BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c806_g1_i1 len=1389 path=[1367:0-676 2044:677-1388]

Length=1389
                                                                      Score     E

ref|XP_009768390.1|  PREDICTED: GDSL esterase/lipase EXL3-like          512   7e-177   
ref|XP_009614809.1|  PREDICTED: GDSL esterase/lipase EXL3-like          504   1e-173   
ref|XP_010320438.1|  PREDICTED: GDSL esterase/lipase EXL3 isoform X1    490   3e-168   
ref|XP_011074698.1|  PREDICTED: GDSL esterase/lipase EXL3-like          489   5e-168   
ref|XP_009594700.1|  PREDICTED: GDSL esterase/lipase EXL3-like          489   5e-168   
ref|XP_009617736.1|  PREDICTED: GDSL esterase/lipase EXL3-like          489   7e-168   
ref|XP_009779479.1|  PREDICTED: GDSL esterase/lipase EXL3-like          484   1e-165   
ref|XP_009786860.1|  PREDICTED: GDSL esterase/lipase EXL3-like is...    483   1e-165   
ref|XP_006342563.1|  PREDICTED: GDSL esterase/lipase EXL3-like          483   3e-165   
ref|XP_009772833.1|  PREDICTED: GDSL esterase/lipase EXL3               479   4e-164   
ref|XP_009627260.1|  PREDICTED: GDSL esterase/lipase EXL3-like          478   3e-163   
ref|XP_009627261.1|  PREDICTED: GDSL esterase/lipase EXL3-like          477   4e-163   
ref|XP_004252803.2|  PREDICTED: GDSL esterase/lipase EXL3-like is...    474   4e-162   
ref|XP_006342238.1|  PREDICTED: uncharacterized protein LOC102603803    487   1e-161   
ref|XP_009786862.1|  PREDICTED: GDSL esterase/lipase EXL3-like          471   8e-161   
emb|CDP07368.1|  unnamed protein product                                471   2e-160   
ref|XP_006342239.1|  PREDICTED: GDSL esterase/lipase EXL3-like          461   2e-156   
ref|XP_009776282.1|  PREDICTED: GDSL esterase/lipase EXL3-like          451   9e-153   
ref|XP_009622933.1|  PREDICTED: GDSL esterase/lipase EXL3-like          449   3e-152   
ref|XP_010692505.1|  PREDICTED: GDSL esterase/lipase EXL3-like          440   2e-148   
ref|XP_002279353.2|  PREDICTED: GDSL esterase/lipase EXL3               434   4e-146   Vitis vinifera
gb|KHN45938.1|  GDSL esterase/lipase EXL3                               434   6e-146   
ref|XP_010314650.1|  PREDICTED: GDSL esterase/lipase EXL3-like is...    432   8e-146   
ref|XP_010061080.1|  PREDICTED: GDSL esterase/lipase EXL3-like          432   2e-145   
ref|XP_009605226.1|  PREDICTED: GDSL esterase/lipase EXL3-like is...    432   2e-145   
gb|ACU24478.1|  unknown                                                 431   5e-145   Glycine max [soybeans]
gb|KHN09073.1|  GDSL esterase/lipase EXL3                               431   5e-145   
gb|KDO84924.1|  hypothetical protein CISIN_1g042648mg                   431   7e-145   
ref|XP_006435221.1|  hypothetical protein CICLE_v10003119mg             429   1e-144   
ref|XP_006473907.1|  PREDICTED: GDSL esterase/lipase EXL3-like          429   2e-144   
ref|XP_011003064.1|  PREDICTED: GDSL esterase/lipase EXL3-like          429   4e-144   
ref|XP_002279381.1|  PREDICTED: GDSL esterase/lipase EXL3               428   8e-144   Vitis vinifera
ref|XP_008221227.1|  PREDICTED: GDSL esterase/lipase EXL3-like          429   9e-144   
ref|XP_002301955.2|  family II extracellular lipase 3 family protein    429   1e-143   Populus trichocarpa [western balsam poplar]
ref|XP_007017868.1|  JHL20J20.8 protein                                 427   2e-143   
ref|XP_008221228.1|  PREDICTED: GDSL esterase/lipase EXL3-like          425   2e-142   
ref|XP_002306948.2|  family II extracellular lipase 3 family protein    424   5e-142   Populus trichocarpa [western balsam poplar]
ref|XP_002270500.1|  PREDICTED: GDSL esterase/lipase EXL3               423   6e-142   Vitis vinifera
ref|XP_008221397.1|  PREDICTED: GDSL esterase/lipase EXL3-like          423   8e-142   
ref|XP_010105284.1|  GDSL esterase/lipase EXL3                          423   9e-142   
ref|XP_009334750.1|  PREDICTED: GDSL esterase/lipase EXL3-like          422   1e-141   
ref|XP_003634393.1|  PREDICTED: GDSL esterase/lipase EXL3-like          422   1e-141   
ref|XP_003603782.1|  GDSL esterase/lipase EXL3                          422   1e-141   
ref|XP_003589534.1|  GDSL esterase/lipase                               422   2e-141   
emb|CBI19908.3|  unnamed protein product                                422   2e-141   
ref|XP_011034987.1|  PREDICTED: GDSL esterase/lipase EXL3-like          422   4e-141   
ref|XP_007225000.1|  hypothetical protein PRUPE_ppa020405mg             421   4e-141   
gb|AFK48612.1|  unknown                                                 421   6e-141   
ref|XP_007136105.1|  hypothetical protein PHAVU_009G018200g             420   1e-140   
ref|XP_002279335.1|  PREDICTED: GDSL esterase/lipase EXL3               419   2e-140   Vitis vinifera
ref|XP_010266839.1|  PREDICTED: GDSL esterase/lipase EXL3-like          431   2e-140   
ref|XP_009757107.1|  PREDICTED: uncharacterized protein LOC104210014    431   2e-140   
ref|XP_008387913.1|  PREDICTED: GDSL esterase/lipase EXL3-like          418   5e-140   
emb|CBI19910.3|  unnamed protein product                                417   1e-139   
gb|KDO84926.1|  hypothetical protein CISIN_1g017687mg                   417   2e-139   
gb|AFK34909.1|  unknown                                                 416   3e-139   
emb|CBI19913.3|  unnamed protein product                                416   3e-139   
ref|XP_006435222.1|  hypothetical protein CICLE_v10001561mg             416   4e-139   
ref|XP_010266339.1|  PREDICTED: GDSL esterase/lipase EXL3-like          415   1e-138   
gb|KHG24596.1|  GDSL esterase/lipase EXL3 -like protein                 413   4e-138   
ref|XP_006435224.1|  hypothetical protein CICLE_v10001578mg             413   9e-138   
ref|XP_007160639.1|  hypothetical protein PHAVU_001G004300g             412   2e-137   
ref|XP_003550433.1|  PREDICTED: GDSL esterase/lipase EXL3-like is...    412   2e-137   
ref|XP_004240848.2|  PREDICTED: uncharacterized protein LOC101249647    431   4e-137   
gb|KHN39410.1|  GDSL esterase/lipase EXL3                               410   4e-137   
ref|XP_003545022.1|  PREDICTED: GDSL esterase/lipase EXL3               410   6e-137   
gb|KHN12627.1|  GDSL esterase/lipase EXL3                               409   7e-137   
ref|XP_009605224.1|  PREDICTED: GDSL esterase/lipase At5g42170-like     411   8e-137   
ref|XP_010664850.1|  PREDICTED: uncharacterized protein LOC100264374    422   9e-137   
ref|XP_008242093.1|  PREDICTED: GDSL esterase/lipase EXL3-like          410   1e-136   
ref|XP_009363463.1|  PREDICTED: GDSL esterase/lipase EXL3-like          410   1e-136   
ref|XP_009336660.1|  PREDICTED: GDSL esterase/lipase EXL1-like          408   4e-136   
ref|XP_008221398.1|  PREDICTED: GDSL esterase/lipase EXL3-like          408   2e-135   
ref|XP_010034703.1|  PREDICTED: GDSL esterase/lipase EXL3-like          407   2e-135   
emb|CAN73607.1|  hypothetical protein VITISV_035505                     405   2e-135   Vitis vinifera
ref|XP_007046630.1|  GDSL-like Lipase/Acylhydrolase superfamily p...    407   3e-135   
ref|XP_006390254.1|  hypothetical protein EUTSA_v10018754mg             405   4e-135   
ref|XP_009106247.1|  PREDICTED: GDSL esterase/lipase EXL3               405   5e-135   
ref|XP_007046631.1|  Serine transhydroxymethyltransferase 1 isofo...    406   6e-135   
ref|NP_177718.1|  GDSL esterase/lipase EXL3                             405   1e-134   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006473698.1|  PREDICTED: GDSL esterase/lipase EXL1-like          417   1e-134   
ref|XP_010033516.1|  PREDICTED: GDSL esterase/lipase EXL3-like          405   1e-134   
ref|XP_004292937.1|  PREDICTED: uncharacterized protein LOC101306013    417   1e-134   
ref|XP_009379346.1|  PREDICTED: GDSL esterase/lipase EXL3-like          404   1e-134   
gb|ACU19367.1|  unknown                                                 404   1e-134   Glycine max [soybeans]
ref|XP_010033517.1|  PREDICTED: GDSL esterase/lipase EXL3-like          404   2e-134   
ref|XP_008350488.1|  PREDICTED: GDSL esterase/lipase EXL3-like          404   3e-134   
ref|XP_009363464.1|  PREDICTED: GDSL esterase/lipase EXL3-like          404   3e-134   
ref|XP_010105283.1|  GDSL esterase/lipase EXL3                          403   4e-134   
dbj|BAC41809.1|  putative family II lipase EXL3                         403   4e-134   Arabidopsis thaliana [mouse-ear cress]
emb|CDX73211.1|  BnaC06g36590D                                          403   5e-134   
ref|XP_008387915.1|  PREDICTED: GDSL esterase/lipase EXL3-like          404   5e-134   
gb|KDP36891.1|  hypothetical protein JCGZ_08182                         403   5e-134   
ref|XP_006302445.1|  hypothetical protein CARUB_v10020529mg             403   6e-134   
ref|XP_002510573.1|  zinc finger protein, putative                      414   6e-134   Ricinus communis
ref|XP_008354621.1|  PREDICTED: GDSL esterase/lipase EXL3-like          402   9e-134   
ref|XP_011083479.1|  PREDICTED: uncharacterized protein LOC105166004    414   1e-133   
ref|XP_009379345.1|  PREDICTED: GDSL esterase/lipase EXL3-like          402   1e-133   
ref|XP_010920107.1|  PREDICTED: GDSL esterase/lipase EXL3               402   1e-133   
ref|XP_008445321.1|  PREDICTED: GDSL esterase/lipase EXL3-like          402   2e-133   
gb|EYU38779.1|  hypothetical protein MIMGU_mgv1a026265mg                401   2e-133   
gb|KHN45939.1|  GDSL esterase/lipase                                    401   2e-133   
gb|KDP23987.1|  hypothetical protein JCGZ_25375                         400   3e-133   
ref|XP_009336671.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    414   4e-133   
ref|XP_010428640.1|  PREDICTED: GDSL esterase/lipase EXL3-like          400   8e-133   
gb|KCW53198.1|  hypothetical protein EUGRSUZ_J02472                     400   1e-132   
ref|XP_010471741.1|  PREDICTED: GDSL esterase/lipase EXL3-like          399   2e-132   
ref|XP_008440851.1|  PREDICTED: GDSL esterase/lipase EXL3-like          399   3e-132   
ref|XP_007136106.1|  hypothetical protein PHAVU_009G018300g             398   3e-132   
ref|XP_008363081.1|  PREDICTED: GDSL esterase/lipase EXL3-like          399   4e-132   
ref|XP_008393902.1|  PREDICTED: GDSL esterase/lipase EXL3-like          399   4e-132   
gb|KHN09072.1|  GDSL esterase/lipase                                    398   4e-132   
ref|XP_004238377.2|  PREDICTED: GDSL esterase/lipase EXL3-like          399   8e-132   
ref|XP_007224778.1|  hypothetical protein PRUPE_ppa023913mg             395   9e-132   
ref|XP_004142994.1|  PREDICTED: GDSL esterase/lipase EXL3-like is...    397   1e-131   
ref|XP_008344250.1|  PREDICTED: GDSL esterase/lipase EXL3-like          397   1e-131   
ref|XP_004134848.1|  PREDICTED: GDSL esterase/lipase EXL3-like          396   2e-131   
ref|XP_009334746.1|  PREDICTED: GDSL esterase/lipase EXL3-like          396   2e-131   
ref|XP_010416499.1|  PREDICTED: GDSL esterase/lipase EXL3               395   4e-131   
ref|XP_004499293.1|  PREDICTED: GDSL esterase/lipase EXL3-like          394   6e-131   
ref|XP_010320440.1|  PREDICTED: LOW QUALITY PROTEIN: GDSL esteras...    395   6e-131   
ref|XP_010266840.1|  PREDICTED: GDSL esterase/lipase EXL3-like          395   6e-131   
ref|XP_009104692.1|  PREDICTED: GDSL esterase/lipase EXL3-like          395   8e-131   
ref|XP_010539839.1|  PREDICTED: GDSL esterase/lipase EXL3-like          395   1e-130   
ref|XP_004158854.1|  PREDICTED: GDSL esterase/lipase EXL3-like          394   1e-130   
emb|CDX85929.1|  BnaC06g22050D                                          394   1e-130   
emb|CDX68113.1|  BnaA07g21530D                                          394   2e-130   
ref|XP_006390257.1|  hypothetical protein EUTSA_v10018728mg             394   2e-130   
gb|AES59777.2|  GDSL-like lipase/acylhydrolase                          396   4e-130   
ref|XP_008387914.1|  PREDICTED: GDSL esterase/lipase EXL3-like          393   4e-130   
ref|XP_009400370.1|  PREDICTED: GDSL esterase/lipase At1g20120-like     392   5e-130   
ref|XP_009106244.1|  PREDICTED: GDSL esterase/lipase EXL1 isoform X1    392   6e-130   
ref|XP_006601361.1|  PREDICTED: GDSL esterase/lipase EXL1-like          392   9e-130   
gb|KHN09074.1|  GDSL esterase/lipase EXL3                               391   2e-129   
ref|XP_003589526.1|  GDSL esterase/lipase                               396   3e-129   
gb|ACU20672.1|  unknown                                                 391   4e-129   Glycine max [soybeans]
emb|CDY70534.1|  BnaAnng34060D                                          390   7e-129   
ref|XP_006425399.1|  hypothetical protein CICLE_v10025900mg             390   8e-129   
ref|XP_008344249.1|  PREDICTED: LOW QUALITY PROTEIN: GDSL esteras...    387   3e-128   
ref|XP_008357124.1|  PREDICTED: GDSL esterase/lipase EXL3-like          389   3e-128   
gb|KDP23988.1|  hypothetical protein JCGZ_25376                         388   3e-128   
ref|XP_008807139.1|  PREDICTED: GDSL esterase/lipase EXL3-like          387   4e-128   
ref|NP_974149.1|  GDSL esterase/lipase EXL1                             388   5e-128   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007156185.1|  hypothetical protein PHAVU_003G265500g             388   6e-128   
ref|XP_010026063.1|  PREDICTED: GDSL esterase/lipase At5g42170-like     387   1e-127   
ref|XP_002887619.1|  T4O12.13                                           397   1e-127   
gb|KFK42029.1|  hypothetical protein AALP_AA2G202800                    386   3e-127   
ref|XP_006596537.1|  PREDICTED: GDSL esterase/lipase EXL1-like          386   3e-127   
gb|KHN39412.1|  GDSL esterase/lipase EXL1                               386   3e-127   
emb|CDX85928.1|  BnaC06g22060D                                          385   4e-127   
ref|XP_006302332.1|  hypothetical protein CARUB_v10020390mg             386   8e-127   
ref|XP_003589528.1|  GDSL esterase/lipase                               385   9e-127   
ref|XP_006601360.1|  PREDICTED: GDSL esterase/lipase EXL3-like          385   1e-126   
ref|XP_009379344.1|  PREDICTED: GDSL esterase/lipase EXL3-like          385   1e-126   
ref|XP_008807138.1|  PREDICTED: GDSL esterase/lipase EXL3               384   1e-126   
ref|NP_565120.1|  GDSL esterase/lipase EXL1                             384   2e-126   Arabidopsis thaliana [mouse-ear cress]
emb|CDX73210.1|  BnaC06g36580D                                          384   2e-126   
ref|XP_010679879.1|  PREDICTED: GDSL esterase/lipase EXL3-like is...    383   4e-126   
ref|XP_009786861.1|  PREDICTED: GDSL esterase/lipase EXL3-like is...    380   7e-126   
ref|XP_006596538.1|  PREDICTED: GDSL esterase/lipase EXL3-like          382   1e-125   
dbj|BAJ53101.1|  JHL20J20.8                                             392   1e-125   
ref|XP_009397996.1|  PREDICTED: GDSL esterase/lipase EXL3-like          381   2e-125   
ref|XP_007160640.1|  hypothetical protein PHAVU_001G004400g             381   2e-125   
ref|XP_010933356.1|  PREDICTED: GDSL esterase/lipase EXL3-like          380   2e-125   
ref|XP_010920106.1|  PREDICTED: GDSL esterase/lipase EXL3-like          382   2e-125   
ref|XP_010471731.1|  PREDICTED: GDSL esterase/lipase EXL1-like is...    380   5e-125   
gb|KHN35532.1|  GDSL esterase/lipase EXL3                               379   6e-125   
ref|XP_003603778.1|  GDSL esterase/lipase                               380   6e-125   
gb|EYU38777.1|  hypothetical protein MIMGU_mgv1a009038mg                379   9e-125   
ref|XP_009106246.1|  PREDICTED: GDSL esterase/lipase EXL2               379   1e-124   
ref|XP_003548834.1|  PREDICTED: GDSL esterase/lipase EXL3-like          379   2e-124   
gb|AES59784.2|  GDSL-like lipase/acylhydrolase                          380   2e-124   
ref|XP_006574669.1|  PREDICTED: GDSL esterase/lipase EXL3-like          378   3e-124   
ref|XP_007223323.1|  hypothetical protein PRUPE_ppa009528mg             375   3e-124   
gb|KFK42027.1|  hypothetical protein AALP_AA2G202600                    378   4e-124   
ref|XP_010934102.1|  PREDICTED: GDSL esterase/lipase EXL3-like          377   4e-124   
ref|XP_004287786.1|  PREDICTED: GDSL esterase/lipase EXL3-like          377   4e-124   
gb|KHN00457.1|  GDSL esterase/lipase EXL3                               377   5e-124   
ref|XP_010416497.1|  PREDICTED: GDSL esterase/lipase EXL1-like          378   6e-124   
gb|AAF79815.1|AC007396_8  T4O12.13                                      389   7e-124   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010428638.1|  PREDICTED: GDSL esterase/lipase EXL1-like          377   8e-124   
ref|XP_010026062.1|  PREDICTED: GDSL esterase/lipase At5g42170-like     376   9e-124   
ref|XP_007160642.1|  hypothetical protein PHAVU_001G004600g             377   1e-123   
emb|CDX87652.1|  BnaA07g32210D                                          376   1e-123   
ref|XP_004499292.1|  PREDICTED: GDSL esterase/lipase EXL1-like          375   6e-123   
ref|XP_004499298.1|  PREDICTED: GDSL esterase/lipase EXL1-like          375   6e-123   
ref|XP_003629270.1|  GDSL esterase/lipase                               374   6e-123   
ref|XP_010029654.1|  PREDICTED: GDSL esterase/lipase EXL3-like          374   1e-122   
ref|XP_010471732.1|  PREDICTED: GDSL esterase/lipase EXL1-like is...    374   1e-122   
ref|XP_007160641.1|  hypothetical protein PHAVU_001G004500g             374   2e-122   
ref|XP_003589529.1|  GDSL esterase/lipase                               373   3e-122   
ref|XP_003589533.1|  GDSL esterase/lipase                               378   3e-122   
ref|XP_004289076.1|  PREDICTED: LOW QUALITY PROTEIN: GDSL esteras...    371   1e-121   
gb|EYU38772.1|  hypothetical protein MIMGU_mgv1a008997mg                371   2e-121   
gb|KFK42028.1|  hypothetical protein AALP_AA2G202700                    371   2e-121   
ref|XP_010536419.1|  PREDICTED: GDSL esterase/lipase At1g20120-like     382   2e-121   
ref|XP_003527436.1|  PREDICTED: GDSL esterase/lipase EXL3-like          370   3e-121   
ref|XP_010680078.1|  PREDICTED: uncharacterized protein LOC104895310    384   3e-121   
ref|XP_007157889.1|  hypothetical protein PHAVU_002G106300g             370   4e-121   
ref|XP_006342070.1|  PREDICTED: GDSL esterase/lipase EXL3-like          369   4e-121   
gb|KCW58232.1|  hypothetical protein EUGRSUZ_H00934                     369   5e-121   
ref|XP_009123675.1|  PREDICTED: GDSL esterase/lipase At5g42170          370   6e-121   
ref|XP_007136104.1|  hypothetical protein PHAVU_009G018100g             370   6e-121   
gb|EYU17581.1|  hypothetical protein MIMGU_mgv1a008769mg                369   8e-121   
ref|XP_003544388.1|  PREDICTED: GDSL esterase/lipase EXL3-like is...    369   9e-121   
ref|XP_004499299.1|  PREDICTED: GDSL esterase/lipase EXL1-like          369   1e-120   
ref|XP_004512156.1|  PREDICTED: GDSL esterase/lipase EXL3-like          369   1e-120   
ref|NP_001241717.1|  uncharacterized protein LOC100856895 precursor     368   2e-120   
ref|XP_010428639.1|  PREDICTED: GDSL esterase/lipase EXL2-like          368   4e-120   
ref|XP_003550432.1|  PREDICTED: GDSL esterase/lipase EXL3-like          367   1e-119   
ref|XP_010416498.1|  PREDICTED: GDSL esterase/lipase EXL2               366   1e-119   
ref|XP_008651333.1|  PREDICTED: uncharacterized protein LOC100279...    368   1e-119   
ref|XP_003612217.1|  GDSL esterase/lipase                               366   1e-119   
ref|XP_008651330.1|  PREDICTED: uncharacterized protein LOC100279...    369   2e-119   
ref|NP_001146030.1|  uncharacterized protein LOC100279561               367   4e-119   Zea mays [maize]
ref|XP_008809448.1|  PREDICTED: uncharacterized protein LOC103721152    380   4e-119   
ref|NP_001242335.1|  uncharacterized protein LOC100810354               364   1e-118   
ref|XP_010935130.1|  PREDICTED: GDSL esterase/lipase EXL3-like          364   1e-118   
gb|KHN41128.1|  GDSL esterase/lipase EXL3                               364   1e-118   
ref|NP_199032.2|  GDSL esterase/lipase                                  364   1e-118   Arabidopsis thaliana [mouse-ear cress]
emb|CDX87653.1|  BnaA07g32200D                                          361   2e-118   
ref|XP_008806618.1|  PREDICTED: GDSL esterase/lipase EXL3-like          362   2e-118   
ref|XP_004509383.1|  PREDICTED: GDSL esterase/lipase EXL3-like          363   2e-118   
emb|CBI19911.3|  unnamed protein product                                360   3e-118   
ref|XP_010320539.1|  PREDICTED: GDSL esterase/lipase EXL3-like          371   3e-118   
emb|CDP07367.1|  unnamed protein product                                362   4e-118   
ref|XP_002463471.1|  hypothetical protein SORBIDRAFT_01g000430          363   5e-118   Sorghum bicolor [broomcorn]
ref|NP_001077829.1|  GDSL esterase/lipase EXL2                          361   1e-117   Arabidopsis thaliana [mouse-ear cress]
gb|ABK28470.1|  unknown                                                 361   1e-117   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004983037.1|  PREDICTED: GDSL esterase/lipase EXL3-like          361   2e-117   
ref|XP_003527440.1|  PREDICTED: GDSL esterase/lipase EXL3-like          360   2e-117   
gb|KHN41131.1|  GDSL esterase/lipase EXL3                               360   3e-117   
ref|XP_009106245.1|  PREDICTED: GDSL esterase/lipase EXL1 isoform X2    358   4e-117   
ref|XP_006301398.1|  hypothetical protein CARUB_v10021812mg             360   5e-117   
ref|XP_009385168.1|  PREDICTED: GDSL esterase/lipase EXL3-like          359   8e-117   
ref|XP_003571815.1|  PREDICTED: GDSL esterase/lipase EXL3-like          359   9e-117   
ref|XP_004957497.1|  PREDICTED: GDSL esterase/lipase EXL3-like          360   1e-116   
ref|XP_007132710.1|  hypothetical protein PHAVU_011G118200g             358   2e-116   
ref|XP_003527438.1|  PREDICTED: GDSL esterase/lipase EXL3-like          358   2e-116   
ref|XP_010935132.1|  PREDICTED: GDSL esterase/lipase EXL3-like          357   4e-116   
ref|XP_009398920.1|  PREDICTED: GDSL esterase/lipase EXL3-like          356   8e-116   
ref|XP_002462749.1|  hypothetical protein SORBIDRAFT_02g031310          356   8e-116   Sorghum bicolor [broomcorn]
gb|EYU17582.1|  hypothetical protein MIMGU_mgv1a008769mg                355   1e-115   
ref|XP_002887618.1|  T4O12.12                                           366   1e-115   
ref|NP_188100.2|  GDSL esterase/lipase                                  355   1e-115   Arabidopsis thaliana [mouse-ear cress]
gb|ACG32957.1|  anther-specific proline-rich protein APG precursor      355   1e-115   Zea mays [maize]
ref|XP_010266977.1|  PREDICTED: GDSL esterase/lipase At3g14820-like     365   1e-115   
gb|ACR34471.1|  unknown                                                 355   2e-115   Zea mays [maize]
emb|CDY12974.1|  BnaC02g29810D                                          361   3e-115   
ref|XP_010471733.1|  PREDICTED: GDSL esterase/lipase EXL1-like is...    355   3e-115   
ref|XP_007223325.1|  hypothetical protein PRUPE_ppa009531mg             352   3e-115   
ref|XP_006407041.1|  hypothetical protein EUTSA_v10021047mg             354   5e-115   
ref|XP_010266003.1|  PREDICTED: GDSL esterase/lipase EXL3-like is...    355   5e-115   
gb|KHN00461.1|  GDSL esterase/lipase EXL3                               354   6e-115   
gb|AFW66909.1|  anther-specific proline-rich protein APG                353   7e-115   
ref|NP_001150849.1|  anther-specific proline-rich protein APG pre...    354   8e-115   Zea mays [maize]
ref|NP_001150794.1|  anther-specific proline-rich protein APG pre...    353   9e-115   Zea mays [maize]
tpg|DAA64318.1|  TPA: anther-specific proline-rich protein APG          355   1e-114   
gb|EPS65517.1|  hypothetical protein M569_09255                         352   1e-114   
ref|XP_008651332.1|  PREDICTED: uncharacterized protein LOC100279...    356   2e-114   
ref|XP_010266838.1|  PREDICTED: GDSL esterase/lipase EXL3-like          353   2e-114   
ref|XP_006574671.1|  PREDICTED: GDSL esterase/lipase EXL3-like          353   2e-114   
ref|NP_565121.1|  GDSL esterase/lipase EXL2                             353   2e-114   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006485151.1|  PREDICTED: GDSL esterase/lipase EXL3-like          352   2e-114   
gb|KDO45611.1|  hypothetical protein CISIN_1g045030mg                   352   3e-114   
ref|XP_007156186.1|  hypothetical protein PHAVU_003G265600g             352   3e-114   
ref|NP_001064682.1|  Os10g0438600                                       352   5e-114   Oryza sativa Japonica Group [Japonica rice]
tpg|DAA49872.1|  TPA: anther-specific proline-rich protein APG          352   6e-114   
ref|XP_002464577.1|  hypothetical protein SORBIDRAFT_01g021130          352   8e-114   Sorghum bicolor [broomcorn]
ref|XP_004980964.1|  PREDICTED: GDSL esterase/lipase EXL3-like          350   2e-113   
gb|KHN39411.1|  GDSL esterase/lipase EXL3                               348   3e-113   
emb|CBI19912.3|  unnamed protein product                                346   7e-113   
ref|XP_010030870.1|  PREDICTED: GDSL esterase/lipase EXL3-like          347   1e-112   
ref|XP_010487287.1|  PREDICTED: GDSL esterase/lipase At3g14820 is...    348   1e-112   
ref|XP_010465393.1|  PREDICTED: GDSL esterase/lipase At3g14820-li...    348   1e-112   
dbj|BAK03291.1|  predicted protein                                      348   1e-112   
ref|XP_009397974.1|  PREDICTED: GDSL esterase/lipase At3g14820-like     347   2e-112   
gb|EAZ16202.1|  hypothetical protein OsJ_31652                          347   2e-112   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006392286.1|  hypothetical protein EUTSA_v10024141mg             347   3e-112   
ref|XP_003612218.1|  GDSL esterase/lipase                               347   3e-112   
ref|XP_006661793.1|  PREDICTED: GDSL esterase/lipase EXL3-like          347   3e-112   
gb|EMT27012.1|  GDSL esterase/lipase EXL3                               347   4e-112   
ref|XP_010511053.1|  PREDICTED: GDSL esterase/lipase At1g58725-like     346   5e-112   
ref|XP_006301957.1|  hypothetical protein CARUB_v10022436mg             346   5e-112   
ref|XP_006301689.1|  hypothetical protein CARUB_v10022144mg             345   2e-111   
gb|EMS55624.1|  GDSL esterase/lipase EXL3                               346   2e-111   
ref|XP_010470233.1|  PREDICTED: GDSL esterase/lipase At1g58725-like     345   2e-111   
ref|XP_010459694.1|  PREDICTED: GDSL esterase/lipase At1g20120-li...    346   3e-111   
ref|XP_006301261.1|  hypothetical protein CARUB_v10021661mg             344   3e-111   
ref|XP_010459696.1|  PREDICTED: GDSL esterase/lipase At1g20120-li...    345   4e-111   
ref|NP_001051965.1|  Os03g0859100                                       345   4e-111   
ref|XP_006299788.1|  hypothetical protein CARUB_v10015984mg             344   4e-111   
ref|XP_010459695.1|  PREDICTED: GDSL esterase/lipase At1g20120-li...    345   4e-111   
ref|XP_010419187.1|  PREDICTED: GDSL esterase/lipase At3g14820-like     343   6e-111   
emb|CDY32339.1|  BnaC01g36580D                                          343   6e-111   
ref|XP_003576900.1|  PREDICTED: GDSL esterase/lipase EXL3-like          344   1e-110   
ref|XP_009113303.1|  PREDICTED: GDSL esterase/lipase At1g58725-li...    343   1e-110   
ref|XP_010679880.1|  PREDICTED: GDSL esterase/lipase EXL3-like is...    343   1e-110   
ref|XP_009113300.1|  PREDICTED: GDSL esterase/lipase At1g58725-li...    342   1e-110   
ref|XP_010501533.1|  PREDICTED: GDSL esterase/lipase At1g20120          344   1e-110   
gb|EYU38776.1|  hypothetical protein MIMGU_mgv1a009257mg                342   2e-110   
ref|XP_009103357.1|  PREDICTED: GDSL esterase/lipase At1g20120          345   2e-110   
ref|XP_010414724.1|  PREDICTED: GDSL esterase/lipase At1g58725-li...    342   2e-110   
ref|XP_010470243.1|  PREDICTED: GDSL esterase/lipase At1g58725 is...    342   3e-110   
ref|XP_010477243.1|  PREDICTED: GDSL esterase/lipase At1g20120          343   3e-110   
gb|AAF79814.1|AC007396_7  T4O12.12                                      352   5e-110   
ref|XP_009110239.1|  PREDICTED: GDSL esterase/lipase At1g20120-like     343   6e-110   
dbj|BAB02648.1|  GDSL-motif lipase/hydrolase-like protein               339   7e-110   
emb|CDY20086.1|  BnaA01g29160D                                          340   2e-109   
ref|XP_006599317.1|  PREDICTED: GDSL esterase/lipase EXL3-like          339   3e-109   
ref|XP_009124095.1|  PREDICTED: GDSL esterase/lipase At3g14820          338   4e-109   
gb|KDO36514.1|  hypothetical protein CISIN_1g019467mg                   338   5e-109   
ref|XP_006416429.1|  hypothetical protein EUTSA_v10007849mg             340   7e-109   
ref|XP_002886683.1|  predicted protein                                  338   7e-109   
ref|XP_002882894.1|  GDSL-motif lipase/hydrolase family protein         337   8e-109   
ref|XP_010511065.1|  PREDICTED: GDSL esterase/lipase At1g58725          338   9e-109   
ref|XP_009109873.1|  PREDICTED: GDSL esterase/lipase At1g58725-like     338   1e-108   
ref|XP_003629269.1|  GDSL esterase/lipase                               338   2e-108   
ref|NP_564104.1|  GDSL esterase/lipase                                  339   2e-108   
ref|XP_006392281.1|  hypothetical protein EUTSA_v10023563mg             337   3e-108   
ref|XP_006416431.1|  hypothetical protein EUTSA_v10007776mg             338   3e-108   
ref|XP_002888210.1|  hypothetical protein ARALYDRAFT_475383             336   4e-108   
gb|AAM64323.1|  anter-specific proline-rich protein APG precursor...    338   4e-108   
ref|XP_003570760.2|  PREDICTED: GDSL esterase/lipase EXL3-like          339   6e-108   
ref|XP_006304433.1|  hypothetical protein CARUB_v10011033mg             337   9e-108   
ref|NP_001063808.1|  Os09g0540400                                       335   1e-107   
gb|AEM36355.1|  At1g59406                                               335   1e-107   
gb|EEC84967.1|  hypothetical protein OsI_32213                          335   3e-107   
ref|XP_006480518.1|  PREDICTED: GDSL esterase/lipase EXL3-like          333   3e-107   
ref|XP_009129206.1|  PREDICTED: GDSL esterase/lipase At1g58725 is...    334   3e-107   
gb|ABK26503.1|  unknown                                                 334   3e-107   
ref|XP_004951174.1|  PREDICTED: GDSL esterase/lipase EXL3-like          334   4e-107   
gb|EMS48896.1|  GDSL esterase/lipase EXL3                               334   5e-107   
gb|KDO45326.1|  hypothetical protein CISIN_1g046560mg                   332   6e-107   
ref|NP_564741.3|  GDSL esterase/lipase                                  333   6e-107   
ref|XP_003629267.1|  GDSL esterase/lipase                               335   7e-107   
ref|XP_004509384.1|  PREDICTED: GDSL esterase/lipase EXL3-like          333   8e-107   
ref|XP_006392463.1|  hypothetical protein EUTSA_v10023950mg             333   9e-107   
gb|EMS62537.1|  GDSL esterase/lipase EXL3                               333   1e-106   
gb|AET03745.2|  GDSL-like lipase/acylhydrolase                          333   2e-106   
ref|XP_010465394.1|  PREDICTED: GDSL esterase/lipase At3g14820-li...    330   4e-106   
ref|XP_006435225.1|  hypothetical protein CICLE_v10001578mg             329   9e-106   
ref|XP_010487288.1|  PREDICTED: GDSL esterase/lipase At3g14820 is...    328   2e-105   
ref|NP_001131302.1|  uncharacterized protein LOC100192615 precursor     329   5e-105   
ref|XP_009113399.1|  PREDICTED: LOW QUALITY PROTEIN: GDSL esteras...    328   5e-105   
ref|XP_007202420.1|  hypothetical protein PRUPE_ppa009721mg             325   5e-105   
ref|XP_004142995.1|  PREDICTED: GDSL esterase/lipase EXL3-like is...    327   7e-105   
ref|XP_009113304.1|  PREDICTED: GDSL esterase/lipase At1g58480-li...    327   7e-105   
ref|XP_009113301.1|  PREDICTED: GDSL esterase/lipase At1g58480-li...    327   9e-105   
ref|XP_006282175.1|  hypothetical protein CARUB_v10028437mg             327   1e-104   
ref|XP_010414725.1|  PREDICTED: GDSL esterase/lipase At1g58480-li...    327   1e-104   
ref|XP_002528958.1|  zinc finger protein, putative                      327   1e-104   
ref|XP_010470244.1|  PREDICTED: GDSL esterase/lipase At1g58480 is...    327   2e-104   
ref|XP_009113400.1|  PREDICTED: GDSL esterase/lipase At1g58725 is...    326   3e-104   
emb|CDY67439.1|  BnaCnng55000D                                          342   4e-104   
ref|XP_010266001.1|  PREDICTED: GDSL esterase/lipase EXL3-like          326   8e-104   
gb|EMT05955.1|  GDSL esterase/lipase EXL3                               325   1e-103   
ref|XP_006344847.1|  PREDICTED: GDSL esterase/lipase At5g42170-like     325   1e-103   
ref|XP_004965425.1|  PREDICTED: GDSL esterase/lipase EXL1-like          325   1e-103   
gb|AFW69692.1|  LOW QUALITY PROTEIN: anther-specific proline-rich...    329   1e-103   
gb|EMT30559.1|  GDSL esterase/lipase EXL3                               326   1e-103   
ref|XP_010414726.1|  PREDICTED: GDSL esterase/lipase At3g43570-li...    323   1e-103   
emb|CDY65553.1|  BnaAnng20620D                                          323   2e-103   
dbj|BAJ87048.1|  predicted protein                                      325   2e-103   
ref|XP_004288853.1|  PREDICTED: GDSL esterase/lipase At5g42170-like     323   2e-103   
ref|XP_010470245.1|  PREDICTED: GDSL esterase/lipase At3g43570 is...    323   2e-103   
gb|ACG31357.1|  anther-specific proline-rich protein APG precursor      325   2e-103   
emb|CDY48852.1|  BnaA09g14610D                                          323   2e-103   
ref|XP_010113314.1|  GDSL esterase/lipase EXL3                          328   3e-103   
ref|XP_006295451.1|  hypothetical protein CARUB_v10024554mg             323   3e-103   
ref|XP_002451338.1|  hypothetical protein SORBIDRAFT_04g000310          324   6e-103   
ref|XP_006416432.1|  hypothetical protein EUTSA_v10008023mg             323   6e-103   
gb|KDO84927.1|  hypothetical protein CISIN_1g017687mg                   322   7e-103   
ref|XP_009113302.1|  PREDICTED: GDSL esterase/lipase At3g43570-li...    322   8e-103   
ref|XP_006648199.1|  PREDICTED: GDSL esterase/lipase EXL3-like          323   8e-103   
ref|NP_001150585.1|  anther-specific proline-rich protein APG           323   1e-102   
ref|XP_009113305.1|  PREDICTED: GDSL esterase/lipase At3g43570-li...    321   1e-102   
dbj|BAJ87897.1|  predicted protein                                      323   2e-102   
gb|KDP30830.1|  hypothetical protein JCGZ_13773                         322   2e-102   
ref|XP_002459341.1|  hypothetical protein SORBIDRAFT_02g002860          323   2e-102   
gb|AGT15973.1|  anther-specific proline-rich protein APG precursor      323   3e-102   
ref|XP_006390255.1|  hypothetical protein EUTSA_v10019532mg             320   1e-101   
ref|XP_009129207.1|  PREDICTED: GDSL esterase/lipase At1g58480 is...    319   2e-101   
ref|XP_010477245.1|  PREDICTED: GDSL esterase/lipase At1g20120-like     320   2e-101   
ref|NP_564738.2|  GDSL esterase/lipase                                  317   2e-101   
ref|XP_010539110.1|  PREDICTED: GDSL esterase/lipase At1g20120-like     320   3e-101   
ref|XP_003562055.1|  PREDICTED: GDSL esterase/lipase EXL1-like          319   3e-101   
gb|ABK26273.1|  unknown                                                 319   3e-101   
ref|NP_001154437.1|  protein RXW8                                       317   8e-101   
ref|XP_011003480.1|  PREDICTED: GDSL esterase/lipase At2g42990-like     318   1e-100   
dbj|BAG68919.1|  carboxylic ester hydrolase                             315   3e-100   
ref|XP_006416428.1|  hypothetical protein EUTSA_v10007871mg             317   4e-100   
ref|NP_189943.1|  GDSL esterase/lipase                                  314   7e-100   
ref|XP_002301596.1|  GDSL-motif lipase/hydrolase family protein         315   9e-100   
emb|CDY51993.1|  BnaC03g75690D                                          313   2e-99    
ref|XP_010229809.1|  PREDICTED: GDSL esterase/lipase EXL3-like          315   2e-99    
ref|XP_004289077.1|  PREDICTED: GDSL esterase/lipase At1g20120-like     313   2e-99    
gb|KFK44140.1|  hypothetical protein AALP_AA1G220300                    315   3e-99    
gb|AGT15972.1|  anther-specific proline-rich protein                    320   4e-99    
ref|XP_008229820.1|  PREDICTED: GDSL esterase/lipase At2g42990-like     313   5e-99    
ref|XP_002437412.1|  hypothetical protein SORBIDRAFT_10g026470          313   6e-99    
ref|XP_007215622.1|  hypothetical protein PRUPE_ppa007953mg             312   7e-99    
ref|XP_003545614.1|  PREDICTED: GDSL esterase/lipase At2g42990-like     312   7e-99    
emb|CDY44206.1|  BnaC05g15630D                                          313   8e-99    
ref|XP_010657253.1|  PREDICTED: GDSL esterase/lipase At4g26790-like     312   1e-98    
ref|XP_004243509.1|  PREDICTED: GDSL esterase/lipase At2g04570-like     312   1e-98    
emb|CDY53577.1|  BnaC09g51560D                                          310   2e-98    
emb|CAN70740.1|  hypothetical protein VITISV_013920                     311   2e-98    
ref|XP_009113401.1|  PREDICTED: GDSL esterase/lipase At1g58480 is...    311   2e-98    
ref|NP_001117317.1|  GDSL-like Lipase/Acylhydrolase superfamily p...    312   2e-98    
ref|XP_006390256.1|  hypothetical protein EUTSA_v10018728mg             311   3e-98    
ref|XP_003616835.1|  GDSL esterase/lipase                               311   3e-98    
ref|XP_009149502.1|  PREDICTED: anther-specific proline-rich prot...    312   3e-98    
dbj|BAD07804.1|  putative family II extracellular lipase 3 (EXL3)       311   3e-98    
gb|KFK44138.1|  hypothetical protein AALP_AA1G220000                    308   4e-98    
gb|EAY84073.1|  hypothetical protein OsI_05454                          310   4e-98    
ref|XP_011100466.1|  PREDICTED: GDSL esterase/lipase At2g04570-like     310   6e-98    
ref|XP_004140129.1|  PREDICTED: GDSL esterase/lipase At2g42990-like     310   7e-98    
ref|XP_008229819.1|  PREDICTED: GDSL esterase/lipase At2g04570-like     310   8e-98    
ref|XP_004965426.1|  PREDICTED: GDSL esterase/lipase At1g58725-li...    310   1e-97    
emb|CDY41727.1|  BnaA09g15550D                                          308   1e-97    
ref|XP_010110233.1|  GDSL esterase/lipase                               310   1e-97    
gb|EMS63525.1|  GDSL esterase/lipase EXL3                               309   2e-97    
dbj|BAJ89897.1|  predicted protein                                      308   2e-97    
ref|XP_008380187.1|  PREDICTED: GDSL esterase/lipase At2g42990          308   3e-97    
ref|XP_008449490.1|  PREDICTED: GDSL esterase/lipase At2g42990-like     308   3e-97    
ref|XP_006428644.1|  hypothetical protein CICLE_v10013506mg             307   3e-97    
ref|XP_002509883.1|  zinc finger protein, putative                      307   4e-97    
ref|XP_010252997.1|  PREDICTED: GDSL esterase/lipase At4g26790          308   5e-97    
ref|XP_007211512.1|  hypothetical protein PRUPE_ppa008001mg             307   6e-97    
emb|CDY42062.1|  BnaC09g15250D                                          305   8e-97    
ref|XP_009365140.1|  PREDICTED: GDSL esterase/lipase At2g42990-li...    307   8e-97    
ref|XP_010498445.1|  PREDICTED: GDSL esterase/lipase At1g20120-like     308   1e-96    
ref|XP_006424351.1|  hypothetical protein CICLE_v10030240mg             305   2e-96    
ref|XP_004491082.1|  PREDICTED: GDSL esterase/lipase At4g26790-like     306   2e-96    
ref|XP_007160638.1|  hypothetical protein PHAVU_001G004200g             306   2e-96    
ref|XP_004143225.1|  PREDICTED: GDSL esterase/lipase At2g30310-like     306   2e-96    
ref|XP_004305967.1|  PREDICTED: GDSL esterase/lipase At2g42990-like     306   2e-96    
ref|XP_008379702.1|  PREDICTED: GDSL esterase/lipase At2g42990-li...    305   3e-96    
ref|XP_004240155.1|  PREDICTED: GDSL esterase/lipase At2g04570-like     305   4e-96    
ref|XP_008463828.1|  PREDICTED: GDSL esterase/lipase At2g30310-like     306   4e-96    
gb|KCW53195.1|  hypothetical protein EUGRSUZ_J02469                     303   4e-96    
ref|XP_010459698.1|  PREDICTED: GDSL esterase/lipase At1g20120-like     306   4e-96    
ref|XP_007215623.1|  hypothetical protein PRUPE_ppa007958mg             305   5e-96    
ref|XP_004305842.1|  PREDICTED: GDSL esterase/lipase At2g42990-like     305   5e-96    
ref|XP_004502157.1|  PREDICTED: GDSL esterase/lipase At2g04570-like     305   5e-96    
ref|XP_009356602.1|  PREDICTED: GDSL esterase/lipase At2g42990-like     305   5e-96    
ref|XP_006447673.1|  hypothetical protein CICLE_v10015770mg             305   6e-96    
ref|XP_007141675.1|  hypothetical protein PHAVU_008G215600g             305   6e-96    
dbj|BAK06014.1|  predicted protein                                      306   6e-96    
emb|CDY41728.1|  BnaA09g15560D                                          304   7e-96    
ref|XP_006656957.1|  PREDICTED: GDSL esterase/lipase EXL1-like          305   9e-96    
ref|XP_008357836.1|  PREDICTED: GDSL esterase/lipase At2g04570-like     304   9e-96    
gb|KDO59581.1|  hypothetical protein CISIN_1g018590mg                   304   1e-95    
ref|XP_004168797.1|  PREDICTED: GDSL esterase/lipase At2g30310-like     305   1e-95    
ref|NP_001239864.1|  uncharacterized protein LOC100809260 precursor     304   1e-95    
ref|XP_006357973.1|  PREDICTED: GDSL esterase/lipase At2g04570-like     303   2e-95    
ref|XP_006418560.1|  hypothetical protein EUTSA_v10002592mg             303   2e-95    
ref|XP_004151059.1|  PREDICTED: GDSL esterase/lipase At2g30310-like     303   3e-95    
ref|XP_007017007.1|  GDSL-like Lipase/Acylhydrolase family protei...    307   4e-95    
ref|XP_008226998.1|  PREDICTED: GDSL esterase/lipase At4g26790          302   5e-95    
gb|EPS67060.1|  hypothetical protein M569_07715                         302   6e-95    
ref|XP_002883649.1|  GDSL-motif lipase/hydrolase family protein         302   7e-95    
ref|XP_006342286.1|  PREDICTED: GDSL esterase/lipase At2g04570-like     302   7e-95    
ref|XP_003601542.1|  GDSL esterase/lipase                               302   7e-95    
ref|XP_007020707.1|  Zinc finger protein, putative                      302   8e-95    
ref|XP_006342261.1|  PREDICTED: GDSL esterase/lipase At2g04570-like     302   1e-94    
ref|XP_009334183.1|  PREDICTED: GDSL esterase/lipase At4g26790-like     301   1e-94    
gb|KEH30938.1|  GDSL-like lipase/acylhydrolase                          302   1e-94    
ref|XP_004140128.1|  PREDICTED: GDSL esterase/lipase At2g04570-like     301   2e-94    
ref|XP_009395858.1|  PREDICTED: GDSL esterase/lipase At2g42990-like     301   3e-94    
ref|XP_003549470.1|  PREDICTED: GDSL esterase/lipase At1g23500-like     301   3e-94    
ref|XP_008449488.1|  PREDICTED: GDSL esterase/lipase At2g04570          301   3e-94    
ref|XP_004240156.1|  PREDICTED: GDSL esterase/lipase At2g04570-like     300   3e-94    
ref|XP_004505116.1|  PREDICTED: GDSL esterase/lipase At5g45960-like     301   4e-94    
ref|XP_004243510.2|  PREDICTED: GDSL esterase/lipase At2g42990-like     300   4e-94    
emb|CAN76714.1|  hypothetical protein VITISV_018794                     300   4e-94    
gb|KHN12626.1|  GDSL esterase/lipase EXL3                               301   4e-94    
ref|XP_007215626.1|  hypothetical protein PRUPE_ppa007991mg             300   4e-94    
ref|XP_003616833.1|  GDSL esterase/lipase                               300   4e-94    
ref|XP_006447674.1|  hypothetical protein CICLE_v10015771mg             300   5e-94    
gb|KHG15434.1|  hypothetical protein F383_19515                         300   6e-94    
gb|KDO59582.1|  hypothetical protein CISIN_1g018664mg                   300   6e-94    
gb|EEE65668.1|  hypothetical protein OsJ_21277                          300   6e-94    
emb|CBI26692.3|  unnamed protein product                                299   7e-94    
emb|CDP05713.1|  unnamed protein product                                299   8e-94    
ref|XP_009365138.1|  PREDICTED: GDSL esterase/lipase At2g04570          299   1e-93    
ref|XP_010644495.1|  PREDICTED: GDSL esterase/lipase At4g26790          299   1e-93    
ref|XP_006488600.1|  PREDICTED: GDSL esterase/lipase At1g58430-like     299   1e-93    
gb|EMS61903.1|  GDSL esterase/lipase EXL3                               300   1e-93    
ref|XP_007049209.1|  GDSL-like Lipase/Acylhydrolase superfamily p...    301   2e-93    
emb|CBI28884.3|  unnamed protein product                                308   2e-93    
ref|NP_001057586.2|  Os06g0351700                                       299   2e-93    
ref|XP_003544387.2|  PREDICTED: GDSL esterase/lipase At1g23500-like     298   2e-93    
ref|XP_008229570.1|  PREDICTED: GDSL esterase/lipase At2g42990          298   3e-93    
ref|XP_010488704.1|  PREDICTED: GDSL esterase/lipase At2g04570          298   3e-93    
gb|KDO59580.1|  hypothetical protein CISIN_1g018590mg                   298   3e-93    
ref|XP_003551930.1|  PREDICTED: GDSL esterase/lipase At2g42990-li...    298   3e-93    
ref|XP_008379700.1|  PREDICTED: GDSL esterase/lipase At2g04570          297   4e-93    
ref|XP_010045391.1|  PREDICTED: GDSL esterase/lipase At2g30310 is...    298   5e-93    



>ref|XP_009768390.1| PREDICTED: GDSL esterase/lipase EXL3-like [Nicotiana sylvestris]
Length=362

 Score =   512 bits (1319),  Expect = 7e-177, Method: Compositional matrix adjust.
 Identities = 233/344 (68%), Positives = 283/344 (82%), Gaps = 0/344 (0%)
 Frame = -2

Query  1307  IAFLVLAGCSEAKIKLPNGLVVKAVIAFGDSIVDQGMNNNLSTMIKTNFPPYGQDFMGGK  1128
             + FL+     + K++LP  + V+AV AFGDSIVDQG NN+++T++K NF PYG+DFMGGK
Sbjct  18    VLFLLFVASCKGKVQLPENVTVRAVFAFGDSIVDQGNNNHIATVVKCNFEPYGKDFMGGK  77

Query  1127  HTGRYSNGKTPPDLVAEELGIKELVPAYLDPHLQPEDIKTGVSFASGASGYDPQTAALMS  948
              TGR+SN KTP DL+ +ELGIKEL+PAYLDP+LQ ED+KTGVSFASGA+G+DPQT AL+S
Sbjct  78    PTGRFSNAKTPSDLIVDELGIKELMPAYLDPNLQAEDLKTGVSFASGATGFDPQTPALVS  137

Query  947   VIPLSEQLKYFKEYLGKLNAMVGEKEAKSIINNTLFMVVSGSDDLANTYFTIGIRRYQYD  768
             VIPLS QL +F+EY+GKL  +VGE+EA  I+ N++F+VV+GSDDLANTYFT+GIRR QYD
Sbjct  138   VIPLSTQLDHFREYIGKLKQLVGEEEANDILRNSVFLVVAGSDDLANTYFTVGIRRLQYD  197

Query  767   INSYTDLLLEGASNFLQELYSLGARRIGFFGIPPVGCLPSQRTLAGGSERECVENYNQAA  588
             +N YTDL+  GAS F+QELY LGAR+I  FG+PP+GCLPSQRTL GG  REC E YNQAA
Sbjct  198   VNGYTDLMAAGASEFIQELYKLGARKIAIFGVPPIGCLPSQRTLGGGKSRECSEEYNQAA  257

Query  587   QLANAKFSAEIKILSKKLPNSKLIFIDIYEDFLDMIKNPAKYGFEVVNLGCCGTGTIEVT  408
             QLAN K SA I  LSK L  SKL+F+DIY   LD+I NP K+GFEVV+ GCCGTG IEV 
Sbjct  258   QLANTKLSAAIDSLSKNLLQSKLVFVDIYSSLLDLIVNPQKHGFEVVDRGCCGTGNIEVV  317

Query  407   MLCNKLSGTCPDRNKYLFWDSYHPTEKGYRIIVNRIITKYINSF  276
             +LCNK SGTC D  KYLFWDSYHPTEKGYRI+V++I+ KY+NSF
Sbjct  318   ILCNKYSGTCEDDTKYLFWDSYHPTEKGYRILVDQILKKYVNSF  361



>ref|XP_009614809.1| PREDICTED: GDSL esterase/lipase EXL3-like [Nicotiana tomentosiformis]
Length=362

 Score =   504 bits (1298),  Expect = 1e-173, Method: Compositional matrix adjust.
 Identities = 232/344 (67%), Positives = 280/344 (81%), Gaps = 0/344 (0%)
 Frame = -2

Query  1307  IAFLVLAGCSEAKIKLPNGLVVKAVIAFGDSIVDQGMNNNLSTMIKTNFPPYGQDFMGGK  1128
             + FL+     + K++LP  + VKAV AFGDSIVDQG NN+++T+ K NF PYG+DFMGGK
Sbjct  18    VLFLLFVASCKGKVQLPENVTVKAVFAFGDSIVDQGNNNHITTVAKCNFEPYGKDFMGGK  77

Query  1127  HTGRYSNGKTPPDLVAEELGIKELVPAYLDPHLQPEDIKTGVSFASGASGYDPQTAALMS  948
              TGR+SN KTP DL+ +ELGIKEL+PAYLDP+LQ ED+KTGVSFASGASG+DPQT AL+S
Sbjct  78    PTGRFSNAKTPSDLIVDELGIKELMPAYLDPNLQTEDLKTGVSFASGASGFDPQTPALVS  137

Query  947   VIPLSEQLKYFKEYLGKLNAMVGEKEAKSIINNTLFMVVSGSDDLANTYFTIGIRRYQYD  768
             VI LS QL +F+EY+GKL  +VGE+EA  I+ N++F+VV+GSDDLANTYFT+GIRR QYD
Sbjct  138   VISLSTQLDHFREYIGKLKQLVGEEEANDILRNSVFLVVAGSDDLANTYFTVGIRRLQYD  197

Query  767   INSYTDLLLEGASNFLQELYSLGARRIGFFGIPPVGCLPSQRTLAGGSERECVENYNQAA  588
             +N YTDL+  GAS F+QELY LGAR+I  FGIPP+GCLPSQRTL GG  REC E YNQAA
Sbjct  198   VNGYTDLMAAGASEFIQELYKLGARKIAVFGIPPIGCLPSQRTLGGGISRECSEEYNQAA  257

Query  587   QLANAKFSAEIKILSKKLPNSKLIFIDIYEDFLDMIKNPAKYGFEVVNLGCCGTGTIEVT  408
             QLAN K SA I  LSK    +KL+FIDIY   LD+I NP K+GFEVV+ GCCGTG IEV 
Sbjct  258   QLANTKLSAAIDSLSKNFLQTKLVFIDIYSSLLDLIVNPQKHGFEVVDRGCCGTGNIEVV  317

Query  407   MLCNKLSGTCPDRNKYLFWDSYHPTEKGYRIIVNRIITKYINSF  276
             +LCNK SGTC D  KYLFWDSYHPTEKGYRI+V++I+ KY+++F
Sbjct  318   ILCNKYSGTCEDDTKYLFWDSYHPTEKGYRILVDQILKKYVDNF  361



>ref|XP_010320438.1| PREDICTED: GDSL esterase/lipase EXL3 isoform X1 [Solanum lycopersicum]
Length=355

 Score =   490 bits (1261),  Expect = 3e-168, Method: Compositional matrix adjust.
 Identities = 232/345 (67%), Positives = 281/345 (81%), Gaps = 2/345 (1%)
 Frame = -2

Query  1307  IAFLVL-AGCSEAKIKLPNGLVVKAVIAFGDSIVDQGMNNNLSTMIKTNFPPYGQDFMGG  1131
             I+FL+L   C E K++LPN +VVKAV AFGDSIVDQG NN +ST++K NFPPYG+DF GG
Sbjct  11    ISFLLLFINCCEGKVQLPNNMVVKAVFAFGDSIVDQGSNNYVSTIVKCNFPPYGKDFNGG  70

Query  1130  KHTGRYSNGKTPPDLVAEELGIKELVPAYLDPHLQPEDIKTGVSFASGASGYDPQTAALM  951
               TGR+SNGKTPPDL+ EELGIK+ VPAYLDP+L+ ED+ TGVSFASG  GYDP TA ++
Sbjct  71    LPTGRFSNGKTPPDLIVEELGIKDFVPAYLDPNLKIEDLITGVSFASGGCGYDPLTATIV  130

Query  950   SVIPLSEQLKYFKEYLGKLNAMVGEKEAKSIINNTLFMVVSGSDDLANTYFTIGIRRYQY  771
             S IPLS QL  FKEYL KL  +VGE+EA  I+ N+LF+VV+GSDDLANTYFT G+R  + 
Sbjct  131   SAIPLSTQLNQFKEYLSKLEVLVGEEEANDILKNSLFLVVAGSDDLANTYFTAGVR-LKK  189

Query  770   DINSYTDLLLEGASNFLQELYSLGARRIGFFGIPPVGCLPSQRTLAGGSERECVENYNQA  591
             D+NSYTDL++  AS F+QELY+LGAR+IG FGIPP+GC+PSQRTLAGG  R C E YN+A
Sbjct  190   DVNSYTDLMVAKASEFVQELYNLGARKIGIFGIPPIGCVPSQRTLAGGPHRVCSEEYNEA  249

Query  590   AQLANAKFSAEIKILSKKLPNSKLIFIDIYEDFLDMIKNPAKYGFEVVNLGCCGTGTIEV  411
             AQLAN KFS +I  LS+KL  SKL+F++IY   LD+I NP KYGFE V+ GCCGTG IEV
Sbjct  250   AQLANTKFSTQIHSLSQKLAQSKLVFLEIYNPLLDLIVNPKKYGFEEVDKGCCGTGKIEV  309

Query  410   TMLCNKLSGTCPDRNKYLFWDSYHPTEKGYRIIVNRIITKYINSF  276
             T+LCNK SGTC D  KYLFWDSYHPTEKGY+I+V++++ KY+N F
Sbjct  310   TVLCNKFSGTCEDDTKYLFWDSYHPTEKGYKILVDQLLNKYVNQF  354



>ref|XP_011074698.1| PREDICTED: GDSL esterase/lipase EXL3-like [Sesamum indicum]
Length=356

 Score =   489 bits (1260),  Expect = 5e-168, Method: Compositional matrix adjust.
 Identities = 223/346 (64%), Positives = 283/346 (82%), Gaps = 1/346 (0%)
 Frame = -2

Query  1313  CIIAFLVLAGCSEAKIKLPNGLVVKAVIAFGDSIVDQGMNNNLSTMIKTNFPPYGQDFMG  1134
             C++A L ++ C +  IKLP G+ +  V A+GDSIVDQG NN + T++K NFPPYG+DF G
Sbjct  11    CVLALLCIS-CCDGAIKLPPGVTIPGVFAYGDSIVDQGNNNVVKTLLKCNFPPYGKDFQG  69

Query  1133  GKHTGRYSNGKTPPDLVAEELGIKELVPAYLDPHLQPEDIKTGVSFASGASGYDPQTAAL  954
             G  TGRYSNGKTPPDL+AEELGI   +PAYLDP+L+ +D+ TGVSFASG  GYDPQT+ +
Sbjct  70    GVPTGRYSNGKTPPDLIAEELGITNFIPAYLDPNLKAQDLPTGVSFASGGCGYDPQTSQI  129

Query  953   MSVIPLSEQLKYFKEYLGKLNAMVGEKEAKSIINNTLFMVVSGSDDLANTYFTIGIRRYQ  774
             +SVI LS+QLK+FKEY+GKL   VGE+ A +I++N+L +VV+GSDDLANTYFTIGIRR Q
Sbjct  130   VSVISLSDQLKHFKEYMGKLKGAVGEERANNIVSNSLHLVVAGSDDLANTYFTIGIRRAQ  189

Query  773   YDINSYTDLLLEGASNFLQELYSLGARRIGFFGIPPVGCLPSQRTLAGGSERECVENYNQ  594
             YDI+SY DL++  AS+F+QELY LGARRI  FGIPP+GCLP+QRTLAGGS R C E YNQ
Sbjct  190   YDISSYADLVVSSASSFIQELYQLGARRIAVFGIPPIGCLPAQRTLAGGSLRVCSEEYNQ  249

Query  593   AAQLANAKFSAEIKILSKKLPNSKLIFIDIYEDFLDMIKNPAKYGFEVVNLGCCGTGTIE  414
             AAQL NAK S+ ++ L++ LP S++++IDIY   LD+I++P  YGFEV + GCCGTG IE
Sbjct  250   AAQLVNAKLSSTLESLNQSLPQSRVVYIDIYNPLLDLIQHPQNYGFEVNDRGCCGTGNIE  309

Query  413   VTMLCNKLSGTCPDRNKYLFWDSYHPTEKGYRIIVNRIITKYINSF  276
             V +LCNK SGTCPD +KY+FWDSYHPTE+ Y+I+V++II KY+NSF
Sbjct  310   VVILCNKYSGTCPDDSKYIFWDSYHPTEQAYKILVHQIIQKYVNSF  355



>ref|XP_009594700.1| PREDICTED: GDSL esterase/lipase EXL3-like [Nicotiana tomentosiformis]
Length=361

 Score =   489 bits (1260),  Expect = 5e-168, Method: Compositional matrix adjust.
 Identities = 232/346 (67%), Positives = 285/346 (82%), Gaps = 3/346 (1%)
 Frame = -2

Query  1307  IAFLVLAGCSEAKIKLPNGLVVKAVIAFGDSIVDQGMNNNLSTMIKTNFPPYGQDFMGGK  1128
             +  L L  C E K +LP  L +KAV  FGDSIVDQG NNN++T++K NFPPYG+DF+ GK
Sbjct  18    VVLLWLCAC-EGKTQLPKNLNIKAVFVFGDSIVDQGNNNNITTLMKCNFPPYGKDFIDGK  76

Query  1127  HTGRYSNGKTPPDLVAEELGIKELVPAYLDPHLQPEDIKTGVSFASGASGYDPQTAALMS  948
              TGR++N KTP DL+ EELGIKEL+PAYLDP LQ +D+KTGVSFASGA GYDPQTAA+ S
Sbjct  77    PTGRFTNAKTPADLIVEELGIKELMPAYLDPKLQAKDLKTGVSFASGACGYDPQTAAIAS  136

Query  947   VIPLSEQLKYFKEYLGKLNAMVGEKEAKSIINNTLFMVVSGSDDLANTYFTIGIRRYQYD  768
             VIPLS QL +F+EY+GKL  +VGE+EA +I++++L+ VV+GS+DLANTYFTIG+R+ QYD
Sbjct  137   VIPLSTQLNHFQEYVGKLKGLVGEEEANTILHSSLYFVVAGSNDLANTYFTIGLRQKQYD  196

Query  767   INSYTDLLLEGASNFLQELYSLGARRIGFFGIPPVGCLPSQRTLAGGSERECVENYNQAA  588
             INSYTDL+++GA++F++ELY LGAR+IG FGIPPVGCLP QRT++GG  R CVE YN+AA
Sbjct  197   INSYTDLMVDGAADFIRELYKLGARKIGVFGIPPVGCLPFQRTMSGGIFRMCVEEYNEAA  256

Query  587   QLANAKFSAEIK-ILSKKLPNSKLIFIDIYEDFLDMIKNPAKYGFEVVNLGCCGTGTIEV  411
             QLAN K SA I   LS KLP SKL+FID+Y+  LD+I NP KYGFEVV  GCCGTG IEV
Sbjct  257   QLANTKLSAAINDSLSNKLPQSKLVFIDLYDPMLDLIVNPQKYGFEVVEKGCCGTGNIEV  316

Query  410   TMLCNKLSGTCPDRNKYLFWDSYHPTEKGYRIIVNRIITKYINSFT  273
              +LC K  GTC D  KYLFWDSYHPTE+GYRI+V++++ KYINSFT
Sbjct  317   LLLC-KYGGTCEDDTKYLFWDSYHPTERGYRILVDQMMKKYINSFT  361



>ref|XP_009617736.1| PREDICTED: GDSL esterase/lipase EXL3-like [Nicotiana tomentosiformis]
Length=351

 Score =   489 bits (1258),  Expect = 7e-168, Method: Compositional matrix adjust.
 Identities = 237/346 (68%), Positives = 276/346 (80%), Gaps = 3/346 (1%)
 Frame = -2

Query  1313  CIIAFLVLAGCSEAKIKLPNGLVVKAVIAFGDSIVDQGMNNNLSTMIKTNFPPYGQDFMG  1134
             C + F + + C E K++LPN +VVKAV AFGDSIVDQG NN+++T+ K NFPPYG+DF G
Sbjct  8     CFVLFSI-SSC-EGKVQLPNNVVVKAVFAFGDSIVDQGNNNDMTTLAKCNFPPYGKDFKG  65

Query  1133  GKHTGRYSNGKTPPDLVAEELGIKELVPAYLDPHLQPEDIKTGVSFASGASGYDPQTAAL  954
             G  TGR+ NGKTPPD++ EELGI ELVPAYLDP+L  ED+KTGVSFASG  G+DP T+ L
Sbjct  66    GIPTGRFCNGKTPPDILVEELGIAELVPAYLDPNLNTEDLKTGVSFASGGCGFDPLTSTL  125

Query  953   MSVIPLSEQLKYFKEYLGKLNAMVGEKEAKSIINNTLFMVVSGSDDLANTYFTIGIRRYQ  774
              + IPLS QL  FKEY+ KL  +VGE+E   I+ N+LFMVV+GSDDLANTYFT GIR  Q
Sbjct  126   ATAIPLSSQLTQFKEYIEKLKGLVGEEETNYILQNSLFMVVAGSDDLANTYFTGGIRLKQ  185

Query  773   YDINSYTDLLLEGASNFLQELYSLGARRIGFFGIPPVGCLPSQRTLAGGSERECVENYNQ  594
              DINSYT+L++  AS F+QELY LGAR+IGFFGIPP+GCLPSQRTLAGG  RECV+ YNQ
Sbjct  186   -DINSYTNLMMAKASEFVQELYKLGARKIGFFGIPPLGCLPSQRTLAGGFNRECVQEYNQ  244

Query  593   AAQLANAKFSAEIKILSKKLPNSKLIFIDIYEDFLDMIKNPAKYGFEVVNLGCCGTGTIE  414
             AAQLAN K SA I  LSK LP SKL+FIDIY   LD I NP KYGFE V  GCCGTG IE
Sbjct  245   AAQLANTKLSAAINSLSKNLPQSKLVFIDIYYPLLDFIVNPKKYGFEEVEKGCCGTGKIE  304

Query  413   VTMLCNKLSGTCPDRNKYLFWDSYHPTEKGYRIIVNRIITKYINSF  276
             VT+LCNK SGTC D  KYLFWDSYHPTEK YRI+V++I+ KYIN+F
Sbjct  305   VTLLCNKFSGTCEDNTKYLFWDSYHPTEKAYRILVDQILKKYINNF  350



>ref|XP_009779479.1| PREDICTED: GDSL esterase/lipase EXL3-like [Nicotiana sylvestris]
Length=371

 Score =   484 bits (1246),  Expect = 1e-165, Method: Compositional matrix adjust.
 Identities = 230/343 (67%), Positives = 279/343 (81%), Gaps = 2/343 (1%)
 Frame = -2

Query  1298  LVLAGCSEAKIKLPNGLVVKAVIAFGDSIVDQGMNNNLSTMIKTNFPPYGQDFMGGKHTG  1119
             L+  G  E K +LP  L +KAV+ FGDSIVDQG NNN++T+IK NFPPYG+DF+ GK TG
Sbjct  20    LLWLGACEGKTELPKNLNIKAVLVFGDSIVDQGNNNNITTLIKCNFPPYGKDFIDGKPTG  79

Query  1118  RYSNGKTPPDLVAEELGIKELVPAYLDPHLQPEDIKTGVSFASGASGYDPQTAALMSVIP  939
             R++N KTP DL+ EELGIKEL+PAYLDP LQ ED+KTGVSFASGA GYDPQTA + SVIP
Sbjct  80    RFTNAKTPADLIVEELGIKELMPAYLDPKLQAEDLKTGVSFASGACGYDPQTAVITSVIP  139

Query  938   LSEQLKYFKEYLGKLNAMVGEKEAKSIINNTLFMVVSGSDDLANTYFTIGIRRYQYDINS  759
             LS QL YF+EY+GKL  +VGEKE   I++N+L++VV+GS+DLANTYFT+G+R+ QYDINS
Sbjct  140   LSTQLNYFQEYVGKLKGLVGEKEGNDILHNSLYLVVAGSNDLANTYFTVGLRQKQYDINS  199

Query  758   YTDLLLEGASNFLQELYSLGARRIGFFGIPPVGCLPSQRTLAGGSERECVENYNQAAQLA  579
             YTDL+++GA++F+QELY LGAR+IG FGIPPVGCLP QRT++GG  R CVE YN+AA LA
Sbjct  200   YTDLMVDGAADFIQELYKLGARKIGVFGIPPVGCLPFQRTVSGGIFRMCVEEYNEAALLA  259

Query  578   NAKFSAEIK-ILSKKLPNSKLIFIDIYEDFLDMIKNPAKYGFEVVNLGCCGTGTIEVTML  402
             N K SA I   LSKKLP SKL+FID+Y+  LD+I NP KYGFEVV  GCCGTG IEV ML
Sbjct  260   NTKLSAAINDSLSKKLPQSKLVFIDLYDPMLDLIVNPQKYGFEVVEKGCCGTGNIEVLML  319

Query  401   CNKLSGTCPDRNKYLFWDSYHPTEKGYRIIVNRIITKYINSFT  273
             C K  GTC D  KYLFWDSYHPTE+GYRI+V++++ K  + F 
Sbjct  320   C-KYGGTCEDDTKYLFWDSYHPTERGYRILVDQMMKKGEDCFV  361



>ref|XP_009786860.1| PREDICTED: GDSL esterase/lipase EXL3-like isoform X1 [Nicotiana 
sylvestris]
Length=362

 Score =   483 bits (1244),  Expect = 1e-165, Method: Compositional matrix adjust.
 Identities = 235/342 (69%), Positives = 269/342 (79%), Gaps = 1/342 (0%)
 Frame = -2

Query  1298  LVLAGCSEAKIKLPNGLVVKAVIAFGDSIVDQGMNNNLSTMIKTNFPPYGQDFMGGKHTG  1119
              VL    EAK++LP  ++ KAV AFGDSIVDQG NN + T++K NF PYG+DFMGG  TG
Sbjct  22    FVLFSVCEAKVQLPQNVIFKAVFAFGDSIVDQGNNNYIKTLVKCNFQPYGKDFMGGMPTG  81

Query  1118  RYSNGKTPPDLVAEELGIKELVPAYLDPHLQPEDIKTGVSFASGASGYDPQTAALMSVIP  939
             R+SNGKTPPDL+A ELGIK+L+PAYLDP+L+ EDIK+GVSFASG  GYDP TA L++VIP
Sbjct  82    RFSNGKTPPDLIAVELGIKKLIPAYLDPNLKTEDIKSGVSFASGGCGYDPLTATLVAVIP  141

Query  938   LSEQLKYFKEYLGKLNAMVGEKEAKSIINNTLFMVVSGSDDLANTYFTIGIRRYQYDINS  759
             LS QL  F EY GKL  +VGE+EA  I+ N+LFMVV+G+DDLANTYFT GIR  Q DINS
Sbjct  142   LSRQLTQFIEYTGKLKVLVGEEEANYILKNSLFMVVAGTDDLANTYFTAGIRLKQ-DINS  200

Query  758   YTDLLLEGASNFLQELYSLGARRIGFFGIPPVGCLPSQRTLAGGSERECVENYNQAAQLA  579
             YTDL++  AS FL ELY LGAR+    GIPP+GCLPSQRTLAGG  R C + YNQAAQLA
Sbjct  201   YTDLMVAEASKFLNELYKLGARKFWILGIPPIGCLPSQRTLAGGHNRMCSQEYNQAAQLA  260

Query  578   NAKFSAEIKILSKKLPNSKLIFIDIYEDFLDMIKNPAKYGFEVVNLGCCGTGTIEVTMLC  399
             N KFS  I  LSKKLP SKL+FIDIY   LD+I NP KYGFE V  GCCGTGTIE   LC
Sbjct  261   NTKFSIAINSLSKKLPQSKLVFIDIYNPLLDLIFNPEKYGFEEVEKGCCGTGTIEGAKLC  320

Query  398   NKLSGTCPDRNKYLFWDSYHPTEKGYRIIVNRIITKYINSFT  273
             NK SGTC D  KYLFWDSYHPTEK Y+IIV++II KYIN+FT
Sbjct  321   NKFSGTCEDDTKYLFWDSYHPTEKAYKIIVDQIIKKYINNFT  362



>ref|XP_006342563.1| PREDICTED: GDSL esterase/lipase EXL3-like [Solanum tuberosum]
Length=360

 Score =   483 bits (1242),  Expect = 3e-165, Method: Compositional matrix adjust.
 Identities = 229/346 (66%), Positives = 283/346 (82%), Gaps = 3/346 (1%)
 Frame = -2

Query  1307  IAFLVLAGCSEAKIKLPNGLVVKAVIAFGDSIVDQGMNNNLSTMIKTNFPPYGQDFMGGK  1128
             + FL L  C      L     +KAV AFGDSIVDQG NNN++T++K NF PYG+DF+ GK
Sbjct  15    VMFLYLL-CEGKTQLLSKNSTIKAVFAFGDSIVDQGNNNNITTIVKCNFSPYGKDFVDGK  73

Query  1127  HTGRYSNGKTPPDLVAEELGIKELVPAYLDPHLQPEDIKTGVSFASGASGYDPQTAALMS  948
              TGR++N KTP DL+ EELGIKEL+PAY DP+LQ ED+KTGVSFASGASGYDPQTA+++S
Sbjct  74    ATGRFTNAKTPADLIVEELGIKELMPAYRDPNLQVEDLKTGVSFASGASGYDPQTASIVS  133

Query  947   VIPLSEQLKYFKEYLGKLNAMVGEKEAKSIINNTLFMVVSGSDDLANTYFTIGIRRYQYD  768
             VIPLS QL YF+EY+GKL  +VGEKEA  I+NN+L++VV+GS+DLANTY+TIG+R+ QYD
Sbjct  134   VIPLSTQLNYFEEYIGKLKGLVGEKEANKIVNNSLYLVVAGSNDLANTYYTIGLRQKQYD  193

Query  767   INSYTDLLLEGASNFLQELYSLGARRIGFFGIPPVGCLPSQRTLAGGSERECVENYNQAA  588
             I+SYTDL+++ A +F+QELY LGAR+IG FGIPP+GC+P QRTL+GG  R CVE +NQAA
Sbjct  194   IDSYTDLMVDKAEDFIQELYKLGARKIGVFGIPPIGCMPCQRTLSGGLGRLCVEEHNQAA  253

Query  587   QLANAKFSAEIK-ILSKKLPNSKLIFIDIYEDFLDMIKNPAKYGFEVVNLGCCGTGTIEV  411
             QLAN K S  +   LSKKLP SKL+FIDIY+  LD+I NP KYGFEVV+ GCCGTG IEV
Sbjct  254   QLANTKISLALNGSLSKKLPQSKLVFIDIYDPMLDLILNPQKYGFEVVDKGCCGTGNIEV  313

Query  410   TMLCNK-LSGTCPDRNKYLFWDSYHPTEKGYRIIVNRIITKYINSF  276
              +LCN+ +S TC D +KYLFWDSYHPTE+GYRI+V+++I KYIN F
Sbjct  314   VILCNRYMSSTCEDGSKYLFWDSYHPTERGYRILVDQMIKKYINRF  359



>ref|XP_009772833.1| PREDICTED: GDSL esterase/lipase EXL3 [Nicotiana sylvestris]
Length=348

 Score =   479 bits (1233),  Expect = 4e-164, Method: Compositional matrix adjust.
 Identities = 231/347 (67%), Positives = 273/347 (79%), Gaps = 3/347 (1%)
 Frame = -2

Query  1310  IIAFLVLAGCS--EAKIKLPNGLVVKAVIAFGDSIVDQGMNNNLSTMIKTNFPPYGQDFM  1137
             ++ F VL   S  E K++LP  +VVKAV AFGDSIVDQG NN++ T+ K NFPPYG+DF 
Sbjct  2     LVIFFVLFSISSCEGKVQLPKNVVVKAVFAFGDSIVDQGNNNDIITLAKCNFPPYGKDFN  61

Query  1136  GGKHTGRYSNGKTPPDLVAEELGIKELVPAYLDPHLQPEDIKTGVSFASGASGYDPQTAA  957
             GG  TGR+ NGKTPPD++ EELG+ ELVPAYLDP+L+ ED+KTGVSFASG  G+DP T  
Sbjct  62    GGIPTGRFCNGKTPPDILVEELGVAELVPAYLDPNLKTEDLKTGVSFASGGCGFDPLTTT  121

Query  956   LMSVIPLSEQLKYFKEYLGKLNAMVGEKEAKSIINNTLFMVVSGSDDLANTYFTIGIRRY  777
             L + IPLS QL  F+EY+ KL A+VGE+E   I+ N+LF+VV+GSDD+ANTYF+ GIR  
Sbjct  122   LATAIPLSTQLNQFEEYIEKLKALVGEEETNYILENSLFLVVAGSDDIANTYFSAGIRLK  181

Query  776   QYDINSYTDLLLEGASNFLQELYSLGARRIGFFGIPPVGCLPSQRTLAGGSERECVENYN  597
             Q DINSYT+ ++  AS FLQELY LGAR+IGFFGIPP+GCLPSQRTLAGG  R CV+ YN
Sbjct  182   Q-DINSYTNFMVAKASEFLQELYKLGARKIGFFGIPPLGCLPSQRTLAGGFNRVCVQEYN  240

Query  596   QAAQLANAKFSAEIKILSKKLPNSKLIFIDIYEDFLDMIKNPAKYGFEVVNLGCCGTGTI  417
             QAAQLAN K SA +  LSK LP SKL+FIDIY   LD+I NP KYG E V  GCCGTG I
Sbjct  241   QAAQLANTKLSAALNSLSKNLPQSKLVFIDIYNPILDLIVNPQKYGLEEVEKGCCGTGKI  300

Query  416   EVTMLCNKLSGTCPDRNKYLFWDSYHPTEKGYRIIVNRIITKYINSF  276
             EVT+LCNK SGTC D  KYLFWDSYHPTEK YRI+VN+I+ KYIN+F
Sbjct  301   EVTLLCNKFSGTCEDDTKYLFWDSYHPTEKAYRILVNQILKKYINNF  347



>ref|XP_009627260.1| PREDICTED: GDSL esterase/lipase EXL3-like [Nicotiana tomentosiformis]
Length=364

 Score =   478 bits (1229),  Expect = 3e-163, Method: Compositional matrix adjust.
 Identities = 230/344 (67%), Positives = 271/344 (79%), Gaps = 2/344 (1%)
 Frame = -2

Query  1307  IAFLVLAGCSEAKIKLPNGLVVKAVIAFGDSIVDQGMNNNLSTMIKTNFPPYGQDFMGGK  1128
             +   +++ C EA+++LPN +  KAV AFGDSIVDQG NNN++T+IK NF PYG+DFMGG 
Sbjct  22    VVLFIISAC-EARVQLPNNVFFKAVFAFGDSIVDQGNNNNITTLIKCNFQPYGKDFMGGM  80

Query  1127  HTGRYSNGKTPPDLVAEELGIKELVPAYLDPHLQPEDIKTGVSFASGASGYDPQTAALMS  948
              TGR+SNGKTP DL+AEELGIKE V AYLDP+L+ EDIKTGVSFASG  GYDPQTA + +
Sbjct  81    PTGRFSNGKTPADLIAEELGIKEFVSAYLDPNLKSEDIKTGVSFASGGCGYDPQTATIGA  140

Query  947   VIPLSEQLKYFKEYLGKLNAMVGEKEAKSIINNTLFMVVSGSDDLANTYFTIGIRRYQYD  768
              IPLS QL  FKEY+ KL  +VGE+EA  I+ N+LF+VV+GSDDLANTYFT G+R  Q D
Sbjct  141   AIPLSTQLTQFKEYIVKLKGLVGEEEANYILKNSLFLVVAGSDDLANTYFTYGVRLKQ-D  199

Query  767   INSYTDLLLEGASNFLQELYSLGARRIGFFGIPPVGCLPSQRTLAGGSERECVENYNQAA  588
             INSYTDL++  AS FL+ELY LGAR+   FGIPP+G LPSQRTLAGG  R CV+ YN+AA
Sbjct  200   INSYTDLMVAEASKFLKELYKLGARKCCIFGIPPIGYLPSQRTLAGGINRVCVQEYNEAA  259

Query  587   QLANAKFSAEIKILSKKLPNSKLIFIDIYEDFLDMIKNPAKYGFEVVNLGCCGTGTIEVT  408
             QLAN KFS     LSKKLP S+L+ +DIY   LD+I NP KYGFE V  GCCGTG IEVT
Sbjct  260   QLANTKFSITFDSLSKKLPQSRLVLVDIYNPLLDLILNPQKYGFEEVEKGCCGTGKIEVT  319

Query  407   MLCNKLSGTCPDRNKYLFWDSYHPTEKGYRIIVNRIITKYINSF  276
             +LCNK SGTC D  KY+FWDSYHPTEK YR IV++II K INSF
Sbjct  320   LLCNKFSGTCEDDTKYIFWDSYHPTEKAYRTIVDQIINKIINSF  363



>ref|XP_009627261.1| PREDICTED: GDSL esterase/lipase EXL3-like [Nicotiana tomentosiformis]
Length=362

 Score =   477 bits (1228),  Expect = 4e-163, Method: Compositional matrix adjust.
 Identities = 231/344 (67%), Positives = 273/344 (79%), Gaps = 2/344 (1%)
 Frame = -2

Query  1307  IAFLVLAGCSEAKIKLPNGLVVKAVIAFGDSIVDQGMNNNLSTMIKTNFPPYGQDFMGGK  1128
             + F++ + C EAK++LP  ++ KAV AFGDSIVDQG NNN++T+IK NF PYG+DF+GG 
Sbjct  20    VTFVLFSVC-EAKVQLPQNVIFKAVFAFGDSIVDQGNNNNITTLIKCNFQPYGKDFVGGM  78

Query  1127  HTGRYSNGKTPPDLVAEELGIKELVPAYLDPHLQPEDIKTGVSFASGASGYDPQTAALMS  948
              TGR+SNGKTPPDL+A+ELGIK+L+PAYLDP+L+ EDIKTGVSFASG  GYDP TA L++
Sbjct  79    PTGRFSNGKTPPDLIADELGIKKLIPAYLDPNLKTEDIKTGVSFASGGCGYDPLTATLVA  138

Query  947   VIPLSEQLKYFKEYLGKLNAMVGEKEAKSIINNTLFMVVSGSDDLANTYFTIGIRRYQYD  768
              I LS QL  FKEY+GKL  +VGE+EA  I+ N+LFMVV+G+DDLANTYFT GIR  Q D
Sbjct  139   AIHLSTQLTQFKEYIGKLKGLVGEEEANYILKNSLFMVVAGTDDLANTYFTAGIRLKQ-D  197

Query  767   INSYTDLLLEGASNFLQELYSLGARRIGFFGIPPVGCLPSQRTLAGGSERECVENYNQAA  588
             INSYTDL++  AS FL+ELY LGAR+    GIPP+GCLPSQRTLAGG  R C + YN+AA
Sbjct  198   INSYTDLMVAEASKFLKELYKLGARKFWILGIPPIGCLPSQRTLAGGIYRVCSQEYNEAA  257

Query  587   QLANAKFSAEIKILSKKLPNSKLIFIDIYEDFLDMIKNPAKYGFEVVNLGCCGTGTIEVT  408
             QLAN KFS  I   SK LP SKL+FIDIY   L +I NP KYGFE V  GCCGTGTIE  
Sbjct  258   QLANTKFSTAINSSSKNLPQSKLVFIDIYNPLLGLIFNPQKYGFEEVEKGCCGTGTIEGA  317

Query  407   MLCNKLSGTCPDRNKYLFWDSYHPTEKGYRIIVNRIITKYINSF  276
              LCNK SGTC D  KYLFWDSYHPTEK Y+IIV++I+ KYINSF
Sbjct  318   KLCNKFSGTCEDDTKYLFWDSYHPTEKAYKIIVDQILKKYINSF  361



>ref|XP_004252803.2| PREDICTED: GDSL esterase/lipase EXL3-like isoform X1 [Solanum 
lycopersicum]
Length=346

 Score =   474 bits (1220),  Expect = 4e-162, Method: Compositional matrix adjust.
 Identities = 227/346 (66%), Positives = 279/346 (81%), Gaps = 3/346 (1%)
 Frame = -2

Query  1307  IAFLVLAGCSEAKIKLPNGLVVKAVIAFGDSIVDQGMNNNLSTMIKTNFPPYGQDFMGGK  1128
             + FL L  C      L     +KAV AFGDSIVDQG NNN++T++K NFPPYG+DF+ GK
Sbjct  1     MMFLFLL-CEGKTQLLSKNSTIKAVFAFGDSIVDQGNNNNITTIVKCNFPPYGKDFVDGK  59

Query  1127  HTGRYSNGKTPPDLVAEELGIKELVPAYLDPHLQPEDIKTGVSFASGASGYDPQTAALMS  948
              TGR++N KTP DL+ EEL IKEL+PAY DP+LQ ED+KTGVSFASGA GYDPQTA+++S
Sbjct  60    ATGRFTNAKTPADLIVEELEIKELMPAYRDPNLQTEDLKTGVSFASGACGYDPQTASIVS  119

Query  947   VIPLSEQLKYFKEYLGKLNAMVGEKEAKSIINNTLFMVVSGSDDLANTYFTIGIRRYQYD  768
             VIPLS QL YF+EY+GKL  +VGEKEA  I+NN+L++VV+GS+DLANTY+TIG R+ QYD
Sbjct  120   VIPLSTQLNYFEEYIGKLKGLVGEKEANKILNNSLYLVVAGSNDLANTYYTIGFRQKQYD  179

Query  767   INSYTDLLLEGASNFLQELYSLGARRIGFFGIPPVGCLPSQRTLAGGSERECVENYNQAA  588
             I+SYTD +++ A +F+QELY LGAR+IG FGIPP+GCLP QRTL+GG  R CVE +NQAA
Sbjct  180   IDSYTDFMVDKAEHFIQELYKLGARKIGVFGIPPIGCLPFQRTLSGGLSRVCVEEHNQAA  239

Query  587   QLANAKFSAEIK-ILSKKLPNSKLIFIDIYEDFLDMIKNPAKYGFEVVNLGCCGTGTIEV  411
             QLAN K S  I   LS KLP SKL+FIDIY+  LD+I NP K+GFEVV+ GCCGTG IEV
Sbjct  240   QLANTKISLAINGSLSNKLPQSKLVFIDIYDPMLDLILNPKKHGFEVVDKGCCGTGNIEV  299

Query  410   TMLCNK-LSGTCPDRNKYLFWDSYHPTEKGYRIIVNRIITKYINSF  276
              +LCN+ +S TC D  KYLF+DSYHPTE+GYRI+V+++I KYINSF
Sbjct  300   VILCNRYMSSTCEDDTKYLFFDSYHPTERGYRILVDQMIKKYINSF  345



>ref|XP_006342238.1| PREDICTED: uncharacterized protein LOC102603803 [Solanum tuberosum]
Length=742

 Score =   487 bits (1254),  Expect = 1e-161, Method: Compositional matrix adjust.
 Identities = 235/346 (68%), Positives = 275/346 (79%), Gaps = 2/346 (1%)
 Frame = -2

Query  1313  CIIAFLVLAGCSEAKIKLPNGLVVKAVIAFGDSIVDQGMNNNLSTMIKTNFPPYGQDFMG  1134
             C +  L +  C E K++LPN +VVKAV AFGDSIVDQG NN + T+ K NFPPYG+DF G
Sbjct  398   CFVLMLTIRSC-EGKVQLPNNVVVKAVFAFGDSIVDQGNNNYIPTIAKCNFPPYGKDFNG  456

Query  1133  GKHTGRYSNGKTPPDLVAEELGIKELVPAYLDPHLQPEDIKTGVSFASGASGYDPQTAAL  954
             G  TGR+ NGKTPPDL+ EELGIKE VPAYLD +L+ ED+KTGVSFASG SGYDP+T+ L
Sbjct  457   GIPTGRFCNGKTPPDLIVEELGIKEYVPAYLDSNLRSEDLKTGVSFASGGSGYDPRTSTL  516

Query  953   MSVIPLSEQLKYFKEYLGKLNAMVGEKEAKSIINNTLFMVVSGSDDLANTYFTIGIRRYQ  774
              S IPLS QL  FKEY+GKL  +VGE+EA  I+ N+LF+VV GSDDLANTYFT+G+R  Q
Sbjct  517   ASAIPLSTQLNQFKEYIGKLEGLVGEEEANYILKNSLFLVVVGSDDLANTYFTLGVRLKQ  576

Query  773   YDINSYTDLLLEGASNFLQELYSLGARRIGFFGIPPVGCLPSQRTLAGGSERECVENYNQ  594
              DI+SYTDL++  A+ FLQELY+LGAR+IG FGIPP+GCLPSQRTLAGG  REC + YN+
Sbjct  577   -DIDSYTDLMVAKATEFLQELYNLGARKIGIFGIPPIGCLPSQRTLAGGPNRECAKEYNE  635

Query  593   AAQLANAKFSAEIKILSKKLPNSKLIFIDIYEDFLDMIKNPAKYGFEVVNLGCCGTGTIE  414
             AAQLAN KFS  I  LSKKL  SKL+ IDIY  F D+I NP KYG E V  GCCGTG IE
Sbjct  636   AAQLANTKFSIGIDSLSKKLAQSKLVLIDIYNPFPDIIVNPQKYGLEEVEKGCCGTGNIE  695

Query  413   VTMLCNKLSGTCPDRNKYLFWDSYHPTEKGYRIIVNRIITKYINSF  276
             VT+LCNK SGTC D  KYLFWDSYHPTEKGYRI+V++I+ KY+N F
Sbjct  696   VTILCNKFSGTCEDDTKYLFWDSYHPTEKGYRILVDQILKKYVNRF  741


 Score =   482 bits (1240),  Expect = 1e-159, Method: Compositional matrix adjust.
 Identities = 226/334 (68%), Positives = 273/334 (82%), Gaps = 1/334 (0%)
 Frame = -2

Query  1277  EAKIKLPNGLVVKAVIAFGDSIVDQGMNNNLSTMIKTNFPPYGQDFMGGKHTGRYSNGKT  1098
             E K++LP  +VVKAV AFGDSIVDQG NN ++T++K +FPPYG+DF GG  TGR+SNGKT
Sbjct  22    EGKVQLPKNVVVKAVFAFGDSIVDQGSNNYVATIVKCDFPPYGKDFNGGMPTGRFSNGKT  81

Query  1097  PPDLVAEELGIKELVPAYLDPHLQPEDIKTGVSFASGASGYDPQTAALMSVIPLSEQLKY  918
             PPDL+ EELGIK+ VPAYLDP+L+ ED+KTGVSFASG  GYDP TA ++S IPLS QL  
Sbjct  82    PPDLIVEELGIKDFVPAYLDPNLKIEDLKTGVSFASGGCGYDPLTATIVSAIPLSTQLNQ  141

Query  917   FKEYLGKLNAMVGEKEAKSIINNTLFMVVSGSDDLANTYFTIGIRRYQYDINSYTDLLLE  738
             FKEY+GKL  +VGE+EA  I  N+LF+VV+GSDDLANTYFT G+R  + D+NSYTDL++ 
Sbjct  142   FKEYIGKLEGLVGEEEANDIFKNSLFLVVAGSDDLANTYFTAGVR-LKKDVNSYTDLMVA  200

Query  737   GASNFLQELYSLGARRIGFFGIPPVGCLPSQRTLAGGSERECVENYNQAAQLANAKFSAE  558
              AS F+QELY+LGAR+IG FGIPP+GCLP+QRTLAGG  R C E YN+AAQ+AN KFS E
Sbjct  201   KASEFVQELYNLGARKIGIFGIPPIGCLPAQRTLAGGLHRVCSEEYNEAAQMANTKFSTE  260

Query  557   IKILSKKLPNSKLIFIDIYEDFLDMIKNPAKYGFEVVNLGCCGTGTIEVTMLCNKLSGTC  378
             I  LSKKL  SKL+F+DIY   LD+I NP KYGFE V+ GCCGTG IEVT+LCNK SGTC
Sbjct  261   IDSLSKKLAQSKLVFLDIYNPLLDLIVNPQKYGFEEVDKGCCGTGKIEVTVLCNKFSGTC  320

Query  377   PDRNKYLFWDSYHPTEKGYRIIVNRIITKYINSF  276
              D  KYLFWDSYHPTEKGY+I+V++++ K +N F
Sbjct  321   EDDTKYLFWDSYHPTEKGYKILVDQVLNKNVNKF  354



>ref|XP_009786862.1| PREDICTED: GDSL esterase/lipase EXL3-like [Nicotiana sylvestris]
Length=363

 Score =   471 bits (1213),  Expect = 8e-161, Method: Compositional matrix adjust.
 Identities = 227/343 (66%), Positives = 268/343 (78%), Gaps = 2/343 (1%)
 Frame = -2

Query  1307  IAFLVLAGCSEAKIKLPNGLVVKAVIAFGDSIVDQGMNNNLSTMIKTNFPPYGQDFMGGK  1128
             + F++ + C EA +KLP+ ++ KAV AFGDSIVDQG NN L T+IK NF PYG+DFMGG 
Sbjct  20    VNFVLFSVC-EANVKLPHNMIFKAVFAFGDSIVDQGNNNYLKTLIKCNFQPYGKDFMGGM  78

Query  1127  HTGRYSNGKTPPDLVAEELGIKELVPAYLDPHLQPEDIKTGVSFASGASGYDPQTAALMS  948
              TGR+SNGKTP DL+AEELGIKEL+PAY DP+L+ EDIKTGVSFASG  GYDPQTA +++
Sbjct  79    PTGRFSNGKTPADLIAEELGIKELMPAYSDPNLKSEDIKTGVSFASGGCGYDPQTATIVA  138

Query  947   VIPLSEQLKYFKEYLGKLNAMVGEKEAKSIINNTLFMVVSGSDDLANTYFTIGIRRYQYD  768
              IPLS QL  FKEY+ KL  +VGE+EA  I+ N+LFMVV+G+DDLANTYFT GI   Q D
Sbjct  139   AIPLSTQLTQFKEYIVKLKGLVGEEEANYILKNSLFMVVAGTDDLANTYFTAGIHLKQ-D  197

Query  767   INSYTDLLLEGASNFLQELYSLGARRIGFFGIPPVGCLPSQRTLAGGSERECVENYNQAA  588
             INSYTDL++  AS FL+ELY LGAR+   FGIPP+GCLPSQRTLAGG  REC++ YN  A
Sbjct  198   INSYTDLMVAEASKFLKELYKLGARKYWIFGIPPIGCLPSQRTLAGGLSRECIKKYNDGA  257

Query  587   QLANAKFSAEIKILSKKLPNSKLIFIDIYEDFLDMIKNPAKYGFEVVNLGCCGTGTIEVT  408
             QLAN KFS     LSKKLP S+L+ +DIY   LD+I  P KYGFE    GCCGTG IEV 
Sbjct  258   QLANTKFSIAFDSLSKKLPQSRLVLVDIYNPLLDLILKPQKYGFEEAAKGCCGTGNIEVA  317

Query  407   MLCNKLSGTCPDRNKYLFWDSYHPTEKGYRIIVNRIITKYINS  279
             +LCNK SGTC D  KY+FWDSYHPTEK Y  IV+++ITKYINS
Sbjct  318   LLCNKFSGTCEDDTKYIFWDSYHPTEKVYTTIVDQLITKYINS  360



>emb|CDP07368.1| unnamed protein product [Coffea canephora]
Length=372

 Score =   471 bits (1211),  Expect = 2e-160, Method: Compositional matrix adjust.
 Identities = 207/346 (60%), Positives = 273/346 (79%), Gaps = 0/346 (0%)
 Frame = -2

