BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c80713_g1_i1 len=1351 path=[1:0-1350]

Length=1351
                                                                      Score     E

ref|XP_009759913.1|  PREDICTED: probable purine permease 4              387   2e-127   
gb|KEH37325.1|  triose-phosphate transporter family protein             380   1e-124   
gb|KEH37326.1|  triose-phosphate transporter family protein             380   1e-124   
ref|XP_009622283.1|  PREDICTED: probable purine permease 4 isofor...    377   2e-123   
ref|XP_009799236.1|  PREDICTED: probable purine permease 4              376   4e-123   
ref|XP_009622284.1|  PREDICTED: probable purine permease 4 isofor...    372   1e-121   
ref|XP_004488230.1|  PREDICTED: probable purine permease 4-like         370   1e-121   
ref|XP_007138880.1|  hypothetical protein PHAVU_009G245400g             365   1e-118   
ref|XP_004248514.2|  PREDICTED: probable purine permease 4              354   2e-115   
ref|XP_009115035.1|  PREDICTED: probable purine permease 4              354   8e-115   
ref|XP_009115032.1|  PREDICTED: probable purine permease 4              354   1e-114   
ref|XP_002533991.1|  purine transporter, putative                       353   2e-114   Ricinus communis
ref|XP_004248515.2|  PREDICTED: probable purine permease 4              350   2e-113   
ref|XP_004488231.1|  PREDICTED: probable purine permease 4-like         350   5e-113   
ref|XP_011089061.1|  PREDICTED: probable purine permease 4              349   6e-113   
ref|XP_006352647.1|  PREDICTED: probable purine permease 4-like         348   2e-112   
ref|XP_007213488.1|  hypothetical protein PRUPE_ppa022736mg             347   2e-112   
ref|XP_007034137.1|  Purine permease 4                                  346   8e-112   
ref|XP_002263453.2|  PREDICTED: probable purine permease 4              345   1e-111   Vitis vinifera
ref|XP_008226019.1|  PREDICTED: probable purine permease 4              345   3e-111   
ref|XP_004248513.1|  PREDICTED: probable purine permease 4              345   5e-111   
ref|XP_010058075.1|  PREDICTED: probable purine permease 4              344   7e-111   
ref|XP_006352648.1|  PREDICTED: probable purine permease 4-like         344   1e-110   
ref|NP_564365.1|  purine permease 4                                     343   2e-110   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006307602.1|  hypothetical protein CARUB_v10009226mg             342   1e-109   
ref|XP_002534165.1|  purine transporter, putative                       340   3e-109   Ricinus communis
ref|XP_006364822.1|  PREDICTED: probable purine permease 4-like         341   5e-109   
ref|XP_009363284.1|  PREDICTED: probable purine permease 4              340   7e-109   
ref|XP_008371936.1|  PREDICTED: probable purine permease 4              339   9e-109   
gb|KHN26582.1|  Putative purine permease 4                              337   2e-108   
ref|XP_010460900.1|  PREDICTED: probable purine permease 4              337   2e-108   
ref|XP_003534853.1|  PREDICTED: probable purine permease 4-like         338   4e-108   
ref|XP_010499636.1|  PREDICTED: probable purine permease 4 isofor...    337   4e-108   
ref|XP_010676487.1|  PREDICTED: probable purine permease 4              337   4e-108   
ref|XP_010478523.1|  PREDICTED: probable purine permease 4 isofor...    336   1e-107   
ref|XP_010519027.1|  PREDICTED: probable purine permease 4              334   4e-107   
ref|XP_004232602.1|  PREDICTED: probable purine permease 4              335   6e-107   
gb|AGV54805.1|  purine permease 4-like protein                          333   2e-106   
ref|XP_007138881.1|  hypothetical protein PHAVU_009G245500g             331   1e-105   
ref|XP_011008209.1|  PREDICTED: probable purine permease 4              328   9e-105   
ref|XP_002304614.1|  purine permease-related family protein             329   1e-104   Populus trichocarpa [western balsam poplar]
gb|KFK41670.1|  hypothetical protein AALP_AA2G157700                    328   1e-104   
ref|XP_006415403.1|  hypothetical protein EUTSA_v10007839mg             328   2e-104   
ref|XP_002297909.2|  purine permease-related family protein             324   1e-103   Populus trichocarpa [western balsam poplar]
ref|XP_011022291.1|  PREDICTED: probable purine permease 4              325   3e-103   
ref|XP_002890908.1|  hypothetical protein ARALYDRAFT_473325             323   7e-103   
ref|XP_009614957.1|  PREDICTED: probable purine permease 4              320   3e-102   
ref|XP_009368569.1|  PREDICTED: probable purine permease 4              320   6e-101   
gb|EYU19429.1|  hypothetical protein MIMGU_mgv1a018240mg                317   8e-101   
gb|KHN26580.1|  Putative purine permease 4                              317   1e-100   
ref|XP_003533498.1|  PREDICTED: probable purine permease 4-like         318   2e-100   
ref|XP_003534852.1|  PREDICTED: probable purine permease 4-like         318   3e-100   
ref|XP_008383243.1|  PREDICTED: probable purine permease 4              318   3e-100   
ref|XP_003547402.1|  PREDICTED: probable purine permease 4-like         313   3e-99    
gb|KHN47749.1|  Putative purine permease 4                              312   4e-99    
ref|XP_010540621.1|  PREDICTED: probable purine permease 4              314   5e-99    
gb|KHN47750.1|  Putative purine permease 4                              312   4e-98    
ref|XP_003547401.1|  PREDICTED: probable purine permease 4-like         311   5e-98    
ref|XP_007040977.1|  Purine permease 4                                  310   1e-97    
ref|XP_010094635.1|  putative purine permease 4                         310   5e-97    
ref|XP_006468659.1|  PREDICTED: probable purine permease 4-like         305   7e-96    
ref|XP_006448569.1|  hypothetical protein CICLE_v10015596mg             303   6e-95    
ref|XP_010260818.1|  PREDICTED: probable purine permease 4              300   2e-93    
ref|XP_004293849.1|  PREDICTED: probable purine permease 4-like         295   2e-92    
ref|XP_009407088.1|  PREDICTED: probable purine permease 4              288   1e-88    
ref|XP_009622285.1|  PREDICTED: probable purine permease 4              275   1e-85    
ref|XP_009622287.1|  PREDICTED: probable purine permease 4              269   2e-83    
gb|KDP35091.1|  hypothetical protein JCGZ_11000                         268   8e-83    
gb|KCW75587.1|  hypothetical protein EUGRSUZ_E04331                     268   1e-82    
emb|CDP04107.1|  unnamed protein product                                269   1e-81    
emb|CBI16952.3|  unnamed protein product                                265   4e-81    
ref|XP_006859063.1|  hypothetical protein AMTR_s00068p00197770          258   7e-78    
ref|XP_010924628.1|  PREDICTED: probable purine permease 4              256   4e-77    
emb|CBH32558.1|  Triose-phosphate Transporter family domain conta...    252   2e-75    
ref|XP_008799578.1|  PREDICTED: LOW QUALITY PROTEIN: probable pur...    251   3e-75    
gb|EMT13849.1|  hypothetical protein F775_18178                         249   2e-74    
emb|CAN70704.1|  hypothetical protein VITISV_021892                     254   2e-73    Vitis vinifera
ref|NP_001043870.1|  Os01g0680200                                       246   5e-73    Oryza sativa Japonica Group [Japonica rice]
ref|XP_004969543.1|  PREDICTED: probable purine permease 4-like         245   2e-72    
ref|XP_006644522.1|  PREDICTED: probable purine permease 4-like         245   2e-72    
gb|EEE55178.1|  hypothetical protein OsJ_03013                          244   2e-72    Oryza sativa Japonica Group [Japonica rice]
ref|XP_002456148.1|  hypothetical protein SORBIDRAFT_03g031210          244   3e-72    Sorghum bicolor [broomcorn]
ref|XP_003566995.2|  PREDICTED: probable purine permease 4              243   2e-71    
tpg|DAA58126.1|  TPA: hypothetical protein ZEAMMB73_217515              241   4e-71    
emb|CDY02338.1|  BnaA09g25640D                                          236   5e-70    
emb|CDY09527.1|  BnaC05g23920D                                          234   3e-69    
emb|CDY09533.1|  BnaC05g23860D                                          234   4e-69    
ref|XP_009416726.1|  PREDICTED: probable purine permease 4              231   3e-67    
ref|XP_008656754.1|  PREDICTED: probable purine permease 4              231   4e-67    
ref|XP_010918723.1|  PREDICTED: probable purine permease 4              229   6e-67    
ref|XP_004961267.1|  PREDICTED: probable purine permease 4-like         230   7e-67    
ref|XP_002440227.1|  hypothetical protein SORBIDRAFT_09g028030          223   1e-64    Sorghum bicolor [broomcorn]
ref|XP_006654764.1|  PREDICTED: probable purine permease 4-like         223   3e-64    
dbj|BAK04769.1|  predicted protein                                      223   5e-64    
ref|XP_002441494.1|  hypothetical protein SORBIDRAFT_09g028020          222   7e-64    Sorghum bicolor [broomcorn]
ref|XP_009392542.1|  PREDICTED: probable purine permease 4              221   2e-63    
gb|AFW79100.1|  purine permease                                         217   4e-62    
ref|XP_003565934.1|  PREDICTED: probable purine permease 4              217   6e-62    
gb|EAY98974.1|  hypothetical protein OsI_20932                          217   7e-62    Oryza sativa Indica Group [Indian rice]
gb|AAT58711.1|  unknown protein                                         216   9e-62    Oryza sativa Japonica Group [Japonica rice]
ref|NP_001056283.2|  Os05g0556800                                       217   1e-61    Oryza sativa Japonica Group [Japonica rice]
ref|XP_009415218.1|  PREDICTED: probable purine permease 4              209   5e-59    
ref|XP_004973073.1|  PREDICTED: probable purine permease 4-like         203   1e-56    
gb|EAY75375.1|  hypothetical protein OsI_03272                          191   2e-53    Oryza sativa Indica Group [Indian rice]
ref|NP_001043142.1|  Os01g0504100                                       192   9e-53    Oryza sativa Japonica Group [Japonica rice]
ref|XP_003565787.1|  PREDICTED: probable purine permease 4              189   1e-51    
gb|EEE64646.1|  hypothetical protein OsJ_19500                          184   8e-50    Oryza sativa Japonica Group [Japonica rice]
gb|ABR16480.1|  unknown                                                 179   8e-48    Picea sitchensis
gb|EPS65699.1|  hypothetical protein M569_09078                         175   8e-47    
ref|XP_006364706.1|  PREDICTED: purine permease 3-like                  176   1e-46    
ref|XP_010247465.1|  PREDICTED: purine permease 3-like                  175   2e-46    
ref|XP_010675382.1|  PREDICTED: purine permease 3-like                  176   2e-46    
ref|XP_008219366.1|  PREDICTED: purine permease 3-like                  174   4e-46    
ref|XP_010939717.1|  PREDICTED: purine permease 3-like isoform X2       174   4e-46    
ref|XP_004242795.1|  PREDICTED: purine permease 3-like                  174   6e-46    
ref|XP_006841259.1|  hypothetical protein AMTR_s00135p00097090          174   6e-46    
ref|NP_001063425.1|  Os09g0467400                                       174   7e-46    Oryza sativa Japonica Group [Japonica rice]
ref|XP_010263028.1|  PREDICTED: purine permease 1-like                  174   8e-46    
ref|XP_008667169.1|  PREDICTED: uncharacterized protein LOC100193...    173   8e-46    
ref|XP_009373619.1|  PREDICTED: purine permease 3-like                  174   9e-46    
ref|XP_007227615.1|  hypothetical protein PRUPE_ppa022492mg             173   1e-45    
ref|XP_002983502.1|  hypothetical protein SELMODRAFT_118529             171   2e-45    
ref|XP_009373503.1|  PREDICTED: purine permease 3-like                  172   3e-45    
dbj|BAD19737.1|  putative purine permease                               172   4e-45    Oryza sativa Japonica Group [Japonica rice]
ref|XP_004501676.1|  PREDICTED: purine permease 1-like isoform X1       171   6e-45    
ref|XP_006841262.1|  hypothetical protein AMTR_s00135p00100890          171   6e-45    
ref|XP_002973993.1|  hypothetical protein SELMODRAFT_232165             170   6e-45    
gb|EMT00369.1|  hypothetical protein F775_21645                         168   7e-45    
ref|XP_004299692.1|  PREDICTED: purine permease 3-like                  171   8e-45    
gb|EEC84724.1|  hypothetical protein OsI_31699                          170   1e-44    Oryza sativa Indica Group [Indian rice]
ref|XP_008338896.1|  PREDICTED: purine permease 3-like                  170   2e-44    
ref|XP_008444876.1|  PREDICTED: purine permease 3-like                  170   2e-44    
ref|XP_007223326.1|  hypothetical protein PRUPE_ppa007339mg             169   3e-44    
ref|XP_004299691.1|  PREDICTED: purine permease 3-like                  169   3e-44    
ref|NP_001149498.1|  purine permease                                    166   4e-44    Zea mays [maize]
ref|XP_009603730.1|  PREDICTED: purine permease 3-like                  168   6e-44    
ref|XP_004245857.1|  PREDICTED: probable purine permease 11             169   6e-44    
ref|XP_010942638.1|  PREDICTED: purine permease 3-like isoform X2       168   9e-44    
ref|XP_006295883.1|  hypothetical protein CARUB_v10025013mg             167   1e-43    
ref|XP_006602851.1|  PREDICTED: probable purine permease 11-like ...    167   1e-43    
gb|AES73111.2|  purine permease-like protein                            167   2e-43    
ref|XP_003551696.2|  PREDICTED: probable purine permease 11-like ...    167   2e-43    
ref|XP_010064227.1|  PREDICTED: purine permease 3-like                  167   2e-43    
ref|XP_010942637.1|  PREDICTED: purine permease 3-like isoform X1       169   2e-43    
ref|XP_006305220.1|  hypothetical protein CARUB_v10009586mg             166   2e-43    
ref|XP_008219368.1|  PREDICTED: purine permease 3-like                  167   2e-43    
gb|KDP41439.1|  hypothetical protein JCGZ_15846                         166   3e-43    
ref|XP_007018134.1|  Purine permease 3                                  166   3e-43    
ref|XP_004152619.1|  PREDICTED: purine permease 3-like                  166   4e-43    
ref|XP_004164781.1|  PREDICTED: purine permease 3-like                  166   4e-43    
gb|KHG22236.1|  Purine permease 1 -like protein                         166   5e-43    
ref|XP_003602860.1|  Purine permease                                    167   5e-43    
ref|XP_006354634.1|  PREDICTED: probable purine permease 11-like        166   8e-43    
ref|XP_003578263.2|  PREDICTED: purine permease 3-like                  166   8e-43    
ref|XP_009611006.1|  PREDICTED: purine permease 1-like                  165   8e-43    
ref|XP_010939715.1|  PREDICTED: purine permease 3-like                  165   9e-43    
gb|KDP40961.1|  hypothetical protein JCGZ_24960                         167   1e-42    
ref|XP_009598031.1|  PREDICTED: purine permease 1-like                  164   1e-42    
ref|XP_006358606.1|  PREDICTED: probable purine permease 11-like        165   1e-42    
ref|XP_009776518.1|  PREDICTED: purine permease 1-like                  164   2e-42    
gb|AFK45074.1|  unknown                                                 164   2e-42    
emb|CDP01126.1|  unnamed protein product                                164   2e-42    
ref|XP_010263027.1|  PREDICTED: purine permease 3-like                  164   2e-42    
ref|XP_002285718.1|  PREDICTED: purine permease 1                       164   2e-42    Vitis vinifera
ref|XP_009769306.1|  PREDICTED: purine permease 1-like                  164   2e-42    
ref|XP_010060063.1|  PREDICTED: purine permease 3-like isoform X1       164   2e-42    
gb|ADP30798.1|  nicotine uptake permease 1                              164   3e-42    
ref|XP_009380886.1|  PREDICTED: purine permease 3-like                  164   3e-42    
ref|XP_009763953.1|  PREDICTED: purine permease 3-like                  163   4e-42    
ref|XP_002893512.1|  ATPUP3                                             163   4e-42    
ref|XP_010266597.1|  PREDICTED: purine permease 3-like                  164   4e-42    
ref|XP_009143832.1|  PREDICTED: purine permease 2 isoform X1            163   5e-42    
ref|XP_009765499.1|  PREDICTED: purine permease 1-like                  163   5e-42    
ref|XP_002285717.1|  PREDICTED: purine permease 1                       162   6e-42    Vitis vinifera
gb|KDP40942.1|  hypothetical protein JCGZ_24941                         162   6e-42    
ref|NP_001241384.1|  uncharacterized protein LOC100819409               163   7e-42    
ref|XP_008812221.1|  PREDICTED: purine permease 3-like                  162   9e-42    
ref|XP_009109745.1|  PREDICTED: purine permease 1                       162   1e-41    
ref|XP_002462515.1|  hypothetical protein SORBIDRAFT_02g027100          162   1e-41    Sorghum bicolor [broomcorn]
gb|KHG13700.1|  Purine permease 3 -like protein                         162   1e-41    
emb|CDY35722.1|  BnaC03g58430D                                          162   2e-41    
ref|XP_006357923.1|  PREDICTED: purine permease 3-like                  161   2e-41    
ref|XP_010680002.1|  PREDICTED: probable purine permease 11             162   2e-41    
ref|XP_009795252.1|  PREDICTED: purine permease 1-like                  161   2e-41    
ref|XP_009102926.1|  PREDICTED: purine permease 3                       161   2e-41    
emb|CDX94595.1|  BnaC07g10630D                                          160   3e-41    
emb|CDP08377.1|  unnamed protein product                                160   4e-41    
ref|XP_008232299.1|  PREDICTED: probable purine permease 11 isofo...    161   4e-41    
ref|XP_004959530.1|  PREDICTED: purine permease 1-like                  161   4e-41    
ref|XP_009621473.1|  PREDICTED: purine permease 3-like                  160   4e-41    
ref|XP_008232298.1|  PREDICTED: probable purine permease 11 isofo...    161   5e-41    
ref|XP_010509840.1|  PREDICTED: purine permease 2-like                  161   5e-41    
ref|XP_010469434.1|  PREDICTED: purine permease 2-like                  160   5e-41    
ref|XP_009599635.1|  PREDICTED: purine permease 1-like                  160   7e-41    
ref|XP_003550935.1|  PREDICTED: probable purine permease 11-like        160   8e-41    
gb|KFK44702.1|  hypothetical protein AALP_AA1G292000                    160   8e-41    
gb|AES73112.2|  purine permease-like protein                            160   9e-41    
gb|EPS67422.1|  hypothetical protein M569_07351                         159   1e-40    
gb|EYU21537.1|  hypothetical protein MIMGU_mgv1a018814mg                159   1e-40    
ref|XP_010677221.1|  PREDICTED: probable purine permease 11 isofo...    160   1e-40    
ref|XP_010509839.1|  PREDICTED: purine permease 2-like                  159   1e-40    
ref|XP_009783837.1|  PREDICTED: purine permease 3-like                  159   1e-40    
ref|NP_174143.1|  purine permease 3                                     159   1e-40    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010060067.1|  PREDICTED: purine permease 1-like                  159   2e-40    
ref|XP_008806390.1|  PREDICTED: purine permease 3-like                  159   2e-40    
ref|XP_011006371.1|  PREDICTED: purine permease 3                       159   2e-40    
ref|XP_006433898.1|  hypothetical protein CICLE_v10001546mg             159   2e-40    
ref|XP_002320858.2|  purine permease family protein                     159   2e-40    Populus trichocarpa [western balsam poplar]
ref|XP_007139692.1|  hypothetical protein PHAVU_008G051100g             159   2e-40    
dbj|BAK04933.1|  predicted protein                                      159   2e-40    
ref|XP_010413821.1|  PREDICTED: purine permease 2                       158   2e-40    
ref|XP_009615076.1|  PREDICTED: purine permease 3-like                  158   2e-40    
ref|XP_010060066.1|  PREDICTED: purine permease 1-like                  159   3e-40    
ref|XP_002513994.1|  purine transporter, putative                       158   3e-40    Ricinus communis
ref|XP_008667894.1|  PREDICTED: PUP1 isoform X1                         159   3e-40    
ref|XP_007218138.1|  hypothetical protein PRUPE_ppa007245mg             158   3e-40    
dbj|BAJ86755.1|  predicted protein                                      158   3e-40    
ref|XP_004229705.1|  PREDICTED: probable purine permease 11             158   4e-40    
ref|XP_007042880.1|  Purine permease 3                                  159   4e-40    
ref|XP_007018133.1|  Purine permease 3, putative                        159   4e-40    
ref|XP_002531513.1|  purine transporter, putative                       158   4e-40    Ricinus communis
ref|XP_007218139.1|  hypothetical protein PRUPE_ppa007245mg             158   4e-40    
emb|CDY17197.1|  BnaA05g09910D                                          157   5e-40    
ref|XP_010509841.1|  PREDICTED: purine permease 2-like                  157   5e-40    
emb|CDP19267.1|  unnamed protein product                                157   5e-40    
ref|XP_004237961.1|  PREDICTED: purine permease 1-like                  157   7e-40    
ref|XP_006366415.1|  PREDICTED: purine permease 3-like                  157   8e-40    
gb|KCW66598.1|  hypothetical protein EUGRSUZ_F00392                     159   8e-40    
ref|XP_010549316.1|  PREDICTED: purine permease 3                       156   8e-40    
ref|NP_001131978.1|  uncharacterized protein LOC100193377               157   9e-40    Zea mays [maize]
gb|EMT19524.1|  Purine permease 3                                       156   9e-40    
ref|XP_008652812.1|  PREDICTED: purine permease 3-like                  157   1e-39    
ref|XP_006410518.1|  hypothetical protein EUTSA_v10017788mg             157   1e-39    
emb|CDY27947.1|  BnaCnng05320D                                          156   1e-39    
ref|XP_009400212.1|  PREDICTED: probable purine permease 11             157   1e-39    
gb|EYU34537.1|  hypothetical protein MIMGU_mgv1a022801mg                156   1e-39    
ref|XP_008450620.1|  PREDICTED: probable purine permease 11 isofo...    156   1e-39    
ref|XP_010248452.1|  PREDICTED: purine permease 3-like                  155   2e-39    
ref|XP_010538168.1|  PREDICTED: purine permease 1-like                  156   2e-39    
gb|KFK44691.1|  hypothetical protein AALP_AA1G290900                    156   2e-39    
ref|XP_002285719.1|  PREDICTED: purine permease 1-like                  156   2e-39    Vitis vinifera
ref|XP_009143833.1|  PREDICTED: purine permease 2 isoform X2            156   2e-39    
ref|XP_006357925.1|  PREDICTED: purine permease 3-like                  155   2e-39    
ref|XP_008812219.1|  PREDICTED: purine permease 3-like                  155   2e-39    
ref|XP_007155747.1|  hypothetical protein PHAVU_003G228300g             156   3e-39    
ref|XP_009588639.1|  PREDICTED: purine permease 3-like                  155   3e-39    
ref|XP_004957086.1|  PREDICTED: purine permease 3-like                  155   3e-39    
ref|XP_010266586.1|  PREDICTED: purine permease 3-like                  156   3e-39    
ref|XP_002307351.2|  PURINE PERMEASE 1 family protein                   155   4e-39    Populus trichocarpa [western balsam poplar]
ref|XP_009770717.1|  PREDICTED: purine permease 1-like                  155   4e-39    
ref|XP_004490401.1|  PREDICTED: purine permease 1-like                  155   4e-39    
ref|XP_002993859.1|  hypothetical protein SELMODRAFT_236829             154   5e-39    
ref|XP_004492883.1|  PREDICTED: probable purine permease 11-like ...    155   5e-39    
gb|AAF64547.1|AF078531_1  purine permease                               155   5e-39    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010244044.1|  PREDICTED: purine permease 1-like                  155   5e-39    
ref|XP_010926344.1|  PREDICTED: purine permease 3-like isoform X1       155   6e-39    
ref|XP_010055380.1|  PREDICTED: probable purine permease 11             155   6e-39    
ref|XP_004492882.1|  PREDICTED: probable purine permease 11-like ...    155   6e-39    
ref|XP_002977418.1|  hypothetical protein SELMODRAFT_417454             155   7e-39    
ref|XP_004252714.1|  PREDICTED: purine permease 3-like                  154   7e-39    
ref|XP_002991403.1|  hypothetical protein SELMODRAFT_236291             154   7e-39    
ref|NP_174144.1|  purine permease 1                                     154   7e-39    Arabidopsis thaliana [mouse-ear cress]
ref|XP_009109746.1|  PREDICTED: purine permease 1-like                  154   7e-39    
gb|KHG06856.1|  Purine permease 1 -like protein                         155   8e-39    
ref|XP_008225422.1|  PREDICTED: probable purine permease 9              155   8e-39    
ref|XP_008225353.1|  PREDICTED: probable purine permease 9              154   1e-38    
ref|XP_009123493.1|  PREDICTED: probable purine permease 4              147   1e-38    
gb|ABR16841.1|  unknown                                                 154   1e-38    Picea sitchensis
ref|XP_009605309.1|  PREDICTED: purine permease 1-like                  154   1e-38    
ref|XP_006472532.1|  PREDICTED: purine permease 1-like                  154   2e-38    
ref|XP_002454455.1|  hypothetical protein SORBIDRAFT_04g031400          154   2e-38    Sorghum bicolor [broomcorn]
ref|XP_003522775.1|  PREDICTED: purine permease 1-like                  153   2e-38    
gb|KGN66057.1|  hypothetical protein Csa_1G569340                       153   3e-38    
ref|XP_003579811.2|  PREDICTED: purine permease 3-like                  153   3e-38    
ref|XP_008364779.1|  PREDICTED: probable purine permease 11 isofo...    153   3e-38    
ref|XP_006338103.1|  PREDICTED: purine permease 1-like                  152   4e-38    
emb|CDY16284.1|  BnaC01g23190D                                          153   4e-38    
ref|XP_008364778.1|  PREDICTED: probable purine permease 11 isofo...    152   4e-38    
ref|XP_004293484.1|  PREDICTED: probable purine permease 9-like i...    153   4e-38    
ref|XP_008444875.1|  PREDICTED: purine permease 3-like                  152   4e-38    
ref|XP_007141230.1|  hypothetical protein PHAVU_008G178300g             152   4e-38    
ref|XP_004293485.1|  PREDICTED: probable purine permease 9-like i...    153   4e-38    
ref|XP_010322002.1|  PREDICTED: LOW QUALITY PROTEIN: purine perme...    152   5e-38    
ref|XP_006358992.1|  PREDICTED: purine permease 1-like                  152   6e-38    
ref|XP_009148632.1|  PREDICTED: purine permease 2-like                  152   7e-38    
ref|XP_009339630.1|  PREDICTED: probable purine permease 11 isofo...    152   7e-38    
ref|XP_010549318.1|  PREDICTED: purine permease 3-like                  151   7e-38    
ref|XP_011072345.1|  PREDICTED: LOW QUALITY PROTEIN: purine perme...    151   7e-38    
emb|CDY12422.1|  BnaC08g09110D                                          152   7e-38    
ref|XP_009339629.1|  PREDICTED: probable purine permease 11 isofo...    152   8e-38    
ref|XP_002881298.1|  ATPUP2                                             151   8e-38    
gb|EYU21538.1|  hypothetical protein MIMGU_mgv1a020196mg                151   9e-38    
ref|XP_010413817.1|  PREDICTED: purine permease 2-like                  151   9e-38    
ref|XP_010098679.1|  Purine permease 3                                  152   9e-38    
emb|CDY29741.1|  BnaA01g19250D                                          151   1e-37    
gb|AFK38153.1|  unknown                                                 151   1e-37    
gb|KHN40504.1|  Putative purine permease 11                             149   1e-37    
ref|XP_007039598.1|  Drug/metabolite transporter superfamily protein    150   1e-37    
ref|XP_006661330.1|  PREDICTED: purine permease 3-like                  151   1e-37    
emb|CDP11456.1|  unnamed protein product                                150   2e-37    
ref|XP_006415682.1|  hypothetical protein EUTSA_v10008037mg             150   2e-37    
ref|XP_008677756.1|  PREDICTED: uncharacterized protein LOC100502...    151   2e-37    
ref|XP_007042882.1|  Purine permease 3 isoform 2                        150   2e-37    
ref|XP_004959525.1|  PREDICTED: purine permease 3-like                  151   3e-37    
ref|XP_009623687.1|  PREDICTED: probable purine permease 4              145   3e-37    
ref|XP_010460601.1|  PREDICTED: purine permease 1                       150   3e-37    
ref|XP_003519187.1|  PREDICTED: purine permease 1-like                  149   3e-37    
ref|XP_010538169.1|  PREDICTED: purine permease 3-like                  149   4e-37    
ref|NP_973592.1|  purine permease 2                                     149   4e-37    
ref|XP_010092275.1|  hypothetical protein L484_021136                   150   5e-37    
ref|XP_004953494.1|  PREDICTED: probable purine permease 11-like        150   6e-37    
gb|KDP45955.1|  hypothetical protein JCGZ_11858                         149   7e-37    
ref|XP_007211409.1|  hypothetical protein PRUPE_ppa006967mg             149   7e-37    
ref|NP_001147096.1|  PUP1                                               149   8e-37    
ref|XP_004152618.1|  PREDICTED: purine permease 3-like                  149   8e-37    
ref|XP_002893513.1|  hypothetical protein ARALYDRAFT_890360             149   8e-37    
ref|XP_008355645.1|  PREDICTED: probable purine permease 11             149   9e-37    
ref|XP_006841261.1|  hypothetical protein AMTR_s00135p00099660          149   9e-37    
ref|XP_002526505.1|  ATPUP11, putative                                  149   1e-36    
ref|XP_009762239.1|  PREDICTED: purine permease 1-like                  148   1e-36    
ref|XP_009353822.1|  PREDICTED: probable purine permease 10             149   1e-36    
ref|XP_009766753.1|  PREDICTED: purine permease 3-like                  148   1e-36    
dbj|BAJ94351.1|  predicted protein                                      149   1e-36    
ref|XP_006357924.1|  PREDICTED: purine permease 3-like                  148   1e-36    
ref|XP_004246178.1|  PREDICTED: probable purine permease 11             149   1e-36    
ref|XP_011031685.1|  PREDICTED: probable purine permease 11             148   2e-36    
ref|XP_002298513.2|  hypothetical protein POPTR_0001s34550g             148   2e-36    
ref|XP_008677755.1|  PREDICTED: uncharacterized protein LOC100502...    150   2e-36    
gb|KDP37934.1|  hypothetical protein JCGZ_04577                         149   2e-36    
ref|XP_010478191.1|  PREDICTED: purine permease 1-like                  147   2e-36    
ref|XP_009766626.1|  PREDICTED: probable purine permease 11 isofo...    148   2e-36    
ref|XP_009766627.1|  PREDICTED: probable purine permease 11 isofo...    147   2e-36    
gb|KDP28910.1|  hypothetical protein JCGZ_14681                         147   2e-36    
ref|XP_008383566.1|  PREDICTED: probable purine permease 9              148   3e-36    
ref|XP_010460596.1|  PREDICTED: purine permease 3                       147   4e-36    
ref|XP_010674210.1|  PREDICTED: probable purine permease 11 isofo...    146   5e-36    
ref|XP_003624233.1|  hypothetical protein MTR_7g080750                  146   5e-36    
ref|XP_007213551.1|  hypothetical protein PRUPE_ppa018140mg             146   5e-36    
ref|XP_010674209.1|  PREDICTED: probable purine permease 11 isofo...    147   5e-36    
ref|XP_006338102.1|  PREDICTED: purine permease 1-like                  146   5e-36    
ref|XP_007136297.1|  hypothetical protein PHAVU_009G034400g             146   5e-36    
ref|XP_008663458.1|  PREDICTED: probable purine permease 11             147   6e-36    
ref|XP_011018650.1|  PREDICTED: probable purine permease 11 isofo...    147   6e-36    
ref|XP_011018648.1|  PREDICTED: probable purine permease 11 isofo...    147   6e-36    
gb|KDP20127.1|  hypothetical protein JCGZ_05896                         147   7e-36    
ref|XP_008446590.1|  PREDICTED: purine permease 3-like                  146   7e-36    
ref|XP_010110511.1|  hypothetical protein L484_023343                   147   8e-36    
ref|NP_193556.1|  putative purine permease 9                            145   9e-36    
gb|EAZ09425.1|  hypothetical protein OsI_31698                          146   9e-36    
ref|NP_001063424.1|  Os09g0467300                                       146   9e-36    
ref|XP_003525599.1|  PREDICTED: probable purine permease 10-like        145   1e-35    
ref|XP_011007507.1|  PREDICTED: probable purine permease 10             146   1e-35    
ref|XP_007042881.1|  Purine permease 3 isoform 1                        145   1e-35    
sp|O49726.2|PUP9_ARATH  RecName: Full=Probable purine permease 9;...    146   1e-35    
ref|XP_006368464.1|  hypothetical protein POPTR_0001s03050g             146   1e-35    
ref|XP_009604157.1|  PREDICTED: probable purine permease 11 isofo...    145   2e-35    
ref|XP_006662363.1|  PREDICTED: probable purine permease 11-like        145   2e-35    
ref|XP_009604158.1|  PREDICTED: probable purine permease 11 isofo...    145   2e-35    
emb|CDP01096.1|  unnamed protein product                                145   2e-35    
ref|XP_010247689.1|  PREDICTED: probable purine permease 11             145   2e-35    
ref|XP_009609429.1|  PREDICTED: purine permease 3-like                  145   2e-35    
ref|XP_002447004.1|  hypothetical protein SORBIDRAFT_06g026770          145   3e-35    
ref|XP_007052417.1|  Purine permease 11 isoform 1                       144   3e-35    
ref|XP_007052418.1|  Purine permease 11 isoform 2                       144   3e-35    
ref|XP_004295378.1|  PREDICTED: probable purine permease 9-like         144   4e-35    
tpg|DAA61854.1|  TPA: hypothetical protein ZEAMMB73_233624              144   5e-35    
emb|CDY15687.1|  BnaA07g08580D                                          142   5e-35    
ref|XP_006282809.1|  hypothetical protein CARUB_v10006525mg             144   5e-35    
ref|XP_006661332.1|  PREDICTED: purine permease 3-like                  141   5e-35    
ref|XP_010439889.1|  PREDICTED: probable purine permease 9              144   5e-35    
ref|XP_004976625.1|  PREDICTED: probable purine permease 11-like        144   6e-35    
emb|CDP09375.1|  unnamed protein product                                144   6e-35    
ref|XP_002301070.2|  hypothetical protein POPTR_0002s09980g             143   6e-35    
ref|XP_006358633.1|  PREDICTED: probable purine permease 11-like        144   6e-35    
ref|XP_002977419.1|  hypothetical protein SELMODRAFT_417455             144   7e-35    
ref|XP_010677223.1|  PREDICTED: probable purine permease 11             144   8e-35    
ref|XP_003593723.1|  hypothetical protein MTR_2g015470                  144   8e-35    
gb|EEC70720.1|  hypothetical protein OsI_02099                          140   8e-35    
gb|EYU38177.1|  hypothetical protein MIMGU_mgv1a023817mg                143   9e-35    
ref|XP_002274345.2|  PREDICTED: probable purine permease 10             143   9e-35    
ref|XP_002870060.1|  purine permease family protein                     142   1e-34    
ref|XP_006305203.1|  hypothetical protein CARUB_v10009570mg             142   1e-34    
ref|XP_008450621.1|  PREDICTED: probable purine permease 11 isofo...    141   1e-34    
ref|XP_010499327.1|  PREDICTED: purine permease 1-like isoform X1       142   1e-34    
emb|CBI30830.3|  unnamed protein product                                144   1e-34    
ref|XP_003570128.1|  PREDICTED: probable purine permease 11 isofo...    142   2e-34    
ref|XP_010235835.1|  PREDICTED: probable purine permease 11 isofo...    142   2e-34    
gb|KDO85410.1|  hypothetical protein CISIN_1g0170172mg                  141   2e-34    
gb|AAC69140.1|  hypothetical protein                                    142   2e-34    
ref|XP_006445485.1|  hypothetical protein CICLE_v10020615mg             141   2e-34    
ref|XP_010663907.1|  PREDICTED: probable purine permease 11             142   2e-34    
ref|XP_010247691.1|  PREDICTED: probable purine permease 11 isofo...    142   3e-34    
ref|NP_180931.2|  purine permease 2                                     142   3e-34    
gb|KDO85409.1|  hypothetical protein CISIN_1g0170172mg                  141   3e-34    
ref|XP_010499329.1|  PREDICTED: purine permease 3-like                  141   3e-34    
ref|XP_006445483.1|  hypothetical protein CICLE_v10020615mg             140   4e-34    
ref|XP_006464375.1|  PREDICTED: probable purine permease 11-like ...    141   4e-34    
ref|XP_006464373.1|  PREDICTED: probable purine permease 11-like ...    141   5e-34    
ref|XP_006445484.1|  hypothetical protein CICLE_v10020615mg             141   5e-34    
ref|XP_010478189.1|  PREDICTED: purine permease 3-like                  140   5e-34    
ref|XP_010056479.1|  PREDICTED: probable purine permease 11 isofo...    140   5e-34    
ref|XP_010100974.1|  hypothetical protein L484_010629                   142   5e-34    
gb|KCW71838.1|  hypothetical protein EUGRSUZ_E00319                     139   6e-34    
gb|EEE69873.1|  hypothetical protein OsJ_29687                          140   6e-34    
ref|XP_008383506.1|  PREDICTED: probable purine permease 9              141   7e-34    
ref|XP_004237962.1|  PREDICTED: purine permease 3-like                  140   7e-34    
ref|XP_010056477.1|  PREDICTED: probable purine permease 11 isofo...    141   7e-34    
ref|XP_010056475.1|  PREDICTED: probable purine permease 11 isofo...    141   8e-34    
ref|XP_004307271.1|  PREDICTED: probable purine permease 11-like        142   9e-34    
gb|EMT19164.1|  hypothetical protein F775_05921                         140   1e-33    
ref|XP_011007506.1|  PREDICTED: probable purine permease 9 isofor...    139   1e-33    
ref|XP_010100973.1|  hypothetical protein L484_010628                   140   1e-33    
dbj|BAG93087.1|  unnamed protein product                                139   1e-33    
ref|XP_010434561.1|  PREDICTED: probable purine permease 9              140   1e-33    
ref|XP_002298512.2|  hypothetical protein POPTR_0001s34540g             140   1e-33    
ref|XP_011007505.1|  PREDICTED: probable purine permease 9 isofor...    140   1e-33    
ref|XP_010091777.1|  hypothetical protein L484_003837                   140   2e-33    
ref|XP_010517569.1|  PREDICTED: probable purine permease 9              140   2e-33    
ref|XP_010100975.1|  hypothetical protein L484_010630                   144   2e-33    
ref|XP_004135778.1|  PREDICTED: probable purine permease 10-like        138   2e-33    
ref|XP_002266773.1|  PREDICTED: probable purine permease 11 isofo...    139   2e-33    
ref|XP_010661433.1|  PREDICTED: probable purine permease 11 isofo...    139   2e-33    
ref|NP_001047783.1|  Os02g0689200                                       140   2e-33    
emb|CDP13405.1|  unnamed protein product                                139   2e-33    
ref|XP_010234593.1|  PREDICTED: purine permease 3-like isoform X1       139   2e-33    
dbj|BAD07671.1|  putative purine permease                               139   2e-33    
gb|EAZ24234.1|  hypothetical protein OsJ_07985                          140   2e-33    
ref|XP_003580442.1|  PREDICTED: probable purine permease 11             139   3e-33    
gb|EEC73811.1|  hypothetical protein OsI_08525                          139   3e-33    
ref|XP_010677220.1|  PREDICTED: probable purine permease 11             139   4e-33    
ref|XP_002462514.1|  hypothetical protein SORBIDRAFT_02g027090          139   4e-33    
gb|KDO38040.1|  hypothetical protein CISIN_1g0167861mg                  138   6e-33    
ref|XP_010274633.1|  PREDICTED: probable purine permease 11             137   6e-33    
ref|XP_004295379.1|  PREDICTED: probable purine permease 9-like         138   6e-33    
ref|XP_009775721.1|  PREDICTED: probable purine permease 11             138   7e-33    
ref|XP_002975003.1|  hypothetical protein SELMODRAFT_232471             136   7e-33    
gb|KCW75957.1|  hypothetical protein EUGRSUZ_D00325                     139   7e-33    
ref|XP_010052098.1|  PREDICTED: probable purine permease 9              138   9e-33    
gb|EPS58788.1|  hypothetical protein M569_16026                         136   1e-32    
ref|XP_006305130.1|  hypothetical protein CARUB_v10009499mg             137   1e-32    
dbj|BAJ95311.1|  predicted protein                                      137   1e-32    
ref|XP_009591151.1|  PREDICTED: probable purine permease 11             137   1e-32    
ref|XP_004508992.1|  PREDICTED: probable purine permease 10-like        138   1e-32    
ref|XP_010538524.1|  PREDICTED: probable purine permease 10             137   1e-32    
gb|EYU40318.1|  hypothetical protein MIMGU_mgv1a008679mg                137   1e-32    
ref|XP_006436828.1|  hypothetical protein CICLE_v10031810mg             137   2e-32    
ref|XP_010557496.1|  PREDICTED: probable purine permease 11             136   2e-32    
ref|XP_007149374.1|  hypothetical protein PHAVU_005G064800g             136   3e-32    
gb|EPS59789.1|  hypothetical protein M569_15017                         135   4e-32    
ref|XP_004498216.1|  PREDICTED: probable purine permease 9-like         135   5e-32    
ref|XP_006647707.1|  PREDICTED: probable purine permease 11-like        135   6e-32    
ref|XP_008795222.1|  PREDICTED: purine permease 3-like                  135   6e-32    
ref|XP_008226761.1|  PREDICTED: probable purine permease 10             135   7e-32    
ref|XP_008371579.1|  PREDICTED: probable purine permease 10             135   7e-32    
ref|XP_007025158.1|  Purine permease 10                                 135   7e-32    
ref|XP_007212398.1|  hypothetical protein PRUPE_ppa016371mg             134   8e-32    
gb|ADN34099.1|  purine transmembrane transporter                        135   8e-32    
ref|XP_008460053.1|  PREDICTED: probable purine permease 11             134   1e-31    
ref|XP_003615204.1|  Purine permease                                    134   1e-31    
gb|EEE69876.1|  hypothetical protein OsJ_29691                          132   1e-31    
ref|XP_010941200.1|  PREDICTED: probable purine permease 11             134   1e-31    
ref|XP_009401279.1|  PREDICTED: purine permease 1-like                  134   1e-31    
gb|KGN46286.1|  hypothetical protein Csa_6G079800                       134   1e-31    
gb|KFK22500.1|  hypothetical protein AALP_AAs43274U000100               133   1e-31    
ref|XP_004160684.1|  PREDICTED: probable purine permease 11-like        134   2e-31    
ref|XP_010091784.1|  hypothetical protein L484_003844                   134   2e-31    
ref|XP_004145022.1|  PREDICTED: probable purine permease 11-like        134   2e-31    
ref|XP_010097761.1|  hypothetical protein L484_023902                   132   2e-31    
ref|XP_010666510.1|  PREDICTED: probable purine permease 9              135   2e-31    
gb|KHN47451.1|  Putative purine permease 11                             134   2e-31    
ref|XP_003541802.2|  PREDICTED: probable purine permease 11-like        134   2e-31    
ref|XP_007214484.1|  hypothetical protein PRUPE_ppa020615mg             132   2e-31    
gb|EEC84725.1|  hypothetical protein OsI_31703                          131   3e-31    
ref|XP_008444266.1|  PREDICTED: probable purine permease 10             133   3e-31    
gb|EYU35321.1|  hypothetical protein MIMGU_mgv1a008781mg                133   3e-31    
ref|XP_004242601.1|  PREDICTED: probable purine permease 5 isofor...    132   4e-31    
ref|XP_004242599.1|  PREDICTED: probable purine permease 5 isofor...    132   5e-31    
gb|EMT31478.1|  hypothetical protein F775_19803                         132   6e-31    
ref|XP_002513954.1|  purine transporter, putative                       132   6e-31    
dbj|BAJ87663.1|  predicted protein                                      132   6e-31    
ref|XP_008225352.1|  PREDICTED: probable purine permease 10             132   7e-31    
ref|XP_007025156.1|  Purine permease 10, putative                       131   8e-31    
ref|XP_006857228.1|  hypothetical protein AMTR_s00065p00208130          130   8e-31    
tpg|DAA40289.1|  TPA: hypothetical protein ZEAMMB73_258363              130   8e-31    
ref|XP_008229522.1|  PREDICTED: probable purine permease 11             132   8e-31    
ref|XP_010052097.1|  PREDICTED: probable purine permease 9              132   9e-31    
ref|XP_006592598.1|  PREDICTED: probable purine permease 5-like i...    131   9e-31    
ref|XP_010559253.1|  PREDICTED: probable purine permease 8              132   1e-30    
gb|EMT31477.1|  hypothetical protein F775_19802                         132   1e-30    
gb|KHN42588.1|  Putative purine permease 5                              131   1e-30    
dbj|BAJ85920.1|  predicted protein                                      132   1e-30    
ref|XP_008784692.1|  PREDICTED: probable purine permease 11             131   1e-30    
dbj|BAJ88177.1|  predicted protein                                      132   1e-30    
ref|XP_006467517.1|  PREDICTED: probable purine permease 9-like         131   1e-30    
ref|XP_003541140.1|  PREDICTED: probable purine permease 5-like i...    131   1e-30    
ref|XP_010666509.1|  PREDICTED: probable purine permease 9              131   1e-30    
ref|XP_011016754.1|  PREDICTED: purine permease 1-like                  130   2e-30    
ref|XP_002519731.1|  purine transporter, putative                       131   2e-30    
ref|XP_008671258.1|  PREDICTED: probable purine permease 11             131   2e-30    
gb|KEH34049.1|  purine permease                                         130   2e-30    



>ref|XP_009759913.1| PREDICTED: probable purine permease 4 [Nicotiana sylvestris]
Length=399

 Score =   387 bits (993),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 210/292 (72%), Positives = 244/292 (84%), Gaps = 0/292 (0%)
 Frame = -1

Query  1153  KFYFVHGGSSRWVATWVQCAGFPLLIPAVYLPYYAFNSTERRPFAGFSLRIFSLSVVIGL  974
             KFYF H G+SRWV+TWVQ AGFP L+  +YL +Y F STER+PF GF+ +I SLS++IG 
Sbjct  80    KFYFNHKGASRWVSTWVQSAGFPFLLLPIYLSFYVFKSTERKPFTGFTPKILSLSILIGF  139

Query  973   MLGVNNLLISWGTSYLPVSTCSLVLASQLVFILFLSAIIVRQKITFANLNCvvlltlaav  794
             +LG NNLL SWG SYLPVST SLVL+SQL F L  S IIV+QKIT+ANLNCV+LLTL++V
Sbjct  140   LLGFNNLLFSWGNSYLPVSTNSLVLSSQLAFTLITSVIIVKQKITYANLNCVILLTLSSV  199

Query  793   llaLDSSSDKPAGLTKAKYFVGFFCTVGAALLFALYLPLVEKLYRNVDCYamvvemqvvm  614
             LLAL SS DKP GLTK+KY +GFF TVGA LLFALYLPL+EK+Y+ V CY+MVVEMQ+VM
Sbjct  200   LLALGSSHDKPKGLTKSKYLIGFFSTVGAGLLFALYLPLMEKIYKKVYCYSMVVEMQIVM  259

Query  613   eaaATVLATVGMAIDGGFSGMKKESQGGFDLGSKAYAMTVGLNVLTWQLCFMGTAGMVFL  434
             E AATVLAT GM IDGGFS MKKES   FDLG+KAY +TV  NV+TWQLCFMGTAGMVFL
Sbjct  260   ELAATVLATAGMTIDGGFSEMKKESTNVFDLGAKAYWLTVIFNVVTWQLCFMGTAGMVFL  319

Query  433   TTSVTSGICSTALMAFNVVGGVLAYGDHMGGSKAVSTVLCVWGFSSYVYGMY  278
             T+S+T GIC TALMA NV+GGVL YGD+   +K VST+LCVWGFSSY+YGMY
Sbjct  320   TSSLTGGICMTALMAVNVLGGVLVYGDNFSDTKIVSTLLCVWGFSSYLYGMY  371



>gb|KEH37325.1| triose-phosphate transporter family protein [Medicago truncatula]
Length=393

 Score =   380 bits (975),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 198/294 (67%), Positives = 250/294 (85%), Gaps = 0/294 (0%)
 Frame = -1

Query  1153  KFYFVHGGSSRWVATWVQCAGFPLLIPAVYLPYYAFNSTERRPFAGFSLRIFSLSVVIGL  974
             K+YF+H GSSRWV+TWVQ +GFPLL+  ++ PYY  NST+R+PF+ F+ ++ +LS+ IG+
Sbjct  72    KYYFIHKGSSRWVSTWVQSSGFPLLLVPIFSPYYLLNSTKRKPFSDFNPKMLTLSISIGV  131

Query  973   MLGVNNLLISWGTSYLPVSTCSLVLASQLVFILFLSAIIVRQKITFANLNCvvlltlaav  794
             MLGVNNL  SWG SYLPVST +L+L+SQLVF L LS IIV+QKITF+NLNCV+LLTL+++
Sbjct  132   MLGVNNLFFSWGNSYLPVSTSALLLSSQLVFNLVLSVIIVKQKITFSNLNCVILLTLSSI  191

Query  793   llaLDSSSDKPAGLTKAKYFVGFFCTVGAALLFALYLPLVEKLYRNVDCYamvvemqvvm  614
             LLALDSS++KP GLTK +YF+GFFCT+GA LLFALYLP++EK+Y++V CY MV+EMQ++M
Sbjct  192   LLALDSSNEKPNGLTKKEYFIGFFCTIGAGLLFALYLPVMEKVYKDVYCYEMVMEMQLIM  251

Query  613   eaaATVLATVGMAIDGGFSGMKKESQGGFDLGSKAYAMTVGLNVLTWQLCFMGTAGMVFL  434
             E AATVLAT+GM +DGGFS MK+ES+  FD GS  Y +TV  NV+TWQ CFMGTAGMVFL
Sbjct  252   EIAATVLATIGMGMDGGFSEMKRESEEIFDKGSLVYWVTVMANVVTWQFCFMGTAGMVFL  311

Query  433   TTSVTSGICSTALMAFNVVGGVLAYGDHMGGSKAVSTVLCVWGFSSYVYGMYLK  272
             T+S+T GIC TAL++ NV+GGVL + D  GG KAVSTVLC+WGF SYVYGMY+K
Sbjct  312   TSSLTGGICMTALLSMNVLGGVLVFRDAFGGVKAVSTVLCMWGFCSYVYGMYVK  365



>gb|KEH37326.1| triose-phosphate transporter family protein [Medicago truncatula]
Length=414

 Score =   380 bits (976),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 208/326 (64%), Positives = 262/326 (80%), Gaps = 7/326 (2%)
 Frame = -1

Query  1153  KFYFVHGGSSRWVATWVQCAGFPLLIPAVYLPYYAFNSTERRPFAGFSLRIFSLSVVIGL  974
             K+YF+H GSS+WV+TWVQCAGFPLLI  ++LPY  FN T+R PF  F+ ++ +LS+ +G+
Sbjct  92    KYYFIHKGSSKWVSTWVQCAGFPLLIIPIFLPYL-FNLTKRNPFTDFTPKMLTLSIFVGI  150

Query  973   MLGVNNLLISWGTSYLPVSTCSLVLASQLVFILFLSAIIVRQKITFANLNCvvlltlaav  794
             MLG NNLLISWG +YLPVST +L+L+SQLVF L LSAIIV+QKITF+NLNCV+LLTL+++
Sbjct  151   MLGFNNLLISWGVAYLPVSTSALLLSSQLVFNLILSAIIVKQKITFSNLNCVILLTLSSI  210

Query  793   llaLDSSSDKPAGLTKAKYFVGFFCTVGAALLFALYLPLVEKLYRNVDCYamvvemqvvm  614
             +LAL+SSS++P GLTK +YF+GFFCT+GA LLFALYLP++EK+Y+ V CY MV+EMQ++M
Sbjct  211   ILALNSSSERPKGLTKKEYFIGFFCTLGAGLLFALYLPVMEKVYKKVYCYEMVMEMQLIM  270

Query  613   eaaATVLATVGMAIDGGFSGMKKESQGGFDLGSKAYAMTVGLNVLTWQLCFMGTAGMVFL  434
             E AATVLATVGMA DGGF  MK+ES+  FD GS+ Y +TV  NV+TWQ CFMGTAGMVFL
Sbjct  271   EIAATVLATVGMAWDGGFKEMKRESEEVFDKGSRVYWVTVMANVVTWQFCFMGTAGMVFL  330

Query  433   TTSVTSGICSTALMAFNVVGGVLAYGDHMGGSKAVSTVLCVWGFSSYVYGMYLK----TK  266
             T+S+T GIC TAL++ NV+GGV+ Y D  GG KAVSTVLC+WGF SYVYGMY+K      
Sbjct  331   TSSLTGGICMTALLSMNVLGGVIVYRDAFGGLKAVSTVLCMWGFCSYVYGMYVKMLEEKG  390

Query  265   KVTKEVPPAIGA*SD*TPARRRTATG  188
             ++ KE   +    S  T  R R ATG
Sbjct  391   RMAKERNDSSMELS--TMRRSRGATG  414



>ref|XP_009622283.1| PREDICTED: probable purine permease 4 isoform X1 [Nicotiana tomentosiformis]
Length=385

 Score =   377 bits (967),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 208/303 (69%), Positives = 244/303 (81%), Gaps = 5/303 (2%)
 Frame = -1

Query  1153  KFYFVHGGSSRWVATWVQCAGFPLLIPAVYLPYYAFN-STERRPFAGFSLRIFSLSVVIG  977
             KFYF H G SRWV+TWVQCAGFPLL+     P Y F   T R+PF GF+ +I  LS+ IG
Sbjct  72    KFYFNHKGGSRWVSTWVQCAGFPLLL----FPIYLFKICTHRKPFTGFTPKILCLSICIG  127

Query  976   LMLGVNNLLISWGTSYLPVSTCSLVLASQLVFILFLSAIIVRQKITFANLNCvvlltlaa  797
              +LG+NNLL SWG SYLPVST SLVL++QL F L  S IIV+QKITFANLNCV+LLT+++
Sbjct  128   FLLGINNLLFSWGNSYLPVSTNSLVLSTQLAFTLITSVIIVKQKITFANLNCVILLTVSS  187

Query  796   vllaLDSSSDKPAGLTKAKYFVGFFCTVGAALLFALYLPLVEKLYRNVDCYamvvemqvv  617
             VLLAL SS DKP GLTK KYF+GFF TVGA LLFALYLP++EK+YR V CYAMV+EMQ+V
Sbjct  188   VLLALGSSHDKPRGLTKGKYFIGFFSTVGAGLLFALYLPIMEKIYRKVYCYAMVIEMQLV  247

Query  616   meaaATVLATVGMAIDGGFSGMKKESQGGFDLGSKAYAMTVGLNVLTWQLCFMGTAGMVF  437
             ME AAT L+TVGM   GGFS MK ES   FDLG+KAY +TVG NV+TWQLCFMGTAGMVF
Sbjct  248   MEIAATALSTVGMVAGGGFSEMKTESIKVFDLGAKAYWLTVGFNVVTWQLCFMGTAGMVF  307

Query  436   LTTSVTSGICSTALMAFNVVGGVLAYGDHMGGSKAVSTVLCVWGFSSYVYGMYLKTKKVT  257
             LTTS+T G+C TALM  NV+GGVL YGDH GG KAVST+LC+WGF SY+YG+Y+KTK+  
Sbjct  308   LTTSLTGGVCMTALMGINVLGGVLVYGDHFGGFKAVSTLLCLWGFCSYIYGIYIKTKEEE  367

Query  256   KEV  248
              ++
Sbjct  368   NKI  370



>ref|XP_009799236.1| PREDICTED: probable purine permease 4 [Nicotiana sylvestris]
Length=399

 Score =   376 bits (965),  Expect = 4e-123, Method: Compositional matrix adjust.
 Identities = 210/303 (69%), Positives = 244/303 (81%), Gaps = 5/303 (2%)
 Frame = -1

Query  1153  KFYFVHGGSSRWVATWVQCAGFPLLIPAVYLPYYAFN-STERRPFAGFSLRIFSLSVVIG  977
             KFYF H G SRWV+TWVQ AGFPLL+     P Y F   T+R+PF GF+ +I  LS+ IG
Sbjct  72    KFYFNHKGGSRWVSTWVQSAGFPLLL----FPIYLFKICTDRKPFTGFTPKILCLSICIG  127

Query  976   LMLGVNNLLISWGTSYLPVSTCSLVLASQLVFILFLSAIIVRQKITFANLNCvvlltlaa  797
               LG+NNLL SWG SYLPVST SLVL++QL F L  S IIV+QKITFANLNCV+LLT+++
Sbjct  128   FFLGINNLLFSWGNSYLPVSTNSLVLSTQLAFTLITSVIIVKQKITFANLNCVILLTVSS  187

Query  796   vllaLDSSSDKPAGLTKAKYFVGFFCTVGAALLFALYLPLVEKLYRNVDCYamvvemqvv  617
             VLLAL SS DKP GLTK KYF+GFF TVGA LLFALYLP++EK+YR V CYAMVVEMQ+V
Sbjct  188   VLLALGSSHDKPRGLTKGKYFIGFFSTVGAGLLFALYLPIMEKIYRKVYCYAMVVEMQLV  247

Query  616   meaaATVLATVGMAIDGGFSGMKKESQGGFDLGSKAYAMTVGLNVLTWQLCFMGTAGMVF  437
             ME AAT LATVGMA  GGFS MK ES   FDLG+KAY +TVG NV+TWQLCFMGTAGMVF
Sbjct  248   MEMAATALATVGMAAGGGFSEMKTESIKVFDLGAKAYWLTVGFNVVTWQLCFMGTAGMVF  307

Query  436   LTTSVTSGICSTALMAFNVVGGVLAYGDHMGGSKAVSTVLCVWGFSSYVYGMYLKTKKVT  257
             LTTS+T G+C TALM  NV+GGVL YGDH GG KAVST+LC+WGF SY+YG+Y+KTK+  
Sbjct  308   LTTSLTGGVCMTALMGINVLGGVLVYGDHFGGLKAVSTLLCLWGFCSYIYGIYIKTKEQE  367

Query  256   KEV  248
              ++
Sbjct  368   NQM  370



>ref|XP_009622284.1| PREDICTED: probable purine permease 4 isoform X2 [Nicotiana tomentosiformis]
Length=386

 Score =   372 bits (955),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 209/304 (69%), Positives = 244/304 (80%), Gaps = 6/304 (2%)
 Frame = -1

Query  1153  KFYFVHGGSSRWVATWVQCAGFPLLIPAVYLPYYAFN-STERRPFAGFSLRIFSLSVVIG  977
             KFYF H G SRWV+TWVQCAGFPLL+     P Y F   T R+PF GF+ +I  LS+ IG
Sbjct  72    KFYFNHKGGSRWVSTWVQCAGFPLLL----FPIYLFKICTHRKPFTGFTPKILCLSICIG  127

Query  976   LMLGVNNLLISWGTSYLPVSTCSLVLASQLVFILFLSAIIVRQKITFANLNCvvlltlaa  797
              +LG+NNLL SWG SYLPVST SLVL++QL F L  S IIV+QKITFANLNCV+LLT+++
Sbjct  128   FLLGINNLLFSWGNSYLPVSTNSLVLSTQLAFTLITSVIIVKQKITFANLNCVILLTVSS  187

Query  796   vllaLDSSSDKPAGLTKAKYFVGFFCTVGAALLFALYLPLVEKLYRNVDCYamvvemqv-  620
             VLLAL SS DKP GLTK KYF+GFF TVGA LLFALYLP++EK+YR V CYAMVVEMQ+ 
Sbjct  188   VLLALGSSHDKPRGLTKGKYFIGFFSTVGAGLLFALYLPIMEKIYRKVYCYAMVVEMQLL  247

Query  619   vmeaaATVLATVGMAIDGGFSGMKKESQGGFDLGSKAYAMTVGLNVLTWQLCFMGTAGMV  440
             VME AAT L+TVGM   GGFS MK ES   FDLG+KAY +TVG NV+TWQLCFMGTAGMV
Sbjct  248   VMEIAATALSTVGMVAGGGFSEMKTESIKVFDLGAKAYWLTVGFNVVTWQLCFMGTAGMV  307

Query  439   FLTTSVTSGICSTALMAFNVVGGVLAYGDHMGGSKAVSTVLCVWGFSSYVYGMYLKTKKV  260
             FLTTS+T G+C TALM  NV+GGVL YGDH GG KAVST+LC+WGF SY+YG+Y+KTK+ 
Sbjct  308   FLTTSLTGGVCMTALMGINVLGGVLVYGDHFGGFKAVSTLLCLWGFCSYIYGIYIKTKEE  367

Query  259   TKEV  248
               ++
Sbjct  368   ENKI  371



>ref|XP_004488230.1| PREDICTED: probable purine permease 4-like [Cicer arietinum]
Length=346

 Score =   370 bits (951),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 192/294 (65%), Positives = 245/294 (83%), Gaps = 0/294 (0%)
 Frame = -1

Query  1153  KFYFVHGGSSRWVATWVQCAGFPLLIPAVYLPYYAFNSTERRPFAGFSLRIFSLSVVIGL  974
             K+YF+H GSSRWV+T+VQ +GFPLLI  ++ PYY   ST+R+PF+ F+L++ +LS+ IGL
Sbjct  40    KYYFIHKGSSRWVSTFVQSSGFPLLIIPIFSPYYILKSTKRKPFSDFNLKMLTLSISIGL  99

Query  973   MLGVNNLLISWGTSYLPVSTCSLVLASQLVFILFLSAIIVRQKITFANLNCvvlltlaav  794
             MLG+NNL  SWG SYLPVST +L+L+SQL+F LFLS IIV+QKITF+NLNCV+LLTL+++
Sbjct  100   MLGINNLFFSWGNSYLPVSTSALLLSSQLIFNLFLSVIIVKQKITFSNLNCVILLTLSSI  159

Query  793   llaLDSSSDKPAGLTKAKYFVGFFCTVGAALLFALYLPLVEKLYRNVDCYamvvemqvvm  614
             LLALDSS +KP G+TK +YF+GFFCT+ A LLFALYLP++EK+Y+ V CY MV+EMQ +M
Sbjct  160   LLALDSSHEKPNGVTKKEYFIGFFCTIAAGLLFALYLPVMEKVYKEVYCYKMVMEMQFIM  219

Query  613   eaaATVLATVGMAIDGGFSGMKKESQGGFDLGSKAYAMTVGLNVLTWQLCFMGTAGMVFL  434
             E +AT+LAT+GM++DGGF  MK+ES+  FD G + Y +TV  NV+TWQ CFMGTAGMVFL
Sbjct  220   EISATLLATIGMSLDGGFHDMKEESEKIFDKGKRVYWVTVMANVVTWQFCFMGTAGMVFL  279

Query  433   TTSVTSGICSTALMAFNVVGGVLAYGDHMGGSKAVSTVLCVWGFSSYVYGMYLK  272
             T S+T GIC TAL+  NV+GGVL + D  GG KAVSTVLC+WGF SYVYGMY+K
Sbjct  280   TCSLTGGICMTALLCMNVLGGVLMFRDEFGGFKAVSTVLCMWGFCSYVYGMYVK  333



>ref|XP_007138880.1| hypothetical protein PHAVU_009G245400g [Phaseolus vulgaris]
 gb|ESW10874.1| hypothetical protein PHAVU_009G245400g [Phaseolus vulgaris]
Length=411

 Score =   365 bits (937),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 190/297 (64%), Positives = 248/297 (84%), Gaps = 1/297 (0%)
 Frame = -1

Query  1153  KFYFVHGGSSRWVATWVQCAGFPLLIPAVYLPYYAFNSTERRPFAGFSLRIFSLSVVIGL  974
             K+YF+H GSS+WV+TWVQ AGFPLL+  ++LP    N T+R+PF GF  ++F  SV++GL
Sbjct  92    KYYFIHKGSSKWVSTWVQSAGFPLLLFPIFLPVL-LNYTKRKPFTGFGQKLFWFSVLVGL  150

Query  973   MLGVNNLLISWGTSYLPVSTCSLVLASQLVFILFLSAIIVRQKITFANLNCvvlltlaav  794
             MLG NNLLISWG +YLPVST +L+L+SQLVF L LS+IIV+QKITF+NLNCV+L+T++++
Sbjct  151   MLGFNNLLISWGVAYLPVSTSALLLSSQLVFTLILSSIIVKQKITFSNLNCVILITISSI  210

Query  793   llaLDSSSDKPAGLTKAKYFVGFFCTVGAALLFALYLPLVEKLYRNVDCYamvvemqvvm  614
             +LALDSS +KP GLT  +YF+GF  T+GA LLF+LYLP++EK+Y++V+CY MV+EMQ++M
Sbjct  211   ILALDSSHEKPQGLTDREYFIGFSSTIGAGLLFSLYLPVMEKIYQSVNCYQMVMEMQLIM  270

Query  613   eaaATVLATVGMAIDGGFSGMKKESQGGFDLGSKAYAMTVGLNVLTWQLCFMGTAGMVFL  434
             E AATVLATVGMA D GFS MK+E++GGFD G+  Y +T+   V+TWQ CFMGTAGMVFL
Sbjct  271   EIAATVLATVGMACDKGFSDMKREAEGGFDKGTTVYWVTIVSTVVTWQCCFMGTAGMVFL  330

Query  433   TTSVTSGICSTALMAFNVVGGVLAYGDHMGGSKAVSTVLCVWGFSSYVYGMYLKTKK  263
             T+S+T GICSTAL++ NV+GGV  Y D  GG KAVSTVLC+WGF SYV+GMY++ K+
Sbjct  331   TSSLTGGICSTALLSINVLGGVAVYKDPFGGFKAVSTVLCIWGFCSYVFGMYIRMKR  387



>ref|XP_004248514.2| PREDICTED: probable purine permease 4 [Solanum lycopersicum]
Length=336

 Score =   354 bits (908),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 199/292 (68%), Positives = 241/292 (83%), Gaps = 0/292 (0%)
 Frame = -1

Query  1153  KFYFVHGGSSRWVATWVQCAGFPLLIPAVYLPYYAFNSTERRPFAGFSLRIFSLSVVIGL  974
             KFYF H G SRWV+TWVQ AGFPLL+  +YLP+Y F ST R+PF  F+ ++  LS+VIG 
Sbjct  23    KFYFNHKGDSRWVSTWVQSAGFPLLLLPIYLPFYVFKSTNRKPFTKFTPKMLLLSIVIGF  82

Query  973   MLGVNNLLISWGTSYLPVSTCSLVLASQLVFILFLSAIIVRQKITFANLNCvvlltlaav  794
              LG+NNLLISWG SYLPVST SLVL+SQLVF L  S IIV+QKITFANLNCV+LLTL++V
Sbjct  83    FLGLNNLLISWGNSYLPVSTNSLVLSSQLVFTLITSVIIVKQKITFANLNCVILLTLSSV  142

Query  793   llaLDSSSDKPAGLTKAKYFVGFFCTVGAALLFALYLPLVEKLYRNVDCYamvvemqvvm  614
             LLAL SS DKP GLT+  YF+GFF T+GA L+F+LYLPL+EK+Y +V CY+MVVEMQ+VM
Sbjct  143   LLALGSSHDKPNGLTRRNYFIGFFSTIGAGLMFSLYLPLMEKVYGHVYCYSMVVEMQMVM  202

Query  613   eaaATVLATVGMAIDGGFSGMKKESQGGFDLGSKAYAMTVGLNVLTWQLCFMGTAGMVFL  434
             E  AT+LAT+GM ID GF  MKKE++  FDLG KAY +TV +NV+TWQ CFMGTAGMVFL
Sbjct  203   ELTATILATLGMIIDSGFYEMKKEAKNVFDLGEKAYWLTVMVNVVTWQFCFMGTAGMVFL  262

Query  433   TTSVTSGICSTALMAFNVVGGVLAYGDHMGGSKAVSTVLCVWGFSSYVYGMY  278
             T+S+T G+C TALMA NV+GGV+ + D+ GG K VST+LC+WGFSSY+YGMY
Sbjct  263   TSSLTGGVCMTALMAVNVLGGVIVFKDNFGGIKVVSTLLCIWGFSSYLYGMY  314



>ref|XP_009115035.1| PREDICTED: probable purine permease 4 [Brassica rapa]
Length=391

 Score =   354 bits (909),  Expect = 8e-115, Method: Compositional matrix adjust.
 Identities = 194/294 (66%), Positives = 236/294 (80%), Gaps = 1/294 (0%)
 Frame = -1

Query  1153  KFYFVHGGSSRWVATWVQCAGFPLLIPAVYLPYYAFNSTERRPFAGFSLRIFSLSVVIGL  974
             K+YFVHGGSSRWV+TWVQ AGFPLL+  +Y PY+ F +T+RRPF  F+ R    SVVIGL
Sbjct  51    KYYFVHGGSSRWVSTWVQSAGFPLLLGLIYFPYFVFKTTKRRPFTRFTHRHLLFSVVIGL  110

Query  973   MLGVNNLLISWGTSYLPVSTCSLVLASQLVFILFLSAIIVRQKITFANLNCvvlltlaav  794
             +LG NN L SWGTSYLPVST SL+L++QL+F L LS IIV+QK+TF+NLNCVVLLTL++V
Sbjct  111   ILGFNNFLFSWGTSYLPVSTSSLLLSTQLIFTLILSVIIVKQKVTFSNLNCVVLLTLSSV  170

Query  793   llaLDSSSDKPAGLTKAKYFVGFFCTVGAALLFALYLPLVEKLYRNVDCYamvvemqvvm  614
             LLAL SS DKPAGLTK KYF+GF  T+GA LLFALYLP+ E++YR+V CYAMV+EMQ+VM
Sbjct  171   LLALGSSQDKPAGLTKTKYFIGFLSTIGAGLLFALYLPVTERVYRSVYCYAMVMEMQLVM  230

Query  613   eaaATVLATVGMAIDGGFSGMKKESQGGFDLGSKAY-AMTVGLNVLTWQLCFMGTAGMVF  437
             E +ATV AT+GMA DGGF  M KE+   F  G   Y  + +  NV+TWQLCF  T+GMV+
Sbjct  231   EFSATVFATIGMAFDGGFKEMVKEANQVFTKGPTVYWTVAIFANVVTWQLCFAATSGMVY  290

Query  436   LTTSVTSGICSTALMAFNVVGGVLAYGDHMGGSKAVSTVLCVWGFSSYVYGMYL  275
             LT+ +T GIC TAL+A NV+GGV+ YGD  GG K VSTVLC+WGFSSYVYG+Y+
Sbjct  291   LTSGITGGICMTALLAMNVIGGVVVYGDAFGGVKIVSTVLCIWGFSSYVYGIYV  344



>ref|XP_009115032.1| PREDICTED: probable purine permease 4 [Brassica rapa]
Length=391

 Score =   354 bits (908),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 194/294 (66%), Positives = 236/294 (80%), Gaps = 1/294 (0%)
 Frame = -1

Query  1153  KFYFVHGGSSRWVATWVQCAGFPLLIPAVYLPYYAFNSTERRPFAGFSLRIFSLSVVIGL  974
             K+YFVHGGSSRWV+TWVQ AGFPLL+  +Y PY+ F +T+RRPF  F+ R    SVVIGL
Sbjct  51    KYYFVHGGSSRWVSTWVQSAGFPLLLGLIYFPYFVFKTTKRRPFTRFTHRHLLFSVVIGL  110

Query  973   MLGVNNLLISWGTSYLPVSTCSLVLASQLVFILFLSAIIVRQKITFANLNCvvlltlaav  794
             +LG NN L SWGTSYLPVST SL+L++QL+F L LS IIV+QK+TF+NLNCVVLLTL++V
Sbjct  111   ILGFNNFLFSWGTSYLPVSTSSLLLSTQLIFTLILSVIIVKQKVTFSNLNCVVLLTLSSV  170

Query  793   llaLDSSSDKPAGLTKAKYFVGFFCTVGAALLFALYLPLVEKLYRNVDCYamvvemqvvm  614
             LLAL SS DKPAGLTK KYF+GF  T+GA LLFALYLP+ E++YR+V CYAMV+EMQ+VM
Sbjct  171   LLALGSSQDKPAGLTKTKYFIGFLSTIGAGLLFALYLPVTERVYRSVYCYAMVMEMQLVM  230

Query  613   eaaATVLATVGMAIDGGFSGMKKESQGGFDLGSKAY-AMTVGLNVLTWQLCFMGTAGMVF  437
             E +ATV AT+GMA DGGF  M KE+   F  G   Y  + +  NV+TWQLCF  T+GMV+
Sbjct  231   EFSATVFATIGMAFDGGFKEMVKEANQVFTKGPTVYWTVAIFANVVTWQLCFAATSGMVY  290

Query  436   LTTSVTSGICSTALMAFNVVGGVLAYGDHMGGSKAVSTVLCVWGFSSYVYGMYL  275
             LT+ +T GIC TAL+A NV+GGV+ YGD  GG K VSTVLC+WGFSSYVYG+Y+
Sbjct  291   LTSGITGGICMTALLAMNVIGGVVVYGDAFGGVKIVSTVLCIWGFSSYVYGIYV  344



>ref|XP_002533991.1| purine transporter, putative [Ricinus communis]
 gb|EEF28388.1| purine transporter, putative [Ricinus communis]
Length=370

 Score =   353 bits (905),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 207/297 (70%), Positives = 241/297 (81%), Gaps = 0/297 (0%)
 Frame = -1

Query  1153  KFYFVHGGSSRWVATWVQCAGFPLLIPAVYLPYYAFNSTERRPFAGFSLRIFSLSVVIGL  974
             KFYF H GSSRWV+TWVQ AGFPLL   ++LPYY F  TERRPF  F+ R+  LS++IG 
Sbjct  43    KFYFNHRGSSRWVSTWVQSAGFPLLFFPIFLPYYLFKCTERRPFDRFTPRMLILSILIGF  102

Query  973   MLGVNNLLISWGTSYLPVSTCSLVLASQLVFILFLSAIIVRQKITFANLNCvvlltlaav  794
             MLG+NNLL SWG SYLPVST SL+L+SQLVF L LS IIV+QKITF NLNCV+LLTL++V
Sbjct  103   MLGLNNLLFSWGNSYLPVSTSSLLLSSQLVFNLILSVIIVKQKITFQNLNCVILLTLSSV  162

Query  793   llaLDSSSDKPAGLTKAKYFVGFFCTVGAALLFALYLPLVEKLYRNVDCYamvvemqvvm  614
             LLA  S  D+P GLT AKYF+GFF TVGA LLFALYLP++EK+Y+NV CY MV+EMQ+VM
Sbjct  163   LLAFGSRHDRPQGLTPAKYFIGFFSTVGAGLLFALYLPVMEKIYKNVCCYEMVIEMQMVM  222

Query  613   eaaATVLATVGMAIDGGFSGMKKESQGGFDLGSKAYAMTVGLNVLTWQLCFMGTAGMVFL  434
             E AAT LAT+GMA DGGFS MK+ESQ  FD G K Y +TV  N++TWQLCFMGTAGMVFL
Sbjct  223   EIAATALATIGMASDGGFSEMKRESQVVFDRGEKWYWITVFGNIITWQLCFMGTAGMVFL  282

Query  433   TTSVTSGICSTALMAFNVVGGVLAYGDHMGGSKAVSTVLCVWGFSSYVYGMYLKTKK  263
             T+S+T GIC TAL+A NV+GGVL YG+  GG K VST+LC WGF SYVYGM+LK K 
Sbjct  283   TSSLTGGICMTALLAMNVLGGVLVYGEEFGGVKVVSTLLCGWGFCSYVYGMHLKMKD  339



>ref|XP_004248515.2| PREDICTED: probable purine permease 4 [Solanum lycopersicum]
Length=367

 Score =   350 bits (898),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 186/292 (64%), Positives = 238/292 (82%), Gaps = 0/292 (0%)
 Frame = -1

Query  1153  KFYFVHGGSSRWVATWVQCAGFPLLIPAVYLPYYAFNSTERRPFAGFSLRIFSLSVVIGL  974
             KFYF H G+SRWV+TWVQ AGFPLL+  +Y P+Y F ST R+PF  F+ ++  LS+VIG 
Sbjct  52    KFYFNHKGNSRWVSTWVQSAGFPLLLLPIYSPFYVFKSTHRKPFTTFTPKMLLLSIVIGF  111

Query  973   MLGVNNLLISWGTSYLPVSTCSLVLASQLVFILFLSAIIVRQKITFANLNCvvlltlaav  794
              LG+NNLL SWG SYL VST SL+L+SQLVF LF S IIV+QK+T++N+ CVVLLTL++V
Sbjct  112   FLGLNNLLYSWGNSYLSVSTNSLLLSSQLVFTLFTSVIIVKQKVTYSNVTCVVLLTLSSV  171

Query  793   llaLDSSSDKPAGLTKAKYFVGFFCTVGAALLFALYLPLVEKLYRNVDCYamvvemqvvm  614
             LLA++S+ DKP G+T+ KYF+GFF T+GA LLF+LYLPL+EK+Y++V CY+MV+EMQ+VM
Sbjct  172   LLAVNSNHDKPKGITRKKYFIGFFSTLGAGLLFSLYLPLMEKIYKHVYCYSMVMEMQMVM  231

Query  613   eaaATVLATVGMAIDGGFSGMKKESQGGFDLGSKAYAMTVGLNVLTWQLCFMGTAGMVFL  434
             E  ATV A +GM IDGGF+ M  ES+  FD+G KAY +TV LNV+TWQ CFMGTAGMVF+
Sbjct  232   ELTATVFAMLGMIIDGGFTEMINESKQVFDMGEKAYWITVMLNVVTWQFCFMGTAGMVFI  291

Query  433   TTSVTSGICSTALMAFNVVGGVLAYGDHMGGSKAVSTVLCVWGFSSYVYGMY  278
             T+S+T G+C TALMA NV+ GV+ YGD+ G  K +ST+LCVWGF SY+YG+Y
Sbjct  292   TSSLTGGVCMTALMAVNVLAGVIVYGDNFGLIKIISTILCVWGFGSYLYGLY  343



>ref|XP_004488231.1| PREDICTED: probable purine permease 4-like [Cicer arietinum]
Length=397

 Score =   350 bits (898),  Expect = 5e-113, Method: Compositional matrix adjust.
 Identities = 194/295 (66%), Positives = 245/295 (83%), Gaps = 1/295 (0%)
 Frame = -1

Query  1153  KFYFVHGGSSRWVATWVQCAGFPLLIPAVYLPYYAFNSTE-RRPFAGFSLRIFSLSVVIG  977
             K+YF+H GSS+WV TWVQCAGFPLLI  +++PYY  NST  R+PF  F+ ++F  S+ +G
Sbjct  70    KYYFIHNGSSKWVLTWVQCAGFPLLIIPIFIPYYLLNSTNTRKPFTDFTFKMFLASIFVG  129

Query  976   LMLGVNNLLISWGTSYLPVSTCSLVLASQLVFILFLSAIIVRQKITFANLNCvvlltlaa  797
             +MLG NNLLISWG +YLPVST SL+L+SQLVF L LSAIIV+QKITF+NLNCV+LLTL++
Sbjct  130   IMLGFNNLLISWGVAYLPVSTSSLLLSSQLVFNLILSAIIVKQKITFSNLNCVILLTLSS  189

Query  796   vllaLDSSSDKPAGLTKAKYFVGFFCTVGAALLFALYLPLVEKLYRNVDCYamvvemqvv  617
             ++LAL+SSS++P GLT+  YF+GFFCT+GA LLFALYLP+VEK+Y+ V CY MV+EMQ +
Sbjct  190   IILALNSSSERPKGLTQKYYFIGFFCTIGAGLLFALYLPVVEKIYKKVYCYEMVMEMQFI  249

Query  616   meaaATVLATVGMAIDGGFSGMKKESQGGFDLGSKAYAMTVGLNVLTWQLCFMGTAGMVF  437
             ME AAT+LAT+GM  DGGF  MK+ES+  FD G++ Y +T+ + V+TWQ CFMGTAGMVF
Sbjct  250   MEIAATLLATIGMLFDGGFHDMKEESEKFFDKGNRVYWVTIFVTVVTWQFCFMGTAGMVF  309

Query  436   LTTSVTSGICSTALMAFNVVGGVLAYGDHMGGSKAVSTVLCVWGFSSYVYGMYLK  272
             LT+S+T GIC TAL++ NV+GGVL Y D  GG KAVST LC+WGF SYVYGMY+K
Sbjct  310   LTSSITGGICMTALLSMNVLGGVLVYRDSFGGLKAVSTFLCIWGFCSYVYGMYVK  364



>ref|XP_011089061.1| PREDICTED: probable purine permease 4 [Sesamum indicum]
Length=385

 Score =   349 bits (896),  Expect = 6e-113, Method: Compositional matrix adjust.
 Identities = 205/297 (69%), Positives = 235/297 (79%), Gaps = 0/297 (0%)
 Frame = -1

Query  1153  KFYFVHGGSSRWVATWVQCAGFPLLIPAVYLPYYAFNSTERRPFAGFSLRIFSLSVVIGL  974
             KFYF+H GSSRWV+TWVQ AGFPLL+  V+LPYY F  T RRPF+GFS ++  LS+ +G+
Sbjct  66    KFYFIHKGSSRWVSTWVQSAGFPLLLLPVFLPYYLFKCTRRRPFSGFSSKLLLLSMAVGV  125

Query  973   MLGVNNLLISWGTSYLPVSTCSLVLASQLVFILFLSAIIVRQKITFANLNCvvlltlaav  794
              LGVNN L SWG SYLPVST SL+L+SQL F L LS IIV+QKITF NLNCV+LLTL++V
Sbjct  126   FLGVNNFLFSWGNSYLPVSTASLLLSSQLAFNLILSVIIVKQKITFMNLNCVILLTLSSV  185

Query  793   llaLDSSSDKPAGLTKAKYFVGFFCTVGAALLFALYLPLVEKLYRNVDCYamvvemqvvm  614
             LLAL SS DKP GLT+ KY VGFF T+GA  LFALYLP++EK+YR V CY+MVVEMQ+VM
Sbjct  186   LLALSSSHDKPQGLTRGKYMVGFFSTLGAGFLFALYLPVMEKIYRKVYCYSMVVEMQLVM  245

Query  613   eaaATVLATVGMAIDGGFSGMKKESQGGFDLGSKAYAMTVGLNVLTWQLCFMGTAGMVFL  434
             E  ATV AT GMA DGGFS MK ES   FD G   Y  T+  N++ WQ CFMGTAGMVFL
Sbjct  246   EMTATVFATAGMAADGGFSDMKVESARVFDKGPVEYWCTIAGNLVLWQFCFMGTAGMVFL  305

