NT P+FAVGE WN+L+ G   
Sbjct  190   LSDWMNWLKSEIGFDGWRFDFVRGY----APNITKIYMGNTSPDFAVGEFWNSLAYGQDG  245

Query  770   NPDYNQDAHRNELVRWVQNaggaatafdfttKGILQAALNNTELWRLKDAAGKPSGMIGV  949
              PDYNQD HRNELV WVQN GGA TAFDFTTKGILQAA+   ELWRLKD+ GKP GMIGV
Sbjct  246   KPDYNQDNHRNELVGWVQNGGGAVTAFDFTTKGILQAAVEG-ELWRLKDSHGKPPGMIGV  304

Query  950   LPQSAVTFIDNHDTWS-QRLWPFTTSTDDAVNHDRVLQGYAYILTHPGIPSVFYDHFFEW  1126
             LPQ+AVTFIDNHDT S Q +WPF +        D+V+QGYAYILTHPGIP VFYDHFF+W
Sbjct  305   LPQNAVTFIDNHDTGSTQNMWPFPS--------DKVMQGYAYILTHPGIPLVFYDHFFDW  356

Query  1127  GLKDAISKLISIRNKNGVSATSPVEILAADADLYIAKINGKVILKIGPNGDLKNLVPSDF  1306
             GLKD IS LISIR ++G+ ATS V+ILA+D+DLYIA I+ K+I+KIGP  DL NL+P  +
Sbjct  357   GLKDGISALISIRKRSGICATSNVQILASDSDLYIAMIDQKIIVKIGPKLDLGNLIPPSY  416

Query  1307  MLATSGKDFAVWEK  1348
              +ATSG+D+AVWEK
Sbjct  417   QVATSGQDYAVWEK  430



>gb|AFO84070.1| alpha-amylase [Actinidia chinensis]
Length=427

 Score =   524 bits (1350),  Expect = 1e-179, Method: Compositional matrix adjust.
 Identities = 271/442 (61%), Positives = 340/442 (77%), Gaps = 21/442 (5%)
 Frame = +2

Query  41    MKSSF--YLSLFCIAFFLFP--LHSSSTVLFQGFTWTSKDQPGGWWNWLITKVPDLADAG  208
             M ++F  ++S   +A  +FP  L ++ T+L QGF W S ++  GW+N L+  +PDLA AG
Sbjct  1     MTTNFLSFVSFVSLALLIFPTALLAAPTLLIQGFNWESSNKQEGWYNSLLNSIPDLASAG  60

Query  209   ITHVWLPPPSNAREGDDQGYMPKRMYDLDTSKYGNKKELKALNDAFHGRGIKSVADIVLN  388
             ITHVWLPPPS +     QGYMP R+YDL+ SKYGN+ ELK L  AF  +GIK VADIV+N
Sbjct  61    ITHVWLPPPSQSVSS--QGYMPGRLYDLNASKYGNQAELKTLVKAFRDKGIKCVADIVIN  118

Query  389   HRAAERANSRGVFNVFEGGTPDDKLDWGPSEICGDDAAF-EGTGNPDTGDPWGDAPDIDH  565
             HR AE+ +SRG++ +FEGGT DD+LDWGPS IC DD  + +GTGNPDTG  +  APDIDH
Sbjct  119   HRCAEKQDSRGIWCIFEGGTSDDRLDWGPSFICKDDTQYSDGTGNPDTGGDFEPAPDIDH  178

Query  566   RSPRVQREISEWMNWLKSDVGFDGWRFDYVKGYDFVKGFAAVKIYMDNTKPEFAVGELWN  745
              +PRVQRE+S+WMNWLKS++GFDGWRFD+VKGY      +  K YM NT P+FAVGE WN
Sbjct  179   LNPRVQRELSDWMNWLKSEIGFDGWRFDFVKGY----APSITKNYMQNTSPDFAVGEYWN  234

Query  746   ALSPGSVPNPDYNQDAHRNELVRWVQNaggaatafdfttKGILQAALNNTELWRLKDAAG  925
             +LS G    P+YNQD HRN+LV+WVQ AGGA TAFDFTTKGILQAA+   ELWR+KD+ G
Sbjct  235   SLSYGQDGKPNYNQDQHRNDLVQWVQAAGGAVTAFDFTTKGILQAAVQG-ELWRMKDSNG  293

Query  926   KPSGMIGVLPQSAVTFIDNHDTWS-QRLWPFTTSTDDAVNHDRVLQGYAYILTHPGIPSV  1102
             KP GMIGVLPQ+AVTFIDNHDT S Q++WPF +        D+V+QGYAYILTHPGIPSV
Sbjct  294   KPPGMIGVLPQNAVTFIDNHDTGSTQKIWPFPS--------DKVMQGYAYILTHPGIPSV  345

Query  1103  FYDHFFEWGLKDAISKLISIRNKNGVSATSPVEILAADADLYIAKINGKVILKIGPNGDL  1282
             FYDHFF+WGLKD I++L +IR +N + ATS V+I+A+D DLY+A ++ K+I+KIGP  DL
Sbjct  346   FYDHFFDWGLKDQIARLTAIRTRNSIGATSKVQIMASDPDLYVAMVDDKIIVKIGPKLDL  405

Query  1283  KNLVPSDFMLATSGKDFAVWEK  1348
              NL+P +F ++TSG D+AVWEK
Sbjct  406   GNLIPPNFHVSTSGNDYAVWEK  427



>gb|AAA16513.1| alpha amylase precursor, partial [Cuscuta reflexa]
Length=423

 Score =   523 bits (1347),  Expect = 3e-179, Method: Compositional matrix adjust.
 Identities = 271/433 (63%), Positives = 333/433 (77%), Gaps = 19/433 (4%)
 Frame = +2

Query  56    YLSLFCIAFFLFPLHSSSTVLFQGFTWTSKDQPGGWWNWLITKVPDLADAGITHVWLPPP  235
             +LS  CIAFF  P    STVLFQGF W S  Q GGW+N LI  +PDLA+AGITHVWLPP 
Sbjct  3     FLSCICIAFFFVPA-IGSTVLFQGFNWESNKQQGGWYNSLINLIPDLANAGITHVWLPPS  61

Query  236   SNAREGDDQGYMPKRMYDLDTSKYGNKKELKALNDAFHGRGIKSVADIVLNHRAAERANS  415
             S++     QGYMP R+YDLD SKYGNK++L++L  A H +GIK+VADIV+NHR A+  +S
Sbjct  62    SHSVS--PQGYMPGRLYDLDASKYGNKQQLQSLVQALHAKGIKAVADIVINHRCADYKDS  119

Query  416   RGVFNVFEGGTPDDKLDWGPSEICGDDAAF-EGTGNPDTGDPWGDAPDIDHRSPRVQREI  592
             RG++ +FEGGT D +LDWGPS IC DD  + +GTGNPDTG  +  APDIDH + RVQ+E+
Sbjct  120   RGIYCLFEGGTSDGRLDWGPSHICKDDTQYSDGTGNPDTGMDFAAAPDIDHLNSRVQKEL  179

Query  593   SEWMNWLKSDVGFDGWRFDYVKGYDFVKGFAAVKIYMDNTKPEFAVGELWNALSPGSVPN  772
             SEWMNWLKS++GFDGWRFD+V+GY      +  KIYM NT P+FAVGE WN+L+ GS   
Sbjct  180   SEWMNWLKSEIGFDGWRFDFVRGY----APSITKIYMGNTSPDFAVGEFWNSLAYGSDGK  235

Query  773   PDYNQDAHRNELVRWVQNaggaatafdfttKGILQAALNNTELWRLKDAAGKPSGMIGVL  952
             P+YNQD HRNEL +WVQN GG+ TAFDFTTKGILQAA+   ELWRLKD+ GKP G+IG+ 
Sbjct  236   PNYNQDNHRNELSQWVQNGGGSVTAFDFTTKGILQAAVQG-ELWRLKDSNGKPPGLIGIS  294

Query  953   PQSAVTFIDNHDTWS-QRLWPFTTSTDDAVNHDRVLQGYAYILTHPGIPSVFYDHFFEWG  1129
             P++AVTF+DNHDT S Q+LWPF         +D+V+QGYAYI+THPG+PSVFYDHFF+WG
Sbjct  295   PKNAVTFVDNHDTGSTQKLWPFP--------NDKVMQGYAYIITHPGVPSVFYDHFFDWG  346

Query  1130  LKDAISKLISIRNKNGVSATSPVEILAADADLYIAKINGKVILKIGPNGDLKNLVPSDFM  1309
             LK  I  LIS RN+NG++ TS V ILAAD DLY+AK++ KVI+KIG   DL NL+P  F 
Sbjct  347   LKAQI-LLISSRNRNGITETSSVNILAADHDLYVAKVDDKVIVKIGTRMDLGNLIPPGFK  405

Query  1310  LATSGKDFAVWEK  1348
             +  SG+D+AVWEK
Sbjct  406   VVASGQDYAVWEK  418



>ref|XP_006354888.1| PREDICTED: alpha-amylase-like [Solanum tuberosum]
Length=423

 Score =   522 bits (1344),  Expect = 8e-179, Method: Compositional matrix adjust.
 Identities = 275/438 (63%), Positives = 338/438 (77%), Gaps = 19/438 (4%)
 Frame = +2

Query  41    MKSSFYLSLFCIAFFLFPLHSSSTVLFQGFTWTSKDQPGGWWNWLITKVPDLADAGITHV  220
             M S F L L  ++ FL P+ +SSTVLFQGF W S ++ GGW+N LI  VPDLA AG+THV
Sbjct  1     MNSIFPLCLI-LSLFL-PMFASSTVLFQGFNWESSNKQGGWYNSLINLVPDLAKAGVTHV  58

Query  221   WLPPPSNAREGDDQGYMPKRMYDLDTSKYGNKKELKALNDAFHGRGIKSVADIVLNHRAA  400
             WLPP S++     QGYMP R+YDLD SK+GN+++LK L  A H  GIKSVADIV+NHR A
Sbjct  59    WLPPSSHSVA--PQGYMPGRLYDLDASKFGNQQQLKTLIKALHDHGIKSVADIVINHRTA  116

Query  401   ERANSRGVFNVFEGGTPDDKLDWGPSEICGDDAAF-EGTGNPDTGDPWGDAPDIDHRSPR  577
             +  +SRG++++FEGGT DD+LDWGPS IC +D  + +GTGNPDTG  +  APDIDH + R
Sbjct  117   DNKDSRGIYSIFEGGTSDDRLDWGPSFICKNDTQYSDGTGNPDTGLDFEPAPDIDHLNTR  176

Query  578   VQREISEWMNWLKSDVGFDGWRFDYVKGYDFVKGFAAVKIYMDNTKPEFAVGELWNALSP  757
             VQ+E+S+WMNWLKS++GFDGWRFD+V+GY         KIYM NT P+FAVGE WN+L+ 
Sbjct  177   VQKELSDWMNWLKSEIGFDGWRFDFVRGY----APCITKIYMRNTSPDFAVGEFWNSLAY  232

Query  758   GSVPNPDYNQDAHRNELVRWVQNaggaatafdfttKGILQAALNNTELWRLKDAAGKPSG  937
             G    P+YNQD HRNELV WV+NAG A TAFDFTTKGILQAA+   ELWRLKD  GKP G
Sbjct  233   GQDGKPEYNQDNHRNELVDWVKNAGWAVTAFDFTTKGILQAAVQG-ELWRLKDPNGKPPG  291

Query  938   MIGVLPQSAVTFIDNHDTWS-QRLWPFTTSTDDAVNHDRVLQGYAYILTHPGIPSVFYDH  1114
             MIGVLP+ AVTFIDNHDT S Q +WPF +        D+V+QGYAYILTHPGIPSVFYDH
Sbjct  292   MIGVLPRKAVTFIDNHDTGSTQNMWPFPS--------DKVMQGYAYILTHPGIPSVFYDH  343

Query  1115  FFEWGLKDAISKLISIRNKNGVSATSPVEILAADADLYIAKINGKVILKIGPNGDLKNLV  1294
             FF+WG KD IS LISIR +N + ATS V+I+A+D+DLYIA I+ K+I+KIGP  DL NL+
Sbjct  344   FFDWGFKDGISALISIRKRNRICATSNVQIMASDSDLYIAMIHHKIIVKIGPKLDLGNLI  403

Query  1295  PSDFMLATSGKDFAVWEK  1348
             P ++ +ATSG+D+AVWE+
Sbjct  404   PPNYEVATSGQDYAVWEQ  421



>ref|XP_003589186.1| Alpha-amylase [Medicago truncatula]
 gb|AES59437.1| alpha amylase domain protein [Medicago truncatula]
Length=421

 Score =   522 bits (1344),  Expect = 8e-179, Method: Compositional matrix adjust.
 Identities = 269/437 (62%), Positives = 336/437 (77%), Gaps = 18/437 (4%)
 Frame = +2

Query  41    MKSSFYLSLFCIAFFLFPLHSSSTVLFQGFTWTSKDQPGGWWNWLITKVPDLADAGITHV  220
             M S  +LSLFC    +FPL +SST+LFQGF W S ++ GGW+N L   +PDLA+AGITHV
Sbjct  1     MNSLPWLSLFCFCLSIFPLLASSTLLFQGFNWESSNK-GGWYNSLKNLIPDLANAGITHV  59

Query  221   WLPPPSNAREGDDQGYMPKRMYDLDTSKYGNKKELKALNDAFHGRGIKSVADIVLNHRAA  400
             WLPPPS +     QGY+P R+YDLD SKYG+K +LK+L  AF  +GI  +ADIV+NHR A
Sbjct  60    WLPPPSQSV--GPQGYLPGRLYDLDASKYGSKDDLKSLIAAFKDKGINCLADIVINHRTA  117

Query  401   ERANSRGVFNVFEGGTPDDKLDWGPSEICGDDAAF-EGTGNPDTGDPWGDAPDIDHRSPR  577
             ER + RG++ +FEGGTPD KLDWGPS IC DD A+ +GTGN D+G+ +  APDIDH +P+
Sbjct  118   ERKDDRGIYCLFEGGTPDSKLDWGPSFICKDDTAYSDGTGNLDSGEGYQAAPDIDHLNPQ  177

Query  578   VQREISEWMNWLKSDVGFDGWRFDYVKGYDFVKGFAAVKIYMDNTKPEFAVGELWNALSP  757
             VQ+E+SEWMNWLK+++GF GWRFD+VKGY      +  KIYM+NT P+FAVGE WN+LS 
Sbjct  178   VQKELSEWMNWLKTEIGFSGWRFDFVKGY----APSITKIYMENTSPDFAVGEYWNSLSY  233

Query  758   GSVPNPDYNQDAHRNELVRWVQNaggaatafdfttKGILQAALNNTELWRLKDAAGKPSG  937
             G     +YNQDA R ELV WV+N GG   AFDFTTKGILQAA+   ELWRLKD+ GKP G
Sbjct  234   GQDGKLNYNQDAARGELVNWVENGGGVVNAFDFTTKGILQAAVQG-ELWRLKDSNGKPPG  292

Query  938   MIGVLPQSAVTFIDNHDTWS-QRLWPFTTSTDDAVNHDRVLQGYAYILTHPGIPSVFYDH  1114
             +IG+ P++  TFIDNHDT S Q+LWPF +        D+V+QGYAYILTHPG PS+FYDH
Sbjct  293   LIGIKPENGATFIDNHDTGSTQKLWPFPS--------DKVMQGYAYILTHPGTPSIFYDH  344

Query  1115  FFEWGLKDAISKLISIRNKNGVSATSPVEILAADADLYIAKINGKVILKIGPNGDLKNLV  1294
             FF+WGLKD I+KL +IR +NG++  S V ILAADADLY+AKI+ K+I+KIGP  DL NL+
Sbjct  345   FFDWGLKDQIAKLTAIRQRNGINMKSTVNILAADADLYVAKIDNKIIVKIGPRMDLGNLI  404

Query  1295  PSDFMLATSGKDFAVWE  1345
             PS+F +ATSG+D+AVWE
Sbjct  405   PSNFHVATSGQDYAVWE  421



>gb|AFK42146.1| unknown [Medicago truncatula]
Length=421

 Score =   520 bits (1340),  Expect = 3e-178, Method: Compositional matrix adjust.
 Identities = 269/437 (62%), Positives = 335/437 (77%), Gaps = 18/437 (4%)
 Frame = +2

Query  41    MKSSFYLSLFCIAFFLFPLHSSSTVLFQGFTWTSKDQPGGWWNWLITKVPDLADAGITHV  220
             M S  +LSLFC    +FPL +SST+LFQGF W S ++ GGW+N L   +PDLA+AGITHV
Sbjct  1     MNSLPWLSLFCFCLSIFPLLASSTLLFQGFNWESSNK-GGWYNSLKNLIPDLANAGITHV  59

Query  221   WLPPPSNAREGDDQGYMPKRMYDLDTSKYGNKKELKALNDAFHGRGIKSVADIVLNHRAA  400
             WLPPPS +     QGY+P R+YDLD SKYG+K +LK+L  AF  +GI  +ADIV+NHR A
Sbjct  60    WLPPPSQSV--GPQGYLPGRLYDLDASKYGSKDDLKSLIAAFKDKGINCLADIVINHRTA  117

Query  401   ERANSRGVFNVFEGGTPDDKLDWGPSEICGDDAAF-EGTGNPDTGDPWGDAPDIDHRSPR  577
             ER + RG++ +FEGGTPD KLDWGPS IC DD A+ +GTGN D+G+ +  APDIDH +P+
Sbjct  118   ERKDDRGIYCLFEGGTPDSKLDWGPSFICKDDTAYSDGTGNLDSGEGYQAAPDIDHLNPQ  177

Query  578   VQREISEWMNWLKSDVGFDGWRFDYVKGYDFVKGFAAVKIYMDNTKPEFAVGELWNALSP  757
             VQ+E+SEWMNWLK+++GF GWRFD+VKGY      +  KIYM+NT P+FAVGE WN+LS 
Sbjct  178   VQKELSEWMNWLKTEIGFSGWRFDFVKGY----APSITKIYMENTSPDFAVGEYWNSLSY  233

Query  758   GSVPNPDYNQDAHRNELVRWVQNaggaatafdfttKGILQAALNNTELWRLKDAAGKPSG  937
             G     +YNQDA R ELV WV+N GG   AFDFTTKGILQAA+   ELWRLKD+ GKP G
Sbjct  234   GQDGKLNYNQDAARGELVNWVENGGGVVNAFDFTTKGILQAAVQG-ELWRLKDSNGKPPG  292

Query  938   MIGVLPQSAVTFIDNHDTWS-QRLWPFTTSTDDAVNHDRVLQGYAYILTHPGIPSVFYDH  1114
             +IG+ P++  TFIDNHDT S Q+LWPF +        D+V+QGYAYILTHPG PS+FYDH
Sbjct  293   LIGIKPENGATFIDNHDTGSTQKLWPFPS--------DKVMQGYAYILTHPGTPSIFYDH  344

Query  1115  FFEWGLKDAISKLISIRNKNGVSATSPVEILAADADLYIAKINGKVILKIGPNGDLKNLV  1294
             FF+WGLKD I KL +IR +NG++  S V ILAADADLY+AKI+ K+I+KIGP  DL NL+
Sbjct  345   FFDWGLKDQIVKLTAIRQRNGINMKSTVNILAADADLYVAKIDNKIIVKIGPRMDLGNLI  404

Query  1295  PSDFMLATSGKDFAVWE  1345
             PS+F +ATSG+D+AVWE
Sbjct  405   PSNFHVATSGQDYAVWE  421



>ref|XP_011083843.1| PREDICTED: alpha-amylase [Sesamum indicum]
 ref|XP_011083844.1| PREDICTED: alpha-amylase [Sesamum indicum]
Length=449

 Score =   521 bits (1341),  Expect = 5e-178, Method: Compositional matrix adjust.
 Identities = 266/431 (62%), Positives = 329/431 (76%), Gaps = 17/431 (4%)
 Frame = +2

Query  62    SLFCIAFFLFPLHSSSTVLFQGFTWTSKDQPGGWWNWLITKVPDLADAGITHVWLPPPSN  241
             S   +AF LFP  ++ T+LFQGF W S  + GGW+N L+  VPD+A A +THVWLPPPS 
Sbjct  32    SCLYLAFALFPSLAAPTLLFQGFNWESSGRKGGWYNSLLNVVPDIASARVTHVWLPPPS-  90

Query  242   AREGDDQGYMPKRMYDLDTSKYGNKKELKALNDAFHGRGIKSVADIVLNHRAAERANSRG  421
              +    QGY+P R+YDLD SKYGN  ELK L  A H  GIK+VADIV+NHR AE+ ++RG
Sbjct  91    -QSAAPQGYLPGRLYDLDASKYGNGAELKTLIKALHDNGIKAVADIVINHRTAEKMDARG  149

Query  422   VFNVFEGGTPDDKLDWGPSEICGDDAAF-EGTGNPDTGDPWGDAPDIDHRSPRVQREISE  598
             ++ +FEGGTPDD+LDWGPS IC DD  + +GTGNPD+GD +  APDIDH +PRVQ+E+S+
Sbjct  150   IYCIFEGGTPDDRLDWGPSFICKDDIKYSDGTGNPDSGDGYDAAPDIDHLNPRVQKELSD  209

Query  599   WMNWLKSDVGFDGWRFDYVKGYDFVKGFAAVKIYMDNTKPEFAVGELWNALSPGSVPNPD  778
             W+NWLK+++GFDGWR D+VKGY      +  KIYM+N+ P+FAVGELWN+L+ GS    +
Sbjct  210   WLNWLKNEIGFDGWRLDFVKGYSP----SITKIYMENSNPDFAVGELWNSLAYGSDGKLE  265

Query  779   YNQDAHRNELVRWVQNaggaatafdfttKGILQAALNNTELWRLKDAAGKPSGMIGVLPQ  958
             YNQD HRNEL +W Q+ GG  TAFDFTTKGILQAA+   E WRLKD+ G P G+IG+LP+
Sbjct  266   YNQDRHRNELAQWTQSGGGKVTAFDFTTKGILQAAVGG-EFWRLKDSNGNPPGLIGILPK  324

Query  959   SAVTFIDNHDTWS-QRLWPFTTSTDDAVNHDRVLQGYAYILTHPGIPSVFYDHFFEWGLK  1135
             +AVTFIDNHDT S Q +WPF          D+V QGYAYILTHPGIPSVFYDHFF+WG K
Sbjct  325   NAVTFIDNHDTGSTQNIWPFPA--------DKVSQGYAYILTHPGIPSVFYDHFFDWGKK  376

Query  1136  DAISKLISIRNKNGVSATSPVEILAADADLYIAKINGKVILKIGPNGDLKNLVPSDFMLA  1315
             D ISKL +IR +NG++ TS VEILAADADLY+AKI+ ++I KIGP  DL NL+P DF +A
Sbjct  377   DEISKLSAIRARNGITETSKVEILAADADLYVAKIDNRIITKIGPKMDLGNLIPPDFQVA  436

Query  1316  TSGKDFAVWEK  1348
              SG D+AVWEK
Sbjct  437   ASGIDYAVWEK  447



>gb|EYU25422.1| hypothetical protein MIMGU_mgv1a006910mg [Erythranthe guttata]
Length=426

 Score =   520 bits (1338),  Expect = 7e-178, Method: Compositional matrix adjust.
 Identities = 267/432 (62%), Positives = 323/432 (75%), Gaps = 17/432 (4%)
 Frame = +2

Query  59    LSLFCIAFFLFPLHSSSTVLFQGFTWTSKDQPGGWWNWLITKVPDLADAGITHVWLPPPS  238
             LS F I F  FP  + ST+L QGF W S ++ GGW+N L   VPD+A AG THVWLPPPS
Sbjct  9     LSSFLIVFGFFPALTRSTILLQGFNWESSNKRGGWYNTLQNVVPDIASAGFTHVWLPPPS  68

Query  239   NAREGDDQGYMPKRMYDLDTSKYGNKKELKALNDAFHGRGIKSVADIVLNHRAAERANSR  418
             ++     QGY+P R+YDLD SKYGN  ELKAL  + H +GIK+VADIV+NHR AER + R
Sbjct  69    HSVS--PQGYLPGRLYDLDASKYGNSNELKALIQSLHDKGIKAVADIVINHRTAERKDGR  126

Query  419   GVFNVFEGGTPDDKLDWGPSEICGDDAAF-EGTGNPDTGDPWGDAPDIDHRSPRVQREIS  595
             G++ +FEGGTPD +LDWGPS IC DD  + +GTGNPD+G  +  APDIDH +P VQ E+S
Sbjct  127   GIYCLFEGGTPDARLDWGPSFICKDDTQYSDGTGNPDSGAAYDAAPDIDHLNPTVQNELS  186

Query  596   EWMNWLKSDVGFDGWRFDYVKGYDFVKGFAAVKIYMDNTKPEFAVGELWNALSPGSVPNP  775
             +W+NWLK ++GFDGWRFD+VKGY         KIYMDNT+P+FAVGELWN++       P
Sbjct  187   DWLNWLKKEIGFDGWRFDFVKGYSP----RITKIYMDNTRPDFAVGELWNSIDYDGNGKP  242

Query  776   DYNQDAHRNELVRWVQNaggaatafdfttKGILQAALNNTELWRLKDAAGKPSGMIGVLP  955
              YNQD HRNEL RW  +AGG   AFDFTTKGILQAA+   ELWRL+D+ G P G+IG++P
Sbjct  243   AYNQDRHRNELARWAGDAGGNVAAFDFTTKGILQAAVQG-ELWRLRDSGGNPPGLIGIMP  301

Query  956   QSAVTFIDNHDTWS-QRLWPFTTSTDDAVNHDRVLQGYAYILTHPGIPSVFYDHFFEWGL  1132
              +AVTFIDNHDT S Q +WPF +        D+V+QGYAYILTHPG PSVFYDH F+WG 
Sbjct  302   GNAVTFIDNHDTGSTQNMWPFPS--------DKVVQGYAYILTHPGTPSVFYDHLFDWGK  353

Query  1133  KDAISKLISIRNKNGVSATSPVEILAADADLYIAKINGKVILKIGPNGDLKNLVPSDFML  1312
             KD ISKLI IR +NG+ ATS VEILAADADLY+AKI+ KVI KIGP  DL NL+P+DF +
Sbjct  354   KDEISKLIGIRGRNGIGATSKVEILAADADLYVAKIDNKVITKIGPKADLGNLIPADFKV  413

Query  1313  ATSGKDFAVWEK  1348
             + SG D+AVWEK
Sbjct  414   SASGTDYAVWEK  425



>dbj|BAC76729.1| alpha-amylase [Vigna angularis]
Length=421

 Score =   518 bits (1335),  Expect = 2e-177, Method: Compositional matrix adjust.
 Identities = 268/437 (61%), Positives = 339/437 (78%), Gaps = 18/437 (4%)
 Frame = +2

Query  41    MKSSFYLSLFCIAFFLFPLHSSSTVLFQGFTWTSKDQPGGWWNWLITKVPDLADAGITHV  220
             M S   LS+FC+   L PL SS  +LFQGF W S  + GGW+N L   +PDLA+AGITHV
Sbjct  1     MDSFSRLSIFCLFISLLPLFSSPALLFQGFNWESSKK-GGWYNSLKNSIPDLANAGITHV  59

Query  221   WLPPPSNAREGDDQGYMPKRMYDLDTSKYGNKKELKALNDAFHGRGIKSVADIVLNHRAA  400
             WLPPPS +     +GY+P R+YDLD S+YG+K ELK+L  AF+ +GIK +ADIV+NHR A
Sbjct  60    WLPPPSQSVS--PEGYLPGRLYDLDASRYGSKNELKSLIAAFYEKGIKCLADIVINHRTA  117

Query  401   ERANSRGVFNVFEGGTPDDKLDWGPSEICGDDAAF-EGTGNPDTGDPWGDAPDIDHRSPR  577
             ER + RG++ +FEGGTPD +LDWGPS IC DD A+ +GTGN D+G+ +  APDIDH +P+
Sbjct  118   ERKDGRGIYCIFEGGTPDSRLDWGPSFICRDDTAYSDGTGNNDSGEGYDAAPDIDHLNPQ  177

Query  578   VQREISEWMNWLKSDVGFDGWRFDYVKGYDFVKGFAAVKIYMDNTKPEFAVGELWNALSP  757
             VQRE+SEWMNWLK+++GFDGWRFD+VKGY      +  KIYM+ T+P+FAVGE W++LS 
Sbjct  178   VQRELSEWMNWLKTEIGFDGWRFDFVKGY----APSISKIYMEQTRPDFAVGEKWDSLSS  233

Query  758   GSVPNPDYNQDAHRNELVRWVQNaggaatafdfttKGILQAALNNTELWRLKDAAGKPSG  937
             G    P+YNQD+HR  LV WV++AGGA TAFDFTTKGILQAA+   ELWRL D  GKP G
Sbjct  234   GQDGKPNYNQDSHRGALVNWVESAGGAITAFDFTTKGILQAAVQG-ELWRLIDPNGKPPG  292

Query  938   MIGVLPQSAVTFIDNHDTWS-QRLWPFTTSTDDAVNHDRVLQGYAYILTHPGIPSVFYDH  1114
             MIGV P++AVTFIDNHDT S QRLWPF +        D+V+QGYAYILTHPG PS+FYDH
Sbjct  293   MIGVKPENAVTFIDNHDTGSTQRLWPFPS--------DKVMQGYAYILTHPGTPSIFYDH  344

Query  1115  FFEWGLKDAISKLISIRNKNGVSATSPVEILAADADLYIAKINGKVILKIGPNGDLKNLV  1294
             FF+WGLK+ I+KL SIR +NG++  S V+ILA++ DLY+AKI+ K+++KIGP  DL NL+
Sbjct  345   FFDWGLKEQIAKLSSIRVRNGINEKSTVKILASEGDLYVAKIDNKIMVKIGPKMDLGNLI  404

Query  1295  PSDFMLATSGKDFAVWE  1345
             PS+F +ATSG+D+AVWE
Sbjct  405   PSNFHVATSGQDYAVWE  421



>ref|XP_004238157.1| PREDICTED: alpha-amylase isoform X1 [Solanum lycopersicum]
Length=407

 Score =   518 bits (1333),  Expect = 2e-177, Method: Compositional matrix adjust.
 Identities = 268/420 (64%), Positives = 329/420 (78%), Gaps = 17/420 (4%)
 Frame = +2

Query  95    LHSSSTVLFQGFTWTSKDQPGGWWNWLITKVPDLADAGITHVWLPPPSNAREGDDQGYMP  274
             + +SSTVLFQGF W S ++ GGW+N LI  VPDLA AG+THVWLPP S++     QGYMP
Sbjct  1     MFASSTVLFQGFNWDSSNKQGGWYNSLINLVPDLAKAGVTHVWLPPSSHSVS--PQGYMP  58

Query  275   KRMYDLDTSKYGNKKELKALNDAFHGRGIKSVADIVLNHRAAERANSRGVFNVFEGGTPD  454
              R+YDLD SK+GN+++LK L  A H  GIKSVADIV+NHR A+  +SRG++++FEGGT D
Sbjct  59    GRLYDLDASKFGNQQQLKTLIKALHDHGIKSVADIVINHRTADNKDSRGIYSIFEGGTSD  118

Query  455   DKLDWGPSEICGDDAAF-EGTGNPDTGDPWGDAPDIDHRSPRVQREISEWMNWLKSDVGF  631
             D+LDWGPS IC +D  + +GTGNPDTG  +  APDIDH + RVQ+E+S+WMNWLKS++GF
Sbjct  119   DRLDWGPSFICKNDTQYSDGTGNPDTGLDFEPAPDIDHLNTRVQKELSDWMNWLKSEIGF  178

Query  632   DGWRFDYVKGYDFVKGFAAVKIYMDNTKPEFAVGELWNALSPGSVPNPDYNQDAHRNELV  811
             DGWRFD+V+GY         KIYM NT P+FAVGELWN+L+ G    P+YNQD HRNELV
Sbjct  179   DGWRFDFVRGY----APCITKIYMGNTSPDFAVGELWNSLAYGQDGKPEYNQDNHRNELV  234

Query  812   RWVQNaggaatafdfttKGILQAALNNTELWRLKDAAGKPSGMIGVLPQSAVTFIDNHDT  991
              WV+NAG A TAFDFTTKGILQAA+   ELWRLKD  GKP GMIGVLP+ AVTFIDNHDT
Sbjct  235   GWVKNAGRAVTAFDFTTKGILQAAVQE-ELWRLKDPNGKPPGMIGVLPRKAVTFIDNHDT  293

Query  992   WS-QRLWPFTTSTDDAVNHDRVLQGYAYILTHPGIPSVFYDHFFEWGLKDAISKLISIRN  1168
              S Q +WPF +        D+V+QGYAYILTHPGIPSVFYDHFF+WG KD IS LISIR 
Sbjct  294   GSTQNMWPFPS--------DKVMQGYAYILTHPGIPSVFYDHFFDWGFKDGISALISIRK  345

Query  1169  KNGVSATSPVEILAADADLYIAKINGKVILKIGPNGDLKNLVPSDFMLATSGKDFAVWEK  1348
             +N + ATS V+I+A+D+DLYIA I+ K+I+KIGP  DL NL+P ++ +ATSG+D+AVWE+
Sbjct  346   RNRICATSNVQIMASDSDLYIAMIHHKIIVKIGPKLDLGNLIPPNYEVATSGQDYAVWEQ  405



>prf||1803517A alpha amylase
Length=421

 Score =   517 bits (1331),  Expect = 6e-177, Method: Compositional matrix adjust.
 Identities = 267/437 (61%), Positives = 338/437 (77%), Gaps = 18/437 (4%)
 Frame = +2

Query  41    MKSSFYLSLFCIAFFLFPLHSSSTVLFQGFTWTSKDQPGGWWNWLITKVPDLADAGITHV  220
             M S   LS+FC+   L PL SS  +LFQGF W S  + GGW+N L   +PDLA+AGITHV
Sbjct  1     MDSFSRLSIFCLFISLLPLFSSPALLFQGFNWESSKK-GGWYNSLKNSIPDLANAGITHV  59

Query  221   WLPPPSNAREGDDQGYMPKRMYDLDTSKYGNKKELKALNDAFHGRGIKSVADIVLNHRAA  400
             WLPPPS +     +GY+P R+YDLD S+YG+K ELK+L  AFH +GIK +ADIV+NHR A
Sbjct  60    WLPPPSQSVS--PEGYLPGRLYDLDASRYGSKNELKSLIAAFHEKGIKCLADIVINHRTA  117

Query  401   ERANSRGVFNVFEGGTPDDKLDWGPSEICGDDAAF-EGTGNPDTGDPWGDAPDIDHRSPR  577
             ER + RG++ +FEGGTPD +LDWGPS IC DD A+ +GTGN D+G+ +  APDIDH +P+
Sbjct  118   ERKDGRGIYCIFEGGTPDSRLDWGPSFICRDDTAYSDGTGNNDSGEGYDAAPDIDHLNPQ  177

Query  578   VQREISEWMNWLKSDVGFDGWRFDYVKGYDFVKGFAAVKIYMDNTKPEFAVGELWNALSP  757
             VQRE+SEWMNWLK+++GFDGWRFD+VKGY      +  KIYM+ T+P+FAVGE W+A+S 
Sbjct  178   VQRELSEWMNWLKTEIGFDGWRFDFVKGY----APSISKIYMEQTRPDFAVGEKWDAISY  233

Query  758   GSVPNPDYNQDAHRNELVRWVQNaggaatafdfttKGILQAALNNTELWRLKDAAGKPSG  937
             G    P+YNQD+HR  LV WV++AGGA TAFDFTTKGILQAA+   ELWRL D  GKP G
Sbjct  234   GQDGKPNYNQDSHRGALVNWVESAGGAITAFDFTTKGILQAAVQG-ELWRLIDPNGKPPG  292

Query  938   MIGVLPQSAVTFIDNHDTWS-QRLWPFTTSTDDAVNHDRVLQGYAYILTHPGIPSVFYDH  1114
             MIGV P++AVTFIDNHDT S QRLWPF +        D+V+QGYAYILTHPG PS+FYDH
Sbjct  293   MIGVKPENAVTFIDNHDTGSTQRLWPFPS--------DKVMQGYAYILTHPGTPSIFYDH  344

Query  1115  FFEWGLKDAISKLISIRNKNGVSATSPVEILAADADLYIAKINGKVILKIGPNGDLKNLV  1294
             FF+WGLK+ I+KL SIR +NG++  S V+I+A++ DLY+AKI+ K+++KIGP  DL NL+
Sbjct  345   FFDWGLKEQIAKLSSIRLRNGINEKSSVKIMASEGDLYVAKIDNKIMVKIGPKMDLGNLI  404

Query  1295  PSDFMLATSGKDFAVWE  1345
             PS+  +ATSG+D+AVWE
Sbjct  405   PSNLHVATSGQDYAVWE  421



>ref|XP_002301186.2| hypothetical protein POPTR_0002s12790g, partial [Populus trichocarpa]
 gb|EEE80459.2| hypothetical protein POPTR_0002s12790g, partial [Populus trichocarpa]
Length=422

 Score =   516 bits (1330),  Expect = 1e-176, Method: Compositional matrix adjust.
 Identities = 266/432 (62%), Positives = 330/432 (76%), Gaps = 17/432 (4%)
 Frame = +2

Query  59    LSLFCIAFFLFPLHSSSTVLFQGFTWTSKDQPGGWWNWLITKVPDLADAGITHVWLPPPS  238
                F +   +FPL +SS +LFQGF W S +Q GGW+N L   VPDLA+AGITHVWLPP S
Sbjct  6     FCFFSLFLSVFPLFTSSALLFQGFNWESCNQAGGWYNSLKNLVPDLANAGITHVWLPPAS  65

Query  239   NAREGDDQGYMPKRMYDLDTSKYGNKKELKALNDAFHGRGIKSVADIVLNHRAAERANSR  418
              +     QGYMP R+YDL  SKYG++ ELK+L  AFH +GIK +ADIV+NHR AE+ + R
Sbjct  66    QSVA--PQGYMPGRLYDLSASKYGSQGELKSLIGAFHQKGIKCLADIVINHRTAEKQDGR  123

Query  419   GVFNVFEGGTPDDKLDWGPSEICGDDAAF-EGTGNPDTGDPWGDAPDIDHRSPRVQREIS  595
             G++ +FEGGT DD+LDWGPS IC DD A+ +G GNPDTGD +  APDIDH +PRVQ+E+S
Sbjct  124   GIWCIFEGGTSDDRLDWGPSLICSDDTAYSDGKGNPDTGDNFRGAPDIDHLNPRVQKELS  183

Query  596   EWMNWLKSDVGFDGWRFDYVKGYDFVKGFAAVKIYMDNTKPEFAVGELWNALSPGSVPNP  775
             +WMNWLKS++GFDGWRFD+V+GY      +  KIYM+NT P+FAVGE W++L+ G    P
Sbjct  184   DWMNWLKSEIGFDGWRFDFVRGY----APSITKIYMENTSPDFAVGEKWDSLAYGQDGKP  239

Query  776   DYNQDAHRNELVRWVQNaggaatafdfttKGILQAALNNTELWRLKDAAGKPSGMIGVLP  955
             DYNQDAHR  L  W+Q AGGA TAFDFTTKGILQAA+   ELWRLKD+ GKP G+IG+LP
Sbjct  240   DYNQDAHRGGLKDWIQAAGGAVTAFDFTTKGILQAAVQG-ELWRLKDSNGKPPGLIGLLP  298

Query  956   QSAVTFIDNHDTWS-QRLWPFTTSTDDAVNHDRVLQGYAYILTHPGIPSVFYDHFFEWGL  1132
             Q+AVTFIDNHDT S Q+LWPF +        D+V+QGYAYILTHPG PS+FYDHFF+WGL
Sbjct  299   QNAVTFIDNHDTGSTQKLWPFPS--------DKVMQGYAYILTHPGTPSIFYDHFFDWGL  350

Query  1133  KDAISKLISIRNKNGVSATSPVEILAADADLYIAKINGKVILKIGPNGDLKNLVPSDFML  1312
             K+ I KL +IR  +G+ + S V ILA+DADLY+A I+G +I+KIGP  DL NL+PS+F +
Sbjct  351   KEEIGKLATIRKTSGIGSASTVNILASDADLYVAAIDGNMIMKIGPKMDLGNLIPSNFQV  410

Query  1313  ATSGKDFAVWEK  1348
             ATSG D+ VW K
Sbjct  411   ATSGADYCVWVK  422



>ref|XP_006387871.1| hypothetical protein POPTR_0515s00220g [Populus trichocarpa]
 gb|ERP46785.1| hypothetical protein POPTR_0515s00220g [Populus trichocarpa]
Length=423

 Score =   516 bits (1329),  Expect = 1e-176, Method: Compositional matrix adjust.
 Identities = 266/432 (62%), Positives = 329/432 (76%), Gaps = 17/432 (4%)
 Frame = +2

Query  59    LSLFCIAFFLFPLHSSSTVLFQGFTWTSKDQPGGWWNWLITKVPDLADAGITHVWLPPPS  238
                F +   +FPL +SS +LFQGF W S +Q GGW+N L   VPDLA+AGITHVWLPP S
Sbjct  6     FCFFSLFLSVFPLFTSSALLFQGFNWESCNQAGGWYNSLKNLVPDLANAGITHVWLPPAS  65

Query  239   NAREGDDQGYMPKRMYDLDTSKYGNKKELKALNDAFHGRGIKSVADIVLNHRAAERANSR  418
              +     QGYMP R+YDL  SKYG++ ELK+L  AFH +GIK +ADIV+NHR AE+ + R
Sbjct  66    QSVA--PQGYMPGRLYDLSASKYGSQGELKSLIGAFHQKGIKCLADIVINHRTAEKQDGR  123

Query  419   GVFNVFEGGTPDDKLDWGPSEICGDDAAF-EGTGNPDTGDPWGDAPDIDHRSPRVQREIS  595
             G++ +FEGGT DD+LDWGPS IC DD A+ +G GNPDTG  +G APDIDH +PRVQ+E+S
Sbjct  124   GIWCIFEGGTSDDRLDWGPSLICSDDTAYSDGKGNPDTGGDFGGAPDIDHLNPRVQKELS  183

Query  596   EWMNWLKSDVGFDGWRFDYVKGYDFVKGFAAVKIYMDNTKPEFAVGELWNALSPGSVPNP  775
             +WMNWLKS++GFDGWRFD+VKGY      +  KIYM+NT P+FAVGE W++L+ G    P
Sbjct  184   DWMNWLKSEIGFDGWRFDFVKGY----APSITKIYMENTSPDFAVGEKWDSLAYGQDGKP  239

Query  776   DYNQDAHRNELVRWVQNaggaatafdfttKGILQAALNNTELWRLKDAAGKPSGMIGVLP  955
             DYNQDAHR  L  W+Q AGGA TAFDFTTKGILQAA+   ELWRLKD+ GKP G+IG+LP
Sbjct  240   DYNQDAHRGGLKDWIQAAGGAVTAFDFTTKGILQAAVQG-ELWRLKDSNGKPPGLIGLLP  298

Query  956   QSAVTFIDNHDTWS-QRLWPFTTSTDDAVNHDRVLQGYAYILTHPGIPSVFYDHFFEWGL  1132
             Q+AVTFIDNHDT S Q+LWPF +        D+V+QGYAYILTHPG PS+FYDHFF+WGL
Sbjct  299   QNAVTFIDNHDTGSTQKLWPFPS--------DKVMQGYAYILTHPGTPSIFYDHFFDWGL  350

Query  1133  KDAISKLISIRNKNGVSATSPVEILAADADLYIAKINGKVILKIGPNGDLKNLVPSDFML  1312
             K+ I KL +IR  +G+ + S V ILA+DADLY+A I+G +I+KIGP  DL NL+PS+F +
Sbjct  351   KEEIGKLATIRKTSGIGSASTVNILASDADLYVAAIDGNMIMKIGPKMDLGNLIPSNFQV  410

Query  1313  ATSGKDFAVWEK  1348
             A SG D+ VW K
Sbjct  411   AASGTDYCVWVK  422



>ref|XP_004499059.1| PREDICTED: alpha-amylase-like [Cicer arietinum]
Length=420

 Score =   516 bits (1329),  Expect = 1e-176, Method: Compositional matrix adjust.
 Identities = 265/438 (61%), Positives = 334/438 (76%), Gaps = 21/438 (5%)
 Frame = +2

Query  41    MKSSFYLSLFCIAFFLFPLHSSSTVLFQGFTWTSKDQPGGWWNWLITKVPDLADAGITHV  220
             M S  +LSLFC++  +FPL +SST+LFQGF W S  + GGW+N L   +PDLA+AGITHV
Sbjct  1     MDSLPWLSLFCLS--IFPLLASSTLLFQGFNWESSSK-GGWYNLLKNSIPDLANAGITHV  57

Query  221   WLPPPSNAREGDDQGYMPKRMYDLDTSKYGNKKELKALNDAFHGRGIKSVADIVLNHRAA  400
             WLPPPS +     QGY+P R+YDLD SKYG+K ELK+L  AF+ +GIKS+ADIV+NHR A
Sbjct  58    WLPPPSQSV--GSQGYLPGRLYDLDASKYGSKDELKSLIKAFNDKGIKSLADIVINHRTA  115

Query  401   ERANSRGVFNVFEGGTPDDKLDWGPSEICGDDAAF-EGTGNPDTGDPWGDAPDIDHRSPR  577
             ER + RG++ +FEGGTPD KLDWGPS IC DD  + +GTGN DTG+ +  APDIDH +P+
Sbjct  116   ERKDGRGIYCLFEGGTPDTKLDWGPSFICKDDTTYSDGTGNLDTGEDYNAAPDIDHLNPQ  175

Query  578   VQREISEWMNWLKSDVGFDGWRFDYVKGYDFVKGFAAVKIYMDNTKPEFAVGELWNALSP  757
             VQRE+SEWMNWLK+++GF GWRFD+VKGY      +  KIY++NT P+FAVGE WN+LS 
Sbjct  176   VQRELSEWMNWLKTEIGFSGWRFDFVKGY----APSITKIYVENTSPDFAVGEYWNSLSY  231

Query  758   GSVPNPDYNQDAHRNELVRWVQNaggaatafdf-ttKGILQAALNNTELWRLKDAAGKPS  934
             G     DYNQD  R ELV WV+++G         TTKGILQAA+   ELWRLKD+ GKP 
Sbjct  232   GQDGKCDYNQDKARGELVNWVESSGAGVVNAFDFTTKGILQAAVEG-ELWRLKDSNGKPP  290

Query  935   GMIGVLPQSAVTFIDNHDTWS-QRLWPFTTSTDDAVNHDRVLQGYAYILTHPGIPSVFYD  1111
             G+IG+ P++AVTFIDNHDT S Q+LWPF +        D+V+QGYAYILTHPG PS+FYD
Sbjct  291   GLIGLKPENAVTFIDNHDTGSTQKLWPFPS--------DKVMQGYAYILTHPGTPSIFYD  342

Query  1112  HFFEWGLKDAISKLISIRNKNGVSATSPVEILAADADLYIAKINGKVILKIGPNGDLKNL  1291
             H F+WGLK+ I+KL +IR +NG++  S V ILAAD D+Y+AKI+ K+I+KIGP  DL NL
Sbjct  343   HLFDWGLKEQITKLTAIRVRNGINMKSTVNILAADGDIYVAKIDNKIIVKIGPKMDLGNL  402

Query  1292  VPSDFMLATSGKDFAVWE  1345
             VPS+F +ATSG+D+AVWE
Sbjct  403   VPSNFHVATSGQDYAVWE  420



>sp|P17859.1|AMYA_VIGMU RecName: Full=Alpha-amylase; AltName: Full=1,4-alpha-D-glucan 
glucanohydrolase; Flags: Precursor [Vigna mungo]
 emb|CAA37217.1| unnamed protein product [Vigna mungo]
 emb|CAA51734.1| alpha-amylase [Vigna mungo]
 prf||2016476A alpha amylase
Length=421

 Score =   515 bits (1327),  Expect = 3e-176, Method: Compositional matrix adjust.
 Identities = 267/437 (61%), Positives = 337/437 (77%), Gaps = 18/437 (4%)
 Frame = +2

Query  41    MKSSFYLSLFCIAFFLFPLHSSSTVLFQGFTWTSKDQPGGWWNWLITKVPDLADAGITHV  220
             M S   LS+FC+   L PL SS  +LFQGF W S  + GGW+N L   +PDLA+AGITHV
Sbjct  1     MDSFSRLSIFCLFISLLPLFSSPALLFQGFNWESSKK-GGWYNSLKNSIPDLANAGITHV  59

Query  221   WLPPPSNAREGDDQGYMPKRMYDLDTSKYGNKKELKALNDAFHGRGIKSVADIVLNHRAA  400
             WLPPPS +     +GY+P R+YDLD SKYG+K ELK+L  AFH +GIK +ADIV+NHR A
Sbjct  60    WLPPPSQSVS--PEGYLPGRLYDLDASKYGSKNELKSLIAAFHEKGIKCLADIVINHRTA  117

Query  401   ERANSRGVFNVFEGGTPDDKLDWGPSEICGDDAAF-EGTGNPDTGDPWGDAPDIDHRSPR  577
             ER + RG++ +FEGGTPD + DWGPS IC DD A+ +GTGN D+G+ +  APDIDH +P+
Sbjct  118   ERKDGRGIYCIFEGGTPDSRQDWGPSFICRDDTAYSDGTGNNDSGEGYDAAPDIDHLNPQ  177

Query  578   VQREISEWMNWLKSDVGFDGWRFDYVKGYDFVKGFAAVKIYMDNTKPEFAVGELWNALSP  757
             VQRE+SEWMNWLK+++GFDGWRFD+VKGY      +  KIYM+ TKP+FAVGE W+++S 
Sbjct  178   VQRELSEWMNWLKTEIGFDGWRFDFVKGY----APSISKIYMEQTKPDFAVGEKWDSISY  233

Query  758   GSVPNPDYNQDAHRNELVRWVQNaggaatafdfttKGILQAALNNTELWRLKDAAGKPSG  937
             G    P+YNQD+HR  LV WV++AGGA TAFDFTTKGILQAA+   ELWRL D  GKP G
Sbjct  234   GQDGKPNYNQDSHRGALVNWVESAGGAITAFDFTTKGILQAAVQG-ELWRLIDPNGKPPG  292

Query  938   MIGVLPQSAVTFIDNHDTWS-QRLWPFTTSTDDAVNHDRVLQGYAYILTHPGIPSVFYDH  1114
             MIGV P++AVTFIDNHDT S QRLWPF +        D+V+QGYAYILTHPG PS+FYDH
Sbjct  293   MIGVKPENAVTFIDNHDTGSTQRLWPFPS--------DKVMQGYAYILTHPGTPSIFYDH  344

Query  1115  FFEWGLKDAISKLISIRNKNGVSATSPVEILAADADLYIAKINGKVILKIGPNGDLKNLV  1294
             FF+WGLK+ I+KL SIR +NG++  S V+I+A++ DLY+AKI+ K+++KIGP  DL NL+
Sbjct  345   FFDWGLKEQIAKLSSIRLRNGINEKSTVKIMASEGDLYVAKIDNKIMVKIGPKMDLGNLI  404

Query  1295  PSDFMLATSGKDFAVWE  1345
             PS+  +ATSG+D+AVWE
Sbjct  405   PSNLHVATSGQDYAVWE  421



>ref|XP_007134076.1| hypothetical protein PHAVU_010G017600g [Phaseolus vulgaris]
 dbj|BAA33879.1| alpha-amylase [Phaseolus vulgaris]
 gb|ESW06070.1| hypothetical protein PHAVU_010G017600g [Phaseolus vulgaris]
Length=420

 Score =   514 bits (1323),  Expect = 1e-175, Method: Compositional matrix adjust.
 Identities = 270/437 (62%), Positives = 337/437 (77%), Gaps = 19/437 (4%)
 Frame = +2

Query  41    MKSSFYLSLFCIAFFLFPLHSSSTVLFQGFTWTSKDQPGGWWNWLITKVPDLADAGITHV  220
             M S   LS+FC+   L PL SSS +LFQGF W S  + GGW+N L   VPD+A+AGITHV
Sbjct  1     MHSFSRLSIFCLFISLSPLFSSSALLFQGFNWESSKK-GGWYNSLKNSVPDIANAGITHV  59

Query  221   WLPPPSNAREGDDQGYMPKRMYDLDTSKYGNKKELKALNDAFHGRGIKSVADIVLNHRAA  400
             WLPPPS +     +GY+P R+YDLD S+YG+K ELK+L  AFH +GIK +ADIV+NHR A
Sbjct  60    WLPPPSQSVS--PEGYLPGRLYDLDASRYGSKDELKSLIAAFHEKGIKCLADIVINHRTA  117

Query  401   ERANSRGVFNVFEGGTPDDKLDWGPSEICGDDAAF-EGTGNPDTGDPWGDAPDIDHRSPR  577
             ER + RG++ +FEGGTPD +LDWGPS IC DD  + +GTGN D+G+ +  APDIDH +P+
Sbjct  118   ERKDGRGIYCIFEGGTPDARLDWGPSFICKDDTTYSDGTGNNDSGESYDAAPDIDHLNPQ  177

Query  578   VQREISEWMNWLKSDVGFDGWRFDYVKGYDFVKGFAAVKIYMDNTKPEFAVGELWNALSP  757
             VQRE+SEWMNWLK++VGFDGWRFD+VKGY      +  KIYM+ T+P+FAVGE W+ LS 
Sbjct  178   VQRELSEWMNWLKTEVGFDGWRFDFVKGY----APSISKIYMEQTRPDFAVGEKWDPLSY  233

Query  758   GSVPNPDYNQDAHRNELVRWVQNaggaatafdfttKGILQAALNNTELWRLKDAAGKPSG  937
              +   P YNQD+HR  LV WV++AGGA TAFDFTTKGILQAA+   ELWRL D  GKPSG
Sbjct  234   EN-GKPTYNQDSHRGALVNWVESAGGAITAFDFTTKGILQAAVQG-ELWRLIDPNGKPSG  291

Query  938   MIGVLPQSAVTFIDNHDTWS-QRLWPFTTSTDDAVNHDRVLQGYAYILTHPGIPSVFYDH  1114
             MIGV P++AVTFIDNHDT S QRLWPF +        D+V+QGYAYILTHPG PS+FYDH
Sbjct  292   MIGVKPENAVTFIDNHDTGSTQRLWPFPS--------DKVMQGYAYILTHPGTPSIFYDH  343

Query  1115  FFEWGLKDAISKLISIRNKNGVSATSPVEILAADADLYIAKINGKVILKIGPNGDLKNLV  1294
             FF+WGLK+ I+KL SIR +NG++  S VEI+AA+ DLY+AKI+ K+++KIGP  DL  L+
Sbjct  344   FFDWGLKEQIAKLSSIRVRNGINEKSTVEIMAAEGDLYVAKIDNKIMVKIGPKMDLGKLI  403

Query  1295  PSDFMLATSGKDFAVWE  1345
             PS+F +ATSG+D+AVWE
Sbjct  404   PSNFHVATSGQDYAVWE  420



>ref|XP_011017206.1| PREDICTED: alpha-amylase isoform X2 [Populus euphratica]
Length=423

 Score =   512 bits (1318),  Expect = 6e-175, Method: Compositional matrix adjust.
 Identities = 265/432 (61%), Positives = 326/432 (75%), Gaps = 17/432 (4%)
 Frame = +2

Query  59    LSLFCIAFFLFPLHSSSTVLFQGFTWTSKDQPGGWWNWLITKVPDLADAGITHVWLPPPS  238
                F +   +FPL +SS +LFQGF W S +Q GGW+N L   VPDLA+AGITHVWLPP S
Sbjct  6     FCFFSLFLSVFPLFTSSALLFQGFNWESCNQAGGWYNTLKNLVPDLANAGITHVWLPPAS  65

Query  239   NAREGDDQGYMPKRMYDLDTSKYGNKKELKALNDAFHGRGIKSVADIVLNHRAAERANSR  418
              +     QGYMP R+YDL  SKYG++ ELK+L  AFH +GIK +ADIV+NHR AE+ + R
Sbjct  66    QSVA--PQGYMPGRLYDLSASKYGSQGELKSLIGAFHQKGIKCLADIVINHRTAEKQDGR  123

Query  419   GVFNVFEGGTPDDKLDWGPSEICGDDAAF-EGTGNPDTGDPWGDAPDIDHRSPRVQREIS  595
             G++ +FEGGT DD+LDWGPS IC DD A+ +G GNPDTG  +G APDIDH +PRVQ+E+S
Sbjct  124   GIWCIFEGGTSDDRLDWGPSLICSDDTAYSDGKGNPDTGGDFGGAPDIDHLNPRVQKELS  183

Query  596   EWMNWLKSDVGFDGWRFDYVKGYDFVKGFAAVKIYMDNTKPEFAVGELWNALSPGSVPNP  775
             +WMNWLKS++GFDGWRFD+V+GY      +  KIYM NT P+FAVGE W++L+ G    P
Sbjct  184   DWMNWLKSEIGFDGWRFDFVRGY----APSITKIYMKNTSPDFAVGEKWDSLAYGQDGKP  239

Query  776   DYNQDAHRNELVRWVQNaggaatafdfttKGILQAALNNTELWRLKDAAGKPSGMIGVLP  955
              YNQDAHR  L  W+Q AGGA TAFDFTTKGILQAA+   ELWRLKD+ GKP G+IG+LP
Sbjct  240   VYNQDAHRGGLKDWIQAAGGAVTAFDFTTKGILQAAVQG-ELWRLKDSNGKPPGLIGLLP  298

Query  956   QSAVTFIDNHDTWS-QRLWPFTTSTDDAVNHDRVLQGYAYILTHPGIPSVFYDHFFEWGL  1132
             Q+AVTFIDNHDT S Q+LWPF +        D+V+QGYAYILTHPG PS+FYDHFF+WGL
Sbjct  299   QNAVTFIDNHDTGSTQKLWPFPS--------DKVMQGYAYILTHPGTPSIFYDHFFDWGL  350

Query  1133  KDAISKLISIRNKNGVSATSPVEILAADADLYIAKINGKVILKIGPNGDLKNLVPSDFML  1312
             K  I KL +IR  +G+ + S V ILA+DADLY+A I+G VI+KIGP  DL NL+PS+F +
Sbjct  351   KTEIGKLTTIRRTSGIGSASTVNILASDADLYVAAIDGNVIMKIGPKMDLGNLIPSNFQV  410

Query  1313  ATSGKDFAVWEK  1348
             A SG D+ VW K
Sbjct  411   AASGADYCVWVK  422



>ref|XP_002285213.1| PREDICTED: alpha-amylase [Vitis vinifera]
 emb|CBI32409.3| unnamed protein product [Vitis vinifera]
Length=424

 Score =   509 bits (1312),  Expect = 5e-174, Method: Compositional matrix adjust.
 Identities = 267/441 (61%), Positives = 332/441 (75%), Gaps = 24/441 (5%)
 Frame = +2

Query  38    IMKSSFYLSLFCIAFFLFPLHSSSTVLFQGFTWTSKDQPGGWWNWLITKVPDLADAGITH  217
             I  S  YL  F I   + P  ++S +LFQGF W S  + GGW+N+LI  +P+L+ +GITH
Sbjct  3     ITTSLSYLLFFNI---ILPTLTASPILFQGFNWESSKKQGGWYNFLINSIPELSASGITH  59

Query  218   VWLPPPSNAREGDDQGYMPKRMYDLDTSKYGNKKELKALNDAFHGRGIKSVADIVLNHRA  397
             VWLPPPS  +    +GY+P R+YDL+ S YG + ELKAL  AF   GI+ +ADIV+NHR 
Sbjct  60    VWLPPPS--QSAASEGYLPGRLYDLNASHYGTQYELKALIKAFRSNGIQCIADIVINHRT  117

Query  398   AERANSRGVFNVFEGGTPDDKLDWGPSEICGDDAAF-EGTGNPDTGDPWGDAPDIDHRSP  574
             AE+ +SRG++ +FEGGTPDD+LDWGPS IC DD  F +GTGNPDTG  +  APDIDH +P
Sbjct  118   AEKKDSRGIWAIFEGGTPDDRLDWGPSFICSDDTLFSDGTGNPDTGAGFDPAPDIDHVNP  177

Query  575   RVQREISEWMNWLKSDVGFDGWRFDYVKGY--DFVKGFAAVKIYMDNTKPEFAVGELWNA  748
             RVQRE+S+WMNWLK ++GF GWRFD+ +GY  DF K      +YM+NT P FAVGE+WN+
Sbjct  178   RVQRELSDWMNWLKIEIGFAGWRFDFARGYSPDFTK------LYMENTSPNFAVGEIWNS  231

Query  749   LSPGSVPNPDYNQDAHRNELVRWVQNaggaatafdfttKGILQAALNNTELWRLKDAAGK  928
             LS G+   P+YNQDAHR ELV WV+ AGGA TAFDFTTKGILQAA+   ELWRLKD+ G 
Sbjct  232   LSYGNDSKPNYNQDAHRRELVDWVKAAGGAVTAFDFTTKGILQAAVEG-ELWRLKDSNGG  290

Query  929   PSGMIGVLPQSAVTFIDNHDTWS-QRLWPFTTSTDDAVNHDRVLQGYAYILTHPGIPSVF  1105
             P GMIG++P++AVTFIDNHDT S Q++WPF +        D+V+QGY YILTHPGIPS+F
Sbjct  291   PPGMIGLMPENAVTFIDNHDTGSTQKIWPFPS--------DKVMQGYVYILTHPGIPSIF  342

Query  1106  YDHFFEWGLKDAISKLISIRNKNGVSATSPVEILAADADLYIAKINGKVILKIGPNGDLK  1285
             YDHFF+WGLK+ ISKLISIR +NG+   S V ILA+D DLY+A I+ K+I KIGP  D+ 
Sbjct  343   YDHFFDWGLKEEISKLISIRTRNGIKPNSVVRILASDPDLYVAAIDEKIIAKIGPRYDVG  402

Query  1286  NLVPSDFMLATSGKDFAVWEK  1348
             NLVPS F LATSG ++AVWEK
Sbjct  403   NLVPSTFKLATSGNNYAVWEK  423



>ref|XP_007017240.1| Alpha-amylase-like isoform 1 [Theobroma cacao]
 gb|EOY14465.1| Alpha-amylase-like isoform 1 [Theobroma cacao]
Length=419

 Score =   509 bits (1311),  Expect = 6e-174, Method: Compositional matrix adjust.
 Identities = 263/438 (60%), Positives = 330/438 (75%), Gaps = 22/438 (5%)
 Frame = +2

Query  41    MKSSFYLSLFCIAFFLFPLHSSSTVLFQGFTWTSKDQPGGWWNWLITKVPDLADAGITHV  220
             M S   L    +  ++FP  +S T+LFQGF W S ++ GGW+N L   +PD+A+AG+THV
Sbjct  1     MSSVTSLCFLSLFLYIFPALTSPTLLFQGFNWESCNKAGGWYNSLKNSIPDIANAGVTHV  60

Query  221   WLPPPSNAREGDDQGYMPKRMYDLDTSKYGNKKELKALNDAFHGRGIKSVADIVLNHRAA  400
             WLPPPS +     QGY+P R+YDLD+SKYG++ ELK+L +AFH +GIK +ADIV+NHR A
Sbjct  61    WLPPPSQSV--GPQGYLPGRLYDLDSSKYGSQAELKSLIEAFHRKGIKCLADIVINHRTA  118

Query  401   ERANSRGVFNVFEGGTPDDKLDWGPSEICGDDAAF-EGTGNPDTGDPWGDAPDIDHRSPR  577
             ER + RG++++FEGGT DD+LDWGPS ICG+D  + +GTGNPDTG  +  APDIDH +PR
Sbjct  119   ERKDGRGIYSIFEGGTSDDRLDWGPSFICGNDKEYSDGTGNPDTGLDYQPAPDIDHLNPR  178

Query  578   VQREISEWMNWLKSDVGFDGWRFDYVKGYDFVKGFAAVKIYMDNTKPEFAVGELWNALSP  757
             VQ E+S+WMNWLK+++GFDGWRFD+V+GY      +  KIYM+ T P+FAVGE W  LS 
Sbjct  179   VQNELSDWMNWLKTEIGFDGWRFDFVRGY----APSITKIYMERTSPDFAVGEKWEDLSL  234

Query  758   GSVPNPDYNQDAHRNELVRWVQNaggaatafdfttKGILQAALNNTELWRLKDAAGKPSG  937
             G        QD+HR  L  WVQ AGG   AFDFTTKG+LQAA+   ELWRLKD+ GKP G
Sbjct  235   GQ-----NGQDSHRGALKDWVQAAGGVVKAFDFTTKGVLQAAVRG-ELWRLKDSNGKPPG  288

Query  938   MIGVLPQSAVTFIDNHDTWS-QRLWPFTTSTDDAVNHDRVLQGYAYILTHPGIPSVFYDH  1114
             MIG+LPQ+AVTFIDNHDT S QRLWPF +        D+V+QGYAYILTHPG PS+FYDH
Sbjct  289   MIGLLPQNAVTFIDNHDTGSPQRLWPFPS--------DKVMQGYAYILTHPGTPSIFYDH  340

Query  1115  FFEWGLKDAISKLISIRNKNGVSATSPVEILAADADLYIAKINGKVILKIGPNGDLKNLV  1294
             F  WGLK  I+KL ++R+KNG+SATS V ILA+D+DLY+A I+ K+I+KIGP  DL NLV
Sbjct  341   FVGWGLKGEITKLAAVRSKNGISATSTVNILASDSDLYVAAIDEKIIMKIGPKLDLGNLV  400

Query  1295  PSDFMLATSGKDFAVWEK  1348
             PS + LATSGKD+AVW K
Sbjct  401   PSSYQLATSGKDYAVWAK  418



>ref|XP_004499063.1| PREDICTED: alpha-amylase-like isoform X1 [Cicer arietinum]
Length=422

 Score =   508 bits (1307),  Expect = 3e-173, Method: Compositional matrix adjust.
 Identities = 259/438 (59%), Positives = 331/438 (76%), Gaps = 21/438 (5%)
 Frame = +2

Query  41    MKSSFYLSLFCIAFFLFPLHSSSTVLFQGFTWTSKDQPGGWWNWLITKVPDLADAGITHV  220
             M S  +LSLFC++  +FPL +SST+LFQGF W S  + GGW+N L   +PDLA+AGITHV
Sbjct  1     MDSLAWLSLFCLS--IFPLLASSTLLFQGFNWESSSK-GGWYNLLKNSIPDLANAGITHV  57

Query  221   WLPPPSNAREGDDQGYMPKRMYDLDTSKYGNKKELKALNDAFHGRGIKSVADIVLNHRAA  400
             WLPPPS +     QGY+P R+YDLD SKYG+K ELK+L   F+ +GIKS+ADIV+NHR A
Sbjct  58    WLPPPSQSV--GSQGYLPGRLYDLDASKYGSKDELKSLIKEFNDKGIKSLADIVINHRTA  115

Query  401   ERANSRGVFNVFEGGTPDDKLDWGPSEICGDDAAF-EGTGNPDTGDPWGDAPDIDHRSPR  577
             ER + RG++ +FEGGTPD KLDWGPS IC DD  + +GTGN DTG+ +  APDIDH +P+
Sbjct  116   ERKDERGIYCLFEGGTPDGKLDWGPSFICKDDTTYSDGTGNLDTGEGYNAAPDIDHLNPQ  175

Query  578   VQREISEWMNWLKSDVGFDGWRFDYVKGYDFVKGFAAVKIYMDNTKPEFAVGELWNALSP  757
             VQRE+SEWMNWLK+++GF GWRFD+VKGY      +  KIY++NT P+FAVGE WN+LS 
Sbjct  176   VQRELSEWMNWLKTEIGFSGWRFDFVKGY----APSITKIYVENTSPDFAVGEYWNSLSY  231

Query  758   GSVPNPDYNQDAHRNELVRWVQNaggaatafdf-ttKGILQAALNNTELWRLKDAAGKPS  934
             G     DYNQD  R ELV WV+++G         TTKGILQ A+   ELWRLKD+ GKP 
Sbjct  232   GQDGKCDYNQDKARGELVNWVESSGAGVVNAFDFTTKGILQVAVEG-ELWRLKDSNGKPP  290

Query  935   GMIGVLPQSAVTFIDNHDTWS-QRLWPFTTSTDDAVNHDRVLQGYAYILTHPGIPSVFYD  1111
             G+IG+ P++AVTFIDNHDT S Q+LWPF +        D+V+QGY YILTHPG PS+FYD
Sbjct  291   GLIGLKPENAVTFIDNHDTGSTQKLWPFPS--------DKVMQGYGYILTHPGTPSIFYD  342

Query  1112  HFFEWGLKDAISKLISIRNKNGVSATSPVEILAADADLYIAKINGKVILKIGPNGDLKNL  1291
             H+ EWGL + I KL +IR +NG++ATS V ILAA++DLY+A+I+ K+I+KIGP  DL NL
Sbjct  343   HYIEWGLMEPIKKLTAIRKRNGITATSSVNILAAESDLYMAEIDNKIIVKIGPKLDLGNL  402

Query  1292  VPSDFMLATSGKDFAVWE  1345
             +PS+  +AT+G+D+AVWE
Sbjct  403   LPSNAQVATNGQDYAVWE  420



>ref|XP_011017205.1| PREDICTED: alpha-amylase isoform X1 [Populus euphratica]
Length=435

 Score =   506 bits (1304),  Expect = 1e-172, Method: Compositional matrix adjust.
 Identities = 264/442 (60%), Positives = 326/442 (74%), Gaps = 25/442 (6%)
 Frame = +2

Query  59    LSLFCIAFFLFPLHSSSTVLFQGFTWTSKDQPGGWWNWLITKVPDLADAGITHVWLPPPS  238
                F +   +FPL +SS +LFQGF W S +Q GGW+N L   VPDLA+AGITHVWLPP S
Sbjct  6     FCFFSLFLSVFPLFTSSALLFQGFNWESCNQAGGWYNTLKNLVPDLANAGITHVWLPPAS  65

Query  239   NAREGDDQ----------GYMPKRMYDLDTSKYGNKKELKALNDAFHGRGIKSVADIVLN  388
              +    +           GYMP R+YDL  SKYG++ ELK+L  AFH +GIK +ADIV+N
Sbjct  66    QSVAPQEDIIHPLLKFLLGYMPGRLYDLSASKYGSQGELKSLIGAFHQKGIKCLADIVIN  125

Query  389   HRAAERANSRGVFNVFEGGTPDDKLDWGPSEICGDDAAF-EGTGNPDTGDPWGDAPDIDH  565
             HR AE+ + RG++ +FEGGT DD+LDWGPS IC DD A+ +G GNPDTG  +G APDIDH
Sbjct  126   HRTAEKQDGRGIWCIFEGGTSDDRLDWGPSLICSDDTAYSDGKGNPDTGGDFGGAPDIDH  185

Query  566   RSPRVQREISEWMNWLKSDVGFDGWRFDYVKGYDFVKGFAAVKIYMDNTKPEFAVGELWN  745
              +PRVQ+E+S+WMNWLKS++GFDGWRFD+V+GY      +  KIYM NT P+FAVGE W+
Sbjct  186   LNPRVQKELSDWMNWLKSEIGFDGWRFDFVRGY----APSITKIYMKNTSPDFAVGEKWD  241

Query  746   ALSPGSVPNPDYNQDAHRNELVRWVQNaggaatafdfttKGILQAALNNTELWRLKDAAG  925
             +L+ G    P YNQDAHR  L  W+Q AGGA TAFDFTTKGILQAA+   ELWRLKD+ G
Sbjct  242   SLAYGQDGKPVYNQDAHRGGLKDWIQAAGGAVTAFDFTTKGILQAAVQG-ELWRLKDSNG  300

Query  926   KPSGMIGVLPQSAVTFIDNHDTWS-QRLWPFTTSTDDAVNHDRVLQGYAYILTHPGIPSV  1102
             KP G+IG+LPQ+AVTFIDNHDT S Q+LWPF +        D+V+QGYAYILTHPG PS+
Sbjct  301   KPPGLIGLLPQNAVTFIDNHDTGSTQKLWPFPS--------DKVMQGYAYILTHPGTPSI  352

Query  1103  FYDHFFEWGLKDAISKLISIRNKNGVSATSPVEILAADADLYIAKINGKVILKIGPNGDL  1282
             FYDHFF+WGLK  I KL +IR  +G+ + S V ILA+DADLY+A I+G VI+KIGP  DL
Sbjct  353   FYDHFFDWGLKTEIGKLTTIRRTSGIGSASTVNILASDADLYVAAIDGNVIMKIGPKMDL  412

Query  1283  KNLVPSDFMLATSGKDFAVWEK  1348
              NL+PS+F +A SG D+ VW K
Sbjct  413   GNLIPSNFQVAASGADYCVWVK  434



>ref|XP_004499060.1| PREDICTED: alpha-amylase-like [Cicer arietinum]
Length=424

 Score =   506 bits (1302),  Expect = 2e-172, Method: Compositional matrix adjust.
 Identities = 253/429 (59%), Positives = 322/429 (75%), Gaps = 14/429 (3%)
 Frame = +2

Query  59    LSLFCIAFFLFPLHSSSTVLFQGFTWTSKDQPGGWWNWLITKVPDLADAGITHVWLPPPS  238
                 C+   LFP  SSS +LFQGF W S ++ GGW+N+L +KVPD+ADAG+ +VWLPPPS
Sbjct  8     FCFLCLCISLFPSFSSSAILFQGFNWASSEKAGGWYNFLKSKVPDIADAGVEYVWLPPPS  67

Query  239   NAREGDDQGYMPKRMYDLDTSKYGNKKELKALNDAFHGRGIKSVADIVLNHRAAERANSR  418
             N+ +   QGY+PKR+YDLDTSKYGNK ELKAL  AF  RG+K+++DIV+NHR AER +S+
Sbjct  68    NSHDDGPQGYLPKRLYDLDTSKYGNKNELKALVAAFRERGVKTISDIVINHRTAERLDSQ  127

Query  419   GVFNVFEGGTPDDKLDWGPSEICGDDAAFEGTGNPDTGDPWGDAPDIDHRSPRVQREISE  598
             G+ ++FEGGTPD +LDW  S IC  D  F+GTGNPDTGD WG APDIDH +P+VQ+E+S+
Sbjct  128   GL-SIFEGGTPDTRLDWDVSYICSTDVEFKGTGNPDTGDDWGGAPDIDHTNPKVQQELSD  186

Query  599   WMNWLKSDVGFDGWRFDYVKGYDFVKGFAAVKIYMDNTKPEFAVGELWNALSPGSVPNPD  778
             WMNWLK+DVGF GWRFD V GY         K YM+ T P+FAVGEL+  ++ GS   P 
Sbjct  187   WMNWLKTDVGFVGWRFDMVVGY----APRYTKTYMEKTSPDFAVGELYEKVALGSDGKPL  242

Query  779   YNQDAHRNELVRWVQNaggaatafdfttKGILQAALNNTELWRLKDAAGKPSGMIGVLPQ  958
              NQ+AHR  LV+WV +AGG  T FDFTTK IL AA+   ELWR+KD  GKP GMIG+   
Sbjct  243   SNQEAHRQRLVKWVNDAGGVVTTFDFTTKMILGAAVEG-ELWRMKDGNGKPPGMIGIKSS  301

Query  959   SAVTFIDNHDTWSQRLWPFTTSTDDAVNHDRVLQGYAYILTHPGIPSVFYDHFFEWGLKD  1138
             +AVTF+DNHDT SQ+LWPF          D+V+ GY YILTHPG P++FYDH+ EWGL +
Sbjct  302   NAVTFVDNHDTGSQKLWPFP--------DDKVMLGYVYILTHPGHPTIFYDHYIEWGLME  353

Query  1139  AISKLISIRNKNGVSATSPVEILAADADLYIAKINGKVILKIGPNGDLKNLVPSDFMLAT  1318
              I KL +IR +NG++ATS V ILAA++DLY+A+I+ K+I+KIGP  DL NL+PS+  +AT
Sbjct  354   PIKKLTAIRKRNGITATSSVNILAAESDLYMAEIDNKIIVKIGPKLDLGNLLPSNAQVAT  413

Query  1319  SGKDFAVWE  1345
             +G+D+AVWE
Sbjct  414   NGQDYAVWE  422



>gb|KHG27234.1| Uncharacterized protein F383_11580 [Gossypium arboreum]
Length=419

 Score =   505 bits (1301),  Expect = 2e-172, Method: Compositional matrix adjust.
 Identities = 262/440 (60%), Positives = 333/440 (76%), Gaps = 25/440 (6%)
 Frame = +2

Query  35    TIMKSSFYLSLFCIAFFLFPLHSSSTVLFQGFTWTSKDQPGGWWNWLITKVPDLADAGIT  214
             + + S  +LSLF    ++FP  +S ++LFQGF W S ++ GGW++ L   +PD+A+AG+T
Sbjct  2     SCVTSLCFLSLF---LYIFPSLTSPSLLFQGFNWESCNKAGGWYSSLKNSIPDIANAGVT  58

Query  215   HVWLPPPSNAREGDDQGYMPKRMYDLDTSKYGNKKELKALNDAFHGRGIKSVADIVLNHR  394
             HVWLPPPS +     QGY+P R+YDLD SKYG++ ELK+L  AFH +GIK +ADIV+NHR
Sbjct  59    HVWLPPPSQSV--GPQGYLPGRLYDLDASKYGSQAELKSLIKAFHQKGIKCLADIVINHR  116

Query  395   AAERANSRGVFNVFEGGTPDDKLDWGPSEICGDDAAF-EGTGNPDTGDPWGDAPDIDHRS  571
              AER + RG++ +FEGGTPDD+LDWGPS ICG+D  + +GTGNPDTG  +  APDIDH +
Sbjct  117   TAERKDGRGIYCIFEGGTPDDRLDWGPSFICGNDKEYSDGTGNPDTGLDYPPAPDIDHLN  176

Query  572   PRVQREISEWMNWLKSDVGFDGWRFDYVKGYDFVKGFAAVKIYMDNTKPEFAVGELWNAL  751
             PRVQ+E+S+WMNWLK+++GFDGWRFD+V+GY      +  KIYM+ T P+FAVGE W  L
Sbjct  177   PRVQKELSDWMNWLKTEIGFDGWRFDFVRGY----APSITKIYMERTSPDFAVGEKWEDL  232

Query  752   SPGSVPNPDYNQDAHRNELVRWVQNaggaatafdfttKGILQAALNNTELWRLKDAAGKP  931
             S G       +QDAHR  L  WV+ AGG   AFDFTTKG+L AA+   ELWRLKD+ G+P
Sbjct  233   SLGQD-----SQDAHRGALKDWVEAAGGVVKAFDFTTKGVLNAAVQG-ELWRLKDSNGEP  286

Query  932   SGMIGVLPQSAVTFIDNHDTWS-QRLWPFTTSTDDAVNHDRVLQGYAYILTHPGIPSVFY  1108
              GMIG+LPQ AVTFIDNHDT S Q+LWPF +        D+V+QGYAYILTHPG PS+FY
Sbjct  287   PGMIGLLPQKAVTFIDNHDTGSTQKLWPFPS--------DKVIQGYAYILTHPGTPSIFY  338

Query  1109  DHFFEWGLKDAISKLISIRNKNGVSATSPVEILAADADLYIAKINGKVILKIGPNGDLKN  1288
             DHF +WGLKD I+KL +IR KNG+S TS V+ILA+D+DLY+A I+ K+I KIGP  DL N
Sbjct  339   DHFVDWGLKDEITKLATIRRKNGISETSKVDILASDSDLYVAAIDEKIITKIGPKMDLGN  398

Query  1289  LVPSDFMLATSGKDFAVWEK  1348
             LVPS++ LATSGKD+AVW K
Sbjct  399   LVPSNYQLATSGKDYAVWAK  418



>ref|XP_009783973.1| PREDICTED: alpha-amylase-like [Nicotiana sylvestris]
Length=431

 Score =   504 bits (1299),  Expect = 7e-172, Method: Compositional matrix adjust.
 Identities = 264/428 (62%), Positives = 323/428 (75%), Gaps = 14/428 (3%)
 Frame = +2

Query  71    CIAFFLFPLHSSSTVLFQGFTWTSKDQPGGWWNWLITKVPDLADAGITHVWLPPPSNARE  250
             C+   L P  +SST+LFQGF W S  Q GGWWN LI  VPDLADAG+THVWLPP SN+ +
Sbjct  14    CLLLILLPAFASSTLLFQGFNWESSGQDGGWWNHLIKLVPDLADAGVTHVWLPPASNSLQ  73

Query  251   GDDQGYMPKRMYDLDTSKYGNKKELKALNDAFHGRGIKSVADIVLNHRAAERANSRGVFN  430
                QGYMP R+YDLDTS YGN +ELKAL  AFH +GIK +ADIV+NHR AE  + RG+  
Sbjct  74    NHSQGYMPSRLYDLDTSSYGNSRELKALIKAFHDKGIKCLADIVINHRWAENKDRRGINC  133

Query  431   VFEGGTPDDKLDWGPSEICGDDAAF-EGTGNPDTGDPWGDAPDIDHRSPRVQREISEWMN  607
             +FEGGTPD+KLDWGP+ ICG+D  F +G GN DTG  WGDAPDIDH +P+VQ+++S+WMN
Sbjct  134   LFEGGTPDNKLDWGPTFICGNDTKFSDGKGNNDTGLDWGDAPDIDHANPQVQKDLSDWMN  193

Query  608   WLKSDVGFDGWRFDYVKGYDFVKGFAAVKIYMDNTKPEFAVGELWNALSPGSVPNPDYNQ  787
             WLK+++GFDGWRFD V GY         KIYMDNTKP+FAVGE +   +      PDY+Q
Sbjct  194   WLKTEIGFDGWRFDMVLGY----APKFTKIYMDNTKPDFAVGEFFLKFNNKPDGKPDYDQ  249

Query  788   DAHRNELVRWVQNaggaatafdfttKGILQAALNNTELWRLKDAAGKPSGMIGVLPQSAV  967
               HRN L++WVQNAGG  T FDFTTKGIL  A+ +T    LKD+ G P GMIG+LPQ+AV
Sbjct  250   --HRNYLLQWVQNAGGVVTTFDFTTKGILGTAVGDTRFDLLKDSKGHPPGMIGILPQNAV  307

Query  968   TFIDNHDTWSQRLWPFTTSTDDAVNHDRVLQGYAYILTHPGIPSVFYDHFFEW-GLKDAI  1144
             TFIDNHDT+SQ+ WPF T+ +     D+V QGYAYILTHPGIPSVFYDHFF + G++  I
Sbjct  308   TFIDNHDTYSQQQWPFPTNPN-----DKVTQGYAYILTHPGIPSVFYDHFFLFQGMRKPI  362

Query  1145  SKLISIRNKNGVSATSPVEILAADADLYIAKINGKVILKIGPNGDLKNLVPSDFMLATSG  1324
               L ++R +NG+SATS V+ILAA  DLY+A I+ K+I+KIGP G++ NLVPS+F LATSG
Sbjct  363   KDLYAVRKRNGISATSKVKILAAQNDLYVANIDDKIIVKIGP-GNVGNLVPSNFQLATSG  421

Query  1325  KDFAVWEK  1348
              D+AV EK
Sbjct  422   VDYAVSEK  429



>gb|AHL44839.1| alpha-amylase-like protein [Vitis labrusca x Vitis vinifera]
Length=424

 Score =   503 bits (1294),  Expect = 3e-171, Method: Compositional matrix adjust.
 Identities = 263/435 (60%), Positives = 327/435 (75%), Gaps = 23/435 (5%)
 Frame = +2

Query  62    SLFCIAFF--LFPLHSSSTVLFQGFTWTSKDQPGGWWNWLITKVPDLADAGITHVWLPPP  235
             SL  + FF  + P  ++S +LFQGF W S  + GGW+N+LI  +P+L+ +GITHVWLPPP
Sbjct  6     SLSYLLFFNTILPTLTASPILFQGFNWESSKKQGGWYNFLINSIPELSASGITHVWLPPP  65

Query  236   SNAREGDDQGYMPKRMYDLDTSKYGNKKELKALNDAFHGRGIKSVADIVLNHRAAERANS  415
             S  +    +GY+P R+YDL+ S YG + ELKAL  AF   GI+ +ADIV+NHR AE+ +S
Sbjct  66    S--QSAASEGYLPGRLYDLNASHYGTQDELKALIKAFRSNGIQCIADIVINHRTAEKKDS  123

Query  416   RGVFNVFEGGTPDDKLDWGPSEICGDDAAF-EGTGNPDTGDPWGDAPDIDHRSPRVQREI  592
             RG++ +FEGGTPDD+LDWGPS IC DD  F +G GNPDTG  +  APDIDH +PRVQRE+
Sbjct  124   RGIWAIFEGGTPDDRLDWGPSFICSDDTLFSDGKGNPDTGAGFDPAPDIDHVNPRVQREL  183

Query  593   SEWMNWLKSDVGFDGWRFDYVKGY--DFVKGFAAVKIYMDNTKPEFAVGELWNALSPGSV  766
             S+WMNWLK ++GF GWRFD+ +GY  DF K      +YM NT P FAVGE+WN+LS G+ 
Sbjct  184   SDWMNWLKIEIGFAGWRFDFARGYSPDFTK------LYMKNTSPNFAVGEIWNSLSYGND  237

Query  767   PNPDYNQDAHRNELVRWVQNaggaatafdfttKGILQAALNNTELWRLKDAAGKPSGMIG  946
               P YNQDAHR ELV WV+ AGGA TAFDFTTKGILQAA+   ELWRLKD+ G P GMIG
Sbjct  238   SKPAYNQDAHRRELVNWVKAAGGAVTAFDFTTKGILQAAVEG-ELWRLKDSNGGPPGMIG  296

Query  947   VLPQSAVTFIDNHDTWS-QRLWPFTTSTDDAVNHDRVLQGYAYILTHPGIPSVFYDHFFE  1123
             ++P++AVTFIDNHDT S Q++WPF +        D+V+QGY YILTHPGIPS+FYDHFF+
Sbjct  297   LMPENAVTFIDNHDTGSTQKIWPFPS--------DKVMQGYVYILTHPGIPSIFYDHFFD  348

Query  1124  WGLKDAISKLISIRNKNGVSATSPVEILAADADLYIAKINGKVILKIGPNGDLKNLVPSD  1303
             WGLK+ ISKLISIR +NG+   S V ILA+D DLY+A I+ K+I KIG   D+ NLVPS 
Sbjct  349   WGLKEEISKLISIRTRNGIKPNSVVRILASDPDLYVAAIDEKIIAKIGSRYDVGNLVPST  408

Query  1304  FMLATSGKDFAVWEK  1348
             F LATSG ++AVWEK
Sbjct  409   FKLATSGNNYAVWEK  423



>ref|XP_010108609.1| hypothetical protein L484_006340 [Morus notabilis]
 gb|EXC19765.1| hypothetical protein L484_006340 [Morus notabilis]
Length=424

 Score =   501 bits (1289),  Expect = 2e-170, Method: Compositional matrix adjust.
 Identities = 263/438 (60%), Positives = 323/438 (74%), Gaps = 18/438 (4%)
 Frame = +2

Query  41    MKSSFYLSLFCIAFFLFPLHSSSTVLFQGFTWTSKDQPGGWWNWLITKVPDLADAGITHV  220
             M S   L +FC+   LFP  ++ T+LFQGF W S D+ GGW+N L   +PDLA AGITHV
Sbjct  1     MDSLISLCVFCLCISLFPSFTTPTILFQGFNWGSSDK-GGWYNSLKNTIPDLAAAGITHV  59

Query  221   WLPPPSNAREGDDQGYMPKRMYDLDTSKYGNKKELKALNDAFHGRGIKSVADIVLNHRAA  400
             WLPP S +     QGYMP R+YDLD SKYG K ELK+L  +   +GIKSVADIV+NHR A
Sbjct  60    WLPPSSQSVA--PQGYMPGRLYDLDASKYGTKDELKSLISSLSEKGIKSVADIVINHRTA  117

Query  401   ERANSRGVFNVFEGGTPDDKLDWGPSEICGDDAAF-EGTGNPDTGDPWGDAPDIDHRSPR  577
             E+ +SRGV+ +FEGGTPD +LDWGPS IC DD  + +GTGNPDTGD +G APDIDH +P 
Sbjct  118   EKQDSRGVWAIFEGGTPDSRLDWGPSFICSDDKTYSDGTGNPDTGDDFGGAPDIDHVNPT  177

Query  578   VQREISEWMNWLKSDVGFDGWRFDYVKGYDFVKGFAAVKIYMDNTKPEFAVGELWNALSP  757
             VQ+E+SEWMNWLK+++GF GWRFD VKGY         KIYM+ T+PEFAVGE W++L+ 
Sbjct  178   VQKELSEWMNWLKTEIGFVGWRFDMVKGY----APRFTKIYMEKTQPEFAVGEKWDSLAY  233

Query  758   GSVPNPDYNQDAHRNELVRWVQNaggaatafdfttKGILQAALNNTELWRLKDAAGKPSG  937
             G    P+ NQDAHR  L  WV  AGG+  AFDFTTKGILQAA+   ELWRL+D+ GKP G
Sbjct  234   GQDRKPEQNQDAHRGALANWVDAAGGSVNAFDFTTKGILQAAVQG-ELWRLRDSNGKPPG  292

Query  938   MIGVLPQSAVTFIDNHDTWS-QRLWPFTTSTDDAVNHDRVLQGYAYILTHPGIPSVFYDH  1114
             +IG+ P++AVTFIDNHDT S Q LWPF          D+V+ GY YILTHPG P++FYDH
Sbjct  293   LIGLKPENAVTFIDNHDTGSSQNLWPFP--------GDKVMLGYVYILTHPGTPTIFYDH  344

Query  1115  FFEWGLKDAISKLISIRNKNGVSATSPVEILAADADLYIAKINGKVILKIGPNGDLKNLV  1294
               EWGLKD ISKL  IR  +G+++ S V ILAA+AD+Y+A I+ KVI+KIGP  DL NL+
Sbjct  345   LIEWGLKDQISKLSGIRTTHGINSGSTVRILAAEADIYMAGIDDKVIMKIGPKLDLGNLL  404

Query  1295  PSDFMLATSGKDFAVWEK  1348
             PS++ L TSG+D+AVWEK
Sbjct  405   PSNYQLVTSGQDYAVWEK  422



>ref|XP_009350378.1| PREDICTED: alpha-amylase-like [Pyrus x bretschneideri]
Length=424

 Score =   501 bits (1289),  Expect = 2e-170, Method: Compositional matrix adjust.
 Identities = 259/432 (60%), Positives = 329/432 (76%), Gaps = 19/432 (4%)
 Frame = +2

Query  59    LSLFCIAFFLFPLHSSSTVLFQGFTWTSKDQPGGWWNWLITKVPDLADAGITHVWLPPPS  238
             L  F ++  L P  ++S +LFQGF W S  + GGW+N L   V DLA +GITHVWLPP S
Sbjct  8     LICFLLSILLTPNFAASQILFQGFNWESS-RKGGWYNILKQSVKDLASSGITHVWLPPSS  66

Query  239   NAREGDDQGYMPKRMYDLDTSKYGNKKELKALNDAFHGRGIKSVADIVLNHRAAERANSR  418
              A    D+GYMP R+YDL+T KYGNK ELK+L  A+   GI+SVADIV+NHR AE+ + R
Sbjct  67    QA--ASDEGYMPGRLYDLNT-KYGNKDELKSLVSAYRDSGIQSVADIVINHRTAEKQDER  123

Query  419   GVFNVFEGGTPDDKLDWGPSEICGDDAAF-EGTGNPDTGDPWGDAPDIDHRSPRVQREIS  595
             G++ +FEGGT DD+LDWGPS IC DD  + +G GNPDTG+ +G APDIDH++ RVQ+E+S
Sbjct  124   GIWCIFEGGTDDDRLDWGPSLICSDDTKYSDGKGNPDTGEDFGGAPDIDHKNTRVQKELS  183

Query  596   EWMNWLKSDVGFDGWRFDYVKGYDFVKGFAAVKIYMDNTKPEFAVGELWNALSPGSVPNP  775
             +WMNWLK+++GF GWRFD+VKGY         K+YM NT P FAVGELWN+LS GS   P
Sbjct  184   DWMNWLKTEIGFSGWRFDFVKGY----APEYTKLYMTNTSPNFAVGELWNSLSYGSDGKP  239

Query  776   DYNQDAHRNELVRWVQNaggaatafdfttKGILQAALNNTELWRLKDAAGKPSGMIGVLP  955
             + +QDAHR  LVRWV++AGG  TAFDFTTKGILQAA+   ELWRLKD+ G  SGMIGV P
Sbjct  240   NPDQDAHRQALVRWVESAGGRVTAFDFTTKGILQAAVQG-ELWRLKDSKGGASGMIGVKP  298

Query  956   QSAVTFIDNHDTWS-QRLWPFTTSTDDAVNHDRVLQGYAYILTHPGIPSVFYDHFFEWGL  1132
              ++VTFIDNHDT S QR+WPF +        D+V+QGYAYILTHPGIPS+FYDH+F+WGL
Sbjct  299   GNSVTFIDNHDTGSTQRMWPFPS--------DKVMQGYAYILTHPGIPSIFYDHYFDWGL  350

Query  1133  KDAISKLISIRNKNGVSATSPVEILAADADLYIAKINGKVILKIGPNGDLKNLVPSDFML  1312
             K+ ISK+ +IR++NG+   S + ILAADAD+Y+A I+ K+I+KIGP  DL  L+P++F +
Sbjct  351   KEEISKITAIRSRNGIKPNSALRILAADADVYVASIDEKIIVKIGPKMDLGQLIPTNFQV  410

Query  1313  ATSGKDFAVWEK  1348
             +TSGKD+AVWE+
Sbjct  411   STSGKDYAVWER  422



>ref|XP_006387870.1| alpha amylase family protein [Populus trichocarpa]
 gb|ERP46784.1| alpha amylase family protein [Populus trichocarpa]
Length=404

 Score =   500 bits (1287),  Expect = 2e-170, Method: Compositional matrix adjust.
 Identities = 258/415 (62%), Positives = 320/415 (77%), Gaps = 17/415 (4%)
 Frame = +2

Query  110   TVLFQGFTWTSKDQPGGWWNWLITKVPDLADAGITHVWLPPPSNAREGDDQGYMPKRMYD  289
              +++QGF W S +Q GGW+N L   VPDLA+AGITHVWLPP S +     QGYMP R+YD
Sbjct  4     VIVWQGFNWESCNQAGGWYNSLKNLVPDLANAGITHVWLPPASQSVA--PQGYMPGRLYD  61

Query  290   LDTSKYGNKKELKALNDAFHGRGIKSVADIVLNHRAAERANSRGVFNVFEGGTPDDKLDW  469
             L  SKYG++ ELK+L  AFH +GIK +ADIV+NHR AE+ + RG++ +FEGGT DD+LDW
Sbjct  62    LSASKYGSQGELKSLIGAFHQKGIKCLADIVINHRTAEKQDGRGIWCIFEGGTSDDRLDW  121

Query  470   GPSEICGDDAAF-EGTGNPDTGDPWGDAPDIDHRSPRVQREISEWMNWLKSDVGFDGWRF  646
             GPS IC DD A+ +G GNPDTG  +G APDIDH +PRVQ+E+S+WMNWLKS++GFDGWRF
Sbjct  122   GPSLICSDDTAYSDGKGNPDTGGDFGGAPDIDHLNPRVQKELSDWMNWLKSEIGFDGWRF  181

Query  647   DYVKGYDFVKGFAAVKIYMDNTKPEFAVGELWNALSPGSVPNPDYNQDAHRNELVRWVQN  826
             D+VKGY      +  KIYM+NT P+FAVGE W++L+ G    PDYNQDAHR  L  W+Q 
Sbjct  182   DFVKGY----APSITKIYMENTSPDFAVGEKWDSLAYGQDGKPDYNQDAHRGGLKDWIQA  237

Query  827   aggaatafdfttKGILQAALNNTELWRLKDAAGKPSGMIGVLPQSAVTFIDNHDTWS-QR  1003
             AGGA TAFDFTTKGILQAA+   ELWRLKD+ GKP G+IG+LPQ+AVTFIDNHDT S Q+
Sbjct  238   AGGAVTAFDFTTKGILQAAVQG-ELWRLKDSNGKPPGLIGLLPQNAVTFIDNHDTGSTQK  296

Query  1004  LWPFTTSTDDAVNHDRVLQGYAYILTHPGIPSVFYDHFFEWGLKDAISKLISIRNKNGVS  1183
             LWPF +        D+V+QGYAYILTHPG PS+FYDHFF+WGLK+ I KL +IR  +G+ 
Sbjct  297   LWPFPS--------DKVMQGYAYILTHPGTPSIFYDHFFDWGLKEEIGKLATIRKTSGIG  348

Query  1184  ATSPVEILAADADLYIAKINGKVILKIGPNGDLKNLVPSDFMLATSGKDFAVWEK  1348
             + S V ILA+DADLY+A I+G +I+KIGP  DL NL+PS+F +A SG D+ VW K
Sbjct  349   SASTVNILASDADLYVAAIDGNMIMKIGPKMDLGNLIPSNFQVAASGTDYCVWVK  403



>ref|XP_006374943.1| alpha amylase family protein [Populus trichocarpa]
 gb|ERP52740.1| alpha amylase family protein [Populus trichocarpa]
Length=423

 Score =   500 bits (1288),  Expect = 2e-170, Method: Compositional matrix adjust.
 Identities = 259/436 (59%), Positives = 327/436 (75%), Gaps = 16/436 (4%)
 Frame = +2

Query  47    SSFYLSLFCIAFFLFPLHSSSTVLFQGFTWTSKDQPGGWWNWLITKVPDLADAGITHVWL  226
             S      F +   +FPL +SS +LFQGF W S ++ GGW+N L   VPDLA+AGITHVWL
Sbjct  2     SFLTFCFFSLFLSVFPLLTSSYLLFQGFNWESCNKAGGWYNSLKNSVPDLANAGITHVWL  61

Query  227   PPPSNAREGDDQGYMPKRMYDLDTSKYGNKKELKALNDAFHGRGIKSVADIVLNHRAAER  406
             PP S +     + YMP R+YDL  S+YG++ ELK+L   F+ +GIK +ADIV+NHR AE+
Sbjct  62    PPSSQSVAPQGR-YMPGRLYDLSASRYGSQDELKSLIGDFNQKGIKCLADIVINHRTAEK  120

Query  407   ANSRGVFNVFEGGTPDDKLDWGPSEICGDDAAF-EGTGNPDTGDPWGDAPDIDHRSPRVQ  583
              + RG+++VFEGGT D +LDWGPS ICGDD A+ +G GNPD+GD +  APDIDH +PRVQ
Sbjct  121   QDERGIWSVFEGGTSDGRLDWGPSFICGDDTAYSDGKGNPDSGDDFEPAPDIDHLNPRVQ  180

Query  584   REISEWMNWLKSDVGFDGWRFDYVKGYDFVKGFAAVKIYMDNTKPEFAVGELWNALSPGS  763
             RE+S+WMNWLKS++GFDGWRFD+VKGY      +  KIYM+NT P+FAVGE W++L+ G 
Sbjct  181   RELSDWMNWLKSEIGFDGWRFDFVKGY----APSVTKIYMENTSPDFAVGEKWDSLAYGQ  236

Query  764   VPNPDYNQDAHRNELVRWVQNaggaatafdfttKGILQAALNNTELWRLKDAAGKPSGMI  943
                 DYNQDAHR  +  W+Q AGGA TAFDFT+KGILQAA+   ELWRLKD+ GKP G+I
Sbjct  237   DGKLDYNQDAHRGSIKDWIQAAGGAVTAFDFTSKGILQAAVQG-ELWRLKDSNGKPPGLI  295

Query  944   GVLPQSAVTFIDNHDTWS-QRLWPFTTSTDDAVNHDRVLQGYAYILTHPGIPSVFYDHFF  1120
             G+LPQ+AVTFIDNHDT S Q++WPF +        D+V+QGYAYILTHPG PS+FYDHFF
Sbjct  296   GLLPQNAVTFIDNHDTGSTQQIWPFPS--------DKVMQGYAYILTHPGTPSIFYDHFF  347

Query  1121  EWGLKDAISKLISIRNKNGVSATSPVEILAADADLYIAKINGKVILKIGPNGDLKNLVPS  1300
             +WGLK+ I KL +IR   G+ + S V ILA+DADLY+A IN  +I+KIGP  DL NL+PS
Sbjct  348   DWGLKEEIGKLATIRKNYGIGSASTVNILASDADLYVAAINDNIIMKIGPKTDLGNLIPS  407

Query  1301  DFMLATSGKDFAVWEK  1348
             +F +ATSG D+ VW K
Sbjct  408   NFQVATSGTDYCVWVK  423



>ref|XP_002510218.1| alpha-amylase, putative [Ricinus communis]
 gb|EEF52405.1| alpha-amylase, putative [Ricinus communis]
Length=422

 Score =   500 bits (1288),  Expect = 3e-170, Method: Compositional matrix adjust.
 Identities = 265/434 (61%), Positives = 328/434 (76%), Gaps = 19/434 (4%)
 Frame = +2

Query  56    YLSLFCIAFFLFPLHSSSTVLFQGFTWTSKDQPGGWWNWLITKVPDLADAGITHVWLPPP  235
             +LS F +   +FPL++S+ VLFQGF W S ++ GGW+N L   VPD+A AGITHVWLPP 
Sbjct  3     FLSWFYL-LSIFPLYTSAAVLFQGFNWESCNKEGGWYNSLKNFVPDIASAGITHVWLPPS  61

Query  236   SNAREGDDQGYMPKRMYDLDTSKYGNKKELKALNDAFHGRGIKSVADIVLNHRAAERANS  415
             S +     QGYMP R+YDL  SKYGN+ ELK+L  A H +GIK +ADIV+NHR AE+ + 
Sbjct  62    SQSVA--PQGYMPGRLYDLSVSKYGNQDELKSLIQALHQKGIKCLADIVINHRTAEKQDE  119

Query  416   RGVFNVFEGGTPDDKLDWGPSEICGDDAAF-EGTGNPDTGDPWGDAPDIDHRSPRVQREI  592
             RG++ +FEGGT DD+LDWGPS IC DD A+ +G GNPDTG  +  APDIDH +PRVQ+E+
Sbjct  120   RGIWCIFEGGTADDRLDWGPSFICRDDTAYSDGKGNPDTGGDFEPAPDIDHLNPRVQQEL  179

Query  593   SEWMNWLKSDVGFDGWRFDYVKGYDFVKGFAAVKIYMDNTKPEFAVGELWNALSPGSVPN  772
             S+WMNWLKS++GFDGWRFDYVKGY      +  KIYM  T P+FAVGE W++LS G    
Sbjct  180   SDWMNWLKSEIGFDGWRFDYVKGY----APSITKIYMGKTTPDFAVGEKWDSLSYGQDRK  235

Query  773   PDYNQDAHRNELVRWVQNaggaatafdfttKGILQAALNNTELWRLKDAAGKPSGMIGVL  952
             PDYNQD HRN L  W+Q AGG  TAFDFTTKGILQAA+   ELWRLKD+ G P G+IG +
Sbjct  236   PDYNQDGHRNALKDWIQAAGGVITAFDFTTKGILQAAVQG-ELWRLKDSNGNPPGLIGTM  294

Query  953   PQSAVTFIDNHDTWS-QRLWPFTTSTDDAVNHDRVLQGYAYILTHPGIPSVFYDHFFEWG  1129
             PQ+AVTFIDNHDT S Q+LWPF +        D+V+QGYAYILTHPGIPS+FYDHFF+WG
Sbjct  295   PQNAVTFIDNHDTGSTQQLWPFPS--------DKVMQGYAYILTHPGIPSIFYDHFFDWG  346

Query  1130  LKDAISKLISIRNKNGVSATSPVEILAADADLYIAKINGKVILKIGPNGDLKNLVPS-DF  1306
             LK+ IS+L SIR   G+ + S V+I+AA++DLY+A IN  VI+KIGP  DL NL+PS +F
Sbjct  347   LKEPISRLASIRKSYGIDSKSRVKIVAAESDLYMAAINDNVIMKIGPKMDLGNLLPSKEF  406

Query  1307  MLATSGKDFAVWEK  1348
              +ATSG+ +AVW K
Sbjct  407   QVATSGESYAVWVK  420



>ref|XP_010690292.1| PREDICTED: alpha-amylase-like [Beta vulgaris subsp. vulgaris]
Length=430

 Score =   499 bits (1285),  Expect = 8e-170, Method: Compositional matrix adjust.
 Identities = 253/436 (58%), Positives = 330/436 (76%), Gaps = 20/436 (5%)
 Frame = +2

Query  56    YLSLFCIAFFLFPLHS--SSTVLFQGFTWTSKDQPGGWWNWLITKVPDLADAGITHVWLP  229
             + +L C++   F L S  + T+LFQGF W S ++PGG +N L   + DLA AG+THVWLP
Sbjct  8     FATLCCLSLSYFLLFSFVTPTLLFQGFNWESSNKPGGLYNSLKNSIDDLARAGVTHVWLP  67

Query  230   PPSNAREGDDQGYMPKRMYDLDTSKYGNKKELKALNDAFHGRGIKSVADIVLNHRAAERA  409
             PP+++     QGYMP R+YDLD+S+YGN+ +LK+L +AFH +GIK VADIV+NHR A++ 
Sbjct  68    PPTHSVS--PQGYMPGRLYDLDSSRYGNEADLKSLINAFHQKGIKCVADIVINHRCADKK  125

Query  410   NSRGVFNVFEGGTPDDKLDWGPSEICGDDAAF-EGTGNPDTGDPWGDAPDIDHRSPRVQR  586
             + RG++ +FEGGTPDD+LDWGP  IC DD  + +G+GN DTG  +G APDIDH +PRVQ+
Sbjct  126   DGRGIYCIFEGGTPDDRLDWGPWAICRDDTQYSDGSGNLDTGAGYGAAPDIDHLNPRVQK  185