Query  1313  CIIAFLVLAGCSEAKIKLPNGLVVKAVIAFGDSIVDQGMNNNLSTMIKTNFPPYGQDFMG  1134
             C +  L+ +   EA++KLP    V A+ AFGDSIVDQG NNNLST++K NF PYG+DF G
Sbjct  26    CCLFLLMFSDTGEARVKLPKNATVTAIFAFGDSIVDQGNNNNLSTLVKCNFHPYGKDFAG  85

Query  1133  GKHTGRYSNGKTPPDLVAEELGIKELVPAYLDPHLQPEDIKTGVSFASGASGYDPQTAAL  954
             G  TGR+ N KTPPD++AEELG+K++VPAYLDPHLQP D++TGVSFASG SGYDPQT  L
Sbjct  86    GVPTGRFCNAKTPPDIIAEELGVKDIVPAYLDPHLQPNDLQTGVSFASGGSGYDPQTPQL  145

Query  953   MSVIPLSEQLKYFKEYLGKLNAMVGEKEAKSIINNTLFMVVSGSDDLANTYFTIGIRRYQ  774
             +SVI L +QL+YFKEY+GKL  +VG ++A  I+ N +F++V+GSDD+ANTYFT GIR+ Q
Sbjct  146   VSVISLQQQLEYFKEYIGKLKGLVGGEKASYILANAMFLIVAGSDDIANTYFTFGIRKAQ  205

Query  773   YDINSYTDLLLEGASNFLQELYSLGARRIGFFGIPPVGCLPSQRTLAGGSERECVENYNQ  594
             YD+NSY DL++  AS+F+Q+L+ LGA +I  F +PP+GC+PSQRTLAGGS R C  + NQ
Sbjct  206   YDVNSYADLVVSSASSFIQDLHKLGASKIAVFSVPPIGCVPSQRTLAGGSLRVCASSQNQ  265

Query  593   AAQLANAKFSAEIKILSKKLPNSKLIFIDIYEDFLDMIKNPAKYGFEVVNLGCCGTGTIE  414
             AAQL N K SAEI  LS+  P  K++++++++  LD+I+NP  YGFEVV+ GCCGTG +E
Sbjct  266   AAQLVNGKLSAEISSLSRNYPQGKIVYVEVFQPLLDIIQNPRNYGFEVVDYGCCGTGQVE  325

Query  413   VTMLCNKLSGTCPDRNKYLFWDSYHPTEKGYRIIVNRIITKYINSF  276
             V +LCN+ + TC D +KYLFWDSYHPTE+GYR++V +I+  Y+N F
Sbjct  326   VAILCNEYTKTCEDDSKYLFWDSYHPTEQGYRMLVKQILKNYLNDF  371



>ref|XP_006342239.1| PREDICTED: GDSL esterase/lipase EXL3-like [Solanum tuberosum]
Length=377

 Score =   461 bits (1186),  Expect = 2e-156, Method: Compositional matrix adjust.
 Identities = 219/325 (67%), Positives = 262/325 (81%), Gaps = 1/325 (0%)
 Frame = -2

Query  1250  LVVKAVIAFGDSIVDQGMNNNLSTMIKTNFPPYGQDFMGGKHTGRYSNGKTPPDLVAEEL  1071
             +VVKA+ AFGDSIVDQG NN +STM K+NF PYG+DF GG  TGR+SNGKTPPDL+ EEL
Sbjct  53    IVVKAIFAFGDSIVDQGNNNYISTMAKSNFLPYGKDFNGGIPTGRFSNGKTPPDLLVEEL  112

Query  1070  GIKELVPAYLDPHLQPEDIKTGVSFASGASGYDPQTAALMSVIPLSEQLKYFKEYLGKLN  891
              IKE++PAYLD +L+  D KTGVSFASG  G+DP T+ + S + LS QL  F+EY+GKL 
Sbjct  113   RIKEILPAYLDSNLKSGDFKTGVSFASGGCGFDPLTSIITSALSLSTQLNQFREYIGKLE  172

Query  890   AMVGEKEAKSIINNTLFMVVSGSDDLANTYFTIGIRRYQYDINSYTDLLLEGASNFLQEL  711
              +VGE+EA  I+ N+LF+VV+GSDDLANTYFT+G  R ++DINSYTDL++  A+ FLQEL
Sbjct  173   RLVGEEEATYILKNSLFLVVAGSDDLANTYFTLG-GRLKHDINSYTDLMVAKATEFLQEL  231

Query  710   YSLGARRIGFFGIPPVGCLPSQRTLAGGSERECVENYNQAAQLANAKFSAEIKILSKKLP  531
             Y+LGAR+IG FGIPP+GCLPSQRTLAGG  R C E YN+AAQ+AN KFS EI  LSKKL 
Sbjct  232   YNLGARKIGIFGIPPIGCLPSQRTLAGGLHRVCSEEYNEAAQMANTKFSTEIDSLSKKLV  291

Query  530   NSKLIFIDIYEDFLDMIKNPAKYGFEVVNLGCCGTGTIEVTMLCNKLSGTCPDRNKYLFW  351
              SKL+FIDIY  FLD+I NP KYGFE V  GCCGTGTIE  +LCN+ SG C D  KYLFW
Sbjct  292   QSKLVFIDIYNTFLDLIVNPKKYGFEEVEKGCCGTGTIEAIILCNEFSGICEDDTKYLFW  351

Query  350   DSYHPTEKGYRIIVNRIITKYINSF  276
             DSYHPTEKGY+I+V+ I+ KYIN+F
Sbjct  352   DSYHPTEKGYKILVDEILKKYINNF  376



>ref|XP_009776282.1| PREDICTED: GDSL esterase/lipase EXL3-like [Nicotiana sylvestris]
Length=376

 Score =   451 bits (1161),  Expect = 9e-153, Method: Compositional matrix adjust.
 Identities = 218/350 (62%), Positives = 267/350 (76%), Gaps = 4/350 (1%)
 Frame = -2

Query  1310  IIAFLVLAGCSEAKIKLPNGLVVKAVIAFGDSIVDQGMNNN-LSTMIKTNFPPYGQDFMG  1134
             +   L+ + C EAK+KLP  +VVKAV AFGDSIVDQG NNN L+T +K NFPPYG+DFMG
Sbjct  27    VFVMLISSSCCEAKVKLPPNVVVKAVYAFGDSIVDQGNNNNILTTPVKCNFPPYGKDFMG  86

Query  1133  GKHTGRYSNGKTPPDLVAEELGIKELVPAYLDPHLQPEDIKTGVSFASGASGYDPQTAAL  954
             G  TGR+SN KTPPD++A+ELG+KEL+PAY DP+L+ ED+KTGVSFASG SGYDP+T+ +
Sbjct  87    GIPTGRFSNAKTPPDMIAKELGLKELIPAYPDPNLKDEDLKTGVSFASGGSGYDPRTSTI  146

Query  953   MSVIPLSEQLKYFKEYLGKLNAMVGEKEAKSIINNTLFMVVSGSDDLAN---TYFTIGIR  783
              S IPLS QL +F EY+GKL  +VGE+E   I+NN+LF++V+GS D+A    +Y+   IR
Sbjct  147   NSAIPLSAQLNHFLEYIGKLKELVGEEEGNYILNNSLFILVAGSVDIAGLTGSYYEDVIR  206

Query  782   RYQYDINSYTDLLLEGASNFLQELYSLGARRIGFFGIPPVGCLPSQRTLAGGSERECVEN  603
             +  YDI+SYT+LL   A +F+QELY LGAR I F G+PP+GCLP+QRTLAGG  R C E 
Sbjct  207   QKLYDIDSYTNLLAAYAFDFVQELYKLGARNIAFLGVPPLGCLPAQRTLAGGPARMCAEE  266

Query  602   YNQAAQLANAKFSAEIKILSKKLPNSKLIFIDIYEDFLDMIKNPAKYGFEVVNLGCCGTG  423
             YNQA++LAN KFS  I  L KK P  KL+FID Y   LD I NP KYG E V  GCCG+G
Sbjct  267   YNQASELANTKFSIAIDSLHKKFPQYKLVFIDAYNSLLDCIVNPQKYGLEEVQKGCCGSG  326

Query  422   TIEVTMLCNKLSGTCPDRNKYLFWDSYHPTEKGYRIIVNRIITKYINSFT  273
              IEV++LCNK SG C D  KYLFWDSYH TEKGYRI+V+RII  Y NSF+
Sbjct  327   NIEVSILCNKFSGICEDDTKYLFWDSYHLTEKGYRILVDRIIKNYTNSFS  376



>ref|XP_009622933.1| PREDICTED: GDSL esterase/lipase EXL3-like [Nicotiana tomentosiformis]
Length=366

 Score =   449 bits (1156),  Expect = 3e-152, Method: Compositional matrix adjust.
 Identities = 217/350 (62%), Positives = 266/350 (76%), Gaps = 4/350 (1%)
 Frame = -2

Query  1310  IIAFLVLAGCSEAKIKLPNGLVVKAVIAFGDSIVDQGMNNNL-STMIKTNFPPYGQDFMG  1134
             +   L+ +   EAK+KLP  LVVKAV AFGDSIVDQG NNN+ +T +K NFPPYG+DFMG
Sbjct  17    VFVMLISSSTCEAKVKLPPNLVVKAVYAFGDSIVDQGNNNNIVTTPVKCNFPPYGKDFMG  76

Query  1133  GKHTGRYSNGKTPPDLVAEELGIKELVPAYLDPHLQPEDIKTGVSFASGASGYDPQTAAL  954
             G  TGR+SN KTPPD++A+ELG+ EL+PAYLDP L+ ED+KTGVSFASG SGYDP+T+ +
Sbjct  77    GMPTGRFSNAKTPPDMIAKELGLNELIPAYLDPELKVEDLKTGVSFASGGSGYDPRTSTI  136

Query  953   MSVIPLSEQLKYFKEYLGKLNAMVGEKEAKSIINNTLFMVVSGSDDLAN---TYFTIGIR  783
              S IPLS QL +F EY+GKL  +VGE+E   I+NN+LF+VV+GS D+A    +Y+   IR
Sbjct  137   NSAIPLSAQLNHFLEYIGKLKELVGEEEGNYILNNSLFIVVAGSVDIAGLTGSYYEDVIR  196

Query  782   RYQYDINSYTDLLLEGASNFLQELYSLGARRIGFFGIPPVGCLPSQRTLAGGSERECVEN  603
             +  YD++SYT+LL   A +F+QELY LGAR I F G+PP+GC+P+QRTLAGG  R C E 
Sbjct  197   QKLYDMDSYTNLLAAYAFDFVQELYKLGARNIAFLGVPPLGCVPAQRTLAGGPARMCAEE  256

Query  602   YNQAAQLANAKFSAEIKILSKKLPNSKLIFIDIYEDFLDMIKNPAKYGFEVVNLGCCGTG  423
             YNQAA+LAN KFS  I  L KK P  KL+FID Y   LD I NP KYG E V  GCCG+G
Sbjct  257   YNQAAELANTKFSLAIDSLHKKFPQYKLVFIDAYNSLLDCIVNPQKYGLEEVQKGCCGSG  316

Query  422   TIEVTMLCNKLSGTCPDRNKYLFWDSYHPTEKGYRIIVNRIITKYINSFT  273
              IEV++LCNK SGTC D  KYLFWDSYH TEKGYRI+V++II  Y NSF+
Sbjct  317   NIEVSILCNKFSGTCEDDTKYLFWDSYHLTEKGYRILVDQIIKNYTNSFS  366



>ref|XP_010692505.1| PREDICTED: GDSL esterase/lipase EXL3-like [Beta vulgaris subsp. 
vulgaris]
Length=367

 Score =   440 bits (1132),  Expect = 2e-148, Method: Compositional matrix adjust.
 Identities = 199/331 (60%), Positives = 258/331 (78%), Gaps = 0/331 (0%)
 Frame = -2

Query  1274  AKIKLPNGLVVKAVIAFGDSIVDQGMNNNLSTMIKTNFPPYGQDFMGGKHTGRYSNGKTP  1095
             A +KLP  + V A++ FGDSI+D G NNN+ T+IK NFPPYGQDFMGG  TGR+SNG+ P
Sbjct  34    ATLKLPPNVTVPAILGFGDSIIDPGNNNNIKTIIKCNFPPYGQDFMGGISTGRFSNGRIP  93

Query  1094  PDLVAEELGIKELVPAYLDPHLQPEDIKTGVSFASGASGYDPQTAALMSVIPLSEQLKYF  915
              D +AEE  IKE +PAYLD +L P+D+ TGVSFASGA+G+DP T+ + SVI LSEQL+YF
Sbjct  94    TDFLAEEFSIKEYLPAYLDTNLSPQDLLTGVSFASGAAGFDPLTSQVASVISLSEQLEYF  153

Query  914   KEYLGKLNAMVGEKEAKSIINNTLFMVVSGSDDLANTYFTIGIRRYQYDINSYTDLLLEG  735
             KEY  K+  +VGE++   I+ N+++ +V+GSDD+ANTYF    RR  YD+ SYTDL++E 
Sbjct  154   KEYTEKVKQLVGEEKTNFILTNSIYFIVAGSDDIANTYFGTPFRRLHYDVESYTDLMVES  213

Query  734   ASNFLQELYSLGARRIGFFGIPPVGCLPSQRTLAGGSERECVENYNQAAQLANAKFSAEI  555
             AS+F+QELY LGARR+G F  PP+GC+PSQRT+ GG  REC E+YNQAAQL N+K S E+
Sbjct  214   ASSFVQELYKLGARRMGLFSAPPIGCVPSQRTIGGGIVRECAEHYNQAAQLYNSKLSIEL  273

Query  554   KILSKKLPNSKLIFIDIYEDFLDMIKNPAKYGFEVVNLGCCGTGTIEVTMLCNKLSGTCP  375
               L+ KLP++K+++IDIY   LD+I+NP KYG E V  GCCGTG +EV++LCNKL   CP
Sbjct  274   DSLAHKLPHTKVVYIDIYSPLLDLIQNPDKYGLEEVVKGCCGTGLLEVSVLCNKLDSVCP  333

Query  374   DRNKYLFWDSYHPTEKGYRIIVNRIITKYIN  282
             D +KYLFWDSYHPTE+GY+++ + II KY N
Sbjct  334   DDSKYLFWDSYHPTERGYQLLFDAIIKKYGN  364



>ref|XP_002279353.2| PREDICTED: GDSL esterase/lipase EXL3 [Vitis vinifera]
 emb|CBI19909.3| unnamed protein product [Vitis vinifera]
Length=358

 Score =   434 bits (1115),  Expect = 4e-146, Method: Compositional matrix adjust.
 Identities = 206/345 (60%), Positives = 263/345 (76%), Gaps = 3/345 (1%)
 Frame = -2

Query  1307  IAFLVLAGCSEAKIKLPNGLVVKAVIAFGDSIVDQGMNNNLSTMIKTNFPPYGQDFMGGK  1128
             ++  ++   +EA IKLP+   V A++ FGDSIVD G NN+L T  K NFPPYG+DF+GG 
Sbjct  15    VSVFIILCSTEALIKLPDNETVPALLVFGDSIVDPGNNNDLVTFAKGNFPPYGRDFIGGI  74

Query  1127  HTGRYSNGKTPPDLVAEELGIKELVPAYLDPHLQPEDIKTGVSFASGASGYDPQTAALMS  948
              TGR+SNGK P D +AEELGIKE+VPAYLDP LQP DI TGVSFASGASGYDP T+ + +
Sbjct  75    PTGRFSNGKIPADFIAEELGIKEIVPAYLDPTLQPSDILTGVSFASGASGYDPLTSKIPA  134

Query  947   VIPLSEQLKYFKEYLGKLNAMVGEKEAKSIINNTLFMVVSGSDDLANTYFTIGIRRYQYD  768
             V  LS+QL+ FKEY GKL AMVGE+   +I++ +LF+VV  S+D+A+TYFT  +RR QYD
Sbjct  135   VYSLSDQLEMFKEYTGKLKAMVGEERTNTILSKSLFLVVQSSNDIASTYFT--VRRVQYD  192

Query  767   INSYTDLLLEGASNFLQELYSLGARRIGFFGIPPVGCLPSQRTLAGGSERECVENYNQAA  588
              +SY DLL+  AS+F +ELY LGARRI  FG PP+GCLPSQ+++AGG ERECVENYN+A 
Sbjct  193   FSSYADLLVTWASSFFKELYGLGARRIAVFGAPPLGCLPSQKSIAGGIERECVENYNEAC  252

Query  587   QLANAKFSAEIKILSKKLPNSKLIFIDIYEDFLDMIKNPAKYGFEVVNLGCCGTGTIEVT  408
             +L N K S+ +  L+   P +K ++IDIY   LD+I+NP K GFEV N GCCGTG IEV 
Sbjct  253   KLFNTKLSSGLDSLNTNFPLAKFVYIDIYNPLLDIIQNPQKSGFEVANKGCCGTGLIEVA  312

Query  407   MLCNKLSG-TCPDRNKYLFWDSYHPTEKGYRIIVNRIITKYINSF  276
             +LCN+L+  TC D  KY+FWDSYHPTE+ Y+I++ RII +Y+ SF
Sbjct  313   LLCNRLNPFTCNDVTKYVFWDSYHPTERVYKILIGRIIQEYVGSF  357



>gb|KHN45938.1| GDSL esterase/lipase EXL3 [Glycine soja]
Length=364

 Score =   434 bits (1115),  Expect = 6e-146, Method: Compositional matrix adjust.
 Identities = 200/344 (58%), Positives = 261/344 (76%), Gaps = 0/344 (0%)
 Frame = -2

Query  1307  IAFLVLAGCSEAKIKLPNGLVVKAVIAFGDSIVDQGMNNNLSTMIKTNFPPYGQDFMGGK  1128
             I  LVL+  ++A +KLP  + + AVIAFGDSIVD G NN + T++K +FPPYG+DF GG 
Sbjct  20    ILSLVLSFRAKAVVKLPPNITIPAVIAFGDSIVDPGNNNKVKTLVKCDFPPYGKDFEGGI  79

Query  1127  HTGRYSNGKTPPDLVAEELGIKELVPAYLDPHLQPEDIKTGVSFASGASGYDPQTAALMS  948
              TGR+ NGK P DL+ EELGIKEL+PAYLDP+L+P D+ TGV FASGASGYDP T  + S
Sbjct  80    PTGRFCNGKIPSDLLVEELGIKELLPAYLDPNLKPSDLVTGVCFASGASGYDPLTPKIAS  139

Query  947   VIPLSEQLKYFKEYLGKLNAMVGEKEAKSIINNTLFMVVSGSDDLANTYFTIGIRRYQYD  768
             VI +SEQL  FKEY+GKL  +VGE   K I+ N+ F+VV+GSDD+ANTYF   +R+ QYD
Sbjct  140   VISMSEQLDMFKEYIGKLKHIVGEDRTKFILANSFFLVVAGSDDIANTYFIARVRQLQYD  199

Query  767   INSYTDLLLEGASNFLQELYSLGARRIGFFGIPPVGCLPSQRTLAGGSERECVENYNQAA  588
             I +YTDL+L  ASNF++ELY LGARRIG    PP+GC+PSQRTLAGG +REC E YN AA
Sbjct  200   IPAYTDLMLHSASNFVKELYGLGARRIGVLSAPPIGCVPSQRTLAGGFQRECAEEYNYAA  259

Query  587   QLANAKFSAEIKILSKKLPNSKLIFIDIYEDFLDMIKNPAKYGFEVVNLGCCGTGTIEVT  408
             +L N+K S E+  L   LPNS++++ID+Y   +D+I N  ++G++VV+ GCCGTG +EV 
Sbjct  260   KLFNSKLSRELDALKHNLPNSRIVYIDVYNPLMDIIVNYQRHGYKVVDRGCCGTGKLEVA  319

Query  407   MLCNKLSGTCPDRNKYLFWDSYHPTEKGYRIIVNRIITKYINSF  276
             +LCN L  TCPD ++Y+FWDSYHPTE  YR ++ +++ KY+  F
Sbjct  320   VLCNPLGATCPDASQYVFWDSYHPTEGVYRQLIVQVLQKYLTRF  363



>ref|XP_010314650.1| PREDICTED: GDSL esterase/lipase EXL3-like isoform X2 [Solanum 
lycopersicum]
Length=325

 Score =   432 bits (1110),  Expect = 8e-146, Method: Compositional matrix adjust.
 Identities = 212/346 (61%), Positives = 262/346 (76%), Gaps = 24/346 (7%)
 Frame = -2

Query  1307  IAFLVLAGCSEAKIKLPNGLVVKAVIAFGDSIVDQGMNNNLSTMIKTNFPPYGQDFMGGK  1128
             + FL L  C      L     +KAV AFGDSIVDQG NNN++T++K NFPPYG+DF+ GK
Sbjct  1     MMFLFLL-CEGKTQLLSKNSTIKAVFAFGDSIVDQGNNNNITTIVKCNFPPYGKDFVDGK  59

Query  1127  HTGRYSNGKTPPDLVAEELGIKELVPAYLDPHLQPEDIKTGVSFASGASGYDPQTAALMS  948
              TGR++N KTP DL+                     D+KTGVSFASGA GYDPQTA+++S
Sbjct  60    ATGRFTNAKTPADLI---------------------DLKTGVSFASGACGYDPQTASIVS  98

Query  947   VIPLSEQLKYFKEYLGKLNAMVGEKEAKSIINNTLFMVVSGSDDLANTYFTIGIRRYQYD  768
             VIPLS QL YF+EY+GKL  +VGEKEA  I+NN+L++VV+GS+DLANTY+TIG R+ QYD
Sbjct  99    VIPLSTQLNYFEEYIGKLKGLVGEKEANKILNNSLYLVVAGSNDLANTYYTIGFRQKQYD  158

Query  767   INSYTDLLLEGASNFLQELYSLGARRIGFFGIPPVGCLPSQRTLAGGSERECVENYNQAA  588
             I+SYTD +++ A +F+QELY LGAR+IG FGIPP+GCLP QRTL+GG  R CVE +NQAA
Sbjct  159   IDSYTDFMVDKAEHFIQELYKLGARKIGVFGIPPIGCLPFQRTLSGGLSRVCVEEHNQAA  218

Query  587   QLANAKFSAEIK-ILSKKLPNSKLIFIDIYEDFLDMIKNPAKYGFEVVNLGCCGTGTIEV  411
             QLAN K S  I   LS KLP SKL+FIDIY+  LD+I NP K+GFEVV+ GCCGTG IEV
Sbjct  219   QLANTKISLAINGSLSNKLPQSKLVFIDIYDPMLDLILNPKKHGFEVVDKGCCGTGNIEV  278

Query  410   TMLCNK-LSGTCPDRNKYLFWDSYHPTEKGYRIIVNRIITKYINSF  276
              +LCN+ +S TC D  KYLF+DSYHPTE+GYRI+V+++I KYINSF
Sbjct  279   VILCNRYMSSTCEDDTKYLFFDSYHPTERGYRILVDQMIKKYINSF  324



>ref|XP_010061080.1| PREDICTED: GDSL esterase/lipase EXL3-like [Eucalyptus grandis]
 gb|KCW67977.1| hypothetical protein EUGRSUZ_F01671 [Eucalyptus grandis]
Length=364

 Score =   432 bits (1111),  Expect = 2e-145, Method: Compositional matrix adjust.
 Identities = 200/336 (60%), Positives = 258/336 (77%), Gaps = 1/336 (0%)
 Frame = -2

Query  1280  SEAKIKLPNGLVVKAVIAFGDSIVDQGMNNNLSTMIKTNFPPYGQDFMGGKHTGRYSNGK  1101
             + A +KLP  + V A+I FGDSIVD G NN+LST++K NFPPYG+DF GG  TGR+ +GK
Sbjct  28    ARAAVKLPPNVTVPAIIVFGDSIVDAGNNNDLSTLVKCNFPPYGEDFKGGIPTGRFCDGK  87

Query  1100  TPPDLVAEELGIKELVPAYLDPHLQPEDIKTGVSFASGASGYDPQTAALMSVIPLSEQLK  921
              P D++AE+LGIK+ VPAYLDP+LQ +D+ TGV+FASG +GYDP T  L+SVI +SEQL 
Sbjct  88    VPSDIMAEQLGIKDTVPAYLDPNLQDQDLVTGVTFASGGTGYDPLTPTLVSVISMSEQLD  147

Query  920   YFKEYLGKLNAMVGEKEAKSIINNTLFMVVSGSDDLANTYFTIGIRRYQYDINSYTDLLL  741
              FK+Y+GKL   VGE++A  I+ N++++VVSGSDD+AN YFT  +R+ QY++  YTDL++
Sbjct  148   LFKKYIGKLKGFVGEEKANFILANSMYLVVSGSDDIANNYFTARVRQLQYNVPEYTDLMV  207

Query  740   EGASNFLQELYSLGARRIGFFGIPPVGCLPSQRTLAGGSERECVENYNQAAQLANAKFSA  561
             + ASNFLQ LY LGARRI  FG PP+GC+PSQRTLAGG  R C E YN AAQL N K S+
Sbjct  208   DAASNFLQGLYDLGARRIAVFGSPPIGCVPSQRTLAGGPLRGCAEQYNAAAQLFNTKLSS  267

Query  560   EIKILSKKLPNSKLIFIDIYEDFLDMIKNPAKYGFEVVNLGCCGTGTIEVTMLCNKLS-G  384
              +  L++KLP SK+++ID+Y   LD+I+ P K GF V + GCCGTGTIEVT+LCNK S  
Sbjct  268   NLDSLNRKLPRSKMVYIDVYNPLLDLIQYPQKQGFVVSDKGCCGTGTIEVTLLCNKFSPD  327

Query  383   TCPDRNKYLFWDSYHPTEKGYRIIVNRIITKYINSF  276
             TC D + Y+FWDSYHPTEK YR ++  ++ KYIN F
Sbjct  328   TCTDVSDYVFWDSYHPTEKAYRALLTPLVNKYINRF  363



>ref|XP_009605226.1| PREDICTED: GDSL esterase/lipase EXL3-like isoform X1 [Nicotiana 
tomentosiformis]
Length=355

 Score =   432 bits (1110),  Expect = 2e-145, Method: Compositional matrix adjust.
 Identities = 205/340 (60%), Positives = 265/340 (78%), Gaps = 3/340 (1%)
 Frame = -2

Query  1307  IAFLVLAGCSEAKIKLPNGLVVKAVIAFGDSIVDQGMNNNLSTMIKTNFPPYGQDFMGGK  1128
             + FL+ + C EAK++LP  +V+KAV AFGDSIVDQG NNNL+T  K NF PYG+DFMGGK
Sbjct  18    VVFLLFSAC-EAKLQLPQDVVIKAVFAFGDSIVDQGNNNNLTTRAKCNFLPYGKDFMGGK  76

Query  1127  HTGRYSNGKTPPDLVAEELGIKELVPAYLDPHLQPEDIKTGVSFASGASGYDPQTAALMS  948
              TGR+SN KTPPD++ E+LGIKEL+PAY DP+L+ ED+K+GVSFASGASGYD  TA   +
Sbjct  77    PTGRFSNAKTPPDMIVEDLGIKELMPAYFDPNLEVEDLKSGVSFASGASGYDLLTAITAT  136

Query  947   VIPLSEQLKYFKEYLGKLNAMVGEKEAKSIINNTLFMVVSGSDDLANTYFTIGI-RRYQY  771
              IPLS QL  F++Y  KL  ++GE+EA SI+ N+LF++V+GSDDL NTYFT+   R++QY
Sbjct  137   AIPLSAQLLLFQQYKLKLEGLIGEEEANSIVKNSLFVIVTGSDDLVNTYFTLKFPRKWQY  196

Query  770   DINSYTDLLLEGASNFLQELYSLGARRIGFFGIPPVGCLPSQRTLAGGSERECVENYNQA  591
             DI+SYT+L++ GASNF+Q+LY+LGARRI  FGIPP+GCLPSQR   GG  R CVE YNQA
Sbjct  197   DIDSYTNLMVNGASNFVQDLYNLGARRIWVFGIPPIGCLPSQRQKNGGLARVCVEEYNQA  256

Query  590   AQLANAKFSAEIKILSKKLPNSKLIFIDIYEDFLDMIKNPAKYGFEVVNLGCCGTGTIEV  411
             AQ+AN K +A+I  LS+ LP S+L++I++Y+  LD+I NP KYGFE V   CC  G  + 
Sbjct  257   AQMANTKLAAKIDSLSEILPQSELVYINVYDPLLDLIVNPDKYGFEEVKRCCCRPGNNKF  316

Query  410   TMLCNKLSGTCPDRNKYLFWDSYHPTEKGYRIIVNRIITK  291
              +LC+  +GTC D  KYLFWD YH TEKGYR+++++I  K
Sbjct  317   -LLCDNHTGTCEDDTKYLFWDGYHLTEKGYRVLLDQIFKK  355



>gb|ACU24478.1| unknown [Glycine max]
Length=364

 Score =   431 bits (1108),  Expect = 5e-145, Method: Compositional matrix adjust.
 Identities = 199/344 (58%), Positives = 260/344 (76%), Gaps = 0/344 (0%)
 Frame = -2

Query  1307  IAFLVLAGCSEAKIKLPNGLVVKAVIAFGDSIVDQGMNNNLSTMIKTNFPPYGQDFMGGK  1128
             I  LVL+  ++A +KLP  + + AVIAFGDSIVD G NN + T++K +FPPY +DF GG 
Sbjct  20    ILSLVLSFRAKAVVKLPPNITIPAVIAFGDSIVDPGNNNKVKTLVKCDFPPYDKDFEGGI  79

Query  1127  HTGRYSNGKTPPDLVAEELGIKELVPAYLDPHLQPEDIKTGVSFASGASGYDPQTAALMS  948
              TGR+ NGK P DL+ EELGIKEL+PAYLDP+L+P D+ TGV FASGASGYDP T  + S
Sbjct  80    PTGRFCNGKIPSDLLVEELGIKELLPAYLDPNLKPSDLVTGVCFASGASGYDPLTPKIAS  139

Query  947   VIPLSEQLKYFKEYLGKLNAMVGEKEAKSIINNTLFMVVSGSDDLANTYFTIGIRRYQYD  768
             VI +SEQL  FKEY+GKL  +VGE   K I+ N+ F+VV+GSDD+ANTYF   +R+ QYD
Sbjct  140   VISMSEQLDMFKEYIGKLKHIVGEDRTKFILANSFFLVVAGSDDIANTYFIARVRQLQYD  199

Query  767   INSYTDLLLEGASNFLQELYSLGARRIGFFGIPPVGCLPSQRTLAGGSERECVENYNQAA  588
             I +YTDL+L  ASNF++ELY LGARRIG    PP+GC+PSQRTLAGG +REC E YN AA
Sbjct  200   IPAYTDLMLHSASNFVKELYGLGARRIGVLSAPPIGCVPSQRTLAGGFQRECAEEYNYAA  259

Query  587   QLANAKFSAEIKILSKKLPNSKLIFIDIYEDFLDMIKNPAKYGFEVVNLGCCGTGTIEVT  408
             +L N+K S E+  L   LPNS++++ID+Y   +D+I N  ++G++VV+ GCCGTG +EV 
Sbjct  260   KLFNSKLSRELDALKHNLPNSRIVYIDVYNPLMDIIVNYQRHGYKVVDRGCCGTGKLEVA  319

Query  407   MLCNKLSGTCPDRNKYLFWDSYHPTEKGYRIIVNRIITKYINSF  276
             +LCN L  TCPD ++Y+FWDSYHPTE  YR ++ +++ KY+  F
Sbjct  320   VLCNPLGATCPDASQYVFWDSYHPTEGVYRQLIVQVLQKYLTRF  363



>gb|KHN09073.1| GDSL esterase/lipase EXL3 [Glycine soja]
Length=349

 Score =   431 bits (1107),  Expect = 5e-145, Method: Compositional matrix adjust.
 Identities = 200/344 (58%), Positives = 260/344 (76%), Gaps = 0/344 (0%)
 Frame = -2

Query  1307  IAFLVLAGCSEAKIKLPNGLVVKAVIAFGDSIVDQGMNNNLSTMIKTNFPPYGQDFMGGK  1128
             I  LVL+  ++A +KLP  +   AVIAFGDSIVD G NN + T++K +FPPYG+DF GG 
Sbjct  5     ILLLVLSFRTKAVVKLPPNITFPAVIAFGDSIVDPGNNNKVKTLVKCDFPPYGKDFEGGI  64

Query  1127  HTGRYSNGKTPPDLVAEELGIKELVPAYLDPHLQPEDIKTGVSFASGASGYDPQTAALMS  948
              TGR+ NGK P DL+AEELGIKEL+PAYLDP+L+P D+ TGV FASGASGYDP T  + S
Sbjct  65    PTGRFCNGKIPSDLLAEELGIKELLPAYLDPNLKPSDLVTGVCFASGASGYDPLTPKIAS  124

Query  947   VIPLSEQLKYFKEYLGKLNAMVGEKEAKSIINNTLFMVVSGSDDLANTYFTIGIRRYQYD  768
             VI +SEQL  FKEY+GKL  +VGE   K I+ N+ F+VV+GSDD+ANTYF   +R+ QYD
Sbjct  125   VISMSEQLDMFKEYIGKLKHIVGEDRTKFILANSFFLVVAGSDDIANTYFIARVRQLQYD  184

Query  767   INSYTDLLLEGASNFLQELYSLGARRIGFFGIPPVGCLPSQRTLAGGSERECVENYNQAA  588
             I +YTDL+L  ASNF++ELY LGARRIG    PP+GC+PSQRTLAGG +R+C E YN AA
Sbjct  185   IPAYTDLMLHSASNFVKELYGLGARRIGVLSAPPIGCVPSQRTLAGGLQRDCAEEYNYAA  244

Query  587   QLANAKFSAEIKILSKKLPNSKLIFIDIYEDFLDMIKNPAKYGFEVVNLGCCGTGTIEVT  408
             +L N+K S E+  L   L NS++++ID+Y   +D+I N  +YG++VV+ GCCGTG +EV 
Sbjct  245   KLFNSKLSRELDSLKHNLRNSRIVYIDVYNPLMDIIVNYQRYGYKVVDRGCCGTGKLEVA  304

Query  407   MLCNKLSGTCPDRNKYLFWDSYHPTEKGYRIIVNRIITKYINSF  276
             +LCN L  TCPD ++Y+FWDSYHPTE  YR ++ +++ KY+  F
Sbjct  305   VLCNPLGATCPDASQYVFWDSYHPTEGVYRQLIVQVLQKYLTRF  348



>gb|KDO84924.1| hypothetical protein CISIN_1g042648mg [Citrus sinensis]
Length=356

 Score =   431 bits (1107),  Expect = 7e-145, Method: Compositional matrix adjust.
 Identities = 196/346 (57%), Positives = 262/346 (76%), Gaps = 1/346 (0%)
 Frame = -2

Query  1310  IIAFLVLAGCSEAKIKLPNGLVVKAVIAFGDSIVDQGMNNNLSTMIKTNFPPYGQDFMGG  1131
             ++   +L  C +A +KLP    + A+IAFGDSIVD G NN+L T+ K +FPPYG+DF GG
Sbjct  10    VVGSCLLFSCIQALVKLPENETIPALIAFGDSIVDTGNNNDLRTISKCDFPPYGKDFQGG  69

Query  1130  KHTGRYSNGKTPPDLVAEELGIKELVPAYLDPHLQPEDIKTGVSFASGASGYDPQTAALM  951
               TGR+SNGK P D++AEELGIKEL+PAY+   L   D+ TGV FASG SGYDP T+ L+
Sbjct  70    VATGRFSNGKVPADIIAEELGIKELLPAYVGQALSSRDLVTGVCFASGGSGYDPMTSKLV  129

Query  950   SVIPLSEQLKYFKEYLGKLNAMVGEKEAKSIINNTLFMVVSGSDDLANTYFTIGIRRYQY  771
             SV+ LS+Q++YFK+Y+ KL  +VGE +   I+   LF+VV+GSDD+ANTYFT+  R+ QY
Sbjct  130   SVLSLSDQIEYFKDYIMKLKLLVGENKTNFILAKGLFLVVAGSDDIANTYFTLRARKLQY  189

Query  770   DINSYTDLLLEGASNFLQELYSLGARRIGFFGIPPVGCLPSQRTLAGGSERECVENYNQA  591
             DI +YTDL+   AS+FL ELY LGARR+  FG PP+GCLP+QRTLAGG+ REC EN+NQA
Sbjct  190   DIPAYTDLMANSASDFLNELYELGARRVAVFGAPPIGCLPAQRTLAGGNARECAENFNQA  249

Query  590   AQLANAKFSAEIKILSKKLPNSKLIFIDIYEDFLDMIKNPAKYGFEVVNLGCCGTGTIEV  411
             +QL N K SA++  +   LP S+++FID+Y  FLD+I+NP K+GFEVVN GCCGTG +EV
Sbjct  250   SQLFNKKLSAKLDSIKNSLPGSRMVFIDVYNPFLDLIQNPKKHGFEVVNEGCCGTGNLEV  309

Query  410   TMLCNKL-SGTCPDRNKYLFWDSYHPTEKGYRIIVNRIITKYINSF  276
              +LCN   S TC + + ++FWDSYHPTE+ YR++V+ ++ KY++ F
Sbjct  310   AVLCNAWTSTTCSNDSSHVFWDSYHPTERAYRVLVSLLVGKYVDKF  355



>ref|XP_006435221.1| hypothetical protein CICLE_v10003119mg [Citrus clementina]
 gb|ESR48461.1| hypothetical protein CICLE_v10003119mg [Citrus clementina]
Length=341

 Score =   429 bits (1104),  Expect = 1e-144, Method: Compositional matrix adjust.
 Identities = 195/340 (57%), Positives = 259/340 (76%), Gaps = 1/340 (0%)
 Frame = -2

Query  1292  LAGCSEAKIKLPNGLVVKAVIAFGDSIVDQGMNNNLSTMIKTNFPPYGQDFMGGKHTGRY  1113
             +  C +A +KLP    + A+IAFGDSIVD G NN+L T+ K +FPPYG+DF GG  TGR+
Sbjct  1     MGNCIQALVKLPENETIPALIAFGDSIVDTGNNNDLRTISKCDFPPYGKDFQGGVATGRF  60

Query  1112  SNGKTPPDLVAEELGIKELVPAYLDPHLQPEDIKTGVSFASGASGYDPQTAALMSVIPLS  933
             SNGK P D++AEELGIKEL+PAY+   L   D+ TGV FASG SGYDP T+ L+SV+ LS
Sbjct  61    SNGKVPADIIAEELGIKELLPAYVGQALSSRDLVTGVCFASGGSGYDPMTSKLVSVLSLS  120

Query  932   EQLKYFKEYLGKLNAMVGEKEAKSIINNTLFMVVSGSDDLANTYFTIGIRRYQYDINSYT  753
             +Q++YFK+Y+ KL  +VGE +   I+   LF+VV+GSDD+ANTYFT+  R+ QYDI +YT
Sbjct  121   DQIEYFKDYIMKLKLLVGENKTNFILAKGLFLVVAGSDDIANTYFTLRARKLQYDIPAYT  180

Query  752   DLLLEGASNFLQELYSLGARRIGFFGIPPVGCLPSQRTLAGGSERECVENYNQAAQLANA  573
             DL+   AS+FL ELY LGARR+  FG PP+GCLP+QRTLAGG+ REC EN+NQA+QL N 
Sbjct  181   DLMANSASDFLNELYELGARRVAVFGAPPIGCLPAQRTLAGGNARECAENFNQASQLFNK  240

Query  572   KFSAEIKILSKKLPNSKLIFIDIYEDFLDMIKNPAKYGFEVVNLGCCGTGTIEVTMLCNK  393
             K SA++  +   LP S+++FID+Y  FLD+I+NP K+GFEVVN GCCGTG +EV +LCN 
Sbjct  241   KLSAKLDSIKNSLPGSRMVFIDVYNPFLDLIQNPKKHGFEVVNEGCCGTGNLEVAVLCNA  300

Query  392   L-SGTCPDRNKYLFWDSYHPTEKGYRIIVNRIITKYINSF  276
               S TC + + ++FWDSYHPTE+ YR++V+ ++ KY++ F
Sbjct  301   WTSTTCSNDSSHVFWDSYHPTERAYRVLVSLLVGKYVDKF  340



>ref|XP_006473907.1| PREDICTED: GDSL esterase/lipase EXL3-like [Citrus sinensis]
Length=356

 Score =   429 bits (1103),  Expect = 2e-144, Method: Compositional matrix adjust.
 Identities = 196/346 (57%), Positives = 261/346 (75%), Gaps = 1/346 (0%)
 Frame = -2

Query  1310  IIAFLVLAGCSEAKIKLPNGLVVKAVIAFGDSIVDQGMNNNLSTMIKTNFPPYGQDFMGG  1131
             ++   +L  C +A +KLP    + A+IAFGDSIVD G NN+L T+ K +FPPYG+DF GG
Sbjct  10    VVGSCLLFSCIQALVKLPENETIPALIAFGDSIVDTGNNNDLRTISKCDFPPYGKDFQGG  69

Query  1130  KHTGRYSNGKTPPDLVAEELGIKELVPAYLDPHLQPEDIKTGVSFASGASGYDPQTAALM  951
               TGR+SNGK P D++AEELGIKEL+PAY+   L   D+ TGV FASG SGYDP T+ L+
Sbjct  70    VATGRFSNGKVPADIIAEELGIKELLPAYVGQALSSRDLVTGVCFASGGSGYDPMTSKLV  129

Query  950   SVIPLSEQLKYFKEYLGKLNAMVGEKEAKSIINNTLFMVVSGSDDLANTYFTIGIRRYQY  771
             SV+ LS+Q++YFK+Y+ KL  +VGE +   I+   LF+VV+GSDD+ANTYFT+  R+ QY
Sbjct  130   SVLSLSDQIEYFKDYIMKLKLLVGENKTNFILAKGLFLVVAGSDDIANTYFTLRARKLQY  189

Query  770   DINSYTDLLLEGASNFLQELYSLGARRIGFFGIPPVGCLPSQRTLAGGSERECVENYNQA  591
             DI +YTDL+   AS+FL ELY LGARR+  FG PP+GCLP+QRTLAGG+ REC EN+NQA
Sbjct  190   DIPAYTDLMANSASDFLNELYELGARRVAVFGAPPIGCLPAQRTLAGGNARECAENFNQA  249

Query  590   AQLANAKFSAEIKILSKKLPNSKLIFIDIYEDFLDMIKNPAKYGFEVVNLGCCGTGTIEV  411
             +QL N K SA++  +   LP S+++FID+Y  FLD+I+NP K+GFEVVN GCCGTG +EV
Sbjct  250   SQLFNKKLSAKLDSIKNSLPGSRMVFIDVYNPFLDLIQNPKKHGFEVVNEGCCGTGNLEV  309

Query  410   TMLCNKL-SGTCPDRNKYLFWDSYHPTEKGYRIIVNRIITKYINSF  276
              +LCN   S TC + + ++FWDSYHPTE+ YR++V+ +  KY++ F
Sbjct  310   AVLCNAWTSTTCSNDSSHVFWDSYHPTERAYRVLVSLLFGKYVDKF  355



>ref|XP_011003064.1| PREDICTED: GDSL esterase/lipase EXL3-like [Populus euphratica]
Length=366

 Score =   429 bits (1102),  Expect = 4e-144, Method: Compositional matrix adjust.
 Identities = 194/344 (56%), Positives = 266/344 (77%), Gaps = 2/344 (1%)
 Frame = -2

Query  1310  IIAFLVLAGCS-EAKIKLPNGLVVKAVIAFGDSIVDQGMNNNLSTMIKTNFPPYGQDFMG  1134
             ++ FL +  C+  + +KLP  + V A++ FGDSIVD G NN+L T++K+NFPPYG+DF G
Sbjct  19    LVLFLTVVICTVSSSLKLPPNVTVPALLVFGDSIVDAGNNNDLQTLVKSNFPPYGKDFEG  78

Query  1133  GKHTGRYSNGKTPPDLVAEELGIKELVPAYLDPHLQPEDIKTGVSFASGASGYDPQTAAL  954
             G  TGR+ NGK P D++A+ELGIK+ VPAYLDP + P+D+ TGV+FAS  SG+DP T+ L
Sbjct  79    GIPTGRFCNGKIPSDIIAKELGIKDTVPAYLDPAVLPQDLITGVTFASSGSGFDPLTSKL  138

Query  953   MSVIPLSEQLKYFKEYLGKLNAMVGEKEAKSIINNTLFMVVSGSDDLANTYFTIGIRRYQ  774
             +SV+ LS+QL++FKEY+GKL A++GE+     I N+LF+VV+GSDD+ANTYFT+  R  Q
Sbjct  139   VSVLSLSDQLEHFKEYIGKLKAIIGEENTIFTIRNSLFLVVAGSDDIANTYFTLRARNLQ  198

Query  773   YDINSYTDLLLEGASNFLQELYSLGARRIGFFGIPPVGCLPSQRTLAGGSERECVENYNQ  594
             YD+ +YTDL+   AS+F QELY LGARRI  F  PPVGC+PSQRTLAGG+EREC EN+N+
Sbjct  199   YDVPAYTDLMANSASSFAQELYDLGARRIVIFSAPPVGCVPSQRTLAGGAERECAENFNE  258

Query  593   AAQLANAKFSAEIKILSKKLPNSKLIFIDIYEDFLDMIKNPAKYGFEVVNLGCCGTGTIE  414
             AA+L N+K S ++  L+  LPNS+L+++D+Y   LD+I+N  KYGF+V + GCCGTG +E
Sbjct  259   AAKLFNSKLSKKLDSLASSLPNSRLVYVDVYNPLLDVIQNHQKYGFQVADKGCCGTGNLE  318

Query  413   VTMLCNK-LSGTCPDRNKYLFWDSYHPTEKGYRIIVNRIITKYI  285
             V +LCN+  S TC D + Y+FWDSYHPTE+ Y+ +VN ++ KY+
Sbjct  319   VAILCNQHTSETCADVSDYIFWDSYHPTERAYKALVNPVLGKYL  362



>ref|XP_002279381.1| PREDICTED: GDSL esterase/lipase EXL3 [Vitis vinifera]
 ref|XP_010664851.1| PREDICTED: GDSL esterase/lipase EXL3 [Vitis vinifera]
 emb|CBI19907.3| unnamed protein product [Vitis vinifera]
Length=356

 Score =   428 bits (1100),  Expect = 8e-144, Method: Compositional matrix adjust.
 Identities = 207/347 (60%), Positives = 262/347 (76%), Gaps = 4/347 (1%)
 Frame = -2

Query  1310  IIAFLVLAGCS-EAKIKLPNGLVVKAVIAFGDSIVDQGMNNNLSTMIKTNFPPYGQDFMG  1134
             ++ F+ ++ CS EA +KLP+   V AVI FGDSIVD G NNNL T+ K NFPPYG+DF+G
Sbjct  11    LLVFVFISLCSTEALVKLPDNEKVPAVIVFGDSIVDPGNNNNLVTVAKCNFPPYGRDFIG  70

Query  1133  GKHTGRYSNGKTPPDLVAEELGIKELVPAYLDPHLQPEDIKTGVSFASGASGYDPQTAAL  954
             G  TGR+SNGK P D +AEELGIK+L+PAYLDP LQP D+ TGVSFASGASGYDP T  +
Sbjct  71    GIPTGRFSNGKIPSDFIAEELGIKKLLPAYLDPTLQPSDLLTGVSFASGASGYDPLTPKI  130

Query  953   MSVIPLSEQLKYFKEYLGKLNAMVGEKEAKSIINNTLFMVVSGSDDLANTYFTIGIRRYQ  774
              SV  LS+QL+ FKEY+GKL  MVGE+   +I++ +LF VV GS+D+ +TYF   IRR Q
Sbjct  131   PSVFSLSDQLEMFKEYIGKLKGMVGEERTNTILSKSLFFVVQGSNDITSTYFN--IRRGQ  188

Query  773   YDINSYTDLLLEGASNFLQELYSLGARRIGFFGIPPVGCLPSQRTLAGGSERECVENYNQ  594
             YD  SY DLL+  AS+F +ELY LGARRIG F  PP+GCLPSQR+LAGG +RECVE YN+
Sbjct  189   YDFASYADLLVIWASSFFKELYGLGARRIGVFSAPPLGCLPSQRSLAGGIQRECVEKYNE  248

Query  593   AAQLANAKFSAEIKILSKKLPNSKLIFIDIYEDFLDMIKNPAKYGFEVVNLGCCGTGTIE  414
             A+QL N K S+ +  L+   P +K +++DIY   LD+I+NP K GFEVVN GCCGTG IE
Sbjct  249   ASQLFNTKLSSGLDSLNTNFPLAKFVYVDIYNPLLDIIQNPQKSGFEVVNKGCCGTGLIE  308

Query  413   VTMLCNKLSG-TCPDRNKYLFWDSYHPTEKGYRIIVNRIITKYINSF  276
             V++LC++L+  TC D  KY+FWDSYHPTE+ Y+ I+  I   Y++SF
Sbjct  309   VSVLCDQLNPFTCNDATKYVFWDSYHPTERAYKTIIGEIFQGYVDSF  355



>ref|XP_008221227.1| PREDICTED: GDSL esterase/lipase EXL3-like [Prunus mume]
Length=389

 Score =   429 bits (1103),  Expect = 9e-144, Method: Compositional matrix adjust.
 Identities = 204/338 (60%), Positives = 256/338 (76%), Gaps = 3/338 (1%)
 Frame = -2

Query  1280  SEAKIKLPNGLVVKAVIAFGDSIVDQGMNNN-LSTMIKTNFPPYGQDFMGGKHTGRYSNG  1104
             + A+IKLP    V AVI FGDSIVD G NNN   T+ ++NFPPYG+D  GG  TGRYSNG
Sbjct  51    AAARIKLPGNASVSAVIIFGDSIVDTGNNNNNFKTLARSNFPPYGKDLKGGMPTGRYSNG  110

Query  1103  KTPPDLVAEELGIKELVPAYLDPHLQPEDIKTGVSFASGASGYDPQTAALMSVIPLSEQL  924
             K P DL+ EELGIKEL+PAYLDP LQP+D+ TGV  A+G +GYDP TA +  V  LS+QL
Sbjct  111   KVPSDLIVEELGIKELLPAYLDPTLQPKDLLTGVVIAAGGAGYDPLTAQVAGVASLSDQL  170

Query  923   KYFKEYLGKLNAMVGEKEAKSIINNTLFMVVSGSDDLANTYFTIGIRRYQYDINSYTDLL  744
             K FKEY+ KL A+ GE+ A  II+N+L  VV+GS+D++NTYF  G+R+ +YD+ SYTDL+
Sbjct  171   KQFKEYIKKLKAIAGEERANFIISNSLIFVVAGSNDISNTYFLTGMRKLEYDVPSYTDLM  230

Query  743   LEGASNFLQELYSLGARRIGFFGIPPVGCLPSQRTLAGGSERECVENYNQAAQLANAKFS  564
             L  AS F+++LY LGARRIG    PP+GC+PSQRT+AGG  REC E  NQA+QL N+K S
Sbjct  231   LNYASEFVKDLYGLGARRIGLLNTPPIGCVPSQRTVAGGVLRECDEKQNQASQLFNSKLS  290

Query  563   AEIKILSKKLPNSKLIFIDIYEDFLDMIKNPAKYGFEVVNLGCCGTGTIEVTMLCNKL--  390
             AE   L+K LPNS++++IDIY   LD+I NP KYGFEV N GCCG+G IEVT LCN++  
Sbjct  291   AEADDLNKNLPNSRVVYIDIYNPLLDLINNPTKYGFEVANKGCCGSGIIEVTKLCNQIQP  350

Query  389   SGTCPDRNKYLFWDSYHPTEKGYRIIVNRIITKYINSF  276
             +GTC D +KY+FWDSYHPTE+ Y+IIV +I+ KY   F
Sbjct  351   AGTCSDDSKYVFWDSYHPTERAYKIIVQQILDKYTKFF  388



>ref|XP_002301955.2| family II extracellular lipase 3 family protein [Populus trichocarpa]
 gb|EEE81228.2| family II extracellular lipase 3 family protein [Populus trichocarpa]
Length=399

 Score =   429 bits (1102),  Expect = 1e-143, Method: Compositional matrix adjust.
 Identities = 194/346 (56%), Positives = 265/346 (77%), Gaps = 1/346 (0%)
 Frame = -2

Query  1310  IIAFLVLAGCSEAKIKLPNGLVVKAVIAFGDSIVDQGMNNNLSTMIKTNFPPYGQDFMGG  1131
             ++ FL +    ++ +KLP  + V A++ FGDSIVD G NNN+ T++K NFPPYG+DF GG
Sbjct  53    LLLFLTVVCSVKSSVKLPPNVTVPALLLFGDSIVDAGNNNNIKTLVKCNFPPYGKDFEGG  112

Query  1130  KHTGRYSNGKTPPDLVAEELGIKELVPAYLDPHLQPEDIKTGVSFASGASGYDPQTAALM  951
               TGR+ NGK P D++A+ELGIK+ +PAYLDP + P+D+ TGV+FASG SG+DP T  L+
Sbjct  113   VPTGRFCNGKVPSDIIAKELGIKDTLPAYLDPTVLPQDLVTGVTFASGGSGFDPLTPKLV  172

Query  950   SVIPLSEQLKYFKEYLGKLNAMVGEKEAKSIINNTLFMVVSGSDDLANTYFTIGIRRYQY  771
             SVI LS+QLKY KEY+GKL AM+GE++ K I+ N+LF VV+GSDD+ANTYFTI  R+ QY
Sbjct  173   SVISLSDQLKYLKEYIGKLEAMIGEEKTKFILKNSLFFVVAGSDDIANTYFTIRARKSQY  232

Query  770   DINSYTDLLLEGASNFLQELYSLGARRIGFFGIPPVGCLPSQRTLAGGSERECVENYNQA  591
             D+ +YTDL+   AS F QELY LGARRIGFF  PP+GC+PSQRTLAGG+ER+C EN N+A
Sbjct  233   DVPAYTDLMANSASTFAQELYELGARRIGFFSTPPIGCVPSQRTLAGGAERKCAENLNEA  292

Query  590   AQLANAKFSAEIKILSKKLPNSKLIFIDIYEDFLDMIKNPAKYGFEVVNLGCCGTGTIEV  411
             A+L N+K S ++  L   LPN + ++ID+Y   LD+I+NP KYGF+VV+ GCCGTG +EV
Sbjct  293   AKLFNSKLSKKLDSLGSSLPNGRFVYIDVYNLLLDLIQNPKKYGFQVVDKGCCGTGDLEV  352

Query  410   TMLCNKLSGT-CPDRNKYLFWDSYHPTEKGYRIIVNRIITKYINSF  276
             ++LCN+ +   C + + ++FWDSYHPTE  Y+ +V+ ++ + +N F
Sbjct  353   SILCNQYTPVKCANVSDHIFWDSYHPTESAYKALVSPLLGENLNKF  398



>ref|XP_007017868.1| JHL20J20.8 protein [Theobroma cacao]
 gb|EOY15093.1| JHL20J20.8 protein [Theobroma cacao]
Length=366

 Score =   427 bits (1098),  Expect = 2e-143, Method: Compositional matrix adjust.
 Identities = 203/344 (59%), Positives = 257/344 (75%), Gaps = 3/344 (1%)
 Frame = -2

Query  1298  LVLAGCS-EAKIKLPNGLVVKAVIAFGDSIVDQGMNNNLSTMIKTNFPPYGQDFMGGKHT  1122
             L L  CS +A +KLP    V AVI FGDSIVD G NN+LST+IK NF PYGQDF GG  T
Sbjct  22    LALLICSTKALVKLPPNETVPAVIVFGDSIVDAGNNNDLSTLIKCNFLPYGQDFDGGVPT  81

Query  1121  GRYSNGKTPPDLVAEELGIKELVPAYLDPHLQPEDIKTGVSFASGASGYDPQTAALMSVI  942
             GR+ NGK P D++A+E+GIK+ VPAYLDP L P+D+ TGV+FASG +GYDP T  L SVI
Sbjct  82    GRFCNGKIPSDIIAKEMGIKDTVPAYLDPTLTPQDLLTGVTFASGGTGYDPMTPKLASVI  141

Query  941   PLSEQLKYFKEYLGKLNAMVGEKEAKSIINNTLFMVVSGSDDLANTYFTIGIRRYQYDIN  762
              LS+QL +FKEY+ KL A+VGE+    II  +L+++V+GSDD+ANTYF + +R+ QYDI 
Sbjct  142   SLSDQLDHFKEYIAKLKALVGEERTNFIIAKSLYLIVAGSDDIANTYFVLRVRKLQYDIP  201

Query  761   SYTDLLLEGASNFLQELYSLGARRIGFFGIPPVGCLPSQRTLAGGSERECVENYNQAAQL  582
             +YTDL+   A  F +ELY+LGARR+  F  PP+GC+PSQRTLAGG EREC E+YNQAA+L
Sbjct  202   AYTDLMANSAQTFFKELYALGARRMAVFSAPPIGCVPSQRTLAGGIERECAEDYNQAARL  261

Query  581   ANAKFSAEIKILSKKLPNSKLIFIDIYEDFLDMIKNPAKYGFEVVNLGCCGTGTIEVTML  402
              N K  A +  L   LP+ K ++ D+Y   L +I+NP KYGFEV N GCCGTG IEV +L
Sbjct  262   FNKKLYAVLNSLQTSLPDGKFVYTDVYNPLLQLIENPQKYGFEVANKGCCGTGNIEVAIL  321

Query  401   CNKLS-GTCPDRNKYLFWDSYHPTEKGYRIIVNRIITK-YINSF  276
             CNKLS  TC D +KY+FWDSYHPTEK YR++V  I+ + ++N+F
Sbjct  322   CNKLSPSTCTDDSKYIFWDSYHPTEKAYRVLVPLILDQDFVNNF  365



>ref|XP_008221228.1| PREDICTED: GDSL esterase/lipase EXL3-like [Prunus mume]
Length=379

 Score =   425 bits (1092),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 190/334 (57%), Positives = 254/334 (76%), Gaps = 0/334 (0%)
 Frame = -2

Query  1277  EAKIKLPNGLVVKAVIAFGDSIVDQGMNNNLSTMIKTNFPPYGQDFMGGKHTGRYSNGKT  1098
             EA +K+P G  + AVI FGDSI+D G NN+L +++K NF PYG+DF G K TGR+ NGK 
Sbjct  42    EAAVKIPPGQTIPAVIVFGDSIMDTGNNNHLKSLVKCNFSPYGRDFQGHKPTGRFGNGKV  101

Query  1097  PPDLVAEELGIKELVPAYLDPHLQPEDIKTGVSFASGASGYDPQTAALMSVIPLSEQLKY  918
             P D + EELGIK+ +PAYLDP L+PED+ TGV FASG +GYDP T  ++SVI LS+QL  
Sbjct  102   PSDFIVEELGIKKYLPAYLDPSLRPEDLATGVCFASGGTGYDPMTPEIVSVISLSDQLSM  161

Query  917   FKEYLGKLNAMVGEKEAKSIINNTLFMVVSGSDDLANTYFTIGIRRYQYDINSYTDLLLE  738
             FKEY+GKL  +VGE+    I++N LF+VV+GSDDLANTYFTI +R+ QYDI +YTDL+++
Sbjct  162   FKEYIGKLKGIVGEERTNFILSNALFLVVAGSDDLANTYFTIRVRKAQYDIPAYTDLMVD  221

Query  737   GASNFLQELYSLGARRIGFFGIPPVGCLPSQRTLAGGSERECVENYNQAAQLANAKFSAE  558
              AS+F++ELY LGARRIG F  PP+GC+PSQRTL GG  R+C E YN+AA+L NAK S  
Sbjct  222   SASSFVKELYGLGARRIGLFSAPPIGCVPSQRTLGGGLARDCAEEYNEAAKLFNAKLSRS  281

Query  557   IKILSKKLPNSKLIFIDIYEDFLDMIKNPAKYGFEVVNLGCCGTGTIEVTMLCNKLSGTC  378
             +  L+  LPNS+++++D+Y   L++I NPAK GF+V   GCCGTG IEV +LCNK   TC
Sbjct  282   LNSLNTALPNSRVVYVDVYNPLLEIILNPAKDGFKVAEKGCCGTGVIEVAVLCNKYDATC  341

Query  377   PDRNKYLFWDSYHPTEKGYRIIVNRIITKYINSF  276
              + + ++FWDSYHPTE+ Y +++  ++ +Y+N F
Sbjct  342   ANASDHVFWDSYHPTERTYSVLIPPLLQRYVNDF  375



>ref|XP_002306948.2| family II extracellular lipase 3 family protein [Populus trichocarpa]
 gb|EEE93944.2| family II extracellular lipase 3 family protein [Populus trichocarpa]
Length=365

 Score =   424 bits (1089),  Expect = 5e-142, Method: Compositional matrix adjust.
 Identities = 193/345 (56%), Positives = 261/345 (76%), Gaps = 1/345 (0%)
 Frame = -2

Query  1307  IAFLVLAGCSEAKIKLPNGLVVKAVIAFGDSIVDQGMNNNLSTMIKTNFPPYGQDFMGGK  1128
             + FL +     + +KLP  + + A++ FGDSIVD G NN+L T++K+NFPPYG+DF GG 
Sbjct  20    VLFLTVVCTVSSLVKLPPNVTIPALLVFGDSIVDAGNNNDLETLVKSNFPPYGKDFEGGI  79

Query  1127  HTGRYSNGKTPPDLVAEELGIKELVPAYLDPHLQPEDIKTGVSFASGASGYDPQTAALMS  948
              TGR+ NGK P D++A+ELGIK+ +PAYLDP + P+D+ TGV+FAS  SG+DP T  L+S
Sbjct  80    PTGRFCNGKIPSDIIAKELGIKDTLPAYLDPAVLPQDLITGVTFASSGSGFDPLTPKLVS  139

Query  947   VIPLSEQLKYFKEYLGKLNAMVGEKEAKSIINNTLFMVVSGSDDLANTYFTIGIRRYQYD  768
             V+ LS+QL++FKEY+GKL A++GE+     I N+LF+VV+GSDD+ANTYFT+  R+ QYD
Sbjct  140   VLSLSDQLEHFKEYIGKLKAIIGEENTIFTIRNSLFLVVAGSDDIANTYFTLRARKLQYD  199

Query  767   INSYTDLLLEGASNFLQELYSLGARRIGFFGIPPVGCLPSQRTLAGGSERECVENYNQAA  588
             + +YTDL+   AS+F QELY LGARRI  F  PPVGC+PSQRTLAGG+EREC EN+N+AA
Sbjct  200   VPAYTDLMANSASSFAQELYELGARRIVVFSAPPVGCVPSQRTLAGGAERECAENFNEAA  259

Query  587   QLANAKFSAEIKILSKKLPNSKLIFIDIYEDFLDMIKNPAKYGFEVVNLGCCGTGTIEVT  408
             +L N+K S ++  L   LPNS L++ID+Y   LD+I+ P KYGF+V + GCCGTG +EV 
Sbjct  260   KLFNSKLSKKLDSLGSSLPNSSLVYIDVYNLLLDIIQKPQKYGFQVADKGCCGTGNLEVA  319

Query  407   MLCNK-LSGTCPDRNKYLFWDSYHPTEKGYRIIVNRIITKYINSF  276
             +LCN+  S TC D + Y+FWDSYHPTEK Y+ +V  ++ KY+  F
Sbjct  320   VLCNQHTSETCADVSDYVFWDSYHPTEKAYKALVYPLLGKYLTKF  364



>ref|XP_002270500.1| PREDICTED: GDSL esterase/lipase EXL3 [Vitis vinifera]
Length=357

 Score =   423 bits (1087),  Expect = 6e-142, Method: Compositional matrix adjust.
 Identities = 194/345 (56%), Positives = 259/345 (75%), Gaps = 1/345 (0%)
 Frame = -2

Query  1307  IAFLVLAGCSEAKIKLPNGLVVKAVIAFGDSIVDQGMNNNLSTMIKTNFPPYGQDFMGGK  1128
             ++  ++   +EA +KLP      AV+ FGDSIVD G NNNLST++K NFPPYG+DF+GG 
Sbjct  12    LSVFIILCTTEALVKLPRNETFPAVLVFGDSIVDPGNNNNLSTVVKCNFPPYGRDFVGGF  71

Query  1127  HTGRYSNGKTPPDLVAEELGIKELVPAYLDPHLQPEDIKTGVSFASGASGYDPQTAALMS  948
              TGR+SNGK PPD +AEELGIK L+P Y  P LQ  D+ TGVSFAS  SG+DP T  L+S
Sbjct  72    PTGRFSNGKIPPDFIAEELGIKNLLPPYSSPSLQLGDLLTGVSFASSGSGFDPLTPKLVS  131

Query  947   VIPLSEQLKYFKEYLGKLNAMVGEKEAKSIINNTLFMVVSGSDDLANTYFTIGIRRYQYD  768
             V+ L +QL  FKEY+GKL  MVGE+   +I++ +LF+VV+GSDD+AN+YF IG+R+ QYD
Sbjct  132   VLSLRDQLGMFKEYIGKLKVMVGEERTNTILSKSLFLVVAGSDDIANSYFVIGVRKRQYD  191

Query  767   INSYTDLLLEGASNFLQELYSLGARRIGFFGIPPVGCLPSQRTLAGGSERECVENYNQAA  588
             + +YTD +   A++FL+ELY LGARRIG    PP+GCLPSQR+LAGG +REC E++N+AA
Sbjct  192   VPAYTDFMATSAASFLKELYGLGARRIGVASAPPLGCLPSQRSLAGGKQRECAEDHNEAA  251

Query  587   QLANAKFSAEIKILSKKLPNSKLIFIDIYEDFLDMIKNPAKYGFEVVNLGCCGTGTIEVT  408
             +L N K S+++  L+   P +K ++IDIY+ FLD+I+NP K GFEVV+ GCCGTG IE  
Sbjct  252   KLFNTKLSSQLDSLNANSPQAKFVYIDIYKPFLDLIQNPQKSGFEVVDKGCCGTGRIEAA  311

Query  407   MLCNKLSG-TCPDRNKYLFWDSYHPTEKGYRIIVNRIITKYINSF  276
              LC+ LS  TC D + Y+FWDSYHPTE+ Y++I+ +II K ++ F
Sbjct  312   ALCSLLSSFTCEDASNYVFWDSYHPTERAYKVIIEKIIQKCVDGF  356



>ref|XP_008221397.1| PREDICTED: GDSL esterase/lipase EXL3-like [Prunus mume]
Length=359

 Score =   423 bits (1087),  Expect = 8e-142, Method: Compositional matrix adjust.
 Identities = 199/342 (58%), Positives = 258/342 (75%), Gaps = 2/342 (1%)
 Frame = -2

Query  1295  VLAGCSEAKIKLPNGLVVKAVIAFGDSIVDQGMNNNLSTMIKTNFPPYGQDFMGGKHTGR  1116
             ++   ++A  KLPN + +  V  FGDSIVD G NNNL+T++K+NF PYG+DFMGG  TGR
Sbjct  14    LILSTAQAIAKLPNNVTIPGVFMFGDSIVDTGNNNNLTTLVKSNFLPYGRDFMGGLPTGR  73

Query  1115  YSNGKTPPDLVAEELGIKELVPAYLDPHLQPEDIKTGVSFASGASGYDPQTAALMSVIPL  936
             + NGK P DL+ E+LGIKEL+PAYLDP LQPED+ TGV+FASG +G+DP T+ LM VIPL
Sbjct  74    FGNGKVPSDLIVEDLGIKELLPAYLDPCLQPEDLPTGVNFASGGAGFDPLTSKLMLVIPL  133

Query  935   SEQLKYFKEYLGKLNAMVGEKEAKSIINNTLFMVVSGSDDLANTYFTIGIRRYQYDINSY  756
             SEQL+  KEY+ KL   +GE+ A SII+N+LF+V +GSDD+ NTY+    R ++YDI +Y
Sbjct  134   SEQLQLLKEYIEKLKKYIGEERASSIISNSLFVVAAGSDDIVNTYYHTPARFWKYDIYAY  193

Query  755   TDLLLEGASNFLQELYSLGARRIGFFGIPPVGCLPSQRTLAGGSERECVENYNQAAQLAN  576
             TDL+L  AS F+Q+LY+LGARRIG   +PPVGC+P+QRTL GG ER+CVE YN+AA+L N
Sbjct  194   TDLMLTEASAFVQKLYALGARRIGVISVPPVGCIPAQRTLGGGPERKCVEIYNEAAELFN  253

Query  575   AKFSAEIKIL-SKKLPNSKLIFIDIYEDFLDMIKNPAKYGFEVVNLGCCGTGTIEVTMLC  399
              K SAE+  L S +   +  +F+D+Y  FLD+I NP KYGFEVVN GCCGTG IEV   C
Sbjct  254   KKLSAELDCLNSDQFHATVAVFMDVYGPFLDIIHNPQKYGFEVVNRGCCGTGIIEVAEFC  313

Query  398   NKLS-GTCPDRNKYLFWDSYHPTEKGYRIIVNRIITKYINSF  276
             NK S  TC +   Y+FWDSYHP+E+ YRII ++++ K I +F
Sbjct  314   NKWSPNTCENATSYVFWDSYHPSERAYRIITHQVLHKSIQAF  355



>ref|XP_010105284.1| GDSL esterase/lipase EXL3 [Morus notabilis]
 gb|EXC04219.1| GDSL esterase/lipase EXL3 [Morus notabilis]
Length=366

 Score =   423 bits (1087),  Expect = 9e-142, Method: Compositional matrix adjust.
 Identities = 193/345 (56%), Positives = 258/345 (75%), Gaps = 0/345 (0%)
 Frame = -2

Query  1310  IIAFLVLAGCSEAKIKLPNGLVVKAVIAFGDSIVDQGMNNNLSTMIKTNFPPYGQDFMGG  1131
             I+  + L   S+A +KLP  + V A+I FGDSI+D G NNNL T++K +FPPYGQDF G 
Sbjct  21    ILVLICLFHPSKAVLKLPPNVTVPALIVFGDSIMDTGNNNNLKTVVKCDFPPYGQDFAGR  80

Query  1130  KHTGRYSNGKTPPDLVAEELGIKELVPAYLDPHLQPEDIKTGVSFASGASGYDPQTAALM  951
             K TGR+ NGK P DL+ EELGIKE +PAYLDP+L P+D+ TGV FASG SG+DP T  ++
Sbjct  81    KPTGRFGNGKVPSDLIVEELGIKEYLPAYLDPNLNPKDLATGVCFASGGSGFDPMTPQIV  140

Query  950   SVIPLSEQLKYFKEYLGKLNAMVGEKEAKSIINNTLFMVVSGSDDLANTYFTIGIRRYQY  771
             SV+  S+QL+ F+EYLGKL A VG++  K I+ N++F+VV+GSDD+ANTYFT+ +R+ QY
Sbjct  141   SVLSFSDQLRLFEEYLGKLKANVGKRRTKFILENSIFLVVAGSDDIANTYFTVRLRKLQY  200

Query  770   DINSYTDLLLEGASNFLQELYSLGARRIGFFGIPPVGCLPSQRTLAGGSERECVENYNQA  591
             D+ +YTDL+L  AS+F+++LY LGARRIG F  PP+GC+PSQRTL GG  R+C E YN+A
Sbjct  201   DVPAYTDLMLNSASDFVKQLYGLGARRIGLFSTPPIGCVPSQRTLGGGLLRDCAEEYNEA  260

Query  590   AQLANAKFSAEIKILSKKLPNSKLIFIDIYEDFLDMIKNPAKYGFEVVNLGCCGTGTIEV  411
             A L N+K SA +  L  +LPN +L++IDIY   LD+I N  KYGF+ V+ GCCGTG IEV
Sbjct  261   ALLFNSKLSATLDSLKPQLPNGRLVYIDIYNPLLDLIVNHKKYGFDYVDKGCCGTGAIEV  320

Query  410   TMLCNKLSGTCPDRNKYLFWDSYHPTEKGYRIIVNRIITKYINSF  276
              +LCN LS  C +   ++FWDSYHP++  Y+ +V  ++ KY+N F
Sbjct  321   AILCNPLSPPCENPAGHIFWDSYHPSDAAYKFLVPTLLKKYVNGF  365



>ref|XP_009334750.1| PREDICTED: GDSL esterase/lipase EXL3-like [Pyrus x bretschneideri]
Length=362

 Score =   422 bits (1086),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 200/330 (61%), Positives = 251/330 (76%), Gaps = 2/330 (1%)
 Frame = -2

Query  1268  IKLPNGLVVKAVIAFGDSIVDQGMNN-NLSTMIKTNFPPYGQDFMGGKHTGRYSNGKTPP  1092
             +KLP+   + AV  FGDSIVD G NN NL T  + NFPPYG++F GG  TGRYSNGK P 
Sbjct  29    VKLPSNATIPAVFMFGDSIVDTGNNNVNLKTPARCNFPPYGREFEGGISTGRYSNGKVPS  88

Query  1091  DLVAEELGIKELVPAYLDPHLQPEDIKTGVSFASGASGYDPQTAALMSVIPLSEQLKYFK  912
             DL+ E+LGIKEL+PAYLDP+LQP D+ TGVSFA GA+GYDP TA +++V PLS+QL+ F+
Sbjct  89    DLIVEKLGIKELLPAYLDPNLQPNDLLTGVSFAVGATGYDPMTAQIVAVTPLSDQLRQFE  148

Query  911   EYLGKLNAMVGEKEAKSIINNTLFMVVSGSDDLANTYFTIGIRRYQYDINSYTDLLLEGA  732
             EY+GKL  +VGE+ A  I+ N+L  VV+ S+D+ANTYF  G+R+ +YD+ SYTDL+L  A
Sbjct  149   EYIGKLKGIVGEERANFILANSLCFVVASSNDIANTYFVAGVRKLEYDVPSYTDLMLNHA  208

Query  731   SNFLQELYSLGARRIGFFGIPPVGCLPSQRTLAGGSERECVENYNQAAQLANAKFSAEIK  552
             S+F + LY+LGARRIG F  PP+GCLPSQRTL GG ER+C +  NQAA L N+K SAE+ 
Sbjct  209   SDFFKGLYALGARRIGVFSAPPIGCLPSQRTLGGGVERDCADKPNQAAMLFNSKLSAELD  268

Query  551   ILSKKLPNSKLIFIDIYEDFLDMIKNPAKYGFEVVNLGCCGTGTIEVTMLCNKLS-GTCP  375
              L   LPNS LI++DIY   LDMI NP  YGFEV N GCCG+G +EV++LCN+    TC 
Sbjct  269   DLKNNLPNSMLIYVDIYNPLLDMIINPTNYGFEVSNKGCCGSGKLEVSILCNRFDPETCT  328

Query  374   DRNKYLFWDSYHPTEKGYRIIVNRIITKYI  285
             D + YLFWDSYHPTE  Y+IIV+ +ITKY+
Sbjct  329   DDSHYLFWDSYHPTEGAYKIIVDELITKYL  358



>ref|XP_003634393.1| PREDICTED: GDSL esterase/lipase EXL3-like [Vitis vinifera]
Length=360

 Score =   422 bits (1086),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 200/345 (58%), Positives = 259/345 (75%), Gaps = 3/345 (1%)
 Frame = -2

Query  1307  IAFLVLAGCSEAKIKLPNGLVVKAVIAFGDSIVDQGMNNNLSTMIKTNFPPYGQDFMGGK  1128
             ++  ++   +EA +KLP+   V A+I FGDSIVD G NN+L ++ K NFPPYG+DF+GG 
Sbjct  17    VSVFIILCSTEALVKLPDNETVPALIVFGDSIVDPGNNNDLVSVAKCNFPPYGRDFIGGI  76

Query  1127  HTGRYSNGKTPPDLVAEELGIKELVPAYLDPHLQPEDIKTGVSFASGASGYDPQTAALMS  948
              TGR+SNGK P D +AEELGIK+L+PAYLDP LQP D+ TGVSFASGASGYDP T  + S
Sbjct  77    PTGRFSNGKIPSDFIAEELGIKKLLPAYLDPALQPSDLLTGVSFASGASGYDPLTPKISS  136

Query  947   VIPLSEQLKYFKEYLGKLNAMVGEKEAKSIINNTLFMVVSGSDDLANTYFTIGIRRYQYD  768
             V  LS+QL+ FKEY+GKL AMVGE+   +I++ +LF+VV  S+D+A TYF   IR+ QYD
Sbjct  137   VFSLSDQLEQFKEYIGKLTAMVGEQRTNTILSKSLFLVVQSSNDIATTYF--DIRKVQYD  194

Query  767   INSYTDLLLEGASNFLQELYSLGARRIGFFGIPPVGCLPSQRTLAGGSERECVENYNQAA  588
               SY DLL+  AS+F +ELY LGARRI  F  PP+GCLPSQR+LA G ERECVE YN+A+
Sbjct  195   FASYADLLVTWASSFFKELYGLGARRIAVFSAPPLGCLPSQRSLAAGIERECVEKYNEAS  254

Query  587   QLANAKFSAEIKILSKKLPNSKLIFIDIYEDFLDMIKNPAKYGFEVVNLGCCGTGTIEVT  408
             +L N K S+ +  L+   P +K +++DIY   LD+I+NP K GFEVVN GCCGTG IEV 
Sbjct  255   KLFNTKLSSGLDSLNTNFPLAKFVYVDIYNPLLDIIQNPQKSGFEVVNKGCCGTGLIEVA  314

Query  407   MLCNKLSG-TCPDRNKYLFWDSYHPTEKGYRIIVNRIITKYINSF  276
             +LCN+ +  TC D  KY+FWDSYHPTE+ Y+I++  II +Y++SF
Sbjct  315   VLCNQFNPFTCNDVTKYVFWDSYHPTERLYKILIGEIIQEYVDSF  359



>ref|XP_003603782.1| GDSL esterase/lipase EXL3 [Medicago truncatula]
 gb|AES74033.1| GDSL-like lipase/acylhydrolase [Medicago truncatula]
Length=369

 Score =   422 bits (1086),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 196/336 (58%), Positives = 254/336 (76%), Gaps = 0/336 (0%)
 Frame = -2

Query  1280  SEAKIKLPNGLVVKAVIAFGDSIVDQGMNNNLSTMIKTNFPPYGQDFMGGKHTGRYSNGK  1101
             + A +KLP  + + A+IAFGDSI+D G NNN+ T++K NFPPYGQDF GG  TGR+ NGK
Sbjct  33    TNALVKLPPNVTIPALIAFGDSIMDTGNNNNIKTIVKCNFPPYGQDFEGGIPTGRFCNGK  92

Query  1100  TPPDLVAEELGIKELVPAYLDPHLQPEDIKTGVSFASGASGYDPQTAALMSVIPLSEQLK  921
              P DL+ EELGIKEL+PAYLDP+L+P D+ TGV FASGASGYDP T  ++SVI + +QLK
Sbjct  93    NPSDLIVEELGIKELLPAYLDPNLKPSDLSTGVCFASGASGYDPLTPKIVSVISMGDQLK  152

Query  920   YFKEYLGKLNAMVGEKEAKSIINNTLFMVVSGSDDLANTYFTIGIRRYQYDINSYTDLLL  741
              FKEY+ KL  +VGE  A  I+ NTLF++V+GSDDLANTYFTI  R+  YD+ +Y DL++
Sbjct  153   MFKEYIVKLKGVVGENRANFILANTLFLIVAGSDDLANTYFTIRTRQLHYDVPAYADLMV  212

Query  740   EGASNFLQELYSLGARRIGFFGIPPVGCLPSQRTLAGGSERECVENYNQAAQLANAKFSA  561
             +GAS+F++E+Y LGARRIG F   P+G LPSQ+TL GG  R+  E YN+AA+L N+K S 
Sbjct  213   KGASDFIKEIYKLGARRIGVFSAAPIGYLPSQKTLGGGVFRKTNEKYNEAAKLFNSKLSK  272

Query  560   EIKILSKKLPNSKLIFIDIYEDFLDMIKNPAKYGFEVVNLGCCGTGTIEVTMLCNKLSGT  381
             E+  L   LPNS +I+IDIY   LD+I  P KYG++V + GCCGTG +EV++LCN LS T
Sbjct  273   ELDYLHSNLPNSNVIYIDIYSPLLDIILKPQKYGYKVADKGCCGTGKLEVSVLCNPLSAT  332

Query  380   CPDRNKYLFWDSYHPTEKGYRIIVNRIITKYINSFT  273
             CPD ++Y+FWDSYHPTE  YR +V  ++ KY+   T
Sbjct  333   CPDNSEYIFWDSYHPTESVYRKLVAVVLPKYVGRLT  368



>ref|XP_003589534.1| GDSL esterase/lipase [Medicago truncatula]
 gb|AES59785.1| GDSL-like lipase/acylhydrolase [Medicago truncatula]
Length=361

 Score =   422 bits (1084),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 201/346 (58%), Positives = 259/346 (75%), Gaps = 4/346 (1%)
 Frame = -2

Query  1310  IIAFLVL-AGCSEAK--IKLPNGLVVKAVIAFGDSIVDQGMNNNLSTMIKTNFPPYGQDF  1140
             +I F+VL A C + K  IKLP  + V AVIAFGDSIVD G NN+L T++K NFPPYG+DF
Sbjct  14    LIRFIVLFALCYKTKGLIKLPPNVTVPAVIAFGDSIVDSGNNNDLKTLVKCNFPPYGKDF  73

Query  1139  MGGKHTGRYSNGKTPPDLVAEELGIKELVPAYLDPHLQPEDIKTGVSFASGASGYDPQTA  960
              GG  TGR+ NGK P D++AE+ GIK  VPAYLDP+L+  D+ TGV FASGASGYDP T 
Sbjct  74    QGGVPTGRFCNGKIPSDILAEQFGIKGYVPAYLDPNLKSSDLLTGVGFASGASGYDPLTP  133

Query  959   ALMSVIPLSEQLKYFKEYLGKLNAMVGEKEAKSIINNTLFMVVSGSDDLANTYFTIGIRR  780
              + SVIPLS QL  FKEY+GKL  +VGE+    I+ N+LF+VV GSDD+ANTY+ +   R
Sbjct  134   QIASVIPLSAQLDMFKEYIGKLKGIVGEERTNFILANSLFVVVGGSDDIANTYYVVH-AR  192

Query  779   YQYDINSYTDLLLEGASNFLQELYSLGARRIGFFGIPPVGCLPSQRTLAGGSERECVENY  600
              QYDI +YTDL+   A+NF++E+Y LGARRI   G PP+GC+PSQRTLAGG  REC E Y
Sbjct  193   LQYDIPAYTDLMSNSATNFIKEIYKLGARRIAVLGAPPIGCVPSQRTLAGGIVRECAEKY  252

Query  599   NQAAQLANAKFSAEIKILSKKLPNSKLIFIDIYEDFLDMIKNPAKYGFEVVNLGCCGTGT  420
             N AA+L N+K S ++  LS+  PNS++++ID+Y   LD+I N  KYGF+VV+ GCCGTG 
Sbjct  253   NDAAKLFNSKLSKQLDSLSQNSPNSRIVYIDVYTPLLDIIVNYQKYGFKVVDRGCCGTGK  312

Query  419   IEVTMLCNKLSGTCPDRNKYLFWDSYHPTEKGYRIIVNRIITKYIN  282
             +EV +LCN L  TC D ++Y+FWDSYHPTE+ YR +V+ ++ +Y+N
Sbjct  313   LEVAVLCNPLDATCSDASEYVFWDSYHPTERAYRKLVDSVLERYLN  358



>emb|CBI19908.3| unnamed protein product [Vitis vinifera]
Length=376

 Score =   422 bits (1086),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 200/345 (58%), Positives = 259/345 (75%), Gaps = 3/345 (1%)
 Frame = -2

Query  1307  IAFLVLAGCSEAKIKLPNGLVVKAVIAFGDSIVDQGMNNNLSTMIKTNFPPYGQDFMGGK  1128
             ++  ++   +EA +KLP+   V A+I FGDSIVD G NN+L ++ K NFPPYG+DF+GG 
Sbjct  33    VSVFIILCSTEALVKLPDNETVPALIVFGDSIVDPGNNNDLVSVAKCNFPPYGRDFIGGI  92

Query  1127  HTGRYSNGKTPPDLVAEELGIKELVPAYLDPHLQPEDIKTGVSFASGASGYDPQTAALMS  948
              TGR+SNGK P D +AEELGIK+L+PAYLDP LQP D+ TGVSFASGASGYDP T  + S
Sbjct  93    PTGRFSNGKIPSDFIAEELGIKKLLPAYLDPALQPSDLLTGVSFASGASGYDPLTPKISS  152

Query  947   VIPLSEQLKYFKEYLGKLNAMVGEKEAKSIINNTLFMVVSGSDDLANTYFTIGIRRYQYD  768
             V  LS+QL+ FKEY+GKL AMVGE+   +I++ +LF+VV  S+D+A TYF   IR+ QYD
Sbjct  153   VFSLSDQLEQFKEYIGKLTAMVGEQRTNTILSKSLFLVVQSSNDIATTYF--DIRKVQYD  210

Query  767   INSYTDLLLEGASNFLQELYSLGARRIGFFGIPPVGCLPSQRTLAGGSERECVENYNQAA  588
               SY DLL+  AS+F +ELY LGARRI  F  PP+GCLPSQR+LA G ERECVE YN+A+
Sbjct  211   FASYADLLVTWASSFFKELYGLGARRIAVFSAPPLGCLPSQRSLAAGIERECVEKYNEAS  270

Query  587   QLANAKFSAEIKILSKKLPNSKLIFIDIYEDFLDMIKNPAKYGFEVVNLGCCGTGTIEVT  408
             +L N K S+ +  L+   P +K +++DIY   LD+I+NP K GFEVVN GCCGTG IEV 
Sbjct  271   KLFNTKLSSGLDSLNTNFPLAKFVYVDIYNPLLDIIQNPQKSGFEVVNKGCCGTGLIEVA  330

Query  407   MLCNKLSG-TCPDRNKYLFWDSYHPTEKGYRIIVNRIITKYINSF  276
             +LCN+ +  TC D  KY+FWDSYHPTE+ Y+I++  II +Y++SF
Sbjct  331   VLCNQFNPFTCNDVTKYVFWDSYHPTERLYKILIGEIIQEYVDSF  375



>ref|XP_011034987.1| PREDICTED: GDSL esterase/lipase EXL3-like [Populus euphratica]
Length=398

 Score =   422 bits (1086),  Expect = 4e-141, Method: Compositional matrix adjust.
 Identities = 191/346 (55%), Positives = 263/346 (76%), Gaps = 1/346 (0%)
 Frame = -2

Query  1310  IIAFLVLAGCSEAKIKLPNGLVVKAVIAFGDSIVDQGMNNNLSTMIKTNFPPYGQDFMGG  1131
             +  FL +    ++ +KLP  + V A++ FGDSI D G NNN+ T++K NFPPYG+DF GG
Sbjct  52    LFLFLTVVCSVKSSVKLPPNVTVPALLLFGDSIADAGNNNNIQTLVKCNFPPYGKDFEGG  111

Query  1130  KHTGRYSNGKTPPDLVAEELGIKELVPAYLDPHLQPEDIKTGVSFASGASGYDPQTAALM  951
               TGR+ NGK P D++A+ELGIK+ +PAYLD  + P+D+ TGV+FASG SG+DP T  L+
Sbjct  112   VPTGRFCNGKVPSDIIAKELGIKDTLPAYLDSTVLPQDLVTGVTFASGGSGFDPLTPKLV  171

Query  950   SVIPLSEQLKYFKEYLGKLNAMVGEKEAKSIINNTLFMVVSGSDDLANTYFTIGIRRYQY  771
             SVI LS+QLKY KEY+GKL AM+GE++ K I+ N+LF+VV+GSDD+ANTYFTI  R+ QY
Sbjct  172   SVISLSDQLKYLKEYIGKLEAMIGEEKTKFILKNSLFLVVAGSDDIANTYFTIRARKSQY  231

Query  770   DINSYTDLLLEGASNFLQELYSLGARRIGFFGIPPVGCLPSQRTLAGGSERECVENYNQA  591
             D+ +YTDL+   AS+F QELY LGARRIGFF  PPVGC+P+QRTLAGG+ER+C EN N+A
Sbjct  232   DVPAYTDLMANSASSFAQELYELGARRIGFFSAPPVGCVPAQRTLAGGAERKCAENLNEA  291

Query  590   AQLANAKFSAEIKILSKKLPNSKLIFIDIYEDFLDMIKNPAKYGFEVVNLGCCGTGTIEV  411
             A+L N+K S ++  L   LPN + ++ID+Y   LD+I+NP K GF+V + GCCGTG IEV
Sbjct  292   AKLFNSKLSKKMDSLGSSLPNGRFVYIDVYNLLLDLIQNPEKQGFQVADKGCCGTGDIEV  351

Query  410   TMLCNKLSGT-CPDRNKYLFWDSYHPTEKGYRIIVNRIITKYINSF  276
             ++LCN+ +   C + + ++FWDSYHPTE  Y+ +V+ ++ +++N F
Sbjct  352   SILCNQYTQVMCTNVSDHIFWDSYHPTESAYKALVSPLLGEHLNKF  397



>ref|XP_007225000.1| hypothetical protein PRUPE_ppa020405mg [Prunus persica]
 gb|EMJ26199.1| hypothetical protein PRUPE_ppa020405mg [Prunus persica]
Length=354

 Score =   421 bits (1081),  Expect = 4e-141, Method: Compositional matrix adjust.
 Identities = 196/337 (58%), Positives = 256/337 (76%), Gaps = 2/337 (1%)
 Frame = -2

Query  1280  SEAKIKLPNGLVVKAVIAFGDSIVDQGMNNNLSTMIKTNFPPYGQDFMGGKHTGRYSNGK  1101
             ++A +KLPN + +  V  FGDSIVD G NNNL+T++K+NF PYG+DFMGG  TGR+ NGK
Sbjct  12    AQAIVKLPNNVTIPGVFMFGDSIVDTGNNNNLTTLVKSNFLPYGRDFMGGLPTGRFGNGK  71

Query  1100  TPPDLVAEELGIKELVPAYLDPHLQPEDIKTGVSFASGASGYDPQTAALMSVIPLSEQLK  921
              P DL+ E+LGIKEL+PAYLDP LQ ED+ TGV+FASG +G+DP T+ LM VIPLSEQL+
Sbjct  72    VPSDLIVEDLGIKELLPAYLDPCLQAEDLPTGVNFASGGAGFDPLTSKLMLVIPLSEQLQ  131

Query  920   YFKEYLGKLNAMVGEKEAKSIINNTLFMVVSGSDDLANTYFTIGIRRYQYDINSYTDLLL  741
               KEY+ KL   VGE+ A SII+N+LF+V +GSDD+ NTY+    R ++YDI +YTDL+L
Sbjct  132   LLKEYIEKLKKYVGEERASSIISNSLFVVAAGSDDIVNTYYHTPARFWKYDIYAYTDLML  191

Query  740   EGASNFLQELYSLGARRIGFFGIPPVGCLPSQRTLAGGSERECVENYNQAAQLANAKFSA  561
               AS F+Q+LY+LGARRIG   +PP+GC+P+QRTL GG ER+CVE YN+AA+L N K SA
Sbjct  192   TEASAFVQKLYTLGARRIGVISVPPIGCIPAQRTLGGGPERKCVERYNEAAELFNKKLSA  251

Query  560   EIKIL-SKKLPNSKLIFIDIYEDFLDMIKNPAKYGFEVVNLGCCGTGTIEVTMLCNKLS-  387
             E+  L S +   +  +F+D+Y  FLD+I NP KYGFEV+N GCCGTG IEV   CN+ S 
Sbjct  252   ELDCLNSHQFHATVAVFMDVYGPFLDIIHNPKKYGFEVINRGCCGTGIIEVAAFCNQCSP  311

Query  386   GTCPDRNKYLFWDSYHPTEKGYRIIVNRIITKYINSF  276
              TC +   Y+FWDSYHP+E+ YRII ++++ K I +F
Sbjct  312   NTCKNATNYVFWDSYHPSERAYRIITHQVLHKSIQAF  348



>gb|AFK48612.1| unknown [Medicago truncatula]
Length=369

 Score =   421 bits (1082),  Expect = 6e-141, Method: Compositional matrix adjust.
 Identities = 195/336 (58%), Positives = 254/336 (76%), Gaps = 0/336 (0%)
 Frame = -2

Query  1280  SEAKIKLPNGLVVKAVIAFGDSIVDQGMNNNLSTMIKTNFPPYGQDFMGGKHTGRYSNGK  1101
             + A +KLP  + + A+IAFGDSI+D G NNN+ T++K NFPPYGQDF GG  TGR+ NGK
Sbjct  33    TNALVKLPPNVTIPALIAFGDSIMDTGNNNNIKTIVKCNFPPYGQDFEGGIPTGRFCNGK  92

Query  1100  TPPDLVAEELGIKELVPAYLDPHLQPEDIKTGVSFASGASGYDPQTAALMSVIPLSEQLK  921
              P DL+ EELGIKEL+PAYLDP+L+P D+ TGV FASGASGYDP T  ++SVI + +QLK
Sbjct  93    NPSDLIVEELGIKELLPAYLDPNLKPSDLSTGVCFASGASGYDPLTPKIVSVISMGDQLK  152

Query  920   YFKEYLGKLNAMVGEKEAKSIINNTLFMVVSGSDDLANTYFTIGIRRYQYDINSYTDLLL  741
              FKEY+ KL  +VGE  A  I+ NTLF++V+GSDDLANTYFTI  R+  YD+ +Y DL++
Sbjct  153   MFKEYIVKLKGVVGENRANFILANTLFLIVAGSDDLANTYFTIRTRQLHYDVPAYADLMV  212

Query  740   EGASNFLQELYSLGARRIGFFGIPPVGCLPSQRTLAGGSERECVENYNQAAQLANAKFSA  561
             +GAS+F++E+Y LGARRIG F   P+G LPSQ+TL GG  R+  E YN+AA+L N+K S 
Sbjct  213   KGASDFIKEIYKLGARRIGVFSAAPIGYLPSQKTLGGGVFRKTNEKYNEAAKLFNSKLSK  272

Query  560   EIKILSKKLPNSKLIFIDIYEDFLDMIKNPAKYGFEVVNLGCCGTGTIEVTMLCNKLSGT  381
             E+  L   LPNS +I+IDIY   LD+I  P KYG++V + GCCGTG +EV++LCN LS T
Sbjct  273   ELDYLHSNLPNSNVIYIDIYSPLLDIILKPQKYGYKVADKGCCGTGKLEVSVLCNPLSAT  332

Query  380   CPDRNKYLFWDSYHPTEKGYRIIVNRIITKYINSFT  273
             CPD ++Y+FWDS+HPTE  YR +V  ++ KY+   T
Sbjct  333   CPDNSEYIFWDSHHPTESVYRKLVAVVLPKYVGRLT  368



>ref|XP_007136105.1| hypothetical protein PHAVU_009G018200g [Phaseolus vulgaris]
 gb|ESW08099.1| hypothetical protein PHAVU_009G018200g [Phaseolus vulgaris]
Length=362

 Score =   420 bits (1079),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 200/345 (58%), Positives = 258/345 (75%), Gaps = 2/345 (1%)
 Frame = -2

Query  1310  IIAFLVLAGCSEAKIKLPNGLVVKAVIAFGDSIVDQGMNNNLSTMIKTNFPPYGQDFMGG  1131
             +I  LVL+  S+  +KLP  + + AVI FGDSI+D G NN + T++K NFPPYG+DF GG
Sbjct  19    VILLLVLSMRSKGLVKLPANVSIPAVIGFGDSIIDPGNNNKVKTLVKCNFPPYGKDFQGG  78

Query  1130  KHTGRYSNGKTPPDLVAEELGIKELVPAYLDPHLQPEDIKTGVSFASGASGYDPQTAALM  951
               TGR+ NGK P DL+ EELGIK L+PAYLDP+L+P+D+ TGV FASGASGYDP T  + 
Sbjct  79    P-TGRFCNGKIPSDLLVEELGIKNLLPAYLDPNLKPDDLVTGVCFASGASGYDPLTPKIA  137

Query  950   SVIPLSEQLKYFKEYLGKLNAMVGEKEAKSIINNTLFMVVSGSDDLANTYFTIGIRRYQY  771
             SVI +SEQ++ FKEY+GKL  +VG      I+ N+ F+VV+GSDD+ANTYF    R+ QY
Sbjct  138   SVISMSEQIEMFKEYIGKLKQIVGVDRTNFILANSFFLVVAGSDDIANTYFVARARQLQY  197

Query  770   DINSYTDLLLEGASNFLQELYSLGARRIGFFGIPPVGCLPSQRTLAGGSERECVENYNQA  591
             DI +YTDL+   AS+F++ELY LGARRIG  G PP+GC+PSQRTLAGG EREC E YN A
Sbjct  198   DIPAYTDLMCNSASDFVKELYGLGARRIGVLGAPPIGCVPSQRTLAGGLERECAEEYNYA  257

Query  590   AQLANAKFSAEIKILSKKLPNSKLIFIDIYEDFLDMIKNPAKYGFEVVNLGCCGTGTIEV  411
             A+L N+K S ++  LS  LPNS++++IDIY   +D+I N  +YG+EV++ GCCGTG +EV
Sbjct  258   AKLFNSKLSRKLDSLS-HLPNSRIVYIDIYNPLMDIIVNYHRYGYEVMDSGCCGTGKLEV  316

Query  410   TMLCNKLSGTCPDRNKYLFWDSYHPTEKGYRIIVNRIITKYINSF  276
              +LCN L  TC D +KY+FWDSYHPTEK YR +V  I+  YI+ F
Sbjct  317   AVLCNHLDSTCSDASKYVFWDSYHPTEKVYRQLVAGILQNYISRF  361