Query  433   TTSVTSGICSTALMAFNVVGGVLAYGDHMGGSKAVSTVLCVWGFSSYVYGMYLKTKK  263
             TTS+T GIC TALMA NVVGGV  YGD +GG KAVSTVLCVWGF SY+YGMY+K K 
Sbjct  306   TTSLTGGICMTALMAMNVVGGVAVYGDELGGVKAVSTVLCVWGFCSYLYGMYMKNKN  362



>ref|XP_006352647.1| PREDICTED: probable purine permease 4-like [Solanum tuberosum]
Length=381

 Score =   348 bits (893),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 197/293 (67%), Positives = 240/293 (82%), Gaps = 0/293 (0%)
 Frame = -1

Query  1153  KFYFVHGGSSRWVATWVQCAGFPLLIPAVYLPYYAFNSTERRPFAGFSLRIFSLSVVIGL  974
             KFYF H G SRWV+TWVQ AGFPLL+  +YLP+Y F ST R+PF  F+ ++  LS+VIG 
Sbjct  67    KFYFNHKGDSRWVSTWVQSAGFPLLLLPIYLPFYVFKSTHRKPFTNFTPKMLLLSIVIGF  126

Query  973   MLGVNNLLISWGTSYLPVSTCSLVLASQLVFILFLSAIIVRQKITFANLNCvvlltlaav  794
              LG+NNLL SWG SYL VST SLVL+SQLVF L  S IIV+QKITFANL CVVLLTL++V
Sbjct  127   FLGLNNLLFSWGNSYLSVSTNSLVLSSQLVFTLITSVIIVKQKITFANLTCVVLLTLSSV  186

Query  793   llaLDSSSDKPAGLTKAKYFVGFFCTVGAALLFALYLPLVEKLYRNVDCYamvvemqvvm  614
             LLAL+S+ DKP G+T+ KYF+GFF T+GA LLF+LYLPL+EK+Y+ V CY+MV+EMQ+VM
Sbjct  187   LLALNSNHDKPKGITRTKYFIGFFSTLGAGLLFSLYLPLMEKIYKIVSCYSMVMEMQMVM  246

Query  613   eaaATVLATVGMAIDGGFSGMKKESQGGFDLGSKAYAMTVGLNVLTWQLCFMGTAGMVFL  434
             E  ATV A +GMAIDGGFS M KES+  FDLG KAY +TV LNVLTWQ CFMGTAGMVF+
Sbjct  247   ELTATVFAMLGMAIDGGFSEMIKESKNVFDLGEKAYWITVMLNVLTWQFCFMGTAGMVFI  306

Query  433   TTSVTSGICSTALMAFNVVGGVLAYGDHMGGSKAVSTVLCVWGFSSYVYGMYL  275
             T+S+T G+C TALMA NV+GGV+ +GD+ G  K +ST+LCVWGF SY+YG+Y+
Sbjct  307   TSSLTGGVCMTALMAVNVLGGVIVFGDNFGVMKIISTILCVWGFGSYLYGIYI  359



>ref|XP_007213488.1| hypothetical protein PRUPE_ppa022736mg [Prunus persica]
 gb|EMJ14687.1| hypothetical protein PRUPE_ppa022736mg [Prunus persica]
Length=348

 Score =   347 bits (889),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 200/296 (68%), Positives = 242/296 (82%), Gaps = 0/296 (0%)
 Frame = -1

Query  1153  KFYFVHGGSSRWVATWVQCAGFPLLIPAVYLPYYAFNSTERRPFAGFSLRIFSLSVVIGL  974
             K+YF+H GSS WV+TWVQCAGFPLL+P V+ PYY  NST+R+PF+ F+ +I +LS+ IGL
Sbjct  23    KYYFIHKGSSIWVSTWVQCAGFPLLLPFVFTPYYLLNSTQRKPFSHFTPKILTLSIFIGL  82

Query  973   MLGVNNLLISWGTSYLPVSTCSLVLASQLVFILFLSAIIVRQKITFANLNCvvlltlaav  794
             MLG+NN L SWG SYLPVST SL+L+SQLVF L LS IIV+QKITF+NLNCV+LLT+++V
Sbjct  83    MLGLNNFLFSWGNSYLPVSTSSLLLSSQLVFNLILSVIIVKQKITFSNLNCVILLTISSV  142

Query  793   llaLDSSSDKPAGLTKAKYFVGFFCTVGAALLFALYLPLVEKLYRNVDCYamvvemqvvm  614
             LLAL SS DKP GLT+ KYF+GFF T+GA LLFALYLP++EK+YR V CYAMV+EMQ+VM
Sbjct  143   LLALGSSHDKPPGLTRGKYFLGFFSTIGAGLLFALYLPVMEKIYRKVYCYAMVIEMQLVM  202

Query  613   eaaATVLATVGMAIDGGFSGMKKESQGGFDLGSKAYAMTVGLNVLTWQLCFMGTAGMVFL  434
             + +AT LAT+GMA++G F  MK ES   FD G   Y +TV  NV+TWQLCFMGTAGMVFL
Sbjct  203   QVSATALATLGMALNGAFREMKVESMRVFDKGQSIYWVTVLCNVVTWQLCFMGTAGMVFL  262

Query  433   TTSVTSGICSTALMAFNVVGGVLAYGDHMGGSKAVSTVLCVWGFSSYVYGMYLKTK  266
             T+S+T GIC TALM  NV+GGVL YGD  GG K VST+LC WGF SY YG+Y+ TK
Sbjct  263   TSSLTGGICMTALMGMNVLGGVLVYGDEFGGVKVVSTLLCGWGFCSYAYGIYMNTK  318



>ref|XP_007034137.1| Purine permease 4 [Theobroma cacao]
 gb|EOY05063.1| Purine permease 4 [Theobroma cacao]
Length=376

 Score =   346 bits (888),  Expect = 8e-112, Method: Compositional matrix adjust.
 Identities = 199/296 (67%), Positives = 240/296 (81%), Gaps = 0/296 (0%)
 Frame = -1

Query  1153  KFYFVHGGSSRWVATWVQCAGFPLLIPAVYLPYYAFNSTERRPFAGFSLRIFSLSVVIGL  974
             K+YF H GSSRWV+TWVQ AGFPLL+  ++LPYY F  TER+PF  F+ ++  LS+ IGL
Sbjct  52    KYYFNHKGSSRWVSTWVQSAGFPLLVIPIFLPYYLFKCTERKPFTHFTPKVLGLSIFIGL  111

Query  973   MLGVNNLLISWGTSYLPVSTCSLVLASQLVFILFLSAIIVRQKITFANLNCvvlltlaav  794
             MLG+NNLL SWG SYLPVST SL+L+SQLVF L LS IIV+QKITF NLNCV+LLTL + 
Sbjct  112   MLGINNLLFSWGNSYLPVSTSSLLLSSQLVFNLILSVIIVKQKITFMNLNCVILLTLGSA  171

Query  793   llaLDSSSDKPAGLTKAKYFVGFFCTVGAALLFALYLPLVEKLYRNVDCYamvvemqvvm  614
             LLA +SS DKP GLT+AKYF+GF  T+GA LLFALYLP++E +Y+ V CYAMV+EMQ+VM
Sbjct  172   LLAFESSHDKPRGLTRAKYFIGFSATIGAGLLFALYLPIMEMIYKKVFCYAMVMEMQLVM  231

Query  613   eaaATVLATVGMAIDGGFSGMKKESQGGFDLGSKAYAMTVGLNVLTWQLCFMGTAGMVFL  434
             E AAT LA+VGMA DGGF+ M++ES+  FD G + Y   V  NV+TWQLCF+GTAGMVFL
Sbjct  232   EIAATALASVGMACDGGFAEMRRESREVFDKGERVYWAAVVSNVVTWQLCFIGTAGMVFL  291

Query  433   TTSVTSGICSTALMAFNVVGGVLAYGDHMGGSKAVSTVLCVWGFSSYVYGMYLKTK  266
             T+S+T GIC TAL+  NV+GGVL YG+  GG KAVSTV+CVWGF SYVYGMY+K K
Sbjct  292   TSSLTGGICMTALLGMNVLGGVLVYGEEFGGVKAVSTVMCVWGFCSYVYGMYVKNK  347



>ref|XP_002263453.2| PREDICTED: probable purine permease 4 [Vitis vinifera]
Length=368

 Score =   345 bits (886),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 201/306 (66%), Positives = 243/306 (79%), Gaps = 0/306 (0%)
 Frame = -1

Query  1153  KFYFVHGGSSRWVATWVQCAGFPLLIPAVYLPYYAFNSTERRPFAGFSLRIFSLSVVIGL  974
             KFYF+H GSS WV+TWVQ  GFPLL+  +YLP++ F  T RRPF  F+ ++  LSV IGL
Sbjct  55    KFYFIHKGSSIWVSTWVQSVGFPLLLLLIYLPHHLFKCTRRRPFTSFTPKLLLLSVFIGL  114

Query  973   MLGVNNLLISWGTSYLPVSTCSLVLASQLVFILFLSAIIVRQKITFANLNCvvlltlaav  794
             MLG+NN L SWGTSYLPVST SL+L+SQL F L LS IIV+QKITF+N NCV+LLTL+++
Sbjct  115   MLGLNNFLFSWGTSYLPVSTASLLLSSQLAFNLILSIIIVKQKITFSNFNCVILLTLSSI  174

Query  793   llaLDSSSDKPAGLTKAKYFVGFFCTVGAALLFALYLPLVEKLYRNVDCYamvvemqvvm  614
             LLAL S+ D+P  LT AKYF+GFF T+GA LLFALYLP++E +Y+ V CY MV+EMQ+VM
Sbjct  175   LLALSSNHDRPKDLTHAKYFIGFFSTIGAGLLFALYLPVMEMIYKKVYCYEMVIEMQLVM  234

Query  613   eaaATVLATVGMAIDGGFSGMKKESQGGFDLGSKAYAMTVGLNVLTWQLCFMGTAGMVFL  434
             E AAT LAT+GMA   GFS MKKES+  FDLG KAY +T+  N++TWQ  FMGTAG+VFL
Sbjct  235   EMAATALATIGMAAGHGFSEMKKESEMVFDLGPKAYWLTLVFNMVTWQFAFMGTAGLVFL  294

Query  433   TTSVTSGICSTALMAFNVVGGVLAYGDHMGGSKAVSTVLCVWGFSSYVYGMYLKTKKVTK  254
             TTS+T GIC TALMA NV+GGVLAYGD +GG K VST+LCVWGF SYVYGMY+K K+  K
Sbjct  295   TTSLTGGICMTALMAANVLGGVLAYGDKLGGGKVVSTLLCVWGFCSYVYGMYVKMKEEEK  354

Query  253   EVPPAI  236
                 +I
Sbjct  355   NNNQSI  360



>ref|XP_008226019.1| PREDICTED: probable purine permease 4 [Prunus mume]
Length=389

 Score =   345 bits (885),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 199/296 (67%), Positives = 241/296 (81%), Gaps = 0/296 (0%)
 Frame = -1

Query  1153  KFYFVHGGSSRWVATWVQCAGFPLLIPAVYLPYYAFNSTERRPFAGFSLRIFSLSVVIGL  974
             K+YF+H GSS WV+TWVQCAGFPLL+P V+ PYY  NST+R+PF+ F+ +I +LS+ IGL
Sbjct  71    KYYFIHKGSSIWVSTWVQCAGFPLLLPFVFTPYYLLNSTQRKPFSHFTPKILTLSIFIGL  130

Query  973   MLGVNNLLISWGTSYLPVSTCSLVLASQLVFILFLSAIIVRQKITFANLNCvvlltlaav  794
             MLG+NN L SWG SYLPVST SL+L+SQLVF L LS IIV+QKITF+NLNCV+LLT+++V
Sbjct  131   MLGLNNFLFSWGNSYLPVSTSSLLLSSQLVFNLILSVIIVKQKITFSNLNCVILLTISSV  190

Query  793   llaLDSSSDKPAGLTKAKYFVGFFCTVGAALLFALYLPLVEKLYRNVDCYamvvemqvvm  614
             LLAL SS DKP GLT+ KYF+GFF T+GA LLFALYLP++EK+Y  V CYAMV+EMQ+VM
Sbjct  191   LLALGSSHDKPPGLTRGKYFLGFFSTIGAGLLFALYLPVMEKIYSKVYCYAMVIEMQLVM  250

Query  613   eaaATVLATVGMAIDGGFSGMKKESQGGFDLGSKAYAMTVGLNVLTWQLCFMGTAGMVFL  434
             + +AT LAT+GMA++G F  MK ES   FD G   Y +TV  NV+TWQLCFMGTAGMVFL
Sbjct  251   QVSATALATLGMALNGAFREMKVESMKVFDKGQSIYWVTVLCNVVTWQLCFMGTAGMVFL  310

Query  433   TTSVTSGICSTALMAFNVVGGVLAYGDHMGGSKAVSTVLCVWGFSSYVYGMYLKTK  266
             T+S+T GIC TALM  NV+GGVL YGD  GG K VST+LC WGF SY YG+Y+ TK
Sbjct  311   TSSLTGGICMTALMGMNVLGGVLVYGDEFGGVKVVSTLLCGWGFCSYAYGIYMNTK  366



>ref|XP_004248513.1| PREDICTED: probable purine permease 4 [Solanum lycopersicum]
Length=398

 Score =   345 bits (884),  Expect = 5e-111, Method: Compositional matrix adjust.
 Identities = 193/297 (65%), Positives = 240/297 (81%), Gaps = 0/297 (0%)
 Frame = -1

Query  1153  KFYFVHGGSSRWVATWVQCAGFPLLIPAVYLPYYAFNSTERRPFAGFSLRIFSLSVVIGL  974
             KFYF H G+SRWV+TWVQ AGFPLL+  VY P+Y F S+ R+PF  F+ ++  LS+VIGL
Sbjct  79    KFYFNHKGNSRWVSTWVQSAGFPLLLLPVYSPFYVFKSSNRKPFTNFTPKMLLLSIVIGL  138

Query  973   MLGVNNLLISWGTSYLPVSTCSLVLASQLVFILFLSAIIVRQKITFANLNCvvlltlaav  794
              LG+NNLL SWG SYLPVST SLVL+ QLVF L  S +IV+QKIT+ N+NCV LLTL++V
Sbjct  139   FLGLNNLLFSWGNSYLPVSTNSLVLSLQLVFTLITSVVIVKQKITYTNINCVFLLTLSSV  198

Query  793   llaLDSSSDKPAGLTKAKYFVGFFCTVGAALLFALYLPLVEKLYRNVDCYamvvemqvvm  614
             LLAL SS DKP  LTK KYF+GFF T+GA LLFA+YLPL+EK+YR V CY+MVVEMQ+VM
Sbjct  199   LLALGSSHDKPKDLTKTKYFIGFFSTIGAGLLFAIYLPLMEKIYREVCCYSMVVEMQMVM  258

Query  613   eaaATVLATVGMAIDGGFSGMKKESQGGFDLGSKAYAMTVGLNVLTWQLCFMGTAGMVFL  434
             E +ATVLAT+GM I+GGF  MKKE++  FDLG K Y +TV +NV+TWQ CFMGTAGMVFL
Sbjct  259   ELSATVLATLGMIINGGFYEMKKEAKNVFDLGEKTYWLTVMVNVVTWQFCFMGTAGMVFL  318

Query  433   TTSVTSGICSTALMAFNVVGGVLAYGDHMGGSKAVSTVLCVWGFSSYVYGMYLKTKK  263
             ++S+T G+C TALM  NV+GGV+ + D+ G  K +ST+LC+WGFSSY+YGMY K ++
Sbjct  319   SSSLTGGVCMTALMTVNVLGGVIVFKDNFGLIKVISTLLCIWGFSSYLYGMYKKMEE  375



>ref|XP_010058075.1| PREDICTED: probable purine permease 4 [Eucalyptus grandis]
Length=387

 Score =   344 bits (882),  Expect = 7e-111, Method: Compositional matrix adjust.
 Identities = 200/297 (67%), Positives = 244/297 (82%), Gaps = 1/297 (0%)
 Frame = -1

Query  1153  KFYFVHGGSSRWVATWVQCAGFPLLIPAVYLPYYAFNSTERRPFAGFSLRIFSLSVVIGL  974
             K+YF+H GSSRWV+TWVQ AGFPLLIP V +PY+    T+RRPF  F+ +++ LS+ +GL
Sbjct  54    KYYFIHKGSSRWVSTWVQSAGFPLLIPFVCVPYF-LKRTQRRPFTHFTPKLWVLSIFVGL  112

Query  973   MLGVNNLLISWGTSYLPVSTCSLVLASQLVFILFLSAIIVRQKITFANLNCvvlltlaav  794
             MLGVNNLL SWGTSYLPVST SL+L++QL+F L LS +IV+QK+TF+NLNCV+LLTL++V
Sbjct  113   MLGVNNLLFSWGTSYLPVSTSSLLLSTQLLFNLILSVLIVKQKVTFSNLNCVMLLTLSSV  172

Query  793   llaLDSSSDKPAGLTKAKYFVGFFCTVGAALLFALYLPLVEKLYRNVDCYamvvemqvvm  614
             LLAL SS D+P GLT+AKYF+GFF TVGA LLFALYLP++EK+YR V CYAMVVEMQ+VM
Sbjct  173   LLALSSSHDRPPGLTRAKYFIGFFSTVGAGLLFALYLPVMEKIYRKVYCYAMVVEMQLVM  232

Query  613   eaaATVLATVGMAIDGGFSGMKKESQGGFDLGSKAYAMTVGLNVLTWQLCFMGTAGMVFL  434
             E AATVLATVGM  DGGF+ MK+E +  FD G + Y +TV + V  WQ+CFMGTAGMVF+
Sbjct  233   EIAATVLATVGMMADGGFAEMKREGERVFDKGPRVYYVTVAMTVACWQMCFMGTAGMVFM  292

Query  433   TTSVTSGICSTALMAFNVVGGVLAYGDHMGGSKAVSTVLCVWGFSSYVYGMYLKTKK  263
             T+S+T GIC TAL+A NV+GGV+ Y D   G K VSTVLCVWGF SYVYGM+LK  K
Sbjct  293   TSSLTGGICMTALLAMNVLGGVVVYRDDFEGVKIVSTVLCVWGFCSYVYGMHLKNTK  349



>ref|XP_006352648.1| PREDICTED: probable purine permease 4-like [Solanum tuberosum]
Length=410

 Score =   344 bits (883),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 201/292 (69%), Positives = 240/292 (82%), Gaps = 0/292 (0%)
 Frame = -1

Query  1153  KFYFVHGGSSRWVATWVQCAGFPLLIPAVYLPYYAFNSTERRPFAGFSLRIFSLSVVIGL  974
             KFYF H G SRWV+TWVQ AGFPLL+  +YLP+Y F ST R+PF   + ++  LS+VIG 
Sbjct  81    KFYFNHKGDSRWVSTWVQSAGFPLLLLPIYLPFYVFKSTHRKPFTNLTPKMLLLSIVIGF  140

Query  973   MLGVNNLLISWGTSYLPVSTCSLVLASQLVFILFLSAIIVRQKITFANLNCvvlltlaav  794
             +LG+NNLL SWG SYLPVST SLVL+SQLVF L    IIV+QKIT+ NLNCV+LLTL++V
Sbjct  141   LLGLNNLLFSWGNSYLPVSTNSLVLSSQLVFTLITCVIIVKQKITYTNLNCVILLTLSSV  200

Query  793   llaLDSSSDKPAGLTKAKYFVGFFCTVGAALLFALYLPLVEKLYRNVDCYamvvemqvvm  614
             +LAL SS DKP  LTK KYF+GFF T+GA LLFALYLPL+EK+Y+ V CY+MV+EMQ+VM
Sbjct  201   MLALGSSHDKPKDLTKTKYFIGFFSTIGAGLLFALYLPLMEKIYKEVYCYSMVMEMQIVM  260

Query  613   eaaATVLATVGMAIDGGFSGMKKESQGGFDLGSKAYAMTVGLNVLTWQLCFMGTAGMVFL  434
             E AATVLAT+GM IDGGFS MKKE +  FDLG KAY +TV  NV+TWQ CFMGTAGMVFL
Sbjct  261   ELAATVLATLGMIIDGGFSEMKKEGKNVFDLGEKAYWLTVMFNVVTWQFCFMGTAGMVFL  320

Query  433   TTSVTSGICSTALMAFNVVGGVLAYGDHMGGSKAVSTVLCVWGFSSYVYGMY  278
             T+S+T G+C TALMA NV+GGV+ YGD+ GG K VST+LC+WGFSSY+YGMY
Sbjct  321   TSSLTGGVCMTALMAVNVLGGVIVYGDNFGGIKVVSTLLCIWGFSSYLYGMY  372



>ref|NP_564365.1| purine permease 4 [Arabidopsis thaliana]
 ref|NP_001185119.1| purine permease 4 [Arabidopsis thaliana]
 sp|Q9SY29.1|PUP4_ARATH RecName: Full=Probable purine permease 4; Short=AtPUP4 [Arabidopsis 
thaliana]
 gb|AAD32940.1|AC004135_15 T17H7.15 [Arabidopsis thaliana]
 gb|AAM61204.1| unknown [Arabidopsis thaliana]
 gb|AAO42180.1| unknown protein [Arabidopsis thaliana]
 gb|AAO63915.1| unknown protein [Arabidopsis thaliana]
 gb|AEE31282.1| purine permease 4 [Arabidopsis thaliana]
 gb|AEE31283.1| purine permease 4 [Arabidopsis thaliana]
Length=382

 Score =   343 bits (879),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 192/291 (66%), Positives = 230/291 (79%), Gaps = 1/291 (0%)
 Frame = -1

Query  1153  KFYFVHGGSSRWVATWVQCAGFPLLIPAVYLPYYAFNSTERRPFAGFSLRIFSLSVVIGL  974
             K+YFV+GGSSRWV+TWVQ AGFPLL+  +Y P+Y   +T RRPF  F+LR    SV+IGL
Sbjct  47    KYYFVYGGSSRWVSTWVQSAGFPLLLILIYFPHYVLKTTTRRPFTRFTLRHLIFSVLIGL  106

Query  973   MLGVNNLLISWGTSYLPVSTCSLVLASQLVFILFLSAIIVRQKITFANLNCvvlltlaav  794
             +LG NN L SWGTSYLPVST SL+L++QLVF L LS IIV+QKITF+NLNCVVLLTL++V
Sbjct  107   VLGFNNFLFSWGTSYLPVSTSSLLLSTQLVFTLILSRIIVKQKITFSNLNCVVLLTLSSV  166

Query  793   llaLDSSSDKPAGLTKAKYFVGFFCTVGAALLFALYLPLVEKLYRNVDCYamvvemqvvm  614
             LLALDSS DKP+GLTK KYF+G+  T+GA LLFALYLP+ EKLYR V CYAMV+E+Q+VM
Sbjct  167   LLALDSSKDKPSGLTKTKYFIGYVSTIGAGLLFALYLPVTEKLYRTVYCYAMVMEVQLVM  226

Query  613   eaaATVLATVGMAIDGGFSGMKKESQGGFDLGSKAY-AMTVGLNVLTWQLCFMGTAGMVF  437
             E AATV AT+GMA +GGF  M KE+   F  G   Y    +  NV+TWQL F  T+GMV+
Sbjct  227   EFAATVFATIGMACEGGFKEMVKEANHVFTKGPTFYWTFAILANVVTWQLSFAATSGMVY  286

Query  436   LTTSVTSGICSTALMAFNVVGGVLAYGDHMGGSKAVSTVLCVWGFSSYVYG  284
             LT+ +T GIC TAL+A NV+GGV+AYGD  GG K VSTVLC+WGFSSY YG
Sbjct  287   LTSGITGGICMTALLAMNVIGGVVAYGDVFGGVKIVSTVLCIWGFSSYTYG  337



>ref|XP_006307602.1| hypothetical protein CARUB_v10009226mg, partial [Capsella rubella]
 gb|EOA40500.1| hypothetical protein CARUB_v10009226mg, partial [Capsella rubella]
Length=425

 Score =   342 bits (877),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 197/298 (66%), Positives = 239/298 (80%), Gaps = 1/298 (0%)
 Frame = -1

Query  1153  KFYFVHGGSSRWVATWVQCAGFPLLIPAVYLPYYAFNSTERRPFAGFSLRIFSLSVVIGL  974
             KFYFVHGGSSRWV+TWVQ AGFPLL+  +Y P Y F +T RRPF  F+ R+   SV+IG 
Sbjct  90    KFYFVHGGSSRWVSTWVQSAGFPLLLTLIYFPRYVFKTTTRRPFTRFTRRLVIFSVLIGF  149

Query  973   MLGVNNLLISWGTSYLPVSTCSLVLASQLVFILFLSAIIVRQKITFANLNCvvlltlaav  794
             +LG NN L SWGTSYLPVST SL+L++QLVF L LS +IV+QK+TF+NLNCVVLLTL++V
Sbjct  150   VLGFNNFLFSWGTSYLPVSTSSLLLSTQLVFTLILSVLIVKQKVTFSNLNCVVLLTLSSV  209

Query  793   llaLDSSSDKPAGLTKAKYFVGFFCTVGAALLFALYLPLVEKLYRNVDCYamvvemqvvm  614
             LLAL SSSDKPAGLTK+KY++GF  T+GA LLFALYLP+ EKLYR V CYAMV+E+Q+VM
Sbjct  210   LLALGSSSDKPAGLTKSKYYIGFVSTIGAGLLFALYLPVTEKLYRTVYCYAMVMEVQLVM  269

Query  613   eaaATVLATVGMAIDGGFSGMKKESQGGFDLGSKAY-AMTVGLNVLTWQLCFMGTAGMVF  437
             E +ATV AT+GMA DGGFS M KE+   F  G   Y  + +  NV+TWQLCF  T+GMV+
Sbjct  270   EFSATVFATIGMAFDGGFSEMVKEANHVFTKGPTVYWTVAIFANVVTWQLCFAATSGMVY  329

Query  436   LTTSVTSGICSTALMAFNVVGGVLAYGDHMGGSKAVSTVLCVWGFSSYVYGMYLKTKK  263
             LT+ +T GIC TAL+A NV+GGV+ YGD  GG K VSTVLC+WGFSSY+YGMY+K+K 
Sbjct  330   LTSGITGGICMTALLAMNVIGGVVVYGDEFGGVKIVSTVLCIWGFSSYIYGMYMKSKN  387



>ref|XP_002534165.1| purine transporter, putative [Ricinus communis]
 gb|EEF28219.1| purine transporter, putative [Ricinus communis]
Length=382

 Score =   340 bits (871),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 212/296 (72%), Positives = 245/296 (83%), Gaps = 0/296 (0%)
 Frame = -1

Query  1153  KFYFVHGGSSRWVATWVQCAGFPLLIPAVYLPYYAFNSTERRPFAGFSLRIFSLSVVIGL  974
             KFYF+H GSSRWV+TWVQ AGFPLL+  +YLPYY F  TER+PF  F+ RI  LSV+IGL
Sbjct  59    KFYFIHKGSSRWVSTWVQSAGFPLLLFPIYLPYYLFKCTERKPFNRFTPRILMLSVLIGL  118

Query  973   MLGVNNLLISWGTSYLPVSTCSLVLASQLVFILFLSAIIVRQKITFANLNCvvlltlaav  794
             MLG+NNLL SWG SYLPVST SL+L+SQLVF L LS IIV+Q+ITF NLNCV+LLTL++V
Sbjct  119   MLGLNNLLFSWGNSYLPVSTSSLLLSSQLVFNLILSVIIVKQRITFQNLNCVMLLTLSSV  178

Query  793   llaLDSSSDKPAGLTKAKYFVGFFCTVGAALLFALYLPLVEKLYRNVDCYamvvemqvvm  614
             LLAL SS D+P GLT AKYF+GFF TVGA LLFALYLP++EK+Y+NV CY MV+EMQ+VM
Sbjct  179   LLALGSSHDRPQGLTTAKYFIGFFSTVGAGLLFALYLPVMEKIYKNVYCYQMVMEMQLVM  238

Query  613   eaaATVLATVGMAIDGGFSGMKKESQGGFDLGSKAYAMTVGLNVLTWQLCFMGTAGMVFL  434
             E AAT LATVGMA DGGF+ MK+ES+  FD G K Y +TV  NV TWQLCFMGTAGMVFL
Sbjct  239   EIAATALATVGMASDGGFAEMKRESEYVFDGGEKWYWITVFTNVFTWQLCFMGTAGMVFL  298

Query  433   TTSVTSGICSTALMAFNVVGGVLAYGDHMGGSKAVSTVLCVWGFSSYVYGMYLKTK  266
             T+S+T GIC TAL+A NV+GGVL YGD  GG K VST+LC WGF SYVYGM+LK K
Sbjct  299   TSSLTGGICMTALLAMNVLGGVLVYGDEFGGVKVVSTLLCGWGFCSYVYGMHLKMK  354



>ref|XP_006364822.1| PREDICTED: probable purine permease 4-like [Solanum tuberosum]
Length=424

 Score =   341 bits (874),  Expect = 5e-109, Method: Compositional matrix adjust.
 Identities = 207/295 (70%), Positives = 240/295 (81%), Gaps = 5/295 (2%)
 Frame = -1

Query  1153  KFYFVHGGSSRWVATWVQCAGFPLLI-PAVYLPYYAFNSTERRPFAGFSLRIFSLSVVIG  977
             KFYF H G SRWV+TWVQCAGFPLL+ P  +   +    T R+ F GF+ +I  LS++IG
Sbjct  94    KFYFNHKGGSRWVSTWVQCAGFPLLLFPICFFKIF----TVRKSFTGFTPKIMCLSILIG  149

Query  976   LMLGVNNLLISWGTSYLPVSTCSLVLASQLVFILFLSAIIVRQKITFANLNCvvlltlaa  797
             L+LGVNNLL SWG SYLPVST SLVL++QL F L  S IIV+QKITF NLNCV++LTL++
Sbjct  150   LLLGVNNLLFSWGNSYLPVSTNSLVLSTQLAFTLVTSMIIVKQKITFPNLNCVMVLTLSS  209

Query  796   vllaLDSSSDKPAGLTKAKYFVGFFCTVGAALLFALYLPLVEKLYRNVDCYamvvemqvv  617
             V+LAL SS DKP GLTKAKYF GFF TVGA L+FALYLP++EK+Y+ VDCYAMVVEMQ+V
Sbjct  210   VILALGSSHDKPIGLTKAKYFKGFFSTVGAGLMFALYLPVMEKIYQKVDCYAMVVEMQLV  269

Query  616   meaaATVLATVGMAIDGGFSGMKKESQGGFDLGSKAYAMTVGLNVLTWQLCFMGTAGMVF  437
             ME AAT LATVGMA DGGFS MK ES   FDLG KAY +TVG NV+TWQLCFMGTAGMVF
Sbjct  270   MEIAATALATVGMAADGGFSEMKTESLKVFDLGPKAYWLTVGFNVVTWQLCFMGTAGMVF  329

Query  436   LTTSVTSGICSTALMAFNVVGGVLAYGDHMGGSKAVSTVLCVWGFSSYVYGMYLK  272
             LTTS+T G+C TALM  NV+GGVL YGDH GG KAVST+LCVWGF SY+YG+Y+ 
Sbjct  330   LTTSLTGGVCMTALMGINVLGGVLVYGDHFGGLKAVSTLLCVWGFCSYIYGIYMN  384



>ref|XP_009363284.1| PREDICTED: probable purine permease 4 [Pyrus x bretschneideri]
Length=422

 Score =   340 bits (872),  Expect = 7e-109, Method: Compositional matrix adjust.
 Identities = 198/298 (66%), Positives = 243/298 (82%), Gaps = 0/298 (0%)
 Frame = -1

Query  1153  KFYFVHGGSSRWVATWVQCAGFPLLIPAVYLPYYAFNSTERRPFAGFSLRIFSLSVVIGL  974
             K+YF+H GSS WV+TWVQC+GFPLL+P +++PYY  + T+R+PF+ F+ +I  LS++IGL
Sbjct  93    KYYFIHKGSSIWVSTWVQCSGFPLLLPFIFIPYYLLHCTQRKPFSHFTPKILVLSILIGL  152

Query  973   MLGVNNLLISWGTSYLPVSTCSLVLASQLVFILFLSAIIVRQKITFANLNCvvlltlaav  794
             MLG+NN L SWG SYLPVST SL+L+SQLVF L LS IIV+QK+TF+NLNCV+LLTL++V
Sbjct  153   MLGLNNFLFSWGNSYLPVSTSSLLLSSQLVFNLILSVIIVKQKVTFSNLNCVILLTLSSV  212

Query  793   llaLDSSSDKPAGLTKAKYFVGFFCTVGAALLFALYLPLVEKLYRNVDCYamvvemqvvm  614
             LLAL S+ DKP  LT+ KYF+GFF T+GA LLFALYLP++EK+Y  V CYAMV+EMQ+VM
Sbjct  213   LLALGSNHDKPHDLTRGKYFLGFFSTIGAGLLFALYLPVMEKIYSKVYCYAMVIEMQLVM  272

Query  613   eaaATVLATVGMAIDGGFSGMKKESQGGFDLGSKAYAMTVGLNVLTWQLCFMGTAGMVFL  434
             EAAATVLATVGMA+ GGF  MK ES   FD G   Y +TV  NV+TWQLCF+GTAGMVFL
Sbjct  273   EAAATVLATVGMALKGGFREMKVESARVFDKGENVYWVTVWCNVVTWQLCFIGTAGMVFL  332

Query  433   TTSVTSGICSTALMAFNVVGGVLAYGDHMGGSKAVSTVLCVWGFSSYVYGMYLKTKKV  260
             T+S+T GIC TALM  NV+GGVL YGD  GG K VST LC WGF SYVYG+Y+K + +
Sbjct  333   TSSLTGGICMTALMGMNVLGGVLVYGDSFGGVKVVSTFLCGWGFCSYVYGLYIKARDI  390



>ref|XP_008371936.1| PREDICTED: probable purine permease 4 [Malus domestica]
Length=409

 Score =   339 bits (870),  Expect = 9e-109, Method: Compositional matrix adjust.
 Identities = 199/298 (67%), Positives = 243/298 (82%), Gaps = 0/298 (0%)
 Frame = -1

Query  1153  KFYFVHGGSSRWVATWVQCAGFPLLIPAVYLPYYAFNSTERRPFAGFSLRIFSLSVVIGL  974
             K+YF+H GSS  V+TWVQC+GFPLL+P +++PYY  + T+R+PF+ F+ +I  LS++IGL
Sbjct  80    KYYFIHKGSSILVSTWVQCSGFPLLLPFIFIPYYLLHCTQRKPFSHFTPKILVLSILIGL  139

Query  973   MLGVNNLLISWGTSYLPVSTCSLVLASQLVFILFLSAIIVRQKITFANLNCvvlltlaav  794
             MLG+NN L SWG SYLPVST SL+L+SQLVF L LS IIV+QK+TF+NLNCV+LLTL++V
Sbjct  140   MLGLNNFLFSWGNSYLPVSTSSLLLSSQLVFNLILSVIIVKQKVTFSNLNCVILLTLSSV  199

Query  793   llaLDSSSDKPAGLTKAKYFVGFFCTVGAALLFALYLPLVEKLYRNVDCYamvvemqvvm  614
             LLAL S+ DKP GLT+ KYF+GFF T+GA LLFALYLP++EK+Y  V CYAMV+EMQ+VM
Sbjct  200   LLALGSNHDKPHGLTRGKYFLGFFSTIGAGLLFALYLPVMEKIYSKVYCYAMVIEMQLVM  259

Query  613   eaaATVLATVGMAIDGGFSGMKKESQGGFDLGSKAYAMTVGLNVLTWQLCFMGTAGMVFL  434
             EAAATVLATVGMA+ GGF  MK ES   FD G   Y +TV  NV+TWQLCFMGTAGMVFL
Sbjct  260   EAAATVLATVGMALKGGFREMKVESARVFDKGENVYWVTVWCNVVTWQLCFMGTAGMVFL  319

Query  433   TTSVTSGICSTALMAFNVVGGVLAYGDHMGGSKAVSTVLCVWGFSSYVYGMYLKTKKV  260
             T+S+T GIC TALM  NV+GGVL YGD  GG K VST LC WGF SYVYG+Y+K + +
Sbjct  320   TSSLTGGICMTALMGMNVLGGVLVYGDSFGGVKVVSTFLCGWGFCSYVYGLYIKARDI  377



>gb|KHN26582.1| Putative purine permease 4 [Glycine soja]
Length=364

 Score =   337 bits (864),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 189/333 (57%), Positives = 247/333 (74%), Gaps = 15/333 (5%)
 Frame = -1

Query  1153  KFYFVHGGSSRWVATWVQCAGFPLLIPAVYLPYYAFNSTERRPFAGFSLRIFSLSVVIGL  974
             K+YF H GSS+WV+TWVQCAGFP LI  ++LP    N TER+PF  F+ ++   S  IG+
Sbjct  43    KYYFNHKGSSKWVSTWVQCAGFPFLIIPIFLPS-LLNYTERKPFTDFTPKMLCYSFCIGV  101

Query  973   MLGVNNLLISWGTSYLPVSTCSLVLASQLVFILFLSAIIVRQKITFANLNCvvlltlaav  794
             MLG NNLL S+G +YLPVST +L+L+SQLVF L LSAIIV+QKITF+NLN V+L+T++++
Sbjct  102   MLGFNNLLYSFGVAYLPVSTSALLLSSQLVFTLILSAIIVKQKITFSNLNSVILITMSSI  161

Query  793   llaLDSSSDKPAGLTKAKYFVGFFCTVGAALLFALYLPLVEKLYRNVDCYamvvemqvvm  614
             +LAL+SS +KP GLT+  YF+GF CT+GA LLF+LYLPL+EK+Y  V CY MV+EMQ+VM
Sbjct  162   ILALNSSHEKPQGLTQKDYFIGFSCTIGAGLLFSLYLPLMEKIYERVYCYGMVMEMQLVM  221

Query  613   eaaATVLATVGMAIDGGFSGMKKESQGGFDLGSKAYAMTVGLNVLTWQLCFMGTAGMVFL  434
             E AATVLAT GM   GGFS MK+E+   FD G+  Y +TV L+V+TWQ CFMGTAGMVFL
Sbjct  222   EIAATVLATGGMVYKGGFSEMKEEADRVFDKGNTFYWVTVVLSVVTWQCCFMGTAGMVFL  281

Query  433   TTSVTSGICSTALMAFNVVGGVLAYGDHMGGSKAVSTVLCVWGFSSYVYGMYLKTKKVTK  254
             T+S+T G+ +TAL++ NV+ G L Y D   G K V+TVLC+WGF SYVYGMY+K ++  +
Sbjct  282   TSSLTGGVSATALLSMNVLAGWLVYHDAFKGFKIVATVLCIWGFCSYVYGMYIKREQEEE  341

Query  253   EVPPAIGA*SD*TPARRRTATGGSIVEGIVRGS  155
                           A+RR ++GG+  E I  G+
Sbjct  342   --------------AKRRNSSGGTTTELIPNGN  360



>ref|XP_010460900.1| PREDICTED: probable purine permease 4 [Camelina sativa]
Length=385

 Score =   337 bits (865),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 193/298 (65%), Positives = 237/298 (80%), Gaps = 1/298 (0%)
 Frame = -1

Query  1153  KFYFVHGGSSRWVATWVQCAGFPLLIPAVYLPYYAFNSTERRPFAGFSLRIFSLSVVIGL  974
             K+YFVHGGSSRWV+TWVQ AGFPLL+  +Y P Y F +T RRPF  F+ R    SV+IG 
Sbjct  47    KYYFVHGGSSRWVSTWVQSAGFPLLLTLIYFPRYVFKTTTRRPFTRFTRRHLLFSVLIGF  106

Query  973   MLGVNNLLISWGTSYLPVSTCSLVLASQLVFILFLSAIIVRQKITFANLNCvvlltlaav  794
              LG+NN L SWGTSYLPVST SL+L++QLVF L LS +IV+QK+TF+NLNCV+LLTL++V
Sbjct  107   FLGINNFLFSWGTSYLPVSTSSLLLSTQLVFTLILSVLIVKQKVTFSNLNCVILLTLSSV  166

Query  793   llaLDSSSDKPAGLTKAKYFVGFFCTVGAALLFALYLPLVEKLYRNVDCYamvvemqvvm  614
             LLAL SSSDKPAGLTK+KY++GF  T+GA LLFALYLP+ EKLYR+V CYAMV+E+Q++M
Sbjct  167   LLALGSSSDKPAGLTKSKYYIGFASTIGAGLLFALYLPVTEKLYRSVYCYAMVMELQLMM  226

Query  613   eaaATVLATVGMAIDGGFSGMKKESQGGFDLGSKAY-AMTVGLNVLTWQLCFMGTAGMVF  437
             E +ATV AT+GMA DGGF  M  E+   F  G   Y  + +  NV+TWQLCF  T+GMV+
Sbjct  227   ELSATVFATIGMAFDGGFREMVNEANHVFTKGPTVYWTVAIFANVVTWQLCFAATSGMVY  286

Query  436   LTTSVTSGICSTALMAFNVVGGVLAYGDHMGGSKAVSTVLCVWGFSSYVYGMYLKTKK  263
             LT+ +T GIC TAL+A NV+GGV+ YGD  GG K VSTVLC+WGFSSY+YGMY K+KK
Sbjct  287   LTSGITGGICMTALLAMNVIGGVVVYGDKFGGVKIVSTVLCIWGFSSYIYGMYTKSKK  344



>ref|XP_003534853.1| PREDICTED: probable purine permease 4-like [Glycine max]
Length=407

 Score =   338 bits (866),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 189/333 (57%), Positives = 247/333 (74%), Gaps = 15/333 (5%)
 Frame = -1

Query  1153  KFYFVHGGSSRWVATWVQCAGFPLLIPAVYLPYYAFNSTERRPFAGFSLRIFSLSVVIGL  974
             K+YF H GSS+WV+TWVQCAGFP LI  ++LP    N TER+PF  F+ ++   S  IG+
Sbjct  86    KYYFNHKGSSKWVSTWVQCAGFPFLIIPIFLPS-LLNYTERKPFTDFTPKMLCYSFCIGV  144

Query  973   MLGVNNLLISWGTSYLPVSTCSLVLASQLVFILFLSAIIVRQKITFANLNCvvlltlaav  794
             MLG NNLL S+G +YLPVST +L+L+SQLVF L LSAIIV+QKITF+NLN V+L+T++++
Sbjct  145   MLGFNNLLYSFGVAYLPVSTSALLLSSQLVFTLILSAIIVKQKITFSNLNSVILITMSSI  204

Query  793   llaLDSSSDKPAGLTKAKYFVGFFCTVGAALLFALYLPLVEKLYRNVDCYamvvemqvvm  614
             +LAL+SS +KP GLT+  YF+GF CT+GA LLF+LYLPL+EK+Y  V CY MV+EMQ+VM
Sbjct  205   ILALNSSHEKPQGLTQKDYFIGFSCTIGAGLLFSLYLPLMEKIYERVYCYGMVMEMQLVM  264

Query  613   eaaATVLATVGMAIDGGFSGMKKESQGGFDLGSKAYAMTVGLNVLTWQLCFMGTAGMVFL  434
             E AATVLAT GM   GGFS MK+E+   FD G+  Y +TV L+V+TWQ CFMGTAGMVFL
Sbjct  265   EIAATVLATGGMVYKGGFSEMKEEADRVFDKGNTFYWVTVVLSVVTWQCCFMGTAGMVFL  324

Query  433   TTSVTSGICSTALMAFNVVGGVLAYGDHMGGSKAVSTVLCVWGFSSYVYGMYLKTKKVTK  254
             T+S+T G+ +TAL++ NV+ G L Y D   G K V+TVLC+WGF SYVYGMY+K ++  +
Sbjct  325   TSSLTGGVSATALLSMNVLAGWLVYHDAFKGFKIVATVLCIWGFCSYVYGMYIKREQEEE  384

Query  253   EVPPAIGA*SD*TPARRRTATGGSIVEGIVRGS  155
                           A+RR ++GG+  E I  G+
Sbjct  385   --------------AKRRNSSGGTTTELIPNGN  403



>ref|XP_010499636.1| PREDICTED: probable purine permease 4 isoform X1 [Camelina sativa]
 ref|XP_010499637.1| PREDICTED: probable purine permease 4 isoform X2 [Camelina sativa]
Length=385

 Score =   337 bits (864),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 193/298 (65%), Positives = 236/298 (79%), Gaps = 1/298 (0%)
 Frame = -1

Query  1153  KFYFVHGGSSRWVATWVQCAGFPLLIPAVYLPYYAFNSTERRPFAGFSLRIFSLSVVIGL  974
             K+YFVHGGSSRWV+TWVQ AGFPLL+  +Y P Y F +T RRPF  F+ R    SV+IG 
Sbjct  47    KYYFVHGGSSRWVSTWVQSAGFPLLLTLIYFPRYVFKTTTRRPFTRFTRRHLIFSVLIGF  106

Query  973   MLGVNNLLISWGTSYLPVSTCSLVLASQLVFILFLSAIIVRQKITFANLNCvvlltlaav  794
              LGVNN L SWGTSYLPVST SL+L++QLVF L LS +IV+QK+TF+NLNCV+LLTL++V
Sbjct  107   FLGVNNFLFSWGTSYLPVSTSSLLLSTQLVFTLILSVLIVKQKVTFSNLNCVILLTLSSV  166

Query  793   llaLDSSSDKPAGLTKAKYFVGFFCTVGAALLFALYLPLVEKLYRNVDCYamvvemqvvm  614
             LLAL SSSDKPAGLTK+KY++GF  T+GA LLFALYLP+ EKLYR+V CYAMV+E+Q++M
Sbjct  167   LLALGSSSDKPAGLTKSKYYIGFASTIGAGLLFALYLPVTEKLYRSVYCYAMVMELQLMM  226

Query  613   eaaATVLATVGMAIDGGFSGMKKESQGGFDLGSKAY-AMTVGLNVLTWQLCFMGTAGMVF  437
             E +ATV AT GMA DGGF  M  E+   F  G   Y  + + +NV+TWQLCF  T+GMV+
Sbjct  227   ELSATVFATFGMAFDGGFKEMVNEANHVFTKGPTVYWTVAIFVNVVTWQLCFAATSGMVY  286

Query  436   LTTSVTSGICSTALMAFNVVGGVLAYGDHMGGSKAVSTVLCVWGFSSYVYGMYLKTKK  263
             LT+ +T GIC TAL+A NV+GGV+ Y D  GG K VSTVLC+WGFSSY+YGMY K+KK
Sbjct  287   LTSGITGGICMTALLAMNVIGGVVVYSDEFGGVKIVSTVLCIWGFSSYIYGMYTKSKK  344



>ref|XP_010676487.1| PREDICTED: probable purine permease 4 [Beta vulgaris subsp. vulgaris]
Length=379

 Score =   337 bits (863),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 204/292 (70%), Positives = 245/292 (84%), Gaps = 1/292 (0%)
 Frame = -1

Query  1153  KFYFVHGGSSRWVATWVQCAGFPLLIPAVYLPYYAFNSTERRPFAGFSLRIFSLSVVIGL  974
             KFYF+H GSSRWV+TWVQCAGFP+L+  + LPY+    T+R+PF  F+ +I +LS+VIGL
Sbjct  60    KFYFIHKGSSRWVSTWVQCAGFPILVFPILLPYF-LKFTQRKPFTKFTKKILALSLVIGL  118

Query  973   MLGVNNLLISWGTSYLPVSTCSLVLASQLVFILFLSAIIVRQKITFANLNCvvlltlaav  794
             +LGVNNLL SWGTSYLPVST SL+L+SQLVF L LS +IV+QKITF NLNCV+LLTL++V
Sbjct  119   LLGVNNLLFSWGTSYLPVSTSSLLLSSQLVFTLILSCLIVKQKITFNNLNCVILLTLSSV  178

Query  793   llaLDSSSDKPAGLTKAKYFVGFFCTVGAALLFALYLPLVEKLYRNVDCYamvvemqvvm  614
             LLA  SS D+P G+TKA YFVG+FCT+GA LLFALYLP++EK+YR V CY MV+EMQ+VM
Sbjct  179   LLAFTSSHDRPKGITKAMYFVGYFCTIGAGLLFALYLPVMEKIYREVYCYEMVMEMQLVM  238

Query  613   eaaATVLATVGMAIDGGFSGMKKESQGGFDLGSKAYAMTVGLNVLTWQLCFMGTAGMVFL  434
             E AAT LATVGMA DGGF  M++ES+  FDLG + Y +TV   V++WQLCFMGTAGMVFL
Sbjct  239   EIAATALATVGMASDGGFREMRRESKILFDLGPRMYCLTVVATVVSWQLCFMGTAGMVFL  298

Query  433   TTSVTSGICSTALMAFNVVGGVLAYGDHMGGSKAVSTVLCVWGFSSYVYGMY  278
             TTS+T G+C TAL+A NVVGGVL YGDH GG+KAVSTVLC WGF SYVYG+Y
Sbjct  299   TTSLTGGVCMTALLAMNVVGGVLVYGDHFGGAKAVSTVLCAWGFCSYVYGLY  350



>ref|XP_010478523.1| PREDICTED: probable purine permease 4 isoform X1 [Camelina sativa]
 ref|XP_010478524.1| PREDICTED: probable purine permease 4 isoform X2 [Camelina sativa]
Length=385

 Score =   336 bits (861),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 192/298 (64%), Positives = 236/298 (79%), Gaps = 1/298 (0%)
 Frame = -1

Query  1153  KFYFVHGGSSRWVATWVQCAGFPLLIPAVYLPYYAFNSTERRPFAGFSLRIFSLSVVIGL  974
             K+YFVHGGSSRWV+TWVQ AGFPLL+  +Y P Y F +T RRPF  F+ R    SV+IG 
Sbjct  47    KYYFVHGGSSRWVSTWVQSAGFPLLLTLIYFPRYVFKTTTRRPFTRFTRRHLLFSVLIGF  106

Query  973   MLGVNNLLISWGTSYLPVSTCSLVLASQLVFILFLSAIIVRQKITFANLNCvvlltlaav  794
              LG+NN L SWGTSYLPVST SL+L++QLVF L LS +IV+QK+TF+NLNCV+LLTL++V
Sbjct  107   FLGINNFLFSWGTSYLPVSTSSLLLSTQLVFTLILSVLIVKQKVTFSNLNCVILLTLSSV  166

Query  793   llaLDSSSDKPAGLTKAKYFVGFFCTVGAALLFALYLPLVEKLYRNVDCYamvvemqvvm  614
             LLAL SSSDKP GLTK+KY++GF  T+GA LLFALYLP+ EKLYR+V CYAMV+E+Q++M
Sbjct  167   LLALGSSSDKPDGLTKSKYYIGFASTIGAGLLFALYLPVTEKLYRSVYCYAMVMELQLMM  226

Query  613   eaaATVLATVGMAIDGGFSGMKKESQGGFDLGSKAY-AMTVGLNVLTWQLCFMGTAGMVF  437
             E +ATV AT+GMA DGGF  M  E+   F  G   Y  + +  NV+TWQLCF  T+GMV+
Sbjct  227   ELSATVFATIGMAFDGGFREMVNEANHVFTKGPTVYWTVAIFANVVTWQLCFAATSGMVY  286

Query  436   LTTSVTSGICSTALMAFNVVGGVLAYGDHMGGSKAVSTVLCVWGFSSYVYGMYLKTKK  263
             LT+ +T GIC TAL+A NV+GGV+ YGD  GG K VSTVLC+WGFSSY+YGMY K+KK
Sbjct  287   LTSGITGGICMTALLAMNVIGGVVVYGDKFGGVKIVSTVLCIWGFSSYIYGMYTKSKK  344



>ref|XP_010519027.1| PREDICTED: probable purine permease 4 [Tarenaya hassleriana]
Length=378

 Score =   334 bits (857),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 200/313 (64%), Positives = 244/313 (78%), Gaps = 2/313 (1%)
 Frame = -1

Query  1153  KFYFVHGGSSRWVATWVQCAGFPLLIPAVYLPYYAFNS-TERRPFAGFSLRIFSLSVVIG  977
             KFYFV+GGSSRWV+TWVQ AGFPLL+  +Y+P+    +   RRPF  F+ R F  SV +G
Sbjct  45    KFYFVNGGSSRWVSTWVQSAGFPLLLLPIYVPHLLLPTLFTRRPFTRFTRRRFLFSVAVG  104

Query  976   LMLGVNNLLISWGTSYLPVSTCSLVLASQLVFILFLSAIIVRQKITFANLNCvvlltlaa  797
             LMLG NNLL SWGTSYLPVST SL+L++QL+F L LS +IVRQKITF+NLNCVVLLTL++
Sbjct  105   LMLGFNNLLFSWGTSYLPVSTSSLLLSTQLIFTLILSVLIVRQKITFSNLNCVVLLTLSS  164

Query  796   vllaLDSSSDKPAGLTKAKYFVGFFCTVGAALLFALYLPLVEKLYRNVDCYamvvemqvv  617
             VLLAL SSSDKPAGLT+ KYF+GF  T+GA LLFALY P+VEKLY +V CYAMV+EMQ+V
Sbjct  165   VLLALGSSSDKPAGLTRFKYFIGFISTIGAGLLFALYFPVVEKLYMSVSCYAMVMEMQLV  224

Query  616   meaaATVLATVGMAIDGGFSGMKKESQGGFDLGSKAY-AMTVGLNVLTWQLCFMGTAGMV  440
             ME +ATVLA VGM  DGGF+ M KE+   F  G   Y ++ +G  V+TWQLCF GTAGMV
Sbjct  225   MEISATVLAMVGMVFDGGFAEMVKEANRVFTRGPVCYWSVAIGATVVTWQLCFAGTAGMV  284

Query  439   FLTTSVTSGICSTALMAFNVVGGVLAYGDHMGGSKAVSTVLCVWGFSSYVYGMYLKTKKV  260
             +LT+ +T GIC TAL+A NV+GGV+ YGD  GG KAVSTVLC+WGF SYVYG+Y   K+ 
Sbjct  285   YLTSGITGGICMTALLAVNVIGGVVVYGDKFGGVKAVSTVLCIWGFCSYVYGIYTTVKEE  344

Query  259   TKEVPPAIGA*SD  221
              +++P    A +D
Sbjct  345   EEDIPATFSAEND  357



>ref|XP_004232602.1| PREDICTED: probable purine permease 4 [Solanum lycopersicum]
Length=411

 Score =   335 bits (859),  Expect = 6e-107, Method: Compositional matrix adjust.
 Identities = 205/298 (69%), Positives = 245/298 (82%), Gaps = 5/298 (2%)
 Frame = -1

Query  1153  KFYFVHGGSSRWVATWVQCAGFPLLI-PAVYLPYYAFNSTERRPFAGFSLRIFSLSVVIG  977
             KFYF H G SRWV+TWVQCAGFPLL+ P  +   +    T+R+ F+GF+ +I +LS++IG
Sbjct  86    KFYFNHKGGSRWVSTWVQCAGFPLLLFPICFFRIF----TDRKLFSGFTPKIIALSILIG  141

Query  976   LMLGVNNLLISWGTSYLPVSTCSLVLASQLVFILFLSAIIVRQKITFANLNCvvlltlaa  797
             L+LGVNNLL SWG SYLPVST SLVL++QL F L  S IIV+QKIT+ NLNCVV+LTL++
Sbjct  142   LLLGVNNLLFSWGNSYLPVSTNSLVLSTQLAFTLVTSMIIVKQKITYPNLNCVVVLTLSS  201

Query  796   vllaLDSSSDKPAGLTKAKYFVGFFCTVGAALLFALYLPLVEKLYRNVDCYamvvemqvv  617
             V+LAL SS DKP GLTKAKYF GFF TVGA L+FALYLP++EK+Y+ V+CYAMVVEMQ+V
Sbjct  202   VILALSSSHDKPIGLTKAKYFKGFFSTVGAGLMFALYLPVMEKIYQRVNCYAMVVEMQLV  261

Query  616   meaaATVLATVGMAIDGGFSGMKKESQGGFDLGSKAYAMTVGLNVLTWQLCFMGTAGMVF  437
             ME AATVLATVGMA DGGFS MK+ES   FDLG KAY +TVG NV+TWQ+CFMGTAGMVF
Sbjct  262   MEIAATVLATVGMAADGGFSEMKRESLKVFDLGPKAYWLTVGFNVVTWQVCFMGTAGMVF  321

Query  436   LTTSVTSGICSTALMAFNVVGGVLAYGDHMGGSKAVSTVLCVWGFSSYVYGMYLKTKK  263
             LTTS+T G+C TALM  NV+GGVL YGD+  G KAVST LCVWGF SY+YG+Y+  K+
Sbjct  322   LTTSLTGGVCMTALMGINVLGGVLVYGDYFSGLKAVSTSLCVWGFCSYIYGIYMNMKE  379



>gb|AGV54805.1| purine permease 4-like protein [Phaseolus vulgaris]
Length=400

 Score =   333 bits (855),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 184/297 (62%), Positives = 232/297 (78%), Gaps = 1/297 (0%)
 Frame = -1

Query  1153  KFYFVHGGSSRWVATWVQCAGFPLLIPAVYLPYYAFNSTERRPFAGFSLRIFSLSVVIGL  974
             K+YF+H GSS WV+TWVQ AGFPLL+  + +PY  F  T+R PF  F+  +  LSV +G+
Sbjct  80    KYYFIHKGSSIWVSTWVQTAGFPLLMIPICVPYL-FKFTKRVPFTDFTPTMLILSVSVGI  138

Query  973   MLGVNNLLISWGTSYLPVSTCSLVLASQLVFILFLSAIIVRQKITFANLNCvvlltlaav  794
             MLG NNL  SWG SYLP+ST +L+L+SQLVF LF S IIV QK+TF+N+NCV+LLTL+++
Sbjct  139   MLGFNNLFFSWGNSYLPISTSALLLSSQLVFNLFFSVIIVNQKMTFSNVNCVILLTLSSI  198

Query  793   llaLDSSSDKPAGLTKAKYFVGFFCTVGAALLFALYLPLVEKLYRNVDCYamvvemqvvm  614
             LLALDSS+++P GLT+  YF GFFCT+ A LLFA YLPL+EK+Y+ V+CY MV+EMQ+VM
Sbjct  199   LLALDSSNERPEGLTQRNYFFGFFCTIAAGLLFAFYLPLMEKIYKRVNCYEMVMEMQLVM  258

Query  613   eaaATVLATVGMAIDGGFSGMKKESQGGFDLGSKAYAMTVGLNVLTWQLCFMGTAGMVFL  434
             E AAT +AT+GMA  GGF+ M  ES   FD G   Y +TV  NV+TWQLCFMGTAGMVFL
Sbjct  259   EFAATTMATIGMASGGGFAKMISESTMVFDKGCMVYWVTVVANVVTWQLCFMGTAGMVFL  318

Query  433   TTSVTSGICSTALMAFNVVGGVLAYGDHMGGSKAVSTVLCVWGFSSYVYGMYLKTKK  263
             T+S+T GIC TAL++ NV+GGVL Y D  GG KAVST+LC+WGF SYVYG++   +K
Sbjct  319   TSSLTGGICMTALLSMNVLGGVLVYKDAFGGFKAVSTILCIWGFLSYVYGVHKVNRK  375



>ref|XP_007138881.1| hypothetical protein PHAVU_009G245500g [Phaseolus vulgaris]
 gb|ESW10875.1| hypothetical protein PHAVU_009G245500g [Phaseolus vulgaris]
Length=400

 Score =   331 bits (849),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 182/297 (61%), Positives = 231/297 (78%), Gaps = 1/297 (0%)
 Frame = -1

Query  1153  KFYFVHGGSSRWVATWVQCAGFPLLIPAVYLPYYAFNSTERRPFAGFSLRIFSLSVVIGL  974
             K+YF+H GSS WV+TWVQ AGFPLL+  + +PY  F  T+R PF  F+  +  LSV +G+
Sbjct  80    KYYFIHKGSSIWVSTWVQTAGFPLLMIPICVPYL-FKFTKRVPFTDFTPTMLILSVSVGI  138

Query  973   MLGVNNLLISWGTSYLPVSTCSLVLASQLVFILFLSAIIVRQKITFANLNCvvlltlaav  794
             MLG NNL  SWG SYLP+ST +L+L+SQLVF L  S IIV QK+TF+N+NCV+LLTL+++
Sbjct  139   MLGFNNLFFSWGNSYLPISTSALLLSSQLVFNLLFSVIIVNQKMTFSNVNCVILLTLSSI  198

Query  793   llaLDSSSDKPAGLTKAKYFVGFFCTVGAALLFALYLPLVEKLYRNVDCYamvvemqvvm  614
             LLALDSS+++P GLT+  YF GFFCT+ A LLFA YLPL+EK+Y+ V+CY MV+EMQ+VM
Sbjct  199   LLALDSSNERPEGLTQRNYFFGFFCTIAAGLLFAFYLPLMEKIYKRVNCYEMVMEMQLVM  258

Query  613   eaaATVLATVGMAIDGGFSGMKKESQGGFDLGSKAYAMTVGLNVLTWQLCFMGTAGMVFL  434
             E +AT +AT+GMA  GGF+ M  ES   FD G   Y +TV  NV+TWQLCFMGTAGMVFL
Sbjct  259   EFSATTMATIGMASGGGFAKMISESTMVFDKGCMVYWVTVVANVVTWQLCFMGTAGMVFL  318

Query  433   TTSVTSGICSTALMAFNVVGGVLAYGDHMGGSKAVSTVLCVWGFSSYVYGMYLKTKK  263
             T+S+T GIC TAL++ NV+GGVL Y D  GG KAVST+LC+WGF SYVYG++   +K
Sbjct  319   TSSLTGGICMTALLSMNVLGGVLVYKDAFGGFKAVSTILCIWGFLSYVYGVHKVNRK  375



>ref|XP_011008209.1| PREDICTED: probable purine permease 4 [Populus euphratica]
Length=362

 Score =   328 bits (840),  Expect = 9e-105, Method: Compositional matrix adjust.
 Identities = 212/297 (71%), Positives = 246/297 (83%), Gaps = 0/297 (0%)
 Frame = -1

Query  1153  KFYFVHGGSSRWVATWVQCAGFPLLIPAVYLPYYAFNSTERRPFAGFSLRIFSLSVVIGL  974
             KFYF H GSSRWV+TWVQ AGFPLLI  +YLP+Y    T+RRPF+ F+ RI  LS++IGL
Sbjct  43    KFYFNHHGSSRWVSTWVQSAGFPLLIFPIYLPFYVLKCTDRRPFSHFTPRILILSIIIGL  102

Query  973   MLGVNNLLISWGTSYLPVSTCSLVLASQLVFILFLSAIIVRQKITFANLNCvvlltlaav  794
             MLG+NNLL SWG SYLPVST SL+L+SQLVF L LS IIV+QKITF NLNCV+LLTL++V
Sbjct  103   MLGLNNLLFSWGNSYLPVSTSSLLLSSQLVFNLILSVIIVKQKITFQNLNCVLLLTLSSV  162

Query  793   llaLDSSSDKPAGLTKAKYFVGFFCTVGAALLFALYLPLVEKLYRNVDCYamvvemqvvm  614
             LLAL SS DKP GLT+AKYFVGFF T+GA LLFALYLP++EK+Y+ + CY MV+EMQ+VM
Sbjct  163   LLALGSSHDKPQGLTRAKYFVGFFSTIGAGLLFALYLPVMEKIYKWIYCYEMVMEMQLVM  222

Query  613   eaaATVLATVGMAIDGGFSGMKKESQGGFDLGSKAYAMTVGLNVLTWQLCFMGTAGMVFL  434
             E AATVLAT GMA DGGFS MK+ESQ  FD G + Y +TV  NV+TWQLCFMGTAGMVFL
Sbjct  223   EIAATVLATAGMASDGGFSEMKRESQVKFDKGPEIYWVTVFANVVTWQLCFMGTAGMVFL  282

Query  433   TTSVTSGICSTALMAFNVVGGVLAYGDHMGGSKAVSTVLCVWGFSSYVYGMYLKTKK  263
             T+S+T GIC TAL+A NV+GGVL YGD  GG K VSTVLC WGF SYVYGMYLK ++
Sbjct  283   TSSLTGGICMTALLAMNVLGGVLVYGDEFGGVKVVSTVLCGWGFCSYVYGMYLKMRE  339



>ref|XP_002304614.1| purine permease-related family protein [Populus trichocarpa]
 gb|EEE79593.1| purine permease-related family protein [Populus trichocarpa]
Length=413

 Score =   329 bits (844),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 206/297 (69%), Positives = 244/297 (82%), Gaps = 0/297 (0%)
 Frame = -1

Query  1153  KFYFVHGGSSRWVATWVQCAGFPLLIPAVYLPYYAFNSTERRPFAGFSLRIFSLSVVIGL  974
             KFYF H GSSRWV+TWVQ AGFPLL+  +YLP+Y F  T+RRPF+ F+ ++  LS+ IGL
Sbjct  94    KFYFNHQGSSRWVSTWVQSAGFPLLLFPIYLPFYVFKCTDRRPFSLFTPKLLILSIFIGL  153

Query  973   MLGVNNLLISWGTSYLPVSTCSLVLASQLVFILFLSAIIVRQKITFANLNCvvlltlaav  794
             MLG+NNLL SWG SYLPVST SL+L+SQLVF L LSAIIV+QKITF N NCV+LLTL++V
Sbjct  154   MLGLNNLLFSWGNSYLPVSTSSLLLSSQLVFNLILSAIIVKQKITFQNFNCVILLTLSSV  213

Query  793   llaLDSSSDKPAGLTKAKYFVGFFCTVGAALLFALYLPLVEKLYRNVDCYamvvemqvvm  614
             LLAL SS DK  GLT+AKYF+GF  T+GA LLFALYLP++EK+YR + CY MVVEMQ+VM
Sbjct  214   LLALGSSHDKSQGLTRAKYFIGFLSTIGAGLLFALYLPVMEKIYRRIYCYEMVVEMQLVM  273

Query  613   eaaATVLATVGMAIDGGFSGMKKESQGGFDLGSKAYAMTVGLNVLTWQLCFMGTAGMVFL  434
             E AAT LAT+GMA  GGFS MK+ESQ  FD G++ Y +TV  NV+TWQLCFMGTAGMVFL
Sbjct  274   EIAATALATMGMASAGGFSEMKRESQVRFDKGARVYWVTVFANVVTWQLCFMGTAGMVFL  333

Query  433   TTSVTSGICSTALMAFNVVGGVLAYGDHMGGSKAVSTVLCVWGFSSYVYGMYLKTKK  263
             T+S+T GIC TAL+A NV+GGV+ YGD  GG K VSTVLC WGF SYVYG+YLK K+
Sbjct  334   TSSLTGGICMTALLAMNVLGGVVVYGDEFGGVKVVSTVLCGWGFCSYVYGLYLKMKE  390



>gb|KFK41670.1| hypothetical protein AALP_AA2G157700 [Arabis alpina]
Length=383

 Score =   328 bits (841),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 189/293 (65%), Positives = 228/293 (78%), Gaps = 1/293 (0%)
 Frame = -1

Query  1153  KFYFVHGGSSRWVATWVQCAGFPLLIPAVYLPYYAFNSTERRPFAGFSLRIFSLSVVIGL  974
             K+YFVHGGSSRWV+TWVQ AGFPLL+  +Y PY+ F +T RRPF  F+ R    S +IG 
Sbjct  47    KYYFVHGGSSRWVSTWVQSAGFPLLLILIYAPYFIFGTTTRRPFTRFTRRHLIFSALIGF  106

Query  973   MLGVNNLLISWGTSYLPVSTCSLVLASQLVFILFLSAIIVRQKITFANLNCvvlltlaav  794
             +LG NN L SWGTSYLPVST SL+L++QL+F L LS IIV+QK+TF+NLNCV+LLT+++V
Sbjct  107   VLGFNNFLFSWGTSYLPVSTSSLLLSTQLIFTLLLSVIIVKQKVTFSNLNCVILLTISSV  166

Query  793   llaLDSSSDKPAGLTKAKYFVGFFCTVGAALLFALYLPLVEKLYRNVDCYamvvemqvvm  614
             LLAL SS DKP GLTK KYF+GF  T+GA LLFALYLP+ EKLYR V CY+MV+EMQ V 
Sbjct  167   LLALGSSQDKPPGLTKTKYFIGFLSTIGAGLLFALYLPVTEKLYRTVYCYSMVMEMQFVF  226

Query  613   eaaATVLATVGMAIDGGFSGMKKESQGGFDLGSKAY-AMTVGLNVLTWQLCFMGTAGMVF  437
             E +ATV AT+GMA DGGF  M KE+   F  G   Y  + +  NV+TWQLCF  T+GMV+
Sbjct  227   EFSATVFATIGMAFDGGFKEMVKEANHVFTKGPTVYWTVAILANVVTWQLCFAATSGMVY  286

Query  436   LTTSVTSGICSTALMAFNVVGGVLAYGDHMGGSKAVSTVLCVWGFSSYVYGMY  278
             LT+ +T GIC TAL+A NV+GGV+ YGD  GG K VSTVLCVWGFSSYVYG+Y
Sbjct  287   LTSGITGGICMTALLAMNVIGGVVVYGDEFGGIKIVSTVLCVWGFSSYVYGLY  339



>ref|XP_006415403.1| hypothetical protein EUTSA_v10007839mg [Eutrema salsugineum]
 gb|ESQ33756.1| hypothetical protein EUTSA_v10007839mg [Eutrema salsugineum]
Length=394

 Score =   328 bits (841),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 192/294 (65%), Positives = 235/294 (80%), Gaps = 1/294 (0%)
 Frame = -1

Query  1153  KFYFVHGGSSRWVATWVQCAGFPLLIPAVYLPYYAFNSTERRPFAGFSLRIFSLSVVIGL  974
             K+YFVHGGSSRWV+TWVQ AGFPLL+  +Y P++ F +T RRPF  F+ R    SV+IG 
Sbjct  49    KYYFVHGGSSRWVSTWVQSAGFPLLLFLIYFPHFVFKTTTRRPFTRFTRRHLVFSVLIGF  108

Query  973   MLGVNNLLISWGTSYLPVSTCSLVLASQLVFILFLSAIIVRQKITFANLNCvvlltlaav  794
             +LG NN L SWGTSYLPVST SL+L++QL+F L LS IIV+QK+TF+NLNCVVLLTL++V
Sbjct  109   VLGFNNFLFSWGTSYLPVSTSSLLLSTQLIFTLLLSVIIVKQKVTFSNLNCVVLLTLSSV  168

Query  793   llaLDSSSDKPAGLTKAKYFVGFFCTVGAALLFALYLPLVEKLYRNVDCYamvvemqvvm  614
             LLAL SS DKPAGLTK KYF+GF  T+GA LLFALYLP+ E+LYR+V CYAMV+EMQ+VM
Sbjct  169   LLALGSSQDKPAGLTKTKYFIGFLSTIGAGLLFALYLPVTERLYRSVYCYAMVMEMQLVM  228

Query  613   eaaATVLATVGMAIDGGFSGMKKESQGGFDLGSKAY-AMTVGLNVLTWQLCFMGTAGMVF  437
             E AATV AT+GMA DGGF+ M KE+   F  G   +  + +  NV+TWQLCF  T+GMV+
Sbjct  229   EFAATVFATIGMAFDGGFNEMVKEANRVFSKGPTVFWTVAILANVVTWQLCFAATSGMVY  288

Query  436   LTTSVTSGICSTALMAFNVVGGVLAYGDHMGGSKAVSTVLCVWGFSSYVYGMYL  275
             LT+ +T GIC TAL+A NV+GGV+ YGD  GG K VSTVLC+WGFSSYVYG+Y+
Sbjct  289   LTSGITGGICMTALLAMNVIGGVVVYGDEFGGVKIVSTVLCIWGFSSYVYGIYV  342



>ref|XP_002297909.2| purine permease-related family protein [Populus trichocarpa]
 gb|EEE82714.2| purine permease-related family protein [Populus trichocarpa]
Length=342

 Score =   324 bits (830),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 211/301 (70%), Positives = 247/301 (82%), Gaps = 0/301 (0%)
 Frame = -1

Query  1153  KFYFVHGGSSRWVATWVQCAGFPLLIPAVYLPYYAFNSTERRPFAGFSLRIFSLSVVIGL  974
             KFYF H GSSRWV+TWVQ AGFPLLI  +YLP+Y    T+RRPF+ F+ RI  LS++IGL
Sbjct  23    KFYFNHHGSSRWVSTWVQSAGFPLLIFPIYLPFYVLKCTDRRPFSHFTPRILILSILIGL  82

Query  973   MLGVNNLLISWGTSYLPVSTCSLVLASQLVFILFLSAIIVRQKITFANLNCvvlltlaav  794
             MLG+NNLL SWG SYLPVST SL+L+SQLVF L LS IIV+QKITF NLNCVVLLTL++V
Sbjct  83    MLGLNNLLFSWGNSYLPVSTSSLLLSSQLVFNLILSVIIVKQKITFQNLNCVVLLTLSSV  142

Query  793   llaLDSSSDKPAGLTKAKYFVGFFCTVGAALLFALYLPLVEKLYRNVDCYamvvemqvvm  614
             LLAL S+ DKP GLT+AKYFVGFF T+GA LLFALYLP++EK+Y+ + CY MV+EMQ+VM
Sbjct  143   LLALGSTHDKPQGLTRAKYFVGFFSTIGAGLLFALYLPVMEKIYKWIYCYEMVMEMQLVM  202

Query  613   eaaATVLATVGMAIDGGFSGMKKESQGGFDLGSKAYAMTVGLNVLTWQLCFMGTAGMVFL  434
             E AAT LAT GMA DGGFS MK+ESQ  FD G + Y +TV  NV+TWQLCFMGTAGMVFL
Sbjct  203   EIAATALATAGMASDGGFSEMKRESQVKFDKGPEIYWVTVFANVVTWQLCFMGTAGMVFL  262

Query  433   TTSVTSGICSTALMAFNVVGGVLAYGDHMGGSKAVSTVLCVWGFSSYVYGMYLKTKKVTK  254
             T+S+T GIC TAL+A NV+GGVL YGD  GG K VSTVLC WGF SYVYGMYLK ++  +
Sbjct  263   TSSLTGGICMTALLAMNVLGGVLVYGDEFGGVKVVSTVLCGWGFCSYVYGMYLKMREEKE  322

Query  253   E  251
             +
Sbjct  323   K  323



>ref|XP_011022291.1| PREDICTED: probable purine permease 4 [Populus euphratica]
Length=414

 Score =   325 bits (834),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 204/297 (69%), Positives = 242/297 (81%), Gaps = 0/297 (0%)
 Frame = -1

Query  1153  KFYFVHGGSSRWVATWVQCAGFPLLIPAVYLPYYAFNSTERRPFAGFSLRIFSLSVVIGL  974
             KFYF H GSSRWV+TWVQ AGFPLL+  +YLP+Y F  T+RRPF+ F+ ++  LS+ IGL
Sbjct  95    KFYFNHQGSSRWVSTWVQSAGFPLLLFPIYLPFYVFKCTDRRPFSLFTPKLLILSIFIGL  154

Query  973   MLGVNNLLISWGTSYLPVSTCSLVLASQLVFILFLSAIIVRQKITFANLNCvvlltlaav  794
             MLG+NNLL SWG SYLPVST SL+L+SQLVF L LS IIV+QKITF N NCV+LLTL++V
Sbjct  155   MLGLNNLLFSWGNSYLPVSTSSLLLSSQLVFNLILSVIIVKQKITFQNFNCVILLTLSSV  214

Query  793   llaLDSSSDKPAGLTKAKYFVGFFCTVGAALLFALYLPLVEKLYRNVDCYamvvemqvvm  614
             LLAL SS DK  GLT+AKYF+GF  T+GA LLFALYLP++EK+YR + CY MVVEMQ+VM
Sbjct  215   LLALGSSHDKSQGLTRAKYFLGFLSTIGAGLLFALYLPVMEKIYRRIYCYEMVVEMQLVM  274

Query  613   eaaATVLATVGMAIDGGFSGMKKESQGGFDLGSKAYAMTVGLNVLTWQLCFMGTAGMVFL  434
             E AAT LAT+GMA  GGFS MK+ESQ  FD G + Y +TV  NV+TWQLCFMGTAGMVFL
Sbjct  275   EIAATALATMGMASAGGFSEMKRESQVKFDKGERVYWITVFANVVTWQLCFMGTAGMVFL  334

Query  433   TTSVTSGICSTALMAFNVVGGVLAYGDHMGGSKAVSTVLCVWGFSSYVYGMYLKTKK  263
             T+S+T GIC TAL+A NV+GGV+ YGD  GG K VSTVLC WGF SYV+G+YLK K+
Sbjct  335   TSSLTGGICMTALLAMNVLGGVVVYGDEFGGVKVVSTVLCGWGFCSYVHGLYLKVKE  391



>ref|XP_002890908.1| hypothetical protein ARALYDRAFT_473325 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH67167.1| hypothetical protein ARALYDRAFT_473325 [Arabidopsis lyrata subsp. 
lyrata]
Length=382

 Score =   323 bits (829),  Expect = 7e-103, Method: Compositional matrix adjust.
 Identities = 191/291 (66%), Positives = 229/291 (79%), Gaps = 1/291 (0%)
 Frame = -1

Query  1153  KFYFVHGGSSRWVATWVQCAGFPLLIPAVYLPYYAFNSTERRPFAGFSLRIFSLSVVIGL  974
             K+YFVHGGSSRWV+TWVQ AGFPLL+  +Y P Y F +T RRPF  F+ R    SV+IG 
Sbjct  47    KYYFVHGGSSRWVSTWVQSAGFPLLLTLIYFPRYVFKTTTRRPFTRFTRRHLIFSVLIGF  106

Query  973   MLGVNNLLISWGTSYLPVSTCSLVLASQLVFILFLSAIIVRQKITFANLNCvvlltlaav  794
             +LG NN L SWGTSYLPVST SL+L++QLVF L LSAIIV+QKI F+NLNCVVLLTL++V
Sbjct  107   VLGFNNFLFSWGTSYLPVSTSSLLLSTQLVFTLILSAIIVKQKINFSNLNCVVLLTLSSV  166

Query  793   llaLDSSSDKPAGLTKAKYFVGFFCTVGAALLFALYLPLVEKLYRNVDCYamvvemqvvm  614
             LLAL SS DKPAGLTK KY++GF  T+GA LLFALYLP+ EKLYR+V CYAMV+E+Q+VM
Sbjct  167   LLALGSSRDKPAGLTKTKYYIGFVSTIGAGLLFALYLPVTEKLYRSVYCYAMVMEVQLVM  226

Query  613   eaaATVLATVGMAIDGGFSGMKKESQGGFDLGSKAY-AMTVGLNVLTWQLCFMGTAGMVF  437
             E AATV AT+GM  DGGF  M KE+   F  G   Y  + +  NV+TWQLCF  T+G+V+
Sbjct  227   EFAATVFATIGMVFDGGFREMVKEANHVFTKGPTVYWTVAIFANVVTWQLCFAATSGIVY  286

Query  436   LTTSVTSGICSTALMAFNVVGGVLAYGDHMGGSKAVSTVLCVWGFSSYVYG  284
             LT+ +T GIC TAL+A NV+GGV+ YGD  GG K VSTVLC+WGFSSY+YG
Sbjct  287   LTSGITGGICMTALLAMNVIGGVVVYGDEFGGVKIVSTVLCIWGFSSYIYG  337



>ref|XP_009614957.1| PREDICTED: probable purine permease 4, partial [Nicotiana tomentosiformis]
Length=342

 Score =   320 bits (821),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 186/263 (71%), Positives = 220/263 (84%), Gaps = 0/263 (0%)
 Frame = -1

Query  1153  KFYFVHGGSSRWVATWVQCAGFPLLIPAVYLPYYAFNSTERRPFAGFSLRIFSLSVVIGL  974
             KFYF H G+SRWV+TWVQ AGFPLL+  +YLP+Y   ST+R+PF GF+ +I SLS++IG 
Sbjct  80    KFYFNHKGASRWVSTWVQSAGFPLLLLPIYLPFYVLKSTDRKPFTGFTPKILSLSILIGF  139

Query  973   MLGVNNLLISWGTSYLPVSTCSLVLASQLVFILFLSAIIVRQKITFANLNCvvlltlaav  794
             +LG NNLL SWG SYLPVST SLVL+SQL F L  S IIV+QKIT+ANLNCV+LLTL++V
Sbjct  140   LLGFNNLLFSWGNSYLPVSTNSLVLSSQLAFTLITSVIIVKQKITYANLNCVILLTLSSV  199

Query  793   llaLDSSSDKPAGLTKAKYFVGFFCTVGAALLFALYLPLVEKLYRNVDCYamvvemqvvm  614
             LLAL SS DKP GLTK+KY +GFF TVGA LLFALYLPL+EK+Y+ V CY+MVVEMQ+VM
Sbjct  200   LLALGSSHDKPKGLTKSKYLIGFFSTVGAGLLFALYLPLMEKIYKKVHCYSMVVEMQMVM  259

Query  613   eaaATVLATVGMAIDGGFSGMKKESQGGFDLGSKAYAMTVGLNVLTWQLCFMGTAGMVFL  434
             E AATVLAT+GM I+ GF  MKKES+  FDLG KAY +TV  NV+TWQLCFMGTAGMVFL
Sbjct  260   ELAATVLATMGMTINRGFLEMKKESKNVFDLGEKAYWLTVIFNVVTWQLCFMGTAGMVFL  319

Query  433   TTSVTSGICSTALMAFNVVGGVL  365
             T+S+T GIC TALMA NV+GGV+
Sbjct  320   TSSLTGGICMTALMAVNVLGGVI  342



>ref|XP_009368569.1| PREDICTED: probable purine permease 4 [Pyrus x bretschneideri]
Length=423

 Score =   320 bits (819),  Expect = 6e-101, Method: Compositional matrix adjust.
 Identities = 197/296 (67%), Positives = 246/296 (83%), Gaps = 0/296 (0%)
 Frame = -1

Query  1153  KFYFVHGGSSRWVATWVQCAGFPLLIPAVYLPYYAFNSTERRPFAGFSLRIFSLSVVIGL  974
             K+YF+H GSS WV+TWVQC+GFPLL+P +++PY+  + T+R PF+ F+ +I  LSV+IGL
Sbjct  95    KYYFIHKGSSIWVSTWVQCSGFPLLLPFIFIPYHLLHCTQRIPFSHFTPKILVLSVLIGL  154

Query  973   MLGVNNLLISWGTSYLPVSTCSLVLASQLVFILFLSAIIVRQKITFANLNCvvlltlaav  794
             MLG+NNLL SWG SYLPVST SL+L+SQLVF L LS IIV+QK+TF+NLNCV+LLT+++V
Sbjct  155   MLGLNNLLFSWGNSYLPVSTSSLLLSSQLVFNLILSVIIVKQKVTFSNLNCVILLTVSSV  214

