BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c80706_g1_i1 len=546 path=[547:0-545]

Length=546
                                                                      Score     E

ref|XP_009768060.1|  PREDICTED: uncharacterized protein LOC104219128    101   5e-24   
ref|XP_009616521.1|  PREDICTED: uncharacterized protein LOC104109046    101   7e-24   
ref|XP_006356625.1|  PREDICTED: uncharacterized protein LOC102584537  89.4    2e-19   
ref|XP_009765312.1|  PREDICTED: uncharacterized protein LOC104216873  74.3    6e-14   
emb|CDP18430.1|  unnamed protein product                              71.6    6e-13   
ref|XP_011081864.1|  PREDICTED: uncharacterized protein LOC105164790  69.3    6e-12   
gb|EPS58607.1|  hypothetical protein M569_16206                       62.0    2e-09   
emb|CBI20947.3|  unnamed protein product                              58.2    3e-08   



>ref|XP_009768060.1| PREDICTED: uncharacterized protein LOC104219128 [Nicotiana sylvestris]
Length=110

 Score =   101 bits (252),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 51/109 (47%), Positives = 75/109 (69%), Gaps = 5/109 (5%)
 Frame = -3

Query  481  MEKKSVKIWVVLGVLVAMSGAQCGKADSVYGCLGGCYNKCVVLARNSGA---SRYPCYIG  311
            ME+ SV + +++ ++V         AD+ Y C GGCYN+C++L+  +G    S  PCY+ 
Sbjct  1    MERISVFVTLLIVLIVVGKQVHNVSADNPYACWGGCYNQCIILSFQAGVTPNSNNPCYVQ  60

Query  310  CINGCVPTTAADDYQNYCQIGCNLQLCSPTRYD-GAQLEKCVGRCGNIC  167
            C++ C+P +AA+ YQNYC+IGC+L+LC PTR D GA L+KC G CGN+C
Sbjct  61   CLSKCIPRSAAE-YQNYCKIGCSLELCVPTRSDAGADLDKCFGNCGNVC  108



>ref|XP_009616521.1| PREDICTED: uncharacterized protein LOC104109046 [Nicotiana tomentosiformis]
Length=110

 Score =   101 bits (251),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 51/109 (47%), Positives = 74/109 (68%), Gaps = 5/109 (5%)
 Frame = -3

Query  481  MEKKSVKIWVVLGVLVAMSGAQCGKADSVYGCLGGCYNKCVVLARNSGA---SRYPCYIG  311
            ME+ SV + + + ++V         ADS Y C GGCYN+C++L+  +G    +  PCY+ 
Sbjct  1    MERISVFVTLFIVLIVVGKEMHNVSADSPYACWGGCYNQCIILSFQAGTIPNNNNPCYVQ  60

Query  310  CINGCVPTTAADDYQNYCQIGCNLQLCSPTRYD-GAQLEKCVGRCGNIC  167
            C++ C+P +AA+ YQNYC+IGC+L+LC PTR D GA L+KC G CGN+C
Sbjct  61   CLSKCIPRSAAE-YQNYCKIGCSLELCVPTRSDAGADLDKCFGNCGNVC  108



>ref|XP_006356625.1| PREDICTED: uncharacterized protein LOC102584537 [Solanum tuberosum]
Length=110

 Score = 89.4 bits (220),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 47/109 (43%), Positives = 71/109 (65%), Gaps = 5/109 (5%)
 Frame = -3

Query  481  MEK-KSVKIWVVLGVLVAMSGAQCGKADSVYGCLGGCYNKCVVLARNS--GASRYPCYIG  311
            ME+  S+ + V++ + V  +       DS Y C GGCYNKC++L   S   +   PCY+ 
Sbjct  1    MERITSIFVSVLIVLFVVGNEMYIVNGDSPYACWGGCYNKCILLTMKSRIPSGNDPCYVK  60

Query  310  CINGCVPTTAADDYQNYCQIGCNLQLCSPTRYD-GAQLEKCVGRCGNIC  167
            C++ C+PT+A++ Y++YC IGC+L+LC P R+D GA L+ C G CG+IC
Sbjct  61   CLSKCIPTSASE-YRDYCTIGCSLELCVPIRFDAGADLDACYGSCGSIC  108



>ref|XP_009765312.1| PREDICTED: uncharacterized protein LOC104216873 [Nicotiana sylvestris]
Length=101