>ref|XP_002279335.1| PREDICTED: GDSL esterase/lipase EXL3 [Vitis vinifera]
Length=356

 Score =   419 bits (1077),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 204/350 (58%), Positives = 261/350 (75%), Gaps = 7/350 (2%)
 Frame = -2

Query  1310  IIAFLV---LAGCSE-AKIKLPNGLVVKAVIAFGDSIVDQGMNNNLSTMIKTNFPPYGQD  1143
             +I F V   ++ CS  A +KLP    + AVI FGDSIVD G NNNL T+ K+N+PPYG+D
Sbjct  8     VIPFFVSVFISLCSTGALVKLPENGTIPAVIVFGDSIVDAGNNNNLVTVAKSNYPPYGRD  67

Query  1142  FMGGKHTGRYSNGKTPPDLVAEELGIKELVPAYLDPHLQPEDIKTGVSFASGASGYDPQT  963
             F GG  TGR+SNGK P D++AE LGIK+L+PAYLDP LQP D+ TGVSFASGASGYDP T
Sbjct  68    FSGGIPTGRFSNGKIPSDIIAELLGIKKLLPAYLDPTLQPSDLLTGVSFASGASGYDPLT  127

Query  962   AALMSVIPLSEQLKYFKEYLGKLNAMVGEKEAKSIINNTLFMVVSGSDDLANTYFTIGIR  783
             + + SV  LS+QL+ FKEY+GKL AMVGE+   +I++ +LF+VV  S+D+ +TYFT  +R
Sbjct  128   SKIPSVFSLSDQLEMFKEYIGKLKAMVGEERTNTILSKSLFLVVHSSNDITSTYFT--VR  185

Query  782   RYQYDINSYTDLLLEGASNFLQELYSLGARRIGFFGIPPVGCLPSQRTLAGGSERECVEN  603
             + QYD  SY D+L+  AS+FL+ELY LGARRI  FG PP+GCLPSQR+LAGG +REC EN
Sbjct  186   KEQYDFASYADILVTLASSFLKELYGLGARRIAVFGAPPLGCLPSQRSLAGGIQRECAEN  245

Query  602   YNQAAQLANAKFSAEIKILSKKLPNSKLIFIDIYEDFLDMIKNPAKYGFEVVNLGCCGTG  423
              N+AA+L N + S+E+  L+   P +K +++DIY   LD+I+NP K GFEV N GCCGTG
Sbjct  246   LNEAAKLFNTQLSSELDSLNTNFPLAKFVYVDIYNPLLDIIQNPQKSGFEVANKGCCGTG  305

Query  422   TIEVTMLCNKLSG-TCPDRNKYLFWDSYHPTEKGYRIIVNRIITKYINSF  276
             TIE  +LCN+ +  TC D  KY+FWDSYHPTEK Y+I+    I KY+ SF
Sbjct  306   TIESVLLCNRFNPFTCKDVTKYVFWDSYHPTEKVYKILSGGFIPKYVGSF  355



>ref|XP_010266839.1| PREDICTED: GDSL esterase/lipase EXL3-like [Nelumbo nucifera]
Length=688

 Score =   431 bits (1107),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 196/335 (59%), Positives = 261/335 (78%), Gaps = 1/335 (0%)
 Frame = -2

Query  1277  EAKIKLPNGLVVKAVIAFGDSIVDQGMNNNLSTMIKTNFPPYGQDFMGGKHTGRYSNGKT  1098
             +A++ LP    V A+I FGDSIVD G NNNL+T++K NF PYG+DFMGG  TGR+SNGK 
Sbjct  353   DARLTLPYNATVPALIVFGDSIVDSGNNNNLATLVKCNFSPYGKDFMGGIPTGRFSNGKI  412

Query  1097  PPDLVAEELGIKELVPAYLDPHLQPEDIKTGVSFASGASGYDPQTAALMSVIPLSEQLKY  918
             P DL+A+ LGIK+L+PAYLDP+L+ ED+ TGV+FASG +G+DP T  + +V+ LS+QL+ 
Sbjct  413   PSDLIADSLGIKQLLPAYLDPNLRTEDLLTGVTFASGGTGFDPLTPKVAAVLSLSKQLEL  472

Query  917   FKEYLGKLNAMVGEKEAKSIINNTLFMVVSGSDDLANTYFTIGIRRYQYDINSYTDLLLE  738
             FKEY+G+LN  VGE+ + +II+ ++++V +GSDDLANTYFT   R+  YD+ SYTDL+L+
Sbjct  473   FKEYVGRLNLAVGEERSATIISESMYIVCAGSDDLANTYFTTPFRKLSYDVPSYTDLMLQ  532

Query  737   GASNFLQELYSLGARRIGFFGIPPVGCLPSQRTLAGGSERECVENYNQAAQLANAKFSAE  558
              AS+F+QELY LGARRIG   IPP+GC+PSQRTL GG +R C ENYN+AA+L N K S+E
Sbjct  533   SASSFVQELYGLGARRIGLISIPPIGCVPSQRTLGGGKDRSCAENYNEAAKLFNTKLSSE  592

Query  557   IKILSKKLPNSKLIFIDIYEDFLDMIKNPAKYGFEVVNLGCCGTGTIEVTMLCNKLSG-T  381
             +  L ++LP S+L++ID+Y   LD+I+ P  YGFEV+N GCCGTG IEV +LCN L   T
Sbjct  593   LNSLKQQLPQSRLVYIDVYYRILDIIQRPQNYGFEVINKGCCGTGKIEVAVLCNDLDPLT  652

Query  380   CPDRNKYLFWDSYHPTEKGYRIIVNRIITKYINSF  276
             C D + Y+FWDSYHPTEK YR +V  +++K+IN F
Sbjct  653   CLDVSNYVFWDSYHPTEKAYRSVVEPVLSKHINEF  687


 Score =   357 bits (915),  Expect = 8e-112, Method: Compositional matrix adjust.
 Identities = 169/323 (52%), Positives = 230/323 (71%), Gaps = 16/323 (5%)
 Frame = -2

Query  1211  VDQGMNNNLSTMIKTNFPPYGQDFMGGKHTGRYSNGKTPPDLVAEELGIKELVPAYLDPH  1032
             +D G NN + ++ K NF PYG+DF+GG  TGR+SNGK P D +AE  G+KEL+P YLDP 
Sbjct  1     MDTGNNNYIVSLAKCNFSPYGRDFVGGIPTGRFSNGKVPSDFLAEGFGVKELLPPYLDPD  60

Query  1031  LQPEDIKTGVSFASGASGYDPQTAALMSVIPLSEQLKYFKEYLGKLNAMVGEKEAKSIIN  852
             LQ +D+ TGV+FASG +GYDP T+ + + I LS+QLK FKEY+GKL   VGE+   +I++
Sbjct  61    LQTQDLITGVNFASGGAGYDPLTSQIETAISLSKQLKLFKEYIGKLKEAVGEERTATILS  120

Query  851   NTLFMVVSGSDDLANTYFTIGIRRYQYDINSYTDLLLEGASNFLQ---------------  717
              +++++  GS+D+   YF    RR  YD++++TDLLL+ AS FLQ               
Sbjct  121   ESIYIMCVGSNDVTINYFFAPFRRPNYDVSAFTDLLLQFASTFLQVFLANFYSSSFFLLF  180

Query  716   ELYSLGARRIGFFGIPPVGCLPSQRTLAGGSERECVENYNQAAQLANAKFSAEIKILSKK  537
             ELY LGARRIG F IPP+GC+PSQRTLAGG  ++CV+N NQA ++ NAK S+E+  L+ K
Sbjct  181   ELYGLGARRIGVFNIPPIGCVPSQRTLAGGKHKDCVDNLNQAXEMFNAKLSSELISLTNK  240

Query  536   LPNSKLIFIDIYEDFLDMIKNPAKYGFEVVNLGCCGTGTIEVTMLCNKLSG-TCPDRNKY  360
             L +S L++ID+Y   LD+I+ P  YGFE ++ GCCGTG IE T+LCN LS  TC + +KY
Sbjct  241   LSHSTLVYIDVYSSLLDIIQRPQDYGFEEISKGCCGTGKIEATILCNDLSPFTCKNASKY  300

Query  359   LFWDSYHPTEKGYRIIVNRIITK  291
             LFWDS+HPTE GY+I ++ I+ K
Sbjct  301   LFWDSFHPTEAGYKIYISWILNK  323



>ref|XP_009757107.1| PREDICTED: uncharacterized protein LOC104210014 [Nicotiana sylvestris]
Length=717

 Score =   431 bits (1109),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 208/340 (61%), Positives = 264/340 (78%), Gaps = 3/340 (1%)
 Frame = -2

Query  1307  IAFLVLAGCSEAKIKLPNGLVVKAVIAFGDSIVDQGMNNNLSTMIKTNFPPYGQDFMGGK  1128
             +  L+ + C EAK++LP G+ +KAV AFGDSIVDQG NNNL+T  K NF PYG+DFMGGK
Sbjct  19    VVILLFSAC-EAKLQLPQGVNIKAVFAFGDSIVDQGNNNNLTTRAKCNFLPYGKDFMGGK  77

Query  1127  HTGRYSNGKTPPDLVAEELGIKELVPAYLDPHLQPEDIKTGVSFASGASGYDPQTAALMS  948
              TGR+SN KTPPD++ EELGIKEL+PAY DP+L+ ED+KTGVSFASGASGYD  TA   +
Sbjct  78    PTGRFSNAKTPPDMIVEELGIKELMPAYFDPNLKVEDLKTGVSFASGASGYDLLTAITAT  137

Query  947   VIPLSEQLKYFKEYLGKLNAMVGEKEAKSIINNTLFMVVSGSDDLANTYFTIGI-RRYQY  771
              IPLS QL  F++Y  KL  ++GE+EA  I+ N+LF+VV+GSDDL NTYFT+ I R++QY
Sbjct  138   AIPLSAQLLLFQQYKLKLEGLIGEEEANYIVKNSLFLVVTGSDDLVNTYFTLKIPRKWQY  197

Query  770   DINSYTDLLLEGASNFLQELYSLGARRIGFFGIPPVGCLPSQRTLAGGSERECVENYNQA  591
             +I+SYT+L++ GASNF+Q+LY+LGAR+I  FGIPP+GCLPSQR  +GG  R CVE YNQA
Sbjct  198   NIDSYTNLMVNGASNFVQDLYTLGARKIWVFGIPPIGCLPSQRQKSGGLARVCVEEYNQA  257

Query  590   AQLANAKFSAEIKILSKKLPNSKLIFIDIYEDFLDMIKNPAKYGFEVVNLGCCGTGTIEV  411
             AQLAN K +A+I  LS+ LP S+L+FI+IY+  LD+I NP KYGFE V   CC  G  + 
Sbjct  258   AQLANTKLAAKIDSLSEILPQSELVFINIYDPLLDLIDNPDKYGFEEVKRCCCRPGKNKF  317

Query  410   TMLCNKLSGTCPDRNKYLFWDSYHPTEKGYRIIVNRIITK  291
              +LCN  + TC D  KYLFWD YH TEKGYR++V++I  +
Sbjct  318   -LLCNNHTKTCEDDTKYLFWDGYHLTEKGYRVLVDQIFKE  356


 Score =   410 bits (1055),  Expect = 3e-132, Method: Compositional matrix adjust.
 Identities = 193/345 (56%), Positives = 257/345 (74%), Gaps = 3/345 (1%)
 Frame = -2

Query  1310  IIAFLVLAGCSEAKIKLPNGLVVKAVIAFGDSIVDQGMNNNLSTMIKTNFPPYGQDFMGG  1131
             ++ + +L    +A  ++P    + AVI FGDSIVD G NN L T+ K N+PPYGQDFMGG
Sbjct  375   LVCYSLLLCYVKAVTRIPYNESIPAVIVFGDSIVDTGNNNGLKTVSKVNYPPYGQDFMGG  434

Query  1130  KHTGRYSNGKTPPDLVAEELGIKELVPAYLDPHLQPEDIKTGVSFASGASGYDPQTAALM  951
             K TGR+SNGK P DL+ EELGIKEL+PAYLDP LQP D+ TGV+FASG +GYDP T+ L 
Sbjct  435   KPTGRFSNGKVPADLIVEELGIKELLPAYLDPTLQPVDLITGVNFASGGAGYDPLTSELA  494

Query  950   SVIPLSEQLKYFKEYLGKLNAMVGEKEAKSIINNTLFMVVSGSDDLANTYFTIGIRRYQY  771
              VI LS QL+ FKEY+ KL  +VGE     I+ N+LF++V+G++D+ NTYF   +R+  Y
Sbjct  495   KVISLSRQLEMFKEYILKLREIVGEDRKNEILANSLFILVTGTNDIINTYFNTPLRKSYY  554

Query  770   DINSYTDLLLEGASNFLQELYSLGARRIGFFGIPPVGCLPSQRTLAGGSERECVENYNQA  591
             D++SY DLL+  AS+F+Q+LY LGARRIG FGIPP+GCLPSQRTL GG ERECV+  NQA
Sbjct  555   DVSSYADLLVRSASSFVQDLYGLGARRIGVFGIPPIGCLPSQRTLRGGEERECVDYLNQA  614

Query  590   AQLANAKFSAEIKILSKKLPNSKLIFIDIYEDFLDMIKNPAKYGFEVVNLGCCGTGTIEV  411
             AQL N+K +AE+  L  K P+S+++++D+Y   LD+I NP KYGF++ + GCCGTG IEV
Sbjct  615   AQLFNSKLAAELSSLGNKFPDSRMVYVDVYNLPLDVIYNPQKYGFKISDKGCCGTGKIEV  674

Query  410   TMLCNKLSGTCPDRNKYLFWDSYHPTEKGYRIIVNRIITKYINSF  276
               LC   + TC   + Y+FWDS+H TEK YR +V++I+ ++++SF
Sbjct  675   AELC---TFTCSSDSDYVFWDSFHLTEKAYRQLVHQILAQHLSSF  716



>ref|XP_008387913.1| PREDICTED: GDSL esterase/lipase EXL3-like [Malus domestica]
Length=362

 Score =   418 bits (1075),  Expect = 5e-140, Method: Compositional matrix adjust.
 Identities = 199/330 (60%), Positives = 249/330 (75%), Gaps = 2/330 (1%)
 Frame = -2

Query  1268  IKLPNGLVVKAVIAFGDSIVDQGMNN-NLSTMIKTNFPPYGQDFMGGKHTGRYSNGKTPP  1092
             +KLP    + AV  FGDSIVD G NN NL T  + NFPPYG++F GG  TGRYSNGK P 
Sbjct  29    VKLPPNATIPAVFMFGDSIVDTGNNNVNLKTPARCNFPPYGREFEGGISTGRYSNGKVPS  88

Query  1091  DLVAEELGIKELVPAYLDPHLQPEDIKTGVSFASGASGYDPQTAALMSVIPLSEQLKYFK  912
             DL+ E+LGIKEL+PAYLDP+LQP D+ TGVSFA GA+GYDP TA +++V PL +QL+ F+
Sbjct  89    DLIVEKLGIKELLPAYLDPNLQPNDLLTGVSFAVGATGYDPMTAQIVAVTPLFDQLRQFE  148

Query  911   EYLGKLNAMVGEKEAKSIINNTLFMVVSGSDDLANTYFTIGIRRYQYDINSYTDLLLEGA  732
             EY+GKL  +VGE+ A  I+ N+L  VV+ S+D+ANTYF  G+R+ +YD+ SYTDL+L  A
Sbjct  149   EYIGKLKGIVGEERANFILANSLCFVVASSNDIANTYFVAGVRKLEYDVPSYTDLMLNQA  208

Query  731   SNFLQELYSLGARRIGFFGIPPVGCLPSQRTLAGGSERECVENYNQAAQLANAKFSAEIK  552
             S+F + LY+LGARRIG F  PP+GCLPSQRTL GG ER+C +  NQAA L N+K SAE+ 
Sbjct  209   SDFFKGLYALGARRIGVFSAPPIGCLPSQRTLGGGVERDCADKPNQAAMLFNSKLSAELD  268

Query  551   ILSKKLPNSKLIFIDIYEDFLDMIKNPAKYGFEVVNLGCCGTGTIEVTMLCNKLS-GTCP  375
              L   LPNS LI++DIY   LDMI NP  YGFEV N GCCG+G +EV++LCN+    TC 
Sbjct  269   DLKNNLPNSMLIYVDIYNPLLDMIINPTNYGFEVSNKGCCGSGKLEVSILCNRFEPETCT  328

Query  374   DRNKYLFWDSYHPTEKGYRIIVNRIITKYI  285
             D + YLFWDSYHPTE  Y+IIV+ +ITKY+
Sbjct  329   DDSHYLFWDSYHPTEGAYKIIVDELITKYL  358



>emb|CBI19910.3| unnamed protein product [Vitis vinifera]
Length=359

 Score =   417 bits (1072),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 201/338 (59%), Positives = 255/338 (75%), Gaps = 4/338 (1%)
 Frame = -2

Query  1283  CSE-AKIKLPNGLVVKAVIAFGDSIVDQGMNNNLSTMIKTNFPPYGQDFMGGKHTGRYSN  1107
             CS  A +KLP    + AVI FGDSIVD G NNNL T+ K+N+PPYG+DF GG  TGR+SN
Sbjct  23    CSTGALVKLPENGTIPAVIVFGDSIVDAGNNNNLVTVAKSNYPPYGRDFSGGIPTGRFSN  82

Query  1106  GKTPPDLVAEELGIKELVPAYLDPHLQPEDIKTGVSFASGASGYDPQTAALMSVIPLSEQ  927
             GK P D++AE LGIK+L+PAYLDP LQP D+ TGVSFASGASGYDP T+ + SV  LS+Q
Sbjct  83    GKIPSDIIAELLGIKKLLPAYLDPTLQPSDLLTGVSFASGASGYDPLTSKIPSVFSLSDQ  142

Query  926   LKYFKEYLGKLNAMVGEKEAKSIINNTLFMVVSGSDDLANTYFTIGIRRYQYDINSYTDL  747
             L+ FKEY+GKL AMVGE+   +I++ +LF+VV  S+D+ +TYFT  +R+ QYD  SY D+
Sbjct  143   LEMFKEYIGKLKAMVGEERTNTILSKSLFLVVHSSNDITSTYFT--VRKEQYDFASYADI  200

Query  746   LLEGASNFLQELYSLGARRIGFFGIPPVGCLPSQRTLAGGSERECVENYNQAAQLANAKF  567
             L+  AS+FL+ELY LGARRI  FG PP+GCLPSQR+LAGG +REC EN N+AA+L N + 
Sbjct  201   LVTLASSFLKELYGLGARRIAVFGAPPLGCLPSQRSLAGGIQRECAENLNEAAKLFNTQL  260

Query  566   SAEIKILSKKLPNSKLIFIDIYEDFLDMIKNPAKYGFEVVNLGCCGTGTIEVTMLCNKLS  387
             S+E+  L+   P +K +++DIY   LD+I+NP K GFEV N GCCGTGTIE  +LCN+ +
Sbjct  261   SSELDSLNTNFPLAKFVYVDIYNPLLDIIQNPQKSGFEVANKGCCGTGTIESVLLCNRFN  320

Query  386   G-TCPDRNKYLFWDSYHPTEKGYRIIVNRIITKYINSF  276
               TC D  KY+FWDSYHPTEK Y+I+    I KY+ SF
Sbjct  321   PFTCKDVTKYVFWDSYHPTEKVYKILSGGFIPKYVGSF  358



>gb|KDO84926.1| hypothetical protein CISIN_1g017687mg [Citrus sinensis]
Length=367

 Score =   417 bits (1072),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 203/346 (59%), Positives = 260/346 (75%), Gaps = 3/346 (1%)
 Frame = -2

Query  1307  IAFLVLAGCSEAKIKLPNGLVVKAVIAFGDSIVDQGMNNNLSTMIKTNFPPYGQDFMGGK  1128
             ++ L L   +EA IKLP  + V AVI FGDSIVD G NNNL T  K NFPPYG+DF GG 
Sbjct  22    VSVLDLFRRTEAVIKLPGNVTVSAVIVFGDSIVDTGNNNNLKTPAKCNFPPYGRDFEGGA  81

Query  1127  HTGRYSNGKTPPDLVAEELGIKELVPAYLDPHLQPEDIKTGVSFASGASGYDPQTAAL-M  951
              TGR+SNGK P D++AEELG+KEL PAYLDP L+PED+ TGV+FASG  GYDP T  L  
Sbjct  82    ATGRFSNGKVPSDILAEELGVKELSPAYLDPTLKPEDLLTGVNFASGGCGYDPLTTRLSA  141

Query  950   SVIPLSEQLKYFKEYLGKLNAMVGEKEAKSIINNTLFMVVSGSDDLANTYFTIGIRRYQY  771
             + + LS+QL+ FKEY+ KL A+VGE+    I   + F+VV GS+D+ N YF   IRR QY
Sbjct  142   AALSLSDQLQLFKEYIDKLRAIVGEEGKNRIFETSFFLVVVGSNDINNNYFGSRIRRLQY  201

Query  770   DINSYTDLLLEGASNFLQELYSLGARRIGFFGIPPVGCLPSQRTLAGGSERECVENYNQA  591
             DI++YTDLL+  AS FL+E+Y LGARRIG FG P +GCLPS RT+AGG +R+C + YN+A
Sbjct  202   DISTYTDLLVGHASTFLKEIYGLGARRIGVFGAPTLGCLPSTRTVAGGIKRDCAKEYNEA  261

Query  590   AQLANAKFSAEIKILSKKLPNSKLIFIDIYEDFLDMIKNPAKYGFEVVNLGCCGTGTIEV  411
             AQL N+K SAE+  L+  LP+ ++++IDIY   LD+I+NP KYGF++V+ GCCGTGTIEV
Sbjct  262   AQLFNSKLSAELDSLN-NLPDVRIVYIDIYSPLLDIIQNPNKYGFDIVDKGCCGTGTIEV  320

Query  410   TMLCNKLSG-TCPDRNKYLFWDSYHPTEKGYRIIVNRIITKYINSF  276
              +LCN+ S  TC + + YLFWDS+HPTEK Y+I+V+ ++ KYIN F
Sbjct  321   IILCNQFSPYTCTNDSGYLFWDSFHPTEKAYKILVSNLVKKYINRF  366



>gb|AFK34909.1| unknown [Lotus japonicus]
Length=364

 Score =   416 bits (1070),  Expect = 3e-139, Method: Compositional matrix adjust.
 Identities = 195/344 (57%), Positives = 253/344 (74%), Gaps = 0/344 (0%)
 Frame = -2

Query  1307  IAFLVLAGCSEAKIKLPNGLVVKAVIAFGDSIVDQGMNNNLSTMIKTNFPPYGQDFMGGK  1128
             I  LVL   ++A +KLP  + V AV+AFGD IVD G NN + T++K NFPPYG+DF GG 
Sbjct  20    ILLLVLTSRTKAVVKLPPNVEVPAVMAFGDPIVDPGNNNKIKTLVKCNFPPYGKDFEGGN  79

Query  1127  HTGRYSNGKTPPDLVAEELGIKELVPAYLDPHLQPEDIKTGVSFASGASGYDPQTAALMS  948
              TGR+ NGK P DL+AEELGIKEL+PAY  P+L+P D+ TGVSFASGASGYDP T  + S
Sbjct  80    PTGRFCNGKIPSDLLAEELGIKELLPAYKQPNLKPSDLLTGVSFASGASGYDPLTPKIAS  139

Query  947   VIPLSEQLKYFKEYLGKLNAMVGEKEAKSIINNTLFMVVSGSDDLANTYFTIGIRRYQYD  768
             VI +S+QL  FKEY+GKL  +VGE     II N+L +VV+GSDD+ANTYF   +R+  YD
Sbjct  140   VISMSDQLDMFKEYIGKLKNIVGENRTNYIIANSLMLVVAGSDDIANTYFIARVRQLHYD  199

Query  767   INSYTDLLLEGASNFLQELYSLGARRIGFFGIPPVGCLPSQRTLAGGSERECVENYNQAA  588
             + +YTDL++  AS F++ELY LGARRIG    PP+GC+PSQRTLAGG  REC   YN AA
Sbjct  200   VPAYTDLMVNSASQFVKELYILGARRIGVISAPPIGCVPSQRTLAGGIHRECSGKYNDAA  259

Query  587   QLANAKFSAEIKILSKKLPNSKLIFIDIYEDFLDMIKNPAKYGFEVVNLGCCGTGTIEVT  408
             +L N+K S E+  L    PNS++++IDIY   LD+I N  KYGF+V + GCCGTG +EV+
Sbjct  260   KLFNSKLSKELDSLHHNSPNSRIVYIDIYNPLLDIIVNYQKYGFKVADKGCCGTGLLEVS  319

Query  407   MLCNKLSGTCPDRNKYLFWDSYHPTEKGYRIIVNRIITKYINSF  276
             +LCN L  +C D ++Y+FWDSYHPTE  YR ++++++ KY+N  
Sbjct  320   ILCNPLGDSCSDASQYVFWDSYHPTEVVYRKLIDQVLQKYLNRL  363



>emb|CBI19913.3| unnamed protein product [Vitis vinifera]
Length=346

 Score =   416 bits (1068),  Expect = 3e-139, Method: Compositional matrix adjust.
 Identities = 192/332 (58%), Positives = 251/332 (76%), Gaps = 1/332 (0%)
 Frame = -2

Query  1268  IKLPNGLVVKAVIAFGDSIVDQGMNNNLSTMIKTNFPPYGQDFMGGKHTGRYSNGKTPPD  1089
             I LP      AV+ FGDSIVD G NNNLST++K NFPPYG+DF+GG  TGR+SNGK PPD
Sbjct  14    IFLPRNETFPAVLVFGDSIVDPGNNNNLSTVVKCNFPPYGRDFVGGFPTGRFSNGKIPPD  73

Query  1088  LVAEELGIKELVPAYLDPHLQPEDIKTGVSFASGASGYDPQTAALMSVIPLSEQLKYFKE  909
              +AEELGIK L+P Y  P LQ  D+ TGVSFAS  SG+DP T  L+SV+ L +QL  FKE
Sbjct  74    FIAEELGIKNLLPPYSSPSLQLGDLLTGVSFASSGSGFDPLTPKLVSVLSLRDQLGMFKE  133

Query  908   YLGKLNAMVGEKEAKSIINNTLFMVVSGSDDLANTYFTIGIRRYQYDINSYTDLLLEGAS  729
             Y+GKL  MVGE+   +I++ +LF+VV+GSDD+AN+YF IG+R+ QYD+ +YTD +   A+
Sbjct  134   YIGKLKVMVGEERTNTILSKSLFLVVAGSDDIANSYFVIGVRKRQYDVPAYTDFMATSAA  193

Query  728   NFLQELYSLGARRIGFFGIPPVGCLPSQRTLAGGSERECVENYNQAAQLANAKFSAEIKI  549
             +FL+ELY LGARRIG    PP+GCLPSQR+LAGG +REC E++N+AA+L N K S+++  
Sbjct  194   SFLKELYGLGARRIGVASAPPLGCLPSQRSLAGGKQRECAEDHNEAAKLFNTKLSSQLDS  253

Query  548   LSKKLPNSKLIFIDIYEDFLDMIKNPAKYGFEVVNLGCCGTGTIEVTMLCNKLSG-TCPD  372
             L+   P +K ++IDIY+ FLD+I+NP K GFEVV+ GCCGTG IE   LC+ LS  TC D
Sbjct  254   LNANSPQAKFVYIDIYKPFLDLIQNPQKSGFEVVDKGCCGTGRIEAAALCSLLSSFTCED  313

Query  371   RNKYLFWDSYHPTEKGYRIIVNRIITKYINSF  276
              + Y+FWDSYHPTE+ Y++I+ +II K ++ F
Sbjct  314   ASNYVFWDSYHPTERAYKVIIEKIIQKCVDGF  345



>ref|XP_006435222.1| hypothetical protein CICLE_v10001561mg [Citrus clementina]
 gb|ESR48462.1| hypothetical protein CICLE_v10001561mg [Citrus clementina]
Length=369

 Score =   416 bits (1070),  Expect = 4e-139, Method: Compositional matrix adjust.
 Identities = 195/346 (56%), Positives = 251/346 (73%), Gaps = 1/346 (0%)
 Frame = -2

Query  1310  IIAFLVLAGCSEAKIKLPNGLVVKAVIAFGDSIVDQGMNNNLSTMIKTNFPPYGQDFMGG  1131
             + +  VL   +EA IKLP  + + AVI FGDSIVD G NNNL T  K NFPPYG+DFMGG
Sbjct  17    LFSVFVLVVSTEAVIKLPGNVTIPAVIVFGDSIVDAGNNNNLKTPAKCNFPPYGRDFMGG  76

Query  1130  KHTGRYSNGKTPPDLVAEELGIKELVPAYLDPHLQPEDIKTGVSFASGASGYDPQTAALM  951
               TGR+SNGK P DL+ EELGIKEL+PAYL P+LQPED+ TGV+FASG  GYDP T  L 
Sbjct  77    VSTGRFSNGKVPSDLIVEELGIKELLPAYLQPNLQPEDLLTGVTFASGGCGYDPLTTELA  136

Query  950   SVIPLSEQLKYFKEYLGKLNAMVGEKEAKSIINNTLFMVVSGSDDLANTYFTIGIRRYQY  771
             S IPLS+QL+ FKEY  K+  +VGE+    I+     +VV+GS+D+ NTYF   +R+ QY
Sbjct  137   SAIPLSDQLQLFKEYTEKVKQIVGEEGQNRIMKTAFVLVVAGSNDIDNTYFASRVRKLQY  196

Query  770   DINSYTDLLLEGASNFLQELYSLGARRIGFFGIPPVGCLPSQRTLAGGSERECVENYNQA  591
             DI++YTDL++  AS F +ELY LG RR+G F  PP+GCLPS RTL GG  R+C  +YN+A
Sbjct  197   DISAYTDLIVGLASTFFKELYGLGVRRMGVFSAPPLGCLPSSRTLGGGKTRDCANDYNEA  256

Query  590   AQLANAKFSAEIKILSKKLPNSKLIFIDIYEDFLDMIKNPAKYGFEVVNLGCCGTGTIEV  411
             AQ+ N K SAE+  L+ + P+++L+ IDIY   L +I+NP KYGFEVVN GCCGTGT+E 
Sbjct  257   AQMFNTKLSAELDSLNIQFPDARLLLIDIYNPLLYLIQNPIKYGFEVVNKGCCGTGTLEA  316

Query  410   TMLCNKLS-GTCPDRNKYLFWDSYHPTEKGYRIIVNRIITKYINSF  276
             ++ CN+ S  TC + + Y+FWD YHPTE+ Y+I+V+ +I K  N F
Sbjct  317   SIFCNQFSLNTCTNVSGYIFWDGYHPTERTYKILVSSLINKIANGF  362



>ref|XP_010266339.1| PREDICTED: GDSL esterase/lipase EXL3-like [Nelumbo nucifera]
Length=373

 Score =   415 bits (1067),  Expect = 1e-138, Method: Compositional matrix adjust.
 Identities = 191/332 (58%), Positives = 252/332 (76%), Gaps = 1/332 (0%)
 Frame = -2

Query  1268  IKLPNGLVVKAVIAFGDSIVDQGMNNNLSTMIKTNFPPYGQDFMGGKHTGRYSNGKTPPD  1089
             + LP+ + + A+I FGDSIVD G NNNL T +K NFPPYG+DFMGG  TGR+SNG+ P D
Sbjct  41    VALPHNVTIPALIVFGDSIVDTGNNNNLLTAVKCNFPPYGRDFMGGIPTGRFSNGRVPSD  100

Query  1088  LVAEELGIKELVPAYLDPHLQPEDIKTGVSFASGASGYDPQTAALMSVIPLSEQLKYFKE  909
             L+ +E+GIKEL+PAYLDP LQ ED+ TGVSFASG +G+DP TA   SV+ L +QL+ FKE
Sbjct  101   LLVQEIGIKELLPAYLDPDLQTEDLHTGVSFASGGAGFDPLTAQASSVLSLPKQLELFKE  160

Query  908   YLGKLNAMVGEKEAKSIINNTLFMVVSGSDDLANTYFTIGIRRYQYDINSYTDLLLEGAS  729
             Y+GKLN  VGE+ + +I++ +L+++ +GSDD+ANTYF    RR  YDI SYTDL+++ AS
Sbjct  161   YIGKLNEAVGEERSSTIVSESLYVIGAGSDDIANTYFGATFRRLHYDIPSYTDLMVQEAS  220

Query  728   NFLQELYSLGARRIGFFGIPPVGCLPSQRTLAGGSERECVENYNQAAQLANAKFSAEIKI  549
              F+QELY LG RRIG F  PP+GC+PSQRT AGG  REC E YNQ A+L NAK S+++  
Sbjct  221   GFVQELYELGGRRIGVFSSPPIGCVPSQRTQAGGIYRECAEEYNQVARLFNAKLSSQLNS  280

Query  548   LSKKLPNSKLIFIDIYEDFLDMIKNPAKYGFEVVNLGCCGTGTIEVTMLCNKLSG-TCPD  372
             L  KLP ++L++ID+Y   LD+I+ P  YGFE V+ GCCGTG IEVT+LCN L+  TC D
Sbjct  281   LRHKLPGTRLLYIDVYSPLLDIIQRPQDYGFEEVSKGCCGTGKIEVTLLCNDLNPFTCAD  340

Query  371   RNKYLFWDSYHPTEKGYRIIVNRIITKYINSF  276
              +KY+FWDS+HPT+K Y+ +   ++ KY++ F
Sbjct  341   VSKYVFWDSFHPTQKAYKALFGPLLRKYLSFF  372



>gb|KHG24596.1| GDSL esterase/lipase EXL3 -like protein [Gossypium arboreum]
Length=363

 Score =   413 bits (1062),  Expect = 4e-138, Method: Compositional matrix adjust.
 Identities = 194/336 (58%), Positives = 250/336 (74%), Gaps = 1/336 (0%)
 Frame = -2

Query  1280  SEAKIKLPNGLVVKAVIAFGDSIVDQGMNNNLSTMIKTNFPPYGQDFMGGKHTGRYSNGK  1101
             ++A IKLP    + AVI FGDSIVD G NN+L+T+I+ +F PYGQDF GG  TGR+ NGK
Sbjct  27    AKALIKLPINGTIPAVIVFGDSIVDAGNNNDLNTVIRCDFLPYGQDFAGGVPTGRFCNGK  86

Query  1100  TPPDLVAEELGIKELVPAYLDPHLQPEDIKTGVSFASGASGYDPQTAALMSVIPLSEQLK  921
              P DL+AEELGIK++VPAYLDP L+ +D+ TGV+FASG +GYDP T  L SVI L EQL 
Sbjct  87    VPSDLIAEELGIKDIVPAYLDPTLKTQDLLTGVTFASGGTGYDPLTPKLASVISLGEQLN  146

Query  920   YFKEYLGKLNAMVGEKEAKSIINNTLFMVVSGSDDLANTYFTIGIRRYQYDINSYTDLLL  741
             YFKEY+GKL A+ GE++   I+  ++F+VV+GSDD+ANTYF +  R+ QYD+ +YTDL++
Sbjct  147   YFKEYIGKLKAIAGEEKTNFILAKSMFLVVAGSDDIANTYFVLRARKLQYDVPAYTDLMV  206

Query  740   EGASNFLQELYSLGARRIGFFGIPPVGCLPSQRTLAGGSERECVENYNQAAQLANAKFSA  561
               A+ F++ELY LGAR+IG F  PP+GC+PSQRTL GG EREC E+YN AA L N K S+
Sbjct  207   NSAAEFVKELYGLGARKIGVFSTPPIGCVPSQRTLGGGIERECAEDYNVAAILFNKKLSS  266

Query  560   EIKILSKKLPNSKLIFIDIYEDFLDMIKNPAKYGFEVVNLGCCGTGTIEVTMLCNKLS-G  384
              +      +P+ + ++ID+Y   L +I+NP K GFEVV+ GCCGTG IEV +LCNKLS  
Sbjct  267   VLNSFKTSIPDGRFVYIDVYNPLLGLIQNPQKNGFEVVDNGCCGTGNIEVAILCNKLSPS  326

Query  383   TCPDRNKYLFWDSYHPTEKGYRIIVNRIITKYINSF  276
             TC D +KY+FWDSYHPTEK YR +V  I+   I  F
Sbjct  327   TCTDVSKYIFWDSYHPTEKAYRALVTLILQNIIGDF  362



>ref|XP_006435224.1| hypothetical protein CICLE_v10001578mg [Citrus clementina]
 gb|ESR48464.1| hypothetical protein CICLE_v10001578mg [Citrus clementina]
Length=367

 Score =   413 bits (1061),  Expect = 9e-138, Method: Compositional matrix adjust.
 Identities = 202/346 (58%), Positives = 259/346 (75%), Gaps = 3/346 (1%)
 Frame = -2

Query  1307  IAFLVLAGCSEAKIKLPNGLVVKAVIAFGDSIVDQGMNNNLSTMIKTNFPPYGQDFMGGK  1128
             ++ L L   +EA IKLP  + V AVI FGDSIVD G NNNL T  K NFPPYG+DF GG 
Sbjct  22    VSVLDLFCRTEAVIKLPGNVTVSAVIVFGDSIVDTGNNNNLKTPAKCNFPPYGRDFEGGA  81

Query  1127  HTGRYSNGKTPPDLVAEELGIKELVPAYLDPHLQPEDIKTGVSFASGASGYDPQTAAL-M  951
              TGR+SNGK P D++AEELG+KEL  AYLDP L+PED+ TGV+FASG  GYDP T  L  
Sbjct  82    ATGRFSNGKVPSDILAEELGVKELSLAYLDPTLKPEDLLTGVNFASGGCGYDPLTTRLSA  141

Query  950   SVIPLSEQLKYFKEYLGKLNAMVGEKEAKSIINNTLFMVVSGSDDLANTYFTIGIRRYQY  771
             + + LS+QL+ FKEY+ KL A+VGE+    I   + F+VV GS+D+ N YF   IRR QY
Sbjct  142   AALSLSDQLQLFKEYIDKLRAIVGEEGKNRIFERSFFLVVVGSNDINNNYFGSRIRRLQY  201

Query  770   DINSYTDLLLEGASNFLQELYSLGARRIGFFGIPPVGCLPSQRTLAGGSERECVENYNQA  591
             DI++YTDLL+  AS FL+E+Y LGARRIG FG P +GCLPS RT+AGG +R+C + YN+A
Sbjct  202   DISTYTDLLVGHASTFLKEIYGLGARRIGVFGAPTLGCLPSTRTVAGGIKRDCAKEYNEA  261

Query  590   AQLANAKFSAEIKILSKKLPNSKLIFIDIYEDFLDMIKNPAKYGFEVVNLGCCGTGTIEV  411
             AQL N+K SAE+  L+  LP+ ++++IDIY   LD+I+NP KYGF++V+ GCCGTGTIEV
Sbjct  262   AQLFNSKLSAELDSLN-NLPDVRIVYIDIYNPLLDIIQNPNKYGFDIVDKGCCGTGTIEV  320

Query  410   TMLCNKLSG-TCPDRNKYLFWDSYHPTEKGYRIIVNRIITKYINSF  276
              +LCN+ S  TC + + YLFWDS+HPTEK Y+I+V+ ++ KYIN F
Sbjct  321   IILCNQFSPYTCTNDSGYLFWDSFHPTEKAYKILVSNLVKKYINRF  366



>ref|XP_007160639.1| hypothetical protein PHAVU_001G004300g [Phaseolus vulgaris]
 gb|ESW32633.1| hypothetical protein PHAVU_001G004300g [Phaseolus vulgaris]
Length=356

 Score =   412 bits (1058),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 193/335 (58%), Positives = 250/335 (75%), Gaps = 1/335 (0%)
 Frame = -2

Query  1280  SEAKIKLPNGLVVKAVIAFGDSIVDQGMNNNLSTMIKTNFPPYGQDFMGGKHTGRYSNGK  1101
             ++  +KLP  + V AV+AFGDSIVD G NNNL+T++K +FPPYG+DF GGK TGR+ NGK
Sbjct  22    TKGVVKLPPHVSVPAVLAFGDSIVDSGNNNNLTTLVKCDFPPYGKDFQGGKPTGRFCNGK  81

Query  1100  TPPDLVAEELGIKELVPAYLDPHLQPEDIKTGVSFASGASGYDPQTAALMSVIPLSEQLK  921
              P D++AEELGIKE +PAY+DP+L+  D+ TGV FASGASGYDP T  + SVI LS QL 
Sbjct  82    IPSDIIAEELGIKEYLPAYMDPNLKSSDLATGVCFASGASGYDPLTPEIASVISLSSQLD  141

Query  920   YFKEYLGKLNAMVGEKEAKSIINNTLFMVVSGSDDLANTYFTIGIRRYQYDINSYTDLLL  741
              FKEY+GKL  +VGE     I+ N+LF+VV+GSDD+ANTYF    R  QYDI SYTDL++
Sbjct  142   MFKEYIGKLKGIVGESRTNFILGNSLFLVVAGSDDIANTYFVTHARILQYDIPSYTDLMV  201

Query  740   EGASNFLQELYSLGARRIGFFGIPPVGCLPSQRTLAGGSERECVENYNQAAQLANAKFSA  561
               ASNF++ELY+LGARRIG    PP+GC+PSQRTLAGG  R C E YN AA+L N+K S 
Sbjct  202   NSASNFVKELYNLGARRIGVLSAPPIGCVPSQRTLAGGLVRGCSEKYNDAAKLFNSKLSK  261

Query  560   EIKILSKKLPNSKLIFIDIYEDFLDMIKNPAKYGFEVVNLGCCGTGTIEVTMLCNKLSGT  381
             E+  L K    S++++ID+Y   LD+I+N   YGF+V++ GCCGTG +EV +LCN L  T
Sbjct  262   ELDSLHKS-SKSRIVYIDVYNPLLDIIQNYQNYGFKVMDRGCCGTGKLEVAVLCNPLDST  320

Query  380   CPDRNKYLFWDSYHPTEKGYRIIVNRIITKYINSF  276
             C + ++Y+FWDSYHPTE  YR +V+ ++ KY+N  
Sbjct  321   CSNASEYVFWDSYHPTEGVYRKLVSHVLKKYMNQL  355



>ref|XP_003550433.1| PREDICTED: GDSL esterase/lipase EXL3-like isoform 1 [Glycine 
max]
Length=363

 Score =   412 bits (1058),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 194/343 (57%), Positives = 251/343 (73%), Gaps = 1/343 (0%)
 Frame = -2

Query  1307  IAFLVLAGCSEAKIKLP-NGLVVKAVIAFGDSIVDQGMNNNLSTMIKTNFPPYGQDFMGG  1131
             I    L   + A +KLP N   V AV+AFGDSIVD G NNN+ T+IK NFPPYG+DF GG
Sbjct  18    IVIFALCYRTMALVKLPPNASSVPAVLAFGDSIVDSGNNNNIKTLIKCNFPPYGKDFQGG  77

Query  1130  KHTGRYSNGKTPPDLVAEELGIKELVPAYLDPHLQPEDIKTGVSFASGASGYDPQTAALM  951
               TGR+ NGK P DL+ E+LGIKE +PAYLDP+L+  D+ TGV FASGASGYDP T  + 
Sbjct  78    NPTGRFCNGKIPSDLIVEQLGIKEYLPAYLDPNLKSSDLVTGVGFASGASGYDPLTPKIT  137

Query  950   SVIPLSEQLKYFKEYLGKLNAMVGEKEAKSIINNTLFMVVSGSDDLANTYFTIGIRRYQY  771
             SVI LS QL  F+EY+GKL  +VGE     I+ N+L++VV+GSDD+ANTYF    R  QY
Sbjct  138   SVISLSTQLDMFREYIGKLKGIVGESRTNYILANSLYLVVAGSDDIANTYFVAHARILQY  197

Query  770   DINSYTDLLLEGASNFLQELYSLGARRIGFFGIPPVGCLPSQRTLAGGSERECVENYNQA  591
             DI SYTDL++  ASNF++ELY+LGARR+   G PP+GC+PSQRTLAGG  R+C E YN A
Sbjct  198   DIPSYTDLMVNSASNFVKELYNLGARRVAVLGAPPIGCVPSQRTLAGGLTRKCSEKYNYA  257

Query  590   AQLANAKFSAEIKILSKKLPNSKLIFIDIYEDFLDMIKNPAKYGFEVVNLGCCGTGTIEV  411
             A+L N+K S E+  L   L ++++++ID+Y   LD+I N  KYG++V++ GCCGTG +EV
Sbjct  258   ARLFNSKLSKELDSLGHNLSDTRIVYIDVYSPLLDIIDNYQKYGYKVMDRGCCGTGKLEV  317

Query  410   TMLCNKLSGTCPDRNKYLFWDSYHPTEKGYRIIVNRIITKYIN  282
              +LCN L  TC + ++Y+FWDSYHPTE  YR IVN ++ KY++
Sbjct  318   AVLCNPLDDTCSNASEYVFWDSYHPTEGVYRKIVNHVLEKYMD  360



>ref|XP_004240848.2| PREDICTED: uncharacterized protein LOC101249647 [Solanum lycopersicum]
Length=982

 Score =   431 bits (1107),  Expect = 4e-137, Method: Compositional matrix adjust.
 Identities = 202/338 (60%), Positives = 252/338 (75%), Gaps = 1/338 (0%)
 Frame = -2

Query  1310  IIAFLVLAGCSEAKIKLPNGLVVKAVIAFGDSIVDQGMNNNLSTMIKTNFPPYGQDFMGG  1131
             I+  L++    +  +KLP  +VV AV AFGDSIVDQG NN ++T IK NFPPYG+D   G
Sbjct  636   ILISLIMPSSYKIIVKLPEKVVVPAVYAFGDSIVDQGNNNYIATTIKCNFPPYGKDLRDG  695

Query  1130  KHTGRYSNGKTPPDLVAEELGIKELVPAYLDPHLQPEDIKTGVSFASGASGYDPQTAALM  951
               TGR+SN KTPPDL+AEELGIK L+PAYLDP+L+ ED+KTGVSFASG  GYDP T +  
Sbjct  696   IPTGRFSNAKTPPDLIAEELGIKGLIPAYLDPNLKDEDLKTGVSFASGGCGYDPLTGSAF  755

Query  950   SVIPLSEQLKYFKEYLGKLNAMVGEKEAKSIINNTLFMVVSGSDDLANTYFTIGIRRYQY  771
             S++ LS+QL  F+EY+ KL  +VG++E   I+NN+ +MVV+GS+D  N Y+  G R++QY
Sbjct  756   SILHLSDQLTLFQEYIEKLKRLVGKQETTHILNNSFYMVVAGSNDFLNNYYVTGFRKHQY  815

Query  770   DINSYTDLLLEGASNFLQELYSLGARRIGFFGIPPVGCLPSQRTLAGG-SERECVENYNQ  594
             DINSY D ++  ASNF+QELY LGARRIG  G+PP+GC+P QRTL GG   R CV+ YNQ
Sbjct  816   DINSYIDHIVSWASNFVQELYELGARRIGIMGLPPLGCVPFQRTLQGGIISRVCVDEYNQ  875

Query  593   AAQLANAKFSAEIKILSKKLPNSKLIFIDIYEDFLDMIKNPAKYGFEVVNLGCCGTGTIE  414
              AQLAN KF+    +LSK LP SKL+FIDIY    D I N  KYGFE V+ GCCGTGTIE
Sbjct  876   DAQLANTKFAVAFGLLSKSLPQSKLVFIDIYNLVTDFIVNNTKYGFEEVDKGCCGTGTIE  935

Query  413   VTMLCNKLSGTCPDRNKYLFWDSYHPTEKGYRIIVNRI  300
             V+ LCNK S  C D  KYLFWDS+HPTEKGY+++++ I
Sbjct  936   VSTLCNKYSAICEDDTKYLFWDSFHPTEKGYKVLIDHI  973



>gb|KHN39410.1| GDSL esterase/lipase EXL3 [Glycine soja]
Length=336

 Score =   410 bits (1053),  Expect = 4e-137, Method: Compositional matrix adjust.
 Identities = 189/328 (58%), Positives = 247/328 (75%), Gaps = 0/328 (0%)
 Frame = -2

Query  1259  PNGLVVKAVIAFGDSIVDQGMNNNLSTMIKTNFPPYGQDFMGGKHTGRYSNGKTPPDLVA  1080
             PN   V AV+AFGDSIVD G NNN+ T+IK NFPPYG+DF GG  TGR+ NGK P DL+A
Sbjct  8     PNASSVPAVLAFGDSIVDPGNNNNIKTLIKCNFPPYGKDFQGGNPTGRFCNGKIPSDLIA  67

Query  1079  EELGIKELVPAYLDPHLQPEDIKTGVSFASGASGYDPQTAALMSVIPLSEQLKYFKEYLG  900
             E+LGIKE +PAYLDP+L+  D+ TGV FASGASGYDP T  + SV+ LS QL  F+EY+G
Sbjct  68    EQLGIKEYLPAYLDPNLKSSDLVTGVCFASGASGYDPLTPKITSVLSLSTQLDMFREYIG  127

Query  899   KLNAMVGEKEAKSIINNTLFMVVSGSDDLANTYFTIGIRRYQYDINSYTDLLLEGASNFL  720
             KL  +VGE     I++N+L++VV+GSDD+ANTYF    R  QYDI SYTDL++  ASNF+
Sbjct  128   KLKGIVGESRTNYILSNSLYLVVAGSDDIANTYFVAHARILQYDIPSYTDLMVNSASNFV  187

Query  719   QELYSLGARRIGFFGIPPVGCLPSQRTLAGGSERECVENYNQAAQLANAKFSAEIKILSK  540
             +ELY+LGARR+   G PP+GC+PSQRTLAGG  R+C E YN AA+L N+K S E+  L  
Sbjct  188   KELYNLGARRVAVLGAPPIGCVPSQRTLAGGLTRKCSEKYNYAARLFNSKLSKELDSLGH  247

Query  539   KLPNSKLIFIDIYEDFLDMIKNPAKYGFEVVNLGCCGTGTIEVTMLCNKLSGTCPDRNKY  360
              L ++++++ID+Y   LD+I+N  KYG++V++ GCCGTG +EV +LCN L  TC + ++Y
Sbjct  248   NLSDTRIVYIDVYTPLLDIIENYQKYGYKVMDRGCCGTGKLEVAVLCNPLDATCSNASEY  307

Query  359   LFWDSYHPTEKGYRIIVNRIITKYINSF  276
             +FWDSYHPTE  YR +VN ++ KYI+  
Sbjct  308   VFWDSYHPTEGVYRKLVNYVLEKYIDRL  335



>ref|XP_003545022.1| PREDICTED: GDSL esterase/lipase EXL3 [Glycine max]
Length=363

 Score =   410 bits (1055),  Expect = 6e-137, Method: Compositional matrix adjust.
 Identities = 189/326 (58%), Positives = 247/326 (76%), Gaps = 0/326 (0%)
 Frame = -2

Query  1259  PNGLVVKAVIAFGDSIVDQGMNNNLSTMIKTNFPPYGQDFMGGKHTGRYSNGKTPPDLVA  1080
             PN   V AV+AFGDSIVD G NNN+ T+IK NFPPYG+DF GG  TGR+ NGK P DL+A
Sbjct  35    PNASSVPAVLAFGDSIVDPGNNNNIKTLIKCNFPPYGKDFQGGNPTGRFCNGKIPSDLIA  94

Query  1079  EELGIKELVPAYLDPHLQPEDIKTGVSFASGASGYDPQTAALMSVIPLSEQLKYFKEYLG  900
             E+LGIKE +PAYLDP+L+  D+ TGV FASGASGYDP T  + SV+ LS QL  F+EY+G
Sbjct  95    EQLGIKEYLPAYLDPNLKSSDLVTGVCFASGASGYDPLTPKITSVLSLSTQLDMFREYIG  154

Query  899   KLNAMVGEKEAKSIINNTLFMVVSGSDDLANTYFTIGIRRYQYDINSYTDLLLEGASNFL  720
             KL  +VGE     I++N+L++VV+GSDD+ANTYF    R  QYDI SYTDL++  ASNF+
Sbjct  155   KLKGIVGESRTNYILSNSLYLVVAGSDDIANTYFVAHARILQYDIPSYTDLMVNSASNFV  214

Query  719   QELYSLGARRIGFFGIPPVGCLPSQRTLAGGSERECVENYNQAAQLANAKFSAEIKILSK  540
             +ELY+LGARR+   G PP+GC+PSQRTLAGG  R+C E YN AA+L N+K S E+  L  
Sbjct  215   KELYNLGARRVAVLGAPPIGCVPSQRTLAGGLTRKCSEKYNYAARLFNSKLSKELDSLGH  274

Query  539   KLPNSKLIFIDIYEDFLDMIKNPAKYGFEVVNLGCCGTGTIEVTMLCNKLSGTCPDRNKY  360
              L ++++++ID+Y   LD+I+N  KYG++V++ GCCGTG +EV +LCN L  TC + ++Y
Sbjct  275   NLSDTRIVYIDVYTPLLDIIENYQKYGYKVMDRGCCGTGKLEVAVLCNPLDATCSNASEY  334

Query  359   LFWDSYHPTEKGYRIIVNRIITKYIN  282
             +FWDSYHPTE  YR +VN ++ KYI+
Sbjct  335   VFWDSYHPTEGVYRKLVNYVLEKYID  360



>gb|KHN12627.1| GDSL esterase/lipase EXL3 [Glycine soja]
Length=336

 Score =   409 bits (1052),  Expect = 7e-137, Method: Compositional matrix adjust.
 Identities = 192/334 (57%), Positives = 248/334 (74%), Gaps = 1/334 (0%)
 Frame = -2

Query  1274  AKIKLP-NGLVVKAVIAFGDSIVDQGMNNNLSTMIKTNFPPYGQDFMGGKHTGRYSNGKT  1098
             A +KLP N   V AV+AFGDSIVD G NNN+ T+IK NFPPYG+DF GG  TGR+ NGK 
Sbjct  2     ALVKLPPNASSVPAVLAFGDSIVDSGNNNNIKTLIKCNFPPYGKDFQGGNPTGRFCNGKI  61

Query  1097  PPDLVAEELGIKELVPAYLDPHLQPEDIKTGVSFASGASGYDPQTAALMSVIPLSEQLKY  918
             P DL+ E+LGIKE +PAYLDP+L+  D+ TGV FASGASGYDP T  + SVI LS QL  
Sbjct  62    PSDLIVEQLGIKEYLPAYLDPNLKSSDLVTGVGFASGASGYDPLTPKITSVISLSTQLDM  121

Query  917   FKEYLGKLNAMVGEKEAKSIINNTLFMVVSGSDDLANTYFTIGIRRYQYDINSYTDLLLE  738
             F+EY+GKL  +VGE     I+ N+L++VV+GSDD+ANTYF    R  QYDI SYTDL++ 
Sbjct  122   FREYIGKLKGIVGESRTNYILANSLYLVVAGSDDIANTYFVAHARILQYDIPSYTDLMVN  181

Query  737   GASNFLQELYSLGARRIGFFGIPPVGCLPSQRTLAGGSERECVENYNQAAQLANAKFSAE  558
              ASNF++ELY+LGARR+   G PP+GC+PSQRTLAGG  R+C E YN AA+L N+K S E
Sbjct  182   SASNFVKELYNLGARRVAVLGAPPIGCVPSQRTLAGGLTRKCSEKYNYAARLFNSKLSKE  241

Query  557   IKILSKKLPNSKLIFIDIYEDFLDMIKNPAKYGFEVVNLGCCGTGTIEVTMLCNKLSGTC  378
             +  L   L ++++++ID+Y   LD+I N  KYG++V++ GCCGTG +EV +LCN L  TC
Sbjct  242   LDSLGHNLSDTRIVYIDVYTPLLDIIDNYQKYGYKVMDRGCCGTGKLEVAVLCNPLDDTC  301

Query  377   PDRNKYLFWDSYHPTEKGYRIIVNRIITKYINSF  276
              + ++Y+FWDSYHPTE  YR IVN ++ KY++  
Sbjct  302   SNASEYVFWDSYHPTEGVYRKIVNHVLEKYMDRL  335



>ref|XP_009605224.1| PREDICTED: GDSL esterase/lipase At5g42170-like [Nicotiana tomentosiformis]
Length=382

 Score =   411 bits (1056),  Expect = 8e-137, Method: Compositional matrix adjust.
 Identities = 192/345 (56%), Positives = 259/345 (75%), Gaps = 3/345 (1%)
 Frame = -2

Query  1310  IIAFLVLAGCSEAKIKLPNGLVVKAVIAFGDSIVDQGMNNNLSTMIKTNFPPYGQDFMGG  1131
             ++ + +L    +A  ++P    + AVI FGDSIVD G NN L T+ K N+PPYGQDFMGG
Sbjct  40    LVCYSLLVCYVKAVTRIPYNESIPAVIVFGDSIVDTGNNNGLKTVSKVNYPPYGQDFMGG  99

Query  1130  KHTGRYSNGKTPPDLVAEELGIKELVPAYLDPHLQPEDIKTGVSFASGASGYDPQTAALM  951
             K TGR+SNGK P DL+ EELGIKEL+PAYLDP LQP+D+ TGV+FASG +GYDP T+ L 
Sbjct  100   KPTGRFSNGKVPADLIVEELGIKELLPAYLDPTLQPKDLITGVNFASGGAGYDPLTSELA  159

Query  950   SVIPLSEQLKYFKEYLGKLNAMVGEKEAKSIINNTLFMVVSGSDDLANTYFTIGIRRYQY  771
              VI LS QL+ FKEY+ KL  +VGE +   I+ N+LF++V+G++D+ NTYF   +R+  Y
Sbjct  160   KVISLSRQLEMFKEYILKLREIVGEDKKNEILANSLFILVTGTNDIINTYFNTPLRKTYY  219

Query  770   DINSYTDLLLEGASNFLQELYSLGARRIGFFGIPPVGCLPSQRTLAGGSERECVENYNQA  591
             D++SY DLL+  AS+F+Q+LY LGARRIG FGIPP+GCLPSQRTL GG ERECV+  NQA
Sbjct  220   DVSSYADLLVNSASSFVQDLYGLGARRIGVFGIPPIGCLPSQRTLRGGEERECVDYLNQA  279

Query  590   AQLANAKFSAEIKILSKKLPNSKLIFIDIYEDFLDMIKNPAKYGFEVVNLGCCGTGTIEV  411
             AQL N+K +AE+  L  + P+S+++++D+Y   LD+I NP KYGF++ + GCCGTG IEV
Sbjct  280   AQLFNSKLAAELSSLGNEFPDSRMVYVDVYNLPLDVIYNPQKYGFKISDKGCCGTGKIEV  339

Query  410   TMLCNKLSGTCPDRNKYLFWDSYHPTEKGYRIIVNRIITKYINSF  276
               LC   + TC   + Y+FWDS+H TEK YR +V++I+ ++++SF
Sbjct  340   AELC---TFTCSSDSDYVFWDSFHLTEKAYRQLVHQILAQHLSSF  381



>ref|XP_010664850.1| PREDICTED: uncharacterized protein LOC100264374 [Vitis vinifera]
Length=713

 Score =   422 bits (1085),  Expect = 9e-137, Method: Compositional matrix adjust.
 Identities = 198/340 (58%), Positives = 255/340 (75%), Gaps = 2/340 (1%)
 Frame = -2

Query  1304  AFLVLAGCSEAKIKLPNGLVVKAVIAFGDSIVDQGMNNNLSTMIKTNFPPYGQDFMGGKH  1125
             AF++L   +EA +KLP    + AV+ FGDSIVD G NNNL T++K NFPPYG+DFMGG  
Sbjct  16    AFIILC-TTEALVKLPRNETIPAVLVFGDSIVDPGNNNNLITVVKCNFPPYGRDFMGGFP  74

Query  1124  TGRYSNGKTPPDLVAEELGIKELVPAYLDPHLQPEDIKTGVSFASGASGYDPQTAALMSV  945
             TGR+SNGK PPD +AEELGIKEL+P Y +P LQ  D+ TGVSFAS  SGYDP T  L SV
Sbjct  75    TGRFSNGKIPPDFIAEELGIKELLPPYSNPALQLSDLLTGVSFASSGSGYDPMTPKLASV  134

Query  944   IPLSEQLKYFKEYLGKLNAMVGEKEAKSIINNTLFMVVSGSDDLANTYFTIGIRRYQYDI  765
             + L +QL+ FKEY+ KL  MVGE+   +I++ +LF+VV+GSDD+AN+YF  G+R+ QYD+
Sbjct  135   LSLRDQLEMFKEYIRKLKMMVGEERTNTILSKSLFLVVAGSDDIANSYFVSGVRKIQYDV  194

Query  764   NSYTDLLLEGASNFLQELYSLGARRIGFFGIPPVGCLPSQRTLAGGSERECVENYNQAAQ  585
              +YTDL++  AS+F +ELY LGARRI     PP+GCLPSQR+LAGG  REC E++N AA+
Sbjct  195   PAYTDLMIASASSFFKELYGLGARRIVVGSAPPLGCLPSQRSLAGGILRECAEDHNDAAK  254

Query  584   LANAKFSAEIKILSKKLPNSKLIFIDIYEDFLDMIKNPAKYGFEVVNLGCCGTGTIEVTM  405
             L N K S+++  L+   P +K ++IDIY  FLD+I+NP K GFEVV+ GCCGTG IEV +
Sbjct  255   LFNTKLSSQLDSLNANFPQAKFVYIDIYNPFLDLIQNPQKSGFEVVDKGCCGTGKIEVAV  314

Query  404   LCNKLSG-TCPDRNKYLFWDSYHPTEKGYRIIVNRIITKY  288
             LCN  S  TC D + Y+FWDSYHPTEK Y++++  II KY
Sbjct  315   LCNPFSPFTCEDASNYVFWDSYHPTEKAYKVLIGEIIQKY  354


 Score =   407 bits (1047),  Expect = 5e-131, Method: Compositional matrix adjust.
 Identities = 187/345 (54%), Positives = 258/345 (75%), Gaps = 1/345 (0%)
 Frame = -2

Query  1307  IAFLVLAGCSEAKIKLPNGLVVKAVIAFGDSIVDQGMNNNLSTMIKTNFPPYGQDFMGGK  1128
             ++  ++   +EA +KLP    V AV+ FGDSIVD G NNNL+T++K+NFPPYG+D MGG 
Sbjct  368   LSVFIILCTTEALVKLPRNETVPAVLVFGDSIVDPGNNNNLNTLVKSNFPPYGRDLMGGV  427

Query  1127  HTGRYSNGKTPPDLVAEELGIKELVPAYLDPHLQPEDIKTGVSFASGASGYDPQTAALMS  948
              TGR+SNGK P D +AE LGIKELVP Y +  LQ  D+ TGVSFAS  SG+DP T  L S
Sbjct  428   PTGRFSNGKIPSDFIAEALGIKELVPPYSNAALQLGDLLTGVSFASSGSGFDPMTPKLAS  487

Query  947   VIPLSEQLKYFKEYLGKLNAMVGEKEAKSIINNTLFMVVSGSDDLANTYFTIGIRRYQYD  768
             V+ L +QL+ FKEY+ KL  MVG +   +I++ +LF+VV+GSDD+AN+YF   ++++QYD
Sbjct  488   VLSLRDQLEMFKEYIRKLKRMVGVERTNTILSKSLFLVVAGSDDIANSYFDSRVQKFQYD  547

Query  767   INSYTDLLLEGASNFLQELYSLGARRIGFFGIPPVGCLPSQRTLAGGSERECVENYNQAA  588
             + +YTDL++  A++FL+ELY LGARR      PP+GCLPSQR+LAGG++REC E +N+AA
Sbjct  548   VPAYTDLMVTSAASFLKELYGLGARRTVVTSAPPLGCLPSQRSLAGGTQRECAEGHNEAA  607

Query  587   QLANAKFSAEIKILSKKLPNSKLIFIDIYEDFLDMIKNPAKYGFEVVNLGCCGTGTIEVT  408
             +L N K S+ +  L+   P +K +++DIY+  LD+I+NP K GFEVV+ GCCG+GTIEV 
Sbjct  608   KLFNFKLSSRLDSLNANFPQAKFVYVDIYKPLLDLIQNPQKSGFEVVDKGCCGSGTIEVA  667

Query  407   MLCNKLSG-TCPDRNKYLFWDSYHPTEKGYRIIVNRIITKYINSF  276
             +LCN+LS  TC D + Y+FWDSYHPTE+ Y++I++ II K ++S 
Sbjct  668   VLCNQLSPFTCEDASTYVFWDSYHPTERAYKVIIDEIIQKCVDSL  712



>ref|XP_008242093.1| PREDICTED: GDSL esterase/lipase EXL3-like [Prunus mume]
Length=366

 Score =   410 bits (1054),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 185/334 (55%), Positives = 253/334 (76%), Gaps = 1/334 (0%)
 Frame = -2

Query  1274  AKIKLPNGLVVKAVIAFGDSIVDQGMNNNLSTMIKTNFPPYGQDFMGGKHTGRYSNGKTP  1095
             A + LP    + AVI FGDSIVD G NNN+ T++K NFPPYG+DF G K TGR+SNG+ P
Sbjct  32    AAVTLPENETIPAVIVFGDSIVDPGNNNNIRTIVKCNFPPYGRDFTGRKPTGRFSNGRVP  91

Query  1094  PDLVAEELGIKELVPAYLDPHLQPEDIKTGVSFASGASGYDPQTAALMSVIPLSEQLKYF  915
              DL+AE +G+K ++PAYLDP L+ +D+ TGVSFASG +GYDP T  ++SV+ LS+QL  F
Sbjct  92    SDLIAESVGVKNILPAYLDPSLKVQDLLTGVSFASGGTGYDPLTPQVVSVLSLSDQLDLF  151

Query  914   KEYLGKLNAMVGEKEAKSIINNTLFMVVSGSDDLANTYFTIGIRRYQYDINSYTDLLLEG  735
             K+YL K+NA VGE    +I++ ++++V  GSDD+ANTY++  +RR QYDI +YTDL+++ 
Sbjct  152   KKYLSKINAAVGEARTATILSKSIYIVCLGSDDIANTYYSTPLRRPQYDIPAYTDLMIKS  211

Query  734   ASNFLQELYSLGARRIGFFGIPPVGCLPSQRTLAGGSERECVENYNQAAQLANAKFSAEI  555
             AS+F QELY LGARRIG   +P +GC+PSQRTL GG +R C +N NQAA L N+K +A+I
Sbjct  212   ASSFFQELYDLGARRIGILSLPAIGCVPSQRTLNGGIDRGCSDNANQAASLFNSKLTAQI  271

Query  554   KILSKKLPNSKLIFIDIYEDFLDMIKNPAKYGFEVVNLGCCGTGTIEVTMLCNKLS-GTC  378
                +K+LP ++L+++DIY   L +I+ P++YG EVVN GCCGTG IEV++LC + S GTC
Sbjct  272   DAFNKRLPEARLVYLDIYNILLSLIQKPSQYGLEVVNKGCCGTGNIEVSILCTRYSTGTC  331

Query  377   PDRNKYLFWDSYHPTEKGYRIIVNRIITKYINSF  276
              D +KYLFWDSYHPTEK Y+++V  +  K ++ F
Sbjct  332   KDPSKYLFWDSYHPTEKAYKVLVPLVFDKQVHKF  365



>ref|XP_009363463.1| PREDICTED: GDSL esterase/lipase EXL3-like [Pyrus x bretschneideri]
Length=368

 Score =   410 bits (1053),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 181/334 (54%), Positives = 256/334 (77%), Gaps = 1/334 (0%)
 Frame = -2

Query  1274  AKIKLPNGLVVKAVIAFGDSIVDQGMNNNLSTMIKTNFPPYGQDFMGGKHTGRYSNGKTP  1095
             A +KLPN   + AVI FGDS+VD G NNN+ST++K NFPPYG+DF+G + TGR+SNG+ P
Sbjct  34    AAVKLPNNEKIPAVIVFGDSVVDSGNNNNISTVVKCNFPPYGRDFVGQRPTGRFSNGRVP  93

Query  1094  PDLVAEELGIKELVPAYLDPHLQPEDIKTGVSFASGASGYDPQTAALMSVIPLSEQLKYF  915
              DL+AE +G+K+++PAYLDP+L+  D+ TGV+FASG SGYDP T  ++SV+ LS+Q+  F
Sbjct  94    SDLIAESVGVKKILPAYLDPNLKIHDLLTGVAFASGGSGYDPLTPKIVSVLSLSDQIDMF  153

Query  914   KEYLGKLNAMVGEKEAKSIINNTLFMVVSGSDDLANTYFTIGIRRYQYDINSYTDLLLEG  735
             K Y+ K+ A VG++ A  I++ ++++V +GS+D+ANTYF+  +RR +YDI++YTDL++E 
Sbjct  154   KTYINKITASVGKESAAIIVSKSIYIVCTGSNDIANTYFSTPLRRPRYDISAYTDLMVES  213

Query  734   ASNFLQELYSLGARRIGFFGIPPVGCLPSQRTLAGGSERECVENYNQAAQLANAKFSAEI  555
             AS+F QELY LGARRIG   +PP+GCLPSQRTL GG +R C E  NQAA L N+K  +EI
Sbjct  214   ASSFFQELYGLGARRIGVVSLPPIGCLPSQRTLRGGRDRGCSETVNQAASLFNSKLLSEI  273

Query  554   KILSKKLPNSKLIFIDIYEDFLDMIKNPAKYGFEVVNLGCCGTGTIEVTMLCNKLS-GTC  378
                + +LP ++L+++D+Y   L +I+NPA+YGFEV++ GCCGTG IEV++LC + S GTC
Sbjct  274   NAFNTRLPEARLVYLDVYNTLLSLIRNPAQYGFEVMDQGCCGTGNIEVSILCTRYSPGTC  333

Query  377   PDRNKYLFWDSYHPTEKGYRIIVNRIITKYINSF  276
              D + Y+FWDSYHP+EKGY +I   +    ++ F
Sbjct  334   NDASNYIFWDSYHPSEKGYEVITPMVFDSQVHKF  367



>ref|XP_009336660.1| PREDICTED: GDSL esterase/lipase EXL1-like [Pyrus x bretschneideri]
Length=359

 Score =   408 bits (1049),  Expect = 4e-136, Method: Compositional matrix adjust.
 Identities = 196/335 (59%), Positives = 253/335 (76%), Gaps = 2/335 (1%)
 Frame = -2

Query  1280  SEAKIKLPNGLVVKAVIAFGDSIVDQGMNNNLSTMIKTNFPPYGQDFMGGKHTGRYSNGK  1101
             ++A +KLP  + + AV  FGDSIVD G NNNL T+IK+NFPPYG+DFMGG  TGR+ NGK
Sbjct  19    AQATVKLPKNVTIPAVFMFGDSIVDTGNNNNLVTIIKSNFPPYGRDFMGGVATGRFGNGK  78

Query  1100  TPPDLVAEELGIKELVPAYLDPHLQPEDIKTGVSFASGASGYDPQTAALMSVIPLSEQLK  921
              P D+V EELGIK+L+PAYLDP+LQ +D  TGV+FASGASG+DP T+ +MSVIPLSEQL 
Sbjct  79    VPSDIVVEELGIKKLLPAYLDPNLQEKDFATGVNFASGASGFDPLTSEMMSVIPLSEQLL  138

Query  920   YFKEYLGKLNAMVGEKEAKSIINNTLFMVVSGSDDLANTYFTIGIRRYQYDINSYTDLLL  741
               KEY  KL   VG K AKSI++ +L  VV+GSDDL NTYF    R  QY+I++Y D ++
Sbjct  139   LLKEYKEKLKNYVGGKRAKSIVSKSLHFVVTGSDDLVNTYFHTPARSLQYNIDAYIDFMV  198

Query  740   EGASNFLQELYSLGARRIGFFGIPPVGCLPSQRTLAGGSERECVENYNQAAQLANAKFSA  561
               AS F++ELY+LGARRI   G+PPVGCLPS RT+ GGSER CV  YNQAA+L N+K S 
Sbjct  199   AEASAFVRELYALGARRIVISGLPPVGCLPSMRTVDGGSERNCVARYNQAAELFNSKLSV  258

Query  560   EIKILSKKLPNSK-LIFIDIYEDFLDMIKNPAKYGFEVVNLGCCGTGTIEVTMLCNKLS-  387
             E+  L+K+L ++K ++ +D+Y  F+D+I  P KYGF+V + GCCGTG IEV  LCN+LS 
Sbjct  259   EVDRLNKQLFHAKVVVLMDVYGPFMDIILKPQKYGFKVEDKGCCGTGRIEVVRLCNRLSP  318

Query  386   GTCPDRNKYLFWDSYHPTEKGYRIIVNRIITKYIN  282
              TC +  +Y+FWDSYHPTE+ Y++ V +++ K IN
Sbjct  319   NTCNNTREYVFWDSYHPTERVYKLFVPKLLQKCIN  353



>ref|XP_008221398.1| PREDICTED: GDSL esterase/lipase EXL3-like [Prunus mume]
Length=386

 Score =   408 bits (1048),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 198/357 (55%), Positives = 252/357 (71%), Gaps = 11/357 (3%)
 Frame = -2

Query  1313  CIIAFLVLAGC--------SEAKIKLPNGLVVKAVIAFGDSIVDQGMNNN-LSTMIKTNF  1161
             CI  F++L  C        +   +KLP  + V AVI FGDSIVD G NNN   T+ + NF
Sbjct  29    CINIFVLLFLCIVSNTTETAATTVKLPGNVSVPAVITFGDSIVDTGNNNNNFKTLARCNF  88

Query  1160  PPYGQDFMGGKHTGRYSNGKTPPDLVAEELGIKELVPAYLDPHLQPEDIKTGVSFASGAS  981
              PYG+D  GG  TGR+SNGK P DL+ E  GIKEL+PAYLDP LQPED+ TGV  A+G +
Sbjct  89    LPYGKDLKGGMPTGRFSNGKVPSDLLVEAFGIKELLPAYLDPTLQPEDLLTGVVIAAGGA  148

Query  980   GYDPQTAALMSVIPLSEQLKYFKEYLGKLNAMVGEKEAKSIINNTLFMVVSGSDDLANTY  801
             GYDP TA L  V  LS+QLK F+EY+ KL  + GE+    I+ N L  VV+GS+D++NTY
Sbjct  149   GYDPLTAQLAGVASLSDQLKQFQEYVEKLKGIAGEERTNFIVANCLIFVVAGSNDISNTY  208

Query  800   FTIGIRRYQYDINSYTDLLLEGASNFLQELYSLGARRIGFFGIPPVGCLPSQRTLAGGSE  621
             F  G R+ +YD+ SYTD +L  AS F+++LY LGARRIG   +PP+GC+PSQRT+ GG  
Sbjct  209   FLSGARKLEYDVPSYTDFMLNYASQFVKDLYGLGARRIGVLNVPPIGCVPSQRTVGGGML  268

Query  620   RECVENYNQAAQLANAKFSAEIKILSKKLPNSKLIFIDIYEDFLDMIKNPAKYGFEVVNL  441
             REC +  NQA+QL N K SAE+  L+K LPNS++++IDIY   LD+I NP KYGFEVVN 
Sbjct  269   RECDDKQNQASQLFNFKLSAEMDGLNKNLPNSRVVYIDIYNPLLDLIINPTKYGFEVVNK  328

Query  440   GCCGTGTIEVTMLCNKL--SGTCPDRNKYLFWDSYHPTEKGYRIIVNRIITKYINSF  276
             GCCG+G IEVT LCN+   +GTC D +KY+FWDSYHPTE  ++IIV +++ KY N F
Sbjct  329   GCCGSGIIEVTKLCNQFQPAGTCSDDSKYVFWDSYHPTESAFKIIVQQVLDKYANRF  385



>ref|XP_010034703.1| PREDICTED: GDSL esterase/lipase EXL3-like [Eucalyptus grandis]
 gb|KCW53196.1| hypothetical protein EUGRSUZ_J02470 [Eucalyptus grandis]
Length=367

 Score =   407 bits (1045),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 189/325 (58%), Positives = 244/325 (75%), Gaps = 2/325 (1%)
 Frame = -2

Query  1244  VKAVIAFGDSIVDQGMNNNLSTMIKTNFPPYGQDFMGGKHTGRYSNGKTPPDLVAEELGI  1065
             + A IAFGDSI+D G NNN+ T++K NFPPYG+DFMGGK +GR+SNGK PPDL  E  GI
Sbjct  42    LPAFIAFGDSIIDPGNNNNIQTIVKCNFPPYGRDFMGGKPSGRFSNGKIPPDLFVEAFGI  101

Query  1064  KELVPAYLDPHLQPEDIKTGVSFASGASGYDPQTAALMSVIPLSEQLKYFKEYLGKLNAM  885
             K+ +PAYLDP L+ ED+ TGVSFASGA+GYDP T  + S + LS+QL  FKEY+ K+ + 
Sbjct  102   KQYLPAYLDPSLKLEDLLTGVSFASGATGYDPLTPQIASALSLSDQLNLFKEYVNKIKSG  161

Query  884   VGEKEAKSIINNTLFMVVSGSDDLANTYFTIGIRRYQYDINSYTDLLLEGASNFLQELYS  705
              GE++A  II N+L+ VV GSDD+ANTY++   RR +YDI +YTDL+L  AS+F+QELY 
Sbjct  162   AGEEKASYIIKNSLYTVVCGSDDIANTYYSTPFRRGEYDIPAYTDLMLNSASSFIQELYG  221

Query  704   LGARRIGFFGIPPVGCLPSQRTLAGGSERECVENYNQAAQLANAKFSAEIKILSKKLPNS  525
             LGAR+IG   IPP+GC+P+QRTL GG ER C    NQAA L N+K  +EI+ L +KLP S
Sbjct  222   LGARKIGILSIPPIGCVPAQRTLDGGLERACNAPANQAATLFNSKLISEIESLKQKLPGS  281

Query  524   KLIFIDIYEDFLDMIKNPAKYGFEVVNLGCCGTGTIEVTMLCNKLSG--TCPDRNKYLFW  351
             KL+++DIY   L +I+NP+ YGFEV N GCCGTG IEV++LCN+L    TC D +KY+FW
Sbjct  282   KLVYLDIYHKLLSVIQNPSHYGFEVANRGCCGTGNIEVSILCNRLDDLETCQDDSKYVFW  341

Query  350   DSYHPTEKGYRIIVNRIITKYINSF  276
             DSYHPTE  Y+I+ + +I  Y +  
Sbjct  342   DSYHPTENTYKILTDHVIDNYADQL  366



>emb|CAN73607.1| hypothetical protein VITISV_035505 [Vitis vinifera]
Length=346

 Score =   405 bits (1042),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 202/337 (60%), Positives = 249/337 (74%), Gaps = 14/337 (4%)
 Frame = -2

Query  1280  SEAKIKLPNGLVVKAVIAFGDSIVDQGMNNNLSTMIKTNFPPYGQDFMGGKHTGRYSNGK  1101
             +EA +KLP+   V AVI FGDSIVD G NNNL T+ K NFPPYG+DF+GG  TGR+SNGK
Sbjct  19    TEALVKLPDNEKVPAVIVFGDSIVDPGNNNNLVTVAKCNFPPYGRDFIGGIPTGRFSNGK  78

Query  1100  TPPDLVA--EELGIKELVPAYLDPHLQPEDIKTGVSFASGASGYDPQTAALMSVIPLSEQ  927
              P D +A  EELGIK+L+PAYLDP LQP D+ TGVSFASGASGYDP T  + SV  LS+Q
Sbjct  79    IPSDFIATAEELGIKKLLPAYLDPTLQPSDLLTGVSFASGASGYDPLTPKIPSVFSLSDQ  138

Query  926   LKYFKEYLGKLNAMVGEKEAKSIINNTLFMVVSGSDDLANTYFTIGIRRYQYDINSYTDL  747
             L+ FKEY+GKL  MVGE+   +I++ +LF VV GS+D+ +TYF I  RR QYD  SY DL
Sbjct  139   LEMFKEYIGKLKGMVGEERTNTILSKSLFFVVQGSNDITSTYFBI--RRGQYDFASYADL  196

Query  746   LLEGASNFLQELYSLGARRIGFFGIPPVGCLPSQRTLAGGSERECVENYNQAAQLANAKF  567
             L         ELY LGARRIG F  PP+GCLPSQRTLAGG +RECVE YN+A+QL N K 
Sbjct  197   L---------ELYGLGARRIGVFSAPPLGCLPSQRTLAGGIQRECVEKYNEASQLFNTKL  247

Query  566   SAEIKILSKKLPNSKLIFIDIYEDFLDMIKNPAKYGFEVVNLGCCGTGTIEVTMLCNKLS  387
             S+ +  L+   P +K +++DIY   LD+I+NP K GFEVVN GCCGTG IEV++LC++L+
Sbjct  248   SSGLDSLNTNFPLAKFLYVDIYNPLLDIIQNPQKSGFEVVNKGCCGTGLIEVSVLCDRLN  307

Query  386   G-TCPDRNKYLFWDSYHPTEKGYRIIVNRIITKYINS  279
               TC D  KY+FWDSYHPTE+ Y+ I+  II  Y++S
Sbjct  308   PFTCNDATKYVFWDSYHPTERAYKTIIGEIIQGYVDS  344



>ref|XP_007046630.1| GDSL-like Lipase/Acylhydrolase superfamily protein, putative 
isoform 1 [Theobroma cacao]
 gb|EOX90787.1| GDSL-like Lipase/Acylhydrolase superfamily protein, putative 
isoform 1 [Theobroma cacao]
Length=394

 Score =   407 bits (1046),  Expect = 3e-135, Method: Compositional matrix adjust.
 Identities = 203/351 (58%), Positives = 254/351 (72%), Gaps = 7/351 (2%)
 Frame = -2

Query  1310  IIAFLVLAGC--SEAKIKLPNGLVVKAVIAFGDSIVDQGMNNNLSTMIKTNFPPYGQDFM  1137
             I +FLV   C  +EA + LPN   V AV+ FGDSIVD G NNNL+T+ K+NFPPYG+DF 
Sbjct  44    IFSFLVALCCHGNEAALVLPNNETVPAVLVFGDSIVDPGNNNNLNTIAKSNFPPYGRDFE  103

Query  1136  GGKHTGRYSNGKTPPDLVAEELGIKELVPAYLDPHLQPEDIKTGVSFASGASGYDPQTAA  957
             GG  TGR+SNGK P DL+AEE G+KELVPAYLDP LQ ED+ TGVSFASGA+GYDP  A 
Sbjct  104   GGP-TGRFSNGKVPSDLIAEEFGVKELVPAYLDPSLQLEDLLTGVSFASGAAGYDPIAAK  162

Query  956   LMSVIPLSEQLKYFKEYLGKLNAMVGEKEAKSIINNTLFMVVSGSDDLANTYFTIGIRRY  777
             + +V+  S+QL  F++Y  K+ + VGE+ A +II+  +++VV GS+D+AN YF   IRR 
Sbjct  163   ISNVLSTSDQLDLFEQYKTKIKSAVGEERAATIISKAIYIVVFGSNDVANIYFGTPIRRT  222

Query  776   QYDINSYTDLLLEGASNFLQELYSLGARRIGFFGIPPVGCLPSQRTLAGGSERECVENYN  597
              YD NSYTD  +  AS FLQELY LGARRIG  G+PP+GC+PSQRTL GG  R+C +  N
Sbjct  223   HYDFNSYTDFTVSYASKFLQELYGLGARRIGVLGLPPIGCVPSQRTLGGGPNRDCYKGEN  282

Query  596   QAAQLANAKFSAEIKIL--SKKLPNSKLIFIDIYEDFLDMIKNPAKYGFEVVNLGCCGTG  423
             Q A L NAK S  I  L  S  LP +KLIF+DIY   L +I+N AKYGFEV N GCCGTG
Sbjct  283   QLASLYNAKLSGMIDSLRTSLNLPGTKLIFLDIYYPLLSLIQNAAKYGFEVTNKGCCGTG  342

Query  422   TIEVTMLCNKLS--GTCPDRNKYLFWDSYHPTEKGYRIIVNRIITKYINSF  276
              IE ++LCN LS   +CPD +KY+FWD YHP++K Y+I+V  I+  ++N F
Sbjct  343   LIEASILCNPLSIPKSCPDASKYVFWDGYHPSDKAYKILVPIILNMHLNEF  393



>ref|XP_006390254.1| hypothetical protein EUTSA_v10018754mg [Eutrema salsugineum]
 gb|ESQ27540.1| hypothetical protein EUTSA_v10018754mg [Eutrema salsugineum]
Length=362

 Score =   405 bits (1042),  Expect = 4e-135, Method: Compositional matrix adjust.
 Identities = 189/332 (57%), Positives = 254/332 (77%), Gaps = 2/332 (1%)
 Frame = -2

Query  1268  IKLPNGLVVKAVIAFGDSIVDQGMNNNLSTMIKTNFPPYGQDFMGGKHTGRYSNGKTPPD  1089
             +KLP  L + A+IAFGDSIVD G NNN+ T++K +F PYG +F GG  TGR+ +G+TP D
Sbjct  31    VKLPPNLKIPALIAFGDSIVDTGNNNNVKTVVKCDFHPYGINFQGGVPTGRFCDGRTPAD  90

Query  1088  LVAEELGIKELVPAYLDPHLQPEDIKTGVSFASGASGYDPQTAALMSVIPLSEQLKYFKE  909
             L+AEE+GIK +VPAYLDP+L+PED+ TGVSFASG SGYDP T  L++VI L +QLKYF+E
Sbjct  91    LLAEEVGIKSVVPAYLDPNLKPEDLLTGVSFASGGSGYDPITPKLVAVISLQQQLKYFEE  150

Query  908   YLGKLNAMVGEKEAKSIINNTLFMVVSGSDDLANTYFTIGIRRYQYDINSYTDLLLEGAS  729
             Y+ K+N +VGE+  + I+ N++ ++V+GSDD+ANTY+ +  R  QYD++SYT L+   AS
Sbjct  151   YIEKVNHLVGEERKRFILANSIILLVAGSDDIANTYYDLHARP-QYDVDSYTTLMANSAS  209

Query  728   NFLQELYSLGARRIGFFGIPPVGCLPSQRTLAGGSERECVENYNQAAQLANAKFSAEIKI  549
             +F+ +LY  G RRI  FG PP+GC+PSQRT+ GG  REC E YN AA+L N+K S ++ +
Sbjct  210   DFVTKLYGYGVRRIAVFGAPPLGCVPSQRTVGGGLLRECAEYYNDAAKLFNSKLSVKLDL  269

Query  548   LSKKLPNSKLIFIDIYEDFLDMIKNPAKYGFEVVNLGCCGTGTIEVTMLCNKL-SGTCPD  372
               K LP  K ++I+IY+  LD+I+NPAKYGFEV N GCCGTG IEV +LCNK+ S  CPD
Sbjct  270   FRKTLPGIKPVYINIYDPLLDIIQNPAKYGFEVSNKGCCGTGVIEVAVLCNKITSSVCPD  329

Query  371   RNKYLFWDSYHPTEKGYRIIVNRIITKYINSF  276
              + ++FWDSYHPTEK Y+++V+ +I K IN F
Sbjct  330   VSSHVFWDSYHPTEKTYKVLVSLLINKAINQF  361



>ref|XP_009106247.1| PREDICTED: GDSL esterase/lipase EXL3 [Brassica rapa]
 emb|CDX87651.1| BnaA07g32220D [Brassica napus]
Length=362

 Score =   405 bits (1042),  Expect = 5e-135, Method: Compositional matrix adjust.
 Identities = 191/348 (55%), Positives = 262/348 (75%), Gaps = 3/348 (1%)
 Frame = -2

Query  1313  CIIAFLVLAGCSEAKIKLPNGLVVKAVIAFGDSIVDQGMNNNLSTMIKTNFPPYGQDFMG  1134
             C+++ L L     A IKLP  L   A+IAFGDSIVD G NNN+ T++K +F PYG +F G
Sbjct  17    CLLSVLFLTETLVA-IKLPPNLTFPALIAFGDSIVDTGNNNNVKTVVKCDFQPYGINFQG  75

Query  1133  GKHTGRYSNGKTPPDLVAEELGIKELVPAYLDPHLQPEDIKTGVSFASGASGYDPQTAAL  954
             G  TGR+ +G+ PPDL+AEELGIK +VPAYLDP L+ ED+ TGVSFASG SGYDP T  L
Sbjct  76    GVPTGRFCDGRVPPDLIAEELGIKSVVPAYLDPSLKTEDLLTGVSFASGGSGYDPLTPKL  135

Query  953   MSVIPLSEQLKYFKEYLGKLNAMVGEKEAKSIINNTLFMVVSGSDDLANTYFTIGIRRYQ  774
             ++VI L +QLKYF+EY+ K+  +VGE+    I+ N+LF++V+GSDD+ANTY+ +  R + 
Sbjct  136   VAVISLEDQLKYFEEYIEKVKNIVGEERKGFILANSLFLLVAGSDDIANTYYVLRARPH-  194

Query  773   YDINSYTDLLLEGASNFLQELYSLGARRIGFFGIPPVGCLPSQRTLAGGSERECVENYNQ  594
             YD++SYT L++  AS+F+ +LY  G RRI  FG PP+GC+PSQRTL GG  REC ENYN+
Sbjct  195   YDVDSYTTLMVNSASDFVNKLYGYGVRRIAVFGAPPLGCVPSQRTLGGGLLRECAENYNE  254

Query  593   AAQLANAKFSAEIKILSKKLPNSKLIFIDIYEDFLDMIKNPAKYGFEVVNLGCCGTGTIE  414
             AA+L N+K S ++ ++ K LP  K ++I+IY+  LD+I++PAKYGF V N GCCGTG IE
Sbjct  255   AAKLFNSKISPKLDLMQKTLPGIKPVYINIYDPLLDIIQSPAKYGFGVSNKGCCGTGVIE  314

Query  413   VTMLCNKL-SGTCPDRNKYLFWDSYHPTEKGYRIIVNRIITKYINSFT  273
             V +LCNK+ S  CPD + ++FWDSYHPTEK Y+++++ +I+K+++ F 
Sbjct  315   VAVLCNKITSSVCPDVSSHVFWDSYHPTEKTYKVLISLLISKFVDQFV  362



>ref|XP_007046631.1| Serine transhydroxymethyltransferase 1 isoform 2 [Theobroma cacao]
 gb|EOX90788.1| Serine transhydroxymethyltransferase 1 isoform 2 [Theobroma cacao]
Length=391

 Score =   406 bits (1044),  Expect = 6e-135, Method: Compositional matrix adjust.
 Identities = 203/351 (58%), Positives = 254/351 (72%), Gaps = 7/351 (2%)
 Frame = -2

Query  1310  IIAFLVLAGC--SEAKIKLPNGLVVKAVIAFGDSIVDQGMNNNLSTMIKTNFPPYGQDFM  1137
             I +FLV   C  +EA + LPN   V AV+ FGDSIVD G NNNL+T+ K+NFPPYG+DF 
Sbjct  41    IFSFLVALCCHGNEAALVLPNNETVPAVLVFGDSIVDPGNNNNLNTIAKSNFPPYGRDFE  100

Query  1136  GGKHTGRYSNGKTPPDLVAEELGIKELVPAYLDPHLQPEDIKTGVSFASGASGYDPQTAA  957
             GG  TGR+SNGK P DL+AEE G+KELVPAYLDP LQ ED+ TGVSFASGA+GYDP  A 
Sbjct  101   GGP-TGRFSNGKVPSDLIAEEFGVKELVPAYLDPSLQLEDLLTGVSFASGAAGYDPIAAK  159

Query  956   LMSVIPLSEQLKYFKEYLGKLNAMVGEKEAKSIINNTLFMVVSGSDDLANTYFTIGIRRY  777
             + +V+  S+QL  F++Y  K+ + VGE+ A +II+  +++VV GS+D+AN YF   IRR 
Sbjct  160   ISNVLSTSDQLDLFEQYKTKIKSAVGEERAATIISKAIYIVVFGSNDVANIYFGTPIRRT  219

Query  776   QYDINSYTDLLLEGASNFLQELYSLGARRIGFFGIPPVGCLPSQRTLAGGSERECVENYN  597
              YD NSYTD  +  AS FLQELY LGARRIG  G+PP+GC+PSQRTL GG  R+C +  N
Sbjct  220   HYDFNSYTDFTVSYASKFLQELYGLGARRIGVLGLPPIGCVPSQRTLGGGPNRDCYKGEN  279

Query  596   QAAQLANAKFSAEIKIL--SKKLPNSKLIFIDIYEDFLDMIKNPAKYGFEVVNLGCCGTG  423
             Q A L NAK S  I  L  S  LP +KLIF+DIY   L +I+N AKYGFEV N GCCGTG
Sbjct  280   QLASLYNAKLSGMIDSLRTSLNLPGTKLIFLDIYYPLLSLIQNAAKYGFEVTNKGCCGTG  339

Query  422   TIEVTMLCNKLS--GTCPDRNKYLFWDSYHPTEKGYRIIVNRIITKYINSF  276
              IE ++LCN LS   +CPD +KY+FWD YHP++K Y+I+V  I+  ++N F
Sbjct  340   LIEASILCNPLSIPKSCPDASKYVFWDGYHPSDKAYKILVPIILNMHLNEF  390



>ref|NP_177718.1| GDSL esterase/lipase EXL3 [Arabidopsis thaliana]
 sp|Q94CH6.1|EXL3_ARATH RecName: Full=GDSL esterase/lipase EXL3; AltName: Full=Family 
II extracellular lipase 3; Short=Family II lipase EXL3; Flags: 
Precursor [Arabidopsis thaliana]
 gb|AAK30018.1| family II lipase EXL3 [Arabidopsis thaliana]
 gb|AEE35772.1| GDSL esterase/lipase EXL3 [Arabidopsis thaliana]
Length=364

 Score =   405 bits (1040),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 190/348 (55%), Positives = 259/348 (74%), Gaps = 3/348 (1%)
 Frame = -2

Query  1313  CIIAFLVLAGCSEAKIKLPNGLVVKAVIAFGDSIVDQGMNNNLSTMIKTNFPPYGQDFMG  1134
             C+++ L L     A +KLP  L++ AVIAFGDSIVD GMNNN+ T++K +F PYG +F  
Sbjct  19    CLLSVLFLTETITA-VKLPPKLIIPAVIAFGDSIVDTGMNNNVKTVVKCDFLPYGINFQS  77

Query  1133  GKHTGRYSNGKTPPDLVAEELGIKELVPAYLDPHLQPEDIKTGVSFASGASGYDPQTAAL  954
             G  TGR+ +G+ P DL+AEELGIK +VPAYLDP+L+ +D+ TGVSFASG SGYDP T  L
Sbjct  78    GVATGRFCDGRVPADLLAEELGIKSIVPAYLDPNLKSKDLLTGVSFASGGSGYDPITPKL  137

Query  953   MSVIPLSEQLKYFKEYLGKLNAMVGEKEAKSIINNTLFMVVSGSDDLANTYFTIGIRRYQ  774
             ++VI L +QL YF+EY+ K+  +VGE     I+ N+LF++V+GSDD+ANTY+T+  R  +
Sbjct  138   VAVISLEDQLSYFEEYIEKVKNIVGEARKDFIVANSLFLLVAGSDDIANTYYTLRARP-E  196

Query  773   YDINSYTDLLLEGASNFLQELYSLGARRIGFFGIPPVGCLPSQRTLAGGSERECVENYNQ  594
             YD++SYT L+ + AS F+ +LY  G RR+  FG PP+GC+PSQRTL GG  R+C +NYN+
Sbjct  197   YDVDSYTTLMSDSASEFVTKLYGYGVRRVAVFGAPPIGCVPSQRTLGGGILRDCADNYNE  256

Query  593   AAQLANAKFSAEIKILSKKLPNSKLIFIDIYEDFLDMIKNPAKYGFEVVNLGCCGTGTIE  414
             AA+L N+K S ++  L K LP  K I+I+IY+   D+I+NPA YGFEV N GCCGTG IE
Sbjct  257   AAKLFNSKLSPKLDSLRKTLPGIKPIYINIYDPLFDIIQNPANYGFEVSNKGCCGTGAIE  316

Query  413   VTMLCNKL-SGTCPDRNKYLFWDSYHPTEKGYRIIVNRIITKYINSFT  273
             V +LCNK+ S  CPD + ++FWDSYHPTEK Y+++V+ +I K++N F 
Sbjct  317   VAVLCNKITSSVCPDVSTHVFWDSYHPTEKTYKVLVSLLINKFVNQFV  364



>ref|XP_006473698.1| PREDICTED: GDSL esterase/lipase EXL1-like [Citrus sinensis]
Length=722

 Score =   417 bits (1071),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 203/346 (59%), Positives = 260/346 (75%), Gaps = 3/346 (1%)
 Frame = -2

Query  1307  IAFLVLAGCSEAKIKLPNGLVVKAVIAFGDSIVDQGMNNNLSTMIKTNFPPYGQDFMGGK  1128
             ++ L L   +EA IKLP  + V AVI FGDSIVD G NNNL T  K NFPPYG+DF GG 
Sbjct  377   VSVLDLFRRTEAVIKLPGNVTVSAVIVFGDSIVDTGNNNNLKTPAKCNFPPYGRDFEGGA  436

Query  1127  HTGRYSNGKTPPDLVAEELGIKELVPAYLDPHLQPEDIKTGVSFASGASGYDPQTAAL-M  951
              TGR+SNGK P D++AEELG+KEL PAYLDP L+PED+ TGV+FASG  GYDP T  L  
Sbjct  437   ATGRFSNGKVPSDILAEELGVKELSPAYLDPTLKPEDLLTGVNFASGGCGYDPLTTRLSA  496