Query  793   llaLDSSSDKPAGLTKAKYFVGFFCTVGAALLFALYLPLVEKLYRNVDCYamvvemqvvm  614
             LLAL S  DKP GLT++KYF+GFF T+GA LLFALYLP++EK+Y  V CYAMV+EMQ+VM
Sbjct  215   LLALGSHHDKPHGLTRSKYFLGFFSTIGAGLLFALYLPVMEKIYSKVYCYAMVIEMQLVM  274

Query  613   eaaATVLATVGMAIDGGFSGMKKESQGGFDLGSKAYAMTVGLNVLTWQLCFMGTAGMVFL  434
             EAAATV ATVGMA++GGF  MK ES+  +D G   Y +T+  NV+TWQLCFMGTAGMVFL
Sbjct  275   EAAATVFATVGMALNGGFREMKAESEKVYDKGENVYWVTLWCNVVTWQLCFMGTAGMVFL  334

Query  433   TTSVTSGICSTALMAFNVVGGVLAYGDHMGGSKAVSTVLCVWGFSSYVYGMYLKTK  266
             T+S+T GIC TAL+  NV+GGVL YGD  GG KAVST+LC WGF SYVYG+Y+K +
Sbjct  335   TSSLTGGICMTALIGMNVLGGVLVYGDSFGGVKAVSTLLCGWGFCSYVYGLYMKAR  390



>gb|EYU19429.1| hypothetical protein MIMGU_mgv1a018240mg [Erythranthe guttata]
Length=349

 Score =   317 bits (812),  Expect = 8e-101, Method: Compositional matrix adjust.
 Identities = 201/308 (65%), Positives = 244/308 (79%), Gaps = 3/308 (1%)
 Frame = -1

Query  1153  KFYFVHGGSSRWVATWVQCAGFPLLIPAVYLPYYAFNSTERRPFAGFSLRIFSLSVVIGL  974
             KFYF+H GSSRWV+TWVQ AGFP+L+  VYLPYY F  TER+PF+GFS  +   S+V+G+
Sbjct  38    KFYFIHKGSSRWVSTWVQSAGFPVLLLPVYLPYYVFKCTERKPFSGFSSNLLIPSLVVGV  97

Query  973   MLGVNNLLISWGTSYLPVSTCSLVLASQLVFILFLSAIIVRQKITFANLNCvvlltlaav  794
              LGVNNLL SWG SYLPVST SL+L+SQL F L LS IIV+Q+ITF NLNCV+LLTL++V
Sbjct  98    FLGVNNLLFSWGNSYLPVSTSSLLLSSQLAFNLILSVIIVKQRITFKNLNCVILLTLSSV  157

Query  793   llaLDSSSDKPAGLTKAKYFVGFFCTVGAALLFALYLPLVEKLYRNVDCYamvvemqvvm  614
             LLA+ SS DKPAGLT++KY +GFF T+GA L+FALYLP++E +YR V CYAMV+EMQ+VM
Sbjct  158   LLAIGSSHDKPAGLTRSKYLIGFFSTLGAGLMFALYLPIMEAIYRRVYCYAMVLEMQLVM  217

Query  613   eaaATVLATVGMAIDGGFSGMKKESQGGFDLGSK--AYAMTVGLNVLTWQLCFMGTAGMV  440
             EAAATV ATVG+A DGGF  M+ ES G FD G     Y +T+  N++ WQ CF+GTAGMV
Sbjct  218   EAAATVFATVGLAADGGFGDMRVES-GVFDSGGGVVGYWLTIVGNLIVWQFCFVGTAGMV  276

Query  439   FLTTSVTSGICSTALMAFNVVGGVLAYGDHMGGSKAVSTVLCVWGFSSYVYGMYLKTKKV  260
             FLTTS+T GIC TALMA NVV GV+ YGD  GG KAVSTVLCVWGF SY+YGM++K  K 
Sbjct  277   FLTTSLTGGICMTALMAVNVVAGVVVYGDAFGGVKAVSTVLCVWGFCSYLYGMFVKNMKN  336

Query  259   TKEVPPAI  236
               +   ++
Sbjct  337   NNKCDESV  344



>gb|KHN26580.1| Putative purine permease 4 [Glycine soja]
Length=374

 Score =   317 bits (813),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 186/292 (64%), Positives = 233/292 (80%), Gaps = 1/292 (0%)
 Frame = -1

Query  1153  KFYFVHGGSSRWVATWVQCAGFPLLIPAVYLPYYAFNSTERRPFAGFSLRIFSLSVVIGL  974
             K+YF H GSSRWV+TWVQ AGFPLL+  + +PY  F  T+R PF  F+ R+  +S+ IG+
Sbjct  51    KYYFTHKGSSRWVSTWVQTAGFPLLLIPICVPY-LFKFTKRVPFNDFTPRMLIISISIGV  109

Query  973   MLGVNNLLISWGTSYLPVSTCSLVLASQLVFILFLSAIIVRQKITFANLNCvvlltlaav  794
             MLG NNL  SWG SYLPVST +L+L+SQL+F L  S IIV+QKITF+N+NCV+LLTL+++
Sbjct  110   MLGFNNLFFSWGNSYLPVSTSALLLSSQLLFNLLFSVIIVKQKITFSNVNCVILLTLSSI  169

Query  793   llaLDSSSDKPAGLTKAKYFVGFFCTVGAALLFALYLPLVEKLYRNVDCYamvvemqvvm  614
             L+ALDSS ++P GLT+  YF+GFFCT+GA L+FALYLPL+EK+Y+ V+CY MV+EMQV+M
Sbjct  170   LIALDSSHERPKGLTQKNYFIGFFCTIGAGLMFALYLPLMEKIYKKVNCYQMVMEMQVIM  229

Query  613   eaaATVLATVGMAIDGGFSGMKKESQGGFDLGSKAYAMTVGLNVLTWQLCFMGTAGMVFL  434
             E AAT LA VGM  DGGFS MK ESQ  FD GS+ Y +TV  NV+TWQLCFMGTAGMVFL
Sbjct  230   EGAATALAIVGMTWDGGFSEMKVESQMVFDKGSRVYWVTVMGNVVTWQLCFMGTAGMVFL  289

Query  433   TTSVTSGICSTALMAFNVVGGVLAYGDHMGGSKAVSTVLCVWGFSSYVYGMY  278
             T+S+T GIC T L++ NV+GGV+ + D  GG KAVST LC+ GF SYVYG+Y
Sbjct  290   TSSLTGGICMTFLLSMNVLGGVVFFRDAFGGVKAVSTFLCILGFCSYVYGIY  341



>ref|XP_003533498.1| PREDICTED: probable purine permease 4-like [Glycine max]
 gb|KHN26581.1| Putative purine permease 4 [Glycine soja]
Length=401

 Score =   318 bits (815),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 185/292 (63%), Positives = 232/292 (79%), Gaps = 1/292 (0%)
 Frame = -1

Query  1153  KFYFVHGGSSRWVATWVQCAGFPLLIPAVYLPYYAFNSTERRPFAGFSLRIFSLSVVIGL  974
             K+YF H GSSRWV+TWVQ AGFPLL+  + +PY  F  T+R PF  F+ R+  +S+ IG+
Sbjct  78    KYYFTHKGSSRWVSTWVQTAGFPLLMIPICVPYL-FKFTKRVPFTDFTPRMLIISISIGV  136

Query  973   MLGVNNLLISWGTSYLPVSTCSLVLASQLVFILFLSAIIVRQKITFANLNCvvlltlaav  794
             MLG NNL  SWG SYLPVST +L+L+SQL+F L  S IIV+QKITF+N+NCV+LLTL+++
Sbjct  137   MLGFNNLFFSWGNSYLPVSTSALLLSSQLLFNLLFSVIIVKQKITFSNVNCVILLTLSSI  196

Query  793   llaLDSSSDKPAGLTKAKYFVGFFCTVGAALLFALYLPLVEKLYRNVDCYamvvemqvvm  614
             LL LDSS ++P GL +  YF+GFFCT+GA L+FALYLPL+EK+Y+ V+CY MV+EMQV+M
Sbjct  197   LLGLDSSHERPKGLNQKNYFIGFFCTIGAGLMFALYLPLMEKIYKKVNCYQMVMEMQVIM  256

Query  613   eaaATVLATVGMAIDGGFSGMKKESQGGFDLGSKAYAMTVGLNVLTWQLCFMGTAGMVFL  434
             EAAAT LA +GM  DGGFS MK ESQ  FD GS+ Y +TV  NV+TWQLCFMGTAGMVFL
Sbjct  257   EAAATALAIIGMTWDGGFSEMKVESQTVFDKGSRVYWVTVMGNVVTWQLCFMGTAGMVFL  316

Query  433   TTSVTSGICSTALMAFNVVGGVLAYGDHMGGSKAVSTVLCVWGFSSYVYGMY  278
             T+S+T GI  T L++ NV+GGV+ + D  GG KAVST LC+WGF SYVYG+Y
Sbjct  317   TSSLTGGISMTFLLSMNVLGGVVVFRDAFGGVKAVSTFLCIWGFCSYVYGIY  368



>ref|XP_003534852.1| PREDICTED: probable purine permease 4-like [Glycine max]
Length=409

 Score =   318 bits (814),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 186/292 (64%), Positives = 233/292 (80%), Gaps = 1/292 (0%)
 Frame = -1

Query  1153  KFYFVHGGSSRWVATWVQCAGFPLLIPAVYLPYYAFNSTERRPFAGFSLRIFSLSVVIGL  974
             K+YF H GSSRWV+TWVQ AGFPLL+  + +PY  F  T+R PF  F+ R+  +S+ IG+
Sbjct  86    KYYFTHKGSSRWVSTWVQTAGFPLLLIPICVPYL-FKFTKRVPFNDFTPRMLIISISIGV  144

Query  973   MLGVNNLLISWGTSYLPVSTCSLVLASQLVFILFLSAIIVRQKITFANLNCvvlltlaav  794
             MLG NNL  SWG SYLPVST +L+L+SQL+F L  S IIV+QKITF+N+NCV+LLTL+++
Sbjct  145   MLGFNNLFFSWGNSYLPVSTSALLLSSQLLFNLLFSVIIVKQKITFSNVNCVILLTLSSI  204

Query  793   llaLDSSSDKPAGLTKAKYFVGFFCTVGAALLFALYLPLVEKLYRNVDCYamvvemqvvm  614
             L+ALDSS ++P GLT+  YF+GFFCT+GA L+FALYLPL+EK+Y+ V+CY MV+EMQV+M
Sbjct  205   LIALDSSHERPKGLTQKNYFIGFFCTIGAGLMFALYLPLMEKIYKKVNCYQMVMEMQVIM  264

Query  613   eaaATVLATVGMAIDGGFSGMKKESQGGFDLGSKAYAMTVGLNVLTWQLCFMGTAGMVFL  434
             E AAT LA VGM  DGGFS MK ESQ  FD GS+ Y +TV  NV+TWQLCFMGTAGMVFL
Sbjct  265   EGAATALAIVGMTWDGGFSEMKVESQMVFDKGSRVYWVTVMGNVVTWQLCFMGTAGMVFL  324

Query  433   TTSVTSGICSTALMAFNVVGGVLAYGDHMGGSKAVSTVLCVWGFSSYVYGMY  278
             T+S+T GIC T L++ NV+GGV+ + D  GG KAVST LC+ GF SYVYG+Y
Sbjct  325   TSSLTGGICMTFLLSMNVLGGVVFFRDAFGGVKAVSTFLCILGFCSYVYGIY  376



>ref|XP_008383243.1| PREDICTED: probable purine permease 4 [Malus domestica]
Length=423

 Score =   318 bits (815),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 196/296 (66%), Positives = 243/296 (82%), Gaps = 0/296 (0%)
 Frame = -1

Query  1153  KFYFVHGGSSRWVATWVQCAGFPLLIPAVYLPYYAFNSTERRPFAGFSLRIFSLSVVIGL  974
             K+YF+H GSS WV+TWVQC+GFPLL+P +++PYY  + T+R+PF+ F+ +I  LSV+IGL
Sbjct  95    KYYFIHKGSSIWVSTWVQCSGFPLLLPFIFIPYYLLHCTQRKPFSHFTPKILVLSVLIGL  154

Query  973   MLGVNNLLISWGTSYLPVSTCSLVLASQLVFILFLSAIIVRQKITFANLNCvvlltlaav  794
             MLG+NNLL SWG SYLPVST SL+L+SQLVF L LS IIV+QK+TF+NLNCV+LLT+++V
Sbjct  155   MLGLNNLLFSWGNSYLPVSTSSLLLSSQLVFNLILSVIIVKQKVTFSNLNCVILLTVSSV  214

Query  793   llaLDSSSDKPAGLTKAKYFVGFFCTVGAALLFALYLPLVEKLYRNVDCYamvvemqvvm  614
             LLAL S  DKP GLT++KYF+GFF T+GA LLFALYLP++EK+Y  V CYAMV+EMQ+VM
Sbjct  215   LLALGSHHDKPHGLTRSKYFLGFFSTIGAGLLFALYLPVMEKIYSKVYCYAMVIEMQLVM  274

Query  613   eaaATVLATVGMAIDGGFSGMKKESQGGFDLGSKAYAMTVGLNVLTWQLCFMGTAGMVFL  434
             EAAATV A  GMA++GGF  MK ES   +D G   Y +T+  NV+TWQLCFMGTAGMVFL
Sbjct  275   EAAATVFAMAGMALNGGFREMKAESARVYDKGENVYWVTLWCNVVTWQLCFMGTAGMVFL  334

Query  433   TTSVTSGICSTALMAFNVVGGVLAYGDHMGGSKAVSTVLCVWGFSSYVYGMYLKTK  266
             T+S+T GIC TAL+  NV+GGVL YGD  GG KAVST LC WGF SYVYG+Y+K +
Sbjct  335   TSSLTGGICMTALIGMNVLGGVLVYGDSFGGVKAVSTFLCGWGFCSYVYGLYMKAR  390



>ref|XP_003547402.1| PREDICTED: probable purine permease 4-like [Glycine max]
Length=358

 Score =   313 bits (802),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 188/374 (50%), Positives = 262/374 (70%), Gaps = 16/374 (4%)
 Frame = -1

Query  1282  LSSLHTFNHKKQPGKTDTIHYKvllivnyvillvgsvsssllSKFYFVHGGSSRWVATWV  1103
             + ++   +H+ Q   T+   Y+ LL +NYV+L VGSVSSSLL+K+YF H GSS+WV++WV
Sbjct  1     MDNIEHHHHEDQKSMTNK-RYRPLLFLNYVLLFVGSVSSSLLTKYYFNHKGSSKWVSSWV  59

Query  1102  QCAGFPLLIPAVYLPYYAFNSTERRPFAGFSLRIFSLSVVIGLMLGVNNLLISWGTSYLP  923
             QCAGFP L+  ++LP    N TER+PF+ F+ ++   S  +G+MLG NNLL SWG +YLP
Sbjct  60    QCAGFPFLVIPIFLPS-LLNYTERKPFSDFTPKMLWYSFCVGVMLGFNNLLYSWGVAYLP  118

Query  922   VSTCSLVLASQLVFILFLSAIIVRQKITFANLNCvvlltlaavllaLDSSSDKPAGLTKA  743
             +ST  ++L+ QL F L LSAIIV+QKITF+NLN ++L+T+++ +LA +SS +K  GLT+ 
Sbjct  119   ISTSGILLSFQLAFTLILSAIIVKQKITFSNLNSMILITMSSAILAFNSSHEKSEGLTQK  178

Query  742   KYFVGFFCTVGAALLFALYLPLVEKLYRNVDCYamvvemqvvmeaaATVLATVGMAIDGG  563
              Y +GF CT+GA+ LF+LYLPL+E++Y  V CY MV+EMQ++ME AAT L T GM   GG
Sbjct  179   DYIIGFSCTIGASFLFSLYLPLMERIYERVYCYEMVMEMQIIMEIAATALVTGGMVYKGG  238

Query  562   FSGMKKESQGGFDLGSKAYAMTVGLNVLTWQLCFMGTAGMVFLTTSVTSGICSTALMAFN  383
             FS M++E++  FD GS  Y +TV  +V+TWQ C+MGTAG+VFLT+SVT G+ + AL++ N
Sbjct  239   FSEMREEAERVFDKGSTFYWLTVVSSVVTWQCCYMGTAGLVFLTSSVTGGVSANALLSLN  298

Query  382   VVGGVLAYGDHMGGSKAVSTVLCVWGFSSYVYGMYLKTKKVTKEVPPAIGA*SD*TPARR  203
             V+ G   Y D   G K V+TVLC+WGF SYVY MY K ++                 A R
Sbjct  299   VLAGWFVYHDAFNGFKIVATVLCIWGFCSYVYCMYFKRRQE--------------EAAER  344

Query  202   RTATGGSIVEGIVR  161
             R ++GGS  E +V+
Sbjct  345   RNSSGGSTTELVVK  358



>gb|KHN47749.1| Putative purine permease 4 [Glycine soja]
Length=344

 Score =   312 bits (800),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 169/331 (51%), Positives = 233/331 (70%), Gaps = 15/331 (5%)
 Frame = -1

Query  1153  KFYFVHGGSSRWVATWVQCAGFPLLIPAVYLPYYAFNSTERRPFAGFSLRIFSLSVVIGL  974
             K+YF H GSS+WV++WVQCAGFP L+  ++LP    N TER+PF+ F+ ++   S  +G+
Sbjct  29    KYYFNHKGSSKWVSSWVQCAGFPFLVIPIFLPS-LLNYTERKPFSDFTPKMLWYSFCVGV  87

Query  973   MLGVNNLLISWGTSYLPVSTCSLVLASQLVFILFLSAIIVRQKITFANLNCvvlltlaav  794
             MLG NNLL SWG +YLP+ST  ++L+ QL F L LSAIIV+QKITF+NLN ++L+T+++ 
Sbjct  88    MLGFNNLLYSWGVAYLPISTSGILLSFQLAFTLILSAIIVKQKITFSNLNSMILITMSSA  147

Query  793   llaLDSSSDKPAGLTKAKYFVGFFCTVGAALLFALYLPLVEKLYRNVDCYamvvemqvvm  614
             +LA +SS +K  GLT+  Y +GF CT+GA+ LF+LYLPL+E++Y  V CY MV+EMQ++M
Sbjct  148   ILAFNSSHEKSEGLTQKDYIIGFSCTIGASFLFSLYLPLMERIYERVYCYEMVMEMQIIM  207

Query  613   eaaATVLATVGMAIDGGFSGMKKESQGGFDLGSKAYAMTVGLNVLTWQLCFMGTAGMVFL  434
             E AAT L T GM   GGFS M++E++  FD GS  Y +TV  +V+TWQ C+MGTAG+VFL
Sbjct  208   EIAATALVTGGMVYKGGFSEMREEAERVFDKGSTFYWLTVVSSVVTWQCCYMGTAGLVFL  267

Query  433   TTSVTSGICSTALMAFNVVGGVLAYGDHMGGSKAVSTVLCVWGFSSYVYGMYLKTKKVTK  254
             T+SVT G+ + AL++ NV+ G   Y D   G K V+TVLC+WGF SYVY MY K ++   
Sbjct  268   TSSVTGGVSANALLSLNVLAGWFVYHDAFNGFKIVATVLCIWGFCSYVYCMYFKRRQE--  325

Query  253   EVPPAIGA*SD*TPARRRTATGGSIVEGIVR  161
                           A RR ++GGS  E +V+
Sbjct  326   ------------EAAERRNSSGGSTTELVVK  344



>ref|XP_010540621.1| PREDICTED: probable purine permease 4 [Tarenaya hassleriana]
Length=403

 Score =   314 bits (805),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 195/302 (65%), Positives = 237/302 (78%), Gaps = 2/302 (1%)
 Frame = -1

Query  1153  KFYFVHGGSSRWVATWVQCAGFPLLIPAVYLPYYAFNSTERRPFAGFSLRI-FSLSVVIG  977
             KFYFV+GGSSRWV+TWVQ AGFPLL+  +YLPY  F +   R       R     SV +G
Sbjct  59    KFYFVNGGSSRWVSTWVQSAGFPLLLLPIYLPYLLFPTRFTRRPFTRFTRRHLVFSVFVG  118

Query  976   LMLGVNNLLISWGTSYLPVSTCSLVLASQLVFILFLSAIIVRQKITFANLNCvvlltlaa  797
             +MLG NNLL SWGTSYLPVST SL+L++QL+F L LS +IV+QKITF+NLNCVVLLTL++
Sbjct  119   IMLGFNNLLFSWGTSYLPVSTSSLLLSTQLIFTLILSVLIVKQKITFSNLNCVVLLTLSS  178

Query  796   vllaLDSSSDKPAGLTKAKYFVGFFCTVGAALLFALYLPLVEKLYRNVDCYamvvemqvv  617
             VLLAL SS+DKPAGLT++KYF+GF  TVGA LLFALYLP+ EKLYR+V CYAMV+EMQ+V
Sbjct  179   VLLALGSSTDKPAGLTRSKYFIGFISTVGAGLLFALYLPVTEKLYRSVSCYAMVMEMQLV  238

Query  616   meaaATVLATVGMAIDGGFSGMKKESQGGFDLGSKAY-AMTVGLNVLTWQLCFMGTAGMV  440
             ME +ATVLA +GM  DGGF+ M KE+   F  G   Y ++ +G+ V+ WQLCF GTAG+V
Sbjct  239   MEISATVLAMIGMVFDGGFAEMVKEANRVFAKGPVCYWSVAIGVTVVMWQLCFAGTAGLV  298

Query  439   FLTTSVTSGICSTALMAFNVVGGVLAYGDHMGGSKAVSTVLCVWGFSSYVYGMYLKTKKV  260
             +LT+ +T GIC TAL+A NV+GGV+ YGD  GG KAVSTVLCVWGF SYVYG+Y KTK+ 
Sbjct  299   YLTSGITGGICMTALLAMNVIGGVVVYGDEFGGVKAVSTVLCVWGFCSYVYGLYTKTKED  358

Query  259   TK  254
              K
Sbjct  359   EK  360



>gb|KHN47750.1| Putative purine permease 4 [Glycine soja]
Length=404

 Score =   312 bits (799),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 185/305 (61%), Positives = 234/305 (77%), Gaps = 1/305 (0%)
 Frame = -1

Query  1153  KFYFVHGGSSRWVATWVQCAGFPLLIPAVYLPYYAFNSTERRPFAGFSLRIFSLSVVIGL  974
             K+YF H GSSRWV+TWVQ AGFPLL+  + +PY  F  T+R PF  F+ R+  LS+ IG+
Sbjct  82    KYYFTHNGSSRWVSTWVQTAGFPLLMIPICVPYL-FKFTKRVPFTDFTPRMLILSISIGV  140

Query  973   MLGVNNLLISWGTSYLPVSTCSLVLASQLVFILFLSAIIVRQKITFANLNCvvlltlaav  794
             MLG NNL  SWG SYLPVST +L+L+SQL+F L  S IIV+Q+ITF+N+NCV+LLTL+++
Sbjct  141   MLGFNNLFFSWGNSYLPVSTSALLLSSQLLFNLLFSVIIVKQEITFSNVNCVILLTLSSI  200

Query  793   llaLDSSSDKPAGLTKAKYFVGFFCTVGAALLFALYLPLVEKLYRNVDCYamvvemqvvm  614
             LLALDSS ++P GLT+  YF+GFFCT+GA L+FALYLPL+EK+Y+ V+CY MV+E QV+M
Sbjct  201   LLALDSSHERPQGLTQKNYFIGFFCTIGAGLMFALYLPLMEKIYKKVNCYQMVMETQVIM  260

Query  613   eaaATVLATVGMAIDGGFSGMKKESQGGFDLGSKAYAMTVGLNVLTWQLCFMGTAGMVFL  434
             EAAAT LA VGM  DGGFS MK ESQ  FD GS+ Y +TV  NV+TWQLCFMGTAGMVFL
Sbjct  261   EAAATALAIVGMTWDGGFSEMKVESQMVFDKGSRVYWVTVMGNVVTWQLCFMGTAGMVFL  320

Query  433   TTSVTSGICSTALMAFNVVGGVLAYGDHMGGSKAVSTVLCVWGFSSYVYGMYLKTKKVTK  254
             T+S+T GIC T L+  NV+GGV+ + D  GG K VST LC+ GF SY+ G+Y   +    
Sbjct  321   TSSLTGGICMTFLLIMNVLGGVVVFRDAFGGIKVVSTFLCILGFCSYICGIYKYNQMGEH  380

Query  253   EVPPA  239
             ++ P 
Sbjct  381   KLAPT  385



>ref|XP_003547401.1| PREDICTED: probable purine permease 4-like [Glycine max]
Length=404

 Score =   311 bits (798),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 186/305 (61%), Positives = 235/305 (77%), Gaps = 1/305 (0%)
 Frame = -1

Query  1153  KFYFVHGGSSRWVATWVQCAGFPLLIPAVYLPYYAFNSTERRPFAGFSLRIFSLSVVIGL  974
             K+YF H GSSRWV+TWVQ AGFPLL+  + +PY  F  T+R PF  F+ R+  LS+ IG+
Sbjct  82    KYYFTHNGSSRWVSTWVQTAGFPLLMIPICVPYL-FKFTKRVPFTDFTPRMLILSISIGV  140

Query  973   MLGVNNLLISWGTSYLPVSTCSLVLASQLVFILFLSAIIVRQKITFANLNCvvlltlaav  794
             MLG NNL  SWG SYLPVST +L+L+SQL+F L  S IIV+Q+ITF+N+NCV+LLTL+++
Sbjct  141   MLGFNNLFFSWGNSYLPVSTSALLLSSQLLFNLLFSVIIVKQEITFSNVNCVILLTLSSI  200

Query  793   llaLDSSSDKPAGLTKAKYFVGFFCTVGAALLFALYLPLVEKLYRNVDCYamvvemqvvm  614
             LLALDSS ++P GLT+  YF+GFFCT+GA L+FALYLPL+EK+Y+ V+CY MV+EMQV+M
Sbjct  201   LLALDSSHERPQGLTQKNYFIGFFCTIGAGLMFALYLPLMEKIYKKVNCYQMVMEMQVIM  260

Query  613   eaaATVLATVGMAIDGGFSGMKKESQGGFDLGSKAYAMTVGLNVLTWQLCFMGTAGMVFL  434
             EAAAT LA VGM  DGGFS MK ESQ  FD GS+ Y +TV  NV+TWQLCFMGTAGMVFL
Sbjct  261   EAAATALAIVGMTWDGGFSEMKVESQMVFDKGSRVYWVTVMGNVVTWQLCFMGTAGMVFL  320

Query  433   TTSVTSGICSTALMAFNVVGGVLAYGDHMGGSKAVSTVLCVWGFSSYVYGMYLKTKKVTK  254
             T+S+T GIC T L+  NV+GGV+ + D  GG K VST LC+ GF SY+ G+Y   +    
Sbjct  321   TSSLTGGICMTFLLIMNVLGGVVVFRDAFGGIKVVSTFLCILGFCSYICGIYKYNQMGEH  380

Query  253   EVPPA  239
             ++ P 
Sbjct  381   KLAPT  385



>ref|XP_007040977.1| Purine permease 4 [Theobroma cacao]
 gb|EOX96808.1| Purine permease 4 [Theobroma cacao]
Length=380

 Score =   310 bits (793),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 194/301 (64%), Positives = 240/301 (80%), Gaps = 0/301 (0%)
 Frame = -1

Query  1153  KFYFVHGGSSRWVATWVQCAGFPLLIPAVYLPYYAFNSTERRPFAGFSLRIFSLSVVIGL  974
             K+YF H G++RWV+TWVQ AGFPLL   ++LPYY F  T+R+PF+ F+  I  LS+ IGL
Sbjct  50    KYYFNHKGTNRWVSTWVQSAGFPLLFLPIFLPYYLFKCTQRKPFSRFTPGILILSIFIGL  109

Query  973   MLGVNNLLISWGTSYLPVSTCSLVLASQLVFILFLSAIIVRQKITFANLNCvvlltlaav  794
             MLG+NNLL SWG SYLPVST SL+L+SQLVF L LS IIV+Q+ITF NLNCV+LLTL+++
Sbjct  110   MLGLNNLLFSWGNSYLPVSTSSLLLSSQLVFNLILSVIIVKQRITFMNLNCVILLTLSSI  169

Query  793   llaLDSSSDKPAGLTKAKYFVGFFCTVGAALLFALYLPLVEKLYRNVDCYamvvemqvvm  614
             LLAL SS D+P  LT+AKYF+GF  T+GA LLFALYLP++E +Y+ V CYAMV+EMQ+VM
Sbjct  170   LLALGSSHDRPHDLTRAKYFIGFMATIGAGLLFALYLPIMEMVYKKVYCYAMVMEMQLVM  229

Query  613   eaaATVLATVGMAIDGGFSGMKKESQGGFDLGSKAYAMTVGLNVLTWQLCFMGTAGMVFL  434
             E +AT LA+VGMA+DGGF+ MK+ES   FD G   Y  TV  N++TWQLCFMGTAGMVFL
Sbjct  230   EISATALASVGMALDGGFAEMKRESGEVFDKGEGVYWATVMANLVTWQLCFMGTAGMVFL  289

Query  433   TTSVTSGICSTALMAFNVVGGVLAYGDHMGGSKAVSTVLCVWGFSSYVYGMYLKTKKVTK  254
             T S+T GIC TAL+  NV+GGVL YG+  GG KAVSTV+C WGF SYVYGMY+  K++  
Sbjct  290   TCSLTGGICMTALLGMNVLGGVLVYGEDFGGVKAVSTVMCGWGFCSYVYGMYVNNKQLDD  349

Query  253   E  251
             +
Sbjct  350   D  350



>ref|XP_010094635.1| putative purine permease 4 [Morus notabilis]
 gb|EXB56454.1| putative purine permease 4 [Morus notabilis]
Length=421

 Score =   310 bits (793),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 200/301 (66%), Positives = 240/301 (80%), Gaps = 0/301 (0%)
 Frame = -1

Query  1153  KFYFVHGGSSRWVATWVQCAGFPLLIPAVYLPYYAFNSTERRPFAGFSLRIFSLSVVIGL  974
             K+YF+H GSS WV+TWVQ AGFPLL   ++LPYY   ST+R+PF  F+ R+F LS++IGL
Sbjct  85    KYYFIHKGSSIWVSTWVQSAGFPLLFLPIFLPYYLLKSTQRKPFCRFTPRLFLLSLLIGL  144

Query  973   MLGVNNLLISWGTSYLPVSTCSLVLASQLVFILFLSAIIVRQKITFANLNCvvlltlaav  794
             +LG+NNLL SWG SYLPVST SL+L+SQL F L LS IIV+QKITF+NLNCVVLL  ++ 
Sbjct  145   LLGLNNLLFSWGNSYLPVSTSSLLLSSQLAFTLILSVIIVKQKITFSNLNCVVLLVTSSF  204

Query  793   llaLDSSSDKPAGLTKAKYFVGFFCTVGAALLFALYLPLVEKLYRNVDCYamvvemqvvm  614
             LLAL SS DKP GLTK+KYF+GF  TVGA LLFALYLP++E +YR V CYAMVVEMQ++M
Sbjct  205   LLALGSSHDKPQGLTKSKYFLGFASTVGAGLLFALYLPVMEMIYRKVYCYAMVVEMQLLM  264

Query  613   eaaATVLATVGMAIDGGFSGMKKESQGGFDLGSKAYAMTVGLNVLTWQLCFMGTAGMVFL  434
             E AAT LAT+GMA+DGGFS M++ES   FD G   Y   V  NV+TWQLCF+GTAGMVF+
Sbjct  265   EVAATALATIGMAVDGGFSAMREESLRVFDKGPAGYWAAVFSNVVTWQLCFLGTAGMVFM  324

Query  433   TTSVTSGICSTALMAFNVVGGVLAYGDHMGGSKAVSTVLCVWGFSSYVYGMYLKTKKVTK  254
             TTS+T GIC TALMA NV+GGV+ YGD  GG KAVST L +WGF SYVYGMY+K K+   
Sbjct  325   TTSLTGGICMTALMAMNVLGGVVVYGDKFGGVKAVSTALTLWGFCSYVYGMYIKMKEEKN  384

Query  253   E  251
             +
Sbjct  385   D  385



>ref|XP_006468659.1| PREDICTED: probable purine permease 4-like [Citrus sinensis]
 gb|KDO77176.1| hypothetical protein CISIN_1g043611mg [Citrus sinensis]
Length=383

 Score =   305 bits (782),  Expect = 7e-96, Method: Compositional matrix adjust.
 Identities = 198/301 (66%), Positives = 245/301 (81%), Gaps = 0/301 (0%)
 Frame = -1

Query  1153  KFYFVHGGSSRWVATWVQCAGFPLLIPAVYLPYYAFNSTERRPFAGFSLRIFSLSVVIGL  974
             K+YF H GSSRWV+TWVQCAGFPLL+P ++LPYY F  TERRPF+ F+ ++ +LS+++GL
Sbjct  55    KYYFNHKGSSRWVSTWVQCAGFPLLLPPIFLPYYLFKCTERRPFSHFTTKVLTLSILVGL  114

Query  973   MLGVNNLLISWGTSYLPVSTCSLVLASQLVFILFLSAIIVRQKITFANLNCvvlltlaav  794
             +LG+NNLL SWG SYLPVST +L+L+SQL+F L  S IIV+QKITF+NLNCV+LLTL++V
Sbjct  115   LLGLNNLLFSWGNSYLPVSTSALLLSSQLLFNLVFSVIIVKQKITFSNLNCVILLTLSSV  174

Query  793   llaLDSSSDKPAGLTKAKYFVGFFCTVGAALLFALYLPLVEKLYRNVDCYamvvemqvvm  614
             LLAL S  DK   L K+KYF+GFFCTVGA LLFALYLP++E +Y+ V CY+MV+EMQ+VM
Sbjct  175   LLALGSGHDKSPDLPKSKYFIGFFCTVGAGLLFALYLPVMEMIYKKVYCYSMVMEMQLVM  234

Query  613   eaaATVLATVGMAIDGGFSGMKKESQGGFDLGSKAYAMTVGLNVLTWQLCFMGTAGMVFL  434
             E AAT LATVGMA DGG+  MK+E+Q  +D G   Y +T+  NV+TWQLCFMGTAGMVFL
Sbjct  235   EIAATALATVGMASDGGYPEMKREAQTVYDKGPVVYCLTIIGNVVTWQLCFMGTAGMVFL  294

Query  433   TTSVTSGICSTALMAFNVVGGVLAYGDHMGGSKAVSTVLCVWGFSSYVYGMYLKTKKVTK  254
             T+S+T GI  TA++A NV+ GV+ YGD  GG KAVSTVLC WGF SYVYGMY+K K   K
Sbjct  295   TSSLTGGISMTAILAMNVIAGVVVYGDSFGGVKAVSTVLCAWGFCSYVYGMYVKLKLQEK  354

Query  253   E  251
             E
Sbjct  355   E  355



>ref|XP_006448569.1| hypothetical protein CICLE_v10015596mg [Citrus clementina]
 gb|ESR61809.1| hypothetical protein CICLE_v10015596mg [Citrus clementina]
Length=383

 Score =   303 bits (776),  Expect = 6e-95, Method: Compositional matrix adjust.
 Identities = 196/296 (66%), Positives = 243/296 (82%), Gaps = 0/296 (0%)
 Frame = -1

Query  1153  KFYFVHGGSSRWVATWVQCAGFPLLIPAVYLPYYAFNSTERRPFAGFSLRIFSLSVVIGL  974
             K+YF H GSSRWV+TWVQCAGFPLL+P ++LPYY F  TERRPF+ F+ ++ +LS+++GL
Sbjct  55    KYYFNHKGSSRWVSTWVQCAGFPLLLPPIFLPYYLFKCTERRPFSHFTTKVLTLSILVGL  114

Query  973   MLGVNNLLISWGTSYLPVSTCSLVLASQLVFILFLSAIIVRQKITFANLNCvvlltlaav  794
             +LG+NNLL SWG SYLPVST +L+L+SQL+F L  S IIV+QKITF+NLNCV+LLTL++V
Sbjct  115   LLGLNNLLFSWGNSYLPVSTSALLLSSQLLFNLVFSVIIVKQKITFSNLNCVILLTLSSV  174

Query  793   llaLDSSSDKPAGLTKAKYFVGFFCTVGAALLFALYLPLVEKLYRNVDCYamvvemqvvm  614
             LLAL S  DK   L K+KYF+GFFCTVGA LLFALYLP++E +Y+ V CY+MV+EMQ+VM
Sbjct  175   LLALGSGHDKSPDLPKSKYFIGFFCTVGAGLLFALYLPVMEMIYKKVYCYSMVMEMQLVM  234

Query  613   eaaATVLATVGMAIDGGFSGMKKESQGGFDLGSKAYAMTVGLNVLTWQLCFMGTAGMVFL  434
             E AAT LATVGMA DGG+  MK+E+Q  +D G   Y +T+  NV+TWQLCFMGTAGMVFL
Sbjct  235   EIAATALATVGMASDGGYPEMKREAQTVYDKGPVVYCLTIIGNVVTWQLCFMGTAGMVFL  294

Query  433   TTSVTSGICSTALMAFNVVGGVLAYGDHMGGSKAVSTVLCVWGFSSYVYGMYLKTK  266
             T+S+T GI  TA++A NV+ GV+ YGD  GG KAVSTVLC WGF SYVYGMY+K K
Sbjct  295   TSSLTGGISMTAILAMNVIAGVVVYGDSFGGVKAVSTVLCAWGFCSYVYGMYVKLK  350



>ref|XP_010260818.1| PREDICTED: probable purine permease 4 [Nelumbo nucifera]
Length=404

 Score =   300 bits (768),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 191/302 (63%), Positives = 239/302 (79%), Gaps = 1/302 (0%)
 Frame = -1

Query  1153  KFYFVHGGSSRWVATWVQCAGFPLLIPAVYLPYYAFNSTERRPFAGFSLRIFSLSVVIGL  974
             ++YF+HGGSSRWV+TWVQ AGFPLL+  +YL    FN T RRPF+ F+ ++  LSV+IGL
Sbjct  90    RYYFIHGGSSRWVSTWVQSAGFPLLLLLIYL-PRLFNCTYRRPFSLFTPKLLLLSVLIGL  148

Query  973   MLGVNNLLISWGTSYLPVSTCSLVLASQLVFILFLSAIIVRQKITFANLNCvvlltlaav  794
              +G+NN L SWG SYL VST SL+L+SQL F L LS I+V+QK++F N+NCV LLTL+++
Sbjct  149   AMGLNNFLFSWGISYLSVSTSSLLLSSQLAFNLLLSVILVKQKLSFTNVNCVFLLTLSSI  208

Query  793   llaLDSSSDKPAGLTKAKYFVGFFCTVGAALLFALYLPLVEKLYRNVDCYamvvemqvvm  614
             LLAL SS D+P G+TK  YF+GFF  +GA LLFALYLP++E +YR +  Y MV+EMQVVM
Sbjct  209   LLALGSSHDRPEGVTKTHYFLGFFSILGAGLLFALYLPVIEMVYRKIHSYEMVMEMQVVM  268

Query  613   eaaATVLATVGMAIDGGFSGMKKESQGGFDLGSKAYAMTVGLNVLTWQLCFMGTAGMVFL  434
             E AATVLATVGM  +GG+  M+ ES+  FDLG   Y +TVG NV++WQ+CFMGTAG+VFL
Sbjct  269   EIAATVLATVGMVSNGGYEDMRNESRLRFDLGPVGYWLTVGFNVVSWQMCFMGTAGLVFL  328

Query  433   TTSVTSGICSTALMAFNVVGGVLAYGDHMGGSKAVSTVLCVWGFSSYVYGMYLKTKKVTK  254
             TTS+T GIC TAL+  NVVGGVL YGD  GGSKAVSTVLC+WGF SYVYG Y+K K+  +
Sbjct  329   TTSLTGGICMTALLPMNVVGGVLVYGDSFGGSKAVSTVLCLWGFCSYVYGEYVKMKRERE  388

Query  253   EV  248
             E+
Sbjct  389   EL  390



>ref|XP_004293849.1| PREDICTED: probable purine permease 4-like, partial [Fragaria 
vesca subsp. vesca]
Length=336

 Score =   295 bits (754),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 197/297 (66%), Positives = 240/297 (81%), Gaps = 1/297 (0%)
 Frame = -1

Query  1153  KFYFVHGGSSRWVATWVQCAGFPLLIPAVYLPYYAFNSTERRPFAGFSLRIFSLSVVIGL  974
             K+YF+H GS+ W+ATWVQCAGFPLL+P + LPY+    T RRPF  F+ +IFS+S+ +GL
Sbjct  40    KYYFIHKGSNIWLATWVQCAGFPLLLPPILLPYF-LKLTTRRPFTQFTSKIFSISIFVGL  98

Query  973   MLGVNNLLISWGTSYLPVSTCSLVLASQLVFILFLSAIIVRQKITFANLNCvvlltlaav  794
             MLG+NNLL S G S LPVST SL+L+SQLVF L LS +IV+QK+TF+NLNCV+LLT++++
Sbjct  99    MLGLNNLLFSLGNSNLPVSTSSLLLSSQLVFNLILSVLIVKQKVTFSNLNCVILLTVSSI  158

Query  793   llaLDSSSDKPAGLTKAKYFVGFFCTVGAALLFALYLPLVEKLYRNVDCYamvvemqvvm  614
             LLAL SS DKP GLT+ KYFVGFF TVGA LLFALYLP++EK+YR VDCY+M++EMQV M
Sbjct  159   LLALGSSHDKPPGLTRGKYFVGFFSTVGAGLLFALYLPVMEKVYRKVDCYSMMMEMQVAM  218

Query  613   eaaATVLATVGMAIDGGFSGMKKESQGGFDLGSKAYAMTVGLNVLTWQLCFMGTAGMVFL  434
             EAAAT L+TV M  +G F GM +E +  FD G   Y +TV  NV+TWQLCFMGTAGMVFL
Sbjct  219   EAAATALSTVLMVSNGAFGGMVREGREVFDKGETLYWVTVVFNVVTWQLCFMGTAGMVFL  278

Query  433   TTSVTSGICSTALMAFNVVGGVLAYGDHMGGSKAVSTVLCVWGFSSYVYGMYLKTKK  263
             TTS+T GIC TALM  NV+GGV+ YGD  GG K VSTVLCVWGF SYVYG+Y+K K+
Sbjct  279   TTSLTGGICMTALMGINVLGGVVVYGDKFGGVKVVSTVLCVWGFCSYVYGIYIKVKR  335



>ref|XP_009407088.1| PREDICTED: probable purine permease 4 [Musa acuminata subsp. 
malaccensis]
Length=431

 Score =   288 bits (738),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 169/301 (56%), Positives = 221/301 (73%), Gaps = 7/301 (2%)
 Frame = -1

Query  1153  KFYFVHGGSSRWVATWVQCAGFPLLIPAVYLPYYAFNSTERRPFAGFSLRIFSLSVVIGL  974
             +FYFVHGGSSRWV+T VQ AGFPLL+P +Y        + R P   F+ R+    V+IGL
Sbjct  134   RFYFVHGGSSRWVSTLVQSAGFPLLLPLIYF-------SPRPPRTAFTPRLVLYCVLIGL  186

Query  973   MLGVNNLLISWGTSYLPVSTCSLVLASQLVFILFLSAIIVRQKITFANLNCvvlltlaav  794
              LGVNNL ISWG SYLPVST SL+L+SQL   L LS ++VRQ + F NLNCV+LLTL+++
Sbjct  187   FLGVNNLFISWGVSYLPVSTSSLILSSQLAINLLLSVVLVRQPLYFTNLNCVLLLTLSSI  246

Query  793   llaLDSSSDKPAGLTKAKYFVGFFCTVGAALLFALYLPLVEKLYRNVDCYamvvemqvvm  614
             LLAL+ S ++P+G+T ++Y +G   T+GAA++FA+YLP+ + +YR V  +  V+EMQVVM
Sbjct  247   LLALNHSHERPSGVTSSQYIIGVLTTLGAAVMFAVYLPIAQIVYRGVTAFRTVMEMQVVM  306

Query  613   eaaATVLATVGMAIDGGFSGMKKESQGGFDLGSKAYAMTVGLNVLTWQLCFMGTAGMVFL  434
             EA AT  A VGMA  GGF  MK+E+   FDLG   Y +T+G  + +WQLCFMGTAGMVFL
Sbjct  307   EAVATGFALVGMAATGGFKQMKREAAVEFDLGRNRYWVTIGATIASWQLCFMGTAGMVFL  366

Query  433   TTSVTSGICSTALMAFNVVGGVLAYGDHMGGSKAVSTVLCVWGFSSYVYGMYLKTKKVTK  254
             T+S+ SGICSTAL+  NVVGG++ + D  G  KAVSTVLCVWGF+SY+YG + +  +  +
Sbjct  367   TSSLNSGICSTALLVVNVVGGLVVFHDEFGVQKAVSTVLCVWGFASYLYGEHRRKARADE  426

Query  253   E  251
             E
Sbjct  427   E  427



>ref|XP_009622285.1| PREDICTED: probable purine permease 4 [Nicotiana tomentosiformis]
Length=257

 Score =   275 bits (703),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 158/221 (71%), Positives = 185/221 (84%), Gaps = 0/221 (0%)
 Frame = -1

Query  910  SLVLASQLVFILFLSAIIVRQKITFANLNCvvlltlaavllaLDSSSDKPAGLTKAKYFV  731
            SLVL++QL F L  S IIV+QKITFANLNCV+LLT+++VLLAL SS DKP GLTK KYF+
Sbjct  8    SLVLSTQLAFTLITSVIIVKQKITFANLNCVILLTVSSVLLALGSSHDKPRGLTKGKYFI  67

Query  730  GFFCTVGAALLFALYLPLVEKLYRNVDCYamvvemqvvmeaaATVLATVGMAIDGGFSGM  551
            GFF TVGA LLFALYLP++EK+YR V CYAMVVEMQ+VME AAT L+TVGM   GGFS M
Sbjct  68   GFFSTVGAGLLFALYLPIMEKIYRKVYCYAMVVEMQLVMEIAATALSTVGMVAGGGFSEM  127

Query  550  KKESQGGFDLGSKAYAMTVGLNVLTWQLCFMGTAGMVFLTTSVTSGICSTALMAFNVVGG  371
            K ES   FDLG+KAY +TVG NV+TWQLCFMGTAGMVFLTTS+T G+C TALM  NV+GG
Sbjct  128  KTESIKVFDLGAKAYWLTVGFNVVTWQLCFMGTAGMVFLTTSLTGGVCMTALMGINVLGG  187

Query  370  VLAYGDHMGGSKAVSTVLCVWGFSSYVYGMYLKTKKVTKEV  248
            VL YGDH GG KAVST+LC+WGF SY+YG+Y+KTK+   ++
Sbjct  188  VLVYGDHFGGFKAVSTLLCLWGFCSYIYGIYIKTKEEENKI  228



>ref|XP_009622287.1| PREDICTED: probable purine permease 4, partial [Nicotiana tomentosiformis]
Length=256

 Score =   269 bits (687),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 154/219 (70%), Positives = 181/219 (83%), Gaps = 0/219 (0%)
 Frame = -1

Query  895  SQLVFILFLSAIIVRQKITFANLNCvvlltlaavllaLDSSSDKPAGLTKAKYFVGFFCT  716
            +QL F L  S IIV+QKITFANLNCV+LLT+++VLLAL SS DKP GLTK KYF+GFF T
Sbjct  12   TQLAFTLITSVIIVKQKITFANLNCVILLTVSSVLLALGSSHDKPRGLTKGKYFIGFFST  71

Query  715  VGAALLFALYLPLVEKLYRNVDCYamvvemqvvmeaaATVLATVGMAIDGGFSGMKKESQ  536
            VGA LLFALYLP++EK+YR V CYAMVVEMQ+VME AAT L+TVGM   GGFS MK ES 
Sbjct  72   VGAGLLFALYLPIMEKIYRKVYCYAMVVEMQLVMEIAATALSTVGMVAGGGFSEMKTESI  131

Query  535  GGFDLGSKAYAMTVGLNVLTWQLCFMGTAGMVFLTTSVTSGICSTALMAFNVVGGVLAYG  356
              FDLG+KAY +TVG NV+TWQLCFMGTAGMVFLTTS+T G+C TALM  NV+GGVL YG
Sbjct  132  KVFDLGAKAYWLTVGFNVVTWQLCFMGTAGMVFLTTSLTGGVCMTALMGINVLGGVLVYG  191

Query  355  DHMGGSKAVSTVLCVWGFSSYVYGMYLKTKKVTKEVPPA  239
            DH GG KAVST+LC+WGF SY+YG+Y+KTK+   ++  +
Sbjct  192  DHFGGFKAVSTLLCLWGFCSYIYGIYIKTKEEENKIDNS  230



>gb|KDP35091.1| hypothetical protein JCGZ_11000 [Jatropha curcas]
Length=275

 Score =   268 bits (685),  Expect = 8e-83, Method: Compositional matrix adjust.
 Identities = 167/238 (70%), Positives = 199/238 (84%), Gaps = 0/238 (0%)
 Frame = -1

Query  985  VIGLMLGVNNLLISWGTSYLPVSTCSLVLASQLVFILFLSAIIVRQKITFANLNCvvllt  806
            ++GLMLGVNNLL SWG SYLPVST SL+L+SQLVF L LS IIV+QKITF NLNCV+LLT
Sbjct  1    MVGLMLGVNNLLFSWGNSYLPVSTSSLLLSSQLVFNLILSVIIVKQKITFQNLNCVILLT  60

Query  805  laavllaLDSSSDKPAGLTKAKYFVGFFCTVGAALLFALYLPLVEKLYRNVDCYamvvem  626
            L++VLLAL SS D+P GLT++KYF+GFF T+GA LLFALYLP++EK+Y+NV  Y MV+EM
Sbjct  61   LSSVLLALGSSHDRPQGLTRSKYFIGFFSTIGAGLLFALYLPVMEKIYKNVYSYQMVMEM  120

Query  625  qvvmeaaATVLATVGMAIDGGFSGMKKESQGGFDLGSKAYAMTVGLNVLTWQLCFMGTAG  446
            Q++ME +AT LAT GMA  GGFS MK+ES+  FD G K Y +TV  NV TWQLCFMGTAG
Sbjct  121  QLIMEISATALATAGMATGGGFSEMKRESELVFDKGEKWYWVTVFGNVFTWQLCFMGTAG  180

Query  445  MVFLTTSVTSGICSTALMAFNVVGGVLAYGDHMGGSKAVSTVLCVWGFSSYVYGMYLK  272
            +VFLT+S+T GIC TAL+A NV+GGVL YGD  GG+K VST+LC WGF SYVYGMYL+
Sbjct  181  LVFLTSSLTGGICMTALLAMNVLGGVLVYGDEFGGAKVVSTLLCGWGFCSYVYGMYLQ  238



>gb|KCW75587.1| hypothetical protein EUGRSUZ_E04331 [Eucalyptus grandis]
Length=275

 Score =   268 bits (684),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 165/237 (70%), Positives = 197/237 (83%), Gaps = 0/237 (0%)
 Frame = -1

Query  973  MLGVNNLLISWGTSYLPVSTCSLVLASQLVFILFLSAIIVRQKITFANLNCvvlltlaav  794
            MLGVNNLL SWGTSYLPVST SL+L++QL+F L LS +IV+QK+TF+NLNCV+LLTL++V
Sbjct  1    MLGVNNLLFSWGTSYLPVSTSSLLLSTQLLFNLILSVLIVKQKVTFSNLNCVMLLTLSSV  60

Query  793  llaLDSSSDKPAGLTKAKYFVGFFCTVGAALLFALYLPLVEKLYRNVDCYamvvemqvvm  614
            LLAL SS D+P GLT+AKYF+GFF TVGA LLFALYLP++EK+YR V CYAMVVEMQ+VM
Sbjct  61   LLALSSSHDRPPGLTRAKYFIGFFSTVGAGLLFALYLPVMEKIYRKVYCYAMVVEMQLVM  120

Query  613  eaaATVLATVGMAIDGGFSGMKKESQGGFDLGSKAYAMTVGLNVLTWQLCFMGTAGMVFL  434
            E AATVLATVGM  DGGF+ MK+E +  FD G + Y +TV + V  WQ+CFMGTAGMVF+
Sbjct  121  EIAATVLATVGMMADGGFAEMKREGERVFDKGPRVYYVTVAMTVACWQMCFMGTAGMVFM  180

Query  433  TTSVTSGICSTALMAFNVVGGVLAYGDHMGGSKAVSTVLCVWGFSSYVYGMYLKTKK  263
            T+S+T GIC TAL+A NV+GGV+ Y D   G K VSTVLCVWGF SYVYGM+LK  K
Sbjct  181  TSSLTGGICMTALLAMNVLGGVVVYRDDFEGVKIVSTVLCVWGFCSYVYGMHLKNTK  237



>emb|CDP04107.1| unnamed protein product [Coffea canephora]
Length=385

 Score =   269 bits (687),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 172/304 (57%), Positives = 206/304 (68%), Gaps = 42/304 (14%)
 Frame = -1

Query  1153  KFYFVHGGSSRWVATWVQCAGFPLLIPAVYLPYYAFNSTERRPFAGFSLRIFSLSVVIGL  974
             KFYF H G SRWV+TWVQ AGFPLL+  +YLPYY F  T+RRPF+ F+ ++ SLSV+IG 
Sbjct  86    KFYFNHKGGSRWVSTWVQSAGFPLLLLPIYLPYYLFKCTDRRPFSRFTPKLLSLSVIIGF  145

Query  973   MLGVNNLLISWGTSYLPVSTCSLVLASQLVFILFLSAIIVRQKITFANLNCvvlltlaav  794
             +LG+NNLL SWG SYLPVST SL+L+SQL F L L+ IIV+QKITF NLNC         
Sbjct  146   LLGINNLLFSWGNSYLPVSTSSLLLSSQLAFTLILAVIIVKQKITFCNLNC---------  196

Query  793   llaLDSSSDKPAGLTKAKYFVGFFCTVGAALLFALYLPLVEKLYRNVDCYamvvemqvvm  614
                                               + L L  K+YR V CYAMV+EMQ++M
Sbjct  197   ---------------------------------VVLLTLSSKIYRQVYCYAMVMEMQMIM  223

Query  613   eaaATVLATVGMAIDGGFSGMKKESQGGFDLGSKAYAMTVGLNVLTWQLCFMGTAGMVFL  434
             E AAT LAT+GMA DGGFS MK ES   FDLG +AY +TV  N++TWQLCFMGTAGMVFL
Sbjct  224   EIAATALATIGMAADGGFSEMKNESFKVFDLGPRAYWLTVSFNIVTWQLCFMGTAGMVFL  283

Query  433   TTSVTSGICSTALMAFNVVGGVLAYGDHMGGSKAVSTVLCVWGFSSYVYGMYLKTKKVTK  254
             TTS+T GIC TAL++ NV+GGVL Y D   G KAVST+LCVW FSSYVYGMY+K ++  +
Sbjct  284   TTSLTGGICMTALLSMNVLGGVLVYRDQFSGMKAVSTLLCVWAFSSYVYGMYMKMEEEKE  343

Query  253   EVPP  242
              V  
Sbjct  344   RVRE  347



>emb|CBI16952.3| unnamed protein product [Vitis vinifera]
Length=323

 Score =   265 bits (678),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 168/306 (55%), Positives = 200/306 (65%), Gaps = 42/306 (14%)
 Frame = -1

Query  1153  KFYFVHGGSSRWVATWVQCAGFPLLIPAVYLPYYAFNSTERRPFAGFSLRIFSLSVVIGL  974
             KFYF+H GSS WV+TWVQ  GFPLL+  +YLP++ F  T RRPF  F+ ++  LSV IGL
Sbjct  31    KFYFIHKGSSIWVSTWVQSVGFPLLLLLIYLPHHLFKCTRRRPFTSFTPKLLLLSVFIGL  90

Query  973   MLGVNNLLISWGTSYLPVSTCSLVLASQLVFILFLSAIIVRQKITFANLNCvvlltlaav  794
             MLG+NN L SWGTSYLPVST SL+L+SQL F L LS IIV+QKITF+N            
Sbjct  91    MLGLNNFLFSWGTSYLPVSTASLLLSSQLAFNLILSIIIVKQKITFSN------------  138

Query  793   llaLDSSSDKPAGLTKAKYFVGFFCTVGAALLFALYLPLVEKLYRNVDCYamvvemqvvm  614
                                   F C +   L           L   + CY MV+EMQ+VM
Sbjct  139   ----------------------FNCVILLTL--------SSILLALIYCYEMVIEMQLVM  168

Query  613   eaaATVLATVGMAIDGGFSGMKKESQGGFDLGSKAYAMTVGLNVLTWQLCFMGTAGMVFL  434
             E AAT LAT+GMA   GFS MKKES+  FDLG KAY +T+  N++TWQ  FMGTAG+VFL
Sbjct  169   EMAATALATIGMAAGHGFSEMKKESEMVFDLGPKAYWLTLVFNMVTWQFAFMGTAGLVFL  228

Query  433   TTSVTSGICSTALMAFNVVGGVLAYGDHMGGSKAVSTVLCVWGFSSYVYGMYLKTKKVTK  254
             TTS+T GIC TALMA NV+GGVLAYGD +GG K VST+LCVWGF SYVYGMY+K K+  K
Sbjct  229   TTSLTGGICMTALMAANVLGGVLAYGDKLGGGKVVSTLLCVWGFCSYVYGMYVKMKEEEK  288

Query  253   EVPPAI  236
                 +I
Sbjct  289   NNNQSI  294



>ref|XP_006859063.1| hypothetical protein AMTR_s00068p00197770 [Amborella trichopoda]
 gb|ERN20530.1| hypothetical protein AMTR_s00068p00197770 [Amborella trichopoda]
Length=376

 Score =   258 bits (660),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 148/302 (49%), Positives = 214/302 (71%), Gaps = 6/302 (2%)
 Frame = -1

Query  1153  KFYFVHGGSSRWVATWVQCAGFPLLIPAVYLPYYAFNSTERRPFAGFSLRIFSLSVVIGL  974
             +FYF+HGGSSRW++TWVQ  GFPLL+  +YL +   +S   RPF+ F+ ++      +GL
Sbjct  53    RFYFMHGGSSRWLSTWVQSIGFPLLLMPIYLSHLTGHSP--RPFSLFTPKLLYACFGLGL  110

Query  973   MLGVNNLLISWGTSYLPVSTCSLVLASQLVFILFLSAIIVRQKITFANLNCvvlltlaav  794
             ++G+NN L SWG SY+ V+T SL+L++QL F    S ++V+QKI+F ++NC+VLLT +++
Sbjct  111   LIGINNFLYSWGISYISVTTASLLLSTQLAFNAIFSFVLVKQKISFPSMNCIVLLTSSSI  170

Query  793   llaLDSSSDKPAGLTKAKYFVGFFCTVGAALLFALYLPLVEKLYRNVD----CYamvvem  626
             LLAL SS D P G+TK +Y +GF  T+GAA LFA+YLPL+E +Y+ +      YA+V+EM
Sbjct  171   LLALSSSQDMPKGVTKFQYILGFLSTLGAAGLFAIYLPLMEMVYKKLTSIKFTYALVMEM  230

Query  625   qvvmeaaATVLATVGMAIDGGFSGMKKESQGGFDLGSKAYAMTVGLNVLTWQLCFMGTAG  446
             Q+VM  +AT+ AT+GM  DG F  M++E+ G F+LG  +Y +TV   V++WQ CFM T G
Sbjct  231   QLVMSISATLFATIGMVGDGAFREMREEANGKFELGRLSYILTVVGGVISWQFCFMATTG  290

Query  445   MVFLTTSVTSGICSTALMAFNVVGGVLAYGDHMGGSKAVSTVLCVWGFSSYVYGMYLKTK  266
             ++FLTTS+  GIC +AL+   VV G + + D   G K +STVLC+WGF SY+YG   K +
Sbjct  291   LIFLTTSLMCGICMSALLPLIVVAGAVIFKDDFSGEKWISTVLCMWGFFSYLYGERKKNQ  350

Query  265   KV  260
             +V
Sbjct  351   EV  352



>ref|XP_010924628.1| PREDICTED: probable purine permease 4 [Elaeis guineensis]
Length=361

 Score =   256 bits (654),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 176/290 (61%), Positives = 229/290 (79%), Gaps = 7/290 (2%)
 Frame = -1

Query  1153  KFYFVHGGSSRWVATWVQCAGFPLLIPAVYLPYYAFNSTERRPFAGFSLRIFSLSVVIGL  974
             +FYF HGGS+RWVAT VQ AGFPLL+  +YL   + +S+    F  F+ R+F+L + +GL
Sbjct  34    RFYFAHGGSNRWVATLVQSAGFPLLLVPIYLSPSSSSSSSP--FFRFTPRLFALCLFVGL  91

Query  973   MLGVNNLLISWGTSYLPVSTCSLVLASQLVFILFLSAIIVRQKITFANLNCvvlltlaav  794
             +LGVNNLLISWG SYLPVST SL+L+SQL FIL LSA++VRQ +TF+NLNCVVLLTLA+V
Sbjct  92    LLGVNNLLISWGVSYLPVSTSSLILSSQLAFILVLSALLVRQPLTFSNLNCVVLLTLASV  151

Query  793   llaLDSSSDKPAGLTKAKYFVGFFCTVGAALLFALYLPLVEKLYRNVDCYamvvemqvvm  614
             LLA+ S+SD+P G+++ ++F+GF  T+GAA LFALYLP++E +YR VD Y +V+E+QVVM
Sbjct  152   LLAIGSNSDRPPGVSRGRFFLGFAATLGAACLFALYLPIMELVYRKVDGYRLVMEVQVVM  211

Query  613   eaaATVLATVGMAIDGGFSGMKKESQGGFDLGSKAYAMTVGLNVLTWQLCFMGTAGMVFL  434
             + AAT LA VGMA DGG+       +  +DLG   Y +T+   V+TWQ+CFMGTAGMVFL
Sbjct  212   QVAATALAAVGMAADGGW-----RVEESWDLGKAGYWVTIVATVVTWQMCFMGTAGMVFL  266

Query  433   TTSVTSGICSTALMAFNVVGGVLAYGDHMGGSKAVSTVLCVWGFSSYVYG  284
             T+S+ SG+C TAL+A NVVGGV+A+GD  GG KAV+  LC+WGFSSY+YG
Sbjct  267   TSSLHSGVCMTALLAVNVVGGVVAFGDVFGGQKAVALALCLWGFSSYLYG  316



>emb|CBH32558.1| Triose-phosphate Transporter family domain containing protein 
[Triticum aestivum]
 emb|CDM83953.1| unnamed protein product [Triticum aestivum]
Length=366

 Score =   252 bits (643),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 161/306 (53%), Positives = 217/306 (71%), Gaps = 14/306 (5%)
 Frame = -1

Query  1153  KFYFVHGGSSRWVATWVQCAGFPLLIPAVYLPYYAFNST-ERRPFAGFSLRIFSLSVVIG  977
             ++YF HGG  RWVAT VQ  GFP+L+    +P YA     + RPFA F+ R+    VVIG
Sbjct  40    RYYFAHGGRDRWVATLVQSVGFPVLL----VPVYAGRPAGQPRPFAWFTRRLLMACVVIG  95

Query  976   LMLGVNNLLISWGTSYLPVSTCSLVLASQLVFILFLSAIIVRQKITFANLNCvvlltlaa  797
             +++GVNNLL S+ +SYLPVST SL+L++QL F L L+A+IVR  +TF+NLN VVLLTL++
Sbjct  96    VLMGVNNLLFSYSSSYLPVSTSSLLLSTQLAFTLVLAAVIVRHPVTFSNLNAVVLLTLSS  155

Query  796   vllaLDSS--SDKPAGLTKAKYFVGFFCTVGAALLFALYLPLVEKLYRNV--DCYamvve  629
             VLLAL SS  +++P G ++ +YF+GF  T+GAA LFA YLP++E LYR      + MVVE
Sbjct  156   VLLALRSSDSAEQPDGGSRTRYFIGFAVTLGAAGLFAAYLPVMELLYRRAVSGGFRMVVE  215

Query  628   mqvvmeaaATVLATVGMAIDGGFSGMKKESQGGFDLGSKAYAMTVGLNVLTWQLCFMGTA  449
             +QVVM+AAAT LA VG+ + G +S    E    +D    AY + V   V TWQ CFMGTA
Sbjct  216   VQVVMQAAATALAVVGLVVAGRWS----EELARWDKSPAAYWVLVAALVATWQACFMGTA  271

Query  448   GMVFLTTSVTSGICSTALMAFNVVGGVLAYGDHMGGSKAVSTVLCVWGFSSYVYGMYLKT  269
             GMV+LT+S+ SG+C TA++  NV+GGV+ + D  G  KA++TVLC+WGFSSY+YG Y  T
Sbjct  272   GMVYLTSSLHSGVCMTAVLTANVIGGVVVFRDPFGAEKAIATVLCIWGFSSYLYGEY-ST  330

Query  268   KKVTKE  251
             ++  +E
Sbjct  331   RQKQQE  336



>ref|XP_008799578.1| PREDICTED: LOW QUALITY PROTEIN: probable purine permease 4 [Phoenix 
dactylifera]
Length=364

 Score =   251 bits (642),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 170/289 (59%), Positives = 220/289 (76%), Gaps = 10/289 (3%)
 Frame = -1

Query  1153  KFYFVHGGSSRWVATWVQCAGFPLLIPAVYLPYYAFNSTERRPFAGFSLRIFSLSVVIGL  974
             +FYFVHGGS RWVAT VQ AGFPLL+  +YL     + +   PF+ F+ R+F+L V++GL
Sbjct  34    RFYFVHGGSKRWVATLVQSAGFPLLLVPIYL-----SPSSSAPFSRFTPRLFALCVLLGL  88

Query  973   MLGVNNLLISWGTSYLPVSTCSLVLASQLVFILFLSAIIVRQKITFANLNCvvlltlaav  794
             +LGVNNL IS G SYLPVST SL+L+SQL FIL L+A++VRQ +TF+NLNCVVLLTLA++
Sbjct  89    LLGVNNLFISCGQSYLPVSTYSLILSSQLAFILVLTALLVRQPLTFSNLNCVVLLTLASI  148

Query  793   llaLDSSSDKPAGLTKAKYFVGFFCTVGAALLFALYLPLVEKLYRNVDCYamvvemqvvm  614
             LLA  S SD+PAG++ + +F+GF  T+GAA LFA YLP +E +YR VD Y MV+E+QVVM
Sbjct  149   LLATGSDSDRPAGISSSCFFLGFAATLGAAGLFAAYLPAMELVYRKVDGYRMVMEVQVVM  208

Query  613   eaaATVLATVGMAIDGGFSGMKKESQGGFDLGSKAYAMTVGLNVLTWQLCFMGTAGMVFL  434
             EAAA  LA  G+A  G +S  ++     +DLG   Y  T+   V++WQLCFMGTAGMV+L
Sbjct  209   EAAAAALAAAGVAAGGRWSVEER-----WDLGKAGYWATIAATVVSWQLCFMGTAGMVYL  263

Query  433   TTSVTSGICSTALMAFNVVGGVLAYGDHMGGSKAVSTVLCVWGFSSYVY  287
             T+S+ SGIC TAL+A NV+GGV+ +GD  GG KAV+  LC+WGFSSY+Y
Sbjct  264   TSSLNSGICMTALLAVNVLGGVVTFGDMFGGQKAVALALCLWGFSSYLY  312



>gb|EMT13849.1| hypothetical protein F775_18178 [Aegilops tauschii]
Length=369

 Score =   249 bits (636),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 160/306 (52%), Positives = 217/306 (71%), Gaps = 14/306 (5%)
 Frame = -1

Query  1153  KFYFVHGGSSRWVATWVQCAGFPLLIPAVYLPYYAFN-STERRPFAGFSLRIFSLSVVIG  977
             ++YF HGG  RWVAT VQ  GFP+L+    +P YA   + + RPFA F+ R+  + VVIG
Sbjct  40    RYYFAHGGRDRWVATLVQSVGFPVLL----VPVYAGRPAGQPRPFAWFTRRLLMVCVVIG  95

Query  976   LMLGVNNLLISWGTSYLPVSTCSLVLASQLVFILFLSAIIVRQKITFANLNCvvlltlaa  797
             +++GVNNLL S+ +SYLPVST SL+L++QL F L L+A+IVR  +TF+NLN VVLLTL++
Sbjct  96    VLMGVNNLLFSYSSSYLPVSTSSLLLSTQLAFTLVLAAVIVRHPVTFSNLNAVVLLTLSS  155

Query  796   vllaLDSS--SDKPAGLTKAKYFVGFFCTVGAALLFALYLPLVEKLYRNV--DCYamvve  629
             VLLAL SS  +++P G ++ +YF+GF  T+GAA LFA YLP++E LYR      + MVVE
Sbjct  156   VLLALRSSDSAEQPDGGSRTRYFIGFAVTLGAAGLFAAYLPVMELLYRRAVSGGFRMVVE  215

Query  628   mqvvmeaaATVLATVGMAIDGGFSGMKKESQGGFDLGSKAYAMTVGLNVLTWQLCFMGTA  449
             +QVVM+AAAT LA VG+ + G +     E    +D    AY + V   V TWQ CFMGTA
Sbjct  216   VQVVMQAAATALAVVGLVVAGRWG----EELARWDKSPAAYWVLVAALVATWQACFMGTA  271

Query  448   GMVFLTTSVTSGICSTALMAFNVVGGVLAYGDHMGGSKAVSTVLCVWGFSSYVYGMYLKT  269
             GMV+LT+S+ SG+C TA++  NV+GGV+ + D  G  K ++TVLCVWGFSSY+YG Y  T
Sbjct  272   GMVYLTSSLHSGVCMTAVLTANVIGGVVVFRDPFGAEKGIATVLCVWGFSSYLYGEY-ST  330

Query  268   KKVTKE  251
             ++  +E
Sbjct  331   RQKQQE  336



>emb|CAN70704.1| hypothetical protein VITISV_021892 [Vitis vinifera]
Length=638

 Score =   254 bits (650),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 154/235 (66%), Positives = 189/235 (80%), Gaps = 0/235 (0%)
 Frame = -1

Query  1153  KFYFVHGGSSRWVATWVQCAGFPLLIPAVYLPYYAFNSTERRPFAGFSLRIFSLSVVIGL  974
             KFYF+H GSS WV+TWVQ  GFPLL+  +YLP++ F  T+RRPF  F+ ++  LSV IGL
Sbjct  372   KFYFIHKGSSIWVSTWVQSVGFPLLLLLIYLPHHLFKCTQRRPFTSFTPKLLLLSVFIGL  431

Query  973   MLGVNNLLISWGTSYLPVSTCSLVLASQLVFILFLSAIIVRQKITFANLNCvvlltlaav  794
             MLG+NN L SWGTSYLPVST SL+L+SQL F L LS IIV+QKITF+N NCV+LLTL+++
Sbjct  432   MLGLNNFLFSWGTSYLPVSTASLLLSSQLAFNLILSIIIVKQKITFSNFNCVILLTLSSI  491

Query  793   llaLDSSSDKPAGLTKAKYFVGFFCTVGAALLFALYLPLVEKLYRNVDCYamvvemqvvm  614
             LLAL S+ D+P  LT AKYF+GFF T+GA LLFALYLP++E +Y+ V CY MV+EMQ+VM
Sbjct  492   LLALSSNHDRPKDLTHAKYFIGFFSTIGAGLLFALYLPVMEMIYKKVYCYEMVIEMQLVM  551

Query  613   eaaATVLATVGMAIDGGFSGMKKESQGGFDLGSKAYAMTVGLNVLTWQLCFMGTA  449
             E AAT LAT+GMA D GFSGMKKES+  FDLG KAY +T+  N++TWQ  FMGTA
Sbjct  552   EMAATALATIGMAADHGFSGMKKESEMVFDLGPKAYWLTLVFNMVTWQFAFMGTA  606



>ref|NP_001043870.1| Os01g0680200 [Oryza sativa Japonica Group]
 dbj|BAD73487.1| purine permease-like protein [Oryza sativa Japonica Group]
 dbj|BAD73743.1| purine permease-like protein [Oryza sativa Japonica Group]
 dbj|BAF05784.1| Os01g0680200 [Oryza sativa Japonica Group]
 dbj|BAH00704.1| unnamed protein product [Oryza sativa Japonica Group]
Length=387

 Score =   246 bits (629),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 152/304 (50%), Positives = 203/304 (67%), Gaps = 9/304 (3%)
 Frame = -1

Query  1153  KFYFVHGGSSRWVATWVQCAGFPLLIPAVYLPYYAFNS-TERRPFAGFSLRIFSLSVVIG  977
             ++YF HGG +RWVAT VQ  GFP L+    +P YA  S ++ RPFA F+ R+ +  VVIG
Sbjct  56    RYYFAHGGHNRWVATLVQSVGFPFLL----VPVYAGRSPSQPRPFAWFTRRLLAACVVIG  111

Query  976   LMLGVNNLLISWGTSYLPVSTCSLVLASQLVFILFLSAIIVRQKITFANLNCvvlltlaa  797
             +++GVNNLL S+ +SYLPVST SL+L++QL F L L+AIIVR  + F+NLN VVLLTL++
Sbjct  112   VLMGVNNLLFSYSSSYLPVSTSSLLLSTQLAFTLVLAAIIVRHPLNFSNLNAVVLLTLSS  171

Query  796   vllaLDSSS--DKPAGLTKAKYFVGFFCTVGAALLFALYLPLVEKLYRNVDCYamvvemq  623
             VL+AL SS   ++P G ++A+YFVGF  T+GAA LFA YLP++E +YR     +    M 
Sbjct  172   VLIALRSSDSGEQPGGGSRARYFVGFAVTLGAAGLFAAYLPVMELVYRK--AVSGGFRMA  229

Query  622   vvmeaaATVLATVGMAIDGGFSGMKKESQGGFDLGSKAYAMTVGLNVLTWQLCFMGTAGM  443
             V ++      AT         +G  KE    +DL   AY   +   V TWQ C MGTAGM
Sbjct  230   VEVQVIMQAAATALAVAGLAAAGGWKEELARWDLSPAAYWAVLAALVATWQACLMGTAGM  289

Query  442   VFLTTSVTSGICSTALMAFNVVGGVLAYGDHMGGSKAVSTVLCVWGFSSYVYGMYLKTKK  263
             V+LT+S+ SG+C TA++  NV+GGV+ + D  G  KAV+TVLCVWGFSSY+YG Y   KK
Sbjct  290   VYLTSSLHSGVCMTAVLTANVIGGVVVFRDPFGADKAVATVLCVWGFSSYLYGEYTTQKK  349

Query  262   VTKE  251
             V  +
Sbjct  350   VDGD  353



>ref|XP_004969543.1| PREDICTED: probable purine permease 4-like [Setaria italica]
Length=393

 Score =   245 bits (625),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 151/304 (50%), Positives = 208/304 (68%), Gaps = 10/304 (3%)
 Frame = -1

Query  1153  KFYFVHGGSSRWVATWVQCAGFPLLIPAVYLPYYAFN-STERRPFAGFSLRIFSLSVVIG  977
             ++YF HGG +RWVAT VQ  GFP+L+    +P YA   + + RPFA F+ R+ +  VVIG
Sbjct  57    RYYFAHGGHNRWVATLVQSVGFPVLL----VPVYAGRPAAQPRPFAWFTRRLLAACVVIG  112

Query  976   LMLGVNNLLISWGTSYLPVSTCSLVLASQLVFILFLSAIIVRQKITFANLNCvvlltlaa  797
             +++GVNNLL S+ +SYLPVST SL+L++QL F L L+A+IVR  +TF+NLN VVLLTL++
Sbjct  113   VLMGVNNLLFSYSSSYLPVSTSSLLLSTQLAFTLVLAAVIVRHPLTFSNLNAVVLLTLSS  172

Query  796   vllaLDSSS--DKPAGLTKAKYFVGFFCTVGAALLFALYLPLVEKLYRNVDCYamvvemq  623
             VLLAL SS   + P G ++A+YFVGF  T+GAA LFA YLP++E +YR     +    M 
Sbjct  173   VLLALRSSDSGEHPDGGSRARYFVGFAVTLGAAGLFAAYLPVMELVYRR--AVSGGFRMA  230

Query  622   vvmeaaATVLATVGMAIDGGFSGMKKESQGGFDLGSKAYAMTVGLNVLTWQLCFMGTAGM  443
             V ++      AT         +G  +E    +DL   AY + +   V+TWQ CFMGTAGM
Sbjct  231   VEVQVIMQAAATALAVAGLAAAGGWREELARWDLSPAAYWVVLAALVVTWQACFMGTAGM  290

Query  442   VFLTTSVTSGICSTALMAFNVVGGVLAYGDHMGGSKAVSTVLCVWGFSSYVYGMYLKTKK  263
             V+LT+S+ SG+C TA++  NV+GGV+ + D  G  KAV+TVLCVWGFSSY+YG Y +T++
Sbjct  291   VYLTSSLHSGVCMTAVLTANVIGGVVVFRDPFGSEKAVATVLCVWGFSSYLYGEY-RTQQ  349

Query  262   VTKE  251
               +E
Sbjct  350   KAQE  353



>ref|XP_006644522.1| PREDICTED: probable purine permease 4-like [Oryza brachyantha]
Length=395

 Score =   245 bits (625),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 151/300 (50%), Positives = 204/300 (68%), Gaps = 9/300 (3%)
 Frame = -1

Query  1153  KFYFVHGGSSRWVATWVQCAGFPLLIPAVYLPYYAFNS-TERRPFAGFSLRIFSLSVVIG  977
             ++YF HGG +RWVAT VQ  GFP+L+    +P YA  S ++ RPF  F+ R+ +  VVIG
Sbjct  61    RYYFAHGGHNRWVATLVQSVGFPVLL----VPVYAGRSPSQPRPFEWFTRRLLAACVVIG  116

Query  976   LMLGVNNLLISWGTSYLPVSTCSLVLASQLVFILFLSAIIVRQKITFANLNCvvlltlaa  797
             +++GVNNLL S+ +SYLPVST SL+L++QL F L L+A+IVR  + F+NLN VVLLTL++
Sbjct  117   VLMGVNNLLFSYSSSYLPVSTSSLLLSTQLAFTLVLAAVIVRHPLNFSNLNAVVLLTLSS  176

Query  796   vllaLDSSS--DKPAGLTKAKYFVGFFCTVGAALLFALYLPLVEKLYRNVDCYamvvemq  623
             VLLAL SS   ++P G ++A+YFVGF  T+GAA LFA YLP++E +YR     +    M 
Sbjct  177   VLLALRSSDSGERPGGGSRARYFVGFAVTLGAAGLFAAYLPVMELVYRK--AVSGGFRMA  234

Query  622   vvmeaaATVLATVGMAIDGGFSGMKKESQGGFDLGSKAYAMTVGLNVLTWQLCFMGTAGM  443
             V ++      AT         +G  KE    +DL   AY + +   V TWQ CFMGTAGM
Sbjct  235   VEVQVIMQAAATALAVAGLAAAGGWKEELARWDLSPAAYWVVLASLVATWQACFMGTAGM  294

Query  442   VFLTTSVTSGICSTALMAFNVVGGVLAYGDHMGGSKAVSTVLCVWGFSSYVYGMYLKTKK  263
             V+LT+S+ SG+C TA++  NV+GGVL + D  G  KAV+TVLCVWGFSSY+YG Y  T++
Sbjct  295   VYLTSSLHSGVCMTAVLTANVIGGVLVFRDPFGADKAVATVLCVWGFSSYLYGEYNSTQQ  354



>gb|EEE55178.1| hypothetical protein OsJ_03013 [Oryza sativa Japonica Group]
Length=387

 Score =   244 bits (624),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 151/304 (50%), Positives = 202/304 (66%), Gaps = 9/304 (3%)
 Frame = -1

Query  1153  KFYFVHGGSSRWVATWVQCAGFPLLIPAVYLPYYAFNS-TERRPFAGFSLRIFSLSVVIG  977
             ++YF HGG +RWVAT VQ  GFP L+    +P YA  S ++ RPFA F+ R+ +  VVIG
Sbjct  56    RYYFAHGGHNRWVATLVQSVGFPFLL----VPVYAGRSPSQPRPFAWFTRRLLAACVVIG  111

Query  976   LMLGVNNLLISWGTSYLPVSTCSLVLASQLVFILFLSAIIVRQKITFANLNCvvlltlaa  797
             +++GVNNLL S+ +SYLPVST SL+L++QL F L L+AIIVR  + F+NLN VVLLTL++
Sbjct  112   VLMGVNNLLFSYSSSYLPVSTSSLLLSTQLAFTLVLAAIIVRHPLNFSNLNAVVLLTLSS  171

Query  796   vllaLDSSS--DKPAGLTKAKYFVGFFCTVGAALLFALYLPLVEKLYRNVDCYamvvemq  623
             VL+AL SS   ++P G ++A+YFVGF  T+GAA LFA YLP++E +YR     +    M 
Sbjct  172   VLIALRSSDSGEQPGGGSRARYFVGFAVTLGAAGLFAAYLPVMELVYRK--AVSGGFRMA  229

Query  622   vvmeaaATVLATVGMAIDGGFSGMKKESQGGFDLGSKAYAMTVGLNVLTWQLCFMGTAGM  443
             V ++      AT         +G  KE    +DL   AY   +   V TWQ C MGTAGM
Sbjct  230   VEVQVIMQAAATALAVAGLAAAGGWKEELARWDLSPAAYWAVLAALVATWQACLMGTAGM  289

Query  442   VFLTTSVTSGICSTALMAFNVVGGVLAYGDHMGGSKAVSTVLCVWGFSSYVYGMYLKTKK  263
             V+LT+S+ SG+C TA++  NV+GGV+ + D  G  KAV+TVLCVWG SSY+YG Y   KK
Sbjct  290   VYLTSSLHSGVCMTAVLTANVIGGVVVFRDPFGADKAVATVLCVWGLSSYLYGEYTTQKK  349

Query  262   VTKE  251
             V  +
Sbjct  350   VDGD  353



>ref|XP_002456148.1| hypothetical protein SORBIDRAFT_03g031210 [Sorghum bicolor]
 gb|EES01268.1| hypothetical protein SORBIDRAFT_03g031210 [Sorghum bicolor]
Length=391

 Score =   244 bits (623),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 149/303 (49%), Positives = 206/303 (68%), Gaps = 5/303 (2%)
 Frame = -1

Query  1153  KFYFVHGGSSRWVATWVQCAGFPLLIPAVYLPY-YAFNSTERRPFAGFSLRIFSLSVVIG  977
             ++YF HGG  RWVAT VQ  GFP+L+  VY     + + ++ RPFA F+ R+ +  VVIG
Sbjct  56    RYYFAHGGCDRWVATLVQSVGFPVLLVPVYAGRCRSASQSQPRPFAWFTRRLLAACVVIG  115