Query  587   EISEWMNWLKSDVGFDGWRFDYVKGYDFVKGFAAVKIYMDNTKPEFAVGELWNALSPGSV  766
             E+ +WMNWLK+++GFDGWRFD+VKGY      +  KIYM+ T+P+FAVGELW++++    
Sbjct  186   ELVDWMNWLKTEIGFDGWRFDFVKGY----APSITKIYMEKTRPDFAVGELWDSITYDPD  241

Query  767   PNPDYNQDAHRNELVRWVQNaggaatafdf-ttKGILQAALNNTELWRLKDAAGKPSGMI  943
               PDYNQD  RNEL  WVQ AGG   A    TTKG+LQAA+   E WR+KD+ G+PSG+I
Sbjct  242   GKPDYNQDGPRNELAGWVQAAGGGVIAAFDFTTKGVLQAAVQG-EWWRMKDSNGRPSGLI  300

Query  944   GVLPQSAVTFIDNHDTWS-QRLWPFTTSTDDAVNHDRVLQGYAYILTHPGIPSVFYDHFF  1120
             G++P++AVTFIDNHDT S QRLWPF          D+V+QGYAYILTHPGIPS+FYDHF 
Sbjct  301   GIMPKNAVTFIDNHDTGSTQRLWPFPA--------DKVMQGYAYILTHPGIPSIFYDHFL  352

Query  1121  EWGLKDAISKLISIRNKNGVSATSPVEILAADADLYIAKINGKVILKIGPNGDLKNLVPS  1300
             EWGLK+ I KL SIR +NG+S +S V I+A+DADLY+A I+GKVI+K+GP  DL NL+PS
Sbjct  353   EWGLKEEIDKLTSIRLRNGISESSNVNIMASDADLYVAMIDGKVIVKLGPRYDLGNLIPS  412

Query  1301  DFMLATSGKDFAVWEK  1348
             +F  +T GKD+ VWEK
Sbjct  413   NFKASTFGKDYCVWEK  428



>ref|XP_010061754.1| PREDICTED: alpha-amylase-like isoform X1 [Eucalyptus grandis]
 gb|KCW68752.1| hypothetical protein EUGRSUZ_F02349 [Eucalyptus grandis]
Length=425

 Score =   499 bits (1285),  Expect = 8e-170, Method: Compositional matrix adjust.
 Identities = 261/439 (59%), Positives = 327/439 (74%), Gaps = 17/439 (4%)
 Frame = +2

Query  38    IMKSSFYLSLFCIAFFLFPLHSSSTVLFQGFTWTSKDQPGGWWNWLITKVPDLADAGITH  217
             +M S     LF +  F     +S  +LFQGF W S  + GGW+N L   VPDLA+AGITH
Sbjct  1     MMSSPSLFWLFVLLVFYLAASASPALLFQGFNWESSKKEGGWYNSLKNLVPDLANAGITH  60

Query  218   VWLPPPSNAREGDDQGYMPKRMYDLDTSKYGNKKELKALNDAFHGRGIKSVADIVLNHRA  397
             VWLPPPS +     QGY+P R+YDL+ S YGN+ ELK L DAFH +GIK +ADIV+NHR 
Sbjct  61    VWLPPPSQSAA--QQGYLPGRLYDLNASSYGNQDELKHLIDAFHQKGIKCLADIVINHRT  118

Query  398   AERANSRGVFNVFEGGTPDDKLDWGPSEICGDDAAF-EGTGNPDTGDPWGDAPDIDHRSP  574
             AE+ +SRG++ +FEGGTPD++LDWGPS IC DD  F +G GN DTG  + + PDIDH +P
Sbjct  119   AEKQDSRGIWCIFEGGTPDERLDWGPSFICRDDTEFSDGMGNLDTGGDFNNTPDIDHLNP  178

Query  575   RVQREISEWMNWLKSDVGFDGWRFDYVKGYDFVKGFAAVKIYMDNTKPEFAVGELWNALS  754
             RVQ+E+S+WMNWLKSD+GFDGWRFD+V GYD     +  KIYMD T P FAVGE W++LS
Sbjct  179   RVQKELSDWMNWLKSDIGFDGWRFDFVLGYDP----SITKIYMDRTLPNFAVGENWDSLS  234

Query  755   PGSVPNPDYNQDAHRNELVRWVQNaggaatafdfttKGILQAALNNTELWRLKDAAGKPS  934
              G    P+ NQDAHR++L  WV  AGGA TAFDFTTKGILQAA+   ELWRLKD+ G P 
Sbjct  235   YGQDKKPNPNQDAHRHKLAEWVNAAGGAVTAFDFTTKGILQAAVEG-ELWRLKDSNGMPP  293

Query  935   GMIGVLPQSAVTFIDNHDTWS-QRLWPFTTSTDDAVNHDRVLQGYAYILTHPGIPSVFYD  1111
             G+IG+ P SAVTFIDNHDT S Q++WPF +        D+V+QGYAYILTHPG+PS+FYD
Sbjct  294   GLIGLQPSSAVTFIDNHDTGSTQKIWPFPS--------DKVMQGYAYILTHPGVPSIFYD  345

Query  1112  HFFEWGLKDAISKLISIRNKNGVSATSPVEILAADADLYIAKINGKVILKIGPNGDLKNL  1291
             HFF+WGLK+ I KL +IR +N ++  S VEILA+D+DLY+AKI+  VI+KIGP  ++ NL
Sbjct  346   HFFDWGLKEEIGKLTAIRARNQINEKSSVEILASDSDLYVAKIDDGVIMKIGPRFEVGNL  405

Query  1292  VPSDFMLATSGKDFAVWEK  1348
             VP ++ +ATSG+D+ VWEK
Sbjct  406   VPPNYQIATSGQDYCVWEK  424



>ref|XP_007199844.1| hypothetical protein PRUPE_ppa006152mg [Prunus persica]
 gb|EMJ01043.1| hypothetical protein PRUPE_ppa006152mg [Prunus persica]
Length=425

 Score =   499 bits (1285),  Expect = 8e-170, Method: Compositional matrix adjust.
 Identities = 258/433 (60%), Positives = 325/433 (75%), Gaps = 19/433 (4%)
 Frame = +2

Query  62    SLFCIAFF--LFPLHSSSTVLFQGFTWTSKDQPGGWWNWLITKVPDLADAGITHVWLPPP  235
             +LFC+     L P  ++S +LFQGF W S    GGW+N L   VP+LA +GITHVWLPPP
Sbjct  6     TLFCVLLCINLLPNFAASQILFQGFNWESWKTEGGWYNSLRKSVPELASSGITHVWLPPP  65

Query  236   SNAREGDDQGYMPKRMYDLDTSKYGNKKELKALNDAFHGRGIKSVADIVLNHRAAERANS  415
             S A     +GY+P R+YDL  SKYG++ ELK+L  AFH  GI++VADIV+NHR AE+ + 
Sbjct  66    SQA--ASSEGYLPGRLYDLSASKYGSQDELKSLISAFHDSGIQAVADIVINHRTAEKQDE  123

Query  416   RGVFNVFEGGTPDDKLDWGPSEICGDDAAF-EGTGNPDTGDPWGDAPDIDHRSPRVQREI  592
             RG++ +FEGGTPD++LDWGPS IC DD  + +G GNPDTG  +  APDIDH++ RVQ+E+
Sbjct  124   RGIWCIFEGGTPDNRLDWGPSLICSDDTQYSDGKGNPDTGAGYDAAPDIDHKNTRVQKEL  183

Query  593   SEWMNWLKSDVGFDGWRFDYVKGYDFVKGFAAVKIYMDNTKPEFAVGELWNALSPGSVPN  772
             S+WMNWLK+++GF GWRFD+V+GY         K+YM NT P FAVGELWN+L+ GS   
Sbjct  184   SDWMNWLKTEIGFSGWRFDFVRGYSP----EITKLYMTNTSPNFAVGELWNSLAIGSDGK  239

Query  773   PDYNQDAHRNELVRWVQNaggaatafdfttKGILQAALNNTELWRLKDAAGKPSGMIGVL  952
             P+YNQDAHR EL  WV+ AGGA TAFDFTTKGILQAA+   EL RLKD  G+  GMIG+L
Sbjct  240   PEYNQDAHRQELAGWVEGAGGAVTAFDFTTKGILQAAVQG-ELSRLKDPNGRAPGMIGLL  298

Query  953   PQSAVTFIDNHDTWS-QRLWPFTTSTDDAVNHDRVLQGYAYILTHPGIPSVFYDHFFEWG  1129
             P  +VTFIDNHDT S Q++WPF +        D+V+QGYAYILTHPGIPS+FYDHFF+WG
Sbjct  299   PGKSVTFIDNHDTGSTQKIWPFPS--------DKVIQGYAYILTHPGIPSIFYDHFFDWG  350

Query  1130  LKDAISKLISIRNKNGVSATSPVEILAADADLYIAKINGKVILKIGPNGDLKNLVPSDFM  1309
             LKD I+KLI+IR++NG+   S + ILA+DADLY+A I+ K+I KIG   D+ NLVP  + 
Sbjct  351   LKDEITKLIAIRSRNGIKPDSALRILASDADLYVAAIDEKIIAKIGSRYDVGNLVPPTYQ  410

Query  1310  LATSGKDFAVWEK  1348
             +ATSGKD+AVWEK
Sbjct  411   VATSGKDYAVWEK  423



>ref|XP_008236505.1| PREDICTED: alpha-amylase-like [Prunus mume]
Length=419

 Score =   499 bits (1284),  Expect = 8e-170, Method: Compositional matrix adjust.
 Identities = 261/436 (60%), Positives = 327/436 (75%), Gaps = 27/436 (6%)
 Frame = +2

Query  47    SSFYLSLFCIAFFLFPLHSSSTVLFQGFTWTSKDQPGGWWNWLITKVPDLADAGITHVWL  226
             S FYL L CI   L P  ++S +LFQGF W S  + GGW+N L   VP+LA +GITHVWL
Sbjct  7     SLFYL-LLCIN--LLPNFTASQILFQGFNWESWKKEGGWYNSLRKSVPELASSGITHVWL  63

Query  227   PPPSNAREGDDQGYMPKRMYDLDTSKYGNKKELKALNDAFHGRGIKSVADIVLNHRAAER  406
             PPPS A    D+GY+P R+YDL  SKYG++ ELK+L  AFHG GI++VADIV+NHR AE+
Sbjct  64    PPPSQA--ASDEGYLPGRLYDLSASKYGSQDELKSLISAFHGSGIQAVADIVINHRTAEK  121

Query  407   ANSRGVFNVFEGGTPDDKLDWGPSEICGDDAAF-EGTGNPDTGDPWGDAPDIDHRSPRVQ  583
              + RG++ +FEGGTPD++LDWGPS IC DD  + +G GNPDTG P+  APDIDH++ RVQ
Sbjct  122   QDERGIWCLFEGGTPDERLDWGPSLICSDDTKYSDGKGNPDTGAPYDAAPDIDHKNTRVQ  181

Query  584   REISEWMNWLKSDVGFDGWRFDYVKGYDFVKGFAAVKIYMDNTKPEFAVGELWNALSPGS  763
             +E+S+WMNWLK+++GF GWRFD+V+GY         K+YM NT P FAVGELWN L+ GS
Sbjct  182   KELSDWMNWLKTEIGFSGWRFDFVRGYSP----EITKLYMTNTSPNFAVGELWNPLAFGS  237

Query  764   VPNPDYNQDAHRNELVRWVQNaggaatafdfttKGILQAALNNTELWRLKDAAGKPSGMI  943
                    +DAHR ELVRWV+ AGG  TAFDFTTKGILQ A+   ELWRLKD  G+  GMI
Sbjct  238   -------EDAHRQELVRWVEGAGGDVTAFDFTTKGILQQAVQG-ELWRLKDPNGRAPGMI  289

Query  944   GVLPQSAVTFIDNHDTWS-QRLWPFTTSTDDAVNHDRVLQGYAYILTHPGIPSVFYDHFF  1120
             G+LP  +VTFIDNHDT S Q++WPF +        D+V+QGYAYILTHPGIPS+FYDHFF
Sbjct  290   GLLPGKSVTFIDNHDTGSTQKIWPFPS--------DKVMQGYAYILTHPGIPSIFYDHFF  341

Query  1121  EWGLKDAISKLISIRNKNGVSATSPVEILAADADLYIAKINGKVILKIGPNGDLKNLVPS  1300
             +WGLK+ I+KLI+IR++NG+   S + ILA+DADLY+A I+ K+I KIG   D+ NLVP 
Sbjct  342   DWGLKEEITKLIAIRSRNGIQPNSALRILASDADLYVAAIDEKIIAKIGSRYDVGNLVPP  401

Query  1301  DFMLATSGKDFAVWEK  1348
              + +ATSGKD+AVWEK
Sbjct  402   TYQIATSGKDYAVWEK  417



>ref|XP_010061756.1| PREDICTED: alpha-amylase-like isoform X3 [Eucalyptus grandis]
Length=425

 Score =   497 bits (1280),  Expect = 4e-169, Method: Compositional matrix adjust.
 Identities = 260/439 (59%), Positives = 327/439 (74%), Gaps = 17/439 (4%)
 Frame = +2

Query  38    IMKSSFYLSLFCIAFFLFPLHSSSTVLFQGFTWTSKDQPGGWWNWLITKVPDLADAGITH  217
             +M S     LF ++       +S  +LFQGF W S  + GGW+N L   VPDLA+AGITH
Sbjct  1     MMSSPSLFWLFVLSVSYLAASASPALLFQGFNWESSKKEGGWYNSLKNLVPDLANAGITH  60

Query  218   VWLPPPSNAREGDDQGYMPKRMYDLDTSKYGNKKELKALNDAFHGRGIKSVADIVLNHRA  397
             VWLPPPS  +    QGY+P R+YDL+ S YGN+ ELK L DAFH +GIK +ADIV+NHR 
Sbjct  61    VWLPPPS--QSAAQQGYLPGRLYDLNASSYGNQDELKHLIDAFHQKGIKCLADIVINHRT  118

Query  398   AERANSRGVFNVFEGGTPDDKLDWGPSEICGDDAAF-EGTGNPDTGDPWGDAPDIDHRSP  574
             AE+ +SRG++ +FEGGTPD++LDWGPS IC DD  F +G GN DTG  + + PDIDH +P
Sbjct  119   AEKQDSRGIWCIFEGGTPDERLDWGPSFICRDDTEFSDGMGNLDTGGDFNNTPDIDHLNP  178

Query  575   RVQREISEWMNWLKSDVGFDGWRFDYVKGYDFVKGFAAVKIYMDNTKPEFAVGELWNALS  754
             RVQ+E+S+WMNWLKSD+GFDGWRFD+V GYD     +  KIYMD T P FAVGE W++LS
Sbjct  179   RVQKELSDWMNWLKSDIGFDGWRFDFVLGYDP----SITKIYMDRTLPNFAVGENWDSLS  234

Query  755   PGSVPNPDYNQDAHRNELVRWVQNaggaatafdfttKGILQAALNNTELWRLKDAAGKPS  934
              G    P+ NQDAHR++L  WV  AGGA TAFDFTTKGILQAA+   ELWRLKD+ G P 
Sbjct  235   YGQDKKPNPNQDAHRHKLAEWVNAAGGAVTAFDFTTKGILQAAVEG-ELWRLKDSNGMPP  293

Query  935   GMIGVLPQSAVTFIDNHDTWS-QRLWPFTTSTDDAVNHDRVLQGYAYILTHPGIPSVFYD  1111
             G+IG+ P SAVTFIDNHDT S Q++WPF +        D+V+QGYAYILTHPG+PS+FYD
Sbjct  294   GLIGLQPSSAVTFIDNHDTGSTQKIWPFPS--------DKVMQGYAYILTHPGVPSIFYD  345

Query  1112  HFFEWGLKDAISKLISIRNKNGVSATSPVEILAADADLYIAKINGKVILKIGPNGDLKNL  1291
             HFF+WGLK+ I KL +IR +N ++  S VEILA+D+DLY+AKI+  VI+KIGP  ++ NL
Sbjct  346   HFFDWGLKEEIGKLTAIRARNQINEKSSVEILASDSDLYVAKIDDGVIMKIGPRFEVGNL  405

Query  1292  VPSDFMLATSGKDFAVWEK  1348
             VP ++ +ATSG+D+ VWEK
Sbjct  406   VPPNYQIATSGQDYCVWEK  424



>ref|XP_002282184.1| PREDICTED: alpha-amylase [Vitis vinifera]
 emb|CBI32414.3| unnamed protein product [Vitis vinifera]
Length=425

 Score =   497 bits (1280),  Expect = 5e-169, Method: Compositional matrix adjust.
 Identities = 255/434 (59%), Positives = 325/434 (75%), Gaps = 20/434 (5%)
 Frame = +2

Query  62    SLFCIAFFL--FPLHSSSTVLFQGFTWTSKDQPGGWWNWLITKVPDLADAGITHVWLPPP  235
             SL C+ FF+   P  ++S +LFQGF W S  + GGW+N+LI  +P+LA +GITHVWLPPP
Sbjct  6     SLSCLLFFITILPALTASPILFQGFNWESSKKEGGWYNFLINSIPELAASGITHVWLPPP  65

Query  236   SNAREGDDQGYMPKRMYDLDTSKYGNKKELKALNDAFHGRGIKSVADIVLNHRAAERANS  415
             S +     +GYMP R+YDL+ SKYG + ELK L   FH +G++ +ADIV+NHR AE+ ++
Sbjct  66    SQSVS--PEGYMPGRLYDLNASKYGTQDELKTLIKVFHSKGVQCIADIVINHRTAEKQDA  123

Query  416   RGVFNVFEGGTPDDKLDWGPSEICGDDAAF-EGTGNPDTGDPWGDAPDIDHRSPRVQREI  592
             RG++ +FEGGTPDD+LDW PS IC DD  + +GTGNPD+GD +  APDIDH +PRVQ+E+
Sbjct  124   RGIWAIFEGGTPDDRLDWTPSFICKDDTPYSDGTGNPDSGDDYSAAPDIDHINPRVQQEL  183

Query  593   SEWMNWLKSDVGFDGWRFDYVKGYDFVKGFAAVKIYMDNTKPEFAVGELWNALSPGSVPN  772
              +WMNWLK ++GFDGWRFD+ +G+      A  K YM  T+P+FAVGE+W +LS  S   
Sbjct  184   IDWMNWLKIEIGFDGWRFDFARGFSP----AFTKFYMAKTRPKFAVGEIWKSLSYRSDGK  239

Query  773   PDYNQDAHRNELVRWVQNaggaatafdfttKGILQAALNNTELWRLKDAAGKPSGMIGVL  952
             P YNQD+HR ELV WV+ AGGA  AFDFTTKGILQAA+   ELWR+KD  GKP GMIG++
Sbjct  240   PSYNQDSHRRELVEWVRGAGGAVNAFDFTTKGILQAAVEG-ELWRMKDLNGKPPGMIGLM  298

Query  953   PQSAVTFIDNHDTWSQ-RLWPFTTSTDDAVNHDRVLQGYAYILTHPGIPSVFYDHFFEWG  1129
             P +AVTFIDNHDT S  + WPF +        D+V+QGYAYILTHPGIPS+FYDHFFEWG
Sbjct  299   PGNAVTFIDNHDTGSTLQHWPFPS--------DKVMQGYAYILTHPGIPSIFYDHFFEWG  350

Query  1130  LKDAISKLISIRNKNGVSATSPVEILAADADLYIAKINGKVILKIGPNGDLKNLVPSDF-  1306
             LK+ I KLI IR++N +   S V ILA+D+DLY+A I+GK+I+KIGP  D+ NLVP  F 
Sbjct  351   LKEEIMKLIIIRSRNRIKPNSAVRILASDSDLYVAAIDGKIIVKIGPRFDVGNLVPKSFK  410

Query  1307  MLATSGKDFAVWEK  1348
              +ATSGKD+ VWEK
Sbjct  411   KIATSGKDYCVWEK  424



>ref|XP_003550340.1| PREDICTED: alpha-amylase-like [Glycine max]
 gb|KHN12782.1| Alpha-amylase [Glycine soja]
Length=414

 Score =   496 bits (1278),  Expect = 5e-169, Method: Compositional matrix adjust.
 Identities = 261/422 (62%), Positives = 325/422 (77%), Gaps = 25/422 (6%)
 Frame = +2

Query  86    LFPLHSSSTVLFQGFTWTSKDQPGGWWNWLITKVPDLADAGITHVWLPPPSNAREGDDQG  265
              FPL +S  +LFQGF W S  + GGW+N L   +PDLA+AGITHVWLPPPS +     +G
Sbjct  16    FFPLFASPALLFQGFNWESSKK-GGWYNSLKNTIPDLANAGITHVWLPPPSQSVS--PEG  72

Query  266   YMPKRMYDLDTSKYGNKKELKALNDAFHGRGIKSVADIVLNHRAAERANSRGVFNVFEGG  445
             Y+P R+YDLD SKYG K +LK+L  AFH +GIK +ADIV+NHR AER + RG++ +FEGG
Sbjct  73    YLPGRLYDLDASKYGTKDQLKSLIAAFHDKGIKCLADIVINHRTAERKDGRGIYCIFEGG  132

Query  446   TPDDKLDWGPSEICGDDAAF-EGTGNPDTGDPWGDAPDIDHRSPRVQREISEWMNWLKSD  622
             TPD +LDWGPS IC DD  + +GTGN D+G+P+  APDIDH +P+VQRE+SEWMNWLK++
Sbjct  133   TPDARLDWGPSFICKDDNTYSDGTGNLDSGEPYDPAPDIDHLNPQVQRELSEWMNWLKTE  192

Query  623   VGFDGWRFDYVKGYDFVKGFAAVKIYMDNTKPEFAVGELWNALSPGSVPNPDYNQDAHRN  802
             +GFDGWRFDYVKGY      +  KIYM+ T+P+FAVGE W++LS         N D HR 
Sbjct  193   IGFDGWRFDYVKGY----APSITKIYMEQTRPDFAVGEKWDSLSID-------NYDGHRG  241

Query  803   ELVRWVQNaggaatafdfttKGILQAALNNTELWRLKDAAGKPSGMIGVLPQSAVTFIDN  982
              LV WV++AGGA TAFDFTTKGILQAA+   +LWRLKD+ GKPSGMIGV P++AVTFIDN
Sbjct  242   ALVNWVESAGGAITAFDFTTKGILQAAVQG-QLWRLKDSNGKPSGMIGVKPENAVTFIDN  300

Query  983   HDTWS-QRLWPFTTSTDDAVNHDRVLQGYAYILTHPGIPSVFYDHFFEWGLKDAISKLIS  1159
             HDT S QR+WPF +        D+V+QGYAYILTHPG PS+FYDHFF+WGLK+ I+KL S
Sbjct  301   HDTGSTQRIWPFPS--------DKVMQGYAYILTHPGTPSIFYDHFFDWGLKEQIAKLSS  352

Query  1160  IRNKNGVSATSPVEILAADADLYIAKINGKVILKIGPNGDLKNLVPSDFMLATSGKDFAV  1339
             IR K+G++  S V ILAA+ADLY+AKI+ K+ LKIGP  DL NL+P +F +ATSG+D+AV
Sbjct  353   IRVKHGINEKSSVNILAAEADLYVAKIDNKIFLKIGPKMDLGNLIPPNFHVATSGQDYAV  412

Query  1340  WE  1345
             WE
Sbjct  413   WE  414



>ref|XP_006434774.1| hypothetical protein CICLE_v10001266mg [Citrus clementina]
 ref|XP_006473327.1| PREDICTED: alpha-amylase-like [Citrus sinensis]
 gb|ESR48014.1| hypothetical protein CICLE_v10001266mg [Citrus clementina]
 gb|KDO84179.1| hypothetical protein CISIN_1g014447mg [Citrus sinensis]
Length=424

 Score =   496 bits (1277),  Expect = 1e-168, Method: Compositional matrix adjust.
 Identities = 261/440 (59%), Positives = 327/440 (74%), Gaps = 20/440 (5%)
 Frame = +2

Query  35    TIMKSSFYLSLFCIAFFLFPLHSSSTVLFQGFTWTSKDQPGGWWNWLITKVPDLADAGIT  214
             + +KS  +LS     F  F   +S  +LFQGF W S ++ GGW+N L   +PDL++AGIT
Sbjct  2     STLKSFCFLSFLLAIFLPF---TSPALLFQGFNWESSNKAGGWYNSLKNSIPDLSNAGIT  58

Query  215   HVWLPPPSNAREGDDQGYMPKRMYDLDTSKYGNKKELKALNDAFHGRGIKSVADIVLNHR  394
             HVWLPPPS +     QGYMP R+YDLD SKYG++ +LK+L  AF  +GIK +AD+V+NHR
Sbjct  59    HVWLPPPSQSVA--PQGYMPGRLYDLDASKYGSQADLKSLIQAFRQKGIKCLADMVINHR  116

Query  395   AAERANSRGVFNVFEGGTPDDKLDWGPSEIC-GDDAAFEGTGNPDTGDPWGDAPDIDHRS  571
              AER + RG++ +FEGGT DD+LDWGPS IC GD    +G GN DTG+ +  APDIDH +
Sbjct  117   TAERKDGRGIYCIFEGGTSDDRLDWGPSFICRGDKEYSDGQGNDDTGEDFQPAPDIDHLN  176

Query  572   PRVQREISEWMNWLKSDVGFDGWRFDYVKGYDFVKGFAAVKIYMDNTKPEFAVGELWNAL  751
             PRVQ+E+S+WMNWLK+++GFDGWRFD+VKGY      +  K+YM+NT P+FAVGE W++L
Sbjct  177   PRVQKELSDWMNWLKTEIGFDGWRFDFVKGY----APSITKVYMENTSPDFAVGEKWDSL  232

Query  752   SPGSVPNPDYNQDAHRNELVRWVQNaggaatafdfttKGILQAALNNTELWRLKDAAGKP  931
             S G    PD NQD HR  L  WVQ AGGA  AFDFTTKGILQAA+   ELWRLKD+ GKP
Sbjct  233   SYGPDGKPDANQDGHRGALKDWVQAAGGAVAAFDFTTKGILQAAVQG-ELWRLKDSNGKP  291

Query  932   SGMIGVLPQSAVTFIDNHDTWS-QRLWPFTTSTDDAVNHDRVLQGYAYILTHPGIPSVFY  1108
              G IG+LPQ+AVTFIDNHDT S QRLWPF +        D+V+ GYAYILTHPG P +FY
Sbjct  292   PGFIGILPQNAVTFIDNHDTGSTQRLWPFPS--------DKVMLGYAYILTHPGTPCIFY  343

Query  1109  DHFFEWGLKDAISKLISIRNKNGVSATSPVEILAADADLYIAKINGKVILKIGPNGDLKN  1288
             DHFF+WGLK+AISKL ++RN+NG++  S V ILA+DAD+YIA I  +VI+KIGP  D+ N
Sbjct  344   DHFFDWGLKEAISKLAAVRNRNGINTASRVNILASDADVYIAAIGDRVIMKIGPKMDIGN  403

Query  1289  LVPSDFMLATSGKDFAVWEK  1348
             L+PSDF +A  G D+AVWEK
Sbjct  404   LIPSDFKVAADGTDYAVWEK  423



>emb|CAN77038.1| hypothetical protein VITISV_004485 [Vitis vinifera]
Length=442

 Score =   495 bits (1275),  Expect = 4e-168, Method: Compositional matrix adjust.
 Identities = 265/459 (58%), Positives = 331/459 (72%), Gaps = 42/459 (9%)
 Frame = +2

Query  38    IMKSSFYLSLFCIAFFLFPLHSSSTVLFQ------------------GFTWTSKDQPGGW  163
             I  S  YL  F I   + P  ++S +LFQ                  GF W S  + GGW
Sbjct  3     ITTSLSYLLFFNI---ILPTLTASPILFQVLHIILSHILSLSLPMCLGFNWESSKKQGGW  59

Query  164   WNWLITKVPDLADAGITHVWLPPPSNAREGDDQGYMPKRMYDLDTSKYGNKKELKALNDA  343
             +N+LI  +P+L+ +GITHVWLPPPS  +    +GY+P R+YDL+ S YG + ELKAL  A
Sbjct  60    YNFLINSIPELSASGITHVWLPPPS--QSAASEGYLPGRLYDLNASHYGTQDELKALIKA  117

Query  344   FHGRGIKSVADIVLNHRAAERANSRGVFNVFEGGTPDDKLDWGPSEICGDDAAF-EGTGN  520
             F   GI+ +ADIV+NHR AE+ +SRG++ +FEGGTPDD+LDWGPS IC DD  F +GTGN
Sbjct  118   FRSNGIQCIADIVINHRTAEKKDSRGIWAIFEGGTPDDRLDWGPSFICSDDTLFSDGTGN  177

Query  521   PDTGDPWGDAPDIDHRSPRVQREISEWMNWLKSDVGFDGWRFDYVKGY--DFVKGFAAVK  694
             PDTG  +  APDIDH +PRVQRE+S+WMNWLK ++GF GWRFD+ +GY  DF K      
Sbjct  178   PDTGAGFDPAPDIDHVNPRVQRELSDWMNWLKIEIGFAGWRFDFARGYSPDFTK------  231

Query  695   IYMDNTKPEFAVGELWNALSPGSVPNPDYNQDAHRNELVRWVQNaggaatafdfttKGIL  874
             +YM+NT P FAVGE+WN+LS G+   P+YNQDAHR ELV WV+ AGGA TAFDFTTKGIL
Sbjct  232   LYMENTSPNFAVGEIWNSLSYGNDSKPNYNQDAHRRELVDWVKAAGGAVTAFDFTTKGIL  291

Query  875   QAALNNTELWRLKDAAGKPSGMIGVLPQSAVTFIDNHDTWS-QRLWPFTTSTDDAVNHDR  1051
             QAA+   ELWRLKD+ G P GMIG++P++AVTFIDNHDT S Q++WPF +        ++
Sbjct  292   QAAVEG-ELWRLKDSNGGPPGMIGLMPENAVTFIDNHDTGSTQKIWPFPS--------EK  342

Query  1052  VLQGYAYILTHPGIPSVFYDHFFEWGLKDAISKLISIRNKNGVSATSPVEILAADADLYI  1231
             V+QGY YILTHPGIPS+FYDHFF+WGLK+ ISKLI IR +NG+   S V ILA+D DLY+
Sbjct  343   VMQGYVYILTHPGIPSIFYDHFFDWGLKEEISKLIIIRTRNGIKPNSGVRILASDPDLYV  402

Query  1232  AKINGKVILKIGPNGDLKNLVPSDFMLATSGKDFAVWEK  1348
             A I+ K+I KIGP  D+ NLVPS F LATSG ++AVWEK
Sbjct  403   AAIDEKIIAKIGPRYDVGNLVPSTFKLATSGNNYAVWEK  441



>ref|XP_010690291.1| PREDICTED: alpha-amylase-like [Beta vulgaris subsp. vulgaris]
Length=428

 Score =   494 bits (1273),  Expect = 5e-168, Method: Compositional matrix adjust.
 Identities = 253/437 (58%), Positives = 328/437 (75%), Gaps = 23/437 (5%)
 Frame = +2

Query  47    SSFYLSLFCIAFFLFPLHSSSTVLFQGFTWTSKDQPGGWWNWLITKVPDLADAGITHVWL  226
              S YLS   +  F+ P     T+LFQGF W S ++PGG +N L   + DLA AG+THVWL
Sbjct  10    CSLYLSFSLVFNFVAP-----TILFQGFNWESCNKPGGLYNSLKNSIDDLARAGVTHVWL  64

Query  227   PPPSNAREGDDQGYMPKRMYDLDTSKYGNKKELKALNDAFHGRGIKSVADIVLNHRAAER  406
             PPP+++     QGY+P R+YDLD S+YGN  +LK+L +AFH +GIK VADIV+NHR A++
Sbjct  65    PPPTHSVS--PQGYLPGRLYDLDASRYGNGADLKSLINAFHQKGIKCVADIVINHRCADK  122

Query  407   ANSRGVFNVFEGGTPDDKLDWGPSEICGDDAAF-EGTGNPDTGDPWGDAPDIDHRSPRVQ  583
              + RG++ +FEGGTPDD+LDWGP  IC DD  + +G+GN DTG  +G APDIDH +PRVQ
Sbjct  123   QDGRGIYCIFEGGTPDDRLDWGPWAICRDDTQYSDGSGNLDTGASYGVAPDIDHLNPRVQ  182

Query  584   REISEWMNWLKSDVGFDGWRFDYVKGYDFVKGFAAVKIYMDNTKPEFAVGELWNALSPGS  763
             RE+ +WMNWLK+++GFDGWRFD+VKGY      +  KIYM+ T+P+FAVGELW++++   
Sbjct  183   RELVDWMNWLKTEIGFDGWRFDFVKGY----APSITKIYMEKTRPDFAVGELWDSINYDP  238

Query  764   VPNPDYNQDAHRNELVRWVQNaggaatafd-fttKGILQAALNNTELWRLKDAAGKPSGM  940
                PDYNQD  RNEL  WVQ AGG   A   FTTKG+LQAA+   E WR+KD++G+PSG+
Sbjct  239   DGKPDYNQDGPRNELAGWVQAAGGGVIAAFDFTTKGVLQAAVQG-EWWRMKDSSGRPSGL  297

Query  941   IGVLPQSAVTFIDNHDTWS-QRLWPFTTSTDDAVNHDRVLQGYAYILTHPGIPSVFYDHF  1117
             IG++P++AVTFIDNHDT S QRLWPF          D+V+QGYAYILTHPGIPS+FYDHF
Sbjct  298   IGIMPKNAVTFIDNHDTGSTQRLWPFPA--------DKVMQGYAYILTHPGIPSIFYDHF  349

Query  1118  FEWGLKDAISKLISIRNKNGVSATSPVEILAADADLYIAKINGKVILKIGPNGDLKNLVP  1297
              EWGLK+ + KL SIR +NG+S +S V I+A+DADLY+A I+GKVI+K+GP  +L NL+P
Sbjct  350   LEWGLKEELVKLTSIRLRNGISESSNVNIMASDADLYVAMIDGKVIVKLGPRYNLGNLIP  409

Query  1298  SDFMLATSGKDFAVWEK  1348
             S+F  +T GKD+ VWEK
Sbjct  410   SNFKASTFGKDYCVWEK  426



>gb|KDP38338.1| hypothetical protein JCGZ_04263 [Jatropha curcas]
Length=421

 Score =   493 bits (1269),  Expect = 2e-167, Method: Compositional matrix adjust.
 Identities = 260/433 (60%), Positives = 320/433 (74%), Gaps = 18/433 (4%)
 Frame = +2

Query  65    LFCIAFF-LFPLHSSSTVLFQGFTWTSKDQPGGWWNWLITKVPDLADAGITHVWLPPPSN  241
             L C  F   FPL +S+ +LFQGF W S ++ GG +N L   +P+L  AGITH+WLPPPS 
Sbjct  4     LVCFHFLSFFPLFTSAELLFQGFNWESCNKEGGLYNSLKNSIPELVGAGITHIWLPPPSQ  63

Query  242   AREGDDQGYMPKRMYDLDTSKYGNKKELKALNDAFHGRGIKSVADIVLNHRAAERANSRG  421
             +     QGYMP R+YDL+ SKYGN+ ELK+L +AFHG+GIK +ADIV+NHR AER + RG
Sbjct  64    SVA--PQGYMPGRLYDLNASKYGNQNELKSLVNAFHGQGIKCLADIVINHRTAERKDERG  121

Query  422   VFNVFEGGTPDDKLDWGPSEICGDDAAFE-GTGNPDTGDPWGDAPDIDHRSPRVQREISE  598
             ++ +FEGGT DD+LDWGPS IC DD A+  G GNPDTG+ +  APDIDH + RVQ+E+S+
Sbjct  122   IWCIFEGGTADDRLDWGPSFICSDDTAYSNGKGNPDTGEDFPPAPDIDHLNLRVQKELSD  181

Query  599   WMNWLKSDVGFDGWRFDYVKGYDFVKGFAAVKIYMDNTKPEFAVGELWNALSPGSVPNPD  778
             WMNWLK+++GFDGWRFD+VKGY         KI M  T P FAVGE W++L+ G    P+
Sbjct  182   WMNWLKNEIGFDGWRFDFVKGY----APTITKICMAQTSPNFAVGEKWDSLAYGQDGKPE  237

Query  779   YNQDAHRNELVRWVQNaggaatafdfttKGILQAALNNTELWRLKDAAGKPSGMIGVLPQ  958
              NQDAHR  L  WV+ AGG  TAFDFTTKGILQAA+   ELWRLKD+ G P G+IG+LPQ
Sbjct  238   ANQDAHRGALRDWVEAAGGVVTAFDFTTKGILQAAVQG-ELWRLKDSNGNPPGLIGILPQ  296

Query  959   SAVTFIDNHDTWS-QRLWPFTTSTDDAVNHDRVLQGYAYILTHPGIPSVFYDHFFEWGLK  1135
             +AVTFIDNHDT S Q+LWPF +        D+V+QGYAYILTHPGIPS+FYDHFFEWGLK
Sbjct  297   NAVTFIDNHDTGSTQKLWPFPS--------DKVMQGYAYILTHPGIPSIFYDHFFEWGLK  348

Query  1136  DAISKLISIRNKNGVSATSPVEILAADADLYIAKINGKVILKIGPNGDLKNLVPSDFMLA  1315
             D I+KL SIR    +   S V+ILAA++DLY+A IN  VI+KIGP  DL NL+P +  LA
Sbjct  349   DQITKLASIRKACRIHNRSTVKILAAESDLYMAAINDNVIMKIGPKMDLGNLLPPNVQLA  408

Query  1316  TSGKDFAVWEKPT  1354
             TSG+ +AVW K T
Sbjct  409   TSGESYAVWIKKT  421



>ref|XP_007017239.1| Alpha-amylase-like [Theobroma cacao]
 gb|EOY14464.1| Alpha-amylase-like [Theobroma cacao]
Length=449

 Score =   493 bits (1270),  Expect = 3e-167, Method: Compositional matrix adjust.
 Identities = 261/471 (55%), Positives = 332/471 (70%), Gaps = 57/471 (12%)
 Frame = +2

Query  38    IMKSSFYLSLFCIAFFLFPLHSSSTVLFQGFTWTSKDQPGGWWNWLITKVPDLADAGITH  217
             ++ S  ++SLF     +FP   S  +LFQGF W S ++ GGW+N+L   V D+A+AG+TH
Sbjct  1     MLTSLCFISLF---LSVFPSLVSPALLFQGFNWESCNKAGGWYNFLKNSVSDIANAGVTH  57

Query  218   VWLPPPSNAREGDD--------------------------------QGYMPKRMYDLDTS  301
             VWLPPPS +    +                                 GY+P R+YDLD S
Sbjct  58    VWLPPPSQSVGPQELRPCILFENCPVLAIFDCIDDYVHILKELIFHPGYLPGRLYDLDAS  117

Query  302   KYGNKKELKALNDAFHGRGIKSVADIVLNHRAAERANSRGVFNVFEGGTPDDKLDWGPSE  481
             KYG++ ELK+L DAFH +G+K VADIV+NHR AER + RG++ +FEGGTPDD+LDWGPS 
Sbjct  118   KYGSQAELKSLIDAFHQKGVKCVADIVINHRTAERKDGRGIYCIFEGGTPDDRLDWGPSF  177

Query  482   ICGDDAAF-EGTGNPDTGDPWGDAPDIDHRSPRVQREISEWMNWLKSDVGFDGWRFDYVK  658
             ICGDD  + +GTGNPDTG  +  APDIDH +PRVQ+E+S+WMNWLK+++GFDGWRFD+V+
Sbjct  178   ICGDDKEYSDGTGNPDTGLCYQPAPDIDHLNPRVQKELSDWMNWLKTEIGFDGWRFDFVR  237

Query  659   GYDFVKGFAAVKIYMDNTKPEFAVGELWNALSPGSVPNPDYNQDAHRNELVRWVQNagga  838
             GY      +  KIYMD T P+FAVGE W   S G        +D+HR  L  WV+ AGG 
Sbjct  238   GY----APSITKIYMDQTSPDFAVGEKWEDFSLG-------QEDSHRGALKDWVEAAGGV  286

Query  839   atafdfttKGILQAALNNTELWRLKDAAGKPSGMIGVLPQSAVTFIDNHDTWS-QRLWPF  1015
              TAFDFTTKG+L AA+   ELWRLKD+ GKP GMIG+LPQ+A TF+DNHDT S Q  WPF
Sbjct  287   VTAFDFTTKGVLNAAVQG-ELWRLKDSNGKPPGMIGLLPQNAATFVDNHDTGSTQNQWPF  345

Query  1016  TTSTDDAVNHDRVLQGYAYILTHPGIPSVFYDHFFEWGLKDAISKLISIRNKNGVSATSP  1195
              +        D+V+QGYAYILTHPG+PS+FYDHFF+WGLKD ISKL++IRN+NG+S +S 
Sbjct  346   PS--------DKVMQGYAYILTHPGVPSIFYDHFFDWGLKDEISKLVAIRNRNGISTSST  397

Query  1196  VEILAADADLYIAKINGKVILKIGPNGDLKNLVPSDFMLATSGKDFAVWEK  1348
             V ILA+D+DLY+A I+ K+I+KIGP  DL NLVPS++ LATSG D+AVWEK
Sbjct  398   VNILASDSDLYMASIDEKIIMKIGPKMDLGNLVPSNYQLATSGNDYAVWEK  448



>ref|XP_004294806.1| PREDICTED: alpha-amylase-like [Fragaria vesca subsp. vesca]
Length=461

 Score =   493 bits (1270),  Expect = 4e-167, Method: Compositional matrix adjust.
 Identities = 259/438 (59%), Positives = 324/438 (74%), Gaps = 21/438 (5%)
 Frame = +2

Query  47    SSFYLSLFC--IAFFLFPLHSSSTVLFQGFTWTSKDQPGGWWNWLITKVPDLADAGITHV  220
             +S  +S  C  ++    P  + S +LFQGF W S  + GGW+N L     +LA +GITHV
Sbjct  39    NSLKISTLCFLLSIISIPNFTVSQILFQGFNWESAKK-GGWYNILEQSAAELASSGITHV  97

Query  221   WLPPPSNAREGDDQGYMPKRMYDLDTSKYGNKKELKALNDAFHGRGIKSVADIVLNHRAA  400
             WLPPPS A    D+GYMP R+YDL TSKYGN+  LKAL  A+   GIKSVADIV+NHR A
Sbjct  98    WLPPPSQAIS--DEGYMPGRLYDL-TSKYGNQDGLKALVKAYQDNGIKSVADIVINHRCA  154

Query  401   ERANSRGVFNVFEGGTPDDKLDWGPSEICGDDAAF-EGTGNPDTGDPWGDAPDIDHRSPR  577
             E+ + RG++ +FEGGTPDD+LDWGPS IC DD  + +G GNPDTG  +G APDIDH++ R
Sbjct  155   EKQDERGIWCIFEGGTPDDRLDWGPSLICSDDTKYSDGKGNPDTGADFGGAPDIDHKNTR  214

Query  578   VQREISEWMNWLKSDVGFDGWRFDYVKGYDFVKGFAAVKIYMDNTKPEFAVGELWNALSP  757
             VQ E+S+WMNWLK+++GF GWRFD+V+GY         K+Y+ NTKP F+VGE WN+++ 
Sbjct  215   VQSELSDWMNWLKTEIGFSGWRFDFVRGY----APEFTKLYVANTKPSFSVGEYWNSIAY  270

Query  758   GSVPNPDYNQDAHRNELVRWVQNaggaatafdfttKGILQAALNNTELWRLKDAAGKPSG  937
             GS   P+YNQD HRNEL  W+ NAGG  TAFDFTTKGILQAA+   ELWRLKD+ G P G
Sbjct  271   GSDGKPEYNQDNHRNELAGWIGNAGGEVTAFDFTTKGILQAAVQG-ELWRLKDSNGGPPG  329

Query  938   MIGVLPQSAVTFIDNHDTWS-QRLWPFTTSTDDAVNHDRVLQGYAYILTHPGIPSVFYDH  1114
             +IG+ P+++VTFIDNHDT S Q+LWPF +        D+V+QGYAY LTHPGIPS+FYDH
Sbjct  330   LIGISPRNSVTFIDNHDTGSTQKLWPFPS--------DKVMQGYAYTLTHPGIPSIFYDH  381

Query  1115  FFEWGLKDAISKLISIRNKNGVSATSPVEILAADADLYIAKINGKVILKIGPNGDLKNLV  1294
             FF+WGLK  ISKL +IR++NG+   S V ILAADADLY+A I+ K+I KIGP  D+ NLV
Sbjct  382   FFDWGLKGEISKLTAIRSRNGIKPDSAVRILAADADLYVASIDDKIITKIGPRFDVGNLV  441

Query  1295  PSDFMLATSGKDFAVWEK  1348
             P  F +ATSGKD++VWEK
Sbjct  442   PPTFKIATSGKDYSVWEK  459



>ref|XP_008373147.1| PREDICTED: alpha-amylase-like [Malus domestica]
Length=424

 Score =   491 bits (1263),  Expect = 1e-166, Method: Compositional matrix adjust.
 Identities = 258/432 (60%), Positives = 326/432 (75%), Gaps = 19/432 (4%)
 Frame = +2

Query  59    LSLFCIAFFLFPLHSSSTVLFQGFTWTSKDQPGGWWNWLITKVPDLADAGITHVWLPPPS  238
             L  F ++  L P  ++S ++FQGF W S  + GGW+N L   V DLA +GITHVWLPP S
Sbjct  8     LICFLLSILLTPNFTASQIIFQGFNWESS-RKGGWYNILKQSVQDLASSGITHVWLPPSS  66

Query  239   NAREGDDQGYMPKRMYDLDTSKYGNKKELKALNDAFHGRGIKSVADIVLNHRAAERANSR  418
             +A    D+GYMP R+YDL+ SK+GNK ELK+L  A+   GI+SVADIV+NHR AE+ + R
Sbjct  67    HA--ASDEGYMPGRLYDLN-SKFGNKDELKSLVSAYRNSGIQSVADIVINHRTAEKQDER  123

Query  419   GVFNVFEGGTPDDKLDWGPSEICGDDAAF-EGTGNPDTGDPWGDAPDIDHRSPRVQREIS  595
             G++ +FEGGT DD+LDWGPS ICGDD  + +G GNPDTG+ +G APDIDH++ RVQ+E+S
Sbjct  124   GIWCIFEGGTDDDRLDWGPSLICGDDTKYSDGKGNPDTGEDFGGAPDIDHKNTRVQKELS  183

Query  596   EWMNWLKSDVGFDGWRFDYVKGYDFVKGFAAVKIYMDNTKPEFAVGELWNALSPGSVPNP  775
             +WMNWLK+++GF GWRFD+VKGY         K+YM NT P FAVGELWN+LS GS   P
Sbjct  184   DWMNWLKTEIGFSGWRFDFVKGY----APEYTKLYMTNTSPNFAVGELWNSLSYGSDGKP  239

Query  776   DYNQDAHRNELVRWVQNaggaatafdfttKGILQAALNNTELWRLKDAAGKPSGMIGVLP  955
             + +QDAHR  LV WV++AGG  TAFDFTTKGILQAA+   ELWRLKD+ G   GMIG+ P
Sbjct  240   NPDQDAHRQALVGWVESAGGGVTAFDFTTKGILQAAVQG-ELWRLKDSNGGAPGMIGLKP  298

Query  956   QSAVTFIDNHDTWS-QRLWPFTTSTDDAVNHDRVLQGYAYILTHPGIPSVFYDHFFEWGL  1132
              S+VTFIDNHDT S Q LWPF +        D+V+QGYAYILTHPGIPS+FYDHFF+WGL
Sbjct  299   GSSVTFIDNHDTGSTQHLWPFPS--------DKVMQGYAYILTHPGIPSIFYDHFFDWGL  350

Query  1133  KDAISKLISIRNKNGVSATSPVEILAADADLYIAKINGKVILKIGPNGDLKNLVPSDFML  1312
             K  ISKL +IR++NG+   S + ILAADAD+Y+A I+ K+I+KIGP  DL  L+P +F +
Sbjct  351   KGEISKLTAIRSRNGIKPDSALRILAADADVYVASIDEKIIVKIGPKMDLGQLIPPNFQV  410

Query  1313  ATSGKDFAVWEK  1348
             +TSGKD+AVWE+
Sbjct  411   STSGKDYAVWER  422



>ref|XP_008236504.1| PREDICTED: alpha-amylase-like [Prunus mume]
Length=425

 Score =   490 bits (1262),  Expect = 2e-166, Method: Compositional matrix adjust.
 Identities = 261/437 (60%), Positives = 325/437 (74%), Gaps = 23/437 (5%)
 Frame = +2

Query  47    SSFYLSLFCIAFFLFPLHSSSTVLFQGFTWTSKDQPGGWWNWLITKVPDLADAGITHVWL  226
             S FYL L CI   L P  ++S +LFQGF W S    GGW+N L   VP+LA +GITHVWL
Sbjct  7     SLFYL-LLCIN--LLPNFTASQILFQGFNWVSWKTEGGWYNSLRKSVPELASSGITHVWL  63

Query  227   PPPSNAREGDDQGYMPKRMYDLDTSKYGNKKELKALNDAFHGRGIKSVADIVLNHRAAER  406
             PPPS A    D+GY+P R+YDL  SKYG++ ELK+L  AFH  GI++VADIV+NHR AE+
Sbjct  64    PPPSQA--ASDEGYLPGRLYDLSASKYGSQDELKSLISAFHDSGIQAVADIVINHRTAEK  121

Query  407   ANSRGVFNVFEGGTPDDKLDWGPSEICGDDAAF-EGTGNPDTGDPWGDAPDIDHRSPRVQ  583
              + RG++ +FEGGTPDD+LDWGPS IC DD  + +G GNPDTG  +  APDIDH++ RVQ
Sbjct  122   QDERGIWCIFEGGTPDDRLDWGPSLICSDDTQYSDGKGNPDTGAKYEPAPDIDHKNTRVQ  181

Query  584   REISEWMNWLKSDVGFDGWRFDYVKGYDFVKGFAAVKIYMDNTKPEFAVGELW-NALSPG  760
             +E+S+WMNWLK+++GF GWRFD+V+GY         K+Y+ NT P FAVGELW ++ + G
Sbjct  182   KELSDWMNWLKTEIGFSGWRFDFVRGYSP----EITKLYVTNTSPNFAVGELWSDSFAKG  237

Query  761   SVPNPDYNQDAHRNELVRWVQNaggaatafdfttKGILQAALNNTELWRLKDAAGKPSGM  940
             S   P+YNQDA+R EL  WVQ AGG  TAFDFTTKGILQAA+   ELWRLKD  GK  GM
Sbjct  238   SDGKPEYNQDANRQELAGWVQGAGGDVTAFDFTTKGILQAAVQG-ELWRLKDPNGKAPGM  296

Query  941   IGVLPQSAVTFIDNHDTWS-QRLWPFTTSTDDAVNHDRVLQGYAYILTHPGIPSVFYDHF  1117
             IG+LP   VTFIDNHDT S Q +WPF +        D+V+QGYAYILTHPGIPS+FYDHF
Sbjct  297   IGLLP--GVTFIDNHDTGSTQNIWPFPS--------DKVMQGYAYILTHPGIPSIFYDHF  346

Query  1118  FEWGLKDAISKLISIRNKNGVSATSPVEILAADADLYIAKINGKVILKIGPNGDLKNLVP  1297
             F+WGLK+ I+KLI+IR++NG+   S + ILA+DADLY+A I+ K+I KIG   ++ NLVP
Sbjct  347   FDWGLKEEITKLIAIRSRNGIKPDSALRILASDADLYVAAIDEKIIAKIGSRYEVGNLVP  406

Query  1298  SDFMLATSGKDFAVWEK  1348
               + LATSGKD+AVWEK
Sbjct  407   PTYQLATSGKDYAVWEK  423



>ref|XP_010061755.1| PREDICTED: alpha-amylase-like isoform X2 [Eucalyptus grandis]
Length=425

 Score =   490 bits (1261),  Expect = 3e-166, Method: Compositional matrix adjust.
 Identities = 258/439 (59%), Positives = 327/439 (74%), Gaps = 17/439 (4%)
 Frame = +2

Query  38    IMKSSFYLSLFCIAFFLFPLHSSSTVLFQGFTWTSKDQPGGWWNWLITKVPDLADAGITH  217
             +M S     LF ++       +S  +LFQGF W S  + GGW+N L   VPDLA+AGITH
Sbjct  1     MMSSPSLFWLFVLSVSYLAASASPALLFQGFNWESWKKEGGWYNSLKNLVPDLANAGITH  60

Query  218   VWLPPPSNAREGDDQGYMPKRMYDLDTSKYGNKKELKALNDAFHGRGIKSVADIVLNHRA  397
             VWLPPPS  +    QGY+P R+YDL+ S YGN+ ELK L DAFH +GIK +ADIV+NHR 
Sbjct  61    VWLPPPS--QSAAQQGYLPGRLYDLNASSYGNQDELKHLIDAFHQKGIKCLADIVINHRT  118

Query  398   AERANSRGVFNVFEGGTPDDKLDWGPSEICGDDAAF-EGTGNPDTGDPWGDAPDIDHRSP  574
             AE+ +SRG++ +FEGGTPDD+LDWGPS IC +DA + +G GNPDTG+ +  APDIDH +P
Sbjct  119   AEKQDSRGIWCIFEGGTPDDRLDWGPSFICRNDANYSDGMGNPDTGEDYEFAPDIDHLNP  178

Query  575   RVQREISEWMNWLKSDVGFDGWRFDYVKGYDFVKGFAAVKIYMDNTKPEFAVGELWNALS  754
             RVQ+E+S+WMNWLKSD+GFDGWRFD+VKGY      +  KIYMD T P FAVGE W +LS
Sbjct  179   RVQKELSDWMNWLKSDIGFDGWRFDFVKGY----SSSITKIYMDRTLPNFAVGENWESLS  234

Query  755   PGSVPNPDYNQDAHRNELVRWVQNaggaatafdfttKGILQAALNNTELWRLKDAAGKPS  934
              G     + NQDAHR +L  WV  AGGA TAFDFTTKGILQAA+   ELWRL+D+ G P 
Sbjct  235   YGQDGKLNPNQDAHRLKLADWVNAAGGAITAFDFTTKGILQAAIER-ELWRLRDSNGMPP  293

Query  935   GMIGVLPQSAVTFIDNHDTWS-QRLWPFTTSTDDAVNHDRVLQGYAYILTHPGIPSVFYD  1111
             G+IG+ P+SAVTFIDNHDT S Q++WPF +         +V+QGYAYILTHPG+PS+FYD
Sbjct  294   GLIGLQPRSAVTFIDNHDTGSTQKMWPFPSY--------KVMQGYAYILTHPGVPSIFYD  345

Query  1112  HFFEWGLKDAISKLISIRNKNGVSATSPVEILAADADLYIAKINGKVILKIGPNGDLKNL  1291
             HFF+WGLK+ I KL +IR +N ++  S V+ILA+D+DLY+AKI+  VI+KIGP  ++ NL
Sbjct  346   HFFDWGLKEEIGKLTAIRARNRINEKSSVKILASDSDLYVAKIDDGVIMKIGPRFEVGNL  405

Query  1292  VPSDFMLATSGKDFAVWEK  1348
             VP ++ +ATSG+D+ VWEK
Sbjct  406   VPPNYQIATSGQDYCVWEK  424



>ref|XP_010061752.1| PREDICTED: alpha-amylase-like [Eucalyptus grandis]
 gb|KCW68748.1| hypothetical protein EUGRSUZ_F02347 [Eucalyptus grandis]
 gb|KCW68750.1| hypothetical protein EUGRSUZ_F02347 [Eucalyptus grandis]
Length=425

 Score =   489 bits (1259),  Expect = 7e-166, Method: Compositional matrix adjust.
 Identities = 258/439 (59%), Positives = 327/439 (74%), Gaps = 17/439 (4%)
 Frame = +2

Query  38    IMKSSFYLSLFCIAFFLFPLHSSSTVLFQGFTWTSKDQPGGWWNWLITKVPDLADAGITH  217
             +M S     LF I+       +S  +LFQGF W S  + GGW+N L   VPDLA+AGITH
Sbjct  1     MMSSPSLFWLFVISVSYLAASASPALLFQGFNWESWKKEGGWYNSLKNLVPDLANAGITH  60

Query  218   VWLPPPSNAREGDDQGYMPKRMYDLDTSKYGNKKELKALNDAFHGRGIKSVADIVLNHRA  397
             VWLPPPS  +    QGY+P R+YDL+ S YGN+ ELK L DAFH +GIK +ADIV+NHR 
Sbjct  61    VWLPPPS--QSAAQQGYLPGRLYDLNASSYGNQVELKHLIDAFHQKGIKCLADIVINHRT  118

Query  398   AERANSRGVFNVFEGGTPDDKLDWGPSEICGDDAAF-EGTGNPDTGDPWGDAPDIDHRSP  574
             AE+ +SRG++ +FEGGTPDD+LDWGPS IC DD  + +G GN D+G+ +  APDIDH +P
Sbjct  119   AEKQDSRGIWCIFEGGTPDDRLDWGPSLICRDDTEYSDGRGNLDSGEDFKPAPDIDHLNP  178

Query  575   RVQREISEWMNWLKSDVGFDGWRFDYVKGYDFVKGFAAVKIYMDNTKPEFAVGELWNALS  754
             RVQ+E+S+WMNWLKSD+GFDGWRFD+VKGY      +  KIYMD T P FAVGE W++LS
Sbjct  179   RVQKELSDWMNWLKSDIGFDGWRFDFVKGY----APSITKIYMDRTLPNFAVGEKWDSLS  234

Query  755   PGSVPNPDYNQDAHRNELVRWVQNaggaatafdfttKGILQAALNNTELWRLKDAAGKPS  934
              G     + NQDAHR+ L  WV  AGGA TAFDFTTKGILQAA+   ELWRL+D+ G P 
Sbjct  235   YGQDGKLNPNQDAHRHALADWVNAAGGAVTAFDFTTKGILQAAIEG-ELWRLRDSNGMPP  293

Query  935   GMIGVLPQSAVTFIDNHDTWS-QRLWPFTTSTDDAVNHDRVLQGYAYILTHPGIPSVFYD  1111
             G+IG+ P+SAVTFIDNHDT S Q++WPF +        D+V+QGYAYILTHPG+PS+FYD
Sbjct  294   GLIGLQPRSAVTFIDNHDTGSTQKVWPFPS--------DKVMQGYAYILTHPGVPSIFYD  345

Query  1112  HFFEWGLKDAISKLISIRNKNGVSATSPVEILAADADLYIAKINGKVILKIGPNGDLKNL  1291
             HFF+WGLK+ I KL +IR +N ++  S V+ILA+D+DLY+AKI+  VI+KIGP  ++ NL
Sbjct  346   HFFDWGLKEEIGKLTAIRARNRINEKSSVKILASDSDLYVAKIDDGVIMKIGPRFEVGNL  405

Query  1292  VPSDFMLATSGKDFAVWEK  1348
             VP ++ +ATSG+D+ VWEK
Sbjct  406   VPPNYQIATSGQDYCVWEK  424



>ref|XP_010108610.1| hypothetical protein L484_006341 [Morus notabilis]
 gb|EXC19766.1| hypothetical protein L484_006341 [Morus notabilis]
Length=425

 Score =   486 bits (1252),  Expect = 7e-165, Method: Compositional matrix adjust.
 Identities = 254/440 (58%), Positives = 321/440 (73%), Gaps = 20/440 (5%)
 Frame = +2

Query  41    MKSSFYLSLFCIAFFLFPLHSSSTVLFQGFTWTSKDQPGGWWNWLITKVPDLADAGITHV  220
             MK      L C+   LFP  +S T+LFQGF W S +   GW+N L   +PDLA  GITHV
Sbjct  1     MKVPIAFGLLCLFISLFPPFTSPTILFQGFNWASSEN-AGWYNSLKNTIPDLAKVGITHV  59

Query  221   WLPPPSNAREGDDQGYMPKRMYDLDTSKYGNKKELKALNDAFHGRGIKSVADIVLNHRAA  400
             WLPPPS++    DQGY+P R+YDL+ SKYG ++ELK+L  A   +GIK +ADIVLNHR+A
Sbjct  60    WLPPPSHS--AADQGYLPGRLYDLNASKYGTQEELKSLIAALREKGIKVIADIVLNHRSA  117

Query  401   ERANSRGVFNVFEGGTPDDKLDWGPSEICGDDAAF-EGTGNPDTGDPWGDAPDIDHRSPR  577
             E+ + RG+  +FEGGT D +LDWGPS IC DD  F +GTGN DTGD WG+ PDIDH +P+
Sbjct  118   EKRDERGILCIFEGGTSDARLDWGPSFICRDDTEFSDGTGNLDTGDSWGEVPDIDHLNPQ  177

Query  578   VQREISEWMNWLKSDVGFDGWRFDYVKGYDFVKGFAAVKIYMDNTKPEFAVGELWN--AL  751
             VQRE+SEWMNWLK+++GF GWRFD V+GY         KIYM+ T PEFAVGE W+    
Sbjct  178   VQRELSEWMNWLKTEIGFVGWRFDMVRGY----APNITKIYMEQTSPEFAVGEKWDRQEF  233

Query  752   SPGSVPNPDYNQDAHRNELVRWVQNaggaatafdfttKGILQAALNNTELWRLKDAAGKP  931
             + G    P+ NQD HR  LV WV+ AGG+ TAFDFTTKGILQAA+   ELWRLKD+ GKP
Sbjct  234   AVGEDGKPNANQDYHRGLLVNWVEAAGGSVTAFDFTTKGILQAAVEG-ELWRLKDSNGKP  292

Query  932   SGMIGVLPQSAVTFIDNHDTWSQRLWPFTTSTDDAVNHDRVLQGYAYILTHPGIPSVFYD  1111
              G+IG+ P+SAVTFIDNHDTWSQ+LWPF          D+++ GY YILTHPGIP++FYD
Sbjct  293   PGLIGIKPESAVTFIDNHDTWSQKLWPFP--------EDKIMLGYVYILTHPGIPTIFYD  344

Query  1112  HFF-EWGLKDAISKLISIRNKNGVSATSPVEILAADADLYIAKINGKVILKIGPNGDLKN  1288
             H F +  L   IS + +IRN++G+++ S V ILAA+ADLY+++I+ K+I+KIGP  DL N
Sbjct  345   HLFIKRELMAPISNVTAIRNRHGINSRSVVNILAAEADLYMSRIDEKIIMKIGPKTDLGN  404

Query  1289  LVPSDFMLATSGKDFAVWEK  1348
             L+PSD+ +A SG+DFAVWEK
Sbjct  405   LLPSDYQVAYSGQDFAVWEK  424



>gb|KHG00963.1| Uncharacterized protein F383_22263 [Gossypium arboreum]
Length=415

 Score =   484 bits (1247),  Expect = 3e-164, Method: Compositional matrix adjust.
 Identities = 247/418 (59%), Positives = 318/418 (76%), Gaps = 24/418 (6%)
 Frame = +2

Query  101   SSSTVLFQGFTWTSKDQPGGWWNWLITKVPDLADAGITHVWLPPPSNAREGDDQGYMPKR  280
             ++ T+LFQGF W S ++ GGW+N+L + V D+A+AG+THVWLPPPS  +    QGY+P R
Sbjct  19    ATPTLLFQGFNWESSNKAGGWYNFLQSSVSDIANAGVTHVWLPPPS--QSAAPQGYLPGR  76

Query  281   MYDLDTSKYGNKKELKALNDAFHGRGIKSVADIVLNHRAAERANSRGVFNVFEGGTPDDK  460
             +YDLD SKYG++ ELK+L DAFH +G+K VADIV+NHR AER ++RG++ +FEGGT DD+
Sbjct  77    LYDLDASKYGSQAELKSLIDAFHQKGVKCVADIVINHRTAERQDNRGIYCLFEGGTSDDR  136

Query  461   LDWGPSEICGDDAAF-EGTGNPDTGDPWGDAPDIDHRSPRVQREISEWMNWLKSDVGFDG  637
             LDWGPS IC DD A+ +GTGNPDTG P+  APDIDH +PRVQ E+S+W+NWLK+++GFDG
Sbjct  137   LDWGPSFICKDDTAYSDGTGNPDTGLPYDPAPDIDHLNPRVQNELSDWLNWLKTEIGFDG  196

Query  638   WRFDYVKGYDFVKGFAAVKIYMDNTKPEFAVGELWNALSPGSVPNPDYNQDAHRNELVRW  817
             WRFD+V+GY         KIYMD T P+FAVGE W     G        ++ HR  L  W
Sbjct  197   WRFDFVRGY----APTITKIYMDRTSPDFAVGEKWEDFIDG-------QEELHRAALKDW  245

Query  818   VQNaggaatafdfttKGILQAALNNTELWRLKDAAGKPSGMIGVLPQSAVTFIDNHDTWS  997
             V+ AGG  TAFDFTTKG+L  A+   +LWRLKD+ GKP GMIG+LPQ+AVTFIDNHDT S
Sbjct  246   VEAAGGTVTAFDFTTKGVLNDAVQG-KLWRLKDSNGKPPGMIGLLPQNAVTFIDNHDTGS  304

Query  998   -QRLWPFTTSTDDAVNHDRVLQGYAYILTHPGIPSVFYDHFFEWGLKDAISKLISIRNKN  1174
              Q +WPF +        D+++QGYAYILTHPGIPS+FYDHFF+ G KD ISKL+ IRN+N
Sbjct  305   TQNIWPFPS--------DKIMQGYAYILTHPGIPSIFYDHFFDLGFKDEISKLVEIRNRN  356

Query  1175  GVSATSPVEILAADADLYIAKINGKVILKIGPNGDLKNLVPSDFMLATSGKDFAVWEK  1348
             G+ +TS V ILA++++LY+A I+ K+I+KIGP  DL NLVP ++ LATSG ++AVWEK
Sbjct  357   GIQSTSTVTILASESELYMASIDDKIIMKIGPKMDLANLVPPNYQLATSGNNYAVWEK  414



>gb|KHG23972.1| Uncharacterized protein F383_31428 [Gossypium arboreum]
Length=415

 Score =   484 bits (1246),  Expect = 4e-164, Method: Compositional matrix adjust.
 Identities = 247/418 (59%), Positives = 318/418 (76%), Gaps = 24/418 (6%)
 Frame = +2

Query  101   SSSTVLFQGFTWTSKDQPGGWWNWLITKVPDLADAGITHVWLPPPSNAREGDDQGYMPKR  280
             ++ T+LFQGF W S ++ GGW+N+L + V D+A+AG+THVWLPPPS  +    QGY+P R
Sbjct  19    ATPTLLFQGFNWESSNKAGGWYNFLQSSVSDIANAGVTHVWLPPPS--QSAAPQGYLPGR  76

Query  281   MYDLDTSKYGNKKELKALNDAFHGRGIKSVADIVLNHRAAERANSRGVFNVFEGGTPDDK  460
             +YDLD SKYG++ ELK+L DAFH +G+K VADIV+NHR AER ++RG++ +FEGGT DD+
Sbjct  77    LYDLDASKYGSQAELKSLIDAFHQKGVKCVADIVINHRTAERQDNRGIYCLFEGGTSDDR  136

Query  461   LDWGPSEICGDDAAF-EGTGNPDTGDPWGDAPDIDHRSPRVQREISEWMNWLKSDVGFDG  637
             LDWGPS IC DD A+ +GTGNPDTG P+  APDIDH +PRVQ E+S+W+NWLK+++GFDG
Sbjct  137   LDWGPSFICKDDTAYSDGTGNPDTGLPYDPAPDIDHLNPRVQNELSDWLNWLKTEIGFDG  196

Query  638   WRFDYVKGYDFVKGFAAVKIYMDNTKPEFAVGELWNALSPGSVPNPDYNQDAHRNELVRW  817
             WRFD+V+GY         KIYMD T P+FAVGE W     G        ++ HR  L  W
Sbjct  197   WRFDFVRGY----APTITKIYMDRTSPDFAVGEKWEDFIDG-------QEELHRAALKDW  245

Query  818   VQNaggaatafdfttKGILQAALNNTELWRLKDAAGKPSGMIGVLPQSAVTFIDNHDTWS  997
             V+ AGG  TAFDFTTKG+L  A+   +LWRLKD+ GKP GMIG+LPQ+AVTFIDNHDT S
Sbjct  246   VEAAGGTVTAFDFTTKGVLNDAVQG-KLWRLKDSNGKPPGMIGLLPQNAVTFIDNHDTGS  304

Query  998   -QRLWPFTTSTDDAVNHDRVLQGYAYILTHPGIPSVFYDHFFEWGLKDAISKLISIRNKN  1174
              Q +WPF +        D+++QGYAYILTHP IPS+FYDHFF+ GLKD ISKL+ IRN+N
Sbjct  305   TQNIWPFPS--------DKIMQGYAYILTHPSIPSIFYDHFFDLGLKDEISKLVEIRNRN  356

Query  1175  GVSATSPVEILAADADLYIAKINGKVILKIGPNGDLKNLVPSDFMLATSGKDFAVWEK  1348
             G+ +TS V ILA++++LY+A I+ K+I+KIGP  DL NLVP ++ LATSG ++AVWEK
Sbjct  357   GIQSTSTVTILASESELYMASIDDKIIMKIGPKMDLANLVPPNYQLATSGNNYAVWEK  414



>gb|KHG14183.1| Uncharacterized protein F383_17328 [Gossypium arboreum]
 gb|KHG30294.1| Uncharacterized protein F383_36543 [Gossypium arboreum]
Length=415

 Score =   483 bits (1242),  Expect = 2e-163, Method: Compositional matrix adjust.
 Identities = 246/418 (59%), Positives = 317/418 (76%), Gaps = 24/418 (6%)
 Frame = +2

Query  101   SSSTVLFQGFTWTSKDQPGGWWNWLITKVPDLADAGITHVWLPPPSNAREGDDQGYMPKR  280
             ++ T+LFQGF W S ++ GGW+N+L + V D+A+AG+THVWLPPPS  +    QGY+P R
Sbjct  19    ATPTLLFQGFNWESSNKAGGWYNFLQSSVSDIANAGVTHVWLPPPS--QSAAPQGYLPGR  76

Query  281   MYDLDTSKYGNKKELKALNDAFHGRGIKSVADIVLNHRAAERANSRGVFNVFEGGTPDDK  460
             +YDLD SKYG++ ELK+L DAFH +G+K VADIV+NHR AER ++RG++ +FEGGT DD+
Sbjct  77    LYDLDASKYGSQAELKSLIDAFHQKGVKCVADIVINHRTAERQDNRGIYCLFEGGTSDDR  136

Query  461   LDWGPSEICGDDAAF-EGTGNPDTGDPWGDAPDIDHRSPRVQREISEWMNWLKSDVGFDG  637
             LDWGPS IC DD A+ +GTGNPDTG P+  APDIDH +PRVQ E+S+W+NWLK+++GFDG
Sbjct  137   LDWGPSFICKDDTAYSDGTGNPDTGLPYDPAPDIDHLNPRVQNELSDWLNWLKTEIGFDG  196

Query  638   WRFDYVKGYDFVKGFAAVKIYMDNTKPEFAVGELWNALSPGSVPNPDYNQDAHRNELVRW  817
             WRFD+V+GY         KIYMD T P+FAVGE W     G        ++ HR  L  W
Sbjct  197   WRFDFVRGY----APTITKIYMDRTSPDFAVGEKWEDFIDG-------QEELHRAALKDW  245

Query  818   VQNaggaatafdfttKGILQAALNNTELWRLKDAAGKPSGMIGVLPQSAVTFIDNHDTWS  997
             V+ AGG  TAFDFTTKG+L  A+   +LWRLKD+ GKP GMIG+LPQ+AVTFIDNHDT S
Sbjct  246   VEAAGGTVTAFDFTTKGVLNDAVQG-KLWRLKDSNGKPPGMIGLLPQNAVTFIDNHDTGS  304

Query  998   -QRLWPFTTSTDDAVNHDRVLQGYAYILTHPGIPSVFYDHFFEWGLKDAISKLISIRNKN  1174
              Q +WPF +        D+++QGYAYILTHP IPS+FYDHFF+ G KD ISKL+ IRN+N
Sbjct  305   TQNIWPFPS--------DKIMQGYAYILTHPSIPSIFYDHFFDLGFKDEISKLVEIRNRN  356

Query  1175  GVSATSPVEILAADADLYIAKINGKVILKIGPNGDLKNLVPSDFMLATSGKDFAVWEK  1348
             G+ +TS V ILA++++LY+A I+ K+I+KIGP  DL NLVP ++ LATSG ++AVWEK
Sbjct  357   GIQSTSTVTILASESELYMASIDDKIIMKIGPKMDLANLVPPNYQLATSGNNYAVWEK  414



>ref|XP_008373148.1| PREDICTED: alpha-amylase-like [Malus domestica]
Length=432

 Score =   482 bits (1240),  Expect = 6e-163, Method: Compositional matrix adjust.
 Identities = 252/444 (57%), Positives = 325/444 (73%), Gaps = 20/444 (5%)
 Frame = +2

Query  47    SSFYLSLFCIAFFLFPLHSSSTVLFQGFTWTSKDQPGGWWNWLITKVPD-LADAGITHVW  223
             +S +  LFCI   L P  ++  +LFQGF W S  + GGW+  L   +P  LA +GITHVW
Sbjct  6     TSXFFLLFCIP--LLPNLTAPQILFQGFNWESWKEEGGWYKSLSQSIPQQLASSGITHVW  63

Query  224   LPPPSNAREGDDQGYMPKRMYDLDTSKYGNKKELKALNDAFHGRGIKSVADIVLNHRAAE  403
             LPPPS++     QGYMP R+YDL+ S+YGN+ ELKAL + FH  GI+S+ADIV+NHR AE
Sbjct  64    LPPPSHSVS--PQGYMPGRLYDLNASRYGNQDELKALINTFHDNGIQSIADIVINHRCAE  121

Query  404   RANSRGVFNVFEGGTPDDKLDWGPSEICGDDAAFE-GTGNPDTGDPWGDAPDIDHRSPRV  580
             + + RG++ +FEGGTPDD+LDWGPS IC DD A+  G GNPDTG  +  APDIDH + RV
Sbjct  122   KKDERGIWCIFEGGTPDDRLDWGPSLICSDDTAYSNGKGNPDTGADFSAAPDIDHINTRV  181

Query  581   QREISEWMNWLKSDVGFDGWRFDYVKGYDFVKGFAAVKIYMDNTKPEFAVGELWNALSPG  760
             QRE+S+WMNWLK+++GF+GWRFD+VKGY         K+++ NT+P F+VGELWN+L+ G
Sbjct  182   QRELSDWMNWLKTEIGFNGWRFDFVKGY----APEFTKLFVTNTRPSFSVGELWNSLAYG  237

Query  761   SVPNPDYNQDAHRNELVRWVQNaggaatafdfttKGILQAALNNTELWRLKDAAGKPSGM  940
             S    +YNQDAHR  LV WV+ AGG  TAFDFTTKGILQAA+   ELWR+KD+ G   GM
Sbjct  238   SDGKLEYNQDAHRRALVGWVEGAGGDVTAFDFTTKGILQAAVQG-ELWRMKDSNGGAPGM  296

Query  941   IGVLPQSAVTFIDNHDTWS-QRLWPFTTSTDDAVNHDRVLQGYAYILTHPGIPSVFYDHF  1117
             IG+ P  +VTF+DNHDT S Q +WPF +        D+V+QGYAYILTHPGIPS+FYDH+
Sbjct  297   IGLSPGKSVTFVDNHDTGSTQNMWPFPS--------DKVMQGYAYILTHPGIPSIFYDHY  348

Query  1118  FEWGLKDAISKLISIRNKNGVSATSPVEILAADADLYIAKINGKVILKIGPNGDLKNLVP  1297
             F+WGLK+ I+KL++IR +NGV   S + ILA+DADLY+A  + K+I KIGP  D+ NLVP
Sbjct  349   FDWGLKEEITKLVAIRLRNGVGPDSALRILASDADLYVAATDEKIIAKIGPRYDVGNLVP  408

Query  1298  SDFMLATSGKDFAVWEKPT*SRLQ  1369
               + +ATSG D+ VWEK   + L+
Sbjct  409   PTYQIATSGNDYCVWEKKAGALLE  432



>ref|XP_010690299.1| PREDICTED: alpha-amylase-like [Beta vulgaris subsp. vulgaris]
Length=432

 Score =   481 bits (1238),  Expect = 1e-162, Method: Compositional matrix adjust.
 Identities = 247/445 (56%), Positives = 330/445 (74%), Gaps = 24/445 (5%)
 Frame = +2

Query  41    MKSSFYLSLFCIAFFLFPLHSS--STVLFQGFTWTSKDQPGGWWNWLITKVPDLADAGIT  214
             MKS   + L C+      L +S  ST+LFQGF W S ++ GG +N L+  + DLA AGIT
Sbjct  1     MKSLNIVILCCLNLSFSILFNSVASTLLFQGFNWESCNKQGGLYNSLLNSIDDLARAGIT  60

Query  215   HVWLPPPSNAREGDDQGYMPKRMYDLDTSKYGNKKELKALNDAFHGRGIKSVADIVLNHR  394
             H+WLPPPS++     QGY+  R+YDLD S YG++ +LK L +AFH +GIK VADIV+NHR
Sbjct  61    HIWLPPPSHSVA--PQGYLHGRLYDLDASTYGSETQLKTLINAFHKKGIKCVADIVINHR  118

Query  395   AAERANSRGVFNVFEGGTPDDKLDWGPSEICGDDAAF-EGTGNPDTGDPWGDAPDIDHRS  571
              A++ + RG++++FEGGT DD+LDWGP  IC DD  + +G+GN DTG  +G APDIDH +
Sbjct  119   CADKKDKRGIYSIFEGGTTDDRLDWGPWAICRDDTQYSDGSGNLDTGADYGAAPDIDHLN  178

Query  572   PRVQREISEWMNWLKSDVGFDGWRFDYVKGYDFVKGFAAVKIYMDNTKPEFAVGELWNAL  751
             PRVQ+E+ +WM WLKS++GFDGWRFD+VKGY      + +KIYM+ T P+FAV ELW+++
Sbjct  179   PRVQKELVDWMKWLKSEIGFDGWRFDFVKGY----APSIMKIYMEKTTPDFAVVELWDSI  234

Query  752   SPGSVPNPDYNQDAHRNELVRWVQNaggaatafdf-----ttKGILQAALNNTELWRLKD  916
             +  S   PDY+QD HRN+L RWV+ AGG   A        TTKG+LQAA+   E WR+KD
Sbjct  235   NSDSDGRPDYDQDGHRNKLARWVEAAGGGGGASAIAAFDFTTKGVLQAAVQG-EWWRMKD  293

Query  917   AAGKPSGMIGVLPQSAVTFIDNHDTWS-QRLWPFTTSTDDAVNHDRVLQGYAYILTHPGI  1093
             + GKP+G+I ++P++AVTFIDNHDT S Q+LWPF +        D+V QGYAYILTHPGI
Sbjct  294   SEGKPTGLIRIMPKNAVTFIDNHDTGSTQQLWPFPS--------DKVTQGYAYILTHPGI  345

Query  1094  PSVFYDHFFEWGLKDAISKLISIRNKNGVSATSPVEILAADADLYIAKINGKVILKIGPN  1273
             PS+FYDHFFEWG+K+ I+KL SIR +N ++ +S V I+A+DADLY+A I+ KVI+KIGP 
Sbjct  346   PSIFYDHFFEWGIKEEIAKLASIRLRNMINGSSGVNIMASDADLYVAMIDEKVIVKIGPR  405

Query  1274  GDLKNLVPSDFMLATSGKDFAVWEK  1348
              ++ NL+PS+F ++TSGKD+AVWEK
Sbjct  406   YNVGNLIPSNFKISTSGKDYAVWEK  430



>ref|XP_010274277.1| PREDICTED: pentatricopeptide repeat-containing protein At2g04860 
[Nelumbo nucifera]
Length=1179

 Score =   502 bits (1293),  Expect = 1e-161, Method: Compositional matrix adjust.
 Identities = 250/432 (58%), Positives = 317/432 (73%), Gaps = 17/432 (4%)
 Frame = +2

Query  59    LSLFCIAFFLFPLHSSSTVLFQGFTWTSKDQPGGWWNWLITKVPDLADAGITHVWLPPPS  238
              S  C+   L P    + ++FQGF W S  + GGW+N L   +P+LA+AG+THVWLPPPS
Sbjct  7     FSYLCLIVSLLPTSIFAQLVFQGFNWESWKKEGGWYNSLRNSIPELANAGVTHVWLPPPS  66

Query  239   NAREGDDQGYMPKRMYDLDTSKYGNKKELKALNDAFHGRGIKSVADIVLNHRAAERANSR  418
             ++     +GY+P R+YDLD+S+YGNK EL+ L +AFH  GI+ +ADIV+NHR AE+ ++R
Sbjct  67    HSV--SSEGYLPGRLYDLDSSRYGNKDELRTLINAFHKVGIQCIADIVINHRCAEKQDAR  124

Query  419   GVFNVFEGGTPDDKLDWGPSEICGDDAAF-EGTGNPDTGDPWGDAPDIDHRSPRVQREIS  595
             G++ +FEGGTPDD+LDWGPS IC DD  + +GTGNPDTG  +  APDIDH +PRVQRE+S
Sbjct  125   GIWCIFEGGTPDDRLDWGPSFICSDDKQYSDGTGNPDTGAGYDIAPDIDHANPRVQRELS  184

Query  596   EWMNWLKSDVGFDGWRFDYVKGYDFVKGFAAVKIYMDNTKPEFAVGELWNALSPGSVPNP  775
             +WMNWLKS++GF+GWRFD+ KGY         KIYM+ T P FAV E+WN+LS G    P
Sbjct  185   DWMNWLKSEIGFNGWRFDFAKGY----APYITKIYMEQTHPNFAVMEIWNSLSYGQDGKP  240

Query  776   DYNQDAHRNELVRWVQNaggaatafdfttKGILQAALNNTELWRLKDAAGKPSGMIGVLP  955
             +YNQD HR E+V WVQ AGGA  AFDFTTKGILQAA+   ELWR+KD+ G   GMIGVLP
Sbjct  241   EYNQDKHRYEMVEWVQAAGGAVKAFDFTTKGILQAAVQG-ELWRMKDSKGGAPGMIGVLP  299

Query  956   QSAVTFIDNHDTWS-QRLWPFTTSTDDAVNHDRVLQGYAYILTHPGIPSVFYDHFFEWGL  1132
             ++AVTF+DNHDT S Q LWPF          D+V+QGY YILTHPGIPS+FYDHFF WGL
Sbjct  300   ENAVTFVDNHDTGSTQHLWPFPA--------DKVMQGYVYILTHPGIPSIFYDHFFNWGL  351

Query  1133  KDAISKLISIRNKNGVSATSPVEILAADADLYIAKINGKVILKIGPNGDLKNLVPSDFML  1312
             K+ I KL++IR +NG+   S + I+A + DLY+A I+ K+I KIG   D+ NLVP  F +
Sbjct  352   KEEIVKLVAIRTRNGIRPNSTLRIIAFNPDLYLAAIDEKIIAKIGSRYDVGNLVPPTFQI  411

Query  1313  ATSGKDFAVWEK  1348
             ATSG D+ VWEK
Sbjct  412   ATSGNDYCVWEK  423



>ref|XP_002510219.1| pentatricopeptide repeat-containing protein, putative [Ricinus 
communis]
 gb|EEF52406.1| pentatricopeptide repeat-containing protein, putative [Ricinus 
communis]
Length=1113

 Score =   499 bits (1284),  Expect = 5e-161, Method: Compositional matrix adjust.
 Identities = 255/424 (60%), Positives = 322/424 (76%), Gaps = 18/424 (4%)
 Frame = +2

Query  86    LFPLHSSSTVLFQGFTWTSKDQPGGWWNWLITKVPDLADAGITHVWLPPPSNAREGDDQG  265
             +FPL +SS +LFQGF W S ++ GGW+N L   + D+A+AGITHVWLPPPS +     QG
Sbjct  18    IFPLSTSSALLFQGFNWESCNKGGGWYNLLKNSILDIANAGITHVWLPPPSQSVS--PQG  75

Query  266   YMPKRMYDLDTSKYGNKKELKALNDAFHGRGIKSVADIVLNHRAAERANSRGVFNVFEGG  445
             YMP R+YDL+ S+YG + ELK+L  AFH +GIK +ADIV+NHR AE+ + RG++ +FEGG
Sbjct  76    YMPGRLYDLNASRYGTQDELKSLIRAFHHKGIKCLADIVINHRTAEKKDERGIWCIFEGG  135

Query  446   TPDDKLDWGPSEICGDDAAF-EGTGNPDTGDPWGDAPDIDHRSPRVQREISEWMNWLKSD  622
             T DD+LDWGPS IC DD  F +GTGNPDTG+ +  APDIDH +PRVQ+E+S+WMNWLK +
Sbjct  136   TDDDRLDWGPSFICCDDTVFSDGTGNPDTGEDYPPAPDIDHLNPRVQKELSDWMNWLKLE  195

Query  623   VGFDGWRFDYVKGYDFVKGFAAVKIYMDNTKPEFAVGELWNALSPGSVPNPDYNQDAHRN  802
             +GF GWRFD+ KGY        +KIYM+   P FAVGE W++LS G    PDYNQDAHRN
Sbjct  196   IGFGGWRFDFAKGYSP----TIMKIYMEQIPPGFAVGEKWDSLSYGQDWKPDYNQDAHRN  251

Query  803   ELVRWVQNaggaatafdfttKGILQAALNNTELWRLKDAAGKPSGMIGVLPQSAVTFIDN  982
              L  W+Q +GG  TAFDFTTKGILQAA+   ELWRL D+ G P G+IG++PQ+AVTFIDN
Sbjct  252   ALKDWIQASGGVITAFDFTTKGILQAAVQG-ELWRLIDSNGNPPGLIGIMPQNAVTFIDN  310

Query  983   HDTWS-QRLWPFTTSTDDAVNHDRVLQGYAYILTHPGIPSVFYDHFFEWGLKDAISKLIS  1159
             HDT S Q+LWPF +        D+V+QGYAYILTHPGIP++FYDHFF+WGLK+ ISKL S
Sbjct  311   HDTGSTQQLWPFPS--------DKVMQGYAYILTHPGIPTIFYDHFFDWGLKEQISKLAS  362

Query  1160  IRNKNGVSATSPVEILAADADLYIAKINGKVILKIGPNGDLKNLVPS-DFMLATSGKDFA  1336
             IR   G+ + S ++ILAA++DLY+A IN  VI+KIGP  DL NL+PS +F +ATSG+ +A
Sbjct  363   IRKNYGIDSRSGMKILAAESDLYMAAINDNVIMKIGPRMDLGNLLPSKEFQVATSGESYA  422

Query  1337  VWEK  1348
             VW K
Sbjct  423   VWVK  426



>ref|XP_010943052.1| PREDICTED: alpha-amylase isozyme 3D-like [Elaeis guineensis]
Length=426

 Score =   476 bits (1226),  Expect = 6e-161, Method: Compositional matrix adjust.
 Identities = 241/421 (57%), Positives = 314/421 (75%), Gaps = 17/421 (4%)
 Frame = +2

Query  92    PLHSSSTVLFQGFTWTSKDQPGGWWNWLITKVPDLADAGITHVWLPPPSNAREGDDQGYM  271
             P  + + +LFQGF W S  + GGW+N+L  +V D+A+AG+THVWLPPPS++    +QGYM
Sbjct  20    PNGAVAQILFQGFNWESWKKEGGWYNFLKGQVSDIANAGVTHVWLPPPSHSVS--EQGYM  77

Query  272   PKRMYDLDTSKYGNKKELKALNDAFHGRGIKSVADIVLNHRAAERANSRGVFNVFEGGTP  451
             P R+YDL+ SKYGN+ ELK+L  AFHG+GIK VADIV+NHR A++ + RG++ +FEGGTP
Sbjct  78    PGRLYDLNVSKYGNQDELKSLISAFHGKGIKCVADIVINHRCADKMDGRGIYCIFEGGTP  137

Query  452   DDKLDWGPSEICGDDAAF-EGTGNPDTGDPWGDAPDIDHRSPRVQREISEWMNWLKSDVG  628
             DD+LDWGP+ IC DD  + +GTG+PDTG  +  APDIDH + RVQ E+S+WMNWLKSD+G
Sbjct  138   DDRLDWGPTMICSDDTKYSDGTGHPDTGLGFDAAPDIDHLNLRVQHELSDWMNWLKSDLG  197

Query  629   FDGWRFDYVKGYDFVKGFAAVKIYMDNTKPEFAVGELWNALSPGSVPNPDYNQDAHRNEL  808
             FDGWR D+ KGY         KIY+D T P F V E+W++L+ G+   P Y+Q+AHR EL
Sbjct  198   FDGWRLDFAKGYSS----DIAKIYVDQTTPSFVVAEIWSSLAYGNDGKPAYDQNAHRQEL  253

Query  809   VRWVQNaggaatafdfttKGILQAALNNTELWRLKDAAGKPSGMIGVLPQSAVTFIDNHD  988
             V WVQ   G ATAFDFTTKGILQAA+   ELWR++D+ GK SGM+G  P+ AVTFIDNHD
Sbjct  254   VNWVQTVAGPATAFDFTTKGILQAAVQG-ELWRMRDSNGKASGMLGWWPEKAVTFIDNHD  312

Query  989   TWS-QRLWPFTTSTDDAVNHDRVLQGYAYILTHPGIPSVFYDHFFEWGLKDAISKLISIR  1165
             T S QRLWPF +        D+V+QGY YILTHPGIPS+FYDH F+WG K+ IS+L +IR
Sbjct  313   TGSTQRLWPFPS--------DKVMQGYVYILTHPGIPSIFYDHLFDWGFKEQISELATIR  364

Query  1166  NKNGVSATSPVEILAADADLYIAKINGKVILKIGPNGDLKNLVPSDFMLATSGKDFAVWE  1345
             ++NG+   S + I+ +D+DLY+A I+ K+I KIGP  D+  +VPS+F +  SG D+ VWE
Sbjct  365   SRNGIHPGSSLRIIVSDSDLYVAAIDEKIIAKIGPRYDVGKVVPSNFQIVASGNDYCVWE  424

Query  1346  K  1348
             K
Sbjct  425   K  425



>ref|XP_011042248.1| PREDICTED: pentatricopeptide repeat-containing protein At2g04860 
[Populus euphratica]
Length=1272

 Score =   502 bits (1293),  Expect = 9e-161, Method: Compositional matrix adjust.
 Identities = 263/445 (59%), Positives = 331/445 (74%), Gaps = 20/445 (4%)
 Frame = +2

Query  11    HQSNKIPETIMKSSFYLSLFCIAFFL--FPLHSSSTVLFQGFTWTSKDQPGGWWNWLITK  184
             HQS   P +  K   +L+L   + FL  FPL +SS +LFQGF W S ++ GGW+N L   
Sbjct  34    HQSLP-PNSKTKRMSFLTLCFFSLFLSVFPLLTSSYLLFQGFNWESCNKAGGWYNSLKNS  92

Query  185   VPDLADAGITHVWLPPPSNAREGDDQGYMPKRMYDLDTSKYGNKKELKALNDAFHGRGIK  364
             VPDLA+AGITHVW PP S +     QGYMP R+YDL  S+YG++ ELK+L   F+ +GIK
Sbjct  93    VPDLANAGITHVWRPPSSQSVA--PQGYMPGRLYDLSASRYGSQDELKSLIGDFNQKGIK  150

Query  365   SVADIVLNHRAAERANSRGVFNVFEGGTPDDKLDWGPSEICGDDAAF-EGTGNPDTGDPW  541
              +ADIV+NHR AE+ + RG+++VFEGGT DD+LDWGPS IC DD  + +G GNPD+GD +
Sbjct  151   CLADIVINHRTAEKQDERGIWSVFEGGTSDDRLDWGPSFICADDTTYSDGKGNPDSGDDF  210

Query  542   GDAPDIDHRSPRVQREISEWMNWLKSDVGFDGWRFDYVKGYDFVKGFAAVKIYMDNTKPE  721
               APDIDH +PRVQRE+S+WMNWLKS++GFDGWRFD+VKGY      +  KIYM+NT P+
Sbjct  211   EPAPDIDHLNPRVQRELSDWMNWLKSEIGFDGWRFDFVKGY----APSITKIYMENTSPD  266

Query  722   FAVGELWNALSPGSVPNPDYNQDAHRNELVRWVQNaggaatafdfttKGILQAALNNTEL  901
             FAVGE W++L+ G     DYNQDAHR  +  W+Q AGGA TAFDFT+KGILQAA+   EL
Sbjct  267   FAVGEKWDSLADGQDGKLDYNQDAHRGSIRDWIQAAGGAVTAFDFTSKGILQAAVQG-EL  325

Query  902   WRLKDAAGKPSGMIGVLPQSAVTFIDNHDTWS-QRLWPFTTSTDDAVNHDRVLQGYAYIL  1078
             WRLKD+ GKP G+IG+LPQ+AVTFIDNHDT S Q++WPF +        D+V+QGYAYIL
Sbjct  326   WRLKDSNGKPPGLIGLLPQNAVTFIDNHDTGSTQQIWPFPS--------DKVIQGYAYIL  377

Query  1079  THPGIPSVFYDHFFEWGLKDAISKLISIRNKNGVSATSPVEILAADADLYIAKINGKVIL  1258
             THPG  S+FYDHFF+WGLK+ I KL +IR   G+ +TS V ILA+DADLY+A IN  +I+
Sbjct  378   THPGTGSIFYDHFFDWGLKEEIGKLATIRKNYGIGSTSTVNILASDADLYVAAINDNIIM  437

Query  1259  KIGPNGDLKNLVPSDFMLATSGKDF  1333
             KIGP  DL NL+P +F +ATSG DF
Sbjct  438   KIGPKTDLGNLIPLNFQVATSGTDF  462



>gb|AAA98615.1| alpha-amylase [Hordeum vulgare subsp. vulgare]
Length=427

 Score =   476 bits (1224),  Expect = 2e-160, Method: Compositional matrix adjust.
 Identities = 245/434 (56%), Positives = 312/434 (72%), Gaps = 19/434 (4%)
 Frame = +2

Query  59    LSLFCIAFFLFPLHSSSTVLFQGFTWTSKDQPGGWWNWLITKVPDLADAGITHVWLPPPS  238
             LSLF +   L    +S  VLFQGF W S    GGW+N+L+ KV D+A AG+THVWLPP S
Sbjct  8     LSLFIVLLGLSCSLASGQVLFQGFNWESWKHNGGWYNFLMGKVDDIAAAGVTHVWLPPAS  67

Query  239   NAREGDDQGYMPKRMYDLDTSKYGNKKELKALNDAFHGRGIKSVADIVLNHRAAERANSR  418
              +    +QGYMP R+YDLD SKYGNK +LK+L  A HG+G+K++ADIV+NHR AER + R
Sbjct  68    QSVA--EQGYMPGRLYDLDASKYGNKAQLKSLIGALHGKGVKAIADIVINHRTAERKDGR  125

Query  419   GVFNVFEGGTPDDKLDWGPSEICGDDAAF-EGTGNPDTGDPWGDAPDIDHRSPRVQREIS  595
             G++ +FEGGTPD +LDWGP  IC DD  + +GTGNPDTG  +G APDIDH +PRVQ+E+ 
Sbjct  126   GIYCIFEGGTPDARLDWGPHMICRDDRPYADGTGNPDTGADFGAAPDIDHLNPRVQKELV  185

Query  596   EWMNWLKSDVGFDGWRFDYVKGYDFVKGFAAVKIYMDNTKPEFAVGELWNALSPGSVPNP  775
             EW+NWL++DVGFDGWRFD+ KGY         KIY+D ++P FAV E+W +L+ G    P
Sbjct  186   EWLNWLRTDVGFDGWRFDFAKGYSA----DVAKIYVDRSEPSFAVAEIWTSLAYGGDGKP  241

Query  776   DYNQDAHRNELVRWVQNagga--atafdfttKGILQAALNNTELWRLKDAAGKPSGMIGV  949
             + NQD HR ELV WV   GG+  AT FDFTTKGIL  A+   ELWRL+   GK  GMIG 
Sbjct  242   NLNQDPHRQELVNWVNKVGGSGPATTFDFTTKGILNVAVEG-ELWRLRGTDGKAPGMIGW  300

Query  950   LPQSAVTFIDNHDTWS-QRLWPFTTSTDDAVNHDRVLQGYAYILTHPGIPSVFYDHFFEW  1126
              P  AVTF+DNHDT S Q +WPF +        DRV+QGYAYILTHPG P +FYDHFF+W
Sbjct  301   WPAKAVTFVDNHDTGSTQHMWPFPS--------DRVMQGYAYILTHPGTPCIFYDHFFDW  352

Query  1127  GLKDAISKLISIRNKNGVSATSPVEILAADADLYIAKINGKVILKIGPNGDLKNLVPSDF  1306
             GLK+ I +L+SIR + G+ + S ++I+ ADADLY+A+I+GKVI+K+GP  D+ +L+P  F
Sbjct  353   GLKEEIDRLVSIRTRQGIHSESKLQIMEADADLYLAEIDGKVIVKLGPRYDVGHLIPEGF  412

Query  1307  MLATSGKDFAVWEK  1348
              +   G D+AVWEK
Sbjct  413   KVVAHGNDYAVWEK  426



>ref|XP_009349497.1| PREDICTED: alpha-amylase-like [Pyrus x bretschneideri]
Length=432

 Score =   474 bits (1221),  Expect = 5e-160, Method: Compositional matrix adjust.
 Identities = 252/444 (57%), Positives = 321/444 (72%), Gaps = 20/444 (5%)
 Frame = +2

Query  47    SSFYLSLFCIAFFLFPLHSSSTVLFQGFTWTSKDQPGGWWNWLITKVPD-LADAGITHVW  223
             +S +  LFCI   L P  ++  +LFQGF W S  + GGW+  L    P  LA +GITHVW
Sbjct  6     TSLFFLLFCIP--LLPNFTAPQILFQGFNWESWKEEGGWYKSLSKCTPQQLASSGITHVW  63

Query  224   LPPPSNAREGDDQGYMPKRMYDLDTSKYGNKKELKALNDAFHGRGIKSVADIVLNHRAAE  403
             LPPPS++     QGYMP R+YDL+ S+YGN+ ELKAL + FH  GI+S+ADIV+NHR AE
Sbjct  64    LPPPSHSVS--PQGYMPGRLYDLNASRYGNQDELKALINTFHDNGIQSIADIVINHRCAE  121

Query  404   RANSRGVFNVFEGGTPDDKLDWGPSEICGDDAAFE-GTGNPDTGDPWGDAPDIDHRSPRV  580
             + + RG++ +FEGGTPDD+LDWGPS IC DD A+  G GNPDTG  +  APDID+ + RV
Sbjct  122   KKDERGIWCIFEGGTPDDRLDWGPSLICSDDIAYSNGKGNPDTGADFSAAPDIDYINTRV  181

Query  581   QREISEWMNWLKSDVGFDGWRFDYVKGYDFVKGFAAVKIYMDNTKPEFAVGELWNALSPG  760
             QRE+S+WMNWLK+++GF GWRFD+VKGY         K+++ NT P F+VGELWN+L+ G
Sbjct  182   QRELSDWMNWLKTEIGFSGWRFDFVKGY----APEFTKLFVINTGPSFSVGELWNSLAYG  237

Query  761   SVPNPDYNQDAHRNELVRWVQNaggaatafdfttKGILQAALNNTELWRLKDAAGKPSGM  940
             S    +YNQDAHR  LV WV+ AGG  TAFDFTTKGILQAA+   ELWR+KD+ G   GM
Sbjct  238   SDGKLEYNQDAHRRALVGWVEGAGGDVTAFDFTTKGILQAAVQG-ELWRMKDSNGGAPGM  296

Query  941   IGVLPQSAVTFIDNHDTWS-QRLWPFTTSTDDAVNHDRVLQGYAYILTHPGIPSVFYDHF  1117
             IG+ P   VTFIDNHDT S Q +WPF +        D+V+QGYAYILTHPGIPS+FYDHF
Sbjct  297   IGLSPGKRVTFIDNHDTGSTQNMWPFPS--------DKVMQGYAYILTHPGIPSIFYDHF  348

Query  1118  FEWGLKDAISKLISIRNKNGVSATSPVEILAADADLYIAKINGKVILKIGPNGDLKNLVP  1297
             F+WGLK+ I+KL++IR +N +   S + ILA+DADLY+A I+ K+I KIGP  D+ NLVP
Sbjct  349   FDWGLKEEITKLVAIRLRNRIGPDSALRILASDADLYVAAIDEKIIAKIGPRYDVGNLVP  408

Query  1298  SDFMLATSGKDFAVWEKPT*SRLQ  1369
               + +ATSG D+ VWEK   + L+
Sbjct  409   PTYQIATSGNDYCVWEKKAGALLE  432



>emb|CAX51373.1| alpha-amylase [Hordeum vulgare subsp. vulgare]
Length=427

 Score =   473 bits (1216),  Expect = 2e-159, Method: Compositional matrix adjust.
 Identities = 241/420 (57%), Positives = 309/420 (74%), Gaps = 19/420 (5%)
 Frame = +2

Query  101   SSSTVLFQGFTWTSKDQPGGWWNWLITKVPDLADAGITHVWLPPPSNAREGDDQGYMPKR  280
             +S  VLFQGF W S    GGW+N+L+ KV D+A AG+THVWLPP S +    +QGYMP R
Sbjct  22    ASGQVLFQGFNWESWKHNGGWYNFLMGKVDDIAAAGVTHVWLPPASQSVA--EQGYMPGR  79

Query  281   MYDLDTSKYGNKKELKALNDAFHGRGIKSVADIVLNHRAAERANSRGVFNVFEGGTPDDK  460
             +YDLD SKYGNK +LK+L  A HG+G+K++ADIV+NHR AER + RG++ +FEGGTPD +
Sbjct  80    LYDLDASKYGNKAQLKSLIGALHGKGVKAIADIVINHRTAERKDGRGIYCIFEGGTPDAR  139

Query  461   LDWGPSEICGDDAAF-EGTGNPDTGDPWGDAPDIDHRSPRVQREISEWMNWLKSDVGFDG  637
             LDWGP  IC DD  + +GTGNPDTG  +G APDIDH +PRVQ+E+ EW+NWL++DVGFDG
Sbjct  140   LDWGPHMICRDDRPYADGTGNPDTGADFGAAPDIDHLNPRVQKELVEWLNWLRTDVGFDG  199

Query  638   WRFDYVKGYDFVKGFAAVKIYMDNTKPEFAVGELWNALSPGSVPNPDYNQDAHRNELVRW  817
             WRFD+ KGY         KIY+D ++P FAV E+W +L+ G    P+ NQD HR ELV W
Sbjct  200   WRFDFAKGYSA----DVAKIYVDRSEPSFAVAEIWTSLAYGGDGKPNLNQDPHRQELVNW  255

Query  818   VQNagga--atafdfttKGILQAALNNTELWRLKDAAGKPSGMIGVLPQSAVTFIDNHDT  991
             V   GG+  AT FDFTTKGIL  A+   ELWRL+   GK  GMIG  P  AVTF+DNHDT
Sbjct  256   VNKVGGSGPATTFDFTTKGILNVAVEG-ELWRLRGTDGKAPGMIGWWPAKAVTFVDNHDT  314

Query  992   WS-QRLWPFTTSTDDAVNHDRVLQGYAYILTHPGIPSVFYDHFFEWGLKDAISKLISIRN  1168
              S Q +WPF +        DRV+QGYAYILTHPG P +FYDHFF+WGLK+ I +L+SIR 
Sbjct  315   GSTQHMWPFPS--------DRVMQGYAYILTHPGTPCIFYDHFFDWGLKEEIDRLVSIRT  366

Query  1169  KNGVSATSPVEILAADADLYIAKINGKVILKIGPNGDLKNLVPSDFMLATSGKDFAVWEK  1348
             ++G+ + S ++I+ ADADLY+A+I+GKVI+K+GP  D+++L+P  F +A  G D+AVWEK
Sbjct  367   RHGIHSESKLQIMEADADLYLAEIDGKVIVKLGPRYDVRHLIPEGFKVAAHGNDYAVWEK  426



>ref|XP_010690290.1| PREDICTED: alpha-amylase-like [Beta vulgaris subsp. vulgaris]
Length=427

 Score =   471 bits (1212),  Expect = 8e-159, Method: Compositional matrix adjust.
 Identities = 243/419 (58%), Positives = 316/419 (75%), Gaps = 19/419 (5%)
 Frame = +2

Query  101   SSSTVLFQGFTWTSKDQPGGWWNWLITKVPDLADAGITHVWLPPPSNAREGDDQGYMPKR  280
             ++ T+LFQGF W S ++PGG +N+L   V DLA AG+THVWLPPP+++     QGY+P R
Sbjct  23    ATPTLLFQGFNWDSWNKPGGLYNFLKGSVNDLARAGVTHVWLPPPTHSVS--PQGYLPGR  80

Query  281   MYDLDTSKYGNKKELKALNDAFHGRGIKSVADIVLNHRAAERANSRGVFNVFEGGTPDDK  460
             +YDL+ SKYGN+ ELK L  + H +GIKSVADIV+NHR AE  + RG++ +FEGGTPD++
Sbjct  81    LYDLNASKYGNQMELKTLIASLHQKGIKSVADIVINHRTAEYKDGRGIYCIFEGGTPDNR  140

Query  461   LDWGPSEICGDDAAF-EGTGNPDTGDPWGDAPDIDHRSPRVQREISEWMNWLKSDVGFDG  637
             LDWGP  IC DD  + +G+GNPDTGD +  APDIDH +PRVQ+E+ +WMNWLK+ +GFDG
Sbjct  141   LDWGPWAICRDDTQYSDGSGNPDTGDGYAAAPDIDHLNPRVQKELIDWMNWLKTSIGFDG  200