Query  950   SVIPLSEQLKYFKEYLGKLNAMVGEKEAKSIINNTLFMVVSGSDDLANTYFTIGIRRYQY  771
             + + LS+QL+ FKEY+ KL A+VGE+    I   + F+VV GS+D+ N YF   IRR QY
Sbjct  497   AALSLSDQLQLFKEYIDKLRAIVGEEGKNRIFETSFFLVVVGSNDINNNYFGSRIRRLQY  556

Query  770   DINSYTDLLLEGASNFLQELYSLGARRIGFFGIPPVGCLPSQRTLAGGSERECVENYNQA  591
             DI++YTDLL+  AS FL+E+Y LGARRIG FG P +GCLPS RT+AGG +R+C + YN+A
Sbjct  557   DISTYTDLLVGHASTFLKEIYGLGARRIGVFGAPTLGCLPSTRTVAGGIKRDCAKEYNEA  616

Query  590   AQLANAKFSAEIKILSKKLPNSKLIFIDIYEDFLDMIKNPAKYGFEVVNLGCCGTGTIEV  411
             AQL N+K SAE+  L+  LP+ ++++IDIY   LD+I+NP KYGF++V+ GCCGTGTIEV
Sbjct  617   AQLFNSKLSAELDSLN-NLPDVRIVYIDIYSPLLDIIQNPNKYGFDIVDKGCCGTGTIEV  675

Query  410   TMLCNKLSG-TCPDRNKYLFWDSYHPTEKGYRIIVNRIITKYINSF  276
              +LCN+ S  TC + + YLFWDS+HPTEK Y+I+V+ ++ KYIN F
Sbjct  676   IILCNQFSPYTCTNDSGYLFWDSFHPTEKAYKILVSNLVKKYINRF  721


 Score =   414 bits (1065),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 194/346 (56%), Positives = 251/346 (73%), Gaps = 1/346 (0%)
 Frame = -2

Query  1310  IIAFLVLAGCSEAKIKLPNGLVVKAVIAFGDSIVDQGMNNNLSTMIKTNFPPYGQDFMGG  1131
             + +  VL   +EA IKLP  + + AVI FGDSIVD G NNNL T  K NFPPYG+DFMGG
Sbjct  17    LFSVFVLVVSTEAVIKLPGNVTIPAVIVFGDSIVDAGNNNNLKTPAKCNFPPYGRDFMGG  76

Query  1130  KHTGRYSNGKTPPDLVAEELGIKELVPAYLDPHLQPEDIKTGVSFASGASGYDPQTAALM  951
               TGR+SNGK P DL+ EELGIKEL+PAYL P+LQPED+ TGV+FASG  GYDP T  L 
Sbjct  77    VSTGRFSNGKVPSDLIVEELGIKELLPAYLQPNLQPEDLLTGVTFASGGCGYDPLTTELA  136

Query  950   SVIPLSEQLKYFKEYLGKLNAMVGEKEAKSIINNTLFMVVSGSDDLANTYFTIGIRRYQY  771
             S IPLS+QL+ FKEY  K+  +VGE+    I+     +VV+GS+D+ NTYF   +R+ QY
Sbjct  137   SAIPLSDQLQLFKEYTEKVKQIVGEEGQNRIVKTAFVLVVAGSNDIDNTYFASRVRKLQY  196

Query  770   DINSYTDLLLEGASNFLQELYSLGARRIGFFGIPPVGCLPSQRTLAGGSERECVENYNQA  591
             DI++YTDL++  AS F +ELY LG RR+G F  PP+GCLPS RTL GG  R+C  +YN+A
Sbjct  197   DISAYTDLIVGLASTFFKELYGLGVRRMGVFSAPPLGCLPSSRTLGGGKTRDCANDYNEA  256

Query  590   AQLANAKFSAEIKILSKKLPNSKLIFIDIYEDFLDMIKNPAKYGFEVVNLGCCGTGTIEV  411
             AQ+ N K SAE++ L+ + P+++L+ IDIY   L +I+NP KYGFEVVN GCCGTG +E 
Sbjct  257   AQMFNTKLSAELESLNIQFPDARLLLIDIYNPLLYLIQNPIKYGFEVVNKGCCGTGYLEA  316

Query  410   TMLCNKLS-GTCPDRNKYLFWDSYHPTEKGYRIIVNRIITKYINSF  276
             ++ CN+ S  TC + + Y+FWD YHPTE+ Y+I+V+ +I K  N F
Sbjct  317   SIFCNQFSPNTCTNVSGYIFWDGYHPTERTYKILVSSLINKIANGF  362



>ref|XP_010033516.1| PREDICTED: GDSL esterase/lipase EXL3-like [Eucalyptus grandis]
Length=367

 Score =   405 bits (1040),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 184/323 (57%), Positives = 244/323 (76%), Gaps = 2/323 (1%)
 Frame = -2

Query  1238  AVIAFGDSIVDQGMNNNLSTMIKTNFPPYGQDFMGGKHTGRYSNGKTPPDLVAEELGIKE  1059
             A IAFGDSI+D G NNN+ T++K NFPPYG+DFMGGK +GR+SNGK PPDL  E  G+K+
Sbjct  44    AYIAFGDSIIDPGNNNNIQTIVKCNFPPYGRDFMGGKPSGRFSNGKIPPDLFVEAFGVKQ  103

Query  1058  LVPAYLDPHLQPEDIKTGVSFASGASGYDPQTAALMSVIPLSEQLKYFKEYLGKLNAMVG  879
              +PAYLDP L+ ED+ TGVSFASGA+GYDP T  + S + LS+QL  FKEY+ K+ +  G
Sbjct  104   YLPAYLDPSLKLEDLLTGVSFASGATGYDPLTPQIASALSLSDQLNLFKEYVNKIKSGAG  163

Query  878   EKEAKSIINNTLFMVVSGSDDLANTYFTIGIRRYQYDINSYTDLLLEGASNFLQELYSLG  699
             E++A  I+ N+++MVV GSDD+ANTY++   RR +YDI +YTDL+L  AS+F+QELY LG
Sbjct  164   EEKAADIVKNSVYMVVCGSDDIANTYYSTPFRRGEYDIPAYTDLMLNSASSFIQELYGLG  223

Query  698   ARRIGFFGIPPVGCLPSQRTLAGGSERECVENYNQAAQLANAKFSAEIKILSKKLPNSKL  519
             AR+IG   +PP+GC+P+QRTL GG ER C    NQAA L N+K S+E++ L +KLP SKL
Sbjct  224   ARKIGILSLPPIGCVPAQRTLDGGLERACNAPANQAATLFNSKLSSELESLKQKLPGSKL  283

Query  518   IFIDIYEDFLDMIKNPAKYGFEVVNLGCCGTGTIEVTMLCNKLSG--TCPDRNKYLFWDS  345
             +++DIY   L +I+NP+ YGFEV + GCCGTG IEV++LCN+L    TC D +KY+FWD 
Sbjct  284   VYMDIYHKLLSVIQNPSHYGFEVADRGCCGTGNIEVSILCNRLDDLETCQDDSKYVFWDG  343

Query  344   YHPTEKGYRIIVNRIITKYINSF  276
             YHPTE  Y+I+ + +I  Y +  
Sbjct  344   YHPTENAYKILSDHVIDNYADQL  366



>ref|XP_004292937.1| PREDICTED: uncharacterized protein LOC101306013 [Fragaria vesca 
subsp. vesca]
Length=748

 Score =   417 bits (1073),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 190/337 (56%), Positives = 253/337 (75%), Gaps = 1/337 (0%)
 Frame = -2

Query  1280  SEAKIKLPNGLVVKAVIAFGDSIVDQGMNNNLSTMIKTNFPPYGQDFMGGKHTGRYSNGK  1101
             +E ++++P G  + A+I FGDSI+D G NNNL ++IK NFPPYGQ+F G   TGR+ NGK
Sbjct  42    TECRVQIPPGKTLPAIIIFGDSIMDTGNNNNLKSVIKCNFPPYGQNFPGKVPTGRFGNGK  101

Query  1100  TPPDLVAEELGIKELVPAYLDPHLQPEDIKTGVSFASGASGYDPQTAALMSVIPLSEQLK  921
              P D +A ELG+KE VP Y D  L PE++ TGV FASG +GYDPQT  L+SVI LS+QL 
Sbjct  102   VPSDFIAHELGVKEFVPPYADTSLTPEELSTGVCFASGGTGYDPQTPELVSVISLSDQLN  161

Query  920   YFKEYLGKLNAMVGEKEAKSIINNTLFMVVSGSDDLANTYFTIGIRRYQYDINSYTDLLL  741
              FKEY+GKL A  GE+    I+ N+LF+VV+GSDD+ANTYFTIGIR+ QYD+ +YTDL++
Sbjct  162   SFKEYIGKLKANFGEERTNFILANSLFLVVAGSDDIANTYFTIGIRKAQYDVPAYTDLMV  221

Query  740   EGASNFLQ-ELYSLGARRIGFFGIPPVGCLPSQRTLAGGSERECVENYNQAAQLANAKFS  564
               A+NFLQ +LY+LGARR G F  PP+GC+PSQRTL GG +R+C E YN AA+L N+K S
Sbjct  222   NSATNFLQVDLYALGARRFGVFSAPPIGCVPSQRTLGGGIQRQCAEEYNDAAKLFNSKLS  281

Query  563   AEIKILSKKLPNSKLIFIDIYEDFLDMIKNPAKYGFEVVNLGCCGTGTIEVTMLCNKLSG  384
             A +K L+ KLP+S++++ID+Y   LD+I  P KYG +V N GCCGTG +EV +LC KLS 
Sbjct  282   ANMKSLNSKLPDSRMVYIDVYTPILDIILYPTKYGLKVANKGCCGTGVLEVAILCTKLSP  341

Query  383   TCPDRNKYLFWDSYHPTEKGYRIIVNRIITKYINSFT  273
             TC +   ++FWDSYHPTE+ Y +++  ++ KY+N  +
Sbjct  342   TCENPGDHVFWDSYHPTEQAYSVLIPPLLQKYVNHLS  378


 Score =   386 bits (991),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 186/354 (53%), Positives = 251/354 (71%), Gaps = 10/354 (3%)
 Frame = -2

Query  1313  CIIAFLVLAGCSEA------KIKLPNGLVVKAVIAFGDSIVDQGMNNN-LSTMIKTNFPP  1155
             C++ ++++  C+E       K+KLP  + V AVI FGDSIVD G NNN + T  + NF P
Sbjct  396   CVLCYILM--CNEGLAMKPMKLKLPANVSVPAVIMFGDSIVDTGNNNNNMKTFARCNFLP  453

Query  1154  YGQDFMGGKHTGRYSNGKTPPDLVAEELGIKELVPAYLDPHLQPEDIKTGVSFASGASGY  975
             YG+DF GG  TGR+SNGK P DL+ E  GIKEL+P Y+D  L+P D+ TGV+ A+G  GY
Sbjct  454   YGKDFEGGLPTGRFSNGKVPADLLVEAFGIKELLPPYMDGSLEPNDLLTGVNLAAGGVGY  513

Query  974   DPQTAALMSVIPLSEQLKYFKEYLGKLNAMVGEKEAKSIINNTLFMVVSGSDDLANTYFT  795
             DP T+ + +V  LS+QL+ FKEY+ KL  +VGEK    II+N++  VV GS+D++NTYF 
Sbjct  514   DPLTSKIAAVESLSDQLEQFKEYIEKLKGIVGEKRTNFIISNSMIFVVIGSNDISNTYFL  573

Query  794   IGIRRYQYDINSYTDLLLEGASNFLQELYSLGARRIGFFGIPPVGCLPSQRTLAGGSERE  615
             +G R+ Q+D+ SY D +L  AS F +ELY LGARRI   G+P +GC+PSQRT+ GG  R+
Sbjct  574   LGARKLQFDLPSYIDFILNHASEFFKELYRLGARRIAVLGVPAIGCVPSQRTIGGGVGRD  633

Query  614   CVENYNQAAQLANAKFSAEIKILSKKLPNSKLIFIDIYEDFLDMIKNPAKYGFEVVNLGC  435
             C E  NQAA+L N+K SAE+  L   LP+SK  ++D+Y    D+IKNP KYGFEVVN GC
Sbjct  634   CDEKQNQAAELFNSKLSAEMNHLRHTLPDSKFTYMDVYNPLQDIIKNPNKYGFEVVNKGC  693

Query  434   CGTGTIEVTMLCNKLS-GTCPDRNKYLFWDSYHPTEKGYRIIVNRIITKYINSF  276
             CGTG +EVT+LCNK S  TC + + Y+FWDSYHPTE+ Y+I+ ++++   I+SF
Sbjct  694   CGTGMLEVTILCNKWSPKTCSNASTYVFWDSYHPTERAYQILSHQVLQNTIHSF  747



>ref|XP_009379346.1| PREDICTED: GDSL esterase/lipase EXL3-like [Pyrus x bretschneideri]
Length=366

 Score =   404 bits (1039),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 184/334 (55%), Positives = 253/334 (76%), Gaps = 1/334 (0%)
 Frame = -2

Query  1274  AKIKLPNGLVVKAVIAFGDSIVDQGMNNNLSTMIKTNFPPYGQDFMGGKHTGRYSNGKTP  1095
             A +KLPN   + A+I FGDSIVD G N+N+ T++K NFPPYG+DF+G + TGR+SNG+ P
Sbjct  32    AAVKLPNNEKIPALIVFGDSIVDPGNNDNIGTIVKCNFPPYGRDFIGKRPTGRFSNGRVP  91

Query  1094  PDLVAEELGIKELVPAYLDPHLQPEDIKTGVSFASGASGYDPQTAALMSVIPLSEQLKYF  915
              DL+AE +G+K ++PAYLDP+++ ED+ TGVSFASG SGYDP T  ++SV+ LS+QL  F
Sbjct  92    SDLIAESVGVKNILPAYLDPNVKIEDLLTGVSFASGGSGYDPLTPQIVSVLSLSDQLDLF  151

Query  914   KEYLGKLNAMVGEKEAKSIINNTLFMVVSGSDDLANTYFTIGIRRYQYDINSYTDLLLEG  735
             K+Y+ K+ A VGE+ A +I++ +++++  GSDD+ANTY +  +RR  YDI +YTDL++  
Sbjct  152   KDYIRKITAAVGEESAATIVSKSIYILCIGSDDIANTYLSTPVRRPYYDIPAYTDLMINS  211

Query  734   ASNFLQELYSLGARRIGFFGIPPVGCLPSQRTLAGGSERECVENYNQAAQLANAKFSAEI  555
             AS+FLQELY LGARRIG   +P +GC+PSQRTL GG  R+C E  NQAA+L N+K SA+I
Sbjct  212   ASSFLQELYGLGARRIGVINLPAIGCVPSQRTLGGGINRDCSETANQAARLFNSKLSAKI  271

Query  554   KILSKKLPNSKLIFIDIYEDFLDMIKNPAKYGFEVVNLGCCGTGTIEVTMLCNKLS-GTC  378
                +K+LP ++++++DIY   L +I+NP +YGFEV N GCCGTG IEV++LC + S GTC
Sbjct  272   DAFNKRLPQARVVYLDIYYTLLSLIQNPTQYGFEVANKGCCGTGNIEVSVLCTRYSPGTC  331

Query  377   PDRNKYLFWDSYHPTEKGYRIIVNRIITKYINSF  276
              D +KY+FWDSYHPTEK Y I+V  +    I  F
Sbjct  332   NDSSKYIFWDSYHPTEKTYEILVPLVFDTQIRKF  365



>gb|ACU19367.1| unknown [Glycine max]
Length=363

 Score =   404 bits (1039),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 186/326 (57%), Positives = 245/326 (75%), Gaps = 0/326 (0%)
 Frame = -2

Query  1259  PNGLVVKAVIAFGDSIVDQGMNNNLSTMIKTNFPPYGQDFMGGKHTGRYSNGKTPPDLVA  1080
             PN   V AV+AFGDSIVD G NNN+ T+IK NFPPYG+DF G   TGR+ NGK P DL+A
Sbjct  35    PNASSVPAVLAFGDSIVDPGNNNNIKTLIKCNFPPYGKDFQGRNPTGRFCNGKIPSDLIA  94

Query  1079  EELGIKELVPAYLDPHLQPEDIKTGVSFASGASGYDPQTAALMSVIPLSEQLKYFKEYLG  900
             E+LGIKE +P YLDP+L+  D+ TGV FASGASGYDP T  + SV+ LS QL  F+EY+G
Sbjct  95    EQLGIKEYLPVYLDPNLKSSDLVTGVCFASGASGYDPLTPKITSVLSLSTQLDMFREYIG  154

Query  899   KLNAMVGEKEAKSIINNTLFMVVSGSDDLANTYFTIGIRRYQYDINSYTDLLLEGASNFL  720
             KL  +VGE     I++N+L++VV+GSDD+ANTYF    R  QYDI SYTDL++  ASNF+
Sbjct  155   KLKGIVGESRTNYILSNSLYLVVAGSDDIANTYFVAHARILQYDIPSYTDLMVNSASNFV  214

Query  719   QELYSLGARRIGFFGIPPVGCLPSQRTLAGGSERECVENYNQAAQLANAKFSAEIKILSK  540
             +ELY+LGARR+   G PP+GC+PSQRTLAGG  R+C E YN AA+L N+K S E+  L  
Sbjct  215   KELYNLGARRVAVLGAPPIGCVPSQRTLAGGLTRKCSEKYNYAARLFNSKLSKELDSLGH  274

Query  539   KLPNSKLIFIDIYEDFLDMIKNPAKYGFEVVNLGCCGTGTIEVTMLCNKLSGTCPDRNKY  360
              L ++++++ID+Y   LD+I+N  K+G++V++ GCCGTG +EV +LCN L  TC + ++Y
Sbjct  275   NLSDTRIVYIDVYTPLLDIIENYQKHGYKVMDRGCCGTGKLEVAVLCNPLDATCSNASEY  334

Query  359   LFWDSYHPTEKGYRIIVNRIITKYIN  282
             +FWDSYHPTE  YR +VN ++ KYI+
Sbjct  335   VFWDSYHPTEGVYRKLVNYVLEKYID  360



>ref|XP_010033517.1| PREDICTED: GDSL esterase/lipase EXL3-like [Eucalyptus grandis]
 gb|KCW53199.1| hypothetical protein EUGRSUZ_J02472 [Eucalyptus grandis]
Length=367

 Score =   404 bits (1038),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 186/323 (58%), Positives = 242/323 (75%), Gaps = 2/323 (1%)
 Frame = -2

Query  1238  AVIAFGDSIVDQGMNNNLSTMIKTNFPPYGQDFMGGKHTGRYSNGKTPPDLVAEELGIKE  1059
             A I FGDSI+D G NNN+ T++K NFPPYG+DFMGGK +GR+SNGK PPDL  E  G+K+
Sbjct  44    AFIVFGDSIIDPGNNNNIQTIVKCNFPPYGRDFMGGKPSGRFSNGKIPPDLFVEAFGLKQ  103

Query  1058  LVPAYLDPHLQPEDIKTGVSFASGASGYDPQTAALMSVIPLSEQLKYFKEYLGKLNAMVG  879
              +PAYLDP L+ ED+ TGVSFASGA+GYDP T  + S + LS+QL  FKEY+ K+ +  G
Sbjct  104   YLPAYLDPSLKLEDLLTGVSFASGATGYDPLTPQIASALSLSDQLNLFKEYVNKIKSGAG  163

Query  878   EKEAKSIINNTLFMVVSGSDDLANTYFTIGIRRYQYDINSYTDLLLEGASNFLQELYSLG  699
             E++A  I+ N+L+MVV GSDD+ANTY++   RR +YDI +YTDL+L  AS+F+QELY LG
Sbjct  164   EEKASYIVKNSLYMVVCGSDDIANTYYSTPFRRGEYDIPAYTDLMLNSASSFIQELYGLG  223

Query  698   ARRIGFFGIPPVGCLPSQRTLAGGSERECVENYNQAAQLANAKFSAEIKILSKKLPNSKL  519
             AR+I    IPP+GC+P+QRTL GG ER C    NQAA L N+K  +EI+ L +KLP SKL
Sbjct  224   ARKISILSIPPIGCVPAQRTLDGGLERACNAPANQAATLFNSKLISEIESLKQKLPGSKL  283

Query  518   IFIDIYEDFLDMIKNPAKYGFEVVNLGCCGTGTIEVTMLCNKLSG--TCPDRNKYLFWDS  345
             +++DIY   L +I+NP+ YGFEV N GCCGTG IEV++LCN+L    TC D +KY+FWDS
Sbjct  284   VYLDIYHKLLSVIQNPSHYGFEVANRGCCGTGNIEVSILCNRLDDLETCQDDSKYVFWDS  343

Query  344   YHPTEKGYRIIVNRIITKYINSF  276
             YHPTE  Y+I+ + +I  Y +  
Sbjct  344   YHPTENTYKILTDHVIDNYADQL  366



>ref|XP_008350488.1| PREDICTED: GDSL esterase/lipase EXL3-like [Malus domestica]
Length=379

 Score =   404 bits (1039),  Expect = 3e-134, Method: Compositional matrix adjust.
 Identities = 192/336 (57%), Positives = 241/336 (72%), Gaps = 1/336 (0%)
 Frame = -2

Query  1280  SEAKIKLPNGLVVKAVIAFGDSIVDQGMNN-NLSTMIKTNFPPYGQDFMGGKHTGRYSNG  1104
             + A +KLP  + + AVI FGDSIVD G NN N  T  + NF PYG+D  GG  TGRYSNG
Sbjct  43    AAATVKLPENVTIPAVIVFGDSIVDTGNNNKNFVTFARCNFLPYGKDLKGGMPTGRYSNG  102

Query  1103  KTPPDLVAEELGIKELVPAYLDPHLQPEDIKTGVSFASGASGYDPQTAALMSVIPLSEQL  924
             K P D + E  GIKEL+PAYLDP LQP D+ TGV  A+GA GYDP TA L  V  LS+Q 
Sbjct  103   KVPSDFIVEAFGIKELLPAYLDPTLQPNDLLTGVVXANGAXGYDPLTAKLGVVASLSDQX  162

Query  923   KYFKEYLGKLNAMVGEKEAKSIINNTLFMVVSGSDDLANTYFTIGIRRYQYDINSYTDLL  744
             K FKEY+ KL  +VGE++   II N+L  VV+GS+D++ TYF  G RR +YD+ SYTD +
Sbjct  163   KQFKEYIEKLKGIVGEEKTNFIIKNSLIFVVAGSNDISXTYFLTGARRLEYDVPSYTDFM  222

Query  743   LEGASNFLQELYSLGARRIGFFGIPPVGCLPSQRTLAGGSERECVENYNQAAQLANAKFS  564
             L+ AS+F+++LY LG RRIG    PP+GC+PSQRT+ GG ER+C E  NQA QL N+K +
Sbjct  223   LKHASDFVKDLYGLGVRRIGVLSAPPIGCVPSQRTVNGGIERDCDERQNQACQLFNSKLN  282

Query  563   AEIKILSKKLPNSKLIFIDIYEDFLDMIKNPAKYGFEVVNLGCCGTGTIEVTMLCNKLSG  384
              E+  L+K LPNS++++IDIY   LD+IKNPAKYGFEV N GCCGTG IEVT LCN+L  
Sbjct  283   VEMDRLNKXLPNSRVVYIDIYNPLLDIIKNPAKYGFEVANKGCCGTGLIEVTKLCNQLQX  342

Query  383   TCPDRNKYLFWDSYHPTEKGYRIIVNRIITKYINSF  276
              C D + Y+FWDSYHPTE  Y+IIV +++  Y + F
Sbjct  343   VCTDDSNYVFWDSYHPTETAYKIIVKQMLNNYSSRF  378



>ref|XP_009363464.1| PREDICTED: GDSL esterase/lipase EXL3-like [Pyrus x bretschneideri]
Length=367

 Score =   404 bits (1037),  Expect = 3e-134, Method: Compositional matrix adjust.
 Identities = 180/334 (54%), Positives = 254/334 (76%), Gaps = 1/334 (0%)
 Frame = -2

Query  1274  AKIKLPNGLVVKAVIAFGDSIVDQGMNNNLSTMIKTNFPPYGQDFMGGKHTGRYSNGKTP  1095
             A +KLPN   V AVI FGDS+VD G NNN+ST++K NFPPYG+DF G + TGR+SNG+ P
Sbjct  33    AAVKLPNNEKVPAVIVFGDSVVDPGNNNNISTIVKCNFPPYGRDFAGQRPTGRFSNGRVP  92

Query  1094  PDLVAEELGIKELVPAYLDPHLQPEDIKTGVSFASGASGYDPQTAALMSVIPLSEQLKYF  915
              D++AE +G+K+++PAYLDP+L+  D+ TGVSFASG SGYDP T  ++SV+ LS+Q+  F
Sbjct  93    SDMIAESVGVKKILPAYLDPNLKIHDLLTGVSFASGGSGYDPLTPKIVSVLSLSDQIDMF  152

Query  914   KEYLGKLNAMVGEKEAKSIINNTLFMVVSGSDDLANTYFTIGIRRYQYDINSYTDLLLEG  735
             K Y+ K+   VG++ A +I++ ++++V +GSDD+A+TY+   +RR +YDI++YTDL++E 
Sbjct  153   KNYISKITVAVGKEGAATIVSKSIYIVCTGSDDIAHTYYFTPLRRPRYDISAYTDLMVES  212

Query  734   ASNFLQELYSLGARRIGFFGIPPVGCLPSQRTLAGGSERECVENYNQAAQLANAKFSAEI  555
             AS+F QELY LGARRIG   +PP+GCLPSQRTL GG ER C E  NQAA L N+K   +I
Sbjct  213   ASSFFQELYELGARRIGVVNLPPIGCLPSQRTLGGGRERGCSETTNQAASLFNSKLLPKI  272

Query  554   KILSKKLPNSKLIFIDIYEDFLDMIKNPAKYGFEVVNLGCCGTGTIEVTMLCNKLS-GTC  378
                + +LP ++L+++DIY   L +I+NP ++GFEV++ GCCGTG IEV++LC + S GTC
Sbjct  273   DAFNTRLPEARLVYLDIYNTVLSLIQNPTQFGFEVMDQGCCGTGIIEVSILCTRYSPGTC  332

Query  377   PDRNKYLFWDSYHPTEKGYRIIVNRIITKYINSF  276
              D +KY+FWDSYHP+EKGY +I+  +    ++ F
Sbjct  333   NDSSKYIFWDSYHPSEKGYEVIIPLVFDSQVHKF  366



>ref|XP_010105283.1| GDSL esterase/lipase EXL3 [Morus notabilis]
 gb|EXC04218.1| GDSL esterase/lipase EXL3 [Morus notabilis]
Length=356

 Score =   403 bits (1035),  Expect = 4e-134, Method: Compositional matrix adjust.
 Identities = 192/348 (55%), Positives = 251/348 (72%), Gaps = 2/348 (1%)
 Frame = -2

Query  1313  CIIAFLVLAGCSEAKIKLPNGLVVKAVIAFGDSIVDQGMNNN-LSTMIKTNFPPYGQDFM  1137
             C+   L+     EA++KLP    V AVI FGDSIVD G NNN + ++ ++NFPPYG+DF 
Sbjct  10    CVCLLLIFTEI-EARVKLPGNATVPAVIVFGDSIVDTGNNNNNVLSLARSNFPPYGRDFK  68

Query  1136  GGKHTGRYSNGKTPPDLVAEELGIKELVPAYLDPHLQPEDIKTGVSFASGASGYDPQTAA  957
             GG  TGRYSNGK P DL+ EELGIKEL+P Y DP+L+PED+ TGV FA G  GYD  T+ 
Sbjct  69    GGVPTGRYSNGKVPSDLLVEELGIKELLPPYADPNLKPEDLLTGVCFAVGGVGYDDFTSK  128

Query  956   LMSVIPLSEQLKYFKEYLGKLNAMVGEKEAKSIINNTLFMVVSGSDDLANTYFTIGIRRY  777
             L SV  LS+QL+ FKEY+ KL  +VG +    II N++  VV  S+D+ANTYF+   R  
Sbjct  129   LASVPLLSDQLEKFKEYIKKLKGIVGVERTNFIIANSIHFVVLSSNDIANTYFSTKTRSL  188

Query  776   QYDINSYTDLLLEGASNFLQELYSLGARRIGFFGIPPVGCLPSQRTLAGGSERECVENYN  597
             QYDI+SYTDL++  AS F QELY LG RR+G  G PP+GC+PSQRT+ GG ER C E  N
Sbjct  189   QYDISSYTDLMVNHASKFFQELYGLGVRRLGVLGAPPIGCVPSQRTIGGGLERNCFEQEN  248

Query  596   QAAQLANAKFSAEIKILSKKLPNSKLIFIDIYEDFLDMIKNPAKYGFEVVNLGCCGTGTI  417
             +AA+L N+K SAE+  L+K  P+++L++IDIY   L++I+NP K GF++VN GCCGTG I
Sbjct  249   EAAKLFNSKLSAELDNLNKDRPDARLVYIDIYYPLLNLIQNPTKNGFKIVNKGCCGTGLI  308

Query  416   EVTMLCNKLSGTCPDRNKYLFWDSYHPTEKGYRIIVNRIITKYINSFT  273
             E  + CN L  TC D + Y+FWD+YHPTE+ Y++IV++II+KY+N F 
Sbjct  309   EAALTCNALDTTCKDDSIYVFWDAYHPTERAYKLIVSQIISKYVNEFV  356



>dbj|BAC41809.1| putative family II lipase EXL3 [Arabidopsis thaliana]
Length=364

 Score =   403 bits (1036),  Expect = 4e-134, Method: Compositional matrix adjust.
 Identities = 189/348 (54%), Positives = 259/348 (74%), Gaps = 3/348 (1%)
 Frame = -2

Query  1313  CIIAFLVLAGCSEAKIKLPNGLVVKAVIAFGDSIVDQGMNNNLSTMIKTNFPPYGQDFMG  1134
             C+++ L L     A +KLP  L++ AVIAFGDSIVD G+NNN+ T++K +F PYG +F  
Sbjct  19    CLLSVLFLTETITA-VKLPPKLIIPAVIAFGDSIVDTGINNNVKTVVKCDFLPYGINFQS  77

Query  1133  GKHTGRYSNGKTPPDLVAEELGIKELVPAYLDPHLQPEDIKTGVSFASGASGYDPQTAAL  954
             G  TGR+ +G+ P DL+AEELGIK +VPAYLDP+L+ +D+ TGVSFASG SGYDP T  L
Sbjct  78    GVATGRFCDGRVPADLLAEELGIKSIVPAYLDPNLKSKDLLTGVSFASGGSGYDPITPKL  137

Query  953   MSVIPLSEQLKYFKEYLGKLNAMVGEKEAKSIINNTLFMVVSGSDDLANTYFTIGIRRYQ  774
             ++VI L +QL YF+EY+ K+  +VGE     I+ N+LF++V+GSDD+ANTY+T+  R  +
Sbjct  138   VAVISLEDQLSYFEEYIEKVKNIVGEARKDFIVANSLFLLVAGSDDIANTYYTLRARP-E  196

Query  773   YDINSYTDLLLEGASNFLQELYSLGARRIGFFGIPPVGCLPSQRTLAGGSERECVENYNQ  594
             YD++SYT L+ + AS F+ +LY  G RR+  FG PP+GC+PSQRTL GG  R+C +NYN+
Sbjct  197   YDVDSYTTLMSDSASEFVTKLYGYGVRRVAVFGAPPIGCVPSQRTLGGGILRDCADNYNE  256

Query  593   AAQLANAKFSAEIKILSKKLPNSKLIFIDIYEDFLDMIKNPAKYGFEVVNLGCCGTGTIE  414
             AA+L N+K S ++  L K LP  K I+I+IY+   D+I+NPA YGFEV N GCCGTG IE
Sbjct  257   AAKLFNSKLSPKLDSLRKTLPGIKPIYINIYDPLFDIIQNPANYGFEVSNKGCCGTGAIE  316

Query  413   VTMLCNKL-SGTCPDRNKYLFWDSYHPTEKGYRIIVNRIITKYINSFT  273
             V +LCNK+ S  CPD + ++FWDSYHPTEK Y+++V+ +I K++N F 
Sbjct  317   VAVLCNKITSSVCPDVSTHVFWDSYHPTEKTYKVLVSLLINKFVNQFV  364



>emb|CDX73211.1| BnaC06g36590D [Brassica napus]
Length=362

 Score =   403 bits (1036),  Expect = 5e-134, Method: Compositional matrix adjust.
 Identities = 191/348 (55%), Positives = 261/348 (75%), Gaps = 3/348 (1%)
 Frame = -2

Query  1313  CIIAFLVLAGCSEAKIKLPNGLVVKAVIAFGDSIVDQGMNNNLSTMIKTNFPPYGQDFMG  1134
             C+++ L L     A IKLP  L   A+IAFGDSIVD G NNN+ T++K +F PYG +F G
Sbjct  17    CLLSILFLTETLVA-IKLPPNLTFPALIAFGDSIVDTGNNNNVKTVVKCDFQPYGINFQG  75

Query  1133  GKHTGRYSNGKTPPDLVAEELGIKELVPAYLDPHLQPEDIKTGVSFASGASGYDPQTAAL  954
             G  TGR+ +G+ PPDL+AEELGIK +VPAYLDP+L+ ED+ TGVSFASG SGYDP T  L
Sbjct  76    GVPTGRFCDGRVPPDLIAEELGIKSVVPAYLDPNLKTEDLLTGVSFASGGSGYDPLTPKL  135

Query  953   MSVIPLSEQLKYFKEYLGKLNAMVGEKEAKSIINNTLFMVVSGSDDLANTYFTIGIRRYQ  774
             ++VI L +QLKYF+EY+ K+  +VGE+    I+ N+LF++V+GSDD+ANTY+ +  R + 
Sbjct  136   VAVISLEDQLKYFEEYIEKVKNIVGEERKGFILANSLFLLVAGSDDIANTYYVLRARPH-  194

Query  773   YDINSYTDLLLEGASNFLQELYSLGARRIGFFGIPPVGCLPSQRTLAGGSERECVENYNQ  594
             YD++SYT L++  AS+F+ +LY  G RRI  FG PP+GC+PSQRT+ GG  REC E YN+
Sbjct  195   YDVDSYTTLMVNSASDFVNKLYGYGVRRIAVFGAPPLGCVPSQRTVGGGLLRECAEYYNE  254

Query  593   AAQLANAKFSAEIKILSKKLPNSKLIFIDIYEDFLDMIKNPAKYGFEVVNLGCCGTGTIE  414
             AA+L N+K S ++ ++ K LP  K  +I+IY+  LD+I++PAKYGF V N GCCGTG IE
Sbjct  255   AAKLFNSKISTKLDLMHKTLPGIKPAYINIYDPLLDIIQSPAKYGFGVSNKGCCGTGVIE  314

Query  413   VTMLCNKL-SGTCPDRNKYLFWDSYHPTEKGYRIIVNRIITKYINSFT  273
             V +LCNK+ S  CPD + ++FWDSYHPTEK Y+++V+ +I+K++N F 
Sbjct  315   VAVLCNKITSSVCPDVSSHVFWDSYHPTEKTYKVLVSLLISKFVNQFV  362



>ref|XP_008387915.1| PREDICTED: GDSL esterase/lipase EXL3-like [Malus domestica]
Length=379

 Score =   404 bits (1037),  Expect = 5e-134, Method: Compositional matrix adjust.
 Identities = 192/336 (57%), Positives = 241/336 (72%), Gaps = 1/336 (0%)
 Frame = -2

Query  1280  SEAKIKLPNGLVVKAVIAFGDSIVDQGMNN-NLSTMIKTNFPPYGQDFMGGKHTGRYSNG  1104
             + A +KLP  + + AVI FGDSIVD G NN N  T  + NF PYG+D  GG  TGRYSNG
Sbjct  43    AAATVKLPENVTIPAVIVFGDSIVDTGNNNKNFVTFARCNFLPYGKDLKGGMPTGRYSNG  102

Query  1103  KTPPDLVAEELGIKELVPAYLDPHLQPEDIKTGVSFASGASGYDPQTAALMSVIPLSEQL  924
             K P D + E  GIKEL+PAYLDP LQP D+ TGV  A+GA GYDP TA L  V  LS+Q 
Sbjct  103   KVPSDFIVEAFGIKELLPAYLDPTLQPNDLLTGVVXANGAXGYDPLTAKLGVVASLSDQX  162

Query  923   KYFKEYLGKLNAMVGEKEAKSIINNTLFMVVSGSDDLANTYFTIGIRRYQYDINSYTDLL  744
             K FKEY+ KL  +VGE++   II N+L  VV+GS+D++ TYF  G RR +YD+ SYTD +
Sbjct  163   KQFKEYIEKLKGIVGEEKTNFIIKNSLIFVVAGSNDISXTYFLTGARRLEYDVPSYTDFM  222

Query  743   LEGASNFLQELYSLGARRIGFFGIPPVGCLPSQRTLAGGSERECVENYNQAAQLANAKFS  564
             L+ AS+F+++LY LG RRIG    PP+GC+PSQRT+ GG ER+C E  NQA QL N+K +
Sbjct  223   LKHASDFVKDLYGLGVRRIGVLSAPPIGCVPSQRTVNGGIERDCDERQNQACQLFNSKLN  282

Query  563   AEIKILSKKLPNSKLIFIDIYEDFLDMIKNPAKYGFEVVNLGCCGTGTIEVTMLCNKLSG  384
              E+  L+K LPNS++++IDIY   LD+IKNPAKYGFEV N GCCGTG IEVT LCN+L  
Sbjct  283   VEMDRLNKILPNSRVVYIDIYNPLLDIIKNPAKYGFEVANKGCCGTGLIEVTKLCNQLQQ  342

Query  383   TCPDRNKYLFWDSYHPTEKGYRIIVNRIITKYINSF  276
              C D + Y+FWDSYHPTE  Y+IIV +++  Y + F
Sbjct  343   VCTDDSNYVFWDSYHPTETAYKIIVKQMLDNYSSRF  378



>gb|KDP36891.1| hypothetical protein JCGZ_08182 [Jatropha curcas]
Length=359

 Score =   403 bits (1035),  Expect = 5e-134, Method: Compositional matrix adjust.
 Identities = 178/336 (53%), Positives = 264/336 (79%), Gaps = 3/336 (1%)
 Frame = -2

Query  1280  SEAKIKLPNGLVVKAVIAFGDSIVDQGMNNNLSTMIKTNFPPYGQDFMGGKHTGRYSNGK  1101
             + A +KLP  + V A++ FGDSIVD G NNN+ T++K +F PYG +F GG  TGR+ +GK
Sbjct  25    TTALVKLPPNVTVPALLVFGDSIVDSGNNNNIRTIVKCDFLPYGINFKGGTPTGRFCDGK  84

Query  1100  TPPDLVAEELGIKELVPAYLDPHLQPEDIKTGVSFASGASGYDPQTAALMSVIPLSEQLK  921
              P D++AEELGIK+ VPAY+DP ++ +D+ TGV+FASGASGYDP T+ L SV+ L +QL+
Sbjct  85    IPSDILAEELGIKDTVPAYMDPEVKDQDLLTGVTFASGASGYDPLTSKLTSVMSLDDQLE  144

Query  920   YFKEYLGKLNAMVGEKEAKSIINNTLFMVVSGSDDLANTYFTIGIRRYQYDINSYTDLLL  741
              FKEY+ KL  +VGE++   I+ N++F+VV+GSDD+ANTY+T+ +R+ QYD+ +YTDL+L
Sbjct  145   QFKEYIEKLKEIVGEEKTNFILANSVFLVVAGSDDIANTYYTLRVRKLQYDVPAYTDLML  204

Query  740   EGASNFLQELYSLGARRIGFFGIPPVGCLPSQRTLAGGSERECVENYNQAAQLANAKFSA  561
             + AS F+Q LY LGARRI  F  PP+GC+P+QRTLAGGS+REC E++N+AA L N+K S 
Sbjct  205   DYASTFVQNLYDLGARRIAVFSAPPIGCVPAQRTLAGGSQRECAEDFNKAATLFNSKLSK  264

Query  560   EIKILSKKLPNSKLIFIDIYEDFLDMIKNPAKYGFEVVNLGCCGTGTIEVTMLCNKLSG-  384
               K+ S  +P++K++++D+Y   L++I++P ++GFEVVN GCCG+G +EV++LCN+L+  
Sbjct  265   --KLDSFNMPDAKVVYVDVYNPLLNIIQDPNQFGFEVVNKGCCGSGNLEVSVLCNRLTPF  322

Query  383   TCPDRNKYLFWDSYHPTEKGYRIIVNRIITKYINSF  276
              C + + ++FWDSYHPTE+ YR++V++++ KY++ F
Sbjct  323   ICSNTSDHVFWDSYHPTERAYRVLVSQLLVKYLDKF  358



>ref|XP_006302445.1| hypothetical protein CARUB_v10020529mg [Capsella rubella]
 gb|EOA35343.1| hypothetical protein CARUB_v10020529mg [Capsella rubella]
Length=362

 Score =   403 bits (1035),  Expect = 6e-134, Method: Compositional matrix adjust.
 Identities = 188/347 (54%), Positives = 260/347 (75%), Gaps = 3/347 (1%)
 Frame = -2

Query  1313  CIIAFLVLAGCSEAKIKLPNGLVVKAVIAFGDSIVDQGMNNNLSTMIKTNFPPYGQDFMG  1134
             C+++ L L   + A +KLP  L+V A+IAFGDSIVD GMNN + T++K +F PYG +F G
Sbjct  17    CLLSVLFLTE-TIAAVKLPPKLIVPALIAFGDSIVDTGMNNFVKTVVKCDFRPYGINFQG  75

Query  1133  GKHTGRYSNGKTPPDLVAEELGIKELVPAYLDPHLQPEDIKTGVSFASGASGYDPQTAAL  954
             G  TGR+ +G+ P DL+AEELGIK  VPAY DP L+ +D+ TGVSFASG SGYDP T  L
Sbjct  76    GAATGRFCDGRVPADLLAEELGIKSTVPAYFDPTLKSKDLLTGVSFASGGSGYDPITPKL  135

Query  953   MSVIPLSEQLKYFKEYLGKLNAMVGEKEAKSIINNTLFMVVSGSDDLANTYFTIGIRRYQ  774
             +SV+ L +QL YF+EY+ K+  +VGE++   II N+LF+VV+GSDD+ANTY+T+  R  Q
Sbjct  136   VSVLSLEDQLNYFEEYIEKVKNIVGEEKKDFIIANSLFLVVAGSDDIANTYYTLRARP-Q  194

Query  773   YDINSYTDLLLEGASNFLQELYSLGARRIGFFGIPPVGCLPSQRTLAGGSERECVENYNQ  594
             YD+++YT L+ + A++F+ +LY  G RR+  FG PP+GC+PSQRTL GG  R+C E+YN 
Sbjct  195   YDVDAYTTLMSDSATDFVTKLYGYGVRRLAVFGAPPIGCVPSQRTLGGGIMRDCAESYNV  254

Query  593   AAQLANAKFSAEIKILSKKLPNSKLIFIDIYEDFLDMIKNPAKYGFEVVNLGCCGTGTIE  414
             AA+L N+K S ++ +L K LP  + ++I+IY+   D+I+NPA YGFEV N GCCGTG IE
Sbjct  255   AAKLFNSKLSPKLDMLHKTLPGIRPVYINIYDPLFDIIQNPANYGFEVANKGCCGTGAIE  314

Query  413   VTMLCNKL-SGTCPDRNKYLFWDSYHPTEKGYRIIVNRIITKYINSF  276
             V +LCNK+ S  CPD + ++FWDSYHPTEK Y+++V+ +I K++N F
Sbjct  315   VAVLCNKITSSVCPDVSSHVFWDSYHPTEKTYKVLVSLLINKFVNQF  361



>ref|XP_002510573.1| zinc finger protein, putative [Ricinus communis]
 gb|EEF52760.1| zinc finger protein, putative [Ricinus communis]
Length=707

 Score =   414 bits (1065),  Expect = 6e-134, Method: Compositional matrix adjust.
 Identities = 194/342 (57%), Positives = 262/342 (77%), Gaps = 5/342 (1%)
 Frame = -2

Query  1298  LVLAGCSEAKIKLPNGLVVKAVIAFGDSIVDQGMNNNLSTMIKTNFPPYGQDFMGGKHTG  1119
             +V    + A IKLP  + V A+I FGDSIVD G NNN+ T+IK NF PYG DF GG  TG
Sbjct  5     IVWISSTTALIKLPENVAVPALIVFGDSIVDAGNNNNIKTLIKCNFRPYGLDFYGGIPTG  64

Query  1118  RYSNGKTPPDLVAEELGIKELVPAYLDPHLQPEDIKTGVSFASGASGYDPQTAALMSVIP  939
             R+ NGK P D++A ELGIK+++P YLDP LQP+D+ TGV+FASG  GYDP T  L+SVI 
Sbjct  65    RFCNGKIPSDIIAGELGIKDILPGYLDPTLQPQDLITGVTFASGGCGYDPLTPKLVSVIS  124

Query  938   LSEQLKYFKEYLGKLNAMVGEKEAKSIINNTLFMVVSGSDDLANTYFTIGIRRYQYDINS  759
             L++QL  FKEY+GK+ A+VGE++   II N+LF+VV+GSDD+ANTYF +G R+ QYD+ +
Sbjct  125   LADQLNQFKEYIGKVKAIVGEEQTNFIIANSLFLVVAGSDDIANTYFILGARKLQYDVPA  184

Query  758   YTDLLLEGASNFLQ----ELYSLGARRIGFFGIPPVGCLPSQRTLAGGSERECVENYNQA  591
             YTDL+ + AS+F Q    +LY LGARRIG FG PP+GC+PSQRT+AGG +REC ENYN+A
Sbjct  185   YTDLMADSASSFAQYLLLDLYDLGARRIGVFGAPPIGCVPSQRTIAGGIQRECAENYNEA  244

Query  590   AQLANAKFSAEIKILSKKLPNSKLIFIDIYEDFLDMIKNPAKYGFEVVNLGCCGTGTIEV  411
             A L N+K S ++  L   LPNS+++++D+Y   L++I+NP +YGFEVVN GCCGTG +EV
Sbjct  245   AILFNSKLSNKLDSLGSSLPNSRIVYVDVYNPLLNLIQNPKQYGFEVVNKGCCGTGALEV  304

Query  410   TMLCNKLSG-TCPDRNKYLFWDSYHPTEKGYRIIVNRIITKY  288
              +LCNK++  TC + + ++FWDSYHPTE+ Y I++++++ KY
Sbjct  305   AILCNKVTPVTCDNVSDHIFWDSYHPTERAYEILISQVLAKY  346


 Score =   403 bits (1036),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 181/336 (54%), Positives = 251/336 (75%), Gaps = 1/336 (0%)
 Frame = -2

Query  1280  SEAKIKLPNGLVVKAVIAFGDSIVDQGMNNNLSTMIKTNFPPYGQDFMGGKHTGRYSNGK  1101
             + A  KLP  + + A++ FGDSIVD G NN + T+++ NF PYG DF GG  TGR+ +GK
Sbjct  371   TTALTKLPPNVTIPAILVFGDSIVDTGNNNYVPTLLRCNFRPYGIDFKGGFPTGRFCDGK  430

Query  1100  TPPDLVAEELGIKELVPAYLDPHLQPEDIKTGVSFASGASGYDPQTAALMSVIPLSEQLK  921
              P DL+AEELGIK+ VPAYLDP + PED  TGV+FASG SGYDP T  L+  I L +QLK
Sbjct  431   VPSDLIAEELGIKDTVPAYLDPTVLPEDFLTGVTFASGGSGYDPLTPVLVKAISLDDQLK  490

Query  920   YFKEYLGKLNAMVGEKEAKSIINNTLFMVVSGSDDLANTYFTIGIRRYQYDINSYTDLLL  741
             Y +EY+GK+  +VGE+ A+ +I N+L++VV+GSDD+ANTY+T+  R+ +Y++NSY+DL+ 
Sbjct  491   YLREYIGKVKGLVGEERAQFVIANSLYLVVAGSDDIANTYYTLRARKLRYNVNSYSDLMA  550

Query  740   EGASNFLQELYSLGARRIGFFGIPPVGCLPSQRTLAGGSERECVENYNQAAQLANAKFSA  561
               AS F+Q LY++GARRIG    PP+GC+P+QRT+AGG  REC E+ NQAA L N+K S 
Sbjct  551   NSASTFVQNLYNMGARRIGILSAPPIGCVPAQRTVAGGIHRECAESQNQAAILFNSKLSQ  610

Query  560   EIKILSKKLPNSKLIFIDIYEDFLDMIKNPAKYGFEVVNLGCCGTGTIEVTMLCNKLSG-  384
              +  L+ KLPNSK+++ID+Y  FLD+++NP KYGFEV N GCCGTG +E  +LCN+ +  
Sbjct  611   LLASLNIKLPNSKIVYIDVYNTFLDIVQNPQKYGFEVANRGCCGTGMLEAAILCNRATPI  670

Query  383   TCPDRNKYLFWDSYHPTEKGYRIIVNRIITKYINSF  276
              C + + Y+FWDSYHPTEK YR++ ++  ++ ++ F
Sbjct  671   ICANVSNYVFWDSYHPTEKAYRVLTSQFFSENVDKF  706



>ref|XP_008354621.1| PREDICTED: GDSL esterase/lipase EXL3-like [Malus domestica]
 ref|XP_008363080.1| PREDICTED: GDSL esterase/lipase EXL3-like [Malus domestica]
Length=366

 Score =   402 bits (1034),  Expect = 9e-134, Method: Compositional matrix adjust.
 Identities = 185/337 (55%), Positives = 248/337 (74%), Gaps = 1/337 (0%)
 Frame = -2

Query  1283  CSEAKIKLPNGLVVKAVIAFGDSIVDQGMNNNLSTMIKTNFPPYGQDFMGGKHTGRYSNG  1104
             C  A +KLPN   + A+I FGDSIVD G NNN+ T++K NFPPYG+DF+G   TGR+SNG
Sbjct  29    CHAAAVKLPNNEKIPALIVFGDSIVDPGNNNNIGTIVKCNFPPYGRDFIGKXPTGRFSNG  88

Query  1103  KTPPDLVAEELGIKELVPAYLDPHLQPEDIKTGVSFASGASGYDPQTAALMSVIPLSEQL  924
             + P DL+AE +G+K ++PAYLDP+L+ ED+ TGVSFASG SGYDP T  ++SV+ LS+QL
Sbjct  89    RVPSDLIAESVGVKNILPAYLDPNLKIEDLLTGVSFASGGSGYDPLTPQIVSVLSLSDQL  148

Query  923   KYFKEYLGKLNAMVGEKEAKSIINNTLFMVVSGSDDLANTYFTIGIRRYQYDINSYTDLL  744
               FK Y+ K+ A  GE+ A +I++ ++++V  GSDD+ANTY +  +RR  YDI +YTDL+
Sbjct  149   DLFKNYIRKITAAAGEERAATIVSKSIYIVCIGSDDIANTYLSTPVRRPYYDIPAYTDLM  208

Query  743   LEGASNFLQELYSLGARRIGFFGIPPVGCLPSQRTLAGGSERECVENYNQAAQLANAKFS  564
             +  AS+FLQELY LGARRIG   +P +GC+PSQRT+ GG  R+C E  NQAA+L N+K S
Sbjct  209   INSASSFLQELYGLGARRIGVINLPAIGCVPSQRTVGGGINRDCSETANQAARLFNSKLS  268

Query  563   AEIKILSKKLPNSKLIFIDIYEDFLDMIKNPAKYGFEVVNLGCCGTGTIEVTMLCNKLS-  387
             A I   +K+LP ++++++DIY   L +I+NP  YGFEV N GCCGTG IEV++LC + S 
Sbjct  269   AXIDAFNKRLPEARVVYLDIYYTLLSLIQNPTXYGFEVANKGCCGTGNIEVSVLCTRYSP  328

Query  386   GTCPDRNKYLFWDSYHPTEKGYRIIVNRIITKYINSF  276
             GTC D +KY+FWDSYHPTEK Y  +V  +    I  F
Sbjct  329   GTCNDSSKYIFWDSYHPTEKXYEXLVPLVFDTQIRKF  365



>ref|XP_011083479.1| PREDICTED: uncharacterized protein LOC105166004 [Sesamum indicum]
Length=704

 Score =   414 bits (1064),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 191/343 (56%), Positives = 258/343 (75%), Gaps = 6/343 (2%)
 Frame = -2

Query  1304  AFLVLAGCSEAKIKLPNGLVVKAVIAFGDSIVDQGMNNNLSTMIKTNFPPYGQDFMGGKH  1125
             A L +AG   A I LP+ + + A+I FGDSIVD G NN + T+ K NFPPYG+DF+GGK 
Sbjct  366   ALLCIAG---AVIHLPHNITIPALIVFGDSIVDTGNNNYIKTIAKANFPPYGKDFVGGKP  422

Query  1124  TGRYSNGKTPPDLVAEELGIKELVPAYLDPHLQPEDIKTGVSFASGASGYDPQTAALMSV  945
             TGR+S+ K P DL+AEELGIK L+PAYLDP LQP+D+ TGV+FASGA+G+DP T+ L SV
Sbjct  423   TGRFSDAKVPSDLIAEELGIKPLLPAYLDPSLQPQDLLTGVNFASGAAGFDPLTSDLASV  482

Query  944   IPLSEQLKYFKEYLGKLNAMVGEKEAKSIINNTLFMVVSGSDDLANTYFTIGIRRYQYDI  765
             + L++QL  FK+Y+ KL  + GE+ +  I+  +L ++V+GS+D+ NTYF   +R+  YD+
Sbjct  483   LSLTDQLALFKDYITKLKKIAGEERSSKILQESLVILVAGSNDITNTYFGTPLRQSHYDV  542

Query  764   NSYTDLLLEGASNFLQELYSLGARRIGFFGIPPVGCLPSQRTLAGGSERECVENYNQAAQ  585
              SYTDLL+  AS+F+Q+LY LGARRIG   +PP+GCLPSQRTL GG  R CV+ YNQ AQ
Sbjct  543   PSYTDLLVSYASSFVQDLYRLGARRIGLLRLPPIGCLPSQRTLRGGPARNCVDEYNQVAQ  602

Query  584   LANAKFSAEIKILSKKLPNSKLIFIDIYEDFLDMIKNPAKYGFEVVNLGCCGTGTIEVTM  405
             L N K SA +  ++++ P ++L+ IDIY  FLD+I+NP KYGF++ + GCCGTGT+EV  
Sbjct  603   LFNKKLSAALNSINRQFPEARLVDIDIYNYFLDLIQNPQKYGFKIADKGCCGTGTVEVAF  662

Query  404   LCNKLSGTCPDRNKYLFWDSYHPTEKGYRIIVNRIITKYINSF  276
             LC      CPD + Y+FWDS+HPTE+ YR+IV++I+ +YINSF
Sbjct  663   LCKY---ACPDVSDYVFWDSFHPTERTYRLIVHQILEQYINSF  702


 Score =   400 bits (1029),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 183/344 (53%), Positives = 255/344 (74%), Gaps = 3/344 (1%)
 Frame = -2

Query  1307  IAFLVLAGCSEAKIKLPNGLVVKAVIAFGDSIVDQGMNNNLSTMIKTNFPPYGQDFMGGK  1128
             + F VL   +EA   +P    + AVI FGDS+VD G NN + T++K N+PPYG+DF+GG+
Sbjct  8     LLFPVLVCIAEAVTTMPQNSTIPAVIMFGDSVVDTGNNNYIETVVKVNYPPYGKDFIGGR  67

Query  1127  HTGRYSNGKTPPDLVAEELGIKELVPAYLDPHLQPEDIKTGVSFASGASGYDPQTAALMS  948
              TGR+ +GK P DL+ EELGIK+L+PAY DP L  +D+ TGV+FASG +GYDP T+ L+S
Sbjct  68    PTGRFCDGKVPSDLIVEELGIKDLLPAYFDPTLHAQDLLTGVNFASGGAGYDPLTSHLVS  127

Query  947   VIPLSEQLKYFKEYLGKLNAMVGEKEAKSIINNTLFMVVSGSDDLANTYFTIGIRRYQYD  768
             V+ LS+QL+ FK+Y  KL  + G ++  +I+   LF+VV+GS+D+ NTYF   +R+  YD
Sbjct  128   VLSLSDQLRMFKDYTTKLELIAGHEKTMTILQEGLFVVVAGSNDITNTYFGTPLRKSHYD  187

Query  767   INSYTDLLLEGASNFLQELYSLGARRIGFFGIPPVGCLPSQRTLAGGSERECVENYNQAA  588
             ++SYTDLL+  ASNF+QELY LGARRIG FG+PP+GCLPSQRTL GG+ER+C++ YNQ A
Sbjct  188   VSSYTDLLVAYASNFVQELYKLGARRIGVFGLPPLGCLPSQRTLKGGAERKCIDIYNQVA  247

Query  587   QLANAKFSAEIKILSKKLPNSKLIFIDIYEDFLDMIKNPAKYGFEVVNLGCCGTGTIEVT  408
             +L N K SAE+  ++ + P +++++IDIY   LD+I++P KYGF++ + GCCGTGTIEV 
Sbjct  248   ELFNNKLSAEVDSINARYPEARVVYIDIYNLPLDLIRSPQKYGFKISDKGCCGTGTIEVA  307

Query  407   MLCNKLSGTCPDRNKYLFWDSYHPTEKGYRIIVNRIITKYINSF  276
              LC     TC D + Y+FWDS+H TEK YR++V++I+ K I   
Sbjct  308   FLCKY---TCSDVSDYVFWDSFHLTEKAYRLLVHQILKKSIREL  348



>ref|XP_009379345.1| PREDICTED: GDSL esterase/lipase EXL3-like [Pyrus x bretschneideri]
Length=374

 Score =   402 bits (1034),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 179/334 (54%), Positives = 254/334 (76%), Gaps = 1/334 (0%)
 Frame = -2

Query  1274  AKIKLPNGLVVKAVIAFGDSIVDQGMNNNLSTMIKTNFPPYGQDFMGGKHTGRYSNGKTP  1095
             A + LPN   + AVI FGDSIVD G NNN+ T++K NFPPYG+DF+G + TGR+SNG+ P
Sbjct  40    AAVDLPNNEKIPAVIVFGDSIVDPGNNNNIGTIVKCNFPPYGRDFVGKRPTGRFSNGRVP  99

Query  1094  PDLVAEELGIKELVPAYLDPHLQPEDIKTGVSFASGASGYDPQTAALMSVIPLSEQLKYF  915
              DL+AE +G+K+++PAYLD +L+ +D+ TGVSFASG SGYDP T  ++SV+ LS+QL  F
Sbjct  100   SDLIAESVGVKKILPAYLDSNLKIQDLVTGVSFASGGSGYDPLTPKIVSVLSLSDQLDLF  159

Query  914   KEYLGKLNAMVGEKEAKSIINNTLFMVVSGSDDLANTYFTIGIRRYQYDINSYTDLLLEG  735
             K+Y+ K+NA VG++   +I++ ++++V +GS+D+ANTY +  +RR  YDI +YTDL+++ 
Sbjct  160   KKYIIKINAAVGKERTATIVSKSIYIVCTGSNDIANTYLSTPLRRPHYDIPAYTDLMVKS  219

Query  734   ASNFLQELYSLGARRIGFFGIPPVGCLPSQRTLAGGSERECVENYNQAAQLANAKFSAEI  555
             AS+F QELY LGARRIG   +P +GC+PSQRTL+GG +R C E  NQAA L N+K SA+I
Sbjct  220   ASSFFQELYGLGARRIGVVSLPAIGCVPSQRTLSGGIDRGCSETANQAASLFNSKLSAQI  279

Query  554   KILSKKLPNSKLIFIDIYEDFLDMIKNPAKYGFEVVNLGCCGTGTIEVTMLCNKLS-GTC  378
                +++LP ++L+++DIY   L +I+NP +YGFEV+N GCCGTG +EV++LC + S GTC
Sbjct  280   DAFNRRLPEARLVYLDIYNTLLSLIQNPTQYGFEVINRGCCGTGNVEVSILCTRYSPGTC  339

Query  377   PDRNKYLFWDSYHPTEKGYRIIVNRIITKYINSF  276
              D +KY+FWDSYHP+EKGY +I        ++ F
Sbjct  340   NDSSKYIFWDSYHPSEKGYEVITPLAFDSQVHKF  373



>ref|XP_010920107.1| PREDICTED: GDSL esterase/lipase EXL3 [Elaeis guineensis]
Length=358

 Score =   402 bits (1033),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 189/342 (55%), Positives = 254/342 (74%), Gaps = 1/342 (0%)
 Frame = -2

Query  1307  IAFLVLAGCSEAKIKLPNGLVVKAVIAFGDSIVDQGMNNNLSTMIKTNFPPYGQDFMGGK  1128
             +A  +L G + A  K      + AVI FGDSIVD G NN+L T+IK NFPPYGQDF+  +
Sbjct  13    MALCILVGQALADTKNQTAPKIPAVIVFGDSIVDPGNNNDLETLIKCNFPPYGQDFINHQ  72

Query  1127  HTGRYSNGKTPPDLVAEELGIKELVPAYLDPHLQPEDIKTGVSFASGASGYDPQTAALMS  948
              TGR+SNG+ P DL+A +LG+KELVP Y+   L+PEDI TGVSFASGA+GYDP T A+++
Sbjct  73    ATGRFSNGRIPSDLIASKLGVKELVPPYIGYDLKPEDILTGVSFASGATGYDPLTPAILN  132

Query  947   VIPLSEQLKYFKEYLGKLNAMVGEKEAKSIINNTLFMVVSGSDDLANTYFTIGIRRYQYD  768
             VIP++++LK F EY  +L A+ GE+ A SI++N+L++V SG+DD+ANTY+T   R  +YD
Sbjct  133   VIPMTDELKLFGEYKERLKAIAGEERAASIVSNSLYIVCSGTDDIANTYYTTPFRILEYD  192

Query  767   INSYTDLLLEGASNFLQELYSLGARRIGFFGIPPVGCLPSQRTLAGGSERECVENYNQAA  588
             I SY DLL+ GAS+FL+EL  +GA++I F G+PP+GC+PSQRTL GG +R C    NQAA
Sbjct  193   IRSYVDLLIRGASSFLEELIHMGAQKIVFVGLPPIGCVPSQRTLGGGIQRNCEPKRNQAA  252

Query  587   QLANAKFSAEIKILSKKLPNSKLIFIDIYEDFLDMIKNPAKYGFEVVNLGCCGTGTIEVT  408
             QL N+K   EI  L+K+     + ++DIY   +D+I +P+KYGFEV N GCCGTG IEVT
Sbjct  253   QLFNSKIQKEIDTLNKEHKGIMVAYVDIYSMLIDLIFHPSKYGFEVSNRGCCGTGEIEVT  312

Query  407   MLCNKLSGT-CPDRNKYLFWDSYHPTEKGYRIIVNRIITKYI  285
             +LCNK++ + CPD  KY+FWDSYHPTE+ Y+I+V +I  + I
Sbjct  313   LLCNKVTASVCPDVTKYVFWDSYHPTERAYKIMVEKIYQETI  354



>ref|XP_008445321.1| PREDICTED: GDSL esterase/lipase EXL3-like [Cucumis melo]
Length=374

 Score =   402 bits (1033),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 186/331 (56%), Positives = 246/331 (74%), Gaps = 0/331 (0%)
 Frame = -2

Query  1268  IKLPNGLVVKAVIAFGDSIVDQGMNNNLSTMIKTNFPPYGQDFMGGKHTGRYSNGKTPPD  1089
             I +P G  V AV  FGDSIVD G NNNL T  K N+PPYG+DF  G+ TGR+SNG+ P D
Sbjct  43    IIIPPGYSVPAVFVFGDSIVDTGNNNNLITQAKCNYPPYGRDFADGRPTGRFSNGRVPSD  102

Query  1088  LVAEELGIKELVPAYLDPHLQPEDIKTGVSFASGASGYDPQTAALMSVIPLSEQLKYFKE  909
             LV + LGIK L+P Y DP+LQ ED+ TGV+FASG +G+DP T+ L   I L  QL  F+E
Sbjct  103   LVVDVLGIKPLLPPYADPNLQLEDLLTGVNFASGGAGFDPLTSKLAPAISLDAQLAMFRE  162

Query  908   YLGKLNAMVGEKEAKSIINNTLFMVVSGSDDLANTYFTIGIRRYQYDINSYTDLLLEGAS  729
             Y  K+  +VGE++AK II+N+LF+VV+GS+D+ NT++    R+ QY+I++YTD + + AS
Sbjct  163   YRKKIEGLVGEEKAKFIIDNSLFLVVAGSNDIGNTFYLARFRQGQYNIDTYTDFMNQHAS  222

Query  728   NFLQELYSLGARRIGFFGIPPVGCLPSQRTLAGGSERECVENYNQAAQLANAKFSAEIKI  549
              ++++LY+ GARRIGFF  PP+GCLPSQRTLAGG +R CV  YN AA+L N K    +  
Sbjct  223   AYVKDLYAAGARRIGFFATPPLGCLPSQRTLAGGIQRACVNEYNDAAKLFNGKLQTTLSY  282

Query  548   LSKKLPNSKLIFIDIYEDFLDMIKNPAKYGFEVVNLGCCGTGTIEVTMLCNKLSGTCPDR  369
             L   LP+S+++++DIY   LD+I+N AKYGFEV + GCCGTGTIEVT+LCNKL  TCPD 
Sbjct  283   LQSTLPDSRVVYVDIYNPLLDVIQNYAKYGFEVADRGCCGTGTIEVTLLCNKLVKTCPDT  342

Query  368   NKYLFWDSYHPTEKGYRIIVNRIITKYINSF  276
              KY+FWDS+HP+E  Y ++V+ II +YI+SF
Sbjct  343   TKYVFWDSFHPSETTYNLLVSPIIQRYISSF  373



>gb|EYU38779.1| hypothetical protein MIMGU_mgv1a026265mg [Erythranthe guttata]
Length=350

 Score =   401 bits (1030),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 187/346 (54%), Positives = 256/346 (74%), Gaps = 7/346 (2%)
 Frame = -2

Query  1310  IIAFLVLAGCSEAKIKLPNGLVVKAVIAFGDSIVDQGMNNNLSTMIKTNFPPYGQDFMGG  1131
             +++FLV     EA IKLP  + + AVI FGDS+VD G NNN+ T++K NFPPYG+DFMGG
Sbjct  12    VLSFLVRFYVLEAAIKLPKNISIPAVIVFGDSVVDTGNNNNIETIVKVNFPPYGKDFMGG  71

Query  1130  KHTGRYSNGKTPPDLVAEELGIKELVPAYLDPHLQPEDIKTGVSFASGASGYDPQTAALM  951
             K TGR+S+GK P DL+AEELGIKEL+PAY DP LQ ED+ TGV+FASG +G+DP T+ L 
Sbjct  72    KPTGRFSDGKVPSDLIAEELGIKELLPAYFDPALQAEDLLTGVNFASGGAGFDPITSNLA  131

Query  950   SVIPLSEQLKYFKEYLGKLNAMVGEKEAKSIINNTLFMVVSGSDDLANTYFTIGIRRYQY  771
             SV+ LS+QL+ FK+Y+ KL A++G ++   I++ +L+++V+GS+D+ NTYF    R+  Y
Sbjct  132   SVLSLSDQLEMFKDYIKKLEAIIGHEKTSKILSESLYILVAGSNDIINTYFGTPFRKSTY  191

Query  770   DINSYTDLLLEGASNFLQELYSLGARRIGFFGIPPVGCLPSQRTLAGGSERECVENYNQA  591
             D++SY DLL+  AS F+QELY LGARRIG FG+PP+GCLPSQRTL GG+ER+C++ YN+ 
Sbjct  192   DVSSYNDLLVGYASTFVQELYGLGARRIGVFGLPPLGCLPSQRTLKGGAERKCIDIYNEV  251

Query  590   AQLANAKFSAEIKILSKKLPNSKLIFIDIYEDFLDMIKNPAKYGFEVVNLGCCGTGTIEV  411
             +Q+ N K   EI+ ++ +   +++ ++DIY   LD+I NP KY     + GCCGTG +EV
Sbjct  252   SQIFNNKLYDEIESINGRYSMARVTYMDIYTLPLDLIHNPHKYA----DRGCCGTGMVEV  307

Query  410   TMLCNKLSGTCPDRNKYLFWDSYHPTEKGYRIIVNRIITKYINSFT  273
             + LC      CPD   Y+FWDS H TEK YRI+V RI+ +Y+N FT
Sbjct  308   SFLCKN---ACPDVEDYVFWDSVHQTEKAYRILVRRILDEYVNYFT  350



>gb|KHN45939.1| GDSL esterase/lipase [Glycine soja]
Length=357

 Score =   401 bits (1031),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 191/348 (55%), Positives = 250/348 (72%), Gaps = 1/348 (0%)
 Frame = -2

Query  1313  CIIAFLVLAGCSEAKIKLPNGLVVKAVIAFGDSIVDQGMNNNLSTMIKTNFPPYGQDFMG  1134
             C +        +EA +KL     + A+I FGDSIVD G NNNL T +K NFPPYG+DF G
Sbjct  10    CCVLCYSFCHTAEAIVKLRGNETIPALILFGDSIVDTGSNNNLITGLKCNFPPYGRDFEG  69

Query  1133  GKHTGRYSNGKTPPDLVAEELGIKELVPAYLDPHLQPEDIKTGVSFASGASGYDPQTAAL  954
             G  TGR+SNGK P D VAEELGIKE +  Y  P LQP D+  GV+FASG +GYDP TA L
Sbjct  70    GIPTGRFSNGKVPADFVAEELGIKEYIAPYTSPALQPGDLLRGVNFASGGTGYDPLTAQL  129

Query  953   MSVIPLSEQLKYFKEYLGKLNAMVGEKEAKSIINNTLFMVVSGSDDLANTYFTIGIRRYQ  774
             +SVIPLSEQL+ FKEY+GKL    GE +   I++ +L +VVS S+D+ANTYF  G+R+  
Sbjct  130   VSVIPLSEQLEQFKEYIGKLKGNFGEAKTNFILSKSLVLVVSSSNDIANTYFATGVRKLN  189

Query  773   YDINSYTDLLLEGASNFLQELYSLGARRIGFFGIPPVGCLPSQRTLAGGSERECVENYNQ  594
             YD+ +YTD+L++ AS+F++ELY LGARRIG FG PP+GCLP  R L GG  R C E  N 
Sbjct  190   YDVPNYTDMLVQQASSFVKELYGLGARRIGVFGAPPLGCLPFVRALFGGLRRLCSEEINM  249

Query  593   AAQLANAKFSAEIKILSKKLPNSKLIFIDIYEDFLDMIKNPAKYGFEVVNLGCCGTGTIE  414
             A++L N+K S+E+  L++ LP +K+++I IY+  L++I+NP KYGFEV + GCCGTGT+E
Sbjct  250   ASKLFNSKLSSELHKLNQSLPQAKVVYIHIYDSLLNIIQNPTKYGFEVADKGCCGTGTVE  309

Query  413   VTMLCNKLS-GTCPDRNKYLFWDSYHPTEKGYRIIVNRIITKYINSFT  273
                LCN L   TC D +KY+FWDSYHPT+K Y+I+V  I+ KY ++F+
Sbjct  310   AAFLCNMLDPTTCSDDSKYVFWDSYHPTQKTYQILVGEILNKYTSNFS  357



>gb|KDP23987.1| hypothetical protein JCGZ_25375 [Jatropha curcas]
Length=330

 Score =   400 bits (1027),  Expect = 3e-133, Method: Compositional matrix adjust.
 Identities = 190/323 (59%), Positives = 245/323 (76%), Gaps = 2/323 (1%)
 Frame = -2

Query  1238  AVIAFGDSIVDQGMNNNLSTMIKTNFPPYGQDFMGGKHTGRYSNGKTPPDLVAEELGIKE  1059
             AVI FGDSIVD G NN + T+IK NFPPYG+DF+G K TGR+SNG  P D+ A+ LGIK+
Sbjct  7     AVIVFGDSIVDPGNNNYVKTIIKCNFPPYGRDFIGRKPTGRFSNGFIPSDIAAQILGIKK  66

Query  1058  LVPAYLDPHLQPEDIKTGVSFASGASGYDPQTAALMSVIPLSEQLKYFKEYLGKLNAMVG  879
             LVPAYLDP++QPED+ TGVSFASG SGYDPQT+ + SV+ LS+QL  F+ YL KL ++VG
Sbjct  67    LVPAYLDPNVQPEDLLTGVSFASGGSGYDPQTSKIASVLSLSDQLDLFRGYLSKLKSIVG  126

Query  878   EKEAKSIINNTLFMVVSGSDDLANTYFTIGIRRYQYDINSYTDLLLEGASNFLQELYSLG  699
             E+   +I++  LF+V  GSDD+ANTYF +  RRYQYDINSYTDL++  AS F +ELY +G
Sbjct  127   EEGTSTILSKGLFIVCIGSDDIANTYFALPFRRYQYDINSYTDLMVSSASTFYKELYEVG  186

Query  698   ARRIGFFGIPPVGCLPSQRTLAGGSERECVENYNQAAQLANAKFSAEIKILSKKLPNSKL  519
             ARRIG   +PP+GC+PSQRTL GG  REC E+ N+AA+L N+K S+ I  L+ +LP+ +L
Sbjct  187   ARRIGVLNLPPIGCVPSQRTLGGGIVRECSESANEAAKLFNSKISSAIDSLNTELPDVRL  246

Query  518   IFIDIYEDFLDMIKNPAKYGFEVVNLGCCGTGTIEVTMLCNKLSG--TCPDRNKYLFWDS  345
             + IDIY   L +IKNP++YGFE    GCCGTG IEV++LCN L    TC D +KY+FWDS
Sbjct  247   VNIDIYNPLLSIIKNPSQYGFEEATKGCCGTGNIEVSILCNPLEDKHTCEDASKYIFWDS  306

Query  344   YHPTEKGYRIIVNRIITKYINSF  276
             YHP+EK Y+I+   I+ + +  F
Sbjct  307   YHPSEKTYQILTPMILNECLYKF  329



>ref|XP_009336671.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC103929236 
[Pyrus x bretschneideri]
Length=756

 Score =   414 bits (1064),  Expect = 4e-133, Method: Compositional matrix adjust.
 Identities = 196/338 (58%), Positives = 250/338 (74%), Gaps = 3/338 (1%)
 Frame = -2

Query  1280  SEAKIKLPNGLVVKAVIAFGDSIVDQGMNN-NLSTMIKTNFPPYGQDFMGGKHTGRYSNG  1104
             + A +KLP  + + AVI FGDSIVD G NN N  T  + NF PYG+D  GG  TGR+SNG
Sbjct  418   AAATVKLPENVTIPAVIVFGDSIVDTGNNNENFGTFARCNFLPYGKDLKGGMPTGRFSNG  477

Query  1103  KTPPDLVAEELGIKELVPAYLDPHLQPEDIKTGVSFASGASGYDPQTAALMSVIPLSEQL  924
             K P D + + LGIKEL+PAYLDP LQP D+ TGV  A+G +GYDP TA L  V  LS+Q+
Sbjct  478   KVPSDFIVKALGIKELLPAYLDPTLQPNDLLTGVVIATGGAGYDPLTAKLAVVASLSDQM  537

Query  923   KYFKEYLGKLNAMVGEKEAKSIINNTLFMVVSGSDDLANTYFTIGIRRYQYDINSYTDLL  744
             K FKEY+ KL  +VGEK+   II N+L  VV+GS+D++NTYF  G+RR +YD+ SYTD +
Sbjct  538   KQFKEYIEKLKGIVGEKKTNFIIKNSLIFVVAGSNDISNTYFLSGLRRLEYDVPSYTDFI  597

Query  743   LEGASNFLQELYSLGARRIGFFGIPPVGCLPSQRTLAGGSERECVENYNQAAQLANAKFS  564
             L+ AS+F+++LY LGARRIG    PP+GC+PSQRTL GG +R+C E  NQA QL N+K S
Sbjct  598   LKHASDFVKDLYGLGARRIGVLSTPPIGCVPSQRTLNGGIQRDCDEKQNQACQLFNSKLS  657

Query  563   AEIKILSKKLPNSKLIFIDIYEDFLDMIKNPAKYGFEVVNLGCCGTGTIEVTMLCNKL--  390
              E+  L+K LPNS++++IDIY   LD+IKNPAKYGFEV N+GCCGTG IEVT LCN+L  
Sbjct  658   VEMDRLNKNLPNSRVVYIDIYNPLLDIIKNPAKYGFEVANIGCCGTGLIEVTKLCNQLQP  717

Query  389   SGTCPDRNKYLFWDSYHPTEKGYRIIVNRIITKYINSF  276
             +G C   +KY+FWDSYHPTE+ Y+IIV +I+  Y + F
Sbjct  718   AGVCTHDSKYVFWDSYHPTERAYKIIVKQILDNYSSRF  755


 Score =   404 bits (1038),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 195/327 (60%), Positives = 244/327 (75%), Gaps = 8/327 (2%)
 Frame = -2

Query  1244  VKAVIAFGDSIVDQGMNN-NLSTMIKTNFPPYGQDFMGGKHTGRYSNGKTPPDLVAEELG  1068
             V AVI FGDSIVD G NN N  T  + NF PYG+D  GG  TGRYSNGK PPD + E LG
Sbjct  44    VPAVIVFGDSIVDTGNNNENFRTFARCNFLPYGKDLKGGMPTGRYSNGKVPPDFIVEALG  103

Query  1067  IKELVPAYLDPHLQPEDIKTGVSFASGASGYDPQTAALMSVIPLSEQLKYFKEYLGKLNA  888
             IKEL+PAYLDP LQP D+ TGV  A+G +GYDP TA L +V  LS+QLK FKEY+ KL  
Sbjct  104   IKELLPAYLDPTLQPNDLLTGVVIAAGGAGYDPLTAKLAAVASLSDQLKQFKEYIEKLKG  163

Query  887   MVGEKEAKSIINNTLFMVVSGSDDLANTYFTIGIRRYQYDINSYTDLLLEGASNF-----  723
             +VGE++   II N+L +VV+GS+D++NTYF  G+R  +YD+ SYTD +L+ AS+F     
Sbjct  164   IVGEEKTNFIIQNSLILVVAGSNDISNTYFLSGVRELEYDVPSYTDFMLKYASDFIKLXI  223

Query  722   LQELYSLGARRIGFFGIPPVGCLPSQRTLAGGSERECVENYNQAAQLANAKFSAEIKILS  543
             L +LY LGARRIG    PP+GC+PSQRT+ GG +R+C E  NQA+QL N+K S E+  L+
Sbjct  224   LXDLYGLGARRIGVLSAPPIGCVPSQRTVKGGIQRDCDEKQNQASQLFNSKLSMEMDHLN  283

Query  542   KKLPNSKLIFIDIYEDFLDMIKNPAKYGFEVVNLGCCGTGTIEVTMLCNKL--SGTCPDR  369
             K LPNS++++IDIY   LD+IKNPAKYGFEV N GCCGTGTIEVT LCN+L  +G C D 
Sbjct  284   KNLPNSRVVYIDIYNPLLDLIKNPAKYGFEVANKGCCGTGTIEVTKLCNQLQPAGVCIDD  343

Query  368   NKYLFWDSYHPTEKGYRIIVNRIITKY  288
             +KY+FWDSYHPT++ Y+IIV +I+  Y
Sbjct  344   SKYVFWDSYHPTKRAYKIIVKQILDNY  370



>ref|XP_010428640.1| PREDICTED: GDSL esterase/lipase EXL3-like [Camelina sativa]
Length=363

 Score =   400 bits (1027),  Expect = 8e-133, Method: Compositional matrix adjust.
 Identities = 187/347 (54%), Positives = 258/347 (74%), Gaps = 3/347 (1%)
 Frame = -2

Query  1313  CIIAFLVLAGCSEAKIKLPNGLVVKAVIAFGDSIVDQGMNNNLSTMIKTNFPPYGQDFMG  1134
             C+++ L+L   + A +KLP  L++ AVIAFGDSIVD GMNN + T++K +F PYG +F G
Sbjct  18    CLLSVLILTD-TIAAVKLPPNLIIPAVIAFGDSIVDTGMNNYVKTIVKCDFQPYGINFQG  76

Query  1133  GKHTGRYSNGKTPPDLVAEELGIKELVPAYLDPHLQPEDIKTGVSFASGASGYDPQTAAL  954
             G  TGR+ +G+ P DL+AEELGIK  VPAY D  L  +D+ TGVSFASG SGYDP T  L
Sbjct  77    GVATGRFCDGRVPVDLIAEELGIKSTVPAYFDSKLNSKDLLTGVSFASGGSGYDPITPKL  136

Query  953   MSVIPLSEQLKYFKEYLGKLNAMVGEKEAKSIINNTLFMVVSGSDDLANTYFTIGIRRYQ  774
             ++VI L EQL YF+EY+ K+  +VGE+    II N+LF+VV+GSDD+ANTY+T+  R + 
Sbjct  137   VTVISLEEQLTYFEEYIEKVKNIVGEERKDFIIANSLFLVVAGSDDIANTYYTLRARPH-  195

Query  773   YDINSYTDLLLEGASNFLQELYSLGARRIGFFGIPPVGCLPSQRTLAGGSERECVENYNQ  594
             YD++SYT L+ + AS+F+ +LY  G RR+  F  PP+GC+PSQRTL GG  R+C + YNQ
Sbjct  196   YDVDSYTTLMSDSASDFVTKLYGYGVRRLAVFSAPPIGCVPSQRTLGGGILRDCADTYNQ  255

Query  593   AAQLANAKFSAEIKILSKKLPNSKLIFIDIYEDFLDMIKNPAKYGFEVVNLGCCGTGTIE  414
             AA+L N+K S ++ +L K LP  K ++++IY+  LD+I+NPAKYGF+V N GCCGTG IE
Sbjct  256   AAKLFNSKLSPKLDMLHKTLPGIKPMYVNIYDPLLDIIQNPAKYGFKVANKGCCGTGVIE  315

Query  413   VTMLCNKL-SGTCPDRNKYLFWDSYHPTEKGYRIIVNRIITKYINSF  276
             V++LCNK+ S  CPD + ++FWDSYHPTE  Y+++V+ +I K+I+  
Sbjct  316   VSVLCNKITSSVCPDVSNHVFWDSYHPTEHTYKVLVSLLINKFIDQL  362



>gb|KCW53198.1| hypothetical protein EUGRSUZ_J02472 [Eucalyptus grandis]
Length=368

 Score =   400 bits (1027),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 186/324 (57%), Positives = 242/324 (75%), Gaps = 3/324 (1%)
 Frame = -2

Query  1238  AVIAFGDSIVDQGMNNNLSTMIKTNFPPYGQDFMGGKHTGRYSNGKTPPDLVAEELGIKE  1059
             A I FGDSI+D G NNN+ T++K NFPPYG+DFMGGK +GR+SNGK PPDL  E  G+K+
Sbjct  44    AFIVFGDSIIDPGNNNNIQTIVKCNFPPYGRDFMGGKPSGRFSNGKIPPDLFVEAFGLKQ  103

Query  1058  LVPAYLDPHLQPEDIKTGVSFASGASGYDPQTAALMSVIPLSEQLKYFKEYLGKLNAMVG  879
              +PAYLDP L+ ED+ TGVSFASGA+GYDP T  + S + LS+QL  FKEY+ K+ +  G
Sbjct  104   YLPAYLDPSLKLEDLLTGVSFASGATGYDPLTPQIASALSLSDQLNLFKEYVNKIKSGAG  163

Query  878   EKEAKSIINNTLFMVVSGSDDLANTYFTIGIRRYQYDINSYTDLLLEGASNFL-QELYSL  702
             E++A  I+ N+L+MVV GSDD+ANTY++   RR +YDI +YTDL+L  AS+F+ QELY L
Sbjct  164   EEKASYIVKNSLYMVVCGSDDIANTYYSTPFRRGEYDIPAYTDLMLNSASSFIQQELYGL  223

Query  701   GARRIGFFGIPPVGCLPSQRTLAGGSERECVENYNQAAQLANAKFSAEIKILSKKLPNSK  522
             GAR+I    IPP+GC+P+QRTL GG ER C    NQAA L N+K  +EI+ L +KLP SK
Sbjct  224   GARKISILSIPPIGCVPAQRTLDGGLERACNAPANQAATLFNSKLISEIESLKQKLPGSK  283

Query  521   LIFIDIYEDFLDMIKNPAKYGFEVVNLGCCGTGTIEVTMLCNKLSG--TCPDRNKYLFWD  348
             L+++DIY   L +I+NP+ YGFEV N GCCGTG IEV++LCN+L    TC D +KY+FWD
Sbjct  284   LVYLDIYHKLLSVIQNPSHYGFEVANRGCCGTGNIEVSILCNRLDDLETCQDDSKYVFWD  343

Query  347   SYHPTEKGYRIIVNRIITKYINSF  276
             SYHPTE  Y+I+ + +I  Y +  
Sbjct  344   SYHPTENTYKILTDHVIDNYADQL  367



>ref|XP_010471741.1| PREDICTED: GDSL esterase/lipase EXL3-like [Camelina sativa]
Length=358

 Score =   399 bits (1024),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 190/348 (55%), Positives = 256/348 (74%), Gaps = 3/348 (1%)
 Frame = -2

Query  1313  CIIAFLVLAGCSEAKIKLPNGLVVKAVIAFGDSIVDQGMNNNLSTMIKTNFPPYGQDFMG  1134
             C+++ L+L   + A +KL   L++ AVIAFGDSIVD GMNN + T++K +F PYG +F G
Sbjct  13    CLLSVLILTD-TIAAVKLQPNLIIPAVIAFGDSIVDTGMNNYVKTVVKCDFQPYGINFQG  71

Query  1133  GKHTGRYSNGKTPPDLVAEELGIKELVPAYLDPHLQPEDIKTGVSFASGASGYDPQTAAL  954
             G  TGR+ +G+ P DL+AEELGIK  VPAY D  L P+D+ TGVSFASG SGYDP T  L
Sbjct  72    GVATGRFCDGRVPVDLLAEELGIKLNVPAYFDSKLNPKDLLTGVSFASGGSGYDPITPKL  131

Query  953   MSVIPLSEQLKYFKEYLGKLNAMVGEKEAKSIINNTLFMVVSGSDDLANTYFTIGIRRYQ  774
             ++VI L EQL YF+EY+ K+  +VGEK    II N+LF+VV+GSDD+ANTY+T+  R  Q
Sbjct  132   VTVISLEEQLTYFEEYIEKVKNIVGEKRKDFIIANSLFLVVAGSDDIANTYYTLRARP-Q  190

Query  773   YDINSYTDLLLEGASNFLQELYSLGARRIGFFGIPPVGCLPSQRTLAGGSERECVENYNQ  594
             YD++SYT L+ + AS F+ +LY  G RR+  F  PP+GC+PSQRTL GG  R+C + YN+
Sbjct  191   YDVDSYTTLMSDSASAFVTKLYGYGVRRLAVFSAPPIGCVPSQRTLGGGILRDCADTYNE  250

Query  593   AAQLANAKFSAEIKILSKKLPNSKLIFIDIYEDFLDMIKNPAKYGFEVVNLGCCGTGTIE  414
             AA+L N+K S ++ +L K LP  K I+I+IY+  LD+I+NPA YGF+V N GCCGTG IE
Sbjct  251   AAKLFNSKLSPKLDMLRKTLPGIKPIYINIYDPLLDIIQNPANYGFKVANKGCCGTGAIE  310

Query  413   VTMLCNKL-SGTCPDRNKYLFWDSYHPTEKGYRIIVNRIITKYINSFT  273
             V +LCNK+ S  CPD + ++FWDSYHPTE  Y+++V+ +I K+I+ F 
Sbjct  311   VAVLCNKITSSVCPDVSSHVFWDSYHPTEHTYKVLVSLLINKFIDQFV  358



>ref|XP_008440851.1| PREDICTED: GDSL esterase/lipase EXL3-like [Cucumis melo]
Length=369

 Score =   399 bits (1025),  Expect = 3e-132, Method: Compositional matrix adjust.
 Identities = 188/350 (54%), Positives = 250/350 (71%), Gaps = 4/350 (1%)
 Frame = -2

Query  1313  CIIAFLVLA--GCSEAKIKLPNGLVVKAVIAFGDSIVDQGMNNNLSTMIKTNFPPYGQDF  1140
             C I  L     G +     LP+   V A+I FGDSIVD G NN+L T+IK NFPPYG+DF
Sbjct  19    CFILLLCFCHVGAAAGSKLLPDNEEVSAIIVFGDSIVDPGNNNHLKTLIKCNFPPYGRDF  78

Query  1139  MGGKHTGRYSNGKTPPDLVAEELGIKELVPAYLDPHLQPEDIKTGVSFASGASGYDPQTA  960
              GG  TGR++NGK P D VAEE G+KELVPAYLDPHL  +D+ TGVSFASGASGYDP T+
Sbjct  79    NGGMPTGRFTNGKIPTDFVAEEFGVKELVPAYLDPHLTTQDLLTGVSFASGASGYDPLTS  138

Query  959   ALMSVIPLSEQLKYFKEYLGKLNAMVGEKEAKSIINNTLFMVVSGSDDLANTYFTIGIRR  780
              + SV+ LS+QL+ FK+Y+ K+ A VGE++A +I++ ++ +V +GSDD+ANTYF    RR
Sbjct  139   KITSVLSLSDQLELFKDYIKKIKAAVGEEKATAILSKSVIIVCTGSDDIANTYFITPFRR  198

Query  779   YQYDINSYTDLLLEGASNFLQELYSLGARRIGFFGIPPVGCLPSQRTLAGGSERECVENY  600
               YD+ SYTDL+L+ AS+F  +LY+LGARRIG   +P +GC+PSQRTL GG  R C E  
Sbjct  199   LHYDVASYTDLMLQSASSFFHQLYALGARRIGVLSLPAIGCVPSQRTLFGGVARGCSEAA  258

Query  599   NQAAQLANAKFSAEIKILSKKLPNSKLIFIDIYEDFLDMIKNPAKYGFEVVNLGCCGTGT  420
             N AA L N+K S+ I  L  +  ++K +++D+Y  FL +I+NP++YGFE    GCCGTG 
Sbjct  259   NSAALLFNSKLSSLITSLGNEYSDAKFVYLDVYTPFLALIQNPSEYGFEEATKGCCGTGA  318

Query  419   IEVTMLCNKLSG--TCPDRNKYLFWDSYHPTEKGYRIIVNRIITKYINSF  276
             IEV++LCN LS   +CP+ +KY+FWDSYHPT   Y+++ +RII   +  F
Sbjct  319   IEVSVLCNPLSSKLSCPNPDKYIFWDSYHPTGNAYQVLTSRIIKDSLPKF  368



>ref|XP_007136106.1| hypothetical protein PHAVU_009G018300g [Phaseolus vulgaris]
 gb|ESW08100.1| hypothetical protein PHAVU_009G018300g [Phaseolus vulgaris]
Length=356

 Score =   398 bits (1023),  Expect = 3e-132, Method: Compositional matrix adjust.
 Identities = 192/350 (55%), Positives = 253/350 (72%), Gaps = 6/350 (2%)
 Frame = -2

Query  1307  IAFLVLAGC-----SEAKIKLPNGLVVKAVIAFGDSIVDQGMNNNLSTMIKTNFPPYGQD  1143
             +AF+    C     +EA + L     + A+I FGDSI+D G NN+L T  K NFPPYG+D
Sbjct  6     MAFVCCVFCHCFSHTEAIVTLRGNETIPALILFGDSIMDTGTNNDLITAFKCNFPPYGRD  65

Query  1142  FMGGKHTGRYSNGKTPPDLVAEELGIKELVPAYLDPHLQPEDIKTGVSFASGASGYDPQT  963
             F G + TGR+SNGK P DLVAE+LGI E V AY    LQP+D+  G++FASG +GYDP T
Sbjct  66    FHGAQPTGRFSNGKVPSDLVAEQLGINEYVAAYTSSSLQPDDLLKGINFASGGTGYDPFT  125

Query  962   AALMSVIPLSEQLKYFKEYLGKLNAMVGEKEAKSIINNTLFMVVSGSDDLANTYFTIGIR  783
             A L SV PLSEQL+ FKEY+GKL    GE++   I++ +L +VVS S+D+ANTYF  GIR
Sbjct  126   ARLASVRPLSEQLEQFKEYIGKLKENFGEEKTNFILSKSLVLVVSSSNDIANTYFASGIR  185

Query  782   RYQYDINSYTDLLLEGASNFLQELYSLGARRIGFFGIPPVGCLPSQRTLAGGSERECVEN  603
             +  +D+  YTD+L++ AS+F++ELYSLG +RIG FG PP+GCLP  RTL GG EREC E 
Sbjct  186   KLDHDVPRYTDMLVQLASSFVKELYSLGVKRIGVFGAPPLGCLPFMRTLFGGVERECTEE  245

Query  602   YNQAAQLANAKFSAEIKILSKKLPNSKLIFIDIYEDFLDMIKNPAKYGFEVVNLGCCGTG  423
              N A++L N+K SAE+  L++  P +K+++I IY+  L++I+NP KYG EVV+ GCCGTG
Sbjct  246   INMASKLFNSKLSAELHNLNQNWPQAKIVYIQIYDPLLNIIQNPIKYGLEVVDRGCCGTG  305

Query  422   TIEVTMLCNKLS-GTCPDRNKYLFWDSYHPTEKGYRIIVNRIITKYINSF  276
             ++E  +LCN L   TC D +KY+FWDSYHPTEK Y+I+V  I+ KYINSF
Sbjct  306   SVEAGILCNPLDLQTCTDDSKYVFWDSYHPTEKTYQILVAEILNKYINSF  355



>ref|XP_008363081.1| PREDICTED: GDSL esterase/lipase EXL3-like [Malus domestica]
Length=377

 Score =   399 bits (1024),  Expect = 4e-132, Method: Compositional matrix adjust.
 Identities = 176/334 (53%), Positives = 252/334 (75%), Gaps = 1/334 (0%)
 Frame = -2

Query  1274  AKIKLPNGLVVKAVIAFGDSIVDQGMNNNLSTMIKTNFPPYGQDFMGGKHTGRYSNGKTP  1095
             A ++LPN   + AVI FGDSIVD G NNN+ T++K NFPPYG+DF+G + TGR+SNG+ P
Sbjct  43    AAVELPNNEKIPAVIVFGDSIVDPGNNNNIGTIVKCNFPPYGRDFVGKRPTGRFSNGRVP  102

Query  1094  PDLVAEELGIKELVPAYLDPHLQPEDIKTGVSFASGASGYDPQTAALMSVIPLSEQLKYF  915
              D +AE +G+K+++PAYLD +L+ +D+ TGVSFASG SGYDP T  ++SV+ LS+QL  F
Sbjct  103   SDWIAESVGVKKILPAYLDSNLKIQDLLTGVSFASGGSGYDPLTPKIVSVLSLSDQLDLF  162

Query  914   KEYLGKLNAMVGEKEAKSIINNTLFMVVSGSDDLANTYFTIGIRRYQYDINSYTDLLLEG  735
             K+Y+ K+NA VG++   +I++  +++V + S+D+ NTY +  +RR  YDI +YTDL+++ 
Sbjct  163   KKYISKINAXVGKERTXTIVSKXIYIVCTXSNDIXNTYLSTPLRRXHYDIPAYTDLMVKS  222

Query  734   ASNFLQELYSLGARRIGFFGIPPVGCLPSQRTLAGGSERECVENYNQAAQLANAKFSAEI  555
             AS+F QELY LGARRIG   +P +GC+PSQRTL+GG +R C E  NQAA L N+K SA+I
Sbjct  223   ASSFFQELYGLGARRIGVVSLPAIGCVPSQRTLSGGLDRGCSETANQAASLFNSKLSAQI  282

Query  554   KILSKKLPNSKLIFIDIYEDFLDMIKNPAKYGFEVVNLGCCGTGTIEVTMLCNKLS-GTC  378
                +++LP ++L+++DIY   L +I+NP +YGFEV+N GCCGTG  EV++LC + S GTC
Sbjct  283   DAFNRRLPEARLVYLDIYNTLLSLIQNPTQYGFEVINRGCCGTGNFEVSILCTRYSPGTC  342

Query  377   PDRNKYLFWDSYHPTEKGYRIIVNRIITKYINSF  276
              D +KY+FWDSYHP+EKGY +I + +    ++ F
Sbjct  343   NDSSKYIFWDSYHPSEKGYEVITSLVFDSQVHKF  376



>ref|XP_008393902.1| PREDICTED: GDSL esterase/lipase EXL3-like [Malus domestica]
Length=377

 Score =   399 bits (1024),  Expect = 4e-132, Method: Compositional matrix adjust.
 Identities = 176/334 (53%), Positives = 253/334 (76%), Gaps = 1/334 (0%)
 Frame = -2

Query  1274  AKIKLPNGLVVKAVIAFGDSIVDQGMNNNLSTMIKTNFPPYGQDFMGGKHTGRYSNGKTP  1095
             A ++LPN   + AVI FGDSIVD G NNN+ T++K NFPPYG+DF+G + TGR+SNG+ P
Sbjct  43    AAVELPNNEKIPAVIVFGDSIVDPGNNNNIGTIVKCNFPPYGRDFVGKRPTGRFSNGRVP  102

Query  1094  PDLVAEELGIKELVPAYLDPHLQPEDIKTGVSFASGASGYDPQTAALMSVIPLSEQLKYF  915
              D +AE +G+K+++PAYLD +L+ +D+ TGVSFASG SGYDP T  ++    LS+QL  F
Sbjct  103   SDWIAESVGVKKILPAYLDSNLKIQDLLTGVSFASGGSGYDPLTPKIVVNKSLSDQLDLF  162