Query  976   LMLGVNNLLISWGTSYLPVSTCSLVLASQLVFILFLSAIIVRQKITFANLNCvvlltlaa  797
             +++GVNNLL S+ +SYLPVST SL+L++QL F L L+A+IVR  +TF+NLN VVLLTL++
Sbjct  116   VLMGVNNLLFSYSSSYLPVSTSSLLLSTQLAFTLVLAAVIVRHPLTFSNLNAVVLLTLSS  175

Query  796   vllaLDSS--SDKPAGLTKAKYFVGFFCTVGAALLFALYLPLVEKLYRNVDCYamvvemq  623
             VLLAL SS  +++P G ++A+YFVGF  T+GAA LFA YLP++E +YR     +    M 
Sbjct  176   VLLALRSSDSAERPDGGSRARYFVGFAVTLGAAGLFAAYLPVMELVYRR--AVSGGFRMA  233

Query  622   vvmeaaATVLATVGMAIDGGFSGMKKESQGGFDLGSKAYAMTVGLNVLTWQLCFMGTAGM  443
             V ++      AT         +G  +E    +DL   AY   V   V+TWQ CFMGTAGM
Sbjct  234   VEVQVIMQAAATALAVAGLAAAGGWREELARWDLSPAAYWAVVAALVVTWQACFMGTAGM  293

Query  442   VFLTTSVTSGICSTALMAFNVVGGVLAYGDHMGGSKAVSTVLCVWGFSSYVYGMYLKTKK  263
             V+LT+S+ SG+C TA++  NV+GGV+ + D  G  KAV++VLCVWGFSSY+YG Y  T++
Sbjct  294   VYLTSSLHSGVCMTAVLTANVIGGVVVFRDPFGWEKAVASVLCVWGFSSYLYGEYSSTQQ  353

Query  262   VTK  254
               +
Sbjct  354   AQE  356



>ref|XP_003566995.2| PREDICTED: probable purine permease 4 [Brachypodium distachyon]
Length=402

 Score =   243 bits (619),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 165/313 (53%), Positives = 213/313 (68%), Gaps = 15/313 (5%)
 Frame = -1

Query  1153  KFYFVHGGSSRWVATWVQCAGFPLLIPAVYLPYYAFNST---ERRPFAGFSLRIFSLSVV  983
             ++YF HGG  RWVAT VQ  GFP+L+    LP YA   +   + RPF+ FS R+    VV
Sbjct  52    RYYFAHGGHDRWVATLVQSVGFPILL----LPVYACRPSSPDQPRPFSWFSRRLLMACVV  107

Query  982   IGLMLGVNNLLISWGTSYLPVSTCSLVLASQLVFILFLSAIIVRQKITFANLNCvvlltl  803
             IGL++GVNNLL S+ +SYLPVST SL+L++QL F L L+ +IVR   TF+NLN VVLLTL
Sbjct  108   IGLLMGVNNLLFSYSSSYLPVSTSSLLLSTQLAFTLVLAVVIVRHPFTFSNLNAVVLLTL  167

Query  802   aavllaLDSSSDKPAGLTKAKYFVGFFCTVGAALLFALYLPLVEKLYRNV---DCYamvv  632
             ++VLLAL  SSD     ++A YFVGF  T+GAA LFA YLP++E LYR       + MVV
Sbjct  168   SSVLLAL-RSSDSAEQRSRADYFVGFAVTLGAAGLFAAYLPVMELLYRRAVSGGSFRMVV  226

Query  631   emqvvmeaaATVLATVGMAIDGGFSGMKKESQGGFDLGSKAYAMTVGLNVLTWQLCFMGT  452
             E+QVVM+AAAT LA  GM + GG+    +E +  +D  + AY   V   V TWQ CFMGT
Sbjct  227   EVQVVMQAAATALAVAGMVVAGGW----REERARWDRSAAAYWALVAALVATWQACFMGT  282

Query  451   AGMVFLTTSVTSGICSTALMAFNVVGGVLAYGDHMGGSKAVSTVLCVWGFSSYVYGMYLK  272
             AGMV+LT+S+ SG+C TA++  NVVGGV+ + D  G  KAV+TVLCVWGFSSY+YG Y  
Sbjct  283   AGMVYLTSSLHSGVCMTAVLTLNVVGGVVVFRDAFGAEKAVATVLCVWGFSSYLYGEYST  342

Query  271   TKKVTKEVPPAIG  233
              ++  + +    G
Sbjct  343   QQQRQRALQERDG  355



>tpg|DAA58126.1| TPA: hypothetical protein ZEAMMB73_217515 [Zea mays]
Length=396

 Score =   241 bits (616),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 149/300 (50%), Positives = 202/300 (67%), Gaps = 9/300 (3%)
 Frame = -1

Query  1153  KFYFVHGGSSRWVATWVQCAGFPLLIPAVYLPYYAFNS-TERRPFAGFSLRIFSLSVVIG  977
             ++YF HGG  RWVAT VQ  GFP+L+    +P YA  S ++ RPFA F+ R+ +  VVIG
Sbjct  63    RYYFAHGGRDRWVATLVQSVGFPVLL----VPVYAGRSASQPRPFAWFTRRLLAACVVIG  118

Query  976   LMLGVNNLLISWGTSYLPVSTCSLVLASQLVFILFLSAIIVRQKITFANLNCvvlltlaa  797
             +++GVNNLL S+ +SYLPVST SL+L++QL F L L+A+IVR  +TF+NLN VVLLTL++
Sbjct  119   VLMGVNNLLFSYSSSYLPVSTSSLLLSTQLAFTLVLAAVIVRHPLTFSNLNAVVLLTLSS  178

Query  796   vllaLDSSS--DKPAGLTKAKYFVGFFCTVGAALLFALYLPLVEKLYRNVDCYamvvemq  623
             VLLAL SS   ++P G ++A+YF GF  T+GAA LFA YLP++E +YR     +    M 
Sbjct  179   VLLALRSSDSGERPDGGSRARYFAGFAVTLGAAGLFAAYLPVMELVYRR--AVSGGFRMA  236

Query  622   vvmeaaATVLATVGMAIDGGFSGMKKESQGGFDLGSKAYAMTVGLNVLTWQLCFMGTAGM  443
             V ++      AT         +G  +E    +DL   AY   V   V+TWQ CFMGTAGM
Sbjct  237   VEVQVIMQAAATALAVAGLAAAGGWREELARWDLSPAAYWALVAALVVTWQACFMGTAGM  296

Query  442   VFLTTSVTSGICSTALMAFNVVGGVLAYGDHMGGSKAVSTVLCVWGFSSYVYGMYLKTKK  263
             V+LT+S+ SG+C  A++  NV+GGV+ + D  G  KAV+T LCVWGFSSY+YG Y  T++
Sbjct  297   VYLTSSLHSGVCMAAVLTANVIGGVVVFRDPFGWEKAVATALCVWGFSSYLYGEYSSTQQ  356



>emb|CDY02338.1| BnaA09g25640D [Brassica napus]
Length=320

 Score =   236 bits (603),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 136/203 (67%), Positives = 168/203 (83%), Gaps = 1/203 (0%)
 Frame = -1

Query  1153  KFYFVHGGSSRWVATWVQCAGFPLLIPAVYLPYYAFNSTERRPFAGFSLRIFSLSVVIGL  974
             K+YFVHGGSSRWV+TWVQ AGFPLL+  +Y P++ F +T+RRPF  F+ R    SVVIGL
Sbjct  51    KYYFVHGGSSRWVSTWVQSAGFPLLLGLIYFPHFVFKTTKRRPFTRFTHRHLLFSVVIGL  110

Query  973   MLGVNNLLISWGTSYLPVSTCSLVLASQLVFILFLSAIIVRQKITFANLNCvvlltlaav  794
             +LG NN L SWGTSYLPVST SL+L++QL+F L LS IIV+QK+TF+NLNCVVLLTL++V
Sbjct  111   ILGFNNFLFSWGTSYLPVSTSSLLLSTQLIFTLILSVIIVKQKVTFSNLNCVVLLTLSSV  170

Query  793   llaLDSSSDKPAGLTKAKYFVGFFCTVGAALLFALYLPLVEKLYRNVDCYamvvemqvvm  614
             LLAL SS DKPAGLTK KYF+GF  T+GA LLFALYLP+ E++YR+V CYAMV+EMQ+VM
Sbjct  171   LLALGSSQDKPAGLTKTKYFIGFLSTIGAGLLFALYLPVTERVYRSVYCYAMVMEMQLVM  230

Query  613   eaaATVLATVGMAIDG-GFSGMK  548
             E +ATV AT+G+ + G  F G+K
Sbjct  231   EFSATVFATIGVVVYGDAFGGVK  253


 Score = 55.5 bits (132),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 24/33 (73%), Positives = 28/33 (85%), Gaps = 0/33 (0%)
 Frame = -1

Query  373  GVLAYGDHMGGSKAVSTVLCVWGFSSYVYGMYL  275
            GV+ YGD  GG K VSTVLC+WGFSSYVYG+Y+
Sbjct  241  GVVVYGDAFGGVKIVSTVLCIWGFSSYVYGIYV  273



>emb|CDY09527.1| BnaC05g23920D [Brassica napus]
Length=320

 Score =   234 bits (597),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 135/203 (67%), Positives = 168/203 (83%), Gaps = 1/203 (0%)
 Frame = -1

Query  1153  KFYFVHGGSSRWVATWVQCAGFPLLIPAVYLPYYAFNSTERRPFAGFSLRIFSLSVVIGL  974
             K+YFVHGGSSRWV+TWVQ AGFPLL+  +Y P++ F +T+RRPF  F+ R    SVVIGL
Sbjct  51    KYYFVHGGSSRWVSTWVQSAGFPLLLGLIYFPHFVFKTTKRRPFTRFTHRHLLFSVVIGL  110

Query  973   MLGVNNLLISWGTSYLPVSTCSLVLASQLVFILFLSAIIVRQKITFANLNCvvlltlaav  794
             +LG NN L SWGTSYLPVST SL+L++QL+F L LS IIV+QK+TF+NLNCVVLLTL++V
Sbjct  111   ILGFNNFLFSWGTSYLPVSTSSLLLSTQLIFTLILSVIIVKQKVTFSNLNCVVLLTLSSV  170

Query  793   llaLDSSSDKPAGLTKAKYFVGFFCTVGAALLFALYLPLVEKLYRNVDCYamvvemqvvm  614
             LLAL SS DKPAGLTK KYF+GF  T+GA LLFALYLP+ E++YR+V C+AMV+EMQ+VM
Sbjct  171   LLALGSSQDKPAGLTKTKYFIGFLSTIGAGLLFALYLPVTERVYRSVYCFAMVMEMQLVM  230

Query  613   eaaATVLATVGMAIDG-GFSGMK  548
             E +ATV AT+G+ + G  F G+K
Sbjct  231   EFSATVFATIGVVMYGDAFGGVK  253


 Score = 57.4 bits (137),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 25/34 (74%), Positives = 29/34 (85%), Gaps = 0/34 (0%)
 Frame = -1

Query  373  GVLAYGDHMGGSKAVSTVLCVWGFSSYVYGMYLK  272
            GV+ YGD  GG K VSTVLC+WGFSSYVYG+Y+K
Sbjct  241  GVVMYGDAFGGVKIVSTVLCIWGFSSYVYGIYVK  274



>emb|CDY09533.1| BnaC05g23860D [Brassica napus]
Length=320

 Score =   234 bits (597),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 136/203 (67%), Positives = 167/203 (82%), Gaps = 1/203 (0%)
 Frame = -1

Query  1153  KFYFVHGGSSRWVATWVQCAGFPLLIPAVYLPYYAFNSTERRPFAGFSLRIFSLSVVIGL  974
             K+YFVHGGSSRWV+TWVQ AGFPLL+  +Y P + F +T+RRPF  F+ R    SVVIGL
Sbjct  51    KYYFVHGGSSRWVSTWVQSAGFPLLLGLIYFPRFVFRTTKRRPFTRFTHRHLLFSVVIGL  110

Query  973   MLGVNNLLISWGTSYLPVSTCSLVLASQLVFILFLSAIIVRQKITFANLNCvvlltlaav  794
             +LG NN L SWGTSYLPVST SL+L++QL+F L LS IIV+QK+TF+NLNCVVLLTL++V
Sbjct  111   ILGFNNFLFSWGTSYLPVSTSSLLLSTQLIFTLILSVIIVKQKVTFSNLNCVVLLTLSSV  170

Query  793   llaLDSSSDKPAGLTKAKYFVGFFCTVGAALLFALYLPLVEKLYRNVDCYamvvemqvvm  614
             LLAL SS DKPAGLTK KYF+GF  T+GA LLFALYLP+ E++YR+V CYAMV+EMQ+VM
Sbjct  171   LLALGSSQDKPAGLTKTKYFIGFLSTIGAGLLFALYLPVTERVYRSVYCYAMVMEMQLVM  230

Query  613   eaaATVLATVGMAIDG-GFSGMK  548
             E +ATV AT+G+ + G  F G+K
Sbjct  231   EFSATVFATIGVVMYGDAFGGVK  253


 Score = 57.4 bits (137),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 25/34 (74%), Positives = 29/34 (85%), Gaps = 0/34 (0%)
 Frame = -1

Query  373  GVLAYGDHMGGSKAVSTVLCVWGFSSYVYGMYLK  272
            GV+ YGD  GG K VSTVLC+WGFSSYVYG+Y+K
Sbjct  241  GVVMYGDAFGGVKIVSTVLCIWGFSSYVYGIYVK  274



>ref|XP_009416726.1| PREDICTED: probable purine permease 4 [Musa acuminata subsp. 
malaccensis]
Length=376

 Score =   231 bits (588),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 169/298 (57%), Positives = 223/298 (75%), Gaps = 9/298 (3%)
 Frame = -1

Query  1153  KFYFVHGGSSRWVATWVQCAGFPLLIPAVYLPYYAFNSTERRPFAGFSLRIFSLSVVIGL  974
             +FYFVHGGS+RWV+T VQ AGFPLL+P +YL +    S   RPF+ FS R+  LS+ +GL
Sbjct  63    RFYFVHGGSNRWVSTLVQSAGFPLLLPLIYLTH----SPSSRPFSCFSPRLLYLSLFLGL  118

Query  973   MLGVNNLLISWGTSYLPVSTCSLVLASQLVFILFLSAIIVRQKITFANLNCvvlltlaav  794
             +LGVNNLL S G SYLPVST SL+L+SQL F L LSA+++R  +TF+NLNCVVLLTL++V
Sbjct  119   LLGVNNLLFSCGVSYLPVSTSSLLLSSQLGFTLILSALLIRHPLTFSNLNCVVLLTLSSV  178

Query  793   llaLDSSSDKPAGLTKAKYFVGFFCTVGAALLFALYLPLVEKLYRNVDCYamvvemqvvm  614
             LLAL+SS D  AG+ +  +F+GF  T+GAA LFA+YLP+++ +YR V+ Y   VE+Q++M
Sbjct  179   LLALNSSGDHSAGVDRGHFFLGFAATLGAAGLFAVYLPVMQLVYRGVNGYRTAVEVQLLM  238

Query  613   eaaATVLATVGMAIDGGFSGMKKESQGGFDLGSKAYAMTVGLNVLTWQLCFMGTAGMVFL  434
             EA+AT LA  GM   GG+   ++E    +DLG+  Y + VG    +WQLCFMGTAGMVFL
Sbjct  239   EASATALAAAGMVASGGW---RRED--AWDLGAAHYWVVVGTTAASWQLCFMGTAGMVFL  293

Query  433   TTSVTSGICSTALMAFNVVGGVLAYGDHMGGSKAVSTVLCVWGFSSYVYGMYLKTKKV  260
             T+SV SGIC TAL+  NV+GGVL +GD  GGSKAV+ +LC+WGF+SY+YG     ++ 
Sbjct  294   TSSVHSGICMTALLPVNVLGGVLVFGDEFGGSKAVAMLLCLWGFASYLYGTRTNKEET  351



>ref|XP_008656754.1| PREDICTED: probable purine permease 4 [Zea mays]
 gb|AFW83583.1| hypothetical protein ZEAMMB73_686451 [Zea mays]
Length=385

 Score =   231 bits (588),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 148/307 (48%), Positives = 201/307 (65%), Gaps = 7/307 (2%)
 Frame = -1

Query  1153  KFYFVHGGSSRWVATWVQCAGFPLLIPAVYLPYYAFNS---TERRPFAGFSLR--IFSLS  989
             ++YF HGG  RWVAT VQ  GFP+L+  VY    A +S   ++ RPFA  + R  + +  
Sbjct  56    RYYFAHGGCDRWVATLVQSVGFPVLLVPVYAGRPASHSQSQSQPRPFAWLTRRPLLVAAC  115

Query  988   VVIGLMLGVNNLLISWGTSYLPVSTCSLVLASQLVFILFLSAIIVRQKITFANLNCvvll  809
             VVIG+++GVNNLL S+ +SYLPVST SL+L++QL F L L+A IVR  +TF++LN VVLL
Sbjct  116   VVIGVLMGVNNLLFSYSSSYLPVSTSSLLLSTQLAFTLVLAAAIVRHPLTFSSLNAVVLL  175

Query  808   tlaavllaLDSSS-DKPAGLTKAKYFVGFFCTVGAALLFALYLPLVEKLYRNVDCYamvv  632
             TL++VLLAL SSS ++P G ++A Y  G   T+GAA LFA YLP++E +YR        +
Sbjct  176   TLSSVLLALRSSSAERPDGGSRASYLAGLAVTLGAAGLFAAYLPVMELVYRRAVSGGFRM  235

Query  631   emqvvmeaaATVLATVGMAIDGGFSGMKKESQGGFDLGSKAYAMTVGLNVLTWQLCFMGT  452
              ++V +   A   A     +     G + E    +DL   AY   V   V+TWQ CFMGT
Sbjct  236   AVEVQVVMQAAATALAVAGLAAAGGGWRGE-LARWDLSPAAYWAVVAALVVTWQACFMGT  294

Query  451   AGMVFLTTSVTSGICSTALMAFNVVGGVLAYGDHMGGSKAVSTVLCVWGFSSYVYGMYLK  272
             AGMV+LT+S+ SG+C TA++  NV+GGV  + D  G  KAV+TVLCVWGFSSY+YG Y  
Sbjct  295   AGMVYLTSSLHSGVCMTAVLTANVIGGVAVFRDPFGWEKAVATVLCVWGFSSYLYGEYST  354

Query  271   TKKVTKE  251
             T++  +E
Sbjct  355   TQQAQEE  361



>ref|XP_010918723.1| PREDICTED: probable purine permease 4 [Elaeis guineensis]
Length=346

 Score =   229 bits (584),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 169/292 (58%), Positives = 224/292 (77%), Gaps = 10/292 (3%)
 Frame = -1

Query  1153  KFYFVHGGSSRWVATWVQCAGFPLLIPAVYLPYYAFNSTERRPFAGFSLRIFSLSVVIGL  974
             +FYFVH GS  WVAT VQ AGFPLL+  +YL       +   PF+ F+ R+F+L V +GL
Sbjct  34    RFYFVHRGSKLWVATLVQSAGFPLLLVPIYLA-----PSSSPPFSRFTPRLFALCVFLGL  88

Query  973   MLGVNNLLISWGTSYLPVSTCSLVLASQLVFILFLSAIIVRQKITFANLNCvvlltlaav  794
             +LG+NNLLIS G +YLPVST SL+L+SQL FIL L+++++R+ +TF+NLNCVVLLTLA++
Sbjct  89    LLGINNLLISCGQAYLPVSTNSLILSSQLAFILVLTSLLLRRPLTFSNLNCVVLLTLASI  148

Query  793   llaLDSSSDKPAGLTKAKYFVGFFCTVGAALLFALYLPLVEKLYRNVDCYamvvemqvvm  614
             LLA+ S+SD+PAG+++ ++F+GF  T+GAA LFA YLP++E +YR VD Y MV+E+QVVM
Sbjct  149   LLAIGSNSDRPAGVSRGQFFLGFASTLGAAGLFAAYLPIMELVYRKVDGYRMVMEVQVVM  208

Query  613   eaaATVLATVGMAIDGGFSGMKKESQGGFDLGSKAYAMTVGLNVLTWQLCFMGTAGMVFL  434
             EAAA  LA  G+A  G +S  K+     +DLG   Y +T+   V++WQLCFMGTAGMVFL
Sbjct  209   EAAAAALAATGVAAGGRWSVEKR-----WDLGKAGYWVTIAATVVSWQLCFMGTAGMVFL  263

Query  433   TTSVTSGICSTALMAFNVVGGVLAYGDHMGGSKAVSTVLCVWGFSSYVYGMY  278
             T+S+ SGIC TAL+A NVVGGV+A+GD  GG KAV+  LC+WGFSSY+ G Y
Sbjct  264   TSSLNSGICMTALLAVNVVGGVVAFGDMFGGQKAVALALCLWGFSSYLCGEY  315



>ref|XP_004961267.1| PREDICTED: probable purine permease 4-like [Setaria italica]
Length=385

 Score =   230 bits (587),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 137/297 (46%), Positives = 192/297 (65%), Gaps = 4/297 (1%)
 Frame = -1

Query  1153  KFYFVHGGSSRWVATWVQCAGFPLLIPAVYLPYYAFNSTERRPFAGFSLRIFSLSVVIGL  974
             +FYF HGG +RWV T VQ AGFPLL+ AV   +    +   RPF  FS R  ++ +VIG 
Sbjct  65    RFYFAHGGRNRWVVTLVQSAGFPLLVVAVL--FAGRPAAAPRPFTWFSRRFLAVCLVIGA  122

Query  973   MLGVNNLLISWGTSYLPVSTCSLVLASQLVFILFLSAIIVRQKITFANLNCvvlltlaav  794
             ++G NNLL S+ TS+LPVST SL+L++QL F L L+AIIVR  +TF NLN V+LLT+ +V
Sbjct  123   LMGANNLLFSYSTSFLPVSTSSLLLSTQLAFTLVLAAIIVRHPLTFVNLNAVILLTITSV  182

Query  793   llaLDSSSDKPAGLTKAKYFVGFFCTVGAALLFALYLPLVEKLYRNVDCYamvvemqvvm  614
             LLAL  S + P G  ++ Y +G+  T+GAA LFA YLP++E LYR  +  +    + V +
Sbjct  183   LLALRESGESPEGGGRSHYLIGYVVTLGAAGLFAAYLPVMELLYR--EAVSGGFILAVEV  240

Query  613   eaaATVLATVGMAIDGGFSGMKKESQGGFDLGSKAYAMTVGLNVLTWQLCFMGTAGMVFL  434
             +A    +A+V  A      G        ++  +  Y + V   VLTWQ CFMGTAG+++L
Sbjct  241   QAVMQAMASVVAAAGLAAKGGFGGDVARWEGSTALYWVVVLTLVLTWQACFMGTAGVIYL  300

Query  433   TTSVTSGICSTALMAFNVVGGVLAYGDHMGGSKAVSTVLCVWGFSSYVYGMYLKTKK  263
             T+S+ SG+C TA++  NV+GGV+ +GD  G  K ++T LC WG +SY+YG Y K K+
Sbjct  301   TSSLHSGVCMTAVLVANVLGGVVVFGDAFGAEKGIATALCAWGLASYLYGEYTKKKE  357



>ref|XP_002440227.1| hypothetical protein SORBIDRAFT_09g028030 [Sorghum bicolor]
 gb|EES18657.1| hypothetical protein SORBIDRAFT_09g028030 [Sorghum bicolor]
Length=345

 Score =   223 bits (569),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 139/299 (46%), Positives = 198/299 (66%), Gaps = 16/299 (5%)
 Frame = -1

Query  1153  KFYFVHGGSSRWVATWVQCAGFPLLIPAVYLPYYAFNSTERRPFAGFSLRIFSLSVVIGL  974
             ++YF HGG +RW+ T VQ  GFPLL+PAV+       +   RPF  FS +  ++ +VIG 
Sbjct  33    RYYFAHGGQNRWIVTLVQSVGFPLLVPAVFAS--GRPAAAPRPFLWFSRKFLAVCLVIGA  90

Query  973   MLGVNNLLISWGTSYLPVSTCSLVLASQLVFILFLSAIIVRQKITFANLNCvvlltlaav  794
             ++GVNNLL S+ +S+LPVST SL+L++QL F L L+A+IVR  ITF NLN V LLTL++V
Sbjct  91    LMGVNNLLFSYSSSFLPVSTSSLLLSTQLAFTLVLAAVIVRHPITFVNLNAVFLLTLSSV  150

Query  793   llaLDS--SSDKPAGLTKAKYFVGFFCTVGAALLFALYLPLVEKLYRNVDCYamvvemqv  620
             LLAL S  S + P G  +++Y +G+  T+GAA LFA YLP++E LYR     +    + V
Sbjct  151   LLALRSGDSGETPEGGGRSRYVLGYVVTLGAAGLFAAYLPVMELLYRR--AVSGGFILAV  208

Query  619   vmeaaATVLATVGMAIDGGFSGMKKESQGGFDLGSKAYAMTVGLNVLTWQLCFMGTAGMV  440
              ++ A   +ATV +A  GG     ++    ++  +  Y + V   VLTWQ CFMGTAG++
Sbjct  209   EVQVAMQAMATV-VAAGGG-----RDDVARWEGSTALYWVVVLTLVLTWQACFMGTAGVI  262

Query  439   FLTTSVTSGICSTALMAFNVVGGVLAYGDHMGGSKAVSTVLCVWGFSSYVYGMYLKTKK  263
             +LT+S+ SG+C  A++  NV+GGV+ +GD     KAV+T LCVWG +SY+YG Y K K+
Sbjct  263   YLTSSLHSGVCMAAVLTANVLGGVVVFGDE----KAVATALCVWGLASYLYGEYKKKKE  317



>ref|XP_006654764.1| PREDICTED: probable purine permease 4-like [Oryza brachyantha]
Length=368

 Score =   223 bits (568),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 146/296 (49%), Positives = 193/296 (65%), Gaps = 9/296 (3%)
 Frame = -1

Query  1153  KFYFVHGGSSRWVATWVQCAGFPLLIPAVYLPYYAFNSTERRPFAGFSLRIFSLSVVIGL  974
             +FYF+ GG +RWV T VQ AGFPLL+ AV+       +   RPF  FS R  ++ VVIG 
Sbjct  36    RFYFIRGGRNRWVVTLVQSAGFPLLVAAVF-GVGGRPAAAPRPFTWFSRRFLAVCVVIGA  94

Query  973   MLGVNNLLISWGTSYLPVSTCSLVLASQLVFILFLSAIIVRQKITFANLNCvvlltlaav  794
             ++G NNLL S+ TS LPVST SL++++QL F L L+ IIVR   TF NLN VVLLTL++V
Sbjct  95    LMGANNLLFSYSTSLLPVSTSSLLMSTQLAFTLVLAVIIVRHPATFVNLNAVVLLTLSSV  154

Query  793   llaLDS--SSDKPAGLTKAKYFVGFFCTVGAALLFALYLPLVEKLYRNV--DCYamvvem  626
             LLAL S  S + P G     Y +GF  T+GAA LF+ YLP++E LYR      + + VE+
Sbjct  155   LLALRSGDSGETPEGGGGKSYLLGFVVTLGAAGLFSAYLPVMELLYREAVSGGFVLAVEV  214

Query  625   qvvmeaaATVLATVGMAIDGGFSGMKKESQGGFDLGSKAYAMTVGLNVLTWQLCFMGTAG  446
             Q VM+A A+++A VG+A   G +      +G        Y   V   VLTWQ CFMGTAG
Sbjct  215   QAVMQAMASLVAAVGLAASWGVADDVSNWKGS----PAQYWAVVATLVLTWQACFMGTAG  270

Query  445   MVFLTTSVTSGICSTALMAFNVVGGVLAYGDHMGGSKAVSTVLCVWGFSSYVYGMY  278
             +++LT+S+ SG+C  A++  NV+GGV+ +GD  G  KAV+T LC WGFSSY+YG Y
Sbjct  271   VIYLTSSLHSGVCMAAVLTLNVLGGVVVFGDPFGAEKAVATALCAWGFSSYLYGEY  326



>dbj|BAK04769.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=407

 Score =   223 bits (569),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 142/297 (48%), Positives = 196/297 (66%), Gaps = 9/297 (3%)
 Frame = -1

Query  1153  KFYFVHGGSSRWVATWVQCAGFPLLIPAVYLPYYAFNSTERRPFAGFSLRIFSLSVVIGL  974
             +FYF HGG ++WV T VQ AGFP L+ AV+L     ++   RPF  FS R  ++ + IG 
Sbjct  74    RFYFEHGGQNKWVVTLVQSAGFPTLVVAVFLAGRPVSAP--RPFLWFSRRFLAVCLFIGA  131

Query  973   MLGVNNLLISWGTSYLPVSTCSLVLASQLVFILFLSAIIVRQKITFANLNCvvlltlaav  794
             ++GVNNLL ++ +S LPVST SL+L++QL F L L+  IVR  +TF NLN VVL+TL +V
Sbjct  132   LMGVNNLLFAYSSSLLPVSTSSLLLSTQLAFTLVLAVAIVRHPLTFVNLNAVVLMTLCSV  191

Query  793   llaLDSSSDKPAGLTKAKYFVGFFCTVGAALLFALYLPLVEKLYRNVDC--Yamvvemqv  620
             LLAL S  D      +  Y +GF  T+GAA LF+ YLP++E LYR      + + VE+Q 
Sbjct  192   LLALRSG-DAGESPDRKGYILGFVVTLGAAGLFSAYLPVMELLYREAVSGGFILAVEVQA  250

Query  619   vmeaaATVLATVGMAIDGGFSGMKKESQGGFDLGSKAYAMTVGLNVLTWQLCFMGTAGMV  440
             VM+A A+V+A +G+A  GGF       +G   +    Y + V   V+TWQ CFMGTAG++
Sbjct  251   VMQAMASVVAAIGLAATGGFGNDVAHWKGSHAV----YWVVVATLVVTWQACFMGTAGVI  306

Query  439   FLTTSVTSGICSTALMAFNVVGGVLAYGDHMGGSKAVSTVLCVWGFSSYVYGMYLKT  269
             +LT+S+ SG+C  A++  NV+GGV+ +GD  G  KAV+T LCVWG SSY+YG Y K+
Sbjct  307   YLTSSLHSGVCMAAVLTANVIGGVVVFGDPFGAEKAVATTLCVWGLSSYLYGEYTKS  363



>ref|XP_002441494.1| hypothetical protein SORBIDRAFT_09g028020 [Sorghum bicolor]
 gb|EES19924.1| hypothetical protein SORBIDRAFT_09g028020 [Sorghum bicolor]
Length=369

 Score =   222 bits (565),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 149/325 (46%), Positives = 205/325 (63%), Gaps = 7/325 (2%)
 Frame = -1

Query  1153  KFYFVHGGSSRWVATWVQCAGFPLLIPAVYLPYYAFNSTERRPFAGFSLRIFSLSVVIGL  974
             +FYF HGG +RWV T VQ AGFPLL+ AV +      +   RPF  FS R  +  +VIG 
Sbjct  42    RFYFAHGGRNRWVVTLVQSAGFPLLVVAVLVA--RRPAAAPRPFTWFSRRFLTACLVIGA  99

Query  973   MLGVNNLLISWGTSYLPVSTCSLVLASQLVFILFLSAIIVRQKITFANLNCvvlltlaav  794
             ++G NNLL S+ TS+LPVST SL+L++QL F L L+AIIVR  +TF NLN VVLLT+++V
Sbjct  100   LMGANNLLFSYSTSFLPVSTSSLLLSTQLAFTLVLAAIIVRHPLTFVNLNAVVLLTISSV  159

Query  793   llaLDS--SSDKPAGLTKAKYFVGFFCTVGAALLFALYLPLVEKLYRNVDCYamvvemqv  620
             LLAL S  S + P G + A YFVG+  T+GAA LFA YLP++E LYR     +    + V
Sbjct  160   LLALRSGDSGENPEGGSAAHYFVGYVVTLGAAGLFAAYLPVMELLYRK--AVSGGFILAV  217

Query  619   vmeaaATVLATVGMAIDGGFSGMKKESQGGFDLGSKAYAMTVGLNVLTWQLCFMGTAGMV  440
              ++ A   +AT   A+    +G  ++    +   +  Y + V   VLTWQ CFMGTAG++
Sbjct  218   EVQVAMQAMATAVAAVGLAAAGGARDDVARWKGSAALYWVVVLTLVLTWQACFMGTAGVI  277

Query  439   FLTTSVTSGICSTALMAFNVVGGVLAYGDHMGGSKAVSTVLCVWGFSSYVYGMYLKTKKV  260
             +LT+S+ SG+C  A++  NV+GGV+ +GD  G  K ++T LC WG +SY+YG Y K KK 
Sbjct  278   YLTSSLHSGVCMAAVLTANVLGGVVVFGDPFGAEKGIATALCAWGLASYLYGEYTKMKKE  337

Query  259   TKEVPPAIGA*SD*TPARRRTATGG  185
                V     A +D +  +  TA+GG
Sbjct  338   VAAVADTSAADAD-SVRKSLTASGG  361



>ref|XP_009392542.1| PREDICTED: probable purine permease 4 [Musa acuminata subsp. 
malaccensis]
Length=378

 Score =   221 bits (563),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 175/297 (59%), Positives = 220/297 (74%), Gaps = 9/297 (3%)
 Frame = -1

Query  1153  KFYFVHGGSSRWVATWVQCAGFPLLIPAVYLPYYAFNSTERRPFAGFSLRIFSLSVVIGL  974
             +FYFVHGGS+RWV T VQ AGFPLL+    LP Y   S   RPF+GFS R+  +S+++GL
Sbjct  64    RFYFVHGGSNRWVETLVQSAGFPLLL----LPIYLTPSPSSRPFSGFSRRLVYVSLLLGL  119

Query  973   MLGVNNLLISWGTSYLPVSTCSLVLASQLVFILFLSAIIVRQKITFANLNCvvlltlaav  794
             +LGVNNLL S G SYL VST SL+L+SQL F L LSA++VR  +TF++LNCVVLLTL++V
Sbjct  120   LLGVNNLLFSCGVSYLSVSTSSLLLSSQLGFTLLLSALLVRHPLTFSSLNCVVLLTLSSV  179

Query  793   llaLDSSSDKPAGLTKAKYFVGFFCTVGAALLFALYLPLVEKLYRNVDCYamvvemqvvm  614
             LLAL+SS D+P G+ +  +F+GF  T+GAA LFA+YLP+ + +YR V  Y MVVE+Q++M
Sbjct  180   LLALNSSGDRPPGVDRGHFFLGFAATLGAAGLFAVYLPVTQLVYRGVSGYRMVVEVQLLM  239

Query  613   eaaATVLATVGMAIDGGFSGMKKESQGGFDLGSKAYAMTVGLNVLTWQLCFMGTAGMVFL  434
             EAAAT LA  GMA  GG+   +KE  G +DLG   Y   V   V+ WQ CFMGTAGMVFL
Sbjct  240   EAAATALAATGMAASGGW---RKE--GAWDLGGARYWTVVAATVVGWQFCFMGTAGMVFL  294

Query  433   TTSVTSGICSTALMAFNVVGGVLAYGDHMGGSKAVSTVLCVWGFSSYVYGMYLKTKK  263
             T+SV S IC TAL++ NV+GGVL +GD  GG KAV+ VLC+W FSSY+YG Y K K 
Sbjct  295   TSSVNSVICMTALLSVNVLGGVLVFGDEFGGGKAVALVLCLWAFSSYLYGEYKKKKD  351



>gb|AFW79100.1| purine permease [Zea mays]
Length=366

 Score =   217 bits (552),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 146/328 (45%), Positives = 204/328 (62%), Gaps = 10/328 (3%)
 Frame = -1

Query  1153  KFYFVHGGSSRWVATWVQCAGFPLLIPAVYLPYYAFNSTERRPFAGFSLRIFSLSVVIGL  974
             +FYF  GG +RWV T VQ AGFPLL+ AV +      +   RPF  FS R  ++ +VIG 
Sbjct  38    RFYFARGGRNRWVVTLVQSAGFPLLVVAVLVA--GRPAAAPRPFTWFSRRFLTVCLVIGA  95

Query  973   MLGVNNLLISWGTSYLPVSTCSLVLASQLVFILFLSAIIVRQKITFANLNCvvlltlaav  794
             ++G NNLL S+ TS+LPVST SL+L++QL F L L+A+IVR  +TF NLN VVLLT+++V
Sbjct  96    LMGANNLLFSYSTSFLPVSTSSLLLSTQLAFTLVLAAVIVRHPLTFVNLNAVVLLTVSSV  155

Query  793   llaLDS--SSDKP--AGLTKAKYFVGFFCTVGAALLFALYLPLVEKLYRNVDCYamvvem  626
             LLAL S  S + P   G   A YF G+  T+GAA LFA YLP++E LYR     +    +
Sbjct  156   LLALRSGDSGENPDGGGAAAAHYFAGYVVTLGAAGLFAAYLPVMELLYRQ--AVSGGFVL  213

Query  625   qvvmeaaATVLATVGMAIDGGFSGMKKESQGGFDLGSKAYAMTVGLNVLTWQLCFMGTAG  446
              V ++A    +A++  AI     G        +   +  Y + V   VLTWQ CFMGTAG
Sbjct  214   AVEVQAVMQAMASLVAAIGLAAKGGLGGDVARWKGSAALYWVVVSTLVLTWQACFMGTAG  273

Query  445   MVFLTTSVTSGICSTALMAFNVVGGVLAYGDHMGGSKAVSTVLCVWGFSSYVYGMYLKTK  266
             +++LT+S+ SG+C TA++  NV+GGV+ +GD  G  K ++T LC WG +SY+YG Y K K
Sbjct  274   VIYLTSSLHSGVCMTAVLTANVLGGVVVFGDPFGAEKGIATALCAWGLASYLYGEYTKKK  333

Query  265   KVTKEVPPAIGA*SD*TPARRRTATGGS  182
             K  ++   A+   S    + R++ TGG+
Sbjct  334   KEEEDEAVAVADTS--ADSVRKSLTGGA  359



>ref|XP_003565934.1| PREDICTED: probable purine permease 4 [Brachypodium distachyon]
Length=374

 Score =   217 bits (552),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 148/305 (49%), Positives = 203/305 (67%), Gaps = 12/305 (4%)
 Frame = -1

Query  1153  KFYFVHGGSSRWVATWVQCAGFPLLIPAVYL----PYYAFNSTERRPFAGFSLRIFSLSV  986
             + YF   G ++WV T+VQ AGFP+LI AV+L    P  +  +   RPF   S R+  +S+
Sbjct  51    RLYFARKGDNKWVVTFVQSAGFPMLIAAVFLVSSRPGASRPAVAPRPFLWISRRLLCVSL  110

Query  985   VIGLMLGVNNLLISWGTSYLPVSTCSLVLASQLVFILFLSAIIVRQKITFANLNCvvllt  806
             +IG ++GVNNLL ++ TS LPVST SL+L++QL F L L+ +IVR  ITF NLN VVLLT
Sbjct  111   IIGALMGVNNLLFAYSTSLLPVSTSSLILSTQLAFTLVLATLIVRLPITFVNLNAVVLLT  170

Query  805   laavllaLDS--SSDKPAGLTKAKYFVGFFCTVGAALLFALYLPLVEKLYRNV--DCYam  638
             L +VLLAL S  S +  +G  K  Y +G+  T+GAA LF+ YLP++E +YR      + M
Sbjct  171   LCSVLLALRSGDSGENSSGGGKKGYLLGYVVTLGAAGLFSAYLPVMELVYREAVSGGFVM  230

Query  637   vvemqvvmeaaATVLATVGMAIDGGFSGMKKESQGGFDLGSKAYAMTVGLNVLTWQLCFM  458
              VE+Q VM+A AT +A VG+A  GGF    ++    +   +  Y   V   V+TWQ CFM
Sbjct  231   AVEVQAVMQATATAVAGVGLAATGGF----RDDVARWHGPTWVYWAVVATLVVTWQACFM  286

Query  457   GTAGMVFLTTSVTSGICSTALMAFNVVGGVLAYGDHMGGSKAVSTVLCVWGFSSYVYGMY  278
             GTAG+++LT+S+ SG+C  A+++ NV+GGV+ +GD  G  KAV+T LCVWGFSSY+YG Y
Sbjct  287   GTAGVIYLTSSLHSGVCMAAVLSANVIGGVVVFGDPFGAEKAVATALCVWGFSSYLYGEY  346

Query  277   LKTKK  263
              K KK
Sbjct  347   NKCKK  351



>gb|EAY98974.1| hypothetical protein OsI_20932 [Oryza sativa Indica Group]
Length=383

 Score =   217 bits (552),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 142/302 (47%), Positives = 191/302 (63%), Gaps = 15/302 (5%)
 Frame = -1

Query  1153  KFYFVHGGSSRWVATWVQCAGFPLLIPAVYLPYYAFNSTERRPFAGFSLRIFSLSVVIGL  974
             +FYF HGG +RWV T VQ AGFPLL+           ++  RPF   S R  ++ +VIG 
Sbjct  41    RFYFTHGGRNRWVVTLVQSAGFPLLVAGALAG--GRPASAPRPFTWLSRRFLAVCLVIGA  98

Query  973   MLGVNNLLISWGTSYLPVSTCSLVLASQLVFILFLSAIIVRQKITFANLNCvvlltlaav  794
             ++G NNLL ++ TS LPVST SL+L++QL F L L+ +IVR  +TF NLN VVLLTL++V
Sbjct  99    LMGANNLLFAYSTSLLPVSTSSLLLSTQLAFTLVLAVVIVRHPVTFVNLNAVVLLTLSSV  158

Query  793   llaLDSSSDKPAG------LTKAKYFVGFFCTVGAALLFALYLPLVEKLYRNV--DCYam  638
             LLAL S               +  Y VGF  T+GAA LF+ YLP++E +YR      + +
Sbjct  159   LLALRSGDSGETAEGGVGGGGRKNYLVGFVVTLGAAGLFSAYLPVMELVYREAVSGGFVL  218

Query  637   vvemqvvmeaaATVLATVGMAIDGGFSGMKKESQGGFDLGSK--AYAMTVGLNVLTWQLC  464
              VE+Q VM+A A+++A VG+A  GG   +  +  G  D GS    Y   V   VLTWQ C
Sbjct  219   AVEVQAVMQAMASLIAAVGLAASGG---VADDVSGWVDGGSSPAVYWAVVATLVLTWQAC  275

Query  463   FMGTAGMVFLTTSVTSGICSTALMAFNVVGGVLAYGDHMGGSKAVSTVLCVWGFSSYVYG  284
             FMGTAG+++LT+S+ SG+C  A++  NV+GGV  +GD  G  KA++T LC WGFSSY+YG
Sbjct  276   FMGTAGVIYLTSSLHSGVCMAAVLTLNVLGGVAVFGDPFGAEKALATALCAWGFSSYLYG  335

Query  283   MY  278
              Y
Sbjct  336   EY  337



>gb|AAT58711.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAG98947.1| unnamed protein product [Oryza sativa Japonica Group]
Length=383

 Score =   216 bits (551),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 142/302 (47%), Positives = 191/302 (63%), Gaps = 15/302 (5%)
 Frame = -1

Query  1153  KFYFVHGGSSRWVATWVQCAGFPLLIPAVYLPYYAFNSTERRPFAGFSLRIFSLSVVIGL  974
             +FYF HGG +RWV T VQ AGFPLL+           ++  RPF   S R  ++ +VIG 
Sbjct  41    RFYFTHGGRNRWVVTLVQSAGFPLLVAGALAG--GRPASAPRPFTWLSRRFLAVCLVIGA  98

Query  973   MLGVNNLLISWGTSYLPVSTCSLVLASQLVFILFLSAIIVRQKITFANLNCvvlltlaav  794
             ++G NNLL ++ TS LPVST SL+L++QL F L L+ +IVR  +TF NLN VVLLTL++V
Sbjct  99    LMGANNLLFAYSTSLLPVSTSSLLLSTQLAFTLVLAVVIVRHPVTFVNLNAVVLLTLSSV  158

Query  793   llaLDSSSDKPAG------LTKAKYFVGFFCTVGAALLFALYLPLVEKLYRNV--DCYam  638
             LLAL S               +  Y VGF  T+GAA LF+ YLP++E +YR      + +
Sbjct  159   LLALRSGDSGETAEGGVGGGGRKSYLVGFVVTLGAAGLFSAYLPVMELVYREAVSGGFVL  218

Query  637   vvemqvvmeaaATVLATVGMAIDGGFSGMKKESQGGFDLGSK--AYAMTVGLNVLTWQLC  464
              VE+Q VM+A A+++A VG+A  GG   +  +  G  D GS    Y   V   VLTWQ C
Sbjct  219   AVEVQAVMQAMASLIAAVGLAASGG---VADDVSGWVDGGSSPAVYWAVVATLVLTWQAC  275

Query  463   FMGTAGMVFLTTSVTSGICSTALMAFNVVGGVLAYGDHMGGSKAVSTVLCVWGFSSYVYG  284
             FMGTAG+++LT+S+ SG+C  A++  NV+GGV  +GD  G  KA++T LC WGFSSY+YG
Sbjct  276   FMGTAGVIYLTSSLHSGVCMAAVLTLNVLGGVAVFGDPFGAEKALATALCAWGFSSYLYG  335

Query  283   MY  278
              Y
Sbjct  336   EY  337



>ref|NP_001056283.2| Os05g0556800 [Oryza sativa Japonica Group]
 dbj|BAF18197.2| Os05g0556800, partial [Oryza sativa Japonica Group]
Length=394

 Score =   217 bits (552),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 142/302 (47%), Positives = 191/302 (63%), Gaps = 15/302 (5%)
 Frame = -1

Query  1153  KFYFVHGGSSRWVATWVQCAGFPLLIPAVYLPYYAFNSTERRPFAGFSLRIFSLSVVIGL  974
             +FYF HGG +RWV T VQ AGFPLL+           ++  RPF   S R  ++ +VIG 
Sbjct  52    RFYFTHGGRNRWVVTLVQSAGFPLLVAGALAG--GRPASAPRPFTWLSRRFLAVCLVIGA  109

Query  973   MLGVNNLLISWGTSYLPVSTCSLVLASQLVFILFLSAIIVRQKITFANLNCvvlltlaav  794
             ++G NNLL ++ TS LPVST SL+L++QL F L L+ +IVR  +TF NLN VVLLTL++V
Sbjct  110   LMGANNLLFAYSTSLLPVSTSSLLLSTQLAFTLVLAVVIVRHPVTFVNLNAVVLLTLSSV  169

Query  793   llaLDSSSDKPAG------LTKAKYFVGFFCTVGAALLFALYLPLVEKLYRNV--DCYam  638
             LLAL S               +  Y VGF  T+GAA LF+ YLP++E +YR      + +
Sbjct  170   LLALRSGDSGETAEGGVGGGGRKSYLVGFVVTLGAAGLFSAYLPVMELVYREAVSGGFVL  229

Query  637   vvemqvvmeaaATVLATVGMAIDGGFSGMKKESQGGFDLGSK--AYAMTVGLNVLTWQLC  464
              VE+Q VM+A A+++A VG+A  GG   +  +  G  D GS    Y   V   VLTWQ C
Sbjct  230   AVEVQAVMQAMASLIAAVGLAASGG---VADDVSGWVDGGSSPAVYWAVVATLVLTWQAC  286

Query  463   FMGTAGMVFLTTSVTSGICSTALMAFNVVGGVLAYGDHMGGSKAVSTVLCVWGFSSYVYG  284
             FMGTAG+++LT+S+ SG+C  A++  NV+GGV  +GD  G  KA++T LC WGFSSY+YG
Sbjct  287   FMGTAGVIYLTSSLHSGVCMAAVLTLNVLGGVAVFGDPFGAEKALATALCAWGFSSYLYG  346

Query  283   MY  278
              Y
Sbjct  347   EY  348



>ref|XP_009415218.1| PREDICTED: probable purine permease 4 [Musa acuminata subsp. 
malaccensis]
Length=379

 Score =   209 bits (532),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 166/290 (57%), Positives = 213/290 (73%), Gaps = 9/290 (3%)
 Frame = -1

Query  1153  KFYFVHGGSSRWVATWVQCAGFPLLIPAVYLPYYAFNSTERRPFAGFSLRIFSLSVVIGL  974
             ++YFVHGGS+RWV+T VQ AGFP L+    LP    +S   RPF+G + R+  LS+ +GL
Sbjct  64    RYYFVHGGSNRWVSTLVQSAGFPFLL----LPICLASSPSSRPFSGLTPRLLYLSLFVGL  119

Query  973   MLGVNNLLISWGTSYLPVSTCSLVLASQLVFILFLSAIIVRQKITFANLNCvvlltlaav  794
             +LGVNNLL S   SYL VST SL+L+SQL F L LSA++VR  +TF+NLNCVVLLTL++V
Sbjct  120   LLGVNNLLFSCSVSYLSVSTSSLLLSSQLGFTLLLSALLVRHPLTFSNLNCVVLLTLSSV  179

Query  793   llaLDSSSDKPAGLTKAKYFVGFFCTVGAALLFALYLPLVEKLYRNVDCYamvvemqvvm  614
             LLAL+S  D+P G+ +A +F+GF  T+GAA LFA+YLPL++ +YR V  Y MVVE+QV+M
Sbjct  180   LLALNSKHDRPDGVDRAHFFLGFAATLGAAGLFAVYLPLMQLVYREVSGYRMVVEVQVLM  239

Query  613   eaaATVLATVGMAIDGGFSGMKKESQGGFDLGSKAYAMTVGLNVLTWQLCFMGTAGMVFL  434
             EAAAT LA  GM   GG+       +G ++LG   Y + V   V  WQLCF+GTAGMV+L
Sbjct  240   EAAATALAATGMFATGGW-----RREGKWNLGVARYWVVVAATVAAWQLCFLGTAGMVYL  294

Query  433   TTSVTSGICSTALMAFNVVGGVLAYGDHMGGSKAVSTVLCVWGFSSYVYG  284
             T+SV SGIC TAL++ NVVGGVL +GD  GG KAV+  LC+W FSSY+YG
Sbjct  295   TSSVNSGICMTALLSVNVVGGVLVFGDAFGGGKAVAMALCIWSFSSYLYG  344



>ref|XP_004973073.1| PREDICTED: probable purine permease 4-like [Setaria italica]
Length=390

 Score =   203 bits (516),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 153/309 (50%), Positives = 198/309 (64%), Gaps = 16/309 (5%)
 Frame = -1

Query  1153  KFYFVHGGSSRWVATWVQCAGFPLLIPAVYLPYYAFNSTERRPFAGFSLRIFSLSVVIGL  974
             +FYF HGG+ RW+AT VQ AGFP L+    L   A      + F GF+ R+    V++GL
Sbjct  70    RFYFAHGGADRWLATLVQSAGFPFLL----LVLLARPPAMGKMFGGFTPRLVLYCVLLGL  125

Query  973   MLGVNNLLISWGTSYLPVSTCSLVLASQLVFILFLSAIIVRQKITFANLNCvvlltlaav  794
             ++G+NNLL S GTSYLPVST SL+L+ QL F L L+A +VR  ++FAN+N VVLLTL+++
Sbjct  126   VMGLNNLLYSCGTSYLPVSTTSLLLSMQLAFTLVLAAGLVRVPLSFANINAVVLLTLSSL  185

Query  793   lla----------LDSSSDKPAGLTKAKYFVGFFCTVGAALLFALYLPLVEKLYRN--VD  650
             LLA            +++      +   Y +G   T+GAALLFALYLP  E LYR+  V 
Sbjct  186   LLALRHEEVGGGGRRANTGDATATSPDYYLLGVAATLGAALLFALYLPAAELLYRHGGVT  245

Query  649   CYamvvemqvvmeaaATVLATVGMAIDGGFSGMKKESQGGFDLGSKAYAMTVGLNVLTWQ  470
              + MVVE QV+MEA AT ++  GMA+ GG  G     +  +DL   AY   VG  VL+WQ
Sbjct  246   GFRMVVEAQVIMEAVATTVSGAGMAVSGGGKGPWSGVEATWDLSPAAYYAVVGAAVLSWQ  305

Query  469   LCFMGTAGMVFLTTSVTSGICSTALMAFNVVGGVLAYGDHMGGSKAVSTVLCVWGFSSYV  290
             +CF GTAG VFLTTS+  GIC TAL+A NV GGV+ +GD  G  K V+ VLC+W FSSY+
Sbjct  306   MCFFGTAGTVFLTTSLHGGICMTALLAVNVAGGVVVFGDDFGAEKGVAMVLCLWAFSSYI  365

Query  289   YGMYLKTKK  263
             YG Y K  K
Sbjct  366   YGEYKKGGK  374



>gb|EAY75375.1| hypothetical protein OsI_03272 [Oryza sativa Indica Group]
Length=274

 Score =   191 bits (486),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 123/242 (51%), Positives = 162/242 (67%), Gaps = 4/242 (2%)
 Frame = -1

Query  970  LGVNNLLISWGTSYLPVSTCSLVLASQLVFILFLSAIIVRQKITFANLNCvvlltlaavl  791
            +GVNNLL S+ +SYLPVST SL+L++QL F L L+AIIVR  + F+NLN VVLLTL++VL
Sbjct  1    MGVNNLLFSYSSSYLPVSTSSLLLSTQLAFTLVLAAIIVRHPLNFSNLNAVVLLTLSSVL  60

Query  790  laLDSSS--DKPAGLTKAKYFVGFFCTVGAALLFALYLPLVEKLYRNVDCYamvvemqvv  617
            +AL SS   ++P G ++A+YFVGF  T+GAA LFA YLP++E +YR     +    M V 
Sbjct  61   IALRSSDSGEQPGGGSRARYFVGFAVTLGAAGLFAAYLPVMELVYRK--AVSGGFRMAVE  118

Query  616  meaaATVLATVGMAIDGGFSGMKKESQGGFDLGSKAYAMTVGLNVLTWQLCFMGTAGMVF  437
            ++      AT         +G  KE    +DL   AY   +   V TWQ CFMGTAGMV+
Sbjct  119  VQVIMQAAATALAVAGLAAAGGWKEELARWDLSPAAYWAVLAALVATWQACFMGTAGMVY  178

Query  436  LTTSVTSGICSTALMAFNVVGGVLAYGDHMGGSKAVSTVLCVWGFSSYVYGMYLKTKKVT  257
            LT+S+ SG+C TA++  NV+GGV+ + D  G  KAV+TVLCVWGFSSY+YG Y   KKV 
Sbjct  179  LTSSLHSGVCMTAVLTANVIGGVVVFRDPFGADKAVATVLCVWGFSSYLYGEYTTQKKVD  238

Query  256  KE  251
             +
Sbjct  239  GD  240



>ref|NP_001043142.1| Os01g0504100 [Oryza sativa Japonica Group]
 dbj|BAD73108.1| purine permease-like protein [Oryza sativa Japonica Group]
 dbj|BAF05056.1| Os01g0504100 [Oryza sativa Japonica Group]
 dbj|BAG97511.1| unnamed protein product [Oryza sativa Japonica Group]
Length=379

 Score =   192 bits (489),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 156/302 (52%), Positives = 195/302 (65%), Gaps = 9/302 (3%)
 Frame = -1

Query  1153  KFYFVHGGSSRWVATWVQCAGFPLLIPAVYLPYYAFNSTERRPFAGFSLRIFSLSVVIGL  974
             +FYF HGG+ RW+AT VQ AGFP L+    LP         RPFAGF+ R+    V++GL
Sbjct  68    RFYFAHGGADRWLATLVQSAGFPALL----LPLMCARRPASRPFAGFTPRLVMYCVLLGL  123

Query  973   MLGVNNLLISWGTSYLPVSTCSLVLASQLVFILFLSAIIVRQKITFANLNCvvlltlaav  794
             ++G+NNLL S GTSYLPVST +L+L+ QL F L L+A +VR  ++FAN N VVLLTL+++
Sbjct  124   VMGLNNLLYSCGTSYLPVSTTALLLSMQLAFTLALAAALVRVPLSFANFNAVVLLTLSSL  183

Query  793   llaLDSSSDKPA---GLTKAKYFVGFFCTVGAALLFALYLPLVEKLYRN--VDCYamvve  629
             LLAL   +         T   Y VG   T+GAALLFALYLP  E +YR+  V  + MVVE
Sbjct  184   LLALRHGAGGGGGGADATSPDYLVGVAATLGAALLFALYLPAAELVYRHGGVTGFRMVVE  243

Query  628   mqvvmeaaATVLATVGMAIDGGFSGMKKESQGGFDLGSKAYAMTVGLNVLTWQLCFMGTA  449
              QV+MEA AT +   GM    G        +  +DL   AY   VG  VL+WQLCF+GTA
Sbjct  244   AQVIMEAVATAVGAAGMVSSAGGKWPWDGVEATWDLSPAAYYAVVGAAVLSWQLCFLGTA  303

Query  448   GMVFLTTSVTSGICSTALMAFNVVGGVLAYGDHMGGSKAVSTVLCVWGFSSYVYGMYLKT  269
             G VFLTTS+  GIC TAL+A NV GGV+ +GD  G  KAV+ +LC+W FSSYVYG Y K 
Sbjct  304   GTVFLTTSLHGGICMTALLAVNVAGGVVVFGDEFGPEKAVAMLLCLWAFSSYVYGEYKKG  363

Query  268   KK  263
              K
Sbjct  364   DK  365



>ref|XP_003565787.1| PREDICTED: probable purine permease 4 [Brachypodium distachyon]
Length=380

 Score =   189 bits (481),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 144/308 (47%), Positives = 187/308 (61%), Gaps = 25/308 (8%)
 Frame = -1

Query  1153  KFYFVHGGSSRWVATWVQCAGFPLLIPAVYLPYYAFNSTERRPFAGFSLRIFSLSVVIGL  974
             +FYF HGG+ RW+AT VQ AGFP L+  +        +   RPF+GF+ R+    V++GL
Sbjct  63    RFYFAHGGADRWLATLVQSAGFPALLLLLLF------TARARPFSGFTPRLVLCCVLLGL  116

Query  973   MLGVNNLLISWGTSYLPVSTCSLVLASQLVFILFLSAIIVRQKITFANLNCvvlltlaav  794
             ++G+NNLL S GTSYLPVST SL+L+ QL F L L+A +VR  ++FAN+N VVLLTL+++
Sbjct  117   VMGLNNLLYSCGTSYLPVSTTSLLLSMQLAFTLALAAALVRAPLSFANVNAVVLLTLSSL  176

Query  793   llaLDSS--SDKPAGLTK---AKYFVGFFCTVGAALLFALYLPLVEKLYRN---------  656
             LLAL     +D+P   +      Y VG   T+GAALLFALYLP  E +YR          
Sbjct  177   LLALRHHGIADEPTTRSTRGGQDYMVGVAATLGAALLFALYLPAAELVYRRGGVTGFRMV  236

Query  655   VDCYamvvemqvvmeaaATVLATVGMAIDGGFSGMKKESQGGFDLGSKAYAMTVGLNVLT  476
             V+   ++  +     A             GGF       +  ++L   AY   VG  VL+
Sbjct  237   VEAQVIMEAVATAAVAVGAAGTGGEWPWSGGFV-----VEATWELSPGAYYAVVGAAVLS  291

Query  475   WQLCFMGTAGMVFLTTSVTSGICSTALMAFNVVGGVLAYGDHMGGSKAVSTVLCVWGFSS  296
             WQLCF+GTAG VFLTTS+  GIC TAL+A NV  GVL +GD  G  KAV+ VLC+W FSS
Sbjct  292   WQLCFLGTAGTVFLTTSLHGGICMTALLAVNVAAGVLLFGDDFGPEKAVAMVLCLWAFSS  351

Query  295   YVYGMYLK  272
             YVYG Y K
Sbjct  352   YVYGEYKK  359



>gb|EEE64646.1| hypothetical protein OsJ_19500 [Oryza sativa Japonica Group]
Length=366

 Score =   184 bits (468),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 124/261 (48%), Positives = 168/261 (64%), Gaps = 13/261 (5%)
 Frame = -1

Query  1030  RPFAGFSLRIFSLSVVIGLMLGVNNLLISWGTSYLPVSTCSLVLASQLVFILFLSAIIVR  851
             RPF   S R  ++ +VIG ++G NNLL ++ TS LPVST SL+L++QL F L L+ +IVR
Sbjct  63    RPFTWLSRRFLAVCLVIGALMGANNLLFAYSTSLLPVSTSSLLLSTQLAFTLVLAVVIVR  122

Query  850   QKITFANLNCvvlltlaavllaLDSSSDKPAG------LTKAKYFVGFFCTVGAALLFAL  689
               +TF NLN VVLLTL++VLLAL S               +  Y VGF  T+GAA LF+ 
Sbjct  123   HPVTFVNLNAVVLLTLSSVLLALRSGDSGETAEGGVGGGGRKSYLVGFVVTLGAAGLFSA  182

Query  688   YLPLVEKLYRNV--DCYamvvemqvvmeaaATVLATVGMAIDGGFSGMKKESQGGFDLGS  515
             YLP++E +YR      + + VE+Q VM+A A+++A VG+A  GG   +  +  G  D GS
Sbjct  183   YLPVMELVYREAVSGGFVLAVEVQAVMQAMASLIAAVGLAASGG---VADDVSGWVDGGS  239

Query  514   K--AYAMTVGLNVLTWQLCFMGTAGMVFLTTSVTSGICSTALMAFNVVGGVLAYGDHMGG  341
                 Y   V   VLTWQ CFMGTAG+++LT+S+ SG+C  A++  NV+GGV  +GD  G 
Sbjct  240   SPAVYWAVVATLVLTWQACFMGTAGVIYLTSSLHSGVCMAAVLTLNVLGGVAVFGDPFGA  299

Query  340   SKAVSTVLCVWGFSSYVYGMY  278
              KA++T LC WGFSSY+YG Y
Sbjct  300   EKALATALCAWGFSSYLYGEY  320



>gb|ABR16480.1| unknown [Picea sitchensis]
Length=367

 Score =   179 bits (454),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 114/311 (37%), Positives = 189/311 (61%), Gaps = 15/311 (5%)
 Frame = -1

Query  1153  KFYFVHGGSSRWVATWVQCAGFPLLIPAVYLPYYAFNSTERRPFAGFSLRIFSLSVVIGL  974
             ++YF +GG SRW++T +Q  G+P+L+    +P   +   E       + ++  + V +GL
Sbjct  62    RYYFAYGGDSRWISTLLQTVGWPILL----IPLVLYQGKEASKLTPLTPKLVLIYVALGL  117

Query  973   MLGVNNLLISWGTSYLPVSTCSLVLASQLVFILFLSAIIVRQKITFANLNCvvlltlaav  794
             +L  +NLL SWG S++P ST SL+ +SQL F    + +++RQKIT   +N +VLLTL+A+
Sbjct  118   LLAGDNLLYSWGVSFMPASTYSLLCSSQLAFNAVFAFMLIRQKITPYIVNSLVLLTLSAI  177

Query  793   llaLDSSSDKPAGLTKAKYFVGFFCTVGAALLFALYLPLVEKLYRNV---DCYamvvemq  623
             LL + S SD+P G+  AK+ VGF CT+ A+ ++ L LPL++ ++  V   + +A+V+EMQ
Sbjct  178   LLGVHSDSDRPEGVNTAKHIVGFICTIAASAIYGLLLPLMQLVFDRVIKKETFAVVLEMQ  237

Query  622   vvmeaaATVLATVGMAIDGGFSGMKKESQGGFDLGSKAYAMTVGLNVLTWQLCFMGTAGM  443
             +     ATV+  VG+ + G F  +K+E+   F  G  AY MT+  + + WQ+C +G  G+
Sbjct  238   IYTSLVATVVCIVGLFVSGEFRDIKEEAHS-FTRGKVAYYMTLIWSAIGWQVCSVGVVGL  296

Query  442   VFLTTSVTSGICSTALMAFNVVGGVLAYGDHMGGSKAVSTVLCVWGFSSYVYGMYLKTKK  263
             +FL +S+ S + ST  +    +  V  + D M   K +S +L +WGF SY++G Y+ +K 
Sbjct  297   IFLVSSLFSNVISTLALPVVPILSVGFFHDKMDALKIISMLLSIWGFVSYIFGGYVDSK-  355

Query  262   VTKEVPPAIGA  230
                   PA+G+
Sbjct  356   ------PAMGS  360



>gb|EPS65699.1| hypothetical protein M569_09078, partial [Genlisea aurea]
Length=327

 Score =   175 bits (444),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 117/305 (38%), Positives = 180/305 (59%), Gaps = 5/305 (2%)
 Frame = -1

Query  1153  KFYFVHGGSSRWVATWVQCAGFPLLIPAVYLPYYAFNSTERRPFAGF-SLRIFSLSVVIG  977
             + YF+HGGS  W ++W +  G+P++   + + Y    + E        +LR+F  + VIG
Sbjct  20    RLYFIHGGSLVWFSSWQETGGWPVIFVPLVISYLRRLTAEANAAPVLINLRLFLAAAVIG  79

Query  976   LMLGVNNLLISWGTSYLPVSTCSLVLASQLVFILFLSAIIVRQKITFANLNCvvlltlaa  797
             ++ GV+N + ++G   LPVST SLV+A+QL F      +IV+ + T  ++N VVLLT+ A
Sbjct  80    VLTGVDNYIYAFGLEKLPVSTSSLVIATQLAFTALFGFLIVKLRFTAYSINAVVLLTVGA  139

Query  796   vllaLDSSSDKPAGLTKAKYFVGFFCTVGAALLFALYLPLVEKLYRNVD---CYamvvem  626
              +LA+ +S D+PAG ++  Y++GFF T+GAA L+   LPLVE  YR  +    Y +V+E+
Sbjct  140   AVLAISASGDRPAGESRGAYWLGFFLTLGAAALYGFVLPLVELAYRKANLEMTYTLVMEV  199

Query  625   qvvmeaaATVLATVGMAIDGGFSGMKKESQGGFDLGSKAYAMTVGLNVLTWQLCFMGTAG  446
             Q+VM   AT   TVGM  +  F  +++E +  + LGS  Y + V L+ L WQ  F+G  G
Sbjct  200   QLVMCFFATAFCTVGMFFNKEFQKIRREER-EYKLGSATYYVVVVLSCLAWQGFFLGAIG  258

Query  445   MVFLTTSVTSGICSTALMAFNVVGGVLAYGDHMGGSKAVSTVLCVWGFSSYVYGMYLKTK  266
             ++  ++S+ SGI     +  N + GV+ YG+  G  K VS  L +WGF SY YG Y   K
Sbjct  259   VIHYSSSLVSGIIIAITIPVNELLGVIFYGEKFGSQKGVSLGLSLWGFLSYFYGEYKSRK  318

Query  265   KVTKE  251
             K   +
Sbjct  319   KANND  323



>ref|XP_006364706.1| PREDICTED: purine permease 3-like [Solanum tuberosum]
Length=362

 Score =   176 bits (445),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 120/320 (38%), Positives = 186/320 (58%), Gaps = 26/320 (8%)
 Frame = -1

Query  1153  KFYFVHGGSSRWVATWVQCAGFPL-LIPAVYLPYYAFNSTERRPFAGFSL----------  1007
             + YF+ GG   W+++W++  G+P+ LIP   L +  FN   RR F G  L          
Sbjct  34    RLYFLKGGERIWLSSWLETVGWPIVLIP---LSFSYFN--RRREFQGKMLSTIDNNNTKL  88

Query  1006  -----RIFSLSVVIGLMLGVNNLLISWGTSYLPVSTCSLVLASQLVFILFLSAIIVRQKI  842
                  RIF  S+ IG++ G +N L ++G + LPVST +L++ASQL F    + ++V+QK 
Sbjct  89    ILMTPRIFVASIGIGVLTGFDNYLYAYGVAKLPVSTSALLIASQLAFTAAFAFLLVKQKF  148

Query  841   TFANLNCvvlltlaavllaLDSSSDKPAGLTKAKYFVGFFCTVGAALLFALYLPLVEKLY  662
             T  ++N + LLT  AV+LAL +  D+P G +K +Y +GF  T+GAA L+ L LPL E +Y
Sbjct  149   TSYSINSIFLLTFGAVVLALHAKGDRPNGESKKEYVLGFIMTLGAAALYGLILPLFELMY  208

Query  661   RNVD---CYamvvemqvvmeaaATVLATVGMAIDGGFSGMKKESQGGFDLGSKAYAMTVG  491
             +       Y +V+E+Q V    +TV+ T+GM I+  F  M +E++  F+LG   Y + + 
Sbjct  209   KKAKQGITYTLVMEIQAVSCIFSTVVCTIGMIINKDFQAMSREAK-SFELGEARYYIVII  267

Query  490   LNVLTWQLCFMGTAGMVFLTTSVTSGICSTALMAFNVVGGVLAYGDHMGGSKAVSTVLCV  311
              + + WQ  F+G  G+++ ++S+ SGI  T L+    + GV+ YG+     K VS VL +
Sbjct  268   WSAIIWQCFFLGAIGVIYSSSSLVSGILITVLLPITEILGVVFYGEKFTPEKGVSLVLSI  327

Query  310   WGFSSYVYGMYLKTKKVTKE  251
             WGF SY+YG  +K  K  KE
Sbjct  328   WGFISYLYG-DIKASKKKKE  346



>ref|XP_010247465.1| PREDICTED: purine permease 3-like [Nelumbo nucifera]
Length=364

 Score =   175 bits (444),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 111/310 (36%), Positives = 180/310 (58%), Gaps = 18/310 (6%)
 Frame = -1

Query  1153  KFYFVHGGSSRWVATWVQCAGFPLLIPAVYLPYYAFNSTERRPFAGFSLRIFSL------  992
             + Y++HGG+ RW+++ +Q AGF      + L   +      R   G S   F +      
Sbjct  51    RLYYLHGGNRRWLSSLLQSAGF-----PILLIPLSLLYLRHRRHRGVSPSEFFIEPKLLV  105

Query  991   -SVVIGLMLGVNNLLISWGTSYLPVSTCSLVLASQLVFILFLSAIIVRQKITFANLNCvv  815
              S V+GL+LG++N + + G SY+PVST +++ ASQL FI   + +IV+Q+ T  ++N VV
Sbjct  106   SSAVLGLLLGLDNFMYALGLSYIPVSTSAILFASQLAFIAGFARLIVKQRFTPYSINSVV  165

Query  814   lltlaavllaLDSSSDKPAGLTKAKYFVGFFCTVGAALLFALYLPLVE----KLYRNVDC  647
             L+T+ ++ L + S  D+PAG++  +Y  GF  T+G+ALL    LP +E    K  R VD 
Sbjct  166   LMTIGSITLGIHSDGDRPAGVSDGEYLSGFLLTLGSALLIGFILPSIEFAYSKASRAVDL  225

Query  646   YamvvemqvvmeaaATVLATVGMAIDGGFSGMKKESQGGFDLGSKAYAMTVGLNVLTWQL  467
                V++ Q  +   +++L+  GM I+  F  + +E++  ++LG   Y   +  + + WQL
Sbjct  226   -TAVMQFQFNVGLFSSILSATGMLINKDFQEIPREARE-YELGHGMYYFVLSASAIAWQL  283

Query  466   CFMGTAGMVFLTTSVTSGICSTALMAFNVVGGVLAYGDHMGGSKAVSTVLCVWGFSSYVY  287
              F+G  G++F TTS+ +GI S  L+ F  VG V+AY +   G K ++  LC+WGF+SY Y
Sbjct  284   SFVGLLGLIFCTTSLFTGIYSAVLLPFAEVGAVIAYHEKFTGEKGIALALCLWGFTSYFY  343

Query  286   GMYLKTKKVT  257
             G Y K+K  T
Sbjct  344   GEYRKSKVET  353



>ref|XP_010675382.1| PREDICTED: purine permease 3-like [Beta vulgaris subsp. vulgaris]
Length=388

 Score =   176 bits (445),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 112/308 (36%), Positives = 183/308 (59%), Gaps = 10/308 (3%)
 Frame = -1

Query  1153  KFYFVHGGSSRWVATWVQCAGFPLLIPAVYLPYYAFNSTERRPFAGF---SLRIFSLSVV  983
             + Y++HGG S W+++W++  G+P++I  + + Y+    T+  P A         F  + +
Sbjct  72    RLYYIHGGKSIWLSSWLETGGWPVMILPLLVAYFRRRRTD--PEAKLFYIKANTFCYAAI  129

Query  982   IGLMLGVNNLLISWGTSYLPVSTCSLVLASQLVFILFLSAIIVRQKITFANLNCvvlltl  803
             +GL+ G  +   ++G  ++PVST SL+LA+QL F    + I+VRQK T  ++N V LLT 
Sbjct  130   VGLVAGSADYCYAYGVKHIPVSTSSLILATQLAFTAVFAFILVRQKFTAFSVNAVALLTF  189

Query  802   aavllaLDSSSDKPAGLTKAKYFVGFFCTVGAALLFALYLPLVEKLYRNVD----CYamv  635
              A++LAL + +D+PAG +KA+YFVGFF T+ ++ LFAL LP++E  YR V      Y++V
Sbjct  190   GAIVLALHAGNDRPAGESKAQYFVGFFFTLASSALFALMLPMIELTYRRVKHTAVNYSLV  249

Query  634   vemqvvmeaaATVLATVGMAIDGGFSGMKKESQGGFDLGSKAYAMTVGLNVLTWQLCFMG  455
             +E+Q+V+  +AT L TVGM   G + G  +E Q  + LG+  Y + + ++ + WQ  ++G
Sbjct  250   MEIQLVLSFSATALCTVGMLASGDYKGYAREVQ-EYKLGNAMYFVVLIISAIVWQFFYLG  308

Query  454   TAGMVFLTTSVTSGICSTALMAFNVVGGVLAYGDHMGGSKAVSTVLCVWGFSSYVYGMYL  275
              AG+++  +S+ SGI     +    +  +  Y +     K VS VL +WGF SY YG   
Sbjct  309   AAGVIYYGSSLLSGIIIAVALPITEIAAIFFYHEKFQVEKGVSLVLSLWGFFSYFYGEAK  368

Query  274   KTKKVTKE  251
             + KK  K 
Sbjct  369   EMKKQKKR  376



>ref|XP_008219366.1| PREDICTED: purine permease 3-like [Prunus mume]
Length=368

 Score =   174 bits (442),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 113/306 (37%), Positives = 179/306 (58%), Gaps = 6/306 (2%)
 Frame = -1

Query  1153  KFYFVHGGSSRWVATWVQCAGFPLLIPAVYLPYYAFNSTERRPFAGF--SLRIFSLSVVI  980
             + YF+HGG+  W+++W++  G+P++   + L YY   +TE      F   L +F  S VI
Sbjct  37    RLYFIHGGNRVWLSSWLETGGWPIIFIPIALAYYHRRTTEGPSTKLFFMKLPLFIASAVI  96

Query  979   GLMLGVNNLLISWGTSYLPVSTCSLVLASQLVFILFLSAIIVRQKITFANLNCvvlltla  800
             GL+ G+++ L ++G + LPVST +L++A+QL F    + ++V+QK T  + N VVLLT+ 
Sbjct  97    GLITGLDDYLYAYGVARLPVSTSALIIAAQLAFTALFAFLLVKQKFTSYSTNAVVLLTIG  156

Query  799   avllaLDSSSDKPAGLTKAKYFVGFFCTVGAALLFALYLPLVEKLYRNVD---CYamvve  629
             A +L L++S+D+P G +  +Y  GF  TV AA L+   LPLVE  Y+       YA+V+E
Sbjct  157   AAVLGLNTSADRPKGESDKQYIAGFLMTVAAAALYGFVLPLVELTYKKAKQTITYALVLE  216

Query  628   mqvvmeaaATVLATVGMAIDGGFSGMKKESQGGFDLGSKAYAMTVGLNVLTWQLCFMGTA  449
             +Q+VM   AT+  TVGM ID  F  + +E++  F LG   Y + + L+ + WQ  F+G  
Sbjct  217   IQMVMCLFATIFCTVGMLIDNDFKVIPREAR-NFGLGEGTYYVVLVLSAIVWQTFFLGAI  275

Query  448   GMVFLTTSVTSGICSTALMAFNVVGGVLAYGDHMGGSKAVSTVLCVWGFSSYVYGMYLKT  269
             G++F  +S+ SGI    L+    +  V+ Y +     K V+  L +WGF SY YG    +
Sbjct  276   GVIFCASSLLSGIVIAVLLPITEILAVIFYHEKFQAEKGVALALSLWGFVSYFYGEIKYS  335

Query  268   KKVTKE  251
             K+   E
Sbjct  336   KQRENE  341



>ref|XP_010939717.1| PREDICTED: purine permease 3-like isoform X2 [Elaeis guineensis]
Length=362

 Score =   174 bits (441),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 116/316 (37%), Positives = 191/316 (60%), Gaps = 10/316 (3%)
 Frame = -1

Query  1153  KFYFVHGGSSRWVATWVQCAGFPLLIPAVYLPY-YAFNSTERRPFAGFSLR--IFSLSVV  983
             + YF+ GG+ +W+++W+Q  G+PLL   + + Y +       RP   + +   +F    V
Sbjct  46    RLYFLKGGTRKWLSSWLQTGGWPLLFIPLAISYAHRCRCGGGRPIKLYLMTPPLFLACTV  105

Query  982   IGLMLGVNNLLISWGTSYLPVSTCSLVLASQLVFILFLSAIIVRQKITFANLNCvvlltl  803
             +GL++G+++ L ++G SYLPVST S++++SQL F    +  +V+QK T  ++N VVLL++
Sbjct  106   LGLLVGLDDFLYAYGLSYLPVSTSSILISSQLGFTALFAFFMVKQKFTSFSVNAVVLLSI  165

Query  802   aavllaLDSSSDKPAGLTKAKYFVGFFCTVGAALLFALYLPLVEKLY---RNVDCYamvv  632
              AV+L L +S D+P G +  +Y++GFF T+ AA+L+   LPLVE  Y   + V  Y +V+
Sbjct  166   GAVILGLHASGDRPKGESNTQYYLGFFMTLAAAVLYGFILPLVELTYAKAKQVVSYTLVI  225

Query  631   emqvvmeaaATVLATVGMAIDGGFSGMKKESQGGFDLGSKAYAMTVGLNVLTWQLCFMGT  452
             EMQ+ M   ATV  TVGM ++G F  + +E++  F+LG   Y + +  + + WQ  F+GT
Sbjct  226   EMQLAMGFFATVFCTVGMLVNGDFHVIPREAR-EFELGEATYYVLLVWSAILWQFVFLGT  284

Query  451   AGMVFLTTSVTSGICSTALMAFNVVGGVLAYGDHMGGSKAVSTVLCVWGFSSYVYGMYLK  272
              G +F  +++ +GI    L+  + V  V+ + +     K V+  L +WGF+SY YG +LK
Sbjct  285   VGAIFYGSALLAGIIMAVLVPVSQVLAVVFFHEPFSAEKGVALALALWGFASYFYGEFLK  344

Query  271   TKK---VTKEVPPAIG  233
             +KK   V    PPA G
Sbjct  345   SKKKNPVVDPGPPASG  360



>ref|XP_004242795.1| PREDICTED: purine permease 3-like [Solanum lycopersicum]
Length=367

 Score =   174 bits (441),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 120/325 (37%), Positives = 188/325 (58%), Gaps = 31/325 (10%)
 Frame = -1

Query  1153  KFYFVHGGSSRWVATWVQCAGFPL-LIPAVYLPYYAFNSTERRPFAG-------------  1016
             + YF+ GG   W+++W++  G+P+ LIP   L +  FN   RR F G             
Sbjct  34    RLYFLKGGERIWLSSWLETVGWPIVLIP---LSFSYFN--RRREFRGKMILSTSTDNDND  88

Query  1015  -------FSLRIFSLSVVIGLMLGVNNLLISWGTSYLPVSTCSLVLASQLVFILFLSAII  857
                     + RIF  S+ IG++ G +N L ++G + LPVST +L++ASQL F    + ++
Sbjct  89    NNAKFILMTPRIFVASIGIGILTGFDNYLYAYGVAKLPVSTSALLIASQLAFTAGFAFLL  148

Query  856   VRQKITFANLNCvvlltlaavllaLDSSSDKPAGLTKAKYFVGFFCTVGAALLFALYLPL  677
             V+QK T  ++N + LLTL AV+LAL ++ D+P G ++ +Y +GF  T+GAA L+ L LPL
Sbjct  149   VKQKFTSYSINSIFLLTLGAVVLALHANGDRPNGESRKEYILGFIMTLGAAALYGLILPL  208

Query  676   VEKLYRNVD---CYamvvemqvvmeaaATVLATVGMAIDGGFSGMKKESQGGFDLGSKAY  506
              E LY+       Y +V+E+Q V    +TV+ T+GM I+  F  M +E++  F+LG   Y
Sbjct  209   FELLYKKAKQGITYTLVMEIQAVYCIFSTVVCTIGMIINKDFQAMSREAK-SFELGEARY  267

Query  505   AMTVGLNVLTWQLCFMGTAGMVFLTTSVTSGICSTALMAFNVVGGVLAYGDHMGGSKAVS  326
              + +  + + WQ  F+G  G+++ ++S+ SGI  T L+    + GV+ YG+     K VS
Sbjct  268   YIVIIWSAILWQCFFLGAIGVIYFSSSLVSGILITVLLPVTEILGVVFYGEKFTPEKGVS  327

Query  325   TVLCVWGFSSYVYGMYLKTKKVTKE  251
              VL +WGF SY+YG  +K  K  KE
Sbjct  328   LVLSIWGFISYLYGD-IKASKKKKE  351



>ref|XP_006841259.1| hypothetical protein AMTR_s00135p00097090 [Amborella trichopoda]
 gb|ERN02934.1| hypothetical protein AMTR_s00135p00097090 [Amborella trichopoda]
Length=362

 Score =   174 bits (441),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 118/304 (39%), Positives = 180/304 (59%), Gaps = 17/304 (6%)
 Frame = -1

Query  1153  KFYFVHGGSSRWVATWVQCAGFP-LLIPAVYLPYYAFNSTERR----------PFAGFSL  1007
             + YF+HGG   W++ +++  G+P LL P  +  +  FN T ++               +L
Sbjct  38    RLYFLHGGHKLWLSAFLETGGWPILLFPLAFSKF--FNKTNKKNPQSQQQEGEERTHITL  95

Query  1006  RIFSLSVVIGLMLGVNNLLISWGTSYLPVSTCSLVLASQLVFILFLSAIIVRQKITFANL  827
              +F     IGL+ GV++ + ++G SYLPVST +L++ASQL F    + I+VR K T    
Sbjct  96    PLFLQCSFIGLLTGVDDYMYAFGLSYLPVSTSALLIASQLAFTALFALIVVRHKFTAFLT  155