Query  638   WRFDYVKGYDFVKGFAAVKIYMDNTKPEFAVGELWNALSPGSVPNPDYNQDAHRNELVRW  817
             WR D+VKGY      +  K+YMD TKP+FAVGELW++++  +   PDYNQD HRNEL RW
Sbjct  201   WRLDFVKGYSP----SITKLYMDQTKPDFAVGELWDSITYLNGA-PDYNQDGHRNELARW  255

Query  818   VQ-NaggaatafdfttKGILQAALNNTELWRLKDAAGKPSGMIGVLPQSAVTFIDNHDTW  994
             VQ + GG  TAFDFTTKGILQ A+   + WR+KD  G+PSG+IG+LP++AVTF+DNHDT 
Sbjct  256   VQASGGGVVTAFDFTTKGILQYAVQG-QWWRMKDPNGRPSGLIGILPKNAVTFLDNHDTG  314

Query  995   S-QRLWPFTTSTDDAVNHDRVLQGYAYILTHPGIPSVFYDHFFEWGLKDAISKLISIRNK  1171
             S Q+LWPF          D+V+QGYAYILTHPGIPS+FYDHFF+WGLK+ I +L S+R +
Sbjct  315   SSQKLWPFPP--------DKVMQGYAYILTHPGIPSIFYDHFFDWGLKEEIIRLTSVRTR  366

Query  1172  NGVSATSPVEILAADADLYIAKINGKVILKIGPNGDLKNLVPSDFMLATSGKDFAVWEK  1348
             NG+S TS V I+A D DLY+A I+ K+I+KIG   D  NL+P ++ + T G  + VWEK
Sbjct  367   NGISETSRVNIMACDPDLYMAMIDEKIIVKIGSKYDTGNLIPPNYKVVTYGSCYCVWEK  425



>ref|XP_008811408.1| PREDICTED: alpha-amylase isozyme 3D-like [Phoenix dactylifera]
Length=426

 Score =   471 bits (1211),  Expect = 1e-158, Method: Compositional matrix adjust.
 Identities = 236/421 (56%), Positives = 313/421 (74%), Gaps = 17/421 (4%)
 Frame = +2

Query  92    PLHSSSTVLFQGFTWTSKDQPGGWWNWLITKVPDLADAGITHVWLPPPSNAREGDDQGYM  271
             P  +++ +LFQGF W S  + GGW+N+L  +V D+A+AG+THVWLPPPS++    +QGY+
Sbjct  20    PNWAAAQILFQGFNWESWKKEGGWYNFLKGQVSDIANAGVTHVWLPPPSHSVS--EQGYL  77

Query  272   PKRMYDLDTSKYGNKKELKALNDAFHGRGIKSVADIVLNHRAAERANSRGVFNVFEGGTP  451
             P R+YDL+ SKYGN+ ELK+L   FH +GIK +ADIV+NHR A++ + RGV+ +FEGGTP
Sbjct  78    PGRLYDLNVSKYGNRGELKSLISEFHEKGIKCIADIVINHRCADKKDGRGVYCIFEGGTP  137

Query  452   DDKLDWGPSEICGDDAAF-EGTGNPDTGDPWGDAPDIDHRSPRVQREISEWMNWLKSDVG  628
             DD+LDWGP+ IC DD  + +GTG+PDTG  +  APDIDH +PRVQRE+S+WMNWLKSD+G
Sbjct  138   DDRLDWGPTMICSDDTKYSDGTGHPDTGLGFDAAPDIDHLNPRVQRELSDWMNWLKSDIG  197

Query  629   FDGWRFDYVKGYDFVKGFAAVKIYMDNTKPEFAVGELWNALSPGSVPNPDYNQDAHRNEL  808
             FDGWR D+ +GY         KIY+D T P F V E+W++L+ G+   P Y+Q+AHR EL
Sbjct  198   FDGWRLDFARGYSS----DIAKIYVDQTTPSFVVAEIWSSLAYGNDGKPAYDQNAHRQEL  253

Query  809   VRWVQNaggaatafdfttKGILQAALNNTELWRLKDAAGKPSGMIGVLPQSAVTFIDNHD  988
             V WVQ  G  ATAFDFTTKGILQAA+   ELWR++D+ G+ SGMIG  P+  VTF+DNHD
Sbjct  254   VNWVQTVGSPATAFDFTTKGILQAAVQG-ELWRMRDSKGEASGMIGWWPEKTVTFVDNHD  312

Query  989   TWS-QRLWPFTTSTDDAVNHDRVLQGYAYILTHPGIPSVFYDHFFEWGLKDAISKLISIR  1165
             T S QR WPF +        D+V+QGY YILTHPGIPS+FYDH F+WGLK  I +L +IR
Sbjct  313   TGSTQRQWPFPS--------DKVMQGYVYILTHPGIPSIFYDHLFDWGLKKPIGELAAIR  364

Query  1166  NKNGVSATSPVEILAADADLYIAKINGKVILKIGPNGDLKNLVPSDFMLATSGKDFAVWE  1345
             ++NG+   S + I+ +D+DLY+A I+ K+I KIGP  D+ N+VPS++ +  SG D+ VWE
Sbjct  365   SRNGIHPGSSLRIMVSDSDLYVAAIDEKIIAKIGPRYDVGNIVPSNYHIVASGNDYCVWE  424

Query  1346  K  1348
             K
Sbjct  425   K  425



>ref|XP_004499064.1| PREDICTED: alpha-amylase-like isoform X2 [Cicer arietinum]
Length=401

 Score =   467 bits (1202),  Expect = 1e-157, Method: Compositional matrix adjust.
 Identities = 245/438 (56%), Positives = 313/438 (71%), Gaps = 42/438 (10%)
 Frame = +2

Query  41    MKSSFYLSLFCIAFFLFPLHSSSTVLFQGFTWTSKDQPGGWWNWLITKVPDLADAGITHV  220
             M S  +LSLFC++  +FPL +SST+LFQGF W S  + GGW+N L   +PDLA+AGITHV
Sbjct  1     MDSLAWLSLFCLS--IFPLLASSTLLFQGFNWESSSK-GGWYNLLKNSIPDLANAGITHV  57

Query  221   WLPPPSNAREGDDQGYMPKRMYDLDTSKYGNKKELKALNDAFHGRGIKSVADIVLNHRAA  400
             WLPPPS +     QGY+P R+YDLD SKYG+K ELK+L   F+ +GIKS+ADIV+NHR A
Sbjct  58    WLPPPSQSV--GSQGYLPGRLYDLDASKYGSKDELKSLIKEFNDKGIKSLADIVINHRTA  115

Query  401   ERANSRGVFNVFEGGTPDDKLDWGPSEICGDDAAF-EGTGNPDTGDPWGDAPDIDHRSPR  577
             ER + RG++ +FEGGTPD KLDWGPS IC DD  + +GTGN DTG+ +  APDIDH +P+
Sbjct  116   ERKDERGIYCLFEGGTPDGKLDWGPSFICKDDTTYSDGTGNLDTGEGYNAAPDIDHLNPQ  175

Query  578   VQREISEWMNWLKSDVGFDGWRFDYVKGYDFVKGFAAVKIYMDNTKPEFAVGELWNALSP  757
             VQRE+SEWMN +                          KIY++NT P+FAVGE WN+LS 
Sbjct  176   VQRELSEWMNCI-------------------------TKIYVENTSPDFAVGEYWNSLSY  210

Query  758   GSVPNPDYNQDAHRNELVRWVQNaggaatafdf-ttKGILQAALNNTELWRLKDAAGKPS  934
             G     DYNQD  R ELV WV+++G         TTKGILQ A+   ELWRLKD+ GKP 
Sbjct  211   GQDGKCDYNQDKARGELVNWVESSGAGVVNAFDFTTKGILQVAVEG-ELWRLKDSNGKPP  269

Query  935   GMIGVLPQSAVTFIDNHDTWS-QRLWPFTTSTDDAVNHDRVLQGYAYILTHPGIPSVFYD  1111
             G+IG+ P++AVTFIDNHDT S Q+LWPF +        D+V+QGY YILTHPG PS+FYD
Sbjct  270   GLIGLKPENAVTFIDNHDTGSTQKLWPFPS--------DKVMQGYGYILTHPGTPSIFYD  321

Query  1112  HFFEWGLKDAISKLISIRNKNGVSATSPVEILAADADLYIAKINGKVILKIGPNGDLKNL  1291
             H+ EWGL + I KL +IR +NG++ATS V ILAA++DLY+A+I+ K+I+KIGP  DL NL
Sbjct  322   HYIEWGLMEPIKKLTAIRKRNGITATSSVNILAAESDLYMAEIDNKIIVKIGPKLDLGNL  381

Query  1292  VPSDFMLATSGKDFAVWE  1345
             +PS+  +AT+G+D+AVWE
Sbjct  382   LPSNAQVATNGQDYAVWE  399



>gb|AAO11776.1| alpha-amylase precursor [Musa acuminata]
Length=416

 Score =   468 bits (1203),  Expect = 2e-157, Method: Compositional matrix adjust.
 Identities = 237/430 (55%), Positives = 316/430 (73%), Gaps = 17/430 (4%)
 Frame = +2

Query  65    LFCIAFFLFPLHSSSTVLFQGFTWTSKDQPGGWWNWLITKVPDLADAGITHVWLPPPSNA  244
             +F + F + P  + S +LFQGF W S  Q GGW+N+L  KV D+A+AG+THVWLPPPS++
Sbjct  1     MFLLLFLVIPNLAQSQILFQGFNWESWRQQGGWYNFLKDKVSDIANAGVTHVWLPPPSHS  60

Query  245   REGDDQGYMPKRMYDLDTSKYGNKKELKALNDAFHGRGIKSVADIVLNHRAAERANSRGV  424
                  QGYMP R+YDL  SKYGN+ ELKAL  AFH +G+K VADIV+NHR A++ + RG+
Sbjct  61    V--GVQGYMPGRLYDLGASKYGNQDELKALIGAFHDKGVKCVADIVINHRCADKQDGRGI  118

Query  425   FNVFEGGTPDDKLDWGPSEICGDDAAF-EGTGNPDTGDPWGDAPDIDHRSPRVQREISEW  601
             + +FEGGT D +LDWGP  IC DD  + +GTGN DTG+ +  APDIDH + +VQRE+++W
Sbjct  119   WCIFEGGTDDARLDWGPHMICRDDTQYSDGTGNLDTGEGFAAAPDIDHLNTQVQRELTDW  178

Query  602   MNWLKSDVGFDGWRFDYVKGYDFVKGFAAVKIYMDNTKPEFAVGELWNALSPGSVPNPDY  781
             +NWLK+D+GFDGWR D+ +GY      +  KIY++ T+P F V E+WN+L+ G+   P Y
Sbjct  179   LNWLKTDIGFDGWRLDFAEGYSS----SIAKIYVEQTQPNFVVAEIWNSLAYGNDGKPAY  234

Query  782   NQDAHRNELVRWVQNaggaatafdfttKGILQAALNNTELWRLKDAAGKPSGMIGVLPQS  961
             +Q+ +R  LV WVQ  GG ATAFDFTTKGILQAA+   ELWR++D  GK  GM+G  P+ 
Sbjct  235   DQNGNRQGLVNWVQQVGGPATAFDFTTKGILQAAVEG-ELWRMRDPQGKAPGMMGWWPEK  293

Query  962   AVTFIDNHDTWS-QRLWPFTTSTDDAVNHDRVLQGYAYILTHPGIPSVFYDHFFEWGLKD  1138
             AVTF+DNHDT S QRLWPF +        D+V+QGYAYILTHPG+PS+FYDH F+WGLK+
Sbjct  294   AVTFVDNHDTGSTQRLWPFPS--------DKVMQGYAYILTHPGVPSIFYDHMFDWGLKE  345

Query  1139  AISKLISIRNKNGVSATSPVEILAADADLYIAKINGKVILKIGPNGDLKNLVPSDFMLAT  1318
              I++L   R +NG+ + S + ILA+DADLY+A I+GK++ K+G   D+ NLVPS+F + +
Sbjct  346   KITRLAKTRTRNGIHSGSALNILASDADLYMAMIDGKILTKLGSRYDVGNLVPSNFHVGS  405

Query  1319  SGKDFAVWEK  1348
             SG D+ VWEK
Sbjct  406   SGNDYCVWEK  415



>emb|CAX51374.1| alpha-amylase [Hordeum vulgare subsp. vulgare]
 dbj|BAK03603.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=427

 Score =   467 bits (1202),  Expect = 3e-157, Method: Compositional matrix adjust.
 Identities = 240/420 (57%), Positives = 305/420 (73%), Gaps = 19/420 (5%)
 Frame = +2

Query  101   SSSTVLFQGFTWTSKDQPGGWWNWLITKVPDLADAGITHVWLPPPSNAREGDDQGYMPKR  280
             +S  VLFQGF W S    GGW+N+L+ KV D+A AGITHVWLPP S +    +QGYMP R
Sbjct  22    ASGQVLFQGFNWESWKHNGGWYNFLMGKVDDIAAAGITHVWLPPASQSVA--EQGYMPGR  79

Query  281   MYDLDTSKYGNKKELKALNDAFHGRGIKSVADIVLNHRAAERANSRGVFNVFEGGTPDDK  460
             +YDLD SKYGNK +LK+L  A HG+G+K++ADIV+NHR AE  + RG++ +FEGGTPD +
Sbjct  80    LYDLDASKYGNKAQLKSLIGALHGKGVKAIADIVINHRTAEHKDGRGIYCIFEGGTPDAR  139

Query  461   LDWGPSEICGDDAAF-EGTGNPDTGDPWGDAPDIDHRSPRVQREISEWMNWLKSDVGFDG  637
             LDWGP  IC DD  + +GTGNPDTG  +G APDIDH + RVQ+E+ EW+NWLK+D+GFDG
Sbjct  140   LDWGPHMICRDDRPYADGTGNPDTGADFGAAPDIDHLNLRVQKELVEWLNWLKADIGFDG  199

Query  638   WRFDYVKGYDFVKGFAAVKIYMDNTKPEFAVGELWNALSPGSVPNPDYNQDAHRNELVRW  817
             WRFD+ KGY         KIY+D ++P FAV E+W +L+ G    P+ NQD HR ELV W
Sbjct  200   WRFDFAKGYSA----DVAKIYIDRSEPSFAVAEIWTSLAYGGDGKPNLNQDQHRQELVNW  255

Query  818   VQNagga--atafdfttKGILQAALNNTELWRLKDAAGKPSGMIGVLPQSAVTFIDNHDT  991
             V   GG   AT FDFTTKGIL  A+   ELWRL+   GK  GMIG  P  AVTF+DNHDT
Sbjct  256   VDKVGGKGPATTFDFTTKGILNVAVEG-ELWRLRGTDGKAPGMIGWWPAKAVTFVDNHDT  314

Query  992   WS-QRLWPFTTSTDDAVNHDRVLQGYAYILTHPGIPSVFYDHFFEWGLKDAISKLISIRN  1168
              S Q +WPF +        DRV+QGYAYILTHPG P +FYDHFF+WGLK+ I +L+S+R 
Sbjct  315   GSTQHMWPFPS--------DRVMQGYAYILTHPGTPCIFYDHFFDWGLKEEIDRLVSVRT  366

Query  1169  KNGVSATSPVEILAADADLYIAKINGKVILKIGPNGDLKNLVPSDFMLATSGKDFAVWEK  1348
             ++G+ + S ++I+ ADADLY+A+I+GKVI+K+GP  D+ NL+P  F +A  G D+AVWEK
Sbjct  367   RHGIHSESKLQIIEADADLYLAEIDGKVIVKLGPRYDVGNLIPGGFKVAAHGNDYAVWEK  426



>dbj|BAE47517.2| alpha-amylase [Hyacinthus orientalis]
Length=419

 Score =   466 bits (1200),  Expect = 5e-157, Method: Compositional matrix adjust.
 Identities = 241/433 (56%), Positives = 314/433 (73%), Gaps = 28/433 (6%)
 Frame = +2

Query  62    SLFCIAFFLFPLHSSSTVLFQGFTWTSKDQPGGWWNWLITKVPDLADAGITHVWLPPPSN  241
             +L  I+ FL P ++S  +LFQGF W S  + GGW+N+L TKV D++ +G THVWLPPPS+
Sbjct  11    ALLLISSFLLPSYTSGQILFQGFNWESWKKDGGWYNFLKTKVDDISSSGATHVWLPPPSH  70

Query  242   AREGDDQGYMPKRMYDLDTSKYGNKKELKALNDAFHGRGIKSVADIVLNHRAAERANSRG  421
             +     QGY+P R+YDL  SKYGN+ ELK+L  AFH + IK VADIV+NHR AE  + RG
Sbjct  71    SV--GQQGYLPGRLYDLSASKYGNQDELKSLIQAFHDKSIKCVADIVINHRTAETKDGRG  128

Query  422   VFNVFEGGTPDDKLDWGPSEICGDDAAF-EGTGNPDTGDPWGDAPDIDHRSPRVQREISE  598
             ++ +FEGGTPDD+LDWGP+ IC DDA + +GTGNPDTG  +G APDIDH +PRVQ+E+++
Sbjct  129   IYCIFEGGTPDDRLDWGPTMICRDDAEYSDGTGNPDTGAGYGAAPDIDHTNPRVQKELTD  188

Query  599   WMNWLKSDVGFDGWRFDYVKGY--DFVKGFAAVKIYMDNTKPEFAVGELWNALSPGSVPN  772
             W+NWLK+++GFDGWR D+ KGY  D  KG      Y+    P F V E+W+ L+ G    
Sbjct  189   WLNWLKTEIGFDGWRLDFAKGYSADVAKG------YVSRGAPGFVVAEIWSDLTSG----  238

Query  773   PDYNQDAHRNELVRWVQNaggaatafdfttKGILQAALNNTELWRLKDAAGKPSGMIGVL  952
                N+DAHR EL RW Q  GG A AFDFTTKGILQ A+   +L R++D+ GK  G+IG+ 
Sbjct  239   ---NEDAHRQELARWAQTVGGPAKAFDFTTKGILQQAVQG-QLGRMRDSNGKAPGLIGLA  294

Query  953   PQSAVTFIDNHDTWS-QRLWPFTTSTDDAVNHDRVLQGYAYILTHPGIPSVFYDHFFEWG  1129
             P  AVTF+DNHDT S Q +WPF +        D+V+QGYAYILTHPGIPSVFYDH F+W 
Sbjct  295   PGLAVTFVDNHDTGSTQNMWPFPS--------DKVMQGYAYILTHPGIPSVFYDHLFDWN  346

Query  1130  LKDAISKLISIRNKNGVSATSPVEILAADADLYIAKINGKVILKIGPNGDLKNLVPSDFM  1309
             L + ISKL +IR+KNG+  TS + I+A+D D+Y+A ++ KVI+KIGP  D+ NLVP+++ 
Sbjct  347   LIEEISKLAAIRSKNGLQPTSGLRIIASDNDIYVAVVDEKVIVKIGPKVDVWNLVPTEYK  406

Query  1310  LATSGKDFAVWEK  1348
             L  SGKD+AVWEK
Sbjct  407   LVASGKDYAVWEK  419



>ref|XP_006647962.1| PREDICTED: alpha-amylase-like [Oryza brachyantha]
Length=427

 Score =   466 bits (1200),  Expect = 6e-157, Method: Compositional matrix adjust.
 Identities = 239/441 (54%), Positives = 309/441 (70%), Gaps = 20/441 (5%)
 Frame = +2

Query  41    MKSSFYLSLFCIAFF-LFPLHSSSTVLFQGFTWTSKDQPGGWWNWLITKVPDLADAGITH  217
             M S  +LSLF + F  L    +   VL QGF W S  + GGW+N L+ KV D+A AG+TH
Sbjct  1     MASRQFLSLFVVVFLGLSSSLALGQVLMQGFNWESWRENGGWYNLLMGKVDDIAAAGVTH  60

Query  218   VWLPPPSNAREGDDQGYMPKRMYDLDTSKYGNKKELKALNDAFHGRGIKSVADIVLNHRA  397
             VWLPPPS++    +QGYMP R+YDLD SKYGN+ +LK+L +AFHG+G+K +ADIV+NHR 
Sbjct  61    VWLPPPSHSVA--EQGYMPGRLYDLDASKYGNEAQLKSLIEAFHGKGVKVIADIVINHRT  118

Query  398   AERANSRGVFNVFEGGTPDDKLDWGPSEICGDDAAFEGTGNPDTGDPWGDAPDIDHRSPR  577
             AER + RG++ +FEGGTPD +LDWGP  IC DD   +GTGNPDTG  +  APDIDH + R
Sbjct  119   AERKDGRGIYCLFEGGTPDSRLDWGPHMICRDDPYSDGTGNPDTGADFAAAPDIDHLNKR  178

Query  578   VQREISEWMNWLKSDVGFDGWRFDYVKGYDFVKGFAAVKIYMDNTKPEFAVGELWNALSP  757
             VQRE+  W++WLK D+GFD WR D+ KGY         KIY+DNT+P FAV E+W +L+ 
Sbjct  179   VQRELIGWLDWLKMDIGFDAWRLDFAKGYS----ADVAKIYIDNTEPSFAVAEIWTSLAY  234

Query  758   GSVPNPDYNQDAHRNELVRWVQNaggaatafdf---ttKGILQAALNNTELWRLKDAAGK  928
             G    PDY+Q++HR ELV WV   GGA++       TTKGIL  A+   ELWRL+ A GK
Sbjct  235   GGDGKPDYDQNSHRQELVNWVDRVGGASSNATAFDFTTKGILNVAVEG-ELWRLRAADGK  293

Query  929   PSGMIGVLPQSAVTFIDNHDTWS-QRLWPFTTSTDDAVNHDRVLQGYAYILTHPGIPSVF  1105
               GMIG  P  AVTF+DNHDT S Q +WPF +        D+V+QG AYILTHPG P +F
Sbjct  294   APGMIGWWPAKAVTFVDNHDTGSTQHMWPFPS--------DKVMQGSAYILTHPGHPCIF  345

Query  1106  YDHFFEWGLKDAISKLISIRNKNGVSATSPVEILAADADLYIAKINGKVILKIGPNGDLK  1285
             YDHFF+WG K+ I +L+SIR++NG+ A S + I+ ADADLY+A+I+GKVI+KIG   D++
Sbjct  346   YDHFFDWGHKEEIERLVSIRDQNGIHAESELHIMEADADLYLAEIDGKVIVKIGSRYDVE  405

Query  1286  NLVPSDFMLATSGKDFAVWEK  1348
             +L+P  F +   G  +AVWEK
Sbjct  406   HLIPEGFQVVAHGDGYAVWEK  426



>sp|P04063.3|AMY2_HORVU RecName: Full=Alpha-amylase type B isozyme; AltName: Full=1,4-alpha-D-glucan 
glucanohydrolase; AltName: Full=AMY2-2; AltName: 
Full=High pI alpha-amylase; Flags: Precursor [Hordeum vulgare]
 gb|AAA98790.1| alpha-amylase type B isozyme precursor [Hordeum vulgare subsp. 
vulgare]
Length=427

 Score =   466 bits (1199),  Expect = 7e-157, Method: Compositional matrix adjust.
 Identities = 240/420 (57%), Positives = 304/420 (72%), Gaps = 19/420 (5%)
 Frame = +2

Query  101   SSSTVLFQGFTWTSKDQPGGWWNWLITKVPDLADAGITHVWLPPPSNAREGDDQGYMPKR  280
             +S  VLFQGF W S    GGW+N+L+ KV D+A AGITHVWLPP S +    +QGYMP R
Sbjct  22    ASGQVLFQGFNWESWKHNGGWYNFLMGKVDDIAAAGITHVWLPPASQSVA--EQGYMPGR  79

Query  281   MYDLDTSKYGNKKELKALNDAFHGRGIKSVADIVLNHRAAERANSRGVFNVFEGGTPDDK  460
             +YDLD SKYGNK +LK+L  A HG+G+K++ADIV+NHR AE  + RG++ +FEGGTPD +
Sbjct  80    LYDLDASKYGNKAQLKSLIGALHGKGVKAIADIVINHRTAEHKDGRGIYCIFEGGTPDAR  139

Query  461   LDWGPSEICGDDAAF-EGTGNPDTGDPWGDAPDIDHRSPRVQREISEWMNWLKSDVGFDG  637
             LDWGP  IC DD  + +GTGNPDTG  +G APDIDH + RVQ+E+ EW+NWLK+D+GFDG
Sbjct  140   LDWGPHMICRDDRPYADGTGNPDTGADFGAAPDIDHLNLRVQKELVEWLNWLKADIGFDG  199

Query  638   WRFDYVKGYDFVKGFAAVKIYMDNTKPEFAVGELWNALSPGSVPNPDYNQDAHRNELVRW  817
             WRFD+ KGY         KIY+D ++P FAV E+W +L+ G    P+ NQD HR ELV W
Sbjct  200   WRFDFAKGYSA----DVAKIYIDRSEPSFAVAEIWTSLAYGGDGKPNLNQDQHRQELVNW  255

Query  818   VQNagga--atafdfttKGILQAALNNTELWRLKDAAGKPSGMIGVLPQSAVTFIDNHDT  991
             V   GG   AT FDFTTKGIL  A+   ELWRL+   GK  GMIG  P  AVTF+DNHDT
Sbjct  256   VDKVGGKGPATTFDFTTKGILNVAVEG-ELWRLRGTDGKAPGMIGWWPAKAVTFVDNHDT  314

Query  992   WS-QRLWPFTTSTDDAVNHDRVLQGYAYILTHPGIPSVFYDHFFEWGLKDAISKLISIRN  1168
              S Q +WPF +        DRV+QGYAYILTHPG P +FYDHFF+WGLK+ I +L+S+R 
Sbjct  315   GSTQHMWPFPS--------DRVMQGYAYILTHPGTPCIFYDHFFDWGLKEEIDRLVSVRT  366

Query  1169  KNGVSATSPVEILAADADLYIAKINGKVILKIGPNGDLKNLVPSDFMLATSGKDFAVWEK  1348
             ++G+   S ++I+ ADADLY+A+I+GKVI+K+GP  D+ NL+P  F +A  G D+AVWEK
Sbjct  367   RHGIHNESKLQIIEADADLYLAEIDGKVIVKLGPRYDVGNLIPGGFKVAAHGNDYAVWEK  426



>ref|XP_006659494.1| PREDICTED: alpha-amylase isozyme 3D-like [Oryza brachyantha]
Length=439

 Score =   466 bits (1199),  Expect = 1e-156, Method: Compositional matrix adjust.
 Identities = 238/418 (57%), Positives = 299/418 (72%), Gaps = 17/418 (4%)
 Frame = +2

Query  101   SSSTVLFQGFTWTSKDQPGGWWNWLITKVPDLADAGITHVWLPPPSNAREGDDQGYMPKR  280
             +   VLFQGF W S  Q GGW+N L  +V D+A+AG+THVWLPPPS++     QGYMP R
Sbjct  26    AQGQVLFQGFNWESWKQQGGWYNTLKGQVDDIANAGVTHVWLPPPSHSVS--PQGYMPGR  83

Query  281   MYDLDTSKYGNKKELKALNDAFHGRGIKSVADIVLNHRAAERANSRGVFNVFEGGTPDDK  460
             +YDLD S+YG   EL++L  AF GRGI+ VAD+V+NHR AE+ ++RGV+ VFEGGTPDD+
Sbjct  84    LYDLDASRYGTAAELRSLIAAFRGRGIQCVADVVINHRCAEKKDARGVYCVFEGGTPDDR  143

Query  461   LDWGPSEICGDDAAF-EGTGNPDTGDPWGDAPDIDHRSPRVQREISEWMNWLKSDVGFDG  637
             LDWGPS IC DD  + +GTG+ DTG+ +  APD+DH +PRVQRE+++W++WLKSDVGFDG
Sbjct  144   LDWGPSMICSDDTEYSDGTGHRDTGEGFAAAPDVDHLNPRVQRELTDWLDWLKSDVGFDG  203

Query  638   WRFDYVKGYDFVKGFAAVKIYMDNTKPEFAVGELWNALSPGSVPNPDYNQDAHRNELVRW  817
             WR D+ KGY      A  K Y++N KP F V E+WN+LS      P  NQD  R ELV W
Sbjct  204   WRLDFAKGYST----AITKTYVENCKPSFVVAEIWNSLSYNGDGKPSTNQDQGRQELVNW  259

Query  818   VQNaggaatafdfttKGILQAALNNTELWRLKDAAGKPSGMIGVLPQSAVTFIDNHDTWS  997
             V   GG A  FDFTTKG+LQA +   ELWRL+D  GK +GMIG LP+ AVTF+DNHDT S
Sbjct  260   VNAVGGPAMTFDFTTKGLLQAGVQG-ELWRLRDGNGKAAGMIGWLPEKAVTFVDNHDTGS  318

Query  998   -QRLWPFTTSTDDAVNHDRVLQGYAYILTHPGIPSVFYDHFFEWGLKDAISKLISIRNKN  1174
              Q+LWPF          D+V+QGYAYILTHPG+P +FYDH F+W LK  I  L +IR +N
Sbjct  319   TQKLWPFPA--------DKVMQGYAYILTHPGVPCIFYDHMFDWNLKQEIIALATIRERN  370

Query  1175  GVSATSPVEILAADADLYIAKINGKVILKIGPNGDLKNLVPSDFMLATSGKDFAVWEK  1348
             G+ A S + IL ADAD Y+A ++ KV++KIGP  D+ N+VPSDF     GKD+ VWEK
Sbjct  371   GIHAGSKLRILVADADAYVAVVDEKVMVKIGPRYDVGNVVPSDFHPTVHGKDYCVWEK  428



>gb|AEO09337.4| alpha-amylase [Musa acuminata AAA Group]
Length=416

 Score =   465 bits (1197),  Expect = 1e-156, Method: Compositional matrix adjust.
 Identities = 238/430 (55%), Positives = 317/430 (74%), Gaps = 17/430 (4%)
 Frame = +2

Query  65    LFCIAFFLFPLHSSSTVLFQGFTWTSKDQPGGWWNWLITKVPDLADAGITHVWLPPPSNA  244
             +F +   + P  + S +LFQGF W S  Q GGW+N+L  KV D+A+AG+THVWLPPPS++
Sbjct  1     MFLLLLLVVPNLAQSQILFQGFNWESWRQQGGWYNFLKDKVSDIANAGVTHVWLPPPSHS  60

Query  245   REGDDQGYMPKRMYDLDTSKYGNKKELKALNDAFHGRGIKSVADIVLNHRAAERANSRGV  424
                  QGYMP R+YDL  SKYGN+ ELKAL  AFH +G+K VADIV+NHR A++ + RG+
Sbjct  61    V--GVQGYMPGRLYDLGASKYGNQDELKALIGAFHDKGVKCVADIVINHRCADKQDGRGI  118

Query  425   FNVFEGGTPDDKLDWGPSEICGDDAAF-EGTGNPDTGDPWGDAPDIDHRSPRVQREISEW  601
             + +FEGGT D +LDWGP  IC DD  + +GTGN DTG+ +  APDIDH + +VQRE+++W
Sbjct  119   WCIFEGGTDDARLDWGPHMICRDDTQYSDGTGNLDTGEGFAAAPDIDHLNTQVQRELTDW  178

Query  602   MNWLKSDVGFDGWRFDYVKGYDFVKGFAAVKIYMDNTKPEFAVGELWNALSPGSVPNPDY  781
             +NWLK+D+GFDGWR D+ KGY      +  KIY++ T+P F V E+W++L+ G+   P Y
Sbjct  179   LNWLKTDIGFDGWRLDFAKGYSS----SIAKIYVEQTQPNFVVAEIWSSLAYGNDGKPAY  234

Query  782   NQDAHRNELVRWVQNaggaatafdfttKGILQAALNNTELWRLKDAAGKPSGMIGVLPQS  961
             +Q+ +R ELV WVQ  GG ATAFDFTTKGILQAA+   ELWR++D+ GK  GM+G  P+ 
Sbjct  235   DQNGNRQELVNWVQQVGGPATAFDFTTKGILQAAVEG-ELWRMRDSQGKAPGMMGWWPEK  293

Query  962   AVTFIDNHDTWS-QRLWPFTTSTDDAVNHDRVLQGYAYILTHPGIPSVFYDHFFEWGLKD  1138
             AVTF+DNHDT S QRLWPF +        D+V+QGYAYILTHPG+PS+FYDH F+WGLK+
Sbjct  294   AVTFVDNHDTGSTQRLWPFPS--------DKVMQGYAYILTHPGVPSIFYDHMFDWGLKE  345

Query  1139  AISKLISIRNKNGVSATSPVEILAADADLYIAKINGKVILKIGPNGDLKNLVPSDFMLAT  1318
             AI++L   R +NG+ + S + ILA+DADLY+A I+GK++ K+G   D+ NLVPS+F +  
Sbjct  346   AITQLAETRTRNGIHSGSALNILASDADLYMAMIDGKILTKLGSRYDVGNLVPSNFHVVA  405

Query  1319  SGKDFAVWEK  1348
             SG D+ VWEK
Sbjct  406   SGNDYCVWEK  415



>gb|ADP88919.1| alpha-amylase [Gunnera manicata]
Length=422

 Score =   464 bits (1195),  Expect = 2e-156, Method: Compositional matrix adjust.
 Identities = 242/438 (55%), Positives = 309/438 (71%), Gaps = 22/438 (5%)
 Frame = +2

Query  41    MKSSFYLSLFCIAFFLFPLHSSSTVLFQGFTWTSKDQPGGWWNWLITKVPDLADAGITHV  220
             M  + +L   C+     P      +LFQGF W S  + GGW+N L   +P+LA AGITHV
Sbjct  4     MNYAAFLYFLCVV----PSLGDPVLLFQGFNWESWKKEGGWYNSLAAFIPELAKAGITHV  59

Query  221   WLPPPSNAREGDDQGYMPKRMYDLDTSKYGNKKELKALNDAFHGRGIKSVADIVLNHRAA  400
             WLPPPS++     QGY+P R+YD++ S YGN+ ELK+L + FH  GI  +ADIV+NHR A
Sbjct  60    WLPPPSHSVS--SQGYLPGRLYDINASSYGNQAELKSLINGFHRHGITCLADIVINHRCA  117

Query  401   ERANSRGVFNVFEGGTPDDKLDWGPSEICGDDAAFE-GTGNPDTGDPWGDAPDIDHRSPR  577
             E+ + RG++ +FEGGTPDD+LDWGPS IC DD  +  G GNPDTG P+  APDIDH +PR
Sbjct  118   EKQDERGIWCIFEGGTPDDRLDWGPSLICSDDTEYSNGKGNPDTGAPYQPAPDIDHINPR  177

Query  578   VQREISEWMNWLKSDVGFDGWRFDYVKGYDFVKGFAAVKIYMDNTKPEFAVGELWNALSP  757
             VQ E+S+WMNWLK+++GFDGWRFD+ KGY         ++Y+  T   FAVGE+WN+LS 
Sbjct  178   VQNELSDWMNWLKTEIGFDGWRFDFAKGY----APRFTQLYVGKTSANFAVGEIWNSLSY  233

Query  758   GSVPNPDYNQDAHRNELVRWVQNaggaatafdfttKGILQAALNNTELWRLKDAAGKPSG  937
             G+   P YNQD HRNEL R       A TAFDFTTKGILQAA+   ELWRLKD+ GKP G
Sbjct  234   GNDGKPGYNQDVHRNEL-RICCGDWWAVTAFDFTTKGILQAAVEG-ELWRLKDSNGKPPG  291

Query  938   MIGVLPQSAVTFIDNHDTWS-QRLWPFTTSTDDAVNHDRVLQGYAYILTHPGIPSVFYDH  1114
             +IG+LP   VTFIDNHDT S Q  WPF +        D+V+QGY YILTHPGIPS+FYDH
Sbjct  292   LIGILPGKGVTFIDNHDTGSTQNHWPFPS--------DKVMQGYCYILTHPGIPSLFYDH  343

Query  1115  FFEWGLKDAISKLISIRNKNGVSATSPVEILAADADLYIAKINGKVILKIGPNGDLKNLV  1294
             F  WGLK+ I +L++IR +NG+  TS V ILA+D+ LY+A I+GK+I+KIGP  ++  L+
Sbjct  344   FVGWGLKEQIVELVAIRKRNGIVPTSTVRILASDSGLYVAMIDGKIIMKIGPRYEVGILI  403

Query  1295  PSDFMLATSGKDFAVWEK  1348
             P +F +ATSG ++ VWEK
Sbjct  404   PPNFRVATSGNNYCVWEK  421



>sp|P27933.2|AMY3D_ORYSJ RecName: Full=Alpha-amylase isozyme 3D; AltName: Full=1,4-alpha-D-glucan 
glucanohydrolase; Flags: Precursor [Oryza sativa 
Japonica Group]
 dbj|BAD09375.1| alpha-amylase isozyme 3D precursor [Oryza sativa Japonica Group]
 dbj|BAD09335.1| alpha-amylase isozyme 3D precursor [Oryza sativa Japonica Group]
 gb|EAZ43060.1| hypothetical protein OsJ_27649 [Oryza sativa Japonica Group]
 gb|ACA50524.1| alpha amylase isozyme 3D [Oryza sativa Japonica Group]
Length=436

 Score =   465 bits (1196),  Expect = 3e-156, Method: Compositional matrix adjust.
 Identities = 237/417 (57%), Positives = 301/417 (72%), Gaps = 17/417 (4%)
 Frame = +2

Query  104   SSTVLFQGFTWTSKDQPGGWWNWLITKVPDLADAGITHVWLPPPSNAREGDDQGYMPKRM  283
              + VLFQGF W S  Q GGW+N L  +V D+A AG+THVWLPPPS++     QGYMP R+
Sbjct  24    QAQVLFQGFNWESWKQQGGWYNMLKGQVDDIAKAGVTHVWLPPPSHSVA--PQGYMPGRL  81

Query  284   YDLDTSKYGNKKELKALNDAFHGRGIKSVADIVLNHRAAERANSRGVFNVFEGGTPDDKL  463
             YDLD SKYG   ELK+L  AFHG+G++ VAD+V+NHR AE+ ++RGV+ VFEGGTPDD+L
Sbjct  82    YDLDASKYGTAAELKSLIAAFHGKGVQCVADVVINHRCAEKKDARGVYCVFEGGTPDDRL  141

Query  464   DWGPSEICGDDAAF-EGTGNPDTGDPWGDAPDIDHRSPRVQREISEWMNWLKSDVGFDGW  640
             DWGP  IC DD  + +GTG+ DTG+ +G APDIDH +PRVQRE+++W+NWLKSDVGFDGW
Sbjct  142   DWGPGMICSDDTQYSDGTGHRDTGEGFGAAPDIDHLNPRVQRELTDWLNWLKSDVGFDGW  201

Query  641   RFDYVKGYDFVKGFAAVKIYMDNTKPEFAVGELWNALSPGSVPNPDYNQDAHRNELVRWV  820
             R D+ KGY         K+Y+++ KP F V E+WN+LS      P  NQD  R ELV WV
Sbjct  202   RLDFAKGYST----DIAKMYVESCKPGFVVAEIWNSLSYNGDGKPAANQDQGRQELVNWV  257

Query  821   QNaggaatafdfttKGILQAALNNTELWRLKDAAGKPSGMIGVLPQSAVTFIDNHDTWS-  997
                GG A  FDFTTKG+LQA +   ELWRL+D  GK +GMIG LP+ AVTF+DNHDT S 
Sbjct  258   NAVGGPAMTFDFTTKGLLQAGVQG-ELWRLRDGNGKAAGMIGWLPEKAVTFVDNHDTGST  316

Query  998   QRLWPFTTSTDDAVNHDRVLQGYAYILTHPGIPSVFYDHFFEWGLKDAISKLISIRNKNG  1177
             Q+LWPF +        D+V+QGYAYILTHPG+P +FYDH F+W LK  I+ L +IR +NG
Sbjct  317   QKLWPFPS--------DKVMQGYAYILTHPGVPCIFYDHMFDWNLKQEITALAAIRERNG  368

Query  1178  VSATSPVEILAADADLYIAKINGKVILKIGPNGDLKNLVPSDFMLATSGKDFAVWEK  1348
             ++A S + I+ ADAD Y+A ++ KV++KIG   D+ N VPSDF     GKD++VWEK
Sbjct  369   INAGSKLRIVVADADAYVAVVDEKVMVKIGTRYDVGNAVPSDFHQTVHGKDYSVWEK  425



>ref|XP_009410104.1| PREDICTED: alpha-amylase isozyme 3D-like [Musa acuminata subsp. 
malaccensis]
Length=422

 Score =   464 bits (1194),  Expect = 3e-156, Method: Compositional matrix adjust.
 Identities = 236/432 (55%), Positives = 312/432 (72%), Gaps = 17/432 (4%)
 Frame = +2

Query  59    LSLFCIAFFLFPLHSSSTVLFQGFTWTSKDQPGGWWNWLITKVPDLADAGITHVWLPPPS  238
             L  F     L    + S +LFQGF W S  + GGW+N+L ++VPD+A AG+THVWLPPPS
Sbjct  5     LLAFVFLVVLSLTTAQSQILFQGFNWESWRKQGGWYNFLRSQVPDIARAGVTHVWLPPPS  64

Query  239   NAREGDDQGYMPKRMYDLDTSKYGNKKELKALNDAFHGRGIKSVADIVLNHRAAERANSR  418
             ++    +QGYMP R+YDL+ SKYG + ELK+L  AFH +GIK VADIV+NHR AER ++R
Sbjct  65    HSVS--EQGYMPGRLYDLNASKYGTRDELKSLIAAFHDKGIKCVADIVINHRCAERKDAR  122

Query  419   GVFNVFEGGTPDDKLDWGPSEICGDDAAF-EGTGNPDTGDPWGDAPDIDHRSPRVQREIS  595
             G++ +FEGGT D +LDWGP  IC DD  + +GTGN DTG  +G APDIDH + +VQ+E++
Sbjct  123   GIYCIFEGGTSDSRLDWGPHMICSDDTQYSDGTGNRDTGGDFGAAPDIDHLNQQVQQELT  182

Query  596   EWMNWLKSDVGFDGWRFDYVKGYDFVKGFAAVKIYMDNTKPEFAVGELWNALSPGSVPNP  775
             +W+NWL++D+GFDGWR D+ +GY      +  KIY+ +T P+F V ELW++L+ G    P
Sbjct  183   DWLNWLRTDIGFDGWRLDFARGYSP----SIAKIYVSHTSPDFVVAELWSSLTYGGDGKP  238

Query  776   DYNQDAHRNELVRWVQNaggaatafdfttKGILQAALNNTELWRLKDAAGKPSGMIGVLP  955
              Y+QD  R ELV WV + GG A AFDFTTKG+LQAA+   ELWRL+D  GK SGMIG  P
Sbjct  239   AYDQDGSRQELVNWVHDVGGPAAAFDFTTKGVLQAAVQG-ELWRLRDPQGKASGMIGWWP  297

Query  956   QSAVTFIDNHDTWS-QRLWPFTTSTDDAVNHDRVLQGYAYILTHPGIPSVFYDHFFEWGL  1132
             + AVTF+DNHDT S Q+LWPF +        D+V+QGYAYILTHPG+P++FYDH F+WGL
Sbjct  298   EKAVTFVDNHDTGSTQKLWPFPS--------DKVMQGYAYILTHPGVPTIFYDHLFDWGL  349

Query  1133  KDAISKLISIRNKNGVSATSPVEILAADADLYIAKINGKVILKIGPNGDLKNLVPSDFML  1312
             KD I+ L +IR +NG+   S + IL ADADLY+A I+ KV++KIG   D+ NLVP++F +
Sbjct  350   KDEITGLAAIRTRNGILPGSTLRILVADADLYLAVIDEKVMVKIGQRYDVGNLVPANFHV  409

Query  1313  ATSGKDFAVWEK  1348
               SG  + +WEK
Sbjct  410   VASGNGYCIWEK  421



>pdb|1AVA|A Chain A, Amy2BASI PROTEIN-Protein Complex From Barley Seed
 pdb|1AVA|B Chain B, Amy2BASI PROTEIN-Protein Complex From Barley Seed
 pdb|1AMY|A Chain A, Crystal And Molecular Structure Of Barley Alpha-Amylase
 pdb|1BG9|A Chain A, Barley Alpha-Amylase With Substrate Analogue Acarbose
Length=403

 Score =   463 bits (1192),  Expect = 4e-156, Method: Compositional matrix adjust.
 Identities = 239/416 (57%), Positives = 302/416 (73%), Gaps = 19/416 (5%)
 Frame = +2

Query  113   VLFQGFTWTSKDQPGGWWNWLITKVPDLADAGITHVWLPPPSNAREGDDQGYMPKRMYDL  292
             VLFQGF W S    GGW+N+L+ KV D+A AGITHVWLPP S +    +QGYMP R+YDL
Sbjct  2     VLFQGFNWESWKHNGGWYNFLMGKVDDIAAAGITHVWLPPASQSVA--EQGYMPGRLYDL  59

Query  293   DTSKYGNKKELKALNDAFHGRGIKSVADIVLNHRAAERANSRGVFNVFEGGTPDDKLDWG  472
             D SKYGNK +LK+L  A HG+G+K++ADIV+NHR AE  + RG++ +FEGGTPD +LDWG
Sbjct  60    DASKYGNKAQLKSLIGALHGKGVKAIADIVINHRTAEHKDGRGIYCIFEGGTPDARLDWG  119

Query  473   PSEICGDDAAF-EGTGNPDTGDPWGDAPDIDHRSPRVQREISEWMNWLKSDVGFDGWRFD  649
             P  IC DD  + +GTGNPDTG  +G APDIDH + RVQ+E+ EW+NWLK+D+GFDGWRFD
Sbjct  120   PHMICRDDRPYADGTGNPDTGADFGAAPDIDHLNLRVQKELVEWLNWLKADIGFDGWRFD  179

Query  650   YVKGYDFVKGFAAVKIYMDNTKPEFAVGELWNALSPGSVPNPDYNQDAHRNELVRWVQNa  829
             + KGY         KIY+D ++P FAV E+W +L+ G    P+ NQD HR ELV WV   
Sbjct  180   FAKGYSA----DVAKIYIDRSEPSFAVAEIWTSLAYGGDGKPNLNQDQHRQELVNWVDKV  235

Query  830   gga--atafdfttKGILQAALNNTELWRLKDAAGKPSGMIGVLPQSAVTFIDNHDTWS-Q  1000
             GG   AT FDFTTKGIL  A+   ELWRL+   GK  GMIG  P  AVTF+DNHDT S Q
Sbjct  236   GGKGPATTFDFTTKGILNVAVEG-ELWRLRGTDGKAPGMIGWWPAKAVTFVDNHDTGSTQ  294

Query  1001  RLWPFTTSTDDAVNHDRVLQGYAYILTHPGIPSVFYDHFFEWGLKDAISKLISIRNKNGV  1180
              +WPF +        DRV+QGYAYILTHPG P +FYDHFF+WGLK+ I +L+S+R ++G+
Sbjct  295   HMWPFPS--------DRVMQGYAYILTHPGTPCIFYDHFFDWGLKEEIDRLVSVRTRHGI  346

Query  1181  SATSPVEILAADADLYIAKINGKVILKIGPNGDLKNLVPSDFMLATSGKDFAVWEK  1348
                S ++I+ ADADLY+A+I+GKVI+K+GP  D+ NL+P  F +A  G D+AVWEK
Sbjct  347   HNESKLQIIEADADLYLAEIDGKVIVKLGPRYDVGNLIPGGFKVAAHGNDYAVWEK  402



>ref|XP_004973671.1| PREDICTED: alpha-amylase isozyme 3D-like [Setaria italica]
Length=432

 Score =   464 bits (1194),  Expect = 5e-156, Method: Compositional matrix adjust.
 Identities = 239/419 (57%), Positives = 300/419 (72%), Gaps = 17/419 (4%)
 Frame = +2

Query  104   SSTVLFQGFTWTSKDQPGGWWNWLITKVPDLADAGITHVWLPPPSNAREGDDQGYMPKRM  283
              + VLFQGF W S  + GGW+N L  KV D+A AG+THVWLPPPS++     QGYMP R+
Sbjct  20    QAQVLFQGFNWESCKKQGGWYNSLKAKVDDIAKAGVTHVWLPPPSHSVS--PQGYMPGRL  77

Query  284   YDLDTSKYGNKKELKALNDAFHGRGIKSVADIVLNHRAAERANSRGVFNVFEGGTPDDKL  463
             YDLD SKYG   ELK+L  AFH RGI+ VADIV+NHR A++ ++RGV+ +FEGGTPD++L
Sbjct  78    YDLDASKYGTAAELKSLIAAFHRRGIQCVADIVINHRCADKKDARGVYCIFEGGTPDERL  137

Query  464   DWGPSEICGDDAAF-EGTGNPDTGDPWGDAPDIDHRSPRVQREISEWMNWLKSDVGFDGW  640
             DWGP  IC DD  + +GTG+ DTG+ +  APDIDH + RVQRE+S W+NWLKSDVGFDGW
Sbjct  138   DWGPGMICSDDTQYSDGTGHRDTGEGFAAAPDIDHLNARVQRELSAWLNWLKSDVGFDGW  197

Query  641   RFDYVKGYDFVKGFAAVKIYMDNTKPEFAVGELWNALSPGSVPNPDYNQDAHRNELVRWV  820
             R D+ KGY      A  K+Y+ NT+P F V E+WN+LS      P  NQD  R ELV WV
Sbjct  198   RLDFAKGYSP----AIAKMYVKNTRPSFVVAEIWNSLSYNGDGKPSPNQDQRRQELVNWV  253

Query  821   QNaggaatafdfttKGILQAALNNTELWRLKDAAGKPSGMIGVLPQSAVTFIDNHDTWS-  997
             Q  G  A AFDFTTKG+LQA +   ELWRL+D++GK +G+IG  P+ AVTFIDNHDT S 
Sbjct  254   QAVGKPAMAFDFTTKGLLQAGVQG-ELWRLRDSSGKAAGLIGWTPEKAVTFIDNHDTGST  312

Query  998   QRLWPFTTSTDDAVNHDRVLQGYAYILTHPGIPSVFYDHFFEWGLKDAISKLISIRNKNG  1177
             Q+LWPF +        D+V+QGYAYILTHPG+P +FYDH F+W LK  IS L +IR +NG
Sbjct  313   QKLWPFPS--------DKVMQGYAYILTHPGVPCIFYDHMFDWNLKQEISTLTAIRARNG  364

Query  1178  VSATSPVEILAADADLYIAKINGKVILKIGPNGDLKNLVPSDFMLATSGKDFAVWEKPT  1354
             + A S + IL AD D Y+A ++ KV++KIG   D+ N++PSDF  A  GKD+ VWEK T
Sbjct  365   IHAGSKLRILLADDDAYVAVVDEKVMVKIGTRYDVGNVIPSDFHPAAHGKDYCVWEKGT  423



>ref|NP_001062024.1| Os08g0473900 [Oryza sativa Japonica Group]
 dbj|BAF23938.1| Os08g0473900 [Oryza sativa Japonica Group]
 dbj|BAG93480.1| unnamed protein product [Oryza sativa Japonica Group]
Length=476

 Score =   465 bits (1197),  Expect = 9e-156, Method: Compositional matrix adjust.
 Identities = 237/417 (57%), Positives = 301/417 (72%), Gaps = 17/417 (4%)
 Frame = +2

Query  104   SSTVLFQGFTWTSKDQPGGWWNWLITKVPDLADAGITHVWLPPPSNAREGDDQGYMPKRM  283
              + VLFQGF W S  Q GGW+N L  +V D+A AG+THVWLPPPS++     QGYMP R+
Sbjct  64    QAQVLFQGFNWESWKQQGGWYNMLKGQVDDIAKAGVTHVWLPPPSHSVA--PQGYMPGRL  121

Query  284   YDLDTSKYGNKKELKALNDAFHGRGIKSVADIVLNHRAAERANSRGVFNVFEGGTPDDKL  463
             YDLD SKYG   ELK+L  AFHG+G++ VAD+V+NHR AE+ ++RGV+ VFEGGTPDD+L
Sbjct  122   YDLDASKYGTAAELKSLIAAFHGKGVQCVADVVINHRCAEKKDARGVYCVFEGGTPDDRL  181

Query  464   DWGPSEICGDDAAF-EGTGNPDTGDPWGDAPDIDHRSPRVQREISEWMNWLKSDVGFDGW  640
             DWGP  IC DD  + +GTG+ DTG+ +G APDIDH +PRVQRE+++W+NWLKSDVGFDGW
Sbjct  182   DWGPGMICSDDTQYSDGTGHRDTGEGFGAAPDIDHLNPRVQRELTDWLNWLKSDVGFDGW  241

Query  641   RFDYVKGYDFVKGFAAVKIYMDNTKPEFAVGELWNALSPGSVPNPDYNQDAHRNELVRWV  820
             R D+ KGY         K+Y+++ KP F V E+WN+LS      P  NQD  R ELV WV
Sbjct  242   RLDFAKGYST----DIAKMYVESCKPGFVVAEIWNSLSYNGDGKPAANQDQGRQELVNWV  297

Query  821   QNaggaatafdfttKGILQAALNNTELWRLKDAAGKPSGMIGVLPQSAVTFIDNHDTWS-  997
                GG A  FDFTTKG+LQA +   ELWRL+D  GK +GMIG LP+ AVTF+DNHDT S 
Sbjct  298   NAVGGPAMTFDFTTKGLLQAGVQG-ELWRLRDGNGKAAGMIGWLPEKAVTFVDNHDTGST  356

Query  998   QRLWPFTTSTDDAVNHDRVLQGYAYILTHPGIPSVFYDHFFEWGLKDAISKLISIRNKNG  1177
             Q+LWPF +        D+V+QGYAYILTHPG+P +FYDH F+W LK  I+ L +IR +NG
Sbjct  357   QKLWPFPS--------DKVMQGYAYILTHPGVPCIFYDHMFDWNLKQEITALAAIRERNG  408

Query  1178  VSATSPVEILAADADLYIAKINGKVILKIGPNGDLKNLVPSDFMLATSGKDFAVWEK  1348
             ++A S + I+ ADAD Y+A ++ KV++KIG   D+ N VPSDF     GKD++VWEK
Sbjct  409   INAGSKLRIVVADADAYVAVVDEKVMVKIGTRYDVGNAVPSDFHQTVHGKDYSVWEK  465



>ref|XP_004294808.1| PREDICTED: alpha-amylase-like [Fragaria vesca subsp. vesca]
Length=410

 Score =   462 bits (1190),  Expect = 1e-155, Method: Compositional matrix adjust.
 Identities = 248/438 (57%), Positives = 314/438 (72%), Gaps = 35/438 (8%)
 Frame = +2

Query  47    SSFYLSLFCIAFFLF--PLHSSSTVLFQGFTWTSKDQPGGWWNWLITKVPDLADAGITHV  220
             +S  +S  CI   +   P  ++S +LFQGF W S  + GGW+N L     +LA +GITHV
Sbjct  2     NSLKISTLCILLSIISIPNFTASQILFQGFNWESA-RKGGWYNILEQSAAELASSGITHV  60

Query  221   WLPPPSNAREGDDQGYMPKRMYDLDTSKYGNKKELKALNDAFHGRGIKSVADIVLNHRAA  400
             WLPPPS +    D+GYMP R+YDL TSKYGN+ ELKAL  A+H +GI+S+ADIV+NHR A
Sbjct  61    WLPPPSQSVS--DEGYMPGRLYDL-TSKYGNQDELKALVKAYHDKGIQSIADIVINHRCA  117

Query  401   ERANSRGVFNVFEGGTPDDKLDWGPSEICGDDAAF-EGTGNPDTGDPWGDAPDIDHRSPR  577
             E+ + RG + +FEGGTPDD+LDWGPS IC DD  + +G GNPDTG P+  APDIDH++ R
Sbjct  118   EKQDERGKWCIFEGGTPDDRLDWGPSLICSDDTDYSDGKGNPDTGAPFVPAPDIDHKNTR  177

Query  578   VQREISEWMNWLKSDVGFDGWRFDYVKGYDFVKGFAAVKIYMDNTKPEFAVGELWNALSP  757
             VQ E+S+WMNWLK+++GF GWRFD+V GY         K+Y+ NTKP F+VGE WN+ + 
Sbjct  178   VQSELSDWMNWLKTEIGFSGWRFDFVMGY----APEFTKLYVANTKPSFSVGEYWNSTT-  232

Query  758   GSVPNPDYNQDAHRNELVRWVQNaggaatafdfttKGILQAALNNTELWRLKDAAGKPSG  937
                          R+EL  W+ NAGG  TAFDFTTKGILQAA+   ELWRLKD+ G P G
Sbjct  233   -------------RDELAGWIGNAGGEVTAFDFTTKGILQAAVQG-ELWRLKDSNGGPPG  278

Query  938   MIGVLPQSAVTFIDNHDTWS-QRLWPFTTSTDDAVNHDRVLQGYAYILTHPGIPSVFYDH  1114
             +IG+LP+++VTFIDNHDT S Q+ W F +        D+V+QGYAY LTHPG+PS+FYDH
Sbjct  279   LIGILPRNSVTFIDNHDTGSTQKKWEFPS--------DKVMQGYAYTLTHPGVPSIFYDH  330

Query  1115  FFEWGLKDAISKLISIRNKNGVSATSPVEILAADADLYIAKINGKVILKIGPNGDLKNLV  1294
             FF+WGLK  IS L +IR++NG+   S V ILAADADLY+A I+ K+I KIGP  D+ NLV
Sbjct  331   FFDWGLKGEISNLTAIRSRNGIKPDSAVSILAADADLYVASIDDKIITKIGPRFDVGNLV  390

Query  1295  PSDFMLATSGKDFAVWEK  1348
             PS F +ATSGKD+ VWEK
Sbjct  391   PSTFKIATSGKDYCVWEK  408



>gb|EMT32633.1| Alpha-amylase type B isozyme [Aegilops tauschii]
Length=427

 Score =   463 bits (1191),  Expect = 1e-155, Method: Compositional matrix adjust.
 Identities = 236/416 (57%), Positives = 300/416 (72%), Gaps = 19/416 (5%)
 Frame = +2

Query  113   VLFQGFTWTSKDQPGGWWNWLITKVPDLADAGITHVWLPPPSNAREGDDQGYMPKRMYDL  292
             VLFQGF W S    GGW+N+L+ KV D+A AG+THVWLPP S +     QGYMP R+YDL
Sbjct  26    VLFQGFNWESWKHNGGWYNFLMGKVDDIAAAGVTHVWLPPASQSVS--KQGYMPGRLYDL  83

Query  293   DTSKYGNKKELKALNDAFHGRGIKSVADIVLNHRAAERANSRGVFNVFEGGTPDDKLDWG  472
             D SKYGNK +LK+L  A HG+G+K++ADIV+NHR AER + RG++ +FEGGTPD +LDWG
Sbjct  84    DASKYGNKAQLKSLIGALHGKGVKAIADIVINHRTAERKDGRGIYCIFEGGTPDARLDWG  143

Query  473   PSEICGDDAAF-EGTGNPDTGDPWGDAPDIDHRSPRVQREISEWMNWLKSDVGFDGWRFD  649
             P  IC DD  + +GTGNPDTG  +G APDIDH +PRVQ+E+ EW+NWL++DVGFDGWRFD
Sbjct  144   PHMICRDDRPYADGTGNPDTGADFGAAPDIDHLNPRVQKELVEWLNWLRTDVGFDGWRFD  203

Query  650   YVKGYDFVKGFAAVKIYMDNTKPEFAVGELWNALSPGSVPNPDYNQDAHRNELVRWVQNa  829
             + KGY         KIY+D ++  FAV E+W +L+ G    P+ NQD HR ELV WV   
Sbjct  204   FAKGYSA----DVAKIYIDRSEASFAVAEIWTSLAYGGDGKPNLNQDPHRQELVNWVNKV  259

Query  830   --ggaatafdfttKGILQAALNNTELWRLKDAAGKPSGMIGVLPQSAVTFIDNHDTWS-Q  1000
                G  T FDFTTKGIL  A+   ELWRL+   GK  GMIG  P  AVTF+DNHDT S Q
Sbjct  260   GGSGTGTTFDFTTKGILNVAVEG-ELWRLRGTDGKAPGMIGWWPAKAVTFVDNHDTGSTQ  318

Query  1001  RLWPFTTSTDDAVNHDRVLQGYAYILTHPGIPSVFYDHFFEWGLKDAISKLISIRNKNGV  1180
              +WPF +        D V+QGYAYILTHPG P +FYDHFF+WG+KD I +L+SIR + G+
Sbjct  319   HMWPFPS--------DSVMQGYAYILTHPGTPCIFYDHFFDWGMKDEIYRLVSIRTRQGI  370

Query  1181  SATSPVEILAADADLYIAKINGKVILKIGPNGDLKNLVPSDFMLATSGKDFAVWEK  1348
              + S ++I+ ADADLY+A+I+GK+I+K+GP  D+ +L+P  F +A  GKD+AVWEK
Sbjct  371   HSESKLQIMEADADLYLAEIDGKIIVKLGPRFDVGHLIPGGFKVAAHGKDYAVWEK  426



>emb|CAA33298.1| alpha-amylase [Hordeum vulgare]
 prf||1609234A high pI alpha amylase
Length=427

 Score =   462 bits (1189),  Expect = 3e-155, Method: Compositional matrix adjust.
 Identities = 238/420 (57%), Positives = 303/420 (72%), Gaps = 19/420 (5%)
 Frame = +2

Query  101   SSSTVLFQGFTWTSKDQPGGWWNWLITKVPDLADAGITHVWLPPPSNAREGDDQGYMPKR  280
             +S  VLFQGF W S    GGW+N+L+ KV D+A AGITHVWLPP S +    +QGYMP R
Sbjct  22    ASGQVLFQGFNWESWKHNGGWYNFLMGKVDDIAAAGITHVWLPPASQSVA--EQGYMPGR  79

Query  281   MYDLDTSKYGNKKELKALNDAFHGRGIKSVADIVLNHRAAERANSRGVFNVFEGGTPDDK  460
             +YDLD SKYGNK +LK+L  A HG+G+K++ADIV+NHR AE  + RG++ +FEG TPD +
Sbjct  80    LYDLDASKYGNKAQLKSLIGALHGKGVKAIADIVINHRTAEHKDGRGIYCIFEGDTPDAR  139

Query  461   LDWGPSEICGDDAAF-EGTGNPDTGDPWGDAPDIDHRSPRVQREISEWMNWLKSDVGFDG  637
             LDWGP  IC DD  + +GTGNPDTG  +G APDIDH + RVQ+E+ EW+NWLK+D+GFDG
Sbjct  140   LDWGPHMICRDDRPYADGTGNPDTGADFGAAPDIDHLNLRVQKELVEWLNWLKADIGFDG  199

Query  638   WRFDYVKGYDFVKGFAAVKIYMDNTKPEFAVGELWNALSPGSVPNPDYNQDAHRNELVRW  817
             WRFD+ KGY         KIY+D ++P FAV E+W +L+ G    P+ NQD HR ELV W
Sbjct  200   WRFDFAKGYSA----DVAKIYIDRSEPSFAVAEIWTSLAYGGDGKPNLNQDQHRQELVNW  255

Query  818   VQNagga--atafdfttKGILQAALNNTELWRLKDAAGKPSGMIGVLPQSAVTFIDNHDT  991
             V   GG   AT FDFTTKGIL  A+   ELWRL+   GK  GMIG  P  AVTF+DNHDT
Sbjct  256   VDKVGGKGPATTFDFTTKGILNVAVEG-ELWRLRGTDGKAPGMIGWWPAKAVTFVDNHDT  314

Query  992   WS-QRLWPFTTSTDDAVNHDRVLQGYAYILTHPGIPSVFYDHFFEWGLKDAISKLISIRN  1168
              S Q +WPF +        DRV+QGYAYILTHPG P +FYDHFF+WGLK+ I +L+S+R 
Sbjct  315   GSTQHMWPFPS--------DRVMQGYAYILTHPGTPCIFYDHFFDWGLKEEIDRLVSVRT  366

Query  1169  KNGVSATSPVEILAADADLYIAKINGKVILKIGPNGDLKNLVPSDFMLATSGKDFAVWEK  1348
             ++G+   S ++I+ ADADLY+A+I+GKVI+K+GP  D+ NL+P  F +A  G D+AVW+K
Sbjct  367   RHGIHNESKLQIIEADADLYLAEIDGKVIVKLGPRYDVGNLIPGGFKVAAHGNDYAVWQK  426



>ref|XP_004954023.1| PREDICTED: alpha-amylase-like [Setaria italica]
Length=427

 Score =   462 bits (1188),  Expect = 3e-155, Method: Compositional matrix adjust.
 Identities = 239/441 (54%), Positives = 312/441 (71%), Gaps = 19/441 (4%)
 Frame = +2

Query  38    IMKSSFYLSLFCIAFFLFPLHSSSTVLFQGFTWTSKDQPGGWWNWLITKVPDLADAGITH  217
             +      L+LF     L    ++  VLFQGF W S  Q GGW+N+L+ KV D+A+AGITH
Sbjct  1     MASKGMLLALFIALLGLSSNSAAGQVLFQGFNWESWKQNGGWYNFLMGKVDDIAEAGITH  60

Query  218   VWLPPPSNAREGDDQGYMPKRMYDLDTSKYGNKKELKALNDAFHGRGIKSVADIVLNHRA  397
             VWLPP S++    +QGY+P R+YDLD S+YGN+ +LK+L +AFH +G+K +ADIV+NHR 
Sbjct  61    VWLPPASHSLA--EQGYLPGRLYDLDASRYGNEAQLKSLIEAFHDKGVKVIADIVINHRT  118

Query  398   AERANSRGVFNVFEGGTPDDKLDWGPSEICGDDAAF-EGTGNPDTGDPWGDAPDIDHRSP  574
             AE  + RG++ +FEGGTPD +LDWGP  IC DD A+ +GTGNPDTG  +G APDIDH +P
Sbjct  119   AEHQDGRGIYCMFEGGTPDSRLDWGPHMICSDDRAYSDGTGNPDTGADFGGAPDIDHLNP  178

Query  575   RVQREISEWMNWLKSDVGFDGWRFDYVKGYDFVKGFAAVKIYMDNTKPEFAVGELWNALS  754
             RVQRE+  W+NWLK+D+GFD WR D+ KGY         K+Y+DNT+P FAV E+W +L+
Sbjct  179   RVQRELIGWLNWLKTDIGFDAWRLDFAKGYSA----DVAKVYIDNTEPCFAVAEIWTSLA  234

Query  755   PGSVPNPDYNQDAHRNELVRWVQNagga--atafdfttKGILQAALNNTELWRLKDAAGK  928
              G    P Y+Q+AHR ELV WV   G +  AT FDFTTKGIL  A++  ELWRL+ A GK
Sbjct  235   YGGDGKPYYDQNAHRQELVNWVDRVGRSGPATTFDFTTKGILNVAVDG-ELWRLRGADGK  293

Query  929   PSGMIGVLPQSAVTFIDNHDTWS-QRLWPFTTSTDDAVNHDRVLQGYAYILTHPGIPSVF  1105
               G+IG  P  AVTFIDNHDT S Q +WPF          D+V+QGYAYILTHPG P +F
Sbjct  294   APGLIGWWPAKAVTFIDNHDTGSTQHMWPFPA--------DKVMQGYAYILTHPGSPMIF  345

Query  1106  YDHFFEWGLKDAISKLISIRNKNGVSATSPVEILAADADLYIAKINGKVILKIGPNGDLK  1285
             YDHFF+WGLK+ I+ L+SIR+++G+   S + I+ ADADLY+A+I+GKVI+KIG   D +
Sbjct  346   YDHFFDWGLKNEIAHLVSIRDRHGIQPDSELHIIEADADLYLAEIDGKVIVKIGSRFDCE  405

Query  1286  NLVPSDFMLATSGKDFAVWEK  1348
             +L+P  F +   G  +AVWEK
Sbjct  406   HLIPEGFHVTAHGDGYAVWEK  426



>gb|EMS50638.1| Alpha-amylase type B isozyme [Triticum urartu]
Length=427

 Score =   461 bits (1186),  Expect = 7e-155, Method: Compositional matrix adjust.
 Identities = 237/420 (56%), Positives = 303/420 (72%), Gaps = 19/420 (5%)
 Frame = +2

Query  101   SSSTVLFQGFTWTSKDQPGGWWNWLITKVPDLADAGITHVWLPPPSNAREGDDQGYMPKR  280
             +S  VLFQGF W S    GG  N+L+ KV D+A AG+THVWLPP S +    +QGYMP R
Sbjct  22    ASGQVLFQGFNWESWKHNGGGDNFLMGKVDDIAAAGVTHVWLPPASQSVA--EQGYMPGR  79

Query  281   MYDLDTSKYGNKKELKALNDAFHGRGIKSVADIVLNHRAAERANSRGVFNVFEGGTPDDK  460
             +YDLD SKYGNK +LK+L  A HG+G+K++ADIV+NHR AER + RG++ +FEGGTPD +
Sbjct  80    LYDLDASKYGNKAQLKSLIGALHGKGVKAIADIVINHRTAERKDGRGIYCIFEGGTPDAR  139

Query  461   LDWGPSEICGDDAAF-EGTGNPDTGDPWGDAPDIDHRSPRVQREISEWMNWLKSDVGFDG  637
             LDWGP  IC DD  + +GTGNPDTG  +G APDIDH +PRVQ+E+ EW+NWL++DVGFDG
Sbjct  140   LDWGPHMICRDDRPYADGTGNPDTGADFGAAPDIDHLNPRVQKELVEWLNWLRTDVGFDG  199

Query  638   WRFDYVKGYDFVKGFAAVKIYMDNTKPEFAVGELWNALSPGSVPNPDYNQDAHRNELVRW  817
             WRFD+ KGY         KIY+D ++P FAV E+W +L+ G    P+ NQD HR ELV W
Sbjct  200   WRFDFAKGYSA----DVAKIYIDRSEPSFAVAEIWTSLAYGGDGKPNLNQDQHRQELVNW  255

Query  818   VQNaggaa--tafdfttKGILQAALNNTELWRLKDAAGKPSGMIGVLPQSAVTFIDNHDT  991
             V   GG+   T FDFTTKGIL  A+   ELWRL+   GK  GMIG  P  AVTF+DNHDT
Sbjct  256   VNKVGGSGPGTTFDFTTKGILNVAVEG-ELWRLRGTDGKAPGMIGWWPAKAVTFVDNHDT  314

Query  992   WS-QRLWPFTTSTDDAVNHDRVLQGYAYILTHPGIPSVFYDHFFEWGLKDAISKLISIRN  1168
              S Q +WPF +        D+V+QGYAYILTHPG P +FYDHFF+WGLK+ I +L+SIR 
Sbjct  315   GSTQHMWPFPS--------DKVMQGYAYILTHPGTPCIFYDHFFDWGLKEEIDRLVSIRT  366

Query  1169  KNGVSATSPVEILAADADLYIAKINGKVILKIGPNGDLKNLVPSDFMLATSGKDFAVWEK  1348
             + G+ + S ++I+ ADADLY+A+I+GKVI+K+GP  D+ +L+P  F +   G D+AVWEK
Sbjct  367   RQGIHSESKLQIIEADADLYLAEIDGKVIVKLGPRYDVGHLIPQGFKVVAHGNDYAVWEK  426



>ref|XP_009381896.1| PREDICTED: alpha-amylase isozyme 3D-like [Musa acuminata subsp. 
malaccensis]
Length=425

 Score =   461 bits (1185),  Expect = 9e-155, Method: Compositional matrix adjust.
 Identities = 233/435 (54%), Positives = 310/435 (71%), Gaps = 17/435 (4%)
 Frame = +2

Query  50    SFYLSLFCIAFFLFPLHSSSTVLFQGFTWTSKDQPGGWWNWLITKVPDLADAGITHVWLP  229
             S    L  + F +  + + S +LFQGF W S  + GGW+N+L  +VPD+A AG+T VWLP
Sbjct  5     SLAFVLLILVFSIHTVSAQSHILFQGFNWESWRKQGGWYNFLKGQVPDIARAGVTLVWLP  64

Query  230   PPSNAREGDDQGYMPKRMYDLDTSKYGNKKELKALNDAFHGRGIKSVADIVLNHRAAERA  409
             PPS++    +QGYMP R+YDL  SKYG + ELK+L  AFH +GI+ VADIV+NHR A+R 
Sbjct  65    PPSHSVS--EQGYMPGRLYDLSASKYGTRDELKSLITAFHAKGIECVADIVINHRCADRK  122

Query  410   NSRGVFNVFEGGTPDDKLDWGPSEICGDDAAF-EGTGNPDTGDPWGDAPDIDHRSPRVQR  586
             + RG++ +FEGG+ + +LDWGP  IC DD  + +GTGNPDTG  +  APDIDH +P+VQR
Sbjct  123   DERGIYCMFEGGSREGRLDWGPHMICSDDTQYSDGTGNPDTGADFAAAPDIDHLNPQVQR  182

Query  587   EISEWMNWLKSDVGFDGWRFDYVKGYDFVKGFAAVKIYMDNTKPEFAVGELWNALSPGSV  766
             E+++W+NWL++D+GFDGWR D+ +GY         K Y+  T+P F VGELW++L+ G  
Sbjct  183   ELTDWLNWLETDIGFDGWRLDFARGYSP----NITKTYLSQTRPAFVVGELWSSLTYGQD  238

Query  767   PNPDYNQDAHRNELVRWVQNaggaatafdfttKGILQAALNNTELWRLKDAAGKPSGMIG  946
               P Y+QD  R ELV WV + GG AT FDFTTKG+LQAA+   ELWRL+D  GK SGMIG
Sbjct  239   GKPAYDQDGSRQELVNWVSDVGGPATTFDFTTKGVLQAAVQG-ELWRLRDRQGKASGMIG  297

Query  947   VLPQSAVTFIDNHDTWS-QRLWPFTTSTDDAVNHDRVLQGYAYILTHPGIPSVFYDHFFE  1123
               P+ AVTF+DNHDT S Q++WPF          +RV++GYAYILTHPG+P++FYDH F+
Sbjct  298   WWPEKAVTFVDNHDTGSTQKMWPFPP--------ERVMEGYAYILTHPGVPTIFYDHLFD  349

Query  1124  WGLKDAISKLISIRNKNGVSATSPVEILAADADLYIAKINGKVILKIGPNGDLKNLVPSD  1303
             WGLK+ I+ L +IR +NG+   S + IL ADADLY+A I+ KV +KIGP  ++ NLV +D
Sbjct  350   WGLKEEITGLAAIRTRNGIRPGSTLRILVADADLYMAVIDEKVAVKIGPRYEVGNLVTAD  409

Query  1304  FMLATSGKDFAVWEK  1348
             F +  SGK+F VWEK
Sbjct  410   FHVVASGKEFCVWEK  424



>ref|XP_009399983.1| PREDICTED: alpha-amylase isozyme 3C-like [Musa acuminata subsp. 
malaccensis]
Length=416

 Score =   460 bits (1184),  Expect = 9e-155, Method: Compositional matrix adjust.
 Identities = 235/430 (55%), Positives = 312/430 (73%), Gaps = 17/430 (4%)
 Frame = +2

Query  65    LFCIAFFLFPLHSSSTVLFQGFTWTSKDQPGGWWNWLITKVPDLADAGITHVWLPPPSNA  244
             +F + F + P  + S +LFQGF W S  Q GGW+N+L  KV D+A+AG+THVWLPPPS++
Sbjct  1     MFLLLFLVVPNLAQSQILFQGFNWESWRQQGGWYNFLKDKVSDIANAGVTHVWLPPPSHS  60

Query  245   REGDDQGYMPKRMYDLDTSKYGNKKELKALNDAFHGRGIKSVADIVLNHRAAERANSRGV  424
                  QGYMP R+YDL  SKYGN+ ELKAL  AFH +G+K VADIV+NHR A++ + RG+
Sbjct  61    V--GVQGYMPGRLYDLGASKYGNQDELKALIGAFHDKGVKCVADIVINHRCADKQDGRGI  118

Query  425   FNVFEGGTPDDKLDWGPSEICGDDAAF-EGTGNPDTGDPWGDAPDIDHRSPRVQREISEW  601
             + +FEGGT D +LDWGP  IC DD  + +GTGN DTG+ +  APDIDH + +VQRE+++W
Sbjct  119   WCIFEGGTDDARLDWGPHMICRDDIQYSDGTGNLDTGEGFAAAPDIDHLNTQVQRELTDW  178

Query  602   MNWLKSDVGFDGWRFDYVKGYDFVKGFAAVKIYMDNTKPEFAVGELWNALSPGSVPNPDY  781
             +NWLK D+GFDGWR D+ KGY      +  KIY++ T+P F V E+W++L+ G+   P Y
Sbjct  179   LNWLKIDIGFDGWRLDFAKGYSS----SIAKIYVEQTQPNFVVAEIWSSLAYGNDGKPAY  234

Query  782   NQDAHRNELVRWVQNaggaatafdfttKGILQAALNNTELWRLKDAAGKPSGMIGVLPQS  961
             +Q+ +R  LV WVQ  GG ATAFDFTTKGILQ A+   ELWR++D  GK  GM+G  P+ 
Sbjct  235   DQNGNRQGLVNWVQQVGGPATAFDFTTKGILQVAVEG-ELWRMRDPQGKAPGMMGWWPEK  293

Query  962   AVTFIDNHDTWS-QRLWPFTTSTDDAVNHDRVLQGYAYILTHPGIPSVFYDHFFEWGLKD  1138
             AVTF+DNHDT S QR WPF +        D+V+QGYAYILTHPG+PS+FYDH F+WGLK+
Sbjct  294   AVTFVDNHDTGSTQRSWPFPS--------DKVMQGYAYILTHPGVPSIFYDHMFDWGLKE  345

Query  1139  AISKLISIRNKNGVSATSPVEILAADADLYIAKINGKVILKIGPNGDLKNLVPSDFMLAT  1318
              I++L   R +NG+ + S + ILA+DADLY+A I+GK++ K+G   D+ NLVPS+F +  
Sbjct  346   KITRLAETRTRNGIHSGSALNILASDADLYMAMIDGKILTKLGSRYDVGNLVPSNFHVVA  405

Query  1319  SGKDFAVWEK  1348
             SG D+ VWEK
Sbjct  406   SGNDYCVWEK  415



>ref|XP_004973672.1| PREDICTED: alpha-amylase isozyme 3D-like [Setaria italica]
Length=432

 Score =   461 bits (1186),  Expect = 9e-155, Method: Compositional matrix adjust.
 Identities = 240/427 (56%), Positives = 304/427 (71%), Gaps = 19/427 (4%)
 Frame = +2

Query  80    FFLFPLHS--SSTVLFQGFTWTSKDQPGGWWNWLITKVPDLADAGITHVWLPPPSNAREG  253
              FL  L S   + VLFQGF W S  + G W+N L  +V D+A AG+THVWLPPPS++   
Sbjct  10    LFLLALCSLVQAQVLFQGFNWESCKKQGSWYNSLNAQVDDIAKAGVTHVWLPPPSHSVS-  68

Query  254   DDQGYMPKRMYDLDTSKYGNKKELKALNDAFHGRGIKSVADIVLNHRAAERANSRGVFNV  433
               QGYMP R+YDLD SKYG   ELK+L  AFH RGI+ VADIV+NHR A++ ++RGV+ +
Sbjct  69    -PQGYMPGRLYDLDASKYGTAVELKSLIAAFHRRGIQCVADIVINHRCADKKDARGVYCI  127

Query  434   FEGGTPDDKLDWGPSEICGDDAAF-EGTGNPDTGDPWGDAPDIDHRSPRVQREISEWMNW  610
             FEGGTPDD+LDWGP  IC DD  + +GTG+ DTGD +  APDIDH + RVQRE+ +W+NW
Sbjct  128   FEGGTPDDRLDWGPGMICSDDTQYSDGTGHRDTGDGFAAAPDIDHLNARVQRELIDWLNW  187

Query  611   LKSDVGFDGWRFDYVKGYDFVKGFAAVKIYMDNTKPEFAVGELWNALSPGSVPNPDYNQD  790
             LKSDVG+DGWR D+ KGY      A  K+Y++N+KP F V E+WN+LS      P  NQD
Sbjct  188   LKSDVGYDGWRLDFAKGYSP----AITKMYVENSKPSFVVAEIWNSLSYNGDGKPSPNQD  243

Query  791   AHRNELVRWVQNaggaatafdfttKGILQAALNNTELWRLKDAAGKPSGMIGVLPQSAVT  970
               R ELV WVQ  G  A AFDFTTKG+LQAA+   ELWRL+D++GK +G+IG  P+ AVT
Sbjct  244   QCRQELVDWVQAVGEPAMAFDFTTKGLLQAAVQG-ELWRLRDSSGKAAGLIGWTPEKAVT  302

Query  971   FIDNHDTWS-QRLWPFTTSTDDAVNHDRVLQGYAYILTHPGIPSVFYDHFFEWGLKDAIS  1147
             FIDNHDT S Q++WPF +        D+V+QGYAYILTHPG+P +FYDH F+  LK  IS
Sbjct  303   FIDNHDTGSTQKMWPFPS--------DKVMQGYAYILTHPGVPCIFYDHMFDLNLKQEIS  354

Query  1148  KLISIRNKNGVSATSPVEILAADADLYIAKINGKVILKIGPNGDLKNLVPSDFMLATSGK  1327
              L +IR +NG+ A S + IL ADAD Y+A ++ KV++KIG   D+ N++PSDF  A  GK
Sbjct  355   TLAAIRARNGIHAGSKLRILLADADAYVAIVDEKVMVKIGTRYDVGNVIPSDFQPAAHGK  414

Query  1328  DFAVWEK  1348
             D+ VWEK
Sbjct  415   DYCVWEK  421



>gb|AHY18982.1| high PI alpha-amylase 1, partial [Triticum aestivum]
 gb|AHY18983.1| high PI alpha-amylase 1, partial [Triticum aestivum]
Length=424

 Score =   460 bits (1184),  Expect = 1e-154, Method: Compositional matrix adjust.
 Identities = 235/419 (56%), Positives = 302/419 (72%), Gaps = 19/419 (5%)
 Frame = +2

Query  101   SSSTVLFQGFTWTSKDQPGGWWNWLITKVPDLADAGITHVWLPPPSNAREGDDQGYMPKR  280
             +S  VLFQGF W S    GGW+N+L+ KV D+A AG+THVWLPP S +    +QGYMP R
Sbjct  21    ASGQVLFQGFNWESWKHNGGWYNFLMGKVDDIAAAGVTHVWLPPASQSVA--EQGYMPGR  78

Query  281   MYDLDTSKYGNKKELKALNDAFHGRGIKSVADIVLNHRAAERANSRGVFNVFEGGTPDDK  460
             +YDLD SKYGNK +LK+L  A HG+G+K++ADIV+NHR AER + RG++ +FEGGTPD +
Sbjct  79    LYDLDASKYGNKAQLKSLIGALHGKGVKAIADIVINHRTAERKDGRGIYCIFEGGTPDAR  138

Query  461   LDWGPSEICGDDAAF-EGTGNPDTGDPWGDAPDIDHRSPRVQREISEWMNWLKSDVGFDG  637
             LDWGP  IC DD  + +GTGNPDTG  +G APDIDH +PRVQ+E+ EW+NWL+++VGFDG
Sbjct  139   LDWGPHMICRDDRPYADGTGNPDTGADFGAAPDIDHLNPRVQKELVEWLNWLRTNVGFDG  198

Query  638   WRFDYVKGYDFVKGFAAVKIYMDNTKPEFAVGELWNALSPGSVPNPDYNQDAHRNELVRW  817
             WRFD+ KGY         KIY+D +   FAV E+W +L+ G    P+ NQD HR ELV W
Sbjct  199   WRFDFAKGYSA----DVAKIYIDRSGASFAVAEIWTSLAYGGDGKPNLNQDPHRQELVNW  254

Query  818   VQNaggaa--tafdfttKGILQAALNNTELWRLKDAAGKPSGMIGVLPQSAVTFIDNHDT  991
             V   GG+   T FDFTTKGIL  A+   ELWRL+   GK  GMIG  P  AVTF+DNHDT
Sbjct  255   VNKVGGSGPGTTFDFTTKGILNVAVEG-ELWRLRGTDGKAPGMIGWWPAKAVTFVDNHDT  313

Query  992   WS-QRLWPFTTSTDDAVNHDRVLQGYAYILTHPGIPSVFYDHFFEWGLKDAISKLISIRN  1168
              S Q +WPF +        DRV+QGYAYILTHPG P +FYDHFF+WGLK+ I +L+SI+ 
Sbjct  314   GSTQHMWPFPS--------DRVMQGYAYILTHPGTPCIFYDHFFDWGLKEEIDRLVSIKT  365

Query  1169  KNGVSATSPVEILAADADLYIAKINGKVILKIGPNGDLKNLVPSDFMLATSGKDFAVWE  1345
             + G+ + S ++I+ ADADLY+A+I+GKVI+K+GP  D+ +L+P  F +   G D+AVWE
Sbjct  366   RQGIHSESKLQIIEADADLYLAEIDGKVIVKLGPRYDVGHLIPQGFKVVAHGNDYAVWE  424



>ref|XP_002454601.1| hypothetical protein SORBIDRAFT_04g034140 [Sorghum bicolor]
 gb|EES07577.1| hypothetical protein SORBIDRAFT_04g034140 [Sorghum bicolor]
Length=428

 Score =   460 bits (1183),  Expect = 2e-154, Method: Compositional matrix adjust.
 Identities = 236/435 (54%), Positives = 309/435 (71%), Gaps = 20/435 (5%)
 Frame = +2

Query  59    LSLFCIAFFLFPLHSSSTVLFQGFTWTSKDQPGGWWNWLITKVPDLADAGITHVWLPPPS  238
              +LF +   L    ++  +LFQGF W S  Q GGW+N+++ KV D+A+AGITHVWLPP S
Sbjct  8     FALFIVLLGLSSNLAAGQILFQGFNWESWKQNGGWYNFMMGKVDDIAEAGITHVWLPPAS  67

Query  239   NAREGDDQGYMPKRMYDLDTSKYGNKKELKALNDAFHGRGIKSVADIVLNHRAAERANSR  418
             ++    +QGY+P R+YDLD SKYGN+ +LK+L +AFH +G+K +ADIV+NHR AE  + R
Sbjct  68    HSLA--EQGYLPGRLYDLDASKYGNEAQLKSLIEAFHDKGVKVIADIVINHRTAEHEDGR  125

Query  419   GVFNVFEGGTPDDKLDWGPSEICGDDAAF-EGTGNPDTGDPWGDAPDIDHRSPRVQREIS  595
             G++ +FEGGTPD +LDWGP  IC DD  + +GTGNPDTG  +G APDIDH +PRVQRE+ 
Sbjct  126   GIYCLFEGGTPDSRLDWGPHMICSDDRTYSDGTGNPDTGADFGGAPDIDHLNPRVQRELI  185

Query  596   EWMNWLKSDVGFDGWRFDYVKGYDFVKGFAAVKIYMDNTKPEFAVGELWNALSPGSVPNP  775
              W+NWLK+D+GFD WR D+ KGY         K+Y+DNT+P FAV E+W +L+ G    P
Sbjct  186   GWLNWLKTDIGFDAWRLDFAKGYSA----DVAKVYIDNTEPCFAVAEIWTSLAYGGDGKP  241

Query  776   DYNQDAHRNELVRW---VQNaggaatafdfttKGILQAALNNTELWRLKDAAGKPSGMIG  946
              Y+Q+AHR ELV W   V      AT FDFTTKGIL  A++  ELWRL+ A GK  G+IG
Sbjct  242   FYDQNAHRQELVNWLDRVGGKASPATTFDFTTKGILNVAVDG-ELWRLRGADGKAPGLIG  300

Query  947   VLPQSAVTFIDNHDTWS-QRLWPFTTSTDDAVNHDRVLQGYAYILTHPGIPSVFYDHFFE  1123
               P  AVTF+DNHDT S Q +WPF          D+V+QGYAYILTHPG PS+FYDHFF+
Sbjct  301   WWPAKAVTFVDNHDTGSTQHMWPFPA--------DKVMQGYAYILTHPGNPSIFYDHFFD  352

Query  1124  WGLKDAISKLISIRNKNGVSATSPVEILAADADLYIAKINGKVILKIGPNGDLKNLVPSD  1303
             WGLK+ I+ L+SIR+++G+ A S + I+ ADADLY+A+I+GKVI+KIG   D  +L+P  
Sbjct  353   WGLKNEIAHLVSIRDRHGIQADSELRIIEADADLYLAEIDGKVIVKIGSRYDCDHLIPEG  412

Query  1304  FMLATSGKDFAVWEK  1348
             F +   G  +AVWEK
Sbjct  413   FQVVVHGDGYAVWEK  427



>ref|NP_001150278.1| alpha-amylase precursor [Zea mays]
 gb|ACF87219.1| unknown [Zea mays]
 gb|ACG38489.1| alpha-amylase precursor [Zea mays]
Length=428

 Score =   459 bits (1182),  Expect = 3e-154, Method: Compositional matrix adjust.
 Identities = 234/421 (56%), Positives = 305/421 (72%), Gaps = 20/421 (5%)
 Frame = +2

Query  101   SSSTVLFQGFTWTSKDQPGGWWNWLITKVPDLADAGITHVWLPPPSNAREGDDQGYMPKR  280
             ++  +LFQGF W S  Q GGW+N+L+ KV D+A+AGITHVWLPP S++    +QGY+P R
Sbjct  22    AAGQILFQGFNWESWKQNGGWYNFLMGKVDDIAEAGITHVWLPPASHSLA--EQGYLPGR  79

Query  281   MYDLDTSKYGNKKELKALNDAFHGRGIKSVADIVLNHRAAERANSRGVFNVFEGGTPDDK  460
             +YDLD SKYGN+ +LK+L +AFH +G+K +ADIV+NHR AE  + RG++ +FEGGTPD +
Sbjct  80    LYDLDASKYGNEAQLKSLIEAFHSKGVKVIADIVINHRTAEHQDGRGIYCIFEGGTPDSR  139

Query  461   LDWGPSEICGDDAAF-EGTGNPDTGDPWGDAPDIDHRSPRVQREISEWMNWLKSDVGFDG  637
             LDWGP  IC DD A+ +GTGNPDTG  +G APDIDH +PRVQ+E++ W+NWLK+DVGFD 
Sbjct  140   LDWGPHMICSDDRAYSDGTGNPDTGADFGGAPDIDHLNPRVQQELTGWLNWLKTDVGFDA  199

Query  638   WRFDYVKGYDFVKGFAAVKIYMDNTKPEFAVGELWNALSPGSVPNPDYNQDAHRNELVRW  817
             WR D+ KGY         K+Y+D T+P FAV E+W +L+ G    P Y+Q+AHR ELV W
Sbjct  200   WRLDFAKGYSA----DVAKVYIDGTQPCFAVAEIWTSLAYGGDGKPFYDQNAHRQELVSW  255

Query  818   ---VQNaggaatafdfttKGILQAALNNTELWRLKDAAGKPSGMIGVLPQSAVTFIDNHD  988
                V      AT FDFTTKGIL  A++  ELWRL+ A GK  G+IG  P  AVTF+DNHD
Sbjct  256   LDRVGGKASPATTFDFTTKGILNVAVDG-ELWRLRGADGKAPGLIGWWPAKAVTFVDNHD  314

Query  989   TWS-QRLWPFTTSTDDAVNHDRVLQGYAYILTHPGIPSVFYDHFFEWGLKDAISKLISIR  1165
             T S Q +WPF          D+V+QGYAYILTHPG PS+FYDHFF+WGLK+ I+ L+SIR
Sbjct  315   TGSTQHMWPFPA--------DKVMQGYAYILTHPGNPSIFYDHFFDWGLKNEIAHLVSIR  366

Query  1166  NKNGVSATSPVEILAADADLYIAKINGKVILKIGPNGDLKNLVPSDFMLATSGKDFAVWE  1345
             +++G+ A S + I+ ADADLY+A+I+GKVI+KIG   D  +L+P  F +   G  +AVWE
Sbjct  367   DRHGIQADSELRIIEADADLYLAEIDGKVIVKIGSRYDCGHLIPEGFQVVAHGDGYAVWE  426

Query  1346  K  1348
             K
Sbjct  427   K  427



>pir||JC7137 alpha-amylase (EC 3.2.1.1) isozyme I - rice
Length=435

 Score =   459 bits (1180),  Expect = 9e-154, Method: Compositional matrix adjust.
 Identities = 237/417 (57%), Positives = 299/417 (72%), Gaps = 18/417 (4%)
 Frame = +2

Query  104   SSTVLFQGFTWTSKDQPGGWWNWLITKVPDLADAGITHVWLPPPSNAREGDDQGYMPKRM  283
              + VLFQGF W S  Q GGW+N L  +V D+A AG+THVWLPPPS++     QGYMP R+
Sbjct  24    QAQVLFQGFNWESWKQQGGWYNMLKGQVDDIAKAGVTHVWLPPPSHSVA--PQGYMPGRL  81

Query  284   YDLDTSKYGNKKELKALNDAFHGRGIKSVADIVLNHRAAERANSRGVFNVFEGGTPDDKL  463
             YDLD SKYG   ELK+L  AFHG+G++ VAD+V+NHR AE+ ++RGV+ VFEGGTPD +L
Sbjct  82    YDLDASKYGTAAELKSLIAAFHGKGVQCVADVVINHRCAEKKDARGVYCVFEGGTPD-RL  140

Query  464   DWGPSEICGDDAAF-EGTGNPDTGDPWGDAPDIDHRSPRVQREISEWMNWLKSDVGFDGW  640
             DWGP  IC DD  + EGTG+ DTG+ +G APDIDH +PRVQRE+++W+NWLKSDVGFDGW
Sbjct  141   DWGPGMICSDDTQYSEGTGHRDTGEGFGAAPDIDHLNPRVQRELTDWLNWLKSDVGFDGW  200

Query  641   RFDYVKGYDFVKGFAAVKIYMDNTKPEFAVGELWNALSPGSVPNPDYNQDAHRNELVRWV  820
             R D+ KGY         K+Y+++ KP F V E+WN+LS      P  NQD  R ELV WV
Sbjct  201   RLDFAKGYST----DIAKMYVESCKPGFVVAEIWNSLSYNGDGKPAANQDQGRQELVNWV  256

Query  821   QNaggaatafdfttKGILQAALNNTELWRLKDAAGKPSGMIGVLPQSAVTFIDNHDTWS-  997
                GG A  FDFTTKG+LQA +   ELWRL+D  GK  GMIG LP+ AVTF+DNHDT S 
Sbjct  257   NAVGGPAMTFDFTTKGLLQAGVQG-ELWRLRDGNGKAPGMIGWLPEKAVTFVDNHDTGST  315

Query  998   QRLWPFTTSTDDAVNHDRVLQGYAYILTHPGIPSVFYDHFFEWGLKDAISKLISIRNKNG  1177
             Q+LWPF +        D+V+QGYAYILTHPG+P +FYDH F+W LK  I+ L +IR +NG
Sbjct  316   QKLWPFPS--------DKVMQGYAYILTHPGVPCIFYDHMFDWNLKQEITALAAIRERNG  367

Query  1178  VSATSPVEILAADADLYIAKINGKVILKIGPNGDLKNLVPSDFMLATSGKDFAVWEK  1348
             ++A S + I+ ADAD Y+A ++ KV++KIG   D+ N VPSDF     GKD++VWEK
Sbjct  368   INAGSKLRIVVADADAYVAVVDEKVMVKIGTRYDVGNAVPSDFHQTVHGKDYSVWEK  424



>gb|AFW73583.1| putative alpha-amylase family protein [Zea mays]
Length=480

 Score =   460 bits (1183),  Expect = 1e-153, Method: Compositional matrix adjust.
 Identities = 234/421 (56%), Positives = 305/421 (72%), Gaps = 20/421 (5%)
 Frame = +2

Query  101   SSSTVLFQGFTWTSKDQPGGWWNWLITKVPDLADAGITHVWLPPPSNAREGDDQGYMPKR  280
             ++  +LFQGF W S  Q GGW+N+L+ KV D+A+AGITHVWLPP S++    +QGY+P R
Sbjct  74    AAGQILFQGFNWESWKQNGGWYNFLMGKVDDIAEAGITHVWLPPASHSLA--EQGYLPGR  131

Query  281   MYDLDTSKYGNKKELKALNDAFHGRGIKSVADIVLNHRAAERANSRGVFNVFEGGTPDDK  460
             +YDLD SKYGN+ +LK+L +AFH +G+K +ADIV+NHR AE  + RG++ +FEGGTPD +
Sbjct  132   LYDLDASKYGNEAQLKSLIEAFHSKGVKVIADIVINHRTAEHQDGRGIYCIFEGGTPDSR  191

Query  461   LDWGPSEICGDDAAF-EGTGNPDTGDPWGDAPDIDHRSPRVQREISEWMNWLKSDVGFDG  637
             LDWGP  IC DD A+ +GTGNPDTG  +G APDIDH +PRVQ+E++ W+NWLK+DVGFD 
Sbjct  192   LDWGPHMICSDDRAYSDGTGNPDTGADFGGAPDIDHLNPRVQQELTGWLNWLKTDVGFDA  251

Query  638   WRFDYVKGYDFVKGFAAVKIYMDNTKPEFAVGELWNALSPGSVPNPDYNQDAHRNELVRW  817
             WR D+ KGY         K+Y+D T+P FAV E+W +L+ G    P Y+Q+AHR ELV W
Sbjct  252   WRLDFAKGYSA----DVAKVYIDGTQPCFAVAEIWTSLAYGGDGKPFYDQNAHRQELVSW  307

Query  818   ---VQNaggaatafdfttKGILQAALNNTELWRLKDAAGKPSGMIGVLPQSAVTFIDNHD  988
                V      AT FDFTTKGIL  A++  ELWRL+ A GK  G+IG  P  AVTF+DNHD
Sbjct  308   LDRVGGKASPATTFDFTTKGILNVAVDG-ELWRLRGADGKAPGLIGWWPAKAVTFVDNHD  366

Query  989   TWS-QRLWPFTTSTDDAVNHDRVLQGYAYILTHPGIPSVFYDHFFEWGLKDAISKLISIR  1165
             T S Q +WPF          D+V+QGYAYILTHPG PS+FYDHFF+WGLK+ I+ L+SIR
Sbjct  367   TGSTQHMWPFPA--------DKVMQGYAYILTHPGNPSIFYDHFFDWGLKNEIAHLVSIR  418

Query  1166  NKNGVSATSPVEILAADADLYIAKINGKVILKIGPNGDLKNLVPSDFMLATSGKDFAVWE  1345
             +++G+ A S + I+ ADADLY+A+I+GKVI+KIG   D  +L+P  F +   G  +AVWE
Sbjct  419   DRHGIQADSELRIIEADADLYLAEIDGKVIVKIGSRYDCGHLIPEGFQVVAHGDGYAVWE  478

Query  1346  K  1348
             K
Sbjct  479   K  479



>gb|AAA33895.1| alpha-amylase [Oryza sativa Japonica Group]
Length=435

 Score =   457 bits (1176),  Expect = 3e-153, Method: Compositional matrix adjust.
 Identities = 236/417 (57%), Positives = 299/417 (72%), Gaps = 18/417 (4%)
 Frame = +2

Query  104   SSTVLFQGFTWTSKDQPGGWWNWLITKVPDLADAGITHVWLPPPSNAREGDDQGYMPKRM  283
              + VLFQGF W S  Q GGW+N L  +V D+A AG+THVWLPPPS++     QGYMP R+
Sbjct  24    QAQVLFQGFNWESWKQQGGWYNMLKGQVDDIAKAGVTHVWLPPPSHSVA--PQGYMPGRL  81

Query  284   YDLDTSKYGNKKELKALNDAFHGRGIKSVADIVLNHRAAERANSRGVFNVFEGGTPDDKL  463
             YDLD SKYG   ELK+L  AFHG+G++ VAD+V+NHR AE+ ++RGV+ VFEGGTPD +L
Sbjct  82    YDLDASKYGTAAELKSLIAAFHGKGVQCVADVVINHRCAEKKDARGVYCVFEGGTPD-RL  140

Query  464   DWGPSEICGDDAAF-EGTGNPDTGDPWGDAPDIDHRSPRVQREISEWMNWLKSDVGFDGW  640
             DWGP  IC DD  + +GTG+ DTG+ +G APDIDH +PRVQRE+++W+NWLKSDVGFDGW
Sbjct  141   DWGPGMICSDDTQYSDGTGHRDTGEGFGAAPDIDHLNPRVQRELTDWLNWLKSDVGFDGW  200

Query  641   RFDYVKGYDFVKGFAAVKIYMDNTKPEFAVGELWNALSPGSVPNPDYNQDAHRNELVRWV  820
             R D+ KGY         K+Y+++ KP F V E+WN+LS      P  NQD  R ELV WV
Sbjct  201   RLDFAKGYST----DIAKMYVESCKPGFVVAEIWNSLSYNGDGKPAANQDQGRQELVNWV  256

Query  821   QNaggaatafdfttKGILQAALNNTELWRLKDAAGKPSGMIGVLPQSAVTFIDNHDTWS-  997
                GG A  FDFTTKG+LQA +   ELWRL+D  GK  GMIG LP+ AVTF+DNHDT S 
Sbjct  257   NAVGGPAMTFDFTTKGLLQAGVQG-ELWRLRDGNGKAPGMIGWLPEKAVTFVDNHDTGST  315

Query  998   QRLWPFTTSTDDAVNHDRVLQGYAYILTHPGIPSVFYDHFFEWGLKDAISKLISIRNKNG  1177
             Q+LWPF +        D+V+QGYAYILTHPG+P +FYDH F+W LK  I+ L +IR +NG
Sbjct  316   QKLWPFPS--------DKVMQGYAYILTHPGVPCIFYDHMFDWNLKQEITALAAIRERNG  367

Query  1178  VSATSPVEILAADADLYIAKINGKVILKIGPNGDLKNLVPSDFMLATSGKDFAVWEK  1348
             ++A S + I+ ADAD Y+A ++ KV++KIG   D+ N VPSDF     GKD++VWEK
Sbjct  368   INAGSKLRIVVADADAYVAVVDEKVMVKIGTRYDVGNAVPSDFHQTVHGKDYSVWEK  424



>ref|XP_003589191.1| Alpha amylase [Medicago truncatula]
 gb|AES59442.1| alpha amylase domain protein [Medicago truncatula]
Length=402

 Score =   456 bits (1172),  Expect = 4e-153, Method: Compositional matrix adjust.
 Identities = 239/435 (55%), Positives = 308/435 (71%), Gaps = 35/435 (8%)
 Frame = +2

Query  41    MKSSFYLSLFCIAFFLFPLHSSSTVLFQGFTWTSKDQPGGWWNWLITKVPDLADAGITHV  220
             MK    +   C+   +FP  SSS +LFQGF W S ++ GGWWN+L TKVPD+ADAG+ +V
Sbjct  1     MKFLHSICFLCLCISIFPSFSSSAILFQGFKWASSEKEGGWWNFLKTKVPDIADAGVEYV  60

Query  221   WLPPPSNAREGDDQGYMPKRMYDLDTSKYGNKKELKALNDAFHGRGIKSVADIVLNHRAA  400
             WLPPPSN+ +   QGY+PKR+YDLDTSKYGNK+ELK+L  AF  +G+KS++DIV+NHR A
Sbjct  61    WLPPPSNSHDDGPQGYLPKRLYDLDTSKYGNKQELKSLVAAFREQGVKSISDIVINHRTA  120

Query  401   ERANSRGVFNVFEGGTPDDKLDWGPSEICGDDAAFEGTGNPDTGDPWGDAPDIDHRSPRV  580
             ER ++ G+ ++FEGGTPD++LDW  S ICG+D  F+GTGN DTGD WG APD+DH +P+V
Sbjct  121   ERLDNNGL-SIFEGGTPDNRLDWDVSYICGNDVQFKGTGNNDTGDDWGGAPDVDHTNPKV  179

Query  581   QREISEWMNWLKSDVGFDGWRFDYVKGYDFVKGFAAVKIYMDNTKPEFAVGELWNALSPG  760
             Q+E+S+WMNW                           K Y++ T P+F VGEL+  +  G
Sbjct  180   QQELSDWMNWF-------------------------TKNYVEKTSPDFTVGELYRNVELG  214

Query  761   SVPNPDYNQDAHRNELVRWVQNaggaatafdfttKGILQAALNNTELWRLKDAAGKPSGM  940
             S   P  NQD HR  LV+WV +AGG  T FDFTTK IL AA+   ELWR+KDA GKP GM
Sbjct  215   SDGKPLANQDKHRETLVKWVNDAGGVVTTFDFTTKMILGAAVQG-ELWRMKDANGKPPGM  273

Query  941   IGVLPQSAVTFIDNHDTWSQRLWPFTTSTDDAVNHDRVLQGYAYILTHPGIPSVFYDHFF  1120
             IG++P +AVTF+DNHDT SQ+LWPF          D+V+ GY YILTHPG P++FYDH+ 
Sbjct  274   IGIMPSNAVTFVDNHDTGSQKLWPFP--------DDKVMLGYVYILTHPGHPTIFYDHYI  325

Query  1121  EWGLKDAISKLISIRNKNGVSATSPVEILAADADLYIAKINGKVILKIGPNGDLKNLVPS  1300
             EWGL + I KL +IR +NG++ATS V ILAA+ DLY+A I  K+I+KIGP  DL NL+P 
Sbjct  326   EWGLMEPIKKLTAIRKRNGITATSNVNILAAENDLYMANIGNKIIVKIGPKLDLGNLLPP  385