Query  914   KEYLGKLNAMVGEKEAKSIINNTLFMVVSGSDDLANTYFTIGIRRYQYDINSYTDLLLEG  735
             K+Y+ K+NA VG++   +I++ ++++V +GS+D+ANTY +  +RR  YDI +YTDL+++ 
Sbjct  163   KKYISKINAAVGKERTTTIVSKSIYIVCTGSNDIANTYLSTPLRRSHYDIPAYTDLMVKS  222

Query  734   ASNFLQELYSLGARRIGFFGIPPVGCLPSQRTLAGGSERECVENYNQAAQLANAKFSAEI  555
             AS+F QELY LGARRIG   +P +GC+PSQRTL+GG +R C E  NQAA L N+K SA+I
Sbjct  223   ASSFFQELYGLGARRIGVVSLPAIGCVPSQRTLSGGIDRGCSETANQAASLFNSKLSAQI  282

Query  554   KILSKKLPNSKLIFIDIYEDFLDMIKNPAKYGFEVVNLGCCGTGTIEVTMLCNKLS-GTC  378
                +++LP ++L+++DIY   L +I+NP +YGFEV+N GCCGTG +EV++LC + S GTC
Sbjct  283   DAFNRRLPEARLVYLDIYNTLLSLIQNPTQYGFEVINRGCCGTGNVEVSILCTRYSPGTC  342

Query  377   PDRNKYLFWDSYHPTEKGYRIIVNRIITKYINSF  276
              D +KY+FWDSYHP+EKGY +I + +    ++ F
Sbjct  343   NDSSKYIFWDSYHPSEKGYEVITSLVFDSQVHKF  376



>gb|KHN09072.1| GDSL esterase/lipase [Glycine soja]
Length=357

 Score =   398 bits (1022),  Expect = 4e-132, Method: Compositional matrix adjust.
 Identities = 189/348 (54%), Positives = 249/348 (72%), Gaps = 1/348 (0%)
 Frame = -2

Query  1313  CIIAFLVLAGCSEAKIKLPNGLVVKAVIAFGDSIVDQGMNNNLSTMIKTNFPPYGQDFMG  1134
             C +        +EA +KL     + A+I FGDSIVD G NNNL T++K NFPPYG+DF G
Sbjct  10    CCVLCYSFCHSAEAIVKLGGNETIPALILFGDSIVDTGTNNNLITLLKCNFPPYGRDFQG  69

Query  1133  GKHTGRYSNGKTPPDLVAEELGIKELVPAYLDPHLQPEDIKTGVSFASGASGYDPQTAAL  954
             G  TGR+SNGK P D +AEELGI E +  Y  P LQP D+  GV+FASG SGYD  TA +
Sbjct  70    GIPTGRFSNGKVPADFIAEELGISEYITPYKSPSLQPGDLLKGVNFASGGSGYDSLTAQI  129

Query  953   MSVIPLSEQLKYFKEYLGKLNAMVGEKEAKSIINNTLFMVVSGSDDLANTYFTIGIRRYQ  774
             +SV PLSEQL+ FKEY+GKL    GE +   I++ +L +VVS S+D+ANTYF  G+R+  
Sbjct  130   VSVTPLSEQLEQFKEYIGKLKGNFGEAKTNFILSKSLVLVVSSSNDIANTYFASGVRKVT  189

Query  773   YDINSYTDLLLEGASNFLQELYSLGARRIGFFGIPPVGCLPSQRTLAGGSERECVENYNQ  594
             YD++ YTD+L++ AS+F++ELY LGARRIG FG PP+GCLP  RTL GG ER C E  N 
Sbjct  190   YDVSGYTDMLVQEASSFVKELYGLGARRIGVFGAPPLGCLPFVRTLFGGLERVCTEEINM  249

Query  593   AAQLANAKFSAEIKILSKKLPNSKLIFIDIYEDFLDMIKNPAKYGFEVVNLGCCGTGTIE  414
             A++L N+K S+E+  L++ LP +K+++I IY+  L++I+NP  YGF+V + GCCGTGT+E
Sbjct  250   ASKLFNSKLSSELHNLNQSLPQAKVVYIRIYDSLLNIIQNPINYGFDVADRGCCGTGTVE  309

Query  413   VTMLCNKLS-GTCPDRNKYLFWDSYHPTEKGYRIIVNRIITKYINSFT  273
                LCN L   TC D +KY+FWDSYHPT+K Y+I+V  I+ KYI SF+
Sbjct  310   AAFLCNPLDPTTCVDDSKYVFWDSYHPTQKTYQILVGEILNKYIISFS  357



>ref|XP_004238377.2| PREDICTED: GDSL esterase/lipase EXL3-like [Solanum lycopersicum]
Length=393

 Score =   399 bits (1024),  Expect = 8e-132, Method: Compositional matrix adjust.
 Identities = 190/345 (55%), Positives = 245/345 (71%), Gaps = 3/345 (1%)
 Frame = -2

Query  1310  IIAFLVLAGCSEAKIKLPNGLVVKAVIAFGDSIVDQGMNNNLSTMIKTNFPPYGQDFMGG  1131
             I +F V        I LP    + AV  FGDSIVD G NN L T+ K N+PPYG+DFMGG
Sbjct  51    ICSFFVFCISVCYAISLPPNKSIPAVFVFGDSIVDTGNNNGLKTIAKVNYPPYGKDFMGG  110

Query  1130  KHTGRYSNGKTPPDLVAEELGIKELVPAYLDPHLQPEDIKTGVSFASGASGYDPQTAALM  951
               TGR+SNGK P D + EELGIK+L+PAYLDP LQ ED+ TGV+FASG +GYDP T+ L 
Sbjct  111   IPTGRFSNGKVPSDFLVEELGIKDLLPAYLDPTLQSEDLITGVNFASGGAGYDPLTSELA  170

Query  950   SVIPLSEQLKYFKEYLGKLNAMVGEKEAKSIINNTLFMVVSGSDDLANTYFTIGIRRYQY  771
              VI L  Q+  FKEY+ KL  +VGE     I+ N+LFM+V+G++D+ NTYF + +R+  Y
Sbjct  171   KVISLDGQVILFKEYIVKLTELVGEDRKNEILANSLFMLVTGANDITNTYFGMPLRKSYY  230

Query  770   DINSYTDLLLEGASNFLQELYSLGARRIGFFGIPPVGCLPSQRTLAGGSERECVENYNQA  591
             D+ SY DLL+  AS+F+Q+LY LGARRIG FGIPP+GCLPSQRTL GG ER+CV+N NQA
Sbjct  231   DVPSYADLLVNFASSFVQDLYGLGARRIGMFGIPPIGCLPSQRTLKGGEERQCVDNLNQA  290

Query  590   AQLANAKFSAEIKILSKKLPNSKLIFIDIYEDFLDMIKNPAKYGFEVVNLGCCGTGTIEV  411
             A+L N K  A       KLPNS+L+++D Y   LD+I NP +YGF++ + GCCGTG IEV
Sbjct  291   AKLFNNKLEAYSSSQGNKLPNSRLVYVDTYNVLLDVIDNPQRYGFKITDKGCCGTGKIEV  350

Query  410   TMLCNKLSGTCPDRNKYLFWDSYHPTEKGYRIIVNRIITKYINSF  276
               LC   + TC     Y+FWDS+H TEK YR++V++I+ +++NSF
Sbjct  351   AELC---TYTCSSDTDYIFWDSFHLTEKAYRLLVHQILVQHLNSF  392



>ref|XP_007224778.1| hypothetical protein PRUPE_ppa023913mg, partial [Prunus persica]
 gb|EMJ25977.1| hypothetical protein PRUPE_ppa023913mg, partial [Prunus persica]
Length=313

 Score =   395 bits (1016),  Expect = 9e-132, Method: Compositional matrix adjust.
 Identities = 189/309 (61%), Positives = 235/309 (76%), Gaps = 2/309 (1%)
 Frame = -2

Query  1250  LVVKAVIAFGDSIVDQGMNN-NLSTMIKTNFPPYGQDFMGGKHTGRYSNGKTPPDLVAEE  1074
             + + AV  FGDSIVD G NN NL T  + NFPPYG+DF GG  TGRYSNGK P D +AEE
Sbjct  3     VTIPAVFMFGDSIVDTGNNNDNLKTPARCNFPPYGRDFQGGIPTGRYSNGKVPSDFIAEE  62

Query  1073  LGIKELVPAYLDPHLQPEDIKTGVSFASGASGYDPQTAALMSVIPLSEQLKYFKEYLGKL  894
             LGIKEL+PAYLDP+L   D+ TGVSFA GA+GYDP TA +++V  LS+QL  F+EY+G+L
Sbjct  63    LGIKELLPAYLDPNLAQNDLLTGVSFAVGATGYDPMTAKVVAVTQLSDQLLQFEEYIGRL  122

Query  893   NAMVGEKEAKSIINNTLFMVVSGSDDLANTYFTIGIRRYQYDINSYTDLLLEGASNFLQE  714
               +VGE  A SI+ N+LF VV+ S+DLANTYF  GIR+ +YD+ SYTDL+L  AS+FL+ 
Sbjct  123   KGIVGEDRANSILANSLFFVVASSNDLANTYFVTGIRKLEYDVPSYTDLMLNHASDFLKG  182

Query  713   LYSLGARRIGFFGIPPVGCLPSQRTLAGGSERECVENYNQAAQLANAKFSAEIKILSKKL  534
             LY+LGARRIG F  PP+GCLPSQRTL GG  R+CVE  NQAA L N+K SAE+  L+K L
Sbjct  183   LYALGARRIGVFSAPPIGCLPSQRTLGGGILRDCVEKPNQAAMLFNSKLSAELDNLNKNL  242

Query  533   PNSKLIFIDIYEDFLDMIKNPAKYGFEVVNLGCCGTGTIEVTMLCNKLS-GTCPDRNKYL  357
             PNS L+++DIY   LD+I NP  YGFE+ + GCCG+G +EV++LCN+    TC D + Y+
Sbjct  243   PNSNLVYVDIYNPLLDLIINPTNYGFEIADKGCCGSGKLEVSILCNEFEPETCTDDSNYV  302

Query  356   FWDSYHPTE  330
             FWDSYHPTE
Sbjct  303   FWDSYHPTE  311



>ref|XP_004142994.1| PREDICTED: GDSL esterase/lipase EXL3-like isoform 1 [Cucumis 
sativus]
 ref|XP_004161074.1| PREDICTED: GDSL esterase/lipase EXL3-like isoform 1 [Cucumis 
sativus]
 gb|KGN62267.1| hypothetical protein Csa_2G346080 [Cucumis sativus]
Length=372

 Score =   397 bits (1021),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 185/329 (56%), Positives = 244/329 (74%), Gaps = 0/329 (0%)
 Frame = -2

Query  1262  LPNGLVVKAVIAFGDSIVDQGMNNNLSTMIKTNFPPYGQDFMGGKHTGRYSNGKTPPDLV  1083
             +P G  V AV  FGDSIVD G NNNL T  K N+PPYG+DF  G+ TGR+SNG+ P DLV
Sbjct  43    IPPGYSVPAVFIFGDSIVDTGNNNNLITQAKCNYPPYGRDFPDGRPTGRFSNGRVPSDLV  102

Query  1082  AEELGIKELVPAYLDPHLQPEDIKTGVSFASGASGYDPQTAALMSVIPLSEQLKYFKEYL  903
              + LGIK L+P Y DP+LQ ED+ TGV+FASG +G+DP T+     I L  QL  F+EY 
Sbjct  103   VDVLGIKPLLPPYADPNLQLEDLLTGVNFASGGAGFDPLTSKTAPAISLDAQLAMFREYR  162

Query  902   GKLNAMVGEKEAKSIINNTLFMVVSGSDDLANTYFTIGIRRYQYDINSYTDLLLEGASNF  723
              K+  +VGE++AK II+N+LF+VV+GS+D+ NT++    R+ QY+I++YTD +++ AS +
Sbjct  163   KKIEGLVGEEKAKFIIDNSLFLVVAGSNDIGNTFYLARFRQGQYNIDTYTDFMIQHASAY  222

Query  722   LQELYSLGARRIGFFGIPPVGCLPSQRTLAGGSERECVENYNQAAQLANAKFSAEIKILS  543
             +++LY+ GARRIGFF  PP+GCLPSQRTLAGG ER CV  YN AA+L N K    +  L 
Sbjct  223   VKDLYAAGARRIGFFATPPLGCLPSQRTLAGGIERGCVNEYNNAAKLFNGKLQTTLGYLQ  282

Query  542   KKLPNSKLIFIDIYEDFLDMIKNPAKYGFEVVNLGCCGTGTIEVTMLCNKLSGTCPDRNK  363
               LP+S+++++DIY   LD+I+N AKYGFEVV+ GCCGTGTIEVT LCNK   TCPD  K
Sbjct  283   TILPDSRVVYVDIYNPLLDVIQNYAKYGFEVVDKGCCGTGTIEVTFLCNKFVKTCPDTTK  342

Query  362   YLFWDSYHPTEKGYRIIVNRIITKYINSF  276
             Y+FWDS+HP+E  Y ++V+ II +YI+SF
Sbjct  343   YVFWDSFHPSEATYNLLVSPIIKRYISSF  371



>ref|XP_008344250.1| PREDICTED: GDSL esterase/lipase EXL3-like [Malus domestica]
Length=377

 Score =   397 bits (1021),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 177/345 (51%), Positives = 257/345 (74%), Gaps = 1/345 (0%)
 Frame = -2

Query  1307  IAFLVLAGCSEAKIKLPNGLVVKAVIAFGDSIVDQGMNNNLSTMIKTNFPPYGQDFMGGK  1128
             IA ++   C+ A ++LPN   + AVI FGDSIVD G NNN+ T++K NF PYG+DF+G +
Sbjct  32    IAIVLFLYCNAAAVELPNNEKIPAVIVFGDSIVDPGNNNNIGTIVKCNFSPYGRDFVGKR  91

Query  1127  HTGRYSNGKTPPDLVAEELGIKELVPAYLDPHLQPEDIKTGVSFASGASGYDPQTAALMS  948
              TGR+SNG+ P DLV E +G+K+++P YLD +L+ +D+ TGVSFASG SGYDP T  ++S
Sbjct  92    PTGRFSNGRVPSDLVVESVGVKKILPTYLDSNLKIQDLLTGVSFASGGSGYDPLTPKIVS  151

Query  947   VIPLSEQLKYFKEYLGKLNAMVGEKEAKSIINNTLFMVVSGSDDLANTYFTIGIRRYQYD  768
             ++ LS+QL  FK+Y+ K+NA VG++   +I++ ++++V + S+D+ANTY +  +RR  YD
Sbjct  152   ILSLSDQLDLFKKYISKINAAVGKERTATIVSKSIYIVCTRSNDIANTYLSTPLRRPHYD  211

Query  767   INSYTDLLLEGASNFLQELYSLGARRIGFFGIPPVGCLPSQRTLAGGSERECVENYNQAA  588
             I +YTDL+++ AS+F QELY LGARRIG   +P +GC+ SQRTL+GG ++ C E  NQAA
Sbjct  212   IPAYTDLMVKSASSFFQELYGLGARRIGVVSLPAIGCVLSQRTLSGGIDKGCSETANQAA  271

Query  587   QLANAKFSAEIKILSKKLPNSKLIFIDIYEDFLDMIKNPAKYGFEVVNLGCCGTGTIEVT  408
              L N+K SA+I   +K+LP ++L+++DIY   L +I+NP +YGFEV+N GCCGTG  EV+
Sbjct  272   SLFNSKLSAQIDAFNKRLPETRLVYLDIYNTLLSLIQNPTQYGFEVINRGCCGTGNFEVS  331

Query  407   MLCNKLS-GTCPDRNKYLFWDSYHPTEKGYRIIVNRIITKYINSF  276
             +LC + S GTC D +KY+FWDSYHP+EKGY +I + +    ++ F
Sbjct  332   ILCTRYSPGTCNDSSKYIFWDSYHPSEKGYEVITSLVFDSQVHKF  376



>ref|XP_004134848.1| PREDICTED: GDSL esterase/lipase EXL3-like [Cucumis sativus]
 gb|KGN48939.1| hypothetical protein Csa_6G507140 [Cucumis sativus]
Length=362

 Score =   396 bits (1018),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 188/350 (54%), Positives = 248/350 (71%), Gaps = 4/350 (1%)
 Frame = -2

Query  1313  CIIAFLVL--AGCSEAKIKLPNGLVVKAVIAFGDSIVDQGMNNNLSTMIKTNFPPYGQDF  1140
             C I  L    AG +     LP    V A+I FGDSIVD G NN L T++K NFPPYG+DF
Sbjct  12    CFILLLCFCHAGAAARSKFLPENEEVSAIIVFGDSIVDPGNNNYLKTLVKCNFPPYGRDF  71

Query  1139  MGGKHTGRYSNGKTPPDLVAEELGIKELVPAYLDPHLQPEDIKTGVSFASGASGYDPQTA  960
              GG  TGR+SNGK P D VAEE G+KELVPAYLDPHL  +D+ TGVSFASGASGYDP T+
Sbjct  72    NGGIPTGRFSNGKIPTDFVAEEFGVKELVPAYLDPHLTTQDLLTGVSFASGASGYDPLTS  131

Query  959   ALMSVIPLSEQLKYFKEYLGKLNAMVGEKEAKSIINNTLFMVVSGSDDLANTYFTIGIRR  780
              + SV+ LS+QL+ FK+Y+ K+ A VGE++A +I++ ++ +V +GSDD+ANTYF    RR
Sbjct  132   KITSVLSLSDQLELFKDYIKKIKAAVGEEKATAILSKSVIIVCTGSDDIANTYFITPFRR  191

Query  779   YQYDINSYTDLLLEGASNFLQELYSLGARRIGFFGIPPVGCLPSQRTLAGGSERECVENY  600
             + YD+ SYTDL+L+  S+F  +LY+LGARRIG   +P +GC+PSQRTL GG+ R C E  
Sbjct  192   FHYDVASYTDLMLQSGSSFFHQLYALGARRIGVLSLPAIGCVPSQRTLFGGAARGCSEAA  251

Query  599   NQAAQLANAKFSAEIKILSKKLPNSKLIFIDIYEDFLDMIKNPAKYGFEVVNLGCCGTGT  420
             N  A L N+K S+ I  L  +  ++K +++D+Y  FL +I+NPA+YGFE    GCCGTG+
Sbjct  252   NSMAVLFNSKLSSLIDSLGNEYSDAKFVYLDVYTPFLALIQNPAEYGFEEATKGCCGTGS  311

Query  419   IEVTMLCNKLSG--TCPDRNKYLFWDSYHPTEKGYRIIVNRIITKYINSF  276
             IEV++LCN LS   +CP  +KY+FWDSYHPT   Y+ + +RI+   I  F
Sbjct  312   IEVSVLCNPLSSKLSCPSPDKYIFWDSYHPTGNAYKALTSRILKDSIPKF  361



>ref|XP_009334746.1| PREDICTED: GDSL esterase/lipase EXL3-like [Pyrus x bretschneideri]
Length=370

 Score =   396 bits (1018),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 186/335 (56%), Positives = 248/335 (74%), Gaps = 0/335 (0%)
 Frame = -2

Query  1280  SEAKIKLPNGLVVKAVIAFGDSIVDQGMNNNLSTMIKTNFPPYGQDFMGGKHTGRYSNGK  1101
             +E  +KLP+     AVI FGDSI+D G NN+L +++K NF PYG+DF   K TGR+ NGK
Sbjct  34    TEGLVKLPSNQTFPAVIVFGDSIMDTGNNNHLKSLVKCNFSPYGRDFQQHKPTGRFGNGK  93

Query  1100  TPPDLVAEELGIKELVPAYLDPHLQPEDIKTGVSFASGASGYDPQTAALMSVIPLSEQLK  921
              P D++A +LGI+E +PAYLDP+L+P+D+  GV FASG +GYDP T  ++SVI + +QLK
Sbjct  94    VPSDIIASQLGIQEYLPAYLDPNLRPQDLPAGVVFASGGTGYDPMTPQIVSVISMDDQLK  153

Query  920   YFKEYLGKLNAMVGEKEAKSIINNTLFMVVSGSDDLANTYFTIGIRRYQYDINSYTDLLL  741
              FKEY+ KL  +VGE+  + I++N L +VV+GSDD+ANTYFTI IR+ QY + +YTDL++
Sbjct  154   MFKEYIVKLKGVVGEERTQFILSNALVLVVAGSDDIANTYFTIRIRKAQYSVPAYTDLMV  213

Query  740   EGASNFLQELYSLGARRIGFFGIPPVGCLPSQRTLAGGSERECVENYNQAAQLANAKFSA  561
               AS+F++ELY LGARRIG F  PP+GC+PSQRTL GG  R C E YN AA+L N K S+
Sbjct  214   NSASSFVKELYKLGARRIGVFSAPPIGCVPSQRTLGGGILRMCAEEYNDAAKLFNIKLSS  273

Query  560   EIKILSKKLPNSKLIFIDIYEDFLDMIKNPAKYGFEVVNLGCCGTGTIEVTMLCNKLSGT  381
              +  LS  LP+SK++++DIY   LD+I NPAK GF+VV  GCCGTG IEV +LCNK   T
Sbjct  274   SLNTLSSALPHSKIVYVDIYNPLLDIILNPAKSGFKVVEKGCCGTGNIEVAVLCNKFDST  333

Query  380   CPDRNKYLFWDSYHPTEKGYRIIVNRIITKYINSF  276
             C + + Y+FWDSYHPTE+ Y IIV  ++ +Y+  F
Sbjct  334   CENPSDYVFWDSYHPTERTYNIIVPSLLQRYMKDF  368



>ref|XP_010416499.1| PREDICTED: GDSL esterase/lipase EXL3 [Camelina sativa]
Length=363

 Score =   395 bits (1016),  Expect = 4e-131, Method: Compositional matrix adjust.
 Identities = 188/348 (54%), Positives = 255/348 (73%), Gaps = 3/348 (1%)
 Frame = -2

Query  1313  CIIAFLVLAGCSEAKIKLPNGLVVKAVIAFGDSIVDQGMNNNLSTMIKTNFPPYGQDFMG  1134
             C+++ L+L   + A +KLP  L++ AVIAFGDSIVD GMNN + T++K +F PYG +F G
Sbjct  18    CLLSVLILTD-TIAAVKLPPNLIIPAVIAFGDSIVDTGMNNYVKTVVKCDFQPYGINFQG  76

Query  1133  GKHTGRYSNGKTPPDLVAEELGIKELVPAYLDPHLQPEDIKTGVSFASGASGYDPQTAAL  954
             G  TGR+ +G+ P DL+AEE GIK  VPAY D  L  +D+ TGVSFASG SGYDP T  L
Sbjct  77    GVATGRFCDGRVPVDLLAEEFGIKLNVPAYFDSKLNSKDLLTGVSFASGGSGYDPITPKL  136

Query  953   MSVIPLSEQLKYFKEYLGKLNAMVGEKEAKSIINNTLFMVVSGSDDLANTYFTIGIRRYQ  774
             ++VI L EQL YF+EY+ K+  +VGE+    II N+LF+VV+GSDD+ANTY+T+  R  Q
Sbjct  137   VTVISLEEQLTYFEEYIEKVKNIVGEERKDFIIANSLFLVVAGSDDIANTYYTLRARP-Q  195

Query  773   YDINSYTDLLLEGASNFLQELYSLGARRIGFFGIPPVGCLPSQRTLAGGSERECVENYNQ  594
             YD++SYT L+ + AS F+ +LY  G RR+  F  PP+GC+PSQRTL GG  R+C + YN+
Sbjct  196   YDVDSYTTLMSDSASAFVAKLYGYGVRRLAVFSAPPIGCVPSQRTLGGGILRDCADTYNE  255

Query  593   AAQLANAKFSAEIKILSKKLPNSKLIFIDIYEDFLDMIKNPAKYGFEVVNLGCCGTGTIE  414
             AA+L N+K S ++ +L K LP  K I+I+IY+  LD+I+NPA YGF+V N GCCGTG IE
Sbjct  256   AAKLFNSKLSPKLDMLRKTLPGIKPIYINIYDPLLDIIQNPANYGFKVANKGCCGTGAIE  315

Query  413   VTMLCNKL-SGTCPDRNKYLFWDSYHPTEKGYRIIVNRIITKYINSFT  273
             V +LCNK+ S  CPD + ++FWDSYHPTE  Y+++V+ +I K+I+ F 
Sbjct  316   VAVLCNKITSSVCPDVSSHVFWDSYHPTEHTYKVLVSLLINKFIDQFV  363



>ref|XP_004499293.1| PREDICTED: GDSL esterase/lipase EXL3-like, partial [Cicer arietinum]
Length=346

 Score =   394 bits (1013),  Expect = 6e-131, Method: Compositional matrix adjust.
 Identities = 190/338 (56%), Positives = 241/338 (71%), Gaps = 1/338 (0%)
 Frame = -2

Query  1310  IIAFLVLAGCSEAKIKLPNGLVVKAVIAFGDSIVDQGMNNNLSTMIKTNFPPYGQDFMGG  1131
             +I   VL   ++  IKLP  + + A+IAFGDSIVD G NN++ T+IK NFPPYG+DF+  
Sbjct  7     LIVLFVLCYKTKGLIKLPPNVTIPALIAFGDSIVDSGNNNHIKTLIKCNFPPYGKDFLEN  66

Query  1130  KHTGRYSNGKTPPDLVAEELGIKELVPAYLDPHLQPEDIKTGVSFASGASGYDPQTAALM  951
               TGR+ NGK P D++AEELGIKE VPAYLDP+L+P D+ TGVSFASGASGYDP T+ LM
Sbjct  67    VPTGRFCNGKIPSDIIAEELGIKEYVPAYLDPYLKPNDLLTGVSFASGASGYDPLTSELM  126

Query  950   SVIPLSEQLKYFKEYLGKLNAMVGEKEAKSIINNTLFMVVSGSDDLANTYFTIGIRRYQY  771
             SVIPLS QL  FKEY+ KL  +VGE     II  +L++VV GSDD+ANTYF     R QY
Sbjct  127   SVIPLSTQLDLFKEYINKLKGIVGEDNTNFIIEKSLYVVVGGSDDIANTYFD-AQARLQY  185

Query  770   DINSYTDLLLEGASNFLQELYSLGARRIGFFGIPPVGCLPSQRTLAGGSERECVENYNQA  591
             DI +YTDL+   ASNFLQE+Y LG RR+  FG PP+GCLPSQRT+ GG  R C E  N  
Sbjct  186   DIYAYTDLMSNSASNFLQEIYKLGGRRMFVFGAPPIGCLPSQRTVQGGILRTCAEKLNYV  245

Query  590   AQLANAKFSAEIKILSKKLPNSKLIFIDIYEDFLDMIKNPAKYGFEVVNLGCCGTGTIEV  411
             A+L N K S  I  L+  LP S++ ++D+Y   LD+I NP KYG+++V+ GCCGTG IE 
Sbjct  246   AKLFNLKLSNNIDSLNSNLPKSRVTYVDVYTPLLDIILNPQKYGYKIVDKGCCGTGLIEA  305

Query  410   TMLCNKLSGTCPDRNKYLFWDSYHPTEKGYRIIVNRII  297
              +LCN    TC + ++Y+FWDSYHPTE  Y +++  I+
Sbjct  306   AVLCNPFVNTCYNVSEYVFWDSYHPTEGVYNVLILLIL  343



>ref|XP_010320440.1| PREDICTED: LOW QUALITY PROTEIN: GDSL esterase/lipase At3g14820-like 
[Solanum lycopersicum]
Length=368

 Score =   395 bits (1016),  Expect = 6e-131, Method: Compositional matrix adjust.
 Identities = 189/345 (55%), Positives = 254/345 (74%), Gaps = 11/345 (3%)
 Frame = -2

Query  1307  IAFLVLAGCS-EAKIKLPNGLVVKAVIAFGDSIVDQGMNNNLSTMIKTNFPPYGQDFMGG  1131
             I + VL  C+ +A + +P+   ++AVI FGDSIVD G NN L+T+ K N+PPYG+DFMGG
Sbjct  27    ICYAVLLLCNVQADMNVPHNKSIQAVIVFGDSIVDTGNNNGLTTIGKVNYPPYGKDFMGG  86

Query  1130  KHTGRYSNGKTPPDLVAEELGIKELVPAYLDPHLQPEDIKTGVSFASGASGYDPQTAALM  951
             K TGR+ NGK PPDL+ EELGIKEL+PAYLDP LQ ED+ TGV+FASG +GYDP T+ + 
Sbjct  87    KPTGRFCNGKVPPDLIVEELGIKELLPAYLDPTLQAEDLITGVNFASGGAGYDPLTSEIA  146

Query  950   SVIPLSEQLKYFKEYLGKLNAMVGEKEAKSIINNTLFMVVSGSDDLANTYFTIGIRRYQY  771
             +VI LS QLK FKEY+ K            I+ N+L+++V GS+D+ NTYF+  +R+  Y
Sbjct  147   NVISLSGQLKMFKEYIVK-------XRKNEILANSLYILVVGSNDITNTYFSTHLRKSYY  199

Query  770   DINSYTDLLLEGASNFLQELYSLGARRIGFFGIPPVGCLPSQRTLAGGSERECVENYNQA  591
             DI+SY D LL   S+F+++LY +GARRIG FGIPP+GCLPSQRTL GG ER+CV+  NQA
Sbjct  200   DISSYADFLLNYGSSFVKDLYEIGARRIGVFGIPPIGCLPSQRTLKGGEERQCVDYLNQA  259

Query  590   AQLANAKFSAEIKILSKKLPNSKLIFIDIYEDFLDMIKNPAKYGFEVVNLGCCGTGTIEV  411
             A L N+K +A++  L  KLPNS+L+++DIY   LD+I NP KYGF++ + GCCGTG IEV
Sbjct  260   ALLFNSKLAADLSSLGNKLPNSRLVYVDIYNLPLDVINNPQKYGFKIADKGCCGTGQIEV  319

Query  410   TMLCNKLSGTCPDRNKYLFWDSYHPTEKGYRIIVNRIITKYINSF  276
               LC      C   + Y+FWDS+H TEK YR++V++I+ ++++SF
Sbjct  320   AELCR---FACSSDSDYVFWDSFHLTEKAYRLLVHKILVQHLSSF  361



>ref|XP_010266840.1| PREDICTED: GDSL esterase/lipase EXL3-like [Nelumbo nucifera]
Length=371

 Score =   395 bits (1016),  Expect = 6e-131, Method: Compositional matrix adjust.
 Identities = 189/344 (55%), Positives = 252/344 (73%), Gaps = 3/344 (1%)
 Frame = -2

Query  1298  LVLAGCSEAKIKLPNGLVVKAVIAFGDSIVDQGMNNNLSTMIKTNFPPYGQDFMGGKHTG  1119
             L L+   +A + LP  + + AV  FGDS+VD G NNNL +++K N PPYG+DFMGGK TG
Sbjct  27    LFLSHLIQAALVLPPNVTIPAVYVFGDSVVDTGNNNNLVSVMKCNSPPYGRDFMGGKATG  86

Query  1118  RYSNGKTPPDLVAEELGIKELVPAYLDPHLQPEDIKTGVSFASGASGYDPQTAALMSVIP  939
             R SNG+ P D+ A  LGIKEL+P YLDP+LQ +D+ TGV+FASGASGYDP T+ L SV  
Sbjct  87    RCSNGRVPSDMFASILGIKELLPPYLDPNLQDQDLLTGVNFASGASGYDPLTSKLASVYS  146

Query  938   LSEQLKYFKEYLGKLNAMV-GEKEAKSIINNTLFMVVSGSDDLANTYFTIGIRRYQYDIN  762
             +++QL  FKEY+ KL A   GE+ AKSI   +L++V  GSDD++NTYF    RR  YD+ 
Sbjct  147   ITDQLGMFKEYIEKLKAAAAGEERAKSITTQSLYIVCLGSDDISNTYFNSPFRRMDYDVP  206

Query  761   SYTDLLLEGASNFLQELYSLGARRIGFFGIPPVGCLPSQRTLAGGSERECVENYNQAAQL  582
             +YTDL+L+ AS+FLQELY LGA+RIG     P+GC P QRT+AGG  R+C   YNQAAQL
Sbjct  207   AYTDLMLQSASSFLQELYGLGAKRIGVLSAAPIGCAPYQRTVAGGPNRDCAAPYNQAAQL  266

Query  581   ANAKFSAEIKILSKKLPNSKLIFIDIYEDFLDMIKNPAKYGFEVVNLGCCGTGTIEVTM-  405
              N K S+EI  L++KLP ++++++DIY   LD+I++P  YGFE  + GCCGTG +EVT  
Sbjct  267   FNQKLSSEIDSLNQKLPQARIVYVDIYYPLLDLIQHPRSYGFEESSKGCCGTGNLEVTTA  326

Query  404   LCNKLSG-TCPDRNKYLFWDSYHPTEKGYRIIVNRIITKYINSF  276
             LCN+L+  TC D +KY+FWDS+HPT+K Y I++N ++ KY++ F
Sbjct  327   LCNELTPFTCTDVSKYVFWDSFHPTQKAYEILLNPLLQKYVHRF  370



>ref|XP_009104692.1| PREDICTED: GDSL esterase/lipase EXL3-like [Brassica rapa]
Length=362

 Score =   395 bits (1014),  Expect = 8e-131, Method: Compositional matrix adjust.
 Identities = 184/332 (55%), Positives = 250/332 (75%), Gaps = 2/332 (1%)
 Frame = -2

Query  1268  IKLPNGLVVKAVIAFGDSIVDQGMNNNLSTMIKTNFPPYGQDFMGGKHTGRYSNGKTPPD  1089
             IKLP  L + A+IAFGDSIVD G NNN+ T++K +F PYG +F GG  TGR+ +G+ P D
Sbjct  31    IKLPPNLKIPALIAFGDSIVDTGNNNNVKTVVKCDFQPYGINFQGGVPTGRFCDGRVPAD  90

Query  1088  LVAEELGIKELVPAYLDPHLQPEDIKTGVSFASGASGYDPQTAALMSVIPLSEQLKYFKE  909
             L+AEE+GIK +VPAYLDP+L P+D+ TGVSFASG SGYDP T  L++ I L +QL+YF+E
Sbjct  91    LLAEEVGIKSVVPAYLDPNLTPKDLLTGVSFASGGSGYDPITPKLVAAISLQKQLEYFEE  150

Query  908   YLGKLNAMVGEKEAKSIINNTLFMVVSGSDDLANTYFTIGIRRYQYDINSYTDLLLEGAS  729
             Y+ K+  +VGE+    I+ N+LF++V+GSDD+ANTY+ +  R + YD++SYT L+   AS
Sbjct  151   YIEKVKNLVGEERKNFILANSLFLLVAGSDDIANTYYDLHARPH-YDVDSYTTLMANSAS  209

Query  728   NFLQELYSLGARRIGFFGIPPVGCLPSQRTLAGGSERECVENYNQAAQLANAKFSAEIKI  549
             +F+ +LY  G RRI  FG PP+GC+PSQRTL GG  REC E YN AA+L N+K S ++  
Sbjct  210   DFVNKLYGYGVRRIAVFGAPPLGCIPSQRTLGGGLLRECAEYYNDAAKLFNSKISTKLDY  269

Query  548   LSKKLPNSKLIFIDIYEDFLDMIKNPAKYGFEVVNLGCCGTGTIEVTMLCNKL-SGTCPD  372
             L K LP+SK ++I+IY+   D+I+NP KYGF V N GCCGTG IEV +LCNK+ S  CPD
Sbjct  270   LRKTLPDSKPVYINIYDPLYDIIQNPTKYGFGVSNKGCCGTGAIEVAVLCNKITSSVCPD  329

Query  371   RNKYLFWDSYHPTEKGYRIIVNRIITKYINSF  276
              + ++FWDSYHPTEK Y+++V+ ++ K++N F
Sbjct  330   VSSHVFWDSYHPTEKTYKVLVSLLVDKFVNQF  361



>ref|XP_010539839.1| PREDICTED: GDSL esterase/lipase EXL3-like [Tarenaya hassleriana]
Length=369

 Score =   395 bits (1014),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 182/345 (53%), Positives = 253/345 (73%), Gaps = 1/345 (0%)
 Frame = -2

Query  1307  IAFLVLAGCSEAKIKLPNGLVVKAVIAFGDSIVDQGMNNNLSTMIKTNFPPYGQDFMGGK  1128
             +  L +   ++A +KLP  + V A+I FGDSI+D G NN L T++K +FPPYG DF  G 
Sbjct  24    VLVLPITTTTKALVKLPPNVTVPALIVFGDSIMDTGNNNVLKTVVKADFPPYGIDFQDGV  83

Query  1127  HTGRYSNGKTPPDLVAEELGIKELVPAYLDPHLQPEDIKTGVSFASGASGYDPQTAALMS  948
              TGR+ +GK P DL+AEELGIK +VPAYL+P L+PED+ TGV FAS  SGYDP T+ ++S
Sbjct  84    PTGRFCDGKVPTDLIAEELGIKSIVPAYLNPSLKPEDLLTGVCFASSGSGYDPLTSKIVS  143

Query  947   VIPLSEQLKYFKEYLGKLNAMVGEKEAKSIINNTLFMVVSGSDDLANTYFTIGIRRYQYD  768
             VIPLS QL+YF+EY+ KL  +VGE+    I+ N+LF+VVS S+D+A TYFT+  R+ +YD
Sbjct  144   VIPLSGQLRYFEEYIEKLKELVGEERKDFILENSLFLVVSSSNDIATTYFTLHARQSEYD  203

Query  767   INSYTDLLLEGASNFLQELYSLGARRIGFFGIPPVGCLPSQRTLAGGSERECVENYNQAA  588
             + SYT L+ + AS+F+ +LY  GARRI  FG PP+GC+PSQRTLAGG  R C +N N+AA
Sbjct  204   VVSYTSLMADLASDFVHKLYGYGARRIAVFGAPPLGCIPSQRTLAGGLVRGCDDNRNEAA  263

Query  587   QLANAKFSAEIKILSKKLPNSKLIFIDIYEDFLDMIKNPAKYGFEVVNLGCCGTGTIEVT  408
             +L NAK SA +  +S+ L  ++++++DIY     +I+NP  YGFEV + GCCGTG +EV 
Sbjct  264   KLFNAKLSAGLDSISRTLAGARVVYVDIYTTLFRIIQNPRNYGFEVADRGCCGTGDLEVA  323

Query  407   MLCNKL-SGTCPDRNKYLFWDSYHPTEKGYRIIVNRIITKYINSF  276
             +LCNK+ S  C D + Y+FWDS+HPTE+ YR++V++++ +Y   F
Sbjct  324   VLCNKITSSVCSDVSAYVFWDSFHPTERVYRMLVSKLLDEYAQKF  368



>ref|XP_004158854.1| PREDICTED: GDSL esterase/lipase EXL3-like [Cucumis sativus]
Length=362

 Score =   394 bits (1013),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 188/350 (54%), Positives = 247/350 (71%), Gaps = 4/350 (1%)
 Frame = -2

Query  1313  CIIAFLVL--AGCSEAKIKLPNGLVVKAVIAFGDSIVDQGMNNNLSTMIKTNFPPYGQDF  1140
             C I  L    AG +     LP    V A+I FGDSIVD G NN L T++K NFPPYG+DF
Sbjct  12    CFILLLCFCHAGAAARSKFLPENEEVSAIIVFGDSIVDPGNNNYLKTLVKCNFPPYGRDF  71

Query  1139  MGGKHTGRYSNGKTPPDLVAEELGIKELVPAYLDPHLQPEDIKTGVSFASGASGYDPQTA  960
              GG  TGR+SNGK P D VAEE G+KELVPAYLDPHL  +D+ TGVSFASGASGYDP T+
Sbjct  72    NGGIPTGRFSNGKIPTDFVAEEFGVKELVPAYLDPHLTTQDLLTGVSFASGASGYDPLTS  131

Query  959   ALMSVIPLSEQLKYFKEYLGKLNAMVGEKEAKSIINNTLFMVVSGSDDLANTYFTIGIRR  780
              + SV+ LS+QL+ FK+Y+ K+ A VGE++A +I++ ++ +V +GSDD+ANTYF    RR
Sbjct  132   KITSVLSLSDQLELFKDYIKKIKAAVGEEKATAILSKSVIIVCTGSDDIANTYFITPFRR  191

Query  779   YQYDINSYTDLLLEGASNFLQELYSLGARRIGFFGIPPVGCLPSQRTLAGGSERECVENY  600
             + YD+ SYTDL+L+  S F  +LY+LGARRIG   +P +GC+PSQRTL GG+ R C E  
Sbjct  192   FHYDVASYTDLMLQSGSIFFHQLYALGARRIGVLSLPAIGCVPSQRTLFGGAARGCSEAA  251

Query  599   NQAAQLANAKFSAEIKILSKKLPNSKLIFIDIYEDFLDMIKNPAKYGFEVVNLGCCGTGT  420
             N  A L N+K S+ I  L  +  ++K +++D+Y  FL +I+NPA+YGFE    GCCGTG+
Sbjct  252   NSMAVLFNSKLSSLIDSLGNEYSDAKFVYLDVYTPFLALIQNPAEYGFEEATKGCCGTGS  311

Query  419   IEVTMLCNKLSG--TCPDRNKYLFWDSYHPTEKGYRIIVNRIITKYINSF  276
             IEV++LCN LS   +CP  +KY+FWDSYHPT   Y+ + +RI+   I  F
Sbjct  312   IEVSVLCNPLSSKLSCPSPDKYIFWDSYHPTGNAYKALTSRILKDSIPKF  361



>emb|CDX85929.1| BnaC06g22050D [Brassica napus]
Length=362

 Score =   394 bits (1013),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 185/332 (56%), Positives = 250/332 (75%), Gaps = 2/332 (1%)
 Frame = -2

Query  1268  IKLPNGLVVKAVIAFGDSIVDQGMNNNLSTMIKTNFPPYGQDFMGGKHTGRYSNGKTPPD  1089
             IKLP  L + A+IAFGDSIVD G NNN+ T++K +F PYG +F GG  TGR+ +G+ P D
Sbjct  31    IKLPPNLKIPALIAFGDSIVDTGNNNNVKTVVKCDFQPYGINFQGGVPTGRFCDGRVPAD  90

Query  1088  LVAEELGIKELVPAYLDPHLQPEDIKTGVSFASGASGYDPQTAALMSVIPLSEQLKYFKE  909
             L+AEE+GIK +VPAYLDP+L P+D+ TGVSFASG SGYDP T  L++ I L +QL+YF+E
Sbjct  91    LLAEEVGIKSVVPAYLDPNLTPKDLLTGVSFASGGSGYDPITPKLVAAISLQKQLEYFEE  150

Query  908   YLGKLNAMVGEKEAKSIINNTLFMVVSGSDDLANTYFTIGIRRYQYDINSYTDLLLEGAS  729
             Y+ K+  +VGE+    I+ N+LF++V+GSDD+ANTY+ +  R + YD++SYT L+   AS
Sbjct  151   YIEKVKNLVGEERKNFILANSLFLLVAGSDDIANTYYDLHARPH-YDVDSYTTLMANSAS  209

Query  728   NFLQELYSLGARRIGFFGIPPVGCLPSQRTLAGGSERECVENYNQAAQLANAKFSAEIKI  549
             +F+ +LY  G RRI  FG PP+GC+PSQRTL GG  REC E YN AA+L N+K S ++  
Sbjct  210   DFVNKLYGYGVRRIAVFGAPPLGCIPSQRTLGGGLLRECAEYYNDAAKLFNSKISTKLDY  269

Query  548   LSKKLPNSKLIFIDIYEDFLDMIKNPAKYGFEVVNLGCCGTGTIEVTMLCNKL-SGTCPD  372
             L K LP+SK ++I+IY+   D+I+NP KYGF V N GCCGTG IEV +LCNK+ S  CPD
Sbjct  270   LLKTLPDSKPVYINIYDPLYDIIQNPTKYGFGVSNKGCCGTGAIEVAVLCNKITSSVCPD  329

Query  371   RNKYLFWDSYHPTEKGYRIIVNRIITKYINSF  276
              + ++FWDSYHPTEK Y+++V+ +I K++N F
Sbjct  330   VSSHVFWDSYHPTEKTYKVLVSLLIDKFVNQF  361



>emb|CDX68113.1| BnaA07g21530D [Brassica napus]
Length=362

 Score =   394 bits (1012),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 187/347 (54%), Positives = 256/347 (74%), Gaps = 3/347 (1%)
 Frame = -2

Query  1313  CIIAFLVLAGCSEAKIKLPNGLVVKAVIAFGDSIVDQGMNNNLSTMIKTNFPPYGQDFMG  1134
             C+++ L L     A IKLP  L + A+IAFGDSIVD G NNN+ T++K +F PYG +F G
Sbjct  17    CLLSILFLTETVVA-IKLPPNLKIPALIAFGDSIVDTGNNNNVKTVVKCDFQPYGINFQG  75

Query  1133  GKHTGRYSNGKTPPDLVAEELGIKELVPAYLDPHLQPEDIKTGVSFASGASGYDPQTAAL  954
             G  TGR+ +G+ P DL+AEE+GIK +VPAYLDP+L P+D+ TGVSFASG SGYDP T  L
Sbjct  76    GVPTGRFCDGRVPADLLAEEVGIKSVVPAYLDPNLTPKDLLTGVSFASGGSGYDPITPKL  135

Query  953   MSVIPLSEQLKYFKEYLGKLNAMVGEKEAKSIINNTLFMVVSGSDDLANTYFTIGIRRYQ  774
             ++ I L +QL+YF+EY+ K+  +VGE+    I+ N+LF++V+GSDD+ANTY+ +  R + 
Sbjct  136   VAAISLQKQLEYFEEYIEKVKNLVGEERKNFILANSLFLLVAGSDDIANTYYDLHARPH-  194

Query  773   YDINSYTDLLLEGASNFLQELYSLGARRIGFFGIPPVGCLPSQRTLAGGSERECVENYNQ  594
             YD++SYT L+   AS+F+ +L+  G RRI  FG PP+GC+PSQRTL GG  REC E YN 
Sbjct  195   YDVDSYTTLMANSASDFVNKLHGYGVRRIAVFGAPPLGCIPSQRTLGGGLLRECAEYYND  254

Query  593   AAQLANAKFSAEIKILSKKLPNSKLIFIDIYEDFLDMIKNPAKYGFEVVNLGCCGTGTIE  414
             AA+L N+K S ++  L K LP+SK ++I+IY+   D+I+NP KYGF V N GCCGTG IE
Sbjct  255   AAKLFNSKISTKLDYLRKTLPDSKPVYINIYDPLYDIIQNPTKYGFGVSNKGCCGTGAIE  314

Query  413   VTMLCNKL-SGTCPDRNKYLFWDSYHPTEKGYRIIVNRIITKYINSF  276
             V +LCNK+ S  CPD   ++FWDSYHPTEK Y+++V+ ++ K++N F
Sbjct  315   VAVLCNKITSSVCPDVFSHVFWDSYHPTEKTYKVLVSLLVDKFVNQF  361



>ref|XP_006390257.1| hypothetical protein EUTSA_v10018728mg [Eutrema salsugineum]
 gb|ESQ27543.1| hypothetical protein EUTSA_v10018728mg [Eutrema salsugineum]
Length=373

 Score =   394 bits (1013),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 187/347 (54%), Positives = 250/347 (72%), Gaps = 3/347 (1%)
 Frame = -2

Query  1307  IAFLVL--AGCSEAKIKLPNGLVVKAVIAFGDSIVDQGMNNNLSTMIKTNFPPYGQDFMG  1134
             I FLVL     + A +KLP    + A+I FGDSIVD G N+++ T  + ++PPYG DF G
Sbjct  26    IFFLVLLFTSATNALVKLPENTTIPAIIVFGDSIVDAGNNDDMITEARCDYPPYGIDFDG  85

Query  1133  GKHTGRYSNGKTPPDLVAEELGIKELVPAYLDPHLQPEDIKTGVSFASGASGYDPQTAAL  954
             G  TGR+SNGK P D++AEELGIK  +PAY DP+L+PED+ TGV+FASG +GY P T  +
Sbjct  86    GVPTGRFSNGKVPTDMLAEELGIKPYIPAYRDPNLKPEDLLTGVTFASGGAGYVPLTTQI  145

Query  953   MSVIPLSEQLKYFKEYLGKLNAMVGEKEAKSIINNTLFMVVSGSDDLANTYFTIGIRRYQ  774
                IPLS+QLKYF+EYL +LN +VG++  K II N+LF+++ GS+D+AN +FT     +Q
Sbjct  146   AGGIPLSQQLKYFEEYLERLNGLVGDERTKFIIKNSLFVIICGSNDIANDFFTFPTVWHQ  205

Query  773   YDINSYTDLLLEGASNFLQELYSLGARRIGFFGIPPVGCLPSQRTLAGGSERECVENYNQ  594
             YD+ S+T L+ + A +   +LY  GARRI  FG PP+GC+PSQRT+AGG  R+CV  +N 
Sbjct  206   YDVASFTALMADNARSIAMKLYGYGARRILMFGAPPIGCVPSQRTVAGGPTRDCVVRFND  265

Query  593   AAQLANAKFSAEIKILSKKLPNSKLIFIDIYEDFLDMIKNPAKYGFEVVNLGCCGTGTIE  414
             A++L NAK SA I  LS+ L ++ LI+IDIY   LD+I NP KYGF+V NLGCCGTG IE
Sbjct  266   ASKLFNAKLSANIDGLSRTLLDTTLIYIDIYNPLLDLILNPHKYGFKVANLGCCGTGLIE  325

Query  413   VTMLCNKLS-GTCPDRNKYLFWDSYHPTEKGYRIIVNRIITKYINSF  276
             VT LCN  +   CP R+ Y+FWDS+HPTE  Y+IIV +++ +Y+N F
Sbjct  326   VTALCNNYTAAVCPVRSDYVFWDSFHPTETAYKIIVAKLLDRYLNRF  372



>gb|AES59777.2| GDSL-like lipase/acylhydrolase [Medicago truncatula]
Length=457

 Score =   396 bits (1018),  Expect = 4e-130, Method: Compositional matrix adjust.
 Identities = 188/346 (54%), Positives = 245/346 (71%), Gaps = 1/346 (0%)
 Frame = -2

Query  1310  IIAFLVLAGCSEAKIKLPNGLVVKAVIAFGDSIVDQGMNNN-LSTMIKTNFPPYGQDFMG  1134
              I  L++A  ++  ++LP  + V AV+ FGDSIVD G NNN L T  + NFPPYG+DF G
Sbjct  10    FIILLLVACKTKGIVQLPPNVSVPAVLVFGDSIVDTGNNNNNLRTTARCNFPPYGKDFKG  69

Query  1133  GKHTGRYSNGKTPPDLVAEELGIKELVPAYLDPHLQPEDIKTGVSFASGASGYDPQTAAL  954
             G  TGR+SNGK P D + EELGIKE +PAYLDP+LQP D+ TGV FASG +G+DP T+  
Sbjct  70    GIPTGRFSNGKVPSDFIVEELGIKEFLPAYLDPNLQPSDLSTGVCFASGGAGFDPLTSQT  129

Query  953   MSVIPLSEQLKYFKEYLGKLNAMVGEKEAKSIINNTLFMVVSGSDDLANTYFTIGIRRYQ  774
              S I LS QL  FKEY+GKL  +VGE     I+ N+LF+VV GS+D++NTYF   IR+ Q
Sbjct  130   ASAISLSGQLDLFKEYIGKLRELVGEDRTNFILANSLFLVVLGSNDISNTYFLSHIRQLQ  189

Query  773   YDINSYTDLLLEGASNFLQELYSLGARRIGFFGIPPVGCLPSQRTLAGGSERECVENYNQ  594
             YD   Y DL++  ASNFL+E+Y LGARRIG F  PP+GCLP QRT AGG ER  V  YN+
Sbjct  190   YDFPDYADLMVNSASNFLKEIYELGARRIGVFNAPPIGCLPFQRTAAGGIERRIVVEYNE  249

Query  593   AAQLANAKFSAEIKILSKKLPNSKLIFIDIYEDFLDMIKNPAKYGFEVVNLGCCGTGTIE  414
             A +L N+K S  +   ++  PNS++++ID+Y   LD+I N  KYG++V + GCCGTG IE
Sbjct  250   AVELYNSKLSKGLASFNQNYPNSRIVYIDVYNPLLDIIVNSNKYGYKVDDKGCCGTGIIE  309

Query  413   VTMLCNKLSGTCPDRNKYLFWDSYHPTEKGYRIIVNRIITKYINSF  276
             V +LCN LS TCP+  +++FWDS+HPTE  Y+ ++  II KY+N F
Sbjct  310   VVLLCNHLSSTCPNDMEFVFWDSFHPTESVYKRLIAPIIQKYVNDF  355



>ref|XP_008387914.1| PREDICTED: GDSL esterase/lipase EXL3-like [Malus domestica]
Length=370

 Score =   393 bits (1010),  Expect = 4e-130, Method: Compositional matrix adjust.
 Identities = 183/335 (55%), Positives = 247/335 (74%), Gaps = 0/335 (0%)
 Frame = -2

Query  1280  SEAKIKLPNGLVVKAVIAFGDSIVDQGMNNNLSTMIKTNFPPYGQDFMGGKHTGRYSNGK  1101
             +E  + LP+     AVI FGDSI+D G NN+L +++K NF PYG+DF   K TGR+ NGK
Sbjct  34    TEGLVMLPSNQTFPAVIVFGDSIMDTGNNNHLKSLVKCNFSPYGRDFQQHKPTGRFGNGK  93

Query  1100  TPPDLVAEELGIKELVPAYLDPHLQPEDIKTGVSFASGASGYDPQTAALMSVIPLSEQLK  921
              P D++A +LGI+E +PAYLDP+L+P+D+  GV FASG +GYDP T  ++SVI + +QLK
Sbjct  94    VPSDIIASQLGIQEYLPAYLDPNLRPQDLPAGVVFASGGTGYDPMTPQIVSVISMDDQLK  153

Query  920   YFKEYLGKLNAMVGEKEAKSIINNTLFMVVSGSDDLANTYFTIGIRRYQYDINSYTDLLL  741
              FKEY+ KL  +VGE+  + I++N L +VV+GSDD+ANTYFTI IR+ QY + +YTDL++
Sbjct  154   MFKEYIVKLKGVVGEERTQFILSNALVLVVAGSDDIANTYFTIRIRKAQYSVPAYTDLMV  213

Query  740   EGASNFLQELYSLGARRIGFFGIPPVGCLPSQRTLAGGSERECVENYNQAAQLANAKFSA  561
               AS+F++ELY LGARRIG F  PP+GC+PSQRTL GG  R C E YN AA+L N K S+
Sbjct  214   NSASSFVKELYKLGARRIGLFSAPPIGCVPSQRTLGGGILRMCAEEYNDAAKLFNIKLSS  273

Query  560   EIKILSKKLPNSKLIFIDIYEDFLDMIKNPAKYGFEVVNLGCCGTGTIEVTMLCNKLSGT  381
              +  LS  LP+SK++++DIY   LD+I NPAK GF+VV  GCCGTG IEV +LCNK   T
Sbjct  274   SLNSLSSALPHSKIVYVDIYNPLLDIILNPAKSGFKVVEKGCCGTGNIEVAVLCNKFDST  333

Query  380   CPDRNKYLFWDSYHPTEKGYRIIVNRIITKYINSF  276
             C + + Y+FWDSYHPTE+ Y +++  ++ +YI  F
Sbjct  334   CENPSDYVFWDSYHPTERTYNVLIPPLLQRYIKDF  368



>ref|XP_009400370.1| PREDICTED: GDSL esterase/lipase At1g20120-like [Musa acuminata 
subsp. malaccensis]
Length=355

 Score =   392 bits (1008),  Expect = 5e-130, Method: Compositional matrix adjust.
 Identities = 184/341 (54%), Positives = 245/341 (72%), Gaps = 10/341 (3%)
 Frame = -2

Query  1268  IKLPNGLVVKA---------VIAFGDSIVDQGMNNNLSTMIKTNFPPYGQDFMGGKHTGR  1116
             I LP GL  +A         +I FGDS+VD G NN + T +K NFPPYG+DF+  K TGR
Sbjct  14    ILLPYGLQAQARSSNRTTPALIVFGDSVVDPGNNNAIVTTVKCNFPPYGKDFIDHKATGR  73

Query  1115  YSNGKTPPDLVAEELGIKELVPAYLDPHLQPEDIKTGVSFASGASGYDPQTAALMSVIPL  936
             +SNGK P D++A  LGIK+LVPAYL   L  ED+ TGVSFASG SGYDP T+ L+  IP+
Sbjct  74    FSNGKIPSDMIASRLGIKQLVPAYLGTELDAEDLLTGVSFASGGSGYDPLTSELVQAIPM  133

Query  935   SEQLKYFKEYLGKLNAMVGEKEAKSIINNTLFMVVSGSDDLANTYFTIGIRRYQYDINSY  756
             SEQL  FKEY+ KL  + GE++A+ II+ +L++V++G+DDLANTYFT   RR +YD+ SY
Sbjct  134   SEQLNMFKEYMKKLEEIAGERKARDIISRSLYLVITGTDDLANTYFTTPFRRVEYDLPSY  193

Query  755   TDLLLEGASNFLQELYSLGARRIGFFGIPPVGCLPSQRTLAGGSERECVENYNQAAQLAN  576
                ++E A++F+QELY+LGARRI   GI P+GCLPSQRTLAGG EREC + YNQAA + N
Sbjct  194   IKFVVETATSFVQELYNLGARRISVSGISPIGCLPSQRTLAGGIERECADLYNQAAVIYN  253

Query  575   AKFSAEIKILSKKLPNSKLIFIDIYEDFLDMIKNPAKYGFEVVNLGCCGTGTIEVTMLCN  396
             ++ S E++ L+  LP S+++FID+Y   LD+++ P  YGF+    GCCGTG  EVT+ CN
Sbjct  254   SELSKELQRLNHSLPGSRILFIDMYTSLLDLMQRPEAYGFKETARGCCGTGIYEVTLTCN  313

Query  395   KLSG-TCPDRNKYLFWDSYHPTEKGYRIIVNRIITKYINSF  276
               +   C D +KYLFWD+YHPTE+ Y II+ +I+ +Y +S 
Sbjct  314   SFTAPPCEDVSKYLFWDTYHPTERAYNIIIKKILRQYPSSL  354



>ref|XP_009106244.1| PREDICTED: GDSL esterase/lipase EXL1 isoform X1 [Brassica rapa]
Length=364

 Score =   392 bits (1008),  Expect = 6e-130, Method: Compositional matrix adjust.
 Identities = 182/340 (54%), Positives = 248/340 (73%), Gaps = 1/340 (0%)
 Frame = -2

Query  1298  LVLAGCSEAKIKLPNGLVVKAVIAFGDSIVDQGMNNNLSTMIKTNFPPYGQDFMGGKHTG  1119
             L+    + A +KLP  + + AVI FGDSIVD G N+++ T  + ++P YG DF GG  TG
Sbjct  22    LLFTTTTNALVKLPENITIPAVIVFGDSIVDAGNNDDMITEARCDYPHYGIDFDGGVATG  81

Query  1118  RYSNGKTPPDLVAEELGIKELVPAYLDPHLQPEDIKTGVSFASGASGYDPQTAALMSVIP  939
             R+SNGK P D++AEELG+K  +PAY DP+L+PED+ TGV+FASG +GY P T  +   IP
Sbjct  82    RFSNGKVPTDILAEELGLKPSIPAYRDPNLKPEDLLTGVTFASGGAGYVPFTTQIAGGIP  141

Query  938   LSEQLKYFKEYLGKLNAMVGEKEAKSIINNTLFMVVSGSDDLANTYFTIGIRRYQYDINS  759
             LS+QLKYF+EY+ KLN MVGE+  K I+ N++F+V+ GS+D+AN +F +   R QY ++S
Sbjct  142   LSQQLKYFEEYIEKLNGMVGEERTKFILKNSMFVVICGSNDIANDFFGLPTVRLQYTVDS  201

Query  758   YTDLLLEGASNFLQELYSLGARRIGFFGIPPVGCLPSQRTLAGGSERECVENYNQAAQLA  579
             +T L+ + A +F + LY  GARRI  FG PP+GC+PSQRT+AGG  R+CV  +N A++L 
Sbjct  202   FTALMADNARSFAKSLYGYGARRILMFGAPPIGCVPSQRTVAGGPTRDCVVRFNDASKLF  261

Query  578   NAKFSAEIKILSKKLPNSKLIFIDIYEDFLDMIKNPAKYGFEVVNLGCCGTGTIEVTMLC  399
             NAK S  I +LS+ L +SKLI++DIY   LD+I NP +YGF+V NLGCCGTG IEVT LC
Sbjct  262   NAKLSGNIDVLSRTLLDSKLIYVDIYSPLLDLILNPGQYGFKVSNLGCCGTGLIEVTALC  321

Query  398   NK-LSGTCPDRNKYLFWDSYHPTEKGYRIIVNRIITKYIN  282
             N   S  CP R+ Y+FWDS+HPTE  YRIIV +++ +Y++
Sbjct  322   NNYTSAVCPIRSDYVFWDSFHPTETAYRIIVAKLLDRYLS  361



>ref|XP_006601361.1| PREDICTED: GDSL esterase/lipase EXL1-like [Glycine max]
 gb|KHN12629.1| GDSL esterase/lipase EXL1 [Glycine soja]
Length=372

 Score =   392 bits (1008),  Expect = 9e-130, Method: Compositional matrix adjust.
 Identities = 189/336 (56%), Positives = 245/336 (73%), Gaps = 1/336 (0%)
 Frame = -2

Query  1280  SEAKIKLPNGLVVKAVIAFGDSIVDQGMNNN-LSTMIKTNFPPYGQDFMGGKHTGRYSNG  1104
             + A +K+P  + V AV+ FGDSIVD G NNN L T  + N+PPYG+DF GGK TGR+SNG
Sbjct  36    TRAVVKIPPNVSVPAVLVFGDSIVDTGNNNNNLGTTARCNYPPYGKDFKGGKPTGRFSNG  95

Query  1103  KTPPDLVAEELGIKELVPAYLDPHLQPEDIKTGVSFASGASGYDPQTAALMSVIPLSEQL  924
             K P D +AEELGIKE VPAYLDPHLQP ++ TGV FASG +GYDP T+   S IPLS QL
Sbjct  96    KVPSDFIAEELGIKEYVPAYLDPHLQPGELATGVCFASGGAGYDPFTSQSASAIPLSGQL  155

Query  923   KYFKEYLGKLNAMVGEKEAKSIINNTLFMVVSGSDDLANTYFTIGIRRYQYDINSYTDLL  744
               FKEY+GKL  +VGE  AK I+ N+L++VV GS+D++NTYF   +R+ QYD  +Y D L
Sbjct  156   DLFKEYIGKLRGVVGEDRAKFILGNSLYVVVFGSNDISNTYFLTRVRQLQYDFPAYADFL  215

Query  743   LEGASNFLQELYSLGARRIGFFGIPPVGCLPSQRTLAGGSERECVENYNQAAQLANAKFS  564
             L  ASNF +ELY LGARRI  F  PP+GCLPSQRTLAGG ER+ V N N A Q+ N+K S
Sbjct  216   LSSASNFFKELYGLGARRIAVFSAPPLGCLPSQRTLAGGLERKIVVNINNAVQIYNSKLS  275

Query  563   AEIKILSKKLPNSKLIFIDIYEDFLDMIKNPAKYGFEVVNLGCCGTGTIEVTMLCNKLSG  384
              E+  L+  L +S++++ID+Y    D+I N  KYG++V + GCCGTGTIEV +LCN+ + 
Sbjct  276   KELDSLNHNLQDSRIVYIDVYNPLFDIIVNYNKYGYKVGDKGCCGTGTIEVVLLCNRFTP  335

Query  383   TCPDRNKYLFWDSYHPTEKGYRIIVNRIITKYINSF  276
              CP+  +Y+FWDS+HPTE  Y+ ++  +I KY++ F
Sbjct  336   LCPNDLEYVFWDSFHPTESVYKRLIASLIGKYLDKF  371



>gb|KHN09074.1| GDSL esterase/lipase EXL3 [Glycine soja]
Length=346

 Score =   391 bits (1004),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 184/344 (53%), Positives = 247/344 (72%), Gaps = 2/344 (1%)
 Frame = -2

Query  1301  FLVLAGC-SEAKIKLPNGLVVKAVIAFGDSIVDQGMNNN-LSTMIKTNFPPYGQDFMGGK  1128
              L++  C ++  ++LP  + V AV+ FGDSI+D G NNN + T+ K NFPPYG+DF GG 
Sbjct  2     LLLMVSCKAKGLVELPPNVTVPAVLVFGDSIMDTGNNNNNMQTLAKCNFPPYGRDFEGGI  61

Query  1127  HTGRYSNGKTPPDLVAEELGIKELVPAYLDPHLQPEDIKTGVSFASGASGYDPQTAALMS  948
              TGR+ NGK P DLVAEELGIKEL+PAYLDP+LQP D+ TGV FASG SGYDP T+ L S
Sbjct  62    PTGRFGNGKVPSDLVAEELGIKELLPAYLDPNLQPSDLVTGVCFASGGSGYDPLTSKLAS  121

Query  947   VIPLSEQLKYFKEYLGKLNAMVGEKEAKSIINNTLFMVVSGSDDLANTYFTIGIRRYQYD  768
              I L+ Q+  FKEY+ KL  +VGE +   I+ N + +VV GS+D++NTYF    R  +YD
Sbjct  122   AISLTGQIDMFKEYIRKLKGLVGEDKTNFILANGIVLVVEGSNDISNTYFLSHAREVEYD  181

Query  767   INSYTDLLLEGASNFLQELYSLGARRIGFFGIPPVGCLPSQRTLAGGSERECVENYNQAA  588
             I +YTDL+++ ASNFL+E+Y LG RRIG F  PP+GC+P QRTL GG  R+C E YN AA
Sbjct  182   IPAYTDLMVKSASNFLKEIYQLGGRRIGVFSAPPIGCVPFQRTLVGGIVRKCAEKYNDAA  241

Query  587   QLANAKFSAEIKILSKKLPNSKLIFIDIYEDFLDMIKNPAKYGFEVVNLGCCGTGTIEVT  408
             +L N+K + E+  L++ LPN++++++D+Y   LD+I +   YGF+V + GCCGTG IE  
Sbjct  242   KLFNSKLAKELASLNRNLPNARMVYLDVYNPLLDIIVHYQNYGFKVGDRGCCGTGKIEAA  301

Query  407   MLCNKLSGTCPDRNKYLFWDSYHPTEKGYRIIVNRIITKYINSF  276
             +LCN L  TCPD   Y+FWDS+HP+E  YR +V  I+ KY++ F
Sbjct  302   VLCNPLHPTCPDVGDYVFWDSFHPSENVYRRLVAPILRKYLSQF  345



>ref|XP_003589526.1| GDSL esterase/lipase [Medicago truncatula]
Length=510

 Score =   396 bits (1018),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 188/345 (54%), Positives = 245/345 (71%), Gaps = 1/345 (0%)
 Frame = -2

Query  1307  IAFLVLAGCSEAKIKLPNGLVVKAVIAFGDSIVDQGMNNN-LSTMIKTNFPPYGQDFMGG  1131
             I  L++A  ++  ++LP  + V AV+ FGDSIVD G NNN L T  + NFPPYG+DF GG
Sbjct  11    IILLLVACKTKGIVQLPPNVSVPAVLVFGDSIVDTGNNNNNLRTTARCNFPPYGKDFKGG  70

Query  1130  KHTGRYSNGKTPPDLVAEELGIKELVPAYLDPHLQPEDIKTGVSFASGASGYDPQTAALM  951
               TGR+SNGK P D + EELGIKE +PAYLDP+LQP D+ TGV FASG +G+DP T+   
Sbjct  71    IPTGRFSNGKVPSDFIVEELGIKEFLPAYLDPNLQPSDLSTGVCFASGGAGFDPLTSQTA  130

Query  950   SVIPLSEQLKYFKEYLGKLNAMVGEKEAKSIINNTLFMVVSGSDDLANTYFTIGIRRYQY  771
             S I LS QL  FKEY+GKL  +VGE     I+ N+LF+VV GS+D++NTYF   IR+ QY
Sbjct  131   SAISLSGQLDLFKEYIGKLRELVGEDRTNFILANSLFLVVLGSNDISNTYFLSHIRQLQY  190

Query  770   DINSYTDLLLEGASNFLQELYSLGARRIGFFGIPPVGCLPSQRTLAGGSERECVENYNQA  591
             D   Y DL++  ASNFL+E+Y LGARRIG F  PP+GCLP QRT AGG ER  V  YN+A
Sbjct  191   DFPDYADLMVNSASNFLKEIYELGARRIGVFNAPPIGCLPFQRTAAGGIERRIVVEYNEA  250

Query  590   AQLANAKFSAEIKILSKKLPNSKLIFIDIYEDFLDMIKNPAKYGFEVVNLGCCGTGTIEV  411
              +L N+K S  +   ++  PNS++++ID+Y   LD+I N  KYG++V + GCCGTG IEV
Sbjct  251   VELYNSKLSKGLASFNQNYPNSRIVYIDVYNPLLDIIVNSNKYGYKVDDKGCCGTGIIEV  310

Query  410   TMLCNKLSGTCPDRNKYLFWDSYHPTEKGYRIIVNRIITKYINSF  276
              +LCN LS TCP+  +++FWDS+HPTE  Y+ ++  II KY+N F
Sbjct  311   VLLCNHLSSTCPNDMEFVFWDSFHPTESVYKRLIAPIIQKYVNDF  355



>gb|ACU20672.1| unknown [Glycine max]
Length=372

 Score =   391 bits (1004),  Expect = 4e-129, Method: Compositional matrix adjust.
 Identities = 188/336 (56%), Positives = 245/336 (73%), Gaps = 1/336 (0%)
 Frame = -2

Query  1280  SEAKIKLPNGLVVKAVIAFGDSIVDQGMNNN-LSTMIKTNFPPYGQDFMGGKHTGRYSNG  1104
             + A +K+P  + V AV+ FGDSIVD G NNN L T  + ++PPYG+DF GGK TGR+SNG
Sbjct  36    TRAVVKIPPNVSVPAVLVFGDSIVDTGNNNNNLGTTARCDYPPYGKDFKGGKPTGRFSNG  95

Query  1103  KTPPDLVAEELGIKELVPAYLDPHLQPEDIKTGVSFASGASGYDPQTAALMSVIPLSEQL  924
             K P D +AEELGIKE VPAYLDPHLQP ++ TGV FASG +GYDP T+   S IPLS QL
Sbjct  96    KVPSDFIAEELGIKEYVPAYLDPHLQPGELATGVCFASGGAGYDPFTSQSASAIPLSGQL  155

Query  923   KYFKEYLGKLNAMVGEKEAKSIINNTLFMVVSGSDDLANTYFTIGIRRYQYDINSYTDLL  744
               FKEY+GKL  +VGE  AK I+ N+L++VV GS+D++NTYF   +R+ QYD  +Y D L
Sbjct  156   DLFKEYIGKLRGVVGEDRAKFILGNSLYVVVFGSNDISNTYFLTRVRQLQYDFPAYADFL  215

Query  743   LEGASNFLQELYSLGARRIGFFGIPPVGCLPSQRTLAGGSERECVENYNQAAQLANAKFS  564
             L  ASNF +ELY LGARRI  F  PP+GCLPSQRTLAGG ER+ V N N A Q+ N+K S
Sbjct  216   LSSASNFFKELYGLGARRIAVFSAPPLGCLPSQRTLAGGLERKIVVNINNAVQIYNSKLS  275

Query  563   AEIKILSKKLPNSKLIFIDIYEDFLDMIKNPAKYGFEVVNLGCCGTGTIEVTMLCNKLSG  384
              E+  L+  L +S++++ID+Y    D+I N  KYG++V + GCCGTGTIEV +LCN+ + 
Sbjct  276   KELDSLNHNLQDSRIVYIDVYNPLFDIIVNYNKYGYKVGDKGCCGTGTIEVVLLCNRFTP  335

Query  383   TCPDRNKYLFWDSYHPTEKGYRIIVNRIITKYINSF  276
              CP+  +Y+FWDS+HPTE  Y+ ++  +I KY++ F
Sbjct  336   LCPNDLEYVFWDSFHPTESVYKRLIASLIGKYLDKF  371



>emb|CDY70534.1| BnaAnng34060D [Brassica napus]
Length=374

 Score =   390 bits (1002),  Expect = 7e-129, Method: Compositional matrix adjust.
 Identities = 185/347 (53%), Positives = 250/347 (72%), Gaps = 3/347 (1%)
 Frame = -2

Query  1307  IAFLVL--AGCSEAKIKLPNGLVVKAVIAFGDSIVDQGMNNNLSTMIKTNFPPYGQDFMG  1134
             I+FLVL     + A +KLP    V A+I FGDSIVD G N++L T  + ++PPYG DF G
Sbjct  27    ISFLVLLFTTTTNALVKLPENTTVPAIIVFGDSIVDAGNNDDLITEARCDYPPYGIDFDG  86

Query  1133  GKHTGRYSNGKTPPDLVAEELGIKELVPAYLDPHLQPEDIKTGVSFASGASGYDPQTAAL  954
             G  TGR+SNGK P D++AEELGIK  +PAY DP+L+ ED+ TGV+FASG +GY P T  +
Sbjct  87    GVPTGRFSNGKVPTDILAEELGIKPTIPAYRDPNLRQEDLLTGVTFASGGAGYVPLTTQI  146

Query  953   MSVIPLSEQLKYFKEYLGKLNAMVGEKEAKSIINNTLFMVVSGSDDLANTYFTIGIRRYQ  774
                IPLS+QLK+F+EY+ KLN MVG++    II N+LF+++ GS+D+AN +F++   + Q
Sbjct  147   AGGIPLSQQLKFFEEYIEKLNGMVGQERTTFIITNSLFVIICGSNDIANNFFSLPTTQLQ  206

Query  773   YDINSYTDLLLEGASNFLQELYSLGARRIGFFGIPPVGCLPSQRTLAGGSERECVENYNQ  594
             Y++ S+T L+ + A +F + LY  GARRI  FG PP+GC+PSQRT+AGG  R+CV  +N 
Sbjct  207   YNVASFTALMADNARSFARTLYQYGARRILMFGAPPIGCVPSQRTVAGGPTRDCVVRFND  266

Query  593   AAQLANAKFSAEIKILSKKLPNSKLIFIDIYEDFLDMIKNPAKYGFEVVNLGCCGTGTIE  414
             A +L NAK SA I  LS+ L ++ LI+IDIY+  LD+I NP +YGF+V NLGCCGTG IE
Sbjct  267   ACKLFNAKLSANIDGLSRTLQDTTLIYIDIYDPLLDLILNPQQYGFKVSNLGCCGTGLIE  326

Query  413   VTMLCNKLS-GTCPDRNKYLFWDSYHPTEKGYRIIVNRIITKYINSF  276
             VT LCN  +   CP R+ Y+FWDS+HPTE  YR IV +++ +Y+N F
Sbjct  327   VTALCNNYTAAVCPVRSDYVFWDSFHPTETAYRNIVAKLLQRYLNRF  373



>ref|XP_006425399.1| hypothetical protein CICLE_v10025900mg [Citrus clementina]
 ref|XP_006466996.1| PREDICTED: GDSL esterase/lipase EXL3-like [Citrus sinensis]
 gb|ESR38639.1| hypothetical protein CICLE_v10025900mg [Citrus clementina]
Length=369

 Score =   390 bits (1001),  Expect = 8e-129, Method: Compositional matrix adjust.
 Identities = 180/320 (56%), Positives = 236/320 (74%), Gaps = 2/320 (1%)
 Frame = -2

Query  1244  VKAVIAFGDSIVDQGMNNNLSTMIKTNFPPYGQDFMGGKHTGRYSNGKTPPDLVAEELGI  1065
             V AV  FGDSI D G NNN+ T+IK NFPPYG+DF G   TGR+SNG  P DL+A+E GI
Sbjct  44    VPAVFVFGDSIADPGNNNNIKTIIKCNFPPYGRDFKGKIATGRFSNGVIPSDLIAQEFGI  103

Query  1064  KELVPAYLDPHLQPEDIKTGVSFASGASGYDPQTAALMSVIPLSEQLKYFKEYLGKLNAM  885
             KEL+PAYLDP+L+P+D+ TGVSFASG +GYDP T+ + S + +S+QL  FK+ L  + A 
Sbjct  104   KELLPAYLDPNLKPQDLVTGVSFASGGAGYDPLTSKVASALSMSDQLDLFKKALETIKAT  163

Query  884   VGEKEAKSIINNTLFMVVSGSDDLANTYFTIGIRRYQYDINSYTDLLLEGASNFLQELYS  705
              GE+   +I++  LFMVVSGSDD+ANTY +   RR QYDINSYTDL    A +FLQELY 
Sbjct  164   AGEEATANILSKGLFMVVSGSDDIANTYLSTPFRRGQYDINSYTDLTASSALSFLQELYG  223

Query  704   LGARRIGFFGIPPVGCLPSQRTLAGGSERECVENYNQAAQLANAKFSAEIKILSKKLPNS  525
             +GARRIG   +PP+GC+P QRTL GG  R C +  NQAAQ+ N+K  + +  LSK+ P+S
Sbjct  224   VGARRIGVLSLPPIGCVPVQRTLNGGIARGCSDFANQAAQIYNSKLQSVVDSLSKEFPDS  283

Query  524   KLIFIDIYEDFLDMIKNPAKYGFEVVNLGCCGTGTIEVTMLCNKL--SGTCPDRNKYLFW  351
             + ++ DIY     +I+NP +YGFEV + GCCGTG +EV++LCN+L  + TCPD +KY+FW
Sbjct  284   RFVYFDIYNPLNSLIQNPPQYGFEVADKGCCGTGNLEVSILCNRLEDAATCPDASKYIFW  343

Query  350   DSYHPTEKGYRIIVNRIITK  291
             DSYHPTEK Y+I+  +I+ +
Sbjct  344   DSYHPTEKAYKILTPKILNQ  363



>ref|XP_008344249.1| PREDICTED: LOW QUALITY PROTEIN: GDSL esterase/lipase EXL3-like 
[Malus domestica]
Length=344

 Score =   387 bits (995),  Expect = 3e-128, Method: Compositional matrix adjust.
 Identities = 174/344 (51%), Positives = 255/344 (74%), Gaps = 4/344 (1%)
 Frame = -2

Query  1304  AFLVLAGCSEAKIKLPNGLVVKAVIAFGDSIVDQGMNNNLSTMIKTNFPPYGQDFMGGKH  1125
              F+++   + A ++L N   + AVI FGDSIVD G NNN+ T++K NFPPYG+DF+  + 
Sbjct  3     GFILVLVRNAAAVELXNNEXIPAVIVFGDSIVDPGNNNNIGTIVKCNFPPYGRDFVRKRP  62

Query  1124  TGRYSNGKTPPDLVAEELGIKELVPAYLDPHLQPEDIKTGVSFASGASGYDPQTAALMSV  945
             TGR+SNG+ P D +   +G+K+++PAYLD +L+ +D+ TGVSFASG SGYDP T  ++SV
Sbjct  63    TGRFSNGRVPSDXI---VGVKKILPAYLDSNLKIQDLLTGVSFASGGSGYDPLTPKIVSV  119

Query  944   IPLSEQLKYFKEYLGKLNAMVGEKEAKSIINNTLFMVVSGSDDLANTYFTIGIRRYQYDI  765
             + LS+QL  FK+Y+ K+NA+VG++   +I++  +++V +GS+D+ NTY +  +RR  YDI
Sbjct  120   LSLSDQLDLFKKYISKINAVVGKERTATIVSKIIYIVCTGSNDIPNTYLSTPLRRSHYDI  179

Query  764   NSYTDLLLEGASNFLQELYSLGARRIGFFGIPPVGCLPSQRTLAGGSERECVENYNQAAQ  585
              +YTDL+++ AS+F QELY LGARRIG   +P +GC+PSQRTL+GG +R C E  NQAA 
Sbjct  180   PAYTDLMVKSASSFFQELYGLGARRIGVVSLPAIGCVPSQRTLSGGLDRGCSETANQAAS  239

Query  584   LANAKFSAEIKILSKKLPNSKLIFIDIYEDFLDMIKNPAKYGFEVVNLGCCGTGTIEVTM  405
             L N+K SA+I   +++LP ++L+++DIY   L +I+NP +YGFEV+N GCCGTG  EV++
Sbjct  240   LFNSKLSAQIDAFNRRLPEARLVYLDIYNTLLSLIQNPTQYGFEVINRGCCGTGNFEVSI  299

Query  404   LCNKLS-GTCPDRNKYLFWDSYHPTEKGYRIIVNRIITKYINSF  276
             LC + S GTC D +KY+FWDSYHP+EKGY +I + +    ++ F
Sbjct  300   LCTRYSPGTCNDSSKYIFWDSYHPSEKGYEVITSLVFDSQVHKF  343



>ref|XP_008357124.1| PREDICTED: GDSL esterase/lipase EXL3-like [Malus domestica]
Length=380

 Score =   389 bits (999),  Expect = 3e-128, Method: Compositional matrix adjust.
 Identities = 185/335 (55%), Positives = 245/335 (73%), Gaps = 0/335 (0%)
 Frame = -2

Query  1280  SEAKIKLPNGLVVKAVIAFGDSIVDQGMNNNLSTMIKTNFPPYGQDFMGGKHTGRYSNGK  1101
             +E  +KLP    V AVI FGDSI+D G NN+L ++++ NFPPYG DF     +GR+ NGK
Sbjct  43    TEGLVKLPPNQTVPAVIVFGDSIMDTGNNNDLESLVRCNFPPYGLDFQQHMPSGRFGNGK  102

Query  1100  TPPDLVAEELGIKELVPAYLDPHLQPEDIKTGVSFASGASGYDPQTAALMSVIPLSEQLK  921
              P DL+A ELGI+E +PAYLD +L+P+D+ TGV FASG +G+DP T  + SVI + +QLK
Sbjct  103   VPSDLIASELGIREYLPAYLDXNLRPQDLPTGVVFASGGTGFDPMTPQIXSVISMDDQLK  162

Query  920   YFKEYLGKLNAMVGEKEAKSIINNTLFMVVSGSDDLANTYFTIGIRRYQYDINSYTDLLL  741
              FKEY+ KL  +VGE+  + I++  L +VVSGSDD+ANTYF I IR+ QY + +YTDL++
Sbjct  163   MFKEYIAKLKGVVGEERTEFILSKALVLVVSGSDDIANTYFGIRIRQAQYSVPAYTDLMV  222

Query  740   EGASNFLQELYSLGARRIGFFGIPPVGCLPSQRTLAGGSERECVENYNQAAQLANAKFSA  561
               AS+F++ELY LG RRIG F  PP+GC+PSQRTL GG  R C E +N AA+L N K S+
Sbjct  223   NSASSFVKELYKLGVRRIGVFSAPPIGCVPSQRTLGGGILRGCAEEHNDAAKLFNIKLSS  282

Query  560   EIKILSKKLPNSKLIFIDIYEDFLDMIKNPAKYGFEVVNLGCCGTGTIEVTMLCNKLSGT  381
              +  LS  L  SK++++D+Y   LD+I NPAKYGF+VV+ GCCGTG IEV +LCNK   T
Sbjct  283   SLNSLSSALSGSKIVYVDVYNPLLDIILNPAKYGFKVVDQGCCGTGEIEVAVLCNKYDST  342

Query  380   CPDRNKYLFWDSYHPTEKGYRIIVNRIITKYINSF  276
             C +R+ Y+FWDSYHPTE  Y I++  +I KYIN+F
Sbjct  343   CENRSDYVFWDSYHPTEGTYNILIPSLINKYINNF  377



>gb|KDP23988.1| hypothetical protein JCGZ_25376 [Jatropha curcas]
Length=359

 Score =   388 bits (997),  Expect = 3e-128, Method: Compositional matrix adjust.
 Identities = 183/335 (55%), Positives = 238/335 (71%), Gaps = 2/335 (1%)
 Frame = -2

Query  1274  AKIKLPNGLVVKAVIAFGDSIVDQGMNNNLSTMIKTNFPPYGQDFMGGKHTGRYSNGKTP  1095
             A I LPN   + AV  FGDSIVD G NN + T  K NFPPYG+DFMGGK TGR+SNG+ P
Sbjct  25    ATITLPNNEKIPAVFVFGDSIVDTGNNNYIKTTAKCNFPPYGRDFMGGKPTGRFSNGRVP  84

Query  1094  PDLVAEELGIKELVPAYLDPHLQPEDIKTGVSFASGASGYDPQTAALMSVIPLSEQLKYF  915
              D +AE  G+K+L+PAYLDP+L+ ED+ TGV FASG +GYDP T  L     LS+Q++ F
Sbjct  85    SDFIAEAFGVKKLLPAYLDPNLKLEDLLTGVVFASGGNGYDPITNKLPPAFSLSDQVEQF  144

Query  914   KEYLGKLNAMVGEKEAKSIINNTLFMVVSGSDDLANTYFTIGIRRYQYDINSYTDLLLEG  735
             KEY  K+ + VGE++  +II+ ++F++ +G++D+ NTY++  +R+  YDINSYTD L+  
Sbjct  145   KEYTRKIKSAVGEEKTATIISKSVFLICTGTNDILNTYYSTPLRQLHYDINSYTDFLVRS  204

Query  734   ASNFLQELYSLGARRIGFFGIPPVGCLPSQRTLAGGSERECVENYNQAAQLANAKFSAEI  555
             AS+F QELY LG RRIG  G+P  GC+PSQRT+ GG ER+C +  NQAA L N+K S+ I
Sbjct  205   ASSFFQELYGLGVRRIGILGVPAAGCVPSQRTVRGGIERKCADFANQAAILFNSKLSSAI  264

Query  554   KILSKKLPNSKLIFIDIYEDFLDMIKNPAKYGFEVVNLGCCGTGTIEVTMLCNKLSG--T  381
               L+  L ++ LI++DIY   L +I+NPAKYGFEV   GCCGTG IEVT LCN+     T
Sbjct  265   YSLNTTLSDANLIYLDIYYPLLSLIQNPAKYGFEVATKGCCGTGKIEVTYLCNRFDDPLT  324

Query  380   CPDRNKYLFWDSYHPTEKGYRIIVNRIITKYINSF  276
             C D  KY+FWDSYHPTEK Y+ ++N II    N F
Sbjct  325   CKDDTKYIFWDSYHPTEKAYQTLINMIIPSISNMF  359



>ref|XP_008807139.1| PREDICTED: GDSL esterase/lipase EXL3-like [Phoenix dactylifera]
Length=358

 Score =   387 bits (995),  Expect = 4e-128, Method: Compositional matrix adjust.
 Identities = 177/322 (55%), Positives = 242/322 (75%), Gaps = 1/322 (0%)
 Frame = -2

Query  1244  VKAVIAFGDSIVDQGMNNNLSTMIKTNFPPYGQDFMGGKHTGRYSNGKTPPDLVAEELGI  1065
             V AVI FGDSIVD G NN L T+++ NFPPYGQDF+  + TGR+SNG+ P DL+A +LG+
Sbjct  34    VPAVIVFGDSIVDPGNNNVLPTLVRCNFPPYGQDFVRHQPTGRFSNGRIPSDLIASKLGV  93

Query  1064  KELVPAYLDPHLQPEDIKTGVSFASGASGYDPQTAALMSVIPLSEQLKYFKEYLGKLNAM  885
             KELVP Y    L+PEDI TGVSFASGA+GYDP T  L++V+ ++E+LK FK+Y  +L A+
Sbjct  94    KELVPPYFGYDLKPEDILTGVSFASGATGYDPLTPTLLNVLSMTEELKLFKKYKERLKAI  153

Query  884   VGEKEAKSIINNTLFMVVSGSDDLANTYFTIGIRRYQYDINSYTDLLLEGASNFLQELYS  705
              GE+ A SI+  +L++V SG+DD+ANTYFT   RR QYDI SY +L++ GAS+FL+EL  
Sbjct  154   AGEERATSIVAKSLYVVCSGTDDIANTYFTTPFRRLQYDIPSYVNLMIRGASSFLEELLQ  213

Query  704   LGARRIGFFGIPPVGCLPSQRTLAGGSERECVENYNQAAQLANAKFSAEIKILSKKLPNS  525
             +GAR+I F G+PP+GC+PSQRTL GG ER C    NQAAQL N+K   E   LS++    
Sbjct  214   MGARKIAFVGLPPIGCVPSQRTLGGGIERNCEPMRNQAAQLFNSKIQKEADRLSREHKGV  273

Query  524   KLIFIDIYEDFLDMIKNPAKYGFEVVNLGCCGTGTIEVTMLCNKLSGT-CPDRNKYLFWD  348
             ++++IDIY   +D+I +P+K+GFE+ + GCCGTG IEVT+LCN+++ + CP+   Y+FWD
Sbjct  274   QIVYIDIYSMLIDLIFHPSKFGFEISDRGCCGTGEIEVTVLCNRVTASVCPNVTAYVFWD  333

Query  347   SYHPTEKGYRIIVNRIITKYIN  282
             SYHPTE+ Y+I++++I    I 
Sbjct  334   SYHPTERAYKIMIDKIFKDNIQ  355



>ref|NP_974149.1| GDSL esterase/lipase EXL1 [Arabidopsis thaliana]
 gb|AAO42232.1| putative family II extracellular lipase 1 (EXL1) [Arabidopsis 
thaliana]
 gb|AAO50559.1| putative family II extracellular lipase 1 (EXL1) [Arabidopsis 
thaliana]
 gb|AEE35769.1| GDSL esterase/lipase EXL1 [Arabidopsis thaliana]
Length=374

 Score =   388 bits (997),  Expect = 5e-128, Method: Compositional matrix adjust.
 Identities = 186/349 (53%), Positives = 247/349 (71%), Gaps = 3/349 (1%)
 Frame = -2

Query  1313  CIIAFLVLAGCS--EAKIKLPNGLVVKAVIAFGDSIVDQGMNNNLSTMIKTNFPPYGQDF  1140
             CI   ++L+  S   A +K+P    V AVI FGDSIVD G N+++ T  + ++ PYG DF
Sbjct  25    CIFVLVLLSTTSTTNALVKIPKNTTVPAVIVFGDSIVDAGNNDDMITEARCDYAPYGIDF  84

Query  1139  MGGKHTGRYSNGKTPPDLVAEELGIKELVPAYLDPHLQPEDIKTGVSFASGASGYDPQTA  960
              GG  TGR+SNGK P D+VAEELGIK  +PAY +P+L+PE++ TGV+FASG +GY P T 
Sbjct  85    DGGVATGRFSNGKVPGDIVAEELGIKPNIPAYRNPNLKPEELLTGVTFASGGAGYVPLTT  144

Query  959   ALMSVIPLSEQLKYFKEYLGKLNAMVGEKEAKSIINNTLFMVVSGSDDLANTYFTIGIRR  780
              +   IPL +QL YF+EY+ KL  MVGEK  K II N+LF+V+ GS+D+AN +FT+   R
Sbjct  145   KIAGGIPLPQQLIYFEEYIEKLKQMVGEKRTKFIIKNSLFVVICGSNDIANDFFTLPPVR  204

Query  779   YQYDINSYTDLLLEGASNFLQELYSLGARRIGFFGIPPVGCLPSQRTLAGGSERECVENY  600
               Y + S+T L+ + A +F Q LY  GARRI  FG PP+GC+PSQRT+AGG  R+CV  +
Sbjct  205   LHYTVASFTALMADNARSFAQTLYGYGARRILVFGAPPIGCVPSQRTVAGGPTRDCVARF  264

Query  599   NQAAQLANAKFSAEIKILSKKLPNSKLIFIDIYEDFLDMIKNPAKYGFEVVNLGCCGTGT  420
             N AA+L N K SA I +LS+ L +  +I+IDIY   LD+I NP +YGF+V N GCCGTG 
Sbjct  265   NDAAKLFNTKLSANIDVLSRTLQDPTIIYIDIYSPLLDLILNPHQYGFKVANKGCCGTGL  324

Query  419   IEVTMLCNKLSGT-CPDRNKYLFWDSYHPTEKGYRIIVNRIITKYINSF  276
             IEVT LCN  + + CP R+ Y+FWDS+HPTEK YRIIV +++ +Y+N F
Sbjct  325   IEVTALCNNYTASVCPIRSDYVFWDSFHPTEKAYRIIVAKLLDRYLNRF  373



>ref|XP_007156185.1| hypothetical protein PHAVU_003G265500g [Phaseolus vulgaris]
 gb|ESW28179.1| hypothetical protein PHAVU_003G265500g [Phaseolus vulgaris]
Length=374

 Score =   388 bits (996),  Expect = 6e-128, Method: Compositional matrix adjust.
 Identities = 184/356 (52%), Positives = 250/356 (70%), Gaps = 10/356 (3%)
 Frame = -2

Query  1313  CIIAFLVLAGC--------SEAKIKLPNGLVVKAVIAFGDSIVDQGMNNNLSTMIKTNFP  1158
             C   FLV+  C          + + LPN   V AVI FGDSIVD G NN +ST++K NFP
Sbjct  18    CSQWFLVILMCYIITSMFQHVSALSLPNNATVPAVIVFGDSIVDTGNNNYISTLVKCNFP  77

Query  1157  PYGQDFMGGKH-TGRYSNGKTPPDLVAEELGIKELVPAYLDPHLQPEDIKTGVSFASGAS  981
             PYG+DF  G H +GR+SNG  P D++A + G+K+ +P YLDP+LQ +D+ TGVSFASG +
Sbjct  78    PYGRDFAEGNHPSGRFSNGLVPSDIIAAKFGVKKFLPPYLDPNLQVQDLLTGVSFASGGA  137

Query  980   GYDPQTAALMSVIPLSEQLKYFKEYLGKLNAMVGEKEAKSIINNTLFMVVSGSDDLANTY  801
             GYDP TA L+SV+ L++QL  FKEY+ K+N  VG      I++ ++++V  GSDD+ANTY
Sbjct  138   GYDPLTAELVSVMSLTDQLDMFKEYIKKINDAVGGNRTTLIVSKSIYIVCIGSDDIANTY  197

Query  800   FTIGIRRYQYDINSYTDLLLEGASNFLQELYSLGARRIGFFGIPPVGCLPSQRTLAGGSE  621
                  RR +YDI+SYTDL+   ASNFL+ LY +G RRIG FG+P +GC+PSQRT+AGG +
Sbjct  198   IQSPFRRVEYDISSYTDLMASEASNFLETLYEIGGRRIGVFGVPAIGCVPSQRTMAGGLD  257

Query  620   RECVENYNQAAQLANAKFSAEIKILSKKLPNSKLIFIDIYEDFLDMIKNPAKYGFEVVNL  441
             R CVE+ N+AA L N+K S++I  L KKLP+++++++D Y   L MI +PAKYGFE    
Sbjct  258   RACVESSNEAAMLFNSKLSSQIDALGKKLPDARIVYLDCYNGLLSMIGDPAKYGFEEAMK  317

Query  440   GCCGTGTIEVTMLCNKLS-GTCPDRNKYLFWDSYHPTEKGYRIIVNRIITKYINSF  276
             GCCGTG IE ++LCN+ +  TC + + YLFWDSYHPTE  Y I+ + ++   IN+F
Sbjct  318   GCCGTGNIEASILCNRYAINTCSNSSDYLFWDSYHPTEHAYNILSSIVLDNKINNF  373



>ref|XP_010026063.1| PREDICTED: GDSL esterase/lipase At5g42170-like [Eucalyptus grandis]
Length=360

 Score =   387 bits (993),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 178/340 (52%), Positives = 248/340 (73%), Gaps = 2/340 (1%)
 Frame = -2

Query  1298  LVLAGCS-EAKIKLPNGLVVKAVIAFGDSIVDQGMNNNLSTMIKTNFPPYGQDFMGGKHT  1122
             L++  C+ +AK+ +P    + AV  FGDSIVD G NNNL T++K+NFPPYG+DFMGGK T
Sbjct  16    LMMQICTPQAKVVVPKNATISAVFMFGDSIVDTGNNNNLITLVKSNFPPYGRDFMGGKPT  75

Query  1121  GRYSNGKTPPDLVAEELGIKELVPAYLDPHLQPEDIKTGVSFASGASGYDPQTAALMSVI  942
             GR+SNGK PPD   E+LGIKEL+PA+LDP+LQ +D+  GV+FAS  +G+DP T+ L+S I
Sbjct  76    GRFSNGKIPPDFFVEQLGIKELLPAFLDPNLQLQDLIGGVNFASAGAGFDPLTSELVSAI  135

Query  941   PLSEQLKYFKEYLGKLNAMVGEKEAKSIINNTLFMVVSGSDDLANTYFTIGIRRYQYDIN  762
             P+S+QL+   EY  KL   +GE+   SI+ N L++V +GSDD+ NTYF    R + Y + 
Sbjct  136   PMSKQLQLLDEYKMKLKCFIGEERVDSIVANGLYIVSAGSDDIVNTYFHTPTRIFDYSVF  195

Query  761   SYTDLLLEGASNFLQELYSLGARRIGFFGIPPVGCLPSQRTLAGGSERECVENYNQAAQL  582
             SYT+LL+  AS+FLQEL++ GARRIG F + P+GC+PS RTLAGG +R C ENYNQ  QL
Sbjct  196   SYTELLVRLASSFLQELHAKGARRIGVFSLTPLGCIPSMRTLAGGIKRRCAENYNQMVQL  255

Query  581   ANAKFSAEIKILSKKLPNSKLIFIDIYEDFLDMIKNPAKYGFEVVNLGCCGTGTIEVTML  402
              N+K S+E+  L++  P+++++ IDIY   LD++K+P KYGFE+ + GCCG+G IE   L
Sbjct  256   LNSKLSSELHRLNEAFPHARMVLIDIYGLVLDIVKSPRKYGFEISDRGCCGSGLIETGFL  315