Query  826   NCvvlltlaavllaLDSSSDKPAGLTKAKYFVGFFCTVGAALLFALYLPLVEKLY---RN  656
             N VVLLTL +  L L ++ D+P GL+  +YF+GFF T+GAA L+ L LPL+E +Y   R 
Sbjct  156   NSVVLLTLGSAFLGLGANGDRPKGLSNGRYFLGFFMTLGAAALYGLVLPLIELMYARSRQ  215

Query  655   VDCYamvvemqvvmeaaATVLATVGMAIDGGFSGMKKESQGGFDLGSKAYAMTVGLNVLT  476
                Y +V+EMQ+VM   AT    VGM I+  F  + KE++  FDLG+  Y  T+  + + 
Sbjct  216   KITYMLVLEMQLVMSVFATAFCAVGMLINKDFQHIPKEARA-FDLGAVGYYATLVGSGVA  274

Query  475   WQLCFMGTAGMVFLTTSVTSGICSTALMAFNVVGGVLAYGDHMGGSKAVSTVLCVWGFSS  296
             WQL F+GT G++F  +SV SGI    L+    +  V+ Y +   G KA++ ++ +WGF+S
Sbjct  275   WQLFFIGTVGLIFCASSVVSGIMIAFLIPITEILAVIFYHEKFTGEKAMALIMSLWGFAS  334

Query  295   YVYG  284
             Y+YG
Sbjct  335   YIYG  338



>ref|NP_001063425.1| Os09g0467400 [Oryza sativa Japonica Group]
 dbj|BAD19736.1| putative purine permease [Oryza sativa Japonica Group]
 dbj|BAF25339.1| Os09g0467400 [Oryza sativa Japonica Group]
 dbj|BAG90051.1| unnamed protein product [Oryza sativa Japonica Group]
Length=361

 Score =   174 bits (440),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 111/297 (37%), Positives = 178/297 (60%), Gaps = 8/297 (3%)
 Frame = -1

Query  1153  KFYFVHGGSSRWVATWVQCAGFPLLIPAVYLPYYAFNSTERR-PFAGFSLRIFSLSVVIG  977
             + YF  GG  +W++ W+Q AG+PLL+  V   Y +  + +RR P      R+    V +G
Sbjct  47    RLYFSKGGHRQWLSAWLQTAGWPLLLVPVAASYLSRRARDRRAPLFLTPTRVLLAGVGLG  106

Query  976   LMLGVNNLLISWGTSYLPVSTCSLVLASQLVFILFLSAIIVRQKITFANLNCvvlltlaa  797
              + G ++ + ++G +YLPVST ++++++QL F +F + +IVRQ+ T A LN V LLT+ A
Sbjct  107   FLNGADDFIYAYGLAYLPVSTSAILISTQLAFTVFFACLIVRQRFTAATLNAVALLTIGA  166

Query  796   vllaLDSSSDKPAGLTKAKYFVGFFCTVGAALLFALYLPLVEKLYRNVD------CYamv  635
             V+L L +S D+PAG+T  KY++GFF T+GAA L+ L LPLVE  Y++         YA+V
Sbjct  167   VVLGLHASKDRPAGVTSGKYWMGFFLTLGAAALYGLILPLVELAYKHAAGGGRAVTYALV  226

Query  634   vemqvvmeaaATVLATVGMAIDGGFSGMKKESQGGFDLGSKAYAMTVGLNVLTWQLCFMG  455
             +EMQ+VM   AT   TVGM ++  F  + +E++  ++LG   Y + +  N + W+  F+G
Sbjct  227   MEMQLVMGFFATAFCTVGMVVNKDFQAIPREAK-QYELGEARYYVVLVFNAVLWEFFFVG  285

Query  454   TAGMVFLTTSVTSGICSTALMAFNVVGGVLAYGDHMGGSKAVSTVLCVWGFSSYVYG  284
               G++F   ++ +GI     +    V GV+   +     K V+ VL +WG +SY YG
Sbjct  286   AVGVIFCVHTLLAGIIIAVFIPITEVLGVIFLHEKFSSEKGVALVLSLWGLASYSYG  342



>ref|XP_010263028.1| PREDICTED: purine permease 1-like [Nelumbo nucifera]
Length=365

 Score =   174 bits (440),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 113/300 (38%), Positives = 173/300 (58%), Gaps = 6/300 (2%)
 Frame = -1

Query  1153  KFYFVHGGSSRWVATWVQCAGFPLLIPAVYLPYYAFNSTERRPFAGFSLRIFSLSVVIGL  974
             + YF+HGG+ +W+ +W++ AG P L+  + + Y    ++  R  A    ++  LS  IGL
Sbjct  59    RLYFLHGGNRKWIPSWLETAGVPALLGPLTVLYLRERASGVRFLA--PTKLLLLSAGIGL  116

Query  973   MLGVNNLLISWGTSYLPVSTCSLVLASQLVFILFLSAIIVRQKITFANLNCvvlltlaav  794
             + G+NN + S G S+LPVST SL+L++QL F  F + +I +QK T  + N VVL+TL AV
Sbjct  117   LAGLNNFMYSLGLSFLPVSTSSLLLSTQLAFTAFFAFLIAKQKFTPYSTNAVVLMTLGAV  176

Query  793   llaLDSSSDKPAGLTKAKYFVGFFCTVGAALLFALYLPLVEKLY---RNVDCYamvvemq  623
             LL L  S D+P G++   Y +GF  T+GAA L    LP  E  Y   R    Y++V++ Q
Sbjct  177   LLGLTKSGDRPPGVSNKDYLLGFILTLGAAGLLGFILPCCEVSYATARKTITYSVVLQFQ  236

Query  622   vvmeaaATVLATVGMAIDGGFSGMKKESQGGFDLGSKAYAMTVGLNVLTWQLCFMGTAGM  443
               +   ATV  T+GM I+  F  + +E+   F+LG+  Y M +    + WQ+  +G  G+
Sbjct  237   FGVNFFATVFCTIGMLINKDFQAIPREAN-AFELGAVKYYMVLVSIAIVWQMAVVGLLGV  295

Query  442   VFLTTSVTSGICSTALMAFNVVGGVLAYGDHMGGSKAVSTVLCVWGFSSYVYGMYLKTKK  263
             VF TTS+ +G+ +  L+    +  V+ Y +   G K ++  LC WGF SY YG Y + KK
Sbjct  296   VFCTTSLFAGVLNATLLPLTEIAAVIVYHEKFTGEKGMALALCSWGFISYFYGSYKENKK  355



>ref|XP_008667169.1| PREDICTED: uncharacterized protein LOC100193377 isoform X1 [Zea 
mays]
 gb|ACR36679.1| unknown [Zea mays]
 tpg|DAA40290.1| TPA: hypothetical protein ZEAMMB73_258363 [Zea mays]
Length=363

 Score =   173 bits (439),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 111/301 (37%), Positives = 178/301 (59%), Gaps = 10/301 (3%)
 Frame = -1

Query  1153  KFYFVHGGSSRWVATWVQCAGFPLLIPAVYLPYYAFNSTERRPFAGFSL---RIFSLSVV  983
             + YF  GG  +W++ W+Q  G+PLL+P V   Y    +  R   A  +    RI   +  
Sbjct  41    RLYFSKGGHRQWLSGWLQTGGWPLLLPPVAASYVRRRARYRSAPALLTQTQPRILLAAAG  100

Query  982   IGLMLGVNNLLISWGTSYLPVSTCSLVLASQLVFILFLSAIIVRQKITFANLNCvvlltl  803
             +GL+ GV+NLL +WG  +LPVST ++++++QL F +  + +IVRQ++T A +N V LLT+
Sbjct  101   LGLIAGVDNLLYAWGLEFLPVSTSAILISTQLAFTVLFAFLIVRQRLTMATVNAVALLTV  160

Query  802   aavllaLDSSSDKPAGLTKAKYFVGFFCTVGAALLFALYLPLVEKLYR------NVDCYa  641
              AV+L L  SSD+PAG+T+++Y++GF  T+GAA+L+ L+LPLVE  Y+          YA
Sbjct  161   GAVVLGLHVSSDRPAGVTRSQYWLGFTLTLGAAVLYGLFLPLVELTYKCAAGGGRAVTYA  220

Query  640   mvvemqvvmeaaATVLATVGMAIDGGFSGMKKESQGGFDLGSKAYAMTVGLNVLTWQLCF  461
             +VVE+Q+VM   AT   TVGM ++  F  + +E++  ++LG   Y M +    + WQ  F
Sbjct  221   LVVELQLVMGFVATAFCTVGMIVNKDFQAIPREAR-QYELGEARYYMVLAWAAVLWQCFF  279

Query  460   MGTAGMVFLTTSVTSGICSTALMAFNVVGGVLAYGDHMGGSKAVSTVLCVWGFSSYVYGM  281
             +G  G++F   ++ +GI     +    V  V+   +     K V+  L +WG +SY YG 
Sbjct  280   LGAVGVIFCVHTLLAGILIAVFIPVTEVAAVIFLHEKFSSEKGVALALSLWGLASYSYGE  339

Query  280   Y  278
             +
Sbjct  340   W  340



>ref|XP_009373619.1| PREDICTED: purine permease 3-like [Pyrus x bretschneideri]
Length=380

 Score =   174 bits (440),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 110/295 (37%), Positives = 177/295 (60%), Gaps = 6/295 (2%)
 Frame = -1

Query  1153  KFYFVHGGSSRWVATWVQCAGFPLLIPAVYLPYYAFNSTERRPFAGFSLRI--FSLSVVI  980
             + YF+HGG   W+++W++  G+P++   + + Y     TE      F +++  F+ S VI
Sbjct  39    RLYFIHGGKRVWLSSWLETGGWPIIFIPIAMAYCYRRKTEGPSTKLFLMKLPLFTASAVI  98

Query  979   GLMLGVNNLLISWGTSYLPVSTCSLVLASQLVFILFLSAIIVRQKITFANLNCvvlltla  800
             G++ G+++ L ++G + LP+ST +L+LAS L F    + I+V+QK T  ++N +VLLT+ 
Sbjct  99    GILTGLDDYLYAYGVARLPISTSALILASHLAFTALFAFILVKQKFTLFSINAIVLLTIG  158

Query  799   avllaLDSSSDKPAGLTKAKYFVGFFCTVGAALLFALYLPLVEKLYRNVD---CYamvve  629
             AV+L L++SSD+P G +  +Y  GFF TV AA L+   LPL+E  Y+       YA+V+E
Sbjct  159   AVVLGLNTSSDRPEGESNKEYIAGFFMTVAAAALYGFVLPLIELTYKKAKQTITYALVLE  218

Query  628   mqvvmeaaATVLATVGMAIDGGFSGMKKESQGGFDLGSKAYAMTVGLNVLTWQLCFMGTA  449
             +Q+VM   AT+  TVGM ID  F  + +E++  FDLG   Y + +  + + WQ  F+G  
Sbjct  219   VQLVMCLFATLFCTVGMIIDNDFKVIPREAR-KFDLGETRYYVVLVFSAILWQGFFLGAI  277

Query  448   GMVFLTTSVTSGICSTALMAFNVVGGVLAYGDHMGGSKAVSTVLCVWGFSSYVYG  284
             G++F  +S+ SGI   +L+    +  V+ Y +     K VS  L +WGF SY YG
Sbjct  278   GIIFCASSLLSGIVIASLIPVTQILAVIFYHEKFQAEKGVSLALSLWGFISYFYG  332



>ref|XP_007227615.1| hypothetical protein PRUPE_ppa022492mg [Prunus persica]
 gb|EMJ28814.1| hypothetical protein PRUPE_ppa022492mg [Prunus persica]
Length=368

 Score =   173 bits (439),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 109/307 (36%), Positives = 180/307 (59%), Gaps = 6/307 (2%)
 Frame = -1

Query  1153  KFYFVHGGSSRWVATWVQCAGFPLLIPAVYLPYYAFNSTERRPFAGF--SLRIFSLSVVI  980
             + YF+HGG   W+++W++  G+P++   + L YY   +TE      F   L +F  S VI
Sbjct  37    RLYFIHGGKRVWLSSWLETGGWPIIFIPIALAYYHRRTTEGPSTKLFFMKLPLFIASAVI  96

Query  979   GLMLGVNNLLISWGTSYLPVSTCSLVLASQLVFILFLSAIIVRQKITFANLNCvvlltla  800
             GL+ G+++ L ++G + LPVST +L+ A+ LVF    + ++V+QK T  ++NCV LLT+ 
Sbjct  97    GLLTGLDDYLYAYGVARLPVSTAALITAAHLVFTALFAFLLVKQKFTSYSINCVFLLTIG  156

Query  799   avllaLDSSSDKPAGLTKAKYFVGFFCTVGAALLFALYLPLVEKLYRNVD---CYamvve  629
             A +L L++S+D+P G +  +Y  GF  T+ +A L+   LPLVE  Y+       YA+V+E
Sbjct  157   AAVLGLNTSADRPKGESDKQYIAGFMMTLSSAALYGFVLPLVELTYKKAKQTITYALVLE  216

Query  628   mqvvmeaaATVLATVGMAIDGGFSGMKKESQGGFDLGSKAYAMTVGLNVLTWQLCFMGTA  449
             +Q+VM   AT+  TVGM I+  F  + +E++  F+LG + Y + +  + + WQ  F+G  
Sbjct  217   IQLVMCLFATIFCTVGMLINNDFKVIPREAR-NFELGERRYYVVLVFSAIVWQGFFLGAI  275

Query  448   GMVFLTTSVTSGICSTALMAFNVVGGVLAYGDHMGGSKAVSTVLCVWGFSSYVYGMYLKT  269
             G++F  +S+ SGI    L+    +  V+ Y +     K V+  L +WGF SY YG    +
Sbjct  276   GIIFCASSLLSGIVIAVLLPVTEILAVIFYHEKFQAEKGVALALSLWGFVSYFYGERKYS  335

Query  268   KKVTKEV  248
             K+   E+
Sbjct  336   KQKESEM  342



>ref|XP_002983502.1| hypothetical protein SELMODRAFT_118529 [Selaginella moellendorffii]
 gb|EFJ15403.1| hypothetical protein SELMODRAFT_118529 [Selaginella moellendorffii]
Length=329

 Score =   171 bits (434),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 115/298 (39%), Positives = 176/298 (59%), Gaps = 7/298 (2%)
 Frame = -1

Query  1153  KFYFVHGGSSRWVATWVQCAGFPLLIPAVYLPYYAFNSTERRPFAGFSLRIFSLSVVIGL  974
             +FYF  GGS RW++ W+Q AG+PL    ++L      +   R     S ++ S  VV+G 
Sbjct  21    RFYFTQGGSRRWLSAWIQVAGWPLSASMLFLQ----KTKSLREILSISRKLASAYVVLGA  76

Query  973   MLGVNNLLISWGTSYLPVSTCSLVLASQLVFILFLSAIIVRQKITFANLNCvvlltlaav  794
             + G   LL +WG SYLP ST S+++++QLVF    + +IVR+ ++    N VVL+T + V
Sbjct  77    INGGVCLLYAWGISYLPASTSSILISTQLVFTSLFALVIVRKPLSPFMWNAVVLMTCSTV  136

Query  793   llaLDSSSDKPAGLTKAKYFVGFFCTVGAALLFALYLPLVEKLYRNV--DCYamvvemqv  620
             L+ L SSSDKP GLT ++Y +GF  T+ AA+LF L +PL E + +N+     + V E+  
Sbjct  137   LVGLHSSSDKPPGLTHSQYILGFVMTLAAAVLFGLLIPLFELVTKNLMASSSSAVAELMT  196

Query  619   vmeaaATVLATVGMAIDGGFSGMKKESQGGFDLGSKAYAMTVGLNVLTWQLCFMGTAGMV  440
              +   ATV+ ++GMAI+G FS +  ES+  F  G  +Y MT+  + + +Q+ ++   G+ 
Sbjct  197   FVNIVATVVLSIGMAINGDFSRISAESRV-FKSGRVSYFMTLFWSAVLYQVQYLAVTGVA  255

Query  439   FLTTSVTSGICSTALMAFNVVGGVLAYGDHMGGSKAVSTVLCVWGFSSYVYGMYLKTK  266
              L +S+ SGI  TA      +     + D++GG K ++ VL VWGF SY YG YL  K
Sbjct  256   MLASSLLSGILITASTPLVSIFAFFFFHDNLGGVKIMALVLSVWGFISYAYGGYLDEK  313



>ref|XP_009373503.1| PREDICTED: purine permease 3-like [Pyrus x bretschneideri]
Length=378

 Score =   172 bits (436),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 113/302 (37%), Positives = 172/302 (57%), Gaps = 6/302 (2%)
 Frame = -1

Query  1153  KFYFVHGGSSRWVATWVQCAGFPLLIPAVYLPYYAFNSTERRPFAGF--SLRIFSLSVVI  980
             + YF+HGG   W+++W+Q  G+P++   + + YY    TE      F   L +F  S VI
Sbjct  37    RLYFIHGGKHIWLSSWLQTGGWPIIFIPIAIGYYHRRKTEGPSTKLFFMKLPLFMASAVI  96

Query  979   GLMLGVNNLLISWGTSYLPVSTCSLVLASQLVFILFLSAIIVRQKITFANLNCvvlltla  800
             G++ G+++ L ++G + LPVST +L++A QL F    + I+V+QK T  ++N VVLLT+ 
Sbjct  97    GVLTGLDDYLYAYGVARLPVSTSALIIAGQLAFTALFAFILVKQKFTSFSMNAVVLLTMG  156

Query  799   avllaLDSSSDKPAGLTKAKYFVGFFCTVGAALLFALYLPLVEKLYRNVD---CYamvve  629
             + +L L  SSD+P G +  +Y  GFF  V AA L+   LPL+E  Y+       YA+V+E
Sbjct  157   SAVLGLTISSDRPEGESNKEYIAGFFMMVAAASLYGFVLPLIELTYKRAKQTVTYALVLE  216

Query  628   mqvvmeaaATVLATVGMAIDGGFSGMKKESQGGFDLGSKAYAMTVGLNVLTWQLCFMGTA  449
             +Q VM   AT+  TVGM I+  F  + +E++  FDLG   Y + + L+   WQ  F+G  
Sbjct  217   IQSVMCLFATLFCTVGMLINNDFKVIPREARK-FDLGETRYYLVLVLSATVWQAFFLGAI  275

Query  448   GMVFLTTSVTSGICSTALMAFNVVGGVLAYGDHMGGSKAVSTVLCVWGFSSYVYGMYLKT  269
             G++F  +S+ SGI    L+    +  V+ Y +     K VS  L VWGF SY YG     
Sbjct  276   GIIFCASSLLSGIVIAVLLPITEILAVIFYHEKFQPEKGVSLALSVWGFVSYFYGEIKHN  335

Query  268   KK  263
             K+
Sbjct  336   KQ  337



>dbj|BAD19737.1| putative purine permease [Oryza sativa Japonica Group]
Length=361

 Score =   172 bits (435),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 108/297 (36%), Positives = 180/297 (61%), Gaps = 8/297 (3%)
 Frame = -1

Query  1153  KFYFVHGGSSRWVATWVQCAGFPLLIPAVYLPYYAFNSTER-RPFAGFSLRIFSLSVVIG  977
             + YF  GG  +W++ W++ AG+PLL+  V   Y++  + +R  P      R+     V+G
Sbjct  47    RLYFSKGGHRKWLSAWLETAGWPLLLVPVSASYHSRRARDRGAPLFLTPRRVLLAGAVLG  106

Query  976   LMLGVNNLLISWGTSYLPVSTCSLVLASQLVFILFLSAIIVRQKITFANLNCvvlltlaa  797
             ++ G ++ + ++G +YLPVST ++++++QL F +F + +IVRQ++T A LN V LLT+ A
Sbjct  107   VLTGADDFVYAYGLAYLPVSTSAILISTQLAFTVFFACLIVRQRLTAATLNAVALLTIGA  166

Query  796   vllaLDSSSDKPAGLTKAKYFVGFFCTVGAALLFALYLPLVEKLYRNVD------CYamv  635
             V+L L +S D+PAG+T  KY++GFF T+GAA L+ L LPLVE  Y++         YA+V
Sbjct  167   VVLGLHASKDRPAGVTTGKYWMGFFLTLGAAALYGLILPLVELAYKHAAGGGRAVTYALV  226

Query  634   vemqvvmeaaATVLATVGMAIDGGFSGMKKESQGGFDLGSKAYAMTVGLNVLTWQLCFMG  455
             +EMQ+VM   AT   TVG+ ++  F  + +E++  ++LG   Y + +  N + W+  F+G
Sbjct  227   MEMQLVMGFFATAFCTVGVIVNKDFQAIPREAK-QYELGEARYYVVLVFNAVLWEFFFVG  285

Query  454   TAGMVFLTTSVTSGICSTALMAFNVVGGVLAYGDHMGGSKAVSTVLCVWGFSSYVYG  284
               G++F   ++ +GI     +    V GV+   +     K V+ VL +WG +SY YG
Sbjct  286   AVGVIFCVHTLLAGIIIAVFIPITEVLGVIFLHEKFSSEKGVALVLSLWGLASYSYG  342



>ref|XP_004501676.1| PREDICTED: purine permease 1-like isoform X1 [Cicer arietinum]
 ref|XP_004501677.1| PREDICTED: purine permease 1-like isoform X2 [Cicer arietinum]
Length=367

 Score =   171 bits (434),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 111/316 (35%), Positives = 187/316 (59%), Gaps = 14/316 (4%)
 Frame = -1

Query  1153  KFYFVHGGSSRWVATWVQCAGFPLLIPAVYLPYYAFNSTERRPFAG--------FSLR--  1004
             + YF+HGG+  W++++++ AGFPL++  + + Y       RR  A          S++  
Sbjct  37    RLYFIHGGNRVWLSSFLETAGFPLMLLPLTVSYIKRRRLHRRNAATTESGKLNLISMKPP  96

Query  1003  IFSLSVVIGLMLGVNNLLISWGTSYLPVSTCSLVLASQLVFILFLSAIIVRQKITFANLN  824
             +F     IG++ G+++ L ++G + LPVST +L++ASQL F    + ++V+QK T  ++N
Sbjct  97    LFLAVAFIGIITGLDDYLYAYGVARLPVSTSALIIASQLGFTAVFAFLLVKQKFTAFSIN  156

Query  823   CvvlltlaavllaLDSSSDKPAGLTKAKYFVGFFCTVGAALLFALYLPLVEKLYRNVD--  650
              VVLLT+ A +LA+ +S D+P G +  +Y +GF  TV AA L+   LPL+E +Y+     
Sbjct  157   AVVLLTIGAGVLAMHTSGDRPNGESTKQYVIGFITTVAAAALYGFVLPLIELVYKKTKQP  216

Query  649   -CYamvvemqvvmeaaATVLATVGMAIDGGFSGMKKESQGGFDLGSKAYAMTVGLNVLTW  473
               Y++V+E+Q VM   AT+   VGM ++  F  + +E++  F LG K Y   + ++ + W
Sbjct  217   LTYSLVMEIQFVMCMFATLFCAVGMIVNNDFKVIPREAK-IFGLGEKTYYFVLVVSAIMW  275

Query  472   QLCFMGTAGMVFLTTSVTSGICSTALMAFNVVGGVLAYGDHMGGSKAVSTVLCVWGFSSY  293
             Q  F+G  G++F  +S+ SGI    L+    V  V+ Y +H    KAVS +L +WGF SY
Sbjct  276   QAFFLGAVGVIFCASSLLSGILIAVLLPLTEVLAVIFYKEHFQAEKAVSLILSLWGFVSY  335

Query  292   VYGMYLKTKKVTKEVP  245
              YG + ++K++ K+ P
Sbjct  336   FYGEFKESKELKKKNP  351



>ref|XP_006841262.1| hypothetical protein AMTR_s00135p00100890 [Amborella trichopoda]
 gb|ERN02937.1| hypothetical protein AMTR_s00135p00100890 [Amborella trichopoda]
Length=357

 Score =   171 bits (433),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 110/309 (36%), Positives = 186/309 (60%), Gaps = 10/309 (3%)
 Frame = -1

Query  1153  KFYFVHGGSSRWVATWVQCAGFPLLIPAVYLPYYAFNST----ERRPFAGFSLRIFSLSV  986
             + YF+HGG  +W+  W+Q A FP+L+  ++L   +   T     R+    F L + S S 
Sbjct  44    RLYFIHGGQRKWLTAWIQTAAFPILLIPLFLSKISSTKTSQSQRRQSHLTFPLALQSAS-  102

Query  985   VIGLMLGVNNLLISWGTSYLPVSTCSLVLASQLVFILFLSAIIVRQKITFANLNCvvllt  806
              IGL++G+++ + ++G SYLP+ST +L++++QL F  F + +IV Q+ T   +N VVLL+
Sbjct  103   -IGLLIGIDDYMYAFGLSYLPISTSTLLVSTQLGFTAFFAFLIVGQRFTAHTINAVVLLS  161

Query  805   laavllaLDSSSDKPAGLTKAKYFVGFFCTVGAALLFALYLPLVEKLY---RNVDCYamv  635
             L +VLL + +SSD+P G+T A+Y +GF  T+GAA L  L  PL+E +Y   + +  + +V
Sbjct  162   LGSVLLGIRASSDRPEGVTGAQYGLGFVLTLGAAALIGLVFPLIELVYVKSKQIVTFGLV  221

Query  634   vemqvvmeaaATVLATVGMAIDGGFSGMKKESQGGFDLGSKAYAMTVGLNVLTWQLCFMG  455
             +EM +VM   AT   T+GM I+  F  + +ES+  F LG   Y +TV  + + WQ+  +G
Sbjct  222   MEMLLVMSVVATGFCTIGMVINKDFQVISRESK-EFGLGEFKYHLTVVASGILWQVFLIG  280

Query  454   TAGMVFLTTSVTSGICSTALMAFNVVGGVLAYGDHMGGSKAVSTVLCVWGFSSYVYGMYL  275
             +   +  T+S+ +GI     +    +  V+ + +     K ++ VLC+WGF+SY YG ++
Sbjct  281   SFSFILYTSSLLNGILLAVQLPLTSILAVIFFHEKFSAEKGMALVLCLWGFASYYYGEHI  340

Query  274   KTKKVTKEV  248
             ++KK  + V
Sbjct  341   QSKKREEVV  349



>ref|XP_002973993.1| hypothetical protein SELMODRAFT_232165 [Selaginella moellendorffii]
 gb|EFJ24948.1| hypothetical protein SELMODRAFT_232165 [Selaginella moellendorffii]
Length=329

 Score =   170 bits (431),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 115/298 (39%), Positives = 176/298 (59%), Gaps = 7/298 (2%)
 Frame = -1

Query  1153  KFYFVHGGSSRWVATWVQCAGFPLLIPAVYLPYYAFNSTERRPFAGFSLRIFSLSVVIGL  974
             +FYF  GGS RW++ W+Q AG+PL    ++L      +   R     S ++ S  VV+G 
Sbjct  21    RFYFTQGGSRRWLSAWIQVAGWPLSASMLFLQ----KTKSLRETLSISRKLASAYVVLGA  76

Query  973   MLGVNNLLISWGTSYLPVSTCSLVLASQLVFILFLSAIIVRQKITFANLNCvvlltlaav  794
             + G   LL +WG SYLP ST S+++++QLVF    + +IVR+ ++    N VVL+T + V
Sbjct  77    INGGVCLLYAWGISYLPASTSSILISTQLVFTSLFALVIVRKPLSPFMWNAVVLMTCSTV  136

Query  793   llaLDSSSDKPAGLTKAKYFVGFFCTVGAALLFALYLPLVEKLYRNV--DCYamvvemqv  620
             L+ L SSSDKP GLT ++Y +GF  T+ AA+LF L +PL E + +N+     + V E+  
Sbjct  137   LVGLHSSSDKPPGLTHSQYILGFVMTLAAAVLFGLLIPLFELVTKNLMASSSSAVAELMT  196

Query  619   vmeaaATVLATVGMAIDGGFSGMKKESQGGFDLGSKAYAMTVGLNVLTWQLCFMGTAGMV  440
              +   ATV+ ++GMAI+G FS +  ES+  F  G  +Y MT+  + + +Q+ ++   G+ 
Sbjct  197   FVNIVATVVLSIGMAINGDFSRISAESRV-FKSGRVSYFMTLFWSAVLYQVQYLSVTGVA  255

Query  439   FLTTSVTSGICSTALMAFNVVGGVLAYGDHMGGSKAVSTVLCVWGFSSYVYGMYLKTK  266
              L +S+ SGI  TA      +     + D++GG K ++ VL VWGF SY YG YL  K
Sbjct  256   MLASSLLSGILITASTPLVSIFAFFFFHDNLGGVKIMALVLSVWGFISYAYGGYLDEK  313



>gb|EMT00369.1| hypothetical protein F775_21645 [Aegilops tauschii]
Length=271

 Score =   168 bits (426),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 115/238 (48%), Positives = 158/238 (66%), Gaps = 7/238 (3%)
 Frame = -1

Query  970  LGVNNLLISWGTSYLPVSTCSLVLASQLVFILFLSAIIVRQKITFANLNCvvlltlaavl  791
            +GV+NLL ++ TS LPVST SL+L+ QL F L L+ +IVR  +TF NLN VVL+TL +VL
Sbjct  1    MGVSNLLFAYSTSLLPVSTSSLLLSMQLAFTLVLAVVIVRHPLTFNNLNAVVLMTLCSVL  60

Query  790  laLDSSSDKPAGLTKAKYFVGFFCTVGAALLFALYLPLVEKLYRNV--DCYamvvemqvv  617
            LAL  S D      +  Y +G+  T+ AA LF+ YLP++E +YR      + + VE+Q V
Sbjct  61   LAL-RSGDAGESPNRRGYIIGYIVTLCAAGLFSAYLPVMELVYREAVSGGFILAVEVQAV  119

Query  616  meaaATVLATVGMAIDGGFSGMKKESQGGFDLGSKAYAMTVGLNVLTWQLCFMGTAGMVF  437
            M+A A+V A VG+A+  GFS      +G   +    Y + V   V+TWQ CFMGTAG+++
Sbjct  120  MQAMASVEAAVGLAVSRGFSDDVAHWKGSHAV----YWVVVATLVVTWQACFMGTAGVIY  175

Query  436  LTTSVTSGICSTALMAFNVVGGVLAYGDHMGGSKAVSTVLCVWGFSSYVYGMYLKTKK  263
            LT+S+ SG+C  A++  NV+GG L +GD  G  KAV+T LCVWG SSY+YG Y K+KK
Sbjct  176  LTSSLHSGVCMAAVLTANVIGGGLVFGDPFGPEKAVATALCVWGLSSYLYGEYTKSKK  233



>ref|XP_004299692.1| PREDICTED: purine permease 3-like [Fragaria vesca subsp. vesca]
Length=373

 Score =   171 bits (433),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 112/309 (36%), Positives = 184/309 (60%), Gaps = 10/309 (3%)
 Frame = -1

Query  1153  KFYFVHGGSSRWVATWVQCAGFPLLIPAVYLPYYAFNSTE---RRPFAGF--SLRIFSLS  989
             + YF+HGG   W+++ ++  G+P+++  + + YY     +     P   F   L +F  S
Sbjct  40    RLYFIHGGKRLWLSSMLETGGWPVILVPIAIAYYHRRKNQAPTDPPTKLFFMKLPLFVAS  99

Query  988   VVIGLMLGVNNLLISWGTSYLPVSTCSLVLASQLVFILFLSAIIVRQKITFANLNCvvll  809
              VIG++ G+++ L ++G + LP+ST SL++AS LVF    + I+V+QK T  ++N VVLL
Sbjct  100   AVIGVLTGLDDYLYAYGVARLPLSTLSLIIASHLVFTALFAFILVKQKFTSYSINAVVLL  159

Query  808   tlaavllaLDSSSDKPAGLTKAKYFVGFFCTVGAALLFALYLPLVEKLYRNVD---CYam  638
             T+ A +L L++SSD+P G + A+Y +GF  TV AA L+   LPLVE +Y+       YA+
Sbjct  160   TVGAAVLGLNTSSDRPKGESNAQYMLGFVMTVAAAALYGFVLPLVELMYKKAKQNITYAL  219

Query  637   vvemqvvmeaaATVLATVGMAIDGGFSGMKKESQGGFDLGSKAYAMTVGLNVLTWQLCFM  458
             V+E+Q+VM   AT+  TVGM ++  F  + +E++  F+LG   Y + + ++ + WQ  F+
Sbjct  220   VLEIQMVMSLFATIFCTVGMLVNNDFKVIPREAR-KFELGETTYYVVLVVSAIVWQAFFL  278

Query  457   GTAGMVFLTTSVTSGICSTALMAFNVVGGVLAYGDHMGGSKAVSTVLCVWGFSSYVYGMY  278
             G  G++F  +S+ SGI    L+    +  V+ Y +     K VS  L +WGF SY YG  
Sbjct  279   GAIGLIFCASSLLSGIVIAVLLPVTEIFAVIFYHEKFQAEKGVSLALSLWGFVSYFYG-E  337

Query  277   LKTKKVTKE  251
             +K  K +K+
Sbjct  338   MKHNKQSKQ  346



>gb|EEC84724.1| hypothetical protein OsI_31699 [Oryza sativa Indica Group]
Length=361

 Score =   170 bits (431),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 108/297 (36%), Positives = 179/297 (60%), Gaps = 8/297 (3%)
 Frame = -1

Query  1153  KFYFVHGGSSRWVATWVQCAGFPLLIPAVYLPYYAFNSTER-RPFAGFSLRIFSLSVVIG  977
             + YF  GG  +W++ W++ AG+PLL+  V   Y +  + +R  P      R+     V+G
Sbjct  47    RLYFSKGGHRKWLSAWLETAGWPLLLVPVSASYLSRRARDRGAPLFLTPRRVLLAGAVLG  106

Query  976   LMLGVNNLLISWGTSYLPVSTCSLVLASQLVFILFLSAIIVRQKITFANLNCvvlltlaa  797
             ++ G ++ + ++G +YLPVST ++++++QL F +F + +IVRQ++T A LN V LLT+ A
Sbjct  107   VLTGADDFVYAYGLAYLPVSTSAILISTQLAFTVFFACLIVRQRLTAATLNAVALLTIGA  166

Query  796   vllaLDSSSDKPAGLTKAKYFVGFFCTVGAALLFALYLPLVEKLYRNVD------CYamv  635
             V+L L +S D+PAG+T  KY++GFF T+GAA L+ L LPLVE  Y++         YA+V
Sbjct  167   VVLGLHASKDRPAGVTTGKYWMGFFLTLGAAALYGLILPLVELAYKHAAGGGRAVTYALV  226

Query  634   vemqvvmeaaATVLATVGMAIDGGFSGMKKESQGGFDLGSKAYAMTVGLNVLTWQLCFMG  455
             +EMQ+VM   AT   TVG+ ++  F  + +E++  ++LG   Y + +  N + W+  F+G
Sbjct  227   MEMQLVMGFFATAFCTVGVIVNKDFQAIPREAK-QYELGEARYYVVLVFNAVLWEFFFVG  285

Query  454   TAGMVFLTTSVTSGICSTALMAFNVVGGVLAYGDHMGGSKAVSTVLCVWGFSSYVYG  284
               G++F   ++ +GI     +    V GV+   +     K V+ VL +WG +SY YG
Sbjct  286   AVGVIFCVHTLLAGIIIAVFIPITEVLGVIFLHEKFSSEKGVALVLSLWGLASYSYG  342



>ref|XP_008338896.1| PREDICTED: purine permease 3-like [Malus domestica]
Length=378

 Score =   170 bits (431),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 111/295 (38%), Positives = 175/295 (59%), Gaps = 6/295 (2%)
 Frame = -1

Query  1153  KFYFVHGGSSRWVATWVQCAGFPLLIPAVYLPYYAFNSTERRPFAGF--SLRIFSLSVVI  980
             + YF+HGG   W+++W++  G+P++   + + Y     TE      F   L +F+ S VI
Sbjct  39    RLYFIHGGKRVWLSSWLETGGWPIIFIPIAMAYCYRRKTEGPSTKLFFMKLPLFTASAVI  98

Query  979   GLMLGVNNLLISWGTSYLPVSTCSLVLASQLVFILFLSAIIVRQKITFANLNCvvlltla  800
             G++ G+++ L ++G + LP+ST +L+LAS L F    + I+V+QK T  ++N +VLLT+ 
Sbjct  99    GVLTGLDDYLYAYGVARLPISTSALILASHLAFTALFAFILVKQKFTSFSINAIVLLTIG  158

Query  799   avllaLDSSSDKPAGLTKAKYFVGFFCTVGAALLFALYLPLVEKLYRNVD---CYamvve  629
             AV+L L++SSD+P G +  +Y  GFF TV AA L+   LPL+E  Y+       YA+V+E
Sbjct  159   AVVLGLNTSSDRPEGESNKEYIAGFFMTVAAAALYGFVLPLIELTYKKAKQTITYALVLE  218

Query  628   mqvvmeaaATVLATVGMAIDGGFSGMKKESQGGFDLGSKAYAMTVGLNVLTWQLCFMGTA  449
             +Q+VM   AT+  TVGM ID  F  + KE++  FDLG   Y + +  + + WQ  F+G  
Sbjct  219   VQLVMCLFATLFCTVGMLIDNDFKVIPKEAR-KFDLGETRYYVVLVFSAILWQGFFLGAI  277

Query  448   GMVFLTTSVTSGICSTALMAFNVVGGVLAYGDHMGGSKAVSTVLCVWGFSSYVYG  284
             G++F  +S+ SGI   +L+    +  V+ Y +     K VS  L +WGF  Y YG
Sbjct  278   GIIFCASSLLSGIVIASLIPVTQILAVIFYHEKFQAEKGVSLALSLWGFIFYFYG  332



>ref|XP_008444876.1| PREDICTED: purine permease 3-like [Cucumis melo]
Length=359

 Score =   170 bits (430),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 113/312 (36%), Positives = 180/312 (58%), Gaps = 21/312 (7%)
 Frame = -1

Query  1153  KFYFVHGGSSRWVATWVQCAGFPLLIPAVYLPYYAFNSTE-----------RRPFAGFSL  1007
             + YF+HGG+  W+++W+   G+P+++  + + Y     T            R P   F  
Sbjct  34    RLYFIHGGNRVWLSSWLFSGGWPIILIPLAISYIHRRRTATAGSKTKLIFMREPLLLFG-  92

Query  1006  RIFSLSVVIGLMLGVNNLLISWGTSYLPVSTCSLVLASQLVFILFLSAIIVRQKITFANL  827
                  S VIG + G++N L ++G + LPVST SL++ASQL F    + ++V+QK T   +
Sbjct  93    -----SAVIGALTGLDNYLFAYGMARLPVSTSSLIIASQLAFTAGFAYLLVKQKFTSYTV  147

Query  826   NCvvlltlaavllaLDSSSDKPAGLTKAKYFVGFFCTVGAALLFALYLPLVEKLYRNVD-  650
             N VVLLT+   +LAL SS D+PAG +  +Y  GF  T+GAA+L+ L LPL+E +Y+    
Sbjct  148   NSVVLLTMGGAILALHSSGDRPAGESNGEYIAGFLMTLGAAVLYGLILPLIELMYKKTKQ  207

Query  649   --CYamvvemqvvmeaaATVLATVGMAIDGGFSGMKKESQGGFDLGSKAYAMTVGLNVLT  476
                Y +++E+Q+VM  + TVL T+GM I+  F  + +E +  F LG+  Y + + ++ + 
Sbjct  208   SLTYTLILEIQLVMAISGTVLCTIGMLINNDFQAIPREGR-EFGLGNTKYYVVLVMSCVI  266

Query  475   WQLCFMGTAGMVFLTTSVTSGICSTALMAFNVVGGVLAYGDHMGGSKAVSTVLCVWGFSS  296
             WQ  F+G  G++F ++S+ SGI    L+    +  V+ + +     K VS  L +WGF S
Sbjct  267   WQCFFIGAVGVIFYSSSLFSGIVIALLLPAVEILAVIFFREKFQAEKGVSLALNLWGFVS  326

Query  295   YVYGMYLKTKKV  260
             Y YG Y +TKKV
Sbjct  327   YFYGEYKQTKKV  338



>ref|XP_007223326.1| hypothetical protein PRUPE_ppa007339mg [Prunus persica]
 gb|EMJ24525.1| hypothetical protein PRUPE_ppa007339mg [Prunus persica]
Length=372

 Score =   169 bits (429),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 110/295 (37%), Positives = 174/295 (59%), Gaps = 6/295 (2%)
 Frame = -1

Query  1153  KFYFVHGGSSRWVATWVQCAGFPLLIPAVYLPYYAFNSTERRPFAGF--SLRIFSLSVVI  980
             + YF+HGG   W+++W++  G+P++   + L YY   +TE      F   L +F  S VI
Sbjct  37    RLYFIHGGKRVWLSSWLETGGWPIIFIPIALAYYHRRTTEGPSTKLFFIKLPLFIASAVI  96

Query  979   GLMLGVNNLLISWGTSYLPVSTCSLVLASQLVFILFLSAIIVRQKITFANLNCvvlltla  800
             GL+ G+++ L ++G + LPVST SL++A+QL F    + ++V+QK T  + N VVLLT+ 
Sbjct  97    GLITGLDDYLYAYGVARLPVSTSSLIIAAQLAFTALFAFLLVKQKFTSYSTNAVVLLTIG  156

Query  799   avllaLDSSSDKPAGLTKAKYFVGFFCTVGAALLFALYLPLVEKLYRNVD---CYamvve  629
             A +L L++++D+P G +  +Y  GF  TV AA L+   LPLVE  Y+       YA+V+E
Sbjct  157   AAVLGLNTNADRPKGESDKEYIAGFLMTVAAAALYGFVLPLVELTYKKAKQTITYALVLE  216

Query  628   mqvvmeaaATVLATVGMAIDGGFSGMKKESQGGFDLGSKAYAMTVGLNVLTWQLCFMGTA  449
             +Q+VM   AT+  TVGM I+  F  + +E++  F LG   Y + + L+ + WQ  F+G  
Sbjct  217   IQMVMCLFATIFCTVGMLINNDFKVILREAR-NFGLGKGTYYVVLVLSAIVWQTFFLGAI  275

Query  448   GMVFLTTSVTSGICSTALMAFNVVGGVLAYGDHMGGSKAVSTVLCVWGFSSYVYG  284
             G++F  +S+ SGI    L+    +  V+ Y +     K V+  L +WGF SY YG
Sbjct  276   GIIFCASSLLSGIVIAVLLPITEILAVIFYHEKFQAEKGVALALSLWGFVSYFYG  330



>ref|XP_004299691.1| PREDICTED: purine permease 3-like [Fragaria vesca subsp. vesca]
Length=373

 Score =   169 bits (429),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 111/309 (36%), Positives = 183/309 (59%), Gaps = 10/309 (3%)
 Frame = -1

Query  1153  KFYFVHGGSSRWVATWVQCAGFPLLIPAVYLPYYAFNSTE---RRPFAGF--SLRIFSLS  989
             + YF+HGG   W+++ ++  G+P+++  + + YY     +     P   F   L +F  S
Sbjct  40    RLYFIHGGKRVWLSSMLETGGWPVILVPIAIAYYHRRKNQAPTDPPTKLFFMKLPLFVAS  99

Query  988   VVIGLMLGVNNLLISWGTSYLPVSTCSLVLASQLVFILFLSAIIVRQKITFANLNCvvll  809
              VIG++ G+++ L ++G + LPVST +L++A+QL F    + I+V+QK T  ++N VVLL
Sbjct  100   AVIGVLTGLDDYLYAYGVARLPVSTSALIIAAQLAFTALFAFILVKQKFTSYSINAVVLL  159

Query  808   tlaavllaLDSSSDKPAGLTKAKYFVGFFCTVGAALLFALYLPLVEKLYRNVD---CYam  638
             T+ A +L L++SSD+P G + A+Y +GF  TV AA L+   LPLVE +Y+       YA+
Sbjct  160   TVGAAVLGLNTSSDRPKGESNAQYMLGFVMTVAAAALYGFVLPLVELMYKKAKQNITYAL  219

Query  637   vvemqvvmeaaATVLATVGMAIDGGFSGMKKESQGGFDLGSKAYAMTVGLNVLTWQLCFM  458
             V+E+Q+VM   AT+  TVGM ++  F  + +E++  F+LG   Y + + ++ + WQ  F+
Sbjct  220   VLEIQMVMSLFATIFCTVGMLVNNDFKVIPREAR-KFELGETTYYVVLVVSAIVWQTFFL  278

Query  457   GTAGMVFLTTSVTSGICSTALMAFNVVGGVLAYGDHMGGSKAVSTVLCVWGFSSYVYGMY  278
             G  G++F  +S+ SGI    L+    +  V+ Y +     K VS  L +WGF SY YG  
Sbjct  279   GAIGLIFCASSLLSGIVIAVLLPVTEIFAVIFYHEKFQAEKGVSLALSLWGFVSYFYG-E  337

Query  277   LKTKKVTKE  251
             +K  K  K+
Sbjct  338   IKHNKQKKQ  346



>ref|NP_001149498.1| purine permease [Zea mays]
 gb|ACG35618.1| purine permease [Zea mays]
Length=271

 Score =   166 bits (421),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 110/235 (47%), Positives = 151/235 (64%), Gaps = 6/235 (3%)
 Frame = -1

Query  970  LGVNNLLISWGTSYLPVSTCSLVLASQLVFILFLSAIIVRQKITFANLNCvvlltlaavl  791
            +G NNLL S+ TS+LPVST SL+L++QL F L L+A+IVR  +TF NLN VVLLT+++VL
Sbjct  1    MGANNLLFSYSTSFLPVSTSSLLLSTQLAFTLVLAAVIVRHPLTFVNLNAVVLLTVSSVL  60

Query  790  laLDS--SSDKP--AGLTKAKYFVGFFCTVGAALLFALYLPLVEKLYRNVDCYamvvemq  623
            LAL S  S + P   G   A YF G+  T+GAA LFA YLP++E LYR     +    + 
Sbjct  61   LALRSGDSGENPDGGGAAAAHYFAGYVVTLGAAGLFAAYLPVMELLYRQ--AVSGGFVLA  118

Query  622  vvmeaaATVLATVGMAIDGGFSGMKKESQGGFDLGSKAYAMTVGLNVLTWQLCFMGTAGM  443
            V ++A    +A++  AI     G        +   +  Y + V   VLTWQ CFMGTAG+
Sbjct  119  VEVQAVMQAMASLVAAIGLAAKGGLGGDVARWKGSAALYWVVVSTLVLTWQACFMGTAGV  178

Query  442  VFLTTSVTSGICSTALMAFNVVGGVLAYGDHMGGSKAVSTVLCVWGFSSYVYGMY  278
            ++LT+S+ SG+C TA++  NV+GGVL +GD  G  K ++T LC WG +SY+YG Y
Sbjct  179  IYLTSSLHSGVCMTAVLTANVLGGVLVFGDPFGAEKGIATXLCAWGLASYLYGEY  233



>ref|XP_009603730.1| PREDICTED: purine permease 3-like [Nicotiana tomentosiformis]
Length=352

 Score =   168 bits (426),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 121/314 (39%), Positives = 182/314 (58%), Gaps = 18/314 (6%)
 Frame = -1

Query  1153  KFYFVHGGSSRWVATWVQCAGFPL-LIPAVYLPYYAFNSTERRPFAG-------FSLRIF  998
             + Y+V GGS  W+++W+Q AG+PL LIP   L +Y      RR   G        + RIF
Sbjct  34    RLYYVEGGSRVWLSSWLQTAGWPLTLIPLAILYFY------RRKIEGSNAKFYFITPRIF  87

Query  997   SLSVVIGLMLGVNNLLISWGTSYLPVSTCSLVLASQLVFILFLSAIIVRQKITFANLNCv  818
               S +IGL+ G+++ L SWG S LPVST SL+LA+QL F    +  IV+ K T  ++N V
Sbjct  88    IASFIIGLVTGLDDFLYSWGGSKLPVSTSSLLLAAQLAFTAVGAFFIVKLKFTPYSINAV  147

Query  817   vlltlaavllaLDSSSDKPAGLTKAKYFVGFFCTVGAALLFALYLPLVEKLY---RNVDC  647
             VLLT+ AVLL + S+ D+P G+T   Y +GF  T+ AA L+ + LP +E +Y   +    
Sbjct  148   VLLTVGAVLLGVRSNGDRPEGVTSKAYILGFMMTLLAAALYGVILPCIELIYLKAKQAIT  207

Query  646   YamvvemqvvmeaaATVLATVGMAIDGGFSGMKKESQGGFDLGSKAYAMTVGLNVLTWQL  467
               +V+E+Q+VM  AAT   TVGM I+  F  + +E++  F+LG   Y   V    + WQ 
Sbjct  208   ATLVLEIQMVMCFAATAFCTVGMIINNDFQAISREAK-QFNLGEARYYTVVIWTAIIWQC  266

Query  466   CFMGTAGMVFLTTSVTSGICSTALMAFNVVGGVLAYGDHMGGSKAVSTVLCVWGFSSYVY  287
              F+G  G+++ ++S+ SG+    L+    V  V+ Y ++  G K ++  L +WGF SY Y
Sbjct  267   FFVGVIGVIYCSSSLMSGVMIAVLLPVTEVLAVVFYRENFSGEKGLALFLSLWGFVSYFY  326

Query  286   GMYLKTKKVTKEVP  245
             G + +TKK   + P
Sbjct  327   GEFRQTKKQKNKSP  340



>ref|XP_004245857.1| PREDICTED: probable purine permease 11 [Solanum lycopersicum]
Length=379

 Score =   169 bits (428),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 120/310 (39%), Positives = 178/310 (57%), Gaps = 12/310 (4%)
 Frame = -1

Query  1153  KFYFVHGGSSRWVATWVQCAGFPLLIPAVYL----PYYAFNSTERRPFAGFSLRIFSLSV  986
             +FY+  GG+S+W+AT+VQ +GFP+L+P  +L       AF+S E+   +GFSL  F + +
Sbjct  66    RFYYDEGGNSKWMATFVQSSGFPVLLPLFFLFKSSKNTAFSSPEKP--SGFSL--FLIYL  121

Query  985   VIGLMLGVNNLLISWGTSYLPVSTCSLVLASQLVFILFLSAIIVRQKITFANLNCvvllt  806
               GLML  +NL+ S+G  YLPVST SL+ ASQL F    S ++  QK T   LN VV++T
Sbjct  122   FFGLMLAGDNLMYSYGLLYLPVSTYSLICASQLAFNCLFSLLLNAQKFTALILNSVVIVT  181

Query  805   laavllaLDSSSDKPAGLTKAKYFVGFFCTVGAALLFALYLPLVEKLYRNV---DCYamv  635
             ++A LLA+ S  D    L+  KY +GF CTV A+  +ALYL L+E  ++ V   + +  +
Sbjct  182   ISAALLAVHSEPDTSTKLSAGKYAIGFVCTVAASATYALYLSLLELTFKRVIKSETFNTI  241

Query  634   vemqvvmeaaATVLATVGMAIDGGFSGMKKESQGGFDLGSKAYAMTVGLNVLTWQLCFMG  455
             ++MQV     A+    VG+   G    +  E   GF+ G  +Y MT+    + WQ+C +G
Sbjct  242   LKMQVYPSFIASCACVVGLYASGEIRHLTAE-MNGFNKGEISYLMTLIWTAVLWQICCIG  300

Query  454   TAGMVFLTTSVTSGICSTALMAFNVVGGVLAYGDHMGGSKAVSTVLCVWGFSSYVYGMYL  275
               G++F  +S+ S + ST  +    V  V+ + D M G K ++ +L VWGF SYVY  YL
Sbjct  301   LLGLIFEVSSLFSNVISTLGLPALPVLAVIFFNDKMDGEKIIALLLAVWGFLSYVYQNYL  360

Query  274   KTKKVTKEVP  245
                K     P
Sbjct  361   DDSKAKSSKP  370



>ref|XP_010942638.1| PREDICTED: purine permease 3-like isoform X2 [Elaeis guineensis]
 ref|XP_010942639.1| PREDICTED: purine permease 3-like isoform X2 [Elaeis guineensis]
Length=365

 Score =   168 bits (425),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 107/300 (36%), Positives = 178/300 (59%), Gaps = 9/300 (3%)
 Frame = -1

Query  1153  KFYFVHGGSSRWVATWVQCAGFPLLIPAVYLPYY---AFNSTERRPFAGFSL--RIFSLS  989
             + YF HGG  +W+A+W++  G+PL++  +++ Y       S    P   F L  R+F   
Sbjct  45    RLYFRHGGHRQWLASWLETGGWPLILLPLFISYLYRRRLASDHHHPTKLFFLTPRLFLAC  104

Query  988   VVIGLMLGVNNLLISWGTSYLPVSTCSLVLASQLVFILFLSAIIVRQKITFANLNCvvll  809
              V+GL+ G ++ L ++G S+LPVST ++++++QL F  F + +IV+QK T  ++N + LL
Sbjct  105   AVLGLLTGTDDFLYAYGLSFLPVSTSAILISTQLAFTAFFAFLIVKQKFTPYSINSIALL  164

Query  808   tlaavllaLDSSSDKPAGLTKAKYFVGFFCTVGAALLFALYLPLVEKLYR---NVDCYam  638
             ++ AV+L L +SSD+P  +++ +Y +GFF T+G A L+ L LPLVE  YR    V  Y +
Sbjct  165   SVGAVILGLHTSSDRPDNVSQGQYLMGFFLTLGTAALYGLVLPLVELTYRKASQVITYTL  224

Query  637   vvemqvvmeaaATVLATVGMAIDGGFSGMKKESQGGFDLGSKAYAMTVGLNVLTWQLCFM  458
             V+EMQ+VM   AT   T+GM ++  F  +++E++  + LG   Y + +    + WQ  F+
Sbjct  225   VMEMQLVMGFFATAFCTIGMLVNKDFEAIQREAR-QYGLGEVKYYVVLVWCAILWQCFFL  283

Query  457   GTAGMVFLTTSVTSGICSTALMAFNVVGGVLAYGDHMGGSKAVSTVLCVWGFSSYVYGMY  278
             GT G++F   ++ +GI    L+    + G +   +     K VS  LC+WG +SY YG Y
Sbjct  284   GTVGVIFCVNTLLAGIIIAVLIPVIELFGAIFLHEKFTSEKGVSLALCLWGLASYSYGEY  343



>ref|XP_006295883.1| hypothetical protein CARUB_v10025013mg [Capsella rubella]
 gb|EOA28781.1| hypothetical protein CARUB_v10025013mg [Capsella rubella]
Length=349

 Score =   167 bits (424),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 119/303 (39%), Positives = 176/303 (58%), Gaps = 8/303 (3%)
 Frame = -1

Query  1153  KFYFVHGGSSRWVATWVQCAGFPL-LIPAVY--LPYYAFNSTERRPFAGFSLRIFSLSVV  983
             + YF +GG   W ++++Q  GFPL L P ++  L        E+  F     R+F  SVV
Sbjct  28    RLYFHNGGERIWFSSFLQTVGFPLILFPLLFSFLRRRRLEEQEKTSFFLMKPRLFIASVV  87

Query  982   IGLMLGVNNLLISWGTSYLPVSTCSLVLASQLVFILFLSAIIVRQKITFANLNCvvlltl  803
             +GL++G +N L S+G +YLPVST SL++++QL F    +  +V+QK T   +N +VLLT+
Sbjct  88    VGLLMGFDNYLYSYGLAYLPVSTASLIISAQLGFTALFAFFMVKQKFTPFTINAIVLLTV  147

Query  802   aavllaLDSSSDKPAGLTKAKYFVGFFCTVGAALLFALYLPLVEKLY---RNVDCYamvv  632
              AV+LAL+S SDK A  T  +Y VGF   VGAALL+A  LPLVE  Y   R    Y +V+
Sbjct  148   GAVVLALNSESDKLANETHKEYVVGFLMVVGAALLYAFILPLVELTYKKSRQRITYTLVL  207

Query  631   emqvvmeaaATVLATVGMAIDGGFSGMKKESQGGFDLGSKAYAMTVGLNVLTWQLCFMGT  452
             E Q+V+   AT    VGM   G F  + +E++ GF LG   Y + +    + WQ  F+G 
Sbjct  208   EFQMVLCFVATCFCLVGMLAAGDFKVIAREAR-GFKLGESLYYVVIVFTAVIWQAFFVGA  266

Query  451   AGMVFLTTSVTSGICSTALMAFNVVGGVLAYGDHMGGSKAVSTVLCVWGFSSYVYGMYLK  272
              G++F  +S+ SGI  +AL+   V+  V+ + +     K V+  L +WG  SY YG  +K
Sbjct  267   IGLIFCASSLVSGIMISALLPVTVILAVICFREKFQAGKGVALALSLWGSVSYFYGQ-IK  325

Query  271   TKK  263
             ++K
Sbjct  326   SEK  328



>ref|XP_006602851.1| PREDICTED: probable purine permease 11-like isoform X2 [Glycine 
max]
Length=362

 Score =   167 bits (424),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 112/302 (37%), Positives = 178/302 (59%), Gaps = 10/302 (3%)
 Frame = -1

Query  1153  KFYFVHGGSSRWVATWVQCAGFPLL-IPAVYLPYYAFNSTERRPFAGFSLRIFSL-SVVI  980
             +FY+  GG+S+W+AT VQ A FP+L IP   +P    +  E    A  S++I  L   V+
Sbjct  50    RFYYDQGGNSKWMATLVQTAAFPILFIPLFTIP----SPPEASTSASSSIKIILLIYFVL  105

Query  979   GLMLGVNNLLISWGTSYLPVSTCSLVLASQLVFILFLSAIIVRQKITFANLNCvvlltla  800
             G+++  +N++ S G  YL  ST SL+ ASQL F    S  I  QK T   +N  V+LTL+
Sbjct  106   GILIAADNMMYSTGLLYLSASTYSLISASQLAFNAVFSYFINSQKFTALIINSTVVLTLS  165

Query  799   avllaLDSSSDKPAGLTKAKYFVGFFCTVGAALLFALYLPLVEKLYRNV---DCYamvve  629
             A LLA++  SD+P+GL+  KY +GF CT+GA+ +++L L L++  +  V   + +++V++
Sbjct  166   AALLAVNEDSDEPSGLSMGKYIIGFLCTLGASAVYSLLLSLMQLTFEKVLKKETFSVVLQ  225

Query  628   mqvvmeaaATVLATVGMAIDGGFSGMKKESQGGFDLGSKAYAMTVGLNVLTWQLCFMGTA  449
             MQ+     AT  + +G+   G +  +  E +G F  G  AY MT+    + WQ+C +G  
Sbjct  226   MQIYTSLVATCASVIGLFASGEWHTLHGEMKG-FQKGHVAYVMTLVWTAIAWQVCSVGVV  284

Query  448   GMVFLTTSVTSGICSTALMAFNVVGGVLAYGDHMGGSKAVSTVLCVWGFSSYVYGMYLKT  269
             G++FL +S+ S + ST  +A   +  V+ + D M G K +S +L +WGF+SY+Y  YL  
Sbjct  285   GLIFLVSSLYSNVISTVSLAVTPIAAVIVFHDKMNGVKIISMLLALWGFASYIYQNYLDD  344

Query  268   KK  263
              K
Sbjct  345   SK  346



>gb|AES73111.2| purine permease-like protein [Medicago truncatula]
Length=371

 Score =   167 bits (424),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 114/334 (34%), Positives = 185/334 (55%), Gaps = 20/334 (6%)
 Frame = -1

Query  1153  KFYFVHGGSSRWVATWVQCAGFPLLIPAVYLPYYAFNSTERRPFAGFSLRI---------  1001
             + YF+HGG   W++  ++ AGFPL++  + + Y        +P    ++ I         
Sbjct  38    RLYFIHGGQRVWLSACLETAGFPLMLIPLTISYIQRFRHRHKPLPSNTISIASEKQNIIS  97

Query  1000  -----FSLSVVIGLMLGVNNLLISWGTSYLPVSTCSLVLASQLVFILFLSAIIVRQKITF  836
                  F  +  +G++ G+++ L ++G + LPVST SL++ASQL F  F + ++V+QK T 
Sbjct  98    MKPPIFFAAAFVGILTGLDDYLYAYGVARLPVSTSSLIIASQLGFTAFFAFLLVKQKFTA  157

Query  835   ANLNCvvlltlaavllaLDSSSDKPAGLTKAKYFVGFFCTVGAALLFALYLPLVEKLYRN  656
               +N V LLT+ A +LA+ +SSD+PAG++  +Y +GF  TV A+ L+   LP VE +Y+ 
Sbjct  158   FTVNAVFLLTVGAGVLAMHTSSDRPAGVSAKQYAIGFSTTVAASALYGFVLPAVELVYKK  217

Query  655   VD---CYamvvemqvvmeaaATVLATVGMAIDGGFSGMKKESQGGFDLGSKAYAMTVGLN  485
             +     Y++V+E Q VM   AT+  T+GM I+  F  + +E++  F LG   Y + + LN
Sbjct  218   IKQPITYSLVMEFQFVMCMFATIFCTIGMIINNDFKMIPREAR-NFGLGESIYYVVLVLN  276

Query  484   VLTWQLCFMGTAGMVFLTTSVTSGICSTALMAFNVVGGVLAYGDHMGGSKAVSTVLCVWG  305
              + WQ  F+G  G+VF  +S+ SGI    L+    V  V+ Y +     K VS VL +WG
Sbjct  277   AIMWQAFFLGAIGVVFCASSLLSGILIAVLLPLTEVLAVVFYKEKFQAEKGVSLVLSLWG  336

Query  304   FSSYVYG--MYLKTKKVTKEVPPAIGA*SD*TPA  209
             F SY YG   + K +K  + +   +G   +  PA
Sbjct  337   FVSYFYGEIKHAKAEKKKRSLEIEMGQTIEGLPA  370



>ref|XP_003551696.2| PREDICTED: probable purine permease 11-like isoform X1 [Glycine 
max]
Length=365

 Score =   167 bits (423),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 112/302 (37%), Positives = 178/302 (59%), Gaps = 10/302 (3%)
 Frame = -1

Query  1153  KFYFVHGGSSRWVATWVQCAGFPLL-IPAVYLPYYAFNSTERRPFAGFSLRIFSL-SVVI  980
             +FY+  GG+S+W+AT VQ A FP+L IP   +P    +  E    A  S++I  L   V+
Sbjct  53    RFYYDQGGNSKWMATLVQTAAFPILFIPLFTIP----SPPEASTSASSSIKIILLIYFVL  108

Query  979   GLMLGVNNLLISWGTSYLPVSTCSLVLASQLVFILFLSAIIVRQKITFANLNCvvlltla  800
             G+++  +N++ S G  YL  ST SL+ ASQL F    S  I  QK T   +N  V+LTL+
Sbjct  109   GILIAADNMMYSTGLLYLSASTYSLISASQLAFNAVFSYFINSQKFTALIINSTVVLTLS  168

Query  799   avllaLDSSSDKPAGLTKAKYFVGFFCTVGAALLFALYLPLVEKLYRNV---DCYamvve  629
             A LLA++  SD+P+GL+  KY +GF CT+GA+ +++L L L++  +  V   + +++V++
Sbjct  169   AALLAVNEDSDEPSGLSMGKYIIGFLCTLGASAVYSLLLSLMQLTFEKVLKKETFSVVLQ  228

Query  628   mqvvmeaaATVLATVGMAIDGGFSGMKKESQGGFDLGSKAYAMTVGLNVLTWQLCFMGTA  449
             MQ+     AT  + +G+   G +  +  E +G F  G  AY MT+    + WQ+C +G  
Sbjct  229   MQIYTSLVATCASVIGLFASGEWHTLHGEMKG-FQKGHVAYVMTLVWTAIAWQVCSVGVV  287

Query  448   GMVFLTTSVTSGICSTALMAFNVVGGVLAYGDHMGGSKAVSTVLCVWGFSSYVYGMYLKT  269
             G++FL +S+ S + ST  +A   +  V+ + D M G K +S +L +WGF+SY+Y  YL  
Sbjct  288   GLIFLVSSLYSNVISTVSLAVTPIAAVIVFHDKMNGVKIISMLLALWGFASYIYQNYLDD  347

Query  268   KK  263
              K
Sbjct  348   SK  349



>ref|XP_010064227.1| PREDICTED: purine permease 3-like [Eucalyptus grandis]
 gb|KCW66596.1| hypothetical protein EUGRSUZ_F00390 [Eucalyptus grandis]
Length=379

 Score =   167 bits (424),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 110/307 (36%), Positives = 182/307 (59%), Gaps = 19/307 (6%)
 Frame = -1

Query  1153  KFYFVHGGSSRWVATWVQCAGFPLLIPAVYLPYYAFNSTERRPFAGFSLRI-------FS  995
             + YF+HGG+S W+++W++  G+P++   + + Y+      RR   G S R+       F 
Sbjct  36    RLYFIHGGASVWLSSWLETGGWPIIFIPLAVAYF-----RRRASEGPSARLVLMDPFLFV  90

Query  994   LSVVIGLMLGVNNLLISWGTSYLPVSTCSLVLASQLVFILFLSAIIVRQKITFANLNCvv  815
              + VIG++ G+++ L S+G + LPVST +L++A+QL F    + ++VRQ  T  ++    
Sbjct  91    AAAVIGVLTGLDDYLYSYGVARLPVSTSALLIATQLAFTAGFAFLLVRQLFTSYSI---F  147

Query  814   lltlaavllaLDSSSDKPAGLTKAKYFVGFFCTVGAALLFALYLPLVEKLYRNVD---CY  644
             LLT+ A +LA+ +SSD+PAG +K  Y+ GFF T+GAA L+ L LPLVE  Y+       Y
Sbjct  148   LLTIGAGVLAMHTSSDRPAGESKGAYYAGFFMTLGAAALYGLVLPLVELTYKKAKQAVTY  207

Query  643   amvvemqvvmeaaATVLATVGMAIDGGFSGMKKESQGGFDLGSKAYAMTVGLNVLTWQLC  464
             ++V+E+Q+VM   AT   T+GM ++  F  + +E++  F LG   Y + +  N + WQ  
Sbjct  208   SLVLEIQLVMCFFATAFCTIGMLVNKDFQAIPREARN-FGLGEAQYYVVLVSNAIVWQFF  266

Query  463   FMGTAGMVFLTTSVTSGICSTALMAFNVVGGVLAYGDHMGGSKAVSTVLCVWGFSSYVYG  284
             F+G  G++F  +S+ SGI    L+    + GV+ + +     K VS  L +WGF+SY YG
Sbjct  267   FLGAIGVIFYASSLFSGIMIAILIPVTEILGVICFHEKFQAEKGVSLALSLWGFASYFYG  326

Query  283   MYLKTKK  263
              + + K+
Sbjct  327   EFKRAKE  333



>ref|XP_010942637.1| PREDICTED: purine permease 3-like isoform X1 [Elaeis guineensis]
Length=448

 Score =   169 bits (428),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 107/300 (36%), Positives = 178/300 (59%), Gaps = 9/300 (3%)
 Frame = -1

Query  1153  KFYFVHGGSSRWVATWVQCAGFPLLIPAVYLPY---YAFNSTERRPFAGFSL--RIFSLS  989
             + YF HGG  +W+A+W++  G+PL++  +++ Y       S    P   F L  R+F   
Sbjct  128   RLYFRHGGHRQWLASWLETGGWPLILLPLFISYLYRRRLASDHHHPTKLFFLTPRLFLAC  187

Query  988   VVIGLMLGVNNLLISWGTSYLPVSTCSLVLASQLVFILFLSAIIVRQKITFANLNCvvll  809
              V+GL+ G ++ L ++G S+LPVST ++++++QL F  F + +IV+QK T  ++N + LL
Sbjct  188   AVLGLLTGTDDFLYAYGLSFLPVSTSAILISTQLAFTAFFAFLIVKQKFTPYSINSIALL  247

Query  808   tlaavllaLDSSSDKPAGLTKAKYFVGFFCTVGAALLFALYLPLVEKLYR---NVDCYam  638
             ++ AV+L L +SSD+P  +++ +Y +GFF T+G A L+ L LPLVE  YR    V  Y +
Sbjct  248   SVGAVILGLHTSSDRPDNVSQGQYLMGFFLTLGTAALYGLVLPLVELTYRKASQVITYTL  307

Query  637   vvemqvvmeaaATVLATVGMAIDGGFSGMKKESQGGFDLGSKAYAMTVGLNVLTWQLCFM  458
             V+EMQ+VM   AT   T+GM ++  F  +++E++  + LG   Y + +    + WQ  F+
Sbjct  308   VMEMQLVMGFFATAFCTIGMLVNKDFEAIQREAR-QYGLGEVKYYVVLVWCAILWQCFFL  366

Query  457   GTAGMVFLTTSVTSGICSTALMAFNVVGGVLAYGDHMGGSKAVSTVLCVWGFSSYVYGMY  278
             GT G++F   ++ +GI    L+    + G +   +     K VS  LC+WG +SY YG Y
Sbjct  367   GTVGVIFCVNTLLAGIIIAVLIPVIELFGAIFLHEKFTSEKGVSLALCLWGLASYSYGEY  426



>ref|XP_006305220.1| hypothetical protein CARUB_v10009586mg [Capsella rubella]
 gb|EOA38118.1| hypothetical protein CARUB_v10009586mg [Capsella rubella]
Length=351

 Score =   166 bits (421),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 109/309 (35%), Positives = 178/309 (58%), Gaps = 9/309 (3%)
 Frame = -1

Query  1153  KFYFVHGGSSRWVATWVQCAGFPLLIPAVYLPYYAF----NSTERRPFAGFSLRIFSLSV  986
             + YF +GG   W +T+++ AGFP++   +   Y       N +E   F     R+   ++
Sbjct  25    RLYFNNGGQRIWFSTFLETAGFPVIFIPLLFSYIHRRRNNNGSEPTSFFLIKPRLLGAAI  84

Query  985   VIGLMLGVNNLLISWGTSYLPVSTCSLVLASQLVFILFLSAIIVRQKITFANLNCvvllt  806
              IG++ G +N L ++G +YLPVST +L++ASQL FI   S  +V+ K T   +N VVLLT
Sbjct  85    FIGILSGFDNYLYAYGIAYLPVSTAALIIASQLAFIAIFSFFMVKHKFTPFTINAVVLLT  144

Query  805   laavllaLDSSSDKPAGLTKAKYFVGFFCTVGAALLFALYLPLVEKLYRNVD---CYamv  635
             + A +L + + +DKPA  T+ +Y  GF  TV AA++++L LPLVE  Y+       Y +V
Sbjct  145   VGAAVLGMHTETDKPAHETRKQYVTGFLMTVAAAVMYSLILPLVELAYQKAKQPMSYTLV  204

Query  634   vemqvvmeaaATVLATVGMAIDGGFSGMKKESQGGFDLGSKAYAMTVGLNVLTWQLCFMG  455
             +E+Q+V+   A++++ +GM+I G F  + KE++  F LG   + +    + + WQ  F+G
Sbjct  205   LEVQMVLCFLASIVSLIGMSIAGDFKALPKEAK-EFKLGEAVFYVVAVFSAIIWQGFFLG  263

Query  454   TAGMVFLTTSVTSGICSTALMAFNVVGGVLAYGDHMGGSKAVSTVLCVWGFSSYVYGMYL  275
               G++F T+S+ SGI  + L+    V  V+ Y +     K +S  L +WGF SY YG  +
Sbjct  264   AIGLIFCTSSLVSGIMISVLLPITEVLAVIFYHEKFQAEKGLSLALSLWGFVSYFYG-EI  322

Query  274   KTKKVTKEV  248
             K+ K  K +
Sbjct  323   KSAKEKKRI  331



>ref|XP_008219368.1| PREDICTED: purine permease 3-like [Prunus mume]
Length=370

 Score =   167 bits (423),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 108/307 (35%), Positives = 177/307 (58%), Gaps = 6/307 (2%)
 Frame = -1

Query  1153  KFYFVHGGSSRWVATWVQCAGFPLLIPAVYLPYYAFNSTERRPFAGF--SLRIFSLSVVI  980
             + YF+HGG   W+++W++  G+P++   + L YY   +TE      F   L +F  S VI
Sbjct  39    RLYFIHGGKRVWLSSWLETGGWPIIFIPIALAYYHRRTTEGPSTKLFFMKLPLFIASAVI  98

Query  979   GLMLGVNNLLISWGTSYLPVSTCSLVLASQLVFILFLSAIIVRQKITFANLNCvvlltla  800
             GL+ G+++ L ++G + LPVST +L+ A+ LVF    + ++V+QK T  ++N V LLT+ 
Sbjct  99    GLLTGLDDYLYAYGVARLPVSTAALITAAHLVFTALFAFLLVKQKFTSYSINGVFLLTIG  158

Query  799   avllaLDSSSDKPAGLTKAKYFVGFFCTVGAALLFALYLPLVEKLYRNVD---CYamvve  629
             A +L L++S+D+P G +  +Y  GF  T  +A L+   LPLVE  Y+       YA+V+E
Sbjct  159   AAVLGLNTSADRPKGESDKQYIAGFMMTFSSAALYGFVLPLVELTYKKAKQTITYALVLE  218

Query  628   mqvvmeaaATVLATVGMAIDGGFSGMKKESQGGFDLGSKAYAMTVGLNVLTWQLCFMGTA  449
             +Q+VM   AT+  TVGM I+  F  + +E++  F+LG   Y + +  + + WQ  F+G  
Sbjct  219   IQLVMCLFATIFCTVGMLINNDFKVIPREARN-FELGESRYYVVLVFSAIVWQGFFLGAI  277

Query  448   GMVFLTTSVTSGICSTALMAFNVVGGVLAYGDHMGGSKAVSTVLCVWGFSSYVYGMYLKT  269
             G++F  +S+ SGI    L+    +  V+ Y +     K V+  L +WGF SY YG    +
Sbjct  278   GIIFCASSLLSGIVIAVLLPVTEILAVIFYHEKFQAEKGVALALSLWGFVSYFYGERKYS  337

Query  268   KKVTKEV  248
             K+   E+
Sbjct  338   KQKESEM  344



>gb|KDP41439.1| hypothetical protein JCGZ_15846 [Jatropha curcas]
Length=359

 Score =   166 bits (421),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 112/310 (36%), Positives = 187/310 (60%), Gaps = 9/310 (3%)
 Frame = -1

Query  1153  KFYFVHGGSSRWVATWVQCAGFPLLIPAVYLPYYAFNSTERRPFAG-FSLR--IFSLSVV  983
             + YF+HGG   W+++W++ AG+P++   + + Y+   ST     A  F ++  +F  +  
Sbjct  39    RLYFIHGGKRVWLSSWLETAGWPIIFIPLLISYFHRRSTTDPTTAKLFYMKPSLFLAATG  98

Query  982   IGLMLGVNNLLISWGTSYLPVSTCSLVLASQLVFILFLSAIIVRQKITFANLNCvvlltl  803
             IG++ G ++ L ++G + LPVST SL++A+QL F    + ++V+QK T  ++N VVLLT+
Sbjct  99    IGILTGFDDYLYAYGVARLPVSTSSLIIATQLAFTAGFAFLLVKQKFTSYSINAVVLLTV  158

Query  802   aavllaLDSSSDKPAGLTKAKYFVGFFCTVGAALLFALYLPLVEKLYRNVD---CYamvv  632
              A +LAL +SSD+P   +K +Y +GF  T+GAA+L+ L LPLVE  YR       Y +V+
Sbjct  159   GAGVLALHTSSDRPEHESKKEYNLGFVMTLGAAVLYGLILPLVELTYRKAKQEISYTLVM  218

Query  631   emqvvmeaaATVLATVGMAIDGGFSGMKKESQGGFDLGSKAYAMTVGLNVLTWQLCFMGT  452
             E+Q++M   ATV+ TVGM ++  F  + +E++  F+LG   Y + +  + + WQ  F+G 
Sbjct  219   EIQMIMCLFATVVCTVGMLVNNDFKVIPREAK-EFELGETKYYVIMVWSAIIWQCFFLGA  277

Query  451   AGMVFLTTSVTSGICSTALMAFNVVGGVLAYGDHMGGSKAVSTVLCVWGFSSYVYGMYLK  272
              G+VF  +S+ SG+    L+    +  V+ Y +     K V+  L +WGF SY YG   +
Sbjct  278   IGIVFCASSLASGVVIAVLLPVTEILAVIFYQEKFQAEKGVALALSLWGFLSYFYGEIKQ  337

Query  271   TKK--VTKEV  248
             +KK  +T E+
Sbjct  338   SKKTNLTSEI  347



>ref|XP_007018134.1| Purine permease 3 [Theobroma cacao]
 gb|EOY15359.1| Purine permease 3 [Theobroma cacao]
Length=356

 Score =   166 bits (421),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 113/314 (36%), Positives = 179/314 (57%), Gaps = 11/314 (4%)
 Frame = -1

Query  1153  KFYFVHGGSSRWVATWVQCAGFPLL---IPAVYLPYYAFNSTERRPFAGFSLRIFSLSVV  983
             + YF+HGG   W ++W++  G+P++   I   YL       T R  F      +F  S V
Sbjct  36    RLYFIHGGKRVWFSSWLETGGWPIILFPIAWAYLHRRRTQPTSRNKFFFMKPPLFIASAV  95

Query  982   IGLMLGVNNLLISWGTSYLPVSTCSLVLASQLVFILFLSAIIVRQKITFANLNCvvlltl  803
             IG++ G ++ L ++G + LPVST SL++A+QL F    + ++V+QK T  ++N V LLT+
Sbjct  96    IGILTGFDDYLYAYGVARLPVSTSSLIIAAQLAFTAGFAFLLVKQKFTSYSINAVFLLTI  155

Query  802   aavllaLDSSSDKPAGLTKAKYFVGFFCTVGAALLFALYLPLVEKLYRNVD---CYamvv  632
              A +LAL++SSD+P   +  +Y +GF  T+ AA+L+   LPLVE +Y+       YA+V+
Sbjct  156   GAGVLALNTSSDRPENESNKEYVMGFLMTIAAAVLYGFILPLVELMYKKAKQEISYALVM  215

Query  631   emqvvmeaaATVLATVGMAIDGGFSGMKKESQGGFDLGSKAYAMTVGLNVLTWQLCFMGT  452
             E+Q+VM   ATVL TVGM ++  F  + +E++  F LG   Y +    + + WQ  F+G 
Sbjct  216   EIQMVMCLFATVLCTVGMLVNNDFKVISREAR-EFGLGETKYYVVAISSAIIWQGFFLGA  274

Query  451   AGMVFLTTSVTSGICSTALMAFNVVGGVLAYGDHMGGSKAVSTVLCVWGFSSYVYGMYLK  272
              G++F  +S+ SGI    L+    +  V+   +     K V+  L +WGF SY YG   +
Sbjct  275   IGVIFCASSLVSGIMIAVLLPVTEILAVIFLKEKFQAEKGVALALSLWGFVSYFYGEIKQ  334

Query  271   TKKVTK----EVPP  242
             TKK  +    E+PP
Sbjct  335   TKKKKRALETEMPP  348



>ref|XP_004152619.1| PREDICTED: purine permease 3-like [Cucumis sativus]
 gb|KGN62723.1| hypothetical protein Csa_2G369740 [Cucumis sativus]
Length=371

 Score =   166 bits (421),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 111/314 (35%), Positives = 187/314 (60%), Gaps = 10/314 (3%)
 Frame = -1

Query  1153  KFYFVHGGSSRWVATWVQCAGFPLLIPAVYLPYY-----AFNSTERRPFAGFSLRIFSLS  989
             + YF+HGG+  W+++W+   G+P+++  + + Y      A + T+ +        +   S
Sbjct  47    RLYFIHGGNRVWLSSWLFTGGWPIILLPLAISYIHRRRTATDGTKTKLIFMREPLLLLGS  106

Query  988   VVIGLMLGVNNLLISWGTSYLPVSTCSLVLASQLVFILFLSAIIVRQKITFANLNCvvll  809
              V+G++ GV+N L ++G + LPVST SL++ASQL F    + ++V+QK T   +N VVLL
Sbjct  107   AVVGVLTGVDNYLFAYGMARLPVSTSSLIIASQLAFTAGFAYLLVKQKFTSYTVNAVVLL  166

Query  808   tlaavllaLDSSSDKPAGLTKAKYFVGFFCTVGAALLFALYLPLVEKLYRNVD---CYam  638
             T+   +LAL SS D+P G T  +Y  GF  T+GAA+L+ L LPL+E +Y+       Y +
Sbjct  167   TMGGAILALHSSGDRPEGETNGEYIAGFLMTLGAAVLYGLILPLIELMYKKTKQRLTYTL  226

Query  637   vvemqvvmeaaATVLATVGMAIDGGFSGMKKESQGGFDLGSKAYAMTVGLNVLTWQLCFM  458
             ++E+Q+VM  + T++ T+GM I+  F  + +E +  F LGS  Y + + ++ + WQ  F+
Sbjct  227   ILEIQLVMAISGTLVCTIGMLINNDFQAIAREGR-EFGLGSTKYYVVLVMSCIIWQCFFI  285

Query  457   GTAGMVFLTTSVTSGICSTALMAFNVVGGVLAYGDHMGGSKAVSTVLCVWGFSSYVYGMY  278
             G  G++F ++S+ SGI    L+    +  V+ + +     K VS  L +WGF SY YG +
Sbjct  286   GAVGVIFYSSSLFSGIVIALLLPAVEILAVVFFREKFQVEKGVSLALNLWGFVSYFYGEF  345

Query  277   LKTKKV-TKEVPPA  239
              +TKK+ +KE+  A
Sbjct  346   KQTKKMKSKELQKA  359



>ref|XP_004164781.1| PREDICTED: purine permease 3-like [Cucumis sativus]
Length=371

 Score =   166 bits (421),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 112/320 (35%), Positives = 185/320 (58%), Gaps = 22/320 (7%)
 Frame = -1

Query  1153  KFYFVHGGSSRWVATWVQCAGFPLLIPAVYLPYYAFNSTE-----------RRPFAGFSL  1007
             + YF+HGG+  W+++W+   G+P+++  + + Y     T            R P      
Sbjct  47    RLYFIHGGNRVWLSSWLFTGGWPIILLPLAISYIHRRRTATDGSKTKLIFMREPL-----  101

Query  1006  RIFSLSVVIGLMLGVNNLLISWGTSYLPVSTCSLVLASQLVFILFLSAIIVRQKITFANL  827
              +   S V+G++ GV+N L ++G + LPVST SL++ASQL F    + ++V+QK T   +
Sbjct  102   -LLLGSAVVGVLTGVDNYLFAYGMARLPVSTSSLIIASQLAFTAGFAYLLVKQKFTSYTV  160

Query  826   NCvvlltlaavllaLDSSSDKPAGLTKAKYFVGFFCTVGAALLFALYLPLVEKLYRNVD-  650
             N VVLLT+   +LAL SS D+P G T  +Y  GF  T+GAA+L+ L LPL+E +Y+    
Sbjct  161   NAVVLLTMGGAILALHSSGDRPEGETNGEYIAGFLMTLGAAVLYGLILPLIELMYKKTKQ  220