 Score = 74.3 bits (181),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 32/81 (40%), Positives = 50/81 (62%), Gaps = 1/81 (1%)
 Frame = -3

Query  406  ADSVYGCLGGCYNKCVVLARNS-GASRYPCYIGCINGCVPTTAADDYQNYCQIGCNLQLC  230
            +  +Y C GGCYN C +L +N   A  + CY  C+N C  +++A D+Q+ C+ GC L++C
Sbjct  8    SSKMYSCWGGCYNNCFLLQKNDDSAQSFQCYFNCLNNCTTSSSALDFQSVCRGGCYLEMC  67

Query  229  SPTRYDGAQLEKCVGRCGNIC  167
             P  + GA +  C+G C N+C
Sbjct  68   IPLSFVGANVGDCLGSCTNLC  88



>emb|CDP18430.1| unnamed protein product [Coffea canephora]
Length=88

 Score = 71.6 bits (174),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 35/85 (41%), Positives = 45/85 (53%), Gaps = 1/85 (1%)
 Frame = -3

Query  421  AQCGKADSVYGCLGGCYNKCVVLARNSGASRYPCYIGCINGCVPTTAADDYQNYCQIGCN  242
            AQ     S Y C GGCYN C +L+      RYPCY  C+  C P +A +    YC +GC+
Sbjct  3    AQNATGQSTYACWGGCYNVCFLLSSRPIVERYPCYFNCLASCFPQSALESQLYYCHVGCS  62

Query  241  LQLCSPTRYDGAQLEKCVGRCGNIC  167
             Q C   + D +  EKC G CG+ C
Sbjct  63   AQRCLQIK-DASAREKCFGGCGDAC  86



>ref|XP_011081864.1| PREDICTED: uncharacterized protein LOC105164790 [Sesamum indicum]
Length=107

 Score = 69.3 bits (168),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 34/77 (44%), Positives = 47/77 (61%), Gaps = 1/77 (1%)
 Frame = -3

Query  397  VYGCLGGCYNKCVVLARNSGASRYPCYIGCINGCVPTTAADDYQNYCQIGCNLQLCSPTR  218
            +Y C GGCYN C + +  +     PCY  C++ C   +A+D  Q YCQIGC+L+ C P  
Sbjct  30   LYTCWGGCYNVCFLRSNGTSPVGLPCYYPCLSSCNRGSASDS-QFYCQIGCSLERCDPVS  88

Query  217  YDGAQLEKCVGRCGNIC  167
             DGA+LE C+G C  +C
Sbjct  89   NDGARLENCLGSCTKLC  105



>gb|EPS58607.1| hypothetical protein M569_16206 [Genlisea aurea]
Length=105

 Score = 62.0 bits (149),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 38/99 (38%), Positives = 54/99 (55%), Gaps = 5/99 (5%)
 Frame = -3

Query  451  VLGVLVAMSGAQCGKADSVYGCLGGCYNKCVVLARNSGASRYPCYIGCIN-GCVPTTAAD  275
            V  +L+A+     G     Y C GGCYN C+    N+      CY  C++  C+P TA D
Sbjct  6    VTAILLAVVAMAAGIEAQRYTCWGGCYNVCIGGNNNNNPEGLSCYYRCLSRQCIPRTATD  65

Query  274  DYQNYCQIGCNLQLCSPTRY---DGAQLEKCVGRCGNIC  167
             ++ YCQ+GC+LQ C+  R    DG +LE+C+  C N C
Sbjct  66   -FEYYCQVGCSLQTCAVLRSSSEDGGRLEQCLDGCNNQC  103



>emb|CBI20947.3| unnamed protein product [Vitis vinifera]
Length=86

 Score = 58.2 bits (139),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 29/78 (37%), Positives = 43/78 (55%), Gaps = 1/78 (1%)
 Frame = -3

Query  397  VYGCLGGCYNKCVVLARNSGASRYPCYIGCINGCVPTTAADDYQNYCQIGCNLQLCSPTR  218
            +Y C GGCYN+CV+   +S     PC   C+NGC+P+  +     YC +GC+L  C    
Sbjct  10   IYTCWGGCYNQCVIEIGHSQIPNLPCTWKCLNGCLPSLGSVS-SKYCYLGCSLDRCIEFS  68

Query  217  YDGAQLEKCVGRCGNICN  164
             D  Q++ CV +C + C 
Sbjct  69   GDVPQMDGCVSKCSDPCQ  86



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 546044595962