Query  401   CNKLSG-TCPDRNKYLFWDSYHPTEKGYRIIVNRIITKYI  285
             CN+    TC + ++Y+FWDSYHPTE  Y+++V   + K +
Sbjct  316   CNQWDFLTCSNVSEYVFWDSYHPTENVYKVMVQEKLRKLL  355



>ref|XP_002887619.1| T4O12.13 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH63878.1| T4O12.13 [Arabidopsis lyrata subsp. lyrata]
Length=688

 Score =   397 bits (1021),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 190/343 (55%), Positives = 253/343 (74%), Gaps = 3/343 (1%)
 Frame = -2

Query  1313  CIIAFLVLAGCSEAKIKLPNGLVVKAVIAFGDSIVDQGMNNNLSTMIKTNFPPYGQDFMG  1134
             C+++ L L     A +KLP  LVV A+ AFGDSIVD GMNNN+ T++K +F PYG DF G
Sbjct  17    CLLSVLFLTETITA-VKLPPKLVVPALFAFGDSIVDTGMNNNVKTVVKCDFHPYGIDFQG  75

Query  1133  GKHTGRYSNGKTPPDLVAEELGIKELVPAYLDPHLQPEDIKTGVSFASGASGYDPQTAAL  954
             G  TGR+ +G+ P DL+AEELGIK +VPAYLDP+L+ +D+ TGVSFASG SGYDP T  L
Sbjct  76    GVATGRFCDGRVPADLLAEELGIKSIVPAYLDPNLKSKDLLTGVSFASGGSGYDPITPKL  135

Query  953   MSVIPLSEQLKYFKEYLGKLNAMVGEKEAKSIINNTLFMVVSGSDDLANTYFTIGIRRYQ  774
             ++VI L EQL YF+EY+ K+  +VGE+    I+ N+LF++V+GSDD+ANTY+TI  R  +
Sbjct  136   VAVISLEEQLTYFEEYIEKVKNIVGEERKDFIVANSLFLLVAGSDDIANTYYTIRARP-E  194

Query  773   YDINSYTDLLLEGASNFLQELYSLGARRIGFFGIPPVGCLPSQRTLAGGSERECVENYNQ  594
             YDI+SYT L+ + AS F+ +LY  G RR+  FG PP+GC+PSQRTL GG  R+C E YN+
Sbjct  195   YDIDSYTTLMSDSASEFVTKLYGYGVRRVAVFGAPPIGCVPSQRTLGGGIMRDCAETYNE  254

Query  593   AAQLANAKFSAEIKILSKKLPNSKLIFIDIYEDFLDMIKNPAKYGFEVVNLGCCGTGTIE  414
             AA+L N+K S ++  L K LP  K I+I+IY+   D+I+NPA YGFEV N GCCGTG IE
Sbjct  255   AAKLFNSKLSPKLDSLRKTLPGIKPIYINIYDPLFDIIQNPANYGFEVANKGCCGTGAIE  314

Query  413   VTMLCNKL-SGTCPDRNKYLFWDSYHPTEKGYRIIVNRIITKY  288
             V +LCNK+ S  CPD + ++FWDSYHPTEK Y++ +  ++  +
Sbjct  315   VAVLCNKITSSVCPDVSTHVFWDSYHPTEKTYKVKITLVLALF  357


 Score =   219 bits (559),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 119/317 (38%), Positives = 179/317 (56%), Gaps = 12/317 (4%)
 Frame = -2

Query  1238  AVIAFGDSIVDQGMNNNLSTMIKTNFPPYGQDFMGGKHTGRYSNGKTPPDLVAEELGIKE  1059
             A++AFGDSI+D G NN L T++K N  PYG+ F     TGR+ NG+   D+VAE LGIK+
Sbjct  373   ALLAFGDSILDTGNNNFLLTLMKGNIWPYGRSFNMRMPTGRFGNGRVFSDIVAEGLGIKK  432

Query  1058  LVPAYLDPHLQPEDIKTGVSFASGASGYDPQTAALMSVIPLSEQLKYFKEYLGKLNAMVG  879
             ++PAY    + P D++TGV FASG +G DP T+ L+ V+   +Q+  FK Y+ KL A  G
Sbjct  433   ILPAYRKLFVSPSDLRTGVCFASGGAGVDPVTSKLLRVLTPRDQVNDFKGYIRKLKATAG  492

Query  878   EKEAKSIINNTLFMVVSGSDDLANTYFTIGIRRYQ-YDINSYTDLLLEGASNFLQELYSL  702
               +AK I+ N + +V  G++D+  +YF      ++    N YT  L      F++ELY  
Sbjct  493   PSKAKEIVANAVILVSQGNNDIGISYFGTPSATFRGLTPNRYTTKLAGWNKQFMKELYDQ  552

Query  701   GARRIGFFGIPPVGCLPSQRTLAGGSERECVENYNQAAQLANAKFSAEIKILSKK--LPN  528
             GAR+    G+ P+GCLP  R   GG    C    N+ A+  N K  +  K   ++     
Sbjct  553   GARKFAVMGVIPLGCLPMSRIFLGGFVIWCNFFANRVAEDYNGKLRSGTKSWGRESGFSG  612

Query  527   SKLIFIDIYEDFLDMIKNPAKYGFEVVNLGCCGTGTIEVTMLCNKLSGTCPDRNKYLFWD  348
             +K +++D++   +D+IKN  +YGF     GCC   T  V          CP+ +KY+F+D
Sbjct  613   AKFVYVDMFNTLMDVIKNHRRYGFSNEKNGCCCMITAIV---------PCPNPDKYVFYD  663

Query  347   SYHPTEKGYRIIVNRII  297
               HP+EK Y+ I  +++
Sbjct  664   FVHPSEKAYKTISKKLV  680



>gb|KFK42029.1| hypothetical protein AALP_AA2G202800 [Arabis alpina]
Length=363

 Score =   386 bits (991),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 182/332 (55%), Positives = 245/332 (74%), Gaps = 2/332 (1%)
 Frame = -2

Query  1268  IKLPNGLVVKAVIAFGDSIVDQGMNNNLSTMIKTNFPPYGQDFMGGKHTGRYSNGKTPPD  1089
             +KLP G  V AV+AFGDSIVD G NNN+ T++K +F PYG +F GG  TGR+ +G+ P D
Sbjct  32    VKLPPGFTVPAVMAFGDSIVDTGNNNNVKTVVKCDFQPYGINFEGGVATGRFCDGRVPVD  91

Query  1088  LVAEELGIKELVPAYLDPHLQPEDIKTGVSFASGASGYDPQTAALMSVIPLSEQLKYFKE  909
             L+AEELG+K +VPAYLD +L+PED+ TGVSFASG SGYDP T  L++VI L +QLKYF+E
Sbjct  92    LIAEELGVKSIVPAYLDSNLKPEDLLTGVSFASGGSGYDPITPKLLAVISLEQQLKYFEE  151

Query  908   YLGKLNAMVGEKEAKSIINNTLFMVVSGSDDLANTYFTIGIRRYQYDINSYTDLLLEGAS  729
             Y+ K+  +VGE+    I+ N+L ++V+GSDDLANTY+T+  R + YD++SYT L+ + AS
Sbjct  152   YIEKVKNLVGEERKDFILANSLILLVAGSDDLANTYYTLHARPH-YDVDSYTTLMADYAS  210

Query  728   NFLQELYSLGARRIGFFGIPPVGCLPSQRTLAGGSERECVENYNQAAQLANAKFSAEIKI  549
             +F+ +LY  G RR+  F  PP+GC+PSQRTL GG  R+C E+YN A++L N+K S ++ +
Sbjct  211   DFVTKLYGYGVRRVAVFSAPPIGCVPSQRTLGGGLLRDCAEDYNDASKLFNSKLSKKLDL  270

Query  548   LSKKLPNSKLIFIDIYEDFLDMIKNPAKYGFEVVNLGCCGTGTIEVTMLCNKL-SGTCPD  372
             L + L   K I+IDIY    D+I+ PAKYGF V N GCCGTG +EV +LCNK+ S  C D
Sbjct  271   LRQTLLGIKSIYIDIYNPLSDIIQYPAKYGFGVANKGCCGTGALEVAVLCNKVTSSVCSD  330

Query  371   RNKYLFWDSYHPTEKGYRIIVNRIITKYINSF  276
                ++FWDSYHPTEK Y+ IV  ++ KY+N F
Sbjct  331   VFSHVFWDSYHPTEKTYKAIVKPLMVKYVNQF  362



>ref|XP_006596537.1| PREDICTED: GDSL esterase/lipase EXL1-like [Glycine max]
Length=368

 Score =   386 bits (991),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 188/336 (56%), Positives = 241/336 (72%), Gaps = 1/336 (0%)
 Frame = -2

Query  1280  SEAKIKLPNGLVVKAVIAFGDSIVDQGMNNN-LSTMIKTNFPPYGQDFMGGKHTGRYSNG  1104
             + A +KLP  + V AV+ FGDSIVD G NNN L T  + N+PPYG+DF GGK TGR+SNG
Sbjct  32    TRAVVKLPPNVSVPAVLVFGDSIVDTGNNNNNLGTTARCNYPPYGKDFEGGKPTGRFSNG  91

Query  1103  KTPPDLVAEELGIKELVPAYLDPHLQPEDIKTGVSFASGASGYDPQTAALMSVIPLSEQL  924
             K P D +AEELGIKE VPAYLDPHLQP ++ TGV FASG +GYDP T+   S I LS QL
Sbjct  92    KVPSDFIAEELGIKEYVPAYLDPHLQPGELATGVCFASGGAGYDPLTSQSASAISLSGQL  151

Query  923   KYFKEYLGKLNAMVGEKEAKSIINNTLFMVVSGSDDLANTYFTIGIRRYQYDINSYTDLL  744
               FKEYLGKL  +VGE     I+ N+L++VV GS+D++NTYF   +R+ QYD  +Y D L
Sbjct  152   DLFKEYLGKLRGVVGEDRTNFILANSLYVVVFGSNDISNTYFLSRVRQLQYDFPTYADFL  211

Query  743   LEGASNFLQELYSLGARRIGFFGIPPVGCLPSQRTLAGGSERECVENYNQAAQLANAKFS  564
             L  ASNF +ELY LGARRI  F  PP+GCLPSQRTLAGG ER+ V N N AA+L N K S
Sbjct  212   LSSASNFFKELYGLGARRIAVFSAPPLGCLPSQRTLAGGLERKIVVNINDAAKLFNNKLS  271

Query  563   AEIKILSKKLPNSKLIFIDIYEDFLDMIKNPAKYGFEVVNLGCCGTGTIEVTMLCNKLSG  384
              E+  L+    +S++++ID+Y    D+I N  KYG++V + GCCGTGTIEV +LCN+ + 
Sbjct  272   KELDSLNHNFQDSRIVYIDVYNPLFDIIINYKKYGYKVGDKGCCGTGTIEVVLLCNRFTP  331

Query  383   TCPDRNKYLFWDSYHPTEKGYRIIVNRIITKYINSF  276
              CP+  +Y+FWDS+HPTE  YR ++  ++ KY++ F
Sbjct  332   LCPNDLEYVFWDSFHPTESVYRRLIASLLGKYLDKF  367



>gb|KHN39412.1| GDSL esterase/lipase EXL1 [Glycine soja]
Length=364

 Score =   386 bits (991),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 188/336 (56%), Positives = 241/336 (72%), Gaps = 1/336 (0%)
 Frame = -2

Query  1280  SEAKIKLPNGLVVKAVIAFGDSIVDQGMNNN-LSTMIKTNFPPYGQDFMGGKHTGRYSNG  1104
             + A +KLP  + V AV+ FGDSIVD G NNN L T  + N+PPYG+DF GGK TGR+SNG
Sbjct  28    TRAVVKLPPNVSVPAVLVFGDSIVDTGNNNNNLGTTARCNYPPYGKDFEGGKPTGRFSNG  87

Query  1103  KTPPDLVAEELGIKELVPAYLDPHLQPEDIKTGVSFASGASGYDPQTAALMSVIPLSEQL  924
             K P D +AEELGIKE VPAYLDPHLQP ++ TGV FASG +GYDP T+   S I LS QL
Sbjct  88    KVPSDFIAEELGIKEYVPAYLDPHLQPGELATGVCFASGGAGYDPLTSQSASAISLSGQL  147

Query  923   KYFKEYLGKLNAMVGEKEAKSIINNTLFMVVSGSDDLANTYFTIGIRRYQYDINSYTDLL  744
               FKEYLGKL  +VGE     I+ N+L++VV GS+D++NTYF   +R+ QYD  +Y D L
Sbjct  148   DLFKEYLGKLRGVVGEDRTNFILANSLYVVVFGSNDISNTYFLSRVRQLQYDFPTYADFL  207

Query  743   LEGASNFLQELYSLGARRIGFFGIPPVGCLPSQRTLAGGSERECVENYNQAAQLANAKFS  564
             L  ASNF +ELY LGARRI  F  PP+GCLPSQRTLAGG ER+ V N N AA+L N K S
Sbjct  208   LSSASNFFKELYGLGARRIAVFSAPPLGCLPSQRTLAGGLERKIVVNINDAAKLFNNKLS  267

Query  563   AEIKILSKKLPNSKLIFIDIYEDFLDMIKNPAKYGFEVVNLGCCGTGTIEVTMLCNKLSG  384
              E+  L+    +S++++ID+Y    D+I N  KYG++V + GCCGTGTIEV +LCN+ + 
Sbjct  268   KELDSLNHNFQDSRIVYIDVYNPLFDIIINYKKYGYKVGDKGCCGTGTIEVVLLCNRFTP  327

Query  383   TCPDRNKYLFWDSYHPTEKGYRIIVNRIITKYINSF  276
              CP+  +Y+FWDS+HPTE  YR ++  ++ KY++ F
Sbjct  328   LCPNDLEYVFWDSFHPTESVYRRLIASLLGKYLDKF  363



>emb|CDX85928.1| BnaC06g22060D [Brassica napus]
Length=374

 Score =   385 bits (990),  Expect = 4e-127, Method: Compositional matrix adjust.
 Identities = 184/347 (53%), Positives = 249/347 (72%), Gaps = 3/347 (1%)
 Frame = -2

Query  1307  IAFLVL--AGCSEAKIKLPNGLVVKAVIAFGDSIVDQGMNNNLSTMIKTNFPPYGQDFMG  1134
             I+FLVL     + A +KLP    V A+I FGDSIVD G N++L T  + ++PPYG DF G
Sbjct  27    ISFLVLLFTTNTNALVKLPENTTVPAIIVFGDSIVDAGNNDDLITEARCDYPPYGIDFDG  86

Query  1133  GKHTGRYSNGKTPPDLVAEELGIKELVPAYLDPHLQPEDIKTGVSFASGASGYDPQTAAL  954
             G  TGR+SNGK P D++AEELGIK  +PAY DP+L+ ED+ TGV+FASG +GY P T  +
Sbjct  87    GVPTGRFSNGKVPTDILAEELGIKPTIPAYRDPNLRQEDLLTGVTFASGGAGYVPLTTQI  146

Query  953   MSVIPLSEQLKYFKEYLGKLNAMVGEKEAKSIINNTLFMVVSGSDDLANTYFTIGIRRYQ  774
                IPLS+QLK+F+EY+ KLN MVG++    II N+LF+++ GS+D+AN +F++   + Q
Sbjct  147   AGGIPLSQQLKFFEEYIEKLNGMVGQERTTFIITNSLFVIICGSNDIANNFFSLPTAQLQ  206

Query  773   YDINSYTDLLLEGASNFLQELYSLGARRIGFFGIPPVGCLPSQRTLAGGSERECVENYNQ  594
             Y++ S+T L+ + A +F + LY  GARRI  FG PP+GC+PSQRT+AGG  R+CV  +N 
Sbjct  207   YNVASFTALMADNARSFARTLYQYGARRILMFGAPPIGCVPSQRTVAGGPTRDCVVRFND  266

Query  593   AAQLANAKFSAEIKILSKKLPNSKLIFIDIYEDFLDMIKNPAKYGFEVVNLGCCGTGTIE  414
             A +L NAK SA I  LS+ L ++ LI+IDIY+  LD+I  P +YGF+V NLGCCGTG IE
Sbjct  267   ACKLFNAKLSANIDGLSRTLQDTTLIYIDIYDPLLDLILYPQQYGFKVSNLGCCGTGFIE  326

Query  413   VTMLCNKLS-GTCPDRNKYLFWDSYHPTEKGYRIIVNRIITKYINSF  276
             VT LCN  +   CP R+ Y+FWDS+HPTE  YR IV +++ +Y+N F
Sbjct  327   VTALCNNYTAAVCPVRSDYVFWDSFHPTETAYRNIVAKLLQRYLNRF  373



>ref|XP_006302332.1| hypothetical protein CARUB_v10020390mg, partial [Capsella rubella]
 gb|EOA35230.1| hypothetical protein CARUB_v10020390mg, partial [Capsella rubella]
Length=408

 Score =   386 bits (992),  Expect = 8e-127, Method: Compositional matrix adjust.
 Identities = 184/342 (54%), Positives = 239/342 (70%), Gaps = 1/342 (0%)
 Frame = -2

Query  1298  LVLAGCSEAKIKLPNGLVVKAVIAFGDSIVDQGMNNNLSTMIKTNFPPYGQDFMGGKHTG  1119
             L+    + A +KLP   VV AVI FGDSIVD G N+++ T  + ++PPYG DF GG  TG
Sbjct  66    LLFTTTTNALVKLPENTVVPAVIVFGDSIVDAGNNDDMITEARCDYPPYGIDFDGGVATG  125

Query  1118  RYSNGKTPPDLVAEELGIKELVPAYLDPHLQPEDIKTGVSFASGASGYDPQTAALMSVIP  939
             R+SNGK P D+VAEE GIK  +PAY DP+L+PED+ TGV+FASG +GY P T  +   I 
Sbjct  126   RFSNGKVPGDIVAEEFGIKPSIPAYRDPNLKPEDLLTGVTFASGGAGYVPLTTKIAGGIS  185

Query  938   LSEQLKYFKEYLGKLNAMVGEKEAKSIINNTLFMVVSGSDDLANTYFTIGIRRYQYDINS  759
             L +QLKYF+EY+ KL  MVGE+  K II N+LF+V+SGS+D+AN +F +   +  Y I S
Sbjct  186   LPQQLKYFEEYIAKLKGMVGEERTKFIIKNSLFVVISGSNDIANDFFALPPVQLHYTIAS  245

Query  758   YTDLLLEGASNFLQELYSLGARRIGFFGIPPVGCLPSQRTLAGGSERECVENYNQAAQLA  579
             +T L+ + A +F Q LY  GARRI  FG PP+GC+PSQRT+AGG  R+CV  +N  A+L 
Sbjct  246   FTALMADNARSFAQTLYGYGARRILVFGAPPIGCVPSQRTVAGGPTRDCVARFNDGAKLF  305

Query  578   NAKFSAEIKILSKKLPNSKLIFIDIYEDFLDMIKNPAKYGFEVVNLGCCGTGTIEVTMLC  399
             N K SA I +LS+ L    +I+IDIY   LD+I  P +YGF+V N GCCGTG IEVT LC
Sbjct  306   NTKLSANIDVLSRTLQAPTIIYIDIYNPLLDLILYPQQYGFKVANKGCCGTGLIEVTALC  365

Query  398   NKLS-GTCPDRNKYLFWDSYHPTEKGYRIIVNRIITKYINSF  276
             N  +   CP R+ Y+FWDS+HPTEK YRIIV ++  KY++ F
Sbjct  366   NNYTAAVCPRRSDYVFWDSFHPTEKAYRIIVAKLFDKYLDRF  407



>ref|XP_003589528.1| GDSL esterase/lipase [Medicago truncatula]
 gb|AES59779.1| GDSL-like lipase/acylhydrolase [Medicago truncatula]
Length=371

 Score =   385 bits (988),  Expect = 9e-127, Method: Compositional matrix adjust.
 Identities = 182/345 (53%), Positives = 241/345 (70%), Gaps = 0/345 (0%)
 Frame = -2

Query  1310  IIAFLVLAGCSEAKIKLPNGLVVKAVIAFGDSIVDQGMNNNLSTMIKTNFPPYGQDFMGG  1131
             +  FLV+   + A +KLP    + AV  FGDSI+D G NNN++T  + N+PPYG+DF GG
Sbjct  26    LTIFLVVFFKTNAVLKLPPNTNIPAVFVFGDSIMDTGNNNNMTTPSRCNYPPYGKDFKGG  85

Query  1130  KHTGRYSNGKTPPDLVAEELGIKELVPAYLDPHLQPEDIKTGVSFASGASGYDPQTAALM  951
               TGR+SNGK P D V EELGIKE +PAYLDP+LQP ++ TGV+FASG +GYDP TA L 
Sbjct  86    IPTGRFSNGKVPSDFVVEELGIKEYLPAYLDPNLQPSELATGVNFASGGAGYDPLTAKLE  145

Query  950   SVIPLSEQLKYFKEYLGKLNAMVGEKEAKSIINNTLFMVVSGSDDLANTYFTIGIRRYQY  771
               I +S QL  FK+Y+ +L  + GE  A  I+ N+LF+VV GS+D++NTY+   +R+ QY
Sbjct  146   VAISMSGQLDLFKDYIVRLKGLFGEDRANFILANSLFLVVLGSNDISNTYYLSHLRQAQY  205

Query  770   DINSYTDLLLEGASNFLQELYSLGARRIGFFGIPPVGCLPSQRTLAGGSERECVENYNQA  591
             D  +Y+DLL+  A NF QE+Y LGARRIG F  PP+GC+P QRT+AGG  R CV+ YN A
Sbjct  206   DFPTYSDLLVNSALNFYQEMYQLGARRIGVFNAPPMGCVPFQRTMAGGIIRTCVQEYNDA  265

Query  590   AQLANAKFSAEIKILSKKLPNSKLIFIDIYEDFLDMIKNPAKYGFEVVNLGCCGTGTIEV  411
             A   N K S  I    +  P+S+++++D+Y   LD+I N  KYG+EV + GCCGTGT+EV
Sbjct  266   AVFFNNKLSIGIDTFKQNFPSSRIVYMDVYSPLLDIIVNNQKYGYEVGDRGCCGTGTLEV  325

Query  410   TMLCNKLSGTCPDRNKYLFWDSYHPTEKGYRIIVNRIITKYINSF  276
             T LCN L  TCP+   Y+FWDS+HPTE  YR +V  I+ KY++ F
Sbjct  326   TYLCNHLQPTCPNDLDYVFWDSFHPTESVYRKLVAPILQKYMHQF  370



>ref|XP_006601360.1| PREDICTED: GDSL esterase/lipase EXL3-like [Glycine max]
 gb|KHN12630.1| GDSL esterase/lipase EXL3 [Glycine soja]
Length=372

 Score =   385 bits (988),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 184/344 (53%), Positives = 242/344 (70%), Gaps = 6/344 (2%)
 Frame = -2

Query  1298  LVLAGCSEAK--IKLPNGLVVKAVIAFGDSIVDQGMNNNLST-MIKTNFPPYGQDFMGGK  1128
             ++L  C   K  +KLP  + V AV  FGDS+VD G NNN +T   ++NFPPYG+DF GG 
Sbjct  31    ILLVSCKTIKGLVKLPADVSVPAVFVFGDSVVDTGNNNNRTTSFARSNFPPYGRDFQGGI  90

Query  1127  HTGRYSNGKTPPDLVAEELGIKELVPAYLDPHLQPEDIKTGVSFASGASGYDPQTAALMS  948
              TGR+SNGK P DL+ EELGIKEL+PAYL P+LQ  D+ TGV FASG SGYDP T+ L S
Sbjct  91    PTGRFSNGKVPSDLIVEELGIKELLPAYLKPNLQSSDLITGVCFASGGSGYDPLTSILES  150

Query  947   VIPLSEQLKYFKEYLGKLNAMVGEKEAKSIINNTLFMVVSGSDDLANTYFTIGIRRYQYD  768
              +PL+ Q+   KEY+GKL  +VGE  AK I+ N+LF+VV+GS D++NTY T   R   YD
Sbjct  151   SMPLTGQVDLLKEYIGKLKGLVGEDRAKFILANSLFIVVAGSSDISNTYRT---RSLLYD  207

Query  767   INSYTDLLLEGASNFLQELYSLGARRIGFFGIPPVGCLPSQRTLAGGSERECVENYNQAA  588
             + +YTDLL+  ASNFL E+  LGARRI  F  PP+GCLP QRT+ GG E+ C E  N  A
Sbjct  208   LPAYTDLLVNSASNFLTEINELGARRIAVFSAPPIGCLPFQRTVGGGLEKRCAERPNNLA  267

Query  587   QLANAKFSAEIKILSKKLPNSKLIFIDIYEDFLDMIKNPAKYGFEVVNLGCCGTGTIEVT  408
             QL N K S E+  L++  PNS+ +FI++Y+  LD+I N  KYG++V + GCCGTG IEV 
Sbjct  268   QLFNTKLSKELDSLNRNFPNSRNVFINVYDPLLDIITNHQKYGYKVGDTGCCGTGRIEVA  327

Query  407   MLCNKLSGTCPDRNKYLFWDSYHPTEKGYRIIVNRIITKYINSF  276
             +LCN+   +CP+   Y+FWDS+HPTE  Y+ +++ I+ KY++ F
Sbjct  328   ILCNRFDSSCPNVQDYVFWDSFHPTESVYKRLISPILQKYLDQF  371



>ref|XP_009379344.1| PREDICTED: GDSL esterase/lipase EXL3-like [Pyrus x bretschneideri]
Length=374

 Score =   385 bits (988),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 176/345 (51%), Positives = 253/345 (73%), Gaps = 4/345 (1%)
 Frame = -2

Query  1307  IAFLVLAGCSEAKIKLPNGLVVKAVIAFGDSIVDQGMNNNLSTMIKTNFPPYGQDFMGGK  1128
             IA ++    + A ++LPN   + AVI FGDSIVD G NNN+ T++K NFP    DF+G +
Sbjct  32    IAIVLFLYRNAAAVELPNNEKIPAVIVFGDSIVDPGNNNNIGTIVKCNFP---SDFVGKR  88

Query  1127  HTGRYSNGKTPPDLVAEELGIKELVPAYLDPHLQPEDIKTGVSFASGASGYDPQTAALMS  948
              TGR+SNG+ P DL+AE +G+K+++PAYLD +L+ +D+ TGVSFASG SGYDP T  ++S
Sbjct  89    PTGRFSNGRVPSDLIAESVGVKKILPAYLDSNLKIQDLVTGVSFASGGSGYDPLTPKIVS  148

Query  947   VIPLSEQLKYFKEYLGKLNAMVGEKEAKSIINNTLFMVVSGSDDLANTYFTIGIRRYQYD  768
             V+ LS+QL  FK Y+ K+NA VG++   +I++ ++++V +GS+D+ANTY +  +RR  YD
Sbjct  149   VLSLSDQLDLFKIYISKINAAVGKERTATIVSKSIYIVCTGSNDIANTYLSTPLRRSHYD  208

Query  767   INSYTDLLLEGASNFLQELYSLGARRIGFFGIPPVGCLPSQRTLAGGSERECVENYNQAA  588
             I +YTDL+++ AS+F QEL  LGARRIG   +P +GC+PS RTL+GG +R C E  NQAA
Sbjct  209   IPAYTDLMVKSASSFFQELCGLGARRIGVVSLPAIGCVPSLRTLSGGIDRGCSETANQAA  268

Query  587   QLANAKFSAEIKILSKKLPNSKLIFIDIYEDFLDMIKNPAKYGFEVVNLGCCGTGTIEVT  408
              L N+K SA+I   +++LP ++L+++DIY   L +I+NP +YGFEV+N GCCGTG +EV+
Sbjct  269   SLFNSKLSAQIDAFNRRLPEARLVYLDIYNTLLSLIQNPTQYGFEVINRGCCGTGNVEVS  328

Query  407   MLCNKLS-GTCPDRNKYLFWDSYHPTEKGYRIIVNRIITKYINSF  276
             +LC + S GTC D +KY+FWDSYHP+EKGY +I        ++ F
Sbjct  329   ILCTRYSPGTCNDSSKYIFWDSYHPSEKGYEVITPLAFDSQVHKF  373



>ref|XP_008807138.1| PREDICTED: GDSL esterase/lipase EXL3 [Phoenix dactylifera]
Length=361

 Score =   384 bits (986),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 181/323 (56%), Positives = 238/323 (74%), Gaps = 1/323 (0%)
 Frame = -2

Query  1247  VVKAVIAFGDSIVDQGMNNNLSTMIKTNFPPYGQDFMGGKHTGRYSNGKTPPDLVAEELG  1068
             +V AVI FGDSIVD G NN + T++K NFPPYG DF+G K TGR+ NGK P D +A +LG
Sbjct  36    LVPAVIVFGDSIVDPGNNNAIKTIVKCNFPPYGVDFIGHKPTGRFCNGKIPTDFIASKLG  95

Query  1067  IKELVPAYLDPHLQPEDIKTGVSFASGASGYDPQTAALMSVIPLSEQLKYFKEYLGKLNA  888
             +KEL+PAYL   L PED+ TGVSFASG +G+DP T+ ++SVI ++EQL+ FK+Y+ K+ A
Sbjct  96    VKELLPAYLGTALGPEDLLTGVSFASGGTGFDPLTSKVVSVISMTEQLELFKDYMEKVRA  155

Query  887   MVGEKEAKSIINNTLFMVVSGSDDLANTYFTIGIRRYQYDINSYTDLLLEGASNFLQELY  708
             + G K A+ I++ +L++V +GSDD+ANTYFT   RR  YDI+SY +LLL  ASNFLQEL 
Sbjct  156   IAGAKRAEDILSRSLYVVCAGSDDVANTYFTTPFRRTNYDISSYVNLLLHSASNFLQELI  215

Query  707   SLGARRIGFFGIPPVGCLPSQRTLAGGSERECVENYNQAAQLANAKFSAEIKILSKKLPN  528
              LGAR+IG   IPP+GC+PSQRTL+GG  R C   +NQ A+L N+  + EI+ L+ K   
Sbjct  216   HLGARKIGVTSIPPIGCVPSQRTLSGGILRNCAPGHNQMAELFNSGLAKEIRRLNTKHRG  275

Query  527   SKLIFIDIYEDFLDMIKNPAKYGFEVVNLGCCGTGTIEVTMLCNKLSGT-CPDRNKYLFW  351
              K+++IDIY   LDMI+ P  YGFEV   GCCGTG +EV++LCN L+ T C D ++Y+FW
Sbjct  276   VKVVYIDIYSILLDMIERPNNYGFEVSTKGCCGTGDLEVSVLCNGLTSTICTDVSEYVFW  335

Query  350   DSYHPTEKGYRIIVNRIITKYIN  282
             DSYHPTEK Y I+V+ +   YI 
Sbjct  336   DSYHPTEKAYEILVDWLYKNYIT  358



>ref|NP_565120.1| GDSL esterase/lipase EXL1 [Arabidopsis thaliana]
 sp|Q94CH8.1|EXL1_ARATH RecName: Full=GDSL esterase/lipase EXL1; AltName: Full=Family 
II extracellular lipase 1; Short=Family II lipase EXL1; Flags: 
Precursor [Arabidopsis thaliana]
 gb|AAK30016.1| family II lipase EXL1 [Arabidopsis thaliana]
 gb|AEE35768.1| GDSL esterase/lipase EXL1 [Arabidopsis thaliana]
Length=375

 Score =   384 bits (987),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 186/350 (53%), Positives = 248/350 (71%), Gaps = 4/350 (1%)
 Frame = -2

Query  1313  CIIAFLVLAGCS--EAKIKLPNGLVVKAVIAFGDSIVDQGMNNNLSTMIKTNFPPYGQDF  1140
             CI   ++L+  S   A +K+P    V AVI FGDSIVD G N+++ T  + ++ PYG DF
Sbjct  25    CIFVLVLLSTTSTTNALVKIPKNTTVPAVIVFGDSIVDAGNNDDMITEARCDYAPYGIDF  84

Query  1139  MGGKHTGRYSNGKTPPDLVAEELGIKELVPAYLDPHLQPEDIKTGVSFASGASGYDPQTA  960
              GG  TGR+SNGK P D+VAEELGIK  +PAY +P+L+PE++ TGV+FASG +GY P T 
Sbjct  85    DGGVATGRFSNGKVPGDIVAEELGIKPNIPAYRNPNLKPEELLTGVTFASGGAGYVPLTT  144

Query  959   AL-MSVIPLSEQLKYFKEYLGKLNAMVGEKEAKSIINNTLFMVVSGSDDLANTYFTIGIR  783
              + +  IPL +QL YF+EY+ KL  MVGEK  K II N+LF+V+ GS+D+AN +FT+   
Sbjct  145   KIAVGGIPLPQQLIYFEEYIEKLKQMVGEKRTKFIIKNSLFVVICGSNDIANDFFTLPPV  204

Query  782   RYQYDINSYTDLLLEGASNFLQELYSLGARRIGFFGIPPVGCLPSQRTLAGGSERECVEN  603
             R  Y + S+T L+ + A +F Q LY  GARRI  FG PP+GC+PSQRT+AGG  R+CV  
Sbjct  205   RLHYTVASFTALMADNARSFAQTLYGYGARRILVFGAPPIGCVPSQRTVAGGPTRDCVAR  264

Query  602   YNQAAQLANAKFSAEIKILSKKLPNSKLIFIDIYEDFLDMIKNPAKYGFEVVNLGCCGTG  423
             +N AA+L N K SA I +LS+ L +  +I+IDIY   LD+I NP +YGF+V N GCCGTG
Sbjct  265   FNDAAKLFNTKLSANIDVLSRTLQDPTIIYIDIYSPLLDLILNPHQYGFKVANKGCCGTG  324

Query  422   TIEVTMLCNKLSGT-CPDRNKYLFWDSYHPTEKGYRIIVNRIITKYINSF  276
              IEVT LCN  + + CP R+ Y+FWDS+HPTEK YRIIV +++ +Y+N F
Sbjct  325   LIEVTALCNNYTASVCPIRSDYVFWDSFHPTEKAYRIIVAKLLDRYLNRF  374



>emb|CDX73210.1| BnaC06g36580D [Brassica napus]
Length=369

 Score =   384 bits (986),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 181/347 (52%), Positives = 252/347 (73%), Gaps = 3/347 (1%)
 Frame = -2

Query  1313  CIIAFLVLA-GCSEAKIKLPNGLVVKAVIAFGDSIVDQGMNNNLSTMI-KTNFPPYGQDF  1140
             C++  ++L+   + A +KLP    + A+I FGDSIVD G N++++T + + N+PPYG DF
Sbjct  20    CVLFMVLLSETITNALVKLPANKTIPAIIVFGDSIVDAGNNDDITTTLARCNYPPYGIDF  79

Query  1139  MGGKHTGRYSNGKTPPDLVAEELGIKELVPAYLDPHLQPEDIKTGVSFASGASGYDPQTA  960
              GG  TGR+SNGK P D +AEELGIK +VPAY DP L+PED+ TGV+FASG +GY P T+
Sbjct  80    DGGIPTGRFSNGKVPTDFIAEELGIKPIVPAYRDPTLKPEDLLTGVTFASGGAGYVPFTS  139

Query  959   ALMSVIPLSEQLKYFKEYLGKLNAMVGEKEAKSIINNTLFMVVSGSDDLANTYFTIGIRR  780
              L   I LS+QLK F+EY+ KLN MVGE+  K II N+LFMV+ GS+D+ANTYF +   +
Sbjct  140   QLSGGISLSQQLKLFEEYIEKLNEMVGEERTKFIIQNSLFMVICGSNDIANTYFALASVQ  199

Query  779   YQYDINSYTDLLLEGASNFLQELYSLGARRIGFFGIPPVGCLPSQRTLAGGSERECVENY  600
              QY+++S+T L+ + A +F Q+L+  GARRI  FG+PP+GC+PSQRT+AGG  R CV  +
Sbjct  200   RQYNVDSFTTLMADKAQSFAQKLHEYGARRIQVFGVPPLGCVPSQRTVAGGPTRSCVGRF  259

Query  599   NQAAQLANAKFSAEIKILSKKLPNSKLIFIDIYEDFLDMIKNPAKYGFEVVNLGCCGTGT  420
             N A +L NAK SA +  LS+ L  + LI+IDIY+  L++I +P +YGF+VV+ GCCGTG 
Sbjct  260   NDATKLYNAKLSANLDSLSRNLRENTLIYIDIYDSLLEIILDPQQYGFQVVDRGCCGTGL  319

Query  419   IEVTMLCNKLSG-TCPDRNKYLFWDSYHPTEKGYRIIVNRIITKYIN  282
             IEV +LCN  +   CP+R+ Y+FWDS+HPTEK Y+I+  +   + +N
Sbjct  320   IEVAVLCNNYTADICPNRHDYVFWDSFHPTEKTYKIMTGKYFERVLN  366



>ref|XP_010679879.1| PREDICTED: GDSL esterase/lipase EXL3-like isoform X1 [Beta vulgaris 
subsp. vulgaris]
Length=374

 Score =   383 bits (984),  Expect = 4e-126, Method: Compositional matrix adjust.
 Identities = 190/350 (54%), Positives = 249/350 (71%), Gaps = 6/350 (2%)
 Frame = -2

Query  1310  IIAFLVLAG----CSEAKIKLPNGLVVKAVIAFGDSIVDQGMNNNLSTMIKTNFPPYGQD  1143
             ++ ++V+A        AKI  P    V A+I FGDSIVD G NN L+T+ K NF PYG+D
Sbjct  25    VVYYIVMASYLHIHGHAKIN-PEEKQVPALIVFGDSIVDPGNNNYLATIGKANFLPYGRD  83

Query  1142  FMGGKHTGRYSNGKTPPDLVAEELGIKELVPAYLDPHLQPEDIKTGVSFASGASGYDPQT  963
             F GG  TGRYSNGK P D  AEELGIKELVP YLDP LQ  D+ TGVSFASG SGYDP +
Sbjct  84    FPGGIPTGRYSNGKVPSDFFAEELGIKELVPPYLDPDLQISDLLTGVSFASGVSGYDPSS  143

Query  962   AALMSVIPLSEQLKYFKEYLGKLNAMVGEKEAKSIINNTLFMVVSGSDDLANTYFTIGIR  783
             A L +V+ L +QLK FK Y+ KL   VGE    +II+ +L++V +GS+D+ N++F   I 
Sbjct  144   AKLENVLSLEDQLKLFKGYINKLETTVGESTTSTIISQSLYLVCTGSNDITNSFFGSPIT  203

Query  782   RYQYDINSYTDLLLEGASNFLQELYSLGARRIGFFGIPPVGCLPSQRTLAGGSERECVEN  603
             R QYDI++YTDL++  AS+F+QELY+LGARRIG    PP GCLPSQR L GG  R C E 
Sbjct  204   RLQYDISTYTDLMVNWASSFVQELYALGARRIGVINAPPCGCLPSQRLLHGGLLRACAEE  263

Query  602   YNQAAQLANAKFSAEIKILSKKLPNSKLIFIDIYEDFLDMIKNPAKYGFEVVNLGCCGTG  423
              N+A+ L N K S ++  L++KL  S+++++DIY+ FL++I NP++ GFEVV+ GCCGTG
Sbjct  264   ENKASILFNNKLSFQLASLNQKLAKSRIVYLDIYKPFLNLINNPSQSGFEVVDRGCCGTG  323

Query  422   TIEVTMLCNKLS-GTCPDRNKYLFWDSYHPTEKGYRIIVNRIITKYINSF  276
              IEV++LC KL  GTC D + Y+FWDS+HPTE  YR+IV+ ++ K +  F
Sbjct  324   NIEVSVLCTKLDPGTCQDASNYIFWDSFHPTETTYRLIVHEVLQKSLGDF  373



>ref|XP_009786861.1| PREDICTED: GDSL esterase/lipase EXL3-like isoform X2 [Nicotiana 
sylvestris]
Length=299

 Score =   380 bits (975),  Expect = 7e-126, Method: Compositional matrix adjust.
 Identities = 187/278 (67%), Positives = 217/278 (78%), Gaps = 1/278 (0%)
 Frame = -2

Query  1298  LVLAGCSEAKIKLPNGLVVKAVIAFGDSIVDQGMNNNLSTMIKTNFPPYGQDFMGGKHTG  1119
              VL    EAK++LP  ++ KAV AFGDSIVDQG NN + T++K NF PYG+DFMGG  TG
Sbjct  22    FVLFSVCEAKVQLPQNVIFKAVFAFGDSIVDQGNNNYIKTLVKCNFQPYGKDFMGGMPTG  81

Query  1118  RYSNGKTPPDLVAEELGIKELVPAYLDPHLQPEDIKTGVSFASGASGYDPQTAALMSVIP  939
             R+SNGKTPPDL+A ELGIK+L+PAYLDP+L+ EDIK+GVSFASG  GYDP TA L++VIP
Sbjct  82    RFSNGKTPPDLIAVELGIKKLIPAYLDPNLKTEDIKSGVSFASGGCGYDPLTATLVAVIP  141

Query  938   LSEQLKYFKEYLGKLNAMVGEKEAKSIINNTLFMVVSGSDDLANTYFTIGIRRYQYDINS  759
             LS QL  F EY GKL  +VGE+EA  I+ N+LFMVV+G+DDLANTYFT GIR  Q DINS
Sbjct  142   LSRQLTQFIEYTGKLKVLVGEEEANYILKNSLFMVVAGTDDLANTYFTAGIRLKQ-DINS  200

Query  758   YTDLLLEGASNFLQELYSLGARRIGFFGIPPVGCLPSQRTLAGGSERECVENYNQAAQLA  579
             YTDL++  AS FL ELY LGAR+    GIPP+GCLPSQRTLAGG  R C + YNQAAQLA
Sbjct  201   YTDLMVAEASKFLNELYKLGARKFWILGIPPIGCLPSQRTLAGGHNRMCSQEYNQAAQLA  260

Query  578   NAKFSAEIKILSKKLPNSKLIFIDIYEDFLDMIKNPAK  465
             N KFS  I  LSKKLP SKL+FIDIY   LD+I NP K
Sbjct  261   NTKFSIAINSLSKKLPQSKLVFIDIYNPLLDLIFNPEK  298



>ref|XP_006596538.1| PREDICTED: GDSL esterase/lipase EXL3-like [Glycine max]
 gb|KHN39413.1| GDSL esterase/lipase EXL3 [Glycine soja]
Length=362

 Score =   382 bits (980),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 183/332 (55%), Positives = 234/332 (70%), Gaps = 4/332 (1%)
 Frame = -2

Query  1268  IKLPNGLVVKAVIAFGDSIVDQGMNNNLST-MIKTNFPPYGQDFMGGKHTGRYSNGKTPP  1092
             +KLP  + V AV  FGDS+VD G NNN +T   ++NFPPYG+DF GG  TGR+SNGK P 
Sbjct  33    VKLPADVSVPAVFVFGDSVVDTGNNNNRTTSFARSNFPPYGRDFQGGIPTGRFSNGKVPS  92

Query  1091  DLVAEELGIKELVPAYLDPHLQPEDIKTGVSFASGASGYDPQTAALMSVIPLSEQLKYFK  912
             DL+ EELGIKEL+PAYL P+LQ  D+ TGV FASG SGYDP T+ L S +PL+ Q+   K
Sbjct  93    DLIVEELGIKELLPAYLKPNLQSSDLITGVCFASGGSGYDPLTSILESSMPLTGQVDLLK  152

Query  911   EYLGKLNAMVGEKEAKSIINNTLFMVVSGSDDLANTYFTIGIRRYQYDINSYTDLLLEGA  732
             EY+GKL  +VGE  AK I+ N+LF+VV+GS D++NTY T   R   YD+ +YTDLL+  A
Sbjct  153   EYIGKLKELVGENRAKFILANSLFVVVAGSSDISNTYRT---RSLLYDLPAYTDLLVNSA  209

Query  731   SNFLQELYSLGARRIGFFGIPPVGCLPSQRTLAGGSERECVENYNQAAQLANAKFSAEIK  552
             SNFL E+  LGARRI  F  PP+GCLP QRT+ GG ER C E  N  AQL N K S E+ 
Sbjct  210   SNFLTEINELGARRIAVFSAPPIGCLPFQRTVGGGIERRCAERPNNLAQLFNTKLSKEVD  269

Query  551   ILSKKLPNSKLIFIDIYEDFLDMIKNPAKYGFEVVNLGCCGTGTIEVTMLCNKLSGTCPD  372
              L++  PNS+ +FI++Y+  LD+I N  KYG+ V + GCCGTG IEV +LCN    +CP+
Sbjct  270   SLNRNFPNSRNVFINVYDPLLDIITNYQKYGYRVGDTGCCGTGRIEVAILCNSFDSSCPN  329

Query  371   RNKYLFWDSYHPTEKGYRIIVNRIITKYINSF  276
                Y+FWDS+HPTE  Y+ ++N I+ KY+  F
Sbjct  330   VQDYVFWDSFHPTESVYKRLINPILQKYLYQF  361



>dbj|BAJ53101.1| JHL20J20.8 [Jatropha curcas]
Length=668

 Score =   392 bits (1007),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 177/342 (52%), Positives = 261/342 (76%), Gaps = 3/342 (1%)
 Frame = -2

Query  1280  SEAKIKLPNGLVVKAVIAFGDSIVDQGMNNNLSTMIKTNFPPYGQDFMGGKHTGRYSNGK  1101
             + A +KLP  + V A++ FGDSIVD G NNN+ T++K +F PYG +F GG  TGR+ +GK
Sbjct  32    TTALVKLPPNVTVPALLVFGDSIVDSGNNNNIRTIVKCDFLPYGINFKGGTPTGRFCDGK  91

Query  1100  TPPDLVAEELGIKELVPAYLDPHLQPEDIKTGVSFASGASGYDPQTAALMSVIPLSEQLK  921
              P D++AEELGIK+ VPAY+DP ++ +D+ TGV+FASGASGYDP T+ L SV+ L +QL+
Sbjct  92    IPSDILAEELGIKDTVPAYMDPEVKDQDLLTGVTFASGASGYDPLTSKLTSVMSLDDQLE  151

Query  920   YFKEYLGKLNAMVGEKEAKSIINNTLFMVVSGSDDLANTYFTIGIRRYQYDINSYTDLLL  741
              FKEY+ KL  +VGE++   I+ N++F+VV+GSDD+ANTY+T+ +R+ QYD+ +YTDL+L
Sbjct  152   QFKEYIEKLKEIVGEEKTNFILANSVFLVVAGSDDIANTYYTLRVRKLQYDVPAYTDLML  211

Query  740   EGASNFLQELYSLGARRIGFFGIPPVGCLPSQRTLAGGSERECVENYNQAAQLANAKFSA  561
             + AS F+Q LY LGARRI  F  PP+GC+P+QRTLAGGS+REC E++N+AA L N+K S 
Sbjct  212   DYASTFVQNLYDLGARRIAVFSAPPIGCVPAQRTLAGGSQRECAEDFNKAATLFNSKLSK  271

Query  560   EIKILSKKLPNSKLIFIDIYEDFLDMIKNPAKYGFEVVNLGCCGTGTIEVTMLCNKLSG-  384
               K+ S  +P++K++++D+Y   L++I++P ++GFEVVN GCCG+G +EV++LCN+L+  
Sbjct  272   --KLDSFNMPDAKVVYVDVYNPLLNIIQDPNQFGFEVVNKGCCGSGNLEVSVLCNRLTPF  329

Query  383   TCPDRNKYLFWDSYHPTEKGYRIIVNRIITKYINSFT*SIIE  258
              C + + ++FWDSYHPTE+ YR++        + +F  SI++
Sbjct  330   ICSNTSDHVFWDSYHPTERAYRVLAKNGTISAVVAFGDSILD  371


 Score =   320 bits (820),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 162/333 (49%), Positives = 217/333 (65%), Gaps = 15/333 (5%)
 Frame = -2

Query  1271  KIKLPNGLVVKAVIAFGDSIVDQGMNNNLSTMIKTNFPPYGQDFMGGKHTGRYSNGKTPP  1092
             ++   NG  + AV+AFGDSI+D G NNNL T  K NFPPYG+DF GG  TGR+SNGK   
Sbjct  351   RVLAKNG-TISAVVAFGDSILDTGNNNNLMTYSKCNFPPYGKDFPGGIATGRFSNGKVFS  409

Query  1091  DLVAEELGIKELVPAYLDPHLQPEDIKTGVSFASGASGYDPQTAALMSVIPLSEQLKYFK  912
             DLVA+ LG+K ++PAYLDP+LQ +D+ TGV+FASG SG DP TA   SV+ +++QL  FK
Sbjct  410   DLVADGLGVKAILPAYLDPNLQDQDLPTGVNFASGGSGLDPMTARAQSVLSMTDQLNLFK  469

Query  911   EYLGKLNAMVGEKEAKSIINNTLFMVVSGSDDLANTYFTIGIRRYQYDINSYTDLLLEGA  732
              Y+ +L   VGE +    I+ TL ++ SG++D   +Y        QYDI SYT  L+  A
Sbjct  470   GYISRLKRFVGEDKTYETISTTLCLISSGNNDFGFSYMA-----RQYDIFSYTSQLVSWA  524

Query  731   SNFLQELYSLGARRIGFFGIPPVGCLPSQRTLAGGSERECVENYNQAAQLANAKFSAEIK  552
             SNF+++LY LGARRIGF G  P GCLP  R    G    C E+ N  AQ+ N+K S+E+ 
Sbjct  525   SNFVKDLYELGARRIGFMGTLPFGCLPIVRAYRAGLLGACAEDINGVAQMFNSKLSSELN  584

Query  551   ILSKKLPNSKLIFIDIYEDFLDMIKNPAKYGFEVVNLGCCGTGTIEVTMLCNKLSGTCPD  372
             +L++ L N+ + +ID+Y   L +++NP + GF V N GC GTG +           TC D
Sbjct  585   LLNRSLANATVFYIDVYSPLLALVQNPQQSGFVVTNNGCFGTGGMYF---------TCSD  635

Query  371   RNKYLFWDSYHPTEKGYRIIVNRIITKYINSFT  273
              + Y+FWDS HPTEK YRIIV++I+ KY N F+
Sbjct  636   ISDYVFWDSVHPTEKAYRIIVSQILQKYANYFS  668



>ref|XP_009397996.1| PREDICTED: GDSL esterase/lipase EXL3-like [Musa acuminata subsp. 
malaccensis]
Length=367

 Score =   381 bits (979),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 182/327 (56%), Positives = 239/327 (73%), Gaps = 2/327 (1%)
 Frame = -2

Query  1256  NGLVVKAVIAFGDSIVDQGMNNNLSTMIKTNFPPYGQDFMGGKHTGRYSNGKTPPDLVAE  1077
              G +V A+IAFGDSIVD G N+ L+T I+ +FPPYGQDF+  + TGR+SNG  P DL+A 
Sbjct  38    TGSMVPAIIAFGDSIVDPGNNDVLATTIRCDFPPYGQDFIDHQATGRFSNGLIPTDLIAS  97

Query  1076  ELGIKELVPAYLDPHLQPEDIKTGVSFASGASGYDPQTAALMSVIPLSEQLKYFKEYLGK  897
              LG+KEL+P YL   L PEDI TGVSFASGA+G+DP T  ++SV  ++++LK F EY  K
Sbjct  98    GLGVKELLPPYLGVDLSPEDILTGVSFASGATGFDPITPEIVSVFSMTDELKLFAEYKEK  157

Query  896   LNAMVGEKEAKSIINNTLFMVVSGSDDLANTYFTIGIRRYQYDINSYTDLLLEGASNFLQ  717
             L A+ GE+    I++  L++V +G+DD+ANTYFT   RR  YDI SY +LL+ GAS+F++
Sbjct  158   LYAIAGEERGAEIVSEALYVVCAGTDDIANTYFTTPFRRPHYDIPSYVNLLISGASDFIK  217

Query  716   ELYSLGARRIGFFGIPPVGCLPSQRTLAGGSERECVENYNQAAQLANAKFSAEIKILSKK  537
             +L+ +GAR+IGF G+PP+GC+PSQRT+ GG  R+C E  NQAAQL N+K   EI+ LS +
Sbjct  218   QLHGMGARKIGFVGLPPIGCVPSQRTVGGGILRQCEETRNQAAQLYNSKIEQEIRRLSGE  277

Query  536   LPN-SKLIFIDIYEDFLDMIKNPAKYGFEVVNLGCCGTGTIEVTMLCNKLSGT-CPDRNK  363
               + +KLI+IDIY+  LD+I+ P  YGF+V   GCCGTGTIEVT+LCN  + T C D   
Sbjct  278   FGDGTKLIYIDIYDVLLDLIRRPGYYGFKVSTKGCCGTGTIEVTLLCNSKTATVCSDVTD  337

Query  362   YLFWDSYHPTEKGYRIIVNRIITKYIN  282
             Y+FWDSYHPTEK Y+IIV  I   YI 
Sbjct  338   YVFWDSYHPTEKAYKIIVGSIFDNYIQ  364



>ref|XP_007160640.1| hypothetical protein PHAVU_001G004400g [Phaseolus vulgaris]
 gb|ESW32634.1| hypothetical protein PHAVU_001G004400g [Phaseolus vulgaris]
Length=367

 Score =   381 bits (979),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 175/332 (53%), Positives = 236/332 (71%), Gaps = 1/332 (0%)
 Frame = -2

Query  1268  IKLPNGLVVKAVIAFGDSIVDQGMNNN-LSTMIKTNFPPYGQDFMGGKHTGRYSNGKTPP  1092
             +KLP  + V AV+ FGDSI+D G NNN L+T  + NF PYG+DF GG  TGR+ NGK P 
Sbjct  35    VKLPADVSVPAVLVFGDSIMDTGNNNNKLATSARCNFSPYGKDFKGGIPTGRFCNGKVPS  94

Query  1091  DLVAEELGIKELVPAYLDPHLQPEDIKTGVSFASGASGYDPQTAALMSVIPLSEQLKYFK  912
             D +AEELGIKE +PAYLDP+L+P+++ TGV FASG +GYDP T+     IPLS QL+ FK
Sbjct  95    DYIAEELGIKEFLPAYLDPNLEPDELGTGVCFASGGAGYDPLTSETAGSIPLSGQLQMFK  154

Query  911   EYLGKLNAMVGEKEAKSIINNTLFMVVSGSDDLANTYFTIGIRRYQYDINSYTDLLLEGA  732
             EY+ KL   VGE     I++N+ F +V G++D++NTYF   +R  QYD+ +Y+D L+  A
Sbjct  155   EYIVKLKEHVGENRTNFILSNSFFFIVLGTNDISNTYFLSHLRELQYDLPAYSDFLVNSA  214

Query  731   SNFLQELYSLGARRIGFFGIPPVGCLPSQRTLAGGSERECVENYNQAAQLANAKFSAEIK  552
             SNFL+E+Y LGARRI  FG PPVGC+P  RTL+GG ER+C++ YN A    N K   E+ 
Sbjct  215   SNFLKEIYELGARRIAVFGGPPVGCVPYHRTLSGGRERKCIQKYNDAMMFFNDKLMKELH  274

Query  551   ILSKKLPNSKLIFIDIYEDFLDMIKNPAKYGFEVVNLGCCGTGTIEVTMLCNKLSGTCPD  372
              L++KLPNS++ ++D+Y   LD+ +N  KYG+EV + GCCGTGT+EV + CN L  TCP+
Sbjct  275   SLNQKLPNSRIAYLDVYSPLLDIFQNHQKYGYEVADRGCCGTGTLEVALTCNHLDATCPN  334

Query  371   RNKYLFWDSYHPTEKGYRIIVNRIITKYINSF  276
                Y+FWD +HPTE  Y+ +V +I+ +YIN  
Sbjct  335   VLDYVFWDGFHPTESVYKKLVPKILQEYINQL  366



>ref|XP_010933356.1| PREDICTED: GDSL esterase/lipase EXL3-like [Elaeis guineensis]
Length=358

 Score =   380 bits (977),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 179/342 (52%), Positives = 246/342 (72%), Gaps = 1/342 (0%)
 Frame = -2

Query  1307  IAFLVLAGCSEAKIKLPNGLVVKAVIAFGDSIVDQGMNNNLSTMIKTNFPPYGQDFMGGK  1128
             +AF +L   + A  K     +V AVI FGDSIVD G NN L T++K NFPPYGQDF+  +
Sbjct  13    MAFCLLVAQALAYTKNGTAPMVPAVIVFGDSIVDTGNNNVLETIVKCNFPPYGQDFINHQ  72

Query  1127  HTGRYSNGKTPPDLVAEELGIKELVPAYLDPHLQPEDIKTGVSFASGASGYDPQTAALMS  948
              TGR+SNGK P D +A  +G+KELVP Y+   LQ EDI TGV+FASGA+GYDP T+ +++
Sbjct  73    PTGRFSNGKVPSDFIASAMGVKELVPPYIGYDLQSEDILTGVTFASGATGYDPLTSTIVN  132

Query  947   VIPLSEQLKYFKEYLGKLNAMVGEKEAKSIINNTLFMVVSGSDDLANTYFTIGIRRYQYD  768
             VI +++QL+ F+EY  ++ A+ GE+   +I++N+L++V  G+DD+ANTYFT  +R+  YD
Sbjct  133   VISMTDQLQLFEEYKERMKAIAGEERTATILSNSLYVVCCGTDDIANTYFTTPLRKPHYD  192

Query  767   INSYTDLLLEGASNFLQELYSLGARRIGFFGIPPVGCLPSQRTLAGGSERECVENYNQAA  588
             I SY +LL+ GAS FL++L  +GA++IGF  +PP+GC+PSQRTL GG  R+C    NQAA
Sbjct  193   IPSYVNLLITGASTFLEKLVGMGAQKIGFVSLPPIGCIPSQRTLGGGILRDCEPTRNQAA  252

Query  587   QLANAKFSAEIKILSKKLPNSKLIFIDIYEDFLDMIKNPAKYGFEVVNLGCCGTGTIEVT  408
             QL N+K    I  ++ +    K+I+IDIY   LD++  P+KYGFEV   GCCGTG +E +
Sbjct  253   QLFNSKIKKRIDKIAGQHKGIKIIYIDIYSILLDLMLRPSKYGFEVSTKGCCGTGELEAS  312

Query  407   MLCNKLSG-TCPDRNKYLFWDSYHPTEKGYRIIVNRIITKYI  285
             +LCNK+S  TC D  KY+FWDSYHPTE+ Y+IIV++I   YI
Sbjct  313   VLCNKVSASTCSDITKYVFWDSYHPTERAYKIIVDKIYQDYI  354



>ref|XP_010920106.1| PREDICTED: GDSL esterase/lipase EXL3-like [Elaeis guineensis]
Length=388

 Score =   382 bits (980),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 180/323 (56%), Positives = 238/323 (74%), Gaps = 2/323 (1%)
 Frame = -2

Query  1247  VVKAVIAFGDSIVDQGMNNNLSTMIKTNFPPYGQDFMGGKHTGRYSNGKTPPDLVAEELG  1068
             +V AVI FGDSIVD G NN + T++K NFPPYG DF+G K TGR+SNGK P D +A +LG
Sbjct  64    LVPAVIVFGDSIVDPGNNNAIKTVVKCNFPPYGVDFIGHKPTGRFSNGKIPTDFIASKLG  123

Query  1067  IKELVPAYLDPHLQPEDIKTGVSFASGASGYDPQTAALMSVIPLSEQLKYFKEYLGKLNA  888
             +KEL+PAYL   L PED+ TGVSFASG +G+DP T+ + SV+ ++EQL+ F+EY  K+ A
Sbjct  124   VKELLPAYLGTTLGPEDLLTGVSFASGGTGFDPLTSRVASVLSMAEQLELFQEYKEKVRA  183

Query  887   MVGEKEAKSIINNTLFMVVSGSDDLANTYFTIGIRRYQYDINSYTDLLLEGASNFLQELY  708
             + G K A  I++  L++V +GSDD+ANTYFT   RR  YDI+SY++LLL  ASNFLQEL 
Sbjct  184   IAGAKRADEILSKALYLVCAGSDDIANTYFTTPFRRTHYDISSYSNLLLHSASNFLQELI  243

Query  707   SLGARRIGFFGIPPVGCLPSQRTLAGGSERECVENYNQAAQLANAKFSAEIKILSKKLPN  528
              LGAR+IG  GIPP+GC+PSQRTL+GG  R C   +NQ A+L N+  + EI+ L  K   
Sbjct  244   HLGARKIGVAGIPPIGCVPSQRTLSGGILRHCAPGHNQMAELFNSGLTKEIRRLGDK-HR  302

Query  527   SKLIFIDIYEDFLDMIKNPAKYGFEVVNLGCCGTGTIEVTMLCNKLSGT-CPDRNKYLFW  351
              K+++IDIY   LDMI+ P  YGFEV   GCCGTG +EV++LCN L+ T C D ++Y+FW
Sbjct  303   VKVVYIDIYTILLDMIQRPNNYGFEVSTKGCCGTGDLEVSVLCNGLTSTICTDVSQYVFW  362

Query  350   DSYHPTEKGYRIIVNRIITKYIN  282
             DSYHPTE+ Y+++V+ +   YI+
Sbjct  363   DSYHPTERAYKVLVDWLYQNYIS  385



>ref|XP_010471731.1| PREDICTED: GDSL esterase/lipase EXL1-like isoform X1 [Camelina 
sativa]
 ref|XP_010471734.1| PREDICTED: GDSL esterase/lipase EXL1-like isoform X1 [Camelina 
sativa]
 ref|XP_010471737.1| PREDICTED: GDSL esterase/lipase EXL1-like isoform X1 [Camelina 
sativa]
Length=374

 Score =   380 bits (977),  Expect = 5e-125, Method: Compositional matrix adjust.
 Identities = 181/342 (53%), Positives = 240/342 (70%), Gaps = 1/342 (0%)
 Frame = -2

Query  1298  LVLAGCSEAKIKLPNGLVVKAVIAFGDSIVDQGMNNNLSTMIKTNFPPYGQDFMGGKHTG  1119
             L+    + A +KLP    V AVI FGDSIVD G N+++ T  + ++ PYG DF GG  TG
Sbjct  32    LLFTTTTHALVKLPENTTVPAVIVFGDSIVDAGNNDDMITEARCDYAPYGIDFDGGVATG  91

Query  1118  RYSNGKTPPDLVAEELGIKELVPAYLDPHLQPEDIKTGVSFASGASGYDPQTAALMSVIP  939
             R+SNGK P D+VAEELGIK  +PAY DP+L+PED+ TGV+FASG +GY P T  L   IP
Sbjct  92    RFSNGKVPGDIVAEELGIKPSIPAYRDPNLKPEDLLTGVTFASGGAGYVPLTTKLAGGIP  151

Query  938   LSEQLKYFKEYLGKLNAMVGEKEAKSIINNTLFMVVSGSDDLANTYFTIGIRRYQYDINS  759
             L +QLKYF++Y+ KL AMVGE+  + II N+LF+V+ GS+D+AN +F +   +  Y + S
Sbjct  152   LPQQLKYFEQYIAKLKAMVGEERTQFIIKNSLFVVICGSNDIANDFFALPPVQLHYTVAS  211

Query  758   YTDLLLEGASNFLQELYSLGARRIGFFGIPPVGCLPSQRTLAGGSERECVENYNQAAQLA  579
             +T L+ + A +F Q LY  GARRI  FG PP+GC+PSQRT+AGG  R+CV  +N A++L 
Sbjct  212   FTALMADNARSFAQTLYGYGARRILVFGAPPIGCVPSQRTVAGGPTRDCVARFNDASKLF  271

Query  578   NAKFSAEIKILSKKLPNSKLIFIDIYEDFLDMIKNPAKYGFEVVNLGCCGTGTIEVTMLC  399
             N+K SA I  LS  L +  +I+IDIY   LD+I +P +YGF+V + GCCGTG IEVT LC
Sbjct  272   NSKLSANIDALSTTLQDPTIIYIDIYSPLLDLILSPQQYGFKVGDKGCCGTGLIEVTALC  331

Query  398   NKLS-GTCPDRNKYLFWDSYHPTEKGYRIIVNRIITKYINSF  276
             N  +   CP R+ Y+FWDS+HPTEK YRIIV ++  KY + F
Sbjct  332   NNYTAAVCPIRSDYVFWDSFHPTEKAYRIIVAKLFDKYFDRF  373



>gb|KHN35532.1| GDSL esterase/lipase EXL3 [Glycine soja]
Length=334

 Score =   379 bits (973),  Expect = 6e-125, Method: Compositional matrix adjust.
 Identities = 177/333 (53%), Positives = 243/333 (73%), Gaps = 2/333 (1%)
 Frame = -2

Query  1268  IKLPNGLVVKAVIAFGDSIVDQGMNNNLSTMIKTNFPPYGQDF-MGGKHTGRYSNGKTPP  1092
             + LPN   V AV+ FGDSIVD G NN ++T++K NFPPYG+DF  G + TGR+SNG  P 
Sbjct  1     MSLPNNETVPAVMVFGDSIVDPGNNNYITTLVKCNFPPYGRDFGEGNQPTGRFSNGLVPS  60

Query  1091  DLVAEELGIKELVPAYLDPHLQPEDIKTGVSFASGASGYDPQTAALMSVIPLSEQLKYFK  912
             D++A +LG+K+L+PAYLDP+LQ +D+ TGVSFASG +GYDP TA L++V+ LS+QL  FK
Sbjct  61    DIIAAKLGVKKLLPAYLDPNLQLQDLLTGVSFASGGAGYDPLTAELVNVMSLSDQLDMFK  120

Query  911   EYLGKLNAMVGEKEAKSIINNTLFMVVSGSDDLANTYFTIGIRRYQYDINSYTDLLLEGA  732
             EY+ K+N  VG      I++ ++++V  GSDD+ANTY+    R  +YDI SYTD +   A
Sbjct  121   EYIKKINEAVGRNRTTMIVSKSIYIVCVGSDDIANTYYQSPFRSAEYDIPSYTDFMASEA  180

Query  731   SNFLQELYSLGARRIGFFGIPPVGCLPSQRTLAGGSERECVENYNQAAQLANAKFSAEIK  552
             S FLQELY LGARRIG FG+  +GC+PSQRTL GG  R C+++ NQAA L N+K ++++ 
Sbjct  181   SKFLQELYGLGARRIGVFGLSVIGCVPSQRTLGGGLNRACLDSSNQAAMLFNSKLNSQMV  240

Query  551   ILSKKLPNSKLIFIDIYEDFLDMIKNPAKYGFEVVNLGCCGTGTIEVTMLCNKLS-GTCP  375
             +L KK  +S+L+++D Y  FL+M++NPAK+GFEV+  GCCGTG IEV++LCN+ S  TC 
Sbjct  241   VLGKKFSDSRLVYLDSYNGFLNMLQNPAKFGFEVIKKGCCGTGDIEVSILCNRYSINTCS  300

Query  374   DRNKYLFWDSYHPTEKGYRIIVNRIITKYINSF  276
             +   YLFWDSYHPT++ Y  + + +    I  F
Sbjct  301   NTTHYLFWDSYHPTQEAYLALSSLVFDNKIKDF  333



>ref|XP_003603778.1| GDSL esterase/lipase [Medicago truncatula]
 gb|AES74029.1| GDSL-like lipase/acylhydrolase [Medicago truncatula]
Length=358

 Score =   380 bits (975),  Expect = 6e-125, Method: Compositional matrix adjust.
 Identities = 181/353 (51%), Positives = 242/353 (69%), Gaps = 8/353 (2%)
 Frame = -2

Query  1310  IIAFLVLAG-------CSEAKIKLPNGLVVKAVIAFGDSIVDQGMNNN-LSTMIKTNFPP  1155
             +I F +L G        S A I+LP  +   AV  FGDSI+D G NNN + T  + NF P
Sbjct  5     MIYFFILLGVVSYTTKASLATIELPPNVSFPAVFVFGDSIMDTGNNNNNMKTYARCNFLP  64

Query  1154  YGQDFMGGKHTGRYSNGKTPPDLVAEELGIKELVPAYLDPHLQPEDIKTGVSFASGASGY  975
             YG+DF GG  TGR+ NGK P D + E LGIKE +PAYLDP++QP D+ TGV FASG SGY
Sbjct  65    YGKDFNGGIPTGRFCNGKVPSDYIVEALGIKEFLPAYLDPNIQPSDLVTGVCFASGGSGY  124

Query  974   DPQTAALMSVIPLSEQLKYFKEYLGKLNAMVGEKEAKSIINNTLFMVVSGSDDLANTYFT  795
             DP T+   S I LS Q+  FKEY+GKL  +VGE     I+ N++F+VV GS+D++NTYF 
Sbjct  125   DPLTSKSASAISLSGQIILFKEYIGKLKGIVGEGRKNFILANSVFLVVQGSNDISNTYFL  184

Query  794   IGIRRYQYDINSYTDLLLEGASNFLQELYSLGARRIGFFGIPPVGCLPSQRTLAGGSERE  615
               +R  QYD+ SYTDL+L  ASNFL+E+Y LGARRIG   IPP+GC+P QRT+ GG ER+
Sbjct  185   SHLRELQYDVPSYTDLMLASASNFLKEIYQLGARRIGVLSIPPIGCVPFQRTVVGGIERK  244

Query  614   CVENYNQAAQLANAKFSAEIKILSKKLPNSKLIFIDIYEDFLDMIKNPAKYGFEVVNLGC  435
             C E  N A +L N K S E+  L++ LPN++++++D+Y   LD+I N   YG++VV+ GC
Sbjct  245   CAEKINDACKLFNTKLSKELSSLNRNLPNTRMVYLDVYYPLLDIILNYQNYGYKVVDKGC  304

Query  434   CGTGTIEVTMLCNKLSGTCPDRNKYLFWDSYHPTEKGYRIIVNRIITKYINSF  276
             CGTG +EV +LCN+ +  C D   Y+FWDS+HP+E  Y  ++N ++ KYI+ F
Sbjct  305   CGTGAVEVAVLCNQFATQCEDVRDYVFWDSFHPSESVYSKLLNPLLRKYIHQF  357



>gb|EYU38777.1| hypothetical protein MIMGU_mgv1a009038mg [Erythranthe guttata]
Length=355

 Score =   379 bits (973),  Expect = 9e-125, Method: Compositional matrix adjust.
 Identities = 180/336 (54%), Positives = 242/336 (72%), Gaps = 4/336 (1%)
 Frame = -2

Query  1280  SEAKIKLPNGLVVKAVIAFGDSIVDQGMNNNLSTMIKTNFPPYGQDFMGGKHTGRYSNGK  1101
             + A + L       A+  FGDSI D G NN + T+ K NFPPYG+DF+GG  TGR+S+GK
Sbjct  22    TRAVVNLHKNATFPALFIFGDSIFDTGNNNYIKTIAKANFPPYGKDFIGGIPTGRFSDGK  81

Query  1100  TPPDLVAEELGIKELVPAYLDPHLQPEDIKTGVSFASGASGYDPQTAALMSVIPLSEQLK  921
              P DL AEELGIK ++P +LDP LQ +D+ TGVSFAS ++GYDP TA L SV+  S+QL+
Sbjct  82    IPSDLSAEELGIKTILPPFLDPSLQDQDLLTGVSFASASTGYDPLTARLSSVLSFSDQLE  141

Query  920   YFKEYLGKLNAMVGEKEAKSIINNTLFMVVSGSDDLANTYFTIGIRRYQYDINSYTDLLL  741
              FKEY+ KLN + G++++ +I+  +LF+V  G++D   TYF   +R++QYD+ SY DLL+
Sbjct  142   LFKEYISKLNKIAGDEKSSAILRESLFLVDGGNNDFLITYFGTLLRKFQYDVPSYIDLLV  201

Query  740   EGASNFLQELYSLGARRIGFFGIPPVGCLPSQRTLAGGSERECVENYNQAAQLANAKFSA  561
               AS F+QELY LGAR+IG FG+PP+GC+P  RTL GG +R+C + YN+AAQL N K SA
Sbjct  202   SHASTFVQELYGLGARKIGVFGLPPIGCVPVSRTLRGGLKRKCAKEYNEAAQLFNNKLSA  261

Query  560   EIKIL-SKKLPNSKLIFIDIYEDFLDMIKNPAKYGFEVVNLGCCGTGTIEVTMLCNKLSG  384
             EI  L S +L  + +++ DIY   LD+I+NP KYGFE+V+ GCCGTGT+E++ LC     
Sbjct  262   EIASLKSAQLSEAIIVYADIYNPTLDIIRNPQKYGFEIVDKGCCGTGTVELSFLCKY---  318

Query  383   TCPDRNKYLFWDSYHPTEKGYRIIVNRIITKYINSF  276
              C D + Y+FWDS HPTEK YRIIV+RI  +YI+ F
Sbjct  319   ACSDVSDYVFWDSVHPTEKTYRIIVHRIFEEYISYF  354



>ref|XP_009106246.1| PREDICTED: GDSL esterase/lipase EXL2 [Brassica rapa]
Length=363

 Score =   379 bits (973),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 180/347 (52%), Positives = 250/347 (72%), Gaps = 3/347 (1%)
 Frame = -2

Query  1313  CIIAFLVLA-GCSEAKIKLPNGLVVKAVIAFGDSIVDQGMNNNLSTMI-KTNFPPYGQDF  1140
             C++  ++L+   + A +KLP    + A+I FGDSIVD G N++++T + + N+PPYG DF
Sbjct  14    CVLFMVLLSETITNALVKLPANKTIPAIIVFGDSIVDAGNNDDITTTLARCNYPPYGIDF  73

Query  1139  MGGKHTGRYSNGKTPPDLVAEELGIKELVPAYLDPHLQPEDIKTGVSFASGASGYDPQTA  960
              GG  TGR+SNGK P D +AEELGIK  VPAY DP L+PED+ TGV+FASG +GY P T+
Sbjct  74    DGGIPTGRFSNGKVPTDFIAEELGIKPSVPAYRDPTLKPEDLLTGVTFASGGAGYVPLTS  133

Query  959   ALMSVIPLSEQLKYFKEYLGKLNAMVGEKEAKSIINNTLFMVVSGSDDLANTYFTIGIRR  780
              L   I LS+QLK F+EY+ KLN MVGE+  K I+ N+LFMV+ GS+D+ANTYF +   +
Sbjct  134   QLSGGISLSQQLKLFEEYIEKLNEMVGEERTKFIMQNSLFMVICGSNDIANTYFALPSVQ  193

Query  779   YQYDINSYTDLLLEGASNFLQELYSLGARRIGFFGIPPVGCLPSQRTLAGGSERECVENY  600
              QY+++S+T L+ + A +F Q+L+  GARRI  FG+PP+GC+PSQRT+AGG  R CV  +
Sbjct  194   RQYNVDSFTTLMADKAQSFAQKLHEYGARRIQVFGVPPLGCVPSQRTVAGGPTRSCVGRF  253

Query  599   NQAAQLANAKFSAEIKILSKKLPNSKLIFIDIYEDFLDMIKNPAKYGFEVVNLGCCGTGT  420
             N A +L NAK SA +  LS+ L  + LI+IDIY   LD+I +P +YGF+VV+ GCCGTG 
Sbjct  254   NDATKLYNAKLSANLDSLSRNLRENTLIYIDIYGSLLDIILDPQQYGFQVVDRGCCGTGL  313

Query  419   IEVTMLCNKLSG-TCPDRNKYLFWDSYHPTEKGYRIIVNRIITKYIN  282
             IEV +LCN  +   CP+R+ ++FWDS+HPTEK Y+I+  +   + +N
Sbjct  314   IEVAVLCNNFTADICPNRHDHVFWDSFHPTEKTYKIMTAKYFERVLN  360



>ref|XP_003548834.1| PREDICTED: GDSL esterase/lipase EXL3-like [Glycine max]
Length=366

 Score =   379 bits (972),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 177/333 (53%), Positives = 242/333 (73%), Gaps = 2/333 (1%)
 Frame = -2

Query  1268  IKLPNGLVVKAVIAFGDSIVDQGMNNNLSTMIKTNFPPYGQDF-MGGKHTGRYSNGKTPP  1092
             + LPN   V AV+ FGDSIVD G NN ++T++K NFPPYG+DF  G + TGR+SNG  P 
Sbjct  33    MSLPNNETVPAVMVFGDSIVDPGNNNYITTLVKCNFPPYGRDFGEGNQPTGRFSNGLVPS  92

Query  1091  DLVAEELGIKELVPAYLDPHLQPEDIKTGVSFASGASGYDPQTAALMSVIPLSEQLKYFK  912
             D++A +LG+K+L+PAYLDP+LQ +D+ TGVSFASG +GYDP TA L++V+ LS+QL  FK
Sbjct  93    DIIAAKLGVKKLLPAYLDPNLQLQDLLTGVSFASGGAGYDPLTAELVNVMSLSDQLDMFK  152

Query  911   EYLGKLNAMVGEKEAKSIINNTLFMVVSGSDDLANTYFTIGIRRYQYDINSYTDLLLEGA  732
             EY+ K+N  VG      I++ ++++V  GSDD+ANTY+    R  +YDI SYTD +   A
Sbjct  153   EYIKKINEAVGRNRTTMIVSKSIYIVCVGSDDIANTYYQSPFRSAEYDIPSYTDFMASEA  212

Query  731   SNFLQELYSLGARRIGFFGIPPVGCLPSQRTLAGGSERECVENYNQAAQLANAKFSAEIK  552
             S FLQELY LGARRIG FG+  +GC+PSQRTL GG  R C+++ NQAA L N+K ++++ 
Sbjct  213   SKFLQELYGLGARRIGVFGLSVIGCVPSQRTLGGGLNRACLDSSNQAAMLFNSKLNSQMV  272

Query  551   ILSKKLPNSKLIFIDIYEDFLDMIKNPAKYGFEVVNLGCCGTGTIEVTMLCNKLS-GTCP  375
             +L KK  +S+L+++D Y  FL M++NPAK+GFEV+  GCCGTG IEV++LCN+ S  TC 
Sbjct  273   VLGKKFSDSRLVYLDSYNGFLSMLQNPAKFGFEVIKKGCCGTGDIEVSILCNRYSINTCS  332

Query  374   DRNKYLFWDSYHPTEKGYRIIVNRIITKYINSF  276
             +   YLFWDSYHPT++ Y  + + +    I  F
Sbjct  333   NTTHYLFWDSYHPTQEAYLALSSLVFDNKIKDF  365



>gb|AES59784.2| GDSL-like lipase/acylhydrolase [Medicago truncatula]
Length=402

 Score =   380 bits (975),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 180/347 (52%), Positives = 242/347 (70%), Gaps = 1/347 (0%)
 Frame = -2

Query  1310  IIAFLVLAGCSEAKIKLPNGLVVKAVIAFGDSIVDQGMNNNLSTMIKTNFPPYGQDFMGG  1131
             +I FLV+   ++A +KL   + + AV  FGDSI D G NN   T+ + +F PYG+DF GG
Sbjct  56    LILFLVVCFETKAIVKLQPNVSIPAVFVFGDSITDTGNNNFKKTIARCDFAPYGKDFPGG  115

Query  1130  KHTGRYSNGKTPPDLVAEELGIKELVPAYLDPHLQPEDIKTGVSFASGASGYDPQTAALM  951
               TGR+SNGK P DL+ EELGIKE +P YLDP LQP ++ TGV FASG +GYD  T+ L+
Sbjct  116   IATGRFSNGKVPSDLIVEELGIKEFLPPYLDPKLQPSELTTGVCFASGGAGYDDLTSKLL  175

Query  950   SVIPLSEQLKYFKEYLGKLNAMVGEKEAKSIINNTLFMVVSGSDDLANTYFTIGIRRYQY  771
             + I LS QL  FKEY+GKLNA+VGE   K II N++F V  GS+D++NTYF   +R+ +Y
Sbjct  176   TAISLSSQLDSFKEYIGKLNALVGENRTKFIIANSVFFVEFGSNDISNTYFISRVRQIKY  235

Query  770   -DINSYTDLLLEGASNFLQELYSLGARRIGFFGIPPVGCLPSQRTLAGGSERECVENYNQ  594
              + +SY D L+  ASNF +E+Y LGARRIG F +PP+GC+P QRTLAGG ER+CVE  + 
Sbjct  236   PEFSSYADFLVSLASNFTKEIYKLGARRIGIFNVPPLGCVPMQRTLAGGFERKCVEKISN  295

Query  593   AAQLANAKFSAEIKILSKKLPNSKLIFIDIYEDFLDMIKNPAKYGFEVVNLGCCGTGTIE  414
             A  L N K S EI  L + L NS+++++D+Y    D+I N  KYGF   + GCCGTG +E
Sbjct  296   ATMLYNDKLSKEIDSLKQNLSNSRIVYLDVYSPIQDVIANEQKYGFLNADRGCCGTGRVE  355

Query  413   VTMLCNKLSGTCPDRNKYLFWDSYHPTEKGYRIIVNRIITKYINSFT  273
             V  LCN+L+ TC + ++Y+FWDS+HPTE  Y+ I+  ++ KY+N F 
Sbjct  356   VAFLCNRLAHTCSNDSEYVFWDSFHPTEAMYKRIIVPLLQKYMNQFV  402



>ref|XP_006574669.1| PREDICTED: GDSL esterase/lipase EXL3-like [Glycine max]
Length=365

 Score =   378 bits (970),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 174/333 (52%), Positives = 241/333 (72%), Gaps = 2/333 (1%)
 Frame = -2

Query  1268  IKLPNGLVVKAVIAFGDSIVDQGMNNNLSTMIKTNFPPYGQDFMGGKH-TGRYSNGKTPP  1092
             + LPN   V AVI FGDSIVD G N+ ++T++K NF PYG+DF GG   TGR+SNG  P 
Sbjct  32    VSLPNNETVPAVIVFGDSIVDTGNNDYITTLVKCNFQPYGRDFGGGNQPTGRFSNGLVPS  91

Query  1091  DLVAEELGIKELVPAYLDPHLQPEDIKTGVSFASGASGYDPQTAALMSVIPLSEQLKYFK  912
             D++A + G+K+ +P YLDP+LQ +D+ TGVSFASG +G+DP TA L++V+ LS+QL  F+
Sbjct  92    DIIAAKFGVKKFLPPYLDPNLQLQDLLTGVSFASGGAGFDPLTAELVNVMSLSDQLDMFR  151

Query  911   EYLGKLNAMVGEKEAKSIINNTLFMVVSGSDDLANTYFTIGIRRYQYDINSYTDLLLEGA  732
             EY  K+N  VG      I++ ++++V  GSDD+ANTY  +  R  +YDI SYTDL+   A
Sbjct  152   EYTRKINEAVGRNRTAMIVSKSIYIVCVGSDDIANTYSQLPFRSAEYDIPSYTDLMASEA  211

Query  731   SNFLQELYSLGARRIGFFGIPPVGCLPSQRTLAGGSERECVENYNQAAQLANAKFSAEIK  552
             SNFLQ+LY LGARRIG FG+P +GC+PSQRTL G   R C+++ NQAA L N+K S ++ 
Sbjct  212   SNFLQKLYGLGARRIGVFGLPVIGCVPSQRTLGGSLNRACLDSSNQAAMLFNSKLSTQMV  271

Query  551   ILSKKLPNSKLIFIDIYEDFLDMIKNPAKYGFEVVNLGCCGTGTIEVTMLCNKLS-GTCP  375
             +L KK  +S+L+++D Y   L+M++NPAKYGFEV + GCCGTG IEV++LCN+ S  TC 
Sbjct  272   VLGKKFSDSRLVYLDSYNGLLNMLQNPAKYGFEVTDRGCCGTGNIEVSLLCNRYSIDTCS  331

Query  374   DRNKYLFWDSYHPTEKGYRIIVNRIITKYINSF  276
             + + Y+FWDSYHPT+K Y ++ + ++   I  F
Sbjct  332   NSSNYIFWDSYHPTQKAYNVLSSLVLDNKIKDF  364



>ref|XP_007223323.1| hypothetical protein PRUPE_ppa009528mg [Prunus persica]
 gb|EMJ24522.1| hypothetical protein PRUPE_ppa009528mg [Prunus persica]
Length=288

 Score =   375 bits (963),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 175/285 (61%), Positives = 222/285 (78%), Gaps = 2/285 (1%)
 Frame = -2

Query  1124  TGRYSNGKTPPDLVAEELGIKELVPAYLDPHLQPEDIKTGVSFASGASGYDPQTAALMSV  945
             TGRYSNGK P DL+ E LGIKEL+PAYLDP LQP+D+ TGV  A+G +GYDP TA +  V
Sbjct  3     TGRYSNGKVPSDLIVEALGIKELLPAYLDPTLQPKDLLTGVVIAAGGAGYDPLTAQVAGV  62

Query  944   IPLSEQLKYFKEYLGKLNAMVGEKEAKSIINNTLFMVVSGSDDLANTYFTIGIRRYQYDI  765
               LS+QLK FKEY+ KL A+ GE+ A  II+N+L  VV+G++D++NTYF  G+R+ +YD+
Sbjct  63    ASLSDQLKQFKEYIKKLKAIAGEERANFIISNSLIFVVAGTNDISNTYFLTGLRKLEYDV  122

Query  764   NSYTDLLLEGASNFLQELYSLGARRIGFFGIPPVGCLPSQRTLAGGSERECVENYNQAAQ  585
              SYTDL+L  AS F+++LY LG RRIG    PP+GC+PSQRT+AGG  REC E  NQA+Q
Sbjct  123   PSYTDLMLNYASVFVKDLYGLGVRRIGVLNTPPIGCVPSQRTVAGGVLRECDEKQNQASQ  182

Query  584   LANAKFSAEIKILSKKLPNSKLIFIDIYEDFLDMIKNPAKYGFEVVNLGCCGTGTIEVTM  405
             L N+K SAE+  L+K LPNS++++IDIY   LD+I NP+KYGFEVVN GCCGTG IEVT 
Sbjct  183   LFNSKLSAEVDDLNKNLPNSRVVYIDIYNPLLDLINNPSKYGFEVVNKGCCGTGIIEVTK  242

Query  404   LCNKL--SGTCPDRNKYLFWDSYHPTEKGYRIIVNRIITKYINSF  276
             LCN++  +GTC D +KY+FWDSYHPTE+ Y+IIV  I+ KYIN F
Sbjct  243   LCNQIQPAGTCSDDSKYVFWDSYHPTERAYKIIVQHILDKYINFF  287



>gb|KFK42027.1| hypothetical protein AALP_AA2G202600 [Arabis alpina]
Length=367

 Score =   378 bits (970),  Expect = 4e-124, Method: Compositional matrix adjust.
 Identities = 182/348 (52%), Positives = 245/348 (70%), Gaps = 4/348 (1%)
 Frame = -2

Query  1313  CIIAF-LVLAGCSEAKIKLPNGLVVKAVIAFGDSIVDQGMNNNLSTMIKTNFPPYGQDFM  1137
             CI+   L+    + A + +P+ + V AVI FGDSIVD G N+++ T  + N+PPYG DF 
Sbjct  21    CILVLELLFMTTTNALVNIPDNISVPAVIVFGDSIVDAGNNDDMITEARCNYPPYGIDFD  80

Query  1136  GGKHTGRYSNGKTPPDLVAEELGIKELVPAYLDPHLQPEDIKTGVSFASGASGYDPQTAA  957
             GG  TGR+SNGK P D++AEELGIK  +PAY DP+L+ E++ TGV+FASG +GY P T  
Sbjct  81    GGVPTGRFSNGKVPTDMLAEELGIKPTLPAYRDPNLKQEELLTGVTFASGGAGYVPLTTK  140

Query  956   LMSVIPLSEQLKYFKEYLGKLNAMVGEKEAKSIINNTLFMVVSGSDDLANTYFTIGIRRY  777
             +   I L +QLK F EYL +L  MVGE+  K II N+LF+V+ GS+D+AN +F   + ++
Sbjct  141   IAGGISLPQQLKLFDEYLERLKGMVGEERTKIIIENSLFVVICGSNDIANNFF--ALPQF  198

Query  776   QYDINSYTDLLLEGASNFLQELYSLGARRIGFFGIPPVGCLPSQRTLAGGSERECVENYN  597
             +YD+ S+T L+ + A +F   LY  GARRI  FG PP+GC+PSQRT+AGG  RECV  +N
Sbjct  199   KYDVASFTALMADNARSFATTLYGYGARRILVFGAPPLGCVPSQRTVAGGPRRECVVRFN  258

Query  596   QAAQLANAKFSAEIKILSKKLPNSKLIFIDIYEDFLDMIKNPAKYGFEVVNLGCCGTGTI  417
              A +L N K SA I  LS+ L +S L++IDIY   LD+I NP +YGF+V N GCCGTG I
Sbjct  259   DACKLFNTKLSANIDGLSRTLHDSTLLYIDIYTPLLDLILNPQQYGFKVSNKGCCGTGLI  318

Query  416   EVTMLCNKLSGT-CPDRNKYLFWDSYHPTEKGYRIIVNRIITKYINSF  276
             EVT LCN  + T CP R+ Y+FWDS+HPTE+ YRIIV +++ +Y+N F
Sbjct  319   EVTQLCNNYTATVCPRRSDYVFWDSFHPTERAYRIIVAKLLERYLNRF  366



>ref|XP_010934102.1| PREDICTED: GDSL esterase/lipase EXL3-like [Elaeis guineensis]
Length=359

 Score =   377 bits (969),  Expect = 4e-124, Method: Compositional matrix adjust.
 Identities = 180/331 (54%), Positives = 234/331 (71%), Gaps = 2/331 (1%)
 Frame = -2

Query  1277  EAKIKLPNGLVVKAVIAFGDSIVDQGMNNNLSTMIKTNFPPYGQDFMGGKHTGRYSNGKT  1098
               + K  N     A+I FGDSIVD G NN + T ++ NFPPYG+DF+  K TGR+SNGK 
Sbjct  25    RGQAKATNRSRAPALIVFGDSIVDPGNNNEILTTVRCNFPPYGKDFVEHKATGRFSNGKI  84

Query  1097  PPDLVAEELGIKELVPAYLDPHLQPEDIKTGVSFASGASGYDPQTAALMSVIPLSEQLKY  918
             P D++A  +GIK+ VPAYL   L  +D+ TGVSFASG  GYDP TA L+  + L EQL  
Sbjct  85    PSDIIASLIGIKQYVPAYLGTRLDDQDLLTGVSFASGGGGYDPLTAELVQALTLDEQLNL  144

Query  917   FKEYLGKLNAMVGEKEAKSIINNTLFMVVSGSDDLANTYFTIGIRRYQYDINSYTDLLLE  738
             FK+Y  KL A+ GEK A +II+ +L++V +G+DDLANTYFT   RR  YD++SY   +++
Sbjct  145   FKDYKKKLKAIAGEKRASTIISRSLYIVATGNDDLANTYFTSPFRR-NYDLSSYIKFVVQ  203

Query  737   GASNFLQELYSLGARRIGFFGIPPVGCLPSQRTLAGGSERECVENYNQAAQLANAKFSAE  558
              AS+F Q+LY LGARRIG  G+PPVGCLPSQR+LAGG ERECV  YNQAAQ  N++   E
Sbjct  204   SASSFFQKLYHLGARRIGITGLPPVGCLPSQRSLAGGIERECVPLYNQAAQTLNSELQME  263

Query  557   IKILSKKLPNSKLIFIDIYEDFLDMIKNPAKYGFEVVNLGCCGTGTIEVTMLCNKLSG-T  381
             I+ L++ LP S++++IDIY   LDMI+ P  YGFE V  GCCGTG  EVT+ CN  +   
Sbjct  264   IQRLNRTLPGSRIVYIDIYTPLLDMIQRPYVYGFEEVKRGCCGTGIFEVTLTCNSYTAPA  323

Query  380   CPDRNKYLFWDSYHPTEKGYRIIVNRIITKY  288
             C D +KYLFWD YHPTE+ Y I++ +++ +Y
Sbjct  324   CGDVSKYLFWDVYHPTERAYTILMTQVLQRY  354



>ref|XP_004287786.1| PREDICTED: GDSL esterase/lipase EXL3-like [Fragaria vesca subsp. 
vesca]
Length=361

 Score =   377 bits (969),  Expect = 4e-124, Method: Compositional matrix adjust.
 Identities = 183/343 (53%), Positives = 242/343 (71%), Gaps = 3/343 (1%)
 Frame = -2

Query  1310  IIAFLVLAGCSEAKIKLPNGLVVKAVIAFGDSIVDQGMNNNLSTMIKTNFPPYGQDFMGG  1131
             I+ F++    S A + LP  + + AVI +GDSIVD G NN ++T++K NF PYG D+ GG
Sbjct  17    IVTFIIYH--SAAALTLPKNVTIPAVIVWGDSIVDPGNNNVVNTIVKCNFEPYGMDYNGG  74

Query  1130  KHTGRYSNGKTPPDLVAEELGIKELVPAYLDPHLQPEDIKTGVSFASGASGYDPQTAALM  951
             + TGR+SNG+ P DL+AEELGIK+++PAYLDP+LQ ED+ TGVSFASG SGYDP T  ++
Sbjct  75    EPTGRFSNGRVPSDLIAEELGIKKILPAYLDPNLQTEDLLTGVSFASGGSGYDPLTPKIV  134

Query  950   SVIPLSEQLKYFKEYLGKLNAMVGEKEAKSIINNTLFMVVSGSDDLANTYFTIGIRRYQY  771
             +V+ LS+Q++ FKEY  K++A VG      I++  + +V  GSDD+ANTY +   R   Y
Sbjct  135   NVLSLSDQIELFKEYKSKIDAAVGVARRNIIVSKGIHIVCIGSDDIANTYLSTPFRSPHY  194

Query  770   DINSYTDLLLEGASNFLQELYSLGARRIGFFGIPPVGCLPSQRTLAGGSERECVENYNQA  591
             DI +YTDLL   AS F Q LY  GAR+IG  GIP +GC+PSQRTL+G  +R C    N+A
Sbjct  195   DIPAYTDLLASSASKFFQALYGQGARKIGVVGIPAIGCVPSQRTLSGDIKRGCSAKANKA  254

Query  590   AQLANAKFSAEIKILSKKLPNSKLIFIDIYEDFLDMIKNPAKYGFEVVNLGCCGTGTIEV  411
             A L N K  A ++ L+KKLP +K ++ DIY   + +I+NP+KYGFEVVN GCCGTG IEV
Sbjct  255   ASLFNTKLIALLESLNKKLPQAKFVYFDIYNPSVSLIQNPSKYGFEVVNKGCCGTGNIEV  314

Query  410   TMLCNKLS-GTCPDRNKYLFWDSYHPTEKGYRIIVNRIITKYI  285
             ++LC + S GTC D +KY+FWDSYHPTEK Y  +V     K I
Sbjct  315   SILCTRFSLGTCSDPSKYIFWDSYHPTEKAYETLVPMAFDKEI  357



>gb|KHN00457.1| GDSL esterase/lipase EXL3 [Glycine soja]
Length=365

 Score =   377 bits (969),  Expect = 5e-124, Method: Compositional matrix adjust.
 Identities = 173/333 (52%), Positives = 241/333 (72%), Gaps = 2/333 (1%)
 Frame = -2

Query  1268  IKLPNGLVVKAVIAFGDSIVDQGMNNNLSTMIKTNFPPYGQDFMGGKH-TGRYSNGKTPP  1092
             + LPN   V AV+ FGDSIVD G N+ ++T++K NF PYG+DF GG   TGR+SNG  P 
Sbjct  32    VSLPNNETVPAVVVFGDSIVDTGNNDYITTLVKCNFQPYGRDFGGGNQPTGRFSNGLVPS  91

Query  1091  DLVAEELGIKELVPAYLDPHLQPEDIKTGVSFASGASGYDPQTAALMSVIPLSEQLKYFK  912
             D++A + G+K+ +P YLDP+LQ +D+ TGVSFASG +G+DP TA L++V+ LS+QL  F+
Sbjct  92    DIIAAKFGVKKFLPPYLDPNLQLQDLLTGVSFASGGAGFDPLTAELVNVMSLSDQLDMFR  151

Query  911   EYLGKLNAMVGEKEAKSIINNTLFMVVSGSDDLANTYFTIGIRRYQYDINSYTDLLLEGA  732
             EY  K+N  VG      I++ ++++V  GSDD+ANTY  +  R  +YDI SYTDL+   A
Sbjct  152   EYTRKINEAVGRNRTAMIVSKSIYIVCVGSDDIANTYSQLPFRSAEYDIPSYTDLMASEA  211

Query  731   SNFLQELYSLGARRIGFFGIPPVGCLPSQRTLAGGSERECVENYNQAAQLANAKFSAEIK  552
             SNFLQ+LY LGARRIG FG+P +GC+PSQRTL G   R C+++ NQAA L N+K S ++ 
Sbjct  212   SNFLQKLYGLGARRIGVFGLPVIGCVPSQRTLGGSLNRACLDSSNQAAMLFNSKLSTQMV  271

Query  551   ILSKKLPNSKLIFIDIYEDFLDMIKNPAKYGFEVVNLGCCGTGTIEVTMLCNKLS-GTCP  375
             +L KK  +S+L+++D Y   L+M++NPAKYGFEV + GCCGTG IEV++LCN+ S  TC 
Sbjct  272   VLGKKFSDSRLVYLDSYNGLLNMLQNPAKYGFEVTDRGCCGTGNIEVSLLCNRYSIDTCS  331

Query  374   DRNKYLFWDSYHPTEKGYRIIVNRIITKYINSF  276
             + + Y+FWDSYHPT+K Y ++ + ++   I  F
Sbjct  332   NSSNYIFWDSYHPTQKAYNVLSSLVLDNKIKDF  364