Query  649   --CYamvvemqvvmeaaATVLATVGMAIDGGFSGMKKESQGGFDLGSKAYAMTVGLNVLT  476
                Y +++E+Q+VM  + T++ T+GM I+  F  + +E +  F LGS  Y + + ++ + 
Sbjct  221   RLTYTLILEIQLVMAISGTLVCTIGMLINNDFQAIAREGR-EFGLGSTKYYVVLVMSCII  279

Query  475   WQLCFMGTAGMVFLTTSVTSGICSTALMAFNVVGGVLAYGDHMGGSKAVSTVLCVWGFSS  296
             WQ  F+G  G++F ++S+ SGI    L+    +  V+ + +     K VS  L +WGF S
Sbjct  280   WQCFFIGAVGVIFYSSSLFSGIVIALLLPAVEILAVVFFREKFQVEKGVSLALNLWGFVS  339

Query  295   YVYGMYLKTKKV-TKEVPPA  239
             Y YG + +TKK+ +KE+  A
Sbjct  340   YFYGEFKQTKKMKSKELQKA  359



>gb|KHG22236.1| Purine permease 1 -like protein [Gossypium arboreum]
Length=357

 Score =   166 bits (420),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 116/315 (37%), Positives = 181/315 (57%), Gaps = 12/315 (4%)
 Frame = -1

Query  1153  KFYFVHGGSSRWVATWVQCAGFPLLIPAVYLPYY-----AFNSTERRPFAGFSLRIFSLS  989
             + YF+HGG+  W ++W+Q AG P+++  +   Y      A  ++E + F      +F  +
Sbjct  33    RLYFIHGGNRIWFSSWLQTAGCPIILLPIACAYVHRSRTADPTSENKVFC-MERPLFIAA  91

Query  988   VVIGLMLGVNNLLISWGTSYLPVSTCSLVLASQLVFILFLSAIIVRQKITFANLNCvvll  809
             +V+G++ G++N   S+G S LPVST SL++ASQL F    + ++V+QK T  ++N V LL
Sbjct  92    IVLGILSGLDNYFYSYGLSRLPVSTSSLIIASQLAFTAGFAFLLVKQKFTAYSINAVFLL  151

Query  808   tlaavllaLDSSSDKPAGLTKAKYFVGFFCTVGAALLFALYLPLVEKLYRNVD---CYam  638
             T+ A +LAL SSSD+PA  +  +Y +GF  T+ AA L+   LPLVE  Y+       YA+
Sbjct  152   TIGAGVLALHSSSDRPANESNKEYILGFVMTLAAAALYGFILPLVELTYKKAKQEISYAL  211

Query  637   vvemqvvmeaaATVLATVGMAIDGGFSGMKKESQGGFDLGSKAYAMTVGLNVLTWQLCFM  458
             V+E+Q+VM   AT   TVGM ++  F  + +E++  F+LG   Y +    + + WQ  F+
Sbjct  212   VMEIQLVMCLVATAFCTVGMLVNNDFKVIGREAR-EFELGETKYYIVAIFSAIIWQFFFL  270

Query  457   GTAGMVFLTTSVTSGICSTALMAFNVVGGVLAYGDHMGGSKAVSTVLCVWGFSSYVYG--  284
             G  G+VF  +S+ SG+  + L+    +  V  + +     K VS  L +WGF SY YG  
Sbjct  271   GAIGVVFCASSLLSGVVISVLLPVTEILAVFFFNEKFQAEKGVSLALSLWGFLSYFYGDI  330

Query  283   MYLKTKKVTKEVPPA  239
               +KTKK T E   A
Sbjct  331   KRIKTKKPTPETEMA  345



>ref|XP_003602860.1| Purine permease [Medicago truncatula]
Length=440

 Score =   167 bits (424),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 111/318 (35%), Positives = 177/318 (56%), Gaps = 18/318 (6%)
 Frame = -1

Query  1153  KFYFVHGGSSRWVATWVQCAGFPLLIPAVYLPYYAFNSTERRPFAGFSLRI---------  1001
             + YF+HGG   W++  ++ AGFPL++  + + Y        +P    ++ I         
Sbjct  38    RLYFIHGGQRVWLSACLETAGFPLMLIPLTISYIQRFRHRHKPLPSNTISIASEKQNIIS  97

Query  1000  -----FSLSVVIGLMLGVNNLLISWGTSYLPVSTCSLVLASQLVFILFLSAIIVRQKITF  836
                  F  +  +G++ G+++ L ++G + LPVST SL++ASQL F  F + ++V+QK T 
Sbjct  98    MKPPIFFAAAFVGILTGLDDYLYAYGVARLPVSTSSLIIASQLGFTAFFAFLLVKQKFTA  157

Query  835   ANLNCvvlltlaavllaLDSSSDKPAGLTKAKYFVGFFCTVGAALLFALYLPLVEKLYRN  656
               +N V LLT+ A +LA+ +SSD+PAG++  +Y +GF  TV A+ L+   LP VE +Y+ 
Sbjct  158   FTVNAVFLLTVGAGVLAMHTSSDRPAGVSAKQYAIGFSTTVAASALYGFVLPAVELVYKK  217

Query  655   VD---CYamvvemqvvmeaaATVLATVGMAIDGGFSGMKKESQGGFDLGSKAYAMTVGLN  485
             +     Y++V+E Q VM   AT+  T+GM I+  F  + +E++  F LG   Y + + LN
Sbjct  218   IKQPITYSLVMEFQFVMCMFATIFCTIGMIINNDFKMIPREAR-NFGLGESIYYVVLVLN  276

Query  484   VLTWQLCFMGTAGMVFLTTSVTSGICSTALMAFNVVGGVLAYGDHMGGSKAVSTVLCVWG  305
              + WQ  F+G  G+VF  +S+ SGI    L+    V  V+ Y +     K VS VL +WG
Sbjct  277   AIMWQAFFLGAIGVVFCASSLLSGILIAVLLPLTEVLAVVFYKEKFQAEKGVSLVLSLWG  336

Query  304   FSSYVYGMYLKTKKVTKE  251
             F SY YG     K   K+
Sbjct  337   FVSYFYGEIKHAKAEKKK  354



>ref|XP_006354634.1| PREDICTED: probable purine permease 11-like [Solanum tuberosum]
Length=364

 Score =   166 bits (419),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 122/325 (38%), Positives = 193/325 (59%), Gaps = 16/325 (5%)
 Frame = -1

Query  1153  KFYFVHGGSSRWVATWVQCAGFPLLIPAVYLPYYAFNSTERRPFAGFSLRIFSLSVV---  983
             +FY+  GG+S+W+AT VQ A FPLL    ++PY   +S +    A     I ++SVV   
Sbjct  49    RFYYEKGGNSKWMATVVQTAAFPLL----FIPYLFISSPQTHSEASNRPSIITVSVVYFV  104

Query  982   IGLMLGVNNLLISWGTSYLPVSTCSLVLASQLVFILFLSAIIVRQKITFANLNCvvlltl  803
             IG+++  +N+L S G  YL  ST SL+ A+QLVF   LS  +  QK T   +N VV+L+L
Sbjct  105   IGVLVAGDNMLYSIGLLYLSASTYSLICATQLVFSAVLSYFLNHQKFTALIMNSVVVLSL  164

Query  802   aavllaLDSSSDKPAGLTKAKYFVGFFCTVGAALLFALYLPLVEKLYRNV---DCYamvv  632
             +A LLA++  SDKP+G+TK+KY +GF  T+ A+ ++AL L L++  ++ V   + +++V+
Sbjct  165   SASLLAVNEDSDKPSGVTKSKYVIGFLVTLAASAMYALLLSLMQLSFQKVLKKETFSVVL  224

Query  631   emqvvmeaaATVLATVGMAIDGGFSGMKKESQGGFDLGSKAYAMTVGLNVLTWQLCFMGT  452
             EMQ+     AT ++TVG+   G +  +  E  G F  G  AY MT+    + WQ+C +G 
Sbjct  225   EMQIYTAIVATAVSTVGLFASGEWKTLHGE-MGSFTAGKHAYVMTLVWTAIAWQICSVGV  283

Query  451   AGMVFLTTSVTSGICSTALMAFNVVGGVLAYGDHMGGSKAVSTVLCVWGFSSYVYGMYLK  272
              G+VF+ +S+ S + ST  +A   +  V+   D M G KA++ ++ +WGF +Y+Y  Y+ 
Sbjct  284   VGLVFVVSSLFSNVISTLSLAITPIASVMILHDKMNGVKAIAMLMAIWGFCTYIYQNYVD  343

Query  271   TKKVTKEVPPAIGA*SD*TPARRRT  197
               K  K+ P A+ A    TP   R+
Sbjct  344   DLK-AKKAPSAVDA----TPNESRS  363



>ref|XP_003578263.2| PREDICTED: purine permease 3-like [Brachypodium distachyon]
Length=397

 Score =   166 bits (421),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 109/319 (34%), Positives = 186/319 (58%), Gaps = 16/319 (5%)
 Frame = -1

Query  1153  KFYFVHGGSSRWVATWVQCAGFPLLIPAVYLPYY-------AFNSTERRPFAGFSLRIFS  995
             + YF+HGG+ +W+++ +Q AG+PLL+PA+   +        A       P    S R+ +
Sbjct  70    RAYFLHGGNRKWLSSLLQTAGWPLLLPALGFSFVSRRRRRKATKGATAAPLFLMSPRLLA  129

Query  994   LSVVIGLMLGVNNLLISWGTSYLPVSTCSLVLASQLVFILFLSAIIVRQKITFANLNCvv  815
              +V +G M G+++LL ++G +YLPVST S+++++QLVF    + ++VRQ+ T  ++N VV
Sbjct  130   ATVAVGFMTGLDDLLYAYGLAYLPVSTSSILISTQLVFTAAFALLLVRQRFTAFSVNAVV  189

Query  814   lltlaavllaLDSSSDKPAGLTKAKYFVGFFCTVGAALLFALYLPLVE-------KLYRN  656
             LL++ A +L +++  D+PAG+TK +Y  GF  T+GAA L+ L LP++E         Y  
Sbjct  190   LLSVGAAMLGMNAGGDRPAGVTKGQYVAGFAMTLGAAALYGLVLPVMELSQARHAARYGR  249

Query  655   VDCYamvvemqvvmeaaATVLATVGMAIDGGFSGMKKESQGGFDLGSKAYAMTVGLNVLT  476
                YA+V+EMQ V+   AT  + VGM ++  F  +  E++  F LG   Y + +  +   
Sbjct  250   PVTYALVMEMQAVIGLTATAFSAVGMLVNNDFQAIPGEAR-EFGLGQVGYYLLLAGSATV  308

Query  475   WQLCFMGTAGMVFLTTSVTSGICSTALMAFNVVGGVLAYGDHMGGSKAVSTVLCVWGFSS  296
             +Q  F+GT G +F  +++ +G+  T L+    V  V+ + +   G+K ++  L +WGF S
Sbjct  309   YQFFFLGTIGAIFYGSALLAGVIMTVLIPVTEVLAVMFFHEPFNGTKGIALALSLWGFVS  368

Query  295   YVYG-MYLKTKKVTKEVPP  242
             Y+YG +  K  K   + PP
Sbjct  369   YLYGEVRAKAHKSESDKPP  387



>ref|XP_009611006.1| PREDICTED: purine permease 1-like [Nicotiana tomentosiformis]
Length=352

 Score =   165 bits (418),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 119/314 (38%), Positives = 182/314 (58%), Gaps = 18/314 (6%)
 Frame = -1

Query  1153  KFYFVHGGSSRWVATWVQCAGFPL-LIPAVYLPYYAFNSTERRPFAG-------FSLRIF  998
             + Y+V GGS  W+++W+Q AG+PL LIP   L +Y      RR   G        + RIF
Sbjct  34    RLYYVEGGSRVWLSSWLQTAGWPLTLIPLAILYFY------RRKVEGSNAKFYFITPRIF  87

Query  997   SLSVVIGLMLGVNNLLISWGTSYLPVSTCSLVLASQLVFILFLSAIIVRQKITFANLNCv  818
               S VIG++ G+++ L SWG S LPVST SL+LA+QL F    +  IV+ K T  ++N V
Sbjct  88    IASFVIGVVTGLDDFLYSWGGSKLPVSTSSLLLAAQLAFTSVGAFFIVKLKFTPYSINAV  147

Query  817   vlltlaavllaLDSSSDKPAGLTKAKYFVGFFCTVGAALLFALYLPLVEKLY---RNVDC  647
             +LLT+ AVLL + S+ D+P G+T   Y +GF  T+ AA L+ + LP +E +Y   + V  
Sbjct  148   ILLTVGAVLLGVRSNGDRPEGVTSKAYILGFMMTLLAAALYGVILPCIELIYLKAKQVIT  207

Query  646   YamvvemqvvmeaaATVLATVGMAIDGGFSGMKKESQGGFDLGSKAYAMTVGLNVLTWQL  467
               +V+E+Q+VM  AAT   TVGM  +  F  M +E++  F+LG   Y   +    + WQ 
Sbjct  208   ATLVLEIQMVMCFAATAFCTVGMIANNDFQAMSREAK-QFNLGEARYYTVIVWTSIIWQC  266

Query  466   CFMGTAGMVFLTTSVTSGICSTALMAFNVVGGVLAYGDHMGGSKAVSTVLCVWGFSSYVY  287
              F+G  G+++ ++S+ SG+    L+    V  V+ + ++  G K ++  L +WGF SY Y
Sbjct  267   FFVGVIGVIYCSSSLMSGVMIAVLLPVTEVLAVVFFRENFSGEKGLALFLSLWGFVSYFY  326

Query  286   GMYLKTKKVTKEVP  245
             G + +TKK   + P
Sbjct  327   GEFRQTKKQKNKSP  340



>ref|XP_010939715.1| PREDICTED: purine permease 3-like [Elaeis guineensis]
Length=362

 Score =   165 bits (418),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 112/314 (36%), Positives = 184/314 (59%), Gaps = 15/314 (5%)
 Frame = -1

Query  1153  KFYFVHGGSSRWVATWVQCAGFPLLIPAVYLPYYAFNSTERRPFAGFSLRIFSLS-----  989
             + YF+ GG+ +W+++W+Q  G+PLL    ++P     +  RR   G   +++ ++     
Sbjct  46    RLYFLKGGTRKWLSSWLQTGGWPLL----FIPLVISYAHRRRCGGGRPTKLYLITPPLFL  101

Query  988   --VVIGLMLGVNNLLISWGTSYLPVSTCSLVLASQLVFILFLSAIIVRQKITFANLNCvv  815
                V+G ++G+++ L ++G SYLPVST S+++++QL F    +  IV+QK T  ++N VV
Sbjct  102   SCTVLGFLVGLDDFLYAYGMSYLPVSTSSILISTQLGFTALFAFFIVKQKFTSFSVNAVV  161

Query  814   lltlaavllaLDSSSDKPAGLTKAKYFVGFFCTVGAALLFALYLPLVEKLY---RNVDCY  644
             LL++ AV+L L +S D+P G +   Y+ GFF T+ AA+L+   LPLVE  Y   + V  Y
Sbjct  162   LLSIGAVILGLHASGDRPKGESNTLYYWGFFMTLAAAVLYGFILPLVELTYAKAKQVVSY  221

Query  643   amvvemqvvmeaaATVLATVGMAIDGGFSGMKKESQGGFDLGSKAYAMTVGLNVLTWQLC  464
              +V+EMQ+VM   ATV  TVGM ++  F  + +E+Q   +LG   Y   +  + + WQ  
Sbjct  222   TLVIEMQLVMGFFATVFCTVGMLVNNDFHAIPREAQEC-ELGELRYYELLIWSAILWQFF  280

Query  463   FMGTAGMVFLTTSVTSGICSTALMAFNVVGGVLAYGDHMGGSKAVSTVLCVWGFSSYVYG  284
             F+GT G +F  +++ +GI    L+    V  V+ + +   G K V+  L +WGF SY YG
Sbjct  281   FLGTVGAIFYGSALLAGIIMAVLIPVTEVLAVVFFHEPFSGGKGVALALALWGFVSYFYG  340

Query  283   MYLKTKKVTKEVPP  242
              +L++KK    V P
Sbjct  341   EFLESKKKKPLVDP  354



>gb|KDP40961.1| hypothetical protein JCGZ_24960 [Jatropha curcas]
Length=472

 Score =   167 bits (423),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 117/313 (37%), Positives = 179/313 (57%), Gaps = 12/313 (4%)
 Frame = -1

Query  1153  KFYFVHGGSSRWVATWVQCAGFPL-LIPAV--YLPYYAFNSTERRPFAGFSLRIFSLSVV  983
             + YF+ GG + W+++++Q AG+PL L P +  Y+ Y   N   R      S R+F    V
Sbjct  162   RLYFLKGGKAVWISSFLQTAGWPLVLFPLIVSYM-YRRSNKGSRTKLIYISPRLFLACAV  220

Query  982   IGLMLGVNNLLISWGTSYLPVSTCSLVLASQLVFILFLSAIIVRQKITFANLNCvvlltl  803
             IGL+ G+++ L ++G S LPVST +L++A+QL F    + I+V+QK T   +N + LL++
Sbjct  221   IGLLTGLDDFLTAYGVSLLPVSTSALIIATQLGFTAGFAYILVKQKFTPFTINAIFLLSI  280

Query  802   aavllaLDSSSDKPAGLTKAKYFVGFFCTVGAALLFALYLPLVEKLYRNVD---CYamvv  632
              AV+L + +SSD+P   T  KY +GFF T+GA+ L+   LPL+E  Y+       Y +V+
Sbjct  281   GAVVLVIHASSDRPDHETTEKYLLGFFMTLGASALYGFVLPLIELTYKKAKQTITYTLVM  340

Query  631   emqvvmeaaATVLATVGMAIDGGFSGMKKESQGGFDLGSKAYAMTVGLNVLTWQLCFMGT  452
             EMQVV+   AT    +GM +   F  + +E+   F+LG   Y +      + WQL FMG 
Sbjct  341   EMQVVISFFATAFCAIGMLLHKDFEAIPREA-SEFELGRLKYYVVNVFTAVFWQLFFMGA  399

Query  451   AGMVFLTTSVTSGICSTALMAFNVVGGVLAYGDHMGGSKAVSTVLCVWGFSSYVYGMYLK  272
              G+VF  +S+ SGI    L+      GV+ Y +     KA+S VL +WGF SY YG   +
Sbjct  400   VGVVFCDSSLLSGIIIATLLPVTESLGVMFYHEKFHFEKAISLVLSLWGFVSYFYGELQQ  459

Query  271   TKKVTK----EVP  245
              KK ++    E+P
Sbjct  460   NKKKSRTSELEMP  472



>ref|XP_009598031.1| PREDICTED: purine permease 1-like [Nicotiana tomentosiformis]
Length=353

 Score =   164 bits (416),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 115/310 (37%), Positives = 179/310 (58%), Gaps = 6/310 (2%)
 Frame = -1

Query  1153  KFYFVHGGSSRWVATWVQCAGFPL-LIPAVYLPYYAFNST-ERRPFAGFSLRIFSLSVVI  980
             + Y+V GGS  W+++W+Q  G+PL LIP   L YY   +      F   + RIF  S +I
Sbjct  34    RLYYVEGGSRIWLSSWLQTGGWPLTLIPLAILYYYRRKTEGSNAKFYLMTPRIFIASFII  93

Query  979   GLMLGVNNLLISWGTSYLPVSTCSLVLASQLVFILFLSAIIVRQKITFANLNCvvlltla  800
             G+  G+++ L SWG S LPVST SL+LA+QL F    +  IV+ K++  ++N VVLLT+ 
Sbjct  94    GVATGLDDFLYSWGGSKLPVSTSSLLLAAQLAFTAVGAFFIVKLKLSPFSINAVVLLTVG  153

Query  799   avllaLDSSSDKPAGLTKAKYFVGFFCTVGAALLFALYLPLVEKLY---RNVDCYamvve  629
             AVLL + S+ D+P G+T  +Y +GF  T+ AA L+ + LP +E +Y   +      +V+E
Sbjct  154   AVLLGIRSNGDRPEGVTSKEYIIGFMMTLLAAALYGVILPCIELIYMKAKQAITSTLVLE  213

Query  628   mqvvmeaaATVLATVGMAIDGGFSGMKKESQGGFDLGSKAYAMTVGLNVLTWQLCFMGTA  449
             +Q++M  AAT   TVGM  +  F  M +E++  F+LG   Y   +      WQ  F+G  
Sbjct  214   IQMIMSFAATAFCTVGMIANKDFQAMSREAK-QFNLGEARYYTVIVCTAAIWQCFFVGII  272

Query  448   GMVFLTTSVTSGICSTALMAFNVVGGVLAYGDHMGGSKAVSTVLCVWGFSSYVYGMYLKT  269
             G+++ ++S+ SG+    L+    V  V+ + ++  G K ++  L +WGF SY YG + +T
Sbjct  273   GVIYCSSSLMSGVMIAVLLPVTEVLAVIFFKENFSGEKGLALFLSLWGFVSYFYGEFRQT  332

Query  268   KKVTKEVPPA  239
             KK     P A
Sbjct  333   KKQKNTSPEA  342



>ref|XP_006358606.1| PREDICTED: probable purine permease 11-like [Solanum tuberosum]
Length=379

 Score =   165 bits (418),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 117/304 (38%), Positives = 175/304 (58%), Gaps = 12/304 (4%)
 Frame = -1

Query  1153  KFYFVHGGSSRWVATWVQCAGFPLLIPAVYL----PYYAFNSTERRPFAGFSLRIFSLSV  986
             +FY+  GG+S+W+AT+VQ AGFP+L+P  +L       AF+S E+   +     +F + +
Sbjct  66    RFYYDEGGNSKWMATFVQSAGFPILLPLFFLFKSSKNTAFSSREKPSKSS----LFLIYL  121

Query  985   VIGLMLGVNNLLISWGTSYLPVSTCSLVLASQLVFILFLSAIIVRQKITFANLNCvvllt  806
               GLML  +NL+ S+G  YLPVST SL+ ASQL F    S ++  QK T   LN VV++T
Sbjct  122   FFGLMLAGDNLMYSYGLLYLPVSTYSLICASQLAFNCLFSLLLNAQKFTALILNSVVIVT  181

Query  805   laavllaLDSSSDKPAGLTKAKYFVGFFCTVGAALLFALYLPLVEKLYRNV---DCYamv  635
             ++A LLA+ S SD    L+  KY +GF CTV A+  +ALYL L+E  ++ V   + +  +
Sbjct  182   ISAALLAVHSESDTSTKLSAGKYTIGFVCTVAASATYALYLSLLEVTFKRVIKSETFDTI  241

Query  634   vemqvvmeaaATVLATVGMAIDGGFSGMKKESQGGFDLGSKAYAMTVGLNVLTWQLCFMG  455
             ++MQV     A+    VG+   G    +  E   GF+ G  +Y MT+    + WQ+C +G
Sbjct  242   LKMQVFPSFIASCACVVGLYASGEIRILTAE-MNGFNKGEISYLMTLIWTAVLWQICCIG  300

Query  454   TAGMVFLTTSVTSGICSTALMAFNVVGGVLAYGDHMGGSKAVSTVLCVWGFSSYVYGMYL  275
               G++F  +S+ S + ST  +    V  V+ + D M G K ++ +L VWGF SYVY  YL
Sbjct  301   LLGLIFEVSSLFSNVISTLGLPAVPVLAVIFFHDKMDGEKIIALLLAVWGFLSYVYQNYL  360

Query  274   KTKK  263
                K
Sbjct  361   DDSK  364



>ref|XP_009776518.1| PREDICTED: purine permease 1-like [Nicotiana sylvestris]
Length=352

 Score =   164 bits (416),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 116/308 (38%), Positives = 180/308 (58%), Gaps = 6/308 (2%)
 Frame = -1

Query  1153  KFYFVHGGSSRWVATWVQCAGFPL-LIPAVYLPYYAFNSTERRPFAGF-SLRIFSLSVVI  980
             + Y+V GGS  W ++W+Q AG+P  LIP   L +Y   + +      F + RIF  S VI
Sbjct  34    RLYYVEGGSRVWFSSWLQTAGWPFTLIPLAILYFYRRKTEDSNAKLYFITPRIFIASFVI  93

Query  979   GLMLGVNNLLISWGTSYLPVSTCSLVLASQLVFILFLSAIIVRQKITFANLNCvvlltla  800
             G++ GV++ L SWG S LPVST SL+LA+QL F    +  IV+ K T  ++N VVLLT+ 
Sbjct  94    GVVTGVDDFLYSWGGSKLPVSTSSLLLAAQLAFTAIGAFFIVKLKFTPYSINAVVLLTVG  153

Query  799   avllaLDSSSDKPAGLTKAKYFVGFFCTVGAALLFALYLPLVEKLY---RNVDCYamvve  629
             AVLL + S+ D+P G+T   Y +GF  T+ AA L+ + LP +E +Y   +      +V+E
Sbjct  154   AVLLGVRSNGDRPEGVTSKSYILGFMMTLLAAALYGVILPCIELIYLKAKQAITATLVLE  213

Query  628   mqvvmeaaATVLATVGMAIDGGFSGMKKESQGGFDLGSKAYAMTVGLNVLTWQLCFMGTA  449
             +Q+VM  AATV  T+GM  +  F  + +E++  F+LG   Y   +    + WQ  F+G  
Sbjct  214   IQMVMCFAATVFCTIGMIANNDFQAISREAK-QFNLGEARYYTVIVWTTIIWQCFFVGVI  272

Query  448   GMVFLTTSVTSGICSTALMAFNVVGGVLAYGDHMGGSKAVSTVLCVWGFSSYVYGMYLKT  269
             G+++ ++S+ SG+    L+    V  V+ + ++  G K ++  L +WGF SY YG + +T
Sbjct  273   GVIYCSSSLMSGVMIAVLLPVTEVLAVVFFRENFSGEKGLALFLSLWGFVSYFYGEFRQT  332

Query  268   KKVTKEVP  245
             KK   + P
Sbjct  333   KKQKNKSP  340



>gb|AFK45074.1| unknown [Lotus japonicus]
Length=364

 Score =   164 bits (416),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 114/304 (38%), Positives = 180/304 (59%), Gaps = 10/304 (3%)
 Frame = -1

Query  1153  KFYFVHGGSSRWVATWVQCAGFPLL-IPAVYLPYYAFNSTERRPFAGFSLRIFSLSVVIG  977
             +FY+  GG+S+W+AT VQ A FP+L IP   +P  +  ST   P   F + +  +  V+G
Sbjct  50    RFYYDQGGNSKWIATLVQTAAFPILFIPFFAIPSSSEASTSSAP-PSFKVIVL-IYFVLG  107

Query  976   LMLGVNNLLISWGTSYLPVSTCSLVLASQLVFILFLSAIIVRQKITFANLNCvvlltlaa  797
             +++  +N++ S G  YL  ST SL+ ASQL F    S  I  QK T   +N  V+LT +A
Sbjct  108   VLIAADNMMYSTGLLYLSASTYSLICASQLAFNAVFSYFINSQKFTALIINSTVVLTFSA  167

Query  796   vllaLDSSSDKPAGLTKAKYFVGFFCTVGAALLFALYLPLVEKLYRNV---DCYamvvem  626
              LLA++  SDKP GL++ KY VGF  T+GA+ L++L L L++  +  V   + +++V+EM
Sbjct  168   SLLAVNEDSDKPDGLSQGKYIVGFLVTLGASALYSLILSLMQLSFDKVLKKETFSVVLEM  227

Query  625   qvvmeaaATVLATVGMAIDGGFSGMKKESQGGFDLGSKAYAMTVGLNVLTWQLCFMGTAG  446
             Q+     AT  +T+G+   G +  +  E +G F  G  AY +T+    + WQ+C +G  G
Sbjct  228   QIYTSLVATCASTIGLFASGEWHSLHGEMEG-FKKGEVAYVLTLVWTAVAWQVCSVGVVG  286

Query  445   MVFLTTSVTSGICSTALMAFNVVGGVLAYGDHMGGSKAVSTVLCVWGFSSYVYGMY---L  275
             ++FL +S+ S + ST  +A   +  V+ + D M G K +S +L +WGF+SY+Y  Y   L
Sbjct  287   LIFLVSSLYSNVISTVSLAVTPIASVIVFHDKMNGVKIISMLLAIWGFASYIYQNYIDDL  346

Query  274   KTKK  263
             KT++
Sbjct  347   KTRR  350



>emb|CDP01126.1| unnamed protein product [Coffea canephora]
Length=353

 Score =   164 bits (416),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 109/307 (36%), Positives = 174/307 (57%), Gaps = 7/307 (2%)
 Frame = -1

Query  1153  KFYFVHGGSSRWVATWVQCAGFPLLIPAVYLPYYAFNSTE--RRPFAGFSLRIFSLSVVI  980
             + YFV GG   W+++W+Q  GFP++   + + Y+    TE            +F  +  +
Sbjct  33    RLYFVKGGKRIWLSSWLQTVGFPIIAIPLLISYFHRRKTEGPNTKLVLMKYPLFIAAAAV  92

Query  979   GLMLGVNNLLISWGTSYLPVSTCSLVLASQLVFILFLSAIIVRQKITFANLNCvvlltla  800
             GL+ G+++ L ++G + LPVST S+++ASQL F    + ++V+QK T  ++N VVLLT+ 
Sbjct  93    GLVTGIDDYLYAYGMARLPVSTSSIIIASQLAFTAVFAFLLVKQKFTAYSVNAVVLLTVG  152

Query  799   avllaLDSSSDKPAGLTKAKYFVGFFCTVGAALLFALYLPLVEKLY---RNVDCYamvve  629
             A +LA+ SSSD+P G +   Y +GF  TV AA+L+   LP+VE +Y   +    Y +V+E
Sbjct  153   AGVLAMHSSSDRPKGESTKMYVLGFLMTVAAAVLYGFILPVVELMYLKAKQAITYTLVLE  212

Query  628   mqvvmeaaATVLATVGMAIDGGFSGMKKESQGGFDLGSKAYAMTVGLNVLTWQLCFMGTA  449
             +Q+VM   ATV  TVGM     F  M +E++  + LG   Y + V  + + WQ  F+G  
Sbjct  213   IQLVMCLFATVFCTVGMIAKKDFQAMAREAR-AYALGEAEYYLVVTWSAVIWQFFFLGVI  271

Query  448   GMVFLTTSVTSGICSTALMAFNVVGGVLAYGDHMGGSKAVSTVLCVWGFSSYVYGMYLKT  269
             G++F  +S+ S I    L+    V  V+ + +     K V+  L +WGF SY YG  +K 
Sbjct  272   GVIFCASSLLSAIMIAVLLPVTEVIAVIVFQEKFQAEKGVALFLSLWGFVSYFYG-EIKN  330

Query  268   KKVTKEV  248
             KK  +E+
Sbjct  331   KKSKEEI  337



>ref|XP_010263027.1| PREDICTED: purine permease 3-like [Nelumbo nucifera]
Length=365

 Score =   164 bits (416),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 108/300 (36%), Positives = 174/300 (58%), Gaps = 6/300 (2%)
 Frame = -1

Query  1153  KFYFVHGGSSRWVATWVQCAGFPLLIPAVYLPYYAFNSTERRPFAGFSLRIFSLSVVIGL  974
             + YF+HGG+ +W+ +W+Q AG P+L+  + + Y    ++  R  A    ++  LS  IG+
Sbjct  59    RLYFLHGGNRKWIPSWLQTAGVPVLLGPLTVLYLRERASGVRFLA--PTKLLLLSAGIGI  116

Query  973   MLGVNNLLISWGTSYLPVSTCSLVLASQLVFILFLSAIIVRQKITFANLNCvvlltlaav  794
             ++G+N+ + S G S+LPVST +L+L++QL F    + +I +QK T  ++N VVL+TL A 
Sbjct  117   LVGLNDFMYSHGLSFLPVSTSALLLSTQLGFTALFALLIAKQKFTPYSINAVVLMTLGAA  176

Query  793   llaLDSSSDKPAGLTKAKYFVGFFCTVGAALLFALYLPLVEKLY---RNVDCYamvvemq  623
             LL L  S D+  G++   Y++GF  T+GAA L    LP  E  Y   R    Y++V++ Q
Sbjct  177   LLGLSKSGDRLLGVSNRDYWLGFVLTLGAAGLLGFILPCCEVAYATARKTITYSVVLQFQ  236

Query  622   vvmeaaATVLATVGMAIDGGFSGMKKESQGGFDLGSKAYAMTVGLNVLTWQLCFMGTAGM  443
               +   ATV  T+GM I+  F  + +E+   F+LG+  Y + +    + WQ+  +GT G+
Sbjct  237   FGVNFFATVFCTIGMLINKDFQAIPREAN-AFELGAVKYYLVLVSIAIVWQMAGVGTLGV  295

Query  442   VFLTTSVTSGICSTALMAFNVVGGVLAYGDHMGGSKAVSTVLCVWGFSSYVYGMYLKTKK  263
             VF TTS+ +G+ +  L+       V+ Y +   G K ++  LC WGF SY YG Y + KK
Sbjct  296   VFSTTSLFAGVLNATLLPLTETAAVIVYHEKFTGEKGMALALCSWGFISYFYGSYKEKKK  355



>ref|XP_002285718.1| PREDICTED: purine permease 1 [Vitis vinifera]
Length=351

 Score =   164 bits (414),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 105/308 (34%), Positives = 178/308 (58%), Gaps = 6/308 (2%)
 Frame = -1

Query  1153  KFYFVHGGSSRWVATWVQCAGFPLLIPAVYLPYYAFNSTERRPFAGFSLR--IFSLSVVI  980
             + YFV GG   W ++W++ AG+PL++  + + Y    + +      F ++  +F  S VI
Sbjct  35    RLYFVRGGERIWFSSWLETAGWPLILVPLIITYMHRRTKQGSHAKLFFMKPPLFVASAVI  94

Query  979   GLMLGVNNLLISWGTSYLPVSTCSLVLASQLVFILFLSAIIVRQKITFANLNCvvlltla  800
             G++  +++ L ++G + LPVST +L++ASQL F    + ++V+QK T  ++N + LL++ 
Sbjct  95    GVLTALDDYLYAYGVAKLPVSTIALIIASQLAFTAAFAFLLVKQKFTSYSVNAIFLLSIG  154

Query  799   avllaLDSSSDKPAGLTKAKYFVGFFCTVGAALLFALYLPLVEKLYRNVD---CYamvve  629
             A +LAL +SSD+PA  +  +Y++GFF T+ AA L+   LPLVE  Y+       Y++V+E
Sbjct  155   AGVLALHTSSDRPANESNKEYYLGFFMTLAAAALYGFILPLVELTYKKAKQAITYSLVME  214

Query  628   mqvvmeaaATVLATVGMAIDGGFSGMKKESQGGFDLGSKAYAMTVGLNVLTWQLCFMGTA  449
             +Q+VM   AT   TVGM ++  F  + +E++  ++LG   Y + V  N + WQ  ++G  
Sbjct  215   IQMVMCFFATFFCTVGMLVNNDFQAIPREAK-EYELGEAKYYLVVVWNGIMWQCFYLGAI  273

Query  448   GMVFLTTSVTSGICSTALMAFNVVGGVLAYGDHMGGSKAVSTVLCVWGFSSYVYGMYLKT  269
             G++F  +S+ +GI    L+    +  V+ + D     K VS  L +WGF SY YG    +
Sbjct  274   GVIFCASSLVAGIVLAVLLPVTEILAVIFFHDKFQAEKGVSLALSLWGFVSYFYGEIKDS  333

Query  268   KKVTKEVP  245
             KK     P
Sbjct  334   KKKKNPTP  341



>ref|XP_009769306.1| PREDICTED: purine permease 1-like [Nicotiana sylvestris]
Length=352

 Score =   164 bits (414),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 119/314 (38%), Positives = 180/314 (57%), Gaps = 18/314 (6%)
 Frame = -1

Query  1153  KFYFVHGGSSRWVATWVQCAGFPL-LIPAVYLPYYAFNSTERRPFAG-------FSLRIF  998
             + Y+V GGS  W ++W+Q AG+P  LIP   L +Y      RR   G        + RIF
Sbjct  34    RLYYVEGGSRVWFSSWLQTAGWPFTLIPLAILYFY------RRKTEGSNAKLYFITPRIF  87

Query  997   SLSVVIGLMLGVNNLLISWGTSYLPVSTCSLVLASQLVFILFLSAIIVRQKITFANLNCv  818
               S VIG++ GV++ L SWG S LPVST SL+LA+QL F    +  IV+ K T  ++N V
Sbjct  88    IASFVIGVVTGVDDFLYSWGGSKLPVSTSSLLLAAQLAFTAIGAFFIVKLKFTPYSINAV  147

Query  817   vlltlaavllaLDSSSDKPAGLTKAKYFVGFFCTVGAALLFALYLPLVEKLY---RNVDC  647
             VLLT+ AVLL + S+ D+P G+T   Y +GF  T+ AA L+ + LP +E +Y   +    
Sbjct  148   VLLTVGAVLLGVRSNGDRPEGVTSKAYILGFMMTLLAAALYGVILPCIELIYLKAKQAIT  207

Query  646   YamvvemqvvmeaaATVLATVGMAIDGGFSGMKKESQGGFDLGSKAYAMTVGLNVLTWQL  467
               +V+E+Q+VM  AATV  T+GM  +  F  + KE++  F+LG   Y   +    + WQ 
Sbjct  208   ATLVLEIQMVMCFAATVFCTIGMIANNDFQAISKEAK-QFNLGEARYYTVIVWTTIIWQC  266

Query  466   CFMGTAGMVFLTTSVTSGICSTALMAFNVVGGVLAYGDHMGGSKAVSTVLCVWGFSSYVY  287
              F+G  G+++ ++S+ SG+    L+    V  V+ + ++  G K ++  L +WGF SY Y
Sbjct  267   FFVGVIGVIYCSSSLMSGVMIAVLLPVTEVLAVVFFRENFSGEKGLALFLSLWGFVSYFY  326

Query  286   GMYLKTKKVTKEVP  245
             G + +TKK   + P
Sbjct  327   GEFRQTKKQKNKSP  340



>ref|XP_010060063.1| PREDICTED: purine permease 3-like isoform X1 [Eucalyptus grandis]
 ref|XP_010060064.1| PREDICTED: purine permease 3-like isoform X2 [Eucalyptus grandis]
 ref|XP_010060065.1| PREDICTED: purine permease 3-like isoform X1 [Eucalyptus grandis]
 gb|KCW66595.1| hypothetical protein EUGRSUZ_F00389 [Eucalyptus grandis]
Length=360

 Score =   164 bits (415),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 109/304 (36%), Positives = 180/304 (59%), Gaps = 16/304 (5%)
 Frame = -1

Query  1153  KFYFVHGGSSRWVATWVQCAGFPLLIPAVYLPYYAFNSTERRPFAGFSLRI-------FS  995
             + YF+HGG   W+++W++  G+P++   + + Y+      RR   G S R+       F+
Sbjct  37    RLYFLHGGKRVWLSSWLETGGWPIIFIPLAVAYF-----RRRAAEGPSARLILMDPFLFA  91

Query  994   LSVVIGLMLGVNNLLISWGTSYLPVSTCSLVLASQLVFILFLSAIIVRQKITFANLNCvv  815
              + VIG++ G+++ L ++G + LPVST +L++A+QL F    + ++VRQ  T  ++N V 
Sbjct  92    AAAVIGVLTGLDDYLYAYGVARLPVSTSALLIATQLAFTAGFAFLLVRQLFTSYSVNSVF  151

Query  814   lltlaavllaLDSSSDKPAGLTKAKYFVGFFCTVGAALLFALYLPLVEKLYRNVD---CY  644
             LLT+ A +LA+ +SSD+PAG +K +Y+ GFF T+GAA L+   LPLVE  Y+       Y
Sbjct  152   LLTMGAGVLAMHTSSDRPAGESKGEYYAGFFMTLGAAALYGFVLPLVELTYKKAKQTVTY  211

Query  643   amvvemqvvmeaaATVLATVGMAIDGGFSGMKKESQGGFDLGSKAYAMTVGLNVLTWQLC  464
             ++V+E Q+VM   AT   TVGM ++  F  + +E++  F LG   Y + +  + + WQ  
Sbjct  212   SLVLEFQLVMCFFATAFNTVGMLVNKDFQAIPEEAR-NFTLGETRYYVVLVWSGIIWQFF  270

Query  463   FMGTAGMVFLTTSVTSGICSTALMAFNVVGGVLAYGDHMGGSKAVSTVLCVWGFSSYVYG  284
             F+G  G++   +S+ SGI    L+    + GV+ + +     KAVS VL +WGF SY YG
Sbjct  271   FLGAIGVIHYASSLFSGIMIAVLLPITEILGVICFHEKFQVEKAVSLVLSLWGFVSYFYG  330

Query  283   MYLK  272
              + +
Sbjct  331   EFKR  334



>gb|ADP30798.1| nicotine uptake permease 1 [Nicotiana tabacum]
Length=353

 Score =   164 bits (414),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 115/310 (37%), Positives = 179/310 (58%), Gaps = 6/310 (2%)
 Frame = -1

Query  1153  KFYFVHGGSSRWVATWVQCAGFPL-LIPAVYLPYYAFNST-ERRPFAGFSLRIFSLSVVI  980
             + Y+V GGS  W+++W+Q  G+PL LIP   L YY   +      F   + RIF  S VI
Sbjct  34    RLYYVEGGSRIWLSSWLQTGGWPLTLIPLAILYYYRRKTEGSNAKFYLMTPRIFIASFVI  93

Query  979   GLMLGVNNLLISWGTSYLPVSTCSLVLASQLVFILFLSAIIVRQKITFANLNCvvlltla  800
             G+  G+++ L SWG S LPVST SL+LA+QL F    +  IV+ K++  ++N VVLLT+ 
Sbjct  94    GVATGLDDFLYSWGGSKLPVSTSSLLLAAQLAFTAVGAFFIVKLKLSPFSINAVVLLTVG  153

Query  799   avllaLDSSSDKPAGLTKAKYFVGFFCTVGAALLFALYLPLVEKLY---RNVDCYamvve  629
             AVLL + S+ D+P G+T  +Y +GF  T+ AA L+ + LP +E +Y   +      +V+E
Sbjct  154   AVLLGIRSNGDRPEGVTSKEYIIGFMMTLLAAALYGVILPCIELIYMKAKQAITSTLVLE  213

Query  628   mqvvmeaaATVLATVGMAIDGGFSGMKKESQGGFDLGSKAYAMTVGLNVLTWQLCFMGTA  449
             +Q++M  AAT   TVGM  +  F  M +E++  F++G   Y   +      WQ  F+G  
Sbjct  214   IQMIMSFAATAFCTVGMIANKDFQAMSREAK-QFNVGEARYYTVIVCTAAIWQCFFVGII  272

Query  448   GMVFLTTSVTSGICSTALMAFNVVGGVLAYGDHMGGSKAVSTVLCVWGFSSYVYGMYLKT  269
             G+++ ++S+ SG+    L+    V  V+ + ++  G K ++  L +WGF SY YG + +T
Sbjct  273   GVIYCSSSLMSGVMIAVLLPVTEVLAVIFFKENFSGEKGLALFLSLWGFVSYFYGEFRQT  332

Query  268   KKVTKEVPPA  239
             KK     P A
Sbjct  333   KKQKNTSPEA  342



>ref|XP_009380886.1| PREDICTED: purine permease 3-like [Musa acuminata subsp. malaccensis]
Length=365

 Score =   164 bits (414),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 108/316 (34%), Positives = 182/316 (58%), Gaps = 12/316 (4%)
 Frame = -1

Query  1153  KFYFVHGGSSRWVATWVQCAGFPLLIPAVYLPY-YAFNSTERRP-------FAGFSLRIF  998
             + Y+  GG  +W+++W++ AG+P +   + + Y +     + RP           + R+F
Sbjct  47    RLYYRSGGKRQWLSSWLETAGWPFIFVPLLITYLHRRRRCQLRPGNCHPTKLFFITPRLF  106

Query  997   SLSVVIGLMLGVNNLLISWGTSYLPVSTCSLVLASQLVFILFLSAIIVRQKITFANLNCv  818
                  IGL+ G ++ L ++G S+LPVST SL++++QL F  F + +IV+QK T  ++N V
Sbjct  107   LACAFIGLITGFDDFLYAYGLSFLPVSTSSLLISTQLAFTAFFAFLIVKQKFTPYSINSV  166

Query  817   vlltlaavllaLDSSSDKPAGLTKAKYFVGFFCTVGAALLFALYLPLVEKLY---RNVDC  647
              LLT+ AV+L L  SSD+P  +T+ +Y +GF  T+GAA L+ L LPLVE +Y   +    
Sbjct  167   ALLTVGAVVLGLHVSSDRPDNVTRGQYHLGFILTLGAAALYGLILPLVELMYSKSKQAIT  226

Query  646   YamvvemqvvmeaaATVLATVGMAIDGGFSGMKKESQGGFDLGSKAYAMTVGLNVLTWQL  467
             Y +V+EMQ+VM   AT   TVGM ++  F  + +E++  F+LG   Y + +  + + WQ 
Sbjct  227   YTLVMEMQLVMGFFATAFCTVGMLVNKDFQAIPREARH-FELGEFRYYVVLVWSAVFWQF  285

Query  466   CFMGTAGMVFLTTSVTSGICSTALMAFNVVGGVLAYGDHMGGSKAVSTVLCVWGFSSYVY  287
              F+GT G++F   ++ +GI     +    V GV+ + ++    K ++ VL +WG +SY Y
Sbjct  286   FFLGTVGIIFCVNTLLAGILIALFIPVTEVLGVVFFKENFSSEKGIALVLSLWGLASYSY  345

Query  286   GMYLKTKKVTKEVPPA  239
             G Y + K    +  P+
Sbjct  346   GEYRQEKDKKDKAAPS  361



>ref|XP_009763953.1| PREDICTED: purine permease 3-like [Nicotiana sylvestris]
 gb|ADP30799.1| nicotine uptake permease 2 [Nicotiana tabacum]
Length=352

 Score =   163 bits (413),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 115/316 (36%), Positives = 180/316 (57%), Gaps = 18/316 (6%)
 Frame = -1

Query  1153  KFYFVHGGSSRWVATWVQCAGFPL-LIPAVYLPYYAFNSTERRPFAG-------FSLRIF  998
             + Y+V GGS  W+++W+Q  G+PL  IP  +L YY      RR   G        + RIF
Sbjct  34    RLYYVEGGSRIWLSSWLQTGGWPLTFIPLAFLYYY------RRKIEGSNAKFYLMTPRIF  87

Query  997   SLSVVIGLMLGVNNLLISWGTSYLPVSTCSLVLASQLVFILFLSAIIVRQKITFANLNCv  818
               + VIG+  G+++ L SWG S LPVST SL+LA+QL F    +  IV+ K++  ++N V
Sbjct  88    IAAFVIGIATGLDDFLYSWGGSKLPVSTSSLLLAAQLAFTAVGAFFIVKLKLSPFSINAV  147

Query  817   vlltlaavllaLDSSSDKPAGLTKAKYFVGFFCTVGAALLFALYLPLVEKLY---RNVDC  647
             VLLT+ AVLL + S+ D+P G+T  +Y +GF  T+ AA L+ + LP +E +Y   +    
Sbjct  148   VLLTVGAVLLGIRSNGDRPEGVTSKEYIIGFMMTLLAAALYGVILPCIELIYMKAKQAIT  207

Query  646   YamvvemqvvmeaaATVLATVGMAIDGGFSGMKKESQGGFDLGSKAYAMTVGLNVLTWQL  467
               +V+E+Q++M  AAT   TVGM  +  F  M +E++  F+LG   Y   +      W+ 
Sbjct  208   ATLVLEIQMIMSFAATAFCTVGMIANKDFQAMSREAK-QFNLGEARYYTVIVCTAAIWEC  266

Query  466   CFMGTAGMVFLTTSVTSGICSTALMAFNVVGGVLAYGDHMGGSKAVSTVLCVWGFSSYVY  287
              F+G  G+++ ++S+ SG+    L+    V  V+ + +   G K ++  L +WGF SY Y
Sbjct  267   FFVGIIGVIYCSSSLMSGVMIAVLLPVTEVLAVIFFKEKFSGEKGLALFLSLWGFVSYFY  326

Query  286   GMYLKTKKVTKEVPPA  239
             G + +TKK   + P A
Sbjct  327   GEFRQTKKEKNKSPEA  342



>ref|XP_002893512.1| ATPUP3 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH69771.1| ATPUP3 [Arabidopsis lyrata subsp. lyrata]
Length=348

 Score =   163 bits (412),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 110/315 (35%), Positives = 178/315 (57%), Gaps = 13/315 (4%)
 Frame = -1

Query  1153  KFYFVHGGSSRWVATWVQCAGFPLLIPAVYLPYYAF----NSTERRPFAGFSLRIFSLSV  986
             + YF +GG   W +T+++ AGFP++   +   Y A     N  +   F     R+  ++V
Sbjct  25    RLYFNNGGKRIWFSTFLETAGFPVIFIPLLFSYIARRRSNNVGDDTSFFLIKPRLLIVAV  84

Query  985   VIGLMLGVNNLLISWGTSYLPVSTCSLVLASQLVFILFLSAIIVRQKITFANLNCvvllt  806
              IG++ G +N L ++G +YLPVST +L++ASQL FI   S  +V+ K T   +N VVLLT
Sbjct  85    FIGILSGFDNYLYAYGIAYLPVSTAALIIASQLAFIAIFSFFMVKHKFTPFTINAVVLLT  144

Query  805   laavllaLDSSSDKPAGLTKAKYFVGFFCTVGAALLFALYLPLVEKLY---RNVDCYamv  635
             + A +L + + +DKP   T  +Y +GF  TV AA+++A  LPLVE  Y   R    Y +V
Sbjct  145   VGAAVLGMHTETDKPVHETHKQYIIGFLMTVAAAVMYAFILPLVELAYQKARQPMSYTLV  204

Query  634   vemqvvmeaaATVLATVGMAIDGGFSGMKKESQGGFDLGSKAYAMTVGLNVLTWQLCFMG  455
             +E Q+++   A++++ +GM I G F  + KE++  F LG   + +    + + WQ  F+G
Sbjct  205   LEFQLILCFLASIVSVIGMFIAGDFKALPKEAR-EFKLGEALFYVVAVFSAIIWQGFFLG  263

Query  454   TAGMVFLTTSVTSGICSTALMAFNVVGGVLAYGDHMGGSKAVSTVLCVWGFSSYVYGMYL  275
               G++F T+S+ SGI  + L+    V  V+ Y +     K +S  L +WGF SY YG  +
Sbjct  264   AIGLIFCTSSLVSGIMISVLLPITEVLAVIFYHEKFQAEKGLSLALSLWGFVSYFYGE-I  322

Query  274   KT----KKVTKEVPP  242
             K+    K++ +E  P
Sbjct  323   KSGKDKKRIQQEESP  337



>ref|XP_010266597.1| PREDICTED: purine permease 3-like [Nelumbo nucifera]
Length=369

 Score =   164 bits (414),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 100/312 (32%), Positives = 181/312 (58%), Gaps = 10/312 (3%)
 Frame = -1

Query  1153  KFYFVHGGSSRWVATWVQCAGFPLLIPAVYLPYYAFNSTERRPFAG------FSLRIFSL  992
             + YF+HGG   W ++W++ AG+P+L+  +   Y    S ++    G         R+F+ 
Sbjct  51    RLYFLHGGKRIWFSSWLETAGWPILLLPLLFSYSYRRSQDQGEERGSTRLFLIKPRLFAA  110

Query  991   SVVIGLMLGVNNLLISWGTSYLPVSTCSLVLASQLVFILFLSAIIVRQKITFANLNCvvl  812
             S ++G++ G+++ L ++G S LPVST +L+ ++QL+F    +  +VRQ  T  ++N +V+
Sbjct  111   SAILGIITGLDDYLYAYGLSRLPVSTSALIASTQLIFTAIFAFFLVRQTFTSYSINSIVM  170

Query  811   ltlaavllaLDSSSDKPAGLTKAKYFVGFFCTVGAALLFALYLPLVEKLYRNVD---CYa  641
             LT+ A+++AL + SD+P+  +  +Y+ GFF T+GA+ L+ L LPLVE  Y+  +    Y+
Sbjct  171   LTIGALVMALHTGSDRPSNESNTQYYTGFFMTIGASALYGLVLPLVELTYKKSNQLITYS  230

Query  640   mvvemqvvmeaaATVLATVGMAIDGGFSGMKKESQGGFDLGSKAYAMTVGLNVLTWQLCF  461
             +V+EMQ+V+   AT   ++GM ++  F  + K++   +++G   Y + +  + + WQL F
Sbjct  231   LVIEMQLVISIFATAFCSLGMLVNNDFKSIPKDAS-EYEIGEAKYYLVIVWSAILWQLFF  289

Query  460   MGTAGMVFLTTSVTSGICSTALMAFNVVGGVLAYGDHMGGSKAVSTVLCVWGFSSYVYGM  281
             +G  G++F  +S+  GI   A++    +  V+   +     K +S  LC+WGF+SY YG 
Sbjct  290   LGLVGVIFCGSSMLGGIIIAAVIPVTEILAVIFCREKFKAEKGISLALCLWGFTSYFYGE  349

Query  280   YLKTKKVTKEVP  245
                  K   E P
Sbjct  350   IKGPSKKNSETP  361



>ref|XP_009143832.1| PREDICTED: purine permease 2 isoform X1 [Brassica rapa]
Length=351

 Score =   163 bits (412),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 122/313 (39%), Positives = 180/313 (58%), Gaps = 13/313 (4%)
 Frame = -1

Query  1153  KFYFVHGGSSRWVATWVQCAGFPL-LIPAVY--LPYYAFNSTERRPFAGFSL---RIFSL  992
             + YF +GG   W ++++Q +G P+ L+P ++  L  +     +  P     L    +F  
Sbjct  27    RLYFRNGGKRIWFSSFLQTSGCPIILLPLLFSFLTRHRQQQEQEEPKTTLFLIKPPLFLA  86

Query  991   SVVIGLMLGVNNLLISWGTSYLPVSTCSLVLASQLVFILFLSAIIVRQKITFANLNCvvl  812
             SVV+GL++G +N L ++G +YLPVST SL+++SQL F    +  +V+Q+ T   +N VVL
Sbjct  87    SVVVGLLIGFDNYLYAYGLAYLPVSTSSLIISSQLAFTALFAFFMVKQRFTPFTINAVVL  146

Query  811   ltlaavllaLDSSSDKPAGLTKAKYFVGFFCTVGAALLFALYLPLVEKLYRNVD---CYa  641
             LTL A  LAL +  DK    T+ +Y VGF  TV AA+L+A  LPLVE  Y+       Y 
Sbjct  147   LTLGAGSLALHADGDKLPKETRKEYIVGFVMTVAAAVLYAFVLPLVELAYKKASQRISYT  206

Query  640   mvvemqvvmeaaATVLATVGMAIDGGFSGMKKESQGGFDL-GSKAYAMTVGLNVLTWQLC  464
             +V+EMQ+V+   AT L  VGM  DG F  + +E++  F L GSK Y + V    + WQ  
Sbjct  207   LVLEMQLVLCVVATCLCLVGMLADGDFKELGREAR-EFKLGGSKHYCLVVAFTAVIWQGF  265

Query  463   FMGTAGMVFLTTSVTSGICSTALMAFNVVGGVLAYGDHMGGSKAVSTVLCVWGFSSYVYG  284
             F+G+ GM+F  +S+ SG+  +AL+    V  VL + +    +K VS  L +WGF SY YG
Sbjct  266   FLGSIGMIFCASSLVSGVLISALLPLTEVLAVLFFKEKFQAAKGVSLFLSLWGFVSYFYG  325

Query  283   MYL--KTKKVTKE  251
                  K KK T+E
Sbjct  326   KIQSEKEKKKTQE  338



>ref|XP_009765499.1| PREDICTED: purine permease 1-like [Nicotiana sylvestris]
Length=352

 Score =   163 bits (412),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 116/308 (38%), Positives = 179/308 (58%), Gaps = 6/308 (2%)
 Frame = -1

Query  1153  KFYFVHGGSSRWVATWVQCAGFPL-LIPAVYLPYYAFNSTERRPFAGF-SLRIFSLSVVI  980
             + Y+V GGS  W ++W+Q AG+P  LIP   L +Y   +        F + RIF  S +I
Sbjct  34    RLYYVEGGSRVWFSSWLQTAGWPFTLIPLAILYFYRRKTESSSAKLYFITPRIFIASFII  93

Query  979   GLMLGVNNLLISWGTSYLPVSTCSLVLASQLVFILFLSAIIVRQKITFANLNCvvlltla  800
             G++ GV++ L SWG S LPVST SL+LA+QL F    +  IV+ K T  ++N VVLLT+ 
Sbjct  94    GIVTGVDDFLYSWGGSKLPVSTSSLLLAAQLAFTAIGAFFIVKLKFTPYSINAVVLLTVG  153

Query  799   avllaLDSSSDKPAGLTKAKYFVGFFCTVGAALLFALYLPLVEKLY---RNVDCYamvve  629
             AVLL + S+ D+P G+T   Y +GF  T+ AA L+ + LP +E +Y   +      +V+E
Sbjct  154   AVLLGVRSNGDRPEGVTSKAYILGFMMTLLAAALYGVILPCIELIYLKAKQAITATLVLE  213

Query  628   mqvvmeaaATVLATVGMAIDGGFSGMKKESQGGFDLGSKAYAMTVGLNVLTWQLCFMGTA  449
             +Q+VM  AATV  TVGM  +  F  + +E++  F+LG   Y   +    + WQ  F+G  
Sbjct  214   IQMVMCFAATVFCTVGMIANNDFQAISREAK-QFNLGEARYYTVIIWTTIIWQCFFVGVI  272

Query  448   GMVFLTTSVTSGICSTALMAFNVVGGVLAYGDHMGGSKAVSTVLCVWGFSSYVYGMYLKT  269
             G+++ ++S+ SG+    L+    V  V+ + ++  G K ++  L +WGF SY YG + +T
Sbjct  273   GVIYCSSSLMSGVMIAVLLPVTEVLAVVFFRENFSGEKGLALFLSLWGFVSYFYGEFRQT  332

Query  268   KKVTKEVP  245
             KK   + P
Sbjct  333   KKQKNKSP  340



>ref|XP_002285717.1| PREDICTED: purine permease 1 [Vitis vinifera]
 emb|CAN64392.1| hypothetical protein VITISV_015235 [Vitis vinifera]
Length=349

 Score =   162 bits (411),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 106/308 (34%), Positives = 177/308 (57%), Gaps = 6/308 (2%)
 Frame = -1

Query  1153  KFYFVHGGSSRWVATWVQCAGFPLLIPAVYLPYYAFNSTERRPFAGFSLR--IFSLSVVI  980
             + YFV GG   W ++W++ AG+PL++  + + Y    + +      F ++  +F  S VI
Sbjct  33    RLYFVRGGERIWFSSWLETAGWPLILVPLIITYIHRRTKQGSHAKLFFMKPPLFVASAVI  92

Query  979   GLMLGVNNLLISWGTSYLPVSTCSLVLASQLVFILFLSAIIVRQKITFANLNCvvlltla  800
             G++ G ++ L ++G + LPVST +L++ASQL F    + ++V+QK T  ++N + LL++ 
Sbjct  93    GVLTGFDDYLYAYGVAKLPVSTSALIIASQLAFTAAFAFLLVKQKFTSYSVNAIFLLSIG  152

Query  799   avllaLDSSSDKPAGLTKAKYFVGFFCTVGAALLFALYLPLVEKLYRNVD---CYamvve  629
             A +LAL +SSD+PA  +  +Y++GF  T+ AA L+   LPLVE  Y+       Y++V+E
Sbjct  153   AGVLALHTSSDRPANESNKEYYLGFVMTLAAAALYGFILPLVELTYKKAKQAITYSLVME  212

Query  628   mqvvmeaaATVLATVGMAIDGGFSGMKKESQGGFDLGSKAYAMTVGLNVLTWQLCFMGTA  449
             +Q+VM   ATV  TVGM ++  F  + +E++  ++LG   Y + V  N + WQ  F+G  
Sbjct  213   IQMVMCFFATVFCTVGMLVNNDFQAISREAK-EYELGEAKYYLVVVWNGIIWQCFFLGAI  271

Query  448   GMVFLTTSVTSGICSTALMAFNVVGGVLAYGDHMGGSKAVSTVLCVWGFSSYVYGMYLKT  269
             G++F  +S+  GI    L+    +  V+ + +     K VS  L +WGF SY YG    +
Sbjct  272   GVIFSASSLVCGIVIAVLLPVTEILAVIFFQEKFQAEKGVSLALSLWGFVSYFYGEIKDS  331

Query  268   KKVTKEVP  245
             KK     P
Sbjct  332   KKKKNPTP  339



>gb|KDP40942.1| hypothetical protein JCGZ_24941 [Jatropha curcas]
Length=355

 Score =   162 bits (411),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 115/313 (37%), Positives = 178/313 (57%), Gaps = 12/313 (4%)
 Frame = -1

Query  1153  KFYFVHGGSSRWVATWVQCAGFPL-LIPAV--YLPYYAFNSTERRPFAGFSLRIFSLSVV  983
             + YF+ GG + W+++++Q AG+PL L P +  Y+ Y   N   R      S R+F    V
Sbjct  45    RLYFLEGGKAVWISSFLQTAGWPLVLFPLIVSYM-YRRSNKGSRTKLIYISPRLFLACAV  103

Query  982   IGLMLGVNNLLISWGTSYLPVSTCSLVLASQLVFILFLSAIIVRQKITFANLNCvvlltl  803
             IGL+ G+++ L ++G S LPVST +L++A+QL F    + I+V+QK T   +N + LL++
Sbjct  104   IGLLTGLDDFLAAYGVSLLPVSTSALIIATQLGFTAGFAYILVKQKFTPFTINAIFLLSI  163

Query  802   aavllaLDSSSDKPAGLTKAKYFVGFFCTVGAALLFALYLPLVEKLYRNVD---CYamvv  632
              AV+L + +SSD+P   T  KY +GFF T+GA+ L+   LPL+E  Y+       Y +V+
Sbjct  164   GAVVLVIHASSDRPDHETTEKYLLGFFMTLGASALYGFVLPLIELTYKKAKQTITYTLVM  223

Query  631   emqvvmeaaATVLATVGMAIDGGFSGMKKESQGGFDLGSKAYAMTVGLNVLTWQLCFMGT  452
             EMQ+V+   AT    +GM +   F  + +E+   F+LG   Y +      + WQL FMG 
Sbjct  224   EMQIVISFFATGFCAIGMLLHKDFEAIPREAS-EFELGRVKYYVVNVFTAVFWQLFFMGA  282

Query  451   AGMVFLTTSVTSGICSTALMAFNVVGGVLAYGDHMGGSKAVSTVLCVWGFSSYVYGMYLK  272
              G+VF  +S+ SGI    L+      GV+ Y +     K +S VL +WGF SY YG   +
Sbjct  283   VGVVFCGSSLLSGIIIATLLPVTESLGVMFYHEKFHFEKGISLVLSLWGFISYFYGELQQ  342

Query  271   TKKVTK----EVP  245
              KK ++    E+P
Sbjct  343   NKKKSRTSEFEMP  355



>ref|NP_001241384.1| uncharacterized protein LOC100819409 [Glycine max]
 gb|ACU23620.1| unknown [Glycine max]
 gb|KHN22137.1| Putative purine permease 11 [Glycine soja]
Length=362

 Score =   163 bits (412),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 113/315 (36%), Positives = 181/315 (57%), Gaps = 9/315 (3%)
 Frame = -1

Query  1153  KFYFVHGGSSRWVATWVQCAGFPLL-IPAVYLPYYAFNSTERRPFAGFSLRIFSLSVVIG  977
             +FY+  GG+S+W+AT VQ A FP+L IP   +P     ST   P     L I+     +G
Sbjct  50    RFYYDQGGNSKWMATLVQTAAFPILFIPLFTIPSPPEASTSASPPIKIILLIY---FGLG  106

Query  976   LMLGVNNLLISWGTSYLPVSTCSLVLASQLVFILFLSAIIVRQKITFANLNCvvlltlaa  797
             +++  +N++ S G  YL  ST SL+ ASQL F    S  I  QK T   +N  V+LTL+A
Sbjct  107   VLIAADNMMYSTGLLYLSASTYSLICASQLAFNAVFSYFINSQKFTALIINSTVVLTLSA  166

Query  796   vllaLDSSSDKPAGLTKAKYFVGFFCTVGAALLFALYLPLVEKLYRNV---DCYamvvem  626
              LLA++  +D+P+G +K KY +GF CT+GA+ +++L L L++  +  V   + +++V+EM
Sbjct  167   ALLAVNEDTDEPSGFSKGKYIIGFLCTLGASAVYSLLLSLMQLTFEKVLKKETFSVVLEM  226

Query  625   qvvmeaaATVLATVGMAIDGGFSGMKKESQGGFDLGSKAYAMTVGLNVLTWQLCFMGTAG  446
             Q+     A+  + +G+   G +  +  E +G F  G  AY MT+    + WQ+C +G  G
Sbjct  227   QIYTSFVASGASVIGLFASGEWRTLHGEMEG-FQKGYVAYVMTLVWTSIAWQVCSVGVVG  285

Query  445   MVFLTTSVTSGICSTALMAFNVVGGVLAYGDHMGGSKAVSTVLCVWGFSSYVYGMYLKTK  266
             ++FL +S+ S + ST  +A   +  V+ + D M G K +S +L +WGF+SY+Y  YL   
Sbjct  286   LIFLVSSLYSNVISTVSLAVTPIAAVIVFHDKMNGVKIISMLLALWGFASYIYQNYLDDS  345

Query  265   KVTKEVPPAIGA*SD  221
             K T+    A  + +D
Sbjct  346   K-TRHAQAATKSQND  359



>ref|XP_008812221.1| PREDICTED: purine permease 3-like [Phoenix dactylifera]
Length=361

 Score =   162 bits (411),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 115/317 (36%), Positives = 184/317 (58%), Gaps = 17/317 (5%)
 Frame = -1

Query  1153  KFYFVHGGSSRWVATWVQCAGFPLLIPAVYLPYYAFNSTERRPFAGFSLR--------IF  998
             + YF+ GGS +W++ W+Q  G+PL    +++P  A +   RR   G            +F
Sbjct  45    RLYFLKGGSRKWLSGWLQTGGWPL----IFIPL-AISYAHRRGGGGGGGTKLYLMTPPLF  99

Query  997   SLSVVIGLMLGVNNLLISWGTSYLPVSTCSLVLASQLVFILFLSAIIVRQKITFANLNCv  818
                 V+GL++G+++ L ++G SYLPVST S+++++QL F    +  IV+QK T  + N V
Sbjct  100   LACTVLGLLIGLDDYLYAYGMSYLPVSTSSILISTQLGFTALFAFFIVKQKFTSFSTNAV  159

Query  817   vlltlaavllaLDSSSDKPAGLTKAKYFVGFFCTVGAALLFALYLPLVEKLY---RNVDC  647
             VLL++ AV+L L +S D+P G +   Y++GF  T+ AA+L+A  LPLVE  Y   + V  
Sbjct  160   VLLSIGAVMLGLHASGDRPEGESNTLYYLGFAMTLAAAVLYAFILPLVELTYAKAKQVVS  219

Query  646   YamvvemqvvmeaaATVLATVGMAIDGGFSGMKKESQGGFDLGSKAYAMTVGLNVLTWQL  467
             Y +V+EMQ+VM   ATV  TVGM +   F  + +E++  F LG   Y + +  + + WQ 
Sbjct  220   YTLVMEMQLVMGFFATVFCTVGMLVSKDFQAISREAR-DFVLGEVRYYVLLVWSAILWQF  278

Query  466   CFMGTAGMVFLTTSVTSGICSTALMAFNVVGGVLAYGDHMGGSKAVSTVLCVWGFSSYVY  287
              F+GT G +F  +++ +GI    L+    V  V+ + +   G K V+ VL +WG +SY Y
Sbjct  279   FFLGTVGAIFYGSALLAGIIIAVLIPVAEVLAVIFFHESFSGGKGVALVLALWGLASYFY  338

Query  286   GMYLKTKKVTKEVPPAI  236
             G +L++KK    V P +
Sbjct  339   GEFLESKKKKPVVEPGL  355



>ref|XP_009109745.1| PREDICTED: purine permease 1 [Brassica rapa]
 emb|CDX90136.1| BnaA08g18480D [Brassica napus]
Length=352

 Score =   162 bits (409),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 118/315 (37%), Positives = 179/315 (57%), Gaps = 12/315 (4%)
 Frame = -1

Query  1153  KFYFVHGGSSRWVATWVQCAGFPLLIPAVYLPYYAF------NSTERRPFAGFSLRIFSL  992
             + Y+ +GG   W  +++  AGFP+++  ++  + +        + E+         +F  
Sbjct  25    RLYYTNGGKRIWFMSFLSTAGFPVILVPLFFSFLSRRNRNNSETAEKPKLILMETPLFIA  84

Query  991   SVVIGLMLGVNNLLISWGTSYLPVSTCSLVLASQLVFILFLSAIIVRQKITFANLNCvvl  812
             S+VIGL+ G++N L ++G +YLPVST SL++ +QL F    +  +V+QK T  ++N VVL
Sbjct  85    SIVIGLLTGLDNYLYAYGLAYLPVSTSSLIIGTQLAFNALFAFFMVKQKFTPFSINAVVL  144

Query  811   ltlaavllaLDSSSDKPAGLTKAKYFVGFFCTVGAALLFALYLPLVEKLY---RNVDCYa  641
             LT+  V+LAL SS DKPA  T  +Y VGF  TV AA+L+A  LPLVE  Y   R    + 
Sbjct  145   LTVGIVVLALHSSGDKPANETHKEYVVGFLMTVIAAVLYAFILPLVELTYKKARQEITFP  204

Query  640   mvvemqvvmeaaATVLATVGMAIDGGFSGMKKESQGGFDLGSKAYAMT-VGLNVLTWQLC  464
             +V+E+Q+VM  AAT    VGM IDG F  + +E++  F +G  A+  T + +  + WQ  
Sbjct  205   LVLEIQMVMCLAATCFCVVGMIIDGDFKVISREAR-EFKIGGSAFYYTLIMITGIVWQGF  263

Query  463   FMGTAGMVFLTTSVTSGICSTALMAFNVVGGVLAYGDHMGGSKAVSTVLCVWGFSSYVYG  284
             F+G  G+VF  +S+ S +  + L+    V  V+ + +     K VS  L +WGF SY YG
Sbjct  264   FLGAIGVVFCASSLASAVLISVLLPVTEVLAVICFREKFQAEKGVSLFLSIWGFVSYFYG  323

Query  283   MYLKTKKV-TKEVPP  242
              Y   KKV  K  PP
Sbjct  324   EYKSGKKVLEKHQPP  338



>ref|XP_002462515.1| hypothetical protein SORBIDRAFT_02g027100 [Sorghum bicolor]
 gb|EER99036.1| hypothetical protein SORBIDRAFT_02g027100 [Sorghum bicolor]
Length=365

 Score =   162 bits (410),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 107/309 (35%), Positives = 179/309 (58%), Gaps = 9/309 (3%)
 Frame = -1

Query  1153  KFYFVHGGSSRWVATWVQCAGFPLLIPAVYLPY-YAFNSTERRPFAGFSLRIFSLSVVIG  977
             + YF  GG  +W++ W++  G+PLL+  V L +          P      RI   +V +G
Sbjct  43    RLYFSKGGHRQWLSAWLETGGWPLLLVPVALSFVARRARDRAAPVLLTPPRILLAAVALG  102

Query  976   LMLGVNNLLISWGTSYLPVSTCSLVLASQLVFILFLSAIIVRQKITFANLNCvvlltlaa  797
             +  GV++ + ++G +YLPVST ++++++QL F +F + ++VRQ++T A++N V LLT+ A
Sbjct  103   VATGVDDFIYAYGLAYLPVSTSAILISTQLAFTVFFAFLVVRQRLTAASVNAVALLTVGA  162

Query  796   vllaLDSSSDKPAGLTKAKYFVGFFCTVGAALLFALYLPLVEKLYRNVDC-------Yam  638
             V+L L  SSD+P G+T+ +Y++GF  T+GAA L+ L LPLVE  Y+           YA+
Sbjct  163   VVLGLHVSSDRPPGVTRGQYWLGFTLTLGAAALYGLVLPLVELAYKRAAAGGGRAVSYAL  222

Query  637   vvemqvvmeaaATVLATVGMAIDGGFSGMKKESQGGFDLGSKAYAMTVGLNVLTWQLCFM  458
             VVEMQ+VM   AT   TVGM ++  F  + +E++  ++LG   Y   +  + + WQ  F+
Sbjct  223   VVEMQLVMGFFATAFCTVGMIVNKDFQAIPREAR-QYELGEARYYTVLVWSAVLWQCFFL  281

Query  457   GTAGMVFLTTSVTSGICSTALMAFNVVGGVLAYGDHMGGSKAVSTVLCVWGFSSYVYGMY  278
             G  G++F   ++ +GI     +    V  V+   +     K V+ VL +WG +SY YG +
Sbjct  282   GAVGVIFCVHTLLAGILIAVFIPVTEVAAVIFLHEKFSSEKGVALVLSLWGLASYSYGEW  341

Query  277   LKTKKVTKE  251
              + +K  K+
Sbjct  342   SQARKAKKK  350



>gb|KHG13700.1| Purine permease 3 -like protein [Gossypium arboreum]
 gb|KHG19122.1| Purine permease 3 -like protein [Gossypium arboreum]
Length=358

 Score =   162 bits (409),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 109/325 (34%), Positives = 185/325 (57%), Gaps = 11/325 (3%)
 Frame = -1

Query  1153  KFYFVHGGSSRWVATWVQCAGFPL-LIPAVYLPYYAFNSTERRPFAGFSLR--IFSLSVV  983
             + YF+HGG   W ++W++  G+P+ L P   + +Y   +        F ++  +F  + V
Sbjct  38    RLYFIHGGKRVWFSSWLETGGWPIILFPIACVHFYRSRTQPSSENKLFFMKPHLFIAAAV  97

Query  982   IGLMLGVNNLLISWGTSYLPVSTCSLVLASQLVFILFLSAIIVRQKITFANLNCvvlltl  803
             IG++ G+++ L ++G + LPVST SL++ASQL F    + ++V+QK T  ++N V LLT+
Sbjct  98    IGILTGLDDYLYAYGVARLPVSTSSLIIASQLAFTAGFAFVLVKQKFTSYSINAVFLLTI  157

Query  802   aavllaLDSSSDKPAGLTKAKYFVGFFCTVGAALLFALYLPLVEKLYRNVD---CYamvv  632
              + +LA+ +SSD+PA  +  +Y +GF  TVGA+ L+   LPLVE  Y+       YA+V+
Sbjct  158   GSGVLAMHTSSDRPANESNREYVLGFLMTVGASALYGFILPLVELTYKKAKQEISYALVM  217

Query  631   emqvvmeaaATVLATVGMAIDGGFSGMKKESQGGFDLGSKAYAMTVGLNVLTWQLCFMGT  452
             E+Q+VM   AT + T+GM ++  F  +++E++  ++LG   Y +    + + WQ  F+G 
Sbjct  218   EIQMVMCLFATGVCTIGMLVNNDFKVIRREAR-EYELGETKYYIVAICSAMIWQCFFLGA  276

Query  451   AGMVFLTTSVTSGICSTALMAFNVVGGVLAYGDHMGGSKAVSTVLCVWGFSSYVYGMYLK  272
              G++F  +S+ SGI    L+    +  V+ Y +     K V+  L +WGF SY YG    
Sbjct  277   IGVIFCASSLLSGIIIAVLLPVTEILAVIFYNESFHAEKGVALALSLWGFLSYFYG----  332

Query  271   TKKVTKEVPPAIGA*SD*TPARRRT  197
               K +KE  PA+       P R+ +
Sbjct  333   EIKQSKENKPALETEMASVPNRQES  357



>emb|CDY35722.1| BnaC03g58430D [Brassica napus]
Length=354

 Score =   162 bits (409),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 118/317 (37%), Positives = 180/317 (57%), Gaps = 14/317 (4%)
 Frame = -1

Query  1153  KFYFVHGGSSRWVATWVQCAGFPLLIPAVYLPYYAF--------NSTERRPFAGFSLRIF  998
             + Y+ +GG   W  +++  AGFP+++  ++  + +          + E+         +F
Sbjct  25    RLYYTNGGKRIWFMSFLSTAGFPVILIPLFFSFLSRRNHNRNNSETAEKTKLILMETPLF  84

Query  997   SLSVVIGLMLGVNNLLISWGTSYLPVSTCSLVLASQLVFILFLSAIIVRQKITFANLNCv  818
               S+VIGL+ G++N L ++G +YLPVST SL++ +QL F    +  +V+QK T  ++N V
Sbjct  85    IASIVIGLLTGLDNYLYAYGLAYLPVSTSSLIIGTQLAFNALFAFFMVKQKFTPFSINAV  144

Query  817   vlltlaavllaLDSSSDKPAGLTKAKYFVGFFCTVGAALLFALYLPLVEKLY---RNVDC  647
             VLLT+  V+LAL S+ DKPA  T  +Y VGF  TV AA+L+A  LPLVE  Y   R    
Sbjct  145   VLLTVGIVVLALHSNGDKPANETHKEYVVGFLMTVIAAVLYAFILPLVEFTYKKARQEIT  204

Query  646   YamvvemqvvmeaaATVLATVGMAIDGGFSGMKKESQGGFDLGSKAYAMT-VGLNVLTWQ  470
             + +V+E+Q+VM  AAT    VGM IDG F  + +E++  F +G  A+  T + +  + WQ
Sbjct  205   FPLVLEIQMVMCIAATCFCVVGMIIDGDFKVISREAR-EFKIGGSAFYYTLIVITGIVWQ  263

Query  469   LCFMGTAGMVFLTTSVTSGICSTALMAFNVVGGVLAYGDHMGGSKAVSTVLCVWGFSSYV  290
               F+G  G+VF  +S+ SG+  + L+    V  V+ + +     K VS  L +WGF SY 
Sbjct  264   GFFLGAIGVVFCASSLASGVLISVLLPVTEVLAVICFREKFQAEKGVSLFLSIWGFVSYF  323

Query  289   YGMYLKTKKV-TKEVPP  242
             YG Y   KKV  K  PP
Sbjct  324   YGEYKSGKKVLEKHQPP  340



>ref|XP_006357923.1| PREDICTED: purine permease 3-like [Solanum tuberosum]
Length=341

 Score =   161 bits (407),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 110/310 (35%), Positives = 170/310 (55%), Gaps = 7/310 (2%)
 Frame = -1

Query  1153  KFYFVHGGSSRWVATWVQCAGFPL-LIPAVYLPYYAFNSTERRPFAGFSLRIFSLSVVIG  977
             + YF+ GG   W+++W+Q A +P+  IP V   +Y   +         + RIF  ++ IG
Sbjct  25    RLYFIKGGKRIWLSSWLQTAAWPINFIPLVISYFYRRKNNSTTKLILMTPRIFMATIGIG  84

Query  976   LMLGVNNLLISWGTSYLPVSTCSLVLASQLVFILFLSAIIVRQKITFANLNCvvlltlaa  797
             ++ G  N   ++G   LPVST  L+ A+QL F  F + +IV+ K T  ++N V LLT  A
Sbjct  85    ILQGFTNYFYAYGIGKLPVSTSGLLFATQLAFTAFFAFLIVKLKFTPYSVNSVFLLTTGA  144

Query  796   vllaLDSSSDKPAGLTKAKYFVGFFCTVGAALLFALYLPLVEKLYRNVD---CYamvvem  626
             V+LAL S  D+P G  + +Y +GF  T+ +A L  L  PLVE +Y+       Y  V+E 
Sbjct  145   VVLALRSGGDQPEGEPRKEYILGFVMTLASAALTGLIFPLVELIYKKTQQTITYTFVLEF  204

Query  625   qvvmeaaATVLATVGMAIDGGFSGMKKESQGGFDLGSKAYAMTVGLNVLTWQLCFMGTAG  446
             Q +    ATVLAT+GM I+  F  + +E++  F+LG   Y + +  + +  Q  F+G+ G
Sbjct  205   QTLYCFVATVLATIGMIINKDFQAISREAKT-FELGEDKYYIVIIWSAIILQFYFLGSIG  263

Query  445   MVFLTTSVTSGICSTALMAFNVVGGVLAYGDHMGGSKAVSTVLCVWGFSSYVYGMYLKTK  266
             +++  +S+  GI  + L+    V  V  YG+     K VS  L +WGF+SY YG Y KT+
Sbjct  264   VIYSASSLVCGILLSVLLPLTEVLAVFLYGEKFNAEKGVSLALSLWGFASYFYGDYNKTE  323

Query  265   KVTKEVPPAI  236
                +   PAI
Sbjct  324   NSNQS--PAI  331



>ref|XP_010680002.1| PREDICTED: probable purine permease 11 [Beta vulgaris subsp. 
vulgaris]
 ref|XP_010680070.1| PREDICTED: probable purine permease 11 [Beta vulgaris subsp. 
vulgaris]
 ref|XP_010680126.1| PREDICTED: probable purine permease 11 [Beta vulgaris subsp. 
vulgaris]
Length=380

 Score =   162 bits (410),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 109/308 (35%), Positives = 187/308 (61%), Gaps = 7/308 (2%)
 Frame = -1

Query  1153  KFYFVHGGSSRWVATWVQCAGFPLL-IPAVYLPYYAFNSTERRPFAGFSLRIFSLSVVIG  977
             +FY+  GGSS +VAT VQ AGFP+L IP + +P  A  ST   P +     I  + + +G
Sbjct  55    RFYYAEGGSSMFVATLVQTAGFPVLCIPLILIPLPA--STSPPPDSRTKRNIVLIYLSLG  112

Query  976   LMLGVNNLLISWGTSYLPVSTCSLVLASQLVFILFLSAIIVRQKITFANLNCvvlltlaa  797
             ++L  NNLL + G  YL  ST SL+ A++L+F    S  +  QK+T   LN VV+L+ +A
Sbjct  113   VLLAGNNLLYAVGLLYLSASTYSLICATELIFNAVFSYFLNSQKLTPLILNSVVILSFSA  172

Query  796   vllaLDSSSDKPAGLTKAKYFVGFFCTVGAALLFALYLPLVEKLYRNV---DCYamvvem  626
              LLAL+  SD P G++K +Y +GF CT+GA+ ++AL L L++  ++ V   + +A+V++M
Sbjct  173   ALLALNLDSDSPGGVSKWEYALGFLCTLGASTVYALLLSLMQLSFQKVLKSETFAVVMKM  232

Query  625   qvvmeaaATVLATVGMAIDGGFSGMKKESQGGFDLGSKAYAMTVGLNVLTWQLCFMGTAG  446
             Q+     A++++ VG+   G +  ++KE    F+ G  +Y MT+    ++WQ+C +G  G
Sbjct  233   QIYTCLVASIVSLVGLFASGQWRTLQKE-MDDFNAGPPSYFMTLVWTAISWQVCSVGVVG  291