Query  1301  DFMLATSGKDFAVWE  1345
             +  +ATSG+D+AVWE
Sbjct  386   NAQVATSGQDYAVWE  400



>ref|NP_001062023.1| Os08g0473600 [Oryza sativa Japonica Group]
 sp|P27934.1|AMY3E_ORYSJ RecName: Full=Alpha-amylase isozyme 3E; AltName: Full=1,4-alpha-D-glucan 
glucanohydrolase; Flags: Precursor [Oryza sativa 
Japonica Group]
 gb|AAA33896.1| alpha-amylase [Oryza sativa Japonica Group]
 dbj|BAD09374.1| alpha-amylase isozyme 3E precursor [Oryza sativa Japonica Group]
 dbj|BAD09334.1| alpha-amylase isozyme 3E precursor [Oryza sativa Japonica Group]
 dbj|BAF23937.1| Os08g0473600 [Oryza sativa Japonica Group]
 gb|EAZ07321.1| hypothetical protein OsI_29569 [Oryza sativa Indica Group]
 gb|EAZ43059.1| hypothetical protein OsJ_27648 [Oryza sativa Japonica Group]
 gb|ACF60463.1| alpha amylase isozyme 3E [Oryza sativa Japonica Group]
 dbj|BAG96068.1| unnamed protein product [Oryza sativa Japonica Group]
Length=437

 Score =   456 bits (1173),  Expect = 1e-152, Method: Compositional matrix adjust.
 Identities = 235/436 (54%), Positives = 305/436 (70%), Gaps = 20/436 (5%)
 Frame = +2

Query  56    YLSLFCIAFFLFPLHSS---STVLFQGFTWTSKDQPGGWWNWLITKVPDLADAGITHVWL  226
             +++L C+ F +  L SS   + VLFQGF W S  + GGW+N+L  KV ++A  G THVWL
Sbjct  5     HVTLCCVVFAVLCLASSLAQAQVLFQGFNWESWRKQGGWYNFLHEKVEEIASTGATHVWL  64

Query  227   PPPSNAREGDDQGYMPKRMYDLDTSKYGNKKELKALNDAFHGRGIKSVADIVLNHRAAER  406
             PPPS++     QGYMP R+YDLD SKYG + ELK+L +AFH + ++ +ADIV+NHR A+ 
Sbjct  65    PPPSHSVS--PQGYMPGRLYDLDASKYGTEAELKSLIEAFHDKNVECLADIVINHRCADY  122

Query  407   ANSRGVFNVFEGGTPDDKLDWGPSEICGDDAAFE-GTGNPDTGDPWGDAPDIDHRSPRVQ  583
              +SRGV+ VFEGGTPD +LDWGP  IC DD  +  G G+ DTG  +G APDIDH +PRVQ
Sbjct  123   KDSRGVYCVFEGGTPDGRLDWGPDMICSDDTQYSNGRGHRDTGAGFGAAPDIDHLNPRVQ  182

Query  584   REISEWMNWLKSDVGFDGWRFDYVKGYDFVKGFAAVKIYMDNTKPEFAVGELWNALSPGS  763
             RE+++W+NWL++D+GFDGWR D+ KGY         +IY+DNT P F VGE+W++L    
Sbjct  183   RELTDWLNWLRTDLGFDGWRLDFAKGYSA----PLARIYVDNTNPTFVVGEIWSSLIYNG  238

Query  764   VPNPDYNQDAHRNELVRWVQNaggaatafdfttKGILQAALNNTELWRLKDAAGKPSGMI  943
                P  NQDA R ELV WV+  G  ATAFDFTTKGILQAA+   ELWRL D  GK  G++
Sbjct  239   DGKPSTNQDADRQELVNWVEGVGKPATAFDFTTKGILQAAVQG-ELWRLHDGNGKAPGLM  297

Query  944   GVLPQSAVTFIDNHDTWS-QRLWPFTTSTDDAVNHDRVLQGYAYILTHPGIPSVFYDHFF  1120
             G +P  AVTF+DNHDT S Q LWPF +        D+V+QGYAYILTHPGIP +FYDH F
Sbjct  298   GWMPDQAVTFVDNHDTGSTQSLWPFPS--------DKVMQGYAYILTHPGIPCIFYDHVF  349

Query  1121  EWGLKDAISKLISIRNKNGVSATSPVEILAADADLYIAKINGKVILKIGPNGDLKNLVPS  1300
             +W L+  I+ L  IR++NG+ A S ++IL A+ D+Y+A I+GKVI K+GP  D   ++PS
Sbjct  350   DWNLQHEIATLAEIRSRNGIHAESTLDILKAEGDIYVAMIDGKVITKLGPRYDAGGIIPS  409

Query  1301  DFMLATSGKDFAVWEK  1348
             DF +   G D+ VWEK
Sbjct  410   DFHVVAHGNDYCVWEK  425



>ref|NP_567714.1| alpha-amylase 1 [Arabidopsis thaliana]
 sp|Q8VZ56.1|AMY1_ARATH RecName: Full=Alpha-amylase 1; Short=AtAMY1; AltName: Full=1,4-alpha-D-glucan 
glucanohydrolase; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AAL38709.1| putative alpha-amylase [Arabidopsis thaliana]
 gb|AAM51369.1| putative alpha-amylase [Arabidopsis thaliana]
 gb|AEE84990.1| alpha-amylase 1 [Arabidopsis thaliana]
Length=423

 Score =   455 bits (1171),  Expect = 1e-152, Method: Compositional matrix adjust.
 Identities = 238/438 (54%), Positives = 316/438 (72%), Gaps = 21/438 (5%)
 Frame = +2

Query  47    SSFYLSLF--CIAFFLFPLHS-SSTVLFQGFTWTSKDQPGGWWNWLITKVPDLADAGITH  217
             +S +  LF   + F +FP  + SST+LFQ F W S  + GG++N L   + D+A+AGITH
Sbjct  2     TSLHTLLFSSLLFFIVFPTFTFSSTLLFQSFNWESWKKEGGFYNSLHNSIDDIANAGITH  61

Query  218   VWLPPPSNAREGDDQGYMPKRMYDLDTSKYGNKKELKALNDAFHGRGIKSVADIVLNHRA  397
             +WLPPPS +     +GY+P ++YDL++SKYG++ ELK+L  A + +GIK++ADIV+NHR 
Sbjct  62    LWLPPPSQSVA--PEGYLPGKLYDLNSSKYGSEAELKSLIKALNQKGIKALADIVINHRT  119

Query  398   AERANSRGVFNVFEGGTPDDKLDWGPSEICGDDAAFEGTGNPDTGDPWGDAPDIDHRSPR  577
             AER + +  +  FEGGT DD+LDW PS +C +D  F GTGN DTG  +  APDIDH +PR
Sbjct  120   AERKDDKCGYCYFEGGTSDDRLDWDPSFVCRNDPKFPGTGNLDTGGDFDGAPDIDHLNPR  179

Query  578   VQREISEWMNWLKSDVGFDGWRFDYVKGYDFVKGFAAVKIYMDNTKPEFAVGELWNALSP  757
             VQ+E+SEWMNWLK+++GF GWRFDYV+GY      +  K+Y+ NT P+FAVGE W+ +  
Sbjct  180   VQKELSEWMNWLKTEIGFHGWRFDYVRGY----ASSITKLYVQNTSPDFAVGEKWDDMKY  235

Query  758   GSVPNPDYNQDAHRNELVRWVQNaggaatafd-fttKGILQAALNNTELWRLKDAAGKPS  934
             G     DY+Q+ HR+ L +W++ AGG       FTTKGILQ+A+   ELWRLKD+ GKP 
Sbjct  236   GGDGKLDYDQNEHRSGLKQWIEEAGGGVLTAFDFTTKGILQSAVKG-ELWRLKDSQGKPP  294

Query  935   GMIGVLPQSAVTFIDNHDTWSQRLWPFTTSTDDAVNHDRVLQGYAYILTHPGIPSVFYDH  1114
             GMIG++P +AVTFIDNHDT+  R W F +        D+VL GY YILTHPG P +FY+H
Sbjct  295   GMIGIMPGNAVTFIDNHDTF--RTWVFPS--------DKVLLGYVYILTHPGTPCIFYNH  344

Query  1115  FFEWGLKDAISKLISIRNKNGVSATSPVEILAADADLYIAKINGKVILKIGPNGDLKNLV  1294
             + EWGLK++ISKL++IRNKNG+ +TS V I AA+ADLY+A I+ KVI+KIGP  D+  LV
Sbjct  345   YIEWGLKESISKLVAIRNKNGIGSTSSVTIKAAEADLYLAMIDDKVIMKIGPKQDVGTLV  404

Query  1295  PSDFMLATSGKDFAVWEK  1348
             PS+F LA SG DFAVWEK
Sbjct  405   PSNFALAYSGLDFAVWEK  422



>pir||JC7138 alpha-amylase (EC 3.2.1.1) isozyme III - rice
Length=437

 Score =   456 bits (1172),  Expect = 1e-152, Method: Compositional matrix adjust.
 Identities = 235/436 (54%), Positives = 305/436 (70%), Gaps = 20/436 (5%)
 Frame = +2

Query  56    YLSLFCIAFFLFPLHSS---STVLFQGFTWTSKDQPGGWWNWLITKVPDLADAGITHVWL  226
             +++L C+ F +  L SS   + VLFQGF W S  + GGW+N+L  KV ++A  G THVWL
Sbjct  5     HVTLCCVVFAVLCLASSLAQAQVLFQGFNWESWRKQGGWYNFLHEKVEEIASTGATHVWL  64

Query  227   PPPSNAREGDDQGYMPKRMYDLDTSKYGNKKELKALNDAFHGRGIKSVADIVLNHRAAER  406
             PPPS++     QGYMP R+YDLD SKYG + ELK+L +AFH + ++ +ADIV+NHR A+ 
Sbjct  65    PPPSHSVS--PQGYMPGRLYDLDASKYGTEAELKSLIEAFHDKNVECLADIVINHRCADY  122

Query  407   ANSRGVFNVFEGGTPDDKLDWGPSEICGDDAAFE-GTGNPDTGDPWGDAPDIDHRSPRVQ  583
              +SRGV+ VFEGGTPD +LDWGP  IC DD  +  G G+ DTG  +G APDIDH +PRVQ
Sbjct  123   KDSRGVYCVFEGGTPDGRLDWGPDMICSDDTQYSNGRGHRDTGAGFGAAPDIDHLNPRVQ  182

Query  584   REISEWMNWLKSDVGFDGWRFDYVKGYDFVKGFAAVKIYMDNTKPEFAVGELWNALSPGS  763
             RE+++W+NWL++D+GFDGWR D+ KGY         +IY+DNT P F VGE+W++L    
Sbjct  183   RELTDWLNWLRTDLGFDGWRLDFAKGYSA----PLARIYVDNTNPTFVVGEIWSSLIYNG  238

Query  764   VPNPDYNQDAHRNELVRWVQNaggaatafdfttKGILQAALNNTELWRLKDAAGKPSGMI  943
                P  NQDA R ELV WV+  G  ATAFDFTTKGILQAA+   ELWRL D  GK  G++
Sbjct  239   DGKPSTNQDADRQELVNWVEGVGKPATAFDFTTKGILQAAVQG-ELWRLHDGNGKAPGLM  297

Query  944   GVLPQSAVTFIDNHDTWS-QRLWPFTTSTDDAVNHDRVLQGYAYILTHPGIPSVFYDHFF  1120
             G +P  AVTF+DNHDT S Q LWPF +        D+V+QGYAYILTHPGIP +FYDH F
Sbjct  298   GWMPDQAVTFVDNHDTGSTQSLWPFPS--------DKVMQGYAYILTHPGIPCIFYDHVF  349

Query  1121  EWGLKDAISKLISIRNKNGVSATSPVEILAADADLYIAKINGKVILKIGPNGDLKNLVPS  1300
             +W L+  I+ L  IR++NG+ A S ++IL A+ D+Y+A I+GKVI K+GP  D   ++PS
Sbjct  350   DWNLQHEIATLAEIRSRNGIHAESTLDILKAEGDIYVAMIDGKVITKLGPRYDAGGIIPS  409

Query  1301  DFMLATSGKDFAVWEK  1348
             DF +   G D+ VWEK
Sbjct  410   DFHVVAHGNDYCVWEK  425



>gb|EMS54110.1| Alpha-amylase type B isozyme [Triticum urartu]
Length=427

 Score =   455 bits (1170),  Expect = 2e-152, Method: Compositional matrix adjust.
 Identities = 232/420 (55%), Positives = 296/420 (70%), Gaps = 19/420 (5%)
 Frame = +2

Query  101   SSSTVLFQGFTWTSKDQPGGWWNWLITKVPDLADAGITHVWLPPPSNAREGDDQGYMPKR  280
             +S  VLFQGF W S    GG  N+L+ KV D+A AG+THVWLPP S +    +QGYMP R
Sbjct  22    ASGQVLFQGFNWESWKHNGGGDNFLMGKVDDIAAAGVTHVWLPPASQSVA--EQGYMPGR  79

Query  281   MYDLDTSKYGNKKELKALNDAFHGRGIKSVADIVLNHRAAERANSRGVFNVFEGGTPDDK  460
             +YDLD SKYGNK +LK+L  A HG+G+K++ADIV+NHR AER + RG++ +FEGGTPD +
Sbjct  80    LYDLDASKYGNKAQLKSLIGALHGKGVKAIADIVINHRTAERKDGRGIYCIFEGGTPDAR  139

Query  461   LDWGPSEICGDDAAF-EGTGNPDTGDPWGDAPDIDHRSPRVQREISEWMNWLKSDVGFDG  637
             LDWGP  IC DD  + +GTGNPDTG  +G APDIDH SPRVQ+E+ EW+NWL+++VGFDG
Sbjct  140   LDWGPHMICRDDRPYADGTGNPDTGADFGAAPDIDHLSPRVQKELVEWLNWLRTNVGFDG  199

Query  638   WRFDYVKGYDFVKGFAAVKIYMDNTKPEFAVGELWNALSPGSVPNPDYNQDAHRNELVRW  817
             WRFD+ KGY         KIY+D +   F V E+W +L+ G    P+ NQD HR ELV W
Sbjct  200   WRFDFAKGYSA----DGAKIYIDRSGAGFTVAEIWTSLAYGGARKPNLNQDPHRQELVNW  255

Query  818   VQNaggaatafdf--ttKGILQAALNNTELWRLKDAAGKPSGMIGVLPQSAVTFIDNHDT  991
                 GG+     F  TTKGIL  A+   ELWRL+   GK  GMIG  P  AVTF+DNHDT
Sbjct  256   GNKGGGSGPGTTFDFTTKGILNVAVEG-ELWRLRGTDGKAPGMIGWWPAKAVTFVDNHDT  314

Query  992   WS-QRLWPFTTSTDDAVNHDRVLQGYAYILTHPGIPSVFYDHFFEWGLKDAISKLISIRN  1168
              S Q +WPF +        DRV+QGYAYILTHPG P +FYDHFF+WGLK+ I +L+SIR 
Sbjct  315   GSTQHMWPFPS--------DRVMQGYAYILTHPGTPCIFYDHFFDWGLKEEIDRLVSIRT  366

Query  1169  KNGVSATSPVEILAADADLYIAKINGKVILKIGPNGDLKNLVPSDFMLATSGKDFAVWEK  1348
             + G+ + S ++I+ ADADLY+A+I+GKVI+K+GP  D+ +L+P  F +   G D+AVWEK
Sbjct  367   RQGIHSESKLQIIEADADLYLAEIDGKVIVKLGPRYDVGHLIPQGFKVVAHGNDYAVWEK  426



>gb|AAM64582.1| alpha-amylase-like protein [Arabidopsis thaliana]
Length=423

 Score =   455 bits (1170),  Expect = 2e-152, Method: Compositional matrix adjust.
 Identities = 237/438 (54%), Positives = 316/438 (72%), Gaps = 21/438 (5%)
 Frame = +2

Query  47    SSFYLSLF--CIAFFLFPLHS-SSTVLFQGFTWTSKDQPGGWWNWLITKVPDLADAGITH  217
             +S +  LF   + F +FP  + SST+LFQ F W S  + GG++N L   + D+A+AGITH
Sbjct  2     TSLHTLLFSSLLFFIVFPTFTFSSTLLFQSFNWESWKKEGGFYNSLHNSIDDIANAGITH  61

Query  218   VWLPPPSNAREGDDQGYMPKRMYDLDTSKYGNKKELKALNDAFHGRGIKSVADIVLNHRA  397
             +WLPPPS +     +GY+P ++YDL++SKYG++ ELK+L  A + +GIK++ADIV+NHR 
Sbjct  62    LWLPPPSQSVA--PEGYLPGKLYDLNSSKYGSEAELKSLIKALNQKGIKALADIVINHRT  119

Query  398   AERANSRGVFNVFEGGTPDDKLDWGPSEICGDDAAFEGTGNPDTGDPWGDAPDIDHRSPR  577
             AER + +  +  FEGGT DD+LDW PS +C +D  F GTGN DTG  +  APDIDH +PR
Sbjct  120   AERKDDKCGYCYFEGGTSDDRLDWDPSFVCRNDPKFPGTGNLDTGGDFDGAPDIDHLNPR  179

Query  578   VQREISEWMNWLKSDVGFDGWRFDYVKGYDFVKGFAAVKIYMDNTKPEFAVGELWNALSP  757
             VQ+E+SEWMNWLK+++GF GWRFDYV+GY      +  K+Y+ NT P+FAVGE W+ +  
Sbjct  180   VQKELSEWMNWLKTEIGFHGWRFDYVRGY----ASSITKLYVQNTSPDFAVGEKWDDMKY  235

Query  758   GSVPNPDYNQDAHRNELVRWVQNaggaatafd-fttKGILQAALNNTELWRLKDAAGKPS  934
             G     DY+Q+ HR+ L +W++ AGG       FTTKGILQ+A+   ELWRLKD+ GKP 
Sbjct  236   GGDGKLDYDQNEHRSGLKQWIEEAGGGVLTAFDFTTKGILQSAVKG-ELWRLKDSQGKPP  294

Query  935   GMIGVLPQSAVTFIDNHDTWSQRLWPFTTSTDDAVNHDRVLQGYAYILTHPGIPSVFYDH  1114
             GMIG++P +AVTFIDNHDT+  R W F +        D+VL GY YILTHPG P +FY+H
Sbjct  295   GMIGIMPGNAVTFIDNHDTF--RTWVFPS--------DKVLLGYVYILTHPGTPCIFYNH  344

Query  1115  FFEWGLKDAISKLISIRNKNGVSATSPVEILAADADLYIAKINGKVILKIGPNGDLKNLV  1294
             + EWGLK++ISKL++IRNKNG+ +TS V I AA+ADLY+A I+ KVI+KIGP  D+  LV
Sbjct  345   YIEWGLKESISKLVAIRNKNGIGSTSSVTIKAAEADLYLAMIDDKVIMKIGPKQDVGTLV  404

Query  1295  PSDFMLATSGKDFAVWEK  1348
             PS+F LA SG DFA+WEK
Sbjct  405   PSNFALAYSGLDFAIWEK  422



>sp|P04750.2|AMY6_HORVU RecName: Full=Alpha-amylase type B isozyme; AltName: Full=1,4-alpha-D-glucan 
glucanohydrolase; AltName: Full=Clones GRAMY56 
and 963; Flags: Precursor [Hordeum vulgare]
 emb|CAA33299.1| alpha amylase [Hordeum vulgare]
 prf||1609234B high pI alpha amylase
Length=429

 Score =   455 bits (1170),  Expect = 2e-152, Method: Compositional matrix adjust.
 Identities = 240/436 (55%), Positives = 306/436 (70%), Gaps = 21/436 (5%)
 Frame = +2

Query  59    LSLFCIAFFLFPLHSSSTVLFQGFTWTSKDQPGGWWNWLITKVPDLADAGITHVWLPPPS  238
             LSLF +   L    +S  VLFQGF W S    GGW+N+L+ KV D+A AG+THVWLPP S
Sbjct  8     LSLFIVLLGLSCSLASGQVLFQGFNWESWKHNGGWYNFLMGKVDDIAAAGVTHVWLPPAS  67

Query  239   NAREGDDQGYMPKRMYDLDTSKYGNKKELKALNDAFHGRGIKSVADIVLNHRAAERANSR  418
              +    +QGYMP R+YDLD SKYGNK +LK+L  A HG+ +K++ADIV+NHR AER + R
Sbjct  68    QSVA--EQGYMPGRLYDLDASKYGNKAQLKSLIGALHGKAVKAIADIVINHRTAERKDGR  125

Query  419   GVFNVFEGGTPDDKLDWGPSEICGDDAAF-EGTGN--PDTGDPWGDAPDIDHRSPRVQRE  589
             G++ +FEGGTPD +LDWGP  IC DD  + +GTGN    T   +G APDIDH +PRVQ+E
Sbjct  126   GIYCIFEGGTPDARLDWGPHMICRDDRPYPDGTGNRPTRTRADFGAAPDIDHLNPRVQKE  185

Query  590   ISEWMNWLKSDVGFDGWRFDYVKGYDFVKGFAAVKIYMDNTKPEFAVGELWNALSPGSVP  769
             + EW+NWL++D GFDGWRFD+ KGY         KIY+D ++P FAV E+W +L+ G   
Sbjct  186   LVEWLNWLRTDDGFDGWRFDFAKGYSA----DVAKIYVDRSEPSFAVAEIWTSLAYGGDG  241

Query  770   NPDYNQDAHRNELVRWVQNagga--atafdfttKGILQAALNNTELWRLKDAAGKPSGMI  943
              P+ NQD HR ELV WV   GG+  AT FDFTTKGIL  A+   ELWRL+   GK  GMI
Sbjct  242   KPNLNQDPHRQELVNWVNKVGGSGPATTFDFTTKGILNVAVEG-ELWRLRGTDGKAPGMI  300

Query  944   GVLPQSAVTFIDNHDTWS-QRLWPFTTSTDDAVNHDRVLQGYAYILTHPGIPSVFYDHFF  1120
             G  P  AVTF+DNHDT S Q +WPF +        DRV+QGYAYILTHPG P +FYDHFF
Sbjct  301   GWWPAKAVTFVDNHDTGSTQHMWPFPS--------DRVMQGYAYILTHPGNPCIFYDHFF  352

Query  1121  EWGLKDAISKLISIRNKNGVSATSPVEILAADADLYIAKINGKVILKIGPNGDLKNLVPS  1300
             +WGLK+ I +L+SIR + G+ + S ++I+ ADADLY+A+I GKVI+K+GP  D+ +L+P 
Sbjct  353   DWGLKEEIDRLVSIRTRQGIHSESKLQIMEADADLYLAEIEGKVIVKLGPRYDVGHLIPE  412

Query  1301  DFMLATSGKDFAVWEK  1348
              F +   G D+AVWEK
Sbjct  413   GFKVVAHGNDYAVWEK  428



>ref|NP_001048220.1| Os02g0765600 [Oryza sativa Japonica Group]
 sp|P17654.2|AMY1_ORYSJ RecName: Full=Alpha-amylase; AltName: Full=1,4-alpha-D-glucan 
glucanohydrolase; AltName: Full=Alpha-amylase isozyme 1B; Flags: 
Precursor [Oryza sativa Japonica Group]
 dbj|BAD17125.1| alpha-amylase [Oryza sativa Japonica Group]
 dbj|BAD17313.1| alpha-amylase [Oryza sativa Japonica Group]
 dbj|BAF10134.1| Os02g0765600 [Oryza sativa Japonica Group]
 gb|ACA50496.1| alpha-amylase [Oryza sativa Japonica Group]
 dbj|BAG95208.1| unnamed protein product [Oryza sativa Japonica Group]
Length=434

 Score =   455 bits (1170),  Expect = 2e-152, Method: Compositional matrix adjust.
 Identities = 228/420 (54%), Positives = 297/420 (71%), Gaps = 19/420 (5%)
 Frame = +2

Query  101   SSSTVLFQGFTWTSKDQPGGWWNWLITKVPDLADAGITHVWLPPPSNAREGDDQGYMPKR  280
             ++  VLFQGF W S  + GGW+N+L+ KV D+A AGITHVWLPPPS++    +QGYMP R
Sbjct  29    TAGQVLFQGFNWESWKENGGWYNFLMGKVDDIAAAGITHVWLPPPSHSV--GEQGYMPGR  86

Query  281   MYDLDTSKYGNKKELKALNDAFHGRGIKSVADIVLNHRAAERANSRGVFNVFEGGTPDDK  460
             +YDLD SKYGN+ +LK+L +AFHG+G++ +ADIV+NHR AE  + RG++ +FEGGTPD +
Sbjct  87    LYDLDASKYGNEAQLKSLIEAFHGKGVQVIADIVINHRTAEHKDGRGIYCLFEGGTPDSR  146

Query  461   LDWGPSEICGDDAAFEGTGNPDTGDPWGDAPDIDHRSPRVQREISEWMNWLKSDVGFDGW  640
             LDWGP  IC DD   +GTGNPDTG  +  APDIDH + RVQRE+  W++WLK D+GFD W
Sbjct  147   LDWGPHMICRDDPYGDGTGNPDTGADFAAAPDIDHLNKRVQRELIGWLDWLKMDIGFDAW  206

Query  641   RFDYVKGYDFVKGFAAVKIYMDNTKPEFAVGELWNALSPGSVPNPDYNQDAHRNELVRWV  820
             R D+ KGY         KIY+D T+P FAV E+W +++ G    P+Y+Q+AHR ELV WV
Sbjct  207   RLDFAKGYS----ADMAKIYIDATEPSFAVAEIWTSMANGGDGKPNYDQNAHRQELVNWV  262

Query  821   QNaggaatafdf---ttKGILQAALNNTELWRLKDAAGKPSGMIGVLPQSAVTFIDNHDT  991
                GGA +       TTKGIL  A+   ELWRL+   GK  GMIG  P  A TF+DNHDT
Sbjct  263   DRVGGANSNATAFDFTTKGILNVAVEG-ELWRLRGEDGKAPGMIGWWPAKATTFVDNHDT  321

Query  992   WS-QRLWPFTTSTDDAVNHDRVLQGYAYILTHPGIPSVFYDHFFEWGLKDAISKLISIRN  1168
              S Q LWPF +        D+V+QGYAYILTHPG P +FYDHFF+WGLK+ I +L+SIRN
Sbjct  322   GSTQHLWPFPS--------DKVMQGYAYILTHPGNPCIFYDHFFDWGLKEEIERLVSIRN  373

Query  1169  KNGVSATSPVEILAADADLYIAKINGKVILKIGPNGDLKNLVPSDFMLATSGKDFAVWEK  1348
             + G+   S + I+ AD+DLY+A+I+GKVI KIGP  D+++L+P  F +   G  +A+WEK
Sbjct  374   RQGIHPASELRIMEADSDLYLAEIDGKVITKIGPRYDVEHLIPEGFQVVAHGDGYAIWEK  433



>gb|ACZ72923.1| alpha-amylase isoform [Dactylis glomerata]
Length=427

 Score =   454 bits (1169),  Expect = 2e-152, Method: Compositional matrix adjust.
 Identities = 231/416 (56%), Positives = 299/416 (72%), Gaps = 19/416 (5%)
 Frame = +2

Query  113   VLFQGFTWTSKDQPGGWWNWLITKVPDLADAGITHVWLPPPSNAREGDDQGYMPKRMYDL  292
             VLFQGF W S  Q GGW+N L++KV D+A AGITHVWLPP S++    +QGYMP R+YDL
Sbjct  26    VLFQGFNWESWKQNGGWYNLLMSKVDDIAAAGITHVWLPPASHSIA--EQGYMPGRLYDL  83

Query  293   DTSKYGNKKELKALNDAFHGRGIKSVADIVLNHRAAERANSRGVFNVFEGGTPDDKLDWG  472
             D SKYGN+ +LKAL +A  G+G+K++ADIV+NHR AE  + RG++ +FEGGT D +LDWG
Sbjct  84    DASKYGNEAQLKALIEALKGKGVKAIADIVINHRTAEHKDGRGIYCLFEGGTSDARLDWG  143

Query  473   PSEICGDDAAF-EGTGNPDTGDPWGDAPDIDHRSPRVQREISEWMNWLKSDVGFDGWRFD  649
             P  IC DD  + +GTGNPDTG  +G APDIDH +P VQ+E+ EW+NWLK+D+GFD WR D
Sbjct  144   PHMICRDDRPYADGTGNPDTGADFGGAPDIDHLNPTVQKELVEWLNWLKTDIGFDAWRLD  203

Query  650   YVKGYDFVKGFAAVKIYMDNTKPEFAVGELWNALSPGSVPNPDYNQDAHRNELVRWVQNa  829
             + KGY         K+Y+D T+P FAV E+W +L+ G    P+ NQD HR ELV WV   
Sbjct  204   FAKGYSA----DVAKVYIDGTEPNFAVAEIWTSLAYGGDGKPNLNQDEHRQELVNWVNRV  259

Query  830   gga--atafdfttKGILQAALNNTELWRLKDAAGKPSGMIGVLPQSAVTFIDNHDTWS-Q  1000
             G +  AT FDFTTKG+L  A+   ELWRL+ A GK  GMIG LP  AVTF+DNHDT S Q
Sbjct  260   GASGPATTFDFTTKGVLNVAVEG-ELWRLRGADGKAPGMIGTLPGKAVTFVDNHDTGSTQ  318

Query  1001  RLWPFTTSTDDAVNHDRVLQGYAYILTHPGIPSVFYDHFFEWGLKDAISKLISIRNKNGV  1180
              +WPF +        DRV+QGYAYILTHPG P +FYDHFF+WG K+ I +L+SIR ++ +
Sbjct  319   HMWPFPS--------DRVMQGYAYILTHPGTPCIFYDHFFDWGHKEEIERLVSIRTRHEI  370

Query  1181  SATSPVEILAADADLYIAKINGKVILKIGPNGDLKNLVPSDFMLATSGKDFAVWEK  1348
              + S + I+ ADADLY+A+I+GKVI+K+G   D+++L+P  F +   G  +AVWEK
Sbjct  371   HSESELRIMEADADLYLAEIDGKVIVKLGTRSDVEHLIPGGFQVVAHGDGYAVWEK  426



>gb|AAA33885.1| alpha-amylase (EC 3.2.1.1) [Oryza sativa]
Length=434

 Score =   454 bits (1168),  Expect = 4e-152, Method: Compositional matrix adjust.
 Identities = 228/420 (54%), Positives = 297/420 (71%), Gaps = 19/420 (5%)
 Frame = +2

Query  101   SSSTVLFQGFTWTSKDQPGGWWNWLITKVPDLADAGITHVWLPPPSNAREGDDQGYMPKR  280
             ++  VLFQGF W S  + GGW+N+L+ KV D+A AGITHVWLPPPS++    +QGYMP R
Sbjct  29    TAGQVLFQGFNWESWKENGGWYNFLMGKVDDIAAAGITHVWLPPPSHSV--GEQGYMPGR  86

Query  281   MYDLDTSKYGNKKELKALNDAFHGRGIKSVADIVLNHRAAERANSRGVFNVFEGGTPDDK  460
             +YDLD SKYGN+ +LK+L +AFHG+G++ +ADIV+NHR AE  + RG++ +FEGGTPD +
Sbjct  87    LYDLDASKYGNEAQLKSLIEAFHGKGVQVIADIVINHRTAEHKDGRGIYCLFEGGTPDSR  146

Query  461   LDWGPSEICGDDAAFEGTGNPDTGDPWGDAPDIDHRSPRVQREISEWMNWLKSDVGFDGW  640
             LDWGP  IC DD   +GTGNPDTG  +  APDIDH + RVQRE+  W++WLK D+GFD W
Sbjct  147   LDWGPHMICRDDPYGDGTGNPDTGADFAAAPDIDHLNKRVQRELIGWLDWLKMDIGFDAW  206

Query  641   RFDYVKGYDFVKGFAAVKIYMDNTKPEFAVGELWNALSPGSVPNPDYNQDAHRNELVRWV  820
             R D+ KGY         KIY+D T+P FAV E+W +++ G    P+Y+Q+AHR ELV WV
Sbjct  207   RLDFAKGYS----ADMAKIYIDATEPSFAVAEIWTSMANGGDGKPNYDQNAHRQELVNWV  262

Query  821   QNaggaatafdf---ttKGILQAALNNTELWRLKDAAGKPSGMIGVLPQSAVTFIDNHDT  991
                GGA +       TTKGIL  A+   ELWRL+   GK  GMIG  P  A TF+DNHDT
Sbjct  263   DRVGGANSNGTAFDFTTKGILNVAVEG-ELWRLRGEDGKAPGMIGWWPAKATTFVDNHDT  321

Query  992   WS-QRLWPFTTSTDDAVNHDRVLQGYAYILTHPGIPSVFYDHFFEWGLKDAISKLISIRN  1168
              S Q LWPF +        D+V+QGYAYILTHPG P +FYDHFF+WGLK+ I +L+SIRN
Sbjct  322   GSTQHLWPFPS--------DKVMQGYAYILTHPGNPCIFYDHFFDWGLKEEIERLVSIRN  373

Query  1169  KNGVSATSPVEILAADADLYIAKINGKVILKIGPNGDLKNLVPSDFMLATSGKDFAVWEK  1348
             + G+   S + I+ AD+DLY+A+I+GKVI KIGP  D+++L+P  F +   G  +A+WEK
Sbjct  374   RQGIHPASELRIMEADSDLYLAEIDGKVITKIGPRYDVEHLIPEGFQVVAHGDGYAIWEK  433



>emb|CAA34516.1| alpha-amylase [Oryza sativa Japonica Group]
Length=428

 Score =   454 bits (1168),  Expect = 4e-152, Method: Compositional matrix adjust.
 Identities = 228/420 (54%), Positives = 297/420 (71%), Gaps = 19/420 (5%)
 Frame = +2

Query  101   SSSTVLFQGFTWTSKDQPGGWWNWLITKVPDLADAGITHVWLPPPSNAREGDDQGYMPKR  280
             ++  VLFQGF W S  + GGW+N+L+ KV D+A AGITHVWLPPPS++    +QGYMP R
Sbjct  23    TAGQVLFQGFNWESWKENGGWYNFLMGKVDDIAAAGITHVWLPPPSHSV--GEQGYMPGR  80

Query  281   MYDLDTSKYGNKKELKALNDAFHGRGIKSVADIVLNHRAAERANSRGVFNVFEGGTPDDK  460
             +YDLD SKYGN+ +LK+L +AFHG+G++ +ADIV+NHR AE  + RG++ +FEGGTPD +
Sbjct  81    LYDLDASKYGNEAQLKSLIEAFHGKGVQVIADIVINHRTAEHKDGRGIYCLFEGGTPDSR  140

Query  461   LDWGPSEICGDDAAFEGTGNPDTGDPWGDAPDIDHRSPRVQREISEWMNWLKSDVGFDGW  640
             LDWGP  IC DD   +GTGNPDTG  +  APDIDH + RVQRE+  W++WLK D+GFD W
Sbjct  141   LDWGPHMICRDDPYGDGTGNPDTGADFAAAPDIDHLNKRVQRELIGWLDWLKMDIGFDAW  200

Query  641   RFDYVKGYDFVKGFAAVKIYMDNTKPEFAVGELWNALSPGSVPNPDYNQDAHRNELVRWV  820
             R D+ KGY         KIY+D T+P FAV E+W +++ G    P+Y+Q+AHR ELV WV
Sbjct  201   RLDFAKGYS----ADMAKIYIDATEPSFAVAEIWTSMANGGDGKPNYDQNAHRQELVNWV  256

Query  821   QNaggaatafdf---ttKGILQAALNNTELWRLKDAAGKPSGMIGVLPQSAVTFIDNHDT  991
                GGA +       TTKGIL  A+   ELWRL+   GK  GMIG  P  A TF+DNHDT
Sbjct  257   DRVGGANSNGTAFDFTTKGILNVAVEG-ELWRLRGEDGKAPGMIGWWPAKATTFVDNHDT  315

Query  992   WS-QRLWPFTTSTDDAVNHDRVLQGYAYILTHPGIPSVFYDHFFEWGLKDAISKLISIRN  1168
              S Q LWPF +        D+V+QGYAYILTHPG P +FYDHFF+WGLK+ I +L+SIRN
Sbjct  316   GSTQHLWPFPS--------DKVMQGYAYILTHPGNPCIFYDHFFDWGLKEEIERLVSIRN  367

Query  1169  KNGVSATSPVEILAADADLYIAKINGKVILKIGPNGDLKNLVPSDFMLATSGKDFAVWEK  1348
             + G+   S + I+ AD+DLY+A+I+GKVI KIGP  D+++L+P  F +   G  +A+WEK
Sbjct  368   RQGIHPASELRIMEADSDLYLAEIDGKVITKIGPRYDVEHLIPEGFQVVAHGDGYAIWEK  427



>pdb|3WN6|A Chain A, Crystal Structure Of Alpha-amylase Amyi-1 From Oryza 
Sativa
 pdb|3WN6|B Chain B, Crystal Structure Of Alpha-amylase Amyi-1 From Oryza 
Sativa
 pdb|3WN6|C Chain C, Crystal Structure Of Alpha-amylase Amyi-1 From Oryza 
Sativa
 pdb|3WN6|D Chain D, Crystal Structure Of Alpha-amylase Amyi-1 From Oryza 
Sativa
Length=404

 Score =   453 bits (1165),  Expect = 5e-152, Method: Compositional matrix adjust.
 Identities = 228/416 (55%), Positives = 295/416 (71%), Gaps = 19/416 (5%)
 Frame = +2

Query  113   VLFQGFTWTSKDQPGGWWNWLITKVPDLADAGITHVWLPPPSNAREGDDQGYMPKRMYDL  292
             VLFQGF W S  + GGW+N+L+ KV D+A AGITHVWLPPPS++    +QGYMP R+YDL
Sbjct  3     VLFQGFNWESWKENGGWYNFLMGKVDDIAAAGITHVWLPPPSHSV--GEQGYMPGRLYDL  60

Query  293   DTSKYGNKKELKALNDAFHGRGIKSVADIVLNHRAAERANSRGVFNVFEGGTPDDKLDWG  472
             D SKYGN+ +LK+L +AFHG+G++ +ADIV+NHR AE  + RG++ +FEGGTPD +LDWG
Sbjct  61    DASKYGNEAQLKSLIEAFHGKGVQVIADIVINHRTAEHKDGRGIYCLFEGGTPDSRLDWG  120

Query  473   PSEICGDDAAFEGTGNPDTGDPWGDAPDIDHRSPRVQREISEWMNWLKSDVGFDGWRFDY  652
             P  IC DD   +GTGNPDTG  +  APDIDH + RVQRE+  W++WLK D+GFD WR D+
Sbjct  121   PHMICRDDPYGDGTGNPDTGADFAAAPDIDHLNKRVQRELIGWLDWLKMDIGFDAWRLDF  180

Query  653   VKGYDFVKGFAAVKIYMDNTKPEFAVGELWNALSPGSVPNPDYNQDAHRNELVRWVQNag  832
              KGY         KIY+D T+P FAV E+W +++ G    P+Y+Q+AHR ELV WV   G
Sbjct  181   AKGYS----ADMAKIYIDATEPSFAVAEIWTSMANGGDGKPNYDQNAHRQELVNWVDRVG  236

Query  833   gaatafdf---ttKGILQAALNNTELWRLKDAAGKPSGMIGVLPQSAVTFIDNHDTWS-Q  1000
             GA +       TTKGIL  A+   ELWRL+   GK  GMIG  P  A TF+DNHDT S Q
Sbjct  237   GANSNATAFDFTTKGILNVAVEG-ELWRLRGEDGKAPGMIGWWPAKATTFVDNHDTGSTQ  295

Query  1001  RLWPFTTSTDDAVNHDRVLQGYAYILTHPGIPSVFYDHFFEWGLKDAISKLISIRNKNGV  1180
              LWPF +        D+V+QGYAYILTHPG P +FYDHFF+WGLK+ I +L+SIRN+ G+
Sbjct  296   HLWPFPS--------DKVMQGYAYILTHPGNPCIFYDHFFDWGLKEEIERLVSIRNRQGI  347

Query  1181  SATSPVEILAADADLYIAKINGKVILKIGPNGDLKNLVPSDFMLATSGKDFAVWEK  1348
                S + I+ AD+DLY+A+I+GKVI KIGP  D+++L+P  F +   G  +A+WEK
Sbjct  348   HPASELRIMEADSDLYLAEIDGKVITKIGPRYDVEHLIPEGFQVVAHGDGYAIWEK  403



>gb|EAY87654.1| hypothetical protein OsI_09066 [Oryza sativa Indica Group]
Length=428

 Score =   454 bits (1167),  Expect = 5e-152, Method: Compositional matrix adjust.
 Identities = 228/420 (54%), Positives = 295/420 (70%), Gaps = 19/420 (5%)
 Frame = +2

Query  101   SSSTVLFQGFTWTSKDQPGGWWNWLITKVPDLADAGITHVWLPPPSNAREGDDQGYMPKR  280
             ++  VLFQGF W S  + GGW+N L+ KV D+A AGITHVWLPPPS +    +QGYMP R
Sbjct  23    AAGQVLFQGFNWESWKENGGWYNMLMGKVDDIAAAGITHVWLPPPSQSVA--EQGYMPGR  80

Query  281   MYDLDTSKYGNKKELKALNDAFHGRGIKSVADIVLNHRAAERANSRGVFNVFEGGTPDDK  460
             +YDLD SKYGN+ +LK+L +AFHG+G++ +ADIV+NHR AE  + RG++ +FEGGTPD +
Sbjct  81    LYDLDASKYGNEAQLKSLIEAFHGKGVQVIADIVINHRTAEHKDGRGIYCLFEGGTPDSR  140

Query  461   LDWGPSEICGDDAAFEGTGNPDTGDPWGDAPDIDHRSPRVQREISEWMNWLKSDVGFDGW  640
             LDWGP  IC DD   +GTGNPDTG  +  APDIDH + RVQRE+  W++WLK D+GFD W
Sbjct  141   LDWGPHMICRDDPYGDGTGNPDTGADFAAAPDIDHLNKRVQRELIGWLDWLKMDIGFDAW  200

Query  641   RFDYVKGYDFVKGFAAVKIYMDNTKPEFAVGELWNALSPGSVPNPDYNQDAHRNELVRWV  820
             R D+ KGY         KIY+D T+P FAV E+W +++ G    P+Y+Q+AHR ELV WV
Sbjct  201   RLDFAKGYS----ADMAKIYIDATEPSFAVAEIWTSMANGGDGKPNYDQNAHRQELVNWV  256

Query  821   QNaggaatafdf---ttKGILQAALNNTELWRLKDAAGKPSGMIGVLPQSAVTFIDNHDT  991
                GGA +       TTKGIL  A+   ELWRL+   GK  GMIG  P  A TF+DNHDT
Sbjct  257   DRVGGANSNATAFDFTTKGILNVAVEG-ELWRLRGEDGKAPGMIGWWPAKATTFVDNHDT  315

Query  992   WS-QRLWPFTTSTDDAVNHDRVLQGYAYILTHPGIPSVFYDHFFEWGLKDAISKLISIRN  1168
              S Q LWPF +        D+V+QGYAYILTHPG P +FYDHFF+WGLK+ I +L+SIRN
Sbjct  316   GSTQHLWPFPS--------DKVMQGYAYILTHPGNPCIFYDHFFDWGLKEEIERLVSIRN  367

Query  1169  KNGVSATSPVEILAADADLYIAKINGKVILKIGPNGDLKNLVPSDFMLATSGKDFAVWEK  1348
             + G+   S + I+ AD+DLY+A+I+GKVI KIGP  D+++L+P  F +   G  +A+WEK
Sbjct  368   RQGIHPASELRIMEADSDLYLAEIDGKVITKIGPRYDVEHLIPEGFQVVAHGDGYAIWEK  427



>ref|XP_002460331.1| hypothetical protein SORBIDRAFT_02g026610 [Sorghum bicolor]
 ref|XP_002460332.1| hypothetical protein SORBIDRAFT_02g026620 [Sorghum bicolor]
 gb|EER96852.1| hypothetical protein SORBIDRAFT_02g026610 [Sorghum bicolor]
 gb|EER96853.1| hypothetical protein SORBIDRAFT_02g026620 [Sorghum bicolor]
Length=437

 Score =   454 bits (1168),  Expect = 5e-152, Method: Compositional matrix adjust.
 Identities = 235/416 (56%), Positives = 291/416 (70%), Gaps = 17/416 (4%)
 Frame = +2

Query  107   STVLFQGFTWTSKDQPGGWWNWLITKVPDLADAGITHVWLPPPSNAREGDDQGYMPKRMY  286
             S VLFQGF W S  + GGW+N+L  +V D+A  G THVWLPPPS++     QGYMP R+Y
Sbjct  26    SQVLFQGFNWESCKKQGGWYNYLRGQVDDIAATGATHVWLPPPSHSVA--PQGYMPGRLY  83

Query  287   DLDTSKYGNKKELKALNDAFHGRGIKSVADIVLNHRAAERANSRGVFNVFEGGTPDDKLD  466
             DLD SKYG   ELK+L  AFH +G++ VAD+V+NHR A+  +SRG++ +FEGGTPD +LD
Sbjct  84    DLDASKYGTHAELKSLIAAFHAKGVQCVADVVINHRCADYKDSRGIYCIFEGGTPDSRLD  143

Query  467   WGPSEICGDDAAFE-GTGNPDTGDPWGDAPDIDHRSPRVQREISEWMNWLKSDVGFDGWR  643
             WGP  IC DD  +  G G+ DTG  +G APDIDH +PRVQ E+S W+NWLKSD+GFDGWR
Sbjct  144   WGPDMICSDDTQYSNGRGHRDTGADFGAAPDIDHLNPRVQEELSGWLNWLKSDLGFDGWR  203

Query  644   FDYVKGYDFVKGFAAVKIYMDNTKPEFAVGELWNALSPGSVPNPDYNQDAHRNELVRWVQ  823
              D+ KGY      A  K+Y+DNT P F V E+W++L       P  NQDA R ELV W Q
Sbjct  204   LDFAKGYSA----AVAKVYVDNTAPTFVVAEIWSSLHYDGNGEPSNNQDADRQELVNWAQ  259

Query  824   NaggaatafdfttKGILQAALNNTELWRLKDAAGKPSGMIGVLPQSAVTFIDNHDTWS-Q  1000
               GG A AFDFTTKG+LQAA+   ELWR+KD  GK  GMIG LP+ AVTF+DNHDT S Q
Sbjct  260   AVGGPAAAFDFTTKGVLQAAVQG-ELWRMKDGNGKAPGMIGWLPEKAVTFVDNHDTGSTQ  318

Query  1001  RLWPFTTSTDDAVNHDRVLQGYAYILTHPGIPSVFYDHFFEWGLKDAISKLISIRNKNGV  1180
               WPF +        D+V+QGYAYILTHPG P +FYDH F+W LK  IS L ++R++NG+
Sbjct  319   NSWPFPS--------DKVMQGYAYILTHPGTPCIFYDHVFDWNLKQEISALSAVRSRNGI  370

Query  1181  SATSPVEILAADADLYIAKINGKVILKIGPNGDLKNLVPSDFMLATSGKDFAVWEK  1348
                S + ILAAD DLY+AKI+ KVI+KIG   D+ NL+PSDF     G ++ VWEK
Sbjct  371   HPGSKLNILAADGDLYVAKIDDKVIVKIGSRYDVGNLIPSDFHAVAHGNNYCVWEK  426



>ref|XP_010320333.1| PREDICTED: alpha-amylase isoform X2 [Solanum lycopersicum]
Length=351

 Score =   451 bits (1159),  Expect = 5e-152, Method: Compositional matrix adjust.
 Identities = 233/362 (64%), Positives = 286/362 (79%), Gaps = 15/362 (4%)
 Frame = +2

Query  269   MPKRMYDLDTSKYGNKKELKALNDAFHGRGIKSVADIVLNHRAAERANSRGVFNVFEGGT  448
             MP R+YDLD SK+GN+++LK L  A H  GIKSVADIV+NHR A+  +SRG++++FEGGT
Sbjct  1     MPGRLYDLDASKFGNQQQLKTLIKALHDHGIKSVADIVINHRTADNKDSRGIYSIFEGGT  60

Query  449   PDDKLDWGPSEICGDDAAF-EGTGNPDTGDPWGDAPDIDHRSPRVQREISEWMNWLKSDV  625
              DD+LDWGPS IC +D  + +GTGNPDTG  +  APDIDH + RVQ+E+S+WMNWLKS++
Sbjct  61    SDDRLDWGPSFICKNDTQYSDGTGNPDTGLDFEPAPDIDHLNTRVQKELSDWMNWLKSEI  120

Query  626   GFDGWRFDYVKGYDFVKGFAAVKIYMDNTKPEFAVGELWNALSPGSVPNPDYNQDAHRNE  805
             GFDGWRFD+V+GY         KIYM NT P+FAVGELWN+L+ G    P+YNQD HRNE
Sbjct  121   GFDGWRFDFVRGY----APCITKIYMGNTSPDFAVGELWNSLAYGQDGKPEYNQDNHRNE  176

Query  806   LVRWVQNaggaatafdfttKGILQAALNNTELWRLKDAAGKPSGMIGVLPQSAVTFIDNH  985
             LV WV+NAG A TAFDFTTKGILQAA+   ELWRLKD  GKP GMIGVLP+ AVTFIDNH
Sbjct  177   LVGWVKNAGRAVTAFDFTTKGILQAAVQE-ELWRLKDPNGKPPGMIGVLPRKAVTFIDNH  235

Query  986   DTWS-QRLWPFTTSTDDAVNHDRVLQGYAYILTHPGIPSVFYDHFFEWGLKDAISKLISI  1162
             DT S Q +WPF +        D+V+QGYAYILTHPGIPSVFYDHFF+WG KD IS LISI
Sbjct  236   DTGSTQNMWPFPS--------DKVMQGYAYILTHPGIPSVFYDHFFDWGFKDGISALISI  287

Query  1163  RNKNGVSATSPVEILAADADLYIAKINGKVILKIGPNGDLKNLVPSDFMLATSGKDFAVW  1342
             R +N + ATS V+I+A+D+DLYIA I+ K+I+KIGP  DL NL+P ++ +ATSG+D+AVW
Sbjct  288   RKRNRICATSNVQIMASDSDLYIAMIHHKIIVKIGPKLDLGNLIPPNYEVATSGQDYAVW  347

Query  1343  EK  1348
             E+
Sbjct  348   EQ  349



>ref|NP_001105539.1| alpha-amylase precursor [Zea mays]
 gb|AAA50161.1| alpha-amylase [Zea mays]
Length=439

 Score =   454 bits (1167),  Expect = 7e-152, Method: Compositional matrix adjust.
 Identities = 234/418 (56%), Positives = 293/418 (70%), Gaps = 17/418 (4%)
 Frame = +2

Query  101   SSSTVLFQGFTWTSKDQPGGWWNWLITKVPDLADAGITHVWLPPPSNAREGDDQGYMPKR  280
             + S VLFQGF W S  + GGW+N+L+ +V D+A  G THVWLPPPS++     QGYMP R
Sbjct  26    AQSQVLFQGFNWESWKKQGGWYNYLLGRVDDIAATGATHVWLPPPSHSVA--PQGYMPGR  83

Query  281   MYDLDTSKYGNKKELKALNDAFHGRGIKSVADIVLNHRAAERANSRGVFNVFEGGTPDDK  460
             +YDLD SKYG   ELK+L  AFH +G+K VAD+V+NHR A+  + RG++ VFEGGTPD +
Sbjct  84    LYDLDASKYGTHAELKSLTAAFHAKGVKCVADVVINHRCADYKDGRGIYCVFEGGTPDSR  143

Query  461   LDWGPSEICGDDAAFE-GTGNPDTGDPWGDAPDIDHRSPRVQREISEWMNWLKSDVGFDG  637
             LDWGP  IC DD  +  G G+ DTG  +  APDIDH +PRVQ+E+S+W+NWLKSD+GFDG
Sbjct  144   LDWGPDMICSDDTQYSNGRGHRDTGADFAAAPDIDHLNPRVQQELSDWLNWLKSDLGFDG  203

Query  638   WRFDYVKGYDFVKGFAAVKIYMDNTKPEFAVGELWNALSPGSVPNPDYNQDAHRNELVRW  817
             WR D+ KGY      A  K+Y+D+T P F V E+W++L       P  NQDA R ELV W
Sbjct  204   WRLDFAKGYSA----AVAKVYVDSTAPTFVVAEIWSSLHYDGNGEPSSNQDADRQELVNW  259

Query  818   VQNaggaatafdfttKGILQAALNNTELWRLKDAAGKPSGMIGVLPQSAVTFIDNHDTWS  997
              Q  GG A AFDFTTKG+LQAA+   ELWR+KD  GK  GMIG LP+ AVTF+DNHDT S
Sbjct  260   AQAVGGPAAAFDFTTKGVLQAAVQG-ELWRMKDGNGKAPGMIGWLPEKAVTFVDNHDTGS  318

Query  998   -QRLWPFTTSTDDAVNHDRVLQGYAYILTHPGIPSVFYDHFFEWGLKDAISKLISIRNKN  1174
              Q  WPF +        D+V+QGYAYILTHPG P +FYDH F+W LK  IS L ++R++N
Sbjct  319   TQNSWPFPS--------DKVMQGYAYILTHPGTPCIFYDHVFDWNLKQEISALSAVRSRN  370

Query  1175  GVSATSPVEILAADADLYIAKINGKVILKIGPNGDLKNLVPSDFMLATSGKDFAVWEK  1348
             G+   S + ILAAD DLY+AKI+ KVI+KIG   D+ NL+PSDF     G ++ VWEK
Sbjct  371   GIHPGSELNILAADGDLYVAKIDDKVIVKIGSRYDVGNLIPSDFHAVAHGNNYCVWEK  428



>dbj|BAD17123.1| putative alpha-amylase precursor [Oryza sativa Japonica Group]
 dbj|BAD17311.1| putative alpha-amylase precursor [Oryza sativa Japonica Group]
 gb|EAZ24726.1| hypothetical protein OsJ_08496 [Oryza sativa Japonica Group]
 gb|ACA50497.1| alpha-amylase [Oryza sativa Japonica Group]
Length=428

 Score =   453 bits (1166),  Expect = 7e-152, Method: Compositional matrix adjust.
 Identities = 229/420 (55%), Positives = 294/420 (70%), Gaps = 19/420 (5%)
 Frame = +2

Query  101   SSSTVLFQGFTWTSKDQPGGWWNWLITKVPDLADAGITHVWLPPPSNAREGDDQGYMPKR  280
             ++  VLFQGF W S  + GGW+N L+ KV D+A AGITHVWLPPPS +    +QGYMP R
Sbjct  23    AAGQVLFQGFNWESWKENGGWYNMLMGKVDDIAAAGITHVWLPPPSQSVA--EQGYMPGR  80

Query  281   MYDLDTSKYGNKKELKALNDAFHGRGIKSVADIVLNHRAAERANSRGVFNVFEGGTPDDK  460
             +YDLD SKYGN+ +LK+L +AFHG+G++ +ADIV+NHR AE  + RG++ +FEGGTPD +
Sbjct  81    LYDLDASKYGNEAQLKSLIEAFHGKGVQVIADIVINHRTAEHKDGRGIYCLFEGGTPDSR  140

Query  461   LDWGPSEICGDDAAFEGTGNPDTGDPWGDAPDIDHRSPRVQREISEWMNWLKSDVGFDGW  640
             LDWGP  IC  D   +GTGNPDTG  +G APDIDH + RVQRE+  W++WLK D+GFD W
Sbjct  141   LDWGPHMICRGDPYGDGTGNPDTGADFGAAPDIDHLNKRVQRELIGWLDWLKMDIGFDAW  200

Query  641   RFDYVKGYDFVKGFAAVKIYMDNTKPEFAVGELWNALSPGSVPNPDYNQDAHRNELVRWV  820
             R D+ KGY         KIY+D T+P FAV E+W +L+ G    PDY+Q+AHR ELV WV
Sbjct  201   RLDFAKGYS----ADVAKIYIDATEPSFAVAEIWTSLAYGGDGKPDYDQNAHRQELVNWV  256

Query  821   QNaggaatafdf---ttKGILQAALNNTELWRLKDAAGKPSGMIGVLPQSAVTFIDNHDT  991
                GGA +       TTKGIL  A+   ELWRL+   GK  GMIG  P  A TFIDNHDT
Sbjct  257   DRVGGANSNATTFDFTTKGILNVAVEG-ELWRLRGEDGKAPGMIGWWPAKATTFIDNHDT  315

Query  992   WS-QRLWPFTTSTDDAVNHDRVLQGYAYILTHPGIPSVFYDHFFEWGLKDAISKLISIRN  1168
              S Q +WPF +        D+V+QGYAYILTHPG P +FYDHFF+WG K+ I +L+SIRN
Sbjct  316   GSTQHMWPFPS--------DKVMQGYAYILTHPGNPCIFYDHFFDWGHKEEIERLVSIRN  367

Query  1169  KNGVSATSPVEILAADADLYIAKINGKVILKIGPNGDLKNLVPSDFMLATSGKDFAVWEK  1348
             + G+   S + I+ AD+DLY+A+I+GKVI K+GP  D+++L+P  F +   G  +AVWEK
Sbjct  368   RQGIHPASELRIMEADSDLYLAEIDGKVITKVGPRYDVEHLIPEGFQVVAHGDGYAVWEK  427



>ref|XP_010061758.1| PREDICTED: alpha-amylase-like [Eucalyptus grandis]
Length=422

 Score =   453 bits (1166),  Expect = 7e-152, Method: Compositional matrix adjust.
 Identities = 243/438 (55%), Positives = 314/438 (72%), Gaps = 19/438 (4%)
 Frame = +2

Query  41    MKSSFYLSLFCIAFFLFPLHSSSTVLFQGFTWTSKDQPGGWWNWLITKVPDLADAGITHV  220
             M S  +   F ++       +S  +LFQGF W S ++ GGW+N L   VPDLA+AGITHV
Sbjct  1     MSSHSFFWFFVLSISYLAALTSPALLFQGFNWESSEKEGGWYNSLKNLVPDLANAGITHV  60

Query  221   WLPPPSNAREGDDQGYMPKRMYDLDTSKYGNKKELKALNDAFHGRGIKSVADIVLNHRAA  400
             WLPPPS +   D  GYMP R+YDL+ S YGN+ ELK L DAFH   IK +ADIV+NHR A
Sbjct  61    WLPPPSQS--ADQHGYMPGRLYDLNASSYGNQDELKQLIDAFHQNRIKCLADIVINHRTA  118

Query  401   ERANSRGVFNVFEGGTPDDKLDWGPSEICGDDAAF-EGTGNPDTGDPWGDAPDIDHRSPR  577
              + +SRGV+ +FEGGTPD++LDWGPS IC +D  + +G GNPDTG+ +  APDIDH +PR
Sbjct  119   AKQDSRGVWCIFEGGTPDNRLDWGPSFICRNDTEYSDGVGNPDTGEDFEPAPDIDHLNPR  178

Query  578   VQREISEWMNWLKSDVGFDGWRFDYVKGYDFVKGFAAVKIYMDNTKPEFAVGELWNALSP  757
             VQ+E+S+WMNWLKSD+GFDGW+F++V+GY         KIYM+ T P F VGE    LS 
Sbjct  179   VQKELSDWMNWLKSDIGFDGWQFNFVQGY----APNITKIYMNQTSPNFTVGEREEQLSY  234

Query  758   GSVPNPDYNQDAHRNELVRWVQNaggaatafdfttKGILQAALNNTELWRLKDAAGKPSG  937
             G     + +QD HR  LV WV +AGGA TAFDFTT+GILQAA+   ELWRL D+ G P G
Sbjct  235   GEDGKLNPDQDKHRRALVDWVNDAGGAITAFDFTTRGILQAAVQG-ELWRLMDSKGMPPG  293

Query  938   MIGVLPQSAVTFIDNHDTWS-QRLWPFTTSTDDAVNHDRVLQGYAYILTHPGIPSVFYDH  1114
             +IG+ P SAVTFIDNH+T S Q+  PF         +D+V+QGYAYILTHPG+PS+FYDH
Sbjct  294   LIGLQPGSAVTFIDNHNTGSTQKKSPFP--------YDKVMQGYAYILTHPGVPSIFYDH  345

Query  1115  FFEWGLKDAISKLISIRNKNGVSATSPVEILAADADLYIAKINGKVILKIGPNGDLKNLV  1294
             F   GLK+ I KLI+IR +N ++  S V+ILA+D+DLY+A+I+  VI+KIGP  ++ +LV
Sbjct  346   FL--GLKEEIGKLITIRARNQINEKSSVKILASDSDLYVAEIDHGVIMKIGPKFEVGDLV  403

Query  1295  PSDFMLATSGKDFAVWEK  1348
             P ++ +ATSG+D+ VWEK
Sbjct  404   PPNYRIATSGQDYCVWEK  421



>ref|XP_004957016.1| PREDICTED: alpha-amylase isozyme 3C-like [Setaria italica]
Length=437

 Score =   454 bits (1167),  Expect = 8e-152, Method: Compositional matrix adjust.
 Identities = 236/418 (56%), Positives = 295/418 (71%), Gaps = 17/418 (4%)
 Frame = +2

Query  101   SSSTVLFQGFTWTSKDQPGGWWNWLITKVPDLADAGITHVWLPPPSNAREGDDQGYMPKR  280
             + S VLFQGF W S  + GGW+N+L  +V D+A  G THVWLPPPS++     QGYMP R
Sbjct  24    AQSQVLFQGFNWESWKKQGGWYNFLRGRVDDIAATGATHVWLPPPSHSVA--PQGYMPGR  81

Query  281   MYDLDTSKYGNKKELKALNDAFHGRGIKSVADIVLNHRAAERANSRGVFNVFEGGTPDDK  460
             +YDLD SKYG   ELK+L  AFH +GI+ VADIV+NHR A+  +SRG++ VFEGGTPD +
Sbjct  82    LYDLDASKYGTHAELKSLIAAFHAKGIQCVADIVINHRCADYKDSRGIYCVFEGGTPDSR  141

Query  461   LDWGPSEICGDDAAFE-GTGNPDTGDPWGDAPDIDHRSPRVQREISEWMNWLKSDVGFDG  637
             LDWGP  IC DD  +  G G+ DTG  +G APDIDH +PRVQ+E+++W+NWLK+D+GFDG
Sbjct  142   LDWGPDMICSDDTQYSNGRGHRDTGADFGAAPDIDHLNPRVQQELADWLNWLKTDLGFDG  201

Query  638   WRFDYVKGYDFVKGFAAVKIYMDNTKPEFAVGELWNALSPGSVPNPDYNQDAHRNELVRW  817
             WR D+ KGY      A  K+Y+DNT P F V E+W++L       P   QD  R ELV W
Sbjct  202   WRLDFAKGYSA----AVAKVYVDNTAPTFVVAEIWSSLQYDGNGEPSSIQDKDRQELVNW  257

Query  818   VQNaggaatafdfttKGILQAALNNTELWRLKDAAGKPSGMIGVLPQSAVTFIDNHDTWS  997
              Q  GG A AFDFTTKG+LQAA+   ELWR+KD  GK  GMIG LP+ AVTF+DNHDT S
Sbjct  258   AQAVGGPAAAFDFTTKGVLQAAVQG-ELWRMKDGNGKAPGMIGWLPEKAVTFVDNHDTGS  316

Query  998   -QRLWPFTTSTDDAVNHDRVLQGYAYILTHPGIPSVFYDHFFEWGLKDAISKLISIRNKN  1174
              Q  WPF +        D+V+QGYAYILTHPG P +FYDH F+W LK  IS L ++R++N
Sbjct  317   TQNSWPFPS--------DKVMQGYAYILTHPGTPCIFYDHVFDWNLKQEISTLSTVRSRN  368

Query  1175  GVSATSPVEILAADADLYIAKINGKVILKIGPNGDLKNLVPSDFMLATSGKDFAVWEK  1348
             G+ A S ++ILAAD DLY+AKI+ KVI+KIG   D+ NL+PSDF L   G ++ VWEK
Sbjct  369   GIHAGSKLDILAADGDLYVAKIDDKVIVKIGSRYDVGNLIPSDFHLIAHGNNYCVWEK  426



>ref|XP_002867631.1| hypothetical protein ARALYDRAFT_492338 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH43890.1| hypothetical protein ARALYDRAFT_492338 [Arabidopsis lyrata subsp. 
lyrata]
Length=423

 Score =   453 bits (1165),  Expect = 1e-151, Method: Compositional matrix adjust.
 Identities = 238/438 (54%), Positives = 314/438 (72%), Gaps = 21/438 (5%)
 Frame = +2

Query  47    SSFYLSLFC--IAFFLFPLHS-SSTVLFQGFTWTSKDQPGGWWNWLITKVPDLADAGITH  217
             +S +  LF   + F +FP  + SST+LFQ F W S  + GG++N L   + D+A+AG+TH
Sbjct  2     TSLHTLLFTSLLFFIVFPAFTFSSTLLFQSFNWESWKKDGGFYNSLHNSIDDIANAGVTH  61

Query  218   VWLPPPSNAREGDDQGYMPKRMYDLDTSKYGNKKELKALNDAFHGRGIKSVADIVLNHRA  397
             +WLPPPS +     +GY+P ++YDL++SKYG++ ELK+L  A + +GIKS+ADIV+NHR 
Sbjct  62    LWLPPPSQSVA--PEGYLPGKLYDLNSSKYGSEAELKSLIKALNQKGIKSLADIVINHRT  119

Query  398   AERANSRGVFNVFEGGTPDDKLDWGPSEICGDDAAFEGTGNPDTGDPWGDAPDIDHRSPR  577
             AER + +  +  FEGGT DD+LDW PS +C +D  F GTGN DTG  +  APDIDH +PR
Sbjct  120   AERKDDKCGYCYFEGGTSDDRLDWDPSFVCRNDPKFPGTGNLDTGGDFDGAPDIDHLNPR  179

Query  578   VQREISEWMNWLKSDVGFDGWRFDYVKGYDFVKGFAAVKIYMDNTKPEFAVGELWNALSP  757
             VQ+E+SEWMNWLKS++GF GWRFDYV+GY      +  K+Y+ NT P+FAVGE WN +  
Sbjct  180   VQKELSEWMNWLKSEIGFHGWRFDYVRGY----ASSVTKLYVQNTSPDFAVGENWNDMKY  235

Query  758   GSVPNPDYNQDAHRNELVRWVQNaggaatafd-fttKGILQAALNNTELWRLKDAAGKPS  934
             G     DY+Q+ HR+ L +W++ AGG       FTTKGILQ+A+   ELWRLKD+ GKP 
Sbjct  236   GGDGKLDYDQNEHRSGLKQWIEEAGGGVLTAFDFTTKGILQSAVKG-ELWRLKDSQGKPP  294

Query  935   GMIGVLPQSAVTFIDNHDTWSQRLWPFTTSTDDAVNHDRVLQGYAYILTHPGIPSVFYDH  1114
             G+IG+ P +AVTFIDNHDT+  R W F +        D+VL GY YILTHPGIP +FY+H
Sbjct  295   GLIGINPGNAVTFIDNHDTF--RTWTFPS--------DKVLLGYVYILTHPGIPCIFYNH  344

Query  1115  FFEWGLKDAISKLISIRNKNGVSATSPVEILAADADLYIAKINGKVILKIGPNGDLKNLV  1294
             + EWGLK++ISKL++IRNKNG+  TS V I  A++DLY+A I+ KVI+KIGP  D+  LV
Sbjct  345   YIEWGLKESISKLVAIRNKNGIGNTSSVTIKVAESDLYVANIDDKVIMKIGPKQDVGTLV  404

Query  1295  PSDFMLATSGKDFAVWEK  1348
             PS+F LA SG DFAVWEK
Sbjct  405   PSNFALAYSGLDFAVWEK  422



>gb|AAA33886.1| alpha-amylase (EC 3.2.1.1) [Oryza sativa]
Length=434

 Score =   453 bits (1165),  Expect = 1e-151, Method: Compositional matrix adjust.
 Identities = 234/417 (56%), Positives = 298/417 (71%), Gaps = 19/417 (5%)
 Frame = +2

Query  104   SSTVLFQGFTWTSKDQPGGWWNWLITKVPDLADAGITHVWLPPPSNAREGDDQGYMPKRM  283
              + VLFQGF W S  Q GGW+N L  +V D+A AG+THVWLPPPS++     +GYMP R+
Sbjct  24    QAQVLFQGFNWESWKQQGGWYNMLKGQVDDIAKAGVTHVWLPPPSHSVA---RGYMPGRL  80

Query  284   YDLDTSKYGNKKELKALNDAFHGRGIKSVADIVLNHRAAERANSRGVFNVFEGGTPDDKL  463
             YDLD SKYG   ELK+L  AFHG+G++ VAD+V+NHR AE+ ++RGV+ VFEGGT  D+L
Sbjct  81    YDLDASKYGTAAELKSLIAAFHGKGVQCVADVVINHRCAEKKDARGVYCVFEGGT-RDRL  139

Query  464   DWGPSEICGDDAAF-EGTGNPDTGDPWGDAPDIDHRSPRVQREISEWMNWLKSDVGFDGW  640
             DWGP  IC DD  + +GTG+ DTG+ +G APDIDH +PRVQRE+++W+NWLKSDVGFDGW
Sbjct  140   DWGPGMICSDDTQYSDGTGHRDTGEGFGAAPDIDHLNPRVQRELTDWLNWLKSDVGFDGW  199

Query  641   RFDYVKGYDFVKGFAAVKIYMDNTKPEFAVGELWNALSPGSVPNPDYNQDAHRNELVRWV  820
             R D+ KGY         K+Y+++ KP F V E+WN+LS      P  NQD  R ELV WV
Sbjct  200   RLDFAKGYST----DIAKMYVESCKPGFVVAEIWNSLSYNGDGKPAANQDQGRQELVNWV  255

Query  821   QNaggaatafdfttKGILQAALNNTELWRLKDAAGKPSGMIGVLPQSAVTFIDNHDTWS-  997
                GG A  FDFTTKG+LQA +   ELWRL+D  GK  GMIG LP+ AVTF+DNHDT S 
Sbjct  256   NAVGGPAMTFDFTTKGLLQAGVQG-ELWRLRDGNGKAPGMIGWLPEKAVTFVDNHDTGST  314

Query  998   QRLWPFTTSTDDAVNHDRVLQGYAYILTHPGIPSVFYDHFFEWGLKDAISKLISIRNKNG  1177
             Q+LWPF +        D+V+QGYAYILTHPG+P +FYDH F+W LK  I+ L +IR +NG
Sbjct  315   QKLWPFPS--------DKVMQGYAYILTHPGVPCIFYDHMFDWNLKQEITALAAIRERNG  366

Query  1178  VSATSPVEILAADADLYIAKINGKVILKIGPNGDLKNLVPSDFMLATSGKDFAVWEK  1348
             ++A S + I+ ADAD Y+A ++ KV++KIG   D+ N VPSDF     GKD++VWEK
Sbjct  367   INAGSKLRIVVADADAYVAVVDEKVMVKIGTRYDVGNAVPSDFHQTVHGKDYSVWEK  423



>gb|ACF88424.1| unknown [Zea mays]
 tpg|DAA40237.1| TPA: alpha amylase3 [Zea mays]
Length=439

 Score =   453 bits (1165),  Expect = 2e-151, Method: Compositional matrix adjust.
 Identities = 233/418 (56%), Positives = 293/418 (70%), Gaps = 17/418 (4%)
 Frame = +2

Query  101   SSSTVLFQGFTWTSKDQPGGWWNWLITKVPDLADAGITHVWLPPPSNAREGDDQGYMPKR  280
             + S VLFQGF W S  + GGW+N+L+ +V D+A  G THVWLPPPS++     QGYMP R
Sbjct  26    AQSQVLFQGFNWESWKKQGGWYNYLLGRVDDIAATGATHVWLPPPSHSVA--PQGYMPGR  83

Query  281   MYDLDTSKYGNKKELKALNDAFHGRGIKSVADIVLNHRAAERANSRGVFNVFEGGTPDDK  460
             +YDLD SKYG   ELK+L  AFH +G++ VAD+V+NHR A+  + RG++ VFEGGTPD +
Sbjct  84    LYDLDASKYGTHAELKSLTAAFHAKGVQCVADVVINHRCADYKDGRGIYCVFEGGTPDSR  143

Query  461   LDWGPSEICGDDAAFE-GTGNPDTGDPWGDAPDIDHRSPRVQREISEWMNWLKSDVGFDG  637
             LDWGP  IC DD  +  G G+ DTG  +  APDIDH +PRVQ+E+S+W+NWLKSD+GFDG
Sbjct  144   LDWGPDMICSDDTQYSNGRGHRDTGADFAAAPDIDHLNPRVQQELSDWLNWLKSDLGFDG  203

Query  638   WRFDYVKGYDFVKGFAAVKIYMDNTKPEFAVGELWNALSPGSVPNPDYNQDAHRNELVRW  817
             WR D+ KGY      A  K+Y+D+T P F V E+W++L       P  NQDA R ELV W
Sbjct  204   WRLDFAKGYSA----AVAKVYVDSTAPTFVVAEIWSSLHYDGNGEPSSNQDADRQELVNW  259

Query  818   VQNaggaatafdfttKGILQAALNNTELWRLKDAAGKPSGMIGVLPQSAVTFIDNHDTWS  997
              Q  GG A AFDFTTKG+LQAA+   ELWR+KD  GK  GMIG LP+ AVTF+DNHDT S
Sbjct  260   AQAVGGPAAAFDFTTKGVLQAAVQG-ELWRMKDGNGKAPGMIGWLPEKAVTFVDNHDTGS  318

Query  998   -QRLWPFTTSTDDAVNHDRVLQGYAYILTHPGIPSVFYDHFFEWGLKDAISKLISIRNKN  1174
              Q  WPF +        D+V+QGYAYILTHPG P +FYDH F+W LK  IS L ++R++N
Sbjct  319   TQNSWPFPS--------DKVMQGYAYILTHPGTPCIFYDHVFDWNLKQEISALSAVRSRN  370

Query  1175  GVSATSPVEILAADADLYIAKINGKVILKIGPNGDLKNLVPSDFMLATSGKDFAVWEK  1348
             G+   S + ILAAD DLY+AKI+ KVI+KIG   D+ NL+PSDF     G ++ VWEK
Sbjct  371   GIHPGSELNILAADGDLYVAKIDDKVIVKIGSRYDVGNLIPSDFHAVAHGNNYCVWEK  428



>ref|XP_007017242.1| Alpha-amylase-like [Theobroma cacao]
 gb|EOY14467.1| Alpha-amylase-like [Theobroma cacao]
Length=412

 Score =   452 bits (1162),  Expect = 2e-151, Method: Compositional matrix adjust.
 Identities = 246/430 (57%), Positives = 313/430 (73%), Gaps = 24/430 (6%)
 Frame = +2

Query  65    LFCIAF-FLFPLHSSSTVLFQGFTWTSKDQPGGWWNWLITKVPDLADAGITHVWLPPPSN  241
             L  + F FL    +S+ +LFQGF W S  + GG++N+L + VP+LA AGITHVWLPPPS 
Sbjct  4     LISLCFIFLSSAFASADILFQGFNWQSWTKEGGFYNFLKSSVPELASAGITHVWLPPPSQ  63

Query  242   AREGDDQGYMPKRMYDLDTSKYGNKKELKALNDAFHGRGIKSVADIVLNHRAAERANSRG  421
             +R  D +GY P R+YDL+ SKYG++ ELK+L +AFH  GIK +ADIV+NHR+ ER +++G
Sbjct  64    SR--DPEGYYPGRLYDLNASKYGSQAELKSLVEAFHQNGIKCIADIVVNHRSTEREDAQG  121

Query  422   VFNVFEGGTPDDKLDWGPSEICGDDAAFE-GTGNPDTGDPWGDAPDIDHRSPRVQREISE  598
             VF  FEGGTPD +LD G S IC +D  F  GTG+PD+G  +   PD+D  +   Q+++S+
Sbjct  122   VF--FEGGTPDGRLDGGTSLICNNDPNFTYGTGSPDSGRDFPFGPDVDLLNTTTQQQLSD  179

Query  599   WMNWLKSDVGFDGWRFDYVKGYDFVKGFAAVKIYMDNTKPEFAVGELWNALSPGSVPNPD  778
             WMNWLK+D+GFDGWRFD+V GY      +  K +M+ TKP+FAV E W+  + G      
Sbjct  180   WMNWLKTDIGFDGWRFDFVIGY----ATSITKFFMEQTKPDFAVAEKWDDFTLG------  229

Query  779   YNQDAHRNELVRWVQNaggaatafdfttKGILQAALNNTELWRLKDAAGKPSGMIGVLPQ  958
               ++AHRN L  WV  AGGA TAFDFTTK I   A+   EL RLKD+ G P+GMIGVLPQ
Sbjct  230   -QENAHRNALRDWVGTAGGAITAFDFTTKFIFNQAIKG-ELGRLKDSNGNPAGMIGVLPQ  287

Query  959   SAVTFIDNHDTWSQRLWPFTTSTDDAVNHDRVLQGYAYILTHPGIPSVFYDHFFEWGLKD  1138
             +AVTFIDNHDTWSQRL PF+   DD    D+V QGY YILTHPGIPS+FYDHF EWGLKD
Sbjct  288   NAVTFIDNHDTWSQRLAPFS---DDP---DKVAQGYVYILTHPGIPSIFYDHFLEWGLKD  341

Query  1139  AISKLISIRNKNGVSATSPVEILAADADLYIAKINGKVILKIGPNGDLKNLVPSDFMLAT  1318
              I  L +IR K+G++ TS V+ILAA++DLY+A+I+ K+I+KIGP GDL NL+PS + LA 
Sbjct  342   TIKNLTAIRKKHGINPTSKVKILAAESDLYMAEIDEKIIMKIGPKGDLGNLLPSTYQLAY  401

Query  1319  SGKDFAVWEK  1348
              GKDFAVWEK
Sbjct  402   PGKDFAVWEK  411



>gb|ADH43281.1| alpha amylase [Zea mays]
Length=439

 Score =   452 bits (1164),  Expect = 2e-151, Method: Compositional matrix adjust.
 Identities = 233/418 (56%), Positives = 293/418 (70%), Gaps = 17/418 (4%)
 Frame = +2

Query  101   SSSTVLFQGFTWTSKDQPGGWWNWLITKVPDLADAGITHVWLPPPSNAREGDDQGYMPKR  280
             + S VLFQGF W S  + GGW+N+L+ +V D+A  G THVWLPPPS++     QGYMP R
Sbjct  26    AQSQVLFQGFNWESWKKQGGWYNYLLGRVDDIAATGATHVWLPPPSHSVA--PQGYMPGR  83

Query  281   MYDLDTSKYGNKKELKALNDAFHGRGIKSVADIVLNHRAAERANSRGVFNVFEGGTPDDK  460
             +YDLD SKYG   ELK+L  AFH +G++ VAD+V+NHR A+  + RG++ VFEGGTPD +
Sbjct  84    LYDLDASKYGTHAELKSLTAAFHAKGVQCVADVVINHRCADYKDGRGIYCVFEGGTPDSR  143

Query  461   LDWGPSEICGDDAAFE-GTGNPDTGDPWGDAPDIDHRSPRVQREISEWMNWLKSDVGFDG  637
             LDWGP  IC DD  +  G G+ DTG  +  APDIDH +PRVQ+E+S+W+NWLKSD+GFDG
Sbjct  144   LDWGPDMICSDDTQYSNGRGHRDTGADFAAAPDIDHLNPRVQQELSDWLNWLKSDLGFDG  203

Query  638   WRFDYVKGYDFVKGFAAVKIYMDNTKPEFAVGELWNALSPGSVPNPDYNQDAHRNELVRW  817
             WR D+ KGY      A  K+Y+D+T P F V E+W++L       P  NQDA R ELV W
Sbjct  204   WRLDFAKGYSA----AVAKVYVDSTAPTFVVAEIWSSLHYDGNGEPSSNQDADRQELVNW  259

Query  818   VQNaggaatafdfttKGILQAALNNTELWRLKDAAGKPSGMIGVLPQSAVTFIDNHDTWS  997
              Q  GG A AFDFTTKG+LQAA+   ELWR+KD  GK  GMIG LP+ AVTF+DNHDT S
Sbjct  260   AQAVGGPAAAFDFTTKGVLQAAVQG-ELWRMKDGNGKAPGMIGWLPEKAVTFVDNHDTGS  318

Query  998   -QRLWPFTTSTDDAVNHDRVLQGYAYILTHPGIPSVFYDHFFEWGLKDAISKLISIRNKN  1174
              Q  WPF +        D+V+QGYAYILTHPG P +FYDH F+W LK  IS L ++R++N
Sbjct  319   TQNSWPFPS--------DKVMQGYAYILTHPGTPCIFYDHVFDWNLKQEISALSAVRSRN  370

Query  1175  GVSATSPVEILAADADLYIAKINGKVILKIGPNGDLKNLVPSDFMLATSGKDFAVWEK  1348
             G+   S + ILAAD DLY+AKI+ KVI+KIG   D+ NL+PSDF     G ++ VWEK
Sbjct  371   GIHPGSELNILAADGDLYVAKIDDKVIVKIGSRYDVGNLIPSDFHAVAHGNNYCVWEK  428



>ref|XP_006660698.1| PREDICTED: alpha-amylase isozyme 3B-like isoform X1 [Oryza brachyantha]
Length=437

 Score =   452 bits (1163),  Expect = 3e-151, Method: Compositional matrix adjust.
 Identities = 236/436 (54%), Positives = 302/436 (69%), Gaps = 21/436 (5%)
 Frame = +2

Query  47    SSFYLSLFCIAFFLFPLHSSSTVLFQGFTWTSKDQPGGWWNWLITKVPDLADAGITHVWL  226
             S    +LFC++  L    + + VLFQGF W S  + GGW+N+L  +V D+A  G+THVWL
Sbjct  10    SLLLFALFCLSSQL----AHAQVLFQGFNWESWKKQGGWYNFLHGRVDDIAATGVTHVWL  65

Query  227   PPPSNAREGDDQGYMPKRMYDLDTSKYGNKKELKALNDAFHGRGIKSVADIVLNHRAAER  406
             PPPS++     QGYMP R+YDLD SKYG + EL++L  AFHGRGIK VADIV+NHR A+ 
Sbjct  66    PPPSHSVA--PQGYMPGRLYDLDASKYGTEAELRSLIAAFHGRGIKCVADIVINHRCADY  123

Query  407   ANSRGVFNVFEGGTPDDKLDWGPSEICGDDAAFE-GTGNPDTGDPWGDAPDIDHRSPRVQ  583
              +SRG++ +FEGGTPD +LDWGP  IC DD  +  G G+ DTG  +  APDIDH + RVQ
Sbjct  124   KDSRGIYCIFEGGTPDSRLDWGPDMICSDDTQYSNGRGHRDTGADFAAAPDIDHLNTRVQ  183

Query  584   REISEWMNWLKSDVGFDGWRFDYVKGYDFVKGFAAVKIYMDNTKPEFAVGELWNALSPGS  763
              E+S+W+NWLK+D+GFDGWR D+ KGY      A  K Y+D+T P F V E+W+ +    
Sbjct  184   SELSDWLNWLKNDLGFDGWRLDFAKGYSA----AVAKTYVDSTDPSFVVAEIWSNMRYDG  239

Query  764   VPNPDYNQDAHRNELVRWVQNaggaatafdfttKGILQAALNNTELWRLKDAAGKPSGMI  943
                P +NQDA R ELV W Q  GG A+AFDFTTKG+LQAA+   ELWR+KD  GK  GMI
Sbjct  240   NGEPSWNQDADRQELVNWAQTVGGPASAFDFTTKGVLQAAVQG-ELWRMKDGNGKAPGMI  298

Query  944   GVLPQSAVTFIDNHDTWS-QRLWPFTTSTDDAVNHDRVLQGYAYILTHPGIPSVFYDHFF  1120
             G LP+ AVTFIDNHDT S Q  WPF +        D+V+QGYAYILTHPG+P +FYDH F
Sbjct  299   GWLPEKAVTFIDNHDTGSTQNSWPFPS--------DKVMQGYAYILTHPGVPCIFYDHVF  350

Query  1121  EWGLKDAISKLISIRNKNGVSATSPVEILAADADLYIAKINGKVILKIGPNGDLKNLVPS  1300
             +W LK  IS L ++R++NG+   S + ILAAD D+Y+A I+ KVI KIG   D+ NL+PS
Sbjct  351   DWNLKQEISTLAAVRSRNGIHPGSKLNILAADGDVYVAMIDDKVITKIGTRYDVGNLIPS  410

Query  1301  DFMLATSGKDFAVWEK  1348
             DF +   G ++ +WEK
Sbjct  411   DFHVVAHGSNYCIWEK  426



>ref|XP_004957017.1| PREDICTED: alpha-amylase isozyme 3C-like [Setaria italica]
Length=437

 Score =   452 bits (1162),  Expect = 5e-151, Method: Compositional matrix adjust.
 Identities = 236/418 (56%), Positives = 294/418 (70%), Gaps = 17/418 (4%)
 Frame = +2

Query  101   SSSTVLFQGFTWTSKDQPGGWWNWLITKVPDLADAGITHVWLPPPSNAREGDDQGYMPKR  280
             + S VLFQGF W S  + GGW+N+L  +V D+A  G THVWLPPPS++     QGYMP R
Sbjct  24    AQSQVLFQGFNWESWKKQGGWYNFLRGRVDDIAATGATHVWLPPPSHSVA--PQGYMPGR  81

Query  281   MYDLDTSKYGNKKELKALNDAFHGRGIKSVADIVLNHRAAERANSRGVFNVFEGGTPDDK  460
             +YDLD SKYG   ELK+L  AFH +GI+ VADIV+NHR A+  +SRG++ VFEGGTPD +
Sbjct  82    LYDLDASKYGTHAELKSLIAAFHAKGIQCVADIVINHRCADYKDSRGIYCVFEGGTPDSR  141

Query  461   LDWGPSEICGDDAAFE-GTGNPDTGDPWGDAPDIDHRSPRVQREISEWMNWLKSDVGFDG  637
             LDWGP  IC DD  +  G G+ DTG  +G APDIDH +PRVQ+E+S+W+NWLK+D+GFDG
Sbjct  142   LDWGPDMICSDDTQYSNGRGHRDTGADFGAAPDIDHLNPRVQQELSDWLNWLKTDLGFDG  201

Query  638   WRFDYVKGYDFVKGFAAVKIYMDNTKPEFAVGELWNALSPGSVPNPDYNQDAHRNELVRW  817
             WR D+ KGY      A  K+Y+DNT P F V E+W++L       P   QD  R ELV W
Sbjct  202   WRLDFAKGYSA----AVAKVYVDNTAPTFVVAEIWSSLQYDGNGEPSSIQDKDRQELVNW  257

Query  818   VQNaggaatafdfttKGILQAALNNTELWRLKDAAGKPSGMIGVLPQSAVTFIDNHDTWS  997
              Q  GG A AFDFTTKG+LQAA+   ELWR+KD  GK  GMIG LP+ AVTF+DNHDT S
Sbjct  258   AQAVGGPAAAFDFTTKGVLQAAVQG-ELWRMKDGNGKAPGMIGWLPEKAVTFVDNHDTGS  316

Query  998   -QRLWPFTTSTDDAVNHDRVLQGYAYILTHPGIPSVFYDHFFEWGLKDAISKLISIRNKN  1174
              Q  WPF +        D+V+QGYAYILTHPG P +FYDH F+W LK  IS L ++R++N
Sbjct  317   TQNSWPFPS--------DKVMQGYAYILTHPGTPCIFYDHVFDWNLKQEISTLSTVRSRN  368

Query  1175  GVSATSPVEILAADADLYIAKINGKVILKIGPNGDLKNLVPSDFMLATSGKDFAVWEK  1348
             G+ A S ++ILAAD DLY+AKI+ KVI+KIG   D+ NL+PSDF     G ++ VWEK
Sbjct  369   GIHAGSKLDILAADGDLYVAKIDDKVIVKIGSRYDVGNLIPSDFHPIAHGNNYCVWEK  426



>gb|AAA32925.1| alpha-amylase 1 [Hordeum vulgare]
Length=427

 Score =   450 bits (1158),  Expect = 1e-150, Method: Compositional matrix adjust.
 Identities = 235/420 (56%), Positives = 299/420 (71%), Gaps = 19/420 (5%)
 Frame = +2

Query  101   SSSTVLFQGFTWTSKDQPGGWWNWLITKVPDLADAGITHVWLPPPSNAREGDDQGYMPKR  280
             +S  VLFQGF   S    GGW+N+L+ KV D+A AGITHVWLPP S +    +QGYMP R
Sbjct  22    ASGQVLFQGFNSESWKHNGGWYNFLMGKVDDIAAAGITHVWLPPASQSVA--EQGYMPGR  79

Query  281   MYDLDTSKYGNKKELKALNDAFHGRGIKSVADIVLNHRAAERANSRGVFNVFEGGTPDDK  460
             +YDLD SKYGNK +LK+L  A HG+G+K++ADIV+NHR AE  + RG++ +FEG TPD +
Sbjct  80    LYDLDASKYGNKAQLKSLIGALHGKGVKAIADIVINHRTAEHKDGRGIYCIFEGDTPDAR  139

Query  461   LDWGPSEICGDDAAF-EGTGNPDTGDPWGDAPDIDHRSPRVQREISEWMNWLKSDVGFDG  637
             LDWGP  IC DD  + +GTGNPDTG  +G APDIDH + RVQ+E+ EW+NWLK+D   DG
Sbjct  140   LDWGPHMICRDDRPYADGTGNPDTGADFGAAPDIDHLNLRVQKELVEWLNWLKADHRLDG  199

Query  638   WRFDYVKGYDFVKGFAAVKIYMDNTKPEFAVGELWNALSPGSVPNPDYNQDAHRNELVRW  817
             WRFD+ KGY         KIY+D ++P FAV E+W +L+ G    P+ NQD HR ELV W
Sbjct  200   WRFDFAKGYSA----DVAKIYIDRSEPSFAVAEIWTSLAYGGDGKPNLNQDQHRQELVNW  255

Query  818   VQNagga--atafdfttKGILQAALNNTELWRLKDAAGKPSGMIGVLPQSAVTFIDNHDT  991
             V   GG   AT FDFTTKGIL  A+   ELWRL+   GK  GMIG  P  AVTF+DNHDT
Sbjct  256   VDKVGGKGPATTFDFTTKGILNVAVEG-ELWRLRGTDGKAPGMIGWWPAKAVTFVDNHDT  314

Query  992   WS-QRLWPFTTSTDDAVNHDRVLQGYAYILTHPGIPSVFYDHFFEWGLKDAISKLISIRN  1168
              S Q +WPF +        DRV+QGYAYILTHPG P +FYDHFF+WGLK+ I +L+S+R 
Sbjct  315   GSTQHMWPFPS--------DRVMQGYAYILTHPGTPCIFYDHFFDWGLKEEIDRLVSVRT  366

Query  1169  KNGVSATSPVEILAADADLYIAKINGKVILKIGPNGDLKNLVPSDFMLATSGKDFAVWEK  1348
             ++G+   S ++I+ ADADLY+A+I+GKVI+K+GP  D+ NL+P  F +A  G D+AVW+K
Sbjct  367   RHGIHNESKLQIIEADADLYLAEIDGKVIVKLGPRYDVGNLIPGGFKVAAHGNDYAVWQK  426



>ref|XP_004957015.1| PREDICTED: alpha-amylase isozyme 3C-like [Setaria italica]
Length=437

 Score =   451 bits (1159),  Expect = 1e-150, Method: Compositional matrix adjust.
 Identities = 235/418 (56%), Positives = 294/418 (70%), Gaps = 17/418 (4%)
 Frame = +2

Query  101   SSSTVLFQGFTWTSKDQPGGWWNWLITKVPDLADAGITHVWLPPPSNAREGDDQGYMPKR  280
             + S VLFQGF W S  + GGW+N+L  +V D+A  G THVWLPPPS++     QGYMP R
Sbjct  24    AQSQVLFQGFNWESWKKQGGWYNFLRGRVDDIAATGATHVWLPPPSHSVA--PQGYMPGR  81

Query  281   MYDLDTSKYGNKKELKALNDAFHGRGIKSVADIVLNHRAAERANSRGVFNVFEGGTPDDK  460
             +YDLD SKYG   ELK+L  AFH +GI+ VADIV+NHR A+  +SRG++ VFEGGTPD +
Sbjct  82    LYDLDASKYGTHAELKSLIAAFHAKGIQCVADIVINHRCADYKDSRGIYCVFEGGTPDSR  141

Query  461   LDWGPSEICGDDAAFE-GTGNPDTGDPWGDAPDIDHRSPRVQREISEWMNWLKSDVGFDG  637
             LDWGP  IC DD  +  G G+ DTG  +G APDIDH +PRVQ+E+++W+NWLK+D+GFDG
Sbjct  142   LDWGPDMICSDDTQYSNGRGHRDTGADFGAAPDIDHLNPRVQQELADWLNWLKTDLGFDG  201

Query  638   WRFDYVKGYDFVKGFAAVKIYMDNTKPEFAVGELWNALSPGSVPNPDYNQDAHRNELVRW  817
             WR D+ KGY      A  K+Y+DNT P F V E+W++L       P   QD  R ELV W
Sbjct  202   WRLDFAKGYSA----AVAKVYVDNTAPTFVVAEIWSSLQYDGNGEPSSIQDKDRQELVNW  257

Query  818   VQNaggaatafdfttKGILQAALNNTELWRLKDAAGKPSGMIGVLPQSAVTFIDNHDTWS  997
              Q  GG A AFDFTTKG+LQAA+   ELWR+KD  GK  GMIG LP+ AVTF+DNHDT S
Sbjct  258   AQAVGGPAAAFDFTTKGVLQAAVQG-ELWRMKDGNGKAPGMIGWLPEKAVTFVDNHDTGS  316

Query  998   -QRLWPFTTSTDDAVNHDRVLQGYAYILTHPGIPSVFYDHFFEWGLKDAISKLISIRNKN  1174
              Q  WPF +        D+V+QGYAYILTHPG P +FYDH F+W LK  IS L ++R++N
Sbjct  317   TQNSWPFPS--------DKVMQGYAYILTHPGTPCIFYDHVFDWNLKQEISTLSTVRSRN  368

Query  1175  GVSATSPVEILAADADLYIAKINGKVILKIGPNGDLKNLVPSDFMLATSGKDFAVWEK  1348
             G+ A S ++ILAAD DLY+AKI+ KVI+KIG   D+ NL+PSDF     G ++ VWEK
Sbjct  369   GIHAGSKLDILAADGDLYVAKIDDKVIVKIGSRYDVGNLIPSDFHPIAHGNNYCVWEK  426



>gb|AAN01149.1| alpha-amylase precursor [Musa acuminata]
Length=416

 Score =   450 bits (1157),  Expect = 1e-150, Method: Compositional matrix adjust.
 Identities = 229/418 (55%), Positives = 305/418 (73%), Gaps = 17/418 (4%)
 Frame = +2

Query  101   SSSTVLFQGFTWTSKDQPGGWWNWLITKVPDLADAGITHVWLPPPSNAREGDDQGYMPKR  280
             + S +LFQGF W S  Q GGW+N+L  KV D+A+AG+THVWLPPPS++     QGYMP R
Sbjct  13    AQSQILFQGFNWESWRQQGGWYNFLKDKVSDIANAGVTHVWLPPPSHSV--GVQGYMPGR  70

Query  281   MYDLDTSKYGNKKELKALNDAFHGRGIKSVADIVLNHRAAERANSRGVFNVFEGGTPDDK  460
             +YDL  SKYGN+ ELKAL  AFH +G+K VADIV+NHR A++ + RG++ +FEGGT D +
Sbjct  71    LYDLGASKYGNQDELKALIGAFHDKGVKCVADIVINHRCADKQDGRGIWCIFEGGTDDAR  130

Query  461   LDWGPSEICGDDAAF-EGTGNPDTGDPWGDAPDIDHRSPRVQREISEWMNWLKSDVGFDG  637
             LDWGP  IC DD  + +GTGN DTG+ +  APDIDH + +VQ E+++W+NWLK+D+GFDG
Sbjct  131   LDWGPHMICRDDTQYSDGTGNLDTGEGFAAAPDIDHLNTQVQHELTDWLNWLKTDIGFDG  190

Query  638   WRFDYVKGYDFVKGFAAVKIYMDNTKPEFAVGELWNALSPGSVPNPDYNQDAHRNELVRW  817
             WR D+ KGY      +  KIY++ T+P F V E+W++L+  +   P Y+Q+ +R  LV W
Sbjct  191   WRLDFAKGYSS----SIAKIYVEQTQPNFVVAEIWSSLAYRNDGKPTYDQNGNRQGLVNW  246

Query  818   VQNaggaatafdfttKGILQAALNNTELWRLKDAAGKPSGMIGVLPQSAVTFIDNHDTWS  997
             VQ  GG  TAFDFTTKGILQAA+   ELWR++D  GK  GM+G  P+ AVTF+DNHDT S
Sbjct  247   VQQVGGPVTAFDFTTKGILQAAVEG-ELWRMRDPQGKAPGMMGWWPEKAVTFVDNHDTGS  305

Query  998   -QRLWPFTTSTDDAVNHDRVLQGYAYILTHPGIPSVFYDHFFEWGLKDAISKLISIRNKN  1174
              Q+LWPF +        D+V+QGYAYILTHPG+PS+FYDH F+WGLK+ I++L   R +N
Sbjct  306   TQKLWPFPS--------DKVMQGYAYILTHPGVPSIFYDHMFDWGLKEKITRLAKTRTRN  357

Query  1175  GVSATSPVEILAADADLYIAKINGKVILKIGPNGDLKNLVPSDFMLATSGKDFAVWEK  1348
              + + S + ILA+DADLY+A I+GK++ K+G   D+ NLVPS+F +  SG D+ VWEK
Sbjct  358   RIHSGSSLNILASDADLYMAMIDGKILTKLGSRYDVGNLVPSNFHVVASGNDYCVWEK  415



>ref|XP_009348705.1| PREDICTED: alpha-amylase-like [Pyrus x bretschneideri]
 ref|XP_009348715.1| PREDICTED: alpha-amylase-like [Pyrus x bretschneideri]
Length=425

 Score =   449 bits (1156),  Expect = 2e-150, Method: Compositional matrix adjust.
 Identities = 244/438 (56%), Positives = 312/438 (71%), Gaps = 23/438 (5%)
 Frame = +2

Query  56    YLSLFCIAFF--LFPLHSSSTVLFQGFTWTSKDQPGGWWNWLITKVPDLADAGITHVWLP  229
             +L  FCI     L P  ++  VLFQGF W S  + GGW+N L T +P+LAD+GITHVWLP
Sbjct  3     FLLFFCICLCTSLLPSFAAPAVLFQGFNWDSSKK-GGWYNTLKTSIPELADSGITHVWLP  61

Query  230   PPSNAREGDDQGYMPKRMYDLDTSKYGNKKELKALNDAFHGRGIKSVADIVLNHRAAERA  409
             PPS+A     +GY P R+YDLD S YGNK ELK+L  A H +GIK++ADIV+NHRAA + 
Sbjct  62    PPSHAN--GTEGYYPGRLYDLDASSYGNKDELKSLIAAMHEKGIKAIADIVINHRAAVKQ  119

Query  410   NSRGVFNVFEGGTPDDKLDWGPSEICGDDAAFE-GTGNPDTGDPWGDAPDIDHRSPRVQR  586
             +  G++++FEGGT D +LD+  S IC DD     GTGNPDTGD +    D+DH +PR+Q 
Sbjct  120   DENGIWSIFEGGTADGRLDFNASLICRDDNDHPFGTGNPDTGDNFPYTADVDHTNPRLQS  179

Query  587   EISEWMNWLKSDVGFDGWRFDYVKGYDFVKGFAAVKIYMDNTKPEFAVGELWN-ALSPGS  763
             E+S+WMNWLK+++GFDGWRFDY  GY    G +  K+YMD T PEFAV E W   ++ G 
Sbjct  180   ELSDWMNWLKTEIGFDGWRFDYAIGY----GSSFTKLYMDRTSPEFAVAEYWRWNIAKGQ  235

Query  764   VPNPDYNQDAHRNELVRWVQNaggaatafdfttKGILQAALNNTELWRLKDAAGKPSGMI  943
                 + NQDAHRNE+  W+Q AGG  TAFD TTK I+  A+   ELWRLKD+ GKP G+I
Sbjct  236   DGKLEQNQDAHRNEIASWIQAAGGVVTAFDMTTKYIMDVAVVG-ELWRLKDSNGKPPGLI  294

Query  944   GVLPQSAVTFIDNHDTWSQRLWPFTTSTDDAVNHDRVLQGYAYILTHPGIPSVFYDHFFE  1123
             G+ P++AVTFIDNHDTWSQ+L PF +        D+VL GYAYILTHPG PS+FYDHFFE
Sbjct  295   GIKPENAVTFIDNHDTWSQKLLPFPS--------DQVLLGYAYILTHPGTPSIFYDHFFE  346

Query  1124  WGL-KDAISKLISIRNKNGVSATSPVEILAADADLYIAKINGKVILKIGPNGDLKNLVP-  1297
             WG  K+ I  L +IR +NG+++ S V ILAA+A+LY+A I+ K+I+KIG   DL +L P 
Sbjct  347   WGWPKEPIRNLTAIRARNGINSKSSVSILAAEANLYMANIDDKIIMKIGTKLDLGDLDPT  406

Query  1298  -SDFMLATSGKDFAVWEK  1348
              S+F +ATSG+DFAVWE+
Sbjct  407   KSNFHVATSGQDFAVWER  424



>emb|CAB36742.1| alpha-amylase-like protein [Arabidopsis thaliana]
 emb|CAB79409.1| alpha-amylase-like protein [Arabidopsis thaliana]
Length=428

 Score =   449 bits (1155),  Expect = 3e-150, Method: Compositional matrix adjust.
 Identities = 238/443 (54%), Positives = 316/443 (71%), Gaps = 26/443 (6%)
 Frame = +2

Query  47    SSFYLSLF--CIAFFLFPLHS-SSTVLFQGFTWTSKDQPGGWWNWLITKVPDLADAGITH  217
             +S +  LF   + F +FP  + SST+LFQ F W S  + GG++N L   + D+A+AGITH
Sbjct  2     TSLHTLLFSSLLFFIVFPTFTFSSTLLFQSFNWESWKKEGGFYNSLHNSIDDIANAGITH  61

Query  218   VWLPPPSNAREGDDQGYMPKRMYDLDTSKYGNKKELKALNDAFHGRGIKSVADIVLNHRA  397
             +WLPPPS +     +GY+P ++YDL++SKYG++ ELK+L  A + +GIK++ADIV+NHR 
Sbjct  62    LWLPPPSQSVA--PEGYLPGKLYDLNSSKYGSEAELKSLIKALNQKGIKALADIVINHRT  119

Query  398   AERANSRGVFNVFEGGTPDDKLDWGPSEICGDDAAFEGTGNPDTGDPWGDAPDIDHRSPR  577
             AER + +  +  FEGGT DD+LDW PS +C +D  F GTGN DTG  +  APDIDH +PR
Sbjct  120   AERKDDKCGYCYFEGGTSDDRLDWDPSFVCRNDPKFPGTGNLDTGGDFDGAPDIDHLNPR  179

Query  578   VQREISEWMNWLKSDVGFDGWRFDYVKGYDFVKGFAAVKIYMDNTKPEFAVGELWNALSP  757
             VQ+E+SEWMNWLK+++GF GWRFDYV+GY      +  K+Y+ NT P+FAVGE W+ +  
Sbjct  180   VQKELSEWMNWLKTEIGFHGWRFDYVRGY----ASSITKLYVQNTSPDFAVGEKWDDMKY  235

Query  758   GSVPNPDYNQDAHRNELVRWVQNaggaatafd-fttKGILQAALNNTELWRLKDAAGKPS  934
             G     DY+Q+ HR+ L +W++ AGG       FTTKGILQ+A+   ELWRLKD+ GKP 
Sbjct  236   GGDGKLDYDQNEHRSGLKQWIEEAGGGVLTAFDFTTKGILQSAVKG-ELWRLKDSQGKPP  294

Query  935   GMIGVLPQSAVTFIDNHDTWSQRLWPFTTSTDDAVNHDRVLQGYAYILTHPGIPSV----  1102
             GMIG++P +AVTFIDNHDT+  R W F +        D+VL GY YILTHPG P +    
Sbjct  295   GMIGIMPGNAVTFIDNHDTF--RTWVFPS--------DKVLLGYVYILTHPGTPCIVSII  344

Query  1103  -FYDHFFEWGLKDAISKLISIRNKNGVSATSPVEILAADADLYIAKINGKVILKIGPNGD  1279
              FY+H+ EWGLK++ISKL++IRNKNG+ +TS V I AA+ADLY+A I+ KVI+KIGP  D
Sbjct  345   LFYNHYIEWGLKESISKLVAIRNKNGIGSTSSVTIKAAEADLYLAMIDDKVIMKIGPKQD  404

Query  1280  LKNLVPSDFMLATSGKDFAVWEK  1348
             +  LVPS+F LA SG DFAVWEK
Sbjct  405   VGTLVPSNFALAYSGLDFAVWEK  427



>ref|XP_008347138.1| PREDICTED: alpha-amylase-like [Malus domestica]
 ref|XP_008356942.1| PREDICTED: alpha-amylase-like [Malus domestica]
Length=425

 Score =   448 bits (1153),  Expect = 5e-150, Method: Compositional matrix adjust.
 Identities = 244/439 (56%), Positives = 312/439 (71%), Gaps = 22/439 (5%)
 Frame = +2

Query  50    SFYLSL-FCIAFFLFPLHSSSTVLFQGFTWTSKDQPGGWWNWLITKVPDLADAGITHVWL  226
             +F LS  FC+   L P  ++  VLFQGF W S  + GGW+N L T +P+LAD+GI HVWL
Sbjct  2     NFLLSFCFCLCTSLLPSFATPAVLFQGFNWDSSKK-GGWYNXLKTSIPELADSGIXHVWL  60

Query  227   PPPSNAREGDDQGYMPKRMYDLDTSKYGNKKELKALNDAFHGRGIKSVADIVLNHRAAER  406
             PPPS+A     +GY P R+YDLD S YGNK ELK+L  A H +GIK++ADIV+NHRAA +
Sbjct  61    PPPSHAN--GTEGYYPGRLYDLDASSYGNKDELKSLIXAMHEKGIKAIADIVINHRAAVK  118