>ref|XP_010416497.1| PREDICTED: GDSL esterase/lipase EXL1-like [Camelina sativa]
Length=374

 Score =   378 bits (970),  Expect = 6e-124, Method: Compositional matrix adjust.
 Identities = 183/342 (54%), Positives = 237/342 (69%), Gaps = 1/342 (0%)
 Frame = -2

Query  1298  LVLAGCSEAKIKLPNGLVVKAVIAFGDSIVDQGMNNNLSTMIKTNFPPYGQDFMGGKHTG  1119
             L+    + A +KLP    V AVI FGDSIVD G N+++ T  + ++ PYG DF GG  TG
Sbjct  32    LLFTTTTHALVKLPENTTVPAVIVFGDSIVDAGNNDDMITEARCDYAPYGIDFDGGVATG  91

Query  1118  RYSNGKTPPDLVAEELGIKELVPAYLDPHLQPEDIKTGVSFASGASGYDPQTAALMSVIP  939
             R+SNGK P D+VAEELGIK  +PAY DP+L+PED+ TGV+FASG +GY P T  L   IP
Sbjct  92    RFSNGKVPGDIVAEELGIKPNIPAYRDPNLKPEDLLTGVTFASGGAGYVPLTTKLAGGIP  151

Query  938   LSEQLKYFKEYLGKLNAMVGEKEAKSIINNTLFMVVSGSDDLANTYFTIGIRRYQYDINS  759
             L  QLKYF+EY  +L AMVGE+  + II N+LF+VV GS+D+AN +F +   +  Y + S
Sbjct  152   LPLQLKYFEEYRARLKAMVGEERTQFIIKNSLFVVVCGSNDIANNFFALPPVQLHYTVAS  211

Query  758   YTDLLLEGASNFLQELYSLGARRIGFFGIPPVGCLPSQRTLAGGSERECVENYNQAAQLA  579
             +T L+   A +F Q LY  GARRI  FG PP+GC+PSQRT+AGG  R+CV  +N A++L 
Sbjct  212   FTALMANNARSFAQTLYGYGARRILVFGAPPIGCVPSQRTVAGGPTRDCVARFNDASKLF  271

Query  578   NAKFSAEIKILSKKLPNSKLIFIDIYEDFLDMIKNPAKYGFEVVNLGCCGTGTIEVTMLC  399
             N+K SA I  LS+ L +  +I IDIY   LD+I NP +YGF+V + GCCGTG IEVT LC
Sbjct  272   NSKLSANIDALSRTLQDPTIICIDIYSPLLDLILNPQQYGFKVGDKGCCGTGLIEVTALC  331

Query  398   NKLS-GTCPDRNKYLFWDSYHPTEKGYRIIVNRIITKYINSF  276
             N  +   CP R+ Y+FWDS+HPTEK YRIIV ++  KY + F
Sbjct  332   NNYTAAVCPIRSDYVFWDSFHPTEKAYRIIVAKLFDKYFDRF  373



>gb|AAF79815.1|AC007396_8 T4O12.13 [Arabidopsis thaliana]
Length=730

 Score =   389 bits (1000),  Expect = 7e-124, Method: Compositional matrix adjust.
 Identities = 185/333 (56%), Positives = 248/333 (74%), Gaps = 3/333 (1%)
 Frame = -2

Query  1313  CIIAFLVLAGCSEAKIKLPNGLVVKAVIAFGDSIVDQGMNNNLSTMIKTNFPPYGQDFMG  1134
             C+++ L L     A +KLP  L++ AVIAFGDSIVD GMNNN+ T++K +F PYG +F  
Sbjct  68    CLLSVLFLTETITA-VKLPPKLIIPAVIAFGDSIVDTGMNNNVKTVVKCDFLPYGINFQS  126

Query  1133  GKHTGRYSNGKTPPDLVAEELGIKELVPAYLDPHLQPEDIKTGVSFASGASGYDPQTAAL  954
             G  TGR+ +G+ P DL+AEELGIK +VPAYLDP+L+ +D+ TGVSFASG SGYDP T  L
Sbjct  127   GVATGRFCDGRVPADLLAEELGIKSIVPAYLDPNLKSKDLLTGVSFASGGSGYDPITPKL  186

Query  953   MSVIPLSEQLKYFKEYLGKLNAMVGEKEAKSIINNTLFMVVSGSDDLANTYFTIGIRRYQ  774
             ++VI L +QL YF+EY+ K+  +VGE     I+ N+LF++V+GSDD+ANTY+T+  R  +
Sbjct  187   VAVISLEDQLSYFEEYIEKVKNIVGEARKDFIVANSLFLLVAGSDDIANTYYTLRARP-E  245

Query  773   YDINSYTDLLLEGASNFLQELYSLGARRIGFFGIPPVGCLPSQRTLAGGSERECVENYNQ  594
             YD++SYT L+ + AS F+ +LY  G RR+  FG PP+GC+PSQRTL GG  R+C +NYN+
Sbjct  246   YDVDSYTTLMSDSASEFVTKLYGYGVRRVAVFGAPPIGCVPSQRTLGGGILRDCADNYNE  305

Query  593   AAQLANAKFSAEIKILSKKLPNSKLIFIDIYEDFLDMIKNPAKYGFEVVNLGCCGTGTIE  414
             AA+L N+K S ++  L K LP  K I+I+IY+   D+I+NPA YGFEV N GCCGTG IE
Sbjct  306   AAKLFNSKLSPKLDSLRKTLPGIKPIYINIYDPLFDIIQNPANYGFEVSNKGCCGTGAIE  365

Query  413   VTMLCNKL-SGTCPDRNKYLFWDSYHPTEKGYR  318
             V +LCNK+ S  CPD + ++FWDSYHPTEK Y+
Sbjct  366   VAVLCNKITSSVCPDVSTHVFWDSYHPTEKTYK  398


 Score =   222 bits (566),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 120/317 (38%), Positives = 178/317 (56%), Gaps = 12/317 (4%)
 Frame = -2

Query  1238  AVIAFGDSIVDQGMNNNLSTMIKTNFPPYGQDFMGGKHTGRYSNGKTPPDLVAEELGIKE  1059
             A++AFGDSI+D G NN L T +K N  PYG+ F   + TGR+ NG+   D+VAE LGIK+
Sbjct  415   ALLAFGDSILDTGNNNFLLTFMKGNIWPYGRSFSMRRATGRFGNGRVFSDIVAEGLGIKK  474

Query  1058  LVPAYLDPHLQPEDIKTGVSFASGASGYDPQTAALMSVIPLSEQLKYFKEYLGKLNAMVG  879
             ++PAY      P D++TGV FASG +G DP T+ L+ V+   +Q+  FK Y+ KL A  G
Sbjct  475   ILPAYRKLFNSPSDLRTGVCFASGGAGVDPVTSKLLRVLTPKDQVNDFKGYIRKLKATAG  534

Query  878   EKEAKSIINNTLFMVVSGSDDLANTYFTIGIRRYQ-YDINSYTDLLLEGASNFLQELYSL  702
                A SI++N + +V  G++D+  +YF      ++    N YT  L      F++ELY  
Sbjct  535   PSRASSIVSNAVILVSQGNNDIGISYFGTPTAAFRGLTPNRYTTKLAGWNKQFMKELYDQ  594

Query  701   GARRIGFFGIPPVGCLPSQRTLAGGSERECVENYNQAAQLANAKFSAEIKILSKK--LPN  528
             GAR+    G+ P+GCLP  R   GG    C    N+ A+  N K  +  K   ++     
Sbjct  595   GARKFAVMGVIPLGCLPMTRIFLGGFVITCNFFANRVAEQYNGKLRSGTKSWGREAGFRG  654

Query  527   SKLIFIDIYEDFLDMIKNPAKYGFEVVNLGCCGTGTIEVTMLCNKLSGTCPDRNKYLFWD  348
             +K +++D+Y   +D+IKN  +YGF     GCC   T  +          CP+ +KY+F+D
Sbjct  655   AKFVYVDMYNTLMDVIKNYRRYGFSNEKNGCCCMITAII---------PCPNPDKYVFYD  705

Query  347   SYHPTEKGYRIIVNRII  297
               HP+EK YR I  +++
Sbjct  706   FVHPSEKAYRTISKKLV  722



>ref|XP_010428638.1| PREDICTED: GDSL esterase/lipase EXL1-like [Camelina sativa]
Length=374

 Score =   377 bits (969),  Expect = 8e-124, Method: Compositional matrix adjust.
 Identities = 180/342 (53%), Positives = 240/342 (70%), Gaps = 1/342 (0%)
 Frame = -2

Query  1298  LVLAGCSEAKIKLPNGLVVKAVIAFGDSIVDQGMNNNLSTMIKTNFPPYGQDFMGGKHTG  1119
             L+    + A +KLP    V AVI FGDSIVD G N+++ T  + ++ PYG DF GG  TG
Sbjct  32    LLFTTTTHALVKLPENTTVPAVIVFGDSIVDAGNNDDMITEARCDYAPYGIDFDGGVATG  91

Query  1118  RYSNGKTPPDLVAEELGIKELVPAYLDPHLQPEDIKTGVSFASGASGYDPQTAALMSVIP  939
             R+SNGK P D++AEELGIK  +PAY DP+L+PED+ TGV+FASG +GY P T  L   I 
Sbjct  92    RFSNGKVPGDILAEELGIKPNIPAYRDPNLKPEDLLTGVTFASGGAGYVPLTTKLAGGIS  151

Query  938   LSEQLKYFKEYLGKLNAMVGEKEAKSIINNTLFMVVSGSDDLANTYFTIGIRRYQYDINS  759
             L +QLKYF+EY+ +L AMVGE+  + II N+LF+VV GS+D+AN +F +   +  Y ++S
Sbjct  152   LPQQLKYFEEYIARLKAMVGEERTQFIIKNSLFVVVCGSNDIANDFFALPPVQLHYTVDS  211

Query  758   YTDLLLEGASNFLQELYSLGARRIGFFGIPPVGCLPSQRTLAGGSERECVENYNQAAQLA  579
             +T L+ + A +F Q LY  GARRI  FG PP+GC+PSQRT+AGG  R+CV  +N A++L 
Sbjct  212   FTALMADNARSFAQTLYGYGARRILVFGAPPIGCVPSQRTVAGGPTRDCVAKFNDASKLF  271

Query  578   NAKFSAEIKILSKKLPNSKLIFIDIYEDFLDMIKNPAKYGFEVVNLGCCGTGTIEVTMLC  399
             N+K SA I  LS  L +  +I+IDIY   LD+I +P +YGF+V + GCCGTG IEVT LC
Sbjct  272   NSKLSANIDALSTTLQDPTIIYIDIYSPLLDLILSPQQYGFKVGDKGCCGTGLIEVTALC  331

Query  398   NKLS-GTCPDRNKYLFWDSYHPTEKGYRIIVNRIITKYINSF  276
             N  +   CP R+ Y+FWDS+HPTEK YRIIV ++  KY + F
Sbjct  332   NNYTAAVCPIRSDYVFWDSFHPTEKAYRIIVAKLFDKYFDRF  373



>ref|XP_010026062.1| PREDICTED: GDSL esterase/lipase At5g42170-like [Eucalyptus grandis]
 gb|KCW58231.1| hypothetical protein EUGRSUZ_H00933 [Eucalyptus grandis]
Length=343

 Score =   376 bits (965),  Expect = 9e-124, Method: Compositional matrix adjust.
 Identities = 174/332 (52%), Positives = 242/332 (73%), Gaps = 1/332 (0%)
 Frame = -2

Query  1277  EAKIKLPNGLVVKAVIAFGDSIVDQGMNNNLSTMIKTNFPPYGQDFMGGKHTGRYSNGKT  1098
             +A +  P    + AV  FGDSI+D G NNNL T++K+NF PYG+DFMGGK TGR+SNGK 
Sbjct  7     QAAVVAPENATISAVFMFGDSILDTGNNNNLFTLVKSNFLPYGRDFMGGKPTGRFSNGKI  66

Query  1097  PPDLVAEELGIKELVPAYLDPHLQPEDIKTGVSFASGASGYDPQTAALMSVIPLSEQLKY  918
             P D++A++LGIKEL+PA+LDP+L+ +D+  GV+FAS  +G++P T+ L+SVIP+S QL+ 
Sbjct  67    PSDILAQQLGIKELLPAFLDPNLRLQDLIGGVNFASAGAGFNPLTSELVSVIPMSRQLQL  126

Query  917   FKEYLGKLNAMVGEKEAKSIINNTLFMVVSGSDDLANTYFTIGIRRYQYDINSYTDLLLE  738
             F EY  KL + +GE+ A S+I N L++V +GS+D+ANTYF    R + Y ++SYT+LL  
Sbjct  127   FDEYKMKLKSFIGEERADSVIANGLYVVSAGSNDIANTYFHTLTRLFDYSVSSYTELLAR  186

Query  737   GASNFLQELYSLGARRIGFFGIPPVGCLPSQRTLAGGSERECVENYNQAAQLANAKFSAE  558
              AS+FLQEL++ GARRIG F + P+GC PS RTLAGG ER C E+YNQ AQL NAK + E
Sbjct  187   LASSFLQELHTKGARRIGLFSLAPLGCTPSMRTLAGGIERRCAEDYNQMAQLLNAKLTLE  246

Query  557   IKILSKKLPNSKLIFIDIYEDFLDMIKNPAKYGFEVVNLGCCGTGTIEVTMLCNKLS-GT  381
             +  L+   P +++  IDIY   LD++KNP KYGFE+ + GCCG G IE   +CN+ +  T
Sbjct  247   LHRLNGAFPRARMALIDIYGPLLDIMKNPRKYGFEISDRGCCGLGLIEAAFMCNQWNLLT  306

Query  380   CPDRNKYLFWDSYHPTEKGYRIIVNRIITKYI  285
             C + + Y+FWDS+HPTE  Y I+V+ ++ K +
Sbjct  307   CSNVSGYVFWDSFHPTENVYNILVHGLLGKVL  338



>ref|XP_007160642.1| hypothetical protein PHAVU_001G004600g [Phaseolus vulgaris]
 gb|ESW32636.1| hypothetical protein PHAVU_001G004600g [Phaseolus vulgaris]
Length=370

 Score =   377 bits (967),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 186/346 (54%), Positives = 240/346 (69%), Gaps = 5/346 (1%)
 Frame = -2

Query  1307  IAFLVLAGC-SEAKIKLPNGLVVKAVIAFGDSIVDQGMNNNLST-MIKTNFPPYGQDFMG  1134
             I  L+   C +E  +KLP  + V AV  FGDS+VD G NNN +T   ++NFPPYG+DF G
Sbjct  27    ILLLLFVCCKTEGLLKLPPNVSVPAVFVFGDSVVDTGNNNNRTTSFARSNFPPYGRDFQG  86

Query  1133  GKHTGRYSNGKTPPDLVAEELGIKELVPAYLDPHLQPEDIKTGVSFASGASGYDPQTAAL  954
             G  TGR+SNGK P DL+ EELGIKE +P YL P+LQP D+ TGV FASG SGYDP T+ +
Sbjct  87    GIPTGRFSNGKVPSDLIVEELGIKEFLPPYLKPNLQPSDLVTGVCFASGGSGYDPLTSVI  146

Query  953   MSVIPLSEQLKYFKEYLGKLNAMVGEKEAKSIINNTLFMVVSGSDDLANTYFTIGIRRYQ  774
                IP+S QL  FKEY+GKL  +VGE+ AK I+ N+LF+VV+GS D++NTY T   R   
Sbjct  147   EGSIPVSGQLDLFKEYIGKLKGVVGEERAKFILANSLFIVVAGSSDISNTYRT---RSLL  203

Query  773   YDINSYTDLLLEGASNFLQELYSLGARRIGFFGIPPVGCLPSQRTLAGGSERECVENYNQ  594
             YD+ SY+DLLL  AS FL EL  LGARRI  F  PP+GCLP QRT+ GG E++C +  N 
Sbjct  204   YDLPSYSDLLLNSASKFLTELNELGARRIAVFSAPPIGCLPFQRTVGGGIEKKCAQRPNN  263

Query  593   AAQLANAKFSAEIKILSKKLPNSKLIFIDIYEDFLDMIKNPAKYGFEVVNLGCCGTGTIE  414
              AQL N K S  +  L++  PNS+ +FI+IY+  LD+I N  KYG++V + GCCGTG IE
Sbjct  264   LAQLFNTKLSNLLHSLNRNFPNSRNVFINIYDPLLDIILNYQKYGYKVGDTGCCGTGRIE  323

Query  413   VTMLCNKLSGTCPDRNKYLFWDSYHPTEKGYRIIVNRIITKYINSF  276
             V +LCN L  TC + + Y+FWDS+HPTE  Y+ ++  I+ KY+  F
Sbjct  324   VAILCNSLDSTCSNVHDYVFWDSFHPTESVYKRLIAPILQKYLYQF  369



>emb|CDX87652.1| BnaA07g32210D [Brassica napus]
Length=363

 Score =   376 bits (966),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 179/347 (52%), Positives = 249/347 (72%), Gaps = 3/347 (1%)
 Frame = -2

Query  1313  CIIAFLVLA-GCSEAKIKLPNGLVVKAVIAFGDSIVDQGMNNNLSTMI-KTNFPPYGQDF  1140
             C++  ++L+   + A +KLP    + A+I FGDSIVD G N++++T + + N+PPYG DF
Sbjct  14    CVLFMVLLSETITNALVKLPANKTIPAIIVFGDSIVDAGNNDDITTTLARCNYPPYGIDF  73

Query  1139  MGGKHTGRYSNGKTPPDLVAEELGIKELVPAYLDPHLQPEDIKTGVSFASGASGYDPQTA  960
              GG  TGR+SNGK P D +AE LGIK  VPAY DP L+PED+ TGV+FASG +GY P T+
Sbjct  74    DGGIPTGRFSNGKVPTDFIAEGLGIKPSVPAYRDPTLKPEDLLTGVTFASGGAGYVPLTS  133

Query  959   ALMSVIPLSEQLKYFKEYLGKLNAMVGEKEAKSIINNTLFMVVSGSDDLANTYFTIGIRR  780
              L   I LS+QLK F+EY+ KLN MVGE+  K I+ N+LFMV+ GS+D+ANTYF +   +
Sbjct  134   QLSGGISLSQQLKLFEEYIEKLNEMVGEERTKFIMQNSLFMVICGSNDIANTYFALPSVQ  193

Query  779   YQYDINSYTDLLLEGASNFLQELYSLGARRIGFFGIPPVGCLPSQRTLAGGSERECVENY  600
              QY+++S+T L+ + A +F Q+L+  GARRI  FG+PP+GC+PSQRT+AGG  R CV  +
Sbjct  194   RQYNVDSFTTLMADKAQSFAQKLHEYGARRIQVFGVPPLGCVPSQRTVAGGPTRSCVGRF  253

Query  599   NQAAQLANAKFSAEIKILSKKLPNSKLIFIDIYEDFLDMIKNPAKYGFEVVNLGCCGTGT  420
             N A +L NAK SA +  LS+ L  + LI+IDIY   LD+I +P +YGF+VV+ GCCGTG 
Sbjct  254   NDATKLYNAKLSANLDSLSRNLRENTLIYIDIYGSLLDIILDPQQYGFQVVDRGCCGTGL  313

Query  419   IEVTMLCNKLSG-TCPDRNKYLFWDSYHPTEKGYRIIVNRIITKYIN  282
             IEV +LCN  +   CP+R+ ++FWDS+HPTEK Y+I+  +   + +N
Sbjct  314   IEVAVLCNNFTADICPNRHDHVFWDSFHPTEKTYKIMTAKYFERVLN  360



>ref|XP_004499292.1| PREDICTED: GDSL esterase/lipase EXL1-like [Cicer arietinum]
Length=363

 Score =   375 bits (962),  Expect = 6e-123, Method: Compositional matrix adjust.
 Identities = 176/346 (51%), Positives = 243/346 (70%), Gaps = 0/346 (0%)
 Frame = -2

Query  1313  CIIAFLVLAGCSEAKIKLPNGLVVKAVIAFGDSIVDQGMNNNLSTMIKTNFPPYGQDFMG  1134
             C+   LV+   + A +KLP      AV  FGDSI+D G NNN++T  + N+PPYG+DF G
Sbjct  18    CLTISLVVLCKTNAALKLPPNTSFPAVFVFGDSIMDTGNNNNMTTPSRCNYPPYGKDFQG  77

Query  1133  GKHTGRYSNGKTPPDLVAEELGIKELVPAYLDPHLQPEDIKTGVSFASGASGYDPQTAAL  954
             G  TGR+ NGK P D VAEELGIKE +PAYLDP+LQP ++ TGV+FASG +GYDP T+ L
Sbjct  78    GIPTGRFGNGKVPSDFVAEELGIKEYLPAYLDPNLQPSELATGVNFASGGAGYDPLTSKL  137

Query  953   MSVIPLSEQLKYFKEYLGKLNAMVGEKEAKSIINNTLFMVVSGSDDLANTYFTIGIRRYQ  774
              + I +S QL  FK+Y+ KL  +VGE +A  I+ N+LF+VV GS+D++NTYF   +R+ +
Sbjct  138   EAAISMSGQLDLFKDYIVKLKRVVGEDKANFILANSLFLVVLGSNDISNTYFLSHLRQVE  197

Query  773   YDINSYTDLLLEGASNFLQELYSLGARRIGFFGIPPVGCLPSQRTLAGGSERECVENYNQ  594
             YD  +Y++LL+  A NF ++++ LGARRIG F  PP+GC+P QRT+AGG ER CV+ YN 
Sbjct  198   YDFPTYSNLLVNSAINFYKDIHELGARRIGVFNAPPMGCVPFQRTMAGGIERNCVQQYND  257

Query  593   AAQLANAKFSAEIKILSKKLPNSKLIFIDIYEDFLDMIKNPAKYGFEVVNLGCCGTGTIE  414
             A+ L N   S  I    ++ P+S ++++D+Y   LD+I N  KYG++V + GCCGTG IE
Sbjct  258   ASTLFNNMLSLGIHSFKERFPSSSIVYLDVYTPLLDIIINHHKYGYKVGDRGCCGTGKIE  317

Query  413   VTMLCNKLSGTCPDRNKYLFWDSYHPTEKGYRIIVNRIITKYINSF  276
             VT LC +L  TCP+   Y+FWDS+HPTE  YR +V  I+ KY+++ 
Sbjct  318   VTYLCTQLEPTCPNDLDYVFWDSFHPTESVYRKLVPPILQKYMDNL  363



>ref|XP_004499298.1| PREDICTED: GDSL esterase/lipase EXL1-like [Cicer arietinum]
Length=362

 Score =   375 bits (962),  Expect = 6e-123, Method: Compositional matrix adjust.
 Identities = 179/346 (52%), Positives = 234/346 (68%), Gaps = 2/346 (1%)
 Frame = -2

Query  1313  CIIAFLVLAGCSEAKIKLPNGLVVKAVIAFGDSIVDQGMNNNLSTMIKTNFPPYGQDFMG  1134
             C I    L   + A I+LP  + + AV+ FGDSI+D G NN + T  ++NF PYG+DF G
Sbjct  18    CTIILFCLK--TNAIIQLPPNVSIPAVLVFGDSIMDTGNNNYILTPGRSNFAPYGKDFQG  75

Query  1133  GKHTGRYSNGKTPPDLVAEELGIKELVPAYLDPHLQPEDIKTGVSFASGASGYDPQTAAL  954
             G  TGR+SNGK P DL+ EELGIKE +P YL+P+L   ++ TGV FASG +GYD  T+ L
Sbjct  76    GIATGRFSNGKVPSDLIVEELGIKEYLPPYLNPNLTFNELTTGVCFASGGAGYDHLTSQL  135

Query  953   MSVIPLSEQLKYFKEYLGKLNAMVGEKEAKSIINNTLFMVVSGSDDLANTYFTIGIRRYQ  774
                IPL++QL YFKEY+ KLN  VGE     I+ N++F +V GS+D++NTYF   +R+ +
Sbjct  136   EFAIPLTKQLDYFKEYIEKLNVYVGENRTNFILANSIFFLVMGSNDISNTYFLSHVRKLK  195

Query  773   YDINSYTDLLLEGASNFLQELYSLGARRIGFFGIPPVGCLPSQRTLAGGSERECVENYNQ  594
             YD  SY DLL+  ASNF +E+Y LGARRIG F  PP+GC+P QRTL GG ER CVE YN 
Sbjct  196   YDFPSYADLLVNIASNFTKEIYELGARRIGIFNAPPIGCVPMQRTLDGGKERSCVEKYNN  255

Query  593   AAQLANAKFSAEIKILSKKLPNSKLIFIDIYEDFLDMIKNPAKYGFEVVNLGCCGTGTIE  414
             A  L N K   EI  L++ L NSK+++ D+Y   LD+I N  KYGF V + GCCGTG +E
Sbjct  256   ATTLFNDKLFKEIGSLNQNLSNSKIVYFDVYTPLLDIIVNNHKYGFTVADRGCCGTGKVE  315

Query  413   VTMLCNKLSGTCPDRNKYLFWDSYHPTEKGYRIIVNRIITKYINSF  276
             V  LCN+   TC +  +Y+FWDS+HPTE  Y+ +V  ++ KYI  F
Sbjct  316   VAFLCNRFEDTCSNDTEYVFWDSFHPTEATYKNLVASLLQKYITQF  361



>ref|XP_003629270.1| GDSL esterase/lipase [Medicago truncatula]
 gb|AET03746.1| GDSL-like lipase/acylhydrolase [Medicago truncatula]
Length=358

 Score =   374 bits (961),  Expect = 6e-123, Method: Compositional matrix adjust.
 Identities = 180/347 (52%), Positives = 238/347 (69%), Gaps = 1/347 (0%)
 Frame = -2

Query  1313  CIIAFLVLAGCSEAKIKLPNGLVVKAVIAFGDSIVDQGMNNNLSTMIKTNFPPYGQDFMG  1134
             C    ++L   S   + LPN   V AV  FGDSIVD G NN +ST+IK +FPPYG+DF G
Sbjct  11    CSTIAIILQHVSSVSLPLPNNETVPAVFVFGDSIVDPGNNNYISTLIKCDFPPYGRDFDG  70

Query  1133  GKHTGRYSNGKTPPDLVAEELGIKELVPAYLDPHLQPEDIKTGVSFASGASGYDPQTAAL  954
             G  TGR+SNG  P DLVAE+ G+K+ +PAYLDP++Q  D+ TGVSFASG SGYDP TA +
Sbjct  71    GVPTGRFSNGLVPSDLVAEKFGVKKFLPAYLDPNIQLPDLLTGVSFASGGSGYDPLTAQI  130

Query  953   MSVIPLSEQLKYFKEYLGKLNAMVGEKEAKSIINNTLFMVVSGSDDLANTYFTIGIRRYQ  774
              SV  LS+QL  FK Y+ K++  +G +E   I++ ++++V  GSDD+ANTY     RR+Q
Sbjct  131   TSVKSLSDQLDMFKGYMKKIDEAIGREERALIVSKSIYIVCIGSDDIANTYAQTPFRRFQ  190

Query  773   YDINSYTDLLLEGASNFLQELYSLGARRIGFFGIPPVGCLPSQRTLAGGSERECVENYNQ  594
             YDI SYTD +   AS FLQELY LG RRIG F +P +GC+PSQRTL GG  REC  + NQ
Sbjct  191   YDIQSYTDFMAYEASKFLQELYRLGGRRIGVFDVPVIGCVPSQRTLGGGIFRECSNSSNQ  250

Query  593   AAQLANAKFSAEIKILSKKLPNSKLIFIDIYEDFLDMIKNPAKYGFEVVNLGCCGTGTIE  414
             AA L N+K   E++ L K+  +++ + ++ Y  F+D+I+NP+KYGF     GCCGTG IE
Sbjct  251   AAMLFNSKLFKEMRALGKEYSDARFVSLETYNPFMDIIQNPSKYGFNETEKGCCGTGNIE  310

Query  413   VTMLCNKLS-GTCPDRNKYLFWDSYHPTEKGYRIIVNRIITKYINSF  276
             V +LCN  S  TC + + Y+FWDSYHPTEK Y ++ + ++ K I  F
Sbjct  311   VGILCNPYSINTCSNPSDYVFWDSYHPTEKAYNVLSSLVLDKKIKDF  357



>ref|XP_010029654.1| PREDICTED: GDSL esterase/lipase EXL3-like [Eucalyptus grandis]
 gb|KCW56604.1| hypothetical protein EUGRSUZ_I02326 [Eucalyptus grandis]
Length=372

 Score =   374 bits (961),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 174/335 (52%), Positives = 243/335 (73%), Gaps = 2/335 (1%)
 Frame = -2

Query  1286  GCSEAKIKLPNGLVVKAVIAFGDSIVDQGMNNNLSTMIKTNFPPYGQDFMGGKHTGRYSN  1107
             G + A +  P    V AV AFGDSIVD G NN L+T+ K +FPPYG+D   G   GR+SN
Sbjct  33    GAAAASVVPPCNATVPAVFAFGDSIVDPGNNNGLATVAKCDFPPYGRDLDPGVPIGRFSN  92

Query  1106  GKTPPDLVAEELGIKELVPAYLDPHLQPEDIKTGVSFASGASGYDPQTAALMSVIPLSEQ  927
             G+ P D++AE+LG+K+ +PAYLDP+L+ +D+ TGVSFASGA+GYDP +A L  V+ LS+Q
Sbjct  93    GRVPSDMLAEKLGVKKFLPAYLDPNLELQDLLTGVSFASGANGYDPLSAKLALVLSLSDQ  152

Query  926   LKYFKEYLGKLNAMVGEKEAKSIINNTLFMVVSGSDDLANTYFTIGIRRYQYDINSYTDL  747
             L  + EY+  + + VGE+ A +I + +++MV +G++D+ NTYF   +RR++YD+ SYTDL
Sbjct  153   LDLYSEYMETVRSAVGEERASAIASESVYMVCTGANDITNTYFATPLRRFKYDVPSYTDL  212

Query  746   LLEGASNFLQELYSLGARRIGFFGIPPVGCLPSQRTLAGGSERECVENYNQAAQLANAKF  567
             L+  A +FL+ELY LGARRIG   +PPVGCLPSQRTL GG +R C  + N+AA L N+K 
Sbjct  213   LVNSALSFLRELYGLGARRIGVLSLPPVGCLPSQRTLHGGPKRGCFNSANEAAVLFNSKL  272

Query  566   SAEIKILSKKLPNSKLIFIDIYEDFLDMIKNPAKYGFEVVNLGCCGTGTIEVTMLCNKLS  387
              AEI  L K+LP ++L+++DIY   L +++ PA++GFEV   GCCGTG IEV+ LC++L 
Sbjct  273   YAEIDSLRKELPGARLVYMDIYYPLLAIMQGPAQFGFEVSTKGCCGTGNIEVSYLCSRLD  332

Query  386   G--TCPDRNKYLFWDSYHPTEKGYRIIVNRIITKY  288
                 C D  KY+FWDS+HPTE  YR++ ++I +KY
Sbjct  333   NPVMCDDDTKYVFWDSFHPTEATYRMLTDQIYSKY  367



>ref|XP_010471732.1| PREDICTED: GDSL esterase/lipase EXL1-like isoform X2 [Camelina 
sativa]
 ref|XP_010471735.1| PREDICTED: GDSL esterase/lipase EXL1-like isoform X2 [Camelina 
sativa]
 ref|XP_010471738.1| PREDICTED: GDSL esterase/lipase EXL1-like isoform X2 [Camelina 
sativa]
Length=373

 Score =   374 bits (961),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 180/342 (53%), Positives = 239/342 (70%), Gaps = 2/342 (1%)
 Frame = -2

Query  1298  LVLAGCSEAKIKLPNGLVVKAVIAFGDSIVDQGMNNNLSTMIKTNFPPYGQDFMGGKHTG  1119
             L+    + A +KLP    V AVI FGDSIVD G N+++ T  + ++ PYG DF GG  TG
Sbjct  32    LLFTTTTHALVKLPENTTVPAVIVFGDSIVDAGNNDDMITEARCDYAPYGIDFDGGVATG  91

Query  1118  RYSNGKTPPDLVAEELGIKELVPAYLDPHLQPEDIKTGVSFASGASGYDPQTAALMSVIP  939
             R+SNGK P D+V EELGIK  +PAY DP+L+PED+ TGV+FASG +GY P T  L   IP
Sbjct  92    RFSNGKVPGDIV-EELGIKPSIPAYRDPNLKPEDLLTGVTFASGGAGYVPLTTKLAGGIP  150

Query  938   LSEQLKYFKEYLGKLNAMVGEKEAKSIINNTLFMVVSGSDDLANTYFTIGIRRYQYDINS  759
             L +QLKYF++Y+ KL AMVGE+  + II N+LF+V+ GS+D+AN +F +   +  Y + S
Sbjct  151   LPQQLKYFEQYIAKLKAMVGEERTQFIIKNSLFVVICGSNDIANDFFALPPVQLHYTVAS  210

Query  758   YTDLLLEGASNFLQELYSLGARRIGFFGIPPVGCLPSQRTLAGGSERECVENYNQAAQLA  579
             +T L+ + A +F Q LY  GARRI  FG PP+GC+PSQRT+AGG  R+CV  +N A++L 
Sbjct  211   FTALMADNARSFAQTLYGYGARRILVFGAPPIGCVPSQRTVAGGPTRDCVARFNDASKLF  270

Query  578   NAKFSAEIKILSKKLPNSKLIFIDIYEDFLDMIKNPAKYGFEVVNLGCCGTGTIEVTMLC  399
             N+K SA I  LS  L +  +I+IDIY   LD+I +P +YGF+V + GCCGTG IEVT LC
Sbjct  271   NSKLSANIDALSTTLQDPTIIYIDIYSPLLDLILSPQQYGFKVGDKGCCGTGLIEVTALC  330

Query  398   NKLS-GTCPDRNKYLFWDSYHPTEKGYRIIVNRIITKYINSF  276
             N  +   CP R+ Y+FWDS+HPTEK YRIIV ++  KY + F
Sbjct  331   NNYTAAVCPIRSDYVFWDSFHPTEKAYRIIVAKLFDKYFDRF  372



>ref|XP_007160641.1| hypothetical protein PHAVU_001G004500g [Phaseolus vulgaris]
 gb|ESW32635.1| hypothetical protein PHAVU_001G004500g [Phaseolus vulgaris]
Length=374

 Score =   374 bits (959),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 177/336 (53%), Positives = 237/336 (71%), Gaps = 1/336 (0%)
 Frame = -2

Query  1280  SEAKIKLPNGLVVKAVIAFGDSIVDQGMNN-NLSTMIKTNFPPYGQDFMGGKHTGRYSNG  1104
             + A +KLP  + V AV  FGDSI+D G NN NL+T  + N+PPYG+DF GG  TGR+SNG
Sbjct  38    TRAVVKLPPNVSVPAVFVFGDSIMDTGNNNKNLATTARCNYPPYGKDFKGGIPTGRFSNG  97

Query  1103  KTPPDLVAEELGIKELVPAYLDPHLQPEDIKTGVSFASGASGYDPQTAALMSVIPLSEQL  924
             K P D + EELGIKE +PAYLD +L+P ++ TGV FASG +GYDP TA     I LS QL
Sbjct  98    KVPSDFIVEELGIKEFLPAYLDSNLEPGELVTGVCFASGGAGYDPLTAQTSLTISLSGQL  157

Query  923   KYFKEYLGKLNAMVGEKEAKSIINNTLFMVVSGSDDLANTYFTIGIRRYQYDINSYTDLL  744
               F+EY+GKL  +VGE +AK I+ N+L++VV GS+D++NTYF   +R+ QYD  +Y D +
Sbjct  158   DLFREYIGKLEGIVGEDKAKFILGNSLYIVVLGSNDISNTYFLTRVRQLQYDFPAYADFM  217

Query  743   LEGASNFLQELYSLGARRIGFFGIPPVGCLPSQRTLAGGSERECVENYNQAAQLANAKFS  564
             L  AS FL+E+Y  GARRI  F +PP+G LPSQRT+AGG +R+ V   N A Q+ N K S
Sbjct  218   LSSASTFLKEIYGKGARRIAVFSVPPLGYLPSQRTIAGGIQRDVVVKINDAVQIFNTKLS  277

Query  563   AEIKILSKKLPNSKLIFIDIYEDFLDMIKNPAKYGFEVVNLGCCGTGTIEVTMLCNKLSG  384
              ++  L    P+S++++ID+Y   LD+I N  +YG++V + GCCGTGTIEV +LCN L+ 
Sbjct  278   KKLDSLQHNFPDSRMVYIDVYNPLLDIIVNYQRYGYKVGDKGCCGTGTIEVVLLCNHLTP  337

Query  383   TCPDRNKYLFWDSYHPTEKGYRIIVNRIITKYINSF  276
              CP+   Y+FWDS+HPTE  Y+ ++  II KYIN F
Sbjct  338   LCPNDLDYVFWDSFHPTESVYKKLIAPIIGKYINKF  373



>ref|XP_003589529.1| GDSL esterase/lipase [Medicago truncatula]
 gb|AES59780.1| GDSL-like lipase/acylhydrolase [Medicago truncatula]
Length=358

 Score =   373 bits (957),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 175/349 (50%), Positives = 241/349 (69%), Gaps = 4/349 (1%)
 Frame = -2

Query  1310  IIAFLVLAGC----SEAKIKLPNGLVVKAVIAFGDSIVDQGMNNNLSTMIKTNFPPYGQD  1143
             II FL +       ++A +KLP      AV  FGDSI+D G NNN  T  +  FPPYG+D
Sbjct  9     IILFLTMLFAIFSKTKAILKLPPNASFPAVFVFGDSIMDTGNNNNRPTPTQCKFPPYGKD  68

Query  1142  FMGGKHTGRYSNGKTPPDLVAEELGIKELVPAYLDPHLQPEDIKTGVSFASGASGYDPQT  963
             F GG  TGR+SNGK P DL+ EELGIKE +PAYLDP+LQP ++ TGV+FASG +GYDP T
Sbjct  69    FQGGIPTGRFSNGKVPADLIVEELGIKEYLPAYLDPNLQPSELVTGVNFASGGAGYDPLT  128

Query  962   AALMSVIPLSEQLKYFKEYLGKLNAMVGEKEAKSIINNTLFMVVSGSDDLANTYFTIGIR  783
             + + + I +S Q++ FKEY+ KL  +VGE     I+ N+++ V+ GS+D++NTYF    R
Sbjct  129   SKIEAAISMSAQIELFKEYIVKLKGIVGEDRTNFILANSIYFVLVGSNDISNTYFLFHAR  188

Query  782   RYQYDINSYTDLLLEGASNFLQELYSLGARRIGFFGIPPVGCLPSQRTLAGGSERECVEN  603
             +  YD  SY+DLL++ A NF +E+Y LGARRIG F +PP+GC+P QRT+AGG  R+CV++
Sbjct  189   QVNYDFPSYSDLLVDSAYNFYKEMYQLGARRIGVFNVPPIGCVPFQRTVAGGITRKCVQH  248

Query  602   YNQAAQLANAKFSAEIKILSKKLPNSKLIFIDIYEDFLDMIKNPAKYGFEVVNLGCCGTG  423
             YN A    N K S +I    +  P+S+++++D+Y   LD+I N  KYGF+VV+ GCCGTG
Sbjct  249   YNDAVVFFNKKLSMKIDSFKQNFPSSRIVYMDVYNPILDIIVNYQKYGFKVVDRGCCGTG  308

Query  422   TIEVTMLCNKLSGTCPDRNKYLFWDSYHPTEKGYRIIVNRIITKYINSF  276
              IEV  LCN L  TC + + Y+FWD++HPTE  Y+I+V   + KY+ +F
Sbjct  309   EIEVIFLCNHLEPTCVNDSDYVFWDAFHPTEAVYKILVALSLQKYMYNF  357



>ref|XP_003589533.1| GDSL esterase/lipase [Medicago truncatula]
Length=517

 Score =   378 bits (971),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 180/350 (51%), Positives = 243/350 (69%), Gaps = 1/350 (0%)
 Frame = -2

Query  1310  IIAFLVLAGCSEAKIKLPNGLVVKAVIAFGDSIVDQGMNNNLSTMIKTNFPPYGQDFMGG  1131
             +I FLV+   ++A +KL   + + AV  FGDSI D G NN   T+ + +F PYG+DF GG
Sbjct  56    LILFLVVCFETKAIVKLQPNVSIPAVFVFGDSITDTGNNNFKKTIARCDFAPYGKDFPGG  115

Query  1130  KHTGRYSNGKTPPDLVAEELGIKELVPAYLDPHLQPEDIKTGVSFASGASGYDPQTAALM  951
               TGR+SNGK P DL+ EELGIKE +P YLDP LQP ++ TGV FASG +GYD  T+ L+
Sbjct  116   IATGRFSNGKVPSDLIVEELGIKEFLPPYLDPKLQPSELTTGVCFASGGAGYDDLTSKLL  175

Query  950   SVIPLSEQLKYFKEYLGKLNAMVGEKEAKSIINNTLFMVVSGSDDLANTYFTIGIRRYQY  771
             + I LS QL  FKEY+GKLNA+VGE   K II N++F V  GS+D++NTYF   +R+ +Y
Sbjct  176   TAISLSSQLDSFKEYIGKLNALVGENRTKFIIANSVFFVEFGSNDISNTYFISRVRQIKY  235

Query  770   -DINSYTDLLLEGASNFLQELYSLGARRIGFFGIPPVGCLPSQRTLAGGSERECVENYNQ  594
              + +SY D L+  ASNF +E+Y LGARRIG F +PP+GC+P QRTLAGG ER+CVE  + 
Sbjct  236   PEFSSYADFLVSLASNFTKEIYKLGARRIGIFNVPPLGCVPMQRTLAGGFERKCVEKISN  295

Query  593   AAQLANAKFSAEIKILSKKLPNSKLIFIDIYEDFLDMIKNPAKYGFEVVNLGCCGTGTIE  414
             A  L N K S EI  L + L NS+++++D+Y    D+I N  KYGF   + GCCGTG +E
Sbjct  296   ATMLYNDKLSKEIDSLKQNLSNSRIVYLDVYSPIQDVIANEQKYGFLNADRGCCGTGRVE  355

Query  413   VTMLCNKLSGTCPDRNKYLFWDSYHPTEKGYRIIVNRIITKYINSFT*SI  264
             V  LCN+L+ TC + ++Y+FWDS+HPTE  Y+ I+  ++ KY+N    +I
Sbjct  356   VAFLCNRLAHTCSNDSEYVFWDSFHPTEAMYKRIIVPLLQKYMNQLNFAI  405



>ref|XP_004289076.1| PREDICTED: LOW QUALITY PROTEIN: GDSL esterase/lipase At3g14820-like 
[Fragaria vesca subsp. vesca]
Length=367

 Score =   371 bits (953),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 179/337 (53%), Positives = 241/337 (72%), Gaps = 5/337 (1%)
 Frame = -2

Query  1274  AKIKLPNGLVVKAVIAFGDSIVDQGMNNNLSTMIKTNFPPYGQDFMGGKHTGRYSNGKTP  1095
             A + LP      AV AFGDS +D G N+ + + +K+NFPPYG+DFMGG  TGR+SNG+ P
Sbjct  31    AAVTLPTNGTTPAVFAFGDSTLDTGNNDYIISGLKSNFPPYGRDFMGGMPTGRFSNGRVP  90

Query  1094  PDLVAEELGIKELVPAYLDPHLQPEDIKTGVSFASGASGYDPQTAA---LMSVIPLSEQL  924
              DL+AE  G+K+++PAYLDP+LQ +D+ TGV FAS  SGYDP TA    L SV+ LS+QL
Sbjct  91    SDLIAEVFGVKKILPAYLDPNLQLQDLLTGVCFASAGSGYDPLTAEFAELQSVLSLSDQL  150

Query  923   KYFKEYLGKLNAMVGEKEAKSIINNTLFMVVSGSDDLANTYFTIGIRRYQYDINSYTDLL  744
               FKEY  K+N  VG ++  ++++ +LF++  GS+DLA +YF   +R   YDI +YTD L
Sbjct  151   DLFKEYKSKINTAVGNEKTATLLSKSLFIIWMGSNDLAFSYFATPLRSAHYDIPAYTDFL  210

Query  743   LEGASNFLQELYSLGARRIGFFGIPPVGCLPSQRTLAGGSERECVENYNQAAQLANAKFS  564
             LE AS F Q+LY+LGAR IG   +PP+GC+P+Q TL GG ER C E  NQAA L N+K S
Sbjct  211   LEFASTFFQKLYALGARVIGVASMPPIGCVPAQITLGGGIERACSEAENQAAMLYNSKLS  270

Query  563   AEIKILSKKLPNSKLIFIDIYEDFLDMIKNPAKYGFEVVNLGCCGTGTIEVTMLCNKLS-  387
             A +  L+K+LP + +I+IDIY  FL +I++PA+YGFEVV+ GCCGTG +E  +LCNK + 
Sbjct  271   ALVDSLNKRLPEALVIYIDIYNPFLSIIQDPAQYGFEVVDKGCCGTGIVEFGLLCNKHTP  330

Query  386   GTCPDRNKYLFWDSYHPTEKGYRIIVNRIITKYINSF  276
             GTC D +KY+FWD +HPTE   RI+ + I+ K +N F
Sbjct  331   GTCNDASKYMFWDGFHPTETACRILTSEIL-KQVNKF  366



>gb|EYU38772.1| hypothetical protein MIMGU_mgv1a008997mg [Erythranthe guttata]
Length=356

 Score =   371 bits (952),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 175/331 (53%), Positives = 242/331 (73%), Gaps = 4/331 (1%)
 Frame = -2

Query  1268  IKLPNGLVVKAVIAFGDSIVDQGMNNNLSTMIKTNFPPYGQDFMGGKHTGRYSNGKTPPD  1089
             I LP    + AV+ FGDSIVD G NN ++T+ K NF PYG++F+ GK TGR+S+GK P D
Sbjct  23    IDLPENATIPAVLFFGDSIVDTGNNNYITTVAKCNFRPYGKNFIEGKPTGRFSDGKVPSD  82

Query  1088  LVAEELGIKELVPAYLDPHLQPEDIKTGVSFASGASGYDPQTAALMSVIPLSEQLKYFKE  909
             L A+ELGIK L+P YLDP LQ +D+ TGV+FASGASGYDP T+   SV  LS+QL+ FKE
Sbjct  83    LFAKELGIKPLLPPYLDPSLQDQDLLTGVNFASGASGYDPLTSDPASVFSLSDQLEMFKE  142

Query  908   YLGKLNAMVGEKEAKSIINNTLFMVVSGSDDLANTYFTIGIRRYQYDINSYTDLLLEGAS  729
             Y+ KL  + GE+++ +I+  ++  V +GS+D+ NTYF +  RR+QYD+ SYTDLL+  AS
Sbjct  143   YIAKLKKIAGEEKSSAILRESIIAVATGSNDILNTYF-LTPRRFQYDVPSYTDLLVSYAS  201

Query  728   NFLQELYSLGARRIGFFGIPPVGCLPSQRTLAGGSERECVENYNQAAQLANAKFSAEIKI  549
             +F+QELY LGARRIG F +PP+GC PSQ TL GG +R+CV+ YN+ A+L N K SA I  
Sbjct  202   SFVQELYRLGARRIGVFSMPPIGCAPSQITLKGGLDRKCVDKYNEIAKLFNNKLSAAITS  261

Query  548   LSKKLPNSKLIFIDIYEDFLDMIKNPAKYGFEVVNLGCCGTGTIEVTMLCNKLSGTCPDR  369
             L+ +  ++++++ D Y   LD+I NP KYGF++ + GCCGTG +EV+++C      C + 
Sbjct  262   LNTRFTDARIVYFDAYNPTLDIILNPQKYGFKIADRGCCGTGLVEVSLVCRY---ACSNV  318

Query  368   NKYLFWDSYHPTEKGYRIIVNRIITKYINSF  276
             N Y+FWDS+HP+EK Y I+V RI+ +YI+ F
Sbjct  319   NDYVFWDSFHPSEKTYTILVRRILEQYISYF  349



>gb|KFK42028.1| hypothetical protein AALP_AA2G202700 [Arabis alpina]
Length=369

 Score =   371 bits (953),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 179/341 (52%), Positives = 239/341 (70%), Gaps = 2/341 (1%)
 Frame = -2

Query  1298  LVLAGCSEAKIKLPNGLVVKAVIAFGDSIVDQGMNNN-LSTMIKTNFPPYGQDFMGGKHT  1122
             L L   + A +KLP    + A+I FGDSIVD G N++ ++T+ + N+PPYG DF GG  T
Sbjct  26    LFLNTNTNALVKLPPNKTIPAIIVFGDSIVDAGNNDDIMTTLARCNYPPYGIDFDGGVPT  85

Query  1121  GRYSNGKTPPDLVAEELGIKELVPAYLDPHLQPEDIKTGVSFASGASGYDPQTAALMSVI  942
             GR+SNGK   D++AEE GIK  +PAY DP+L+PED+ TGV+FASG  GY P TA L   I
Sbjct  86    GRFSNGKVSTDIIAEEYGIKPSIPAYRDPNLKPEDLLTGVTFASGGGGYVPFTAQLSGGI  145

Query  941   PLSEQLKYFKEYLGKLNAMVGEKEAKSIINNTLFMVVSGSDDLANTYFTIGIRRYQYDIN  762
               S+QLK F+EY+ KL  MVGE+  K II N+LFMVV GS+D+ NTYF +   + +YD+ 
Sbjct  146   SYSQQLKLFEEYIEKLKEMVGEERTKFIIENSLFMVVFGSNDITNTYFGLPSVQRKYDVG  205

Query  761   SYTDLLLEGASNFLQELYSLGARRIGFFGIPPVGCLPSQRTLAGGSERECVENYNQAAQL  582
             S+T L+ + A +F Q+L+  GARRI  F  PP+GC+PSQRT+AGG  R CV  +N A +L
Sbjct  206   SFTTLMADNARSFAQKLHEYGARRIQVFSAPPLGCVPSQRTIAGGLTRTCVARFNDATKL  265

Query  581   ANAKFSAEIKILSKKLPNSKLIFIDIYEDFLDMIKNPAKYGFEVVNLGCCGTGTIEVTML  402
              NAK  A +  LS+ L +  +I+IDIY+  LD+I NP +YGF+VV+ GCCGTG IEV +L
Sbjct  266   YNAKLYANLDSLSRTLRDKAIIYIDIYDSLLDIILNPQEYGFKVVDKGCCGTGLIEVAVL  325

Query  401   CNKLSG-TCPDRNKYLFWDSYHPTEKGYRIIVNRIITKYIN  282
             CNK +   CP R+ Y+FWDS+HPTEK YR++V +   +Y N
Sbjct  326   CNKFTAEVCPKRDDYVFWDSFHPTEKTYRVMVAKYFKRYFN  366



>ref|XP_010536419.1| PREDICTED: GDSL esterase/lipase At1g20120-like [Tarenaya hassleriana]
Length=722

 Score =   382 bits (982),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 183/343 (53%), Positives = 250/343 (73%), Gaps = 7/343 (2%)
 Frame = -2

Query  1304  AFLVLAGCSEAKIKLPNGLVVKAVIAFGDSIVDQGMNNNLSTMIKTNFPPYGQDFMGGKH  1125
             AF  +A   +AK++LP  + V A+I FGDSIVD G NN   T  K NFPPYG DF GG  
Sbjct  21    AFFTVA---KAKVRLPPNVTVPAIIVFGDSIVDAGNNNKFKTPSKCNFPPYGIDFDGGVP  77

Query  1124  TGRYSNGKTPPDLVAEELGIKELVPAYLDPHLQPEDIKTGVSFASGASGYDPQTAALMSV  945
             TGR+SNG+ P DL+AEE+GIK+ VPAYLDP L PED+ TGV+FASG +GY P T +L   
Sbjct  78    TGRFSNGRVPSDLLAEEIGIKKNVPAYLDPKLTPEDLLTGVTFASGGAGYIPLTNSLAVA  137

Query  944   IPLSEQLKYFKEYLGKLNAMVGEKEAKSIINNTLFMVVSGSDDLANTYFTIGIRRYQYDI  765
               L++QLK+F+EYL K+  +VGE+    I+ N+L+MV++ S+D+ANTY    I +Y+YD+
Sbjct  138   TSLTDQLKHFEEYLEKVKELVGEERKNFILANSLYMVLTASNDIANTY---PILQYKYDV  194

Query  764   NSYTDLLLEGASNFLQELYSLGARRIGFFGIPPVGCLPSQRTLAGGSERECVENYNQAAQ  585
             ++YT L+ + AS+ L++LY  GARRI   G PP+GC+PSQRT+AGG  RECVE  N AA+
Sbjct  195   DTYTALMADSASSILEKLYGYGARRILVLGAPPIGCVPSQRTVAGGPSRECVERLNDAAK  254

Query  584   LANAKFSAEIKILSKKLPNSKLIFIDIYEDFLDMIKNPAKYGFEVVNLGCCGTGTIEVTM  405
             L N+K SA +  L++ LP   L++ DIY   LD+I N   YGF+V + GCCGTG IEVT 
Sbjct  255   LFNSKLSATVDSLARTLPGGNLVYADIYTPLLDIIVNFQNYGFKVGDRGCCGTGYIEVTA  314

Query  404   LCNKLSGT-CPDRNKYLFWDSYHPTEKGYRIIVNRIITKYINS  279
              CNK + T CP+R++++FWDS+HPTE+GYR++V++++ KY+ S
Sbjct  315   TCNKYTSTVCPNRDEFVFWDSFHPTERGYRVLVSKLVGKYVYS  357


 Score =   337 bits (863),  Expect = 9e-104, Method: Compositional matrix adjust.
 Identities = 164/322 (51%), Positives = 224/322 (70%), Gaps = 1/322 (0%)
 Frame = -2

Query  1238  AVIAFGDSIVDQGMNNNLSTMIKTNFPPYGQDFMGGKHTGRYSNGKTPPDLVAEELGIKE  1059
             A++ FGDSI+D G NN++ T++K NF PYG +F  G  TGR+S+GK P D++AE LGIKE
Sbjct  399   ALLVFGDSIIDTGNNNDIMTVVKCNFRPYGINFPNGVATGRFSDGKVPSDILAELLGIKE  458

Query  1058  LVPAYLDPHLQPEDIKTGVSFASGASGYDPQTAALMSVIPLSEQLKYFKEYLGKLNAMVG  879
              +PAYLDP L+PED+ TGV F SG SG+DP T  L+SVI ++ QL YF+EY  +L  M+G
Sbjct  459   TLPAYLDPKLKPEDLLTGVVFGSGGSGFDPLTPVLLSVISMTNQLNYFQEYKERLKGMLG  518

Query  878   EKEAKSIINNTLFMVVSGSDDLANTYFTIGIRRYQYDINSYTDLLLEGASNFLQELYSLG  699
             E++A + I  +LF VV+GSDD+ NTY+    RR+QY++  YT  L + A++F  +L+  G
Sbjct  519   EEKANARIAESLFFVVAGSDDIVNTYYGFQTRRFQYNLGDYTSFLADSATSFALQLHQYG  578

Query  698   ARRIGFFGIPPVGCLPSQRTLAGGSERECVENYNQAAQLANAKFSAEIKILSKKLPNSKL  519
             AR I    +PP+GCLPS RT+ G   R+C +  N AAQL N+K S ++  LSK LP +KL
Sbjct  579   ARYIAIASLPPIGCLPSVRTIRGKFGRDCSKLLNFAAQLFNSKLSTKVDALSKTLPETKL  638

Query  518   IFIDIYEDFLDMIKNPAKYGFEVVNLGCCGTGTIEVTMLCNKLSG-TCPDRNKYLFWDSY  342
             ++ID+Y   + M+K P KY FEV + GCCGTGT+E  +LCN  +   C + + YLFWDSY
Sbjct  639   VYIDVYTPMIQMVKFPEKYDFEVADKGCCGTGTVETVVLCNHFTSYVCRNVSAYLFWDSY  698

Query  341   HPTEKGYRIIVNRIITKYINSF  276
             HPTE+ YRI+   +I KY   F
Sbjct  699   HPTERAYRILTKELIDKYFTRF  720



>ref|XP_003527436.1| PREDICTED: GDSL esterase/lipase EXL3-like [Glycine max]
Length=365

 Score =   370 bits (951),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 173/333 (52%), Positives = 238/333 (71%), Gaps = 2/333 (1%)
 Frame = -2

Query  1268  IKLPNGLVVKAVIAFGDSIVDQGMNNNLSTMIKTNFPPYGQDFMGGKH-TGRYSNGKTPP  1092
             + LPN   V AVI FGDSIVD G NN ++T+ K NF PYG+DF GG   TGR+SNG TP 
Sbjct  32    VSLPNNESVPAVIVFGDSIVDTGNNNYINTIAKVNFLPYGKDFGGGNQPTGRFSNGLTPS  91

Query  1091  DLVAEELGIKELVPAYLDPHLQPEDIKTGVSFASGASGYDPQTAALMSVIPLSEQLKYFK  912
             D++A +LG+K+L+P YLDP LQP+D+ TGVSFASG SGYDP T+ + SV+ LS+QL  F+
Sbjct  92    DIIAAKLGVKKLLPPYLDPKLQPQDLLTGVSFASGGSGYDPLTSKIASVLSLSDQLDKFR  151

Query  911   EYLGKLNAMVGEKEAKSIINNTLFMVVSGSDDLANTYFTIGIRRYQYDINSYTDLLLEGA  732
             EY  K+   VG     +II+ +++++ +GS+D+ANTY     RR QYDI SY D +++ A
Sbjct  152   EYKNKIKETVGGNRTTTIISKSIYILCTGSNDIANTYSLSPFRRLQYDIQSYIDFMIKQA  211

Query  731   SNFLQELYSLGARRIGFFGIPPVGCLPSQRTLAGGSERECVENYNQAAQLANAKFSAEIK  552
             +NFL+ELY LGARRIG  G+P +GC+P QRT+ GG  REC +  N AA L N K S++I 
Sbjct  212   TNFLKELYGLGARRIGVIGLPVLGCVPFQRTIQGGIHRECSDFENHAATLFNNKLSSQID  271

Query  551   ILSKKLPNSKLIFIDIYEDFLDMIKNPAKYGFEVVNLGCCGTGTIEVTMLCNKLS-GTCP  375
              L K+ P +K ++++IY   L+MI+N  KYGFEV + GCCGTG  EV  LCN+L+   C 
Sbjct  272   ALKKQFPETKFVYLEIYNPLLNMIQNATKYGFEVTDKGCCGTGDFEVGFLCNRLTPHICS  331

Query  374   DRNKYLFWDSYHPTEKGYRIIVNRIITKYINSF  276
             + + Y+FWDS+HPTE+GY+++ ++++ K I  F
Sbjct  332   NTSSYIFWDSFHPTEEGYKVLCSQVLDKNIKDF  364



>ref|XP_010680078.1| PREDICTED: uncharacterized protein LOC104895310 [Beta vulgaris 
subsp. vulgaris]
Length=786

 Score =   384 bits (986),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 182/335 (54%), Positives = 238/335 (71%), Gaps = 1/335 (0%)
 Frame = -2

Query  1277  EAKIKLPNGLVVKAVIAFGDSIVDQGMNNNLSTMIKTNFPPYGQDFMGGKHTGRYSNGKT  1098
              A I L     V A+I FGDSIVD G NN + T+ + NFPPYG+DF GG  TGR+SNGK 
Sbjct  451   HAIINLGEKAKVPALIVFGDSIVDPGNNNYIVTIARVNFPPYGRDFPGGVPTGRFSNGKV  510

Query  1097  PPDLVAEELGIKELVPAYLDPHLQPEDIKTGVSFASGASGYDPQTAALMSVIPLSEQLKY  918
             P DL+AEELGIKE VP YLDP LQ  D+ +GV+FASGA+GYDP +A   +V+ L +QLK 
Sbjct  511   PSDLIAEELGIKEFVPPYLDPKLQISDLLSGVNFASGAAGYDPNSARSQNVLSLEDQLKL  570

Query  917   FKEYLGKLNAMVGEKEAKSIINNTLFMVVSGSDDLANTYFTIGIRRYQYDINSYTDLLLE  738
             F+ Y  KL A VGE    SII+ +L++V +GS+D+ NTYF +  R   Y+I++YT L+++
Sbjct  571   FRGYTDKLRAAVGENTTSSIISQSLYLVCAGSNDITNTYFGLPTRSLHYNISTYTTLMVQ  630

Query  737   GASNFLQELYSLGARRIGFFGIPPVGCLPSQRTLAGGSERECVENYNQAAQLANAKFSAE  558
              AS+FLQELY LGAR+IG    PP GCLP+QRTL GG  R C E  NQA+ L N+K S E
Sbjct  631   WASSFLQELYGLGARKIGVISGPPCGCLPAQRTLHGGPSRACFEKENQASMLFNSKLSTE  690

Query  557   IKILSKKLPNSKLIFIDIYEDFLDMIKNPAKYGFEVVNLGCCGTGTIEVTMLCNKLS-GT  381
             +  L++KL  S+++++DIY   +++I NP++ GFEV N GCCGTG IEV++ C +   GT
Sbjct  691   LISLNQKLAQSRIVYLDIYSPIIELITNPSQQGFEVANKGCCGTGNIEVSIFCTRFDPGT  750

Query  380   CPDRNKYLFWDSYHPTEKGYRIIVNRIITKYINSF  276
             C D +KY+FWDS+HPTEK Y+ IV R+I K I  F
Sbjct  751   CKDASKYVFWDSFHPTEKAYKFIVQRVIQKSIGDF  785


 Score =   377 bits (967),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 176/321 (55%), Positives = 236/321 (74%), Gaps = 1/321 (0%)
 Frame = -2

Query  1244  VKAVIAFGDSIVDQGMNNNLSTMIKTNFPPYGQDFMGGKHTGRYSNGKTPPDLVAEELGI  1065
             V A++ FGDSIVD G NN ++T+ K NFPPYG+DF GG  TGRYSNGK P DL+AEELGI
Sbjct  51    VSALLVFGDSIVDPGNNNYIATIGKANFPPYGRDFPGGVPTGRYSNGKVPSDLIAEELGI  110

Query  1064  KELVPAYLDPHLQPEDIKTGVSFASGASGYDPQTAALMSVIPLSEQLKYFKEYLGKLNAM  885
             KE +P YLDP LQ  D+ +GVSFASGA+GYDP +A L +V+ L +QLK FK Y+ KL A 
Sbjct  111   KEFIPPYLDPKLQISDLISGVSFASGAAGYDPDSAKLANVLSLDDQLKLFKGYIKKLKAT  170

Query  884   VGEKEAKSIINNTLFMVVSGSDDLANTYFTIGIRRYQYDINSYTDLLLEGASNFLQELYS  705
             VGE +  SII+ ++++V +GS+D+ NTYF +   R  Y+I++YT L+++ AS F+QELY+
Sbjct  171   VGENKTSSIISQSVYLVCAGSNDITNTYFALPFARLHYNISAYTGLMVKRASTFVQELYA  230

Query  704   LGARRIGFFGIPPVGCLPSQRTLAGGSERECVENYNQAAQLANAKFSAEIKILSKKLPNS  525
             LGARRI     PP GCLPSQRTL GG  R C    NQA+ L N+K   E+  L++KL +S
Sbjct  231   LGARRIAVVSAPPCGCLPSQRTLHGGLSRACATKENQASILFNSKLINELTSLNQKLAHS  290

Query  524   KLIFIDIYEDFLDMIKNPAKYGFEVVNLGCCGTGTIEVTMLCNKLS-GTCPDRNKYLFWD  348
             ++ ++DIY   L++I NP++ GF+V N GCCGTG +EV+ LC KL  GTC D +KY+FWD
Sbjct  291   RIAYLDIYNPLLELITNPSQSGFKVNNRGCCGTGNLEVSFLCTKLDPGTCKDASKYIFWD  350

Query  347   SYHPTEKGYRIIVNRIITKYI  285
             S+HPTE  Y+ IV++++ K +
Sbjct  351   SFHPTEAAYKFIVHKVLQKSV  371



>ref|XP_007157889.1| hypothetical protein PHAVU_002G106300g [Phaseolus vulgaris]
 gb|ESW29883.1| hypothetical protein PHAVU_002G106300g [Phaseolus vulgaris]
Length=363

 Score =   370 bits (950),  Expect = 4e-121, Method: Compositional matrix adjust.
 Identities = 171/333 (51%), Positives = 237/333 (71%), Gaps = 2/333 (1%)
 Frame = -2

Query  1268  IKLPNGLVVKAVIAFGDSIVDQGMNNNLSTMIKTNFPPYGQDFMGGKH-TGRYSNGKTPP  1092
             + LPN   V AVI FGDSIVD G NN ++T+ K NF PYG+DF GG   +GR+SNG TP 
Sbjct  30    VSLPNNETVPAVIVFGDSIVDTGNNNYITTIFKCNFQPYGKDFGGGNQPSGRFSNGITPS  89

Query  1091  DLVAEELGIKELVPAYLDPHLQPEDIKTGVSFASGASGYDPQTAALMSVIPLSEQLKYFK  912
             D++A + G+K+++P YLDP LQP+D+ TGVSFASG SGYDP T+   SV+ L++QL+ F+
Sbjct  90    DIIASKFGVKKILPPYLDPKLQPQDLLTGVSFASGGSGYDPLTSKSASVLSLADQLEKFR  149

Query  911   EYLGKLNAMVGEKEAKSIINNTLFMVVSGSDDLANTYFTIGIRRYQYDINSYTDLLLEGA  732
             EY  K+  +VGE    +I++ +++++ +GS+D+ANTY    IRR  YDI+SYTDL+   A
Sbjct  150   EYKSKIEKIVGEDRTSTIMSKSIYILCTGSNDIANTYSLSPIRRAHYDISSYTDLMTSEA  209

Query  731   SNFLQELYSLGARRIGFFGIPPVGCLPSQRTLAGGSERECVENYNQAAQLANAKFSAEIK  552
             +NFLQELY LG RRIG  G+P +GC+PSQRT+ GG +R C  + NQAA L N K S++I 
Sbjct  210   TNFLQELYGLGGRRIGVIGLPALGCVPSQRTIRGGLQRNCSYSENQAAMLFNTKLSSQID  269

Query  551   ILSKKLPNSKLIFIDIYEDFLDMIKNPAKYGFEVVNLGCCGTGTIEVTMLCNKLS-GTCP  375
              L+KK   ++L+++DIY   L+MI+NPA YGFEV N GCCGTG IE  +LCN  +   C 
Sbjct  270   ALNKKNSEARLVYLDIYNPLLNMIQNPATYGFEVANKGCCGTGNIEAGILCNSFTLHICS  329

Query  374   DRNKYLFWDSYHPTEKGYRIIVNRIITKYINSF  276
             +   Y+FWDS+HPT++ Y ++ +++    I  F
Sbjct  330   NTKSYIFWDSFHPTQEAYNVLCSQVFDNKIKDF  362



>ref|XP_006342070.1| PREDICTED: GDSL esterase/lipase EXL3-like [Solanum tuberosum]
Length=343

 Score =   369 bits (948),  Expect = 4e-121, Method: Compositional matrix adjust.
 Identities = 177/340 (52%), Positives = 248/340 (73%), Gaps = 5/340 (1%)
 Frame = -2

Query  1313  CIIAFLVLAGCSEAKIKLPNGLVVKAVIAFGDSIVDQGMNNNLSTMIKTNFPPYGQDFMG  1134
             C +  ++   C EAK++L   + + A+ AFGDSIVDQG NNNL T  K NF PYG+DFMG
Sbjct  5     CAVFIMLFISC-EAKLQLRKDINITALFAFGDSIVDQGNNNNLITHAKCNFLPYGKDFMG  63

Query  1133  G-KHTGRYSNGKTPPDLVAEELGIKELVPAYLDPHLQPEDIKTGVSFASGASGYDPQTAA  957
             G K TGR+SN +TP D++ E+ GIK+L+PAYLD +L+ ED+KTGVSFASGASG+D  T  
Sbjct  64    GNKPTGRFSNARTPADMLVEDFGIKKLMPAYLDSNLKVEDLKTGVSFASGASGFDLLTPI  123

Query  956   LMSVIPLSEQLKYFKEYLGKLNAMVGEKEAKSIINNTLFMVVSGSDDLANTYFTIGI-RR  780
             + S +PLS QL  F++Y+ K+N  +GE+  K+I+  +L++VV+GSDDL NTYF +   R+
Sbjct  124   VASALPLSVQLALFQQYIWKMNGFIGEEATKNIVKKSLYIVVAGSDDLCNTYFMLKFPRK  183

Query  779   YQYDINSYTDLLLEGASNFLQELYSLGARRIGFFGIPPVGCLPSQRTLAGGSERECVENY  600
              QY+++SYT+L+++GASNF+ +LY++G RRI  FG+PP+GCLPSQ    GG  + CV+ Y
Sbjct  184   IQYNVDSYTNLMVDGASNFINDLYNMGGRRIWIFGLPPIGCLPSQILRGGGPSKICVDEY  243

Query  599   NQAAQLANAKFSAEIKILSKKLPNSKLIFIDIYEDFLDMIKNPAKYGFEVVNLGCCGTGT  420
             NQAAQ+AN K S +I  L+KKLP  +L++I+IY+  LD+I N  KYGFE     CC  G 
Sbjct  244   NQAAQIANTKLSNKIYSLNKKLPQIELLYINIYDPLLDIIVNHDKYGFEDALSACCQGGN  303

Query  419   IEVTMLCNKLSGTCPDRNKYLFWDSYHPTEKGYRIIVNRI  300
               V +LC+ ++  C +   YLFWDSYH TE+GYR+++++I
Sbjct  304   --VYLLCDNITRICENDANYLFWDSYHLTERGYRVLLDQI  341



>gb|KCW58232.1| hypothetical protein EUGRSUZ_H00934 [Eucalyptus grandis]
Length=334

 Score =   369 bits (946),  Expect = 5e-121, Method: Compositional matrix adjust.
 Identities = 171/332 (52%), Positives = 236/332 (71%), Gaps = 10/332 (3%)
 Frame = -2

Query  1277  EAKIKLPNGLVVKAVIAFGDSIVDQGMNNNLSTMIKTNFPPYGQDFMGGKHTGRYSNGKT  1098
             +AK+ +P    + AV  FGDSIVD G NNNL T++K+NFPPYG+DFMGGK TGR+SNGK 
Sbjct  7     QAKVVVPKNATISAVFMFGDSIVDTGNNNNLITLVKSNFPPYGRDFMGGKPTGRFSNGKI  66

Query  1097  PPDLVAEELGIKELVPAYLDPHLQPEDIKTGVSFASGASGYDPQTAALMSVIPLSEQLKY  918
             PPD   E+LGIKEL+PA+LDP+LQ +D+  GV+FAS  +G+DP T+ L+S IP+S+QL+ 
Sbjct  67    PPDFFVEQLGIKELLPAFLDPNLQLQDLIGGVNFASAGAGFDPLTSELVSAIPMSKQLQL  126

Query  917   FKEYLGKLNAMVGEKEAKSIINNTLFMVVSGSDDLANTYFTIGIRRYQYDINSYTDLLLE  738
               EY  KL   +GE+   SI+ N L++V +GSDD+ NTYF    R + Y + SYT+LL  
Sbjct  127   LDEYKMKLKCFIGEERVDSIVANGLYIVSAGSDDIVNTYFHTPTRIFDYSVFSYTELL--  184

Query  737   GASNFLQELYSLGARRIGFFGIPPVGCLPSQRTLAGGSERECVENYNQAAQLANAKFSAE  558
                    EL++ GARRIG F + P+GC+PS RTLAGG +R C ENYNQ  QL N+K S+E
Sbjct  185   -------ELHAKGARRIGVFSLTPLGCIPSMRTLAGGIKRRCAENYNQMVQLLNSKLSSE  237

Query  557   IKILSKKLPNSKLIFIDIYEDFLDMIKNPAKYGFEVVNLGCCGTGTIEVTMLCNKLSG-T  381
             +  L++  P+++++ IDIY   LD++K+P KYGFE+ + GCCG+G IE   LCN+    T
Sbjct  238   LHRLNEAFPHARMVLIDIYGLVLDIVKSPRKYGFEISDRGCCGSGLIETGFLCNQWDFLT  297

Query  380   CPDRNKYLFWDSYHPTEKGYRIIVNRIITKYI  285
             C + ++Y+FWDSYHPTE  Y+++V   + K +
Sbjct  298   CSNVSEYVFWDSYHPTENVYKVMVQEKLRKLL  329



>ref|XP_009123675.1| PREDICTED: GDSL esterase/lipase At5g42170 [Brassica rapa]
 emb|CDY02386.1| BnaA02g22950D [Brassica napus]
Length=392

 Score =   370 bits (951),  Expect = 6e-121, Method: Compositional matrix adjust.
 Identities = 176/332 (53%), Positives = 240/332 (72%), Gaps = 5/332 (2%)
 Frame = -2

Query  1277  EAKIKLPNGLVVKAVIAFGDSIVDQGMNNNLSTMIKTNFPPYGQDFMGGKHTGRYSNGKT  1098
             E  IKLP  + +  VIAFGDSIVD G NNNL T++K+NFPPYGQDF G   TGR+++G+ 
Sbjct  61    EVTIKLPRNVTIPGVIAFGDSIVDSGNNNNLRTILKSNFPPYGQDFRGKFATGRFTDGRV  120

Query  1097  PPDLVAEELGIKELVPAYLDPHLQPEDIKTGVSFASGASGYDPQTAALMSVIPLSEQLKY  918
             P D VAE LGI + +PAYLDP L+ +D+  G++FASG SGYDP TA ++ V+ L +QLKY
Sbjct  121   PSDFVAERLGIAKTIPAYLDPALKGKDLLKGINFASGGSGYDPLTAKIVRVVSLEDQLKY  180

Query  917   FKEYLGKLNAMVGEKEAKSIINNTLFMVVSGSDDLANTYFTIGIRRYQYDINSYTDLLLE  738
             F+EY  K+ A+VGE++AK ++ N+L++VV+ S+DLA+TY     R  +Y+   Y D L +
Sbjct  181   FQEYKEKIKAIVGEEKAKFMVENSLYLVVASSNDLAHTYIA---RSLRYNSTEYPDYLAD  237

Query  737   GASNFLQELYSLGARRIGFFGIPPVGCLPSQRTLAGGSERECVENYNQAAQLANAKFSAE  558
              +S F+++LY LGARRI  F   PVGCLPS+RTL  G +R+C EN N+ A   NAK S  
Sbjct  238   MSSKFVKKLYGLGARRIAVFSAVPVGCLPSRRTL-NGVKRKCSENLNKMALQFNAKLSPA  296

Query  557   IKILSKKLPNSKLIFIDIYEDFLDMIKNPAKYGFEVVNLGCCGTGTIEVTMLCNKLSG-T  381
             +  L KK P SK++ +D+Y+   +MI+NP KYGFEV N GCCGTG  EV +LCNK++  T
Sbjct  297   LVALRKKSPGSKIVLVDVYDILHNMIENPKKYGFEVANRGCCGTGLFEVLILCNKINPFT  356

Query  380   CPDRNKYLFWDSYHPTEKGYRIIVNRIITKYI  285
             C + + Y+FWDSYHPTEK Y++IV++++  YI
Sbjct  357   CKNASSYVFWDSYHPTEKAYQVIVDKLLGIYI  388



>ref|XP_007136104.1| hypothetical protein PHAVU_009G018100g [Phaseolus vulgaris]
 gb|ESW08098.1| hypothetical protein PHAVU_009G018100g [Phaseolus vulgaris]
Length=362

 Score =   370 bits (949),  Expect = 6e-121, Method: Compositional matrix adjust.
 Identities = 174/336 (52%), Positives = 238/336 (71%), Gaps = 1/336 (0%)
 Frame = -2

Query  1280  SEAKIKLPNGLVVKAVIAFGDSIVDQGMNNNLS-TMIKTNFPPYGQDFMGGKHTGRYSNG  1104
             ++  +KLP    V AV+ FGDSI+D G NNN + T+ K NFPPYG+DF G   TGR+ NG
Sbjct  26    TKGAVKLPPNFRVPAVLVFGDSIMDTGNNNNNTQTLAKCNFPPYGRDFQGAIPTGRFGNG  85

Query  1103  KTPPDLVAEELGIKELVPAYLDPHLQPEDIKTGVSFASGASGYDPQTAALMSVIPLSEQL  924
             K P DL+AEELGIK+L+PAY DP+LQP D+ TGV FASG SGYDP T+ + + I LS Q+
Sbjct  86    KVPSDLIAEELGIKDLLPAYFDPNLQPNDLLTGVCFASGGSGYDPLTSKMATAISLSGQI  145

Query  923   KYFKEYLGKLNAMVGEKEAKSIINNTLFMVVSGSDDLANTYFTIGIRRYQYDINSYTDLL  744
               F+EY+ KL  +VGE   K I+ N++ +VV GS+D++NTYF    R  QYDI +YTDL+
Sbjct  146   DMFREYIRKLEELVGEDRTKFILANSIVLVVEGSNDISNTYFLSHAREVQYDIPTYTDLM  205

Query  743   LEGASNFLQELYSLGARRIGFFGIPPVGCLPSQRTLAGGSERECVENYNQAAQLANAKFS  564
             +  A++FL+E+Y LGARRIG F  PP+GC+P QRT+ GG E++C E YN AA+L N K +
Sbjct  206   VSSAASFLKEIYQLGARRIGVFSAPPIGCVPFQRTILGGIEKKCAEKYNDAAKLFNDKLA  265

Query  563   AEIKILSKKLPNSKLIFIDIYEDFLDMIKNPAKYGFEVVNLGCCGTGTIEVTMLCNKLSG  384
              E+  L++ LP+++++++D+Y   LD+I N   YGF+V + GCCGTG IE  + CN L  
Sbjct  266   KELASLNRNLPHARMVYLDVYSPLLDIIVNYQNYGFKVGDRGCCGTGKIESAVFCNPLDT  325

Query  383   TCPDRNKYLFWDSYHPTEKGYRIIVNRIITKYINSF  276
             TC +   Y+FWDS+HP+E  YR +V  I+ KY+  F
Sbjct  326   TCQNVGDYVFWDSFHPSENVYRKLVPPILKKYLYQF  361



>gb|EYU17581.1| hypothetical protein MIMGU_mgv1a008769mg [Erythranthe guttata]
Length=363

 Score =   369 bits (948),  Expect = 8e-121, Method: Compositional matrix adjust.
 Identities = 172/336 (51%), Positives = 245/336 (73%), Gaps = 5/336 (1%)
 Frame = -2

Query  1280  SEAKIKLPNGLVVKAVIAFGDSIVDQGMNNNLSTMIKTNFPPYGQDFMGGKHTGRYSNGK  1101
             S A IK+P    + AV+ FGDS+VD G NN ++T+++ NF PYG+DF+ G+ TGR+SNGK
Sbjct  24    SGALIKVPENATIPAVMFFGDSVVDTGNNNYITTLVRANFLPYGKDFIAGQPTGRFSNGK  83

Query  1100  TPPDLVAEELGIKELVPAYLDPHLQPEDIKTGVSFASGASGYDPQTAALMSVIPLSEQLK  921
              PPDL  EELGIK  +P YLDP L  ED+ TGV+FASG SGYDP T+  MSV  LS+QL+
Sbjct  84    VPPDLFVEELGIKPCLPPYLDPSLVDEDLLTGVNFASGGSGYDPLTSNTMSVFSLSDQLE  143

Query  920   YFKEYLGKLNAMVGEKEAKSIINNTLFMVVSGSDDLANTYFTIGIRRYQYDINSYTDLLL  741
              F+EY+ KL  + G++++  I+  +LF+VVSGS+D+ N++F   +R++QYD+ SYTDLL+
Sbjct  144   MFEEYIIKLKKIAGDEKSSYILRESLFVVVSGSNDIWNSFFN-NLRQFQYDVPSYTDLLV  202

Query  740   EGASNFLQELYSLGARRIGFFGIPPVGCLPSQRTLAG-GSERECVENYNQAAQLANAKFS  564
                S+F QELY LGARRIG F +P +GC+PSQ T+   G ER+CV  YN+ AQL N K  
Sbjct  203   SHVSSFAQELYRLGARRIGVFSMPAIGCMPSQITIRRIGLERKCVTEYNEIAQLFNKKLL  262

Query  563   AEIKILSKKLPNSKLIFIDIYEDFLDMIKNPAKYGFEVVNLGCCGTGTIEVTMLCNKLSG  384
             + +  L+ + P +K++++D Y+  LDMI NP K+GF++V+ GCCGTGT E ++LC   + 
Sbjct  263   SALTSLNAQFPQAKMVYLDFYDLPLDMISNPQKFGFKIVDKGCCGTGTFETSLLC---TY  319

Query  383   TCPDRNKYLFWDSYHPTEKGYRIIVNRIITKYINSF  276
              C + + Y+FWDS+HPTEK YRI++++++ + IN F
Sbjct  320   ACSNEDDYIFWDSFHPTEKAYRILIHQMLQENINYF  355



>ref|XP_003544388.1| PREDICTED: GDSL esterase/lipase EXL3-like isoform X1 [Glycine 
max]
Length=367

 Score =   369 bits (948),  Expect = 9e-121, Method: Compositional matrix adjust.
 Identities = 174/336 (52%), Positives = 231/336 (69%), Gaps = 1/336 (0%)
 Frame = -2

Query  1280  SEAKIKLPNGLVVKAVIAFGDSIVDQGMNNN-LSTMIKTNFPPYGQDFMGGKHTGRYSNG  1104
             ++  +KLP  + V AV+ FGDSI+D G NNN L T  ++NFPPYGQDF GG  TGR+ NG
Sbjct  31    TKGAVKLPPNISVPAVLVFGDSIMDTGNNNNNLITSARSNFPPYGQDFKGGIPTGRFCNG  90

Query  1103  KTPPDLVAEELGIKELVPAYLDPHLQPEDIKTGVSFASGASGYDPQTAALMSVIPLSEQL  924
             K P D++ EELGIKE +PAYLDP+L+  ++ TGV FASG SGYDP T+   + IPLS QL
Sbjct  91    KVPSDILVEELGIKEFLPAYLDPNLELNELPTGVCFASGGSGYDPLTSQTATAIPLSGQL  150

Query  923   KYFKEYLGKLNAMVGEKEAKSIINNTLFMVVSGSDDLANTYFTIGIRRYQYDINSYTDLL  744
               FKEY+ KL   VGE     I+ N LF VV GS+D++NTYF   +R  QYD+ +Y+D +
Sbjct  151   DMFKEYIVKLKGHVGEDRTNFILANGLFFVVLGSNDISNTYFLTHLRELQYDVPTYSDFM  210

Query  743   LEGASNFLQELYSLGARRIGFFGIPPVGCLPSQRTLAGGSERECVENYNQAAQLANAKFS  564
             L  ASNF +E+Y LGARRI     PPVGC+P  RTL+GG  R+CV+ YN A  L N K S
Sbjct  211   LNSASNFFEEIYQLGARRIAVVSAPPVGCVPFHRTLSGGIARKCVQKYNDAVLLFNDKLS  270

Query  563   AEIKILSKKLPNSKLIFIDIYEDFLDMIKNPAKYGFEVVNLGCCGTGTIEVTMLCNKLSG  384
              +I  L++KLPNS++++ D+Y   LD+  N  KYG++V + GCCGTG +EV + CN L  
Sbjct  271   KKINSLNQKLPNSRIVYFDVYNPLLDVTVNHQKYGYKVGDRGCCGTGNLEVALTCNHLDA  330

Query  383   TCPDRNKYLFWDSYHPTEKGYRIIVNRIITKYINSF  276
             TC +   Y+FWD +HP+E  Y+ +V  ++ KYI+ F
Sbjct  331   TCSNVLDYVFWDGFHPSESVYKQLVPPLLQKYIHRF  366



>ref|XP_004499299.1| PREDICTED: GDSL esterase/lipase EXL1-like [Cicer arietinum]
Length=362

 Score =   369 bits (947),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 175/346 (51%), Positives = 237/346 (68%), Gaps = 2/346 (1%)
 Frame = -2

Query  1307  IAFLVLAGC--SEAKIKLPNGLVVKAVIAFGDSIVDQGMNNNLSTMIKTNFPPYGQDFMG  1134
             + F ++  C  + A I+LP  + + AV+ FGDSI+D G NN ++T+ ++NF PYG+DF G
Sbjct  16    LIFTIILFCFKTNAIIQLPPNVSIPAVLVFGDSIMDTGNNNYITTLSRSNFAPYGKDFPG  75

Query  1133  GKHTGRYSNGKTPPDLVAEELGIKELVPAYLDPHLQPEDIKTGVSFASGASGYDPQTAAL  954
             G  TGR+SNGK P D + EELGIKE +P YL+P+L+P+++ TGV FASG +GYD  T+ L
Sbjct  76    GIATGRFSNGKVPSDFIVEELGIKEYLPPYLNPNLKPDELITGVCFASGGAGYDHITSQL  135

Query  953   MSVIPLSEQLKYFKEYLGKLNAMVGEKEAKSIINNTLFMVVSGSDDLANTYFTIGIRRYQ  774
             +  I LS+QL  FKEY+ KLN  VGE     I+ N++F +V GS+D++NTYF    R+ +
Sbjct  136   LFAISLSKQLDLFKEYIEKLNVYVGENRTNFILANSIFFLVMGSNDISNTYFLTHARQLK  195

Query  773   YDINSYTDLLLEGASNFLQELYSLGARRIGFFGIPPVGCLPSQRTLAGGSERECVENYNQ  594
             YD  SY DLL+  ASNF +E+Y LGARRIG F + P+GC+P  RTLAGG ER CVE YN 
Sbjct  196   YDFPSYADLLVTLASNFTKEIYELGARRIGIFSVAPIGCVPLHRTLAGGKERSCVEKYNN  255

Query  593   AAQLANAKFSAEIKILSKKLPNSKLIFIDIYEDFLDMIKNPAKYGFEVVNLGCCGTGTIE  414
             A  L N K   EI  L++ L NSK+++ D+Y   LD+I N  KYGF V + GCCG G +E
Sbjct  256   ATTLFNDKLFKEIGSLNQNLSNSKIVYFDVYTPLLDIIVNNQKYGFTVADQGCCGRGKLE  315

Query  413   VTMLCNKLSGTCPDRNKYLFWDSYHPTEKGYRIIVNRIITKYINSF  276
             V +LCN+   TC +  +Y+FWDS+HPTE  Y+  V  ++ KYI  F
Sbjct  316   VGILCNRFGRTCSNDTEYVFWDSFHPTEAIYKGFVAPLLQKYITQF  361



>ref|XP_004512156.1| PREDICTED: GDSL esterase/lipase EXL3-like [Cicer arietinum]
Length=361

 Score =   369 bits (946),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 176/333 (53%), Positives = 235/333 (71%), Gaps = 2/333 (1%)
 Frame = -2

Query  1268  IKLPNGLVVKAVIAFGDSIVDQGMNNNLSTMIKTNFPPYGQDFMGGKH-TGRYSNGKTPP  1092
             + LPN   V A+I FGDS+VD G NN ++T++K NF PYG+DF GG   TGR+SNG  P 
Sbjct  28    LNLPNNETVPALIVFGDSVVDSGNNNYINTIVKCNFEPYGRDFGGGNQPTGRFSNGLVPS  87

Query  1091  DLVAEELGIKELVPAYLDPHLQPEDIKTGVSFASGASGYDPQTAALMSVIPLSEQLKYFK  912
             D++A + G+K+++PAYLDP+LQ +D+ TGVSFASG +GYDP T+ L SVI LSEQL  FK
Sbjct  88    DIIASKFGVKKILPAYLDPNLQLQDLLTGVSFASGGAGYDPLTSKLASVISLSEQLNMFK  147

Query  911   EYLGKLNAMVGEKEAKSIINNTLFMVVSGSDDLANTYFTIGIRRYQYDINSYTDLLLEGA  732
             EY  K+   VGEK  + II  ++++V  GSDD+ANTY     R  +YDI SYTDLL   A
Sbjct  148   EYKNKIKKAVGEKRMEMIITKSVYIVCIGSDDIANTYAQSPFRSAEYDIPSYTDLLASYA  207

Query  731   SNFLQELYSLGARRIGFFGIPPVGCLPSQRTLAGGSERECVENYNQAAQLANAKFSAEIK  552
             SNFLQELY LG RRIG  G+P +GC+PSQRT+ GG +R C +  NQAA L N+K  ++I+
Sbjct  208   SNFLQELYGLGGRRIGVIGMPNIGCVPSQRTIRGGIQRGCSDLENQAATLFNSKLVSQIE  267

Query  551   ILSKKLPNSKLIFIDIYEDFLDMIKNPAKYGFEVVNLGCCGTGTIEVTMLCNKLSG-TCP  375
                 +   +KL+++DIY   +D+ +NP KYGFEV + GCCGTG IEV++LCN  S  TC 
Sbjct  268   AFQHQFLEAKLVYLDIYNPLMDITQNPTKYGFEVSDRGCCGTGNIEVSVLCNHYSSDTCS  327

Query  374   DRNKYLFWDSYHPTEKGYRIIVNRIITKYINSF  276
             + + Y+FWDSYHPT++ Y ++ + +I   I  F
Sbjct  328   NPSSYVFWDSYHPTQEAYNVLCSMVIDDKIKDF  360



>ref|NP_001241717.1| uncharacterized protein LOC100856895 precursor [Zea mays]
 gb|ACF88253.1| unknown [Zea mays]
Length=359

 Score =   368 bits (945),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 172/325 (53%), Positives = 231/325 (71%), Gaps = 2/325 (1%)
 Frame = -2

Query  1244  VKAVIAFGDSIVDQGMNNNLSTMIKTNFPPYGQDFMGGKHTGRYSNGKTPPDLVAEELGI  1065
             V A++ FGDSIVD G NN + T+ K+NF PYG+D  GG  TGR+SNG+ P D VA  LG+
Sbjct  34    VPAILVFGDSIVDTGNNNAVLTLTKSNFRPYGKDLNGGVPTGRFSNGRIPTDFVASRLGL  93

Query  1064  KELVPAYLDPHLQPEDIKTGVSFASGASGYDPQTAALMSVIPLSEQLKYFKEYLGKLNAM  885
             K+LVPAYL   L  +D+ TGVSFASG +GYDP T+ L++V+P+ E+L  F EY  +L  +
Sbjct  94    KDLVPAYLGTDLSDDDLCTGVSFASGGTGYDPLTSTLVAVLPMQEELNMFAEYKERLAGV  153

Query  884   VG-EKEAKSIINNTLFMVVSGSDDLANTYFTIGIRRYQYDINSYTDLLLEGASNFLQELY  708
             VG E  A  I+  +LF+V +GSDD+AN Y+   +R  QYDI++Y D L+E A +F+++LY
Sbjct  154   VGDEAAAAGIVAESLFLVCAGSDDIANNYYLAPVRPLQYDISAYVDFLVEQACDFIRQLY  213

Query  707   SLGARRIGFFGIPPVGCLPSQRTLAGGSERECVENYNQAAQLANAKFSAEIKILSKKLPN  528
               GARRI   G+PPVGC+PSQRTLAGG  R+C    N AAQL N++   E+ +L K+L  
Sbjct  214   QQGARRIAVLGMPPVGCVPSQRTLAGGLARDCDPARNHAAQLYNSRLKEEVVLLQKELAC  273

Query  527   SKLIFIDIYEDFLDMIKNPAKYGFEVVNLGCCGTGTIEVTMLCNKLSG-TCPDRNKYLFW  351
              ++ ++DIY+   DMI NP KYGFEV   GCCGTG +EV++LCN+L+  TCPD  KY+FW
Sbjct  274   QRIGYVDIYDVLQDMITNPCKYGFEVSTRGCCGTGDLEVSLLCNQLTAPTCPDDRKYVFW  333

Query  350   DSYHPTEKGYRIIVNRIITKYINSF  276
             DS+HPTEK Y IIV+ +  +YI + 
Sbjct  334   DSFHPTEKAYEIIVDYLFPRYIENL  358



>ref|XP_010428639.1| PREDICTED: GDSL esterase/lipase EXL2-like [Camelina sativa]
Length=366

 Score =   368 bits (944),  Expect = 4e-120, Method: Compositional matrix adjust.
 Identities = 173/346 (50%), Positives = 243/346 (70%), Gaps = 3/346 (1%)
 Frame = -2

Query  1313  CIIAFLVLAG--CSEAKIKLPNGLVVKAVIAFGDSIVDQGMNNNL-STMIKTNFPPYGQD  1143
             C++ FLVL G   + A +KL +   + A+I FGDSIVD G N+++ +T+ + N+PPYG D
Sbjct  21    CVLFFLVLLGKTTTNALVKLSSNETIPAIIVFGDSIVDAGNNDDIKTTLARCNYPPYGID  80

Query  1142  FMGGKHTGRYSNGKTPPDLVAEELGIKELVPAYLDPHLQPEDIKTGVSFASGASGYDPQT  963
             F GG  TGR+SNGK   D +AE  GIK  +PAY +P+L+PED+ TGV+FASG +GY P T
Sbjct  81    FDGGVPTGRFSNGKVATDFIAENFGIKPTIPAYRNPNLKPEDLLTGVTFASGGAGYVPFT  140

Query  962   AALMSVIPLSEQLKYFKEYLGKLNAMVGEKEAKSIINNTLFMVVSGSDDLANTYFTIGIR  783
               L   I L +QL+ F+EY+ KL  MVGE+    II N+L MV+ GS+D+ NTYF +   
Sbjct  141   TQLSGGIALPQQLELFEEYIEKLKKMVGEERTNFIIQNSLIMVICGSNDITNTYFGLPSV  200

Query  782   RYQYDINSYTDLLLEGASNFLQELYSLGARRIGFFGIPPVGCLPSQRTLAGGSERECVEN  603
             +++YD++S+T L+ + A +F  +L+  GARRI  FG+PP+GC+PSQRTLAGG  R CV  
Sbjct  201   QHKYDVSSFTTLMADNARSFALKLHEYGARRIQVFGVPPLGCVPSQRTLAGGPTRNCVVR  260

Query  602   YNQAAQLANAKFSAEIKILSKKLPNSKLIFIDIYEDFLDMIKNPAKYGFEVVNLGCCGTG  423
             +N A +L NAK +A +  LS+ L    +I++DIY   LD+I +P +YGF+VV+ GCCGTG
Sbjct  261   FNDATKLYNAKLAANLDSLSRSLGEKTIIYVDIYGSLLDIILDPQQYGFKVVDRGCCGTG  320

Query  422   TIEVTMLCNKLSGTCPDRNKYLFWDSYHPTEKGYRIIVNRIITKYI  285
              IEV +LCN  +  CP+R++Y+FWDS+HPTEK YRI+  +   +YI
Sbjct  321   LIEVAVLCNFAADVCPNRDEYVFWDSFHPTEKTYRIMATKYFERYI  366



>ref|XP_003550432.1| PREDICTED: GDSL esterase/lipase EXL3-like [Glycine max]
 gb|KHN12628.1| GDSL esterase/lipase EXL3 [Glycine soja]
Length=377

 Score =   367 bits (941),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 174/336 (52%), Positives = 229/336 (68%), Gaps = 1/336 (0%)
 Frame = -2

Query  1280  SEAKIKLPNGLVVKAVIAFGDSIVDQGMNNN-LSTMIKTNFPPYGQDFMGGKHTGRYSNG  1104
             ++  ++LP  + V AV+ FGDSI+D G NNN L T  + NF PYGQDFMGG  TGR+ NG
Sbjct  41    TKGAVELPPNVSVPAVLVFGDSIMDTGNNNNNLITSARCNFSPYGQDFMGGIPTGRFCNG  100

Query  1103  KTPPDLVAEELGIKELVPAYLDPHLQPEDIKTGVSFASGASGYDPQTAALMSVIPLSEQL  924
             K P D++ EELGIKE +PAYLDP+LQ  ++ TGV FASG SGYDP T+   + IPLS QL
Sbjct  101   KVPSDILVEELGIKEFLPAYLDPNLQLSELATGVCFASGGSGYDPLTSQTATAIPLSGQL  160

Query  923   KYFKEYLGKLNAMVGEKEAKSIINNTLFMVVSGSDDLANTYFTIGIRRYQYDINSYTDLL  744
               FKEY+ KL   VGE     I+ N LF VV GS+D++NTYF   +R  QYD+ +Y+D +
Sbjct  161   DMFKEYIVKLKGHVGEDRTNFILANALFFVVLGSNDISNTYFLSHLRELQYDVPTYSDFM  220

Query  743   LEGASNFLQELYSLGARRIGFFGIPPVGCLPSQRTLAGGSERECVENYNQAAQLANAKFS  564
             L  ASNF +E+Y LGARRI     PPVGC+P  RTL+GG  R+CV+ YN A  L N K  
Sbjct  221   LNLASNFFKEIYQLGARRIAVLSAPPVGCVPFHRTLSGGIARKCVQKYNNAVVLFNDKLL  280

Query  563   AEIKILSKKLPNSKLIFIDIYEDFLDMIKNPAKYGFEVVNLGCCGTGTIEVTMLCNKLSG  384
              EI  L++ LPNS+++++D+Y   LD+I N  KYG++V + GCCGTG +EV + CN L  
Sbjct  281   KEINSLNQNLPNSRIVYLDVYNPLLDIIVNHQKYGYKVGDRGCCGTGNLEVALTCNHLDA  340

Query  383   TCPDRNKYLFWDSYHPTEKGYRIIVNRIITKYINSF  276
             TC +   Y+FWD +HP+E  Y+ +V  ++ KYI  F
Sbjct  341   TCSNVLDYVFWDGFHPSESVYKKLVPAVLQKYIYQF  376