Query  445   MVFLTTSVTSGICSTALMAFNVVGGVLAYGDHMGGSKAVSTVLCVWGFSSYVYGMYLKTK  266
             ++++ +S+ S + ST  +    +  ++ + D M G+KA++ +L +WGF+SY++  YL   
Sbjct  292   LIYMVSSLFSNVISTVALTAAPIASLIVFHDSMNGAKAIAMLLALWGFASYLFQNYLDDS  351

Query  265   KVTKEVPP  242
             +  +   P
Sbjct  352   RAMESPKP  359



>ref|XP_009795252.1| PREDICTED: purine permease 1-like [Nicotiana sylvestris]
Length=352

 Score =   161 bits (408),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 113/308 (37%), Positives = 177/308 (57%), Gaps = 6/308 (2%)
 Frame = -1

Query  1153  KFYFVHGGSSRWVATWVQCAGFPLLIPAVYLPYYAFNSTE--RRPFAGFSLRIFSLSVVI  980
             + Y+V GGS  W ++W+Q AG+P     + + Y+    TE     +   + RIF  S +I
Sbjct  34    RLYYVEGGSRVWFSSWLQTAGWPFTFIPLAILYFNRRKTEGINAKYYLITPRIFIASFII  93

Query  979   GLMLGVNNLLISWGTSYLPVSTCSLVLASQLVFILFLSAIIVRQKITFANLNCvvlltla  800
             G + G+++ L SWG S LPVST SL+LA+QL F    +  IV+ K T  ++N VVLLTL 
Sbjct  94    GFVTGLDDFLYSWGGSKLPVSTSSLLLAAQLAFTAIGAFFIVKLKFTPYSINAVVLLTLG  153

Query  799   avllaLDSSSDKPAGLTKAKYFVGFFCTVGAALLFALYLPLVEKLY---RNVDCYamvve  629
             AVLL + S+ D+P G+T   Y +GF  T+ AA L+ + LP +E +Y   +      +V+E
Sbjct  154   AVLLGVRSNGDRPEGVTSKAYIIGFMMTLLAAALYGVILPCIELIYLKAKQAITATLVLE  213

Query  628   mqvvmeaaATVLATVGMAIDGGFSGMKKESQGGFDLGSKAYAMTVGLNVLTWQLCFMGTA  449
             +Q+VM  AAT   TVGM  +  F  + +E++  F+LG   Y   V    + WQ  F+G  
Sbjct  214   IQMVMCFAATAFCTVGMIANNDFQAISREAK-QFNLGEARYYTVVVWTTIIWQCFFVGVI  272

Query  448   GMVFLTTSVTSGICSTALMAFNVVGGVLAYGDHMGGSKAVSTVLCVWGFSSYVYGMYLKT  269
             G+++ ++S+ SG+    L+    V  V+ + ++  G K ++  L +WGF SY YG + +T
Sbjct  273   GVIYCSSSLMSGVMIAVLLPVTEVLAVVFFRENFSGEKGLALFLSLWGFVSYFYGEFRQT  332

Query  268   KKVTKEVP  245
             KK+  + P
Sbjct  333   KKLKNKSP  340



>ref|XP_009102926.1| PREDICTED: purine permease 3 [Brassica rapa]
 ref|XP_009102927.1| PREDICTED: purine permease 3 [Brassica rapa]
 emb|CDX94594.1| BnaC07g10640D [Brassica napus]
Length=349

 Score =   161 bits (407),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 108/311 (35%), Positives = 174/311 (56%), Gaps = 11/311 (4%)
 Frame = -1

Query  1153  KFYFVHGGSSRWVATWVQCAGFPLLIPAVYLPYYAF-----NSTERRPFAGFSLRIFSLS  989
             + YF +GG   W +T+++ AGFP++   ++  Y        N  E   F     R+   +
Sbjct  25    RLYFNNGGHRIWFSTFLETAGFPIIFIPLFFSYLNRRRSNNNEGENTRFFLIKPRLLMAA  84

Query  988   VVIGLMLGVNNLLISWGTSYLPVSTCSLVLASQLVFILFLSAIIVRQKITFANLNCvvll  809
             ++IG++ G +N L ++G +YLPVST +L++ASQL FI   S  +V  K T   +N VVLL
Sbjct  85    ILIGILSGFDNYLYAYGIAYLPVSTAALIIASQLAFIAIFSYFMVSHKFTPFTINAVVLL  144

Query  808   tlaavllaLDSSSDKPAGLTKAKYFVGFFCTVGAALLFALYLPLVEKLYRNVD---CYam  638
             T+ A +L + + +DKP   T  +Y VGF  TV AA+++A  LPLVE  Y+       Y +
Sbjct  145   TVGAAVLGMHTETDKPVHETHKQYMVGFLVTVAAAVMYAFLLPLVELAYQKAKQPMSYTL  204

Query  637   vvemqvvmeaaATVLATVGMAIDGGFSGMKKESQGGFDLGSKAYAMTVGLNVLTWQLCFM  458
             V+E+Q+++   A++++ VGM I G F  +  E++  F LG   + +   L+ + WQ  F+
Sbjct  205   VLEVQMILCFLASLVSLVGMLIAGDFKALPNEAR-EFKLGEAMFYVVAVLSAIIWQGFFL  263

Query  457   GTAGMVFLTTSVTSGICSTALMAFNVVGGVLAYGDHMGGSKAVSTVLCVWGFSSYVYGMY  278
             G  G++F  +S+ SGI  + L+    V  V+ Y +     K +S  L +WGF SY YG  
Sbjct  264   GAIGLIFCASSLVSGIMISVLLPITEVLAVIFYHEKFQKEKGLSLALSLWGFVSYFYGEI  323

Query  277   L--KTKKVTKE  251
                K K++ +E
Sbjct  324   KADKDKRIQEE  334



>emb|CDX94595.1| BnaC07g10630D [Brassica napus]
Length=349

 Score =   160 bits (406),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 107/311 (34%), Positives = 174/311 (56%), Gaps = 11/311 (4%)
 Frame = -1

Query  1153  KFYFVHGGSSRWVATWVQCAGFPLLIPAVYLPYYAF-----NSTERRPFAGFSLRIFSLS  989
             + YF +GG   W +T+++ AGFP++   ++  Y        N  E   F     R+   +
Sbjct  25    RLYFNNGGHRIWFSTFLETAGFPIIFIPLFFSYLNRRRSNSNEGENTRFFLIKPRLLMAA  84

Query  988   VVIGLMLGVNNLLISWGTSYLPVSTCSLVLASQLVFILFLSAIIVRQKITFANLNCvvll  809
             ++IG++ G +N L ++G +YLPVST +L++ASQL FI   S  +V  K T   +N VVLL
Sbjct  85    ILIGILSGFDNYLYAYGIAYLPVSTAALIIASQLAFIAIFSYFMVSHKFTPFTINAVVLL  144

Query  808   tlaavllaLDSSSDKPAGLTKAKYFVGFFCTVGAALLFALYLPLVEKLYRNVD---CYam  638
             T+ A +L + + +DKP   T  +Y VGF  TV AA+++A  LPLVE  Y+       Y +
Sbjct  145   TVGAAVLGMHTETDKPVHETHKQYMVGFLVTVAAAVMYAFLLPLVELAYQKAKQPMSYTL  204

Query  637   vvemqvvmeaaATVLATVGMAIDGGFSGMKKESQGGFDLGSKAYAMTVGLNVLTWQLCFM  458
             V+E+Q+++   A++++ +GM I G F  +  E++  F LG   + +   L+ + WQ  F+
Sbjct  205   VLEVQMILCFLASLVSLIGMLIAGDFKALPNEAR-EFKLGEAMFYVVAVLSAIIWQGFFL  263

Query  457   GTAGMVFLTTSVTSGICSTALMAFNVVGGVLAYGDHMGGSKAVSTVLCVWGFSSYVYGMY  278
             G  G++F  +S+ SGI  + L+    V  V+ Y +     K +S  L +WGF SY YG  
Sbjct  264   GAIGLIFCASSLVSGIMISVLLPITEVLAVIFYHEKFQKEKGLSLALSLWGFVSYFYGEI  323

Query  277   L--KTKKVTKE  251
                K K++ +E
Sbjct  324   KADKDKRIQEE  334



>emb|CDP08377.1| unnamed protein product [Coffea canephora]
Length=356

 Score =   160 bits (406),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 101/307 (33%), Positives = 178/307 (58%), Gaps = 7/307 (2%)
 Frame = -1

Query  1153  KFYFVHGGSSRWVATWVQCAGFPLLIPAVYLPYYAFNSTE--RRPFAGFSLRIFSLSVVI  980
             + YFV GG   W+++W++  G+P+    + + Y+    TE            +F  + VI
Sbjct  33    RLYFVKGGKRIWLSSWLETGGWPITFIPLTISYFHRRKTEGPNTKLIQMKCPVFIATAVI  92

Query  979   GLMLGVNNLLISWGTSYLPVSTCSLVLASQLVFILFLSAIIVRQKITFANLNCvvlltla  800
             GL+ G+++ L ++G + LPVST ++++A+ L F  F + ++V+QK T  ++N +VLL++ 
Sbjct  93    GLLTGLDDYLYAYGFARLPVSTATIIVATHLGFTAFFAFLLVKQKFTAYSVNAIVLLSVG  152

Query  799   avllaLDSSSDKPAGLTKAKYFVGFFCTVGAALLFALYLPLVEKLY---RNVDCYamvve  629
             + +LA+ +SSD+P G +   Y +GF  T+ AA L+ L LP+VE +Y   +    Y +++E
Sbjct  153   SGVLAMHTSSDRPKGESTKLYVLGFIMTLAAAALYGLVLPMVELMYIKAKQAITYTLLLE  212

Query  628   mqvvmeaaATVLATVGMAIDGGFSGMKKESQGGFDLGSKAYAMTVGLNVLTWQLCFMGTA  449
             + +VM   ATV  TVGM ++  F  M +E++  ++LG   Y + V  N + WQ  F+G  
Sbjct  213   INLVMCFFATVFCTVGMLVNRDFQAMPREAK-AYELGEAKYYVVVTWNAIIWQFFFLGVI  271

Query  448   GMVFLTTSVTSGICSTALMAFNVVGGVLAYGDHMGGSKAVSTVLCVWGFSSYVYGMYLKT  269
             G++F  +S+ S I   +L+       V+A+ +     K V+  L +WGF SY YG  +K 
Sbjct  272   GVIFCASSLLSAIIIASLLPVTGAIAVVAFDEKFPPEKGVALFLSLWGFVSYFYGA-IKH  330

Query  268   KKVTKEV  248
             K++ +E+
Sbjct  331   KRLKEEI  337



>ref|XP_008232299.1| PREDICTED: probable purine permease 11 isoform X2 [Prunus mume]
Length=368

 Score =   161 bits (407),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 108/306 (35%), Positives = 180/306 (59%), Gaps = 9/306 (3%)
 Frame = -1

Query  1153  KFYFVHGGSSRWVATWVQCAGFP-LLIPAVYLPYYAFNSTERRPFAGFSLRIFSL-SVVI  980
             +FY+  GG+S+W+AT VQ A FP LLIP  ++P     ST   P    S+++ +L    +
Sbjct  54    RFYYDQGGNSKWMATLVQTAAFPVLLIPLYFIPSSKDPSTSSAPP---SIKVLALIYFAL  110

Query  979   GLMLGVNNLLISWGTSYLPVSTCSLVLASQLVFILFLSAIIVRQKITFANLNCvvlltla  800
             G++L  +N+L S G  YL  ST SL+ A+QL F    S  I  QK T   LN V++++ +
Sbjct  111   GVLLACDNMLYSVGLLYLSASTYSLICATQLAFNAVFSYFINSQKFTALILNSVIIVSFS  170

Query  799   avllaLDSSSDKPAGLTKAKYFVGFFCTVGAALLFALYLPLVEKLYRNV---DCYamvve  629
             A L+A+   S  PAG++K K+ +GF CT+GA+ +++L L L++  ++ V   + +++V+E
Sbjct  171   AALIAVSDDSSGPAGVSKWKHILGFICTLGASAIYSLLLSLMQLTFQKVLKKETFSVVLE  230

Query  628   mqvvmeaaATVLATVGMAIDGGFSGMKKESQGGFDLGSKAYAMTVGLNVLTWQLCFMGTA  449
             MQ+     A+  ATVG+   G +  +  E +  F  G  +Y MT+    + WQ+C +G  
Sbjct  231   MQIYTALVASCAATVGLFASGEWRTLHGEMEK-FGEGRVSYVMTLVWTAVAWQVCSVGVV  289

Query  448   GMVFLTTSVTSGICSTALMAFNVVGGVLAYGDHMGGSKAVSTVLCVWGFSSYVYGMYLKT  269
             G++F+ +S+ S + ST  +A   +  V+ + D M G K ++ +L +WGF++Y+Y  YL  
Sbjct  290   GLIFVVSSLFSNVISTLSLAVTPIAAVIIFHDKMDGVKIIAMLLAIWGFATYIYQNYLDD  349

Query  268   KKVTKE  251
              KV + 
Sbjct  350   SKVRRR  355



>ref|XP_004959530.1| PREDICTED: purine permease 1-like [Setaria italica]
Length=378

 Score =   161 bits (407),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 108/314 (34%), Positives = 187/314 (60%), Gaps = 19/314 (6%)
 Frame = -1

Query  1153  KFYFVHGGSSRWVATWVQCAGFPLLIPAVYLPYYAFNSTERR-----PFAGFSLRIFSLS  989
             + YF+HGG+ +W++ ++Q AGFPLL+    +P     S  ++     PF   + R+   S
Sbjct  57    RAYFLHGGARKWLSAFLQTAGFPLLL----VPLCVSFSRRKKAAGGTPFFLMTPRLLVAS  112

Query  988   VVIGLMLGVNNLLISWGTSYLPVSTCSLVLASQLVFILFLSAIIVRQKITFANLNCvvll  809
               IGLM G+++LL ++G +YLPVST S+++++QL F    + ++VRQ+ T +++N VVLL
Sbjct  113   AGIGLMTGLDDLLYTYGLAYLPVSTSSILISTQLAFTAAFALLLVRQRFTASSVNAVVLL  172

Query  808   tlaavllaLDSSSDKPAGLTKAKYFVGFFCTVGAALLFALYLPLVE-KLYRNVD------  650
             ++ A +L +++  D+PAG+++A+Y  GF  T+GAA LF L LP++E    R+        
Sbjct  173   SVGAAMLGMNAGGDRPAGVSRAQYSAGFAMTLGAAALFGLVLPVMELSQARHAARPGAAP  232

Query  649   -CYamvvemqvvmeaaATVLATVGMAIDGGFSGMKKESQGGFDLGSKAYAMTVGLNVLTW  473
               Y +V+EMQ+V+   AT+   VGM ++  F  + +E++  F  G   Y + +  +  T+
Sbjct  233   VTYTLVIEMQLVIGLTATIFTAVGMLVNNDFHAIPEEAR-QFGFGRSGYYLLLAGSAATY  291

Query  472   QLCFMGTAGMVFLTTSVTSGICSTALMAFNVVGGVLAYGDHMGGSKAVSTVLCVWGFSSY  293
             Q  F+GT G +F  +++ +G+  T L+    V  V+ + +   G+K V+  L +WGF SY
Sbjct  292   QCFFLGTIGAIFFGSALLAGVIMTVLIPVTEVLAVMLFSEPFNGTKGVALALSLWGFVSY  351

Query  292   VYGMYLKTKKVTKE  251
              YG  ++T K   +
Sbjct  352   FYG-EVQTSKANHQ  364



>ref|XP_009621473.1| PREDICTED: purine permease 3-like [Nicotiana tomentosiformis]
Length=353

 Score =   160 bits (405),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 114/304 (38%), Positives = 176/304 (58%), Gaps = 10/304 (3%)
 Frame = -1

Query  1153  KFYFVHGGSSRWVATWVQCAGFPL-LIPAVYLPYYAFNSTERRPFAGF---SLRIFSLSV  986
             + Y+V GGS  W+++W+Q  G+PL L+P   L  Y +    + P A F   + RIF  S 
Sbjct  34    RLYYVEGGSRIWLSSWLQTGGWPLTLVPLALL--YLYRRKIKGPDAKFYFITPRIFIASF  91

Query  985   VIGLMLGVNNLLISWGTSYLPVSTCSLVLASQLVFILFLSAIIVRQKITFANLNCvvllt  806
             +IG+  GV++ L SWG S LPVST SL+LA+QL F    +  IV+ K T  + N VVLLT
Sbjct  92    IIGIATGVDDFLYSWGGSKLPVSTSSLLLAAQLAFTAIGAFFIVKLKFTPYSTNAVVLLT  151

Query  805   laavllaLDSSSDKPAGLTKAKYFVGFFCTVGAALLFALYLPLVEKLY---RNVDCYamv  635
             + A+LL + ++ D+P G+T   Y +GF  T+ AA L+ + LP +E +Y   +      +V
Sbjct  152   VGAILLGIRANGDRPEGVTSKAYILGFIMTLLAAALYGVILPCIELMYLKAKQAITATLV  211

Query  634   vemqvvmeaaATVLATVGMAIDGGFSGMKKESQGGFDLGSKAYAMTVGLNVLTWQLCFMG  455
             +E+Q+VM  AAT   TVGM  +  F  M +E++  F+LG   Y   +    + WQ  F+G
Sbjct  212   LEIQMVMCFAATAFCTVGMIANKDFQAMSREAK-QFNLGEARYYTVIVWTAIIWQCFFVG  270

Query  454   TAGMVFLTTSVTSGICSTALMAFNVVGGVLAYGDHMGGSKAVSTVLCVWGFSSYVYGMYL  275
               G+++ ++S+ SG+    L+    V  V+ + +   G K ++  L +WGF SY YG + 
Sbjct  271   VIGVIYCSSSLMSGVMIAVLLPVTEVLAVIFFNEKFSGEKGLALFLSLWGFVSYFYGEFR  330

Query  274   KTKK  263
             +TKK
Sbjct  331   QTKK  334



>ref|XP_008232298.1| PREDICTED: probable purine permease 11 isoform X1 [Prunus mume]
Length=376

 Score =   161 bits (407),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 108/306 (35%), Positives = 180/306 (59%), Gaps = 9/306 (3%)
 Frame = -1

Query  1153  KFYFVHGGSSRWVATWVQCAGFP-LLIPAVYLPYYAFNSTERRPFAGFSLRIFSL-SVVI  980
             +FY+  GG+S+W+AT VQ A FP LLIP  ++P     ST   P    S+++ +L    +
Sbjct  62    RFYYDQGGNSKWMATLVQTAAFPVLLIPLYFIPSSKDPSTSSAPP---SIKVLALIYFAL  118

Query  979   GLMLGVNNLLISWGTSYLPVSTCSLVLASQLVFILFLSAIIVRQKITFANLNCvvlltla  800
             G++L  +N+L S G  YL  ST SL+ A+QL F    S  I  QK T   LN V++++ +
Sbjct  119   GVLLACDNMLYSVGLLYLSASTYSLICATQLAFNAVFSYFINSQKFTALILNSVIIVSFS  178

Query  799   avllaLDSSSDKPAGLTKAKYFVGFFCTVGAALLFALYLPLVEKLYRNV---DCYamvve  629
             A L+A+   S  PAG++K K+ +GF CT+GA+ +++L L L++  ++ V   + +++V+E
Sbjct  179   AALIAVSDDSSGPAGVSKWKHILGFICTLGASAIYSLLLSLMQLTFQKVLKKETFSVVLE  238

Query  628   mqvvmeaaATVLATVGMAIDGGFSGMKKESQGGFDLGSKAYAMTVGLNVLTWQLCFMGTA  449
             MQ+     A+  ATVG+   G +  +  E +  F  G  +Y MT+    + WQ+C +G  
Sbjct  239   MQIYTALVASCAATVGLFASGEWRTLHGEMEK-FGEGRVSYVMTLVWTAVAWQVCSVGVV  297

Query  448   GMVFLTTSVTSGICSTALMAFNVVGGVLAYGDHMGGSKAVSTVLCVWGFSSYVYGMYLKT  269
             G++F+ +S+ S + ST  +A   +  V+ + D M G K ++ +L +WGF++Y+Y  YL  
Sbjct  298   GLIFVVSSLFSNVISTLSLAVTPIAAVIIFHDKMDGVKIIAMLLAIWGFATYIYQNYLDD  357

Query  268   KKVTKE  251
              KV + 
Sbjct  358   SKVRRR  363



>ref|XP_010509840.1| PREDICTED: purine permease 2-like [Camelina sativa]
Length=380

 Score =   161 bits (407),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 116/304 (38%), Positives = 175/304 (58%), Gaps = 9/304 (3%)
 Frame = -1

Query  1153  KFYFVHGGSSRWVATWVQCAGFPL-LIPAVY--LPYYAFNSTERRPFAGFSLRIFSLSVV  983
             + YF +GG+  W ++++Q  G PL L P ++  L        E+         +F  SVV
Sbjct  58    RLYFHNGGARIWFSSFLQTVGCPLILFPLLFSFLRRRRLEEQEKTSLFLMKPPLFIASVV  117

Query  982   IGLMLGVNNLLISWGTSYLPVSTCSLVLASQLVFILFLSAIIVRQKITFANLNCvvlltl  803
             +GL++G +N L S+G +Y+PVST SL++++QL F    +  +V+QKIT   +N +VLLT+
Sbjct  118   VGLLVGFDNYLYSYGLAYIPVSTESLIISAQLGFTALFAFFMVKQKITPFTINAIVLLTV  177

Query  802   aavllaLDSSSDKPAGLTKAKYFVGFFCTVGAALLFALYLPLVEKLYRNVDC----Yamv  635
              AV+LA++S SDK A  T  +Y VGF  TVGAALL+A  LPLVE  Y+   C    Y +V
Sbjct  178   GAVVLAINSDSDKLANETHKEYVVGFLMTVGAALLYAFILPLVELSYKK-SCQRVTYTLV  236

Query  634   vemqvvmeaaATVLATVGMAIDGGFSGMKKESQGGFDLGSKAYAMTVGLNVLTWQLCFMG  455
             +E Q+V+   AT    VGM + G F  + +E++  F LG   Y + V    + WQ  F+G
Sbjct  237   LEFQMVLCFVATCFCLVGMLVAGDFKVIAREAR-DFKLGESLYYVVVVFTAVIWQAFFVG  295

Query  454   TAGMVFLTTSVTSGICSTALMAFNVVGGVLAYGDHMGGSKAVSTVLCVWGFSSYVYGMYL  275
               G++F  +S+ SGI  +AL+   VV  V+ + +     K V+  L +WG  SY YG + 
Sbjct  296   AIGLIFCVSSLVSGIMVSALLPVTVVLAVICFQEKFQAGKGVALALSLWGSVSYFYGQFK  355

Query  274   KTKK  263
               +K
Sbjct  356   SEEK  359



>ref|XP_010469434.1| PREDICTED: purine permease 2-like [Camelina sativa]
Length=350

 Score =   160 bits (405),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 117/304 (38%), Positives = 176/304 (58%), Gaps = 7/304 (2%)
 Frame = -1

Query  1153  KFYFVHGGSSRWVATWVQCAGFPL-LIPAVYLPYYAFNSTERRPFAGFSLR--IFSLSVV  983
             + YF +GG   W ++++Q  G PL L P ++         E+   + F ++  +F  SVV
Sbjct  28    RLYFHNGGERIWFSSFLQTVGCPLILFPLLFSFLRRRRLVEQEKTSLFLMKPPLFIASVV  87

Query  982   IGLMLGVNNLLISWGTSYLPVSTCSLVLASQLVFILFLSAIIVRQKITFANLNCvvlltl  803
              GL++G +N L S+G +Y+PVST SL++++QL F    +  +VRQK T   +N +VLLT+
Sbjct  88    AGLLMGFDNYLYSYGLAYIPVSTASLIISAQLGFTALFAFFMVRQKFTPFTINAIVLLTV  147

Query  802   aavllaLDSSSDKPAGLTKAKYFVGFFCTVGAALLFALYLPLVEKLY---RNVDCYamvv  632
              AV+LA++S SDK A  T  +Y VGF  TVGAALL+A  LPLVE  Y   R    Y +V+
Sbjct  148   GAVVLAINSDSDKLANETHKEYVVGFLMTVGAALLYAFILPLVELSYKKSRQGVTYTLVL  207

Query  631   emqvvmeaaATVLATVGMAIDGGFSGMKKESQGGFDLGSKAYAMTVGLNVLTWQLCFMGT  452
             E Q+V+  AAT    VGM + G F  + +E++  F LG   Y + V    + WQ  F+G 
Sbjct  208   EFQMVLCFAATCFCLVGMLVAGDFKVIAREAR-DFKLGESLYYVVVVFTAVIWQAFFVGA  266

Query  451   AGMVFLTTSVTSGICSTALMAFNVVGGVLAYGDHMGGSKAVSTVLCVWGFSSYVYGMYLK  272
              G++F  +S+ SGI  +AL+   VV  V+ + +     K V+  L +WG  SY YG +  
Sbjct  267   IGLIFCVSSLVSGIMVSALLPVTVVLAVICFQEKFQAGKGVALALSLWGSVSYFYGQFKS  326

Query  271   TKKV  260
              +K+
Sbjct  327   DEKI  330



>ref|XP_009599635.1| PREDICTED: purine permease 1-like [Nicotiana tomentosiformis]
Length=352

 Score =   160 bits (404),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 115/316 (36%), Positives = 179/316 (57%), Gaps = 18/316 (6%)
 Frame = -1

Query  1153  KFYFVHGGSSRWVATWVQCAGFPL-LIPAVYLPYYAFNSTERRPFAGFSL-------RIF  998
             + Y+V GGS  W ++W+Q AG+P  LIP   L +Y      RR   G +        RIF
Sbjct  34    RLYYVEGGSRVWFSSWLQTAGWPFTLIPLAILYFY------RRKTEGINAKYYLITPRIF  87

Query  997   SLSVVIGLMLGVNNLLISWGTSYLPVSTCSLVLASQLVFILFLSAIIVRQKITFANLNCv  818
               S +IG++ G+++ L SWG S LPVST SL+LA+QL F    +  IV+ K T  ++N V
Sbjct  88    IASFIIGVVTGLDDFLYSWGGSKLPVSTSSLLLAAQLAFTAVGAFFIVKLKFTPYSINAV  147

Query  817   vlltlaavllaLDSSSDKPAGLTKAKYFVGFFCTVGAALLFALYLPLVEKLY---RNVDC  647
             VLLT+  VLL + S+ D+P G+T   Y +GF  T+ AA L+ + LP +E +Y   +    
Sbjct  148   VLLTVGVVLLGVRSNGDRPEGVTSKAYILGFMMTLLAAALYGVILPCIELIYLKAKQAIT  207

Query  646   YamvvemqvvmeaaATVLATVGMAIDGGFSGMKKESQGGFDLGSKAYAMTVGLNVLTWQL  467
               +V+E+Q+VM  AAT   TVGM  +  F  + +E++  F+LG   Y   +    + WQ 
Sbjct  208   ATLVLEIQMVMCFAATAFCTVGMIANNDFQAISREAK-QFNLGEARYYTVIVWTTIIWQC  266

Query  466   CFMGTAGMVFLTTSVTSGICSTALMAFNVVGGVLAYGDHMGGSKAVSTVLCVWGFSSYVY  287
              F+G  G+++ ++S+ SG+    L+    V  V+ + ++  G K ++  L +WGF SY Y
Sbjct  267   FFVGVIGVIYCSSSLMSGVMIAVLLPVTEVLAVVFFRENFSGEKGLALFLSLWGFVSYFY  326

Query  286   GMYLKTKKVTKEVPPA  239
             G + +TKK   + P +
Sbjct  327   GEFRQTKKEKNKSPKS  342



>ref|XP_003550935.1| PREDICTED: probable purine permease 11-like [Glycine max]
 gb|KHN01665.1| Putative purine permease 10 [Glycine soja]
Length=390

 Score =   160 bits (406),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 121/323 (37%), Positives = 190/323 (59%), Gaps = 20/323 (6%)
 Frame = -1

Query  1153  KFYFVHGGSSRWVATWVQCAGFPLLIPAV-YLP---YYAFN--------STERRPFAGFS  1010
             + Y+ +GG+S+W+AT+VQ AGFP+L+P + Y P   +  FN        S + +P   FS
Sbjct  63    RLYYDNGGNSKWMATFVQSAGFPVLLPLLFYFPRQTHAKFNNNPSNNDYSYKTKP--KFS  120

Query  1009  LRIFSLSVVIGLMLGVNNLLISWGTSYLPVSTCSLVLASQLVFILFLSAIIVRQKITFAN  830
               +F L +  GL+L  +NL+ S+G  YLP+ST SL+ A+QL F    S  +  QK T   
Sbjct  121   TLVF-LYLAFGLILTGDNLMYSYGLLYLPLSTYSLLCATQLGFNAVFSFFLNSQKFTAFI  179

Query  829   LNCvvlltlaavllaLDSSSDKPA-GLTKAKYFVGFFCTVGAALLFALYLPLVEKLYRNV  653
             +N VVLLT++A LLA++S SD+ + GL++ K+ +GFFCT+GA+  F+LYL LV+  ++ V
Sbjct  180   INSVVLLTISASLLAINSDSDEDSTGLSREKHVIGFFCTIGASATFSLYLSLVQLSFQKV  239

Query  652   ---DCYamvvemqvvmeaaATVLATVGMAIDGGFSGMKKESQGGFDLGSKAYAMTVGLNV  482
                + ++ V++MQ      AT    VG+   G +  +  E +G +D GS +Y MT+    
Sbjct  240   IKRETFSAVLDMQFYPSFIATCACVVGLFASGEWKSLNNEMKG-YDKGSVSYVMTLLWIA  298

Query  481   LTWQLCFMGTAGMVFLTTSVTSGICSTALMAFNVVGGVLAYGDHMGGSKAVSTVLCVWGF  302
             +TWQ+  +G  G++F  +S+ S +  T  +    +  ++ + D + G K V+ +L VWGF
Sbjct  299   VTWQISSIGMLGLIFEVSSLFSNVIGTLALPIVPILAIVFFHDKINGVKFVALLLAVWGF  358

Query  301   SSYVYGMYLKTKKVTKEVPPAIG  233
              SYVY  YL  KK   E    +G
Sbjct  359   LSYVYQHYLDDKKAKAEKSDGLG  381



>gb|KFK44702.1| hypothetical protein AALP_AA1G292000 [Arabis alpina]
Length=354

 Score =   160 bits (404),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 116/314 (37%), Positives = 179/314 (57%), Gaps = 10/314 (3%)
 Frame = -1

Query  1153  KFYFVHGGSSRWVATWVQCAGFP-LLIPAVYLPYYAFNSTERRPFAG------FSLRIFS  995
             + Y+ +GG   W  +++  AGFP +LIP ++   +  N TE    A           +F 
Sbjct  25    RLYYTNGGKRIWFMSFLSTAGFPVILIPLLFSFLHRRNRTETTENAKKEGIILMETPLFI  84

Query  994   LSVVIGLMLGVNNLLISWGTSYLPVSTCSLVLASQLVFILFLSAIIVRQKITFANLNCvv  815
              S+VIGL+ G++N L ++G +YLPVST SL++ +QL F    + ++V+QK T  ++N VV
Sbjct  85    ASIVIGLLTGLDNYLYAYGLAYLPVSTSSLIIGTQLAFNALFAFLMVKQKFTPFSINAVV  144

Query  814   lltlaavllaLDSSSDKPAGLTKAKYFVGFFCTVGAALLFALYLPLVEKLY---RNVDCY  644
             LLT+   +LAL S  DKPA  ++ +Y +GF  TV AA+L+A  LPLVE  Y   R    +
Sbjct  145   LLTVGIGILALHSDGDKPAHESRKEYVIGFLMTVVAAVLYAFILPLVELTYKKARQEITF  204

Query  643   amvvemqvvmeaaATVLATVGMAIDGGFSGMKKESQGGFDLGSKAYAMTVGLNVLTWQLC  464
              +V+EMQ+VM  A +V   VGM IDG F  + +E++     GS  Y   + +  + WQ  
Sbjct  205   TLVLEMQLVMCIAGSVFCLVGMIIDGDFKVIAREAREFKIGGSMFYYSLIVITGIIWQGF  264

Query  463   FMGTAGMVFLTTSVTSGICSTALMAFNVVGGVLAYGDHMGGSKAVSTVLCVWGFSSYVYG  284
             F+G  G+VF  +S+ SG+  + L+    V  V+ + +     K V+ +L +WGF SY YG
Sbjct  265   FLGAIGIVFCASSLASGVLISVLLPVTEVLAVVCFREKFQAEKGVALLLSLWGFVSYFYG  324

Query  283   MYLKTKKVTKEVPP  242
              +   KKV ++  P
Sbjct  325   EFKSGKKVLEKAQP  338



>gb|AES73112.2| purine permease-like protein [Medicago truncatula]
Length=370

 Score =   160 bits (404),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 110/318 (35%), Positives = 178/318 (56%), Gaps = 19/318 (6%)
 Frame = -1

Query  1153  KFYFVHGGSSRWVATWVQCAGFPLLIPAVYLPYYAFNSTERRP-------FAGFSLRIFS  995
             + YF+HGG   W++ ++Q AGFPL++  + + Y   +     P        A   L I S
Sbjct  37    RLYFIHGGQRVWLSAFLQTAGFPLMLIPLAISYIKRHRLHHHPPPLTTISIAPEKLNIIS  96

Query  994   L-------SVVIGLMLGVNNLLISWGTSYLPVSTCSLVLASQLVFILFLSAIIVRQKITF  836
             +       +  IG++ G+++ L ++G + LPVST +L++ASQL F  F + +IV++K T 
Sbjct  97    MKPPIFFAAAFIGILTGLDDYLFAYGVARLPVSTSALIIASQLGFTAFFAFLIVKEKFTA  156

Query  835   ANLNCvvlltlaavllaLDSSSDKPAGLTKAKYFVGFFCTVGAALLFALYLPLVEKLYRN  656
               +N VVLLT+ A +LA+ +SSD+PAG++  +Y++ F  TV A+ L+   LP VE +Y+ 
Sbjct  157   FTVNAVVLLTVGAGVLAMHTSSDRPAGVSAKQYWISFSTTVAASALYGFILPSVELVYKK  216

Query  655   VD---CYamvvemqvvmeaaATVLATVGMAIDGGFSGMKKESQGGFDLGSKAYAMTVGLN  485
             +     Y+ V+E Q V    AT+   +GM  +  F  + KE++  F LG   Y + + ++
Sbjct  217   IKQPVTYSFVMEFQFVTCMFATLFCAIGMIANNDFKVIPKEAR-NFGLGESTYYVVLVVS  275

Query  484   VLTWQLCFMGTAGMVFLTTSVTSGICSTALMAFNVVGGVLAYGDHMGGSKAVSTVLCVWG  305
              + WQ  F+G  G++F  +S+ SGI    L+    V  V+ Y +     K VS VL +WG
Sbjct  276   AIMWQAFFLGAIGVIFCASSLLSGILIAVLLPLTEVLAVVFYKEKFQAEKGVSLVLSLWG  335

Query  304   FSSYVYGMYLKTKKVTKE  251
             F SY YG  +K  K  K+
Sbjct  336   FVSYFYG-EIKHAKAEKK  352



>gb|EPS67422.1| hypothetical protein M569_07351, partial [Genlisea aurea]
Length=319

 Score =   159 bits (401),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 111/296 (38%), Positives = 172/296 (58%), Gaps = 6/296 (2%)
 Frame = -1

Query  1153  KFYFVHGGSSRWVATWVQCAGFP-LLIPAVYLPYYAFNSTERRPFAGFSLRIFSLSVVIG  977
             + YF  GG+  W ++W++ AGFP +LIP +Y  Y A   T        + ++ S + V+G
Sbjct  25    RLYFTRGGNRIWFSSWLESAGFPIILIPLIY-SYCAGRGTHPSGIISMNPKLCSAAAVVG  83

Query  976   LMLGVNNLLISWGTSYLPVSTCSLVLASQLVFILFLSAIIVRQKITFANLNCvvlltlaa  797
             ++ G++N L ++G + LPVST SL++ASQL F    + +IV+QK T  ++N VVLLT+AA
Sbjct  84    VLAGLDNYLYAYGVAKLPVSTSSLIIASQLGFTAVFAYLIVKQKFTAFSINAVVLLTVAA  143

Query  796   vllaLDSSSDKPAGLTKAKYFVGFFCTVGAALLFALYLPLVEKLYRNVDC---Yamvvem  626
              +LAL S+ D+P G +   Y+ GF  T+ AA L+ L LPLVE  Y        Y  V++ 
Sbjct  144   GILALHSNGDRPKGESNGDYYTGFVLTLAAAALYGLMLPLVELAYAKTGQDLNYDAVLKF  203

Query  625   qvvmeaaATVLATVGMAIDGGFSGMKKESQGGFDLGSKAYAMTVGLNVLTWQLCFMGTAG  446
             Q V+   AT+  T+GMA+ G F  +  E++ GF LG   Y   V  + + WQ  F+G  G
Sbjct  204   QFVLGFFATLACTIGMAVSGDFPAIPTEAR-GFQLGEGRYYAVVVSSAIIWQCFFLGNIG  262

Query  445   MVFLTTSVTSGICSTALMAFNVVGGVLAYGDHMGGSKAVSTVLCVWGFSSYVYGMY  278
             ++F ++++ SG+  + L+    +  VL + +     K VS  L ++GF SY YG Y
Sbjct  263   VIFYSSALLSGVLISVLLPPTEILAVLFFREKFQAEKGVSLFLSLFGFVSYFYGEY  318



>gb|EYU21537.1| hypothetical protein MIMGU_mgv1a018814mg [Erythranthe guttata]
Length=354

 Score =   159 bits (403),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 108/301 (36%), Positives = 172/301 (57%), Gaps = 17/301 (6%)
 Frame = -1

Query  1153  KFYFVHGGSSRWVATWVQCAGFPLLIPAVYLPYYAFNSTERRPFAG--------FSLRIF  998
             + YFVHGG   W ++W++  G+P+++  + + Y     T RR  A            R+F
Sbjct  25    RLYFVHGGKRIWFSSWLETGGWPIILAPLIVSY-----TRRRRTAAAGKAELYLMKPRVF  79

Query  997   SLSVVIGLMLGVNNLLISWGTSYLPVSTCSLVLASQLVFILFLSAIIVRQKITFANLNCv  818
               + VIG++ G ++ L ++G + LPVST +L++ASQL F    + ++V+Q+ T  ++N V
Sbjct  80    VAAAVIGVLTGFDDYLYAYGVAKLPVSTSALIVASQLAFTAVFAFLMVKQEFTAYSVNAV  139

Query  817   vlltlaavllaLDSSSDKPAGLTKAKYFVGFFCTVGAALLFALYLPLVEKLYRNVD---C  647
             VLLTL AV+L L +S D+P G +  +Y VGF  TV AA L+   LP VE  Y+       
Sbjct  140   VLLTLGAVVLGLHTSGDRPEGESSKEYMVGFLLTVAAAALYGFILPAVELTYKKAKQAVS  199

Query  646   YamvvemqvvmeaaATVLATVGMAIDGGFSGMKKESQGGFDLGSKAYAMTVGLNVLTWQL  467
             Y +V+EMQ+VM   AT   TVGM ++  F  + +E++  ++LG   Y + V  + + WQ 
Sbjct  200   YTLVLEMQLVMCVFATSFCTVGMLVNNDFQAIAREAR-AYELGETKYYIVVLWSAIVWQC  258

Query  466   CFMGTAGMVFLTTSVTSGICSTALMAFNVVGGVLAYGDHMGGSKAVSTVLCVWGFSSYVY  287
              F+G  G++F ++S+ SGI  T L+    +  ++ Y +     K +S  L +WGF SY Y
Sbjct  259   FFLGAIGVIFYSSSLLSGIVITVLLPATEILAIIFYHEKFQAEKGLSLFLSLWGFISYFY  318

Query  286   G  284
             G
Sbjct  319   G  319



>ref|XP_010677221.1| PREDICTED: probable purine permease 11 isoform X1 [Beta vulgaris 
subsp. vulgaris]
 ref|XP_010677222.1| PREDICTED: probable purine permease 11 isoform X2 [Beta vulgaris 
subsp. vulgaris]
Length=396

 Score =   160 bits (405),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 114/306 (37%), Positives = 179/306 (58%), Gaps = 11/306 (4%)
 Frame = -1

Query  1153  KFYFVHGGSSRWVATWVQCAGFPLLIPAVYLPYYAFNSTERRPFAGFSLRIFSLSVVIGL  974
             + YF  GG+S+W+AT+VQ AGFP+LIP  +  +++ ++   RP      ++ SL +  GL
Sbjct  84    RLYFDKGGNSKWMATFVQSAGFPILIPLKF--FFSSSAASIRPSLA---QLASLYLAFGL  138

Query  973   MLGVNNLLISWGTSYLPVSTCSLVLASQLVFILFLSAIIVRQKITFANLNCvvlltlaav  794
             +L  +NL+ S+G  YLPVST SL+ ASQL F    S  I +QK T   LN +V+LT+A  
Sbjct  139   LLTGDNLMYSYGLLYLPVSTYSLLCASQLAFNAVTSFFINKQKFTALVLNSLVILTIAMC  198

Query  793   llaLDSSSD--KPAGLTKAKYFVGFFCTVGAALLFALYLPLVEKLYRNV---DCYamvve  629
             LLA+++S+D      + + KY +GF CT+GA+  ++LYL L +  +  V   + +  +V 
Sbjct  199   LLAINASNDGNTSNDIARGKYVIGFLCTLGASATYSLYLSLTQYSFEKVIKDESFNTIVC  258

Query  628   mqvvmeaaATVLATVGMAIDGGFSGMKKESQGGFDLGSKAYAMTVGLNVLTWQLCFMGTA  449
             MQ+     AT    +G+   G +  + +E +G + LG  +Y MT+    ++WQ+  +G  
Sbjct  259   MQLYPSFVATCACVIGLFGSGEWKTLNEEMKG-YKLGRVSYVMTLAFTAISWQVSSVGLL  317

Query  448   GMVFLTTSVTSGICSTALMAFNVVGGVLAYGDHMGGSKAVSTVLCVWGFSSYVYGMYLKT  269
             G++F  +S+ S + ST  +    V  V+ + D M G K +S VL +WGF SY+Y  YL  
Sbjct  318   GLIFEVSSLFSNVISTVSLPVVPVFAVVFFHDKMNGVKVISLVLAIWGFVSYIYQHYLDN  377

Query  268   KKVTKE  251
              KV KE
Sbjct  378   TKVIKE  383



>ref|XP_010509839.1| PREDICTED: purine permease 2-like [Camelina sativa]
Length=351

 Score =   159 bits (402),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 115/306 (38%), Positives = 176/306 (58%), Gaps = 8/306 (3%)
 Frame = -1

Query  1153  KFYFVHGGSSRWVATWVQCAGFPLLIPAVYLPYYAFNSTERRPFAGFSLR---IFSLSVV  983
             + YF +GG+  W ++++Q  G PL+I  +   +      E +      L    +F  SVV
Sbjct  29    RLYFHNGGARIWFSSFLQTVGCPLIIFPLLFSFLRRRRLEEQEKTSLFLMKPPLFIASVV  88

Query  982   IGLMLGVNNLLISWGTSYLPVSTCSLVLASQLVFILFLSAIIVRQKITFANLNCvvlltl  803
             +GL++G +N L S+G +Y+PVST SL++++QL F    +  +V+QK T   +N +VLLT+
Sbjct  89    VGLLMGFDNYLYSYGLAYIPVSTASLIISAQLGFTALFAFFMVKQKFTPFTINAIVLLTV  148

Query  802   aavllaLDSSSDKPAGLTKAKYFVGFFCTVGAALLFALYLPLVEKLY---RNVDCYamvv  632
              AV+LA++S SDK A  T  +Y V F  TVGAALL+A  LPLVE  Y   R    Y +V+
Sbjct  149   GAVVLAINSDSDKLANDTHKEYVVAFLMTVGAALLYAFILPLVELSYKKSRQRVTYTLVL  208

Query  631   emqvvmeaaATVLATVGMAIDGGFSGMKKESQGGFDLGSKAYAMTVGLNVLTWQLCFMGT  452
             E Q+V+   AT    VGM + G F  + +E++  F LG   Y + V    + WQ  F+G 
Sbjct  209   EFQMVLCFVATCFCFVGMLVAGDFKVIAREAR-DFKLGESLYYVVVVFTAVIWQAFFVGA  267

Query  451   AGMVFLTTSVTSGICSTALMAFNVVGGVLAYGDHMGGSKAVSTVLCVWGFSSYVYGMYLK  272
              G++F  +S+ SGI  +AL+   VV  V+ + +     K V+  L +WG  SY YG  +K
Sbjct  268   IGLIFCASSLVSGIMVSALLPVTVVLAVICFQEKFQAGKGVALALSLWGSVSYFYGQ-IK  326

Query  271   TKKVTK  254
             +++ TK
Sbjct  327   SEEKTK  332



>ref|XP_009783837.1| PREDICTED: purine permease 3-like [Nicotiana sylvestris]
Length=353

 Score =   159 bits (402),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 114/304 (38%), Positives = 176/304 (58%), Gaps = 10/304 (3%)
 Frame = -1

Query  1153  KFYFVHGGSSRWVATWVQCAGFPL-LIPAVYLPYYAFNSTERRPFAGF---SLRIFSLSV  986
             + Y+V GGS  W+++W+Q  G+PL ++P   L  Y +      P A F   + RIF  S 
Sbjct  34    RLYYVEGGSRIWLSSWLQTGGWPLTIVPLAIL--YLYRRKIEGPDAKFYFITPRIFVASF  91

Query  985   VIGLMLGVNNLLISWGTSYLPVSTCSLVLASQLVFILFLSAIIVRQKITFANLNCvvllt  806
             +IG+  GV++ L SWG S LPVST SL+LA+QL F    +  IV+ K+T  + N VVLLT
Sbjct  92    IIGIATGVDDFLYSWGGSKLPVSTSSLLLAAQLAFTAIGAFFIVKLKLTPYSTNAVVLLT  151

Query  805   laavllaLDSSSDKPAGLTKAKYFVGFFCTVGAALLFALYLPLVEKLY---RNVDCYamv  635
             + AVLL + ++ D+P G+T   Y +GF  T+ AA L+ + LP +E +Y   +      +V
Sbjct  152   VGAVLLGIRANGDRPEGVTSKAYILGFIMTLLAAALYGIILPCIELMYLKAKQSITATLV  211

Query  634   vemqvvmeaaATVLATVGMAIDGGFSGMKKESQGGFDLGSKAYAMTVGLNVLTWQLCFMG  455
             +E+Q+VM  AAT   TVGM  +  F  M +E++  F+LG   Y   +    + WQ  F+G
Sbjct  212   LEIQMVMCFAATAFCTVGMIANKDFQAMSREAK-QFNLGEARYYTVIVWTAIIWQCFFVG  270

Query  454   TAGMVFLTTSVTSGICSTALMAFNVVGGVLAYGDHMGGSKAVSTVLCVWGFSSYVYGMYL  275
               G+++ ++S+ SG+    L+    V  V+ + +   G K ++  L +WGF SY YG + 
Sbjct  271   VIGVIYCSSSLMSGVMIAVLLPVTEVLAVVFFNEKFSGEKGLALFLSLWGFVSYFYGEFR  330

Query  274   KTKK  263
             +TKK
Sbjct  331   QTKK  334



>ref|NP_174143.1| purine permease 3 [Arabidopsis thaliana]
 sp|Q9FZ95.1|PUP3_ARATH RecName: Full=Purine permease 3; Short=AtPUP3 [Arabidopsis thaliana]
 gb|AAF98433.1|AC021044_12 Similar to purine permease [Arabidopsis thaliana]
 gb|AEE30933.1| purine permease 3 [Arabidopsis thaliana]
Length=351

 Score =   159 bits (402),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 105/301 (35%), Positives = 169/301 (56%), Gaps = 16/301 (5%)
 Frame = -1

Query  1153  KFYFVHGGSSRWVATWVQCAGFPLLIPAVYLPYYAFNSTERRP--------FAGFSLRIF  998
             + YF +GG   W +T+++ AGFP+    +++P      T RR         F     R+ 
Sbjct  25    RLYFNNGGKRIWFSTFLETAGFPV----IFIPLLFSYITRRRSNNVGDSTSFFLIKPRLL  80

Query  997   SLSVVIGLMLGVNNLLISWGTSYLPVSTCSLVLASQLVFILFLSAIIVRQKITFANLNCv  818
               +V++G++ G +N L ++G +YLPVST +L++ASQL FI   S  +V+ K T   +N V
Sbjct  81    IAAVIVGILSGFDNYLYAYGIAYLPVSTAALIIASQLAFIAIFSFFMVKHKFTPFTINAV  140

Query  817   vlltlaavllaLDSSSDKPAGLTKAKYFVGFFCTVGAALLFALYLPLVEKLYRNVD---C  647
             VLLT+ A +L + + +DKP   T  +Y  GF  TV AA+++A  LPLVE  Y+       
Sbjct  141   VLLTVGAAVLGMHTETDKPVHETHKQYITGFLITVAAAVMYAFILPLVELAYQKAKQTMS  200

Query  646   YamvvemqvvmeaaATVLATVGMAIDGGFSGMKKESQGGFDLGSKAYAMTVGLNVLTWQL  467
             Y +V+E Q+++   A++++ +GM I G F  + KE++  F LG   + +    + + WQ 
Sbjct  201   YTLVLEFQLILCLLASIVSVIGMFIAGDFKALPKEAR-EFKLGEALFYVVAVFSAIIWQG  259

Query  466   CFMGTAGMVFLTTSVTSGICSTALMAFNVVGGVLAYGDHMGGSKAVSTVLCVWGFSSYVY  287
              F+G  G++F T+S+ SGI  + L+    V  V+ Y +     K +S  L +WGF SY Y
Sbjct  260   FFLGAIGLIFSTSSLVSGIMISVLLPITEVLAVIFYHEKFQAEKGLSLALSLWGFVSYFY  319

Query  286   G  284
             G
Sbjct  320   G  320



>ref|XP_010060067.1| PREDICTED: purine permease 1-like [Eucalyptus grandis]
Length=360

 Score =   159 bits (402),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 105/311 (34%), Positives = 179/311 (58%), Gaps = 17/311 (5%)
 Frame = -1

Query  1153  KFYFVHGGSSRWVATWVQCAGFPLLIPAVYLPYYAFNSTERRPFAGFSLRI-------FS  995
             + YFV GG+  W+ +W++   +P+L+  +   Y     + RR   G + R+       F+
Sbjct  37    RLYFVRGGARMWLVSWLEMGAWPMLLVPLGAAY-----SRRRSAEGPTARLVLMDRFLFA  91

Query  994   LSVVIGLMLGVNNLLISWGTSYLPVSTCSLVLASQLVFILFLSAIIVRQKITFANLNCvv  815
              +  IG++LG++N   ++G   LPVST +L++A+QL F    + ++VRQ+ T  ++N + 
Sbjct  92    AAAGIGVLLGLDNYFYAYGVGRLPVSTSALLIATQLAFTAGFAFLLVRQRFTSCSINSIF  151

Query  814   lltlaavllaLDSSSDKPAGLTKAKYFVGFFCTVGAALLFALYLPLVEKLYRNVD---CY  644
             LLT+ A +L++ +SSD+PAG +K  YF GFF T+GAA L+ L LPLVE +Y+       Y
Sbjct  152   LLTIGAGVLSMHTSSDRPAGESKGAYFTGFFMTLGAAALYGLVLPLVELMYKKAKQAVTY  211

Query  643   amvvemqvvmeaaATVLATVGMAIDGGFSGMKKESQGGFDLGSKAYAMTVGLNVLTWQLC  464
             ++V+E+Q+VM   AT   TV M ++  F  + +E++  ++LG   Y + +    +  Q  
Sbjct  212   SLVLEIQLVMCFFATAFCTVAMLVNKDFQAIPREAR-NYELGEARYYVVLVWTAIINQFF  270

Query  463   FMGTAGMVFLTTSVTSGICSTALMAFNVVGGVLAYGDHMGGSKAVSTVLCVWGFSSYVYG  284
             F+G  G++F  +S+ S +    L+ F  +  V+ + +     K V+  L +WGF+SY YG
Sbjct  271   FLGAIGVIFYASSLFSAVIIATLLPFTEILAVICFQEKFQAEKGVALALSLWGFASYFYG  330

Query  283   MYLKTKKVTKE  251
              + K  K  KE
Sbjct  331   EF-KLAKKEKE  340



>ref|XP_008806390.1| PREDICTED: purine permease 3-like [Phoenix dactylifera]
Length=367

 Score =   159 bits (402),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 109/303 (36%), Positives = 175/303 (58%), Gaps = 12/303 (4%)
 Frame = -1

Query  1153  KFYFVHGGSSRWVATWVQCAGFPLLIPAVYLPYYAFN------STERRPFAGFSL--RIF  998
             + YF HGG  +W+++W++  G+PL++  + + Y               P   F L  R+F
Sbjct  45    RVYFRHGGHRQWLSSWLETGGWPLILLPLSISYLYRRRRRLAPDNHHHPTKLFFLTPRLF  104

Query  997   SLSVVIGLMLGVNNLLISWGTSYLPVSTCSLVLASQLVFILFLSAIIVRQKITFANLNCv  818
                 V+GL++GV++ L ++G S+LPVST +L+++SQL F    + +IV+QK T  ++N V
Sbjct  105   LACAVLGLLIGVDDFLYAYGLSFLPVSTSALLISSQLAFTASFAFLIVKQKFTPYSINSV  164

Query  817   vlltlaavllaLDSSSDKPAGLTKAKYFVGFFCTVGAALLFALYLPLVEKLY---RNVDC  647
              LLT+ AV+L L +SSD+P  +++ +Y  GFF T+G A L+ L LPLVE  Y   R V  
Sbjct  165   ALLTVGAVMLGLHTSSDRPDNVSEGQYLTGFFLTLGTAALYGLILPLVELTYRKARQVIT  224

Query  646   YamvvemqvvmeaaATVLATVGMAIDGGFSGMKKESQGGFDLGSKAYAMTVGLNVLTWQL  467
             Y +V+EMQ+VM   AT L T+GM ++  F  + +E++  + LG   Y M +  + + WQ 
Sbjct  225   YTLVMEMQLVMGFFATALCTIGMLVNKDFEVIPREAR-QYGLGEVKYYMVLVWSAILWQC  283

Query  466   CFMGTAGMVFLTTSVTSGICSTALMAFNVVGGVLAYGDHMGGSKAVSTVLCVWGFSSYVY  287
              F+GT G++F   ++ +GI     +    +   +   +     K VS  LC+WG +SY Y
Sbjct  284   FFLGTVGVIFCVNTLLAGIIIAVFIPVIELFAAILLHEKFTSEKGVSLALCLWGLASYSY  343

Query  286   GMY  278
             G Y
Sbjct  344   GEY  346



>ref|XP_011006371.1| PREDICTED: purine permease 3 [Populus euphratica]
Length=356

 Score =   159 bits (401),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 109/308 (35%), Positives = 180/308 (58%), Gaps = 7/308 (2%)
 Frame = -1

Query  1153  KFYFVHGGSSRWVATWVQCAGFPLLIPAVYLPYYAFNSTE--RRPFAGFSLRIFSLSVVI  980
             + YF+HGG   W++ W++  G+P+++  + L Y+   +T+   R F      +F  +  I
Sbjct  37    RLYFIHGGKRVWLSAWLETGGWPIILIPIALSYFHRRATDPTTRLFY-MKPPLFIAAATI  95

Query  979   GLMLGVNNLLISWGTSYLPVSTCSLVLASQLVFILFLSAIIVRQKITFANLNCvvlltla  800
             G++ G+++ L ++G + LPVST +L++A+QL F    + ++V+QK T  ++N VVLLT+ 
Sbjct  96    GVLTGLDDYLYAYGVARLPVSTSALIIATQLAFTAGFAFLLVKQKFTSYSINAVVLLTVG  155

Query  799   avllaLDSSSDKPAGLTKAKYFVGFFCTVGAALLFALYLPLVEKLY---RNVDCYamvve  629
             A +LA+ + SDKPA  +  +Y +GF  T+ AA L+ L LPLVE  Y   R    Y +V+E
Sbjct  156   AGVLAMHTGSDKPAHESSREYILGFIMTLVAAALYGLILPLVELTYKKSRQEMNYTLVME  215

Query  628   mqvvmeaaATVLATVGMAIDGGFSGMKKESQGGFDLGSKAYAMTVGLNVLTWQLCFMGTA  449
             +Q+VM   ATV  TVGM I+  F  + +E++  F+LG   Y + +  + + WQ  F+G  
Sbjct  216   IQMVMCLLATVFCTVGMLINKDFQAIPREAR-NFELGEVKYYVVLVWSAIIWQCFFLGAI  274

Query  448   GMVFLTTSVTSGICSTALMAFNVVGGVLAYGDHMGGSKAVSTVLCVWGFSSYVYGMYLKT  269
             G++F  +S+ SGI  +AL+    +  V+ + +     K V+  L +WGF SY YG   + 
Sbjct  275   GVIFSASSLLSGILISALLPATEILSVIFFQEKFQAEKGVALGLSLWGFVSYFYGEMKEN  334

Query  268   KKVTKEVP  245
             KK     P
Sbjct  335   KKKKLAAP  342



>ref|XP_006433898.1| hypothetical protein CICLE_v10001546mg [Citrus clementina]
 gb|ESR47138.1| hypothetical protein CICLE_v10001546mg [Citrus clementina]
Length=371

 Score =   159 bits (402),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 113/321 (35%), Positives = 180/321 (56%), Gaps = 21/321 (7%)
 Frame = -1

Query  1153  KFYFVHGGSSRWVATWVQCAGFPLLIPAVYLPYYAF----------NSTERRPFAGFSLR  1004
             + YF+HGG   W ++W++ AG P+++  + + Y             +ST  +P    + +
Sbjct  39    RLYFLHGGKRIWFSSWLEAAGCPVILIPITVSYLQRRRSSTTTDHESSTSSQPSNNDNNK  98

Query  1003  -------IFSLSVVIGLMLGVNNLLISWGTSYLPVSTCSLVLASQLVFILFLSAIIVRQK  845
                    +F  S +IG++ G++N L ++G + LPVST SL++ASQL F    + ++V+QK
Sbjct  99    LILMRPPVFFASAIIGILTGLDNYLYAYGVARLPVSTSSLIIASQLAFTAAFAFLLVKQK  158

Query  844   ITFANLNCvvlltlaavllaLDSSSDKPAGLTKAKYFVGFFCTVGAALLFALYLPLVEKL  665
             +T  +LN V LLTL AV+L L ++ D+P   +  +Y VGF  TVGAA+L+   LPL+E  
Sbjct  159   LTSYSLNAVFLLTLGAVVLGLHTNGDRPHNESARQYLVGFLMTVGAAVLYGFVLPLMELT  218

Query  664   Y---RNVDCYamvvemqvvmeaaATVLATVGMAIDGGFSGMKKESQGGFDLGSKAYAMTV  494
             Y   R    YA+V+E+Q+VM   AT++ TVGM ++  F  + KE++  + LG   Y   V
Sbjct  219   YKRARQEITYALVLEIQMVMCLFATLVCTVGMVVNKDFQAIGKEAR-AYTLGEGKYYAVV  277

Query  493   GLNVLTWQLCFMGTAGMVFLTTSVTSGICSTALMAFNVVGGVLAYGDHMGGSKAVSTVLC  314
               + L WQ  F+G  G+++  +S+ S I    L+    +  V+ Y +     K VS  L 
Sbjct  278   VASALIWQCFFLGAIGVIYCGSSLLSAIIIAVLLPVTEILAVIFYKEKFQAEKGVSLALS  337

Query  313   VWGFSSYVYGMYLKTKKVTKE  251
             +WGF+SY YG     KK+ K 
Sbjct  338   LWGFASYFYGEIKNNKKMKKR  358



>ref|XP_002320858.2| purine permease family protein [Populus trichocarpa]
 gb|EEE99173.2| purine permease family protein [Populus trichocarpa]
Length=368

 Score =   159 bits (402),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 111/309 (36%), Positives = 186/309 (60%), Gaps = 16/309 (5%)
 Frame = -1

Query  1153  KFYFVHGGSSRWVATWVQCAGFPLL-IPAVYLPYYAFNSTERRPFAGF----SLRIF-SL  992
             +FY+  GG+S+W+AT +Q AGFP+L IP   LP      +++ P + +    S+R   S+
Sbjct  53    RFYYDQGGNSKWIATVIQTAGFPILFIPLFLLP------SDKEPLSSYTSSPSVRTLASI  106

Query  991   SVVIGLMLGVNNLLISWGTSYLPVSTCSLVLASQLVFILFLSAIIVRQKITFANLNCvvl  812
              +V+G+++  +N L S G SYL  ST SL+ ASQL F    S  I  QK T   LN V++
Sbjct  107   YLVLGVIIAGDNYLYSLGLSYLSASTYSLICASQLAFNAVFSYFINSQKFTALILNSVII  166

Query  811   ltlaavllaLDSSSDKPAGLTKAKYFVGFFCTVGAALLFALYLPLVEKLYRNV---DCYa  641
             L+ ++ L+A++  S  P+G++K KYF+GF  T+GA+ +++L L L++  ++ V   + ++
Sbjct  167   LSFSSALIAVNDDSGGPSGVSKWKYFLGFLATLGASAVYSLLLSLMQLSFQKVIKKETFS  226

Query  640   mvvemqvvmeaaATVLATVGMAIDGGFSGMKKESQGGFDLGSKAYAMTVGLNVLTWQLCF  461
             +V+EMQ+     AT ++  G+   G +  +  E Q  F  GS +Y +T+    +TWQ+C 
Sbjct  227   VVLEMQIFTSIVATCVSVAGLFASGEWKTLHGEMQS-FGKGSVSYVLTLVWTAVTWQVCS  285

Query  460   MGTAGMVFLTTSVTSGICSTALMAFNVVGGVLAYGDHMGGSKAVSTVLCVWGFSSYVYGM  281
             +G  G++F+ +S+ S + ST  +A + +  V+ + D M G K ++ +L VWGF+SY Y  
Sbjct  286   VGVVGLIFVVSSLFSNVISTVALAVSPIAAVIVFHDKMNGVKIIAMLLAVWGFASYTYQN  345

Query  280   YLKTKKVTK  254
             YL   K+ K
Sbjct  346   YLDDSKLRK  354



>ref|XP_007139692.1| hypothetical protein PHAVU_008G051100g [Phaseolus vulgaris]
 gb|ESW11686.1| hypothetical protein PHAVU_008G051100g [Phaseolus vulgaris]
Length=396

 Score =   159 bits (403),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 115/301 (38%), Positives = 176/301 (58%), Gaps = 8/301 (3%)
 Frame = -1

Query  1153  KFYFVHGGSSRWVATWVQCAGFPLL-IPAVYLPYYAFNSTERRPFAGFSLRIFSLSVVIG  977
             +FY+  GG+S+W+AT VQ A FPLL IP   +P  A  ST   P     L I+    V+G
Sbjct  84    RFYYDQGGNSKWMATLVQTAAFPLLFIPLYTIPAPAEASTSASPSIKIILLIY---FVLG  140

Query  976   LMLGVNNLLISWGTSYLPVSTCSLVLASQLVFILFLSAIIVRQKITFANLNCvvlltlaa  797
             +++  +N++ S G  YL  ST +L+ ASQL F    S  I  QK T   +N  V+LTL+A
Sbjct  141   VLVAADNMMYSTGLLYLSASTYALICASQLAFNAVFSYFINAQKFTVLIINSTVILTLSA  200

Query  796   vllaLDSSSDKPAGLTKAKYFVGFFCTVGAALLFALYLPLVEKLYRNV---DCYamvvem  626
              LLA++  S++P+GL K KY +GF CT+GA+ L++L L L++  +  V   + +++V+EM
Sbjct  201   SLLAVNEDSEEPSGLAKGKYIIGFLCTLGASALYSLLLSLMQLTFEKVLKKETFSVVLEM  260

Query  625   qvvmeaaATVLATVGMAIDGGFSGMKKESQGGFDLGSKAYAMTVGLNVLTWQLCFMGTAG  446
             Q+     AT ++ +G+   G    +  E +G F  G  AY MT+    + WQ+C +G  G
Sbjct  261   QIYTSLVATSVSVIGLFASGESHTLHGEMEG-FGKGQVAYVMTLVWTAVAWQVCSVGVVG  319

Query  445   MVFLTTSVTSGICSTALMAFNVVGGVLAYGDHMGGSKAVSTVLCVWGFSSYVYGMYLKTK  266
             ++FL +S+ S + ST  +A   +  V+ + D M G K +S +L +WGF SY+Y  YL   
Sbjct  320   LIFLVSSLYSNVISTVSLAVTPIAAVIVFHDKMNGVKIISMLLAIWGFVSYIYQNYLDDS  379

Query  265   K  263
             K
Sbjct  380   K  380



>dbj|BAK04933.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=377

 Score =   159 bits (402),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 103/315 (33%), Positives = 190/315 (60%), Gaps = 14/315 (4%)
 Frame = -1

Query  1153  KFYFVHGGSSRWVATWVQCAGFPLLIPAVYLPYYAFNSTERR-----PFAGFSLRIFSLS  989
             + YF+HGG+ +W+++ +Q AG+PLL+  +   + +   + +      P    S R+ + +
Sbjct  57    RAYFLHGGTRKWLSSLLQTAGWPLLLAPLGASFLSRRRSNKDGGSATPLFLMSPRLLAAT  116

Query  988   VVIGLMLGVNNLLISWGTSYLPVSTCSLVLASQLVFILFLSAIIVRQKITFANLNCvvll  809
             V +GLM G+++LL ++G +YLPVST S+++++QL F    + ++VRQ+ T  ++N VVLL
Sbjct  117   VAVGLMTGLDDLLYAYGLAYLPVSTSSILISTQLAFTAAFALLLVRQRFTAFSVNAVVLL  176

Query  808   tlaavllaLDSSSDKPAGLTKAKYFVGFFCTVGAALLFALYLPLVE-KLYRNVD------  650
             ++ A +L +++  D+PAG+T+ +Y+ GF  T+GAAL++ + LP++E    R+        
Sbjct  177   SVGAAMLGMNAGGDRPAGVTRPQYYAGFGMTLGAALIYGIVLPVMELSQARHAARTGAAV  236

Query  649   CYamvvemqvvmeaaATVLATVGMAIDGGFSGMKKESQGGFDLGSKAYAMTVGLNVLTWQ  470
              Y +V+EMQ+V+   AT  + VGM ++  F  ++ E++  F LG   Y + +  +   +Q
Sbjct  237   TYTLVMEMQIVIGFTATAFSAVGMLVNNDFHAIRGEAR-EFGLGQSGYYLLLAGSATVYQ  295

Query  469   LCFMGTAGMVFLTTSVTSGICSTALMAFNVVGGVLAYGDHMGGSKAVSTVLCVWGFSSYV  290
               F+GT G +F  +++ +G+  T L+    V  V+ + +   G+K V+  L +WGF SY+
Sbjct  296   FFFLGTIGAIFYGSALLAGVIMTVLIPVTEVLAVMFFHEPFNGTKGVALALSLWGFVSYL  355

Query  289   YG-MYLKTKKVTKEV  248
             YG +  K K+  K +
Sbjct  356   YGEVRAKAKQSDKPL  370



>ref|XP_010413821.1| PREDICTED: purine permease 2 [Camelina sativa]
Length=351

 Score =   158 bits (400),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 114/308 (37%), Positives = 174/308 (56%), Gaps = 9/308 (3%)
 Frame = -1

Query  1153  KFYFVHGGSSRWVATWVQCAGFPLLIPAVYLPYYAFNSTERRPFAGFSLR---IFSLSVV  983
             + YF +GG   W ++++Q  G PL++  +   + +    E +      L    +F  SVV
Sbjct  29    RLYFHNGGERIWFSSFLQTVGCPLILFPLLFSFLSRRRLEEQEKTSLFLMKPPLFIASVV  88

Query  982   IGLMLGVNNLLISWGTSYLPVSTCSLVLASQLVFILFLSAIIVRQKITFANLNCvvlltl  803
             +GL++G +N L S+G +Y+PVST SL++++QL F    +  +V+QK T   +N +VLLT+
Sbjct  89    VGLLMGFDNYLYSYGLAYIPVSTASLIISAQLGFTALFAFFMVKQKFTPFTINAIVLLTV  148

Query  802   aavllaLDSSSDKPAGLTKAKYFVGFFCTVGAALLFALYLPLVEKLY---RNVDCYamvv  632
              AV+LA +S SDK A  T  +Y VGF  T GAALL+A  LPLVE  Y   R    Y +V+
Sbjct  149   GAVVLAFNSDSDKLANETHKEYVVGFLMTAGAALLYAFILPLVELAYKKSRQRVTYTLVL  208

Query  631   emqvvmeaaATVLATVGMAIDGGFSGMKKESQGG--FDLGSKAYAMTVGLNVLTWQLCFM  458
             E Q+V+   AT    VGM   G F  + +E++    F LG   Y + V    + WQ  F+
Sbjct  209   EFQMVLCFVATCFCLVGMLASGDFKVIAREAREARDFKLGESLYYVVVVFTAVIWQAFFV  268

Query  457   GTAGMVFLTTSVTSGICSTALMAFNVVGGVLAYGDHMGGSKAVSTVLCVWGFSSYVYGMY  278
             G  G++F  +S+ SGI  +AL+   VV  V+ + +     K V+  L +WG  SY YG  
Sbjct  269   GAIGLIFCVSSLVSGIMVSALLPVTVVLAVICFQEKFQAGKGVALALSLWGSVSYFYGQ-  327

Query  277   LKTKKVTK  254
             +K+++ TK
Sbjct  328   IKSEEKTK  335



>ref|XP_009615076.1| PREDICTED: purine permease 3-like [Nicotiana tomentosiformis]
Length=353

 Score =   158 bits (400),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 107/300 (36%), Positives = 172/300 (57%), Gaps = 4/300 (1%)
 Frame = -1

Query  1153  KFYFVHGGSSRWVATWVQCAGFPLLIPAVYLPYYAFNSTERRPFAGFSLRIFSLSVVIGL  974
             + YF+HGG+  W ++W+Q  G+PL++  + + Y+       +     + RIF  S V G+
Sbjct  33    RLYFLHGGNRIWFSSWLQTVGWPLILIPLAIAYFQRRENNIKKLFLITPRIFLASSVFGI  92

Query  973   MLGVNNLLISWGTSYLPVSTCSLVLASQLVFILFLSAIIVRQKITFANLNCvvlltlaav  794
             + GV+N L ++G S LPVST +L+LA+QL F    +  +V+QK T  ++N +VLLT+ AV
Sbjct  93    LTGVDNYLYAYGNSKLPVSTSTLILATQLAFTAVFAFFLVKQKFTAHSINAIVLLTVGAV  152

Query  793   llaLDSSSDKPAGLTKAKYFVGFFCTVGAALLFALYLPLVEKLY---RNVDCYamvvemq  623
             +LAL S SD+P G +  +Y +GF  T+ AA L+   +P+VE  Y        YA+V+E+Q
Sbjct  153   VLALRSGSDRPKGESSKEYILGFVLTLLAAALYGFVMPMVELTYIKATQTITYALVLEVQ  212

Query  622   vvmeaaATVLATVGMAIDGGFSGMKKESQGGFDLGSKAYAMTVGLNVLTWQLCFMGTAGM  443
             +V+   A+  ATVGM I+  F  +  E++  F LG   Y   +  + + WQ  F+G  G+
Sbjct  213   MVICCFASAFATVGMIINNDFKAISSEAR-QFGLGEGKYYNVLVWSAIIWQFFFVGAIGV  271

Query  442   VFLTTSVTSGICSTALMAFNVVGGVLAYGDHMGGSKAVSTVLCVWGFSSYVYGMYLKTKK  263
             +  ++S+ SG+    L+    V  V+ + +     K V+  L +WGF SY YG   + KK
Sbjct  272   ISYSSSLLSGVIIAVLLPVTEVLAVIIFHEKFQPEKGVALFLSIWGFISYFYGEMKQHKK  331



>ref|XP_010060066.1| PREDICTED: purine permease 1-like [Eucalyptus grandis]
Length=367

 Score =   159 bits (401),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 105/302 (35%), Positives = 180/302 (60%), Gaps = 16/302 (5%)
 Frame = -1

Query  1153  KFYFVHGGSSRWVATWVQCAGFPLLIPAVYLPYYAFNSTERRPFAGFSLRI-------FS  995
             + Y+++GGS  W+++W++  G+P +  A+ + Y       RR   G S R+       F+
Sbjct  55    RLYYLYGGSGVWLSSWLETGGWPAIFLALAVAY-----LRRRSAEGPSARLVLMDPFLFA  109

Query  994   LSVVIGLMLGVNNLLISWGTSYLPVSTCSLVLASQLVFILFLSAIIVRQKITFANLNCvv  815
              S V+G++ G+++ L ++G + LP ST +L++A+QL F    + ++VRQ+ T  ++N V 
Sbjct  110   ASAVVGVLTGLDDYLYAYGVARLPASTSALLIATQLAFTAGFAFLLVRQQFTSYSINSVY  169

Query  814   lltlaavllaLDSSSDKPAGLTKAKYFVGFFCTVGAALLFALYLPLVEKLYRNVD---CY  644
             LLT+AA +LAL++SSD+PAG +  +Y+ GFF T+GAA L+   LPLVE  Y+       Y
Sbjct  170   LLTVAAGVLALNASSDRPAGESDQEYYAGFFMTLGAAALYGFVLPLVELTYKKAKQAVTY  229

Query  643   amvvemqvvmeaaATVLATVGMAIDGGFSGMKKESQGGFDLGSKAYAMTVGLNVLTWQLC  464
             ++V+E+Q+VM   AT   TVGM ++  F  +  E++  ++LG   Y + +  N + WQ  
Sbjct  230   SLVLEIQLVMCFFATAFCTVGMLVNKDFQAIPTEAK-NYELGEALYYVVLVGNAIAWQFF  288

Query  463   FMGTAGMVFLTTSVTSGICSTALMAFNVVGGVLAYGDHMGGSKAVSTVLCVWGFSSYVYG  284
             F+G  G++F  +S+ SGI    L+    +  ++ + +    +K VS  L +WG +SY YG
Sbjct  289   FLGVIGVIFCASSLFSGIMIAVLLPVTEILAIICFRETFQAAKGVSLALSLWGLASYFYG  348

Query  283   MY  278
              +
Sbjct  349   EF  350



>ref|XP_002513994.1| purine transporter, putative [Ricinus communis]
 gb|EEF48577.1| purine transporter, putative [Ricinus communis]
Length=356

 Score =   158 bits (400),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 107/302 (35%), Positives = 179/302 (59%), Gaps = 7/302 (2%)
 Frame = -1

Query  1153  KFYFVHGGSSRWVATWVQCAGFPLLIPAVYLPYYAFNSTERRPFAGFSL--RIFSLSVVI  980
             + YF+HGG   W+++W++  G+P+L+  +++ Y    ST   P   F +  R+F  +  I
Sbjct  38    RLYFIHGGKRVWLSSWLETGGWPILLIPLFISYLHRRSTNP-PTKLFYMKPRLFLAATFI  96

Query  979   GLMLGVNNLLISWGTSYLPVSTCSLVLASQLVFILFLSAIIVRQKITFANLNCvvlltla  800
             G++ G+++ L ++G + LPVST SL++A+QL F    + ++V+QK T  ++N VVLLT  
Sbjct  97    GVLTGLDDYLYAYGVARLPVSTSSLIIATQLAFTAAFAFLLVKQKFTSFSINAVVLLTAG  156

Query  799   avllaLDSSSDKPAGLTKAKYFVGFFCTVGAALLFALYLPLVEKLYRNVD---CYamvve  629
             A +LAL +SSD+P   +  +Y +GF  T+ AA L+   LPLVE  Y+       Y +V+E
Sbjct  157   AGVLALHTSSDRPGHESTKQYALGFVMTLVAAALYGFILPLVELTYKKSKQEISYTLVME  216

Query  628   mqvvmeaaATVLATVGMAIDGGFSGMKKESQGGFDLGSKAYAMTVGLNVLTWQLCFMGTA  449
             +Q+VM   AT+  T+GM ++  F+ + +E++  F LG   Y + +  + + WQ  F+G  
Sbjct  217   IQMVMCLFATIFCTIGMLVNKDFNVIPREAR-EFGLGETKYYVILVWSAIIWQCFFLGAI  275

Query  448   GMVFLTTSVTSGICSTALMAFNVVGGVLAYGDHMGGSKAVSTVLCVWGFSSYVYGMYLKT  269
             G++F  +S+ SGI    L+    V  V+ Y ++    K V+  L +WGF SY YG   ++
Sbjct  276   GVIFCASSLLSGILIAVLLPVTEVLAVIFYQENFQAEKGVALALSLWGFVSYFYGEVKES  335

Query  268   KK  263
             KK
Sbjct  336   KK  337



>ref|XP_008667894.1| PREDICTED: PUP1 isoform X1 [Zea mays]
 tpg|DAA40285.1| TPA: PUP1 [Zea mays]
Length=387

 Score =   159 bits (402),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 107/316 (34%), Positives = 181/316 (57%), Gaps = 15/316 (5%)
 Frame = -1

Query  1153  KFYFVHGGSSRWVATWVQCAGFPLLIPAVYLPYYAF------NSTERRPFAGFSLRIFSL  992
             + YF+HGG+ +W++  +Q AGFPLL+  + + +          +  + PF   + R+ + 
Sbjct  63    RAYFLHGGARKWLSALLQTAGFPLLLVPLCVSFSRRRRRRDDGAPAKAPFFLMTPRLLAA  122

Query  991   SVVIGLMLGVNNLLISWGTSYLPVSTCSLVLASQLVFILFLSAIIVRQKITFANLNCvvl  812
             S  IGLM G+++LL ++G +YLPVST S+++++QL F    + ++VRQ+ T  ++N V L
Sbjct  123   SAAIGLMTGLDDLLYAYGLAYLPVSTSSILISTQLAFTAAFALLLVRQRFTAFSVNAVAL  182

Query  811   ltlaavllaLDSSSDKPAGLTKAKYFVGFFCTVGAALLFALYLPLVE-------KLYRNV  653
             L+  A +L +++  D+PAG++ A+Y  GF  T+GAA L+ L LP +E             
Sbjct  183   LSAGAAMLGMNAGGDRPAGVSPAQYGAGFAMTLGAAALYGLLLPAMELSQAQARAGTAAA  242

Query  652   DCYamvvemqvvmeaaATVLATVGMAIDGGFSGMKKESQGGFDLGSKAYAMTVGLNVLTW  473
               Y +V+EMQ+V+   ATV + VGM  +     +  E++  FDLG   Y + +  +  T+
Sbjct  243   VTYTLVIEMQLVIGLTATVFSAVGMLANHDLHAIPGEAR-EFDLGRSGYYLLLAGSAATY  301

Query  472   QLCFMGTAGMVFLTTSVTSGICSTALMAFNVVGGVLAYGDHMGGSKAVSTVLCVWGFSSY  293
             Q  F+GT G VF  +++ +G+  T L+    V  V+ + +   G+K V+  L +WGF SY
Sbjct  302   QCFFLGTIGAVFFGSALLAGVVMTVLIPVTEVLAVVFFHEPFNGTKGVALALSLWGFVSY  361

Query  292   VYGMYLKTKKVTKEVP  245
              YG  ++T K    +P
Sbjct  362   FYG-EVQTSKAHHHLP  376



>ref|XP_007218138.1| hypothetical protein PRUPE_ppa007245mg [Prunus persica]
 gb|EMJ19337.1| hypothetical protein PRUPE_ppa007245mg [Prunus persica]
Length=368

 Score =   158 bits (400),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 107/306 (35%), Positives = 179/306 (58%), Gaps = 9/306 (3%)
 Frame = -1

Query  1153  KFYFVHGGSSRWVATWVQCAGFP-LLIPAVYLPYYAFNSTERRPFAGFSLRIFSL-SVVI  980
             +FY+  GG+S+W+AT VQ A FP LLIP  ++P      T   P    S+++ +L    +
Sbjct  54    RFYYDRGGNSKWMATLVQTAAFPVLLIPLYFIPSSKDPLTSSAPP---SIKVLALIYFAL  110

Query  979   GLMLGVNNLLISWGTSYLPVSTCSLVLASQLVFILFLSAIIVRQKITFANLNCvvlltla  800
             G++L  +N+L S G  YL  ST SL+ A+QL F    S  I  QK T   LN V++++ +
Sbjct  111   GVLLACDNMLYSVGLLYLSASTYSLICATQLAFNAVFSYFINSQKFTALILNSVIIVSFS  170

Query  799   avllaLDSSSDKPAGLTKAKYFVGFFCTVGAALLFALYLPLVEKLYRNV---DCYamvve  629
             A L+A+   S  PAG++K K+ +GF CT+GA+ +++L L L++  ++ V   + +++V+E
Sbjct  171   AALIAVSDDSSGPAGVSKWKHILGFICTLGASAIYSLLLSLMQLTFQKVLKKETFSVVLE  230

Query  628   mqvvmeaaATVLATVGMAIDGGFSGMKKESQGGFDLGSKAYAMTVGLNVLTWQLCFMGTA  449
             MQ+     A+  ATVG+   G +  +  E +  F  G  +Y MT+    + WQ+C +G  
Sbjct  231   MQIYTALVASCAATVGLFASGEWRTLHGEMEN-FGEGRVSYVMTLVWTAVAWQVCSVGVV  289

Query  448   GMVFLTTSVTSGICSTALMAFNVVGGVLAYGDHMGGSKAVSTVLCVWGFSSYVYGMYLKT  269
             G++F+ +S+ S + ST  +A   +  V+ + D M G K ++ +L +WGF++Y+Y  YL  
Sbjct  290   GLIFVVSSLFSNVISTLSLAVTPIAAVIIFHDKMDGVKIIAMLLAIWGFATYIYQNYLDD  349

Query  268   KKVTKE  251
              KV + 
Sbjct  350   SKVRRR  355



>dbj|BAJ86755.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=360

 Score =   158 bits (400),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 105/299 (35%), Positives = 173/299 (58%), Gaps = 8/299 (3%)
 Frame = -1

Query  1153  KFYFVHGGSSRWVATWVQCAGFPLLIPAVYLPYYAFNSTE-RRPFAGFSLRIFSLSVVIG  977
             + YF  GG  +W++ W++  G+PLL+  V   Y    + +   P      RI   +  +G
Sbjct  46    RLYFSKGGHRKWLSAWLETGGWPLLLLPVAASYLRRRAQDPSAPVVLAPPRILVAAAGLG  105