Query  407   ANSRGVFNVFEGGTPDDKLDWGPSEICGDDAAFE-GTGNPDTGDPWGDAPDIDHRSPRVQ  583
              +  G++++FEGGT D +LD+  S IC DD     GTGNPDTGD      D+DH +PR+Q
Sbjct  119   QDENGIWSIFEGGTADGRLDFNASLICRDDNDHPFGTGNPDTGDNXPYTADVDHTNPRLQ  178

Query  584   REISEWMNWLKSDVGFDGWRFDYVKGYDFVKGFAAVKIYMDNTKPEFAVGELWN-ALSPG  760
              E+S+WMNWLK+++GFDGWRFDY  GY    G +  K+YMD T PEFAV E W   ++ G
Sbjct  179   SELSDWMNWLKTEIGFDGWRFDYAIGY----GSSFTKLYMDRTSPEFAVAEYWRWNIAKG  234

Query  761   SVPNPDYNQDAHRNELVRWVQNaggaatafdfttKGILQAALNNTELWRLKDAAGKPSGM  940
                  + NQDAHRNE+  W+Q AGG  TAFD TTK I+  A+   ELWRLKD+ GKP G+
Sbjct  235   QDGKLEQNQDAHRNEIASWIQAAGGVVTAFDMTTKYIMDVAVVG-ELWRLKDSNGKPPGL  293

Query  941   IGVLPQSAVTFIDNHDTWSQRLWPFTTSTDDAVNHDRVLQGYAYILTHPGIPSVFYDHFF  1120
             IG+ P++AVTFIDNHDTWSQ+L PF +        D+VL GYAYILTHPG PS+FYDHFF
Sbjct  294   IGIKPENAVTFIDNHDTWSQKLLPFPS--------DQVLLGYAYILTHPGTPSIFYDHFF  345

Query  1121  EWGL-KDAISKLISIRNKNGVSATSPVEILAADADLYIAKINGKVILKIGPNGDLKNLVP  1297
             EWG  K+ I  L +IR +NG+++ S V ILAA+A+LY+A I+ K+I+KIG   DL +L P
Sbjct  346   EWGWPKEPIRNLTAIRARNGINSKSSVSILAAEANLYMANIDBKIIMKIGTKLDLGDLDP  405

Query  1298  --SDFMLATSGKDFAVWEK  1348
               S+F +ATSG+DFAVWE+
Sbjct  406   TKSNFHVATSGQDFAVWER  424



>ref|NP_001169611.1| uncharacterized protein LOC100383492 precursor [Zea mays]
 gb|ACN34260.1| unknown [Zea mays]
 tpg|DAA48441.1| TPA: putative alpha-amylase family protein [Zea mays]
Length=441

 Score =   449 bits (1155),  Expect = 6e-150, Method: Compositional matrix adjust.
 Identities = 233/420 (55%), Positives = 300/420 (71%), Gaps = 19/420 (5%)
 Frame = +2

Query  107   STVLFQGFTWTSKDQPGGWWNWLITKVPDLADAGITHVWLPPPSNAREGDDQGYMPKRMY  286
             + VLFQGF W S  Q GGW+N L  +V D+A AG+THVWLPPPS++     QGYMP R+Y
Sbjct  28    AQVLFQGFNWESCKQQGGWYNRLKAQVDDIAKAGVTHVWLPPPSHSVS--PQGYMPGRLY  85

Query  287   DLDTSKYGNKKELKALNDAFHGRGIKSVADIVLNHRAAERANSRGVFNVFEGGTPDDKLD  466
             DLD SKYG   ELK+L  AFHGRG++ VADIV+NHR AE+ ++RGV+ +FEGGTPDD+LD
Sbjct  86    DLDASKYGTAAELKSLIAAFHGRGVQCVADIVINHRCAEKKDARGVYCIFEGGTPDDRLD  145

Query  467   WGPSEICGDDAAF-EGTGNPDTGDPWGDAPDIDHRSPRVQREISEWMNWLKSD-VGFDGW  640
             WGP  IC DD  + +GTG+ DTG+ +  APDIDH +PRVQRE+S W+NWL+SD VGFDGW
Sbjct  146   WGPGMICSDDTQYSDGTGHRDTGEGFAAAPDIDHLNPRVQRELSAWLNWLRSDAVGFDGW  205

Query  641   RFDYVKGYDFVKGFAAVKIYMDNT-KPEFAVGELWNALSPGSVPNPDYNQDAHRNELVRW  817
             R D+ KGY      A  ++Y+++T  P F V E+WN+LS      P  NQD  R EL+ W
Sbjct  206   RLDFAKGYSP----AVARMYVESTGPPSFVVAEIWNSLSYSGDGKPAPNQDQCRQELLDW  261

Query  818   VQNaggaatafdfttKGILQAALNNTELWRLKDAAGKPSGMIGVLPQSAVTFIDNHDTWS  997
              +  GG A AFDF TKG+LQA +   ELWRL+D++G  +G+IG  P+ AVTF+DNHDT S
Sbjct  262   TRAVGGPAMAFDFPTKGLLQAGVQG-ELWRLRDSSGNAAGLIGWAPEKAVTFVDNHDTGS  320

Query  998   -QRLWPFTTSTDDAVNHDRVLQGYAYILTHPGIPSVFYDHFFEWGLKDAISKLISIRNKN  1174
              Q+LWPF +        D+V+QGYAYILTHPG+P +FYDH F+W LK  IS L +IR +N
Sbjct  321   TQKLWPFPS--------DKVMQGYAYILTHPGVPCIFYDHMFDWNLKQEISTLSAIRARN  372

Query  1175  GVSATSPVEILAADADLYIAKINGKVILKIGPNGDLKNLVPSDFMLATSGKDFAVWEKPT  1354
             G+ A S + IL ADAD Y+A ++ KV++KIG    + ++VPSDF  A  GKD+ VWEK +
Sbjct  373   GIRAGSKLRILVADADAYVAVVDEKVMVKIGTRYGVSSVVPSDFHPAAHGKDYCVWEKAS  432



>ref|XP_006660697.1| PREDICTED: alpha-amylase isozyme 3A-like [Oryza brachyantha]
Length=438

 Score =   448 bits (1153),  Expect = 9e-150, Method: Compositional matrix adjust.
 Identities = 230/419 (55%), Positives = 296/419 (71%), Gaps = 17/419 (4%)
 Frame = +2

Query  98    HSSSTVLFQGFTWTSKDQPGGWWNWLITKVPDLADAGITHVWLPPPSNAREGDDQGYMPK  277
             H+ + +LFQGF W S  + GGW+N L  +V D+A AG+THVWLPPP+++     QGYMP 
Sbjct  25    HAQTQILFQGFNWDSWKKQGGWYNMLQGQVNDIASAGVTHVWLPPPTHSVS--PQGYMPG  82

Query  278   RMYDLDTSKYGNKKELKALNDAFHGRGIKSVADIVLNHRAAERANSRGVFNVFEGGTPDD  457
             R+YDLD SKYG K ELK+L  AFHG+GIK VADIV+NHR A+  +SRGV+ +F+GG P  
Sbjct  83    RLYDLDASKYGTKAELKSLIAAFHGKGIKCVADIVINHRCADDKDSRGVYCIFKGGGPQG  142

Query  458   KLDWGPSEICGDDAAF-EGTGNPDTGDPWGDAPDIDHRSPRVQREISEWMNWLKSDVGFD  634
              LDWGPS IC DD  + +GTG+ DTG  +  APDIDH +P VQRE+S+W+ WL+ DVGFD
Sbjct  143   CLDWGPSMICSDDTQYSDGTGHRDTGADFAAAPDIDHLNPLVQRELSDWLRWLRRDVGFD  202

Query  635   GWRFDYVKGYDFVKGFAAVKIYMDNTKPEFAVGELWNALSPGSVPNPDYNQDAHRNELVR  814
             GWR D+ KGY      A  K Y+ N +P F V E+W++LS      P  NQD  R ELV 
Sbjct  203   GWRLDFAKGYSA----AVAKAYVQNARPGFLVAEIWSSLSYDGDGKPAANQDGERQELVN  258

Query  815   WVQNaggaatafdfttKGILQAALNNTELWRLKDAAGKPSGMIGVLPQSAVTFIDNHDTW  994
             WV+  GG ATAFDFTTKGILQ+A+   ELWR++D  GK  GMIG LP+  VTF+DNHDT 
Sbjct  259   WVKQVGGPATAFDFTTKGILQSAVQG-ELWRMRDKDGKAPGMIGWLPEKTVTFVDNHDTG  317

Query  995   S-QRLWPFTTSTDDAVNHDRVLQGYAYILTHPGIPSVFYDHFFEWGLKDAISKLISIRNK  1171
             S QR+WPF +        D+V+ GYAYILTHPG+P +FYDH F+W LK  I+ L + R +
Sbjct  318   STQRMWPFPS--------DKVMLGYAYILTHPGVPCIFYDHVFDWNLKQEINALAAARRR  369

Query  1172  NGVSATSPVEILAADADLYIAKINGKVILKIGPNGDLKNLVPSDFMLATSGKDFAVWEK  1348
             NG++A S + ILAADAD+Y+A ++ +VI KIGP  D+ +++PSDF +   G D+ VWEK
Sbjct  370   NGINAGSKLRILAADADMYVAMVDERVITKIGPKTDVGSMIPSDFHVVAHGNDYCVWEK  428



>gb|EMT15942.1| Alpha-amylase isozyme 3D [Aegilops tauschii]
Length=437

 Score =   448 bits (1153),  Expect = 1e-149, Method: Compositional matrix adjust.
 Identities = 224/420 (53%), Positives = 295/420 (70%), Gaps = 17/420 (4%)
 Frame = +2

Query  95    LHSSSTVLFQGFTWTSKDQPGGWWNWLITKVPDLADAGITHVWLPPPSNAREGDDQGYMP  274
             + +   +LFQGF W S  + GGW+N L  +V D+ADAG+THVWLPPPS++     QGYMP
Sbjct  23    VRAKPQILFQGFNWESWKKQGGWYNHLKAQVGDIADAGVTHVWLPPPSHSVS--PQGYMP  80

Query  275   KRMYDLDTSKYGNKKELKALNDAFHGRGIKSVADIVLNHRAAERANSRGVFNVFEGGTPD  454
              R+Y LD S+YG   EL++L  AFH RGI+  AD+V+ HR A++ ++RGV+  FEGGTPD
Sbjct  81    GRLYALDASRYGAAAELRSLLAAFHARGIQCGADVVITHRTADKQDARGVYCAFEGGTPD  140

Query  455   DKLDWGPSEICGDDAAF-EGTGNPDTGDPWGDAPDIDHRSPRVQREISEWMNWLKSDVGF  631
              +LDWGP+E+C DDA + +GTG+ DTGD +   PD+DH SPRV+RE+S+W+ WLK+DVGF
Sbjct  141   ARLDWGPAEVCADDATYSDGTGHRDTGDGFDAPPDVDHLSPRVRRELSDWLRWLKTDVGF  200

Query  632   DGWRFDYVKGYDFVKGFAAVKIYMDNTKPEFAVGELWNALSPGSVPNPDYNQDAHRNELV  811
             DGWR D+ +GY      A  + Y+D  +P F V E+WN L+      P +NQD  R  LV
Sbjct  201   DGWRLDFARGYSP----AVARTYIDAVRPGFVVAEIWNPLAYDGDGRPSHNQDRCRQGLV  256

Query  812   RWVQNaggaatafdfttKGILQAALNNTELWRLKDAAGKPSGMIGVLPQSAVTFIDNHDT  991
              WV+ A  +  AFDF TKG+LQA +   ELWR++D +GK +GMIG LP+ AVTF+DNHDT
Sbjct  257   DWVEAASPSVMAFDFATKGVLQAGVQ-AELWRVRDRSGKAAGMIGWLPERAVTFVDNHDT  315

Query  992   WS-QRLWPFTTSTDDAVNHDRVLQGYAYILTHPGIPSVFYDHFFEWGLKDAISKLISIRN  1168
              S Q+LWPF          D+V+QGYAYILTHPG+P +FYDH FEW LK  ++KL +IR 
Sbjct  316   GSTQKLWPFPA--------DKVMQGYAYILTHPGVPCIFYDHMFEWNLKVQLAKLAAIRA  367

Query  1169  KNGVSATSPVEILAADADLYIAKINGKVILKIGPNGDLKNLVPSDFMLATSGKDFAVWEK  1348
             +NGV A S + IL ADADLY+A +N +V +KIG   D+   VPSDF +A  G+D+ VWEK
Sbjct  368   RNGVHAGSKLRILVADADLYVAVVNERVFVKIGTRYDVGGAVPSDFHIAAHGRDYCVWEK  427



>ref|XP_009148429.1| PREDICTED: alpha-amylase 1 [Brassica rapa]
Length=435

 Score =   448 bits (1152),  Expect = 1e-149, Method: Compositional matrix adjust.
 Identities = 229/420 (55%), Positives = 301/420 (72%), Gaps = 16/420 (4%)
 Frame = +2

Query  92    PLHSSSTVLFQGFTWTSKDQPGGWWNWLITKVPDLADAGITHVWLPPPSNAREGDDQGYM  271
             P  + ST+LFQGF W S  + GG++N L   + DL+++GITHVWLPPPS +     +GY+
Sbjct  30    PTFTVSTLLFQGFKWESWMKEGGFYNSLHNSIDDLSNSGITHVWLPPPSQSVS--PEGYL  87

Query  272   PKRMYDLDTSKYGNKKELKALNDAFHGRGIKSVADIVLNHRAAERANSRGVFNVFEGGTP  451
             P ++YDL++SKYG++ ELK+L  A   +GIK+VADIV+NHR AER +    +  FEGGT 
Sbjct  88    PGKLYDLNSSKYGSETELKSLIAALKQKGIKAVADIVINHRTAERKDDHCGYCYFEGGTS  147

Query  452   DDKLDWGPSEICGDDAAFEGTGNPDTGDPWGDAPDIDHRSPRVQREISEWMNWLKSDVGF  631
             DD+LDW PS IC  D  + GTGNPDTG+ +  APDIDH +PRVQ+E+SEWMNWLKS++GF
Sbjct  148   DDRLDWDPSFICRGDTNYAGTGNPDTGEDYKPAPDIDHLNPRVQKELSEWMNWLKSEIGF  207

Query  632   DGWRFDYVKGYDFVKGFAAVKIYMDNTKPEFAVGELWNALSPGSVPNPDYNQDAHRNELV  811
              GWRFD+V+GY      +  K Y+ NT P+FAVGE W+ +  G     +Y+Q+ HR+ L 
Sbjct  208   SGWRFDFVRGY----AASVTKSYVQNTSPDFAVGEKWDDMKYGGDGKLEYDQEEHRSGLK  263

Query  812   RWVQNaggaataf-dfttKGILQAALNNTELWRLKDAAGKPSGMIGVLPQSAVTFIDNHD  988
              W++  GG      DFTTKGILQ+A+   ELWRLKD+ GKP G+IG++P +AVTF+DNHD
Sbjct  264   HWIEEGGGGVLTAFDFTTKGILQSAVGG-ELWRLKDSQGKPPGLIGIMPGNAVTFVDNHD  322

Query  989   TWSQRLWPFTTSTDDAVNHDRVLQGYAYILTHPGIPSVFYDHFFEWGLKDAISKLISIRN  1168
             T     W F +        D+VL GY YILTHPG P +FY H+ EWGLKD+ISKL++IRN
Sbjct  323   TIRPNSWAFPS--------DKVLLGYVYILTHPGTPCIFYSHYIEWGLKDSISKLVAIRN  374

Query  1169  KNGVSATSPVEILAADADLYIAKINGKVILKIGPNGDLKNLVPSDFMLATSGKDFAVWEK  1348
             +NG+ +TS V I AA+A+LY+A I+ KVI+KIGP  D+  LVP +F+LA SG DFAVWEK
Sbjct  375   RNGIGSTSSVMIKAAEAELYLAMIDEKVIMKIGPKLDIGTLVPPNFVLAYSGLDFAVWEK  434



>gb|AAM09952.1| alpha-amylase [Eleusine coracana subsp. coracana]
Length=403

 Score =   446 bits (1148),  Expect = 2e-149, Method: Compositional matrix adjust.
 Identities = 233/416 (56%), Positives = 298/416 (72%), Gaps = 19/416 (5%)
 Frame = +2

Query  113   VLFQGFTWTSKDQPGGWWNWLITKVPDLADAGITHVWLPPPSNAREGDDQGYMPKRMYDL  292
             +LFQGF W S  Q GGW+N L+ KV  +A AGITHVWLPPPS++    +QGYMP R+YDL
Sbjct  2     ILFQGFNWESWKQNGGWYNLLMGKVDVIAAAGITHVWLPPPSHSVA--EQGYMPGRLYDL  59

Query  293   DTSKYGNKKELKALNDAFHGRGIKSVADIVLNHRAAERANSRGVFNVFEGGTPDDKLDWG  472
             D SKYGN+ +LK+L  AFH +G+K +ADIV+NHR AE  +SRG++ +FEGGTPD +LDWG
Sbjct  60    DASKYGNEAQLKSLIQAFHAKGVKVIADIVINHRTAEHQDSRGIYCMFEGGTPDTRLDWG  119

Query  473   PSEICGDDAAF-EGTGNPDTGDPWGDAPDIDHRSPRVQREISEWMNWLKSDVGFDGWRFD  649
             P  IC DD+ + +GTGNPDTG  +G APDIDH + RVQ+E+  W+NWLK+D+GFD WR D
Sbjct  120   PHMICRDDSPYADGTGNPDTGADFGGAPDIDHLNTRVQQELIGWLNWLKTDIGFDAWRLD  179

Query  650   YVKGYDFVKGFAAVKIYMDNTKPEFAVGELWNALSPGSVPNPDYNQDAHRNELVRWVQNa  829
             + KGY         KIY+D+T+P FAV E+W +L+ G    P+Y+Q AHR ELV WV   
Sbjct  180   FAKGYSA----DVAKIYIDSTEPSFAVAEIWTSLAYGGDGKPNYDQSAHRQELVNWVDRV  235

Query  830   gga--atafdfttKGILQAALNNTELWRLKDAAGKPSGMIGVLPQSAVTFIDNHDTWS-Q  1000
             G +  AT FDFTTKGIL  A++  ELWRL+   GK  GMIG  P  AVTFIDNHDT S Q
Sbjct  236   GRSGPATTFDFTTKGILNVAVDG-ELWRLRGNDGKAPGMIGWWPAKAVTFIDNHDTGSTQ  294

Query  1001  RLWPFTTSTDDAVNHDRVLQGYAYILTHPGIPSVFYDHFFEWGLKDAISKLISIRNKNGV  1180
              +WPF          ++V+QGYAYILTHPG P +FYDHFF+WGLKD I +L+SIRN++G+
Sbjct  295   HMWPFPA--------NKVMQGYAYILTHPGNPCIFYDHFFDWGLKDEIVQLVSIRNRHGI  346

Query  1181  SATSPVEILAADADLYIAKINGKVILKIGPNGDLKNLVPSDFMLATSGKDFAVWEK  1348
                S +  + ADADLY+A+I+GKVI K+G   D+ +L+P  F +   G  +AVWEK
Sbjct  347   HPESELRAIEADADLYLAEIDGKVITKLGTRYDVGHLIPDGFQVVAHGDGYAVWEK  402



>ref|XP_006659493.1| PREDICTED: alpha-amylase isozyme 3E-like [Oryza brachyantha]
Length=436

 Score =   447 bits (1150),  Expect = 3e-149, Method: Compositional matrix adjust.
 Identities = 229/441 (52%), Positives = 303/441 (69%), Gaps = 21/441 (5%)
 Frame = +2

Query  32    ETIMKSSFYLSLFCIAFFLFPLHSSSTVLFQGFTWTSKDQPGGWWNWLITKVPDLADAGI  211
              ++      +++ C+A  L    + + VLFQGF W S    GGW+N+L  KV ++A  G+
Sbjct  4     HSVTVCCALVAVLCMASSL----AQAQVLFQGFNWESWRMQGGWYNFLHEKVEEIASTGV  59

Query  212   THVWLPPPSNAREGDDQGYMPKRMYDLDTSKYGNKKELKALNDAFHGRGIKSVADIVLNH  391
             THVWLPPPS++     QGYMP R+YDLD SKYG + EL++L +AFH + ++ +ADIV+NH
Sbjct  60    THVWLPPPSHSVS--PQGYMPGRLYDLDASKYGTEAELRSLIEAFHEKNVECLADIVINH  117

Query  392   RAAERANSRGVFNVFEGGTPDDKLDWGPSEICGDDAAFE-GTGNPDTGDPWGDAPDIDHR  568
             R A+  +SRGV+ VFEGGTPD +LDWGP  IC DD  +  G G+ DTG  +G APDIDH 
Sbjct  118   RCADYKDSRGVYCVFEGGTPDGRLDWGPDMICSDDTQYSNGRGHRDTGAGFGAAPDIDHL  177

Query  569   SPRVQREISEWMNWLKSDVGFDGWRFDYVKGYDFVKGFAAVKIYMDNTKPEFAVGELWNA  748
             +PRVQRE+++W+NWLK+D+GFDGWR D+ KGY         ++Y+DNT P F VGE+W++
Sbjct  178   NPRVQRELTDWLNWLKADLGFDGWRLDFAKGYSA----PIARVYVDNTNPTFVVGEIWSS  233

Query  749   LSPGSVPNPDYNQDAHRNELVRWVQNaggaatafdfttKGILQAALNNTELWRLKDAAGK  928
             L       P  NQDA R ELV WV   G  ATAFDFTTKGILQAA+   ELWRL D  GK
Sbjct  234   LIYNGDGKPSTNQDADRQELVNWVDGVGKPATAFDFTTKGILQAAVQG-ELWRLHDGNGK  292

Query  929   PSGMIGVLPQSAVTFIDNHDTWS-QRLWPFTTSTDDAVNHDRVLQGYAYILTHPGIPSVF  1105
               G++G +P  AVTF+DNHDT S Q LWPF +        D+V+QGYAYILTHPGIP +F
Sbjct  293   APGLMGWMPDQAVTFVDNHDTGSTQSLWPFPS--------DKVMQGYAYILTHPGIPCIF  344

Query  1106  YDHFFEWGLKDAISKLISIRNKNGVSATSPVEILAADADLYIAKINGKVILKIGPNGDLK  1285
             YDH F+W L+  I+ L +IR++NG+   S ++IL A+ D+Y+A I+G+VI K+GP  D  
Sbjct  345   YDHVFDWNLQHEIATLAAIRSRNGIHPESTLDILKAEGDIYVAMIDGRVITKLGPRYDAG  404

Query  1286  NLVPSDFMLATSGKDFAVWEK  1348
              ++PSDF +   G D+ VWEK
Sbjct  405   GIIPSDFHVVAHGNDYCVWEK  425



>ref|XP_004960025.1| PREDICTED: alpha-amylase type A isozyme-like [Setaria italica]
Length=427

 Score =   446 bits (1148),  Expect = 3e-149, Method: Compositional matrix adjust.
 Identities = 229/416 (55%), Positives = 291/416 (70%), Gaps = 20/416 (5%)
 Frame = +2

Query  113   VLFQGFTWTSKDQPGGWWNWLITKVPDLADAGITHVWLPPPSNAREGDDQGYMPKRMYDL  292
             VLFQGF W S  Q GGW+N L+ KV D+A AG+THVWLPPPS++     QGYMP R+YDL
Sbjct  23    VLFQGFNWESWKQSGGWYNLLMGKVDDIAAAGVTHVWLPPPSHSVS--TQGYMPGRLYDL  80

Query  293   DTSKYGNKKELKALNDAFHGRGIKSVADIVLNHRAAERANSRGVFNVFEGGTPDDKLDWG  472
             D SKYG   ELK+L  AFH +G+++VADIV+NHR A+  +SRG++ +FEGGT D +LDWG
Sbjct  81    DASKYGTAAELKSLIAAFHAKGVQAVADIVINHRCADYKDSRGIYCIFEGGTSDSRLDWG  140

Query  473   PSEICGDDAAF-EGTGNPDTGDPWGDAPDIDHRSPRVQREISEWMNWLKSDVGFDGWRFD  649
             P  IC DD  + +GT N DTG  +  APDIDH + RVQRE++EW+ WLKSD+GFD WR D
Sbjct  141   PHMICRDDTQYSDGTANLDTGADFAAAPDIDHLNDRVQRELTEWLLWLKSDIGFDAWRLD  200

Query  650   YVKGYDFVKGFAAVKIYMDNTKPEFAVGELWNALSPGSVPNPDYNQDAHRNELVRWVQNa  829
             + +GY         K+Y+D T P FAV E+WN + PG    P Y+QD HR  LV WV N 
Sbjct  201   FARGYSA----EVAKVYVDGTAPSFAVAEIWNNMVPGDDGKPAYDQDPHRQTLVDWVDNV  256

Query  830   ggaatafdf---ttKGILQAALNNTELWRLKDAAGKPSGMIGVLPQSAVTFIDNHDTWS-  997
             GGAA+       TTKGIL AA+   ELWRL DA GK  G+IG  P  AVTF+DNHDT S 
Sbjct  257   GGAASPATVFDFTTKGILNAAVEG-ELWRLVDAQGKAPGVIGWWPAKAVTFVDNHDTGST  315

Query  998   QRLWPFTTSTDDAVNHDRVLQGYAYILTHPGIPSVFYDHFFEWGLKDAISKLISIRNKNG  1177
             Q +WPF +        D+V+QGYAYILTHPG P +FYDHFF+WG KD I+ L+++R +NG
Sbjct  316   QAMWPFPS--------DKVMQGYAYILTHPGNPCIFYDHFFDWGFKDEIAALVAVRKRNG  367

Query  1178  VSATSPVEILAADADLYIAKINGKVILKIGPNGDLKNLVPSDFMLATSGKDFAVWE  1345
             ++ TS + IL  D D Y+A+I+GKVI+KIG   D+ +L+P+ F +A  G D+AVWE
Sbjct  368   ITPTSKLTILEHDGDAYVAEIDGKVIMKIGSRLDVGHLIPAGFEVAAHGNDYAVWE  423



>gb|KDP29720.1| hypothetical protein JCGZ_18655 [Jatropha curcas]
Length=401

 Score =   446 bits (1146),  Expect = 3e-149, Method: Compositional matrix adjust.
 Identities = 246/433 (57%), Positives = 300/433 (69%), Gaps = 47/433 (11%)
 Frame = +2

Query  56    YLSLFC-IAFFL--FPLHSSSTVLFQGFTWTSKDQPGGWWNWLITKVPDLADAGITHVWL  226
             +L +FC ++ FL  FP   S  +LFQGF W S +Q GGW+N L   + DLA+AGITHVWL
Sbjct  3     FLIIFCFLSLFLSTFPSFISPHLLFQGFNWESSNQAGGWYNLLENLISDLANAGITHVWL  62

Query  227   PPPSNAREGDDQGYMPKRMYDLDTSKYGNKKELKALNDAFHGRGIKSVADIVLNHRAAER  406
             PPPS +     QGY+P ++YDLD SKYG++ ELK+L +A H +GIKS+ADIV+NHR AE+
Sbjct  63    PPPSQSVSS--QGYLPGKLYDLDASKYGSQDELKSLIEALHQKGIKSIADIVINHRTAEK  120

Query  407   ANSRGVFNVFEGGTPDDKLDWGPSEICGDDAAFEGTGNPDTGDPWGDAPDIDHRSPRVQR  586
                                          D   +G GNPDTG+ +G APDIDH +  VQ 
Sbjct  121   ----------------------------QDKYSDGQGNPDTGEGYGPAPDIDHVNTTVQT  152

Query  587   EISEWMNWLKSDVGFDGWRFDYVKGYDFVKGFAAVKIYMDNTKPEFAVGELWNALSPGSV  766
             E+S W+NWLKSD+GFDGWRFD+VKGY         K+YM+NT P+FAVGE W++L+ G  
Sbjct  153   ELSNWLNWLKSDIGFDGWRFDFVKGY----APRFTKLYMENTSPDFAVGEKWDSLAYGQD  208

Query  767   PNPDYNQDAHRNELVRWVQNaggaatafdfttKGILQAALNNTELWRLKDAAGKPSGMIG  946
               P+ NQD+HR  L  WV+NAGG  TAFDFTTKGILQ A+   ELWRLKD+ GKP G IG
Sbjct  209   GKPNPNQDSHREALKDWVENAGGVVTAFDFTTKGILQVAVEG-ELWRLKDSNGKPPGFIG  267

Query  947   VLPQSAVTFIDNHDTWS-QRLWPFTTSTDDAVNHDRVLQGYAYILTHPGIPSVFYDHFFE  1123
             +LPQ+AVTFIDNHDT S Q+ WPF +        D+VL GYAYILTHPGIPSVFYDHFFE
Sbjct  268   ILPQNAVTFIDNHDTGSTQKSWPFPS--------DKVLLGYAYILTHPGIPSVFYDHFFE  319

Query  1124  WGLKDAISKLISIRNKNGVSATSPVEILAADADLYIAKINGKVILKIGPNGDLKNLVPSD  1303
             WGLK+ I KL +IR  NG+S TS V ILAAD+DLY+AKIN  VI+KIG   DL NL+P D
Sbjct  320   WGLKEEIIKLSAIRKNNGISQTSSVNILAADSDLYVAKINDIVIIKIGTKNDLGNLIPPD  379

Query  1304  FMLATSGKDFAVW  1342
             F +A SG D+AVW
Sbjct  380   FQVAASGNDYAVW  392



>ref|XP_007222445.1| hypothetical protein PRUPE_ppa006160mg [Prunus persica]
 gb|EMJ23644.1| hypothetical protein PRUPE_ppa006160mg [Prunus persica]
Length=425

 Score =   446 bits (1146),  Expect = 6e-149, Method: Compositional matrix adjust.
 Identities = 245/439 (56%), Positives = 311/439 (71%), Gaps = 22/439 (5%)
 Frame = +2

Query  50    SFYLSL-FCIAFFLFPLHSSSTVLFQGFTWTSKDQPGGWWNWLITKVPDLADAGITHVWL  226
             +F LS  FC+     P  ++  VLFQGF W S  + GGW+N L T +P+LA +GITHVWL
Sbjct  2     NFLLSFCFCLCVSRLPSFATPAVLFQGFNWDSS-KKGGWYNSLKTTIPELASSGITHVWL  60

Query  227   PPPSNAREGDDQGYMPKRMYDLDTSKYGNKKELKALNDAFHGRGIKSVADIVLNHRAAER  406
             PPPS++     +GY P R+YDLD S YGNK ELK+L    H +GIK++ADIVLNHR+A +
Sbjct  61    PPPSHSN--GTEGYDPGRLYDLDASSYGNKDELKSLIATMHEKGIKAIADIVLNHRSAVK  118

Query  407   ANSRGVFNVFEGGTPDDKLDWGPSEICGDDAAFE-GTGNPDTGDPWGDAPDIDHRSPRVQ  583
              +  G++++FEGGT D +LD+  S IC DD     GTGNPDTGD +    D+DH +PR+Q
Sbjct  119   QDENGIWSIFEGGTEDGRLDFNASLICRDDNDHPFGTGNPDTGDNFPYTADVDHTNPRLQ  178

Query  584   REISEWMNWLKSDVGFDGWRFDYVKGYDFVKGFAAVKIYMDNTKPEFAVGELWN-ALSPG  760
              E+S+W+NWLK+D+GFDGWR DYV GY    G +  K+YM+ T PEFAV E W   +S G
Sbjct  179   TELSDWLNWLKTDIGFDGWRLDYVIGY----GSSFTKLYMEKTSPEFAVAEYWRWNISKG  234

Query  761   SVPNPDYNQDAHRNELVRWVQNaggaatafdfttKGILQAALNNTELWRLKDAAGKPSGM  940
                  D NQDAHRNE+V W++ AGG  TAFD TTK IL  A+   ELWRLKD+ GKP G+
Sbjct  235   QDGKLDKNQDAHRNEIVNWIEAAGGVVTAFDLTTKYILNVAVEG-ELWRLKDSNGKPPGL  293

Query  941   IGVLPQSAVTFIDNHDTWSQRLWPFTTSTDDAVNHDRVLQGYAYILTHPGIPSVFYDHFF  1120
             IG+ P+SAVTFIDNHDTWSQ L PF          D+VL GYAYILTHPG PS+FYDHFF
Sbjct  294   IGIKPESAVTFIDNHDTWSQGLLPFP--------DDKVLLGYAYILTHPGTPSIFYDHFF  345

Query  1121  EWGL-KDAISKLISIRNKNGVSATSPVEILAADADLYIAKINGKVILKIGPNGDLKNLVP  1297
             +WG  K++I  L +IR +NG+++ S V ILAA+ADLY+A I+ K+I+KIGP   L +L P
Sbjct  346   DWGWPKESIRNLTAIRARNGINSRSSVTILAAEADLYMANIDDKIIMKIGPRLGLGDLDP  405

Query  1298  --SDFMLATSGKDFAVWEK  1348
               S+F +ATSG+DFAVWEK
Sbjct  406   TKSNFHVATSGQDFAVWEK  424



>ref|XP_006413356.1| hypothetical protein EUTSA_v10025232mg [Eutrema salsugineum]
 gb|ESQ54809.1| hypothetical protein EUTSA_v10025232mg [Eutrema salsugineum]
Length=437

 Score =   446 bits (1147),  Expect = 8e-149, Method: Compositional matrix adjust.
 Identities = 229/425 (54%), Positives = 298/425 (70%), Gaps = 19/425 (4%)
 Frame = +2

Query  86    LFPLHSSSTVL-FQGFTWTSKDQPGGWWNWLITKVPDLADAGITHVWLPPPSNAREGDDQ  262
              FP  + ST+L FQGF W S  Q GG++N L   + D++++GITH+WLPPPS +     +
Sbjct  19    FFPTFTFSTLLLFQGFKWESWKQEGGFYNSLQNSIDDISNSGITHIWLPPPSQSVS--PE  76

Query  263   GYMPKRMYDLDTSKYGNKKELKALNDAFHGRGIKSVADIVLNHRAAERANSRGVFNVFEG  442
             GY+P ++YDL++SKYG++ ELK+L  A + RGIKSVADIV+NHR  ER +    +  FEG
Sbjct  77    GYLPGKLYDLNSSKYGSETELKSLIAALNQRGIKSVADIVINHRTGERKDDHCGYCYFEG  136

Query  443   GTPDDKLDWGPSEICGDDAAFEGTGNPDTGDPWGDAPDIDHRSPRVQREISEWMNWLKSD  622
             GT D +LDW PS +C DD  F GTGN DTG  +  APDIDH +PRVQ+E+SEWMNWLKS+
Sbjct  137   GTSDGRLDWDPSFVCRDDPKFPGTGNSDTGKDFDGAPDIDHLNPRVQKELSEWMNWLKSE  196

Query  623   VGFDGWRFDYVKGYDFVKGFAAVKIYMDNTKPEFAVGELWNALSPGSVPNPDYNQDAHRN  802
             +GF GWRFD+V+GY      +  K Y+ NT PEFAVGE W+ +  G    P+Y+QD HR+
Sbjct  197   IGFSGWRFDFVRGY----APSITKSYVKNTSPEFAVGEKWDDMKYGGDGKPEYDQDEHRS  252

Query  803   ELVRWVQNaggaatafdf---ttKGILQAALNNTELWRLKDAAGKPSGMIGVLPQSAVTF  973
              L  W++ AGG          TTKGILQ+A+   ELWRLKD+ GKP G+IG++P +AVTF
Sbjct  253   ALRHWIEEAGGGGGVLTAFDFTTKGILQSAVGG-ELWRLKDSQGKPPGLIGIMPGNAVTF  311

Query  974   IDNHDTWSQRLWPFTTSTDDAVNHDRVLQGYAYILTHPGIPSVFYDHFFEWGLKDAISKL  1153
             +DNHDT     W F +        D+VL GY YILTHPG P +FY H+ EWGLKD+I+KL
Sbjct  312   VDNHDTIRPNTWAFPS--------DKVLLGYVYILTHPGTPCIFYSHYMEWGLKDSITKL  363

Query  1154  ISIRNKNGVSATSPVEILAADADLYIAKINGKVILKIGPNGDLKNLVPSDFMLATSGKDF  1333
             ++IR +NG+ +TS V I AA++DLY+A I+ KVI+KIGP  DL  LVPS++ LA SG D 
Sbjct  364   VAIRKRNGIGSTSSVTIKAAESDLYLAVIDDKVIMKIGPKMDLGTLVPSNYALAYSGLDC  423

Query  1334  AVWEK  1348
             AVWEK
Sbjct  424   AVWEK  428



>ref|NP_001276156.1| alpha-amylase-like precursor [Glycine max]
 gb|ACU18643.1| unknown [Glycine max]
Length=422

 Score =   445 bits (1144),  Expect = 1e-148, Method: Compositional matrix adjust.
 Identities = 237/386 (61%), Positives = 293/386 (76%), Gaps = 25/386 (6%)
 Frame = +2

Query  86    LFPLHSSSTVLFQGFTWTSKDQPGGWWNWLITKVPDLADAGITHVWLPPPSNAREGDDQG  265
              FPL +S  +LFQGF W S  + GGW+N L   +PDLA+AGITHVWLPPPS +     +G
Sbjct  16    FFPLFASPALLFQGFNWESSKK-GGWYNSLKNTIPDLANAGITHVWLPPPSQSVS--PEG  72

Query  266   YMPKRMYDLDTSKYGNKKELKALNDAFHGRGIKSVADIVLNHRAAERANSRGVFNVFEGG  445
             Y+P R+YDLD SKYG K +LK+L  AFH +GIK +ADIV+NHR AER + RG++ +FEGG
Sbjct  73    YLPGRLYDLDASKYGTKDQLKSLIAAFHDKGIKCLADIVINHRTAERKDGRGIYCIFEGG  132

Query  446   TPDDKLDWGPSEICGDDAAF-EGTGNPDTGDPWGDAPDIDHRSPRVQREISEWMNWLKSD  622
             TPD +LDWGPS IC DD  + +GTGN D+G+P+  APDIDH +P+VQRE+SEWMNWLK++
Sbjct  133   TPDARLDWGPSFICKDDNTYSDGTGNLDSGEPYDPAPDIDHLNPQVQRELSEWMNWLKTE  192

Query  623   VGFDGWRFDYVKGYDFVKGFAAVKIYMDNTKPEFAVGELWNALSPGSVPNPDYNQDAHRN  802
             +GFDGWRFDYVKGY      +  KIYM+ T+P+FAVGE W++LS         N D HR 
Sbjct  193   IGFDGWRFDYVKGY----APSITKIYMEQTRPDFAVGEKWDSLSID-------NYDGHRG  241

Query  803   ELVRWVQNaggaatafdfttKGILQAALNNTELWRLKDAAGKPSGMIGVLPQSAVTFIDN  982
              LV WV++AGGA TAFDFTTKGILQAA+   +LWRLKD+ GKPSGMIGV P++AVTFIDN
Sbjct  242   ALVNWVESAGGAITAFDFTTKGILQAAVQG-QLWRLKDSNGKPSGMIGVKPENAVTFIDN  300

Query  983   HDTWS-QRLWPFTTSTDDAVNHDRVLQGYAYILTHPGIPSVFYDHFFEWGLKDAISKLIS  1159
             HDT S QR+WPF +        D+V+QGYAYILTHPG PS+FYDHFF+WGLK+ I+KL S
Sbjct  301   HDTGSTQRIWPFPS--------DKVMQGYAYILTHPGTPSIFYDHFFDWGLKEQIAKLSS  352

Query  1160  IRNKNGVSATSPVEILAADADLYIAK  1237
             IR K+G++  S V ILAA+ADL   K
Sbjct  353   IRVKHGINEKSSVNILAAEADLLCCK  378



>ref|XP_010236079.1| PREDICTED: alpha-amylase type B isozyme-like [Brachypodium distachyon]
Length=428

 Score =   444 bits (1142),  Expect = 3e-148, Method: Compositional matrix adjust.
 Identities = 229/421 (54%), Positives = 293/421 (70%), Gaps = 20/421 (5%)
 Frame = +2

Query  101   SSSTVLFQGFTWTSKDQPGGWWNWLITKVPDLADAGITHVWLPPPSNAREGDDQGYMPKR  280
             +S  +LFQGF W S  Q GGW+N L  KV D+A AG+THVWLPPPS +    +QGYMP R
Sbjct  22    ASGQILFQGFNWESWKQNGGWYNLLKGKVNDIAAAGVTHVWLPPPSQSV--GEQGYMPGR  79

Query  281   MYDLDTSKYGNKKELKALNDAFHGRGIKSVADIVLNHRAAERANSRGVFNVFEGGTPDDK  460
             +YDLD SKYGN  +LKAL  AFH +G+K +ADIV+NHR AE  + RG++ +FEGGTPD +
Sbjct  80    LYDLDASKYGNAAQLKALIGAFHDKGVKVIADIVINHRTAEHKDGRGIYCLFEGGTPDAR  139

Query  461   LDWGPSEICGDDAAF-EGTGNPDTGDPWGDAPDIDHRSPRVQREISEWMNWLKSDVGFDG  637
             LDWG   IC DD  + +GTGNPDTG  +G APDIDH + RVQ E++ W+NWLK+D+GFD 
Sbjct  140   LDWGAHMICRDDKPYADGTGNPDTGADFGGAPDIDHLNTRVQEELTAWLNWLKTDIGFDA  199

Query  638   WRFDYVKGYDFVKGFAAVKIYMDNTKPEFAVGELWNALSPGSVPNPDYNQDAHRNELVRW  817
             WR D+ KGY         K+Y++ T+P+ AV E+W  L+ G    PD +QDAHR ELV W
Sbjct  200   WRLDFAKGYSA----DVAKVYIEKTEPDLAVAEVWTPLAYGGDGKPDADQDAHRQELVNW  255

Query  818   VQNaggaatafdf---ttKGILQAALNNTELWRLKDAAGKPSGMIGVLPQSAVTFIDNHD  988
             V  AGGAA        TTKGIL  A++  ELWR++ A GK  GMIG  P  AVTF+DNHD
Sbjct  256   VDKAGGAAGRATAFDFTTKGILNVAVDG-ELWRMRAADGKAPGMIGWWPAKAVTFVDNHD  314

Query  989   TWS-QRLWPFTTSTDDAVNHDRVLQGYAYILTHPGIPSVFYDHFFEWGLKDAISKLISIR  1165
             T S QR+WPF +        D+V+QGYAYILTHPG P +FYDHFF+WGLK+ I  L++IR
Sbjct  315   TGSTQRMWPFPS--------DKVMQGYAYILTHPGSPCIFYDHFFDWGLKEEIEHLVAIR  366

Query  1166  NKNGVSATSPVEILAADADLYIAKINGKVILKIGPNGDLKNLVPSDFMLATSGKDFAVWE  1345
              K G+   S + I+ ADADLY+A+++GKVI K+G   D+ +L+P  F +   GKD++VW 
Sbjct  367   TKQGIHKDSKLRIIEADADLYLAEVDGKVITKLGSRFDVGHLIPEGFQVVAHGKDYSVWA  426

Query  1346  K  1348
             K
Sbjct  427   K  427



>gb|EAZ09376.1| hypothetical protein OsI_31649 [Oryza sativa Indica Group]
Length=437

 Score =   444 bits (1142),  Expect = 4e-148, Method: Compositional matrix adjust.
 Identities = 232/418 (56%), Positives = 290/418 (69%), Gaps = 17/418 (4%)
 Frame = +2

Query  101   SSSTVLFQGFTWTSKDQPGGWWNWLITKVPDLADAGITHVWLPPPSNAREGDDQGYMPKR  280
             + + VLFQGF W S  + GGW+N+L + V D+A  G+THVWLPPPS++     QGYMP R
Sbjct  24    AQAQVLFQGFNWESWKKQGGWYNFLHSHVDDIAATGVTHVWLPPPSHSVA--PQGYMPGR  81

Query  281   MYDLDTSKYGNKKELKALNDAFHGRGIKSVADIVLNHRAAERANSRGVFNVFEGGTPDDK  460
             +YDLD SKYG   EL++L  AFH + IK VADIV+NHR A+  +SRG++ +FEGGTPD +
Sbjct  82    LYDLDASKYGTGAELRSLIAAFHSKSIKCVADIVINHRCADYKDSRGIYCIFEGGTPDSR  141

Query  461   LDWGPSEICGDDAAFE-GTGNPDTGDPWGDAPDIDHRSPRVQREISEWMNWLKSDVGFDG  637
             LDWGP  IC DD  +  G G+ DTG  +G APDIDH + RVQRE+S+W+NWLKSDVGFDG
Sbjct  142   LDWGPDMICSDDTQYSNGRGHRDTGADFGAAPDIDHLNTRVQRELSDWLNWLKSDVGFDG  201

Query  638   WRFDYVKGYDFVKGFAAVKIYMDNTKPEFAVGELWNALSPGSVPNPDYNQDAHRNELVRW  817
             WR D+ KGY         K Y+DNT P F V E+W+ +       P +NQD  R ELV W
Sbjct  202   WRLDFAKGYSAT----VAKTYVDNTDPSFVVAEIWSNMRYDGNGEPSWNQDGDRQELVNW  257

Query  818   VQNaggaatafdfttKGILQAALNNTELWRLKDAAGKPSGMIGVLPQSAVTFIDNHDTWS  997
              Q  GG A+AFDFTTKG LQAA+   ELWR+KD  GK  GMIG LP+ AVTFIDNHDT S
Sbjct  258   AQAVGGPASAFDFTTKGELQAAVQG-ELWRMKDGNGKAPGMIGWLPEKAVTFIDNHDTGS  316

Query  998   -QRLWPFTTSTDDAVNHDRVLQGYAYILTHPGIPSVFYDHFFEWGLKDAISKLISIRNKN  1174
              Q  WPF +        D+V+QGYAYILTHPG+P +FYDH F+W LK  IS L ++R++N
Sbjct  317   TQNSWPFPS--------DKVMQGYAYILTHPGVPCIFYDHVFDWNLKQEISTLAAVRSRN  368

Query  1175  GVSATSPVEILAADADLYIAKINGKVILKIGPNGDLKNLVPSDFMLATSGKDFAVWEK  1348
             G+   S + ILAAD D+Y+A I+ KVI KIG   D+ NL+PSDF +   G ++ VWEK
Sbjct  369   GIHPGSKLNILAADGDVYVAMIDDKVITKIGTRYDVGNLIPSDFHVVAHGNNYCVWEK  426



>emb|CAA09323.1| alpha amylase [Avena fatua]
Length=434

 Score =   444 bits (1141),  Expect = 5e-148, Method: Compositional matrix adjust.
 Identities = 222/417 (53%), Positives = 294/417 (71%), Gaps = 20/417 (5%)
 Frame = +2

Query  113   VLFQGFTWTSKDQPGGWWNWLITKVPDLADAGITHVWLPPPSNAREGDDQGYMPKRMYDL  292
             VLFQGF W S  Q GGW+N ++ KV D+A AG+THVWLPPPS++    ++GYMP R+YD+
Sbjct  26    VLFQGFNWESWKQSGGWYNMMMGKVDDIAAAGVTHVWLPPPSHSVS--NEGYMPGRLYDI  83

Query  293   DTSKYGNKKELKALNDAFHGRGIKSVADIVLNHRAAERANSRGVFNVFEGGTPDDKLDWG  472
             D SKYGN  ELK+L  AFHG+G+  +ADIV+NHR A+  + RG++ +FEGGTPD +LDWG
Sbjct  84    DASKYGNAAELKSLIGAFHGKGVHVIADIVINHRCADYKDKRGIYCIFEGGTPDSRLDWG  143

Query  473   PSEICGDDAAF-EGTGNPDTGDPWGDAPDIDHRSPRVQREISEWMNWLKSDVGFDGWRFD  649
             P  IC DD  + +GT N DTG  +  APDIDH + RVQRE+ EW+ WLK+D+GFD WR D
Sbjct  144   PHMICRDDTIYSDGTANLDTGADFAAAPDIDHLNDRVQRELKEWLLWLKTDLGFDAWRLD  203

Query  650   YVKGYDFVKGFAAVKIYMDNTKPEFAVGELWNALSPGSVPNPDYNQDAHRNELVRWVQNa  829
             + KGY      A  K+Y+D T P+ AV E+W+ +  G    P+Y+QDAHR  LV WV   
Sbjct  204   FAKGYSA----AMAKVYIDGTSPDLAVAEVWDTMQTGGDGKPEYDQDAHRQNLVNWVDGV  259

Query  830   ggaatafdf---ttKGILQAALNNTELWRLKDAAGKPSGMIGVLPQSAVTFIDNHDTWS-  997
             GGAA+A      TTKGIL AA+   ELWRL D  GK  G++G  P  AVTF+DNHDT S 
Sbjct  260   GGAASAGMVFDFTTKGILNAAVEG-ELWRLIDPQGKAPGVMGWWPAKAVTFVDNHDTGST  318

Query  998   QRLWPFTTSTDDAVNHDRVLQGYAYILTHPGIPSVFYDHFFEWGLKDAISKLISIRNKNG  1177
             Q +WPF +        D+V+QGYAYILTHPG P +FYDHFF WG K+ I+ L+++R +NG
Sbjct  319   QAMWPFPS--------DKVMQGYAYILTHPGTPCIFYDHFFNWGFKEEIAALVAVRKRNG  370

Query  1178  VSATSPVEILAADADLYIAKINGKVILKIGPNGDLKNLVPSDFMLATSGKDFAVWEK  1348
             ++ATS ++IL  D D Y+A+I+GKV++KIG   D+ +++P+ F+ +  G D+AVWEK
Sbjct  371   ITATSELKILMHDGDAYVAEIDGKVVVKIGSRYDVGSVIPAGFVTSAHGSDYAVWEK  427



>ref|XP_010448491.1| PREDICTED: alpha-amylase 1-like [Camelina sativa]
Length=422

 Score =   442 bits (1138),  Expect = 9e-148, Method: Compositional matrix adjust.
 Identities = 231/437 (53%), Positives = 304/437 (70%), Gaps = 19/437 (4%)
 Frame = +2

Query  41    MKSSFYLSLFCIAFFL-FPLHSSSTVLFQGFTWTSKDQPGGWWNWLITKVPDLADAGITH  217
             M S   L   C+ FF+ FP  + ST+LFQ F W S  + GG++N +   + D+A AG TH
Sbjct  1     MTSLHALLFTCLLFFIVFPTFTFSTLLFQSFNWESWKKEGGFYNSIHNSIDDIAKAGTTH  60

Query  218   VWLPPPSNAREGDDQGYMPKRMYDLDTSKYGNKKELKALNDAFHGRGIKSVADIVLNHRA  397
             +WLPP S +     +GY+P ++YDL +SKYG++ ELK+L  A + +GIK+VADIV+NHR 
Sbjct  61    IWLPPSSQSVA--PEGYLPGKLYDLKSSKYGSETELKSLIQALNQKGIKAVADIVINHRT  118

Query  398   AERANSRGVFNVFEGGTPDDKLDWGPSEICGDDAAFEGTGNPDTGDPWGDAPDIDHRSPR  577
                 + +  +  FEGGT DD+LDW PS +C +D  F GTGN DTG  +  APDIDH +PR
Sbjct  119   GVSKDDKCGYCYFEGGTSDDRLDWDPSFVCRNDPNFPGTGNIDTGGDFNGAPDIDHLNPR  178

Query  578   VQREISEWMNWLKSDVGFDGWRFDYVKGYDFVKGFAAVKIYMDNTKPEFAVGELWNALSP  757
             VQ+E+SEWMNWLKSD+GF GWRFD+V+GY      +  K+Y+ NT P+FAVGE W+ +  
Sbjct  179   VQKELSEWMNWLKSDIGFHGWRFDFVRGY----ASSITKLYVQNTSPDFAVGENWDHMKY  234

Query  758   GSVPNPDYNQDAHRNELVRWVQNaggaatafd-fttKGILQAALNNTELWRLKDAAGKPS  934
             G     DYNQD HR+ L +W++ AGG       FTTKGILQ+A+   ELWRLKD+ GKP 
Sbjct  235   GGDGKLDYNQDQHRSGLKQWIEEAGGGVLTAFDFTTKGILQSAVQG-ELWRLKDSQGKPP  293

Query  935   GMIGVLPQSAVTFIDNHDTWSQRLWPFTTSTDDAVNHDRVLQGYAYILTHPGIPSVFYDH  1114
             G+IG +P +AVTFI+NHDT+  R W F +        D+VL GY YILTHPG P +FY+H
Sbjct  294   GLIGTMPGNAVTFIENHDTF--RTWVFPS--------DKVLLGYVYILTHPGTPCIFYNH  343

Query  1115  FFEWGLKDAISKLISIRNKNGVSATSPVEILAADADLYIAKINGKVILKIGPNGDLKNLV  1294
             + EWGLK++ISKL++IRN+NG+ +TS V I AA++DLY+A I+ KVI+KIGP  DL  LV
Sbjct  344   YMEWGLKESISKLVAIRNRNGIGSTSSVTIKAAESDLYLAMIDDKVIMKIGPKLDLGTLV  403

Query  1295  PSDFMLATSGKDFAVWE  1345
             P  + LA SG DFAVWE
Sbjct  404   PPSYALAYSGLDFAVWE  420



>pdb|2QPU|A Chain A, Sugar Tongs Mutant S378p In Complex With Acarbose
 pdb|2QPU|B Chain B, Sugar Tongs Mutant S378p In Complex With Acarbose
 pdb|2QPU|C Chain C, Sugar Tongs Mutant S378p In Complex With Acarbose
Length=405

 Score =   441 bits (1134),  Expect = 2e-147, Method: Compositional matrix adjust.
 Identities = 223/417 (53%), Positives = 295/417 (71%), Gaps = 20/417 (5%)
 Frame = +2

Query  113   VLFQGFTWTSKDQPGGWWNWLITKVPDLADAGITHVWLPPPSNAREGDDQGYMPKRMYDL  292
             VLFQGF W S  Q GGW+N ++ KV D+A AG+THVWLPPPS++    ++GYMP R+YD+
Sbjct  3     VLFQGFNWESWKQSGGWYNMMMGKVDDIAAAGVTHVWLPPPSHSVS--NEGYMPGRLYDI  60

Query  293   DTSKYGNKKELKALNDAFHGRGIKSVADIVLNHRAAERANSRGVFNVFEGGTPDDKLDWG  472
             D SKYGN  ELK+L  A HG+G++++ADIV+NHR A+  +SRG++ +FEGGT D +LDWG
Sbjct  61    DASKYGNAAELKSLIGALHGKGVQAIADIVINHRCADYKDSRGIYCIFEGGTSDGRLDWG  120

Query  473   PSEICGDDAAF-EGTGNPDTGDPWGDAPDIDHRSPRVQREISEWMNWLKSDVGFDGWRFD  649
             P  IC DD  + +GT N DTG  +  APDIDH + RVQRE+ EW+ WLKSD+GFD WR D
Sbjct  121   PHMICRDDTKYSDGTANLDTGADFAAAPDIDHLNDRVQRELKEWLLWLKSDLGFDAWRLD  180

Query  650   YVKGYDFVKGFAAVKIYMDNTKPEFAVGELWNALSPGSVPNPDYNQDAHRNELVRWVQNa  829
             + +GY         K+Y+D T P  AV E+W+ ++ G    P+Y+QDAHR  LV WV   
Sbjct  181   FARGYSP----EMAKVYIDGTSPSLAVAEVWDNMATGGDGKPNYDQDAHRQNLVNWVDKV  236

Query  830   ggaatafdf---ttKGILQAALNNTELWRLKDAAGKPSGMIGVLPQSAVTFIDNHDTWS-  997
             GGAA+A      TTKGIL AA+   ELWRL D  GK  G++G  P  AVTF+DNHDT S 
Sbjct  237   GGAASAGMVFDFTTKGILNAAVEG-ELWRLIDPQGKAPGVMGWWPAKAVTFVDNHDTGST  295

Query  998   QRLWPFTTSTDDAVNHDRVLQGYAYILTHPGIPSVFYDHFFEWGLKDAISKLISIRNKNG  1177
             Q +WPF +        D+V+QGYAYILTHPGIP +FYDHFF WG KD I+ L++IR +NG
Sbjct  296   QAMWPFPS--------DKVMQGYAYILTHPGIPCIFYDHFFNWGFKDQIAALVAIRKRNG  347

Query  1178  VSATSPVEILAADADLYIAKINGKVILKIGPNGDLKNLVPSDFMLATSGKDFAVWEK  1348
             ++ATS ++IL  + D Y+A+I+GKV++KIGP  D+  ++P+ F+ +  G D+AVWEK
Sbjct  348   ITATSALKILMHEGDAYVAEIDGKVVVKIGPRYDVGAVIPAGFVTSAHGNDYAVWEK  404



>ref|XP_003578230.1| PREDICTED: alpha-amylase isozyme 3A-like [Brachypodium distachyon]
Length=439

 Score =   442 bits (1138),  Expect = 2e-147, Method: Compositional matrix adjust.
 Identities = 227/433 (52%), Positives = 298/433 (69%), Gaps = 21/433 (5%)
 Frame = +2

Query  59    LSLFCIAFFLFPLHSSSTVLFQGFTWTSKDQPGGWWNWLITKVPDLADAGITHVWLPPPS  238
             ++L C++       + + +LFQGF W S ++ GGW+N L  +V  +A +G+THVWLPPPS
Sbjct  15    MALLCLSCDAL---AQTQILFQGFNWESCNKQGGWYNMLKGRVGSIASSGVTHVWLPPPS  71

Query  239   NAREGDDQGYMPKRMYDLDTSKYGNKKELKALNDAFHGRGIKSVADIVLNHRAAERANSR  418
             ++     QGYMP R+YD+D SKYG K ELK+L  AFHG+G+K VADIV+NHR AE  + R
Sbjct  72    HSVS--PQGYMPGRLYDVDASKYGTKAELKSLIAAFHGKGVKCVADIVINHRTAEEKDGR  129

Query  419   GVFNVFEGGT-PDDKLDWGPSEICGDDAAF-EGTGNPDTGDPWGDAPDIDHRSPRVQREI  592
             GV+ +F+GG  P+ +LDWGP  IC DDA + +GTG+ DTG  +  APDIDH +PRVQRE+
Sbjct  130   GVYCIFKGGGGPEGQLDWGPGMICSDDAKYSDGTGHRDTGADFAAAPDIDHLNPRVQREL  189

Query  593   SEWMNWLKSDVGFDGWRFDYVKGYDFVKGFAAVKIYMDNTKPEFAVGELWNALSPGSVPN  772
             S W+ WLKSD+GFDGWR D+ KGY         K+Y  N  P F V E+WN+LS      
Sbjct  190   SAWLGWLKSDLGFDGWRLDFAKGYSA----EVAKVYAGNASPGFVVAEIWNSLSYDGDGK  245

Query  773   PDYNQDAHRNELVRWVQNaggaatafdfttKGILQAALNNTELWRLKDAAGKPSGMIGVL  952
             P  NQD  R ELV W +  GG A AFDFTTKGILQAA+   ELWR++   GK  GMIG+ 
Sbjct  246   PATNQDGERQELVNWAKAVGGPAMAFDFTTKGILQAAVQG-ELWRMRGKDGKAPGMIGLS  304

Query  953   PQSAVTFIDNHDTWS-QRLWPFTTSTDDAVNHDRVLQGYAYILTHPGIPSVFYDHFFEWG  1129
             P+ AVTF+DNHDT S Q++WPF          D+V+ GYAYILTHPG+P +FYDH F+W 
Sbjct  305   PEKAVTFVDNHDTGSTQKMWPFPA--------DKVMMGYAYILTHPGLPCIFYDHVFDWN  356

Query  1130  LKDAISKLISIRNKNGVSATSPVEILAADADLYIAKINGKVILKIGPNGDLKNLVPSDFM  1309
             LK  I  L ++R++NG++A S + ILAA++D+Y+A ++ KVI KIGP  D  NL+PSDF 
Sbjct  357   LKKEIDTLAAVRSRNGINAGSKLRILAAESDVYVAMVDEKVISKIGPRFDAGNLIPSDFH  416

Query  1310  LATSGKDFAVWEK  1348
             +   G ++ VWEK
Sbjct  417   VVAHGSNYCVWEK  429



>gb|AAA32926.1| alpha-amylase 1 [Hordeum vulgare]
Length=429

 Score =   442 bits (1136),  Expect = 2e-147, Method: Compositional matrix adjust.
 Identities = 233/422 (55%), Positives = 298/422 (71%), Gaps = 21/422 (5%)
 Frame = +2

Query  101   SSSTVLFQGFTWTSKDQPGGWWNWLITKVPDLADAGITHVWLPPPSNAREGDDQGYMPKR  280
             +S  VLFQGF   S    GGW+N+L+ KV D+A AGITHVWLPP S +    +QGYMP R
Sbjct  22    ASGQVLFQGFNSESWKHNGGWYNFLMGKVDDIAAAGITHVWLPPASQSVA--EQGYMPGR  79

Query  281   MYDLDTSKYGNKKELKALNDAFHGRGIKSVADIVLNHRAAERANSRGVFNVFEGGTPDDK  460
              YDLD SKYGNK +LK+L  A HG+ +K++ADIV+NHR AER + RG++ +FEGGTPD +
Sbjct  80    YYDLDASKYGNKAQLKSLIGALHGKAVKAIADIVINHRTAERKDGRGIYCIFEGGTPDAR  139

Query  461   LDWGPSEICGDDAAF-EGTGNPDTGDP--WGDAPDIDHRSPRVQREISEWMNWLKSDVGF  631
              DWGP  IC DD  + +GTGNP T     +G APDIDH +PRVQ+E+ EW+NWL++DVGF
Sbjct  140   RDWGPHMICRDDRPYPDGTGNPATRRRADFGAAPDIDHLNPRVQKELVEWLNWLRTDVGF  199

Query  632   DGWRFDYVKGYDFVKGFAAVKIYMDNTKPEFAVGELWNALSPGSVPNPDYNQDAHRNELV  811
             DGWRFD+ KGY         KIY+D ++P FAV E+W +L+ G    P+ NQD HR ELV
Sbjct  200   DGWRFDFAKGYSA----DVAKIYVDRSEPSFAVAEIWTSLAYGGDGKPNLNQDPHRQELV  255

Query  812   RWVQNagga--atafdfttKGILQAALNNTELWRLKDAAGKPSGMIGVLPQSAVTFIDNH  985
              WV   GG+  AT FDFTTKGIL  A+   ELWRL+   GK  GMIG  P  AVTF+DNH
Sbjct  256   NWVNKVGGSGPATTFDFTTKGILNVAVEG-ELWRLRGTDGKAPGMIGWWPAKAVTFVDNH  314

Query  986   DTWSQR-LWPFTTSTDDAVNHDRVLQGYAYILTHPGIPSVFYDHFFEWGLKDAISKLISI  1162
             D  S + +WPF +        DRV+QGYAYILTHPG P +FYDHFF+WGLK+ I +L+SI
Sbjct  315   DNGSTKHMWPFPS--------DRVMQGYAYILTHPGNPCIFYDHFFDWGLKEEIDRLVSI  366

Query  1163  RNKNGVSATSPVEILAADADLYIAKINGKVILKIGPNGDLKNLVPSDFMLATSGKDFAVW  1342
             R +  + + S ++I+ ADADLY+A+I+GKVI+K+GP  D+ +L+P  F +   G D+AVW
Sbjct  367   RTRQDIHSESKLQIMEADADLYLAEIDGKVIVKLGPRYDVGHLIPEGFKVVAHGNDYAVW  426

Query  1343  EK  1348
             EK
Sbjct  427   EK  428



>gb|ADC54362.1| alpha amylase [Hordeum vulgare subsp. spontaneum]
Length=414

 Score =   441 bits (1135),  Expect = 3e-147, Method: Compositional matrix adjust.
 Identities = 223/417 (53%), Positives = 294/417 (71%), Gaps = 20/417 (5%)
 Frame = +2

Query  113   VLFQGFTWTSKDQPGGWWNWLITKVPDLADAGITHVWLPPPSNAREGDDQGYMPKRMYDL  292
             VLFQGF W S  Q GGW+N ++ KV D+A AG+THVWLPPPS++    ++GYMP R+YD+
Sbjct  3     VLFQGFNWESWKQSGGWYNMMMGKVDDIAAAGVTHVWLPPPSHSVS--NEGYMPGRLYDI  60

Query  293   DTSKYGNKKELKALNDAFHGRGIKSVADIVLNHRAAERANSRGVFNVFEGGTPDDKLDWG  472
             D SKYGN  ELK+L  A HG+G++++ADIV+NHR A+  +SRG++ +FEGGT D +LDWG
Sbjct  61    DASKYGNAAELKSLIGALHGKGVQAIADIVINHRCADYKDSRGIYCIFEGGTSDGRLDWG  120

Query  473   PSEICGDDAAF-EGTGNPDTGDPWGDAPDIDHRSPRVQREISEWMNWLKSDVGFDGWRFD  649
             P  IC DD  + +GT N DTG  +  APDIDH + RVQRE+ EW+ WLKSD+GFD WR D
Sbjct  121   PHMICRDDTKYSDGTANLDTGADFAAAPDIDHLNDRVQRELKEWLLWLKSDLGFDAWRLD  180

Query  650   YVKGYDFVKGFAAVKIYMDNTKPEFAVGELWNALSPGSVPNPDYNQDAHRNELVRWVQNa  829
             + +GY         K+Y+D T P  AV E+W+ ++ G    P+Y+QDAHR  LV WV   
Sbjct  181   FARGYSP----EMAKVYIDGTSPSLAVAEVWDNMATGGDGKPNYDQDAHRQNLVNWVDKV  236

Query  830   ggaatafdf---ttKGILQAALNNTELWRLKDAAGKPSGMIGVLPQSAVTFIDNHDTWS-  997
             GGAA+A      TTKGIL AA+   ELWRL D  GK  G++G  P  AVTF+DNHDT S 
Sbjct  237   GGAASAGMVFDFTTKGILNAAVEG-ELWRLIDPQGKAPGVMGWWPAKAVTFVDNHDTGST  295

Query  998   QRLWPFTTSTDDAVNHDRVLQGYAYILTHPGIPSVFYDHFFEWGLKDAISKLISIRNKNG  1177
             Q +WPF +        D+V+QGYAYILTHPGIP +FYDHFF WG KD I+ L++IR +NG
Sbjct  296   QAMWPFPS--------DKVMQGYAYILTHPGIPCIFYDHFFNWGFKDQIAALVAIRKRNG  347

Query  1178  VSATSPVEILAADADLYIAKINGKVILKIGPNGDLKNLVPSDFMLATSGKDFAVWEK  1348
             ++ATS ++IL  + D Y+A+I+GKV++KIG   D+  ++P+ F  +  GKD+AVWEK
Sbjct  348   ITATSALKILMHEGDAYVAEIDGKVVVKIGTRYDVGAVIPAGFATSAHGKDYAVWEK  404



>ref|XP_002452881.1| hypothetical protein SORBIDRAFT_04g034150 [Sorghum bicolor]
 gb|EES05857.1| hypothetical protein SORBIDRAFT_04g034150 [Sorghum bicolor]
Length=428

 Score =   441 bits (1135),  Expect = 3e-147, Method: Compositional matrix adjust.
 Identities = 233/437 (53%), Positives = 298/437 (68%), Gaps = 25/437 (6%)
 Frame = +2

Query  68    FCIAFFLFPLHSS-----STVLFQGFTWTSKDQPGGWWNWLITKVPDLADAGITHVWLPP  232
              C+ FFL  L  S       VLFQGF W S  Q GGW+ +L+ KV D+A+AGITHVWLPP
Sbjct  6     LCMCFFLVFLGLSFNLALGQVLFQGFNWESWKQNGGWYKFLMDKVDDIAEAGITHVWLPP  65

Query  233   PSNAREGDDQGYMPKRMYDLDTSKYGNKKELKALNDAFHGRGIKSVADIVLNHRAAERAN  412
             PS++    +QGY+P R+YDLD SKYGNK +LK+L  AFH +G+K +ADIV+NHR AE  +
Sbjct  66    PSHSVA--EQGYLPGRLYDLDASKYGNKAQLKSLIKAFHDKGVKVIADIVINHRTAEHKD  123

Query  413   SRGVFNVFEGGTPDDKLDWGPSEICGDDAAF-EGTGNPDTGDPWGDAPDIDHRSPRVQRE  589
              RG++ +FEGGT D +LDWGP  IC DD A+ +GTGN DTG  +  APDIDH + RVQRE
Sbjct  124   GRGIYCLFEGGTSDSRLDWGPHMICRDDKAYSDGTGNLDTGLDFPGAPDIDHLNKRVQRE  183

Query  590   ISEWMNWLKSDVGFDGWRFDYVKGYDFVKGFAAVKIYMDNTKPEFAVGELWNALSPGSVP  769
             +  W+ WL++D+GFD WR D+ KGY         KI++DN KP FAV ELW++L+ G   
Sbjct  184   LIGWLKWLQTDIGFDAWRLDFAKGYSA----EVAKIFIDNAKPSFAVAELWSSLAYGGDG  239

Query  770   NPDYNQDAHRNELVRWVQNaggaatafdf---ttKGILQAALNNTELWRLKDAAGKPSGM  940
              P  +Q+AHR ELV WV   GG A+       TTKGIL  A++  ELWRL+ A GK  GM
Sbjct  240   KPLQDQNAHRQELVNWVDRVGGKASPATTFDFTTKGILNVAVDG-ELWRLRGADGKAPGM  298

Query  941   IGVLPQSAVTFIDNHDTWS-QRLWPFTTSTDDAVNHDRVLQGYAYILTHPGIPSVFYDHF  1117
             IG  P  AVTF+DNHDT S Q +WPF          D+V+QGYAYILTHPG P +FYDHF
Sbjct  299   IGWWPAKAVTFVDNHDTGSTQHMWPFPA--------DKVIQGYAYILTHPGNPCIFYDHF  350

Query  1118  FEWGLKDAISKLISIRNKNGVSATSPVEILAADADLYIAKINGKVILKIGPNGDLKNLVP  1297
             F+ GLK+ I++L+SIRN++G+   S + I+ ADADLY+A+I+ KVI+KIGP      L+P
Sbjct  351   FDSGLKNEIAQLVSIRNRHGIQPDSKLRIIKADADLYLAEIDDKVIVKIGPRFGASQLIP  410

Query  1298  SDFMLATSGKDFAVWEK  1348
               F +   G  +AVWEK
Sbjct  411   GGFQVVAHGNGYAVWEK  427



>gb|ADC54320.1| alpha amylase [Hordeum vulgare subsp. spontaneum]
Length=414

 Score =   441 bits (1133),  Expect = 4e-147, Method: Compositional matrix adjust.
 Identities = 222/417 (53%), Positives = 294/417 (71%), Gaps = 20/417 (5%)
 Frame = +2

Query  113   VLFQGFTWTSKDQPGGWWNWLITKVPDLADAGITHVWLPPPSNAREGDDQGYMPKRMYDL  292
             VLFQGF W S  Q GGW+N ++ KV D+A AG+THVWLPPPS++    ++GYMP R+YD+
Sbjct  3     VLFQGFNWESWQQSGGWYNMMMGKVDDIAAAGVTHVWLPPPSHSVS--NEGYMPGRLYDI  60

Query  293   DTSKYGNKKELKALNDAFHGRGIKSVADIVLNHRAAERANSRGVFNVFEGGTPDDKLDWG  472
             D SKYGN  ELK+L  A HG+G++++ADIV+NHR A+  ++RG++ +FEGGT D +LDWG
Sbjct  61    DASKYGNAAELKSLIGALHGKGVQAIADIVINHRCADYKDNRGIYCIFEGGTSDGRLDWG  120

Query  473   PSEICGDDAAF-EGTGNPDTGDPWGDAPDIDHRSPRVQREISEWMNWLKSDVGFDGWRFD  649
             P  IC DD  + +GT NPDTG  +  APDIDH + RVQRE+ EW+ WLKSD+GFD WR D
Sbjct  121   PHMICRDDTKYADGTANPDTGADFAAAPDIDHLNDRVQRELKEWLLWLKSDLGFDAWRLD  180

Query  650   YVKGYDFVKGFAAVKIYMDNTKPEFAVGELWNALSPGSVPNPDYNQDAHRNELVRWVQNa  829
             + +GY         K+Y+D T P  AV E+W+ ++ G    P+Y+QDAHR  LV WV   
Sbjct  181   FARGYSP----EMAKVYIDGTSPSLAVAEVWDNMATGGDGKPNYDQDAHRQNLVNWVDKV  236

Query  830   ggaatafdf---ttKGILQAALNNTELWRLKDAAGKPSGMIGVLPQSAVTFIDNHDTWS-  997
             GGAA+A      TTKGIL AA+   ELWRL D  GK  G++G  P  AVTF+DNHDT S 
Sbjct  237   GGAASAGMVFDFTTKGILDAAVEG-ELWRLIDPQGKAPGVMGWWPAKAVTFVDNHDTGST  295

Query  998   QRLWPFTTSTDDAVNHDRVLQGYAYILTHPGIPSVFYDHFFEWGLKDAISKLISIRNKNG  1177
             Q +WPF +        D+V+QGYAYILTHPG P +FYDHFF WG KD I+ L++IR +NG
Sbjct  296   QAMWPFPS--------DKVMQGYAYILTHPGTPCIFYDHFFNWGFKDEIAALVAIRKRNG  347

Query  1178  VSATSPVEILAADADLYIAKINGKVILKIGPNGDLKNLVPSDFMLATSGKDFAVWEK  1348
             ++ATS ++IL  + D Y+A+I+GKV++KIG   D+  ++P+ F  +  GKD+AVWEK
Sbjct  348   ITATSALKILMHEGDAYVAEIDGKVVVKIGTRYDVGAVIPAGFATSAHGKDYAVWEK  404



>ref|NP_001063369.1| Os09g0457800 [Oryza sativa Japonica Group]
 sp|P27939.2|AMY3C_ORYSJ RecName: Full=Alpha-amylase isozyme 3C; AltName: Full=1,4-alpha-D-glucan 
glucanohydrolase; Flags: Precursor [Oryza sativa 
Japonica Group]
 dbj|BAD38369.1| Alpha-amylase isozyme 3C precursor (1,4-alpha-D-glucan glucanohydrolase) 
[Oryza sativa Japonica Group]
 dbj|BAF25283.1| Os09g0457800 [Oryza sativa Japonica Group]
 gb|EAZ44990.1| hypothetical protein OsJ_29632 [Oryza sativa Japonica Group]
Length=437

 Score =   442 bits (1136),  Expect = 4e-147, Method: Compositional matrix adjust.
 Identities = 231/418 (55%), Positives = 289/418 (69%), Gaps = 17/418 (4%)
 Frame = +2

Query  101   SSSTVLFQGFTWTSKDQPGGWWNWLITKVPDLADAGITHVWLPPPSNAREGDDQGYMPKR  280
             + + VLFQGF W S  + GGW+N+L + V D+A  G+THVWLPPPS++     QGYMP R
Sbjct  24    AQAQVLFQGFNWESWKKQGGWYNFLHSHVDDIAATGVTHVWLPPPSHSVA--PQGYMPGR  81

Query  281   MYDLDTSKYGNKKELKALNDAFHGRGIKSVADIVLNHRAAERANSRGVFNVFEGGTPDDK  460
             +YDLD SKYG   EL++L  AFH + IK VADIV+NHR A+  +SRG++ +FEGGTPD +
Sbjct  82    LYDLDASKYGTGAELRSLIAAFHSKSIKCVADIVINHRCADYKDSRGIYCIFEGGTPDSR  141

Query  461   LDWGPSEICGDDAAFE-GTGNPDTGDPWGDAPDIDHRSPRVQREISEWMNWLKSDVGFDG  637
             LDWGP  IC DD  +  G G+ DTG  +G APDIDH + RVQ E+S+W+NWLKSDVGFDG
Sbjct  142   LDWGPDMICSDDTQYSNGRGHRDTGADFGAAPDIDHLNTRVQTELSDWLNWLKSDVGFDG  201

Query  638   WRFDYVKGYDFVKGFAAVKIYMDNTKPEFAVGELWNALSPGSVPNPDYNQDAHRNELVRW  817
             WR D+ KGY         K Y+DNT P F V E+W+ +       P +NQD  R ELV W
Sbjct  202   WRLDFAKGYSAT----VAKTYVDNTDPSFVVAEIWSNMRYDGNGEPSWNQDGDRQELVNW  257

Query  818   VQNaggaatafdfttKGILQAALNNTELWRLKDAAGKPSGMIGVLPQSAVTFIDNHDTWS  997
              Q  GG A+AFDFTTKG LQAA+   ELWR+KD  GK  GMIG LP+ AVTFIDNHDT S
Sbjct  258   AQAVGGPASAFDFTTKGELQAAVQG-ELWRMKDGNGKAPGMIGWLPEKAVTFIDNHDTGS  316

Query  998   -QRLWPFTTSTDDAVNHDRVLQGYAYILTHPGIPSVFYDHFFEWGLKDAISKLISIRNKN  1174
              Q  WPF +        D+V+QGYAYILTHPG+P +FYDH F+W LK  IS L ++R++N
Sbjct  317   TQNSWPFPS--------DKVMQGYAYILTHPGVPCIFYDHVFDWNLKQEISTLAAVRSRN  368

Query  1175  GVSATSPVEILAADADLYIAKINGKVILKIGPNGDLKNLVPSDFMLATSGKDFAVWEK  1348
             G+   S + ILAAD D+Y+A I+ KVI KIG   D+ NL+PSDF +   G ++ VWEK
Sbjct  369   GIHPGSKLNILAADGDVYVAMIDDKVITKIGTRYDVGNLIPSDFHVVAHGNNYCVWEK  426



>pdb|2QPS|A Chain A, "sugar Tongs" Mutant Y380a In Complex With Acarbose
Length=405

 Score =   440 bits (1132),  Expect = 4e-147, Method: Compositional matrix adjust.
 Identities = 222/417 (53%), Positives = 294/417 (71%), Gaps = 20/417 (5%)
 Frame = +2

Query  113   VLFQGFTWTSKDQPGGWWNWLITKVPDLADAGITHVWLPPPSNAREGDDQGYMPKRMYDL  292
             VLFQGF W S  Q GGW+N ++ KV D+A AG+THVWLPPPS++    ++GYMP R+YD+
Sbjct  3     VLFQGFNWESWKQSGGWYNMMMGKVDDIAAAGVTHVWLPPPSHSVS--NEGYMPGRLYDI  60

Query  293   DTSKYGNKKELKALNDAFHGRGIKSVADIVLNHRAAERANSRGVFNVFEGGTPDDKLDWG  472
             D SKYGN  ELK+L  A HG+G++++ADIV+NHR A+  +SRG++ +FEGGT D +LDWG
Sbjct  61    DASKYGNAAELKSLIGALHGKGVQAIADIVINHRCADYKDSRGIYCIFEGGTSDGRLDWG  120

Query  473   PSEICGDDAAF-EGTGNPDTGDPWGDAPDIDHRSPRVQREISEWMNWLKSDVGFDGWRFD  649
             P  IC DD  + +GT N DTG  +  APDIDH + RVQRE+ EW+ WLKSD+GFD WR D
Sbjct  121   PHMICRDDTKYSDGTANLDTGADFAAAPDIDHLNDRVQRELKEWLLWLKSDLGFDAWRLD  180

Query  650   YVKGYDFVKGFAAVKIYMDNTKPEFAVGELWNALSPGSVPNPDYNQDAHRNELVRWVQNa  829
             + +GY         K+Y+D T P  AV E+W+ ++ G    P+Y+QDAHR  LV WV   
Sbjct  181   FARGYSP----EMAKVYIDGTSPSLAVAEVWDNMATGGDGKPNYDQDAHRQNLVNWVDKV  236

Query  830   ggaatafdf---ttKGILQAALNNTELWRLKDAAGKPSGMIGVLPQSAVTFIDNHDTWS-  997
             GGAA+A      TTKGIL AA+   ELWRL D  GK  G++G  P  AVTF+DNHDT S 
Sbjct  237   GGAASAGMVFDFTTKGILNAAVEG-ELWRLIDPQGKAPGVMGWWPAKAVTFVDNHDTGST  295

Query  998   QRLWPFTTSTDDAVNHDRVLQGYAYILTHPGIPSVFYDHFFEWGLKDAISKLISIRNKNG  1177
             Q +WPF +        D+V+QGYAYILTHPGIP +FYDHFF WG KD I+ L++IR +NG
Sbjct  296   QAMWPFPS--------DKVMQGYAYILTHPGIPCIFYDHFFNWGFKDQIAALVAIRKRNG  347

Query  1178  VSATSPVEILAADADLYIAKINGKVILKIGPNGDLKNLVPSDFMLATSGKDFAVWEK  1348
             ++ATS ++IL  + D Y+A+I+GKV++KIG   D+  ++P+ F+ +  G D+AVWEK
Sbjct  348   ITATSALKILMHEGDAYVAEIDGKVVVKIGSRADVGAVIPAGFVTSAHGNDYAVWEK  404



>pdb|3BSG|A Chain A, Barley Alpha-Amylase Isozyme 1 (Amy1) H395a Mutant
Length=414

 Score =   441 bits (1133),  Expect = 5e-147, Method: Compositional matrix adjust.
 Identities = 222/417 (53%), Positives = 295/417 (71%), Gaps = 20/417 (5%)
 Frame = +2

Query  113   VLFQGFTWTSKDQPGGWWNWLITKVPDLADAGITHVWLPPPSNAREGDDQGYMPKRMYDL  292
             VLFQGF W S  Q GGW+N ++ KV D+A AG+THVWLPPPS++    ++GYMP R+YD+
Sbjct  3     VLFQGFNWESWKQSGGWYNMMMGKVDDIAAAGVTHVWLPPPSHSVS--NEGYMPGRLYDI  60

Query  293   DTSKYGNKKELKALNDAFHGRGIKSVADIVLNHRAAERANSRGVFNVFEGGTPDDKLDWG  472
             D SKYGN  ELK+L  A HG+G++++ADIV+NHR A+  +SRG++ +FEGGT D +LDWG
Sbjct  61    DASKYGNAAELKSLIGALHGKGVQAIADIVINHRCADYKDSRGIYCIFEGGTSDGRLDWG  120

Query  473   PSEICGDDAAF-EGTGNPDTGDPWGDAPDIDHRSPRVQREISEWMNWLKSDVGFDGWRFD  649
             P  IC DD  + +GT N DTG  +  APDIDH + RVQRE+ EW+ WLKSD+GFD WR D
Sbjct  121   PHMICRDDTKYSDGTANLDTGADFAAAPDIDHLNDRVQRELKEWLLWLKSDLGFDAWRLD  180

Query  650   YVKGYDFVKGFAAVKIYMDNTKPEFAVGELWNALSPGSVPNPDYNQDAHRNELVRWVQNa  829
             + +GY         K+Y+D T P  AV E+W+ ++ G    P+Y+QDAHR  LV WV   
Sbjct  181   FARGYSP----EMAKVYIDGTSPSLAVAEVWDNMATGGDGKPNYDQDAHRQNLVNWVDKV  236

Query  830   ggaatafdf---ttKGILQAALNNTELWRLKDAAGKPSGMIGVLPQSAVTFIDNHDTWS-  997
             GGAA+A      TTKGIL AA+   ELWRL D  GK  G++G  P  AVTF+DNHDT S 
Sbjct  237   GGAASAGMVFDFTTKGILNAAVEG-ELWRLIDPQGKAPGVMGWWPAKAVTFVDNHDTGST  295

Query  998   QRLWPFTTSTDDAVNHDRVLQGYAYILTHPGIPSVFYDHFFEWGLKDAISKLISIRNKNG  1177
             Q +WPF +        D+V+QGYAYILTHPGIP +FYDHFF WG KD I+ L++IR +NG
Sbjct  296   QAMWPFPS--------DKVMQGYAYILTHPGIPCIFYDHFFNWGFKDQIAALVAIRKRNG  347

Query  1178  VSATSPVEILAADADLYIAKINGKVILKIGPNGDLKNLVPSDFMLATSGKDFAVWEK  1348
             ++ATS ++IL  + D Y+A+I+GKV++KIG   D+  ++P+ F+ + +G D+AVWEK
Sbjct  348   ITATSALKILMHEGDAYVAEIDGKVVVKIGSRYDVGAVIPAGFVTSAAGNDYAVWEK  404



>ref|XP_003563559.1| PREDICTED: alpha-amylase type A isozyme [Brachypodium distachyon]
Length=447

 Score =   442 bits (1136),  Expect = 5e-147, Method: Compositional matrix adjust.
 Identities = 222/421 (53%), Positives = 291/421 (69%), Gaps = 20/421 (5%)
 Frame = +2

Query  101   SSSTVLFQGFTWTSKDQPGGWWNWLITKVPDLADAGITHVWLPPPSNAREGDDQGYMPKR  280
             S   VLFQGF W S  Q GGW+N L+ KV D+A AG+THVWLPPPS++    ++GYMP R
Sbjct  25    SGHQVLFQGFNWESWKQQGGWYNMLLGKVDDIAAAGVTHVWLPPPSHSVS--NEGYMPGR  82

Query  281   MYDLDTSKYGNKKELKALNDAFHGRGIKSVADIVLNHRAAERANSRGVFNVFEGGTPDDK  460
             +YDLD SKYG+  ELK+L  A HG+G++++AD+V+NHR A+  +SRG++ +FEGGT D +
Sbjct  83    LYDLDASKYGSASELKSLIGALHGKGVQAIADVVINHRCADYKDSRGIYCIFEGGTADGR  142

Query  461   LDWGPSEICGDDAAF-EGTGNPDTGDPWGDAPDIDHRSPRVQREISEWMNWLKSDVGFDG  637
             LDWGP  IC DD A+ +GT N DTG  +  APDIDH + RVQRE+++W+ WLKSD+GFD 
Sbjct  143   LDWGPHMICRDDTAYGDGTANLDTGADFAAAPDIDHLNDRVQRELTDWLLWLKSDLGFDA  202

Query  638   WRFDYVKGYDFVKGFAAVKIYMDNTKPEFAVGELWNALSPGSVPNPDYNQDAHRNELVRW  817
             WR D+ KGY         K+Y+D TKP  AV E+WN ++PG    P Y+QDAHR  LV W
Sbjct  203   WRLDFAKGYSP----EMAKVYIDGTKPGLAVAEVWNDMTPGGDGKPAYDQDAHRQALVNW  258

Query  818   VQNaggaatafdf---ttKGILQAALNNTELWRLKDAAGKPSGMIGVLPQSAVTFIDNHD  988
             V   GG  +A      TTKGIL  A+   ELWRL D  GK  G++G  P  AVTF+DNHD
Sbjct  259   VDRVGGKDSAGMVFDFTTKGILNVAVEG-ELWRLIDPQGKAPGVVGWWPAKAVTFVDNHD  317

Query  989   TWS-QRLWPFTTSTDDAVNHDRVLQGYAYILTHPGIPSVFYDHFFEWGLKDAISKLISIR  1165
             T S Q +WPF          D+V+ GYAYILTHPG P +FYDHFF WG K+ I+ L+++R
Sbjct  318   TGSTQAMWPFPA--------DKVMLGYAYILTHPGTPCIFYDHFFNWGFKEEIAALVAVR  369

Query  1166  NKNGVSATSPVEILAADADLYIAKINGKVILKIGPNGDLKNLVPSDFMLATSGKDFAVWE  1345
              +NG++ATS + IL  D D Y+A+++GKV++KIG   D+  ++PS F+    GKD+AVWE
Sbjct  370   KRNGITATSALRILMHDGDAYVAEVDGKVVVKIGSRYDVAAVIPSGFVTTAHGKDYAVWE  429

Query  1346  K  1348
             K
Sbjct  430   K  430



>gb|ADC54366.1| alpha amylase [Hordeum vulgare subsp. spontaneum]
Length=414

 Score =   440 bits (1132),  Expect = 6e-147, Method: Compositional matrix adjust.
 Identities = 222/417 (53%), Positives = 294/417 (71%), Gaps = 20/417 (5%)
 Frame = +2

Query  113   VLFQGFTWTSKDQPGGWWNWLITKVPDLADAGITHVWLPPPSNAREGDDQGYMPKRMYDL  292
             VLFQGF W S  Q GGW+N ++ KV D+A AG+THVWLPPPS++    ++GYMP R+YD+
Sbjct  3     VLFQGFNWESWKQSGGWYNMMMGKVDDIAAAGVTHVWLPPPSHS--ASNEGYMPGRLYDI  60

Query  293   DTSKYGNKKELKALNDAFHGRGIKSVADIVLNHRAAERANSRGVFNVFEGGTPDDKLDWG  472
             D SKYGN  ELK+L  A HG+G++++ADIV+NHR A+  +SRG++ +FEGGT D +LDWG
Sbjct  61    DASKYGNAAELKSLIGALHGKGVQAIADIVINHRCADYKDSRGIYCIFEGGTSDGRLDWG  120

Query  473   PSEICGDDAAF-EGTGNPDTGDPWGDAPDIDHRSPRVQREISEWMNWLKSDVGFDGWRFD  649
             P  IC DD  + +GT N DTG  +  APDIDH + RVQRE+ EW+ WLKSD+GFD WR D
Sbjct  121   PHMICRDDTKYADGTANLDTGADFAAAPDIDHLNDRVQRELKEWLLWLKSDLGFDAWRLD  180

Query  650   YVKGYDFVKGFAAVKIYMDNTKPEFAVGELWNALSPGSVPNPDYNQDAHRNELVRWVQNa  829
             + +GY         K+Y+D T P  AV E+W+ ++ G    P+Y+QDAHR  LV WV   
Sbjct  181   FARGYSP----EMAKVYIDGTSPSLAVAEVWDNMATGGDGKPNYDQDAHRQNLVNWVDKV  236

Query  830   ggaatafdf---ttKGILQAALNNTELWRLKDAAGKPSGMIGVLPQSAVTFIDNHDTWS-  997
             GGAA+A      TTKGIL AA+   ELWRL D  GK  G++G  P  AVTF+DNHDT S 
Sbjct  237   GGAASAGMVFDFTTKGILNAAVEG-ELWRLIDPQGKAPGVMGWWPAKAVTFVDNHDTGST  295

Query  998   QRLWPFTTSTDDAVNHDRVLQGYAYILTHPGIPSVFYDHFFEWGLKDAISKLISIRNKNG  1177
             Q +WPF +        D+V+QGYAYILTHPGIP +FYDHFF WG KD I+ L++IR +NG
Sbjct  296   QAMWPFPS--------DKVMQGYAYILTHPGIPCIFYDHFFNWGFKDQIAALVAIRKRNG  347

Query  1178  VSATSPVEILAADADLYIAKINGKVILKIGPNGDLKNLVPSDFMLATSGKDFAVWEK  1348
             ++ATS ++IL  + D Y+A+I+GKV++KIG   D+  ++P+ F+ +  G D+AVWEK
Sbjct  348   ITATSALKILMHEGDAYVAEIDGKVVVKIGSRYDVGAVIPAGFVTSAHGNDYAVWEK  404



>gb|ADC54373.1| alpha amylase [Hordeum vulgare subsp. spontaneum]
Length=414

 Score =   440 bits (1132),  Expect = 6e-147, Method: Compositional matrix adjust.
 Identities = 221/417 (53%), Positives = 292/417 (70%), Gaps = 20/417 (5%)
 Frame = +2

Query  113   VLFQGFTWTSKDQPGGWWNWLITKVPDLADAGITHVWLPPPSNAREGDDQGYMPKRMYDL  292
             VLFQGF W S  Q GGW+N ++ KV D+A AG+THVWLPPPS++    ++GYMP R+YD+
Sbjct  3     VLFQGFNWESWKQSGGWYNMMMGKVDDIAAAGVTHVWLPPPSHSVS--NEGYMPGRLYDI  60

Query  293   DTSKYGNKKELKALNDAFHGRGIKSVADIVLNHRAAERANSRGVFNVFEGGTPDDKLDWG  472
             D SKYGN  ELK+L  A HG+G++++ADIV+NHR A+  +SRG++ ++EGGT D +LDWG
Sbjct  61    DASKYGNAAELKSLIGALHGKGVQAIADIVINHRCADYKDSRGIYCIYEGGTSDSRLDWG  120

Query  473   PSEICGDDAAF-EGTGNPDTGDPWGDAPDIDHRSPRVQREISEWMNWLKSDVGFDGWRFD  649
             P  IC DD  + +GT N DTG  + DAPDIDH + RVQ E+ EW+ WLKSD+GFD WR D
Sbjct  121   PHMICRDDTKYSDGTANLDTGADYADAPDIDHLNHRVQSELKEWLLWLKSDLGFDAWRLD  180

Query  650   YVKGYDFVKGFAAVKIYMDNTKPEFAVGELWNALSPGSVPNPDYNQDAHRNELVRWVQNa  829
             + +GY         K+Y+D T P  AV E+W+ + PG    P+Y+QDAHR  LV WV   
Sbjct  181   FARGYSA----EMAKVYIDGTSPSLAVAEIWDGMVPGGDGKPNYDQDAHRQNLVNWVDKV  236

Query  830   ggaatafdf---ttKGILQAALNNTELWRLKDAAGKPSGMIGVLPQSAVTFIDNHDTWS-  997
             GGAA+A      TTKGIL  A+   ELWRL D  GK  G++G  P  AVTFIDNHDT S 
Sbjct  237   GGAASAGMVFDFTTKGILNVAVEG-ELWRLIDPQGKAPGVMGWWPAKAVTFIDNHDTGST  295

Query  998   QRLWPFTTSTDDAVNHDRVLQGYAYILTHPGIPSVFYDHFFEWGLKDAISKLISIRNKNG  1177
             Q  WPF +        D+++QGYAYILTHPGIP +FYDHFF WG KD I+ L++IR +NG
Sbjct  296   QAKWPFPS--------DKIMQGYAYILTHPGIPCIFYDHFFNWGFKDQIAALVAIRKRNG  347

Query  1178  VSATSPVEILAADADLYIAKINGKVILKIGPNGDLKNLVPSDFMLATSGKDFAVWEK  1348
             ++ATS ++IL  + D Y+A+I+GKV++KIG   D+  ++P+ F+ +  G D+AVWEK
Sbjct  348   ITATSALKILMHEGDAYVAEIDGKVVVKIGSRYDVGAVIPAGFVTSAHGNDYAVWEK  404



>ref|NP_001063367.1| Os09g0457400 [Oryza sativa Japonica Group]
 sp|P27932.2|AMY3A_ORYSJ RecName: Full=Alpha-amylase isozyme 3A; AltName: Full=1,4-alpha-D-glucan 
glucanohydrolase; Flags: Precursor [Oryza sativa 
Japonica Group]
 dbj|BAD38366.1| Alpha-amylase isozyme 3A precursor (1,4-alpha-D-glucan glucanohydrolase) 
[Oryza sativa Japonica Group]
 dbj|BAF25281.1| Os09g0457400 [Oryza sativa Japonica Group]
 dbj|BAG94071.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG94104.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE69851.1| hypothetical protein OsJ_29629 [Oryza sativa Japonica Group]
Length=440

 Score =   441 bits (1134),  Expect = 6e-147, Method: Compositional matrix adjust.
 Identities = 225/419 (54%), Positives = 294/419 (70%), Gaps = 17/419 (4%)
 Frame = +2

Query  98    HSSSTVLFQGFTWTSKDQPGGWWNWLITKVPDLADAGITHVWLPPPSNAREGDDQGYMPK  277
             H+ + +LFQGF W S  + GGW+N L  +V D+A AG+THVWLPPP+++     QGYMP 
Sbjct  25    HAQTQILFQGFNWDSWKKQGGWYNMLKDQVGDIASAGVTHVWLPPPTHSVS--PQGYMPG  82

Query  278   RMYDLDTSKYGNKKELKALNDAFHGRGIKSVADIVLNHRAAERANSRGVFNVFEGGTPDD  457
             R+YDL+ SKYG K ELK+L  AFH +GIK VADIV+NHR A+  + RGV+ +F+GG P  
Sbjct  83    RLYDLNASKYGTKAELKSLIAAFHAKGIKCVADIVVNHRCADDKDGRGVYCIFKGGGPRG  142

Query  458   KLDWGPSEICGDDAAF-EGTGNPDTGDPWGDAPDIDHRSPRVQREISEWMNWLKSDVGFD  634
              LDWGPS IC DD  + +GTG+ DTG  +  APDIDH +P VQRE+S+W+ WL+ DVGFD
Sbjct  143   CLDWGPSMICCDDTQYSDGTGHRDTGADFAAAPDIDHLNPLVQRELSDWLRWLRRDVGFD  202

Query  635   GWRFDYVKGYDFVKGFAAVKIYMDNTKPEFAVGELWNALSPGSVPNPDYNQDAHRNELVR  814
             GWR D+ KGY      A  + Y+ N +P F V E+WN+LS      P  NQD  R ELV 
Sbjct  203   GWRLDFAKGYSA----AVARTYVQNARPSFVVAEIWNSLSYDGDGKPAANQDGQRQELVN  258

Query  815   WVQNaggaatafdfttKGILQAALNNTELWRLKDAAGKPSGMIGVLPQSAVTFIDNHDTW  994
             WV+  GG ATAFDFTTKGILQ+A+   ELWR++D  GK  GMIG  P+ AVTF+DNHDT 
Sbjct  259   WVKQVGGPATAFDFTTKGILQSAVQG-ELWRMRDKDGKAPGMIGWYPEKAVTFVDNHDTG  317

Query  995   S-QRLWPFTTSTDDAVNHDRVLQGYAYILTHPGIPSVFYDHFFEWGLKDAISKLISIRNK  1171
             S QR+WPF +        D+V+ GYAYILTHPG+P +FYDH F+W LK  I+ L + R +
Sbjct  318   STQRMWPFPS--------DKVILGYAYILTHPGVPCIFYDHVFDWNLKQEINALAATRKR  369

Query  1172  NGVSATSPVEILAADADLYIAKINGKVILKIGPNGDLKNLVPSDFMLATSGKDFAVWEK  1348
             NG++A S + +LAA++D+Y+A ++ +VI KIGP  D+ N++PSDF +   G D+ VWEK
Sbjct  370   NGINAGSKLRVLAAESDMYVAMVDERVITKIGPRIDVGNIIPSDFHIVAHGNDYCVWEK  428



>gb|ADC54359.1| alpha amylase [Hordeum vulgare subsp. spontaneum]
 gb|ADC54360.1| alpha amylase [Hordeum vulgare subsp. spontaneum]
Length=414

 Score =   440 bits (1131),  Expect = 8e-147, Method: Compositional matrix adjust.
 Identities = 222/417 (53%), Positives = 293/417 (70%), Gaps = 20/417 (5%)
 Frame = +2

Query  113   VLFQGFTWTSKDQPGGWWNWLITKVPDLADAGITHVWLPPPSNAREGDDQGYMPKRMYDL  292
             VLFQGF W S  Q GGW+N ++ KV D+A AG+THVWLPPPS++    ++GYMP R+YD+
Sbjct  3     VLFQGFNWESWKQSGGWYNMMMGKVDDIAAAGVTHVWLPPPSHSVS--NEGYMPGRLYDI  60

Query  293   DTSKYGNKKELKALNDAFHGRGIKSVADIVLNHRAAERANSRGVFNVFEGGTPDDKLDWG  472
             D SKYGN  ELK+L  A HG+G++++ADIV+NHR A+  +SRG++ +FEGGT D +LDWG
Sbjct  61    DASKYGNAAELKSLIGALHGKGVQAIADIVINHRCADYKDSRGIYCIFEGGTSDGRLDWG  120

Query  473   PSEICGDDAAF-EGTGNPDTGDPWGDAPDIDHRSPRVQREISEWMNWLKSDVGFDGWRFD  649
             P  IC DD  + +GT N DTG  +  APDIDH + RVQRE+ EW+ WLKSD+GFD WR D
Sbjct  121   PHMICRDDTKYSDGTANLDTGADFAAAPDIDHLNDRVQRELKEWLLWLKSDLGFDAWRLD  180

Query  650   YVKGYDFVKGFAAVKIYMDNTKPEFAVGELWNALSPGSVPNPDYNQDAHRNELVRWVQNa  829
             + +GY         K+Y+D T P  AV E+W+ ++ G    P+Y+QDAHR  LV WV   
Sbjct  181   FARGYSP----EMAKVYIDGTSPSLAVAEMWDNMATGGDGKPNYDQDAHRQNLVNWVDKV  236

Query  830   ggaatafdf---ttKGILQAALNNTELWRLKDAAGKPSGMIGVLPQSAVTFIDNHDTWS-  997
             GGAA+A      TTKGIL AA+   ELWRL D  GK  G++G  P  AVTF+DNHDT S 
Sbjct  237   GGAASASMVFDFTTKGILNAAVEG-ELWRLIDPQGKAPGVMGWWPAKAVTFVDNHDTGST  295

Query  998   QRLWPFTTSTDDAVNHDRVLQGYAYILTHPGIPSVFYDHFFEWGLKDAISKLISIRNKNG  1177
             Q +WPF +        D+V+QGYAYILTHPG P +FYDHFF WG KD I+ L++IR +NG
Sbjct  296   QAMWPFPS--------DKVMQGYAYILTHPGTPCIFYDHFFNWGFKDEIAALVAIRKRNG  347

Query  1178  VSATSPVEILAADADLYIAKINGKVILKIGPNGDLKNLVPSDFMLATSGKDFAVWEK  1348
             ++ATS ++IL  + D Y+A+I+GKV++KIG   D+  ++P+ F  +  GKD+AVWEK
Sbjct  348   ITATSALKILMHEGDAYVAEIDGKVVVKIGTRYDVGAVIPAGFATSAHGKDYAVWEK  404



>gb|EEC84703.1| hypothetical protein OsI_31647 [Oryza sativa Indica Group]
Length=440

 Score =   441 bits (1134),  Expect = 8e-147, Method: Compositional matrix adjust.
 Identities = 224/419 (53%), Positives = 294/419 (70%), Gaps = 17/419 (4%)
 Frame = +2

Query  98    HSSSTVLFQGFTWTSKDQPGGWWNWLITKVPDLADAGITHVWLPPPSNAREGDDQGYMPK  277
             H+ + +LFQGF W S  + GGW+N L  +V D+A AG+TH+WLPPP+++     QGYMP 
Sbjct  25    HAQTQILFQGFNWDSWKKQGGWYNMLKDQVGDIASAGVTHIWLPPPTHSVS--PQGYMPG  82

Query  278   RMYDLDTSKYGNKKELKALNDAFHGRGIKSVADIVLNHRAAERANSRGVFNVFEGGTPDD  457
             R+YDL+ SKYG K ELK+L  AFH +GIK VADIV+NHR A+  + RGV+ +F+GG P  
Sbjct  83    RLYDLNASKYGTKAELKSLIAAFHAKGIKCVADIVVNHRCADDKDGRGVYCIFKGGGPRG  142

Query  458   KLDWGPSEICGDDAAF-EGTGNPDTGDPWGDAPDIDHRSPRVQREISEWMNWLKSDVGFD  634
              LDWGPS IC DD  + +GTG+ DTG  +  APDIDH +P VQRE+S+W+ WL+ DVGFD
Sbjct  143   CLDWGPSMICCDDTQYSDGTGHRDTGADFAAAPDIDHLNPLVQRELSDWLRWLRRDVGFD  202

Query  635   GWRFDYVKGYDFVKGFAAVKIYMDNTKPEFAVGELWNALSPGSVPNPDYNQDAHRNELVR  814
             GWR D+ KGY      A  + Y+ N +P F V E+WN+LS      P  NQD  R ELV 
Sbjct  203   GWRLDFAKGYSA----AVARTYIQNARPSFVVAEIWNSLSYDGDGKPAANQDGQRQELVN  258

Query  815   WVQNaggaatafdfttKGILQAALNNTELWRLKDAAGKPSGMIGVLPQSAVTFIDNHDTW  994
             WV+  GG ATAFDFTTKGILQ+A+   ELWR++D  GK  GMIG  P+ AVTF+DNHDT 
Sbjct  259   WVKQVGGPATAFDFTTKGILQSAVQG-ELWRMRDKDGKAPGMIGWYPEKAVTFVDNHDTG  317

Query  995   S-QRLWPFTTSTDDAVNHDRVLQGYAYILTHPGIPSVFYDHFFEWGLKDAISKLISIRNK  1171
             S QR+WPF +        D+V+ GYAYILTHPG+P +FYDH F+W LK  I+ L + R +
Sbjct  318   STQRMWPFPS--------DKVILGYAYILTHPGVPCIFYDHVFDWNLKQEINALAATRKR  369

Query  1172  NGVSATSPVEILAADADLYIAKINGKVILKIGPNGDLKNLVPSDFMLATSGKDFAVWEK  1348
             NG++A S + +LAA++D+Y+A ++ +VI KIGP  D+ N++PSDF +   G D+ VWEK
Sbjct  370   NGINAGSKLRVLAAESDMYVAMVDERVITKIGPRIDVGNIIPSDFHIVAHGNDYCVWEK  428



>ref|XP_006446537.1| hypothetical protein CICLE_v10018086mg, partial [Citrus clementina]
 gb|ESR59777.1| hypothetical protein CICLE_v10018086mg, partial [Citrus clementina]
Length=404

 Score =   439 bits (1130),  Expect = 9e-147, Method: Compositional matrix adjust.
 Identities = 233/411 (57%), Positives = 300/411 (73%), Gaps = 27/411 (7%)
 Frame = +2

Query  125   GFTWTSKDQPGGWWNWLITKVPDLADAGITHVWLPPPSNAREGDDQGYMPK-RMYDLDTS  301
             GF W S ++ GGW+N+L  ++PD+A AGITHVWLPPPS       Q   P+ R+YDL+ S
Sbjct  17    GFNWESCNKKGGWYNFLKKRIPDIASAGITHVWLPPPS-------QSAAPQGRLYDLNAS  69

Query  302   KYGNKKELKALNDAFHGRGIKSVADIVLNHRAAERANSRGVFNVFEGGTPDDKLDWGPSE  481
              YG++ ELK+L  AF+ +GIK +ADIV+NHR AE+ +SRG++ +FEGGTPD +LDWGP  
Sbjct  70    SYGSQNELKSLIQAFNKKGIKYLADIVINHRTAEKKDSRGIWCIFEGGTPDKRLDWGPFF  129