Query  976   LMLGVNNLLISWGTSYLPVSTCSLVLASQLVFILFLSAIIVRQKITFANLNCvvlltlaa  797
             L  G ++ L ++G S++PVST ++++++QL F +  + +IVRQ++T  ++N V LLT+ A
Sbjct  106   LATGADDFLYAYGLSFVPVSTSAILISTQLAFTVLFAFLIVRQRLTALSVNAVALLTVGA  165

Query  796   vllaLDSSSDKPAGLTKAKYFVGFFCTVGAALLFALYLPLVEKLYRN------VDCYamv  635
             V+L L  SSD+PAG+T+ +Y++GF  T+G+A L+ L LPL+E  Y+       V  YA+V
Sbjct  166   VVLGLHVSSDRPAGVTRGQYWLGFLLTLGSAALYGLVLPLIELTYKRAAGGGRVVTYALV  225

Query  634   vemqvvmeaaATVLATVGMAIDGGFSGMKKESQGGFDLGSKAYAMTVGLNVLTWQLCFMG  455
             +EMQ+VM   AT   TVGM ++  F  M +E++  F+LG   Y   +  + + WQ  F+G
Sbjct  226   MEMQLVMGFFATAFCTVGMIVNNDFQAMAREARA-FELGEARYYTVLVWSAILWQFFFLG  284

Query  454   TAGMVFLTTSVTSGICSTALMAFNVVGGVLAYGDHMGGSKAVSTVLCVWGFSSYVYGMY  278
               G++F   ++ +GI     +    V  V+   +     K V+ VL +WG +SY YG Y
Sbjct  285   AVGVIFCVHTLFAGILIAVFIPVTEVLAVIFLHEKFSSEKGVALVLSLWGLASYSYGEY  343



>ref|XP_004229705.1| PREDICTED: probable purine permease 11 [Solanum lycopersicum]
Length=364

 Score =   158 bits (400),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 118/325 (36%), Positives = 191/325 (59%), Gaps = 16/325 (5%)
 Frame = -1

Query  1153  KFYFVHGGSSRWVATWVQCAGFPLLIPAVYLPYYAFNSTERRPFAGFSLRIFSLSVV---  983
             +FY+  GG+S+W+AT VQ A FPLL    ++PY   +S +    A     I ++SVV   
Sbjct  49    RFYYEKGGNSKWMATVVQTAAFPLL----FIPYLVISSPQTHSEASNRPSIITVSVVYLV  104

Query  982   IGLMLGVNNLLISWGTSYLPVSTCSLVLASQLVFILFLSAIIVRQKITFANLNCvvlltl  803
             IG+++  +N+L S G  YL  ST SL+ A+QLVF   +S  +  QK T   +N VV+L+L
Sbjct  105   IGVLVAGDNMLYSIGLLYLSASTYSLICATQLVFSAVISYFLNHQKFTALIMNSVVVLSL  164

Query  802   aavllaLDSSSDKPAGLTKAKYFVGFFCTVGAALLFALYLPLVEKLYRNV---DCYamvv  632
             +A LLA++  SDKP G+TK+KY +GF  T+ A+ ++AL L L++  ++ V   + +++V+
Sbjct  165   SASLLAVNEDSDKPPGVTKSKYVIGFLVTLAASAMYALLLSLMQLSFQKVLKKETFSVVL  224

Query  631   emqvvmeaaATVLATVGMAIDGGFSGMKKESQGGFDLGSKAYAMTVGLNVLTWQLCFMGT  452
             EMQ+     AT ++TVG+   G +  +  E  G F  G  AY MT+    + WQ+C +G 
Sbjct  225   EMQIYTAIVATAVSTVGLFASGEWKTLHGE-MGSFTAGKLAYVMTLVWTAIAWQICSVGV  283

Query  451   AGMVFLTTSVTSGICSTALMAFNVVGGVLAYGDHMGGSKAVSTVLCVWGFSSYVYGMYLK  272
              G+VF+ +S+ S + ST  +A   +  V+   D + G K ++ ++ +WGF +Y+Y  Y+ 
Sbjct  284   VGLVFVVSSLFSNVISTLSLAITPIASVIILHDTLNGVKVIAMLMAIWGFCTYIYQNYVD  343

Query  271   TKKVTKEVPPAIGA*SD*TPARRRT  197
               K +K  P A+    D +P   R+
Sbjct  344   DLKASKA-PSAV----DDSPNESRS  363



>ref|XP_007042880.1| Purine permease 3 [Theobroma cacao]
 gb|EOX98711.1| Purine permease 3 [Theobroma cacao]
Length=419

 Score =   159 bits (402),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 108/302 (36%), Positives = 176/302 (58%), Gaps = 6/302 (2%)
 Frame = -1

Query  1153  KFYFVHGGSSRWVATWVQCAGFPLLIPAVYLPYYAFNSTERRPFAGFSLR--IFSLSVVI  980
             + YF+ GG   W ++ ++ AG+P ++  +   Y      E      F ++  +F +S V+
Sbjct  110   RLYFLKGGKGVWTSSCLETAGWPFMVMPLTFSYLYRRRKEGPATELFFIKPPLFLVSAVV  169

Query  979   GLMLGVNNLLISWGTSYLPVSTCSLVLASQLVFILFLSAIIVRQKITFANLNCvvlltla  800
             GL+ GV++ L ++G + LPVST +L++++QL F    + ++V+QK T   +N V LLT+ 
Sbjct  170   GLLTGVDDFLYAYGVARLPVSTSALIISTQLAFTAAFAFLLVKQKFTSFTINSVFLLTVG  229

Query  799   avllaLDSSSDKPAGLTKAKYFVGFFCTVGAALLFALYLPLVEKLYRNVD---CYamvve  629
             AV+LAL +SSD+PA  +  +Y++GFF T+ A++L+   LP +E  Y+       Y++V+E
Sbjct  230   AVVLALQTSSDRPANESNRQYYLGFFMTLAASMLYGFVLPAIELTYKKAKQTITYSLVME  289

Query  628   mqvvmeaaATVLATVGMAIDGGFSGMKKESQGGFDLGSKAYAMTVGLNVLTWQLCFMGTA  449
             MQ+VM  +ATV  T+GM     F  + +E+   F+LG   Y + + L+ + WQ  FMG  
Sbjct  290   MQMVMSFSATVFCTIGMLFHKEFEAIPREA-SKFELGQSTYYLVILLSAILWQFFFMGAV  348

Query  448   GMVFLTTSVTSGICSTALMAFNVVGGVLAYGDHMGGSKAVSTVLCVWGFSSYVYGMYLKT  269
             G++F  +S+ SGI   AL+       VL + +     KA+S VL +WG  SY YG   K 
Sbjct  349   GVIFSGSSLLSGIIIAALLPVTESLAVLFFHEKFQVEKAISVVLSLWGSLSYFYGELQKN  408

Query  268   KK  263
             KK
Sbjct  409   KK  410



>ref|XP_007018133.1| Purine permease 3, putative [Theobroma cacao]
 gb|EOY15358.1| Purine permease 3, putative [Theobroma cacao]
Length=410

 Score =   159 bits (402),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 111/298 (37%), Positives = 173/298 (58%), Gaps = 11/298 (4%)
 Frame = -1

Query  1153  KFYFVHGGSSRWVATWVQCAGFPLLIPAVYLPYYAFNSTERRPFAG---FSLR--IFSLS  989
             + YF+HGG   W ++W+   G+P+++  +   Y     TE  P +    F +R  +F  S
Sbjct  25    RAYFIHGGKRFWFSSWLTTGGWPIILFPIACAYMYRRRTE--PTSKNKLFLMRPPLFVAS  82

Query  988   VVIGLMLGVNNLLISWGTSYLPVSTCSLVLASQLVFILFLSAIIVRQKITFANLNCvvll  809
              VIG++ GV++ L S+G + LPVSTCS+V+ASQL F    + I+V+QK T  ++N V LL
Sbjct  83    AVIGILTGVDDYLYSYGVALLPVSTCSIVIASQLAFTAAFAFILVKQKFTSYSVNAVFLL  142

Query  808   tlaavllaLDSSSDKPAGLTKAKYFVGFFCTVGAALLFALYLPLVEKLYRNVD---CYam  638
             T+ A +LAL +SSD+P   +  KY +GF  T+ AA L+   LPLVE +Y+       YA+
Sbjct  143   TVGAGVLALRASSDRPDTESNRKYALGFIMTLAAAALYGFVLPLVELMYKKTKQEMSYAL  202

Query  637   vvemqvvmeaaATVLATVGMAIDGGFSGMKKESQGGFDLGSKAYAMTVGLNVLTWQLCFM  458
             V+E+++V    AT   TVGM ++  F  + +E++  FDLG   Y +    + + WQ  F+
Sbjct  203   VMEIEMVNCLFATGFCTVGMLVNNDFKVIPREAR-EFDLGETKYYVVAIWSAIMWQFFFL  261

Query  457   GTAGMVFLTTSVTSGICSTALMAFNVVGGVLAYGDHMGGSKAVSTVLCVWGFSSYVYG  284
             G  G++F  +S+ SGI    ++    +  V+ Y ++    K V+  L VWGF SY YG
Sbjct  262   GATGVIFCASSLVSGIIIAVVLPVIEILAVIFYKENFQAEKGVALALSVWGFISYFYG  319



>ref|XP_002531513.1| purine transporter, putative [Ricinus communis]
 gb|EEF30867.1| purine transporter, putative [Ricinus communis]
Length=380

 Score =   158 bits (400),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 108/306 (35%), Positives = 173/306 (57%), Gaps = 14/306 (5%)
 Frame = -1

Query  1153  KFYFVHGGSSRWVATWVQCAGFPLLIPAVYLPYYAFNSTERRPFAG------FSLRIFSL  992
             + YF+ GG   W+++++Q AG+P +I  +++ Y       R   AG       + R+F  
Sbjct  70    RLYFLKGGKGVWISSFLQTAGWPFIIFPLFVSYIH----RRSKNAGSTKLYYITPRLFIA  125

Query  991   SVVIGLMLGVNNLLISWGTSYLPVSTCSLVLASQLVFILFLSAIIVRQKITFANLNCvvl  812
               VIG++ G+++ L ++G S LPVST +L++A+QL F    + ++V+QK T   +N + L
Sbjct  126   CAVIGVLTGLDDFLAAYGVSLLPVSTSALIIATQLGFTAGFAYVLVKQKFTPFTVNAIFL  185

Query  811   ltlaavllaLDSSSDKPAGLTKAKYFVGFFCTVGAALLFALYLPLVEKLYRNVD---CYa  641
             L++ AV+L L +SSD+P   T  +Y  GFF T+GA+ L+   LPL+E  Y+  +    Y 
Sbjct  186   LSIGAVVLVLHASSDRPPHETNGQYLSGFFMTLGASALYGFVLPLIELTYKKANQTITYT  245

Query  640   mvvemqvvmeaaATVLATVGMAIDGGFSGMKKESQGGFDLGSKAYAMTVGLNVLTWQLCF  461
             +V+EMQ+V+   AT   T GM +   F+ + +E+   F+LG   Y + + +N + WQL F
Sbjct  246   LVMEMQLVISFFATAFCTTGMLLHKDFAAIPREAS-EFELGKAKYYVVLMVNAIFWQLFF  304

Query  460   MGTAGMVFLTTSVTSGICSTALMAFNVVGGVLAYGDHMGGSKAVSTVLCVWGFSSYVYGM  281
             MG  G+VF  +S+ SGI    L+       V  Y +     K +S VL +WGF  Y YG 
Sbjct  305   MGAVGVVFCGSSLLSGIIIATLLPVTETLAVFFYHEKFRVEKGISLVLSLWGFMFYFYGE  364

Query  280   YLKTKK  263
               + KK
Sbjct  365   LQRNKK  370



>ref|XP_007218139.1| hypothetical protein PRUPE_ppa007245mg [Prunus persica]
 gb|EMJ19338.1| hypothetical protein PRUPE_ppa007245mg [Prunus persica]
Length=376

 Score =   158 bits (400),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 107/306 (35%), Positives = 179/306 (58%), Gaps = 9/306 (3%)
 Frame = -1

Query  1153  KFYFVHGGSSRWVATWVQCAGFP-LLIPAVYLPYYAFNSTERRPFAGFSLRIFSL-SVVI  980
             +FY+  GG+S+W+AT VQ A FP LLIP  ++P      T   P    S+++ +L    +
Sbjct  62    RFYYDRGGNSKWMATLVQTAAFPVLLIPLYFIPSSKDPLTSSAPP---SIKVLALIYFAL  118

Query  979   GLMLGVNNLLISWGTSYLPVSTCSLVLASQLVFILFLSAIIVRQKITFANLNCvvlltla  800
             G++L  +N+L S G  YL  ST SL+ A+QL F    S  I  QK T   LN V++++ +
Sbjct  119   GVLLACDNMLYSVGLLYLSASTYSLICATQLAFNAVFSYFINSQKFTALILNSVIIVSFS  178

Query  799   avllaLDSSSDKPAGLTKAKYFVGFFCTVGAALLFALYLPLVEKLYRNV---DCYamvve  629
             A L+A+   S  PAG++K K+ +GF CT+GA+ +++L L L++  ++ V   + +++V+E
Sbjct  179   AALIAVSDDSSGPAGVSKWKHILGFICTLGASAIYSLLLSLMQLTFQKVLKKETFSVVLE  238

Query  628   mqvvmeaaATVLATVGMAIDGGFSGMKKESQGGFDLGSKAYAMTVGLNVLTWQLCFMGTA  449
             MQ+     A+  ATVG+   G +  +  E +  F  G  +Y MT+    + WQ+C +G  
Sbjct  239   MQIYTALVASCAATVGLFASGEWRTLHGEMEN-FGEGRVSYVMTLVWTAVAWQVCSVGVV  297

Query  448   GMVFLTTSVTSGICSTALMAFNVVGGVLAYGDHMGGSKAVSTVLCVWGFSSYVYGMYLKT  269
             G++F+ +S+ S + ST  +A   +  V+ + D M G K ++ +L +WGF++Y+Y  YL  
Sbjct  298   GLIFVVSSLFSNVISTLSLAVTPIAAVIIFHDKMDGVKIIAMLLAIWGFATYIYQNYLDD  357

Query  268   KKVTKE  251
              KV + 
Sbjct  358   SKVRRR  363



>emb|CDY17197.1| BnaA05g09910D [Brassica napus]
Length=351

 Score =   157 bits (398),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 122/313 (39%), Positives = 179/313 (57%), Gaps = 13/313 (4%)
 Frame = -1

Query  1153  KFYFVHGGSSRWVATWVQCAGFPL-LIPAVY--LPYYAFNSTERRPFAGFSL---RIFSL  992
             + YF +GG   W ++++Q +G P+ L+P ++  L  +     +  P     L    +F  
Sbjct  27    RLYFRNGGKRIWFSSFLQTSGCPIILLPLLFSFLTRHRQQQEQEEPKTTLFLIKPPLFLA  86

Query  991   SVVIGLMLGVNNLLISWGTSYLPVSTCSLVLASQLVFILFLSAIIVRQKITFANLNCvvl  812
             SVV+GL++G +N L ++G +YLPVST SL+++SQL F  F +  +V+Q+ T   +N VVL
Sbjct  87    SVVVGLLIGFDNYLYAYGLAYLPVSTSSLIISSQLAFTAFFAFFMVKQRFTPFTINAVVL  146

Query  811   ltlaavllaLDSSSDKPAGLTKAKYFVGFFCTVGAALLFALYLPLVEKLYRNVD---CYa  641
             LTL A  LAL +  DK    T+ +Y VGF  TV AA+L+A  LPLVE  Y+       Y 
Sbjct  147   LTLGAGSLALHADGDKLPKETRKEYIVGFVMTVAAAVLYAFVLPLVELAYKKASQRISYT  206

Query  640   mvvemqvvmeaaATVLATVGMAIDGGFSGMKKESQGGFDL-GSKAYAMTVGLNVLTWQLC  464
             +V+EMQ+V+   AT    VGM  DG F  + +E++  F L GSK Y + V    + WQ  
Sbjct  207   LVLEMQLVLCFVATCFCLVGMLADGDFKELGREAR-EFKLGGSKHYCLVVAFTAVIWQGF  265

Query  463   FMGTAGMVFLTTSVTSGICSTALMAFNVVGGVLAYGDHMGGSKAVSTVLCVWGFSSYVYG  284
             F+G+ GM+F  +S+ SG+  +AL+    V  VL + +     K VS  L +WGF SY YG
Sbjct  266   FLGSIGMIFCASSLVSGVLISALLPLTEVLAVLFFKEKFQAEKGVSLFLSLWGFVSYFYG  325

Query  283   MYL--KTKKVTKE  251
                  K KK T+E
Sbjct  326   KIQSEKEKKKTQE  338



>ref|XP_010509841.1| PREDICTED: purine permease 2-like [Camelina sativa]
Length=347

 Score =   157 bits (397),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 113/306 (37%), Positives = 175/306 (57%), Gaps = 8/306 (3%)
 Frame = -1

Query  1153  KFYFVHGGSSRWVATWVQCAGFPLLIPAVYLPYYAFNSTERRPFAGFSLR---IFSLSVV  983
             + YF +GG+  W ++++Q  G PL++  +   +      E +      L    +F  SVV
Sbjct  25    RLYFHNGGARIWFSSFLQTVGCPLILFPLLFSFLRRRCLEEQETTSLFLMKPPLFIASVV  84

Query  982   IGLMLGVNNLLISWGTSYLPVSTCSLVLASQLVFILFLSAIIVRQKITFANLNCvvlltl  803
             +GL++G +N L S+G +Y+PVST +L++++QL F    +  +V+QK T   +N +VLLT+
Sbjct  85    VGLLMGFDNYLYSYGLAYIPVSTAALIISAQLGFTALFAFFMVKQKFTPFTINAIVLLTV  144

Query  802   aavllaLDSSSDKPAGLTKAKYFVGFFCTVGAALLFALYLPLVEKLY---RNVDCYamvv  632
              AV+LA++S SDK A  T  +Y VGF  T GAALL+A  LPLVE  Y   R    Y +V+
Sbjct  145   GAVVLAINSDSDKLANETHKEYVVGFLMTAGAALLYAFILPLVELAYKKSRQRVTYTLVL  204

Query  631   emqvvmeaaATVLATVGMAIDGGFSGMKKESQGGFDLGSKAYAMTVGLNVLTWQLCFMGT  452
             E Q+V+   AT    VGM   G F  + +E++  F LG   Y + V    + WQ  F+G 
Sbjct  205   EFQMVLCFVATCFCLVGMLASGDFKVIAREAR-DFKLGESLYYVVVVFTAVIWQAFFVGA  263

Query  451   AGMVFLTTSVTSGICSTALMAFNVVGGVLAYGDHMGGSKAVSTVLCVWGFSSYVYGMYLK  272
              G++F  +S+ SGI  +AL+   VV  V+ + +     K V+  L +WG  SY YG  +K
Sbjct  264   IGLIFCVSSLVSGIMVSALLPVTVVLAVICFQEKFQAGKGVALALSLWGSVSYFYGQ-IK  322

Query  271   TKKVTK  254
             +++ TK
Sbjct  323   SEEKTK  328



>emb|CDP19267.1| unnamed protein product [Coffea canephora]
Length=349

 Score =   157 bits (397),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 101/297 (34%), Positives = 174/297 (59%), Gaps = 8/297 (3%)
 Frame = -1

Query  1153  KFYFVHGGSSRWVATWVQCAGFPLLIPAVYLPYYAFNSTERR----PFAGFSLRIFSLSV  986
             + YFV GG   W+ +W+Q A +P++   + + Y+    T+ R            +F  + 
Sbjct  25    RLYFVKGGQRIWLPSWIQTAAWPIIFIPLLISYFHRQKTDPRAEDSKLIIMKYPVFIATA  84

Query  985   VIGLMLGVNNLLISWGTSYLPVSTCSLVLASQLVFILFLSAIIVRQKITFANLNCvvllt  806
             VIGL+ G++N L ++G + LPVST ++++A+QLVF+ F + ++V+QK T  ++N V+LLT
Sbjct  85    VIGLLTGLDNYLYAYGIARLPVSTAAIIIAAQLVFVAFFAFLLVKQKFTAYSVNAVILLT  144

Query  805   laavllaLDSSSDKPAGLTKAKYFVGFFCTVGAALLFALYLPLVEKLY---RNVDCYamv  635
             + + +L L +SSD+P G +   Y +GF  T+ AA L+ L LP+VE +Y   + V  Y++V
Sbjct  145   VGSGVLGLHTSSDRPKGESNKLYVLGFIMTLAAAALYGLILPMVELMYMKAKQVITYSLV  204

Query  634   vemqvvmeaaATVLATVGMAIDGGFSGMKKESQGGFDLGSKAYAMTVGLNVLTWQLCFMG  455
             +E+Q++M   ATV  TVGM I+  F  + +E++  ++LG   Y + +  + +  Q  F+G
Sbjct  205   LEIQLIMCFFATVFCTVGMLINKDFQAIAREAR-AYELGEMKYYVVLVSSAIVSQCFFLG  263

Query  454   TAGMVFLTTSVTSGICSTALMAFNVVGGVLAYGDHMGGSKAVSTVLCVWGFSSYVYG  284
               G++F  +S+ SGI     +    +  V+ + +     K V+  L +WGF SY YG
Sbjct  264   AIGVIFCASSLVSGIIIAVSLPVTELLAVIFFNEKFQAEKGVALFLSLWGFISYFYG  320



>ref|XP_004237961.1| PREDICTED: purine permease 1-like [Solanum lycopersicum]
Length=374

 Score =   157 bits (398),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 104/302 (34%), Positives = 167/302 (55%), Gaps = 16/302 (5%)
 Frame = -1

Query  1153  KFYFVHGGSSRWVATWVQCAGFPLLIPAVYLPYYAFNSTERRPFAGFSLRI-------FS  995
             + YF+HGG   W+ + +Q  G P+++  + + Y+     +RR   G   +I       F 
Sbjct  46    RLYFIHGGQRIWIPSVLQTVGCPVILIPLAIAYF-----QRRKIQGPEAKIVFITRQEFI  100

Query  994   LSVVIGLMLGVNNLLISWGTSYLPVSTCSLVLASQLVFILFLSAIIVRQKITFANLNCvv  815
              S  +G+++G++  L SWG + LPVST +L+ A+QL F    + +IV+QK+T  + N VV
Sbjct  101   ASAGVGIIVGLDGYLNSWGPAKLPVSTSTLINATQLAFTALFAVLIVKQKLTAYSTNSVV  160

Query  814   lltlaavllaLDSSSDKPAGLTKAKYFVGFFCTVGAALLFALYLPLVEKLY---RNVDCY  644
             LL   A  LAL ++ D+PAG +   Y +GF  T   A+L+ L LPL+E +Y   +    Y
Sbjct  161   LLIAGAATLALRANGDRPAGESAKDYMLGFVMTFVGAVLYGLMLPLIELIYMKSKQAVTY  220

Query  643   amvvemqvvmeaaATVLATVGMAIDGGFSGMKKESQGGFDLGSKAYAMTVGLNVLTWQLC  464
               V+E+Q+V+  +ATV  T+GM I+  F  + +E+   + +G   Y M + L  + WQ  
Sbjct  221   ITVLEIQMVLGISATVFCTIGMIINKDFQAIPREA-SQYTIGESKYYMVLVLCAIIWQFA  279

Query  463   FMGTAGMVFLTTSVTSGICSTALMAFNVVGGVLAYGDHMGGSKAVSTVLCVWGFSSYVYG  284
              MG  G++F ++S+ SGI    L+    V  V+ + +     K V+  L +WGF SY YG
Sbjct  280   LMGLVGVIFYSSSLLSGIIGAFLLPVTEVLAVILFHEKFQAEKGVAIFLALWGFVSYFYG  339

Query  283   MY  278
              Y
Sbjct  340   EY  341



>ref|XP_006366415.1| PREDICTED: purine permease 3-like [Solanum tuberosum]
Length=355

 Score =   157 bits (396),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 114/297 (38%), Positives = 171/297 (58%), Gaps = 6/297 (2%)
 Frame = -1

Query  1153  KFYFVHGGSSRWVATWVQCAGFPL-LIPAVYLPYYAFNST-ERRPFAGFSLRIFSLSVVI  980
             + YFV GG   W  +W+Q  G+PL +IP V L +Y   +      F   + RIF  S +I
Sbjct  35    RLYFVEGGLRLWFNSWLQTGGWPLTIIPLVILYFYRRKTKGSDTKFYYITPRIFIASFII  94

Query  979   GLMLGVNNLLISWGTSYLPVSTCSLVLASQLVFILFLSAIIVRQKITFANLNCvvlltla  800
             G+  GV+  L SWG S LPVST SL++A+QL F    S  I + K T  ++N VVLLTL 
Sbjct  95    GVFTGVDAYLYSWGGSKLPVSTSSLLIAAQLAFTAIGSYFIAKIKFTSYSINAVVLLTLG  154

Query  799   avllaLDSSSDKPAGLTKAKYFVGFFCTVGAALLFALYLPLVEKLY---RNVDCYamvve  629
             AVLL + S+ D+P G+T  +Y +GF  T+ AA L+ L LP +E +Y   +      +V+E
Sbjct  155   AVLLGMRSNGDRPEGVTSKEYVIGFIMTLLAAALYGLILPCIELIYLKAKQAITATLVLE  214

Query  628   mqvvmeaaATVLATVGMAIDGGFSGMKKESQGGFDLGSKAYAMTVGLNVLTWQLCFMGTA  449
             +Q+VM  AAT   T+GM  +  F  + +E++  F+LG   Y + V  + + WQ  F+G  
Sbjct  215   IQMVMAFAATAFCTIGMIANKDFQAISREAK-HFNLGEGRYYIVVIWSAIIWQCFFVGAV  273

Query  448   GMVFLTTSVTSGICSTALMAFNVVGGVLAYGDHMGGSKAVSTVLCVWGFSSYVYGMY  278
             G+++L++S+ SG+    L+    V GV+ + +     K +S  L +WGF SY YG +
Sbjct  274   GVIYLSSSLMSGVMIAVLLPITEVLGVIFFDEKFSAEKGLSLFLSLWGFVSYFYGEF  330



>gb|KCW66598.1| hypothetical protein EUGRSUZ_F00392 [Eucalyptus grandis]
Length=480

 Score =   159 bits (403),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 104/303 (34%), Positives = 176/303 (58%), Gaps = 8/303 (3%)
 Frame = -1

Query  1153  KFYFVHGGSSRWVATWVQCAGFPLLIPAVYLPYYAFNSTERRPFAGFSLR---IFSLSVV  983
             + YFV GG+  W+ +W++   +P+L+  +   Y    S E  P A   L    +F+ +  
Sbjct  157   RLYFVRGGARMWLVSWLEMGAWPMLLVPLGAAYSRRRSAEG-PTARLVLMDRFLFAAAAG  215

Query  982   IGLMLGVNNLLISWGTSYLPVSTCSLVLASQLVFILFLSAIIVRQKITFANLNCvvlltl  803
             IG++LG++N   ++G   LPVST +L++A+QL F    + ++VRQ+ T  ++N + LLT+
Sbjct  216   IGVLLGLDNYFYAYGVGRLPVSTSALLIATQLAFTAGFAFLLVRQRFTSCSINSIFLLTI  275

Query  802   aavllaLDSSSDKPAGLTKAKYFVGFFCTVGAALLFALYLPLVEKLYRNVD---CYamvv  632
              A +L++ +SSD+PAG +K  YF GFF T+GAA L+ L LPLVE +Y+       Y++V+
Sbjct  276   GAGVLSMHTSSDRPAGESKGAYFTGFFMTLGAAALYGLVLPLVELMYKKAKQAVTYSLVL  335

Query  631   emqvvmeaaATVLATVGMAIDGGFSGMKKESQGGFDLGSKAYAMTVGLNVLTWQLCFMGT  452
             E+Q+VM   AT   TV M ++  F  + +E++  ++LG   Y + +    +  Q  F+G 
Sbjct  336   EIQLVMCFFATAFCTVAMLVNKDFQAIPREAR-NYELGEARYYVVLVWTAIINQFFFLGA  394

Query  451   AGMVFLTTSVTSGICSTALMAFNVVGGVLAYGDHMGGSKAVSTVLCVWGFSSYVYGMYLK  272
              G++F  +S+ S +    L+ F  +  V+ + +     K V+  L +WGF+SY YG +  
Sbjct  395   IGVIFYASSLFSAVIIATLLPFTEILAVICFQEKFQAEKGVALALSLWGFASYFYGEFKL  454

Query  271   TKK  263
              KK
Sbjct  455   AKK  457



>ref|XP_010549316.1| PREDICTED: purine permease 3 [Tarenaya hassleriana]
Length=340

 Score =   156 bits (395),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 107/313 (34%), Positives = 177/313 (57%), Gaps = 11/313 (4%)
 Frame = -1

Query  1153  KFYFVHGGSSRWVATWVQCAGFP-LLIPAVYLPYYAFNSTERRPFAGFSLRIFSLSVVIG  977
             + YF +GG+  W +++++ AGFP +L+P ++       +  +  F     R+   S+++G
Sbjct  25    RLYFNNGGNRIWFSSFLETAGFPVILLPLLFFYLQRRRTDTKTSFFLMKPRLLMASIIVG  84

Query  976   LMLGVNNLLISWGTSYLPVSTCSLVLASQLVFILFLSAIIVRQKITFANLNCvvlltlaa  797
             ++ G +N L ++G ++LPVST +L++ASQL FI   S  +V+ K T   +N VVLLT+ A
Sbjct  85    VLSGFDNYLYAYGLAFLPVSTAALIIASQLAFIAVFSFFMVKHKFTHFTINAVVLLTIGA  144

Query  796   vllaLDSSSDKPAGLTKAKYFVGFFCTVGAALLFALYLPLVEKLYRNVD---CYamvvem  626
              +L + + +DKP   +  +Y +GF    GAA+++A  LPLVE  YR       Y +V+E+
Sbjct  145   AVLGMHTEADKPVEESHKQYVMGFIMAAGAAIMYAFILPLVELSYRKARQPITYTLVLEV  204

Query  625   qvvmeaaATVLATVGMAIDGGFSGMKKESQGGFDLGSKAYAMTVGLNVLTWQLCFMGTAG  446
             Q+V+   A+ +   GM   G F  +  E+   F LG+  + + V  + + WQ  F+G  G
Sbjct  205   QMVLCFFASCVCIGGMYFAGDFKALPVEAD-NFKLGTSMFYLVVIFSAIIWQGFFLGAIG  263

Query  445   MVFLTTSVTSGICSTALMAFNVVGGVLAYGDHMGGSKAVSTVLCVWGFSSYVYGMYLKTK  266
             ++F  +S+ SGI  + L+    V  V+ + +     KAVS VL +WGF SY YG  +K++
Sbjct  264   LIFSASSLVSGIMISVLLPITEVLAVIIFHEKFPPEKAVSLVLSLWGFVSYFYG-EVKSE  322

Query  265   KVTK-----EVPP  242
             K  K     E PP
Sbjct  323   KAAKQSEEIEAPP  335



>ref|NP_001131978.1| uncharacterized protein LOC100193377 [Zea mays]
 gb|ACF80629.1| unknown [Zea mays]
 gb|ACG41442.1| ATPUP3 [Zea mays]
 tpg|DAA40288.1| TPA: ATPUP3 [Zea mays]
Length=361

 Score =   157 bits (397),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 105/299 (35%), Positives = 174/299 (58%), Gaps = 8/299 (3%)
 Frame = -1

Query  1153  KFYFVHGGSSRWVATWVQCAGFPLLIPAVYLPYYAFNSTER-RPFAGFSLRIFSLSVVIG  977
             + YF  GG  +W++ W++  G+PLL+  V   + A  + +R  P      RI   +  +G
Sbjct  41    RLYFSKGGHRQWLSAWLETGGWPLLLVPVAASFGARRARDRGAPVLLTPPRILLAAAGLG  100

Query  976   LMLGVNNLLISWGTSYLPVSTCSLVLASQLVFILFLSAIIVRQKITFANLNCvvlltlaa  797
             +  GV++ + ++G +YLPVST ++++++QL F +F + ++VRQ++T A++N V LLT+ A
Sbjct  101   VATGVDDFVYAYGLAYLPVSTSAILISTQLAFTVFFAFLVVRQRLTAASVNAVALLTVGA  160

Query  796   vllaLDSSSDKPAGLTKAKYFVGFFCTVGAALLFALYLPLVEKLYRNVD------CYamv  635
             V+L L  SSD+P G+T+ +Y++GF  T+ AA L+ L LPLVE  YR          YA+V
Sbjct  161   VVLGLHVSSDRPPGVTRGRYWLGFSLTLCAAALYGLVLPLVELAYRRAAGGGRAVTYALV  220

Query  634   vemqvvmeaaATVLATVGMAIDGGFSGMKKESQGGFDLGSKAYAMTVGLNVLTWQLCFMG  455
             VEMQ+VM   AT   TVGM ++  F  + +E++  ++LG   Y M +    + WQ  F+G
Sbjct  221   VEMQLVMGFFATAFCTVGMVVNKDFQAIPREARQ-YELGEARYYMVLAWAAVLWQCFFLG  279

Query  454   TAGMVFLTTSVTSGICSTALMAFNVVGGVLAYGDHMGGSKAVSTVLCVWGFSSYVYGMY  278
               G++F   ++ +GI     +    V  V+   +     K V+  L +WG +SY YG +
Sbjct  280   AVGVIFCVHTLLAGILIAVFIPVTEVAAVIFLHEKFSSEKGVALALSLWGLASYSYGEW  338



>gb|EMT19524.1| Purine permease 3 [Aegilops tauschii]
Length=333

 Score =   156 bits (395),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 102/312 (33%), Positives = 186/312 (60%), Gaps = 14/312 (4%)
 Frame = -1

Query  1144  FVHGGSSRWVATWVQCAGFPLLIPAVYLPYYAFNSTERR-----PFAGFSLRIFSLSVVI  980
             F+HGG  +W+++ +Q AG+PLL+  +   + +   + +      P    S R+ + +V +
Sbjct  16    FLHGGPRKWLSSLLQPAGWPLLLAPLSASFLSRRRSNKDGSSATPLFLMSPRLLAATVAV  75

Query  979   GLMLGVNNLLISWGTSYLPVSTCSLVLASQLVFILFLSAIIVRQKITFANLNCvvlltla  800
             GL  G+++LL ++G +YLPVST S+++++QL F    + ++VRQ+ T  ++N VVLL++ 
Sbjct  76    GLRTGLDDLLYAYGLAYLPVSTSSILISTQLAFTAAFALLLVRQRFTAFSVNAVVLLSVG  135

Query  799   avllaLDSSSDKPAGLTKAKYFVGFFCTVGAALLFALYLPLVE-KLYRNVD------CYa  641
             A +L +++  D+PAG+T+A+Y+ GF  T+GAA L+ L LP++E    R+         Y 
Sbjct  136   AAMLGMNAGGDRPAGVTRAQYYAGFGMTLGAAALYGLMLPVMELSQARHAARTGAAVTYI  195

Query  640   mvvemqvvmeaaATVLATVGMAIDGGFSGMKKESQGGFDLGSKAYAMTVGLNVLTWQLCF  461
             +V+EMQ+V+   AT  + +GM ++  F  + +E++  F LG   Y + +  + + +Q  F
Sbjct  196   LVMEMQIVIGFTATAFSAIGMLVNNDFHAIPREAR-EFGLGQIGYYLLLAASAIVYQFFF  254

Query  460   MGTAGMVFLTTSVTSGICSTALMAFNVVGGVLAYGDHMGGSKAVSTVLCVWGFSSYVYGM  281
             +GT G +F  +++ +G+  T L+    V  VL + +   G+K V+  L +WGF SY+YG 
Sbjct  255   LGTIGAIFYGSALLAGVIMTVLIPVTEVLAVLFFHEPFNGTKGVALALSLWGFVSYLYG-  313

Query  280   YLKTKKVTKEVP  245
              ++ K    + P
Sbjct  314   EIRAKAQDSDKP  325



>ref|XP_008652812.1| PREDICTED: purine permease 3-like [Zea mays]
 tpg|DAA61853.1| TPA: hypothetical protein ZEAMMB73_233624 [Zea mays]
Length=367

 Score =   157 bits (396),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 105/309 (34%), Positives = 178/309 (58%), Gaps = 9/309 (3%)
 Frame = -1

Query  1153  KFYFVHGGSSRWVATWVQCAGFPLLIPAVYLPYYAFNSTER-RPFAGFSLRIFSLSVVIG  977
             + YF  GG  +W++ W++  G+PLL+  V   + A  + +R  P      RI   +  +G
Sbjct  42    RLYFSKGGHRQWLSAWLETGGWPLLVIPVAASFVARRARDRGAPVLLAPPRILLAAAGLG  101

Query  976   LMLGVNNLLISWGTSYLPVSTCSLVLASQLVFILFLSAIIVRQKITFANLNCvvlltlaa  797
             +  G ++ + ++G +YLPVST ++++++QL F +F + ++VRQ++T A++N V LLT+ A
Sbjct  102   VATGADDFIYAFGLAYLPVSTSAILISTQLAFTVFFAFLVVRQRLTAASVNAVALLTVGA  161

Query  796   vllaLDSSSDKPAGLTKAKYFVGFFCTVGAALLFALYLPLVEKLYRNVD-------CYam  638
             V+L L  SSD+P G+T+ +Y++GF  T+GAA L+ L LPLVE  YR           YA+
Sbjct  162   VVLGLHVSSDRPPGVTRGQYWLGFVLTLGAAALYGLVLPLVELAYRRAAGAGGRAVTYAL  221

Query  637   vvemqvvmeaaATVLATVGMAIDGGFSGMKKESQGGFDLGSKAYAMTVGLNVLTWQLCFM  458
             VVEMQ+VM   AT   TVGM ++  F  + +E++  + LG   Y   +  + + WQ  F+
Sbjct  222   VVEMQLVMGFFATAFCTVGMVVNKDFQAIPREARR-YKLGEARYYAVLAWSAVLWQCFFL  280

Query  457   GTAGMVFLTTSVTSGICSTALMAFNVVGGVLAYGDHMGGSKAVSTVLCVWGFSSYVYGMY  278
             G  G++F   ++ +GI     +    V  V+   +     K V+ VL +WG +SY YG +
Sbjct  281   GAVGVIFCVHTLLAGILIAVFIPVTEVAAVIFLRERFSSEKGVALVLSLWGLASYSYGEW  340

Query  277   LKTKKVTKE  251
              + +   ++
Sbjct  341   SEARAKKRK  349



>ref|XP_006410518.1| hypothetical protein EUTSA_v10017788mg [Eutrema salsugineum]
 gb|ESQ51971.1| hypothetical protein EUTSA_v10017788mg [Eutrema salsugineum]
Length=372

 Score =   157 bits (397),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 120/313 (38%), Positives = 172/313 (55%), Gaps = 18/313 (6%)
 Frame = -1

Query  1153  KFYFVHGGSSRWVATWVQCAGFPLLIPAVYLPY-YAF----------NSTERRPFAGFSL  1007
             + Y+ +GG   W ++++Q AG P+    ++LP  ++F              + PF     
Sbjct  45    RLYYRNGGKRIWFSSFLQTAGCPI----IFLPLLFSFLRRRRRRKEEEEEAKTPFFLIKP  100

Query  1006  RIFSLSVVIGLMLGVNNLLISWGTSYLPVSTCSLVLASQLVFILFLSAIIVRQKITFANL  827
              +F  SVVIGL+ G +N L S+G +YLPVST SL+++SQL F    +  +V+QK T   +
Sbjct  101   PLFFASVVIGLLTGFDNYLYSYGLAYLPVSTASLIISSQLAFTALFAFFMVKQKFTPFVI  160

Query  826   NCvvlltlaavllaLDSSSDKPAGLTKAKYFVGFFCTVGAALLFALYLPLVEKLY---RN  656
             N VVLLTL A +LAL +  DK A  T  +Y VGF  TV AA+L+A  LPLVE  Y   R 
Sbjct  161   NAVVLLTLGAGILALHTDGDKLAKETHKEYVVGFLMTVAAAILYAFILPLVELTYKKARQ  220

Query  655   VDCYamvvemqvvmeaaATVLATVGMAIDGGFSGMKKESQGGFDLGSKAYAMTVGLNVLT  476
                Y +V+E+Q+V+   AT    VGM  DG F  + KE++     GS  Y + V    + 
Sbjct  221   QISYTLVLEIQMVLCFVATCFCLVGMLADGDFKVIAKEARDFKHGGSSYYTVVVVFTAII  280

Query  475   WQLCFMGTAGMVFLTTSVTSGICSTALMAFNVVGGVLAYGDHMGGSKAVSTVLCVWGFSS  296
             WQ  F+G+ G++F  +S+ SGI  +AL+    V  VL + +     K +S  L +WGF S
Sbjct  281   WQGFFLGSIGIIFCASSLVSGILISALLPLTEVLAVLCFREKFQAEKGLSLFLSLWGFLS  340

Query  295   YVYGMYLKTKKVT  257
             Y YG     KK T
Sbjct  341   YFYGQIKSEKKKT  353



>emb|CDY27947.1| BnaCnng05320D [Brassica napus]
Length=349

 Score =   156 bits (395),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 114/311 (37%), Positives = 178/311 (57%), Gaps = 11/311 (4%)
 Frame = -1

Query  1153  KFYFVHGGSSRWVATWVQCAGFPLLIPAVYLPYYAFNSTERRPFAGFSL-----RIFSLS  989
             + YF +GG   W ++++Q +G P+++  + + +   +  + +     +L      +F  S
Sbjct  27    RLYFRNGGKRIWFSSFLQTSGCPIILLPLLISFLTRHRKQEQEDTKTTLFLIKPPLFLAS  86

Query  988   VVIGLMLGVNNLLISWGTSYLPVSTCSLVLASQLVFILFLSAIIVRQKITFANLNCvvll  809
             VV GL++G +N L ++G +YLPVST SL+++SQL F    +  +V+Q+ T   +N VVLL
Sbjct  87    VVFGLLIGFDNYLYAYGLAYLPVSTSSLIISSQLAFTALFAFFMVKQRFTPFTINAVVLL  146

Query  808   tlaavllaLDSSSDKPAGLTKAKYFVGFFCTVGAALLFALYLPLVEKLYRNVD---CYam  638
             TL A  LAL +  DK    T+ +Y VGF  TV AA+L+A  LPLVE  Y+       Y +
Sbjct  147   TLGAGSLALHADGDKLPKETRKEYIVGFAMTVAAAVLYAFVLPLVELTYKKASQRISYTL  206

Query  637   vvemqvvmeaaATVLATVGMAIDGGFSGMKKESQGGFDL-GSKAYAMTVGLNVLTWQLCF  461
             V+EMQ+V+   AT    VGM  DG F  +++E++  F L GSK Y + V    + WQ  F
Sbjct  207   VLEMQLVLCVVATCFCLVGMLADGDFKELRREAR-EFKLGGSKYYCVVVAFTAVIWQGFF  265

Query  460   MGTAGMVFLTTSVTSGICSTALMAFNVVGGVLAYGDHMGGSKAVSTVLCVWGFSSYVYG-  284
             +G+ GM+F  +S+ SG+  + L+    V  VL + +     K VS  L +WGF SY YG 
Sbjct  266   LGSIGMIFCASSLVSGVLISTLLPLTEVLAVLFFREKFQAEKGVSLFLSLWGFVSYFYGK  325

Query  283   MYLKTKKVTKE  251
             +  + +K T+E
Sbjct  326   IQSEKEKRTQE  336



>ref|XP_009400212.1| PREDICTED: probable purine permease 11 [Musa acuminata subsp. 
malaccensis]
Length=374

 Score =   157 bits (396),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 112/310 (36%), Positives = 178/310 (57%), Gaps = 13/310 (4%)
 Frame = -1

Query  1153  KFYFVHGGSSRWVATWVQCAGFPLLIPAVYLPYYAFNSTERRPFAGF-----SLRIFSLS  989
             +FY+  GG+S+W+AT VQ AGFP+L     LP + F ST   P           +I  + 
Sbjct  59    RFYYDQGGNSKWMATLVQTAGFPILC----LPLFLFPSTHPPPATSIIPHPSHAKIALVY  114

Query  988   VVIGLMLGVNNLLISWGTSYLPVSTCSLVLASQLVFILFLSAIIVRQKITFANLNCvvll  809
             V++GL++  +NL+ S+G  YLPVST SLV A+QL F    S  +  QK T   +N VVLL
Sbjct  115   VILGLIIAADNLMYSYGLLYLPVSTYSLVCATQLAFNAVFSYYLNSQKFTAFIMNSVVLL  174

Query  808   tlaavllaLDSSSDKPAGLTKAKYFVGFFCTVGAALLFALYLPLVEKLYRNV---DCYam  638
             T +A LL  + +S+  A ++K KY +GF  T+GA+  ++L L L++  ++ V   + ++ 
Sbjct  175   TFSAALLGFNENSESSADVSKGKYAIGFILTLGASATYSLILSLMQLTFQKVIRKETFSA  234

Query  637   vvemqvvmeaaATVLATVGMAIDGGFSGMKKESQGGFDLGSKAYAMTVGLNVLTWQLCFM  458
             V+EMQ+     A+  A VG+   G +  +K E +  +  G+ +Y MT+    L+WQ+  +
Sbjct  235   VLEMQIYTAFVASCAAVVGLLASGEWKDLKSEME-AYGKGTVSYVMTLVWTGLSWQVASV  293

Query  457   GTAGMVFLTTSVTSGICSTALMAFNVVGGVLAYGDHMGGSKAVSTVLCVWGFSSYVYGMY  278
             G  G++F+ +S+ S + ST  +    V  V+ + D M G K V+ ++ +WGF+SY+Y  Y
Sbjct  294   GVVGLIFVVSSLFSNVISTLALPVVPVFAVIFFHDKMNGVKIVAMLIAIWGFASYLYQHY  353

Query  277   LKTKKVTKEV  248
             L   K  K V
Sbjct  354   LDDSKAKKTV  363



>gb|EYU34537.1| hypothetical protein MIMGU_mgv1a022801mg, partial [Erythranthe 
guttata]
Length=349

 Score =   156 bits (394),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 107/299 (36%), Positives = 172/299 (58%), Gaps = 13/299 (4%)
 Frame = -1

Query  1153  KFYFVHGGSSRWVATWVQCAGFPLLIPAVYLPYYAFNSTERRPFAG------FSLRIFSL  992
             + YFVHGG   W ++W++  G+P+L+  + + Y   N   R   +G         R+F  
Sbjct  25    RLYFVHGGKRIWFSSWLETGGWPILLVPLLVSY---NRRRRTAASGKAELYLMKPRVFLA  81

Query  991   SVVIGLMLGVNNLLISWGTSYLPVSTCSLVLASQLVFILFLSAIIVRQKITFANLNCvvl  812
             + VIG++ G ++ L ++G + LPVST +L++ASQL F    + ++V+Q+ T  ++N VVL
Sbjct  82    AAVIGVLTGFDDYLYAYGVAKLPVSTSALIIASQLAFTAAFAFLMVKQEFTAYSVNSVVL  141

Query  811   ltlaavllaLDSSSDKPAGLTKAKYFVGFFCTVGAALLFALYLPLVEKLYRNVD---CYa  641
             LTL AV+L L ++ D+P G +  +Y VGFF TV AA L    LP VE  Y+       Y 
Sbjct  142   LTLGAVVLGLHTNGDRPEGESSKEYMVGFFLTVAAAALCGFILPAVELTYKKAKQAVSYT  201

Query  640   mvvemqvvmeaaATVLATVGMAIDGGFSGMKKESQGGFDLGSKAYAMTVGLNVLTWQLCF  461
             +V+EMQ+VM   AT   T+GM ++  F  + +E++  ++LG   Y + V  + + WQ  F
Sbjct  202   LVLEMQLVMCVFATSFCTLGMLVNNDFQAIAREAR-AYELGETKYYIVVLWSAIVWQCFF  260

Query  460   MGTAGMVFLTTSVTSGICSTALMAFNVVGGVLAYGDHMGGSKAVSTVLCVWGFSSYVYG  284
             +G  G++F ++S+ SGI  T L+    +  ++ Y +     K +S  L +WGF SY YG
Sbjct  261   LGAIGVIFYSSSLLSGIVITVLLPATEILAIIFYHEKFQAEKGLSLFLSLWGFISYFYG  319



>ref|XP_008450620.1| PREDICTED: probable purine permease 11 isoform X1 [Cucumis melo]
Length=364

 Score =   156 bits (395),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 113/301 (38%), Positives = 179/301 (59%), Gaps = 9/301 (3%)
 Frame = -1

Query  1153  KFYFVHGGSSRWVATWVQCAGFPLLIPAVYLPYYAFNSTERRP-FAGFSLRIFSLSVVIG  977
             + Y+  GG+S+W+AT VQ AGFP+L+P ++       S+ ++P F  FS   F+     G
Sbjct  55    RLYYDKGGNSKWMATLVQSAGFPILLPFLWFFSQPTKSSSKQPNFLTFSFICFAF----G  110

Query  976   LMLGVNNLLISWGTSYLPVSTCSLVLASQLVFILFLSAIIVRQKITFANLNCvvlltlaa  797
             L+L  +NL+ S+G  YLPVST SL+ A+QL F   LS  +  QK T   LN +VLLT++A
Sbjct  111   LLLIGDNLMYSYGLLYLPVSTYSLLCATQLAFNALLSFFLNAQKFTPYILNSLVLLTVSA  170

Query  796   vllaLDSSSDKPAGLTKAKYFVGFFCTVGAALLFALYLPLVEKLYRNV---DCYamvvem  626
              LLA +S SD     +K KY +GF CT+GA+  ++LYL L++  +  V   + +++V++M
Sbjct  171   SLLAFNSESDTTTHSSKGKYVIGFLCTLGASATYSLYLCLLQVCFEKVIKRETFSIVLDM  230

Query  625   qvvmeaaATVLATVGMAIDGGFSGMKKESQGGFDLGSKAYAMTVGLNVLTWQLCFMGTAG  446
             Q+     A+    VG+   G + G++ E + G++ G  +Y MT+    +TWQ+  +G  G
Sbjct  231   QIYPSIVASCGCVVGLFGSGEWRGLRDEMR-GYEEGRVSYFMTLVWTAVTWQVSSVGLLG  289

Query  445   MVFLTTSVTSGICSTALMAFNVVGGVLAYGDHMGGSKAVSTVLCVWGFSSYVYGMYLKTK  266
             ++F  +S+ S + ST  +    +  V+ + D M G KA++ VL +WGF SY+Y  YL   
Sbjct  290   LIFEVSSLFSNVISTLALPVVPILAVIFFHDKMNGVKAMALVLALWGFVSYIYQNYLDES  349

Query  265   K  263
             K
Sbjct  350   K  350



>ref|XP_010248452.1| PREDICTED: purine permease 3-like [Nelumbo nucifera]
Length=326

 Score =   155 bits (393),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 112/304 (37%), Positives = 180/304 (59%), Gaps = 12/304 (4%)
 Frame = -1

Query  1153  KFYFVHGGSSRWVATWVQCAGFPLLIPAVYLPYYAFNSTERR---PFAGF-SLRIFSLSV  986
             + Y++HGG+ RW++  +Q AGFP+L+  + L     +   RR   P   F   ++   S 
Sbjct  13    RLYYLHGGNRRWLSCSLQSAGFPILLIPLSL--LYLHHRRRRGVSPSEFFIEPKLLVSSA  70

Query  985   VIGLMLGVNNLLISWGTSYLPVSTCSLVLASQLVFILFLSAIIVRQKITFANLNCvvllt  806
             V+GL+LG++N + + G SY+PVST +L+ A+QL F    + +IV+Q+ T  ++N VVL+ 
Sbjct  71    VLGLLLGLDNFMYALGLSYIPVSTSALLFATQLAFTAGFARLIVKQRFTPYSINSVVLMI  130

Query  805   laavllaLDSSSDKPAGLTKAKYFVGFFCTVGAALLFALYLPLVEKLY----RNVDCYam  638
             L ++ L + S  D PAG++  +Y  GFF T+G+ALL    LP +E  Y    R VD +A 
Sbjct  131   LGSITLGIHSGGDWPAGVSDGEYLSGFFLTLGSALLVGFILPCIEFAYSKASRAVD-FAA  189

Query  637   vvemqvvmeaaATVLATVGMAIDGGFSGMKKESQGGFDLGSKAYAMTVGLNVLTWQLCFM  458
             V++ Q  M   AT+ A + M I+  F  + +E++  ++LG   Y   +  + + WQL  +
Sbjct  190   VMQFQFNMGLFATIFAAMEMLINKDFQEIPREAR-EYELGHGMYYFVLSASAIVWQLSLI  248

Query  457   GTAGMVFLTTSVTSGICSTALMAFNVVGGVLAYGDHMGGSKAVSTVLCVWGFSSYVYGMY  278
             G  G++F TTS+ +GI    L+ F  +G V+AY +   G K ++  LC+WGF+SY YG Y
Sbjct  249   GLLGLIFCTTSLFTGIYGAVLLPFAEIGAVIAYHEKFTGEKGIALALCLWGFTSYFYGEY  308

Query  277   LKTK  266
              K+K
Sbjct  309   RKSK  312



>ref|XP_010538168.1| PREDICTED: purine permease 1-like [Tarenaya hassleriana]
Length=359

 Score =   156 bits (395),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 109/318 (34%), Positives = 178/318 (56%), Gaps = 19/318 (6%)
 Frame = -1

Query  1153  KFYFVHGGSSRWVATWVQCAGFPLLIPAVYLPYYAFNST--------------ERRPFAG  1016
             + YF +GG   W++++++ AGFP++   ++  +   N                E+  F  
Sbjct  25    RLYFNNGGKRVWLSSFLETAGFPIIFIPLFSSFLKRNRNRTSCIITSSSSSSDEKTRFFL  84

Query  1015  FSLRIFSLSVVIGLMLGVNNLLISWGTSYLPVSTCSLVLASQLVFILFLSAIIVRQKITF  836
                R+F+ S  IG++ G++N L ++G ++LPVST SL++ASQL F    + ++V+QK T 
Sbjct  85    MRPRLFAASGFIGIITGLDNYLYAYGLAFLPVSTSSLIIASQLAFTALFAFLLVKQKFTP  144

Query  835   ANLNCvvlltlaavllaLDSSSDKPAGLTKAKYFVGFFCTVGAALLFALYLPLVEKLY--  662
              ++N VVLLT+ A +LAL +  DKP+  ++  Y +GF  TV AA+L+A  LP +E  Y  
Sbjct  145   FSVNAVVLLTVGAGVLALHTGGDKPSNESQKDYMLGFVLTVAAAVLYAFILPFIELTYKK  204

Query  661   -RNVDCYamvvemqvvmeaaATVLATVGMAIDGGFSGMKKESQGGFDLGSKAYAMTVGLN  485
              R    + +V+E+Q+VM   A+V   VGM I   F  + +E++  F LG + Y + +   
Sbjct  205   ARQEMSFTLVLEVQMVMCLFASVFCLVGMLISDDFKAIPREAR-SFGLGERVYYVVIAFT  263

Query  484   VLTWQLCFMGTAGMVFLTTSVTSGICSTALMAFNVVGGVLAYGDHMGGSKAVSTVLCVWG  305
              + WQ  F+G  G++F  +S+ SG+  + L+    V  V+ + +     K VS VL +WG
Sbjct  264   AIIWQGFFLGAIGVIFCASSLVSGVLISVLLPLTEVLAVVCFKERFQAEKGVSLVLSLWG  323

Query  304   FSSYVYGMYLKTKKVTKE  251
             F SY YG   K  KV K+
Sbjct  324   FVSYFYG-EAKHSKVHKD  340



>gb|KFK44691.1| hypothetical protein AALP_AA1G290900 [Arabis alpina]
Length=351

 Score =   156 bits (394),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 105/312 (34%), Positives = 176/312 (56%), Gaps = 12/312 (4%)
 Frame = -1

Query  1153  KFYFVHGGSSRWVATWVQCAGFPLLIPAVYLPYYAF-------NSTERRPFAGFSLRIFS  995
             + YF +GG   W +++++ AGFP+++  ++  Y           ++E   F     R+  
Sbjct  26    RLYFNNGGKRIWFSSFLETAGFPVILIPLFFSYLNRLRRNNNNGTSENISFFLIKPRLLF  85

Query  994   LSVVIGLMLGVNNLLISWGTSYLPVSTCSLVLASQLVFILFLSAIIVRQKITFANLNCvv  815
              +V++G++ G +N L ++G +YLPVST +L++ASQL FI   S  +V  K T   +N VV
Sbjct  86    AAVLVGVLSGFDNYLYAYGIAYLPVSTAALIIASQLAFIAIFSYFMVNHKFTPYTINAVV  145

Query  814   lltlaavllaLDSSSDKPAGLTKAKYFVGFFCTVGAALLFALYLPLVEKLYRNVD---CY  644
             LLT+ A +L + + +DKP   T  +Y +GF  TV AA+++A  LPLVE  Y+       Y
Sbjct  146   LLTVGAAVLGMHTETDKPVHETHKQYVIGFLMTVAAAVMYAFILPLVELAYQKAKQPMSY  205

Query  643   amvvemqvvmeaaATVLATVGMAIDGGFSGMKKESQGGFDLGSKAYAMTVGLNVLTWQLC  464
              +V+E+Q+V+   A++++ +GM I G F  +  E++  F LG   + + V  + + WQ  
Sbjct  206   TLVLEVQLVLCLFASLVSLIGMFIAGDFKALPIEAR-EFKLGEALFYVVVVFSAIIWQGF  264

Query  463   FMGTAGMVFLTTSVTSGICSTALMAFNVVGGVLAYGDHMGGSKAVSTVLCVWGFSSYVYG  284
             F+G  G++F  +S+ SGI  + L+    V  V+ Y +     K +S  L +WGF SY YG
Sbjct  265   FLGAIGLIFCASSLVSGIMISVLLPITEVLAVIFYHEKFQAEKGLSLALSLWGFVSYFYG  324

Query  283   MYLKTKKVTKEV  248
               +K+ K  K +
Sbjct  325   E-IKSDKEKKRI  335



>ref|XP_002285719.1| PREDICTED: purine permease 1-like [Vitis vinifera]
Length=351

 Score =   156 bits (394),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 103/302 (34%), Positives = 175/302 (58%), Gaps = 6/302 (2%)
 Frame = -1

Query  1153  KFYFVHGGSSRWVATWVQCAGFPLLIPAVYLPYYAFNSTERRPFAGFSLR--IFSLSVVI  980
             + YFV GG   W ++W++  G+PL++  + + Y    + +      F ++  +F  S VI
Sbjct  35    RLYFVLGGERIWFSSWLETVGWPLILVPLIITYMHRRTKQDSHAKLFFMKPPLFVASAVI  94

Query  979   GLMLGVNNLLISWGTSYLPVSTCSLVLASQLVFILFLSAIIVRQKITFANLNCvvlltla  800
             G++ G ++ L ++G + LPVST +L++ASQL F    + ++V+QK T  ++N + LL++ 
Sbjct  95    GVLTGFDDYLYAYGVAKLPVSTSALIVASQLAFTAAFAFLLVKQKFTSYSVNAIFLLSIG  154

Query  799   avllaLDSSSDKPAGLTKAKYFVGFFCTVGAALLFALYLPLVEKLYRNVD---CYamvve  629
             A +LAL +SSD+P   +  +Y++GF  T+ AA L+   LPLVE  Y+       Y++V+E
Sbjct  155   AGVLALHTSSDRPTNESNKEYYLGFVMTLAAAALYGFILPLVELTYKKTKQAITYSLVME  214

Query  628   mqvvmeaaATVLATVGMAIDGGFSGMKKESQGGFDLGSKAYAMTVGLNVLTWQLCFMGTA  449
             +Q+VM   ATV  TVGM ++  F  + +E++  ++LG   Y + V  N + WQ  F+ + 
Sbjct  215   IQMVMCFFATVFCTVGMLVNNDFQAISREAK-EYELGEAKYYLVVVWNGIIWQCFFLVSI  273

Query  448   GMVFLTTSVTSGICSTALMAFNVVGGVLAYGDHMGGSKAVSTVLCVWGFSSYVYGMYLKT  269
             G++F  +S+  GI  T L+    +  V+ + +     K VS  L +WGF SY YG    +
Sbjct  274   GVIFSASSLVCGIVITVLLPVTEILAVIFFREKFQAEKGVSLALSLWGFVSYFYGEIKDS  333

Query  268   KK  263
             KK
Sbjct  334   KK  335



>ref|XP_009143833.1| PREDICTED: purine permease 2 isoform X2 [Brassica rapa]
Length=362

 Score =   156 bits (394),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 122/324 (38%), Positives = 180/324 (56%), Gaps = 24/324 (7%)
 Frame = -1

Query  1153  KFYFVHGGSSRWVATWVQCAGFPL-LIPAVY--LPYYAFNSTERRPFAGFSL---RIFSL  992
             + YF +GG   W ++++Q +G P+ L+P ++  L  +     +  P     L    +F  
Sbjct  27    RLYFRNGGKRIWFSSFLQTSGCPIILLPLLFSFLTRHRQQQEQEEPKTTLFLIKPPLFLA  86

Query  991   SVVIGLMLGVNNLLISWGTSYLPVSTCSLVLASQLVFILFLSAIIVRQKITFANLNCvvl  812
             SVV+GL++G +N L ++G +YLPVST SL+++SQL F    +  +V+Q+ T   +N VVL
Sbjct  87    SVVVGLLIGFDNYLYAYGLAYLPVSTSSLIISSQLAFTALFAFFMVKQRFTPFTINAVVL  146

Query  811   ltlaavllaLDSSSDKPAGLTKAKYFVGFFCTVGAALLFALYLPLVEKLYRNVD---CYa  641
             LTL A  LAL +  DK    T+ +Y VGF  TV AA+L+A  LPLVE  Y+       Y 
Sbjct  147   LTLGAGSLALHADGDKLPKETRKEYIVGFVMTVAAAVLYAFVLPLVELAYKKASQRISYT  206

Query  640   mvvemqvvmeaaATVLATVGMAIDGGFSGMK-----------KESQGGFDL-GSKAYAMT  497
             +V+EMQ+V+   AT L  VGM  DG F   +           +E++  F L GSK Y + 
Sbjct  207   LVLEMQLVLCVVATCLCLVGMLADGDFKNQEFDFLFTVQELGREAR-EFKLGGSKHYCLV  265

Query  496   VGLNVLTWQLCFMGTAGMVFLTTSVTSGICSTALMAFNVVGGVLAYGDHMGGSKAVSTVL  317
             V    + WQ  F+G+ GM+F  +S+ SG+  +AL+    V  VL + +    +K VS  L
Sbjct  266   VAFTAVIWQGFFLGSIGMIFCASSLVSGVLISALLPLTEVLAVLFFKEKFQAAKGVSLFL  325

Query  316   CVWGFSSYVYGMYL--KTKKVTKE  251
              +WGF SY YG     K KK T+E
Sbjct  326   SLWGFVSYFYGKIQSEKEKKKTQE  349



>ref|XP_006357925.1| PREDICTED: purine permease 3-like [Solanum tuberosum]
Length=343

 Score =   155 bits (393),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 111/308 (36%), Positives = 171/308 (56%), Gaps = 5/308 (2%)
 Frame = -1

Query  1153  KFYFVHGGSSRWVATWVQCAGFPL-LIPAVYLPYYAFNSTERRPFAGFSLRIFSLSVVIG  977
             + YF+ GG   W++ W+Q   +P+  IP      Y  N+         + RIF  ++ IG
Sbjct  25    RLYFIKGGKRIWLSCWLQTVAWPINFIPLAISYLYRRNNNNSSKLILMTPRIFMATIGIG  84

Query  976   LMLGVNNLLISWGTSYLPVSTCSLVLASQLVFILFLSAIIVRQKITFANLNCvvlltlaa  797
             ++ G++N   S+G + LPVST  L++++QL FI F + IIV+ K+T  ++N V LLT+ A
Sbjct  85    ILQGLSNYFYSYGVAKLPVSTNGLLISTQLAFIAFFAFIIVKLKLTSYSINSVFLLTIGA  144

Query  796   vllaLDSSSDKPAGLTKAKYFVGFFCTVGAALLFALYLPLVEKLYRNVD---CYamvvem  626
             V+LAL S  D+P G T  +Y +GF  T+ +A L  L  PLVE +Y+       Y  V+E 
Sbjct  145   VVLALHSGGDRPEGETNKEYILGFIMTLASAALTGLIFPLVELIYKKAQQAITYTFVLEF  204

Query  625   qvvmeaaATVLATVGMAIDGGFSGMKKESQGGFDLGSKAYAMTVGLNVLTWQLCFMGTAG  446
             Q V    ATV +T+GM I+  F  +  E++  F+LG   Y + +    +  Q  F+GT G
Sbjct  205   QTVYCFVATVFSTIGMVINNDFQAISGEAK-AFELGEGRYYVVIICIAIVLQFYFLGTIG  263

Query  445   MVFLTTSVTSGICSTALMAFNVVGGVLAYGDHMGGSKAVSTVLCVWGFSSYVYGMYLKTK  266
             +++  +S+ SGI +T L+  N V  V  Y +     K +S  L +WGF+SY YG Y + K
Sbjct  264   VIYSASSLVSGILATFLLPVNEVLAVFLYSEKFSAEKGISLALSLWGFASYFYGDYKENK  323

Query  265   KVTKEVPP  242
             K   +  P
Sbjct  324   KRKNDQSP  331



>ref|XP_008812219.1| PREDICTED: purine permease 3-like [Phoenix dactylifera]
 ref|XP_008812222.1| PREDICTED: purine permease 3-like [Phoenix dactylifera]
Length=357

 Score =   155 bits (393),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 112/313 (36%), Positives = 185/313 (59%), Gaps = 17/313 (5%)
 Frame = -1

Query  1153  KFYFVHGGSSRWVATWVQCAGFPLLIPAVYLPYYAFNSTERRPFAG------FSLRIFSL  992
             + YF+ GGS +W+++W++  G+PLL    ++P  A +   RR   G       +  +F  
Sbjct  45    RLYFLKGGSRKWLSSWLETGGWPLL----FIPL-AISYAHRRGGGGPTKLYLMTPPLFLA  99

Query  991   SVVIGLMLGVNNLLISWGTSYLPVSTCSLVLASQLVFILFLSAIIVRQKITFANLNCvvl  812
               V+GL++G+++ L ++G S LPVST S+++++ L F    + +IV+QK T  + N VVL
Sbjct  100   CTVLGLLVGLDDFLYAYGMSCLPVSTASILVSTHLGFTALFAFLIVKQKFTSFSTNAVVL  159

Query  811   ltlaavllaLDSSSDKPAGLTKAKYFVGFFCTVGAALLFALYLPLVEKLY---RNVDCYa  641
             L++ AV+L L +S D+P G +   Y++GF  T+ AA+L+ + LPLVE  Y   + V  Y 
Sbjct  160   LSIGAVILGLHASGDRPKGESNTLYYLGFAMTLAAAMLYGVVLPLVELTYAKAKQVVSYT  219

Query  640   mvvemqvvmeaaATVLATVGMAIDGGFSGMKKESQGGFDLGSKAYAMTVGLNVLTWQLCF  461
             +V+EMQ+VM   ATV  TVGM ++  F  + KE++  F LG   Y + +  + L WQ  +
Sbjct  220   LVMEMQLVMGFFATVFCTVGMLVNKDFQAIPKEAR-DFGLGEVRYYVLLVWSALMWQFFY  278

Query  460   MGTAGMVFLTTSVTSGICSTALMAFNVVGGVLAYGDHMGGSKAVSTVLCVWGFSSYVYGM  281
             +GT G +F  +++ +GI   A++    V  V+ + +   G K V+  L +WGF+SY YG 
Sbjct  279   LGTVGAIFYGSALLAGIIIAAMIPVTEVLAVILFHEPFSGGKGVA--LALWGFASYFYGE  336

Query  280   YLKTKKVTKEVPP  242
             + ++KK    V P
Sbjct  337   FQESKKKKPVVEP  349



>ref|XP_007155747.1| hypothetical protein PHAVU_003G228300g [Phaseolus vulgaris]
 gb|ESW27741.1| hypothetical protein PHAVU_003G228300g [Phaseolus vulgaris]
Length=388

 Score =   156 bits (395),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 110/312 (35%), Positives = 181/312 (58%), Gaps = 17/312 (5%)
 Frame = -1

Query  1147  YFVHGGSSRWVATWVQCAGFPLLIPAVYLPYYA----------FNSTERRPFAGFSLRIF  998
             Y+ +GG+S+W+AT+VQ AGFPLL P ++  Y++           N+   +P   F   +F
Sbjct  66    YYDNGGNSKWMATFVQSAGFPLLFPLLF--YFSTQKQDKLTTELNNDSLKPKPKFCTLVF  123

Query  997   SLSVVIGLMLGVNNLLISWGTSYLPVSTCSLVLASQLVFILFLSAIIVRQKITFANLNCv  818
              L +  GL+L  +NL+ S+G  YLP+ST SL+ A+QL F    S  +  QK T    N V
Sbjct  124   -LYLAFGLILAGDNLMYSYGLLYLPLSTYSLLCATQLGFNAVFSFFLNSQKFTAFIFNSV  182

Query  817   vlltlaavllaLDSSSDKPAGLTKAKYFVGFFCTVGAALLFALYLPLVEKLYRNV---DC  647
             VLLT++A L+A+++ S+   GL++ K+ +GFFCT+GA+  F+LYL LV+  +  V   + 
Sbjct  183   VLLTISASLVAINADSEDQMGLSREKHIIGFFCTIGASATFSLYLSLVQLSFEKVIKRET  242

Query  646   YamvvemqvvmeaaATVLATVGMAIDGGFSGMKKESQGGFDLGSKAYAMTVGLNVLTWQL  467
             +  V++MQ+     AT  + VG+   G +  + KE++  ++ G  +Y MT+    +TWQ+
Sbjct  243   FTAVLDMQIYPSFIATCASVVGLFASGEWKSLDKETK-DYEKGRVSYRMTLLWTAVTWQI  301

Query  466   CFMGTAGMVFLTTSVTSGICSTALMAFNVVGGVLAYGDHMGGSKAVSTVLCVWGFSSYVY  287
               +G  G++F  +S+ S +  T  +    +  V+ + D + G K ++ +L VWGF SYVY
Sbjct  302   SSIGMLGLIFEVSSLFSNVIGTLALPIVPILAVIFFHDKVNGVKFIALLLAVWGFLSYVY  361

Query  286   GMYLKTKKVTKE  251
               Y+  KK   +
Sbjct  362   QHYVDHKKAEAD  373



>ref|XP_009588639.1| PREDICTED: purine permease 3-like [Nicotiana tomentosiformis]
Length=356

 Score =   155 bits (393),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 110/321 (34%), Positives = 183/321 (57%), Gaps = 21/321 (7%)
 Frame = -1

Query  1153  KFYFVHGGSSRWVATWVQCAGFPLLIPAVYLPYYAFNSTERR-----------------P  1025
             + YF+ GG   W+++W+Q + +P+++  + + Y+    ++ +                  
Sbjct  33    RLYFIKGGKRIWLSSWLQTSAWPIILIPLAISYFNRCKSQGKISTTVENNNNNDNNNNTK  92

Query  1024  FAGFSLRIFSLSVVIGLMLGVNNLLISWGTSYLPVSTCSLVLASQLVFILFLSAIIVRQK  845
             F   + RIF  +V +G++ G++N L ++G + LPVST +L++ASQL F    + ++V+QK
Sbjct  93    FILMTPRIFIAAVGMGILSGIDNYLSAYGVAKLPVSTSALLIASQLAFTAGFAFLLVKQK  152

Query  844   ITFANLNCvvlltlaavllaLDSSSDKPAGLTKAKYFVGFFCTVGAALLFALYLPLVEKL  665
              +  ++N + LLTL AV+LAL + SD+P G +K +Y +GF  T+GAA L+ L LPL E L
Sbjct  153   FSAYSINSIYLLTLGAVVLALHAKSDRPKGESKKEYILGFVLTLGAAALYGLILPLFELL  212

Query  664   YRNVD---CYamvvemqvvmeaaATVLATVGMAIDGGFSGMKKESQGGFDLGSKAYAMTV  494
             Y+       Y +V+E+Q V    ATV+ T+GM I+  F  M +E++  F+LG   Y + +
Sbjct  213   YKKAKQTITYTLVLEIQAVYCFFATVVCTIGMIINKDFQAMSREAK-AFELGEGRYYIVI  271

Query  493   GLNVLTWQLCFMGTAGMVFLTTSVTSGICSTALMAFNVVGGVLAYGDHMGGSKAVSTVLC  314
               + + WQ  F+G  G+V+ ++S+ S I  T L+    V  V+ YG+     K VS  L 
Sbjct  272   VWSAIIWQCFFLGAIGVVYSSSSLVSAILITVLLPVTEVLAVIFYGEKFTAEKGVSLALS  331

Query  313   VWGFSSYVYGMYLKTKKVTKE  251
             +WGF SY YG    +KK   +
Sbjct  332   MWGFISYFYGDIKASKKTENQ  352



>ref|XP_004957086.1| PREDICTED: purine permease 3-like [Setaria italica]
Length=356

 Score =   155 bits (393),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 108/303 (36%), Positives = 175/303 (58%), Gaps = 8/303 (3%)
 Frame = -1

Query  1153  KFYFVHGGSSRWVATWVQCAGFPLL-IPAVYLPYYAFNSTERRPFAGFSLRIFSLSVVIG  977
             + YF  GG  +W++ W++ AG+PLL +P V             P      RI   +V +G
Sbjct  41    RLYFSKGGHRQWLSAWLETAGWPLLLVPVVAAYVARRARDRAAPALLTPPRILLAAVGLG  100

Query  976   LMLGVNNLLISWGTSYLPVSTCSLVLASQLVFILFLSAIIVRQKITFANLNCvvlltlaa  797
             +  GV++ + ++G SYLPVST ++++++QL F +  + +IVRQ++T A++N V LLT+ A
Sbjct  101   VATGVDDFIYAYGLSYLPVSTSAILISTQLAFTVLFAFLIVRQRLTAASVNAVALLTVGA  160

Query  796   vllaLDSSSDKPAGLTKAKYFVGFFCTVGAALLFALYLPLVEKLYRNVD------CYamv  635
             V+L L  SSD+P G+T+ +Y++GF  T+GAA L+ L LPLVE  YR          YA+V
Sbjct  161   VVLGLHVSSDRPPGVTRGQYWLGFILTLGAAALYGLVLPLVELAYRRAAGGGRAVTYALV  220

Query  634   vemqvvmeaaATVLATVGMAIDGGFSGMKKESQGGFDLGSKAYAMTVGLNVLTWQLCFMG  455
             +EMQ+VM   AT   TVGM ++  F  + +E++  F+LG   Y   +  + + WQ  F+G
Sbjct  221   IEMQLVMGFFATAFCTVGMIVNKDFQAIPREAK-HFELGEARYYTVLVWSAVLWQCFFLG  279

Query  454   TAGMVFLTTSVTSGICSTALMAFNVVGGVLAYGDHMGGSKAVSTVLCVWGFSSYVYGMYL  275
               G++F   ++ +GI     +    V  V+   +     K V+ VL +WG +SY YG + 
Sbjct  280   AVGVIFCVHTLLAGILIAVFIPVTEVAAVIFLHEKFSSEKGVALVLSLWGLASYSYGEWS  339

Query  274   KTK  266
              ++
Sbjct  340   DSR  342



>ref|XP_010266586.1| PREDICTED: purine permease 3-like [Nelumbo nucifera]
Length=373

 Score =   156 bits (394),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 111/317 (35%), Positives = 179/317 (56%), Gaps = 20/317 (6%)
 Frame = -1

Query  1153  KFYFVHGGSSRWVATWVQCAGFPL-LIPAVYLPYYAFNSTERRPFAG--------FSLRI  1001
             + YF  GG+  W+++W++  G+P+ L P +      F+   RR   G           R+
Sbjct  53    RLYFNRGGNRIWLSSWLETGGWPIFLFPLL------FSYLHRRSKLGEQGARLFFMKPRL  106

Query  1000  FSLSVVIGLMLGVNNLLISWGTSYLPVSTCSLVLASQLVFILFLSAIIVRQKITFANLNC  821
             F  S  +GL+ G+ + L ++G S LPVST SL+ +SQL F    S ++VRQ+ T  ++N 
Sbjct  107   FVASASLGLLTGLVDYLYAYGMSRLPVSTISLINSSQLAFNALFSFLLVRQRFTPFSINS  166

Query  820   vvlltlaavllaLDSSSDKPAGLTKAKYFVGFFCTVGAALLFALYLPLVEKLYRNVD---  650
             VVLLT+ A++L L SSSD+P    K +Y++GFF ++GAA+L+ L LP+VE  Y+      
Sbjct  167   VVLLTIGAIVLGLHSSSDRPKDEAKDQYYMGFFVSIGAAVLYGLLLPMVEFTYKRAKQAI  226

Query  649   CYamvvemqvvmeaaATVLATVGMAIDGGFSGMKKESQGGFDLGSKAYAMTVGLNVLTWQ  470
              Y +V+E+Q+VM   AT   TVGM ++  F  +  E++   +LG   Y + +  + + WQ
Sbjct  227   TYPLVMEIQMVMSIFATAFCTVGMLVNKDFKAIGSEAR-EHELGVVKYYVVLVCSAIFWQ  285

Query  469   LCFMGTAGMVFLTTSVTSGICSTALMAFNVVGGVLAYGDHMGGSKAVSTVLCVWGFSSYV  290
               ++G  G++F  +S+ +GI S  L+    +  V+ Y +   G K +S  L +WGF+SY 
Sbjct  286   FFYLGAVGVIFYASSLVAGITSATLLPILEILAVIFYKEKFKGEKGISLTLALWGFTSYF  345

Query  289   YGMYLKTKKVTKEVPPA  239
             YG  LK      + P +
Sbjct  346   YGE-LKGNNQQDQKPES  361



>ref|XP_002307351.2| PURINE PERMEASE 1 family protein [Populus trichocarpa]
 gb|EEE94347.2| PURINE PERMEASE 1 family protein [Populus trichocarpa]
Length=356

 Score =   155 bits (392),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 105/316 (33%), Positives = 184/316 (58%), Gaps = 7/316 (2%)
 Frame = -1

Query  1153  KFYFVHGGSSRWVATWVQCAGFPLLIPAVYLPYYAFNSTERRPFAGFSLR--IFSLSVVI  980
             + YF+HGG   W++ W++  G+P+++  + + Y+   +T+      F ++  +F  + +I
Sbjct  37    RLYFIHGGKRIWLSAWLETGGWPIILIPLAISYFHRRATDPTT-KLFYMKPPLFIAAAII  95

Query  979   GLMLGVNNLLISWGTSYLPVSTCSLVLASQLVFILFLSAIIVRQKITFANLNCvvlltla  800
             G++ G+++ L ++G + LPVST +L++A+QL F    + ++V+QK T  ++N VVLLT+ 
Sbjct  96    GVLTGLDDYLYAYGVARLPVSTSALIIATQLAFTAGFAFLLVKQKFTSYSINAVVLLTVG  155

Query  799   avllaLDSSSDKPAGLTKAKYFVGFFCTVGAALLFALYLPLVEKLY---RNVDCYamvve  629
             A +LA+ + SDKPA  +  +Y +GF  T+ AA L+   +PLVE  Y   R    Y +V+E
Sbjct  156   AGVLAMHTGSDKPAHESSREYILGFILTLVAAALYGFIMPLVELTYKKSRQEMNYTLVME  215

Query  628   mqvvmeaaATVLATVGMAIDGGFSGMKKESQGGFDLGSKAYAMTVGLNVLTWQLCFMGTA  449
             +Q++M   ATV  TVGM I+  F  + +E++  ++LG   Y + +  + + WQ  F+G  
Sbjct  216   IQMIMCLLATVFCTVGMLINKDFQAIPREAR-NYELGEVKYYVVMVWSAIIWQCFFLGAI  274

Query  448   GMVFLTTSVTSGICSTALMAFNVVGGVLAYGDHMGGSKAVSTVLCVWGFSSYVYGMYLKT  269
             G++F  +S+ SGI  T L+    +  V+ + +     K V+  L +WGF SY YG   + 
Sbjct  275   GVIFCASSLLSGIIITVLLPATEILAVIFFQEKFQVEKGVALGLSLWGFVSYFYGEMKEN  334

Query  268   KKVTKEVPPAIGA*SD  221
             KK     P  + A S+
Sbjct  335   KKKKPAAPETLMAPSN  350



>ref|XP_009770717.1| PREDICTED: purine permease 1-like [Nicotiana sylvestris]
Length=350

 Score =   155 bits (391),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 114/303 (38%), Positives = 178/303 (59%), Gaps = 8/303 (3%)
 Frame = -1

Query  1153  KFYFVHGGSSRWVATWVQCAGFPL-LIPAVYLPYYAFNSTE--RRPFAGFSLRIFSLSVV  983
             + Y+V GGS  W ++W+Q AG+P+ LIP V L +Y    TE     +   + RIF  S +
Sbjct  34    RLYYVEGGSRIWFSSWLQTAGWPITLIPLVILYFYR-QKTEGTNAKYYLITPRIFIASFI  92

Query  982   IGLMLGVNNLLISWGTSYLPVSTCSLVLASQLVFILFLSAIIVRQKITFANLNCvvlltl  803
             IG++ G+++ L SWG S LPVST SL+LA+QL F    +  IV+ K T  ++N VVLLTL
Sbjct  93    IGVVTGLDDFLYSWGGSKLPVSTSSLLLAAQLAFTAIGAFFIVKLKFTPYSINAVVLLTL  152

Query  802   aavllaLDSSSDKPAGLTKAKYFVGFFCTVGAALLFALYLPLVEKLY---RNVDCYamvv  632
              AVLL + S+ D+P G+T   Y +GF  T+ AA L+ + LP +E +Y   +      +V+
Sbjct  153   GAVLLGVRSNGDRPEGVTSKAYIIGFMMTLLAAALYGVILPCIELIYLKAKQAITATLVL  212

Query  631   emqvvmeaaATVLATVGMAIDGGFSGMKKESQGGFDLGSKAYAMTVGLNVLTWQLCFMGT  452
             E+Q+VM  AAT   TVGM ++  F  + +E++  F+LG   Y   +    + W   F+G 
Sbjct  213   EIQMVMCFAATAFCTVGMIVNNNFKAISREAK-QFNLGEARYYTVIVWTTIVWLCFFVGV  271

Query  451   AGMVFLTTSVTSGICSTALMAFNVVGGVLAYGDHMGGSKAVSTVLCVWGFSSYVYGMYLK  272
              G+++ ++S+ SG+    L+    V  V+ + ++    K ++  LC+WGF S  YG + +
Sbjct  272   IGVIYCSSSLMSGVMIAVLLPVTEVLAVVFFRENFLVEKGLALFLCLWGFVSCFYGEFRQ  331

Query  271   TKK  263
             TKK
Sbjct  332   TKK  334



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 3560101069432