Query  482   ICGDDAAF-EGTGNPDTGDPWGDAPDIDHRSPRVQREISEWMNWLKSDVGFDGWRFDYVK  658
             IC DD  + +G G+PD+G+P+G APDIDH +P+VQ+E+S+WMNWLK+++GFDGWRFD+VK
Sbjct  130   ICRDDTTYSDGRGHPDSGEPFGPAPDIDHLNPKVQKELSDWMNWLKTEIGFDGWRFDFVK  189

Query  659   GYDFVKGFAAVKIYMDNTKPEFAVGELWNALSPGSVPNPDYNQDAHRNELVRWVQNagga  838
             GY      +  ++YM NT P FAV E W++LS       D  QDAHR  L  WVQ AG A
Sbjct  190   GY----APSITRLYMKNTMPHFAVAEKWDSLSDRQDGKLDARQDAHRRNLKHWVQAAGRA  245

Query  839   atafdfttKGILQAALNNTELWRLKDAAGKPSGMIGVLPQSAVTFIDNHDTWS-QRLWPF  1015
              TAFDFTTKGILQAA+   ELWRLKD+ GKP G IG+LPQ+AVTFIDNHDT S QRLWPF
Sbjct  246   VTAFDFTTKGILQAAVQG-ELWRLKDSNGKPPGFIGLLPQNAVTFIDNHDTGSTQRLWPF  304

Query  1016  TTSTDDAVNHDRVLQGYAYILTHPGIPSVFYDHFFEWGLKDAISKLISIRNKNGVSATSP  1195
              +        D+V+ GY   +  P    +FYDH F+WGLK  I KL +IR KNG++ TS 
Sbjct  305   PS--------DKVMLGYTNKVLAP----LFYDHLFDWGLKKEIGKLAAIRTKNGINTTSR  352

Query  1196  VEILAADADLYIAKINGKVILKIGPNGDLKNLVPSDFMLATSGKDFAVWEK  1348
             V ILA+ +DLY+A I+ K+I KIGP  DL+NL+P +F +ATSGKD+AVW+K
Sbjct  353   VNILASQSDLYVAAIDDKIITKIGPKMDLRNLIPRNFKVATSGKDYAVWQK  403



>gb|ADC54357.1| alpha amylase [Hordeum vulgare subsp. spontaneum]
Length=414

 Score =   440 bits (1131),  Expect = 1e-146, Method: Compositional matrix adjust.
 Identities = 222/417 (53%), Positives = 293/417 (70%), Gaps = 20/417 (5%)
 Frame = +2

Query  113   VLFQGFTWTSKDQPGGWWNWLITKVPDLADAGITHVWLPPPSNAREGDDQGYMPKRMYDL  292
             VLFQGF W S  Q GGW+N ++ KV D+A AG+THVWLPPPS++    ++GYMP R+YD+
Sbjct  3     VLFQGFNWESWKQSGGWYNMMMGKVDDIAAAGVTHVWLPPPSHSVS--NEGYMPGRLYDI  60

Query  293   DTSKYGNKKELKALNDAFHGRGIKSVADIVLNHRAAERANSRGVFNVFEGGTPDDKLDWG  472
             D SKYGN  ELK+L  A HG+G++++ADIV+NHR A+  +SRG++ +FEGGT D +LDWG
Sbjct  61    DASKYGNAAELKSLIGALHGKGVQAIADIVINHRCADYKDSRGIYCIFEGGTSDGRLDWG  120

Query  473   PSEICGDDAAF-EGTGNPDTGDPWGDAPDIDHRSPRVQREISEWMNWLKSDVGFDGWRFD  649
             P  IC DD  + +GT N DTG  +  APDIDH + RVQRE+ EW+ WLKSD+GFD WR D
Sbjct  121   PHMICRDDTKYSDGTANLDTGADFAAAPDIDHLNDRVQRELKEWLLWLKSDLGFDAWRLD  180

Query  650   YVKGYDFVKGFAAVKIYMDNTKPEFAVGELWNALSPGSVPNPDYNQDAHRNELVRWVQNa  829
             + +GY         K+Y+D T P  AV E+W+ ++ G    P+Y+QDAHR  LV WV   
Sbjct  181   FARGYSP----EMAKVYIDGTSPSLAVAEMWDNMATGGDGKPNYDQDAHRQNLVNWVDKV  236

Query  830   ggaatafdf---ttKGILQAALNNTELWRLKDAAGKPSGMIGVLPQSAVTFIDNHDTWS-  997
             GGAA+A      TTKGIL AA+   ELWRL D  GK  G++G  P  AVTF+DNHDT S 
Sbjct  237   GGAASAGMVFDFTTKGILNAAVEG-ELWRLIDPQGKAPGVMGWWPAKAVTFVDNHDTGST  295

Query  998   QRLWPFTTSTDDAVNHDRVLQGYAYILTHPGIPSVFYDHFFEWGLKDAISKLISIRNKNG  1177
             Q +WPF +        D+V+QGYAYILTHPG P +FYDHFF WG KD I+ L++IR +NG
Sbjct  296   QAMWPFPS--------DKVMQGYAYILTHPGTPCIFYDHFFNWGFKDEIAALVAIRKRNG  347

Query  1178  VSATSPVEILAADADLYIAKINGKVILKIGPNGDLKNLVPSDFMLATSGKDFAVWEK  1348
             ++ATS ++IL  + D Y+A+I+GKV++KIG   D+  ++P+ F  +  GKD+AVWEK
Sbjct  348   ITATSALKILMHEGDAYVAEIDGKVVVKIGTRYDVGAVIPAGFATSAHGKDYAVWEK  404



>gb|ADC54365.1| alpha amylase [Hordeum vulgare subsp. spontaneum]
Length=414

 Score =   439 bits (1130),  Expect = 1e-146, Method: Compositional matrix adjust.
 Identities = 222/417 (53%), Positives = 294/417 (71%), Gaps = 20/417 (5%)
 Frame = +2

Query  113   VLFQGFTWTSKDQPGGWWNWLITKVPDLADAGITHVWLPPPSNAREGDDQGYMPKRMYDL  292
             VLFQGF W S  Q GGW+N ++ KV D+A AG+THVWLPPPS++    ++GYMP R+YD+
Sbjct  3     VLFQGFNWESWKQSGGWYNMMMGKVDDIAAAGVTHVWLPPPSHSVS--NEGYMPGRLYDI  60

Query  293   DTSKYGNKKELKALNDAFHGRGIKSVADIVLNHRAAERANSRGVFNVFEGGTPDDKLDWG  472
             D SKYGN  ELK+L  A HG+G++++ADIV+NHR A+  +SRG++ +FEGGT D +LDWG
Sbjct  61    DASKYGNAAELKSLIGALHGKGVQAIADIVINHRCADYKDSRGIYCIFEGGTSDGRLDWG  120

Query  473   PSEICGDDAAF-EGTGNPDTGDPWGDAPDIDHRSPRVQREISEWMNWLKSDVGFDGWRFD  649
             P  IC DD  + +GT N DTG  +  APDIDH + RVQRE+ EW+ WLKSD+GFD WR D
Sbjct  121   PHMICRDDTKYSDGTANLDTGADFAAAPDIDHLNDRVQRELKEWLLWLKSDLGFDAWRLD  180

Query  650   YVKGYDFVKGFAAVKIYMDNTKPEFAVGELWNALSPGSVPNPDYNQDAHRNELVRWVQNa  829
             + +GY         K+Y+D T P  AV E+W+ ++ G    P+Y+QDAHR  LV WV   
Sbjct  181   FARGYSP----EMAKVYIDGTSPSLAVAEVWDNMATGGDGKPNYDQDAHRQNLVNWVDKV  236

Query  830   ggaatafdf---ttKGILQAALNNTELWRLKDAAGKPSGMIGVLPQSAVTFIDNHDTWS-  997
             GGAA+A      TTKGIL AA+   ELWRL D  GK  G++G  P  AVTF+DNHDT S 
Sbjct  237   GGAASAGMVFDFTTKGILNAAVEG-ELWRLIDPQGKAPGVMGWWPAKAVTFVDNHDTGST  295

Query  998   QRLWPFTTSTDDAVNHDRVLQGYAYILTHPGIPSVFYDHFFEWGLKDAISKLISIRNKNG  1177
             Q +WPF +        D+V+QGYAYILTHPGIP +FYDHFF WG KD I+ L++IR +NG
Sbjct  296   QAMWPFPS--------DKVMQGYAYILTHPGIPCIFYDHFFNWGFKDQIAALVAIRKRNG  347

Query  1178  VSATSPVEILAADADLYIAKINGKVILKIGPNGDLKNLVPSDFMLATSGKDFAVWEK  1348
             ++ATS ++IL  + D Y+A+I+GKV++KIG   D+  ++P+ F+ +  G D+AVWEK
Sbjct  348   ITATSALKILMHEGDAYVAEIDGKVVVKIGSRYDVGAVIPAGFVTSAHGNDYAVWEK  404



>ref|XP_010438943.1| PREDICTED: alpha-amylase 1 [Camelina sativa]
Length=422

 Score =   440 bits (1131),  Expect = 1e-146, Method: Compositional matrix adjust.
 Identities = 231/438 (53%), Positives = 305/438 (70%), Gaps = 19/438 (4%)
 Frame = +2

Query  41    MKSSFYLSLFCIAFFL-FPLHSSSTVLFQGFTWTSKDQPGGWWNWLITKVPDLADAGITH  217
             M S   L   C+ FF+ FP  + ST+LFQ F W S  + GG++N +   + D+A+AG TH
Sbjct  1     MTSLHALLFTCLLFFIVFPTFTFSTLLFQSFNWESWKREGGFYNSIHNSIDDIANAGTTH  60

Query  218   VWLPPPSNAREGDDQGYMPKRMYDLDTSKYGNKKELKALNDAFHGRGIKSVADIVLNHRA  397
             +WLPP S +     +GY+P ++YDL++SKYG++ ELK L  A + +GIK+VADIV+NHR 
Sbjct  61    LWLPPSSQSVA--PEGYLPGKLYDLNSSKYGSETELKLLIQALNQKGIKAVADIVINHRT  118

Query  398   AERANSRGVFNVFEGGTPDDKLDWGPSEICGDDAAFEGTGNPDTGDPWGDAPDIDHRSPR  577
               R + +  +  FEGGT D +LDW PS +C +D  F GTGN DTG  +  APDIDH +PR
Sbjct  119   GVRRDDKCGYCYFEGGTSDGRLDWDPSFVCRNDPNFPGTGNIDTGGDFNGAPDIDHLNPR  178

Query  578   VQREISEWMNWLKSDVGFDGWRFDYVKGYDFVKGFAAVKIYMDNTKPEFAVGELWNALSP  757
             VQ+E+SEWMNWLK+D+GF GWRFD+V GY      +  K+Y+ NT P+FAVGE W+ +  
Sbjct  179   VQKELSEWMNWLKTDIGFHGWRFDFVLGY----ASSITKLYVQNTSPDFAVGEKWDDMKY  234

Query  758   GSVPNPDYNQDAHRNELVRWVQNaggaatafd-fttKGILQAALNNTELWRLKDAAGKPS  934
             G     DYNQD HR+ L +WV+ AGG       FTTKGILQ+A+   ELWRLKD+ GKP 
Sbjct  235   GGDGKLDYNQDQHRSGLKQWVEEAGGGVLTAFDFTTKGILQSAVQG-ELWRLKDSQGKPP  293

Query  935   GMIGVLPQSAVTFIDNHDTWSQRLWPFTTSTDDAVNHDRVLQGYAYILTHPGIPSVFYDH  1114
             G+IGV+P +AVTFI+NHDT+  R W F +        ++VL GY YILTHPG P +FY+H
Sbjct  294   GLIGVMPGNAVTFIENHDTF--RTWVFPS--------EKVLLGYVYILTHPGTPCIFYNH  343

Query  1115  FFEWGLKDAISKLISIRNKNGVSATSPVEILAADADLYIAKINGKVILKIGPNGDLKNLV  1294
             + EWGLK++ISKL++IR +NG+ +TS V I AA++DLY+A I+ KVI+KIGP  DL  LV
Sbjct  344   YMEWGLKESISKLVAIRKRNGIGSTSSVTIKAAESDLYLAMIDDKVIMKIGPKLDLGTLV  403

Query  1295  PSDFMLATSGKDFAVWEK  1348
             P  + LA SG DFAVWEK
Sbjct  404   PPSYALAYSGLDFAVWEK  421



>gb|KFK29029.1| hypothetical protein AALP_AA7G079500 [Arabis alpina]
Length=424

 Score =   440 bits (1131),  Expect = 1e-146, Method: Compositional matrix adjust.
 Identities = 228/420 (54%), Positives = 299/420 (71%), Gaps = 16/420 (4%)
 Frame = +2

Query  92    PLHSSSTVLFQGFTWTSKDQPGGWWNWLITKVPDLADAGITHVWLPPPSNAREGDDQGYM  271
             P  + ST+LFQGF W S  + GG++N L   + D+  AGITH+WLPPPS +     +GY+
Sbjct  19    PALTCSTILFQGFNWESWKKEGGFYNSLHNSIDDITKAGITHIWLPPPSQSVS--PEGYL  76

Query  272   PKRMYDLDTSKYGNKKELKALNDAFHGRGIKSVADIVLNHRAAERANSRGVFNVFEGGTP  451
             P ++YDLD+SKYG+K ELK+L  A + +GIK+VADIV+NHR A R +    +  FEGGT 
Sbjct  77    PGKLYDLDSSKYGSKTELKSLISALNEKGIKTVADIVINHRTAARKDDACGYCFFEGGTS  136

Query  452   DDKLDWGPSEICGDDAAFEGTGNPDTGDPWGDAPDIDHRSPRVQREISEWMNWLKSDVGF  631
             DD+LDW  S IC  D+ + GTGN DTG+ +  APDIDH +P+VQ+E+SEWMNWLKS++GF
Sbjct  137   DDRLDWDASFICRGDSNYAGTGNTDTGEDYKPAPDIDHLNPKVQKELSEWMNWLKSEIGF  196

Query  632   DGWRFDYVKGYDFVKGFAAVKIYMDNTKPEFAVGELWNALSPGSVPNPDYNQDAHRNELV  811
              GWRFD+V+GY      +  KIY+ NT P+FAVGE W+ +  G     +YNQD HR+ L 
Sbjct  197   HGWRFDFVRGY----APSITKIYVQNTSPDFAVGEKWDDMKYGGDGKLEYNQDDHRSVLG  252

Query  812   RWVQNaggaataf-dfttKGILQAALNNTELWRLKDAAGKPSGMIGVLPQSAVTFIDNHD  988
              W++ AGG      DFTTKGILQAA+   ELWRLKD+ GKP G+IG +P +AVTF+DNHD
Sbjct  253   HWIEEAGGGVLTAFDFTTKGILQAAVQG-ELWRLKDSQGKPPGLIGTVPGNAVTFVDNHD  311

Query  989   TWSQRLWPFTTSTDDAVNHDRVLQGYAYILTHPGIPSVFYDHFFEWGLKDAISKLISIRN  1168
             T+    W F +        D++L GY YILTHPG P++FYDH+ + GLK++I KL+ IR 
Sbjct  312   TYRPNSWAFPS--------DKLLLGYVYILTHPGTPTIFYDHYMQGGLKESIWKLVEIRK  363

Query  1169  KNGVSATSPVEILAADADLYIAKINGKVILKIGPNGDLKNLVPSDFMLATSGKDFAVWEK  1348
             +NG+S+TS V I AA++DLY+A I+ KVI+KIGP GDL  LVPS+F LA SG + AVWEK
Sbjct  364   RNGISSTSSVVIKAAESDLYLAMIDDKVIMKIGPKGDLGTLVPSNFALAYSGLNCAVWEK  423



>pdb|3BSH|A Chain A, Barley Alpha-Amylase Isozyme 1 (Amy1) Double Mutant 
Y105aY380A IN COMPLEX WITH INHIBITOR ACARBOSE
Length=414

 Score =   439 bits (1130),  Expect = 1e-146, Method: Compositional matrix adjust.
 Identities = 222/417 (53%), Positives = 293/417 (70%), Gaps = 20/417 (5%)
 Frame = +2

Query  113   VLFQGFTWTSKDQPGGWWNWLITKVPDLADAGITHVWLPPPSNAREGDDQGYMPKRMYDL  292
             VLFQGF W S  Q GGW+N ++ KV D+A AG+THVWLPPPS++    ++GYMP R+YD+
Sbjct  3     VLFQGFNWESWKQSGGWYNMMMGKVDDIAAAGVTHVWLPPPSHSVS--NEGYMPGRLYDI  60

Query  293   DTSKYGNKKELKALNDAFHGRGIKSVADIVLNHRAAERANSRGVFNVFEGGTPDDKLDWG  472
             D SKYGN  ELK+L  A HG+G++++ADIV+NHR A+  +SRG+  +FEGGT D +LDWG
Sbjct  61    DASKYGNAAELKSLIGALHGKGVQAIADIVINHRCADYKDSRGIACIFEGGTSDGRLDWG  120

Query  473   PSEICGDDAAF-EGTGNPDTGDPWGDAPDIDHRSPRVQREISEWMNWLKSDVGFDGWRFD  649
             P  IC DD  + +GT N DTG  +  APDIDH + RVQRE+ EW+ WLKSD+GFD WR D
Sbjct  121   PHMICRDDTKYSDGTANLDTGADFAAAPDIDHLNDRVQRELKEWLLWLKSDLGFDAWRLD  180

Query  650   YVKGYDFVKGFAAVKIYMDNTKPEFAVGELWNALSPGSVPNPDYNQDAHRNELVRWVQNa  829
             + +GY         K+Y+D T P  AV E+W+ ++ G    P+Y+QDAHR  LV WV   
Sbjct  181   FARGYSP----EMAKVYIDGTSPSLAVAEVWDNMATGGDGKPNYDQDAHRQNLVNWVDKV  236

Query  830   ggaatafdf---ttKGILQAALNNTELWRLKDAAGKPSGMIGVLPQSAVTFIDNHDTWS-  997
             GGAA+A      TTKGIL AA+   ELWRL D  GK  G++G  P  AVTF+DNHDT S 
Sbjct  237   GGAASAGMVFDFTTKGILNAAVEG-ELWRLIDPQGKAPGVMGWWPAKAVTFVDNHDTGST  295

Query  998   QRLWPFTTSTDDAVNHDRVLQGYAYILTHPGIPSVFYDHFFEWGLKDAISKLISIRNKNG  1177
             Q +WPF +        D+V+QGYAYILTHPGIP +FYDHFF WG KD I+ L++IR +NG
Sbjct  296   QAMWPFPS--------DKVMQGYAYILTHPGIPCIFYDHFFNWGFKDQIAALVAIRKRNG  347

Query  1178  VSATSPVEILAADADLYIAKINGKVILKIGPNGDLKNLVPSDFMLATSGKDFAVWEK  1348
             ++ATS ++IL  + D Y+A+I+GKV++KIG   D+  ++P+ F+ +  G D+AVWEK
Sbjct  348   ITATSALKILMHEGDAYVAEIDGKVVVKIGSRADVGAVIPAGFVTSAHGNDYAVWEK  404



>gb|ADC54344.1| alpha amylase [Hordeum vulgare subsp. spontaneum]
Length=414

 Score =   439 bits (1130),  Expect = 1e-146, Method: Compositional matrix adjust.
 Identities = 221/417 (53%), Positives = 294/417 (71%), Gaps = 20/417 (5%)
 Frame = +2

Query  113   VLFQGFTWTSKDQPGGWWNWLITKVPDLADAGITHVWLPPPSNAREGDDQGYMPKRMYDL  292
             VLFQGF W S  Q GGW+N ++ KV D+A AG+THVWLPPPS++    ++GYMP R+YD+
Sbjct  3     VLFQGFNWESWKQSGGWYNMMMGKVDDIAAAGVTHVWLPPPSHSVS--NEGYMPGRLYDI  60

Query  293   DTSKYGNKKELKALNDAFHGRGIKSVADIVLNHRAAERANSRGVFNVFEGGTPDDKLDWG  472
             D SKYGN  ELK+L  A HG+G++++ADIV+NHR A+  ++RG++ +FEGGT D +LDWG
Sbjct  61    DASKYGNAAELKSLIGALHGKGVQAIADIVINHRCADYKDNRGIYCIFEGGTSDGRLDWG  120

Query  473   PSEICGDDAAF-EGTGNPDTGDPWGDAPDIDHRSPRVQREISEWMNWLKSDVGFDGWRFD  649
             P  IC DD  + +GT N DTG  +  APDIDH + RVQRE+ EW+ WLKSD+GFD WR D
Sbjct  121   PHMICRDDTKYADGTANLDTGADFAAAPDIDHLNDRVQRELKEWLLWLKSDLGFDAWRLD  180

Query  650   YVKGYDFVKGFAAVKIYMDNTKPEFAVGELWNALSPGSVPNPDYNQDAHRNELVRWVQNa  829
             + +GY         K+Y+D T P  AV E+W+ ++ G    P+Y+QDAHR  LV WV   
Sbjct  181   FARGYSS----EMAKVYIDGTSPSLAVAEVWDNMATGGDGKPNYDQDAHRQNLVNWVDKV  236

Query  830   ggaatafdf---ttKGILQAALNNTELWRLKDAAGKPSGMIGVLPQSAVTFIDNHDTWS-  997
             GGAA+A      TTKGIL AA+   ELWRL D  GK  G++G  P  AVTF+DNHDT S 
Sbjct  237   GGAASAGMVFDFTTKGILNAAVEG-ELWRLIDPQGKAPGVMGWWPAKAVTFVDNHDTGST  295

Query  998   QRLWPFTTSTDDAVNHDRVLQGYAYILTHPGIPSVFYDHFFEWGLKDAISKLISIRNKNG  1177
             Q +WPF +        D+V+QGYAYILTHPGIP +FYDHFF WG KD I+ L++IR +NG
Sbjct  296   QAMWPFPS--------DKVMQGYAYILTHPGIPCIFYDHFFNWGFKDQIAALVAIRKRNG  347

Query  1178  VSATSPVEILAADADLYIAKINGKVILKIGPNGDLKNLVPSDFMLATSGKDFAVWEK  1348
             ++ATS ++IL  + D Y+A+I+GKV++KIG   D+  ++P+ F+ +  G D+AVWEK
Sbjct  348   ITATSALKILMHEGDAYVAEIDGKVVVKIGSRYDVGAVIPAGFVTSAHGNDYAVWEK  404



>gb|ADC54353.1| alpha amylase [Hordeum vulgare subsp. spontaneum]
 gb|ADC54354.1| alpha amylase [Hordeum vulgare subsp. spontaneum]
 gb|ADC54355.1| alpha amylase [Hordeum vulgare subsp. spontaneum]
Length=414

 Score =   439 bits (1130),  Expect = 1e-146, Method: Compositional matrix adjust.
 Identities = 222/417 (53%), Positives = 293/417 (70%), Gaps = 20/417 (5%)
 Frame = +2

Query  113   VLFQGFTWTSKDQPGGWWNWLITKVPDLADAGITHVWLPPPSNAREGDDQGYMPKRMYDL  292
             VLFQGF W S  Q GGW+N ++ KV D+A AG+THVWLPPPS++    ++GYMP R+YD+
Sbjct  3     VLFQGFNWESWKQSGGWYNMMMGKVDDIAAAGVTHVWLPPPSHSVS--NEGYMPGRLYDI  60

Query  293   DTSKYGNKKELKALNDAFHGRGIKSVADIVLNHRAAERANSRGVFNVFEGGTPDDKLDWG  472
             D SKYGN  ELK+L  A HG+G++++ADIV+NHR A+  +SRG++ +FEGGT D +LDWG
Sbjct  61    DASKYGNAAELKSLIGALHGKGVQAIADIVINHRCADYKDSRGIYCIFEGGTSDGRLDWG  120

Query  473   PSEICGDDAAF-EGTGNPDTGDPWGDAPDIDHRSPRVQREISEWMNWLKSDVGFDGWRFD  649
             P  IC DD  + +GT N DTG  +  APDIDH + RVQRE+ EW+ WLKSD+GFD WR D
Sbjct  121   PHMICRDDTKYSDGTANLDTGADFAAAPDIDHLNDRVQRELKEWLLWLKSDLGFDAWRLD  180

Query  650   YVKGYDFVKGFAAVKIYMDNTKPEFAVGELWNALSPGSVPNPDYNQDAHRNELVRWVQNa  829
             + +GY         K+Y+D T P  AV E+W+ ++ G    P+Y+QDAHR  LV WV   
Sbjct  181   FARGYSP----EMAKVYIDGTSPSLAVAEVWDNMATGGDGKPNYDQDAHRQNLVNWVDKV  236

Query  830   ggaatafdf---ttKGILQAALNNTELWRLKDAAGKPSGMIGVLPQSAVTFIDNHDTWS-  997
             GGAA+A      TTKGIL AA+   ELWRL D  GK  G++G  P  AVTF+DNHDT S 
Sbjct  237   GGAASAGMVFDFTTKGILNAAVEG-ELWRLIDPQGKAPGVMGWWPAKAVTFVDNHDTGST  295

Query  998   QRLWPFTTSTDDAVNHDRVLQGYAYILTHPGIPSVFYDHFFEWGLKDAISKLISIRNKNG  1177
             Q +WPF +        D+V+QGYAYILTHPG P +FYDHFF WG KD I+ L++IR +NG
Sbjct  296   QAMWPFPS--------DKVMQGYAYILTHPGTPCIFYDHFFNWGFKDEIAALVAIRKRNG  347

Query  1178  VSATSPVEILAADADLYIAKINGKVILKIGPNGDLKNLVPSDFMLATSGKDFAVWEK  1348
             ++ATS ++IL  + D Y+A+I+GKV++KIG   D+  ++P+ F  +  GKD+AVWEK
Sbjct  348   ITATSALKILMHEGDAYVAEIDGKVVVKIGTRYDVGAVIPAGFATSAHGKDYAVWEK  404



>pdb|1HT6|A Chain A, Crystal Structure At 1.5a Resolution Of The Barley Alpha- 
Amylase Isozyme 1
 pdb|1P6W|A Chain A, Crystal Structure Of Barley Alpha-Amylase Isozyme 1 
(Amy1) In Complex With The Substrate Analogue, Methyl 4i,4ii,4iii- 
Tri-Thiomaltotetraoside (Thio-Dp4)
 pdb|1RPK|A Chain A, Crystal Structure Of Barley Alpha-Amylase Isozyme 1 
(Amy1) In Complex With Acarbose
Length=405

 Score =   439 bits (1129),  Expect = 1e-146, Method: Compositional matrix adjust.
 Identities = 222/417 (53%), Positives = 294/417 (71%), Gaps = 20/417 (5%)
 Frame = +2

Query  113   VLFQGFTWTSKDQPGGWWNWLITKVPDLADAGITHVWLPPPSNAREGDDQGYMPKRMYDL  292
             VLFQGF W S  Q GGW+N ++ KV D+A AG+THVWLPPPS++    ++GYMP R+YD+
Sbjct  3     VLFQGFNWESWKQSGGWYNMMMGKVDDIAAAGVTHVWLPPPSHSVS--NEGYMPGRLYDI  60

Query  293   DTSKYGNKKELKALNDAFHGRGIKSVADIVLNHRAAERANSRGVFNVFEGGTPDDKLDWG  472
             D SKYGN  ELK+L  A HG+G++++ADIV+NHR A+  +SRG++ +FEGGT D +LDWG
Sbjct  61    DASKYGNAAELKSLIGALHGKGVQAIADIVINHRCADYKDSRGIYCIFEGGTSDGRLDWG  120

Query  473   PSEICGDDAAF-EGTGNPDTGDPWGDAPDIDHRSPRVQREISEWMNWLKSDVGFDGWRFD  649
             P  IC DD  + +GT N DTG  +  APDIDH + RVQRE+ EW+ WLKSD+GFD WR D
Sbjct  121   PHMICRDDTKYSDGTANLDTGADFAAAPDIDHLNDRVQRELKEWLLWLKSDLGFDAWRLD  180

Query  650   YVKGYDFVKGFAAVKIYMDNTKPEFAVGELWNALSPGSVPNPDYNQDAHRNELVRWVQNa  829
             + +GY         K+Y+D T P  AV E+W+ ++ G    P+Y+QDAHR  LV WV   
Sbjct  181   FARGYSP----EMAKVYIDGTSPSLAVAEVWDNMATGGDGKPNYDQDAHRQNLVNWVDKV  236

Query  830   ggaatafdf---ttKGILQAALNNTELWRLKDAAGKPSGMIGVLPQSAVTFIDNHDTWS-  997
             GGAA+A      TTKGIL AA+   ELWRL D  GK  G++G  P  AVTF+DNHDT S 
Sbjct  237   GGAASAGMVFDFTTKGILNAAVEG-ELWRLIDPQGKAPGVMGWWPAKAVTFVDNHDTGST  295

Query  998   QRLWPFTTSTDDAVNHDRVLQGYAYILTHPGIPSVFYDHFFEWGLKDAISKLISIRNKNG  1177
             Q +WPF +        D+V+QGYAYILTHPGIP +FYDHFF WG KD I+ L++IR +NG
Sbjct  296   QAMWPFPS--------DKVMQGYAYILTHPGIPCIFYDHFFNWGFKDQIAALVAIRKRNG  347

Query  1178  VSATSPVEILAADADLYIAKINGKVILKIGPNGDLKNLVPSDFMLATSGKDFAVWEK  1348
             ++ATS ++IL  + D Y+A+I+GKV++KIG   D+  ++P+ F+ +  G D+AVWEK
Sbjct  348   ITATSALKILMHEGDAYVAEIDGKVVVKIGSRYDVGAVIPAGFVTSAHGNDYAVWEK  404



>gb|ADC54351.1| alpha amylase [Hordeum vulgare subsp. spontaneum]
Length=414

 Score =   439 bits (1129),  Expect = 2e-146, Method: Compositional matrix adjust.
 Identities = 222/417 (53%), Positives = 292/417 (70%), Gaps = 20/417 (5%)
 Frame = +2

Query  113   VLFQGFTWTSKDQPGGWWNWLITKVPDLADAGITHVWLPPPSNAREGDDQGYMPKRMYDL  292
             VLFQGF W S  Q GGW+N ++ KV D+A AG+THVWLPPPS++     +GYMP R+YD+
Sbjct  3     VLFQGFNWESWKQSGGWYNMMMGKVDDIAAAGVTHVWLPPPSHSVS--SEGYMPGRLYDI  60

Query  293   DTSKYGNKKELKALNDAFHGRGIKSVADIVLNHRAAERANSRGVFNVFEGGTPDDKLDWG  472
             D SKYGN  ELK+L  A HG+G++++ADIV+NHR A+  +SRG++ +FEGGT D +LDWG
Sbjct  61    DASKYGNAAELKSLIGALHGKGVQAIADIVINHRCADYKDSRGIYCIFEGGTSDGRLDWG  120

Query  473   PSEICGDDAAF-EGTGNPDTGDPWGDAPDIDHRSPRVQREISEWMNWLKSDVGFDGWRFD  649
             P  IC DD  + +GT N DTG  +  APDIDH + RVQRE+ EW+ WLKSD+GFD WR D
Sbjct  121   PHMICRDDTKYSDGTANLDTGADFAAAPDIDHLNDRVQRELKEWLLWLKSDLGFDAWRLD  180

Query  650   YVKGYDFVKGFAAVKIYMDNTKPEFAVGELWNALSPGSVPNPDYNQDAHRNELVRWVQNa  829
             + +GY         K+Y+D T P  AV E+W+ ++ G    P+Y+QDAHR  LV WV   
Sbjct  181   FARGYSP----EMAKVYIDGTSPSLAVAEVWDNMATGGDGKPNYDQDAHRQNLVNWVDKV  236

Query  830   ggaatafdf---ttKGILQAALNNTELWRLKDAAGKPSGMIGVLPQSAVTFIDNHDTWS-  997
             GGAA+A      TTKGIL AA+   ELWRL D  GK  G++G  P  AVTF+DNHDT S 
Sbjct  237   GGAASAGMVFDFTTKGILNAAVEG-ELWRLIDPQGKAPGVMGWWPAKAVTFVDNHDTGST  295

Query  998   QRLWPFTTSTDDAVNHDRVLQGYAYILTHPGIPSVFYDHFFEWGLKDAISKLISIRNKNG  1177
             Q +WPF +        D+V+QGYAYILTHPG P +FYDHFF WG KD I+ L++IR +NG
Sbjct  296   QAMWPFPS--------DKVMQGYAYILTHPGTPCIFYDHFFNWGFKDEIAALVAIRKRNG  347

Query  1178  VSATSPVEILAADADLYIAKINGKVILKIGPNGDLKNLVPSDFMLATSGKDFAVWEK  1348
             ++ATS ++IL  + D Y+A+I+GKV++KIG   D+  ++P+ F  +  GKD+AVWEK
Sbjct  348   ITATSALKILMHEGDAYVAEIDGKVVVKIGTRYDVGAVIPAGFATSAHGKDYAVWEK  404



>emb|CAN74301.1| hypothetical protein VITISV_028383 [Vitis vinifera]
Length=577

 Score =   445 bits (1144),  Expect = 2e-146, Method: Compositional matrix adjust.
 Identities = 233/407 (57%), Positives = 303/407 (74%), Gaps = 19/407 (5%)
 Frame = +2

Query  62    SLFCIAFF--LFPLHSSSTVLFQGFTWTSKDQPGGWWNWLITKVPDLADAGITHVWLPPP  235
             SL C+ FF  + P  ++S +LFQGF W S  + GGW+N+LI  +P+LA +GITHVWLPPP
Sbjct  6     SLSCLLFFTTILPALTASPILFQGFNWESSKKEGGWYNFLINSIPELAASGITHVWLPPP  65

Query  236   SNAREGDDQGYMPKRMYDLDTSKYGNKKELKALNDAFHGRGIKSVADIVLNHRAAERANS  415
             S +     +GYMP R+YDL+ SKYG + ELK L   FH +G++ +ADIV+NHR AE+ ++
Sbjct  66    SQSVS--PEGYMPGRLYDLNASKYGTQDELKTLIKVFHSKGVQCIADIVINHRTAEKQDA  123

Query  416   RGVFNVFEGGTPDDKLDWGPSEICGDDAAF-EGTGNPDTGDPWGDAPDIDHRSPRVQREI  592
              G++ +FEGGTPDD+LDW PS IC D+  + +GTGNPD+GD +  APDIDH +P VQ+E+
Sbjct  124   GGIWAIFEGGTPDDRLDWTPSFICKDNTPYSDGTGNPDSGDDYSAAPDIDHINPLVQQEL  183

Query  593   SEWMNWLKSDVGFDGWRFDYVKGYDFVKGFAAVKIYMDNTKPEFAVGELWNALSPGSVPN  772
             ++WMNWLK ++GFDGWRFD+ +G+      A  K YM NT+ +FAVGE+W +LS      
Sbjct  184   TDWMNWLKIEIGFDGWRFDFARGFSP----AFTKFYMANTRAKFAVGEIWKSLSYRGDGK  239

Query  773   PDYNQDAHRNELVRWVQNaggaatafdfttKGILQAALNNTELWRLKDAAGKPSGMIGVL  952
             P YNQD+HR EL+ WV+ AGGA  AFDFTTKGILQAA+   ELWR+KD  GKP GMIG++
Sbjct  240   PSYNQDSHRRELMEWVRGAGGAVNAFDFTTKGILQAAVEG-ELWRMKDLNGKPPGMIGLM  298

Query  953   PQSAVTFIDNHDTWSQ-RLWPFTTSTDDAVNHDRVLQGYAYILTHPGIPSVFYDHFFEWG  1129
             P +AVTFIDNHDT S  + WPF +        D+++QGYAYILTHPGIPS+FYDHFFEWG
Sbjct  299   PGNAVTFIDNHDTGSTLQHWPFPS--------DKIMQGYAYILTHPGIPSIFYDHFFEWG  350

Query  1130  LKDAISKLISIRNKNGVSATSPVEILAADADLYIAKINGKVILKIGP  1270
             LK+ I KLI IR +N +   S V ILA+D+DLY+A I+GK+I+KIGP
Sbjct  351   LKEEIIKLIIIRTRNRIKPNSAVRILASDSDLYVAAIDGKIIVKIGP  397


 Score = 98.6 bits (244),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 48/80 (60%), Positives = 59/80 (74%), Gaps = 1/80 (1%)
 Frame = +2

Query  1103  FYDHFFEWGLKDAISKLISIRNKNGVSATSPVEILAADADLYIAKINGKVILKIGPNGDL  1282
             FYDHFFEWGLK+ I KLI IR +N +   S V ILA+D DLY+A I+GK+I+KIGP  D+
Sbjct  414   FYDHFFEWGLKEEILKLIMIRTRNRIKPNSAVRILASDLDLYVAVIDGKIIVKIGPGFDV  473

Query  1283  KNLVPSDF-MLATSGKDFAV  1339
              NLVP  F  +ATSGKD+  
Sbjct  474   GNLVPQSFKKIATSGKDYCC  493



>emb|CAX51372.1| alpha-amylase [Hordeum vulgare subsp. vulgare]
 dbj|BAK07660.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=438

 Score =   439 bits (1130),  Expect = 2e-146, Method: Compositional matrix adjust.
 Identities = 222/417 (53%), Positives = 294/417 (71%), Gaps = 20/417 (5%)
 Frame = +2

Query  113   VLFQGFTWTSKDQPGGWWNWLITKVPDLADAGITHVWLPPPSNAREGDDQGYMPKRMYDL  292
             VLFQGF W S  Q GGW+N ++ KV D+A AG+THVWLPPPS++    ++GYMP R+YD+
Sbjct  27    VLFQGFNWESWKQSGGWYNMMMGKVDDIAAAGVTHVWLPPPSHSVS--NEGYMPGRLYDI  84

Query  293   DTSKYGNKKELKALNDAFHGRGIKSVADIVLNHRAAERANSRGVFNVFEGGTPDDKLDWG  472
             D SKYGN  ELK+L  A HG+G++++ADIV+NHR A+  +SRG++ +FEGGT D +LDWG
Sbjct  85    DASKYGNAAELKSLIGALHGKGVQAIADIVINHRCADYKDSRGIYCIFEGGTSDGRLDWG  144

Query  473   PSEICGDDAAF-EGTGNPDTGDPWGDAPDIDHRSPRVQREISEWMNWLKSDVGFDGWRFD  649
             P  IC DD  + +GT N DTG  +  APDIDH + RVQRE+ EW+ WLKSD+GFD WR D
Sbjct  145   PHMICRDDTKYSDGTANLDTGADFAAAPDIDHLNDRVQRELKEWLLWLKSDLGFDAWRLD  204

Query  650   YVKGYDFVKGFAAVKIYMDNTKPEFAVGELWNALSPGSVPNPDYNQDAHRNELVRWVQNa  829
             + +GY         K+Y+D T P  AV E+W+ ++ G    P+Y+QDAHR  LV WV   
Sbjct  205   FARGYSP----EMAKVYIDGTSPSLAVAEVWDNMATGGDGKPNYDQDAHRQNLVNWVDKV  260

Query  830   ggaatafdf---ttKGILQAALNNTELWRLKDAAGKPSGMIGVLPQSAVTFIDNHDTWS-  997
             GGAA+A      TTKGIL AA+   ELWRL D  GK  G++G  P  AVTF+DNHDT S 
Sbjct  261   GGAASAGMVFDFTTKGILNAAVEG-ELWRLIDPQGKAPGVMGWWPAKAVTFVDNHDTGST  319

Query  998   QRLWPFTTSTDDAVNHDRVLQGYAYILTHPGIPSVFYDHFFEWGLKDAISKLISIRNKNG  1177
             Q +WPF +        D+V+QGYAYILTHPGIP +FYDHFF WG KD I+ L++IR +NG
Sbjct  320   QAMWPFPS--------DKVMQGYAYILTHPGIPCIFYDHFFNWGFKDQIAALVAIRKRNG  371

Query  1178  VSATSPVEILAADADLYIAKINGKVILKIGPNGDLKNLVPSDFMLATSGKDFAVWEK  1348
             ++ATS ++IL  + D Y+A+I+GKV++KIG   D+  ++P+ F+ +  G D+AVWEK
Sbjct  372   ITATSALKILMHEGDAYVAEIDGKVVVKIGSRYDVGAVIPAGFVTSAHGNDYAVWEK  428



>ref|NP_001175871.1| Os09g0457500 [Oryza sativa Japonica Group]
 sp|P27937.1|AMY3B_ORYSJ RecName: Full=Alpha-amylase isozyme 3B; AltName: Full=1,4-alpha-D-glucan 
glucanohydrolase; Flags: Precursor [Oryza sativa 
Japonica Group]
 emb|CAA39777.1| alpha-amylase [Oryza sativa Japonica Group]
 gb|AAA33897.1| alpha-amylase precursor (EC 3.2.1.1) [Oryza sativa]
 dbj|BAD38368.1| Alpha-amylase isozyme 3B precursor (1,4-alpha-D-glucan glucanohydrolase) 
[Oryza sativa Japonica Group]
 gb|EAZ09375.1| hypothetical protein OsI_31648 [Oryza sativa Indica Group]
 gb|EAZ44988.1| hypothetical protein OsJ_29630 [Oryza sativa Japonica Group]
 dbj|BAH94599.1| Os09g0457500 [Oryza sativa Japonica Group]
Length=438

 Score =   439 bits (1130),  Expect = 3e-146, Method: Compositional matrix adjust.
 Identities = 230/418 (55%), Positives = 290/418 (69%), Gaps = 17/418 (4%)
 Frame = +2

Query  101   SSSTVLFQGFTWTSKDQPGGWWNWLITKVPDLADAGITHVWLPPPSNAREGDDQGYMPKR  280
             + + VLFQGF W S  + GGW+N+L   V D+A  G+THVWLPPPS++     QGYMP R
Sbjct  24    AQAQVLFQGFNWESWKKQGGWYNFLHGHVDDIAATGVTHVWLPPPSHSVA--PQGYMPGR  81

Query  281   MYDLDTSKYGNKKELKALNDAFHGRGIKSVADIVLNHRAAERANSRGVFNVFEGGTPDDK  460
             +YDLD SKYG   EL++L  AFH +GIK VADIV+NHR A+  +SRG++ +FEGGTPD +
Sbjct  82    LYDLDASKYGTGAELRSLIAAFHSKGIKCVADIVINHRCADYKDSRGIYCIFEGGTPDSR  141

Query  461   LDWGPSEICGDDAAFE-GTGNPDTGDPWGDAPDIDHRSPRVQREISEWMNWLKSDVGFDG  637
             LDWGP  IC DD  +  G G+ DTG  +G APDIDH + RVQ E+S+W+NWLKSDVGFDG
Sbjct  142   LDWGPDMICSDDTQYSNGRGHRDTGADFGAAPDIDHLNTRVQTELSDWLNWLKSDVGFDG  201

Query  638   WRFDYVKGYDFVKGFAAVKIYMDNTKPEFAVGELWNALSPGSVPNPDYNQDAHRNELVRW  817
             WR D+ KGY      A  K Y+DNT P F V E+W+ +       P +NQD  R ELV W
Sbjct  202   WRLDFAKGYSA----AVAKTYVDNTDPSFVVAEIWSNMRYDGNGEPSWNQDGDRQELVNW  257

Query  818   VQNaggaatafdfttKGILQAALNNTELWRLKDAAGKPSGMIGVLPQSAVTFIDNHDTWS  997
              Q  GG A+AFDFTTKG LQAA+   ELWR+KD  GK  GMIG LP+ AVTFIDNHDT S
Sbjct  258   AQAVGGPASAFDFTTKGELQAAVQG-ELWRMKDGNGKAPGMIGWLPEKAVTFIDNHDTGS  316

Query  998   -QRLWPFTTSTDDAVNHDRVLQGYAYILTHPGIPSVFYDHFFEWGLKDAISKLISIRNKN  1174
              Q  WPF +        D+V+QGYAYILTHPG+P +FYDH F+W LK  IS L ++R++N
Sbjct  317   TQNSWPFPS--------DKVMQGYAYILTHPGVPCIFYDHVFDWNLKQEISTLAAVRSRN  368

Query  1175  GVSATSPVEILAADADLYIAKINGKVILKIGPNGDLKNLVPSDFMLATSGKDFAVWEK  1348
              +   S ++ILAA+ D+Y+A I+ KVI KIG   D+ NL+PSDF +   G ++ +WEK
Sbjct  369   EIHPGSKLKILAAEGDVYVAMIDDKVITKIGTRYDVGNLIPSDFHVVAHGNNYCIWEK  426



>gb|ADC54347.1| alpha amylase [Hordeum vulgare subsp. spontaneum]
Length=414

 Score =   439 bits (1128),  Expect = 3e-146, Method: Compositional matrix adjust.
 Identities = 222/417 (53%), Positives = 294/417 (71%), Gaps = 20/417 (5%)
 Frame = +2

Query  113   VLFQGFTWTSKDQPGGWWNWLITKVPDLADAGITHVWLPPPSNAREGDDQGYMPKRMYDL  292
             VLFQGF W S  Q GGW+N ++ KV D+A AG+THVWLPPPS++    ++GYMP R+YD+
Sbjct  3     VLFQGFNWESWKQSGGWYNMMMGKVDDIAAAGVTHVWLPPPSHSVS--NEGYMPGRLYDI  60

Query  293   DTSKYGNKKELKALNDAFHGRGIKSVADIVLNHRAAERANSRGVFNVFEGGTPDDKLDWG  472
             D SKYGN  ELK+L  A HG+G++++ADIV+NHR A+  ++RG++ +FEGGT D +LDWG
Sbjct  61    DASKYGNAAELKSLIGALHGKGVQAIADIVINHRCADYKDNRGIYCIFEGGTSDGRLDWG  120

Query  473   PSEICGDDAAF-EGTGNPDTGDPWGDAPDIDHRSPRVQREISEWMNWLKSDVGFDGWRFD  649
             P  IC DD  + +GT N DTG  +  APDIDH + RVQRE+ EW+ WLKSD+GFD WR D
Sbjct  121   PHMICRDDTRYADGTANLDTGADFAAAPDIDHLNDRVQRELKEWLLWLKSDLGFDAWRLD  180

Query  650   YVKGYDFVKGFAAVKIYMDNTKPEFAVGELWNALSPGSVPNPDYNQDAHRNELVRWVQNa  829
             + KGY         K+Y+D T P  AV E+W+ ++ G    P+Y+QDAHR  LV WV   
Sbjct  181   FAKGYSP----EMAKVYIDGTSPSLAVAEVWDNMATGGDGKPNYDQDAHRQNLVNWVDKV  236

Query  830   ggaatafdf---ttKGILQAALNNTELWRLKDAAGKPSGMIGVLPQSAVTFIDNHDTWS-  997
             GGAA+A      TTKGIL AA+   ELWRL D  GK  G++G  P  AVTF+DNHDT S 
Sbjct  237   GGAASAGMVFDFTTKGILNAAVEG-ELWRLIDPQGKAPGVMGWWPAKAVTFVDNHDTGST  295

Query  998   QRLWPFTTSTDDAVNHDRVLQGYAYILTHPGIPSVFYDHFFEWGLKDAISKLISIRNKNG  1177
             Q +WPF +        D+V+QGYAYILTHPGIP +FYDHFF WG KD I+ L++IR +NG
Sbjct  296   QAMWPFPS--------DKVMQGYAYILTHPGIPCIFYDHFFNWGFKDQIAALVAIRKRNG  347

Query  1178  VSATSPVEILAADADLYIAKINGKVILKIGPNGDLKNLVPSDFMLATSGKDFAVWEK  1348
             ++ATS ++IL  + D Y+A+I+GKV++KIG   D+  ++P+ F+ +  G D+AVWEK
Sbjct  348   ITATSALKILMHEGDAYVAEIDGKVVVKIGSRYDVGAVIPAGFVTSAHGNDYAVWEK  404



>gb|ADC54371.1| alpha amylase [Hordeum vulgare subsp. spontaneum]
Length=414

 Score =   439 bits (1128),  Expect = 3e-146, Method: Compositional matrix adjust.
 Identities = 225/427 (53%), Positives = 294/427 (69%), Gaps = 21/427 (5%)
 Frame = +2

Query  113   VLFQGFTWTSKDQPGGWWNWLITKVPDLADAGITHVWLPPPSNAREGDDQGYMPKRMYDL  292
             VLFQGF W S  Q GGW+N ++ KV D+A AG+THVWLPPPS++     +GYMP R+YD+
Sbjct  3     VLFQGFNWESWKQSGGWYNMMLGKVDDIAAAGVTHVWLPPPSHSVAA--EGYMPGRLYDI  60

Query  293   DTSKYGNKKELKALNDAFHGRGIKSVADIVLNHRAAERANSRGVFNVFEGGTPDDKLDWG  472
             D SKYGN  ELK+L  A HG+G++++ADIV+NHR A+  +SRG++  +EGGT D +LDWG
Sbjct  61    DASKYGNAAELKSLIGALHGKGVQAIADIVINHRCADYKDSRGIYCTYEGGTSDSRLDWG  120

Query  473   PSEICGDDAAF-EGTGNPDTGDPWGDAPDIDHRSPRVQREISEWMNWLKSDVGFDGWRFD  649
             P  IC DD  + +GT N DTG  + DAPDIDH + RVQ E+ EW+ WLKSD+GFD WR D
Sbjct  121   PHMICRDDTKYSDGTANLDTGADYADAPDIDHLNHRVQSELKEWLLWLKSDLGFDAWRLD  180

Query  650   YVKGYDFVKGFAAVKIYMDNTKPEFAVGELWNALSPGSVPNPDYNQDAHRNELVRWVQNa  829
             + +GY         K+Y+D T P  AV E+W+ + PG    P+Y+QDAHR  LV WV   
Sbjct  181   FARGYSA----EMAKVYIDGTSPSLAVAEIWDGMVPGGDGKPNYDQDAHRQNLVNWVDKV  236

Query  830   ggaatafdf---ttKGILQAALNNTELWRLKDAAGKPSGMIGVLPQSAVTFIDNHDTWS-  997
             GGAA+A      TTKGIL  A+   ELWRL D  GK  G++G  P  AVTFIDNHDT S 
Sbjct  237   GGAASAGMVFDFTTKGILNVAVEG-ELWRLIDPQGKAPGVMGWWPAKAVTFIDNHDTGST  295

Query  998   QRLWPFTTSTDDAVNHDRVLQGYAYILTHPGIPSVFYDHFFEWGLKDAISKLISIRNKNG  1177
             Q  WPF +        D+++QGYAYILTHPG P +FYDHFF WG KD I+ L++IR +NG
Sbjct  296   QAKWPFPS--------DKIMQGYAYILTHPGTPCIFYDHFFNWGFKDEIAALVAIRKRNG  347

Query  1178  VSATSPVEILAADADLYIAKINGKVILKIGPNGDLKNLVPSDFMLATSGKDFAVWEK-PT  1354
             ++ATS ++IL  + D Y+A+I+GKV++KIG   D+  ++P+ F  +  GKD+AVWEK  T
Sbjct  348   ITATSALKILMHEGDAYVAEIDGKVVVKIGTRYDVGAVIPAGFATSAHGKDYAVWEKTAT  407

Query  1355  *SRLQIS  1375
              + LQ S
Sbjct  408   AATLQRS  414



>gb|ADC54372.1| alpha amylase [Hordeum vulgare subsp. spontaneum]
Length=414

 Score =   438 bits (1127),  Expect = 3e-146, Method: Compositional matrix adjust.
 Identities = 221/417 (53%), Positives = 291/417 (70%), Gaps = 20/417 (5%)
 Frame = +2

Query  113   VLFQGFTWTSKDQPGGWWNWLITKVPDLADAGITHVWLPPPSNAREGDDQGYMPKRMYDL  292
             VLFQGF W S  Q GGW+N ++ KV D+A AG+THVWLPPPS++    ++GYMP R+YD+
Sbjct  3     VLFQGFNWESWKQSGGWYNMMMGKVDDIAAAGVTHVWLPPPSHSVF--NEGYMPGRLYDI  60

Query  293   DTSKYGNKKELKALNDAFHGRGIKSVADIVLNHRAAERANSRGVFNVFEGGTPDDKLDWG  472
             D SKYGN  ELK+L  A HG+G++++ADIV+NHR A+  +SRG++ ++EGGT D +LDWG
Sbjct  61    DASKYGNAAELKSLIGALHGKGVQAIADIVINHRCADYKDSRGIYCIYEGGTSDSRLDWG  120

Query  473   PSEICGDDAAF-EGTGNPDTGDPWGDAPDIDHRSPRVQREISEWMNWLKSDVGFDGWRFD  649
             P  IC DD  + +GT N DTG  + DAPDIDH + RVQ E+ EW+ WLKSD+GFD WR D
Sbjct  121   PHMICRDDTKYSDGTANLDTGADYADAPDIDHLNHRVQSELKEWLLWLKSDLGFDAWRLD  180

Query  650   YVKGYDFVKGFAAVKIYMDNTKPEFAVGELWNALSPGSVPNPDYNQDAHRNELVRWVQNa  829
             + +GY         K+Y+D T P  AV E+W+ + PG    P+Y+QDAHR  LV WV   
Sbjct  181   FARGYSA----EMAKVYIDGTSPSLAVAEVWDGMVPGGDGKPNYDQDAHRQNLVNWVDKV  236

Query  830   ggaatafdf---ttKGILQAALNNTELWRLKDAAGKPSGMIGVLPQSAVTFIDNHDTWS-  997
             GGAA+A      TTKGIL  A+   ELWRL D  GK  G++G  P  AVTFIDNHDT S 
Sbjct  237   GGAASAGMVFDFTTKGILNVAVEG-ELWRLIDPQGKAPGVMGWWPAKAVTFIDNHDTGST  295

Query  998   QRLWPFTTSTDDAVNHDRVLQGYAYILTHPGIPSVFYDHFFEWGLKDAISKLISIRNKNG  1177
             Q  WPF +        D+++QGYAYILTHPG P +FYDHFF WG KD I+ L++IR +NG
Sbjct  296   QAKWPFPS--------DKIMQGYAYILTHPGTPCIFYDHFFNWGFKDEIAALVAIRKRNG  347

Query  1178  VSATSPVEILAADADLYIAKINGKVILKIGPNGDLKNLVPSDFMLATSGKDFAVWEK  1348
             ++ATS ++IL  + D Y+A+I+GKV++KIG   D+  ++P+ F  +  GKD+AVWEK
Sbjct  348   ITATSALKILMHEGDAYVAEIDGKVVVKIGTRYDVGAVIPAGFATSAHGKDYAVWEK  404



>gb|ADC54282.1| alpha amylase [Hordeum vulgare subsp. spontaneum]
Length=414

 Score =   438 bits (1127),  Expect = 3e-146, Method: Compositional matrix adjust.
 Identities = 225/427 (53%), Positives = 298/427 (70%), Gaps = 21/427 (5%)
 Frame = +2

Query  113   VLFQGFTWTSKDQPGGWWNWLITKVPDLADAGITHVWLPPPSNAREGDDQGYMPKRMYDL  292
             VLFQGF W S  Q GGW+N ++ KV D+A AG+THVWLPPPS++    ++GYMP R+YD+
Sbjct  3     VLFQGFNWESWKQSGGWYNMMMGKVDDIAAAGVTHVWLPPPSHSVS--NEGYMPGRLYDI  60

Query  293   DTSKYGNKKELKALNDAFHGRGIKSVADIVLNHRAAERANSRGVFNVFEGGTPDDKLDWG  472
             D SKYGN  ELK+L  A HG+G++++ADIV+NHR A+  ++RG++ +FEGGT D +LDWG
Sbjct  61    DASKYGNAAELKSLIGALHGKGVQAIADIVINHRCADYKDNRGIYCIFEGGTSDGRLDWG  120

Query  473   PSEICGDDAAF-EGTGNPDTGDPWGDAPDIDHRSPRVQREISEWMNWLKSDVGFDGWRFD  649
             P  IC DD  + +GT N DTG  +  APDIDH + RVQRE+ EW+ WLKSD+GFD WR D
Sbjct  121   PHMICRDDTKYADGTANLDTGADFAAAPDIDHLNDRVQRELKEWLLWLKSDLGFDAWRLD  180

Query  650   YVKGYDFVKGFAAVKIYMDNTKPEFAVGELWNALSPGSVPNPDYNQDAHRNELVRWVQNa  829
             + +GY         K+Y+D T P  AV E+W+ ++ G    P+Y+QDAHR  LV WV   
Sbjct  181   FARGYSP----EMAKVYIDGTSPSLAVAEVWDNMATGGDGKPNYDQDAHRQNLVNWVDKV  236

Query  830   ggaatafdf---ttKGILQAALNNTELWRLKDAAGKPSGMIGVLPQSAVTFIDNHDTWS-  997
             GGAA+A      TTKGIL AA+   ELWRL D  GK  G++G  P  AVTF+DNHDT S 
Sbjct  237   GGAASAGMVFDFTTKGILNAAVEG-ELWRLIDPQGKAPGVMGWRPAKAVTFVDNHDTGST  295

Query  998   QRLWPFTTSTDDAVNHDRVLQGYAYILTHPGIPSVFYDHFFEWGLKDAISKLISIRNKNG  1177
             Q +WPF +        D+V+QGYAYILTHPG P +FYDHFF WG KD I+ L++IR +NG
Sbjct  296   QAMWPFPS--------DKVMQGYAYILTHPGTPCIFYDHFFNWGFKDEIAALVAIRKRNG  347

Query  1178  VSATSPVEILAADADLYIAKINGKVILKIGPNGDLKNLVPSDFMLATSGKDFAVWEK-PT  1354
             ++ATS ++IL  + D Y+A+I+GKV++KIG   D+  ++P+ F  +  GKD+AVWEK  T
Sbjct  348   ITATSALKILMHEGDAYVAEIDGKVVVKIGTRYDVGAVIPAGFATSAHGKDYAVWEKTAT  407

Query  1355  *SRLQIS  1375
              + LQ S
Sbjct  408   AATLQRS  414



>gb|ADC54328.1| alpha amylase [Hordeum vulgare subsp. spontaneum]
Length=414

 Score =   438 bits (1127),  Expect = 4e-146, Method: Compositional matrix adjust.
 Identities = 221/417 (53%), Positives = 293/417 (70%), Gaps = 20/417 (5%)
 Frame = +2

Query  113   VLFQGFTWTSKDQPGGWWNWLITKVPDLADAGITHVWLPPPSNAREGDDQGYMPKRMYDL  292
             VLFQGF W S  Q GGW+N ++ KV D+A AG+THVWLPPPS++    ++GYMP R+YD+
Sbjct  3     VLFQGFNWESWKQSGGWYNMMMGKVDDIAAAGVTHVWLPPPSHSVS--NEGYMPGRLYDI  60

Query  293   DTSKYGNKKELKALNDAFHGRGIKSVADIVLNHRAAERANSRGVFNVFEGGTPDDKLDWG  472
             D SKYGN   LK+L  A HG+G++++ADIV+NHR A+  ++RG++ +FEGGT D +LDWG
Sbjct  61    DASKYGNAAALKSLIGALHGKGVQAIADIVINHRCADYKDNRGIYCIFEGGTSDGRLDWG  120

Query  473   PSEICGDDAAF-EGTGNPDTGDPWGDAPDIDHRSPRVQREISEWMNWLKSDVGFDGWRFD  649
             P  IC DD  + +GT N DTG  +  APDIDH + RVQRE+ EW+ WLKSD+GFD WR D
Sbjct  121   PHMICRDDTKYADGTANLDTGADFAAAPDIDHLNDRVQRELKEWLLWLKSDLGFDAWRLD  180

Query  650   YVKGYDFVKGFAAVKIYMDNTKPEFAVGELWNALSPGSVPNPDYNQDAHRNELVRWVQNa  829
             + +GY         K+Y+D T P  AV E+W+ ++ G    P+Y+QDAHR  LV WV   
Sbjct  181   FARGYSP----EMAKVYIDGTSPSLAVAEVWDNMATGGDGKPNYDQDAHRQNLVNWVDKV  236

Query  830   ggaatafdf---ttKGILQAALNNTELWRLKDAAGKPSGMIGVLPQSAVTFIDNHDTWS-  997
             GGAA+A      TTKGIL AA+  +ELWRL D  GK  G++G  P  AVTF+DNHDT S 
Sbjct  237   GGAASAGMVFDFTTKGILNAAVE-SELWRLIDPQGKAPGVMGWWPAKAVTFVDNHDTGST  295

Query  998   QRLWPFTTSTDDAVNHDRVLQGYAYILTHPGIPSVFYDHFFEWGLKDAISKLISIRNKNG  1177
             Q +WPF +        D+V+QGYAYILTHPG P +FYDHFF WG KD I+ L++IR +NG
Sbjct  296   QAMWPFPS--------DKVMQGYAYILTHPGTPCIFYDHFFNWGFKDEIAALVAIRKRNG  347

Query  1178  VSATSPVEILAADADLYIAKINGKVILKIGPNGDLKNLVPSDFMLATSGKDFAVWEK  1348
             ++ATS ++IL  + D Y+A+INGKV++KIG   D+  ++P+ F  +  GKD+AVWEK
Sbjct  348   ITATSALKILMHEGDAYVAEINGKVVVKIGTRYDVGAVIPAGFATSAHGKDYAVWEK  404



>gb|ADC54307.1| alpha amylase [Hordeum vulgare subsp. spontaneum]
Length=414

 Score =   438 bits (1126),  Expect = 5e-146, Method: Compositional matrix adjust.
 Identities = 221/417 (53%), Positives = 293/417 (70%), Gaps = 20/417 (5%)
 Frame = +2

Query  113   VLFQGFTWTSKDQPGGWWNWLITKVPDLADAGITHVWLPPPSNAREGDDQGYMPKRMYDL  292
             VLFQGF W S  Q GGW+N ++ KV D+A AG+THVWLPPPS++    ++GYMP R+YD+
Sbjct  3     VLFQGFNWESWQQSGGWYNMMMGKVDDIAAAGVTHVWLPPPSHSVS--NEGYMPGRLYDI  60

Query  293   DTSKYGNKKELKALNDAFHGRGIKSVADIVLNHRAAERANSRGVFNVFEGGTPDDKLDWG  472
             D SKYGN  ELK+L  A HG+G++++ADIV+NHR A+  ++RG++ +FEGGT D +LDWG
Sbjct  61    DASKYGNAAELKSLIGALHGKGVQAIADIVINHRCADYKDNRGIYCIFEGGTSDGRLDWG  120

Query  473   PSEICGDDAAF-EGTGNPDTGDPWGDAPDIDHRSPRVQREISEWMNWLKSDVGFDGWRFD  649
             P  IC DD  + +GT N DTG  +  APDIDH + RVQRE+ EW+ WLKSD+GFD WR D
Sbjct  121   PHMICRDDTKYADGTANLDTGADFAAAPDIDHLNDRVQRELKEWLLWLKSDLGFDAWRLD  180

Query  650   YVKGYDFVKGFAAVKIYMDNTKPEFAVGELWNALSPGSVPNPDYNQDAHRNELVRWVQNa  829
             + +GY         K+Y+D T P  AV E+W+ ++ G    P+Y+QDAHR  LV WV   
Sbjct  181   FARGYSP----EMAKVYIDGTSPSLAVAEVWDNMATGGDGKPNYDQDAHRQNLVNWVDKV  236

Query  830   ggaatafdf---ttKGILQAALNNTELWRLKDAAGKPSGMIGVLPQSAVTFIDNHDTWS-  997
             GGAA+A      TTKGIL AA+   ELWRL D  GK  G++G  P  AVTF+DNHDT S 
Sbjct  237   GGAASAGMVFDFTTKGILNAAVEG-ELWRLIDPQGKAPGVMGWWPAKAVTFVDNHDTGST  295

Query  998   QRLWPFTTSTDDAVNHDRVLQGYAYILTHPGIPSVFYDHFFEWGLKDAISKLISIRNKNG  1177
             Q +WPF +        D+V+QGYAYILTHPG P +FYDHFF WG KD I+ L++IR +NG
Sbjct  296   QAMWPFPS--------DKVMQGYAYILTHPGTPCIFYDHFFNWGFKDEIAALVAIRKRNG  347

Query  1178  VSATSPVEILAADADLYIAKINGKVILKIGPNGDLKNLVPSDFMLATSGKDFAVWEK  1348
             ++ATS ++IL  + D Y+A+I+GKV++KIG   D+  ++P+ F  +  GKD+AVWEK
Sbjct  348   ITATSALKILMHEGDAYVAEIDGKVVVKIGTRYDVGAVIPAGFATSAHGKDYAVWEK  404



>gb|ADC54340.1| alpha amylase [Hordeum vulgare subsp. spontaneum]
 gb|ADC54341.1| alpha amylase [Hordeum vulgare subsp. spontaneum]
 gb|ADC54342.1| alpha amylase [Hordeum vulgare subsp. spontaneum]
 gb|ADC54343.1| alpha amylase [Hordeum vulgare subsp. spontaneum]
 gb|ADC54345.1| alpha amylase [Hordeum vulgare subsp. spontaneum]
Length=414

 Score =   438 bits (1126),  Expect = 5e-146, Method: Compositional matrix adjust.
 Identities = 221/417 (53%), Positives = 294/417 (71%), Gaps = 20/417 (5%)
 Frame = +2

Query  113   VLFQGFTWTSKDQPGGWWNWLITKVPDLADAGITHVWLPPPSNAREGDDQGYMPKRMYDL  292
             VLFQGF W S  Q GGW+N ++ KV D+A AG+THVWLPPPS++    ++GYMP R+YD+
Sbjct  3     VLFQGFNWESWKQSGGWYNMMMGKVDDIAAAGVTHVWLPPPSHSVS--NEGYMPGRLYDI  60

Query  293   DTSKYGNKKELKALNDAFHGRGIKSVADIVLNHRAAERANSRGVFNVFEGGTPDDKLDWG  472
             D SKYGN  ELK+L  A HG+G++++ADIV+NHR A+  ++RG++ +FEGGT D +LDWG
Sbjct  61    DASKYGNAAELKSLIGALHGKGVQAIADIVINHRCADYKDNRGIYCIFEGGTSDGRLDWG  120

Query  473   PSEICGDDAAF-EGTGNPDTGDPWGDAPDIDHRSPRVQREISEWMNWLKSDVGFDGWRFD  649
             P  IC DD  + +GT N DTG  +  APDIDH + RVQRE+ EW+ WLKSD+GFD WR D
Sbjct  121   PHMICRDDTKYADGTANLDTGADFAAAPDIDHLNDRVQRELKEWLLWLKSDLGFDAWRLD  180

Query  650   YVKGYDFVKGFAAVKIYMDNTKPEFAVGELWNALSPGSVPNPDYNQDAHRNELVRWVQNa  829
             + +GY         K+Y+D T P  AV E+W+ ++ G    P+Y+QDAHR  LV WV   
Sbjct  181   FARGYSP----EMAKVYIDGTSPSLAVAEVWDNMATGGDGKPNYDQDAHRQNLVNWVDKV  236

Query  830   ggaatafdf---ttKGILQAALNNTELWRLKDAAGKPSGMIGVLPQSAVTFIDNHDTWS-  997
             GGAA+A      TTKGIL AA+   ELWRL D  GK  G++G  P  AVTF+DNHDT S 
Sbjct  237   GGAASAGMVFDFTTKGILNAAVEG-ELWRLIDPQGKAPGVMGWWPAKAVTFVDNHDTGST  295

Query  998   QRLWPFTTSTDDAVNHDRVLQGYAYILTHPGIPSVFYDHFFEWGLKDAISKLISIRNKNG  1177
             Q +WPF +        D+V+QGYAYILTHPGIP +FYDHFF WG KD I+ L++IR +NG
Sbjct  296   QAMWPFPS--------DKVMQGYAYILTHPGIPCIFYDHFFNWGFKDQIAALVAIRKRNG  347

Query  1178  VSATSPVEILAADADLYIAKINGKVILKIGPNGDLKNLVPSDFMLATSGKDFAVWEK  1348
             ++ATS ++IL  + D Y+A+I+GKV++KIG   D+  ++P+ F+ +  G D+AVWEK
Sbjct  348   ITATSALKILMHEGDAYVAEIDGKVVVKIGSRYDVGAVIPAGFVTSAHGNDYAVWEK  404



>gb|ADC54277.1| alpha amylase [Hordeum vulgare subsp. spontaneum]
 gb|ADC54279.1| alpha amylase [Hordeum vulgare subsp. spontaneum]
 gb|ADC54280.1| alpha amylase [Hordeum vulgare subsp. spontaneum]
Length=414

 Score =   438 bits (1126),  Expect = 5e-146, Method: Compositional matrix adjust.
 Identities = 225/427 (53%), Positives = 298/427 (70%), Gaps = 21/427 (5%)
 Frame = +2

Query  113   VLFQGFTWTSKDQPGGWWNWLITKVPDLADAGITHVWLPPPSNAREGDDQGYMPKRMYDL  292
             VLFQGF W S  Q GGW+N ++ KV D+A AG+THVWLPPPS++    ++GYMP R+YD+
Sbjct  3     VLFQGFNWESWKQSGGWYNMMMGKVDDIAAAGVTHVWLPPPSHSVS--NEGYMPGRLYDI  60

Query  293   DTSKYGNKKELKALNDAFHGRGIKSVADIVLNHRAAERANSRGVFNVFEGGTPDDKLDWG  472
             D SKYGN  ELK+L  A HG+G++++ADIV+NHR A+  ++RG++ +FEGGT D +LDWG
Sbjct  61    DASKYGNAAELKSLIGALHGKGVQAIADIVINHRCADYKDNRGIYCIFEGGTSDGRLDWG  120

Query  473   PSEICGDDAAF-EGTGNPDTGDPWGDAPDIDHRSPRVQREISEWMNWLKSDVGFDGWRFD  649
             P  IC DD  + +GT N DTG  +  APDIDH + RVQRE+ EW+ WLKSD+GFD WR D
Sbjct  121   PHMICRDDTKYADGTANLDTGADFAAAPDIDHLNDRVQRELKEWLLWLKSDLGFDAWRLD  180

Query  650   YVKGYDFVKGFAAVKIYMDNTKPEFAVGELWNALSPGSVPNPDYNQDAHRNELVRWVQNa  829
             + +GY         K+Y+D T P  AV E+W+ ++ G    P+Y+QDAHR  LV WV   
Sbjct  181   FARGYSP----EMAKVYIDGTSPSLAVAEVWDNMATGGDGKPNYDQDAHRQNLVNWVDKV  236

Query  830   ggaatafdf---ttKGILQAALNNTELWRLKDAAGKPSGMIGVLPQSAVTFIDNHDTWS-  997
             GGAA+A      TTKGIL AA+   ELWRL D  GK  G++G  P  AVTF+DNHDT S 
Sbjct  237   GGAASAGMVFDFTTKGILNAAVEG-ELWRLIDPQGKAPGVMGWWPAKAVTFVDNHDTGST  295

Query  998   QRLWPFTTSTDDAVNHDRVLQGYAYILTHPGIPSVFYDHFFEWGLKDAISKLISIRNKNG  1177
             Q +WPF +        D+V+QGYAYILTHPG P +FYDHFF WG KD I+ L++IR +NG
Sbjct  296   QAMWPFPS--------DKVMQGYAYILTHPGTPCIFYDHFFNWGFKDEIAALVAIRKRNG  347

Query  1178  VSATSPVEILAADADLYIAKINGKVILKIGPNGDLKNLVPSDFMLATSGKDFAVWEK-PT  1354
             ++ATS ++IL  + D Y+A+I+GKV++KIG   D+  ++P+ F  +  GKD+AVWEK  T
Sbjct  348   ITATSALKILMHEGDAYVAEIDGKVVVKIGTRYDVGAVIPAGFATSAHGKDYAVWEKTAT  407

Query  1355  *SRLQIS  1375
              + LQ S
Sbjct  408   AATLQRS  414



>gb|ADC54358.1| alpha amylase [Hordeum vulgare subsp. spontaneum]
Length=414

 Score =   438 bits (1126),  Expect = 6e-146, Method: Compositional matrix adjust.
 Identities = 221/417 (53%), Positives = 293/417 (70%), Gaps = 20/417 (5%)
 Frame = +2

Query  113   VLFQGFTWTSKDQPGGWWNWLITKVPDLADAGITHVWLPPPSNAREGDDQGYMPKRMYDL  292
             VLFQGF W S  Q GGW+N ++ KV D+A AG+THVWLPPPS++    ++GYMP R+YD+
Sbjct  3     VLFQGFNWESWKQSGGWYNMMMGKVDDIAAAGVTHVWLPPPSHSVS--NEGYMPGRLYDI  60

Query  293   DTSKYGNKKELKALNDAFHGRGIKSVADIVLNHRAAERANSRGVFNVFEGGTPDDKLDWG  472
             D SKYGN  ELK+L  A HG+G++++ADIV+NHR A+  +SRG++ +FEGGT D +LDWG
Sbjct  61    DASKYGNAAELKSLIGALHGKGVQAIADIVINHRCADYKDSRGIYCIFEGGTSDGRLDWG  120

Query  473   PSEICGDDAAF-EGTGNPDTGDPWGDAPDIDHRSPRVQREISEWMNWLKSDVGFDGWRFD  649
             P  IC DD  + +GT + DTG  +  APDIDH + RVQRE+ EW+ WLKSD+GFD WR D
Sbjct  121   PHMICRDDTKYSDGTASLDTGADFAAAPDIDHLNDRVQRELKEWLLWLKSDLGFDAWRLD  180

Query  650   YVKGYDFVKGFAAVKIYMDNTKPEFAVGELWNALSPGSVPNPDYNQDAHRNELVRWVQNa  829
             + +GY         K+Y+D T P  AV E+W+ ++ G    P+Y+QDAHR  LV WV   
Sbjct  181   FARGYSP----EMAKVYIDGTSPSLAVAEVWDNMATGGDGKPNYDQDAHRQNLVNWVDKV  236

Query  830   ggaatafdf---ttKGILQAALNNTELWRLKDAAGKPSGMIGVLPQSAVTFIDNHDTWS-  997
             GGAA+A      TTKGIL AA+   ELWRL D  GK  G++G  P  AVTF+DNHDT S 
Sbjct  237   GGAASAGMVFDFTTKGILNAAVEG-ELWRLIDPQGKAPGVMGWWPAKAVTFVDNHDTGST  295

Query  998   QRLWPFTTSTDDAVNHDRVLQGYAYILTHPGIPSVFYDHFFEWGLKDAISKLISIRNKNG  1177
             Q +WPF +        D+V+QGYAYILTHPG P +FYDHFF WG KD I+ L++IR +NG
Sbjct  296   QAMWPFPS--------DKVMQGYAYILTHPGTPCIFYDHFFNWGFKDEIAALVAIRKRNG  347

Query  1178  VSATSPVEILAADADLYIAKINGKVILKIGPNGDLKNLVPSDFMLATSGKDFAVWEK  1348
             ++ATS ++IL  + D Y+A+I+GKV++KIG   D+  ++P+ F  +  GKD+AVWEK
Sbjct  348   ITATSALKILMHEGDAYVAEIDGKVVVKIGTRYDVGAVIPAGFATSAHGKDYAVWEK  404



>gb|ADC54286.1| alpha amylase [Hordeum vulgare subsp. spontaneum]
 gb|ADC54287.1| alpha amylase [Hordeum vulgare subsp. spontaneum]
 gb|ADC54288.1| alpha amylase [Hordeum vulgare subsp. spontaneum]
 gb|ADC54289.1| alpha amylase [Hordeum vulgare subsp. spontaneum]
 gb|ADC54290.1| alpha amylase [Hordeum vulgare subsp. spontaneum]
 gb|ADC54291.1| alpha amylase [Hordeum vulgare subsp. spontaneum]
 gb|ADC54292.1| alpha amylase [Hordeum vulgare subsp. spontaneum]
 gb|ADC54293.1| alpha amylase [Hordeum vulgare subsp. spontaneum]
 gb|ADC54294.1| alpha amylase [Hordeum vulgare subsp. spontaneum]
 gb|ADC54295.1| alpha amylase [Hordeum vulgare subsp. spontaneum]
 gb|ADC54299.1| alpha amylase [Hordeum vulgare subsp. spontaneum]
 gb|ADC54300.1| alpha amylase [Hordeum vulgare subsp. spontaneum]
 gb|ADC54302.1| alpha amylase [Hordeum vulgare subsp. spontaneum]
 gb|ADC54303.1| alpha amylase [Hordeum vulgare subsp. spontaneum]
 gb|ADC54304.1| alpha amylase [Hordeum vulgare subsp. spontaneum]
 gb|ADC54305.1| alpha amylase [Hordeum vulgare subsp. spontaneum]
 gb|ADC54311.1| alpha amylase [Hordeum vulgare subsp. spontaneum]
 gb|ADC54312.1| alpha amylase [Hordeum vulgare subsp. spontaneum]
 gb|ADC54315.1| alpha amylase [Hordeum vulgare subsp. spontaneum]
 gb|ADC54317.1| alpha amylase [Hordeum vulgare subsp. spontaneum]
 gb|ADC54325.1| alpha amylase [Hordeum vulgare subsp. spontaneum]
 gb|ADC54335.1| alpha amylase [Hordeum vulgare subsp. spontaneum]
Length=414

 Score =   437 bits (1125),  Expect = 6e-146, Method: Compositional matrix adjust.
 Identities = 221/417 (53%), Positives = 293/417 (70%), Gaps = 20/417 (5%)
 Frame = +2

Query  113   VLFQGFTWTSKDQPGGWWNWLITKVPDLADAGITHVWLPPPSNAREGDDQGYMPKRMYDL  292
             VLFQGF W S  Q GGW+N ++ KV D+A AG+THVWLPPPS++    ++GYMP R+YD+
Sbjct  3     VLFQGFNWESWKQSGGWYNMMMGKVDDIAAAGVTHVWLPPPSHSVS--NEGYMPGRLYDI  60

Query  293   DTSKYGNKKELKALNDAFHGRGIKSVADIVLNHRAAERANSRGVFNVFEGGTPDDKLDWG  472
             D SKYGN  ELK+L  A HG+G++++ADIV+NHR A+  ++RG++ +FEGGT D +LDWG
Sbjct  61    DASKYGNAAELKSLIGALHGKGVQAIADIVINHRCADYKDNRGIYCIFEGGTSDGRLDWG  120

Query  473   PSEICGDDAAF-EGTGNPDTGDPWGDAPDIDHRSPRVQREISEWMNWLKSDVGFDGWRFD  649
             P  IC DD  + +GT N DTG  +  APDIDH + RVQRE+ EW+ WLKSD+GFD WR D
Sbjct  121   PHMICRDDTKYADGTANLDTGADFAAAPDIDHLNDRVQRELKEWLLWLKSDLGFDAWRLD  180

Query  650   YVKGYDFVKGFAAVKIYMDNTKPEFAVGELWNALSPGSVPNPDYNQDAHRNELVRWVQNa  829
             + +GY         K+Y+D T P  AV E+W+ ++ G    P+Y+QDAHR  LV WV   
Sbjct  181   FARGYSP----EMAKVYIDGTSPSLAVAEVWDNMATGGDGKPNYDQDAHRQNLVNWVDKV  236

Query  830   ggaatafdf---ttKGILQAALNNTELWRLKDAAGKPSGMIGVLPQSAVTFIDNHDTWS-  997
             GGAA+A      TTKGIL AA+   ELWRL D  GK  G++G  P  AVTF+DNHDT S 
Sbjct  237   GGAASAGMVFDFTTKGILNAAVEG-ELWRLIDPQGKAPGVMGWWPAKAVTFVDNHDTGST  295

Query  998   QRLWPFTTSTDDAVNHDRVLQGYAYILTHPGIPSVFYDHFFEWGLKDAISKLISIRNKNG  1177
             Q +WPF +        D+V+QGYAYILTHPG P +FYDHFF WG KD I+ L++IR +NG
Sbjct  296   QAMWPFPS--------DKVMQGYAYILTHPGTPCIFYDHFFNWGFKDEIAALVAIRKRNG  347

Query  1178  VSATSPVEILAADADLYIAKINGKVILKIGPNGDLKNLVPSDFMLATSGKDFAVWEK  1348
             ++ATS ++IL  + D Y+A+I+GKV++KIG   D+  ++P+ F  +  GKD+AVWEK
Sbjct  348   ITATSALKILMHEGDAYVAEIDGKVVVKIGTRYDVGAVIPAGFATSAHGKDYAVWEK  404



>gb|ADC54339.1| alpha amylase [Hordeum vulgare subsp. spontaneum]
Length=414

 Score =   437 bits (1125),  Expect = 7e-146, Method: Compositional matrix adjust.
 Identities = 221/417 (53%), Positives = 292/417 (70%), Gaps = 20/417 (5%)
 Frame = +2

Query  113   VLFQGFTWTSKDQPGGWWNWLITKVPDLADAGITHVWLPPPSNAREGDDQGYMPKRMYDL  292
             VLFQGF W S  Q GGW+N ++ KV D+A  G+THVWLPPPS++    ++GYMP R+YD+
Sbjct  3     VLFQGFNWESWKQSGGWYNMMMGKVDDIAAVGVTHVWLPPPSHSVS--NEGYMPGRLYDI  60

Query  293   DTSKYGNKKELKALNDAFHGRGIKSVADIVLNHRAAERANSRGVFNVFEGGTPDDKLDWG  472
             D SKYGN  ELK+L  A HG+G++++ADIV+NHR A+  +SRG++ +FEGGT D +LDWG
Sbjct  61    DASKYGNAAELKSLIGALHGKGVQAIADIVINHRCADYKDSRGIYCIFEGGTSDGRLDWG  120

Query  473   PSEICGDDAAF-EGTGNPDTGDPWGDAPDIDHRSPRVQREISEWMNWLKSDVGFDGWRFD  649
             P  IC DD  + +GT N DTG  +  APDIDH + RVQRE+ EW+ WLKSD+GFD WR D
Sbjct  121   PHMICRDDTKYSDGTANLDTGADFAAAPDIDHLNDRVQRELKEWLLWLKSDLGFDAWRLD  180

Query  650   YVKGYDFVKGFAAVKIYMDNTKPEFAVGELWNALSPGSVPNPDYNQDAHRNELVRWVQNa  829
             + +GY         K+Y+D T P  AV E+W+ ++ G    P+Y+QDAHR  LV WV   
Sbjct  181   FARGYSP----EMAKVYIDGTSPSLAVAEVWDNMATGGDGKPNYDQDAHRQNLVNWVDKV  236

Query  830   ggaatafdf---ttKGILQAALNNTELWRLKDAAGKPSGMIGVLPQSAVTFIDNHDTWS-  997
             GGAA+A      TTKGIL AA+   ELWRL D  GK  G++G  P  AVTF+DNHDT S 
Sbjct  237   GGAASAGMVFDFTTKGILNAAVEG-ELWRLIDPQGKAPGVMGWWPAKAVTFVDNHDTGST  295

Query  998   QRLWPFTTSTDDAVNHDRVLQGYAYILTHPGIPSVFYDHFFEWGLKDAISKLISIRNKNG  1177
             Q +WPF +        D+V+QGYAYILTHPG P +FYDHFF WG KD I+ L++IR +NG
Sbjct  296   QAMWPFPS--------DKVMQGYAYILTHPGTPCIFYDHFFNWGFKDEIAALVAIRKRNG  347

Query  1178  VSATSPVEILAADADLYIAKINGKVILKIGPNGDLKNLVPSDFMLATSGKDFAVWEK  1348
             ++ATS ++IL  + D Y+A+I+GKV++KIG   D+  ++P+ F  +  GKD+AVWEK
Sbjct  348   ITATSALKILMHEGDAYVAEIDGKVVVKIGTRYDVGAVIPAGFATSAHGKDYAVWEK  404



>gb|ADC54370.1| alpha amylase [Hordeum vulgare subsp. spontaneum]
Length=414

 Score =   437 bits (1125),  Expect = 7e-146, Method: Compositional matrix adjust.
 Identities = 220/417 (53%), Positives = 289/417 (69%), Gaps = 20/417 (5%)
 Frame = +2

Query  113   VLFQGFTWTSKDQPGGWWNWLITKVPDLADAGITHVWLPPPSNAREGDDQGYMPKRMYDL  292
             VLFQGF W S  Q GGW+N ++ KV D+A AG+THVWLPPPS++     +GYMP R+YD+
Sbjct  3     VLFQGFNWESWKQSGGWYNMMLGKVDDIAAAGVTHVWLPPPSHSVAA--EGYMPGRLYDI  60

Query  293   DTSKYGNKKELKALNDAFHGRGIKSVADIVLNHRAAERANSRGVFNVFEGGTPDDKLDWG  472
             D SKYGN  ELK+L  A HG+G++++ADIV+NHR A+  +SRG++ ++EGGT D +LDWG
Sbjct  61    DASKYGNAAELKSLIGALHGKGVQAIADIVINHRCADYRDSRGIYCIYEGGTSDSRLDWG  120

Query  473   PSEICGDDAAF-EGTGNPDTGDPWGDAPDIDHRSPRVQREISEWMNWLKSDVGFDGWRFD  649
             P  IC DD  + +GT N DTG  + DAPDIDH + RVQ E+ EW+ WLKSD+GFD WR D
Sbjct  121   PHMICRDDTKYSDGTANLDTGADYADAPDIDHLNHRVQSELKEWLLWLKSDLGFDAWRLD  180

Query  650   YVKGYDFVKGFAAVKIYMDNTKPEFAVGELWNALSPGSVPNPDYNQDAHRNELVRWVQNa  829
             + +GY         K+Y+D T P   V E+W+ + PG    P+Y+QDAHR  LV WV   
Sbjct  181   FARGYSA----EMAKVYIDGTSPSLVVAEIWDGMVPGGDGKPNYDQDAHRQNLVNWVDKV  236

Query  830   ggaatafdf---ttKGILQAALNNTELWRLKDAAGKPSGMIGVLPQSAVTFIDNHDTWS-  997
             GGAA+A      TTKGIL  A+   ELWRL D  GK  G++G  P  AVTFIDNHDT S 
Sbjct  237   GGAASAGMVFDFTTKGILNVAVEG-ELWRLIDPQGKAPGVMGWWPAKAVTFIDNHDTGST  295

Query  998   QRLWPFTTSTDDAVNHDRVLQGYAYILTHPGIPSVFYDHFFEWGLKDAISKLISIRNKNG  1177
             Q  WPF +        D+++QGYAYILTHPG P +FYDHFF WG KD I+ L++IR +NG
Sbjct  296   QAKWPFPS--------DKIMQGYAYILTHPGTPCIFYDHFFNWGFKDEIAALVAIRKRNG  347

Query  1178  VSATSPVEILAADADLYIAKINGKVILKIGPNGDLKNLVPSDFMLATSGKDFAVWEK  1348
             ++ATS ++IL  + D Y+A+I+GKV++KIG   D+  ++P+ F  +  GKD+AVWEK
Sbjct  348   ITATSALKILMHEGDAYVAEIDGKVVVKIGTRYDVGAVIPAGFATSAHGKDYAVWEK  404



>gb|ADC54322.1| alpha amylase [Hordeum vulgare subsp. spontaneum]
Length=414

 Score =   437 bits (1125),  Expect = 8e-146, Method: Compositional matrix adjust.
 Identities = 221/417 (53%), Positives = 292/417 (70%), Gaps = 20/417 (5%)
 Frame = +2

Query  113   VLFQGFTWTSKDQPGGWWNWLITKVPDLADAGITHVWLPPPSNAREGDDQGYMPKRMYDL  292
             VLFQGF W S  Q GGW+N ++ KV D+A AG+THVWLPPPS++    ++GYMP R+YD+
Sbjct  3     VLFQGFNWESWKQSGGWYNMMMGKVDDIAAAGVTHVWLPPPSHSVS--NEGYMPGRLYDI  60

Query  293   DTSKYGNKKELKALNDAFHGRGIKSVADIVLNHRAAERANSRGVFNVFEGGTPDDKLDWG  472
             D SKYGN  ELK+L  A HG+G++++ADIV+NHR A+  ++RG++ +FEGGT D +LDWG
Sbjct  61    DASKYGNAAELKSLIGALHGKGVQAIADIVINHRCADYTDNRGIYCIFEGGTSDGRLDWG  120

Query  473   PSEICGDDAAF-EGTGNPDTGDPWGDAPDIDHRSPRVQREISEWMNWLKSDVGFDGWRFD  649
             P  IC DD  + +GT N DTG  +  APDIDH   RVQRE+ EW+ WLKSD+GFD WR D
Sbjct  121   PHMICRDDTKYADGTANLDTGADFAAAPDIDHLDDRVQRELKEWLLWLKSDLGFDAWRLD  180

Query  650   YVKGYDFVKGFAAVKIYMDNTKPEFAVGELWNALSPGSVPNPDYNQDAHRNELVRWVQNa  829
             + +GY         K+Y+D T P  AV E+W+ ++ G    P+Y+QDAHR  LV WV   
Sbjct  181   FARGYSP----EMAKVYIDGTSPSLAVAEVWDNMATGGDGKPNYDQDAHRQNLVNWVDKV  236

Query  830   ggaatafdf---ttKGILQAALNNTELWRLKDAAGKPSGMIGVLPQSAVTFIDNHDTWS-  997
             GGAA+A      TTKGIL AA+   ELWRL D  GK  G++G  P  AVTF+DNHDT S 
Sbjct  237   GGAASAGMVFDFTTKGILNAAVEG-ELWRLIDPQGKAPGVMGWWPAKAVTFVDNHDTGST  295

Query  998   QRLWPFTTSTDDAVNHDRVLQGYAYILTHPGIPSVFYDHFFEWGLKDAISKLISIRNKNG  1177
             Q +WPF +        D+V+QGYAYILTHPG P +FYDHFF WG KD I+ L++IR +NG
Sbjct  296   QAMWPFPS--------DKVMQGYAYILTHPGTPCIFYDHFFNWGFKDEIAALVAIRKRNG  347

Query  1178  VSATSPVEILAADADLYIAKINGKVILKIGPNGDLKNLVPSDFMLATSGKDFAVWEK  1348
             ++ATS ++IL  + D Y+A+I+GKV++KIG   D+  ++P+ F  +  GKD+AVWEK
Sbjct  348   ITATSALKILMHEGDAYVAEIDGKVVVKIGTRYDVGAVIPAGFATSAHGKDYAVWEK  404



>sp|P00693.1|AMY1_HORVU RecName: Full=Alpha-amylase type A isozyme; AltName: Full=1,4-alpha-D-glucan 
glucanohydrolase; AltName: Full=AMY1; AltName: 
Full=Low pI alpha-amylase; Flags: Precursor [Hordeum vulgare]
 gb|AAA32929.1| alpha-amylase type A, EC 3.2.1.1 [Hordeum vulgare]
Length=438

 Score =   438 bits (1127),  Expect = 8e-146, Method: Compositional matrix adjust.
 Identities = 221/417 (53%), Positives = 293/417 (70%), Gaps = 20/417 (5%)
 Frame = +2

Query  113   VLFQGFTWTSKDQPGGWWNWLITKVPDLADAGITHVWLPPPSNAREGDDQGYMPKRMYDL  292
             VLFQGF W S  Q GGW+N ++ KV D+A AG+THVWLPPPS++    ++GYMP R+YD+
Sbjct  27    VLFQGFNWESWKQSGGWYNMMMGKVDDIAAAGVTHVWLPPPSHSVS--NEGYMPGRLYDI  84

Query  293   DTSKYGNKKELKALNDAFHGRGIKSVADIVLNHRAAERANSRGVFNVFEGGTPDDKLDWG  472
             D SKYGN  ELK+L  A HG+G++++ADIV+NHR A+  +SRG++ +FEGGT D +LDWG
Sbjct  85    DASKYGNAAELKSLIGALHGKGVQAIADIVINHRCADYKDSRGIYCIFEGGTSDGRLDWG  144

Query  473   PSEICGDDAAF-EGTGNPDTGDPWGDAPDIDHRSPRVQREISEWMNWLKSDVGFDGWRFD  649
             P  IC DD  + +GT N DTG  +  APDIDH + RVQRE+ EW+ WLKSD+GFD WR D
Sbjct  145   PHMICRDDTKYSDGTANLDTGADFAAAPDIDHLNDRVQRELKEWLLWLKSDLGFDAWRLD  204

Query  650   YVKGYDFVKGFAAVKIYMDNTKPEFAVGELWNALSPGSVPNPDYNQDAHRNELVRWVQNa  829
             + +GY         K+Y+D T P  AV E+W+ ++ G    P+Y+QDAHR  LV WV   
Sbjct  205   FARGYSP----EMAKVYIDGTSPSLAVAEVWDNMATGGDGKPNYDQDAHRQNLVNWVDKV  260

Query  830   ggaatafdf---ttKGILQAALNNTELWRLKDAAGKPSGMIGVLPQSAVTFIDNHDTWS-  997
             GGAA+A      TTKGIL AA+   ELWRL D  GK  G++G  P  A TF+DNHDT S 
Sbjct  261   GGAASAGMVFDFTTKGILNAAVEG-ELWRLIDPQGKAPGVMGWWPAKAATFVDNHDTGST  319

Query  998   QRLWPFTTSTDDAVNHDRVLQGYAYILTHPGIPSVFYDHFFEWGLKDAISKLISIRNKNG  1177
             Q +WPF +        D+V+QGYAYILTHPGIP +FYDHFF WG KD I+ L++IR +NG
Sbjct  320   QAMWPFPS--------DKVMQGYAYILTHPGIPCIFYDHFFNWGFKDQIAALVAIRKRNG  371

Query  1178  VSATSPVEILAADADLYIAKINGKVILKIGPNGDLKNLVPSDFMLATSGKDFAVWEK  1348
             ++ATS ++IL  + D Y+A+I+GKV++KIG   D+  ++P+ F+ +  G D+AVWEK
Sbjct  372   ITATSALKILMHEGDAYVAEIDGKVVVKIGSRYDVGAVIPAGFVTSAHGNDYAVWEK  428



>emb|CDY29753.1| BnaA01g19130D [Brassica napus]
Length=434

 Score =   438 bits (1126),  Expect = 8e-146, Method: Compositional matrix adjust.
 Identities = 225/413 (54%), Positives = 295/413 (71%), Gaps = 16/413 (4%)
 Frame = +2

Query  113   VLFQGFTWTSKDQPGGWWNWLITKVPDLADAGITHVWLPPPSNAREGDDQGYMPKRMYDL  292
             V  QGF W S  + GG++N L   + DL+++GITHVWLPPPS +     +GY+P ++YDL
Sbjct  36    VFEQGFKWESWMKEGGFYNSLHNSIDDLSNSGITHVWLPPPSQSVS--PEGYLPGKLYDL  93

Query  293   DTSKYGNKKELKALNDAFHGRGIKSVADIVLNHRAAERANSRGVFNVFEGGTPDDKLDWG  472
             ++SKYG++ ELK+L  A   +GIK+VADIV+NHR AER +    +  FEGGT DD+LDW 
Sbjct  94    NSSKYGSETELKSLIAALKQKGIKAVADIVINHRTAERKDDHCGYCYFEGGTSDDRLDWD  153

Query  473   PSEICGDDAAFEGTGNPDTGDPWGDAPDIDHRSPRVQREISEWMNWLKSDVGFDGWRFDY  652
             PS IC  D  + GTGNPDTG+ +  APDIDH +PRVQ+E+SEWMNWLKS++GF GWRFD+
Sbjct  154   PSFICRGDTNYAGTGNPDTGEDYKPAPDIDHLNPRVQKELSEWMNWLKSEIGFSGWRFDF  213

Query  653   VKGYDFVKGFAAVKIYMDNTKPEFAVGELWNALSPGSVPNPDYNQDAHRNELVRWVQNag  832
             V+GY      +  K Y+ NT P+FAVGE W+ +  G     +Y+Q+ HR+ L  W++  G
Sbjct  214   VRGY----AASVTKSYVQNTSPDFAVGEKWDDMKYGGDGKLEYDQEEHRSGLKHWIEEGG  269

Query  833   gaataf-dfttKGILQAALNNTELWRLKDAAGKPSGMIGVLPQSAVTFIDNHDTWSQRLW  1009
             G      DFTTKGILQ+A+   ELWRLKD+ GKP G+IG++P +AVTF+DNHDT     W
Sbjct  270   GGVLTAFDFTTKGILQSAVGG-ELWRLKDSQGKPPGLIGIMPGNAVTFVDNHDTIRPNSW  328

Query  1010  PFTTSTDDAVNHDRVLQGYAYILTHPGIPSVFYDHFFEWGLKDAISKLISIRNKNGVSAT  1189
              F +        D+VL GY YILTHPG P +FY H+ EWGLKD+ISKL++IRN+NG+ +T
Sbjct  329   AFPS--------DKVLLGYVYILTHPGTPCIFYSHYIEWGLKDSISKLVAIRNRNGIGST  380

Query  1190  SPVEILAADADLYIAKINGKVILKIGPNGDLKNLVPSDFMLATSGKDFAVWEK  1348
             S V I AA+A+LY+A I+ KVI+KIGP  D+  LVP +F+LA SG DFAVWEK
Sbjct  381   SSVMIKAAEAELYLAMIDEKVIMKIGPKLDIGTLVPPNFVLAYSGLDFAVWEK  433



>gb|ADC54283.1| alpha amylase [Hordeum vulgare subsp. spontaneum]
Length=414

 Score =   437 bits (1124),  Expect = 9e-146, Method: Compositional matrix adjust.
 Identities = 225/427 (53%), Positives = 298/427 (70%), Gaps = 21/427 (5%)
 Frame = +2

Query  113   VLFQGFTWTSKDQPGGWWNWLITKVPDLADAGITHVWLPPPSNAREGDDQGYMPKRMYDL  292
             VLFQGF W S  Q GGW+N ++ KV D+A AG+THVWLPPPS++    ++GYMP R+YD+
Sbjct  3     VLFQGFNWESWKQSGGWYNMMMGKVDDIAAAGVTHVWLPPPSHSVS--NEGYMPGRLYDI  60

Query  293   DTSKYGNKKELKALNDAFHGRGIKSVADIVLNHRAAERANSRGVFNVFEGGTPDDKLDWG  472
             D SKYGN  ELK+L  A HG+G++++ADIV+NHR A+  ++RG++ +FEGGT D +LDWG
Sbjct  61    DASKYGNAAELKSLIGALHGKGVQAIADIVINHRCADYKDNRGIYCIFEGGTSDGRLDWG  120

Query  473   PSEICGDDAAF-EGTGNPDTGDPWGDAPDIDHRSPRVQREISEWMNWLKSDVGFDGWRFD  649
             P  IC DD  + +GT N DTG  +  APDIDH + RVQRE+ EW+ WLKSD+GFD WR D
Sbjct  121   PHMICRDDTKYADGTANLDTGADFAAAPDIDHLNNRVQRELKEWLLWLKSDLGFDAWRLD  180

Query  650   YVKGYDFVKGFAAVKIYMDNTKPEFAVGELWNALSPGSVPNPDYNQDAHRNELVRWVQNa  829
             + +GY         K+Y+D T P  AV E+W+ ++ G    P+Y+QDAHR  LV WV   
Sbjct  181   FARGYSP----EMAKVYIDGTSPSLAVAEVWDNMATGGDGKPNYDQDAHRQNLVNWVDKV  236

Query  830   ggaatafdf---ttKGILQAALNNTELWRLKDAAGKPSGMIGVLPQSAVTFIDNHDTWS-  997
             GGAA+A      TTKGIL AA+   ELWRL D  GK  G++G  P  AVTF+DNHDT S 
Sbjct  237   GGAASAGMVFDFTTKGILNAAVEG-ELWRLIDPQGKAPGVMGWWPAKAVTFVDNHDTGST  295

Query  998   QRLWPFTTSTDDAVNHDRVLQGYAYILTHPGIPSVFYDHFFEWGLKDAISKLISIRNKNG  1177
             Q +WPF +        D+V+QGYAYILTHPG P +FYDHFF WG KD I+ L++IR +NG
Sbjct  296   QAMWPFPS--------DKVMQGYAYILTHPGTPCIFYDHFFNWGFKDEIAALVAIRKRNG  347

Query  1178  VSATSPVEILAADADLYIAKINGKVILKIGPNGDLKNLVPSDFMLATSGKDFAVWEK-PT  1354
             ++ATS ++IL  + D Y+A+I+GKV++KIG   D+  ++P+ F  +  GKD+AVWEK  T
Sbjct  348   ITATSALKILMHEGDAYVAEIDGKVVVKIGTRYDVGAVIPAGFATSAHGKDYAVWEKTAT  407

Query  1355  *SRLQIS  1375
              + LQ S
Sbjct  408   AATLQRS  414



>gb|ADC54308.1| alpha amylase [Hordeum vulgare subsp. spontaneum]
 gb|ADC54309.1| alpha amylase [Hordeum vulgare subsp. spontaneum]
 gb|ADC54310.1| alpha amylase [Hordeum vulgare subsp. spontaneum]
Length=414

 Score =   437 bits (1124),  Expect = 9e-146, Method: Compositional matrix adjust.
 Identities = 221/417 (53%), Positives = 293/417 (70%), Gaps = 20/417 (5%)
 Frame = +2

Query  113   VLFQGFTWTSKDQPGGWWNWLITKVPDLADAGITHVWLPPPSNAREGDDQGYMPKRMYDL  292
             VLFQGF W S  Q GGW+N ++ KV D+A AG+THVWLPPPS++    ++GYMP R+YD+
Sbjct  3     VLFQGFNWESWQQSGGWYNMMMGKVDDIAAAGVTHVWLPPPSHSVS--NEGYMPGRLYDI  60

Query  293   DTSKYGNKKELKALNDAFHGRGIKSVADIVLNHRAAERANSRGVFNVFEGGTPDDKLDWG  472
             D SKYGN  ELK+L  A HG+G++++ADIV+NHR A+  ++RG++ +FEGGT D +LDWG
Sbjct  61    DASKYGNAAELKSLIGALHGKGVQAIADIVINHRCADYKDNRGIYCIFEGGTSDGRLDWG  120

Query  473   PSEICGDDAAF-EGTGNPDTGDPWGDAPDIDHRSPRVQREISEWMNWLKSDVGFDGWRFD  649
             P  IC DD  + +GT N DTG  +  APDIDH + RVQRE+ EW+ WLKSD+GFD WR D
Sbjct  121   PHMICRDDTKYADGTANLDTGADFAAAPDIDHLNDRVQRELKEWLLWLKSDLGFDAWRLD  180

Query  650   YVKGYDFVKGFAAVKIYMDNTKPEFAVGELWNALSPGSVPNPDYNQDAHRNELVRWVQNa  829
             + +GY         K+Y+D T P  AV E+W+ ++ G    P+Y+QDAHR  LV WV   
Sbjct  181   FARGYSP----EMAKVYIDGTSPSLAVAEVWDNMATGGDGKPNYDQDAHRQNLVDWVDKV  236

Query  830   ggaatafdf---ttKGILQAALNNTELWRLKDAAGKPSGMIGVLPQSAVTFIDNHDTWS-  997
             GGAA+A      TTKGIL AA+   ELWRL D  GK  G++G  P  AVTF+DNHDT S 
Sbjct  237   GGAASAGMVFDFTTKGILNAAVEG-ELWRLIDPQGKAPGVMGWWPAKAVTFVDNHDTGST  295

Query  998   QRLWPFTTSTDDAVNHDRVLQGYAYILTHPGIPSVFYDHFFEWGLKDAISKLISIRNKNG  1177
             Q +WPF +        D+V+QGYAYILTHPG P +FYDHFF WG KD I+ L++IR +NG
Sbjct  296   QAMWPFPS--------DKVMQGYAYILTHPGTPCIFYDHFFNWGFKDEIAALVAIRKRNG  347

Query  1178  VSATSPVEILAADADLYIAKINGKVILKIGPNGDLKNLVPSDFMLATSGKDFAVWEK  1348
             ++ATS ++IL  + D Y+A+I+GKV++KIG   D+  ++P+ F  +  GKD+AVWEK
Sbjct  348   ITATSALKILMHEGDAYVAEIDGKVVVKIGTRYDVGAVIPAGFATSAHGKDYAVWEK  404



>ref|XP_004966428.1| PREDICTED: alpha-amylase type A isozyme-like [Setaria italica]
 ref|XP_004966429.1| PREDICTED: alpha-amylase type A isozyme-like [Setaria italica]
Length=436

 Score =   438 bits (1126),  Expect = 1e-145, Method: Compositional matrix adjust.
 Identities = 229/418 (55%), Positives = 290/418 (69%), Gaps = 21/418 (5%)
 Frame = +2

Query  113   VLFQGFTWTSKDQPGGWWNWLITKVPDLADAGITHVWLPPPSNAREGDDQGYMPKRMYDL  292
             VLFQGF W S  Q GGW+N L+ KV D+A AG+THVWLPPPS++     +GYMP R+YDL
Sbjct  25    VLFQGFNWESSKQTGGWYNNLMGKVDDIAAAGVTHVWLPPPSHSVS--SEGYMPGRLYDL  82

Query  293   DTSKYGNKKELKALNDAFHGRGIKSVADIVLNHRAAERANSRGVFNVFEGGTPDDKLDWG  472
             D SKYG   ELK+L  AFH +G+++VADIV+NHR A+  +SRG++ +FEGGTPD +LDW 
Sbjct  83    DASKYGTAAELKSLIAAFHDKGVQAVADIVINHRCADYKDSRGIYCIFEGGTPDSRLDWR  142

Query  473   PSEICGDDAAF-EGTGNPDTGDPWGDAPDIDHRSPRVQREISEWMNWLKSDVGFDGWRFD  649
                IC DDA + +GTGN DTG  +  APDIDH + RVQRE++EWM WLKSD+GFD WR D
Sbjct  143   AHMICRDDAKYSDGTGNLDTGADFPGAPDIDHLNDRVQRELTEWMLWLKSDLGFDAWRLD  202

Query  650   YVKGYDFVKGFAAVKIYMDNTKPEFAVGELWNALSP-GSVPNPDYNQDAHRNELVRWVQN  826
             + +GY         ++Y++ T P F V E+W+ + P G    P Y+QD HR  LV WV  
Sbjct  203   FARGYSA----EVARVYINGTAPSFVVAEIWDKMVPAGDDGKPAYDQDPHRQALVDWVDK  258

Query  827   aggaatafdf---ttKGILQAALNNTELWRLKDAAGKPSGMIGVLPQSAVTFIDNHDTWS  997
              GGAA+       TTKGIL AA+   ELWRL D  GK  G+IG  P  AVTF+DNHDT S
Sbjct  259   VGGAASPATVFDFTTKGILNAAVEG-ELWRLIDTEGKAPGVIGWWPAKAVTFVDNHDTGS  317

Query  998   -QRLWPFTTSTDDAVNHDRVLQGYAYILTHPGIPSVFYDHFFEWGLKDAISKLISIRNKN  1174
              Q  WPF         HD+V+QGYAYILTHPG P +FYDHFF+WG KD I+ L+++R +N
Sbjct  318   TQAQWPFP--------HDKVMQGYAYILTHPGNPCIFYDHFFDWGFKDEIAALVAVRKRN  369

Query  1175  GVSATSPVEILAADADLYIAKINGKVILKIGPNGDLKNLVPSDFMLATSGKDFAVWEK  1348
             G++ TS + IL  D D Y+A+I+GKVI+KIG   DL +L+P  F +AT GKD+AVWEK
Sbjct  370   GITPTSELTILEHDGDAYVAEIDGKVIVKIGSRYDLGHLIPVGFEVATHGKDYAVWEK  427



>gb|ADC54352.1| alpha amylase [Hordeum vulgare subsp. spontaneum]
Length=414

 Score =   437 bits (1124),  Expect = 1e-145, Method: Compositional matrix adjust.
 Identities = 221/417 (53%), Positives = 292/417 (70%), Gaps = 20/417 (5%)
 Frame = +2

Query  113   VLFQGFTWTSKDQPGGWWNWLITKVPDLADAGITHVWLPPPSNAREGDDQGYMPKRMYDL  292
             VLFQGF W S  Q GGW+N ++ KV D+A AG+THVWLPPPS++    ++GYMP R+YD+
Sbjct  3     VLFQGFNWESWKQSGGWYNMMMGKVDDIAAAGVTHVWLPPPSHSVS--NEGYMPGRLYDI  60

Query  293   DTSKYGNKKELKALNDAFHGRGIKSVADIVLNHRAAERANSRGVFNVFEGGTPDDKLDWG  472
             D SKYGN  ELK+L  A HG+G++++ADIV+NHR A+  +SRG++ +FEGGT D +LDWG
Sbjct  61    DASKYGNAAELKSLIGALHGKGVQAIADIVINHRCADYKDSRGIYCIFEGGTSDGRLDWG  120

Query  473   PSEICGDDAAF-EGTGNPDTGDPWGDAPDIDHRSPRVQREISEWMNWLKSDVGFDGWRFD  649
             P  IC DD  + +GT N DTG  +  APDIDH + RVQRE+ EW+ WLKSD+GFD WR D
Sbjct  121   PHMICRDDTKYSDGTANLDTGADFAAAPDIDHLNDRVQRELKEWLLWLKSDLGFDAWRLD  180

Query  650   YVKGYDFVKGFAAVKIYMDNTKPEFAVGELWNALSPGSVPNPDYNQDAHRNELVRWVQNa  829
             + +GY         K+Y+D T P  AV E+W+ ++ G    P+Y+QDAHR  LV WV   
Sbjct  181   FARGYSP----EMAKVYIDGTSPSLAVAEVWDNMATGGDGKPNYDQDAHRQNLVNWVDKV  236

Query  830   ggaatafdf---ttKGILQAALNNTELWRLKDAAGKPSGMIGVLPQSAVTFIDNHDTWS-  997
             GGAA+A      TTKGIL AA+   ELWRL D  GK  G++G  P  AVTF+DNHDT S 
Sbjct  237   GGAASAGMVFDFTTKGILNAAVEG-ELWRLIDPQGKAPGVMGWWPAKAVTFVDNHDTGST  295

Query  998   QRLWPFTTSTDDAVNHDRVLQGYAYILTHPGIPSVFYDHFFEWGLKDAISKLISIRNKNG  1177
             Q +WPF +        D+V+QGYAYILTHPG P +FY HFF WG KD I+ L++IR +NG
Sbjct  296   QAMWPFPS--------DKVMQGYAYILTHPGTPCIFYGHFFNWGFKDEIAALVAIRKRNG  347

Query  1178  VSATSPVEILAADADLYIAKINGKVILKIGPNGDLKNLVPSDFMLATSGKDFAVWEK  1348
             ++ATS ++IL  + D Y+A+I+GKV++KIG   D+  ++P+ F  +  GKD+AVWEK
Sbjct  348   ITATSALKILMHEGDAYVAEIDGKVVVKIGTRYDVGAVIPAGFATSAHGKDYAVWEK  404



>emb|CAA72144.1| alpha-amylase [Hordeum vulgare subsp. vulgare]
Length=437

 Score =   438 bits (1126),  Expect = 1e-145, Method: Compositional matrix adjust.
 Identities = 221/417 (53%), Positives = 292/417 (70%), Gaps = 20/417 (5%)
 Frame = +2

Query  113   VLFQGFTWTSKDQPGGWWNWLITKVPDLADAGITHVWLPPPSNAREGDDQGYMPKRMYDL  292
             VLFQGF W S  Q GGW+N ++ KV D+A AG+THVWLPPPS++    ++GYMP R+YD+
Sbjct  26    VLFQGFNWESWKQSGGWYNMMMGKVDDIAAAGVTHVWLPPPSHSVS--NEGYMPGRLYDI  83

Query  293   DTSKYGNKKELKALNDAFHGRGIKSVADIVLNHRAAERANSRGVFNVFEGGTPDDKLDWG  472
             D SKYGN  ELK+L  A HG+G++++ DIV+NHR A+  ++RG++ +FEGGT D +LDWG
Sbjct  84    DASKYGNAAELKSLIGALHGKGVQAITDIVINHRCADYKDNRGIYCIFEGGTSDGRLDWG  143

Query  473   PSEICGDDAAF-EGTGNPDTGDPWGDAPDIDHRSPRVQREISEWMNWLKSDVGFDGWRFD  649
             P  IC DD  + +GT N DTG  +  APDIDH + RVQRE+ EW+ WLKSD+GFD WR D
Sbjct  144   PHMICRDDTKYADGTANLDTGADFAAAPDIDHLNDRVQRELKEWLLWLKSDLGFDAWRLD  203

Query  650   YVKGYDFVKGFAAVKIYMDNTKPEFAVGELWNALSPGSVPNPDYNQDAHRNELVRWVQNa  829
             + +GY         K+Y+D T P  AV E+W+ ++ G    P+Y+QDAHR  LV WV   
Sbjct  204   FARGYSP----EMAKVYIDGTSPSLAVAEVWDNMATGGDGKPNYDQDAHRQNLVNWVDKV  259

Query  830   ggaatafdf---ttKGILQAALNNTELWRLKDAAGKPSGMIGVLPQSAVTFIDNHDTWS-  997
             GGAA+A      TTKGIL AA+   ELWRL D  GK  G++G  P  AVTF+DNHDT S 
Sbjct  260   GGAASAGMVFDFTTKGILNAAVEG-ELWRLIDPQGKAPGVMGWWPAKAVTFVDNHDTGST  318

Query  998   QRLWPFTTSTDDAVNHDRVLQGYAYILTHPGIPSVFYDHFFEWGLKDAISKLISIRNKNG  1177
             Q +WPF +        D+V+QGYAYILTHPG P +FYDHFF WG KD I+ L++IR +NG
Sbjct  319   QAMWPFPS--------DKVMQGYAYILTHPGTPCIFYDHFFNWGFKDEIAALVAIRKRNG  370

Query  1178  VSATSPVEILAADADLYIAKINGKVILKIGPNGDLKNLVPSDFMLATSGKDFAVWEK  1348
             ++ATS +EIL  + D Y+A+I+GKV++KIG   D+  ++P+ F  +  GKD+AVWEK
Sbjct  371   ITATSALEILMHEGDAYVAEIDGKVVVKIGTRYDVGAVIPAGFATSAHGKDYAVWEK  427



>gb|ADC54346.1| alpha amylase [Hordeum vulgare subsp. spontaneum]
Length=414

 Score =   437 bits (1123),  Expect = 1e-145, Method: Compositional matrix adjust.
 Identities = 221/417 (53%), Positives = 293/417 (70%), Gaps = 20/417 (5%)
 Frame = +2

Query  113   VLFQGFTWTSKDQPGGWWNWLITKVPDLADAGITHVWLPPPSNAREGDDQGYMPKRMYDL  292
             VLFQGF W S  Q GGW+N ++ KV D+A AG+THVWLPPPS++    ++GYMP R+YD+
Sbjct  3     VLFQGFNWESWKQSGGWYNMMMGKVDDIAAAGVTHVWLPPPSHSVS--NEGYMPGRLYDI  60

Query  293   DTSKYGNKKELKALNDAFHGRGIKSVADIVLNHRAAERANSRGVFNVFEGGTPDDKLDWG  472
             D SKYGN  ELK+L  A HG+G++++ADIV+NHR A+  ++RG++ +FEGGT D +LDWG
Sbjct  61    DASKYGNAAELKSLIGALHGKGVQAIADIVINHRCADYKDNRGIYCIFEGGTSDGRLDWG  120

Query  473   PSEICGDDAAF-EGTGNPDTGDPWGDAPDIDHRSPRVQREISEWMNWLKSDVGFDGWRFD  649
             P  IC DD  + +GT N DTG  +  APDIDH + RVQRE+ EW+ WLKSD+GFD WR D
Sbjct  121   PHMICRDDTKYADGTANLDTGADFAAAPDIDHLNDRVQRELKEWLLWLKSDLGFDAWRLD  180

Query  650   YVKGYDFVKGFAAVKIYMDNTKPEFAVGELWNALSPGSVPNPDYNQDAHRNELVRWVQNa  829
             + +GY         K+Y+D T P  AV E+W+ ++ G    P+Y+QDAHR  LV WV   
Sbjct  181   FARGYSP----EMAKVYIDGTSPSLAVAEVWDNMATGGDGKPNYDQDAHRQNLVNWVDKV  236

Query  830   ggaatafdf---ttKGILQAALNNTELWRLKDAAGKPSGMIGVLPQSAVTFIDNHDTWS-  997
             GGAA+A      TTKGIL AA+   ELWRL D  GK  G++G  P  AVTF+DNHDT S 
Sbjct  237   GGAASAGMVFDFTTKGILNAAVEG-ELWRLIDPQGKAPGVMGWWPAKAVTFVDNHDTGST  295

Query  998   QRLWPFTTSTDDAVNHDRVLQGYAYILTHPGIPSVFYDHFFEWGLKDAISKLISIRNKNG  1177
             Q +WPF +        D+V+QGYAYILTHPGIP +FYDHFF WG KD I+ L++IR +NG
Sbjct  296   QAMWPFPS--------DKVMQGYAYILTHPGIPCIFYDHFFNWGFKDQIAALVAIRKRNG  347

Query  1178  VSATSPVEILAADADLYIAKINGKVILKIGPNGDLKNLVPSDFMLATSGKDFAVWEK  1348
              +ATS ++IL  + D Y+A+I+GKV++KIG   D+  ++P+ F+ +  G D+AVWEK
Sbjct  348   TTATSALKILMHEGDAYVAEIDGKVVVKIGSRYDVGAVIPAGFVTSAHGNDYAVWEK  404



>gb|ADC54281.1| alpha amylase [Hordeum vulgare subsp. spontaneum]
Length=414

 Score =   437 bits (1123),  Expect = 1e-145, Method: Compositional matrix adjust.
 Identities = 225/427 (53%), Positives = 298/427 (70%), Gaps = 21/427 (5%)
 Frame = +2

Query  113   VLFQGFTWTSKDQPGGWWNWLITKVPDLADAGITHVWLPPPSNAREGDDQGYMPKRMYDL  292
             VLFQGF W S  Q GGW+N ++ KV D+A AG+THVWLPPPS++    ++GYMP R+YD+
Sbjct  3     VLFQGFNWESWKQSGGWYNMMMGKVDDIAAAGVTHVWLPPPSHSVS--NEGYMPGRLYDI  60

Query  293   DTSKYGNKKELKALNDAFHGRGIKSVADIVLNHRAAERANSRGVFNVFEGGTPDDKLDWG  472
             D SKYGN  ELK+L  A HG+G++++ADIV+NHR A+  ++RG++ +FEGGT D +LDWG
Sbjct  61    DASKYGNAAELKSLIGALHGKGVQAIADIVINHRCADYKDNRGIYCIFEGGTSDGRLDWG  120

Query  473   PSEICGDDAAF-EGTGNPDTGDPWGDAPDIDHRSPRVQREISEWMNWLKSDVGFDGWRFD  649
             P  IC DD  + +GT N DTG  +  APDIDH + RVQRE+ EW+ WLKSD+GFD WR D
Sbjct  121   PHMICRDDTKYADGTANLDTGADFAAAPDIDHLNDRVQRELKEWLLWLKSDLGFDAWRLD  180

Query  650   YVKGYDFVKGFAAVKIYMDNTKPEFAVGELWNALSPGSVPNPDYNQDAHRNELVRWVQNa  829
             + +GY         K+Y+D T P  AV E+W+ ++ G    P+Y+QDAHR  LV WV   
Sbjct  181   FARGYSP----EMAKVYIDGTSPSLAVAEVWDNMATGGDGKPNYDQDAHRQNLVNWVDKV  236

Query  830   ggaatafdf---ttKGILQAALNNTELWRLKDAAGKPSGMIGVLPQSAVTFIDNHDTWS-  997
             GGAA+A      TTKGIL AA+   ELWRL D  GK  G++G  P  AVTF+DNHDT S 
Sbjct  237   GGAASAGMVFDFTTKGILNAAVEG-ELWRLIDPQGKAPGVMGWWPAKAVTFVDNHDTGST  295

Query  998   QRLWPFTTSTDDAVNHDRVLQGYAYILTHPGIPSVFYDHFFEWGLKDAISKLISIRNKNG  1177
             Q +WPF +        D+V+QGYAYILTHPG P +FYDHFF WG KD I+ L++IR +NG
Sbjct  296   QAVWPFPS--------DKVMQGYAYILTHPGTPCIFYDHFFNWGFKDEIAALVAIRKRNG  347

Query  1178  VSATSPVEILAADADLYIAKINGKVILKIGPNGDLKNLVPSDFMLATSGKDFAVWEK-PT  1354
             ++ATS ++IL  + D Y+A+I+GKV++KIG   D+  ++P+ F  +  GKD+AVWEK  T
Sbjct  348   ITATSALKILMHEGDAYVAEIDGKVVVKIGTRYDVGAVIPAGFATSAHGKDYAVWEKTAT  407

Query  1355  *SRLQIS  1375
              + LQ S
Sbjct  408   AATLQRS  414



>gb|ADC54369.1| alpha amylase [Hordeum vulgare subsp. spontaneum]
Length=414

 Score =   437 bits (1123),  Expect = 1e-145, Method: Compositional matrix adjust.
 Identities = 221/417 (53%), Positives = 290/417 (70%), Gaps = 20/417 (5%)
 Frame = +2

Query  113   VLFQGFTWTSKDQPGGWWNWLITKVPDLADAGITHVWLPPPSNAREGDDQGYMPKRMYDL  292
             VLFQGF W S  Q GGW+N ++ KV D+A AG+THVWLPPPS++     +GYMP R+YD+
Sbjct  3     VLFQGFNWESWKQSGGWYNMMLGKVDDIAAAGVTHVWLPPPSHSVAA--EGYMPGRLYDI  60

Query  293   DTSKYGNKKELKALNDAFHGRGIKSVADIVLNHRAAERANSRGVFNVFEGGTPDDKLDWG  472
             D SKYGN  ELK+L  A HG+G++++ADIV+NHR A+  +SRG++ ++EGGT D +LDWG
Sbjct  61    DASKYGNAAELKSLIGALHGKGVQAIADIVINHRCADYKDSRGIYCIYEGGTSDSRLDWG  120

Query  473   PSEICGDDAAF-EGTGNPDTGDPWGDAPDIDHRSPRVQREISEWMNWLKSDVGFDGWRFD  649
             P  IC DD  + +GT N DTG  + DAPDIDH + RVQ E+ EW+ WLKSD+GFD WR D
Sbjct  121   PHMICRDDTKYSDGTANLDTGADYADAPDIDHLNHRVQSELKEWLLWLKSDLGFDAWRLD  180

Query  650   YVKGYDFVKGFAAVKIYMDNTKPEFAVGELWNALSPGSVPNPDYNQDAHRNELVRWVQNa  829
             + +GY         K+Y+D T P  AV E+W+ + PG    P+Y+QDAHR  LV WV   
Sbjct  181   FARGYSA----EMAKVYIDGTSPSLAVAEIWDGMVPGGDGKPNYDQDAHRQNLVNWVDKV  236

Query  830   ggaatafdf---ttKGILQAALNNTELWRLKDAAGKPSGMIGVLPQSAVTFIDNHDTWS-  997
             GGAA+A      TTKGIL  A+   ELWRL D  GK  G++G  P  AVTFIDNHDT S 
Sbjct  237   GGAASAGMVFDFTTKGILNVAVEG-ELWRLIDPQGKAPGVMGWWPAKAVTFIDNHDTGST  295

Query  998   QRLWPFTTSTDDAVNHDRVLQGYAYILTHPGIPSVFYDHFFEWGLKDAISKLISIRNKNG  1177
             Q  WPF +        D+++QGYAYILTHPGIP +FYDHFF  G KD I+ L++IR +NG
Sbjct  296   QAKWPFPS--------DKIMQGYAYILTHPGIPCIFYDHFFNLGFKDEIAALVAIRKRNG  347

Query  1178  VSATSPVEILAADADLYIAKINGKVILKIGPNGDLKNLVPSDFMLATSGKDFAVWEK  1348
             ++ATS ++IL  D D Y+A+I+ KV++KIG   D+  ++P+ F+ +  GKD+AVWEK
Sbjct  348   ITATSALKILMHDGDSYVAEIDSKVVVKIGSRYDVGAVIPAGFVTSAHGKDYAVWEK  404



>gb|ADO63831.1| alpha amylase [Brachypodium distachyon]
Length=447

 Score =   438 bits (1126),  Expect = 1e-145, Method: Compositional matrix adjust.
 Identities = 219/421 (52%), Positives = 289/421 (69%), Gaps = 20/421 (5%)
 Frame = +2

Query  101   SSSTVLFQGFTWTSKDQPGGWWNWLITKVPDLADAGITHVWLPPPSNAREGDDQGYMPKR  280
             S   VLFQGF W S  Q GGW+N L+ KV D+A AG+THVWLPPPS++    ++GYMP R
Sbjct  25    SGHQVLFQGFNWESWKQQGGWYNMLLGKVDDIAAAGVTHVWLPPPSHSVS--NEGYMPGR  82

Query  281   MYDLDTSKYGNKKELKALNDAFHGRGIKSVADIVLNHRAAERANSRGVFNVFEGGTPDDK  460
             +YD+D SKYG+  ELK+L  A HG+G++++AD+V+NHR A+  + RG++ +FEGGTPD +
Sbjct  83    LYDIDASKYGSASELKSLIGALHGKGVQAIADVVINHRCADYKDGRGIYCIFEGGTPDGR  142

Query  461   LDWGPSEICGDDAAF-EGTGNPDTGDPWGDAPDIDHRSPRVQREISEWMNWLKSDVGFDG  637
             LDWGP  IC DD A+ +GT N DTG  +  APDIDH + RVQRE++ W+ WLKSD+GFD 
Sbjct  143   LDWGPHMICRDDTAYGDGTANLDTGADFAAAPDIDHLNARVQRELTGWLLWLKSDLGFDA  202

Query  638   WRFDYVKGYDFVKGFAAVKIYMDNTKPEFAVGELWNALSPGSVPNPDYNQDAHRNELVRW  817
             WR D+ KGY         K+Y+D T+P  AV E+WN ++PG    P Y+QDAHR  LV W
Sbjct  203   WRLDFAKGYSP----EMAKVYIDGTEPSLAVAEVWNDMTPGGDGKPAYDQDAHRQALVNW  258

Query  818   VQNaggaatafdf---ttKGILQAALNNTELWRLKDAAGKPSGMIGVLPQSAVTFIDNHD  988
             V   GG  +A      TTKGIL  A+   ELWRL D  GK  G++G  P  AVTF+DNHD
Sbjct  259   VDRVGGKDSAGMVFDFTTKGILNVAVEG-ELWRLIDPQGKAPGVMGWWPAKAVTFVDNHD  317

Query  989   TWS-QRLWPFTTSTDDAVNHDRVLQGYAYILTHPGIPSVFYDHFFEWGLKDAISKLISIR  1165
             T S Q +WPF          D+V+ GYAYILTHPG P +FYDHFF WG K+ I+ L+++R
Sbjct  318   TGSTQAMWPFPA--------DKVMLGYAYILTHPGTPCIFYDHFFNWGFKEEIAALVAVR  369

Query  1166  NKNGVSATSPVEILAADADLYIAKINGKVILKIGPNGDLKNLVPSDFMLATSGKDFAVWE  1345
              +NG+ ATS + +L  D D Y+A+++GKV++KIG   D+  ++PS F+    GKD+AVWE
Sbjct  370   KRNGIRATSALRVLMHDGDAYVAEVDGKVVVKIGSRYDVAAVIPSGFVTTAHGKDYAVWE  429

Query  1346  K  1348
             K
Sbjct  430   K  430



>gb|ADC54367.1| alpha amylase [Hordeum vulgare subsp. spontaneum]
Length=414

 Score =   437 bits (1123),  Expect = 2e-145, Method: Compositional matrix adjust.
 Identities = 222/417 (53%), Positives = 293/417 (70%), Gaps = 20/417 (5%)
 Frame = +2

Query  113   VLFQGFTWTSKDQPGGWWNWLITKVPDLADAGITHVWLPPPSNAREGDDQGYMPKRMYDL  292
             VLFQGF W S  Q GGW+N ++ KV D+A AG+THVWLPPPS++    ++GYMP R+YD+
Sbjct  3     VLFQGFNWESWKQSGGWYNMMMGKVDDIAAAGVTHVWLPPPSHSVS--NEGYMPGRLYDI  60

Query  293   DTSKYGNKKELKALNDAFHGRGIKSVADIVLNHRAAERANSRGVFNVFEGGTPDDKLDWG  472
             D SKYGN  ELK+L  A HG+G++++ADIV+NHR A+  +SRG++ +FEGGT D +LDWG
Sbjct  61    DASKYGNAAELKSLIGALHGKGVQAIADIVINHRCADYKDSRGIYCIFEGGTSDGRLDWG  120

Query  473   PSEICGDDAAF-EGTGNPDTGDPWGDAPDIDHRSPRVQREISEWMNWLKSDVGFDGWRFD  649
             P  IC DD  + +GT N DTG  +  APDIDH + RVQRE+ EW+ WLKSD+GFD WR D
Sbjct  121   PHMICRDDTKYSDGTANLDTGADFAAAPDIDHLNDRVQRELKEWLLWLKSDLGFDAWRLD  180

Query  650   YVKGYDFVKGFAAVKIYMDNTKPEFAVGELWNALSPGSVPNPDYNQDAHRNELVRWVQNa  829
             + +GY         K+Y+D T P  AV E+W+ ++ G    P+Y+QDAHR  LV WV   
Sbjct  181   FARGYSP----EMAKVYIDGTSPSLAVAEVWDNMATGGDGKPNYDQDAHRQNLVNWVDKV  236

Query  830   ggaatafdf---ttKGILQAALNNTELWRLKDAAGKPSGMIGVLPQSAVTFIDNHDTWS-  997
             GGAA+A      TTKGIL AA+   ELWRL D  GK  G++G  P  AVTF+DNHDT S 
Sbjct  237   GGAASAGMVFDFTTKGILNAAVEG-ELWRLIDPQGKAPGVMGWWPAKAVTFVDNHDTGST  295

Query  998   QRLWPFTTSTDDAVNHDRVLQGYAYILTHPGIPSVFYDHFFEWGLKDAISKLISIRNKNG  1177
             Q +WPF +        D+V+QGYAYILTHPGIP +FYDHFF  G KD I+ L++IR +NG
Sbjct  296   QAMWPFPS--------DKVMQGYAYILTHPGIPCIFYDHFFNLGFKDEIAALVAIRKRNG  347

Query  1178  VSATSPVEILAADADLYIAKINGKVILKIGPNGDLKNLVPSDFMLATSGKDFAVWEK  1348
             ++ATS ++IL  D D Y+A+I+ KV++KIG   D+  ++P+ F+ +  GKD+AVWEK
Sbjct  348   ITATSALKILMHDGDSYVAEIDSKVVVKIGSRYDVGAVIPAGFVTSAHGKDYAVWEK  404



>gb|ADC54316.1| alpha amylase [Hordeum vulgare subsp. spontaneum]
Length=414

 Score =   437 bits (1123),  Expect = 2e-145, Method: Compositional matrix adjust.
 Identities = 220/417 (53%), Positives = 293/417 (70%), Gaps = 20/417 (5%)
 Frame = +2

Query  113   VLFQGFTWTSKDQPGGWWNWLITKVPDLADAGITHVWLPPPSNAREGDDQGYMPKRMYDL  292
             V+FQGF W S  Q GGW+N ++ KV D+A AG+THVWLPPPS++    ++GYMP R+YD+
Sbjct  3     VIFQGFNWESWKQSGGWYNMMMGKVDDIAAAGVTHVWLPPPSHSVS--NEGYMPGRLYDI  60

Query  293   DTSKYGNKKELKALNDAFHGRGIKSVADIVLNHRAAERANSRGVFNVFEGGTPDDKLDWG  472
             D SKYGN  ELK+L  A HG+G++++ADIV+NHR A+  ++RG++ +FEGGT D +LDWG
Sbjct  61    DASKYGNAAELKSLIGALHGKGVQAIADIVINHRCADYKDNRGIYCIFEGGTSDGRLDWG  120

Query  473   PSEICGDDAAF-EGTGNPDTGDPWGDAPDIDHRSPRVQREISEWMNWLKSDVGFDGWRFD  649
             P  IC DD  + +GT N DTG  +  APDIDH + RVQRE+ EW+ WLKSD+GFD WR D
Sbjct  121   PHMICRDDTKYADGTANLDTGADFAAAPDIDHLNDRVQRELKEWLLWLKSDLGFDAWRLD  180

Query  650   YVKGYDFVKGFAAVKIYMDNTKPEFAVGELWNALSPGSVPNPDYNQDAHRNELVRWVQNa  829
             + +GY         K+Y+D T P  AV E+W+ ++ G    P+Y+QDAHR  LV WV   
Sbjct  181   FARGYSP----EMAKVYIDGTSPSLAVAEVWDNMATGGDGKPNYDQDAHRQNLVNWVDKV  236

Query  830   ggaatafdf---ttKGILQAALNNTELWRLKDAAGKPSGMIGVLPQSAVTFIDNHDTWS-  997
             GGAA+A      TTKGIL AA+   ELWRL D  GK  G++G  P  AVTF+DNHDT S 
Sbjct  237   GGAASAGMVFDFTTKGILNAAVEG-ELWRLIDPQGKAPGVMGWWPAKAVTFVDNHDTGST  295

Query  998   QRLWPFTTSTDDAVNHDRVLQGYAYILTHPGIPSVFYDHFFEWGLKDAISKLISIRNKNG  1177
             Q +WPF +        D+V+QGYAYILTHPG P +FYDHFF WG KD I+ L++IR +NG
Sbjct  296   QAMWPFPS--------DKVMQGYAYILTHPGTPCIFYDHFFNWGFKDEIAALVAIRKRNG  347

Query  1178  VSATSPVEILAADADLYIAKINGKVILKIGPNGDLKNLVPSDFMLATSGKDFAVWEK  1348
             ++ATS ++IL  + D Y+A+I+GKV++KIG   D+  ++P+ F  +  GKD+AVWEK
Sbjct  348   ITATSALKILMHEGDAYVAEIDGKVVVKIGTRYDVGAVIPAGFATSAHGKDYAVWEK  404



>gb|ADC54363.1| alpha amylase [Hordeum vulgare subsp. spontaneum]
Length=414

 Score =   437 bits (1123),  Expect = 2e-145, Method: Compositional matrix adjust.
 Identities = 220/417 (53%), Positives = 292/417 (70%), Gaps = 20/417 (5%)
 Frame = +2

Query  113   VLFQGFTWTSKDQPGGWWNWLITKVPDLADAGITHVWLPPPSNAREGDDQGYMPKRMYDL  292
             VLFQGF W S  Q GGW+N ++ KV D+A  G+THVWLPPPS++    ++GYMP R+YD+
Sbjct  3     VLFQGFNWESWKQSGGWYNMMMGKVDDIAAVGVTHVWLPPPSHSVS--NEGYMPGRLYDI  60

Query  293   DTSKYGNKKELKALNDAFHGRGIKSVADIVLNHRAAERANSRGVFNVFEGGTPDDKLDWG  472
             D SKYGN  ELK+L  A HG+G++++ADIV+NHR A+  +SRG++ +FEGGT D +LDWG
Sbjct  61    DASKYGNAAELKSLIGALHGKGVQAIADIVINHRCADYKDSRGIYCIFEGGTSDGRLDWG  120

Query  473   PSEICGDDAAF-EGTGNPDTGDPWGDAPDIDHRSPRVQREISEWMNWLKSDVGFDGWRFD  649
             P  IC DD  + +GT N DTG  +  APDIDH + RVQRE+ EW+ WLKSD+GFD WR D
Sbjct  121   PHMICRDDTKYSDGTANLDTGADFAAAPDIDHLNDRVQRELKEWLLWLKSDLGFDAWRLD  180

Query  650   YVKGYDFVKGFAAVKIYMDNTKPEFAVGELWNALSPGSVPNPDYNQDAHRNELVRWVQNa  829
             + +GY         K+Y+D T P  AV E+W+ ++ G    P+Y+QDAHR  LV WV   
Sbjct  181   FARGYSP----EMAKVYIDGTSPSLAVAEVWDNMATGGDGKPNYDQDAHRQNLVNWVDKV  236

Query  830   ggaatafdf---ttKGILQAALNNTELWRLKDAAGKPSGMIGVLPQSAVTFIDNHDTWS-  997
             GGAA+A      TTKGIL AA+   ELWRL D  GK  G++G  P  A TF+DNHDT S 
Sbjct  237   GGAASAGMVFDFTTKGILNAAVEG-ELWRLIDPQGKAPGVMGWWPAKAATFVDNHDTGST  295

Query  998   QRLWPFTTSTDDAVNHDRVLQGYAYILTHPGIPSVFYDHFFEWGLKDAISKLISIRNKNG  1177
             Q +WPF +        D+V+QGYAYILTHPGIP +FYDHFF WG KD I+ L++IR +NG
Sbjct  296   QAMWPFPS--------DKVMQGYAYILTHPGIPCIFYDHFFNWGFKDQIAALVAIRKRNG  347

Query  1178  VSATSPVEILAADADLYIAKINGKVILKIGPNGDLKNLVPSDFMLATSGKDFAVWEK  1348
             ++ATS ++IL  + D Y+A+I+GKV++KIG   D+  ++P+ F+ +  G D+AVWEK
Sbjct  348   ITATSALKILMHEGDAYVAEIDGKVVVKIGSRYDVGAVIPAGFVTSAHGNDYAVWEK  404



>pdb|1RP8|A Chain A, Crystal Structure Of Barley Alpha-Amylase Isozyme 1 
(Amy1) Inactive Mutant D180a In Complex With Maltoheptaose
 pdb|1RP9|A Chain A, Crystal Structure Of Barley Alpha-amylase Isozyme 1 
(amy1) Inactive Mutant D180a In Complex With Acarbose
Length=405

 Score =   436 bits (1122),  Expect = 2e-145, Method: Compositional matrix adjust.
 Identities = 221/417 (53%), Positives = 293/417 (70%), Gaps = 20/417 (5%)
 Frame = +2

Query  113   VLFQGFTWTSKDQPGGWWNWLITKVPDLADAGITHVWLPPPSNAREGDDQGYMPKRMYDL  292
             VLFQGF W S  Q GGW+N ++ KV D+A AG+THVWLPPPS++    ++GYMP R+YD+
Sbjct  3     VLFQGFNWESWKQSGGWYNMMMGKVDDIAAAGVTHVWLPPPSHSVS--NEGYMPGRLYDI  60

Query  293   DTSKYGNKKELKALNDAFHGRGIKSVADIVLNHRAAERANSRGVFNVFEGGTPDDKLDWG  472
             D SKYGN  ELK+L  A HG+G++++ADIV+NHR A+  +SRG++ +FEGGT D +LDWG
Sbjct  61    DASKYGNAAELKSLIGALHGKGVQAIADIVINHRCADYKDSRGIYCIFEGGTSDGRLDWG  120

Query  473   PSEICGDDAAF-EGTGNPDTGDPWGDAPDIDHRSPRVQREISEWMNWLKSDVGFDGWRFD  649
             P  IC DD  + +GT N DTG  +  APDIDH + RVQRE+ EW+ WLKSD+GFD WR  
Sbjct  121   PHMICRDDTKYSDGTANLDTGADFAAAPDIDHLNDRVQRELKEWLLWLKSDLGFDAWRLA  180

Query  650   YVKGYDFVKGFAAVKIYMDNTKPEFAVGELWNALSPGSVPNPDYNQDAHRNELVRWVQNa  829
             + +GY         K+Y+D T P  AV E+W+ ++ G    P+Y+QDAHR  LV WV   
Sbjct  181   FARGYSP----EMAKVYIDGTSPSLAVAEVWDNMATGGDGKPNYDQDAHRQNLVNWVDKV  236

Query  830   ggaatafdf---ttKGILQAALNNTELWRLKDAAGKPSGMIGVLPQSAVTFIDNHDTWS-  997
             GGAA+A      TTKGIL AA+   ELWRL D  GK  G++G  P  AVTF+DNHDT S 
Sbjct  237   GGAASAGMVFDFTTKGILNAAVEG-ELWRLIDPQGKAPGVMGWWPAKAVTFVDNHDTGST  295

Query  998   QRLWPFTTSTDDAVNHDRVLQGYAYILTHPGIPSVFYDHFFEWGLKDAISKLISIRNKNG  1177
             Q +WPF +        D+V+QGYAYILTHPGIP +FYDHFF WG KD I+ L++IR +NG
Sbjct  296   QAMWPFPS--------DKVMQGYAYILTHPGIPCIFYDHFFNWGFKDQIAALVAIRKRNG  347

Query  1178  VSATSPVEILAADADLYIAKINGKVILKIGPNGDLKNLVPSDFMLATSGKDFAVWEK  1348
             ++ATS ++IL  + D Y+A+I+GKV++KIG   D+  ++P+ F+ +  G D+AVWEK
Sbjct  348   ITATSALKILMHEGDAYVAEIDGKVVVKIGSRYDVGAVIPAGFVTSAHGNDYAVWEK  404



>gb|ADC54324.1| alpha amylase [Hordeum vulgare subsp. spontaneum]
Length=414

 Score =   436 bits (1122),  Expect = 2e-145, Method: Compositional matrix adjust.
 Identities = 221/417 (53%), Positives = 292/417 (70%), Gaps = 20/417 (5%)
 Frame = +2

Query  113   VLFQGFTWTSKDQPGGWWNWLITKVPDLADAGITHVWLPPPSNAREGDDQGYMPKRMYDL  292
             VLFQGF W S  Q GGW+N ++ KV D+A AG+THVWLPPPS++    ++GYMP R+YD+
Sbjct  3     VLFQGFNWESWKQSGGWYNMMMGKVDDIAAAGVTHVWLPPPSHSVS--NEGYMPGRLYDI  60

Query  293   DTSKYGNKKELKALNDAFHGRGIKSVADIVLNHRAAERANSRGVFNVFEGGTPDDKLDWG  472
             D SKYGN  ELK+L  A HG+G++++ADIV+NHR A+  ++RG++ +FEGGT D +LDWG
Sbjct  61    DASKYGNAAELKSLIGALHGKGVQAIADIVINHRCADYKDNRGIYCIFEGGTSDGRLDWG  120

Query  473   PSEICGDDAAF-EGTGNPDTGDPWGDAPDIDHRSPRVQREISEWMNWLKSDVGFDGWRFD  649
             P  IC DD  + +GT N DTG  +  APDIDH + RVQRE+ EW+ WLKSD+GFD WR D
Sbjct  121   PHMICVDDTKYADGTANLDTGADFAAAPDIDHLNDRVQRELKEWLLWLKSDLGFDAWRLD  180

Query  650   YVKGYDFVKGFAAVKIYMDNTKPEFAVGELWNALSPGSVPNPDYNQDAHRNELVRWVQNa  829
             + +GY         K+Y+D T P  AV E+W+ ++ G    P+Y+QDAHR  LV WV   
Sbjct  181   FARGYSP----EMAKVYIDGTSPSLAVAEVWDNMATGGDGKPNYDQDAHRQNLVNWVDKV  236

Query  830   ggaatafdf---ttKGILQAALNNTELWRLKDAAGKPSGMIGVLPQSAVTFIDNHDTWS-  997
             GGAA+A      TTKGIL AA+   ELWRL D  GK  G++G  P  AVTF+DNHDT S 
Sbjct  237   GGAASAGMVFDFTTKGILNAAVEG-ELWRLIDPQGKAPGVMGWWPAKAVTFVDNHDTGST  295

Query  998   QRLWPFTTSTDDAVNHDRVLQGYAYILTHPGIPSVFYDHFFEWGLKDAISKLISIRNKNG  1177
             Q +WPF +        D+V+QGYAYILTHPG P +FYDHFF WG KD I+ L++IR +NG
Sbjct  296   QAMWPFPS--------DKVMQGYAYILTHPGTPCIFYDHFFNWGFKDEIAALVAIRKRNG  347

Query  1178  VSATSPVEILAADADLYIAKINGKVILKIGPNGDLKNLVPSDFMLATSGKDFAVWEK  1348
             ++ATS ++IL  + D Y+A+I+GKV++KIG   D+  ++P  F  +  GKD+AVWEK
Sbjct  348   ITATSALKILMHEGDAYVAEIDGKVVVKIGTRYDVGAVIPDGFATSAHGKDYAVWEK  404



>gb|ADC54318.1| alpha amylase [Hordeum vulgare subsp. spontaneum]
Length=414

 Score =   436 bits (1122),  Expect = 2e-145, Method: Compositional matrix adjust.
 Identities = 221/417 (53%), Positives = 292/417 (70%), Gaps = 20/417 (5%)
 Frame = +2

Query  113   VLFQGFTWTSKDQPGGWWNWLITKVPDLADAGITHVWLPPPSNAREGDDQGYMPKRMYDL  292
             VLFQGF W S  Q GGW+N ++ KV D+A AG+THVWLPPPS++    ++GYMP R+YD+
Sbjct  3     VLFQGFNWESWKQSGGWYNMMMGKVDDIAAAGVTHVWLPPPSHSVS--NEGYMPGRLYDI  60

Query  293   DTSKYGNKKELKALNDAFHGRGIKSVADIVLNHRAAERANSRGVFNVFEGGTPDDKLDWG  472
             D SKYGN  ELK+L  A HG+G++++ADIV+NHR A+  ++RG++ +FEGGT D +LDWG
Sbjct  61    DASKYGNAAELKSLIGALHGKGVQAIADIVINHRCADYKDNRGIYCIFEGGTSDGRLDWG  120

Query  473   PSEICGDDAAF-EGTGNPDTGDPWGDAPDIDHRSPRVQREISEWMNWLKSDVGFDGWRFD  649
             P  IC DD  + +GT N DTG  +  APDIDH + RVQRE+ EW+ WLKSD+GFD WR D
Sbjct  121   PHMICRDDTKYADGTANLDTGADFAAAPDIDHLNDRVQRELKEWLLWLKSDLGFDAWRLD  180

Query  650   YVKGYDFVKGFAAVKIYMDNTKPEFAVGELWNALSPGSVPNPDYNQDAHRNELVRWVQNa  829
             +  GY         K+Y+D T P  AV E+W+ ++ G    P+Y+QDAHR  LV WV   
Sbjct  181   FAGGYSP----EMAKVYIDGTSPSLAVAEVWDNMATGGDGKPNYDQDAHRQNLVNWVDKV  236

Query  830   ggaatafdf---ttKGILQAALNNTELWRLKDAAGKPSGMIGVLPQSAVTFIDNHDTWS-  997
             GGAA+A      TTKGIL AA+   ELWRL D  GK  G++G  P  AVTF+DNHDT S 
Sbjct  237   GGAASAGMVFDFTTKGILNAAVEG-ELWRLIDPRGKAPGVMGWWPAKAVTFVDNHDTGST  295

Query  998   QRLWPFTTSTDDAVNHDRVLQGYAYILTHPGIPSVFYDHFFEWGLKDAISKLISIRNKNG  1177
             Q +WPF +        D+V+QGYAYILTHPG P +FYDHFF WG KD I+ L++IR +NG
Sbjct  296   QAMWPFPS--------DKVMQGYAYILTHPGTPCIFYDHFFNWGFKDEIAALVAIRKRNG  347

Query  1178  VSATSPVEILAADADLYIAKINGKVILKIGPNGDLKNLVPSDFMLATSGKDFAVWEK  1348
             ++ATS ++IL  + D Y+A+I+GKV++KIG   D+  ++P+ F  +  GKD+AVWEK
Sbjct  348   ITATSALKILMHEGDAYVAEIDGKVVVKIGTRYDVGAVIPAGFATSAHGKDYAVWEK  404



>gb|ADC54296.1| alpha amylase [Hordeum vulgare subsp. spontaneum]
 gb|ADC54297.1| alpha amylase [Hordeum vulgare subsp. spontaneum]
 gb|ADC54298.1| alpha amylase [Hordeum vulgare subsp. spontaneum]
Length=414

 Score =   436 bits (1122),  Expect = 2e-145, Method: Compositional matrix adjust.
 Identities = 220/417 (53%), Positives = 293/417 (70%), Gaps = 20/417 (5%)
 Frame = +2

Query  113   VLFQGFTWTSKDQPGGWWNWLITKVPDLADAGITHVWLPPPSNAREGDDQGYMPKRMYDL  292
             VLFQGF W S  Q GGW+N ++ KV D+A AG+THVWLPPPS++    ++GYMP R+YD+
Sbjct  3     VLFQGFNWESWKQSGGWYNMMMGKVDDIAAAGVTHVWLPPPSHSVS--NEGYMPGRLYDI  60

Query  293   DTSKYGNKKELKALNDAFHGRGIKSVADIVLNHRAAERANSRGVFNVFEGGTPDDKLDWG  472
             D SKYGN  ELK+L  A HG+G++++ADIV+NHR A+  ++RG++ +FEGGT D +LDWG
Sbjct  61    DASKYGNAAELKSLIGALHGKGVQAIADIVINHRCADYKDNRGIYCIFEGGTSDGRLDWG  120

Query  473   PSEICGDDAAF-EGTGNPDTGDPWGDAPDIDHRSPRVQREISEWMNWLKSDVGFDGWRFD  649
             P  IC DD  + +GT N DTG  +  APDIDH + RVQRE+ EW+ WLKSD+GFD WR D
Sbjct  121   PHMICRDDTKYADGTANLDTGADFAAAPDIDHLNDRVQRELKEWLLWLKSDLGFDAWRLD  180

Query  650   YVKGYDFVKGFAAVKIYMDNTKPEFAVGELWNALSPGSVPNPDYNQDAHRNELVRWVQNa  829
             + +GY         K+Y+D T P  AV E+W+ ++ G    P+Y+QDAHR  LV WV   
Sbjct  181   FARGYSP----EMAKVYIDGTSPSLAVAEVWDNMATGGDGKPNYDQDAHRQNLVNWVDKV  236

Query  830   ggaatafdf---ttKGILQAALNNTELWRLKDAAGKPSGMIGVLPQSAVTFIDNHDTWS-  997
             GGAA+A      TTKGIL AA+   ELWRL D  GK  G++G  P  AVTF+DNHDT S 
Sbjct  237   GGAASAGMVFDFTTKGILNAAVEG-ELWRLIDPQGKAPGVMGWWPAKAVTFVDNHDTGST  295

Query  998   QRLWPFTTSTDDAVNHDRVLQGYAYILTHPGIPSVFYDHFFEWGLKDAISKLISIRNKNG  1177
             Q +WPF +        D+V+QGYAYILTHPG P +FYDHFF WG KD I+ L++IR +NG
Sbjct  296   QAMWPFPS--------DKVMQGYAYILTHPGTPCIFYDHFFNWGFKDEIAALVAIRKRNG  347

Query  1178  VSATSPVEILAADADLYIAKINGKVILKIGPNGDLKNLVPSDFMLATSGKDFAVWEK  1348
             ++ATS ++IL  + D Y+A+I+GKV+++IG   D+  ++P+ F  +  GKD+AVWEK
Sbjct  348   ITATSALKILMHEGDAYVAEIDGKVVVEIGTRYDVGAVIPAGFATSAHGKDYAVWEK  404



>ref|XP_004965680.1| PREDICTED: alpha-amylase type A isozyme-like [Setaria italica]
Length=432

 Score =   437 bits (1124),  Expect = 2e-145, Method: Compositional matrix adjust.
 Identities = 223/417 (53%), Positives = 289/417 (69%), Gaps = 20/417 (5%)
 Frame = +2

Query  113   VLFQGFTWTSKDQPGGWWNWLITKVPDLADAGITHVWLPPPSNAREGDDQGYMPKRMYDL  292
             VLFQ F W S  Q GGW+N L+ KV D+A AG+THVWLPPP+++     QGYMP R+YDL
Sbjct  22    VLFQAFNWESWKQSGGWYNLLMGKVDDIAAAGVTHVWLPPPAHSVSA--QGYMPGRLYDL  79

Query  293   DTSKYGNKKELKALNDAFHGRGIKSVADIVLNHRAAERANSRGVFNVFEGGTPDDKLDWG  472
             D SKYG   EL++L  AFHG+G+++VADIV+NHR A+  +SRG++ VFEGGT D +LDWG
Sbjct  80    DASKYGTAAELRSLIAAFHGKGVQAVADIVINHRCADYKDSRGIYCVFEGGTNDSRLDWG  139

Query  473   PSEICGDDAAF-EGTGNPDTGDPWGDAPDIDHRSPRVQREISEWMNWLKSDVGFDGWRFD  649
             P  IC DD  + +GTGN DTG  +  APDIDH + RVQRE++EW+ WL+SD+GFD WR D
Sbjct  140   PHMICRDDTQYSDGTGNLDTGASFAAAPDIDHLNDRVQRELAEWLLWLRSDLGFDAWRLD  199

Query  650   YVKGYDFVKGFAAVKIYMDNTKPEFAVGELWNALSPGSVPNPDYNQDAHRNELVRWVQNa  829
             + KGY         + Y+D T P FAV E+W+ ++ G    P+Y+QD HR  LV WV   
Sbjct  200   FAKGYSA----EVARAYIDATAPSFAVAEIWSDMAYGGDGKPEYDQDPHRQALVDWVDKV  255

Query  830   ggaatafdf---ttKGILQAALNNTELWRLKDAAGKPSGMIGVLPQSAVTFIDNHDTWS-  997
             GGAA+       TTKGIL AA+   ELWRL D  GK  G+IG  P  AVTF+DNHDT S 
Sbjct  256   GGAASPATVFDFTTKGILNAAVEG-ELWRLIDPRGKAPGVIGWWPAKAVTFVDNHDTGST  314

Query  998   QRLWPFTTSTDDAVNHDRVLQGYAYILTHPGIPSVFYDHFFEWGLKDAISKLISIRNKNG  1177
             Q +WPF +        D+V+QGYAYILTHPG P +FYDHFF+WG KD I+ L+++R +NG
Sbjct  315   QAVWPFPS--------DKVMQGYAYILTHPGNPCIFYDHFFDWGFKDEIAALMAVRKRNG  366

Query  1178  VSATSPVEILAADADLYIAKINGKVILKIGPNGDLKNLVPSDFMLATSGKDFAVWEK  1348
             ++ATS + IL  D D Y+A+I+GKVI+KIG   D+   +P+ + +   G D+AVWEK
Sbjct  367   ITATSELTILVYDGDAYVAEIDGKVIMKIGSRYDVSAFIPAGYQVVAHGNDYAVWEK  423



>gb|ADC54323.1| alpha amylase [Hordeum vulgare subsp. spontaneum]
Length=414

 Score =   436 bits (1122),  Expect = 2e-145, Method: Compositional matrix adjust.
 Identities = 220/417 (53%), Positives = 292/417 (70%), Gaps = 20/417 (5%)
 Frame = +2

Query  113   VLFQGFTWTSKDQPGGWWNWLITKVPDLADAGITHVWLPPPSNAREGDDQGYMPKRMYDL  292
             VLFQGF W S  Q GGW+N ++ KV D+A  G+THVWLPPPS++    ++GYMP R+YD+
Sbjct  3     VLFQGFNWESWKQSGGWYNMMMGKVDDIAAVGVTHVWLPPPSHSVS--NEGYMPGRLYDI  60

Query  293   DTSKYGNKKELKALNDAFHGRGIKSVADIVLNHRAAERANSRGVFNVFEGGTPDDKLDWG  472
             D SKYGN  ELK+L  A HG+G++++ADIV+NHR A+  ++RG++ +FEGGT D +LDWG
Sbjct  61    DASKYGNAAELKSLIGALHGKGVQAIADIVINHRCADYKDNRGIYCIFEGGTSDGRLDWG  120

Query  473   PSEICGDDAAF-EGTGNPDTGDPWGDAPDIDHRSPRVQREISEWMNWLKSDVGFDGWRFD  649
             P  IC DD  + +GT N DTG  +  APDIDH + RVQRE+ EW+ WLKSD+GFD WR D
Sbjct  121   PHMICRDDTKYADGTANLDTGADFAAAPDIDHLNDRVQRELKEWLLWLKSDLGFDAWRLD  180

Query  650   YVKGYDFVKGFAAVKIYMDNTKPEFAVGELWNALSPGSVPNPDYNQDAHRNELVRWVQNa  829
             + +GY         K+Y+D T P  AV E+W+ ++ G    P+Y+QDAHR  LV WV   
Sbjct  181   FARGYSP----EMAKVYIDGTSPSLAVAEVWDNMATGGDGKPNYDQDAHRQNLVNWVDKV  236

Query  830   ggaatafdf---ttKGILQAALNNTELWRLKDAAGKPSGMIGVLPQSAVTFIDNHDTWS-  997
             GGAA+A      TTKGIL AA+   ELWRL D  GK  G++G  P  AVTF+DNHDT S 
Sbjct  237   GGAASAGMVFDFTTKGILNAAVEG-ELWRLIDPQGKAPGVMGWWPAKAVTFVDNHDTGST  295

Query  998   QRLWPFTTSTDDAVNHDRVLQGYAYILTHPGIPSVFYDHFFEWGLKDAISKLISIRNKNG  1177
             Q +WPF +        D+V+QGYAYILTHPG P +FYDHFF WG KD I+ L++IR +NG
Sbjct  296   QAMWPFPS--------DKVMQGYAYILTHPGTPCIFYDHFFNWGFKDEIAALVAIRKRNG  347

Query  1178  VSATSPVEILAADADLYIAKINGKVILKIGPNGDLKNLVPSDFMLATSGKDFAVWEK  1348
             ++ATS ++IL  + D Y+A+I+GKV++KIG   D+  ++P+ F  +  GKD+AVWEK
Sbjct  348   ITATSALKILMHEGDAYVAEIDGKVVVKIGTRYDVGAVIPAGFATSAHGKDYAVWEK  404



>gb|ADC54337.1| alpha amylase [Hordeum vulgare subsp. spontaneum]
Length=414

 Score =   436 bits (1122),  Expect = 2e-145, Method: Compositional matrix adjust.
 Identities = 224/427 (52%), Positives = 297/427 (70%), Gaps = 21/427 (5%)
 Frame = +2

Query  113   VLFQGFTWTSKDQPGGWWNWLITKVPDLADAGITHVWLPPPSNAREGDDQGYMPKRMYDL  292
             VLFQGF W S  Q GGW+N ++ KV D+A  G+THVWLPPPS++    ++GYMP R+YD+
Sbjct  3     VLFQGFNWESWKQSGGWYNMMMGKVDDIAAVGVTHVWLPPPSHSVS--NEGYMPGRLYDI  60

Query  293   DTSKYGNKKELKALNDAFHGRGIKSVADIVLNHRAAERANSRGVFNVFEGGTPDDKLDWG  472
             D SKYGN  ELK+L  A HG+G++++ADIV+NHR A+  ++RG++ +FEGGT D +LDWG
Sbjct  61    DASKYGNAAELKSLIGALHGKGVQAIADIVINHRCADYKDNRGIYCIFEGGTSDGRLDWG  120

Query  473   PSEICGDDAAF-EGTGNPDTGDPWGDAPDIDHRSPRVQREISEWMNWLKSDVGFDGWRFD  649
             P  IC DD  + +GT N DTG  +  APDIDH + RVQRE+ EW+ WLKSD+GFD WR D
Sbjct  121   PHMICRDDTKYADGTANLDTGADFAAAPDIDHLNDRVQRELKEWLLWLKSDLGFDAWRLD  180

Query  650   YVKGYDFVKGFAAVKIYMDNTKPEFAVGELWNALSPGSVPNPDYNQDAHRNELVRWVQNa  829
             + +GY         K+Y+D T P  AV E+W+ ++ G    P+Y+QDAHR  LV WV   
Sbjct  181   FARGYSP----EMAKVYIDGTSPSLAVAEVWDNMATGGDGKPNYDQDAHRQNLVNWVDKV  236

Query  830   ggaatafdf---ttKGILQAALNNTELWRLKDAAGKPSGMIGVLPQSAVTFIDNHDTWS-  997
             GGAA+A      TTKGIL AA+   ELWRL D  GK  G++G  P  AVTF+DNHDT S 
Sbjct  237   GGAASAGMVFDFTTKGILNAAVEG-ELWRLIDPQGKAPGVMGWWPAKAVTFVDNHDTGST  295

Query  998   QRLWPFTTSTDDAVNHDRVLQGYAYILTHPGIPSVFYDHFFEWGLKDAISKLISIRNKNG  1177
             Q +WPF +        D+V+QGYAYILTHPG P +FYDHFF WG KD I+ L++IR +NG
Sbjct  296   QAMWPFPS--------DKVMQGYAYILTHPGTPCIFYDHFFNWGFKDEIAALVAIRKRNG  347

Query  1178  VSATSPVEILAADADLYIAKINGKVILKIGPNGDLKNLVPSDFMLATSGKDFAVWEK-PT  1354
             ++ATS ++IL  + D Y+A+I+GKV++KIG   D+  ++P+ F  +  GKD+AVWEK  T
Sbjct  348   ITATSALKILMHEGDAYVAEIDGKVVVKIGTRYDVGAVIPAGFATSAHGKDYAVWEKTAT  407

Query  1355  *SRLQIS  1375
              + LQ S
Sbjct  408   AATLQRS  414



>emb|CAA39776.1| alpha-amylase [Oryza sativa Japonica Group]
Length=440

 Score =   437 bits (1124),  Expect = 2e-145, Method: Compositional matrix adjust.
 Identities = 223/419 (53%), Positives = 293/419 (70%), Gaps = 17/419 (4%)
 Frame = +2

Query  98    HSSSTVLFQGFTWTSKDQPGGWWNWLITKVPDLADAGITHVWLPPPSNAREGDDQGYMPK  277
             H+ + +LFQGF W S  + GGW+N L  +V D+A AG+THVWLPPP+++     QGYMP 
Sbjct  25    HAQTQILFQGFNWDSWKKQGGWYNMLKDQVGDIASAGVTHVWLPPPTHSVS--PQGYMPG  82

Query  278   RMYDLDTSKYGNKKELKALNDAFHGRGIKSVADIVLNHRAAERANSRGVFNVFEGGTPDD  457
             R+YDL+ SKYG K ELK+L  AFH +GIK VADIV+NHR A+  + RGV+ +F+GG P  
Sbjct  83    RLYDLNASKYGTKAELKSLIAAFHAKGIKCVADIVVNHRCADDKDGRGVYCIFKGGGPRG  142

Query  458   KLDWGPSEICGDDAAF-EGTGNPDTGDPWGDAPDIDHRSPRVQREISEWMNWLKSDVGFD  634
              LDWGPS IC DD  + +GTG+ DTG  +  APDIDH +P VQRE+S+W+ WL+ DVGFD
Sbjct  143   CLDWGPSMICCDDTQYSDGTGHRDTGADFAAAPDIDHLNPLVQRELSDWLRWLRRDVGFD  202

Query  635   GWRFDYVKGYDFVKGFAAVKIYMDNTKPEFAVGELWNALSPGSVPNPDYNQDAHRNELVR  814
             GWR D+ KGY      A  + Y+ N +P F V E+WN+LS      P  NQD  R ELV 
Sbjct  203   GWRLDFAKGYSA----AVARTYVQNARPSFVVAEIWNSLSYDGDGKPAANQDGQRQELVN  258

Query  815   WVQNaggaatafdfttKGILQAALNNTELWRLKDAAGKPSGMIGVLPQSAVTFIDNHDTW  994
             WV+  GG ATAFDFTTKGILQ+A+   ELWR++D  GK  GMIG  P+ AVTF+DNHDT 
Sbjct  259   WVKQVGGPATAFDFTTKGILQSAVQG-ELWRMRDKDGKAPGMIGWYPEKAVTFVDNHDTG  317

Query  995   S-QRLWPFTTSTDDAVNHDRVLQGYAYILTHPGIPSVFYDHFFEWGLKDAISKLISIRNK  1171
             S QR+WPF +        D+V+ GYAYILTHPG+P +FYD  F+W LK  I+ L + R +
Sbjct  318   STQRMWPFPS--------DKVILGYAYILTHPGVPCIFYDQVFDWNLKQEINALAATRKR  369

Query  1172  NGVSATSPVEILAADADLYIAKINGKVILKIGPNGDLKNLVPSDFMLATSGKDFAVWEK  1348
             NG++A S + +LAA++D+Y+A ++ +VI KIGP  ++ N++PSDF +   G D+ VWEK
Sbjct  370   NGINAGSKLRVLAAESDMYVAMVDERVITKIGPRIEVGNIIPSDFHIVAHGNDYCVWEK  428



>gb|ADC54319.1| alpha amylase [Hordeum vulgare subsp. spontaneum]
Length=414

 Score =   436 bits (1121),  Expect = 2e-145, Method: Compositional matrix adjust.
 Identities = 220/417 (53%), Positives = 292/417 (70%), Gaps = 20/417 (5%)
 Frame = +2

Query  113   VLFQGFTWTSKDQPGGWWNWLITKVPDLADAGITHVWLPPPSNAREGDDQGYMPKRMYDL  292
             VLFQGF W S  Q GGW+N ++ KV D+A AG+THVWLPPPS++    ++GYMP R+YD+
Sbjct  3     VLFQGFNWESWKQSGGWYNMMMGKVDDIAAAGVTHVWLPPPSHSVS--NEGYMPGRLYDI  60

Query  293   DTSKYGNKKELKALNDAFHGRGIKSVADIVLNHRAAERANSRGVFNVFEGGTPDDKLDWG  472
             D SKYGN  ELK+L  A HG+G++++ADIV+NHR A+  ++RG++ +FEGGT D +LDWG
Sbjct  61    DASKYGNAAELKSLIGALHGKGVQAIADIVINHRCADYKDNRGIYCIFEGGTSDGRLDWG  120

Query  473   PSEICGDDAAF-EGTGNPDTGDPWGDAPDIDHRSPRVQREISEWMNWLKSDVGFDGWRFD  649
             P  IC DD  + +GT N D G  +  APDIDH + RVQRE+ EW+ WLKSD+GFD WR D
Sbjct  121   PHTICRDDTKYADGTANLDAGADFAAAPDIDHLNDRVQRELKEWLLWLKSDLGFDAWRLD  180

Query  650   YVKGYDFVKGFAAVKIYMDNTKPEFAVGELWNALSPGSVPNPDYNQDAHRNELVRWVQNa  829
             + +GY         K+Y+D T P  AV E+W+ ++ G    P+Y+QDAHR  LV WV   
Sbjct  181   FARGYSP----EMAKVYIDGTSPSLAVAEVWDNMATGGDGKPNYDQDAHRQNLVNWVDKV  236

Query  830   ggaatafdf---ttKGILQAALNNTELWRLKDAAGKPSGMIGVLPQSAVTFIDNHDTWS-  997
             GGAA+A      TTKGIL AA+   ELWRL D  GK  G++G  P  AVTF+DNHDT S 
Sbjct  237   GGAASAGMVFDFTTKGILNAAVEG-ELWRLIDPQGKAPGVMGWWPAKAVTFVDNHDTGST  295

Query  998   QRLWPFTTSTDDAVNHDRVLQGYAYILTHPGIPSVFYDHFFEWGLKDAISKLISIRNKNG  1177
             Q +WPF +        D+V+QGYAYILTHPG P +FYDHFF WG KD I+ L++IR +NG
Sbjct  296   QAMWPFPS--------DKVMQGYAYILTHPGTPCIFYDHFFNWGFKDEIAALVAIRKRNG  347

Query  1178  VSATSPVEILAADADLYIAKINGKVILKIGPNGDLKNLVPSDFMLATSGKDFAVWEK  1348
             ++ATS ++IL  + D Y+A+I+GKV++KIG   D+  ++P+ F  +  GKD+AVWEK
Sbjct  348   ITATSALKILMHEGDAYVAEIDGKVVVKIGTRYDVGAVIPAGFATSAHGKDYAVWEK  404



>gb|ADC54364.1| alpha amylase [Hordeum vulgare subsp. spontaneum]
Length=414

 Score =   436 bits (1121),  Expect = 3e-145, Method: Compositional matrix adjust.
 Identities = 220/417 (53%), Positives = 292/417 (70%), Gaps = 20/417 (5%)
 Frame = +2

Query  113   VLFQGFTWTSKDQPGGWWNWLITKVPDLADAGITHVWLPPPSNAREGDDQGYMPKRMYDL  292
             VLFQGF W S  Q GGW+N ++ KV D+A AG+THVWLPPPS++    ++GYMP R+YD+
Sbjct  3     VLFQGFNWESWKQSGGWYNMMMGKVDDIAAAGVTHVWLPPPSHSVS--NEGYMPGRLYDI  60

Query  293   DTSKYGNKKELKALNDAFHGRGIKSVADIVLNHRAAERANSRGVFNVFEGGTPDDKLDWG  472
             D SKYGN  ELK+L  A HG+G++++ADIV+NHR A+  +SRG++ +FEGGT D +LDWG
Sbjct  61    DASKYGNAAELKSLIGALHGKGVQAIADIVINHRCADYKDSRGIYCIFEGGTSDGRLDWG  120

Query  473   PSEICGDDAAF-EGTGNPDTGDPWGDAPDIDHRSPRVQREISEWMNWLKSDVGFDGWRFD  649
             P  IC DD  + +GT N D G  +  APDIDH + RVQRE+ EW+ WLKSD+GFD WR D
Sbjct  121   PHMICRDDTKYSDGTANLDAGADFAAAPDIDHLNDRVQRELKEWLLWLKSDLGFDAWRLD  180

Query  650   YVKGYDFVKGFAAVKIYMDNTKPEFAVGELWNALSPGSVPNPDYNQDAHRNELVRWVQNa  829
             + +GY         K+Y+D T P  AV E+W+ ++ G    P+Y+QDAHR  LV WV   
Sbjct  181   FARGYSP----EMAKVYIDGTSPSLAVAEVWDNMATGGDGKPNYDQDAHRQNLVNWVDKV  236

Query  830   ggaatafdf---ttKGILQAALNNTELWRLKDAAGKPSGMIGVLPQSAVTFIDNHDTWS-  997
             GGAA+A      TTKGIL AA+   ELWRL D  GK  G++G  P  AVT +DNHDT S 
Sbjct  237   GGAASAGMVFDFTTKGILNAAVEG-ELWRLIDPQGKAPGVMGWWPAKAVTLVDNHDTGST  295

Query  998   QRLWPFTTSTDDAVNHDRVLQGYAYILTHPGIPSVFYDHFFEWGLKDAISKLISIRNKNG  1177
             Q +WPF +        D+V+QGYAYILTHPGIP +FYDHFF WG KD I+ L++IR +NG
Sbjct  296   QAMWPFPS--------DKVMQGYAYILTHPGIPCIFYDHFFNWGFKDQIAALVAIRKRNG  347

Query  1178  VSATSPVEILAADADLYIAKINGKVILKIGPNGDLKNLVPSDFMLATSGKDFAVWEK  1348
             ++ATS ++IL  + D Y+A+I+GKV++KIG   D+  ++P+ F+ +  G D+AVWEK
Sbjct  348   ITATSALKILMHEGDAYVAEIDGKVVVKIGSRYDVGAVIPAGFVTSAHGNDYAVWEK  404



>gb|ADC54332.1| alpha amylase [Hordeum vulgare subsp. spontaneum]
Length=414

 Score =   436 bits (1121),  Expect = 3e-145, Method: Compositional matrix adjust.
 Identities = 220/417 (53%), Positives = 292/417 (70%), Gaps = 20/417 (5%)
 Frame = +2

Query  113   VLFQGFTWTSKDQPGGWWNWLITKVPDLADAGITHVWLPPPSNAREGDDQGYMPKRMYDL  292
             VLFQGF W S  Q GGW+N ++ KV D+A AG+THVWLPPPS++    ++GYMP R+YD+
Sbjct  3     VLFQGFNWESWKQSGGWYNMMMGKVDDIAAAGVTHVWLPPPSHSVS--NEGYMPGRLYDI  60

Query  293   DTSKYGNKKELKALNDAFHGRGIKSVADIVLNHRAAERANSRGVFNVFEGGTPDDKLDWG  472
             D SKYGN  ELK+L  A HG+G++++ADIV+NHR A+  ++RG++ +FEGGT D +LDWG
Sbjct  61    DASKYGNAAELKSLISALHGKGVQAMADIVINHRCADYKDNRGIYCIFEGGTSDGRLDWG  120

Query  473   PSEICGDDAAF-EGTGNPDTGDPWGDAPDIDHRSPRVQREISEWMNWLKSDVGFDGWRFD  649
             P  IC DD  + +GT N DTG  +  APDIDH + RVQRE+ EW+ WLKSD+GFD WR D
Sbjct  121   PHMICRDDTKYADGTANLDTGADFAAAPDIDHLNDRVQRELKEWLLWLKSDLGFDAWRLD  180

Query  650   YVKGYDFVKGFAAVKIYMDNTKPEFAVGELWNALSPGSVPNPDYNQDAHRNELVRWVQNa  829
             + +GY         K+Y+D T P  AV E+W+ ++ G    P+Y+QDAHR  LV WV   
Sbjct  181   FARGYSP----EMAKVYIDGTSPSLAVAEVWDNMATGGDGKPNYDQDAHRQNLVNWVDKV  236

Query  830   ggaatafdf---ttKGILQAALNNTELWRLKDAAGKPSGMIGVLPQSAVTFIDNHDTWSQ  1000
             GGAA+A      TTKGIL  A+   ELWRL D  GK  G++G  P  AVTF+DNHDT S 
Sbjct  237   GGAASAGMVFDFTTKGILNTAVEG-ELWRLIDPQGKAPGVMGWWPTKAVTFVDNHDTGST  295

Query  1001  R-LWPFTTSTDDAVNHDRVLQGYAYILTHPGIPSVFYDHFFEWGLKDAISKLISIRNKNG  1177
             R +WPF +        D+V+QGYAYILTHPG P +FYDHFF WG KD I+ L++IR +NG
Sbjct  296   RAMWPFPS--------DKVMQGYAYILTHPGTPCIFYDHFFNWGFKDEIAALVAIRKRNG  347

Query  1178  VSATSPVEILAADADLYIAKINGKVILKIGPNGDLKNLVPSDFMLATSGKDFAVWEK  1348
             ++ATS ++IL  + D Y+A+I+GKV++KIG   D+  ++P+ F  +  GKD+AVWEK
Sbjct  348   ITATSALKILMHEGDAYVAEIDGKVVVKIGTRYDVGAVIPAGFATSAHGKDYAVWEK  404



>gb|ADC54313.1| alpha amylase [Hordeum vulgare subsp. spontaneum]
Length=414

 Score =   436 bits (1120),  Expect = 3e-145, Method: Compositional matrix adjust.
 Identities = 220/417 (53%), Positives = 292/417 (70%), Gaps = 20/417 (5%)
 Frame = +2

Query  113   VLFQGFTWTSKDQPGGWWNWLITKVPDLADAGITHVWLPPPSNAREGDDQGYMPKRMYDL  292
             VLFQGF W S  Q GGW+N ++ KV D+A AG+THVWLPPPS++    ++GYMP R+YD+
Sbjct  3     VLFQGFNWESWKQSGGWYNMMMGKVDDIAAAGVTHVWLPPPSHSVS--NEGYMPGRLYDI  60

Query  293   DTSKYGNKKELKALNDAFHGRGIKSVADIVLNHRAAERANSRGVFNVFEGGTPDDKLDWG  472
             D SKYGN  ELK+L  A HG+G++++ADIV+NHR A+  ++RG++ +FEGGT D +LDWG
Sbjct  61    DASKYGNAAELKSLIGALHGKGVQAIADIVINHRCADYKDNRGIYCIFEGGTSDGRLDWG  120

Query  473   PSEICGDDAAF-EGTGNPDTGDPWGDAPDIDHRSPRVQREISEWMNWLKSDVGFDGWRFD  649
             P  IC DD  + +GT N DTG  +  APDIDH + RVQRE+ EW+ WLKSD+GFD WR D
Sbjct  121   PHMICRDDTKYADGTANLDTGADFAAAPDIDHLNDRVQRELKEWLLWLKSDLGFDAWRLD  180

Query  650   YVKGYDFVKGFAAVKIYMDNTKPEFAVGELWNALSPGSVPNPDYNQDAHRNELVRWVQNa  829
             + +GY         K+Y+D T P  AV E+W+ ++ G    P+Y+QDAHR  LV WV   
Sbjct  181   FARGYSP----EMAKVYIDGTSPSLAVAEVWDNMATGGDGKPNYDQDAHRQNLVNWVDKV  236

Query  830   ggaatafdf---ttKGILQAALNNTELWRLKDAAGKPSGMIGVLPQSAVTFIDNHDTWS-  997
             GGAA+A      TTKGIL AA+   ELWRL D  GK  G++G  P  AVTF+DNHDT S 
Sbjct  237   GGAASAGMVFDFTTKGILNAAVEG-ELWRLIDPQGKAPGVMGWWPAKAVTFVDNHDTGST  295

Query  998   QRLWPFTTSTDDAVNHDRVLQGYAYILTHPGIPSVFYDHFFEWGLKDAISKLISIRNKNG  1177
             Q +WP  +        D+V+QGYAYILTHPG P +FYDHFF WG KD I+ L++IR +NG
Sbjct  296   QAMWPLPS--------DKVMQGYAYILTHPGTPCIFYDHFFNWGFKDEIAALVAIRKRNG  347

Query  1178  VSATSPVEILAADADLYIAKINGKVILKIGPNGDLKNLVPSDFMLATSGKDFAVWEK  1348
             ++ATS ++IL  + D Y+A+I+GKV++KIG   D+  ++P+ F  +  GKD+AVWEK
Sbjct  348   ITATSALKILMHEGDAYVAEIDGKVVVKIGTRYDVGAVIPAGFATSAHGKDYAVWEK  404



>gb|ADC54301.1| alpha amylase [Hordeum vulgare subsp. spontaneum]
Length=414

 Score =   436 bits (1120),  Expect = 4e-145, Method: Compositional matrix adjust.
 Identities = 220/417 (53%), Positives = 293/417 (70%), Gaps = 20/417 (5%)
 Frame = +2

Query  113   VLFQGFTWTSKDQPGGWWNWLITKVPDLADAGITHVWLPPPSNAREGDDQGYMPKRMYDL  292
             VLFQGF W S  Q GGW+N ++ KV D+A AG+THVWLPPPS++    ++GYMP R+YD+
Sbjct  3     VLFQGFNWESWKQSGGWYNMMMGKVDDIAAAGVTHVWLPPPSHSVS--NEGYMPGRLYDI  60

Query  293   DTSKYGNKKELKALNDAFHGRGIKSVADIVLNHRAAERANSRGVFNVFEGGTPDDKLDWG  472
             D SKYGN  ELK+L  A HG+G++++ADIV+NHR A+  ++RG++ +FEGGT D +LDWG
Sbjct  61    DASKYGNAAELKSLIGALHGKGVQAIADIVINHRCADYKDNRGIYCIFEGGTSDGRLDWG  120

Query  473   PSEICGDDAAF-EGTGNPDTGDPWGDAPDIDHRSPRVQREISEWMNWLKSDVGFDGWRFD  649
             P  IC DD  + +GT + DTG  +  APDIDH + RVQRE+ EW+ WLKSD+GFD WR D
Sbjct  121   PHMICRDDTKYADGTADLDTGADFAAAPDIDHLNDRVQRELKEWLLWLKSDLGFDAWRLD  180

Query  650   YVKGYDFVKGFAAVKIYMDNTKPEFAVGELWNALSPGSVPNPDYNQDAHRNELVRWVQNa  829
             + +GY         K+Y+D T P  AV E+W+ ++ G    P+Y+QDAHR  LV WV   
Sbjct  181   FARGYSP----EMAKVYIDGTSPSLAVAEVWDNMATGGDGKPNYDQDAHRQNLVNWVDKV  236

Query  830   ggaatafdf---ttKGILQAALNNTELWRLKDAAGKPSGMIGVLPQSAVTFIDNHDTWS-  997
             GGAA+A      TTKGIL AA+   ELWRL D  GK  G++G  P  AVTF+DNHDT S 
Sbjct  237   GGAASAGMVFDFTTKGILNAAVEG-ELWRLIDPQGKAPGVMGWWPAKAVTFVDNHDTGST  295

Query  998   QRLWPFTTSTDDAVNHDRVLQGYAYILTHPGIPSVFYDHFFEWGLKDAISKLISIRNKNG  1177
             Q +WPF +        D+V+QGYAYILTHPG P +FYDHFF WG KD I+ L++IR +NG
Sbjct  296   QAMWPFPS--------DKVMQGYAYILTHPGTPCIFYDHFFNWGFKDEIAALVAIRKRNG  347

Query  1178  VSATSPVEILAADADLYIAKINGKVILKIGPNGDLKNLVPSDFMLATSGKDFAVWEK  1348
             ++ATS ++IL  + D Y+A+I+GKV++KIG   D+  ++P+ F  +  GKD+AVWEK
Sbjct  348   ITATSALKILMHEGDAYVAEIDGKVVVKIGTRYDVGAVIPAGFATSAHGKDYAVWEK  404



>gb|ADC54330.1| alpha amylase [Hordeum vulgare subsp. spontaneum]
 gb|ADC54331.1| alpha amylase [Hordeum vulgare subsp. spontaneum]
Length=414

 Score =   436 bits (1120),  Expect = 4e-145, Method: Compositional matrix adjust.
 Identities = 220/417 (53%), Positives = 292/417 (70%), Gaps = 20/417 (5%)
 Frame = +2

Query  113   VLFQGFTWTSKDQPGGWWNWLITKVPDLADAGITHVWLPPPSNAREGDDQGYMPKRMYDL  292
             VLFQGF W S  Q GGW+N ++ KV D+A AG+THVWLPPPS++    ++GYMP R+YD+
Sbjct  3     VLFQGFNWESWKQSGGWYNMMMGKVDDIAAAGVTHVWLPPPSHSVS--NEGYMPGRLYDI  60

Query  293   DTSKYGNKKELKALNDAFHGRGIKSVADIVLNHRAAERANSRGVFNVFEGGTPDDKLDWG  472
             D SKYGN  ELK+L  A HG+G++++ADIV+NHR A+  ++RG++ +FEGGT D +LDWG
Sbjct  61    DASKYGNAAELKSLISALHGKGVQAMADIVINHRCADYKDNRGIYCIFEGGTSDGRLDWG  120

Query  473   PSEICGDDAAF-EGTGNPDTGDPWGDAPDIDHRSPRVQREISEWMNWLKSDVGFDGWRFD  649
             P  IC DD  + +GT N DTG  +  APDIDH + RVQRE+ EW+ WLKSD+GFD WR D
Sbjct  121   PHMICRDDTKYADGTANLDTGADFAAAPDIDHLNDRVQRELKEWLLWLKSDLGFDAWRLD  180

Query  650   YVKGYDFVKGFAAVKIYMDNTKPEFAVGELWNALSPGSVPNPDYNQDAHRNELVRWVQNa  829
             + +GY         K+Y+D T P  AV E+W+ ++ G    P+Y+QDAHR  LV WV   
Sbjct  181   FARGYSP----EMAKVYIDGTSPSLAVAEVWDNMATGGDGKPNYDQDAHRQNLVNWVDKV  236

Query  830   ggaatafdf---ttKGILQAALNNTELWRLKDAAGKPSGMIGVLPQSAVTFIDNHDTWS-  997
             GGAA+A      TTKGIL  A+   ELWRL D  GK  G++G  P  AVTF+DNHDT S 
Sbjct  237   GGAASAGMVFDFTTKGILNTAVEG-ELWRLIDPQGKAPGVMGWWPAKAVTFVDNHDTGST  295

Query  998   QRLWPFTTSTDDAVNHDRVLQGYAYILTHPGIPSVFYDHFFEWGLKDAISKLISIRNKNG  1177
             Q +WPF +        D+V+QGYAYILTHPG P +FYDHFF WG KD I+ L++IR +NG
Sbjct  296   QAMWPFPS--------DKVMQGYAYILTHPGTPCIFYDHFFNWGFKDEIAALVAIRKRNG  347

Query  1178  VSATSPVEILAADADLYIAKINGKVILKIGPNGDLKNLVPSDFMLATSGKDFAVWEK  1348
             ++ATS ++IL  + D Y+A+I+GKV++KIG   D+  ++P+ F  +  GKD+AVWEK
Sbjct  348   ITATSALKILMHEGDAYVAEIDGKVVVKIGTRYDVGAVIPAGFATSAHGKDYAVWEK  404



>gb|ADC54285.1| alpha amylase [Hordeum vulgare subsp. spontaneum]
Length=414

 Score =   436 bits (1120),  Expect = 4e-145, Method: Compositional matrix adjust.
 Identities = 223/427 (52%), Positives = 298/427 (70%), Gaps = 21/427 (5%)
 Frame = +2

Query  113   VLFQGFTWTSKDQPGGWWNWLITKVPDLADAGITHVWLPPPSNAREGDDQGYMPKRMYDL  292
             VLFQGF W S  Q GGW+N ++ KV D+A AG+THVWLPPPS++    ++GYMP R+YD+
Sbjct  3     VLFQGFNWESWKQSGGWYNMMMGKVDDIAAAGVTHVWLPPPSHSVS--NEGYMPGRLYDI  60

Query  293   DTSKYGNKKELKALNDAFHGRGIKSVADIVLNHRAAERANSRGVFNVFEGGTPDDKLDWG  472
             D SKYGN  ELK+L  A HG+G++++ADIV+NHR A+  ++RG++ +FEGGT D +LDWG
Sbjct  61    DASKYGNAAELKSLIGALHGKGVQAIADIVINHRCADYKDNRGIYCIFEGGTSDGRLDWG  120

Query  473   PSEICGDDAAF-EGTGNPDTGDPWGDAPDIDHRSPRVQREISEWMNWLKSDVGFDGWRFD  649
             P  IC DD  + +GT N DTG  +  APDIDH + RVQRE+ EW+ WLKSD+GFD WR D
Sbjct  121   PHMICRDDTKYADGTANLDTGADFAAAPDIDHLNDRVQRELKEWLLWLKSDLGFDAWRLD  180

Query  650   YVKGYDFVKGFAAVKIYMDNTKPEFAVGELWNALSPGSVPNPDYNQDAHRNELVRWVQNa  829
             + +GY         ++Y+D T P  AV E+W+ ++ G    P+Y+QDAHR  LV WV   
Sbjct  181   FARGYSP----EMARVYIDGTSPSLAVAEVWDNMATGGDGKPNYDQDAHRQNLVNWVDKV  236

Query  830   ggaatafdf---ttKGILQAALNNTELWRLKDAAGKPSGMIGVLPQSAVTFIDNHDTWS-  997
             GGAA+A      TTKGIL AA+   ELWRL D  GK  G++G  P  AVTF+DNHDT S 
Sbjct  237   GGAASAGMVFDFTTKGILNAAVEG-ELWRLIDPQGKAPGVMGWWPAKAVTFVDNHDTGST  295

Query  998   QRLWPFTTSTDDAVNHDRVLQGYAYILTHPGIPSVFYDHFFEWGLKDAISKLISIRNKNG  1177
             Q +WPF +        D+V+QGYAYILTHPG P +FYDHFF WG +D I+ L++IR +NG
Sbjct  296   QAMWPFPS--------DKVMQGYAYILTHPGTPCIFYDHFFNWGFEDEIAALVAIRKRNG  347

Query  1178  VSATSPVEILAADADLYIAKINGKVILKIGPNGDLKNLVPSDFMLATSGKDFAVWEK-PT  1354
             ++ATS ++IL  + D Y+A+I+GKV++KIG   D+  ++P+ F  +  GKD+AVWEK  T
Sbjct  348   ITATSALKILMHEGDAYVAEIDGKVVVKIGTRYDVGAVIPAGFATSAHGKDYAVWEKTAT  407

Query  1355  *SRLQIS  1375
              + LQ S
Sbjct  408   AATLQRS  414



>gb|AAA32927.1| alpha-amylase 2 [Hordeum vulgare]
Length=438

 Score =   436 bits (1122),  Expect = 4e-145, Method: Compositional matrix adjust.
 Identities = 220/417 (53%), Positives = 292/417 (70%), Gaps = 20/417 (5%)
 Frame = +2

Query  113   VLFQGFTWTSKDQPGGWWNWLITKVPDLADAGITHVWLPPPSNAREGDDQGYMPKRMYDL  292
             VLFQGF W S  Q GGW+N ++ KV D+A  G+THVWLPPPS++    ++GYMP R+YD+
Sbjct  27    VLFQGFNWESWKQSGGWYNMMMGKVDDIAAVGVTHVWLPPPSHSVS--NEGYMPGRLYDI  84

Query  293   DTSKYGNKKELKALNDAFHGRGIKSVADIVLNHRAAERANSRGVFNVFEGGTPDDKLDWG  472
             D SKYGN  ELK+L  A HG+G++++ADIV+NHR A+  +SRG++ +FEGGT D +LDWG
Sbjct  85    DASKYGNAAELKSLIGALHGKGVQAIADIVINHRCADYKDSRGIYCIFEGGTSDGRLDWG  144

Query  473   PSEICGDDAAF-EGTGNPDTGDPWGDAPDIDHRSPRVQREISEWMNWLKSDVGFDGWRFD  649
             P  IC DD  + +GT N DTG  +  APDIDH + RVQRE+ EW+ WLKSD+GFD WR D
Sbjct  145   PHMICRDDTKYSDGTANLDTGADFAAAPDIDHLNDRVQRELKEWLLWLKSDLGFDAWRLD  204

Query  650   YVKGYDFVKGFAAVKIYMDNTKPEFAVGELWNALSPGSVPNPDYNQDAHRNELVRWVQNa  829
             + +GY         K+Y+D T P  AV E+W+ ++ G    P+Y+QDAHR  LV WV   
Sbjct  205   FARGYSP----EMAKVYIDGTSPSLAVAEVWDNMATGGDGKPNYDQDAHRQNLVNWVDKV  260

Query  830   ggaatafdf---ttKGILQAALNNTELWRLKDAAGKPSGMIGVLPQSAVTFIDNHDTWS-  997
             GGAA+A      TTKGIL AA+   ELWRL D  GK  G++G  P  A TF+DNHDT S 
Sbjct  261   GGAASAGMVFDFTTKGILNAAVEG-ELWRLIDPQGKAPGVMGWWPAKAATFVDNHDTGST  319

Query  998   QRLWPFTTSTDDAVNHDRVLQGYAYILTHPGIPSVFYDHFFEWGLKDAISKLISIRNKNG  1177
             Q +WPF +        D+V+QGYAYILTHPGIP +FYDHFF WG KD I+ L++IR +NG
Sbjct  320   QAMWPFPS--------DKVMQGYAYILTHPGIPCIFYDHFFNWGFKDQIAALVAIRKRNG  371

Query  1178  VSATSPVEILAADADLYIAKINGKVILKIGPNGDLKNLVPSDFMLATSGKDFAVWEK  1348
             ++ATS ++IL  + D Y+A+I+GKV++KIG   D+  ++P+ F+ +  G D+AVWEK
Sbjct  372   ITATSALKILMHEGDAYVAEIDGKVVVKIGSRYDVGAVIPAGFVTSAHGNDYAVWEK  428



>gb|ADC54306.1| alpha amylase [Hordeum vulgare subsp. spontaneum]
Length=414

 Score =   436 bits (1120),  Expect = 4e-145, Method: Compositional matrix adjust.
 Identities = 220/417 (53%), Positives = 292/417 (70%), Gaps = 20/417 (5%)
 Frame = +2

Query  113   VLFQGFTWTSKDQPGGWWNWLITKVPDLADAGITHVWLPPPSNAREGDDQGYMPKRMYDL  292
             VLFQGF W S  Q GGW+N ++ KV D+A AG+THVWLPPPS++    ++GYMP R+YD+
Sbjct  3     VLFQGFNWESWKQSGGWYNMMMGKVDDIAAAGVTHVWLPPPSHSVS--NEGYMPGRLYDI  60

Query  293   DTSKYGNKKELKALNDAFHGRGIKSVADIVLNHRAAERANSRGVFNVFEGGTPDDKLDWG  472
             D SKYGN  ELK+L  A HG+G++++ADIV+NHR A+  ++RG++ +FEGGT D +LDWG
Sbjct  61    DASKYGNAAELKSLIGALHGKGVQAIADIVINHRCADYKDNRGIYCIFEGGTSDGRLDWG  120

Query  473   PSEICGDDAAF-EGTGNPDTGDPWGDAPDIDHRSPRVQREISEWMNWLKSDVGFDGWRFD  649
             P  IC DD  + +GT N DTG  +  APDIDH + RVQRE+ EW+ WLKSD+GFD WR D
Sbjct  121   PHMICRDDTKYADGTANLDTGADFAAAPDIDHLNDRVQRELKEWLLWLKSDLGFDAWRLD  180

Query  650   YVKGYDFVKGFAAVKIYMDNTKPEFAVGELWNALSPGSVPNPDYNQDAHRNELVRWVQNa  829
             + +GY         K+Y+D T P  AV E+W+ ++ G    P+Y+QDAHR  LV WV   
Sbjct  181   FARGYSP----EMAKVYIDGTSPSLAVAEVWDNMATGGDGKPNYDQDAHRQNLVNWVDKV  236

Query  830   ggaatafdf---ttKGILQAALNNTELWRLKDAAGKPSGMIGVLPQSAVTFIDNHDTWS-  997
             GGAA+A      TTKGIL AA+   ELWRL D  GK  G++G  P  AVTF+DNHDT S 
Sbjct  237   GGAASAGMVFDFTTKGILNAAVEG-ELWRLIDPQGKAPGVMGWWPAKAVTFVDNHDTGST  295

Query  998   QRLWPFTTSTDDAVNHDRVLQGYAYILTHPGIPSVFYDHFFEWGLKDAISKLISIRNKNG  1177
             Q +WPF +        D+V+QGYAYILTHPG P +FYDHFF WG KD I+ L++IR +NG
Sbjct  296   QAMWPFPS--------DKVMQGYAYILTHPGTPCIFYDHFFNWGFKDEIAALVAIRKRNG  347

Query  1178  VSATSPVEILAADADLYIAKINGKVILKIGPNGDLKNLVPSDFMLATSGKDFAVWEK  1348
             ++ATS ++ L  + D Y+A+I+GKV++KIG   D+  ++P+ F  +  GKD+AVWEK
Sbjct  348   ITATSALKTLMHEGDAYVAEIDGKVVVKIGTRYDVGAVIPAGFATSAHGKDYAVWEK  404



>gb|ADC54338.1| alpha amylase [Hordeum vulgare subsp. spontaneum]
Length=414

 Score =   436 bits (1120),  Expect = 5e-145, Method: Compositional matrix adjust.
 Identities = 221/417 (53%), Positives = 292/417 (70%), Gaps = 20/417 (5%)
 Frame = +2

Query  113   VLFQGFTWTSKDQPGGWWNWLITKVPDLADAGITHVWLPPPSNAREGDDQGYMPKRMYDL  292
             VLFQGF W S  Q GGW+N ++ KV D+A AG+THVWLPPPS++    ++GYMP R+YD+
Sbjct  3     VLFQGFNWESWKQSGGWYNMMMGKVDDIAAAGVTHVWLPPPSHSVS--NEGYMPGRLYDI  60

Query  293   DTSKYGNKKELKALNDAFHGRGIKSVADIVLNHRAAERANSRGVFNVFEGGTPDDKLDWG  472
             D SKYGN  ELK+L  A HG+G++++ADIV+NHR A+  +SRG++ +FEGGT D +LDWG
Sbjct  61    DASKYGNAAELKSLIGALHGKGVQAIADIVINHRCADYKDSRGIYCIFEGGTSDGRLDWG  120

Query  473   PSEICGDDAAF-EGTGNPDTGDPWGDAPDIDHRSPRVQREISEWMNWLKSDVGFDGWRFD  649
             P  IC DD  + +GT N DTG  +  APDIDH + RVQRE+ EW+ WLKSD+GFD WR D
Sbjct  121   PHMICRDDTKYADGTANLDTGADFAAAPDIDHLNDRVQRELKEWLLWLKSDLGFDAWRLD  180

Query  650   YVKGYDFVKGFAAVKIYMDNTKPEFAVGELWNALSPGSVPNPDYNQDAHRNELVRWVQNa  829
             + +GY         K+Y+D T P  AV E+W+ ++ G    P+Y+QDAHR   V WV   
Sbjct  181   FARGYSP----EMAKVYIDGTSPSLAVAEVWDNMATGGDGKPNYDQDAHRQNPVNWVDKV  236

Query  830   ggaatafdf---ttKGILQAALNNTELWRLKDAAGKPSGMIGVLPQSAVTFIDNHDTWS-  997
             GGAA+A      TTKGIL AA+   ELWRL D  GK  G++G  P  AVTF+DNHDT S 
Sbjct  237   GGAASAGMVFDFTTKGILNAAVEG-ELWRLIDPQGKAPGVMGWWPAKAVTFVDNHDTGST  295

Query  998   QRLWPFTTSTDDAVNHDRVLQGYAYILTHPGIPSVFYDHFFEWGLKDAISKLISIRNKNG  1177
             Q +WPF +        D+V+QGYAYILTHPG P +FYDHFF WG KD I+ L++IR +NG
Sbjct  296   QAMWPFPS--------DKVMQGYAYILTHPGTPCIFYDHFFNWGFKDEIAALVAIRKRNG  347

Query  1178  VSATSPVEILAADADLYIAKINGKVILKIGPNGDLKNLVPSDFMLATSGKDFAVWEK  1348
             ++ATS ++IL  + D Y+A+I+GKV++KIG   D+  ++P+ F  +  GKD+AVWEK
Sbjct  348   ITATSALKILMHEGDAYVAEIDGKVVVKIGTRYDVGAVIPAGFATSAHGKDYAVWEK  404



>gb|ADC54356.1| alpha amylase [Hordeum vulgare subsp. spontaneum]
Length=414

 Score =   435 bits (1119),  Expect = 5e-145, Method: Compositional matrix adjust.
 Identities = 221/417 (53%), Positives = 292/417 (70%), Gaps = 20/417 (5%)
 Frame = +2

Query  113   VLFQGFTWTSKDQPGGWWNWLITKVPDLADAGITHVWLPPPSNAREGDDQGYMPKRMYDL  292
             VLFQGF W S  Q GGW+N ++ KV D+A AG+THVWLPPPS++    ++GYMP R+YD+
Sbjct  3     VLFQGFNWESWKQSGGWYNMMMGKVDDIAAAGVTHVWLPPPSHSVS--NEGYMPGRLYDI  60

Query  293   DTSKYGNKKELKALNDAFHGRGIKSVADIVLNHRAAERANSRGVFNVFEGGTPDDKLDWG  472
             D SKYGN  ELK+L  A HG+G++++ADIV+N R A+  +SRG++ +FEGGT D +LDWG
Sbjct  61    DASKYGNAAELKSLIGALHGKGVQAIADIVINLRCADYKDSRGIYCIFEGGTSDGRLDWG  120

Query  473   PSEICGDDAAF-EGTGNPDTGDPWGDAPDIDHRSPRVQREISEWMNWLKSDVGFDGWRFD  649
             P  IC DD  + +GT N DTG  +  APDIDH + RVQRE+ EW+ WLKSD+GFD WR D
Sbjct  121   PHMICRDDTKYSDGTANLDTGADFAAAPDIDHLNDRVQRELKEWLLWLKSDLGFDAWRLD  180

Query  650   YVKGYDFVKGFAAVKIYMDNTKPEFAVGELWNALSPGSVPNPDYNQDAHRNELVRWVQNa  829
             + +GY         K+Y+D T P  AV E+W+ ++ G    P+Y+QDAHR  LV WV   
Sbjct  181   FARGYSP----EMAKVYIDGTSPSLAVAEVWDNMATGGDGKPNYDQDAHRQNLVNWVDKV  236

Query  830   ggaatafdf---ttKGILQAALNNTELWRLKDAAGKPSGMIGVLPQSAVTFIDNHDTWS-  997
             GGAA+A      TTKGIL AA+   ELWRL D  GK  G++G  P  AVTF+DNHDT S 
Sbjct  237   GGAASAGMVFDFTTKGILNAAVEG-ELWRLIDPQGKAPGVMGWWPAKAVTFVDNHDTGST  295

Query  998   QRLWPFTTSTDDAVNHDRVLQGYAYILTHPGIPSVFYDHFFEWGLKDAISKLISIRNKNG  1177
             Q +WPF +        D+V+QGYAYILTHPG P +FYDHFF WG KD I+ L++IR +NG
Sbjct  296   QAMWPFPS--------DKVMQGYAYILTHPGTPCIFYDHFFNWGFKDEIAALVAIRKRNG  347

Query  1178  VSATSPVEILAADADLYIAKINGKVILKIGPNGDLKNLVPSDFMLATSGKDFAVWEK  1348
             ++ATS ++IL  + D Y+A+I+GKV++KIG   D+  ++P+ F  +  GKD+AVWEK
Sbjct  348   ITATSALKILMHEGDAYVAEIDGKVVVKIGTRYDVGAVIPAGFATSAHGKDYAVWEK  404



>gb|ADC54326.1| alpha amylase [Hordeum vulgare subsp. spontaneum]
Length=414

 Score =   435 bits (1119),  Expect = 5e-145, Method: Compositional matrix adjust.
 Identities = 220/417 (53%), Positives = 292/417 (70%), Gaps = 20/417 (5%)
 Frame = +2

Query  113   VLFQGFTWTSKDQPGGWWNWLITKVPDLADAGITHVWLPPPSNAREGDDQGYMPKRMYDL  292
             VLFQGF W S  Q GGW+N ++ KV D+A AG+THVWLPPPS++    ++GYMP R+YD+
Sbjct  3     VLFQGFNWESWKQSGGWYNMMMGKVDDIAAAGVTHVWLPPPSHSVS--NEGYMPGRLYDI  60

Query  293   DTSKYGNKKELKALNDAFHGRGIKSVADIVLNHRAAERANSRGVFNVFEGGTPDDKLDWG  472
             D SKYGN  ELK+L  A HG+G++++ADIV+NHR A+  ++RG++ +FEGGT D +LDWG
Sbjct  61    DASKYGNAAELKSLIGALHGKGVQAIADIVINHRCADYKDNRGIYCIFEGGTSDGRLDWG  120

Query  473   PSEICGDDAAF-EGTGNPDTGDPWGDAPDIDHRSPRVQREISEWMNWLKSDVGFDGWRFD  649
             P  IC DD  + +GT N DTG  +  APDIDH + RVQR + EW+ WLKSD+GFD WR D
Sbjct  121   PHMICRDDTKYADGTANLDTGADFAAAPDIDHLNDRVQRGLKEWLLWLKSDLGFDAWRLD  180

Query  650   YVKGYDFVKGFAAVKIYMDNTKPEFAVGELWNALSPGSVPNPDYNQDAHRNELVRWVQNa  829
             + +GY         K+Y+D T P  AV E+W+ ++ G    P+Y+QDAHR  LV WV   
Sbjct  181   FARGYSP----EMAKVYIDGTSPSLAVAEVWDNMATGGDGKPNYDQDAHRQNLVNWVDKV  236

Query  830   ggaatafdf---ttKGILQAALNNTELWRLKDAAGKPSGMIGVLPQSAVTFIDNHDTWS-  997
             GGAA+A      TTKGIL AA+   ELWRL D  GK  G++G  P  AVTF+DNHDT S 
Sbjct  237   GGAASAGMVFDFTTKGILNAAVEG-ELWRLIDPQGKAPGVMGWWPAKAVTFVDNHDTGST  295

Query  998   QRLWPFTTSTDDAVNHDRVLQGYAYILTHPGIPSVFYDHFFEWGLKDAISKLISIRNKNG  1177
             Q +WPF +        D+V+QGYAYILTHPG P +FYDHFF WG KD I+ L++IR +NG
Sbjct  296   QAMWPFPS--------DKVMQGYAYILTHPGTPCIFYDHFFNWGFKDEIAALVAIRKRNG  347

Query  1178  VSATSPVEILAADADLYIAKINGKVILKIGPNGDLKNLVPSDFMLATSGKDFAVWEK  1348
             ++ATS ++IL  + D Y+A+I+GKV++KIG   D+  ++P+ F  +  GKD+AVWEK
Sbjct  348   ITATSALKILMHEGDAYVAEIDGKVVVKIGTRYDVGAVIPAGFATSAHGKDYAVWEK  404



>gb|ADC54349.1| alpha amylase [Hordeum vulgare subsp. spontaneum]
Length=414

 Score =   435 bits (1119),  Expect = 6e-145, Method: Compositional matrix adjust.
 Identities = 221/417 (53%), Positives = 293/417 (70%), Gaps = 20/417 (5%)
 Frame = +2

Query  113   VLFQGFTWTSKDQPGGWWNWLITKVPDLADAGITHVWLPPPSNAREGDDQGYMPKRMYDL  292
             VLFQGF W S  Q GGW+N ++ KV D+A AG+THVWLPPPS++    ++GYMP R+YD+
Sbjct  3     VLFQGFNWESWKQSGGWYNMMMGKVDDIAAAGVTHVWLPPPSHSVS--NEGYMPGRLYDI  60

Query  293   DTSKYGNKKELKALNDAFHGRGIKSVADIVLNHRAAERANSRGVFNVFEGGTPDDKLDWG  472
             D SKYGN  ELK+L  A HG+G++++ADIV+NHR A+  ++RG++ +FEGGT D +LDWG
Sbjct  61    DASKYGNAAELKSLIGALHGKGVQAIADIVINHRCADYKDNRGIYCIFEGGTSDGRLDWG  120

Query  473   PSEICGDDAAF-EGTGNPDTGDPWGDAPDIDHRSPRVQREISEWMNWLKSDVGFDGWRFD  649
             P  IC DD  + +GT N DTG  +  APDIDH + RVQRE+ EW+ WLKSD+GFD WR D
Sbjct  121   PHMICRDDTKYADGTANLDTGADFAAAPDIDHLNDRVQRELKEWLLWLKSDLGFDAWRLD  180

Query  650   YVKGYDFVKGFAAVKIYMDNTKPEFAVGELWNALSPGSVPNPDYNQDAHRNELVRWVQNa  829
             + +GY         K+Y+D T P  AV E+W+ ++ G    P+Y+QDAHR  LV WV   
Sbjct  181   FARGYSP----EMAKVYIDGTSPSLAVAEVWDNMATGGDGKPNYDQDAHRQNLVNWVDKV  236

Query  830   ggaatafdf---ttKGILQAALNNTELWRLKDAAGKPSGMIGVLPQSAVTFIDNHDTWS-  997
             GGAA+A      TTKGIL AA+   ELWRL D  GK  G++G  P  AVTF+DNHDT S 
Sbjct  237   GGAASAGMVFDFTTKGILNAAVEG-ELWRLIDPQGKAPGVMGWWPAKAVTFVDNHDTGST  295

Query  998   QRLWPFTTSTDDAVNHDRVLQGYAYILTHPGIPSVFYDHFFEWGLKDAISKLISIRNKNG  1177
             Q +WPF +        D+V+QGYAYILTHPGIP +FYDHFF  G KD I+ L++IR +NG
Sbjct  296   QAMWPFPS--------DKVMQGYAYILTHPGIPCIFYDHFFNLGFKDEIAALVAIRKRNG  347

Query  1178  VSATSPVEILAADADLYIAKINGKVILKIGPNGDLKNLVPSDFMLATSGKDFAVWEK  1348
             ++ATS ++IL  D D Y+A+I+ KV++KIG   D+  ++P+ F+ +  GKD+AVWEK
Sbjct  348   ITATSALKILMHDGDAYVAEIDSKVVVKIGSRYDVGAVIPAGFVTSAHGKDYAVWEK  404



>gb|ADC54327.1| alpha amylase [Hordeum vulgare subsp. spontaneum]
Length=414

 Score =   435 bits (1119),  Expect = 6e-145, Method: Compositional matrix adjust.
 Identities = 219/417 (53%), Positives = 293/417 (70%), Gaps = 20/417 (5%)
 Frame = +2

Query  113   VLFQGFTWTSKDQPGGWWNWLITKVPDLADAGITHVWLPPPSNAREGDDQGYMPKRMYDL  292
             VLFQGF W S  Q GGW+N ++ KV D+A AG+THVWLPPPS++    ++GYMP R+YD+
Sbjct  3     VLFQGFNWESWKQSGGWYNMMMGKVDDIAAAGVTHVWLPPPSHSVS--NEGYMPGRLYDI  60

Query  293   DTSKYGNKKELKALNDAFHGRGIKSVADIVLNHRAAERANSRGVFNVFEGGTPDDKLDWG  472
             D S+YGN  ELK+L  A HG+G++++ADIV+NHR A+  ++RG++ +FEGGT D +LDWG
Sbjct  61    DASEYGNAAELKSLIGALHGKGVQAIADIVINHRCADYKDNRGIYCIFEGGTSDGRLDWG  120

Query  473   PSEICGDDAAF-EGTGNPDTGDPWGDAPDIDHRSPRVQREISEWMNWLKSDVGFDGWRFD  649
             P  IC D+  + +GT N DTG  +  APDIDH + RVQRE+ EW+ WLKSD+GFD WR D
Sbjct  121   PHMICRDETKYADGTANLDTGADFAAAPDIDHLNDRVQRELKEWLLWLKSDLGFDAWRLD  180

Query  650   YVKGYDFVKGFAAVKIYMDNTKPEFAVGELWNALSPGSVPNPDYNQDAHRNELVRWVQNa  829
             + +GY         K+Y+D T P  AV E+W+ ++ G    P+Y+QDAHR  LV WV   
Sbjct  181   FARGYSP----EMAKVYIDGTSPSLAVAEVWDNMATGGDGKPNYDQDAHRQNLVNWVDKV  236

Query  830   ggaatafdf---ttKGILQAALNNTELWRLKDAAGKPSGMIGVLPQSAVTFIDNHDTWS-  997
             GGAA+A      TTKGIL AA+   ELWRL D  GK  G++G  P  AVTF+DNHDT S 
Sbjct  237   GGAASAGMVFDFTTKGILNAAVEG-ELWRLIDPQGKAPGVMGWWPAKAVTFVDNHDTGST  295

Query  998   QRLWPFTTSTDDAVNHDRVLQGYAYILTHPGIPSVFYDHFFEWGLKDAISKLISIRNKNG  1177
             Q +WPF +        D+V+QGYAYILTHPG P +FYDHFF WG KD I+ L++IR +NG
Sbjct  296   QAMWPFPS--------DKVMQGYAYILTHPGTPCIFYDHFFNWGFKDEIAALVAIRKRNG  347

Query  1178  VSATSPVEILAADADLYIAKINGKVILKIGPNGDLKNLVPSDFMLATSGKDFAVWEK  1348
             ++ATS ++IL  + D Y+A+I+GKV++KIG   D+  ++P+ F  +  GKD+AVWEK
Sbjct  348   ITATSALKILMHEGDAYVAEIDGKVVVKIGTRYDVGAVIPAGFATSAHGKDYAVWEK  404



>gb|ADC54314.1| alpha amylase [Hordeum vulgare subsp. spontaneum]
Length=414

 Score =   435 bits (1119),  Expect = 6e-145, Method: Compositional matrix adjust.
 Identities = 220/417 (53%), Positives = 292/417 (70%), Gaps = 20/417 (5%)
 Frame = +2

Query  113   VLFQGFTWTSKDQPGGWWNWLITKVPDLADAGITHVWLPPPSNAREGDDQGYMPKRMYDL  292
             VLFQGF W S  Q GGW+N ++ KV D+A AG+THVWLPPPS++    ++GYMP R+YD+
Sbjct  3     VLFQGFNWESWKQSGGWYNMMMGKVDDIAAAGVTHVWLPPPSHSVS--NEGYMPGRLYDI  60

Query  293   DTSKYGNKKELKALNDAFHGRGIKSVADIVLNHRAAERANSRGVFNVFEGGTPDDKLDWG  472
             D SKYGN  ELK+L  A HG+G++++ADIV+NHR A+  ++RG++ +FEGGT D +LDW 
Sbjct  61    DASKYGNAAELKSLIGALHGKGVQAIADIVINHRCADYKDNRGIYCIFEGGTSDGRLDWC  120

Query  473   PSEICGDDAAF-EGTGNPDTGDPWGDAPDIDHRSPRVQREISEWMNWLKSDVGFDGWRFD  649
             P  IC DD  + +GT N DTG  +  APDIDH + RVQRE+ EW+ WLKSD+GFD WR D
Sbjct  121   PHMICRDDTKYADGTANLDTGADFAAAPDIDHLNDRVQRELKEWLLWLKSDLGFDAWRLD  180

Query  650   YVKGYDFVKGFAAVKIYMDNTKPEFAVGELWNALSPGSVPNPDYNQDAHRNELVRWVQNa  829
             + +GY         K+Y+D T P  AV E+W+ ++ G    P+Y+QDAHR  LV WV   
Sbjct  181   FARGYSP----EMAKVYIDGTSPSLAVAEVWDNMATGGDGKPNYDQDAHRQNLVNWVDKV  236

Query  830   ggaatafdf---ttKGILQAALNNTELWRLKDAAGKPSGMIGVLPQSAVTFIDNHDTWS-  997
             GGAA+A      TTKGIL AA+   ELWRL D  GK  G++G  P  AVTF+DNHDT S 
Sbjct  237   GGAASAGMVFDFTTKGILNAAVEG-ELWRLIDPQGKAPGVMGWWPAKAVTFVDNHDTGST  295

Query  998   QRLWPFTTSTDDAVNHDRVLQGYAYILTHPGIPSVFYDHFFEWGLKDAISKLISIRNKNG  1177
             Q +WPF +        D+V+QGYAYILTHPG P +FYDHFF WG KD I+ L++IR +NG
Sbjct  296   QAMWPFPS--------DKVMQGYAYILTHPGTPCIFYDHFFNWGFKDEIAALVAIRKRNG  347

Query  1178  VSATSPVEILAADADLYIAKINGKVILKIGPNGDLKNLVPSDFMLATSGKDFAVWEK  1348
             ++ATS ++IL  + D Y+A+I+GKV++KIG   D+  ++P+ F  +  GKD+AVWEK
Sbjct  348   ITATSALKILMHEGDAYVAEIDGKVVVKIGTRYDVGAVIPAGFATSAHGKDYAVWEK  404



>emb|CAA39778.1| alpha-amylase [Oryza sativa Japonica Group]
Length=437

 Score =   436 bits (1121),  Expect = 6e-145, Method: Compositional matrix adjust.
 Identities = 229/418 (55%), Positives = 288/418 (69%), Gaps = 17/418 (4%)
 Frame = +2

Query  101   SSSTVLFQGFTWTSKDQPGGWWNWLITKVPDLADAGITHVWLPPPSNAREGDDQGYMPKR  280
             + + VLFQGF W S ++ GGW+N+L + V  +A  G+THVWLPPPS++     QGYMP R
Sbjct  24    AQAQVLFQGFNWESWNKQGGWYNFLHSHVDYIAATGVTHVWLPPPSHSVA--PQGYMPGR  81

Query  281   MYDLDTSKYGNKKELKALNDAFHGRGIKSVADIVLNHRAAERANSRGVFNVFEGGTPDDK  460
             +YDLD SKYG   EL++L  AFH + IK VADIV+NHR A+  +SRG++ +FEGGTPD +
Sbjct  82    LYDLDASKYGTGAELRSLIAAFHSKSIKCVADIVINHRCADYKDSRGIYCIFEGGTPDSR  141

Query  461   LDWGPSEICGDDAAFE-GTGNPDTGDPWGDAPDIDHRSPRVQREISEWMNWLKSDVGFDG  637
             LDWGP  IC DD  +  G G+ DTG  +G APDIDH + RVQ E+S+W+NWLKSDVGFDG
Sbjct  142   LDWGPDMICSDDTQYSNGRGHRDTGADFGAAPDIDHLNTRVQTELSDWLNWLKSDVGFDG  201

Query  638   WRFDYVKGYDFVKGFAAVKIYMDNTKPEFAVGELWNALSPGSVPNPDYNQDAHRNELVRW  817
             WR D+ KGY         K Y+DNT P F V E+W+ +       P +NQD  R ELV W
Sbjct  202   WRLDFAKGYSAT----VAKTYVDNTDPSFVVAEIWSNMRYDGNGEPSWNQDGDRQELVNW  257

Query  818   VQNaggaatafdfttKGILQAALNNTELWRLKDAAGKPSGMIGVLPQSAVTFIDNHDTWS  997
              Q  GG A+AFDFTTKG LQAA+   ELWR+KD  GK  GMIG LP+ AVTFIDNHDT S
Sbjct  258   AQAVGGPASAFDFTTKGELQAAVQG-ELWRMKDGNGKAPGMIGWLPEKAVTFIDNHDTGS  316

Query  998   -QRLWPFTTSTDDAVNHDRVLQGYAYILTHPGIPSVFYDHFFEWGLKDAISKLISIRNKN  1174
              Q  WPF +        D+V+Q YAYILTHPG+P +FYDH F+W LK  IS L ++R++N
Sbjct  317   TQNSWPFPS--------DKVMQRYAYILTHPGVPCIFYDHVFDWNLKQEISTLAAVRSRN  368

Query  1175  GVSATSPVEILAADADLYIAKINGKVILKIGPNGDLKNLVPSDFMLATSGKDFAVWEK  1348
             G+   S + ILAAD D+Y+A I+ KVI KIG   D+ NL+PSDF +   G ++ VWEK
Sbjct  369   GIHPGSKLNILAADGDVYVAMIDDKVITKIGTRYDVGNLIPSDFHVVAHGNNYCVWEK  426



>gb|AAA33894.1| alpha-amylase [Oryza sativa Japonica Group]
Length=443

 Score =   436 bits (1121),  Expect = 7e-145, Method: Compositional matrix adjust.
 Identities = 225/423 (53%), Positives = 295/423 (70%), Gaps = 22/423 (5%)
 Frame = +2

Query  101   SSSTVLFQGFTWTSKDQPGGWWNWLITKVPDLADAGITHVWLPPPSNAREGDDQGYMPKR  280
             S   +LFQGF W S  Q GGW+N L+ KV D+  AG+THVWLPPPS++     QGYMP R
Sbjct  20    SGDKILFQGFNWESWRQSGGWYNLLMGKVDDIVAAGVTHVWLPPPSHSVS--TQGYMPGR  77

Query  281   MYDLDTSKYGNKKELKALNDAFHGRGIKSVADIVLNHRAAERANSRGVFNVFEGGTPDDK  460
             +YDLD S+YG   ELK+L  A HG+GI+++AD+V+NHR A+  +SRG++ +FEGGTPD +
Sbjct  78    LYDLDASRYGTSMELKSLISALHGKGIQAIADVVINHRCADYKDSRGIYCIFEGGTPDGR  137

Query  461   LDWGPSEICGDDAAF-EGTGNPDTGDPWGDAPDIDHRSPRVQREISEWMNWLKSD-VGFD  634
             LDWGP  IC DD  F +GTGN DTG  +  APDIDH +  VQRE+++W+ WLKSD VGFD
Sbjct  138   LDWGPHMICRDDTQFSDGTGNLDTGADFAAAPDIDHLNGVVQRELTDWLLWLKSDEVGFD  197

Query  635   GWRFDYVKGYDFVKGFAAVKIYMDNTKP-EFAVGELWNALSPGSVPNPDYNQDAHRNELV  811
              WR D+ +GY         K+Y++ T P   AV ELW++++ G    P+YNQDAHR  LV
Sbjct  198   AWRLDFARGYSP----EVAKVYIEGTTPVGLAVAELWDSMAYGGDGKPEYNQDAHRQALV  253

Query  812   RWVQNaggaatafdf---ttKGILQAALNNTELWRLKDAAGKPSGMIGVLPQSAVTFIDN  982
              WV   GG A+A      TTKGI+  A+   ELWRL D  GK  G+IG  P  AVTF+DN
Sbjct  254   DWVDRVGGTASAGMVFDFTTKGIMNTAVEG-ELWRLIDQQGKAPGVIGWWPAKAVTFVDN  312

Query  983   HDTWS-QRLWPFTTSTDDAVNHDRVLQGYAYILTHPGIPSVFYDHFFEWGLKDAISKLIS  1159
             HDT S Q++WPF +        D+V+QGYAYILTHPG P +FYDHFF+WGLK+ I+ L++
Sbjct  313   HDTGSTQQMWPFPS--------DKVMQGYAYILTHPGNPCIFYDHFFDWGLKEQIAALVA  364

Query  1160  IRNKNGVSATSPVEILAADADLYIAKINGKVILKIGPNGDLKNLVPSDFMLATSGKDFAV  1339
             +R +NGV+ATS ++I+  DAD Y+A+I+GKV++KIG   D+ +L+P  F LA  G  +AV
Sbjct  365   VRQRNGVTATSSLKIMLHDADAYVAEIDGKVVMKIGSRYDVSSLIPPGFHLAAHGNGYAV  424

Query  1340  WEK  1348
             WEK
Sbjct  425   WEK  427



>gb|ADC54276.1| alpha amylase [Hordeum vulgare subsp. spontaneum]
Length=414

 Score =   435 bits (1118),  Expect = 8e-145, Method: Compositional matrix adjust.
 Identities = 224/427 (52%), Positives = 297/427 (70%), Gaps = 21/427 (5%)
 Frame = +2

Query  113   VLFQGFTWTSKDQPGGWWNWLITKVPDLADAGITHVWLPPPSNAREGDDQGYMPKRMYDL  292
             VLFQGF W S  Q GGW+N ++ KV D+A AG+THVWLPPPS++    ++GYMP R+YD+
Sbjct  3     VLFQGFNWESWKQSGGWYNMMMGKVDDIAAAGVTHVWLPPPSHSVS--NEGYMPGRLYDI  60

Query  293   DTSKYGNKKELKALNDAFHGRGIKSVADIVLNHRAAERANSRGVFNVFEGGTPDDKLDWG  472
             D SKYGN  ELK+L  A HG+G++++ADIV+NHR A+  ++RG++ +FEGGT D +LDWG
Sbjct  61    DASKYGNAAELKSLIGALHGKGVQAIADIVINHRCADYKDNRGIYCIFEGGTSDGRLDWG  120

Query  473   PSEICGDDAAF-EGTGNPDTGDPWGDAPDIDHRSPRVQREISEWMNWLKSDVGFDGWRFD  649
             P  IC DD  + +GT N DTG  +  APDIDH + RVQRE+ EW+ WLKSD+GFD WR D
Sbjct  121   PHMICRDDTKYADGTANLDTGADFAAAPDIDHLNDRVQRELKEWLLWLKSDLGFDAWRLD  180

Query  650   YVKGYDFVKGFAAVKIYMDNTKPEFAVGELWNALSPGSVPNPDYNQDAHRNELVRWVQNa  829
             + +GY         K+Y+D T P  AV E+W+ ++ G    P+Y+QDAHR  LV WV   
Sbjct  181   FARGYSP----EMAKVYIDGTSPSLAVAEVWDNMATGGDGKPNYDQDAHRQNLVNWVDKV  236

Query  830   ggaatafdf---ttKGILQAALNNTELWRLKDAAGKPSGMIGVLPQSAVTFIDNHDTWS-  997
             GGAA+A      TTKGIL AA+   ELWRL D  GK  G++G  P  AVTF+DNHDT S 
Sbjct  237   GGAASAGMVFDFTTKGILNAAVEG-ELWRLIDPQGKAPGVMGWWPAKAVTFVDNHDTGST  295

Query  998   QRLWPFTTSTDDAVNHDRVLQGYAYILTHPGIPSVFYDHFFEWGLKDAISKLISIRNKNG  1177
             Q +WPF +        D+V+QGYAYILTHPG P +FYD FF WG KD I+ L++IR +NG
Sbjct  296   QAMWPFPS--------DKVMQGYAYILTHPGTPCIFYDRFFNWGFKDEIAALVAIRKRNG  347

Query  1178  VSATSPVEILAADADLYIAKINGKVILKIGPNGDLKNLVPSDFMLATSGKDFAVWEK-PT  1354
             ++ATS ++IL  + D Y+A+I+GKV++KIG   D+  ++P+ F  +  GKD+AVWEK  T
Sbjct  348   ITATSALKILMHEGDAYVAEIDGKVVVKIGTRYDVGAVIPAGFATSAHGKDYAVWEKTAT  407

Query  1355  *SRLQIS  1375
              + LQ S
Sbjct  408   AATLQRS  414



>sp|A2YGY2.1|AMY2A_ORYSI RecName: Full=Alpha-amylase isozyme 2A; AltName: Full=1,4-alpha-D-glucan 
glucanohydrolase; AltName: Full=Alpha-amylase isozyme 
C2; Flags: Precursor [Oryza sativa Indica Group]
 gb|EAZ02343.1| hypothetical protein OsI_24446 [Oryza sativa Indica Group]
Length=446

 Score =   436 bits (1121),  Expect = 9e-145, Method: Compositional matrix adjust.
 Identities = 225/423 (53%), Positives = 295/423 (70%), Gaps = 22/423 (5%)
 Frame = +2

Query  101   SSSTVLFQGFTWTSKDQPGGWWNWLITKVPDLADAGITHVWLPPPSNAREGDDQGYMPKR  280
             S   +LFQGF W S  Q GGW+N L+ KV D+  AG+THVWLPPPS++     QGYMP R
Sbjct  20    SGDKILFQGFNWESWRQSGGWYNLLMGKVDDIVAAGVTHVWLPPPSHSVS--TQGYMPGR  77

Query  281   MYDLDTSKYGNKKELKALNDAFHGRGIKSVADIVLNHRAAERANSRGVFNVFEGGTPDDK  460
             +YDLD S+YG   ELK+L  A HG+GI+++AD+V+NHR A+  +SRG++ +FEGGTPD +
Sbjct  78    LYDLDASRYGTSMELKSLISALHGKGIQAIADVVINHRCADYKDSRGIYCIFEGGTPDGR  137

Query  461   LDWGPSEICGDDAAF-EGTGNPDTGDPWGDAPDIDHRSPRVQREISEWMNWLKSD-VGFD  634
             LDWGP  IC DD  F +GTGN DTG  +  APDIDH +  VQRE+++W+ WLKSD VGFD
Sbjct  138   LDWGPHMICRDDTQFSDGTGNLDTGADFAAAPDIDHLNGVVQRELTDWLLWLKSDEVGFD  197

Query  635   GWRFDYVKGYDFVKGFAAVKIYMDNTKP-EFAVGELWNALSPGSVPNPDYNQDAHRNELV  811
              WR D+ +GY         K+Y++ T P   AV ELW++++ G    P+YNQDAHR  LV
Sbjct  198   AWRLDFARGYSP----EVAKVYIEGTTPVGLAVAELWDSMAYGGDGKPEYNQDAHRQALV  253

Query  812   RWVQNaggaatafdf---ttKGILQAALNNTELWRLKDAAGKPSGMIGVLPQSAVTFIDN  982
              WV   GG A+A      TTKGI+  A+   ELWRL D  GK  G+IG  P  AVTF+DN
Sbjct  254   DWVDRVGGTASAGMVFDFTTKGIMNTAVEG-ELWRLIDQQGKAPGVIGWWPAKAVTFVDN  312

Query  983   HDTWS-QRLWPFTTSTDDAVNHDRVLQGYAYILTHPGIPSVFYDHFFEWGLKDAISKLIS  1159
             HDT S Q++WPF +        D+V+QGYAYILTHPG P +FYDHFF+WGLK+ I+ L++
Sbjct  313   HDTGSTQQMWPFPS--------DKVMQGYAYILTHPGNPCIFYDHFFDWGLKEQIAALVA  364

Query  1160  IRNKNGVSATSPVEILAADADLYIAKINGKVILKIGPNGDLKNLVPSDFMLATSGKDFAV  1339
             +R +NGV+ATS ++I+  DAD Y+A+I+GKV++KIG   D+ +L+P  F LA  G  +AV
Sbjct  365   VRQRNGVTATSSLKIMLHDADAYVAEIDGKVVMKIGSRYDVSSLIPPGFHLAAHGNGYAV  424

Query  1340  WEK  1348
             WEK
Sbjct  425   WEK  427



>gb|ADC54368.1| alpha amylase [Hordeum vulgare subsp. spontaneum]
Length=414

 Score =   434 bits (1117),  Expect = 1e-144, Method: Compositional matrix adjust.
 Identities = 220/417 (53%), Positives = 290/417 (70%), Gaps = 20/417 (5%)
 Frame = +2

Query  113   VLFQGFTWTSKDQPGGWWNWLITKVPDLADAGITHVWLPPPSNAREGDDQGYMPKRMYDL  292
             VLFQGF W S  Q GGW+N ++ KV D+A AG+THVWLPPPS++     +GYMP R+YD+
Sbjct  3     VLFQGFNWESWKQSGGWYNMMLGKVDDIAAAGVTHVWLPPPSHSVAA--EGYMPGRLYDI  60

Query  293   DTSKYGNKKELKALNDAFHGRGIKSVADIVLNHRAAERANSRGVFNVFEGGTPDDKLDWG  472
             D SKYGN  ELK+L  A HG+G++++ADIV+NHR A+  +SRG++ ++EGGT D +LDWG
Sbjct  61    DASKYGNAAELKSLIGALHGKGVQAIADIVINHRCADYKDSRGIYCIYEGGTSDSRLDWG  120

Query  473   PSEICGDDAAF-EGTGNPDTGDPWGDAPDIDHRSPRVQREISEWMNWLKSDVGFDGWRFD  649
             P  IC DD  + +GT N DTG  + DAPDIDH + RVQ E+ EW+ WLKSD+GFD WR D
Sbjct  121   PHMICRDDTKYSDGTANLDTGADYADAPDIDHLNHRVQSELKEWLLWLKSDLGFDAWRLD  180

Query  650   YVKGYDFVKGFAAVKIYMDNTKPEFAVGELWNALSPGSVPNPDYNQDAHRNELVRWVQNa  829
             + +GY         K+Y+D T P  AV E+W+ + PG    P+Y+QDAHR  LV WV   
Sbjct  181   FARGYSA----EMAKVYIDGTSPSLAVAEIWDGMVPGGDGKPNYDQDAHRQNLVNWVDKV  236

Query  830   ggaatafdf---ttKGILQAALNNTELWRLKDAAGKPSGMIGVLPQSAVTFIDNHDTWS-  997
             GGAA+A      TTKGIL  A+   ELWRL D  GK  G++G  P  AVTFIDNHDT S 
Sbjct  237   GGAASAGMVFDFTTKGILNVAVEG-ELWRLIDPQGKAPGVMGWWPAKAVTFIDNHDTGST  295

Query  998   QRLWPFTTSTDDAVNHDRVLQGYAYILTHPGIPSVFYDHFFEWGLKDAISKLISIRNKNG  1177
             Q  WPF +        D+++QGYAYILTH GIP +FYDHFF  G KD I+ L++IR +NG
Sbjct  296   QAKWPFPS--------DKIMQGYAYILTHSGIPCIFYDHFFNLGFKDEIAALVAIRKRNG  347

Query  1178  VSATSPVEILAADADLYIAKINGKVILKIGPNGDLKNLVPSDFMLATSGKDFAVWEK  1348
             ++ATS ++IL  D D Y+A+I+ KV++KIG   +L  ++P+ F+ + +GKD+AVWEK
Sbjct  348   ITATSALKILMHDGDAYVAEIDSKVVVKIGSRYELGAVIPARFVTSANGKDYAVWEK  404



>gb|ADC54284.1| alpha amylase [Hordeum vulgare subsp. spontaneum]
Length=414

 Score =   434 bits (1117),  Expect = 1e-144, Method: Compositional matrix adjust.
 Identities = 224/427 (52%), Positives = 296/427 (69%), Gaps = 21/427 (5%)
 Frame = +2

Query  113   VLFQGFTWTSKDQPGGWWNWLITKVPDLADAGITHVWLPPPSNAREGDDQGYMPKRMYDL  292
             VLFQGF W S  Q GGW+N ++ KV D+A AG+THVWLPPPS++    ++GYMP R+YD+
Sbjct  3     VLFQGFNWESWKQSGGWYNMMMGKVDDIAAAGVTHVWLPPPSHSVS--NEGYMPGRLYDI  60

Query  293   DTSKYGNKKELKALNDAFHGRGIKSVADIVLNHRAAERANSRGVFNVFEGGTPDDKLDWG  472
             D SKYGN  ELK+L  A HG+G++++ADIV+NHR A+  ++RG++ +FEG T D +LDWG
Sbjct  61    DASKYGNAAELKSLIGALHGKGVQAIADIVINHRCADYKDNRGIYCIFEGSTSDGRLDWG  120

Query  473   PSEICGDDAAF-EGTGNPDTGDPWGDAPDIDHRSPRVQREISEWMNWLKSDVGFDGWRFD  649
             P  IC DD  + +GT N DTG  +  APDIDH + RVQRE+ EW+ WLKSD+GFD WR D
Sbjct  121   PHMICRDDTKYADGTANLDTGADFAAAPDIDHLNDRVQRELKEWLLWLKSDLGFDAWRLD  180

Query  650   YVKGYDFVKGFAAVKIYMDNTKPEFAVGELWNALSPGSVPNPDYNQDAHRNELVRWVQNa  829
             + +GY         K+Y+D T P  AV E+W+ ++ G    P+Y+QDAHR  LV WV   
Sbjct  181   FARGYSP----EMAKVYIDGTSPSLAVAEVWDNMATGGDGKPNYDQDAHRQNLVNWVDKV  236

Query  830   ggaatafdf---ttKGILQAALNNTELWRLKDAAGKPSGMIGVLPQSAVTFIDNHDTWS-  997
             GGAA+A      TTKGIL AA+   ELWRL D  GK  G++G  P  AVTF+DNHDT S 
Sbjct  237   GGAASAGMVFDFTTKGILNAAVEG-ELWRLIDPQGKAPGVMGWWPAKAVTFVDNHDTGST  295

Query  998   QRLWPFTTSTDDAVNHDRVLQGYAYILTHPGIPSVFYDHFFEWGLKDAISKLISIRNKNG  1177
             Q +WPF +        D+V+QGYAYILTHPG P +FYDHFF WG KD I+ L++IR +NG
Sbjct  296   QAMWPFPS--------DKVMQGYAYILTHPGTPCIFYDHFFNWGFKDEIAALVAIRKRNG  347

Query  1178  VSATSPVEILAADADLYIAKINGKVILKIGPNGDLKNLVPSDFMLATSGKDFAVWEK-PT  1354
             ++ATS ++IL  + D Y+A I+GKV++KIG   D+  ++P+ F  +  GKD+AVWEK  T
Sbjct  348   ITATSALKILMHEGDAYVAGIDGKVVVKIGTRYDVGAVIPAGFATSAHGKDYAVWEKTAT  407

Query  1355  *SRLQIS  1375
              + LQ S
Sbjct  408   AATLQRS  414



>ref|XP_008651084.1| PREDICTED: uncharacterized protein LOC100273029 isoform X1 [Zea 
mays]
 tpg|DAA61291.1| TPA: putative alpha-amylase family protein [Zea mays]
Length=433

 Score =   435 bits (1119),  Expect = 1e-144, Method: Compositional matrix adjust.
 Identities = 227/422 (54%), Positives = 293/422 (69%), Gaps = 21/422 (5%)
 Frame = +2

Query  101   SSSTVLFQGFTWTSKDQPGGWWNWLITKVPDLADAGITHVWLPPPSNAREGDDQGYMPKR  280
             +S  VLFQ F W S  Q GGW+N L+ KV D+A AG+THVWLPPPS++     QGYMP R
Sbjct  18    ASGQVLFQAFNWESWKQSGGWYNLLMGKVDDIASAGVTHVWLPPPSHSVS--TQGYMPGR  75

Query  281   MYDLDTSKYGNKKELKALNDAFHGRGIKSVADIVLNHRAAERANSRGVFNVFEGGTPDDK  460
             +YDLD SKYG   ELK+L  AFHG+G++ VADIV+NHR A+  ++RG++ +FEGGTPD +
Sbjct  76    LYDLDASKYGTAAELKSLIAAFHGKGVQVVADIVINHRCADYKDARGIYCIFEGGTPDGR  135

Query  461   LDWGPSEICGDDAAF-EGTGNPDTGDPWGDAPDIDHRSPRVQREISEWMNWLKS-DVGFD  634
             LDWGP  IC DD  + +GT N DTG  +  APDIDH + RVQRE+++W+ WLKS D+GFD
Sbjct  136   LDWGPHMICRDDTIYSDGTANLDTGADFAAAPDIDHLNDRVQRELTDWLLWLKSSDLGFD  195

Query  635   GWRFDYVKGYDFVKGFAAVKIYMDNTKPEFAVGELWNALSPGSVPNPDYNQDAHRNELVR  814
              WR D+ KGY         K+Y+D T P FAV E+WN+++      P+Y+QD HR  LV 
Sbjct  196   AWRLDFAKGY----SPEVAKVYVDATAPTFAVAEVWNSMAYDGDNKPEYDQDPHRQALVD  251

Query  815   WVQNaggaatafdf---ttKGILQAALNNTELWRLKDAAGKPSGMIGVLPQSAVTFIDNH  985
             WV   GGAA+       TTKGIL AA+   ELWRL D  GK  G+IG  P  AVTF+DNH
Sbjct  252   WVDRVGGAASPATVFDFTTKGILNAAVEG-ELWRLIDPQGKAPGVIGWWPAKAVTFVDNH  310

Query  986   DTWS-QRLWPFTTSTDDAVNHDRVLQGYAYILTHPGIPSVFYDHFFEWGLKDAISKLISI  1162
             DT S Q +WPF +        D+V+QGYAYILTHPG P +FYDHFF+WG KD I+ L+++
Sbjct  311   DTGSTQAMWPFPS--------DKVMQGYAYILTHPGNPCIFYDHFFDWGFKDEIAALVAV  362

Query  1163  RNKNGVSATSPVEILAADADLYIAKINGKVILKIGPNGDLKNLVPSDFMLATSGKDFAVW  1342
             R +NG++ TS + IL  D D Y+A+I+GKVI+KIG   D+ +L+P+ F +A  G D+AVW
Sbjct  363   RKRNGITPTSELTILEHDGDSYVAEIDGKVIVKIGSRYDVGHLIPAGFEVAAHGNDYAVW  422

Query  1343  EK  1348
             EK
Sbjct  423   EK  424



>gb|ADC54321.1| alpha amylase [Hordeum vulgare subsp. spontaneum]
Length=414

 Score =   434 bits (1117),  Expect = 1e-144, Method: Compositional matrix adjust.
 Identities = 219/417 (53%), Positives = 291/417 (70%), Gaps = 20/417 (5%)
 Frame = +2

Query  113   VLFQGFTWTSKDQPGGWWNWLITKVPDLADAGITHVWLPPPSNAREGDDQGYMPKRMYDL  292
             VLFQGF W S  Q GGW+N ++ KV D+A AG+ HVWLPPPS++    ++GYMP R+YD+
Sbjct  3     VLFQGFNWESWKQSGGWYNMMMGKVDDIAAAGVAHVWLPPPSHSVS--NEGYMPGRLYDI  60

Query  293   DTSKYGNKKELKALNDAFHGRGIKSVADIVLNHRAAERANSRGVFNVFEGGTPDDKLDWG  472
             D SKYGN  ELK+L  A HG+G++++ADIV+NHR A+  ++RG++ +FEGGT D +LDWG
Sbjct  61    DASKYGNAAELKSLIGALHGKGVQAIADIVINHRCADYKDNRGIYCIFEGGTSDGRLDWG  120

Query  473   PSEICGDDAAF-EGTGNPDTGDPWGDAPDIDHRSPRVQREISEWMNWLKSDVGFDGWRFD  649
             P  IC DD  + +GT N DTG  +  APDIDH + RVQRE+ EW+ WLKSD+GFD WR D
Sbjct  121   PHMICRDDTKYADGTANLDTGADFAAAPDIDHLNDRVQRELKEWLLWLKSDLGFDAWRLD  180

Query  650   YVKGYDFVKGFAAVKIYMDNTKPEFAVGELWNALSPGSVPNPDYNQDAHRNELVRWVQNa  829
             + +GY         K+Y+D T P  AV E+W+ ++ G    P+Y+QDAHR  LV WV   
Sbjct  181   FARGYSP----EMAKVYIDGTSPSLAVAEVWDNMATGGDGKPNYDQDAHRQNLVNWVDKV  236

Query  830   ggaatafdf---ttKGILQAALNNTELWRLKDAAGKPSGMIGVLPQSAVTFIDNHDTWS-  997
             GGAA+A      TTKGIL AA+   ELWRL D  GK  G++G  P  A TF+DNHDT S 
Sbjct  237   GGAASAGMVFDFTTKGILNAAVEG-ELWRLIDPQGKAPGVMGWWPAKAATFVDNHDTGST  295

Query  998   QRLWPFTTSTDDAVNHDRVLQGYAYILTHPGIPSVFYDHFFEWGLKDAISKLISIRNKNG  1177
             Q +WPF +        D+V+QGYAYILTHPG P +FYDHFF WG KD I+ L++IR +NG
Sbjct  296   QAMWPFPS--------DKVMQGYAYILTHPGTPCIFYDHFFNWGFKDEIAALVAIRKRNG  347

Query  1178  VSATSPVEILAADADLYIAKINGKVILKIGPNGDLKNLVPSDFMLATSGKDFAVWEK  1348
             ++ATS ++IL  + D Y+A+I+GKV++KIG   D+  ++P+ F  +  GKD+AVWEK
Sbjct  348   ITATSALKILMHEGDAYVAEIDGKVVVKIGTRYDVGAVIPAGFATSAHGKDYAVWEK  404



>gb|AAA91883.1| alpha-amylase, partial [Solanum tuberosum]
Length=349

 Score =   432 bits (1110),  Expect = 1e-144, Method: Compositional matrix adjust.
 Identities = 224/352 (64%), Positives = 276/352 (78%), Gaps = 15/352 (4%)
 Frame = +2

Query  299   SKYGNKKELKALNDAFHGRGIKSVADIVLNHRAAERANSRGVFNVFEGGTPDDKLDWGPS  478
             SK+GN+++LK L  A H  GIKSVADIV+NHR A+  +SRG++++FEGGT DD+LDWGPS
Sbjct  9     SKFGNQQQLKTLIKALHDHGIKSVADIVINHRTADNKDSRGIYSIFEGGTSDDRLDWGPS  68

Query  479   EICGDDAAF-EGTGNPDTGDPWGDAPDIDHRSPRVQREISEWMNWLKSDVGFDGWRFDYV  655
              IC +D  + +GTGNPDTG  +  APDIDH + RVQ+E+S+WMNWLKS++GFDGWRFD+V
Sbjct  69    FICKNDTQYSDGTGNPDTGLDFEPAPDIDHLNTRVQKELSDWMNWLKSEIGFDGWRFDFV  128

Query  656   KGYDFVKGFAAVKIYMDNTKPEFAVGELWNALSPGSVPNPDYNQDAHRNELVRWVQNagg  835
             +GY         KIYM NT P+FAVGE WN+L+ G    P+YNQD HRNELV WV+NAG 
Sbjct  129   RGY----APCITKIYMRNTSPDFAVGEFWNSLAYGQDGKPEYNQDNHRNELVGWVKNAGR  184

Query  836   aatafdfttKGILQAALNNTELWRLKDAAGKPSGMIGVLPQSAVTFIDNHDTWS-QRLWP  1012
             A TAFDFTTKGILQAA+   ELWRLKD  GKP GMIGVLP+ AVTFIDNHDT S Q +WP
Sbjct  185   AVTAFDFTTKGILQAAVQG-ELWRLKDPNGKPPGMIGVLPRKAVTFIDNHDTGSTQNMWP  243

Query  1013  FTTSTDDAVNHDRVLQGYAYILTHPGIPSVFYDHFFEWGLKDAISKLISIRNKNGVSATS  1192
             F +        D+V+QGYAYILTHPGIPSVFYDHFF+WG  D IS LISIR +N + ATS
Sbjct  244   FPS--------DKVMQGYAYILTHPGIPSVFYDHFFDWGFMDGISALISIRKRNRICATS  295

Query  1193  PVEILAADADLYIAKINGKVILKIGPNGDLKNLVPSDFMLATSGKDFAVWEK  1348
              V+I+A+D+DLYIA I+ K+I+KIGP  DL NL+P ++ +ATSG+D+AVWE+
Sbjct  296   NVQIMASDSDLYIAMIHHKIIVKIGPKLDLGNLIPPNYEVATSGQDYAVWEQ  347



>gb|ADC54348.1| alpha amylase [Hordeum vulgare subsp. spontaneum]
Length=414

 Score =   434 bits (1116),  Expect = 1e-144, Method: Compositional matrix adjust.
 Identities = 219/417 (53%), Positives = 292/417 (70%), Gaps = 20/417 (5%)
 Frame = +2

Query  113   VLFQGFTWTSKDQPGGWWNWLITKVPDLADAGITHVWLPPPSNAREGDDQGYMPKRMYDL  292
             VLFQGF W S  Q GGW+N ++ KV D+A AG+THVWLPPPS++    ++GYMP R+YD+
Sbjct  3     VLFQGFNWESWKQSGGWYNMMMGKVDDIAAAGVTHVWLPPPSHSVS--NEGYMPGRLYDI  60

Query  293   DTSKYGNKKELKALNDAFHGRGIKSVADIVLNHRAAERANSRGVFNVFEGGTPDDKLDWG  472
             D SKYGN  ELK+L  A HG+G++++ADIV+NHR A+  ++RG++ +FEGGT D +LDWG
Sbjct  61    DASKYGNAAELKSLISALHGKGVQAMADIVINHRCADYKDNRGIYCIFEGGTSDGRLDWG  120

Query  473   PSEICGDDAAF-EGTGNPDTGDPWGDAPDIDHRSPRVQREISEWMNWLKSDVGFDGWRFD  649
             P  IC DD  + +GT N DTG  +  APDIDH + RVQRE+ EW+ WLKSD+GFD WR D
Sbjct  121   PHMICRDDTKYADGTANLDTGADFAAAPDIDHLNDRVQRELKEWLLWLKSDLGFDAWRLD  180

Query  650   YVKGYDFVKGFAAVKIYMDNTKPEFAVGELWNALSPGSVPNPDYNQDAHRNELVRWVQNa  829
             + +GY         K+Y+D T P  AV E+W+ ++ G    P+Y+QDAHR  LV WV   
Sbjct  181   FARGYSP----EMAKVYIDGTSPSLAVAEVWDNMATGGDGKPNYDQDAHRQNLVNWVDKV  236

Query  830   ggaatafdf---ttKGILQAALNNTELWRLKDAAGKPSGMIGVLPQSAVTFIDNHDTWS-  997
             GGAA+A      TTKGIL  A+   ELWRL D  GK  G++G  P  AVTF+DNHDT S 
Sbjct  237   GGAASAGMVFDFTTKGILNTAVEG-ELWRLIDPQGKAPGVMGWWPAKAVTFVDNHDTGST  295

Query  998   QRLWPFTTSTDDAVNHDRVLQGYAYILTHPGIPSVFYDHFFEWGLKDAISKLISIRNKNG  1177
             Q +WPF +        D+V+QGYAYILTHPG P +FYDHFF WG KD I+ L++IR +NG
Sbjct  296   QAMWPFPS--------DKVMQGYAYILTHPGTPCIFYDHFFNWGFKDQIAALVAIRKRNG  347

Query  1178  VSATSPVEILAADADLYIAKINGKVILKIGPNGDLKNLVPSDFMLATSGKDFAVWEK  1348
             ++ATS ++IL  + D Y+A+I+GKV++KIG   D+  ++P+ F+ +  G D+AVWEK
Sbjct  348   ITATSALKILMHEGDAYVAEIDGKVVVKIGSRYDVGAVIPAGFVTSAHGNDYAVWEK  404



>ref|NP_001058568.1| Os06g0713800 [Oryza sativa Japonica Group]
 sp|Q0D9J1.1|AMY2A_ORYSJ RecName: Full=Alpha-amylase isozyme 2A; AltName: Full=1,4-alpha-D-glucan 
glucanohydrolase; AltName: Full=Alpha-amylase isozyme 
C2; Flags: Precursor [Oryza sativa Japonica Group]
 dbj|BAD54103.1| alpha-amylase isozyme 2A precursor [Oryza sativa Japonica Group]
 dbj|BAF20482.1| Os06g0713800 [Oryza sativa Japonica Group]
 dbj|BAG94883.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG87072.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE66350.1| hypothetical protein OsJ_22644 [Oryza sativa Japonica Group]
Length=445

 Score =   435 bits (1119),  Expect = 1e-144, Method: Compositional matrix adjust.
 Identities = 225/423 (53%), Positives = 295/423 (70%), Gaps = 22/423 (5%)
 Frame = +2

Query  101   SSSTVLFQGFTWTSKDQPGGWWNWLITKVPDLADAGITHVWLPPPSNAREGDDQGYMPKR  280
             S   +LFQGF W S  Q GGW+N L+ KV D+  AG+THVWLPPPS++     QGYMP R
Sbjct  20    SGDKILFQGFNWESWRQSGGWYNLLMGKVDDIVAAGVTHVWLPPPSHSVS--TQGYMPGR  77

Query  281   MYDLDTSKYGNKKELKALNDAFHGRGIKSVADIVLNHRAAERANSRGVFNVFEGGTPDDK  460
             +YDLD S+YG   ELK+L  A HG+GI+++AD+V+NHR A+  +SRG++ +FEGGTPD +
Sbjct  78    LYDLDASRYGTSMELKSLISALHGKGIQAIADVVINHRCADYKDSRGIYCIFEGGTPDGR  137

Query  461   LDWGPSEICGDDAAF-EGTGNPDTGDPWGDAPDIDHRSPRVQREISEWMNWLKSD-VGFD  634
             LDWGP  IC DD  F +GTGN DTG  +  APDIDH +  VQRE+++W+ WLKSD VGFD
Sbjct  138   LDWGPHMICRDDTQFSDGTGNLDTGADFAAAPDIDHLNGVVQRELTDWLLWLKSDEVGFD  197

Query  635   GWRFDYVKGYDFVKGFAAVKIYMDNTKP-EFAVGELWNALSPGSVPNPDYNQDAHRNELV  811
              WR D+ +GY         K+Y++ T P   AV ELW++++ G    P+YNQDAHR  LV
Sbjct  198   AWRLDFARGYSP----EVAKVYIEGTTPVGLAVAELWDSMAYGGDGKPEYNQDAHRQALV  253

Query  812   RWVQNaggaatafdf---ttKGILQAALNNTELWRLKDAAGKPSGMIGVLPQSAVTFIDN  982
              WV   GG A+A      TTKGI+  A+   ELWRL D  GK  G+IG  P  AVTF+DN
Sbjct  254   DWVDRVGGTASAGMVFDFTTKGIMNTAVEG-ELWRLIDQQGKAPGVIGWWPAKAVTFVDN  312

Query  983   HDTWS-QRLWPFTTSTDDAVNHDRVLQGYAYILTHPGIPSVFYDHFFEWGLKDAISKLIS  1159
             HDT S Q++WPF +        D+V+QGYAYILTHPG P +FYDHFF+WGLK+ I+ L++
Sbjct  313   HDTGSTQQMWPFPS--------DKVMQGYAYILTHPGNPCIFYDHFFDWGLKEQIAALVA  364

Query  1160  IRNKNGVSATSPVEILAADADLYIAKINGKVILKIGPNGDLKNLVPSDFMLATSGKDFAV  1339
             +R +NGV+ATS ++I+  DAD Y+A+I+GKV++KIG   D+ +L+P  F LA  G  +AV
Sbjct  365   VRQRNGVTATSSLKIMLHDADAYVAEIDGKVVMKIGSRYDVSSLIPPGFHLAAHGNGYAV  424

Query  1340  WEK  1348
             WEK
Sbjct  425   WEK  427



>gb|ADC54278.1| alpha amylase [Hordeum vulgare subsp. spontaneum]
Length=414

 Score =   434 bits (1116),  Expect = 2e-144, Method: Compositional matrix adjust.
 Identities = 224/427 (52%), Positives = 297/427 (70%), Gaps = 21/427 (5%)
 Frame = +2

Query  113   VLFQGFTWTSKDQPGGWWNWLITKVPDLADAGITHVWLPPPSNAREGDDQGYMPKRMYDL  292
             VLFQGF W S  Q GGW+N ++ KV D+A AG+THVWLPPPS++    ++GYMP R+YD+
Sbjct  3     VLFQGFNWESWKQSGGWYNMMMGKVDDIAAAGVTHVWLPPPSHSVS--NEGYMPGRLYDI  60

Query  293   DTSKYGNKKELKALNDAFHGRGIKSVADIVLNHRAAERANSRGVFNVFEGGTPDDKLDWG  472
             D SKYGN  ELK+L  A HG+G++++ADIV+NHR A+  ++RG++ +FEGGT D +LDWG
Sbjct  61    DASKYGNAAELKSLIGALHGKGVQAIADIVINHRCADYKDNRGIYCIFEGGTSDGRLDWG  120

Query  473   PSEICGDDAAF-EGTGNPDTGDPWGDAPDIDHRSPRVQREISEWMNWLKSDVGFDGWRFD  649
             P  IC DD  + +GT N DTG  +  APDIDH + RVQRE+ EW+ WLKSD+GFD WR D
Sbjct  121   PHMICRDDTKYADGTANLDTGADFAAAPDIDHLNDRVQRELKEWLLWLKSDLGFDAWRLD  180

Query  650   YVKGYDFVKGFAAVKIYMDNTKPEFAVGELWNALSPGSVPNPDYNQDAHRNELVRWVQNa  829
             + +GY         K+Y+D T P  AV E+W+ ++ G    P+Y+QDAHR  LV WV   
Sbjct  181   FARGYSP----EMAKVYIDGTSPSLAVAEVWDNMATGGDGKPNYDQDAHRQNLVNWVDKV  236

Query  830   ggaatafdf---ttKGILQAALNNTELWRLKDAAGKPSGMIGVLPQSAVTFIDNHDTWS-  997
             GGAA+A      TTKGIL AA+   ELWRL D  GK  G++G  P  AVTF+DNHDT S 
Sbjct  237   GGAASAGMVFDFTTKGILNAAVEG-ELWRLIDPQGKAPGVMGWWPAKAVTFVDNHDTGST  295

Query  998   QRLWPFTTSTDDAVNHDRVLQGYAYILTHPGIPSVFYDHFFEWGLKDAISKLISIRNKNG  1177
             Q + PF +        D+V+QGYAYILTHPG P +FYDHFF WG KD I+ L++IR +NG
Sbjct  296   QAMLPFPS--------DKVMQGYAYILTHPGTPCIFYDHFFNWGFKDEIAALVAIRKRNG  347

Query  1178  VSATSPVEILAADADLYIAKINGKVILKIGPNGDLKNLVPSDFMLATSGKDFAVWEK-PT  1354
             ++ATS ++IL  + D Y+A+I+GKV++KIG   D+  ++P+ F  +  GKD+AVWEK  T
Sbjct  348   ITATSALKILMHEGDAYVAEIDGKVVVKIGTRYDVGAVIPAGFATSAHGKDYAVWEKTAT  407

Query  1355  *SRLQIS  1375
              + LQ S
Sbjct  408   AATLQRS  414



>gb|ADC54334.1| alpha amylase [Hordeum vulgare subsp. spontaneum]
Length=414

 Score =   434 bits (1115),  Expect = 2e-144, Method: Compositional matrix adjust.
 Identities = 222/427 (52%), Positives = 296/427 (69%), Gaps = 21/427 (5%)
 Frame = +2

Query  113   VLFQGFTWTSKDQPGGWWNWLITKVPDLADAGITHVWLPPPSNAREGDDQGYMPKRMYDL  292
             VLFQGF W S  Q GGW+N ++ K+ D+A AG+THVWLPPPS++    ++GYMP R+YD+
Sbjct  3     VLFQGFNWESWKQSGGWYNMMMGKIDDIAAAGVTHVWLPPPSHSVS--NEGYMPGRLYDI  60

Query  293   DTSKYGNKKELKALNDAFHGRGIKSVADIVLNHRAAERANSRGVFNVFEGGTPDDKLDWG  472
             D SKYGN  ELK+L  A HG+G++++ADIV+NHR A+  ++RG++ +FEGG  D +LDWG
Sbjct  61    DASKYGNAAELKSLIGALHGKGVQAIADIVINHRCADYKDNRGIYCIFEGGASDGRLDWG  120

Query  473   PSEICGDDAAF-EGTGNPDTGDPWGDAPDIDHRSPRVQREISEWMNWLKSDVGFDGWRFD  649
             P  IC DD  + +GT N DTG  +  APDIDH + RVQRE+ EW+ WLK D+GFD WR D
Sbjct  121   PHMICRDDTKYADGTANLDTGADFAAAPDIDHLNDRVQRELKEWLLWLKGDLGFDAWRLD  180

Query  650   YVKGYDFVKGFAAVKIYMDNTKPEFAVGELWNALSPGSVPNPDYNQDAHRNELVRWVQNa  829
             + +GY         K+Y+D T P  AV E+W+ ++ G    P+Y+QDAHR  LV WV   
Sbjct  181   FARGYSP----EMAKVYIDGTSPSLAVAEVWDNMATGGDGKPNYDQDAHRQNLVNWVDKV  236

Query  830   ggaatafdf---ttKGILQAALNNTELWRLKDAAGKPSGMIGVLPQSAVTFIDNHDTWS-  997
             GGAA+A      TTKGIL AA+   ELWRL D  GK  G++G  P  AVTF+DNHDT S 
Sbjct  237   GGAASAGVVFDFTTKGILNAAVEG-ELWRLIDPQGKAPGVMGWWPAKAVTFVDNHDTGST  295

Query  998   QRLWPFTTSTDDAVNHDRVLQGYAYILTHPGIPSVFYDHFFEWGLKDAISKLISIRNKNG  1177
             Q +WPF +        D+V+QGYAYILTHPG P +FYDHFF WG KD I+ L++IR +NG
Sbjct  296   QAMWPFPS--------DKVMQGYAYILTHPGTPCIFYDHFFNWGFKDEIAALVAIRKRNG  347

Query  1178  VSATSPVEILAADADLYIAKINGKVILKIGPNGDLKNLVPSDFMLATSGKDFAVWEK-PT  1354
             ++ATS ++IL  + D Y+A+I+GKV++KIG   D+  ++P+ F  +  GKD+AVWEK  T
Sbjct  348   ITATSALKILMHEGDAYVAEIDGKVVVKIGTRYDVGAVIPAGFATSAHGKDYAVWEKTAT  407

Query  1355  *SRLQIS  1375
              + LQ S
Sbjct  408   AATLQRS  414



>ref|XP_008220223.1| PREDICTED: LOW QUALITY PROTEIN: pentatricopeptide repeat-containing 
protein At2g04860 [Prunus mume]
Length=1127

 Score =   456 bits (1172),  Expect = 2e-144, Method: Compositional matrix adjust.
 Identities = 245/439 (56%), Positives = 310/439 (71%), Gaps = 22/439 (5%)
 Frame = +2

Query  50    SFYLSL-FCIAFFLFPLHSSSTVLFQGFTWTSKDQPGGWWNWLITKVPDLADAGITHVWL  226
             +F LS  FC+     P  ++  VLFQGF W S  + GGW+N L T +P+LA +GITHVWL
Sbjct  21    NFLLSFCFCLCVSRLPSFATPAVLFQGFNWDSS-KKGGWYNSLKTTIPELASSGITHVWL  79

Query  227   PPPSNAREGDDQGYMPKRMYDLDTSKYGNKKELKALNDAFHGRGIKSVADIVLNHRAAER  406
             PPPS++     +GY P R+YDLD S YGNK ELK+L    H +GIK++ADIVLNHR+A +
Sbjct  80    PPPSHSNA--TEGYDPGRLYDLDASSYGNKDELKSLIATMHEKGIKAIADIVLNHRSAVK  137

Query  407   ANSRGVFNVFEGGTPDDKLDWGPSEICGDDAAFE-GTGNPDTGDPWGDAPDIDHRSPRVQ  583
              +  G++++FEGGT D +LD+  S IC DD     GTGNPDTGD +    D+DH +PR+Q
Sbjct  138   QDENGIWSIFEGGTEDGRLDFNASLICRDDNDHPFGTGNPDTGDNFPYTADVDHTNPRLQ  197

Query  584   REISEWMNWLKSDVGFDGWRFDYVKGYDFVKGFAAVKIYMDNTKPEFAVGELWN-ALSPG  760
              E+S+W+NWLK+D+GFDGWR DYV GY    G +  K+YM+ T PEFAV E W   +S G
Sbjct  198   TELSDWLNWLKTDIGFDGWRLDYVIGY----GSSFTKLYMEKTSPEFAVAEYWRWNISKG  253

Query  761   SVPNPDYNQDAHRNELVRWVQNaggaatafdfttKGILQAALNNTELWRLKDAAGKPSGM  940
                  D NQDAHRNE+V W++ AGG  TAFD TTK IL  A+   ELWRLKD+ GKP G+
Sbjct  254   QDGKLDKNQDAHRNEIVNWIEAAGGVVTAFDLTTKYILNVAVEG-ELWRLKDSNGKPPGL  312

Query  941   IGVLPQSAVTFIDNHDTWSQRLWPFTTSTDDAVNHDRVLQGYAYILTHPGIPSVFYDHFF  1120
             IG+ P+SAVTFIDNHDTWSQ L PF          D+VL GYAYI THPG PS+FYDHFF
Sbjct  313   IGIKPESAVTFIDNHDTWSQGLLPFPD--------DKVLLGYAYIFTHPGTPSIFYDHFF  364

Query  1121  EWGL-KDAISKLISIRNKNGVSATSPVEILAADADLYIAKINGKVILKIGPNGDLKNLVP  1297
             +WG  K+ I  L +IR +NG+++ S V ILAA+ADLY+A I+ K+I+KIGP  DL +L P
Sbjct  365   DWGWPKEPIRNLTAIRARNGINSGSSVTILAAEADLYMANIDDKIIMKIGPRSDLGDLDP  424

Query  1298  --SDFMLATSGKDFAVWEK  1348
               S+F +ATSG+DFAVWEK
Sbjct  425   TKSNFHVATSGQDFAVWEK  443



>gb|KDO66103.1| hypothetical protein CISIN_1g045962mg, partial [Citrus sinensis]
Length=423

 Score =   434 bits (1115),  Expect = 3e-144, Method: Compositional matrix adjust.
 Identities = 231/429 (54%), Positives = 294/429 (69%), Gaps = 45/429 (10%)
 Frame = +2

Query  104   SSTVLFQGFTWTSKDQPGGWWNWLITKVPDLADAGITHVWLPPPSNA-------------  244
             S T+LFQGF W S ++ GGW+N+L  ++PD+A AGITHVWL    +              
Sbjct  22    SPTILFQGFNWESCNKKGGWYNFLKKRIPDIASAGITHVWLSSTFSLCCSPRLFFHSIIH  81

Query  245   ---REGDDQGYMPKRMYDLDTSKYGNKKELKALNDAFHGRGIKSVADIVLNHRAAERANS  415
                      GYMP R+YDL  S YG++ ELK+L  AF+ +GIK +ADIV+NHR AE+ + 
Sbjct  82    QAYSHASLAGYMPGRLYDLHASSYGSQNELKSLIQAFNKKGIKCLADIVINHRTAEKKDR  141

Query  416   RGVFNVFEGGTPDDKLDWGPSEICGDDAAF-EGTGNPDTGDPWGDAPDIDHRSPRVQREI  592
             RG++ +FEGGTPD +LDWGPS IC DD  + +G G+PD+G+P+G APDIDH +PRVQ+E+
Sbjct  142   RGIWCIFEGGTPDKRLDWGPSFICRDDTTYSDGRGHPDSGEPFGPAPDIDHLNPRVQKEL  201

Query  593   SEWMNWLKSDVGFDGWRFDYVKGYDFVKGFAAVKIYMDNTKPEFAVGELWNALSPGSVPN  772
             S+WMNWLK+++GFDGWRFD+VKGY      +  ++YM NT P F V E W++LS      
Sbjct  202   SDWMNWLKTEIGFDGWRFDFVKGY----APSITRLYMKNTMPHFTVAEKWDSLSYRQDGK  257

Query  773   PDYNQDAHRNELVRWVQNaggaatafdfttKGILQAALNNTELWRLKDAAGKPSGMIGVL  952
              D  QDAHR  L  WVQ AG A TAFDFTTKGILQAA               P G IG+L
Sbjct  258   LDARQDAHRRNLKYWVQAAGRAVTAFDFTTKGILQAA---------------PPGFIGLL  302

Query  953   PQSAVTFIDNHDTWS-QRLWPFTTSTDDAVNHDRVLQGYAYILTHPGIPSVFYDHFFEWG  1129
             PQ+AVTFIDNHDT S QRLWPF ++        +V+ GYAYILTHPG PS+FYDH F+W 
Sbjct  303   PQNAVTFIDNHDTGSTQRLWPFPSA--------KVMLGYAYILTHPGTPSIFYDHLFDWD  354

Query  1130  LKDAISKLISIRNKNGVSATSPVEILAADADLYIAKINGKVILKIGPNGDLKNLVPSDFM  1309
             LK  I KL +IR KNG++ TS V ILA+ +DLY+A I+ K+I KIGP  DL+NL+P +F 
Sbjct  355   LKKEIGKLAAIRTKNGINTTSRVNILASQSDLYVAAIDDKIITKIGPKMDLRNLIPRNFK  414

Query  1310  LATSGKDFA  1336
             +ATSGKD+A
Sbjct  415   VATSGKDYA  423



>emb|CDY16261.1| BnaC01g22960D [Brassica napus]
Length=443

 Score =   434 bits (1117),  Expect = 3e-144, Method: Compositional matrix adjust.
 Identities = 228/439 (52%), Positives = 300/439 (68%), Gaps = 28/439 (6%)
 Frame = +2

Query  71    CIAFFLFP------LH------SSSTVLFQGFTWTSKDQPGGWWNWLITKVPDLADAGIT  214
             C    LFP      LH      S   +   GF W S  + GG++N L   + DL+++GIT
Sbjct  19    CKTTLLFPPRLLPHLHGFHLVVSGEHIHHIGFKWESWMKEGGFYNSLHNSIDDLSNSGIT  78

Query  215   HVWLPPPSNAREGDDQGYMPKRMYDLDTSKYGNKKELKALNDAFHGRGIKSVADIVLNHR  394
             H+WLPPPS +     +GY+P ++YDL++SKYG++ ELK+L  A   +GIK+VADIV+NHR
Sbjct  79    HIWLPPPSQSVS--PEGYLPGKLYDLNSSKYGSEAELKSLIAALKQKGIKAVADIVINHR  136

Query  395   AAERANSRGVFNVFEGGTPDDKLDWGPSEICGDDAAFEGTGNPDTGDPWGDAPDIDHRSP  574
              A R +    +  FEGGT DD+LDW PS IC  D  + GTGNPDTG+ +  APDIDH +P
Sbjct  137   TAARKDDHCGYCYFEGGTSDDRLDWDPSFICRGDTNYAGTGNPDTGEDYKPAPDIDHLNP  196

Query  575   RVQREISEWMNWLKSDVGFDGWRFDYVKGYDFVKGFAAVKIYMDNTKPEFAVGELWNALS  754
             RVQ+E+SEWMNWLKS++GF GWRFD+V+GY      +  K Y+ NT P+FAVGE W+ + 
Sbjct  197   RVQKELSEWMNWLKSEIGFSGWRFDFVRGY----AASVTKSYVQNTSPDFAVGEKWDDMK  252

Query  755   PGSVPNPDYNQDAHRNELVRWVQNaggaataf-dfttKGILQAALNNTELWRLKDAAGKP  931
              G     +Y+Q+ HR+ L  W++  GG      DFTTKGILQ+A+   ELWRLKD+ GKP
Sbjct  253   YGGDGKLEYDQEEHRSGLKHWIEEGGGGVLTAFDFTTKGILQSAVGG-ELWRLKDSQGKP  311

Query  932   SGMIGVLPQSAVTFIDNHDTWSQRLWPFTTSTDDAVNHDRVLQGYAYILTHPGIPSVFYD  1111
              G+IG++P +AVTF+DNHDT     W F +        D+VL GY YILTHPG P +FY 
Sbjct  312   PGLIGIMPGNAVTFVDNHDTIRPNSWAFPS--------DKVLLGYVYILTHPGTPCIFYS  363

Query  1112  HFFEWGLKDAISKLISIRNKNGVSATSPVEILAADADLYIAKINGKVILKIGPNGDLKNL  1291
             H+ EWGLKD+ISKL++IRN+NG+ +TS V I AA+A+LY+A I+ KVI+KIGP  D+  L
Sbjct  364   HYIEWGLKDSISKLVAIRNRNGIGSTSSVMIKAAEAELYLAMIDEKVIMKIGPKLDIGTL  423

Query  1292  VPSDFMLATSGKDFAVWEK  1348
             VP +F+LA SG DFAVWEK
Sbjct  424   VPPNFVLAYSGLDFAVWEK  442



>emb|CAA72143.1| alpha-amylase [Hordeum vulgare subsp. vulgare]
Length=437

 Score =   434 bits (1116),  Expect = 3e-144, Method: Compositional matrix adjust.
 Identities = 220/417 (53%), Positives = 288/417 (69%), Gaps = 20/417 (5%)
 Frame = +2

Query  113   VLFQGFTWTSKDQPGGWWNWLITKVPDLADAGITHVWLPPPSNAREGDDQGYMPKRMYDL  292
             VLFQGF W S  Q GGW+N ++ KV D+A AG+THVWLPPPS++     +GYMP R+YD+
Sbjct  26    VLFQGFNWESWKQSGGWYNMMLGKVDDIAAAGVTHVWLPPPSHSVAA--EGYMPGRLYDI  83

Query  293   DTSKYGNKKELKALNDAFHGRGIKSVADIVLNHRAAERANSRGVFNVFEGGTPDDKLDWG  472
             D SKYGN  ELK+L  A HG G++++ADIV+NHR A+  +SRG++ ++EGGT D +LDWG
Sbjct  84    DASKYGNAAELKSLIGALHGNGVQAIADIVINHRCADYKDSRGIYCIYEGGTSDSRLDWG  143

Query  473   PSEICGDDAAF-EGTGNPDTGDPWGDAPDIDHRSPRVQREISEWMNWLKSDVGFDGWRFD  649
             P  IC DD  + +GT N DTG  + DAPDIDH + RVQ E+ EW+ WLKSD+GFD WR D
Sbjct  144   PHMICRDDTKYSDGTANLDTGADYADAPDIDHLNHRVQSELKEWLLWLKSDLGFDAWRLD  203

Query  650   YVKGYDFVKGFAAVKIYMDNTKPEFAVGELWNALSPGSVPNPDYNQDAHRNELVRWVQNa  829
             + +GY         K+Y+D T P  AV E+W+ + PG    P+Y+QDAHR  LV WV   
Sbjct  204   FARGYSA----EMAKVYIDGTSPSLAVAEIWDGMVPGGDGKPNYDQDAHRQNLVNWVDKV  259

Query  830   ggaatafdf---ttKGILQAALNNTELWRLKDAAGKPSGMIGVLPQSAVTFIDNHDTWS-  997
             GGAA+A      TTKGIL  A+   ELWRL D  GK  G++G  P  AVTFIDNHDT S 
Sbjct  260   GGAASAGMVFDFTTKGILNVAVEG-ELWRLIDPQGKAPGVMGWWPAKAVTFIDNHDTGST  318

Query  998   QRLWPFTTSTDDAVNHDRVLQGYAYILTHPGIPSVFYDHFFEWGLKDAISKLISIRNKNG  1177
             Q  WPF +        D+++QGYAYILTH GIP +FYDHFF  G KD I+ L++IR +NG
Sbjct  319   QAKWPFPS--------DKIMQGYAYILTHSGIPCIFYDHFFNLGFKDEIAALVAIRKRNG  370

Query  1178  VSATSPVEILAADADLYIAKINGKVILKIGPNGDLKNLVPSDFMLATSGKDFAVWEK  1348
             ++ATS ++IL  D D Y+A+I+ KV++KIG   D+  ++P+ F+ +  GKD+AVWEK
Sbjct  371   ITATSALKILMHDGDAYVAEIDSKVVVKIGSRYDVGAVIPAGFVTSAHGKDYAVWEK  427



>emb|CAA09324.1| alpha-amylase [Avena fatua]
Length=437

 Score =   434 bits (1116),  Expect = 3e-144, Method: Compositional matrix adjust.
 Identities = 219/417 (53%), Positives = 293/417 (70%), Gaps = 20/417 (5%)
 Frame = +2

Query  113   VLFQGFTWTSKDQPGGWWNWLITKVPDLADAGITHVWLPPPSNAREGDDQGYMPKRMYDL  292
             VLFQGF W S  Q GG++N ++ KV D+A AG+THVWLPPPS++    ++GYMP R+YD+
Sbjct  29    VLFQGFNWESWKQSGGYYNMMMGKVDDIAAAGVTHVWLPPPSHSVS--NEGYMPGRLYDI  86

Query  293   DTSKYGNKKELKALNDAFHGRGIKSVADIVLNHRAAERANSRGVFNVFEGGTPDDKLDWG  472
             D SKYG   ELK+L  AFHG+G+  +ADIV+NHR A+  +SRG++ +FEGGT D +LDWG
Sbjct  87    DASKYGYAAELKSLIGAFHGKGVHVIADIVINHRCADYKDSRGIYCIFEGGTSDSRLDWG  146

Query  473   PSEICGDDAAF-EGTGNPDTGDPWGDAPDIDHRSPRVQREISEWMNWLKSDVGFDGWRFD  649
             P  IC DD  + +GT N DTG  +  APDIDH + RVQRE+ EW+ WLK+D+GFD WR D
Sbjct  147   PHMICRDDTIYSDGTANLDTGADFAAAPDIDHLNDRVQRELKEWLLWLKTDLGFDAWRLD  206

Query  650   YVKGYDFVKGFAAVKIYMDNTKPEFAVGELWNALSPGSVPNPDYNQDAHRNELVRWVQNa  829
             + KGY      A  K+Y+D T P+ AV E+W+ +  G    P+Y+QDAHR  LV WV   
Sbjct  207   FAKGYSA----AMAKVYIDGTTPDLAVAEVWDTMPTGGDGKPEYDQDAHRQNLVNWVDGV  262

Query  830   ggaatafdf---ttKGILQAALNNTELWRLKDAAGKPSGMIGVLPQSAVTFIDNHDTWS-  997
             GGAA+A      TTKGIL AA+   ELWRL D+ GK  G+IG  P  AVTF+DNHDT S 
Sbjct  263   GGAASAGMVFDFTTKGILNAAVEG-ELWRLIDSQGKAPGVIGWWPAKAVTFVDNHDTGST  321

Query  998   QRLWPFTTSTDDAVNHDRVLQGYAYILTHPGIPSVFYDHFFEWGLKDAISKLISIRNKNG  1177
             Q +WPF +        D+V+QGYAYILTHPG P +FYDHFF WG K+ I+ L+++R +N 
Sbjct  322   QAMWPFPS--------DKVMQGYAYILTHPGTPCIFYDHFFNWGFKEEIAALVAVRKRNS  373

Query  1178  VSATSPVEILAADADLYIAKINGKVILKIGPNGDLKNLVPSDFMLATSGKDFAVWEK  1348
             +++TS ++IL  D D Y+A+I+GKV++KIG   D+ +++P+ F+ +  G D+AVWEK
Sbjct  374   ITSTSELKILMHDGDAYVAEIDGKVVVKIGSRYDVGDVIPAGFVNSAHGSDYAVWEK  430



>ref|XP_006282624.1| hypothetical protein CARUB_v10004897mg [Capsella rubella]
 gb|EOA15522.1| hypothetical protein CARUB_v10004897mg [Capsella rubella]
Length=422

 Score =   433 bits (1114),  Expect = 5e-144, Method: Compositional matrix adjust.
 Identities = 224/420 (53%), Positives = 295/420 (70%), Gaps = 18/420 (4%)
 Frame = +2

Query  92    PLHSSSTVLFQGFTWTSKDQPGGWWNWLITKVPDLADAGITHVWLPPPSNAREGDDQGYM  271
             P  + ST+LFQ F W S  + GG++N +   + D+A+AG TH+WLPPPS +     +GY+
Sbjct  19    PTFTLSTLLFQSFNWESWKKQGGFYNSIHNSIDDIANAGTTHIWLPPPSQSVS--PEGYL  76

Query  272   PKRMYDLDTSKYGNKKELKALNDAFHGRGIKSVADIVLNHRAAERANSRGVFNVFEGGTP  451
             P ++YDL++SKYG++ ELK+L  A + +GIK+VADIV+NHR     + +  +  FEGGT 
Sbjct  77    PGKLYDLNSSKYGSETELKSLIQALNQKGIKAVADIVINHRTGATRDDKCGYCYFEGGTS  136

Query  452   DDKLDWGPSEICGDDAAFEGTGNPDTGDPWGDAPDIDHRSPRVQREISEWMNWLKSDVGF  631
             DD+LDW  S +C +D  F GTGN DTG  +  APDIDH +PR QRE+SEWMNWLKSD+GF
Sbjct  137   DDRLDWDRSFVCRNDPNFPGTGNIDTGGDFNGAPDIDHLNPRAQRELSEWMNWLKSDIGF  196

Query  632   DGWRFDYVKGYDFVKGFAAVKIYMDNTKPEFAVGELWNALSPGSVPNPDYNQDAHRNELV  811
              GWR D+V G+      +  K+Y+ NT P+FAVGE W+ +  G     DYNQD HR  L 
Sbjct  197   HGWRLDFVIGF----ASSIAKLYVQNTSPDFAVGEKWDDMKYGGDGKLDYNQDQHRYGLK  252

Query  812   RWVQNaggaatafd-fttKGILQAALNNTELWRLKDAAGKPSGMIGVLPQSAVTFIDNHD  988
             +WV+ AG        FTTKGILQ+A+   ELWRLKD+ GKP G+IG++P +AVTFI+NHD
Sbjct  253   QWVEEAGSGVLTAFDFTTKGILQSAVQG-ELWRLKDSQGKPPGLIGIMPGNAVTFIENHD  311

Query  989   TWSQRLWPFTTSTDDAVNHDRVLQGYAYILTHPGIPSVFYDHFFEWGLKDAISKLISIRN  1168
             T+  R W F +        D+VL GY YILTHPG P +FY+H+ EWGLK++ISKL++IR 
Sbjct  312   TF--RTWVFPS--------DKVLLGYVYILTHPGTPCIFYNHYMEWGLKESISKLVAIRK  361

Query  1169  KNGVSATSPVEILAADADLYIAKINGKVILKIGPNGDLKNLVPSDFMLATSGKDFAVWEK  1348
             +NG+ +TS V I AA++DLY+A I+ KVI+KIGP  DL  LVPS+F LA SG DFAVWEK
Sbjct  362   RNGIGSTSSVAIKAAESDLYLAMIDDKVIMKIGPKLDLGTLVPSNFALAYSGLDFAVWEK  421



>gb|ADC54329.1| alpha amylase [Hordeum vulgare subsp. spontaneum]
Length=414

 Score =   433 bits (1113),  Expect = 5e-144, Method: Compositional matrix adjust.
 Identities = 219/417 (53%), Positives = 291/417 (70%), Gaps = 20/417 (5%)
 Frame = +2

Query  113   VLFQGFTWTSKDQPGGWWNWLITKVPDLADAGITHVWLPPPSNAREGDDQGYMPKRMYDL  292
             VLFQGF W S  Q  GW+N ++ KV D+A AG+THVWLPPPS++    ++GYMP R+YD+
Sbjct  3     VLFQGFNWESWKQSSGWYNMMMGKVDDIAAAGVTHVWLPPPSHSVS--NEGYMPGRLYDI  60

Query  293   DTSKYGNKKELKALNDAFHGRGIKSVADIVLNHRAAERANSRGVFNVFEGGTPDDKLDWG  472
             D SKYGN  ELK+L  A HG+G++++ADIV+NHR A+  ++RG++ +FEGGT D +LDWG
Sbjct  61    DASKYGNAAELKSLIGALHGKGVQAMADIVINHRCADYKDNRGIYCIFEGGTSDGRLDWG  120

Query  473   PSEICGDDAAF-EGTGNPDTGDPWGDAPDIDHRSPRVQREISEWMNWLKSDVGFDGWRFD  649
             P  IC DD  + +GT N DTG  +  APDIDH + RVQRE+ EW+ WLKSD+GFD WR D
Sbjct  121   PHMICRDDTKYADGTANLDTGADFAAAPDIDHLNDRVQRELKEWLLWLKSDLGFDAWRLD  180

Query  650   YVKGYDFVKGFAAVKIYMDNTKPEFAVGELWNALSPGSVPNPDYNQDAHRNELVRWVQNa  829
             + +GY         K+Y+D T P  AV E+W+ ++ G    P+Y+QDAHR  LV WV   
Sbjct  181   FARGYSP----EMAKVYIDGTSPSLAVAEVWDNMATGGDGKPNYDQDAHRQNLVNWVDKV  236

Query  830   ggaatafdf---ttKGILQAALNNTELWRLKDAAGKPSGMIGVLPQSAVTFIDNHDTWS-  997
             GGAA+A      TTKGIL AA+   ELWRL D  GK  G++G  P  AVTF+DNHD  S 
Sbjct  237   GGAASAGMVFDFTTKGILNAAVEG-ELWRLIDPQGKAPGVMGWWPAKAVTFVDNHDAGST  295

Query  998   QRLWPFTTSTDDAVNHDRVLQGYAYILTHPGIPSVFYDHFFEWGLKDAISKLISIRNKNG  1177
             Q +WPF +        D+V+QGYAYILTHPG P +FYDHFF WG KD I+ L++IR +NG
Sbjct  296   QAMWPFPS--------DKVMQGYAYILTHPGTPCIFYDHFFNWGFKDEIAALVAIRKRNG  347

Query  1178  VSATSPVEILAADADLYIAKINGKVILKIGPNGDLKNLVPSDFMLATSGKDFAVWEK  1348
             ++ATS ++IL  + D Y+A+I+GKV++KIG   D+  ++P+ F  +  GKD+AVWEK
Sbjct  348   ITATSALKILMHEGDAYVAEIDGKVVVKIGTRYDVGAVIPAGFATSAHGKDYAVWEK  404



>gb|EMT10056.1| Alpha-amylase type A isozyme [Aegilops tauschii]
Length=440

 Score =   434 bits (1115),  Expect = 6e-144, Method: Compositional matrix adjust.
 Identities = 221/417 (53%), Positives = 290/417 (70%), Gaps = 20/417 (5%)
 Frame = +2

Query  113   VLFQGFTWTSKDQPGGWWNWLITKVPDLADAGITHVWLPPPSNAREGDDQGYMPKRMYDL  292
             VLFQGF W S  Q GGW+N ++ KV D+A AG+THVWLPPPS++    ++GYMP R+YD+
Sbjct  29    VLFQGFNWESWKQSGGWYNMMMGKVDDIAAAGVTHVWLPPPSHSVA--NEGYMPGRLYDI  86

Query  293   DTSKYGNKKELKALNDAFHGRGIKSVADIVLNHRAAERANSRGVFNVFEGGTPDDKLDWG  472
             D SKYGN  ELK+L  A HG+G++++ADIV+NHR A+  +SRG++ ++EGGT D +LDWG
Sbjct  87    DASKYGNAAELKSLIAALHGKGVQAIADIVINHRCADYKDSRGIYCIYEGGTSDGRLDWG  146

Query  473   PSEICGDDAAF-EGTGNPDTGDPWGDAPDIDHRSPRVQREISEWMNWLKSDVGFDGWRFD  649
             P  IC DD  + +GT N DTG  +  APDIDH + RVQRE+ EW+ WLKSD+GFD WR D
Sbjct  147   PHMICRDDTTYSDGTANLDTGADFDHAPDIDHLNERVQRELKEWLLWLKSDLGFDAWRLD  206

Query  650   YVKGYDFVKGFAAVKIYMDNTKPEFAVGELWNALSPGSVPNPDYNQDAHRNELVRWVQNa  829
             + KGY         K+Y+D T P  AV E+W+ + PG    P+Y+QDAHR  LV WV   
Sbjct  207   FAKGYSP----EMAKVYIDGTPPSLAVAEIWDDMVPGGDGKPNYDQDAHRQNLVNWVDKV  262

Query  830   ggaatafdf---ttKGILQAALNNTELWRLKDAAGKPSGMIGVLPQSAVTFIDNHDTWS-  997
             GG A+A      TTKGIL AA+   ELWRL D  GK  G++G  P  AVTF+DNHDT S 
Sbjct  263   GGVASAGMVFDFTTKGILNAAVEG-ELWRLIDPQGKAPGVMGWWPAKAVTFVDNHDTGST  321

Query  998   QRLWPFTTSTDDAVNHDRVLQGYAYILTHPGIPSVFYDHFFEWGLKDAISKLISIRNKNG  1177
             Q  WPF         +D+V+QGYAYILTHPGIP +FYDHFF  G KD I+ L++IR +NG
Sbjct  322   QAKWPFP--------YDKVMQGYAYILTHPGIPCIFYDHFFNLGFKDQIAALVAIRKRNG  373

Query  1178  VSATSPVEILAADADLYIAKINGKVILKIGPNGDLKNLVPSDFMLATSGKDFAVWEK  1348
             ++ATS ++IL  + D Y+A+I+GKV++KIG   D+  ++P+ F+    G D+AVWEK
Sbjct  374   ITATSALKILMHEGDAYVAEIDGKVVVKIGSRYDVGAVIPAGFVTTAHGNDYAVWEK  430



>gb|ADC54361.1| alpha amylase [Hordeum vulgare subsp. spontaneum]
Length=414

 Score =   432 bits (1112),  Expect = 6e-144, Method: Compositional matrix adjust.
 Identities = 221/417 (53%), Positives = 291/417 (70%), Gaps = 20/417 (5%)
 Frame = +2

Query  113   VLFQGFTWTSKDQPGGWWNWLITKVPDLADAGITHVWLPPPSNAREGDDQGYMPKRMYDL  292
             VLFQGF W S  Q GGW+N ++ KV D+A AG+T VWLPPPS++    ++GYMP R+YD+
Sbjct  3     VLFQGFNWESWKQSGGWYNMMMGKVDDIAAAGVTRVWLPPPSHSVS--NEGYMPGRLYDI  60

Query  293   DTSKYGNKKELKALNDAFHGRGIKSVADIVLNHRAAERANSRGVFNVFEGGTPDDKLDWG  472
             D SKYGN  ELK+L  A HG+G++++ADIV+NHR A+  +SRG++ +FEGGT D +LDWG
Sbjct  61    DASKYGNAAELKSLIGALHGKGVQAIADIVINHRCADYKDSRGIYCIFEGGTSDGRLDWG  120

Query  473   PSEICGDDAAF-EGTGNPDTGDPWGDAPDIDHRSPRVQREISEWMNWLKSDVGFDGWRFD  649
             P  IC DD  + +GT N DTG  +  APDIDH + RVQRE+ EW+ WLKSD+GFD WR D
Sbjct  121   PHMICRDDTKYSDGTANLDTGADFAAAPDIDHLNDRVQRELKEWLLWLKSDLGFDAWRPD  180

Query  650   YVKGYDFVKGFAAVKIYMDNTKPEFAVGELWNALSPGSVPNPDYNQDAHRNELVRWVQNa  829
             + +GY         K+Y D T P  AV E+W+ ++ G    P+Y+QDAHR  LV WV   
Sbjct  181   FARGYSP----EMAKVYTDGTSPSLAVAEVWDNMATGGDGKPNYDQDAHRQNLVNWVDKV  236

Query  830   ggaatafdf---ttKGILQAALNNTELWRLKDAAGKPSGMIGVLPQSAVTFIDNHDTWS-  997
             GGAA+A      TTKGIL AA+   ELWRL D  GK  G++G  P  AVTF+DNHDT S 
Sbjct  237   GGAASAGMVFDFTTKGILNAAVEG-ELWRLIDPQGKAPGVMGWWPAKAVTFVDNHDTGST  295

Query  998   QRLWPFTTSTDDAVNHDRVLQGYAYILTHPGIPSVFYDHFFEWGLKDAISKLISIRNKNG  1177
             Q +WPF +        D+V+QGYAYILTHPG P +FYDHFF WG KD I+ L++IR +NG
Sbjct  296   QAMWPFPS--------DKVMQGYAYILTHPGTPCIFYDHFFNWGFKDEIAALVAIRKRNG  347

Query  1178  VSATSPVEILAADADLYIAKINGKVILKIGPNGDLKNLVPSDFMLATSGKDFAVWEK  1348
             ++ATS ++IL  + D Y+A+I+GKV++KIG   D+  ++P+ F  +  GKD+AVWEK
Sbjct  348   ITATSALKILMHEGDAYVAEIDGKVVVKIGTRYDVGAVIPAGFATSAHGKDYAVWEK  404



>gb|ADC54350.1| alpha amylase [Hordeum vulgare subsp. spontaneum]
Length=414

 Score =   432 bits (1110),  Expect = 1e-143, Method: Compositional matrix adjust.
 Identities = 222/427 (52%), Positives = 296/427 (69%), Gaps = 21/427 (5%)
 Frame = +2

Query  113   VLFQGFTWTSKDQPGGWWNWLITKVPDLADAGITHVWLPPPSNAREGDDQGYMPKRMYDL  292
             VLFQGF W S  Q GGW+N ++ KV D+A AG+THVWLPPPS++    ++GYMP R+YD+
Sbjct  3     VLFQGFNWESWKQSGGWYNMMMGKVDDIAAAGVTHVWLPPPSHSVS--NEGYMPGRLYDI  60

Query  293   DTSKYGNKKELKALNDAFHGRGIKSVADIVLNHRAAERANSRGVFNVFEGGTPDDKLDWG  472
             D SKYGN  ELK+L  A HG+G++++ADIV+NHR A+  +SRG++ +FEGGT D +LDWG
Sbjct  61    DASKYGNAAELKSLIGALHGKGVQAIADIVINHRCADYKDSRGIYCIFEGGTSDGRLDWG  120

Query  473   PSEICGDDAAF-EGTGNPDTGDPWGDAPDIDHRSPRVQREISEWMNWLKSDVGFDGWRFD  649
             P  IC DD  + +GT N DTG  +  APDIDH + RVQRE+ EW+ WLKSD+GFD WR D
Sbjct  121   PHMICRDDTKYSDGTANLDTGADFAAAPDIDHLNDRVQRELKEWLLWLKSDLGFDAWRLD  180

Query  650   YVKGYDFVKGFAAVKIYMDNTKPEFAVGELWNALSPGSVPNPDYNQDAHRNELVRWVQNa  829
             + +GY         K+Y+D T P  AV E+W+ ++ G    P+Y+QDAHR  LV WV   
Sbjct  181   FARGYSP----EMAKVYIDGTSPSLAVAEVWDNMATGGDGKPNYDQDAHRQNLVNWVDKV  236

Query  830   ggaatafdf---ttKGILQAALNNTELWRLKDAAGKPSGMIGVLPQSAVTFIDNHDTWS-  997
             GGAA+A      TTKGIL AA+   ELWRL D  GK  G++G  P  AVT ++NHDT S 
Sbjct  237   GGAASAGMVFDFTTKGILNAAVEG-ELWRLIDPQGKAPGVMGWWPAKAVTSVNNHDTGST  295

Query  998   QRLWPFTTSTDDAVNHDRVLQGYAYILTHPGIPSVFYDHFFEWGLKDAISKLISIRNKNG  1177
             Q +WPF +        D+V+QGYAYILTHPG P +FYDHFF WG KD I+ L++ R +NG
Sbjct  296   QAMWPFPS--------DKVMQGYAYILTHPGTPCIFYDHFFNWGFKDEIAALVATRKRNG  347

Query  1178  VSATSPVEILAADADLYIAKINGKVILKIGPNGDLKNLVPSDFMLATSGKDFAVWEK-PT  1354
             ++ATS +++L  + D Y+A+I+GKV++KIG   D+  ++P+ F  +  GKD+AVWEK  T
Sbjct  348   ITATSALKVLMHEGDAYVAEIDGKVVVKIGTRYDVGAVIPAGFATSAHGKDYAVWEKTAT  407

Query  1355  *SRLQIS  1375
              + LQ S
Sbjct  408   AATLQRS  414



>ref|XP_010943051.1| PREDICTED: alpha-amylase isozyme 3D-like [Elaeis guineensis]
Length=429

 Score =   432 bits (1110),  Expect = 2e-143, Method: Compositional matrix adjust.
 Identities = 227/424 (54%), Positives = 294/424 (69%), Gaps = 16/424 (4%)
 Frame = +2

Query  86    LFPLHSSSTVLFQGFTWTSKDQPGGWWNWLITKVPDLADAGITHVWLPPPSNAREGDDQG  265
             L P  + + +LFQGF W S  Q GGW+N+L+ +V D+A+AG+THVWLPP S +     QG
Sbjct  18    LAPSSALAQILFQGFNWESWKQEGGWYNFLMGQVSDIANAGVTHVWLPPSSESYTDGPQG  77

Query  266   YMPKRMYDLDTSKYGNKKELKALNDAFHGRGIKSVADIVLNHRAAERANSRGVFNVFEGG  445
             Y+P R+YDLD SKYGNK+ELK+L  AF  +GIK +ADIV+NHR A+  +SRG+  +FEGG
Sbjct  78    YLPARLYDLDESKYGNKEELKSLISAFRDKGIKCIADIVINHRWADNKDSRGINCIFEGG  137

Query  446   TPDDKLDWGPSEICGDDAAF-EGTGNPDTGDPWGDAPDIDHRSPRVQREISEWMNWLKSD  622
             TPD +LDWGP  IC DD  F +GTG+ DTG PWG APDIDH +P VQ+E+++WMNWLKSD
Sbjct  138   TPDSRLDWGPHMICSDDTEFSDGTGHRDTGLPWGGAPDIDHLNPTVQQELTDWMNWLKSD  197

Query  623   VGFDGWRFDYVKGYDFVKGFAAVKIYMDNTKPEFAVGELWNALSPGSVPNPDYNQDAHRN  802
             VGFDGWR D+V GY         KIY+D   P F V E W AL+ G+   P YNQD  R 
Sbjct  198   VGFDGWRLDFVLGYS----ADVAKIYVDQATPSFVVAEYWKALANGTDGKPAYNQDVRRQ  253

Query  803   ELVRWVQNaggaatafdfttKGILQAALNNTELWRLKDAAGKPSGMIGVLPQSAVTFIDN  982
             ELV W+Q  GGAATAFDF TK I+  A+   EL R++D+ GK  G+IG LP+ AVTFIDN
Sbjct  254   ELVDWIQTVGGAATAFDFPTKLIMNLAVQG-ELDRMRDSNGKAPGLIGWLPEKAVTFIDN  312

Query  983   HDTWS-QRLWPFTTSTDDAVNHDRVLQGYAYILTHPGIPSVFYDHFFEWGLKDAISKLIS  1159
             HDT S Q L PF T          ++QGY YILTHPGIP +FYDH    G+K++IS++ +
Sbjct  313   HDTGSTQSLAPFPTPL--------IMQGYVYILTHPGIPCIFYDHLLTMGMKESISQVAA  364

Query  1160  IRNKNGVSATSPVEILAADADLYIAKINGKVILKIGPNGDLK-NLVPSDFMLATSGKDFA  1336
             +R +NG+   S + I+ A+ DLYIA I+ K+I KIG       +++PS+F +  SG+ +A
Sbjct  365   VRTRNGIHPGSTLRIIVAEKDLYIAAIDEKIIAKIGQRDAFDGSIIPSNFKVTLSGEHYA  424

Query  1337  VWEK  1348
             +WEK
Sbjct  425   IWEK  428



>gb|ADC54336.1| alpha amylase [Hordeum vulgare subsp. spontaneum]
Length=414

 Score =   431 bits (1109),  Expect = 2e-143, Method: Compositional matrix adjust.
 Identities = 219/417 (53%), Positives = 291/417 (70%), Gaps = 20/417 (5%)
 Frame = +2

Query  113   VLFQGFTWTSKDQPGGWWNWLITKVPDLADAGITHVWLPPPSNAREGDDQGYMPKRMYDL  292
             VLFQGF W S  Q GG +N ++ KV D+A AG+THVWLPPPS++    ++GYMP R+YD+
Sbjct  3     VLFQGFNWESWKQSGGRYNMMMGKVDDIAAAGVTHVWLPPPSHSVS--NEGYMPGRLYDI  60

Query  293   DTSKYGNKKELKALNDAFHGRGIKSVADIVLNHRAAERANSRGVFNVFEGGTPDDKLDWG  472
             D SKYGN  ELK+L  A HG+G++++ADIV+NHR A+  ++RG++ +FEGGT D +LDWG
Sbjct  61    DASKYGNAAELKSLIGALHGKGVQAIADIVINHRCADYKDNRGIYCIFEGGTSDGRLDWG  120

Query  473   PSEICGDDAAF-EGTGNPDTGDPWGDAPDIDHRSPRVQREISEWMNWLKSDVGFDGWRFD  649
             P  IC DD  + +GT N DTG  +  APDIDH + RVQRE+ EW+ WLKSD+GFD WR D
Sbjct  121   PHMICRDDTKYADGTANLDTGADFAAAPDIDHLNDRVQRELKEWLLWLKSDLGFDAWRLD  180

Query  650   YVKGYDFVKGFAAVKIYMDNTKPEFAVGELWNALSPGSVPNPDYNQDAHRNELVRWVQNa  829
             + +GY         K+Y+D T P  AV E+W+ ++ G    P+Y+QDAHR  LV WV   
Sbjct  181   FARGYSP----EMAKVYIDGTSPSLAVAEVWDNMATGGDGKPNYDQDAHRQNLVNWVDKV  236

Query  830   ggaatafdf---ttKGILQAALNNTELWRLKDAAGKPSGMIGVLPQSAVTFIDNHDTWS-  997
             GGAA+A      TTKGIL AA+   ELWRL D  GK  G++G  P  AVTF+DNHDT S 
Sbjct  237   GGAASAGMVFDFTTKGILNAAVEG-ELWRLIDPQGKAPGVMGWWPAKAVTFVDNHDTGST  295

Query  998   QRLWPFTTSTDDAVNHDRVLQGYAYILTHPGIPSVFYDHFFEWGLKDAISKLISIRNKNG  1177
             Q +WPF +        D+V+QGYAYILTHPG P +FYDHFF WG KD I+ L++IR +NG
Sbjct  296   QAMWPFPS--------DKVMQGYAYILTHPGTPCIFYDHFFNWGFKDEIAALVAIRKRNG  347

Query  1178  VSATSPVEILAADADLYIAKINGKVILKIGPNGDLKNLVPSDFMLATSGKDFAVWEK  1348
             ++ATS ++IL  + D Y+A+I+GKV++KIG   D+  ++P+ F  +  G D+AVWEK
Sbjct  348   ITATSALKILMHEGDAYVAEIDGKVVVKIGTRYDVGAVIPAGFATSAHGNDYAVWEK  404



>gb|ADC54333.1| alpha amylase [Hordeum vulgare subsp. spontaneum]
Length=414

 Score =   431 bits (1108),  Expect = 2e-143, Method: Compositional matrix adjust.
 Identities = 219/417 (53%), Positives = 291/417 (70%), Gaps = 20/417 (5%)
 Frame = +2

Query  113   VLFQGFTWTSKDQPGGWWNWLITKVPDLADAGITHVWLPPPSNAREGDDQGYMPKRMYDL  292
             VLFQGF W S  Q GGW+N ++ KV D+A AG+THVWLPPPS++    ++GYMP R+YD+
Sbjct  3     VLFQGFNWESWKQSGGWYNMMMGKVDDIAAAGVTHVWLPPPSHSVS--NEGYMPGRLYDI  60

Query  293   DTSKYGNKKELKALNDAFHGRGIKSVADIVLNHRAAERANSRGVFNVFEGGTPDDKLDWG  472
             D SKYGN  ELK+L  A HG+G++++ADIV+NHR A+  ++RG++ +FEGGT D +  WG
Sbjct  61    DASKYGNAAELKSLIGALHGKGVQAIADIVINHRCADYKDNRGIYCIFEGGTSDGRPGWG  120

Query  473   PSEICGDDAAF-EGTGNPDTGDPWGDAPDIDHRSPRVQREISEWMNWLKSDVGFDGWRFD  649
             P  IC DD  + +GT N DTG  +  APDIDH + RVQRE+ EW+ WLKSD+GFD WR D
Sbjct  121   PHMICRDDTKYADGTANLDTGADFAAAPDIDHLNDRVQRELKEWLLWLKSDLGFDAWRLD  180

Query  650   YVKGYDFVKGFAAVKIYMDNTKPEFAVGELWNALSPGSVPNPDYNQDAHRNELVRWVQNa  829
             + +GY         K+Y+D T P  AV E+W+ ++ G    P+Y+QDAHR  LV WV   
Sbjct  181   FARGYSP----EMAKVYIDGTSPSLAVAEVWDNMATGGDGKPNYDQDAHRQNLVNWVDKV  236

Query  830   ggaatafdf---ttKGILQAALNNTELWRLKDAAGKPSGMIGVLPQSAVTFIDNHDTWS-  997
             GGAA+A      TTKGIL AA+   ELWRL D  GK  G++G  P  AVTF+DNHDT S 
Sbjct  237   GGAASAGMVFDFTTKGILNAAVEG-ELWRLIDPQGKAPGVMGWWPAKAVTFVDNHDTGST  295

Query  998   QRLWPFTTSTDDAVNHDRVLQGYAYILTHPGIPSVFYDHFFEWGLKDAISKLISIRNKNG  1177
             Q +WPF +        D+V+QGYAYILTHPG P +FYDHFF WG KD I+ L++IR +NG
Sbjct  296   QAMWPFPS--------DKVMQGYAYILTHPGTPCIFYDHFFNWGFKDEIAALVAIRKRNG  347

Query  1178  VSATSPVEILAADADLYIAKINGKVILKIGPNGDLKNLVPSDFMLATSGKDFAVWEK  1348
             ++ATS ++IL  + D Y+A+I+GKV++KIG   D+  ++P+ F  +  GKD+AVWEK
Sbjct  348   ITATSALKILMHEGDAYVAEIDGKVVVKIGTRYDVGAVIPAGFATSAHGKDYAVWEK  404



>gb|KDO84181.1| hypothetical protein CISIN_1g014447mg [Citrus sinensis]
Length=350

 Score =   427 bits (1099),  Expect = 7e-143, Method: Compositional matrix adjust.
 Identities = 224/362 (62%), Positives = 278/362 (77%), Gaps = 15/362 (4%)
 Frame = +2

Query  269   MPKRMYDLDTSKYGNKKELKALNDAFHGRGIKSVADIVLNHRAAERANSRGVFNVFEGGT  448
             MP R+YDLD SKYG++ +LK+L  AF  +GIK +AD+V+NHR AER + RG++ +FEGGT
Sbjct  1     MPGRLYDLDASKYGSQADLKSLIQAFRQKGIKCLADMVINHRTAERKDGRGIYCIFEGGT  60

Query  449   PDDKLDWGPSEIC-GDDAAFEGTGNPDTGDPWGDAPDIDHRSPRVQREISEWMNWLKSDV  625
              DD+LDWGPS IC GD    +G GN DTG+ +  APDIDH +PRVQ+E+S+WMNWLK+++
Sbjct  61    SDDRLDWGPSFICRGDKEYSDGQGNDDTGEDFQPAPDIDHLNPRVQKELSDWMNWLKTEI  120

Query  626   GFDGWRFDYVKGYDFVKGFAAVKIYMDNTKPEFAVGELWNALSPGSVPNPDYNQDAHRNE  805
             GFDGWRFD+VKGY      +  K+YM+NT P+FAVGE W++LS G    PD NQD HR  
Sbjct  121   GFDGWRFDFVKGY----APSITKVYMENTSPDFAVGEKWDSLSYGPDGKPDANQDGHRGA  176

Query  806   LVRWVQNaggaatafdfttKGILQAALNNTELWRLKDAAGKPSGMIGVLPQSAVTFIDNH  985
             L  WVQ AGGA  AFDFTTKGILQAA+   ELWRLKD+ GKP G IG+LPQ+AVTFIDNH
Sbjct  177   LKDWVQAAGGAVAAFDFTTKGILQAAVQG-ELWRLKDSNGKPPGFIGILPQNAVTFIDNH  235

Query  986   DTWS-QRLWPFTTSTDDAVNHDRVLQGYAYILTHPGIPSVFYDHFFEWGLKDAISKLISI  1162
             DT S QRLWPF +        D+V+ GYAYILTHPG P +FYDHFF+WGLK+AISKL ++
Sbjct  236   DTGSTQRLWPFPS--------DKVMLGYAYILTHPGTPCIFYDHFFDWGLKEAISKLAAV  287

Query  1163  RNKNGVSATSPVEILAADADLYIAKINGKVILKIGPNGDLKNLVPSDFMLATSGKDFAVW  1342
             RN+NG++  S V ILA+DAD+YIA I  +VI+KIGP  D+ NL+PSDF +A  G D+AVW
Sbjct  288   RNRNGINTASRVNILASDADVYIAAIGDRVIMKIGPKMDIGNLIPSDFKVAADGTDYAVW  347

Query  1343  EK  1348
             EK
Sbjct  348   EK  349



>gb|EPS60632.1| alpha-amylase, partial [Genlisea aurea]
Length=351

 Score =   427 bits (1098),  Expect = 9e-143, Method: Compositional matrix adjust.
 Identities = 219/364 (60%), Positives = 272/364 (75%), Gaps = 15/364 (4%)
 Frame = +2

Query  260   QGYMPKRMYDLDTSKYGNKKELKALNDAFHGRGIKSVADIVLNHRAAERANSRGVFNVFE  439
             +GY+P R+YDLD S+YGN +ELK L    H RG+++VADIV+NHR AER +SRGV+ +FE
Sbjct  1     KGYLPGRLYDLDASRYGNGEELKRLIGELHARGVRAVADIVINHRKAERMDSRGVYCIFE  60

Query  440   GGTPDDKLDWGPSEICGDDAAF-EGTGNPDTGDPWGDAPDIDHRSPRVQREISEWMNWLK  616
             GGT D +LDWGPS IC DD  + +GTGN DTGDP+  APDIDH +  VQ ++SEW+NWL+
Sbjct  61    GGTSDGRLDWGPSAICRDDVEYSDGTGNLDTGDPYQPAPDIDHLNLTVQAQLSEWLNWLR  120

Query  617   SDVGFDGWRFDYVKGYDFVKGFAAVKIYMDNTKPEFAVGELWNALSPGSVPNPDYNQDAH  796
             +++GFDGWR D+ +GY         KIY++NTKPEFAVGE+WN+L        DYNQ+ H
Sbjct  121   TEIGFDGWRLDFARGYSA----GVAKIYLENTKPEFAVGEIWNSLQYEIDGKLDYNQNHH  176

Query  797   RNELVRWVQNaggaatafdfttKGILQAALNNTELWRLKDAAGKPSGMIGVLPQSAVTFI  976
             R +L  W QNAGG   AFDFTTKGIL  A+   ELWRL+DAAG P G+IG+LP++AVTFI
Sbjct  177   RRDLAEWTQNAGGVVKAFDFTTKGILHVAVKG-ELWRLRDAAGNPPGLIGILPENAVTFI  235

Query  977   DNHDTWS-QRLWPFTTSTDDAVNHDRVLQGYAYILTHPGIPSVFYDHFFEWGLKDAISKL  1153
             DNHDT S Q +WPF          D+V+ GYAYILTHPG PSVFYDHFF+WG KD IS L
Sbjct  236   DNHDTGSTQNIWPFP--------RDKVMLGYAYILTHPGTPSVFYDHFFDWGKKDEISNL  287

Query  1154  ISIRNKNGVSATSPVEILAADADLYIAKINGKVILKIGPNGDLKNLVPSDFMLATSGKDF  1333
              +IR +NG++ TS VEI+ ADADLY+AKI+GKVI KIG   DL  L+P+ F LATSG D+
Sbjct  288   TAIRARNGITDTSRVEIIVADADLYVAKIDGKVIAKIGQRTDLGTLIPTGFALATSGDDY  347

Query  1334  AVWE  1345
             AV+E
Sbjct  348   AVFE  351



>gb|AAX33232.1| secreted alpha-amylase [Malus domestica]
Length=399

 Score =   428 bits (1100),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 232/419 (55%), Positives = 298/419 (71%), Gaps = 29/419 (7%)
 Frame = +2

Query  122   QGFTWTSKDQPGGWWNWLITKVPD-LADAGITHVWLPPPSNAREGDDQGYMPKRMYDLDT  298
             QGF W S  + GGW+  L   +P  LA +GITHVWLPPPS++     QGYMP R+YDL+ 
Sbjct  7     QGFNWESWKEEGGWYKSLSQSIPQQLASSGITHVWLPPPSHSVS--PQGYMPGRLYDLNA  64

Query  299   SKYGNKKELKALNDAFHGRGIKSVADIVLNHRAAERANSRGVFNVFEGGTPDDKLDWGPS  478
             S+YGN+ ELKAL + FH  GI+S+ADIV+NHR AE+ + RG++ +FEGGTPDD+LDWGPS
Sbjct  65    SRYGNQDELKALINTFHDNGIQSIADIVINHRCAEKKDERGIWCIFEGGTPDDRLDWGPS  124

Query  479   EICGDDAAFE-GTGNPDTGDPWGDAPDIDHRSPRVQREISEWMNWLKSDVGFDGWRFDYV  655
              IC DD A+  G GNPDTG  +  APDIDH + RVQRE+S+WMNWLK+++GF+GWRFD+V
Sbjct  125   LICCDDTAYSNGKGNPDTGADFSAAPDIDHINTRVQRELSDWMNWLKTEIGFNGWRFDFV  184

Query  656   KGYDFVKGFAAVKIYMDNTKPEFAVGELWNALSPGSVPNPDYNQDAHRNELVRWVQNagg  835
             KGY         K+++ NT+P F+VGELWN+L+ GS    +YNQDAHR  LV WV+ AGG
Sbjct  185   KGY----APEFTKLFVTNTRPSFSVGELWNSLAYGSDGKLEYNQDAHRRALVGWVEGAGG  240

Query  836   aatafdfttKGILQAALNNTELWRLKDAAGKPSGMIGVLPQSAVTFIDNHDTWS-QRLWP  1012
               TAFDFTTKGILQAA+   ELWR+KD+ G   GMIG+ P  +VTF+DNHDT S Q +WP
Sbjct  241   DVTAFDFTTKGILQAAVQG-ELWRMKDSNGGAPGMIGLSPGKSVTFVDNHDTGSTQNMWP  299

Query  1013  FTTSTDDAVNHDRVLQGYAYILTHPGIPSVFYDHFFEWGLKDAISKLISIRNKNGVSATS  1192
             F +        D+V+QGYAYILTHPGIPS+             I+KL++IR +NG+   S
Sbjct  300   FPS--------DKVMQGYAYILTHPGIPSI-----------RXITKLVAIRLRNGIGPDS  340

Query  1193  PVEILAADADLYIAKINGKVILKIGPNGDLKNLVPSDFMLATSGKDFAVWEKPT*SRLQ  1369
              + ILA+DADLY+A  + K+I KIGP  D+ NLVP  + +ATSG D+ V EK   + L+
Sbjct  341   ALRILASDADLYVAATDEKIIAKIGPRYDVGNLVPPTYQIATSGNDYCVREKKAGALLE  399



>emb|CAA28803.1| alpha-amylase type A [Hordeum vulgare]
 gb|AAA32935.1| alpha-amylase [Hordeum vulgare]
Length=421

 Score =   425 bits (1093),  Expect = 5e-141, Method: Compositional matrix adjust.
 Identities = 217/411 (53%), Positives = 287/411 (70%), Gaps = 20/411 (5%)
 Frame = +2

Query  113   VLFQGFTWTSKDQPGGWWNWLITKVPDLADAGITHVWLPPPSNAREGDDQGYMPKRMYDL  292
             VLFQGF W S  Q GGW+N ++ KV D+A AG+THVWLPPPS++    ++GYMP R+YD+
Sbjct  26    VLFQGFNWESWKQSGGWYNMMMGKVDDIAAAGVTHVWLPPPSHSVS--NEGYMPGRLYDI  83

Query  293   DTSKYGNKKELKALNDAFHGRGIKSVADIVLNHRAAERANSRGVFNVFEGGTPDDKLDWG  472
             D SKYGN  ELK+L  A HG+G++++ADIV+NHR A+  ++RG++ +FEGGT D +LDWG
Sbjct  84    DASKYGNAAELKSLIGALHGKGVQAIADIVINHRCADYKDNRGIYCIFEGGTSDGRLDWG  143

Query  473   PSEICGDDAAF-EGTGNPDTGDPWGDAPDIDHRSPRVQREISEWMNWLKSDVGFDGWRFD  649
             P  IC DD  + +GT N DTG  +  APDIDH + RVQRE+ EW+ WLKSD+GFD WR D
Sbjct  144   PHMICRDDTKYADGTANLDTGADFAAAPDIDHLNDRVQRELKEWLLWLKSDLGFDAWRLD  203

Query  650   YVKGYDFVKGFAAVKIYMDNTKPEFAVGELWNALSPGSVPNPDYNQDAHRNELVRWVQNa  829
             + +GY         K+Y+D T P  AV E+W+ ++ G    P+Y+QDAHR  LV WV   
Sbjct  204   FARGYSP----EMAKVYIDGTSPSLAVAEVWDNMATGGDGKPNYDQDAHRQNLVNWVDKV  259

Query  830   ggaatafdf---ttKGILQAALNNTELWRLKDAAGKPSGMIGVLPQSAVTFIDNHDTWS-  997
             GGAA+A      TTKGIL AA+   ELWRL D  GKP  ++G  P  AVTF+DNHDT S 
Sbjct  260   GGAASAGMVFDFTTKGILNAAVEG-ELWRLIDPQGKPPDVMGWWPAKAVTFVDNHDTGST  318

Query  998   QRLWPFTTSTDDAVNHDRVLQGYAYILTHPGIPSVFYDHFFEWGLKDAISKLISIRNKNG  1177
             Q +WPF +        D+V+QGYAYILTHPG P +FYDHFF WG KD I+ L++IR +NG
Sbjct  319   QPMWPFPS--------DKVMQGYAYILTHPGTPCIFYDHFFNWGFKDEIAALVAIRKRNG  370

Query  1178  VSATSPVEILAADADLYIAKINGKVILKIGPNGDLKNLVPSDFMLATSGKD  1330
             ++ATS +EIL  + D Y+A+I+GKV++KIG   D+  ++P+ F  +  GKD
Sbjct  371   ITATSALEILMHEGDAYVAEIDGKVVVKIGTRYDVGAVIPAGFATSAHGKD  421



>gb|EPS57430.1| hypothetical protein M569_17388 [Genlisea aurea]
Length=441

 Score =   426 bits (1095),  Expect = 6e-141, Method: Compositional matrix adjust.
 Identities = 231/446 (52%), Positives = 303/446 (68%), Gaps = 22/446 (5%)
 Frame = +2

Query  26    IPETIMKSSFYLSLFCIAFFLFPLHSS--STVLFQGFTWTSKDQPGGWWNWLITKVPDLA  199
             +P    +S F+     +   +  L SS  S VL QGF W S  + GGW+N LI   P +A
Sbjct  5     MPGITSRSRFHARFTLVLLPIILLFSSADSDVLLQGFNWESCYR-GGWYNSLIAVAPQIA  63

Query  200   DAGITHVWLPPPSNAREGDDQGYMPKRMYDLDTSKYGNKKELKALNDAFHGRGIKSVADI  379
              AG+THVWLPPPS A   D QGY+P R+YDLD SKYG+K+EL AL  + H RG+K+VAD+
Sbjct  64    AAGVTHVWLPPPSQAV--DPQGYLPGRLYDLDASKYGSKEELTALIKSLHDRGVKAVADV  121

Query  380   VLNHRAAERANSRGVFNVFEGGTPDDKLDWGPSEICGDDAAF-EGTGNPDTGDPWGDAPD  556
             V+NHR AER ++RG++ +FEGGT D +LDWGP+ IC DDA + +GTGN DTG+ +  APD
Sbjct  122   VINHRTAERKDARGIYCIFEGGTDDGRLDWGPAFICRDDAEYSDGTGNLDTGEGYAGAPD  181

Query  557   IDHRSPRVQREISEWMNWLKSDVGFDGWRFDYVKGYDFVKGFAAVKIYMDNTKPEFAVGE  736
             IDH +P VQ E+SEW+NWL+ ++GFDGWR D+VKGY    G A  +IY++NT P F VGE
Sbjct  182   IDHLNPTVQAELSEWLNWLRHEIGFDGWRLDFVKGYS--TGIA--QIYVNNTDPRFVVGE  237

Query  737   LWNALSPGSVPNP-DYNQDAHRNELVRWVQNaggaatafdfttKGILQAALNNTELWRLK  913
             LW++L   ++    +YNQD HR+ +  W  +AGG   AFDFTT GIL+ A+   ELWRLK
Sbjct  238   LWSSLYYNTLDGRLEYNQDRHRDRIANWANSAGGGVKAFDFTTMGILRVAVQG-ELWRLK  296

Query  914   DAAGKPSGMIGVLPQSAVTFIDNHDTWSQRLWPFTTSTDDAVNHDRVLQGYAYILTHPGI  1093
             DA G P GM+G+ P+ +VT + NHD+   + W F          ++++ GYAYILTHPG 
Sbjct  297   DAPGNPPGMMGISPEKSVTLVANHDSVDDQHWRFPP--------EKLILGYAYILTHPGT  348

Query  1094  PSVFYDHFFEWGLKDAISKLISIRNKNGVSATSPVEILAADADLYIAKINGKVILKIGPN  1273
             P +F DHF  W  +DAI +L +IR +NG+S TS +EIL ADADLY+AKI GKVI  IG  
Sbjct  349   PMIFCDHFLAWSNRDAILELTAIRARNGISETSKLEILIADADLYVAKIEGKVITMIGSG  408

Query  1274  GD--LKNLVPSDFMLATSGKDFAVWE  1345
                 L  LVP  F LATSG ++A++E
Sbjct  409   MGMALGTLVPPTFDLATSGDEYAIFE  434



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 4365618994296