>ref|XP_010416498.1| PREDICTED: GDSL esterase/lipase EXL2 [Camelina sativa]
Length=366

 Score =   366 bits (940),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 171/346 (49%), Positives = 244/346 (71%), Gaps = 3/346 (1%)
 Frame = -2

Query  1313  CIIAFLVL--AGCSEAKIKLPNGLVVKAVIAFGDSIVDQGMNNNL-STMIKTNFPPYGQD  1143
             C++ FLVL     + A +KLP+   + A+I FGDSIVD G N+++ +T+ + N+PPYG D
Sbjct  21    CVLFFLVLLCKTTTNALVKLPSNETIPAIIVFGDSIVDAGNNDDIKTTLARCNYPPYGID  80

Query  1142  FMGGKHTGRYSNGKTPPDLVAEELGIKELVPAYLDPHLQPEDIKTGVSFASGASGYDPQT  963
             F GG  TGR+SNGK   D +AE  GIK  +PAY +P+L+PED+ TGV+FASG +GY P T
Sbjct  81    FDGGVPTGRFSNGKVATDFIAENFGIKPTIPAYRNPNLKPEDLLTGVTFASGGAGYVPFT  140

Query  962   AALMSVIPLSEQLKYFKEYLGKLNAMVGEKEAKSIINNTLFMVVSGSDDLANTYFTIGIR  783
               L   I L +Q + F+EY+ KL  +VGE+    II N+L MV+ GS+D+ NTYF +   
Sbjct  141   TQLSGGIALPQQQELFEEYIEKLKKLVGEERTNFIIQNSLIMVICGSNDITNTYFGLPSV  200

Query  782   RYQYDINSYTDLLLEGASNFLQELYSLGARRIGFFGIPPVGCLPSQRTLAGGSERECVEN  603
             +++YD++S+T L+ + A +F  +L+  GARRI  FG+PP+GC+PSQRTLAGG  R+CV  
Sbjct  201   QHKYDVSSFTTLMADNARSFALKLHEYGARRIQVFGVPPLGCVPSQRTLAGGPTRDCVVR  260

Query  602   YNQAAQLANAKFSAEIKILSKKLPNSKLIFIDIYEDFLDMIKNPAKYGFEVVNLGCCGTG  423
             +N A +L NAK +A +  LS+ L    +I++DIY   LD+I +P +YGF+VV+ GCCGTG
Sbjct  261   FNDATKLYNAKLAANLDSLSRTLGEKTIIYVDIYGSLLDIILDPQQYGFKVVDRGCCGTG  320

Query  422   TIEVTMLCNKLSGTCPDRNKYLFWDSYHPTEKGYRIIVNRIITKYI  285
              IEV +LCN  +  CP+R++Y+FWDS+HPTEK YRI+  + + +YI
Sbjct  321   LIEVAVLCNFAADVCPNRDEYVFWDSFHPTEKTYRIMATKYVERYI  366



>ref|XP_008651333.1| PREDICTED: uncharacterized protein LOC100279561 isoform X1 [Zea 
mays]
 tpg|DAA64317.1| TPA: hypothetical protein ZEAMMB73_242688 [Zea mays]
Length=410

 Score =   368 bits (944),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 172/325 (53%), Positives = 231/325 (71%), Gaps = 2/325 (1%)
 Frame = -2

Query  1244  VKAVIAFGDSIVDQGMNNNLSTMIKTNFPPYGQDFMGGKHTGRYSNGKTPPDLVAEELGI  1065
             V A++ FGDSIVD G NN + T+ K+NF PYG+D  GG  TGR+SNG+ P D VA  LG+
Sbjct  85    VPAILVFGDSIVDTGNNNAVLTLTKSNFRPYGKDLNGGVPTGRFSNGRIPTDFVASRLGL  144

Query  1064  KELVPAYLDPHLQPEDIKTGVSFASGASGYDPQTAALMSVIPLSEQLKYFKEYLGKLNAM  885
             K+LVPAYL   L  +D+ TGVSFASG +GYDP T+ L++V+P+ E+L  F EY  +L  +
Sbjct  145   KDLVPAYLGTDLSDDDLCTGVSFASGGTGYDPLTSTLVAVLPMQEELNMFAEYKERLAGV  204

Query  884   VG-EKEAKSIINNTLFMVVSGSDDLANTYFTIGIRRYQYDINSYTDLLLEGASNFLQELY  708
             VG E  A  I+  +LF+V +GSDD+AN Y+   +R  QYDI++Y D L+E A +F+++LY
Sbjct  205   VGDEAAAAGIVAESLFLVCAGSDDIANNYYLAPVRPLQYDISAYVDFLVEQACDFIRQLY  264

Query  707   SLGARRIGFFGIPPVGCLPSQRTLAGGSERECVENYNQAAQLANAKFSAEIKILSKKLPN  528
               GARRI   G+PPVGC+PSQRTLAGG  R+C    N AAQL N++   E+ +L K+L  
Sbjct  265   QQGARRIAVLGMPPVGCVPSQRTLAGGLARDCDPARNHAAQLYNSRLKEEVVLLQKELAC  324

Query  527   SKLIFIDIYEDFLDMIKNPAKYGFEVVNLGCCGTGTIEVTMLCNKLSG-TCPDRNKYLFW  351
              ++ ++DIY+   DMI NP KYGFEV   GCCGTG +EV++LCN+L+  TCPD  KY+FW
Sbjct  325   QRIGYVDIYDVLQDMITNPCKYGFEVSTRGCCGTGDLEVSLLCNQLTAPTCPDDRKYVFW  384

Query  350   DSYHPTEKGYRIIVNRIITKYINSF  276
             DS+HPTEK Y IIV+ +  +YI + 
Sbjct  385   DSFHPTEKAYEIIVDYLFPRYIENL  409



>ref|XP_003612217.1| GDSL esterase/lipase [Medicago truncatula]
 gb|AES95175.1| GDSL-like lipase/acylhydrolase [Medicago truncatula]
Length=367

 Score =   366 bits (940),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 177/334 (53%), Positives = 234/334 (70%), Gaps = 3/334 (1%)
 Frame = -2

Query  1268  IKLPNGLVVKAVIAFGDSIVDQGMNNNL-STMIKTNFPPYGQDFMGGKH-TGRYSNGKTP  1095
             + LPN   V A IAFGDSIVD G NN + +T+ K NFPPYG+DF GG   TGR+SNG  P
Sbjct  33    VNLPNNETVPAFIAFGDSIVDSGNNNYIINTVFKCNFPPYGKDFGGGNQPTGRFSNGLVP  92

Query  1094  PDLVAEELGIKELVPAYLDPHLQPEDIKTGVSFASGASGYDPQTAALMSVIPLSEQLKYF  915
              D++A + G+K+L+PAYLDP+LQ +D+ TGVSFASG +GYDP T+   SVI LS+QL  F
Sbjct  93    SDIIASKFGVKKLLPAYLDPNLQLQDLLTGVSFASGGAGYDPLTSKSASVISLSDQLNMF  152

Query  914   KEYLGKLNAMVGEKEAKSIINNTLFMVVSGSDDLANTYFTIGIRRYQYDINSYTDLLLEG  735
             KEY  K+   VGE   + II+ +++++  GS+D+ANTY     RR +YDI SYTDLL   
Sbjct  153   KEYKNKIKEAVGEMRMEMIISKSVYIICIGSNDIANTYAQTPYRRVKYDIRSYTDLLASY  212

Query  734   ASNFLQELYSLGARRIGFFGIPPVGCLPSQRTLAGGSERECVENYNQAAQLANAKFSAEI  555
             ASNFLQELY LGARRIG  G+P +GC+PSQRT+ GG ER C +  NQAA+L N+K  +++
Sbjct  213   ASNFLQELYGLGARRIGVIGMPNIGCVPSQRTIGGGIERGCSDFENQAARLFNSKLVSKM  272

Query  554   KILSKKLPNSKLIFIDIYEDFLDMIKNPAKYGFEVVNLGCCGTGTIEVTMLCNKLSGT-C  378
                  K P +KL+++DIY     +++NPAKYGFEV + GCCGTG IEV++LCN  S   C
Sbjct  273   DAFENKFPEAKLVYLDIYTSLSQLVQNPAKYGFEVADKGCCGTGNIEVSILCNHYSSNIC  332

Query  377   PDRNKYLFWDSYHPTEKGYRIIVNRIITKYINSF  276
              + + Y+FWDSYHPT++ Y ++   +    I  F
Sbjct  333   SNPSSYIFWDSYHPTQEAYNLLCAMVFDDKIKDF  366



>ref|XP_008651330.1| PREDICTED: uncharacterized protein LOC100279561 isoform X2 [Zea 
mays]
 ref|XP_008651331.1| PREDICTED: uncharacterized protein LOC100279561 isoform X2 [Zea 
mays]
Length=454

 Score =   369 bits (947),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 172/325 (53%), Positives = 231/325 (71%), Gaps = 2/325 (1%)
 Frame = -2

Query  1244  VKAVIAFGDSIVDQGMNNNLSTMIKTNFPPYGQDFMGGKHTGRYSNGKTPPDLVAEELGI  1065
             V A++ FGDSIVD G NN + T+ K+NF PYG+D  GG  TGR+SNG+ P D VA  LG+
Sbjct  129   VPAILVFGDSIVDTGNNNAVLTLTKSNFRPYGKDLNGGVPTGRFSNGRIPTDFVASRLGL  188

Query  1064  KELVPAYLDPHLQPEDIKTGVSFASGASGYDPQTAALMSVIPLSEQLKYFKEYLGKLNAM  885
             K+LVPAYL   L  +D+ TGVSFASG +GYDP T+ L++V+P+ E+L  F EY  +L  +
Sbjct  189   KDLVPAYLGTDLSDDDLCTGVSFASGGTGYDPLTSTLVAVLPMQEELNMFAEYKERLAGV  248

Query  884   VG-EKEAKSIINNTLFMVVSGSDDLANTYFTIGIRRYQYDINSYTDLLLEGASNFLQELY  708
             VG E  A  I+  +LF+V +GSDD+AN Y+   +R  QYDI++Y D L+E A +F+++LY
Sbjct  249   VGDEAAAAGIVAESLFLVCAGSDDIANNYYLAPVRPLQYDISAYVDFLVEQACDFIRQLY  308

Query  707   SLGARRIGFFGIPPVGCLPSQRTLAGGSERECVENYNQAAQLANAKFSAEIKILSKKLPN  528
               GARRI   G+PPVGC+PSQRTLAGG  R+C    N AAQL N++   E+ +L K+L  
Sbjct  309   QQGARRIAVLGMPPVGCVPSQRTLAGGLARDCDPARNHAAQLYNSRLKEEVVLLQKELAC  368

Query  527   SKLIFIDIYEDFLDMIKNPAKYGFEVVNLGCCGTGTIEVTMLCNKLSG-TCPDRNKYLFW  351
              ++ ++DIY+   DMI NP KYGFEV   GCCGTG +EV++LCN+L+  TCPD  KY+FW
Sbjct  369   QRIGYVDIYDVLQDMITNPCKYGFEVSTRGCCGTGDLEVSLLCNQLTAPTCPDDRKYVFW  428

Query  350   DSYHPTEKGYRIIVNRIITKYINSF  276
             DS+HPTEK Y IIV+ +  +YI + 
Sbjct  429   DSFHPTEKAYEIIVDYLFPRYIENL  453



>ref|NP_001146030.1| uncharacterized protein LOC100279561 [Zea mays]
 gb|ACL53063.1| unknown [Zea mays]
Length=410

 Score =   367 bits (941),  Expect = 4e-119, Method: Compositional matrix adjust.
 Identities = 171/325 (53%), Positives = 231/325 (71%), Gaps = 2/325 (1%)
 Frame = -2

Query  1244  VKAVIAFGDSIVDQGMNNNLSTMIKTNFPPYGQDFMGGKHTGRYSNGKTPPDLVAEELGI  1065
             V A++ FGDSIVD G NN + T+ K+NF PYG+D  GG  TGR+SNG+ P D VA  LG+
Sbjct  85    VPAILVFGDSIVDTGNNNAVLTLTKSNFRPYGKDLNGGVPTGRFSNGRIPTDFVASRLGL  144

Query  1064  KELVPAYLDPHLQPEDIKTGVSFASGASGYDPQTAALMSVIPLSEQLKYFKEYLGKLNAM  885
             K+LVPAYL   L  +D+ TGVSFASG +GYDP T+ L++V+P+ E+L  F EY  +L  +
Sbjct  145   KDLVPAYLGTDLSDDDLCTGVSFASGGTGYDPLTSTLVAVLPMQEELNMFAEYKERLAGV  204

Query  884   VG-EKEAKSIINNTLFMVVSGSDDLANTYFTIGIRRYQYDINSYTDLLLEGASNFLQELY  708
             VG E  A  I+  +LF+V +GSDD+AN Y+   +R  QYDI++Y D L+E A +F+++LY
Sbjct  205   VGDEAAAAGIVAESLFLVCAGSDDIANNYYLAPVRPLQYDISAYVDFLVEQACDFIRQLY  264

Query  707   SLGARRIGFFGIPPVGCLPSQRTLAGGSERECVENYNQAAQLANAKFSAEIKILSKKLPN  528
               GARRI   G+PPVGC+PSQRTLAGG  R+C    N AAQL N++   E+ +L K+L  
Sbjct  265   QQGARRIAVLGMPPVGCVPSQRTLAGGLARDCDPARNHAAQLYNSRLKEEVVLLQKELAC  324

Query  527   SKLIFIDIYEDFLDMIKNPAKYGFEVVNLGCCGTGTIEVTMLCNKLSG-TCPDRNKYLFW  351
              ++ ++DIY+   DMI NP KYGFEV   GCCGTG +EV++LCN+L+  TCPD  +Y+FW
Sbjct  325   QRIGYVDIYDVLQDMITNPCKYGFEVSTRGCCGTGDLEVSLLCNQLTAPTCPDDREYVFW  384

Query  350   DSYHPTEKGYRIIVNRIITKYINSF  276
             DS+HPTEK Y IIV+ +  +YI + 
Sbjct  385   DSFHPTEKAYEIIVDYLFPRYIENL  409



>ref|XP_008809448.1| PREDICTED: uncharacterized protein LOC103721152 [Phoenix dactylifera]
Length=864

 Score =   380 bits (977),  Expect = 4e-119, Method: Compositional matrix adjust.
 Identities = 176/342 (51%), Positives = 248/342 (73%), Gaps = 1/342 (0%)
 Frame = -2

Query  1307  IAFLVLAGCSEAKIKLPNGLVVKAVIAFGDSIVDQGMNNNLSTMIKTNFPPYGQDFMGGK  1128
             +A  +L   + A  +     +V AVI FGDSIVD G NN+L T++K NFPPYGQDF+  +
Sbjct  13    MALCLLVAQALASAQNRTAPMVPAVIVFGDSIVDAGNNNDLETIVKCNFPPYGQDFIDHQ  72

Query  1127  HTGRYSNGKTPPDLVAEELGIKELVPAYLDPHLQPEDIKTGVSFASGASGYDPQTAALMS  948
              TGR+SNGK P D +A  +G+KEL+P Y+   LQPEDI TGV+FASGA+GYDP T+ +++
Sbjct  73    PTGRFSNGKVPSDFIASMMGVKELLPPYIGYDLQPEDILTGVTFASGATGYDPLTSTILN  132

Query  947   VIPLSEQLKYFKEYLGKLNAMVGEKEAKSIINNTLFMVVSGSDDLANTYFTIGIRRYQYD  768
             VI + +QLK F+EY  ++ A+ GE+   SI++ +L++V +G+DD+ANTYFT   R+  YD
Sbjct  133   VISMPDQLKMFEEYKERMKAIAGEERTASILSKSLYVVCAGTDDIANTYFTTPFRQQHYD  192

Query  767   INSYTDLLLEGASNFLQELYSLGARRIGFFGIPPVGCLPSQRTLAGGSERECVENYNQAA  588
             I SY +LL+ GAS FL++L  +GA++IGF  +PP+GC+PSQRTL GG  R+C    NQAA
Sbjct  193   IPSYVNLLITGASTFLEKLVEMGAQKIGFVSLPPIGCVPSQRTLGGGILRDCEPTRNQAA  252

Query  587   QLANAKFSAEIKILSKKLPNSKLIFIDIYEDFLDMIKNPAKYGFEVVNLGCCGTGTIEVT  408
             +L N+K   EI I++ +    K+I+IDIY   LD+I  P+KYGF+V   GCCGTG +EV+
Sbjct  253   RLFNSKIKEEIDIIAGQHKGIKIIYIDIYSILLDLILQPSKYGFDVSTKGCCGTGELEVS  312

Query  407   MLCNKLSG-TCPDRNKYLFWDSYHPTEKGYRIIVNRIITKYI  285
             +LCN+L+  TC +  +Y+FWDSYHPTE+ Y+I+V++I   YI
Sbjct  313   VLCNRLTASTCSNITEYVFWDSYHPTERAYKIMVDKIFKDYI  354


 Score =   367 bits (942),  Expect = 6e-114, Method: Compositional matrix adjust.
 Identities = 174/318 (55%), Positives = 228/318 (72%), Gaps = 2/318 (1%)
 Frame = -2

Query  1238  AVIAFGDSIVDQGMNNNLSTMIKTNFPPYGQDFMGGKHTGRYSNGKTPPDLVAEELGIKE  1059
             A+I FGDSIVD G NN + T ++ NFPPYG+DF+G K TGR+SNGK P D++A  +GIKE
Sbjct  542   ALIVFGDSIVDPGNNNAIITTVRCNFPPYGKDFVGHKATGRFSNGKIPSDILASLIGIKE  601

Query  1058  LVPAYLDPHLQPEDIKTGVSFASGASGYDPQTAALMSVIPLSEQLKYFKEYLGKLNAMVG  879
              VPAYL   L  +D+ TGVSFASG  GYDP TA L+  + + +QL  FKEY  KL A+ G
Sbjct  602   YVPAYLGTKLDAQDLLTGVSFASGGGGYDPLTAQLVQALTMDDQLNLFKEYKEKLKAIAG  661

Query  878   EKEAKSIINNTLFMVVSGSDDLANTYFTIGIRRYQYDINSYTDLLLEGASNFLQELYSLG  699
             EK+A +II+ +L++VV+G+DDLANTYFT   RR  YD++SY   +++ AS+F Q+LY LG
Sbjct  662   EKKASTIISRSLYIVVTGNDDLANTYFTSPFRR-NYDLSSYIRFVVQSASSFFQKLYRLG  720

Query  698   ARRIGFFGIPPVGCLPSQRTLAGGSERECVENYNQAAQLANAKFSAEIKILSKKLPNSKL  519
             ARRIG  G+PPVGCLPSQR+ AGG ER+CV  YNQA++  N++   EI+ L+  L  S++
Sbjct  721   ARRIGITGLPPVGCLPSQRSRAGGIERDCVTLYNQASKTLNSELQKEIQRLNHTLAGSRI  780

Query  518   IFIDIYEDFLDMIKNPAKYGFEVVNLGCCGTGTIEVTMLCNKLSG-TCPDRNKYLFWDSY  342
             ++ID+Y   LDMI  P  YGFE V  GCCGTG  EVT  CN  +   C D +KYLFWD Y
Sbjct  781   VYIDMYTPLLDMIIRPFAYGFEEVKRGCCGTGIFEVTFTCNSYTAPACDDVSKYLFWDVY  840

Query  341   HPTEKGYRIIVNRIITKY  288
             HPTE+ Y I++ ++  +Y
Sbjct  841   HPTERAYNILMRQVQQRY  858


 Score = 97.8 bits (242),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 56/130 (43%), Positives = 78/130 (60%), Gaps = 20/130 (15%)
 Frame = -2

Query  1103  KTPPDL-VAEELGIKELVPAYLDPHLQPEDIKTGVSFASGASGYDPQTAALMSVIPLSEQ  927
             K PP L +A  LGIKE VPAYL   L  +D+ TG                    + L +Q
Sbjct  371   KVPPFLHIASLLGIKEHVPAYLGTKLDAQDLLTG------------------QALTLDDQ  412

Query  926   LKYFKEYLGKLNAMVGEKEAKSIINNTLFMVVSGSDDLANTYFTIGIRRYQYDINSYTDL  747
             L  FKEY  KL A+ GEK+A +II+ +L+++V+G+DDLANTYFT   RR  YD+++Y   
Sbjct  413   LNLFKEYKEKLRAIAGEKKASTIISRSLYIIVTGNDDLANTYFTSPFRR-NYDLSAYIRF  471

Query  746   LLEGASNFLQ  717
             +++ AS+F Q
Sbjct  472   VVQSASSFFQ  481



>ref|NP_001242335.1| uncharacterized protein LOC100810354 [Glycine max]
 gb|ACU19734.1| unknown [Glycine max]
Length=366

 Score =   364 bits (934),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 169/335 (50%), Positives = 234/335 (70%), Gaps = 2/335 (1%)
 Frame = -2

Query  1274  AKIKLPNGLVVKAVIAFGDSIVDQGMNNNLSTMIKTNFPPYGQDFMGGKH-TGRYSNGKT  1098
             + + LPN   V AVI FGDSIVD G NN ++T++K NF PYG+DF GG   TGR+SNG T
Sbjct  31    SAVSLPNNETVPAVIVFGDSIVDSGNNNYINTILKCNFQPYGRDFAGGNQPTGRFSNGLT  90

Query  1097  PPDLVAEELGIKELVPAYLDPHLQPEDIKTGVSFASGASGYDPQTAALMSVIPLSEQLKY  918
             P  ++A + G+K+++PAYLDP LQP+D+ TGVSFASG SGYDP T+  +SV+ LS+QL  
Sbjct  91    PSGIIAAKFGVKKILPAYLDPKLQPQDLLTGVSFASGGSGYDPLTSKTVSVLSLSDQLDK  150

Query  917   FKEYLGKLNAMVGEKEAKSIINNTLFMVVSGSDDLANTYFTIGIRRYQYDINSYTDLLLE  738
             F EY  K+   VGE    +II+ +++++ +GS+D+ANTY    +RR  YD+  YTDL+  
Sbjct  151   FSEYKNKIKGTVGENRMATIISKSIYVLCTGSNDVANTYSLSPVRRAHYDVPEYTDLMAS  210

Query  737   GASNFLQELYSLGARRIGFFGIPPVGCLPSQRTLAGGSERECVENYNQAAQLANAKFSAE  558
              A+NFLQELY LGARRIG  G+P +GC+PSQRT+ GG  R C +  NQAA L N+K S++
Sbjct  211   QATNFLQELYGLGARRIGVIGLPVLGCVPSQRTIQGGILRSCSDFENQAAMLFNSKLSSQ  270

Query  557   IKILSKKLPNSKLIFIDIYEDFLDMIKNPAKYGFEVVNLGCCGTGTIEVTMLCNKLS-GT  381
                L+K  P ++ +++DIY   L+MI+NP+ YGF+V N GCCGTG IE  +LCN  +   
Sbjct  271   TDALNKNFPEARFVYLDIYNPLLNMIQNPSTYGFKVTNEGCCGTGIIEAGILCNPFTLQI  330

Query  380   CPDRNKYLFWDSYHPTEKGYRIIVNRIITKYINSF  276
             C +   Y+FWDS+HPTE+ Y ++ + ++   I  F
Sbjct  331   CSNTANYIFWDSFHPTEEAYNVLCSLVLDNKIKDF  365



>ref|XP_010935130.1| PREDICTED: GDSL esterase/lipase EXL3-like [Elaeis guineensis]
Length=364

 Score =   364 bits (934),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 172/321 (54%), Positives = 228/321 (71%), Gaps = 1/321 (0%)
 Frame = -2

Query  1244  VKAVIAFGDSIVDQGMNNNLSTMIKTNFPPYGQDFMGGKHTGRYSNGKTPPDLVAEELGI  1065
             V AV AFGDSIVD G NN + T  K NFPPYG+DF+G   TGR+SNGK P D +A  LG+
Sbjct  44    VPAVFAFGDSIVDPGNNNMVLTPAKCNFPPYGRDFIGHTATGRFSNGKIPTDFIASLLGV  103

Query  1064  KELVPAYLDPHLQPEDIKTGVSFASGASGYDPQTAALMSVIPLSEQLKYFKEYLGKLNAM  885
             KEL+PAYLDP ++ +D+ TGVSFASG +G+D  TA + SV  L +QL+ FKEY  KL A+
Sbjct  104   KELLPAYLDPEIKEQDLLTGVSFASGGAGFDNLTAEIPSVFSLWDQLEMFKEYKRKLEAI  163

Query  884   VGEKEAKSIINNTLFMVVSGSDDLANTYFTIGIRRYQYDINSYTDLLLEGASNFLQELYS  705
              GE+ A +I+  +L  + +GS+DL  TYFT  +R   YD+ SY + LL+  S+FL+ELY+
Sbjct  164   AGEERAANIVMESLCTIFAGSNDLMTTYFTTSVRALNYDLPSYINFLLQAVSSFLEELYN  223

Query  704   LGARRIGFFGIPPVGCLPSQRTLAGGSERECVENYNQAAQLANAKFSAEIKILSKKLPNS  525
             LGAR+IG  G+PP+GC+P+QRTL GG  R+CV+ YNQA+   N + S E++ L+   P +
Sbjct  224   LGARKIGVVGVPPIGCVPAQRTLKGGIARDCVDTYNQASIKFNGELSMELERLATYHPGA  283

Query  524   KLIFIDIYEDFLDMIKNPAKYGFEVVNLGCCGTGTIEVTMLCNKLSG-TCPDRNKYLFWD  348
              +I+ID+Y   L++I +P+ YGFE    GCCGTG IE T+LCN LS  TCPD  KYLFWD
Sbjct  284   NIIYIDVYNPLLELILHPSHYGFEETTKGCCGTGEIEATILCNDLSPFTCPDATKYLFWD  343

Query  347   SYHPTEKGYRIIVNRIITKYI  285
              +HPTEKGY I++  +   YI
Sbjct  344   GFHPTEKGYEILLQFLHKSYI  364



>gb|KHN41128.1| GDSL esterase/lipase EXL3 [Glycine soja]
Length=367

 Score =   364 bits (934),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 172/335 (51%), Positives = 239/335 (71%), Gaps = 4/335 (1%)
 Frame = -2

Query  1268  IKLPNGLVVKAVIAFGDSIVDQGMNNNLSTMIKTNFPPYGQDFMGGKH-TGRYSNGKTPP  1092
             + LPN   V AVI FGDSIVD G NN ++T+ K NF PYG+DF GG   TGR+SNG TP 
Sbjct  32    VSLPNNESVPAVIVFGDSIVDTGNNNYINTIAKVNFLPYGKDFGGGNQPTGRFSNGLTPS  91

Query  1091  DLVAEELGIKELVPAYLDPHLQPEDIKTGVSFASGASGYDPQTA--ALMSVIPLSEQLKY  918
             D++A +LG+K+L+P YLDP LQP+D+ TGVSFASG SGYDP T+  A+ +++ LS+QL  
Sbjct  92    DIIAAKLGVKKLLPPYLDPKLQPQDLLTGVSFASGGSGYDPLTSKIAVNNLLSLSDQLDK  151

Query  917   FKEYLGKLNAMVGEKEAKSIINNTLFMVVSGSDDLANTYFTIGIRRYQYDINSYTDLLLE  738
             F+EY  K+   VG     +II+ +++++ +GS+D+ANTY     RR QYDI SY D +++
Sbjct  152   FREYKNKIKETVGGNRTTTIISKSIYILCTGSNDIANTYSLSPFRRLQYDIQSYIDFMIK  211

Query  737   GASNFLQELYSLGARRIGFFGIPPVGCLPSQRTLAGGSERECVENYNQAAQLANAKFSAE  558
              A+NFL+ELY LGARRIG  G+P +GC+P QRT+ GG  REC +  N AA L N K S++
Sbjct  212   QATNFLKELYGLGARRIGVIGLPVLGCVPFQRTIQGGIHRECSDFENHAATLFNNKLSSQ  271

Query  557   IKILSKKLPNSKLIFIDIYEDFLDMIKNPAKYGFEVVNLGCCGTGTIEVTMLCNKLS-GT  381
             I  L K+ P +K ++++IY   L+MI+N  KYGFEV + GCCGTG  EV  LCN+L+   
Sbjct  272   IDALKKQFPETKFVYLEIYNPLLNMIQNATKYGFEVTDKGCCGTGDFEVGFLCNRLTPHI  331

Query  380   CPDRNKYLFWDSYHPTEKGYRIIVNRIITKYINSF  276
             C + + Y+FWDS+HPTE+GY+++ ++++ K I  F
Sbjct  332   CSNTSSYIFWDSFHPTEEGYKVLCSQVLDKNIKDF  366



>ref|NP_199032.2| GDSL esterase/lipase [Arabidopsis thaliana]
 sp|Q9FHW9.2|GDL90_ARATH RecName: Full=GDSL esterase/lipase At5g42170; AltName: Full=Extracellular 
lipase At5g42170; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AED94775.1| GDSL esterase/lipase [Arabidopsis thaliana]
Length=369

 Score =   364 bits (934),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 173/329 (53%), Positives = 234/329 (71%), Gaps = 4/329 (1%)
 Frame = -2

Query  1268  IKLPNGLVVKAVIAFGDSIVDQGMNNNLSTMIKTNFPPYGQDFMGGKHTGRYSNGKTPPD  1089
             IKLP  + +  +I FGDSIVD G NN+L T +K NFPPYG+DF G   TGR+S+G+ P D
Sbjct  40    IKLPPNVTIPGIITFGDSIVDSGNNNHLRTALKCNFPPYGKDFPGKIATGRFSDGRVPSD  99

Query  1088  LVAEELGIKELVPAYLDPHLQPEDIKTGVSFASGASGYDPQTAALMSVIPLSEQLKYFKE  909
             +VAE LGI E +PAYL+P L+ ED+  GV+FASG SGYDP TA L+ V+ LS+QLK F+E
Sbjct  100   IVAERLGIAETIPAYLNPKLKNEDLLKGVNFASGGSGYDPLTAKLVKVVSLSDQLKNFQE  159

Query  908   YLGKLNAMVGEKEAKSIINNTLFMVVSGSDDLANTYFTIGIRRYQYDINSYTDLLLEGAS  729
             Y  KL  +VGE++A  ++ N+L++VV+ S+D+A+TY     R  +Y+  SY D L + AS
Sbjct  160   YKNKLKVIVGEEKANFLVKNSLYLVVASSNDIAHTYTA---RSIKYNKTSYADYLADSAS  216

Query  728   NFLQELYSLGARRIGFFGIPPVGCLPSQRTLAGGSERECVENYNQAAQLANAKFSAEIKI  549
              F+  LY LGARRIG F   PVGC+P+ RTL G  +R C E  N+ A+  NAK S  ++ 
Sbjct  217   KFVSALYGLGARRIGVFSAVPVGCVPAARTLRGKLKRRCSEKLNEVARNFNAKISPTLEA  276

Query  548   LSKKLPNSKLIFIDIYEDFLDMIKNPAKYGFEVVNLGCCGTGTIEVTMLCNKLSG-TCPD  372
             L K+LP+S+++ ID+ +   DMI+NP  YGFEV N GCCGTG +EV  LCNK++  TC +
Sbjct  277   LGKELPDSRVVLIDVCDTLNDMIENPKNYGFEVSNRGCCGTGLVEVLFLCNKINPFTCKN  336

Query  371   RNKYLFWDSYHPTEKGYRIIVNRIITKYI  285
              + Y+FWDSYHPTEK Y+IIV++++  YI
Sbjct  337   SSSYIFWDSYHPTEKAYQIIVDKLLGNYI  365



>emb|CDX87653.1| BnaA07g32200D [Brassica napus]
Length=306

 Score =   361 bits (927),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 166/301 (55%), Positives = 224/301 (74%), Gaps = 1/301 (0%)
 Frame = -2

Query  1181  TMIKTNFPPYGQDFMGGKHTGRYSNGKTPPDLVAEELGIKELVPAYLDPHLQPEDIKTGV  1002
             T  + ++PPYG DF GG  TGR+SNGK P D++AEELG+K  +PAY DP+L+PED+ TGV
Sbjct  3     TEARCDYPPYGIDFDGGVATGRFSNGKVPTDILAEELGLKPSIPAYRDPNLKPEDLLTGV  62

Query  1001  SFASGASGYDPQTAALMSVIPLSEQLKYFKEYLGKLNAMVGEKEAKSIINNTLFMVVSGS  822
             +FASG +GY P T  +   IPLS+QLKYF+EY+ KLN MVGE+  K I+ N++F+V+ GS
Sbjct  63    TFASGGAGYVPFTTQIAGGIPLSQQLKYFEEYIEKLNGMVGEERTKFILKNSMFVVICGS  122

Query  821   DDLANTYFTIGIRRYQYDINSYTDLLLEGASNFLQELYSLGARRIGFFGIPPVGCLPSQR  642
             +D+AN +F +   R QY ++S+T L+ + A +F + LY  GARRI  FG PP+GC+PSQR
Sbjct  123   NDIANDFFGLPTVRLQYTVDSFTALMADNARSFAKSLYGYGARRILMFGAPPIGCVPSQR  182

Query  641   TLAGGSERECVENYNQAAQLANAKFSAEIKILSKKLPNSKLIFIDIYEDFLDMIKNPAKY  462
             T+AGG  R+CV  +N A++L NAK S  I +LS+ L +SKLI++DIY   LD+I NP +Y
Sbjct  183   TVAGGPTRDCVVRFNDASKLFNAKLSGNIDVLSRTLLDSKLIYVDIYSPLLDLILNPGQY  242

Query  461   GFEVVNLGCCGTGTIEVTMLCNK-LSGTCPDRNKYLFWDSYHPTEKGYRIIVNRIITKYI  285
             GF+V NLGCCGTG IEVT LCN   S  CP R+ Y+FWDS+HPTE  YRIIV +++ +Y+
Sbjct  243   GFKVSNLGCCGTGLIEVTALCNNYTSAVCPIRSDYVFWDSFHPTETAYRIIVAKLLDRYL  302

Query  284   N  282
             +
Sbjct  303   S  303



>ref|XP_008806618.1| PREDICTED: GDSL esterase/lipase EXL3-like [Phoenix dactylifera]
Length=337

 Score =   362 bits (929),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 171/328 (52%), Positives = 230/328 (70%), Gaps = 1/328 (0%)
 Frame = -2

Query  1280  SEAKIKLPNGLVVKAVIAFGDSIVDQGMNNNLSTMIKTNFPPYGQDFMGGKHTGRYSNGK  1101
             S+A +       V AV AFGDS+VD G NN L T  K NFPPYG+DF+G + TGR+SNGK
Sbjct  4     SQALVPEQRAARVPAVFAFGDSVVDSGNNNMLLTTAKCNFPPYGRDFIGHRATGRFSNGK  63

Query  1100  TPPDLVAEELGIKELVPAYLDPHLQPEDIKTGVSFASGASGYDPQTAALMSVIPLSEQLK  921
              P DL A  LG+KEL+PAYLDP ++  D+ TGVSFASG +GYD  TA +  V  L +QL+
Sbjct  64    IPTDLFASYLGVKELLPAYLDPDIKEHDLLTGVSFASGGAGYDNLTAEIPLVFSLWDQLE  123

Query  920   YFKEYLGKLNAMVGEKEAKSIINNTLFMVVSGSDDLANTYFTIGIRRYQYDINSYTDLLL  741
              FKEY  KL A+ GE  A +I+  +  ++ SG++DL  TYFT  IR   YD+ SY + +L
Sbjct  124   MFKEYKRKLEAIAGEMRAANIVAESQCIIFSGTNDLMTTYFTTSIRALSYDLPSYINFML  183

Query  740   EGASNFLQELYSLGARRIGFFGIPPVGCLPSQRTLAGGSERECVENYNQAAQLANAKFSA  561
             + AS+F++ELYSLGAR+I   G+PP+GC+P+QRTL GG  R+CV+ YNQA+   N++ S 
Sbjct  184   QAASSFVEELYSLGARKIAVIGVPPIGCVPAQRTLKGGITRDCVDTYNQASIKFNSELSM  243

Query  560   EIKILSKKLPNSKLIFIDIYEDFLDMIKNPAKYGFEVVNLGCCGTGTIEVTMLCNKLSG-  384
              ++ L+   P +++++IDIY   L++I +P+ YGFE    GCCGTG IE T+LCN L+  
Sbjct  244   RLERLATYHPGARIMYIDIYNPLLELILHPSDYGFEEATKGCCGTGKIEATILCNDLTPF  303

Query  383   TCPDRNKYLFWDSYHPTEKGYRIIVNRI  300
             TCPD  KYLFWD +HPTE+GY I+V +I
Sbjct  304   TCPDATKYLFWDGFHPTERGYEILVTKI  331



>ref|XP_004509383.1| PREDICTED: GDSL esterase/lipase EXL3-like [Cicer arietinum]
Length=358

 Score =   363 bits (931),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 173/347 (50%), Positives = 236/347 (68%), Gaps = 3/347 (1%)
 Frame = -2

Query  1313  CIIAFLVLAGCSEAKIKLPNGLVVKAVIAFGDSIVDQGMNNNLSTMIKTNFPPYGQDFMG  1134
             C +  +++   S   + LPN   V AVI FGDSIVD G NN ++T+IK +FPPYG+DF  
Sbjct  13    CFVISIIIQNVSA--MTLPNNETVPAVIVFGDSIVDSGNNNYITTLIKCDFPPYGRDFTD  70

Query  1133  GKHTGRYSNGKTPPDLVAEELGIKELVPAYLDPHLQPEDIKTGVSFASGASGYDPQTAAL  954
             G  TGR+SNG  P D++A + G+K  +PAYLDP+ Q +D+ +GVSFASG +GYDP TA L
Sbjct  71    GNPTGRFSNGLVPSDIIAAKFGVKNFLPAYLDPNTQLQDLLSGVSFASGGAGYDPLTAEL  130

Query  953   MSVIPLSEQLKYFKEYLGKLNAMVGEKEAKSIINNTLFMVVSGSDDLANTYFTIGIRRYQ  774
              SVI LS QL  FKEY+ K+   VG  + K I++ ++++V  GSDD+ANTY     R  Q
Sbjct  131   TSVISLSGQLDMFKEYIKKVEKAVGRNKRKIIVSKSIYIVCIGSDDIANTYAQTPFRNVQ  190

Query  773   YDINSYTDLLLEGASNFLQELYSLGARRIGFFGIPPVGCLPSQRTLAGGSERECVENYNQ  594
             YDI SYTD +   AS FLQELY LG RRIG F IP +GC+PSQRT++GG  R C ++ NQ
Sbjct  191   YDIPSYTDFMASEASKFLQELYGLGGRRIGVFNIPVIGCVPSQRTISGGMLRVCSDSSNQ  250

Query  593   AAQLANAKFSAEIKILSKKLPNSKLIFIDIYEDFLDMIKNPAKYGFEVVNLGCCGTGTIE  414
             AA+L N+K  +++++L K   +++ +++D Y   +D+I+NP KYGF     GCCGTG IE
Sbjct  251   AAKLFNSKLYSKMRVLGKMYSDARFVYLDSYNPLMDIIQNPTKYGFNETEKGCCGTGNIE  310

Query  413   VTMLCNKLS-GTCPDRNKYLFWDSYHPTEKGYRIIVNRIITKYINSF  276
             V +LCN  S  TC + + Y+FWDSYHPTEK Y ++ + ++   I  F
Sbjct  311   VGILCNPFSINTCSNPSDYVFWDSYHPTEKTYYVLSSLVLDNKIKDF  357



>emb|CBI19911.3| unnamed protein product [Vitis vinifera]
Length=290

 Score =   360 bits (924),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 167/289 (58%), Positives = 217/289 (75%), Gaps = 1/289 (0%)
 Frame = -2

Query  1139  MGGKHTGRYSNGKTPPDLVAEELGIKELVPAYLDPHLQPEDIKTGVSFASGASGYDPQTA  960
             MGG  TGR+SNGK PPD +AEELGIKEL+P Y +P LQ  D+ TGVSFAS  SGYDP T 
Sbjct  1     MGGFPTGRFSNGKIPPDFIAEELGIKELLPPYSNPALQLSDLLTGVSFASSGSGYDPMTP  60

Query  959   ALMSVIPLSEQLKYFKEYLGKLNAMVGEKEAKSIINNTLFMVVSGSDDLANTYFTIGIRR  780
              L SV+ L +QL+ FKEY+ KL  MVGE+   +I++ +LF+VV+GSDD+AN+YF  G+R+
Sbjct  61    KLASVLSLRDQLEMFKEYIRKLKMMVGEERTNTILSKSLFLVVAGSDDIANSYFVSGVRK  120

Query  779   YQYDINSYTDLLLEGASNFLQELYSLGARRIGFFGIPPVGCLPSQRTLAGGSERECVENY  600
              QYD+ +YTDL++  AS+F +ELY LGARRI     PP+GCLPSQR+LAGG  REC E++
Sbjct  121   IQYDVPAYTDLMIASASSFFKELYGLGARRIVVGSAPPLGCLPSQRSLAGGILRECAEDH  180

Query  599   NQAAQLANAKFSAEIKILSKKLPNSKLIFIDIYEDFLDMIKNPAKYGFEVVNLGCCGTGT  420
             N AA+L N K S+++  L+   P +K ++IDIY  FLD+I+NP K GFEVV+ GCCGTG 
Sbjct  181   NDAAKLFNTKLSSQLDSLNANFPQAKFVYIDIYNPFLDLIQNPQKSGFEVVDKGCCGTGK  240

Query  419   IEVTMLCNKLSG-TCPDRNKYLFWDSYHPTEKGYRIIVNRIITKYINSF  276
             IEV +LCN  S  TC D + Y+FWDSYHPTEK Y++++  II K ++SF
Sbjct  241   IEVAVLCNPFSPFTCEDASNYVFWDSYHPTEKAYKVLIGEIIQKCVDSF  289



>ref|XP_010320539.1| PREDICTED: GDSL esterase/lipase EXL3-like [Solanum lycopersicum]
Length=605

 Score =   371 bits (952),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 181/273 (66%), Positives = 216/273 (79%), Gaps = 1/273 (0%)
 Frame = -2

Query  1277  EAKIKLPNGLVVKAVIAFGDSIVDQGMNNNLSTMIKTNFPPYGQDFMGGKHTGRYSNGKT  1098
             E K++LPN +VVKAV AFGDSIVDQG NN + T+ K NFPPYG+DF GG  TGR+ NGKT
Sbjct  8     EGKVQLPNNVVVKAVFAFGDSIVDQGNNNYIPTIAKCNFPPYGKDFNGGIPTGRFCNGKT  67

Query  1097  PPDLVAEELGIKELVPAYLDPHLQPEDIKTGVSFASGASGYDPQTAALMSVIPLSEQLKY  918
             PPDL+ EELGIKE +PAYLD +L+ ED+KTGVSFASG  GYDP+T+ L   IPLS QL  
Sbjct  68    PPDLIVEELGIKEYIPAYLDSNLRNEDLKTGVSFASGGCGYDPRTSTLALAIPLSTQLNQ  127

Query  917   FKEYLGKLNAMVGEKEAKSIINNTLFMVVSGSDDLANTYFTIGIRRYQYDINSYTDLLLE  738
             FKEY+GKL  +VGE+EA  I+ N+LF+VV+GSDDLANTYFT+ +R  Q +I+SYTDL++ 
Sbjct  128   FKEYIGKLEGLVGEEEANYILKNSLFLVVAGSDDLANTYFTLEVRLKQ-NIDSYTDLMVS  186

Query  737   GASNFLQELYSLGARRIGFFGIPPVGCLPSQRTLAGGSERECVENYNQAAQLANAKFSAE  558
              A+ F QELY+LGAR+IG FGIPP+GCLPSQRTLAGG  R C + YN+AAQLAN KFS  
Sbjct  187   KATEFFQELYNLGARKIGIFGIPPIGCLPSQRTLAGGPNRVCAKEYNEAAQLANTKFSIA  246

Query  557   IKILSKKLPNSKLIFIDIYEDFLDMIKNPAKYG  459
             I  LSKKL  SKL+ IDIY  FLD+I NP KY 
Sbjct  247   IDSLSKKLAQSKLVLIDIYNPFLDIIVNPQKYA  279


 Score =   358 bits (918),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 173/327 (53%), Positives = 241/327 (74%), Gaps = 4/327 (1%)
 Frame = -2

Query  1274  AKIKLPNGLVVKAVIAFGDSIVDQGMNNNLSTMIKTNFPPYGQDFMGGKH-TGRYSNGKT  1098
             AK++L   + + A+ AFGDSIVDQG NNNL T  K NF PYG+DFMGG + TGR+SN +T
Sbjct  279   AKLQLRKDINITALFAFGDSIVDQGNNNNLITHAKCNFLPYGKDFMGGNNPTGRFSNART  338

Query  1097  PPDLVAEELGIKELVPAYLDPHLQPEDIKTGVSFASGASGYDPQTAALMSVIPLSEQLKY  918
             P D++ E+ GIK+L+PAYLD +L+ ED+KTGVSFASGASG+D  T  + S +PLS QL  
Sbjct  339   PADMLVEDFGIKKLMPAYLDSNLKVEDLKTGVSFASGASGFDLLTPVVASALPLSVQLAL  398

Query  917   FKEYLGKLNAMVGEKEAKSIINNTLFMVVSGSDDLANTYFTIGI-RRYQYDINSYTDLLL  741
             F++Y+ K+N  +GE+  K+I+  +L++VV+GSDDL NTYF +   R+ QY+++SYT+L++
Sbjct  399   FQQYIWKMNGFIGEEATKNIVKKSLYIVVAGSDDLCNTYFMLKFPRKIQYNVDSYTNLMV  458

Query  740   EGASNFLQELYSLGARRIGFFGIPPVGCLPSQRTLAGGSERECVENYNQAAQLANAKFSA  561
             +GASNF+ +LY++GARRI  FG+PP+GCLPSQ    GG  + CV  YNQAA++AN K S 
Sbjct  459   DGASNFINDLYNMGARRIWIFGLPPIGCLPSQILRGGGPSKICVNEYNQAARIANTKLSN  518

Query  560   EIKILSKKLPNSKLIFIDIYEDFLDMIKNPAKYGFEVVNLGCCGTGTIEVTMLCNKLSGT  381
             +I  L+KKLP  +L++I+IY+  LD+I    KYGFE     CC  G  E  +LC+ ++  
Sbjct  519   KIHSLNKKLPQIELLYINIYDPLLDIIAKHNKYGFEDALSACC-QGRNEY-LLCDNVTKI  576

Query  380   CPDRNKYLFWDSYHPTEKGYRIIVNRI  300
             C +   YLFWDSYH TEKGYR+++++I
Sbjct  577   CENDANYLFWDSYHLTEKGYRVLLDQI  603



>emb|CDP07367.1| unnamed protein product [Coffea canephora]
Length=367

 Score =   362 bits (930),  Expect = 4e-118, Method: Compositional matrix adjust.
 Identities = 174/333 (52%), Positives = 235/333 (71%), Gaps = 10/333 (3%)
 Frame = -2

Query  1274  AKIKLPNGLVVKAVIAFGDSIVDQGMNNNLSTMIKTNFPPYGQDFMGGKHTGRYSNGKTP  1095
             A  +LP    + AVI FGDSIVD G NNNL T+ K N+PPYGQDFMGG+ TGR+SNGK P
Sbjct  44    ANPELPYNSSIPAVIFFGDSIVDTGNNNNLVTIAKANYPPYGQDFMGGRPTGRFSNGKVP  103

Query  1094  PDLVAEELGIKELVPAYLDPHLQPEDIKTGVSFASGASGYDPQTAALMSVIPLSEQLKYF  915
              DL+AEELGIKE +PAYLDP+LQ ED++TGV+FASG +GYDP T+ L SV+ L++QL+ F
Sbjct  104   SDLIAEELGIKEALPAYLDPNLQTEDLRTGVNFASGGAGYDPLTSELASVLSLTDQLELF  163

Query  914   KEYLGKLNAMVGEKEAKSIINNTLFMVVSGSDDLANTYFTIGIRRYQYDINSYTDLLLEG  735
             +EYL KL+ + GE     I++N LF VV GS+D+ NTYF +G ++  YD+ SYTDL+L  
Sbjct  164   REYLTKLHEIFGEDNKNKILSNGLFAVVIGSNDITNTYFGLGGQKSHYDVPSYTDLMLNS  223

Query  734   ASNFLQELYSLGARRIGFFGIPPVGCLPSQRTLAGGSERECVENYNQAAQLANAKFSAEI  555
             AS+F+QELY +GA +I  FG+PP+GC+PSQRTL GG  R+C ++YNQ AQL N+K  AEI
Sbjct  224   ASSFIQELYKVGALKIAVFGLPPIGCMPSQRTLRGGVLRQCADDYNQMAQLFNSKLRAEI  283

Query  554   KILSKKLPNSKLIFIDIYEDFLDMIKNPAKYGFEVVNLGCCGTGTIEVTMLCNKLSGTCP  375
               L  + P ++++++DIY   LD+I  P KYG  + +L            LC     TC 
Sbjct  284   NSLDSRYPKARMVYVDIYNRPLDLINKPQKYGMLLPSLST-------FAFLCQY---TCS  333

Query  374   DRNKYLFWDSYHPTEKGYRIIVNRIITKYINSF  276
             +   Y+FWDS+H TE+ YR++V + + + + SF
Sbjct  334   NVLDYVFWDSFHLTERAYRVVVQQFLKQNLISF  366



>ref|XP_002463471.1| hypothetical protein SORBIDRAFT_01g000430 [Sorghum bicolor]
 gb|EER90469.1| hypothetical protein SORBIDRAFT_01g000430 [Sorghum bicolor]
Length=378

 Score =   363 bits (931),  Expect = 5e-118, Method: Compositional matrix adjust.
 Identities = 174/321 (54%), Positives = 228/321 (71%), Gaps = 1/321 (0%)
 Frame = -2

Query  1247  VVKAVIAFGDSIVDQGMNNNLSTMIKTNFPPYGQDFMGGKHTGRYSNGKTPPDLVAEELG  1068
             VV AVI FGDSIVD G NN+L T+IK N PPYG+D    + TGRYSNG  P DL+A++LG
Sbjct  53    VVTAVIVFGDSIVDPGNNNDLHTLIKANHPPYGKDLFNHEATGRYSNGLIPSDLIAQQLG  112

Query  1067  IKELVPAYLDPHLQPEDIKTGVSFASGASGYDPQTAALMSVIPLSEQLKYFKEYLGKLNA  888
             +K+LVPAYL   L PED+ TGVSFASGA+G+DP T  ++SVI + +QL YF EY GKL  
Sbjct  113   VKQLVPAYLGVDLSPEDLLTGVSFASGATGFDPLTPVVVSVISMDQQLAYFDEYRGKLVD  172

Query  887   MVGEKEAKSIINNTLFMVVSGSDDLANTYFTIGIRRYQYDINSYTDLLLEGASNFLQELY  708
             + GE+E   II+  LF+V +G+DD+ANTYFT   R  +YDI SY +LL+ GA  FL+++ 
Sbjct  173   IAGEEETARIIDGALFVVCAGTDDVANTYFTTPFRSVEYDIPSYVELLVSGAEEFLRKVS  232

Query  707   SLGARRIGFFGIPPVGCLPSQRTLAGGSERECVENYNQAAQLANAKFSAEIKILSKKLPN  528
             + GAR+IGF G+PPVGC+PSQRTL GG  R C  + N+AAQL NA+    I  L+ +   
Sbjct  233   ARGARKIGFVGMPPVGCVPSQRTLGGGLARACEPSRNEAAQLYNARIQEMIAGLNAEQTQ  292

Query  527   SKLIFIDIYEDFLDMIKNPAKYGFEVVNLGCCGTGTIEVTMLCN-KLSGTCPDRNKYLFW  351
             + ++F+DIY    D++++  KYGF     GCCGTGTIEVT LC+ +    C D +K++F+
Sbjct  293   TLVVFLDIYRILDDLMEHGDKYGFADTTRGCCGTGTIEVTGLCDSRFVSVCDDVSKHVFF  352

Query  350   DSYHPTEKGYRIIVNRIITKY  288
             DSYHPTE+ YRIIVN +   Y
Sbjct  353   DSYHPTERAYRIIVNDVFDNY  373



>ref|NP_001077829.1| GDSL esterase/lipase EXL2 [Arabidopsis thaliana]
 gb|ABE65777.1| family II extracellular lipase 2 [Arabidopsis thaliana]
 gb|AEE35771.1| GDSL esterase/lipase EXL2 [Arabidopsis thaliana]
Length=366

 Score =   361 bits (927),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 172/346 (50%), Positives = 239/346 (69%), Gaps = 3/346 (1%)
 Frame = -2

Query  1313  CIIAFLVLAGCS-EAKIKLPNGLVVKAVIAFGDSIVDQGMNNN-LSTMIKTNFPPYGQDF  1140
             C+   ++L   S  A +K P      A+I FGDSIVD G N++ ++T+ + N+PPYG DF
Sbjct  21    CVFFLVLLCKTSTNALVKQPPNETTPAIIVFGDSIVDAGNNDDIMTTLARCNYPPYGIDF  80

Query  1139  MGGKHTGRYSNGKTPPDLVAEELGIKELVPAYLDPHLQPEDIKTGVSFASGASGYDPQTA  960
              GG  TGR+ NGK   D +A + GIK  +PAY +P+L+PED+ TGV+FASG +GY P T 
Sbjct  81    DGGIPTGRFCNGKVATDFIAGKFGIKPSIPAYRNPNLKPEDLLTGVTFASGGAGYVPFTT  140

Query  959   ALMSVIPLSEQLKYFKEYLGKLNAMVGEKEAKSIINNTLFMVVSGSDDLANTYFTIGIRR  780
              L   I LS+QLK F+EY+ K+  MVGE+  K II N+LFMV+ GS+D+ NTYF +   +
Sbjct  141   QLSGGIALSQQLKLFEEYVEKMKKMVGEERTKLIIKNSLFMVICGSNDITNTYFGLPSVQ  200

Query  779   YQYDINSYTDLLLEGASNFLQELYSLGARRIGFFGIPPVGCLPSQRTLAGGSERECVENY  600
              QYD+ S+T L+ + A +F Q+L+  GARRI  FG PPVGC+PSQRTLAGG  R CV  +
Sbjct  201   QQYDVASFTTLMADNARSFAQKLHEYGARRIQVFGAPPVGCVPSQRTLAGGPTRNCVVRF  260

Query  599   NQAAQLANAKFSAEIKILSKKLPNSKLIFIDIYEDFLDMIKNPAKYGFEVVNLGCCGTGT  420
             N A +L N K +A +  LS+ L +  +I++DIY+  LD+I +P +YGF+VV+ GCCGTG 
Sbjct  261   NDATKLYNVKLAANLGSLSRTLGDKTIIYVDIYDSLLDIILDPRQYGFKVVDKGCCGTGL  320

Query  419   IEVTMLCNKLSG-TCPDRNKYLFWDSYHPTEKGYRIIVNRIITKYI  285
             IEV +LCN  +   CP+R++Y+FWDS+HPTEK YRI+  +   +Y+
Sbjct  321   IEVALLCNNFAADVCPNRDEYVFWDSFHPTEKTYRIMATKYFERYV  366



>gb|ABK28470.1| unknown [Arabidopsis thaliana]
Length=367

 Score =   361 bits (926),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 172/346 (50%), Positives = 239/346 (69%), Gaps = 3/346 (1%)
 Frame = -2

Query  1313  CIIAFLVLAGCS-EAKIKLPNGLVVKAVIAFGDSIVDQGMNNN-LSTMIKTNFPPYGQDF  1140
             C+   ++L   S  A +K P      A+I FGDSIVD G N++ ++T+ + N+PPYG DF
Sbjct  21    CVFFLVLLCKTSTNALVKQPPNETTPAIIVFGDSIVDAGNNDDIMTTLARCNYPPYGIDF  80

Query  1139  MGGKHTGRYSNGKTPPDLVAEELGIKELVPAYLDPHLQPEDIKTGVSFASGASGYDPQTA  960
              GG  TGR+ NGK   D +A + GIK  +PAY +P+L+PED+ TGV+FASG +GY P T 
Sbjct  81    DGGIPTGRFCNGKVATDFIAGKFGIKPSIPAYRNPNLKPEDLLTGVTFASGGAGYVPFTT  140

Query  959   ALMSVIPLSEQLKYFKEYLGKLNAMVGEKEAKSIINNTLFMVVSGSDDLANTYFTIGIRR  780
              L   I LS+QLK F+EY+ K+  MVGE+  K II N+LFMV+ GS+D+ NTYF +   +
Sbjct  141   QLSGGIALSQQLKLFEEYVEKMKKMVGEERTKLIIKNSLFMVICGSNDITNTYFGLPSVQ  200

Query  779   YQYDINSYTDLLLEGASNFLQELYSLGARRIGFFGIPPVGCLPSQRTLAGGSERECVENY  600
              QYD+ S+T L+ + A +F Q+L+  GARRI  FG PPVGC+PSQRTLAGG  R CV  +
Sbjct  201   QQYDVASFTTLMADNARSFAQKLHEYGARRIQVFGAPPVGCVPSQRTLAGGPTRNCVVRF  260

Query  599   NQAAQLANAKFSAEIKILSKKLPNSKLIFIDIYEDFLDMIKNPAKYGFEVVNLGCCGTGT  420
             N A +L N K +A +  LS+ L +  +I++DIY+  LD+I +P +YGF+VV+ GCCGTG 
Sbjct  261   NDATKLYNVKLAANLGSLSRTLGDKTIIYVDIYDSLLDIILDPRQYGFKVVDKGCCGTGL  320

Query  419   IEVTMLCNKLSG-TCPDRNKYLFWDSYHPTEKGYRIIVNRIITKYI  285
             IEV +LCN  +   CP+R++Y+FWDS+HPTEK YRI+  +   +Y+
Sbjct  321   IEVALLCNNFAADVCPNRDEYVFWDSFHPTEKTYRIMATKYFERYV  366



>ref|XP_004983037.1| PREDICTED: GDSL esterase/lipase EXL3-like [Setaria italica]
Length=364

 Score =   361 bits (926),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 174/320 (54%), Positives = 225/320 (70%), Gaps = 4/320 (1%)
 Frame = -2

Query  1238  AVIAFGDSIVDQGMNNNLSTMIKTNFPPYGQDFMGGKHTGRYSNGKTPPDLVAEELGIKE  1059
             A+  FGDSIVD G NN L+T+I+ NFPPYGQDF G   TGR+SNG+ P D++A  LGIKE
Sbjct  44    ALFVFGDSIVDTGNNNALTTLIRCNFPPYGQDFPGHNATGRFSNGRVPSDILASRLGIKE  103

Query  1058  LVPAYLDPHLQPEDIKTGVSFASGASGYDPQTAALMSVIPLSEQLKYFKEYLGKLNAMVG  879
              VPAYL   L   D+ TGVSFASG  G+DP TA L+SV+ +  QL  FKEY  KL  + G
Sbjct  104   YVPAYLGTELSDFDLLTGVSFASGGCGFDPLTAELVSVLTMDNQLDLFKEYKAKLERVAG  163

Query  878   EKEAKSIINNTLFMVVSGSDDLANTYFTIGIRRYQYDINSYTDLLLEGASNFLQELYSLG  699
              + A  I++ +L+MVV+G+DDLANTYFT   RR  YD+ SY D ++  AS+F+++L+  G
Sbjct  164   ARRAGEIVSTSLYMVVTGTDDLANTYFTTPFRR-DYDLESYIDFVVRCASDFIRKLHGEG  222

Query  698   ARRIGFFGIPPVGCLPSQRTLAGGSERECVENYNQAAQLANAKFSAEIKIL--SKKLPNS  525
             ARRI   G PP+GC+PSQRT AGG ER+CV  YNQA+ + NA    EIK L  S +LP S
Sbjct  223   ARRINIAGAPPIGCVPSQRTNAGGLERDCVSLYNQASVVLNAALEKEIKRLNGSAELPGS  282

Query  524   KLIFIDIYEDFLDMIKNPAKYGFEVVNLGCCGTGTIEVTMLCNKLSG-TCPDRNKYLFWD  348
              L +ID+Y   LDMI+ P  YGF+V N GCCGTG  EVT+ CN+ +   C D +K+LFWD
Sbjct  283   VLKYIDLYTPLLDMIQRPGAYGFDVTNRGCCGTGVFEVTLTCNRYTAHACRDPSKFLFWD  342

Query  347   SYHPTEKGYRIIVNRIITKY  288
             +YH TE+GY +++ +II +Y
Sbjct  343   TYHLTERGYDLLMAQIINRY  362



>ref|XP_003527440.1| PREDICTED: GDSL esterase/lipase EXL3-like [Glycine max]
Length=362

 Score =   360 bits (925),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 170/343 (50%), Positives = 241/343 (70%), Gaps = 5/343 (1%)
 Frame = -2

Query  1298  LVLAGCSEAKIKLPNGLVVKAVIAFGDSIVDQGMNNNLSTMIKTNFPPYGQDFMGGKH-T  1122
             +V+     + + LPN   + AVI FGDSIVD G NN ++T+ K NF PYG+DF GG   T
Sbjct  22    IVIISLHVSSVSLPNYESIPAVIVFGDSIVDTGNNNYITTIAKCNFLPYGRDFGGGNQPT  81

Query  1121  GRYSNGKTPPDLVAEELGIKELVPAYLDPHLQPEDIKTGVSFASGASGYDPQTAALMSVI  942
             GR+SNG TP D++A + G+KEL+P YLDP LQP+D+ TGVSFASGASGYDP T+ + S +
Sbjct  82    GRFSNGLTPSDIIAAKFGVKELLPPYLDPKLQPQDLLTGVSFASGASGYDPLTSKIASAL  141

Query  941   PLSEQLKYFKEYLGKLNAMVGEKEAKSIINNTLFMVVSGSDDLANTYFTIGIRRYQYDIN  762
              LS+QL  F+EY  K+  +VGE    +II+ +++++ +GS+D+ NTYF   +R  +YDI 
Sbjct  142   SLSDQLDTFREYKNKIMEIVGENRTATIISKSIYILCTGSNDITNTYF---VRGGEYDIQ  198

Query  761   SYTDLLLEGASNFLQELYSLGARRIGFFGIPPVGCLPSQRTLAGGSERECVENYNQAAQL  582
             +YTDL+   A+NFLQELY LGARRIG  G+P +GC+PSQRTL GG  R C +  N+AA L
Sbjct  199   AYTDLMASQATNFLQELYGLGARRIGVVGLPVLGCVPSQRTLHGGIFRACSDFENEAAVL  258

Query  581   ANAKFSAEIKILSKKLPNSKLIFIDIYEDFLDMIKNPAKYGFEVVNLGCCGTGTIEVTML  402
              N+K S+++  L K+   ++ +++D+Y   L++I+NPAKYGFEV++ GCCGTG +EV  L
Sbjct  259   FNSKLSSQMDALKKQFQEARFVYLDLYNPVLNLIQNPAKYGFEVMDQGCCGTGKLEVGPL  318

Query  401   CNKLS-GTCPDRNKYLFWDSYHPTEKGYRIIVNRIITKYINSF  276
             CN  +   C + + Y+FWDS+HPTE  Y ++  +++   I  F
Sbjct  319   CNHFTLLICSNTSNYIFWDSFHPTEAAYNVVCTQVLDHKIKDF  361



>gb|KHN41131.1| GDSL esterase/lipase EXL3 [Glycine soja]
Length=362

 Score =   360 bits (923),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 170/343 (50%), Positives = 241/343 (70%), Gaps = 5/343 (1%)
 Frame = -2

Query  1298  LVLAGCSEAKIKLPNGLVVKAVIAFGDSIVDQGMNNNLSTMIKTNFPPYGQDFMGGKH-T  1122
             +V+     + + LPN   + AVI FGDSIVD G NN ++T+ K NF PYG+DF GG   T
Sbjct  22    IVIISLHVSSVSLPNYESIPAVIVFGDSIVDTGNNNYINTIAKCNFLPYGRDFGGGNQPT  81

Query  1121  GRYSNGKTPPDLVAEELGIKELVPAYLDPHLQPEDIKTGVSFASGASGYDPQTAALMSVI  942
             GR+SNG TP D++A + G+KEL+P YLDP LQP+D+ TGVSFASGASGYDP T+ + S +
Sbjct  82    GRFSNGLTPSDIIAAKFGVKELLPPYLDPKLQPQDLLTGVSFASGASGYDPLTSKIASAL  141

Query  941   PLSEQLKYFKEYLGKLNAMVGEKEAKSIINNTLFMVVSGSDDLANTYFTIGIRRYQYDIN  762
              LS+QL  F+EY  K+  +VGE    +II+ +++++ +GS+D+ NTYF   +R  +YDI 
Sbjct  142   SLSDQLDTFREYKNKIMEIVGENRTATIISKSIYILCTGSNDITNTYF---VRGGEYDIQ  198

Query  761   SYTDLLLEGASNFLQELYSLGARRIGFFGIPPVGCLPSQRTLAGGSERECVENYNQAAQL  582
             +YTDL+   A+NFLQELY LGARRIG  G+P +GC+PSQRTL GG  R C +  N+AA L
Sbjct  199   AYTDLMASQATNFLQELYGLGARRIGVVGLPVLGCVPSQRTLHGGIFRACSDFENEAAVL  258

Query  581   ANAKFSAEIKILSKKLPNSKLIFIDIYEDFLDMIKNPAKYGFEVVNLGCCGTGTIEVTML  402
              N+K S+++  L K+   ++ +++D+Y   L++I+NPAKYGFEV++ GCCGTG +EV  L
Sbjct  259   FNSKLSSQMDALKKQFQEARFVYLDLYNPVLNLIQNPAKYGFEVMDQGCCGTGKLEVGPL  318

Query  401   CNKLS-GTCPDRNKYLFWDSYHPTEKGYRIIVNRIITKYINSF  276
             CN  +   C + + Y+FWDS+HPTE  Y ++  +++   I  F
Sbjct  319   CNHFTLLICSNTSNYIFWDSFHPTEAAYNVVCTQVLDHKIKDF  361



>ref|XP_009106245.1| PREDICTED: GDSL esterase/lipase EXL1 isoform X2 [Brassica rapa]
Length=306

 Score =   358 bits (918),  Expect = 4e-117, Method: Compositional matrix adjust.
 Identities = 165/301 (55%), Positives = 223/301 (74%), Gaps = 1/301 (0%)
 Frame = -2

Query  1181  TMIKTNFPPYGQDFMGGKHTGRYSNGKTPPDLVAEELGIKELVPAYLDPHLQPEDIKTGV  1002
             T  + ++P YG DF GG  TGR+SNGK P D++AEELG+K  +PAY DP+L+PED+ TGV
Sbjct  3     TEARCDYPHYGIDFDGGVATGRFSNGKVPTDILAEELGLKPSIPAYRDPNLKPEDLLTGV  62

Query  1001  SFASGASGYDPQTAALMSVIPLSEQLKYFKEYLGKLNAMVGEKEAKSIINNTLFMVVSGS  822
             +FASG +GY P T  +   IPLS+QLKYF+EY+ KLN MVGE+  K I+ N++F+V+ GS
Sbjct  63    TFASGGAGYVPFTTQIAGGIPLSQQLKYFEEYIEKLNGMVGEERTKFILKNSMFVVICGS  122

Query  821   DDLANTYFTIGIRRYQYDINSYTDLLLEGASNFLQELYSLGARRIGFFGIPPVGCLPSQR  642
             +D+AN +F +   R QY ++S+T L+ + A +F + LY  GARRI  FG PP+GC+PSQR
Sbjct  123   NDIANDFFGLPTVRLQYTVDSFTALMADNARSFAKSLYGYGARRILMFGAPPIGCVPSQR  182

Query  641   TLAGGSERECVENYNQAAQLANAKFSAEIKILSKKLPNSKLIFIDIYEDFLDMIKNPAKY  462
             T+AGG  R+CV  +N A++L NAK S  I +LS+ L +SKLI++DIY   LD+I NP +Y
Sbjct  183   TVAGGPTRDCVVRFNDASKLFNAKLSGNIDVLSRTLLDSKLIYVDIYSPLLDLILNPGQY  242

Query  461   GFEVVNLGCCGTGTIEVTMLCNK-LSGTCPDRNKYLFWDSYHPTEKGYRIIVNRIITKYI  285
             GF+V NLGCCGTG IEVT LCN   S  CP R+ Y+FWDS+HPTE  YRIIV +++ +Y+
Sbjct  243   GFKVSNLGCCGTGLIEVTALCNNYTSAVCPIRSDYVFWDSFHPTETAYRIIVAKLLDRYL  302

Query  284   N  282
             +
Sbjct  303   S  303



>ref|XP_006301398.1| hypothetical protein CARUB_v10021812mg [Capsella rubella]
 gb|EOA34296.1| hypothetical protein CARUB_v10021812mg [Capsella rubella]
Length=368

 Score =   360 bits (923),  Expect = 5e-117, Method: Compositional matrix adjust.
 Identities = 171/347 (49%), Positives = 240/347 (69%), Gaps = 5/347 (1%)
 Frame = -2

Query  1310  IIAFLVL---AGCSEAKIKL-PNGLVVKAVIAFGDSIVDQGMNNNL-STMIKTNFPPYGQ  1146
             ++ FLVL      + A +KL PN  ++ A+I FGDSIVD G N+++ +T+ + N+PPYG 
Sbjct  22    VLFFLVLLCKTTTTNALVKLSPNETIIPAIIVFGDSIVDAGNNDDIKTTLARCNYPPYGI  81

Query  1145  DFMGGKHTGRYSNGKTPPDLVAEELGIKELVPAYLDPHLQPEDIKTGVSFASGASGYDPQ  966
             DF G   TGR+SNGK   D +AE  GIK  VPAY +P+L+PED+ TGV+FASG +GY P 
Sbjct  82    DFYGSIPTGRFSNGKVATDFIAENFGIKPTVPAYRNPNLKPEDLLTGVTFASGGAGYVPL  141

Query  965   TAALMSVIPLSEQLKYFKEYLGKLNAMVGEKEAKSIINNTLFMVVSGSDDLANTYFTIGI  786
             T  L   I L +QL+ F+EY+ KL  MVGE+    II N+L MV+ GS+D+ NTYF +  
Sbjct  142   TTQLSGGIALPQQLELFEEYIDKLKKMVGEERTNFIIKNSLVMVICGSNDITNTYFGLPS  201

Query  785   RRYQYDINSYTDLLLEGASNFLQELYSLGARRIGFFGIPPVGCLPSQRTLAGGSERECVE  606
              +++YD++S+T L+ + A +F Q+L+  GARRI  FG+PP+GC+PSQRTLAGG  R CV 
Sbjct  202   VQHKYDVSSFTTLMADNARSFAQKLHEYGARRIQVFGVPPLGCVPSQRTLAGGPTRNCVV  261

Query  605   NYNQAAQLANAKFSAEIKILSKKLPNSKLIFIDIYEDFLDMIKNPAKYGFEVVNLGCCGT  426
              +N A +L N K +A +  LS  L    + ++DIY   LD+I +P +YGF+VV+ GCCGT
Sbjct  262   RFNDATKLYNTKLAANLDSLSTTLGEKTITYVDIYGSLLDIILDPQQYGFKVVDRGCCGT  321

Query  425   GTIEVTMLCNKLSGTCPDRNKYLFWDSYHPTEKGYRIIVNRIITKYI  285
             G IEV +LCN  +  CP+R++Y+FWDS+HPTEK Y+I+  +   +YI
Sbjct  322   GLIEVAVLCNLAADVCPNRDEYVFWDSFHPTEKTYKIMATKYFERYI  368



>ref|XP_009385168.1| PREDICTED: GDSL esterase/lipase EXL3-like [Musa acuminata subsp. 
malaccensis]
Length=360

 Score =   359 bits (921),  Expect = 8e-117, Method: Compositional matrix adjust.
 Identities = 167/320 (52%), Positives = 224/320 (70%), Gaps = 1/320 (0%)
 Frame = -2

Query  1244  VKAVIAFGDSIVDQGMNNNLSTMIKTNFPPYGQDFMGGKHTGRYSNGKTPPDLVAEELGI  1065
             V AV+ FGDSIVD G NN L T+ + NFPPYG+DF GGK TGR+SNGK P D++A +LG+
Sbjct  35    VPAVVVFGDSIVDPGNNNMLPTIARCNFPPYGKDFPGGKATGRFSNGKNPSDILASQLGV  94

Query  1064  KELVPAYLDPHLQPEDIKTGVSFASGASGYDPQTAALMSVIPLSEQLKYFKEYLGKLNAM  885
             KE VPAYL  HL  +++ TG+SFASG  GYDP T+ L+  + L  QL  FKEY  KL  +
Sbjct  95    KEYVPAYLGTHLDAQELLTGISFASGGCGYDPLTSQLLVALSLRHQLNLFKEYKEKLKRV  154

Query  884   VGEKEAKSIINNTLFMVVSGSDDLANTYFTIGIRRYQYDINSYTDLLLEGASNFLQELYS  705
              GE  A  II N+L+ VV+G++D+A TYF +  RR ++DI SY   L++ AS+FLQELY 
Sbjct  155   AGEGRAADIIANSLYAVVTGTNDIATTYFLLPFRRAEFDIPSYITFLVQSASSFLQELYR  214

Query  704   LGARRIGFFGIPPVGCLPSQRTLAGGSERECVENYNQAAQLANAKFSAEIKILSKKLPNS  525
              GARRI   G PP+GC+PSQRTLAGG ERECV  YN+AA + N++ S E++ L   L  +
Sbjct  215   SGARRIAIMGAPPIGCMPSQRTLAGGIERECVTLYNEAATMFNSQLSKEVQRLDSTLLGA  274

Query  524   KLIFIDIYEDFLDMIKNPAKYGFEVVNLGCCGTGTIEVTMLCNKLSGT-CPDRNKYLFWD  348
             K+++IDIY   LDMI  P  YGF+    GCCGTG  EV + CN ++ T C + ++Y+FWD
Sbjct  275   KIVYIDIYTPLLDMILRPFAYGFKESTRGCCGTGYYEVIITCNSITATSCANASEYVFWD  334

Query  347   SYHPTEKGYRIIVNRIITKY  288
             S+H TE+   +++ +I+ +Y
Sbjct  335   SFHTTERAAEMLITQILQQY  354



>ref|XP_003571815.1| PREDICTED: GDSL esterase/lipase EXL3-like [Brachypodium distachyon]
Length=367

 Score =   359 bits (921),  Expect = 9e-117, Method: Compositional matrix adjust.
 Identities = 179/346 (52%), Positives = 237/346 (68%), Gaps = 6/346 (2%)
 Frame = -2

Query  1310  IIAFLVLAGCSEAKIKLPNGLVVK--AVIAFGDSIVDQGMNNNLSTMIKTNFPPYGQDFM  1137
             I A ++L+ C  A    P+       A+I FGDSIVD G NN L+T ++ +F PYGQDF 
Sbjct  20    ITALMLLSHCCIASPAPPSKQTRPPPALILFGDSIVDPGNNNALTTTVRCDFAPYGQDFP  79

Query  1136  GGKHTGRYSNGKTPPDLVAEELGIKELVPAYLDPHLQPEDIKTGVSFASGASGYDPQTAA  957
             G   TGR+SNGK   D++A  +G+K+ VPAYL   L   D+ TGVSFASG  G+DP TA 
Sbjct  80    GHNATGRFSNGKIVGDILATRMGLKQYVPAYLGTELSDFDLLTGVSFASGGCGFDPLTAE  139

Query  956   LMSVIPLSEQLKYFKEYLGKLNAMVGEKEAKSIINNTLFMVVSGSDDLANTYFTIGIRRY  777
             ++SV+ L +QL  FKEY GK+ A+ GE+ A  I++ ++F+VVSG+DDLANTYFT  +RR 
Sbjct  140   IVSVLTLDDQLDLFKEYKGKIRAIAGEQRAAEIVSTSMFLVVSGTDDLANTYFTTPLRR-  198

Query  776   QYDINSYTDLLLEGASNFLQELYSLGARRIGFFGIPPVGCLPSQRTLAGGSERECVENYN  597
              YD+ SY + +++ AS+F+Q+LY +GARR+   G PP+GC+PSQRT AGG +R CV  YN
Sbjct  199   DYDLESYIEFIVKCASDFIQKLYGMGARRVSIAGAPPIGCVPSQRTNAGGDDRACVSLYN  258

Query  596   QAAQLANAKFSAEIKIL--SKKLPNSKLIFIDIYEDFLDMIKNPAKYGFEVVNLGCCGTG  423
             QAA L NA    EIK L  S  LP S L +ID+Y   LDMI+ PA YGFEV N GCCGTG
Sbjct  259   QAAVLYNAALEKEIKRLNGSALLPGSVLKYIDLYTPLLDMIQRPAAYGFEVSNRGCCGTG  318

Query  422   TIEVTMLCNKLSG-TCPDRNKYLFWDSYHPTEKGYRIIVNRIITKY  288
               EVT+ CN  +   C D  K+LFWD++H TE+GY +++ +II +Y
Sbjct  319   LFEVTLTCNSYTAHACRDPTKFLFWDTFHLTERGYDLLMAQIINRY  364



>ref|XP_004957497.1| PREDICTED: GDSL esterase/lipase EXL3-like [Setaria italica]
Length=388

 Score =   360 bits (923),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 163/327 (50%), Positives = 230/327 (70%), Gaps = 1/327 (0%)
 Frame = -2

Query  1253  GLVVKAVIAFGDSIVDQGMNNNLSTMIKTNFPPYGQDFMGGKHTGRYSNGKTPPDLVAEE  1074
             G  V AV+ FGDSIVD G NN + T+ K+NF PYG D  GG  TGR+SNG+ P DL+A  
Sbjct  61    GPRVPAVLVFGDSIVDTGNNNAVLTLTKSNFRPYGHDLNGGVPTGRFSNGRIPTDLLASR  120

Query  1073  LGIKELVPAYLDPHLQPEDIKTGVSFASGASGYDPQTAALMSVIPLSEQLKYFKEYLGKL  894
             LG+K+LVPAYL   L   D++TGVSFASG +GYDP T+ L++V+P+ E+L  F EY  KL
Sbjct  121   LGLKDLVPAYLGTDLTDYDLRTGVSFASGGTGYDPLTSTLVAVLPMQEELNMFAEYKEKL  180

Query  893   NAMVGEKEAKSIINNTLFMVVSGSDDLANTYFTIGIRRYQYDINSYTDLLLEGASNFLQE  714
               +VG++ A+ I+  +LF+V +G+DD+AN Y+   +R  QYDI++Y D L++ A +F+++
Sbjct  181   AGVVGDEAAEGIVTESLFLVCAGTDDIANNYYLAPVRPLQYDISAYVDFLVQQACDFIKQ  240

Query  713   LYSLGARRIGFFGIPPVGCLPSQRTLAGGSERECVENYNQAAQLANAKFSAEIKILSKKL  534
             LY  GARRI   G+PP+GCLPSQRTLAGG  R+C    N+AA++ N++    +  L  +L
Sbjct  241   LYDRGARRIAILGLPPIGCLPSQRTLAGGLARDCDPARNRAARMFNSRLQGVVARLQGEL  300

Query  533   PNSKLIFIDIYEDFLDMIKNPAKYGFEVVNLGCCGTGTIEVTMLCNKLS-GTCPDRNKYL  357
                ++ ++DIY+   DMI +P +YGF+V   GCCGTG  EV++LCN+L+  TCPD  KY+
Sbjct  301   RCQRIGYVDIYDVLHDMITDPCRYGFDVSTRGCCGTGDFEVSLLCNRLTAATCPDDRKYV  360

Query  356   FWDSYHPTEKGYRIIVNRIITKYINSF  276
             FWDS+HPTE+ Y IIV+ +  +Y+   
Sbjct  361   FWDSFHPTERAYEIIVDYLFPRYVEKL  387



>ref|XP_007132710.1| hypothetical protein PHAVU_011G118200g [Phaseolus vulgaris]
 gb|ESW04704.1| hypothetical protein PHAVU_011G118200g [Phaseolus vulgaris]
Length=357

 Score =   358 bits (918),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 172/333 (52%), Positives = 232/333 (70%), Gaps = 3/333 (1%)
 Frame = -2

Query  1268  IKLPNGLVVKAVIAFGDSIVDQGMNNNLSTMIKTNFPPYGQDFMGGKH-TGRYSNGKTPP  1092
             + LPN   V AVI FGDSIVD G NN + T++  +F PYG+DF GG   TGR+SNG  P 
Sbjct  25    VSLPNNESVPAVIVFGDSIVDTGNNNYIKTIVNCDFQPYGKDFGGGNQPTGRFSNGLIPS  84

Query  1091  DLVAEELGIKELVPAYLDPHLQPEDIKTGVSFASGASGYDPQTAALMSVIPLSEQLKYFK  912
             D  A +  +K+L+P YLDP+L+ ED+ TGVSFA+G SGYDP T+ +  V  LS+QL  F+
Sbjct  85    DFFAAKFEVKKLLPPYLDPNLKREDLLTGVSFATGGSGYDPLTSTIALVPSLSDQLDKFR  144

Query  911   EYLGKLNAMVGEKEAKSIINNTLFMVVSGSDDLANTYFTIGIRRYQYDINSYTDLLLEGA  732
             EY  K+  M+GE    ++I+ +++++ +GS+D+ NT+FT+  RR QY+I++YTD L   A
Sbjct  145   EYKKKIQDMIGE-NTTTMISKSIYILCTGSNDITNTFFTLPFRRLQYNISTYTDFLTSEA  203

Query  731   SNFLQELYSLGARRIGFFGIPPVGCLPSQRTLAGGSERECVENYNQAAQLANAKFSAEIK  552
             S FLQELY LGARRIG  G+  +GC+P QRT  GG +R C +  NQAA L N K S++I 
Sbjct  204   SQFLQELYGLGARRIGITGLTNIGCVPFQRTFKGGIKRACSDLENQAAMLFNNKLSSQID  263

Query  551   ILSKKLPNSKLIFIDIYEDFLDMIKNPAKYGFEVVNLGCCGTGTIEVTMLCNKLS-GTCP  375
              L K LP+++L+++DIY   LDMI+NP KYGFEV N GCCGTG  EV  LCN  +   C 
Sbjct  264   ALGKLLPDARLVYLDIYNPLLDMIQNPTKYGFEVTNKGCCGTGKFEVGFLCNPFTLELCS  323

Query  374   DRNKYLFWDSYHPTEKGYRIIVNRIITKYINSF  276
             +R+ Y+FWDS+HPTE  Y I+ +++I K IN F
Sbjct  324   NRSNYIFWDSFHPTENAYNILCSQVIDKNINGF  356



>ref|XP_003527438.1| PREDICTED: GDSL esterase/lipase EXL3-like [Glycine max]
 gb|KHN41129.1| GDSL esterase/lipase EXL3 [Glycine soja]
Length=362

 Score =   358 bits (918),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 167/343 (49%), Positives = 238/343 (69%), Gaps = 5/343 (1%)
 Frame = -2

Query  1298  LVLAGCSEAKIKLPNGLVVKAVIAFGDSIVDQGMNNNLSTMIKTNFPPYGQDFMGGKH-T  1122
             +V+     + + LPN   + AVI FGDSIVD G NN ++T+ K NF PYG+DF GG   T
Sbjct  22    IVIISLHVSSVSLPNYESIPAVIVFGDSIVDTGNNNYINTIAKCNFLPYGRDFGGGNQPT  81

Query  1121  GRYSNGKTPPDLVAEELGIKELVPAYLDPHLQPEDIKTGVSFASGASGYDPQTAALMSVI  942
             GR+SNG  P D++A + G+KEL+P YLDP LQP+D+ TGVSFASGA+GYDP T+ +  V 
Sbjct  82    GRFSNGLVPSDIIAAKFGVKELLPPYLDPKLQPQDLLTGVSFASGANGYDPLTSKIALVW  141

Query  941   PLSEQLKYFKEYLGKLNAMVGEKEAKSIINNTLFMVVSGSDDLANTYFTIGIRRYQYDIN  762
              LS+QL  F+EY  K+  +VGE    +II+  ++++ +GS+D+ NTY     RR +YDI 
Sbjct  142   SLSDQLDMFREYKNKIMEIVGENRTATIISKGIYILCTGSNDITNTYV---FRRVEYDIQ  198

Query  761   SYTDLLLEGASNFLQELYSLGARRIGFFGIPPVGCLPSQRTLAGGSERECVENYNQAAQL  582
             +YTDL+   A+NFLQELY LGARRIG  G+P +GC+PSQRT+ GG  R C +  NQAA L
Sbjct  199   AYTDLMASQATNFLQELYGLGARRIGVVGLPVLGCVPSQRTIDGGISRACSDFENQAAVL  258

Query  581   ANAKFSAEIKILSKKLPNSKLIFIDIYEDFLDMIKNPAKYGFEVVNLGCCGTGTIEVTML  402
              N+K S+++  L K+   ++L+++D+Y   L +I+NPAKYGFEV++ GCCGTG +EV+++
Sbjct  259   FNSKLSSQMDALKKQFQEARLVYLDLYNPLLHLIQNPAKYGFEVIDKGCCGTGNLEVSLM  318

Query  401   CNKLS-GTCPDRNKYLFWDSYHPTEKGYRIIVNRIITKYINSF  276
             CN      C + + Y+FWDS+HPT+  Y ++ + ++   I  F
Sbjct  319   CNHFVLHICSNTSNYIFWDSFHPTQAAYNVVCSLVLDHKIKDF  361



>ref|XP_010935132.1| PREDICTED: GDSL esterase/lipase EXL3-like [Elaeis guineensis]
Length=355

 Score =   357 bits (916),  Expect = 4e-116, Method: Compositional matrix adjust.
 Identities = 174/333 (52%), Positives = 236/333 (71%), Gaps = 1/333 (0%)
 Frame = -2

Query  1280  SEAKIKLPNGLVVKAVIAFGDSIVDQGMNNNLSTMIKTNFPPYGQDFMGGKHTGRYSNGK  1101
             S+A +     + V AV AFGDSI D G NN L T+ K+NFPPYG+DF+G + TGR+SNGK
Sbjct  19    SQALVPDQTAVRVPAVFAFGDSIDDPGNNNMLLTIAKSNFPPYGRDFIGHRATGRFSNGK  78

Query  1100  TPPDLVAEELGIKELVPAYLDPHLQPEDIKTGVSFASGASGYDPQTAALMSVIPLSEQLK  921
              P D +A  LG+KEL+PAYLDP ++ +D+ TGVSFASG +GYD  TA L+SV  L +QL+
Sbjct  79    IPTDFIASLLGVKELLPAYLDPDVKEQDLLTGVSFASGGAGYDNLTAELLSVFSLWDQLE  138

Query  920   YFKEYLGKLNAMVGEKEAKSIINNTLFMVVSGSDDLANTYFTIGIRRYQYDINSYTDLLL  741
              F+EY  +L A+VGE  A  I+   + ++ +G+DDL NTYFT  IR   YD+ SY + +L
Sbjct  139   MFEEYKRELQAIVGEDRAVDIVAEGVCIIFAGTDDLMNTYFTSSIRALSYDLPSYINFVL  198

Query  740   EGASNFLQELYSLGARRIGFFGIPPVGCLPSQRTLAGGSERECVENYNQAAQLANAKFSA  561
             + AS+FL+ELY+LG R+IG  G+PP+GCLP+QRTL GG  R+CV+ YNQA+   N++ S 
Sbjct  199   QAASSFLKELYNLGPRKIGVVGVPPIGCLPAQRTLRGGIARDCVDAYNQASIKFNSELSM  258

Query  560   EIKILSKKLPNSKLIFIDIYEDFLDMIKNPAKYGFEVVNLGCCGTGTIEVTMLCNKLSG-  384
             E++ L+   P +K+++ID+Y   L++I +P  YGFE V  GC   G I  T+L N LS  
Sbjct  259   EVERLATYHPGAKIVYIDVYNPLLELIMHPYDYGFEEVTKGCFDPGKIVGTILPNNLSQL  318

Query  383   TCPDRNKYLFWDSYHPTEKGYRIIVNRIITKYI  285
             TCPD  KYLFWD  HPTEKGY+I+VN+I+ K +
Sbjct  319   TCPDATKYLFWDPDHPTEKGYQILVNKILPKLL  351



>ref|XP_009398920.1| PREDICTED: GDSL esterase/lipase EXL3-like [Musa acuminata subsp. 
malaccensis]
Length=363

 Score =   356 bits (914),  Expect = 8e-116, Method: Compositional matrix adjust.
 Identities = 167/323 (52%), Positives = 228/323 (71%), Gaps = 2/323 (1%)
 Frame = -2

Query  1247  VVKAVIAFGDSIVDQGMNNNLSTMIKTNFPPYGQDFMGGKHTGRYSNGKTPPDLVAEELG  1068
             +V AVI FGDSIVD G NN + T++K+NFPPYG+DF+G   TGR+ NGK P D +A  +G
Sbjct  37    LVPAVIVFGDSIVDPGNNNVMRTIVKSNFPPYGKDFIGHSPTGRFCNGKIPTDFIASTVG  96

Query  1067  IKELVPAYLDPHLQPEDIKTGVSFASGASGYDPQTAALMSVIPLSEQLKYFKEYLGKLNA  888
             +KEL+PAYL   L PED+ TGVSFAS  SG+DP T  L SV+ L +QL+ FKEY  K+  
Sbjct  97    VKELLPAYLGTTLGPEDLLTGVSFASSGSGFDPLTPTLTSVLSLPDQLELFKEYKKKVRG  156

Query  887   MVGEKEAKSIINNTLFMVVSGSDDLANTYFT-IGIRRYQYDINSYTDLLLEGASNFLQEL  711
             + G+K A SII+ +L++V +GSDD+AN YF    +R++ YD +SY   L+  AS F+++L
Sbjct  157   IAGKKRANSIISASLYVVCAGSDDIANNYFLPASLRQHSYDFSSYAKFLVHKASGFVEDL  216

Query  710   YSLGARRIGFFGIPPVGCLPSQRTLAGGSERECVENYNQAAQLANAKFSAEIKILSKKLP  531
              +LGAR +   GIPP+GC+PSQRTL GG  R C   +NQ AQL N+    E++ L  K  
Sbjct  217   VNLGARSVAVVGIPPIGCVPSQRTLGGGIMRSCASGHNQVAQLYNSGLKEEMQRLKTKHQ  276

Query  530   NSKLIFIDIYEDFLDMIKNPAKYGFEVVNLGCCGTGTIEVTMLCNKLSG-TCPDRNKYLF  354
              +KL+++DIY   L+MI +P  YGFEV   GCCGTG +EV++LCN L+  TC D +KY+F
Sbjct  277   GTKLVYVDIYTILLNMILHPNAYGFEVSAKGCCGTGDLEVSVLCNGLTTVTCADASKYVF  336

Query  353   WDSYHPTEKGYRIIVNRIITKYI  285
             WDS+HPTE+ Y I+V+ ++  Y+
Sbjct  337   WDSFHPTERAYEILVDWVLKTYL  359



>ref|XP_002462749.1| hypothetical protein SORBIDRAFT_02g031310 [Sorghum bicolor]
 gb|EER99270.1| hypothetical protein SORBIDRAFT_02g031310 [Sorghum bicolor]
Length=360

 Score =   356 bits (914),  Expect = 8e-116, Method: Compositional matrix adjust.
 Identities = 168/324 (52%), Positives = 229/324 (71%), Gaps = 1/324 (0%)
 Frame = -2

Query  1244  VKAVIAFGDSIVDQGMNNNLSTMIKTNFPPYGQDFMGGKHTGRYSNGKTPPDLVAEELGI  1065
             V A++ FGDSIVD G NN + T+ K+NF PYG+D  GG  TGR+SNG+ P D VA  LG+
Sbjct  36    VPAILVFGDSIVDTGNNNAVLTLTKSNFRPYGKDLNGGVPTGRFSNGRIPTDFVASRLGL  95

Query  1064  KELVPAYLDPHLQPEDIKTGVSFASGASGYDPQTAALMSVIPLSEQLKYFKEYLGKLNAM  885
             K+LVPAYL   L  +D+ TGVSFASG +GYDP T+ L++V+P+ E+L  F EY  KL  +
Sbjct  96    KDLVPAYLGTDLTDDDLCTGVSFASGGTGYDPLTSTLVAVLPMQEELNMFAEYKEKLAGV  155

Query  884   VGEKEAKSIINNTLFMVVSGSDDLANTYFTIGIRRYQYDINSYTDLLLEGASNFLQELYS  705
             VG+  A  I+ ++LF+V +G+DD+AN Y+   +R  QYDI++Y D L+E A +F+++LY 
Sbjct  156   VGDAAAAGIVADSLFLVCAGTDDIANNYYLAPVRPLQYDISAYVDFLVEQACDFMRQLYQ  215

Query  704   LGARRIGFFGIPPVGCLPSQRTLAGGSERECVENYNQAAQLANAKFSAEIKILSKKLPNS  525
              GARRI   G+PPVGC+P QRTLAGG  R+C    N AAQL N++   EI  L ++L   
Sbjct  216   QGARRIAILGMPPVGCVPLQRTLAGGLARDCDPARNHAAQLYNSRLKEEIARLQEELQCQ  275

Query  524   KLIFIDIYEDFLDMIKNPAKYGFEVVNLGCCGTGTIEVTMLCNKLSG-TCPDRNKYLFWD  348
             K+ ++DIY+   DMI NP KYGFEV   GCCGTG  EV++LCN+++  TCPD  KY+FWD
Sbjct  276   KIGYVDIYDILQDMITNPCKYGFEVSTRGCCGTGEFEVSLLCNQVTATTCPDDRKYVFWD  335

Query  347   SYHPTEKGYRIIVNRIITKYINSF  276
             S+HPTE+ Y IIV+ +  +Y+ + 
Sbjct  336   SFHPTERAYEIIVDYLFPRYVENL  359



>gb|EYU17582.1| hypothetical protein MIMGU_mgv1a008769mg [Erythranthe guttata]
Length=354

 Score =   355 bits (912),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 169/336 (50%), Positives = 240/336 (71%), Gaps = 14/336 (4%)
 Frame = -2

Query  1280  SEAKIKLPNGLVVKAVIAFGDSIVDQGMNNNLSTMIKTNFPPYGQDFMGGKHTGRYSNGK  1101
             S A IK+P    + AV+ FGDS+VD G NN ++T+++ NF PYG+DF+ G+ TGR+SNGK
Sbjct  24    SGALIKVPENATIPAVMFFGDSVVDTGNNNYITTLVRANFLPYGKDFIAGQPTGRFSNGK  83

Query  1100  TPPDLVAEELGIKELVPAYLDPHLQPEDIKTGVSFASGASGYDPQTAALMSVIPLSEQLK  921
              PPDL  EELGIK  +P YLDP L  ED+ TGV+FASG SGYDP T+  MSV  LS+QL+
Sbjct  84    VPPDLFVEELGIKPCLPPYLDPSLVDEDLLTGVNFASGGSGYDPLTSNTMSVFSLSDQLE  143

Query  920   YFKEYLGKLNAMVGEKEAKSIINNTLFMVVSGSDDLANTYFTIGIRRYQYDINSYTDLLL  741
              F+EY+ KL  + G++++  I+  +LF+VVSGS+D+ N++F   +R++QYD+ SYTDLL 
Sbjct  144   MFEEYIIKLKKIAGDEKSSYILRESLFVVVSGSNDIWNSFFN-NLRQFQYDVPSYTDLL-  201

Query  740   EGASNFLQELYSLGARRIGFFGIPPVGCLPSQRTLAG-GSERECVENYNQAAQLANAKFS  564
                     ELY LGARRIG F +P +GC+PSQ T+   G ER+CV  YN+ AQL N K  
Sbjct  202   --------ELYRLGARRIGVFSMPAIGCMPSQITIRRIGLERKCVTEYNEIAQLFNKKLL  253

Query  563   AEIKILSKKLPNSKLIFIDIYEDFLDMIKNPAKYGFEVVNLGCCGTGTIEVTMLCNKLSG  384
             + +  L+ + P +K++++D Y+  LDMI NP K+GF++V+ GCCGTGT E ++LC   + 
Sbjct  254   SALTSLNAQFPQAKMVYLDFYDLPLDMISNPQKFGFKIVDKGCCGTGTFETSLLC---TY  310

Query  383   TCPDRNKYLFWDSYHPTEKGYRIIVNRIITKYINSF  276
              C + + Y+FWDS+HPTEK YRI++++++ + IN F
Sbjct  311   ACSNEDDYIFWDSFHPTEKAYRILIHQMLQENINYF  346



>ref|XP_002887618.1| T4O12.12 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH63877.1| T4O12.12 [Arabidopsis lyrata subsp. lyrata]
Length=673

 Score =   366 bits (940),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 170/334 (51%), Positives = 239/334 (72%), Gaps = 2/334 (1%)
 Frame = -2

Query  1280  SEAKIKLPNGLVVKAVIAFGDSIVDQGMNNN-LSTMIKTNFPPYGQDFMGGKHTGRYSNG  1104
             + A +KLP    + A+I FGDSIVD G N++ ++T+ + N+PPYG DF GG  TGR+SNG
Sbjct  340   TNALVKLPPNETIPAIIVFGDSIVDAGNNDDIMTTLARCNYPPYGIDFDGGIPTGRFSNG  399

Query  1103  KTPPDLVAEELGIKELVPAYLDPHLQPEDIKTGVSFASGASGYDPQTAALMSVIPLSEQL  924
             K   D +AE+ GIK  +PAY +P+L+P+D+ TGV+FASG +GY P T  L   I LS+QL
Sbjct  400   KVATDFIAEKFGIKPTIPAYRNPNLKPDDLLTGVTFASGGAGYVPFTTQLSGGIALSQQL  459

Query  923   KYFKEYLGKLNAMVGEKEAKSIINNTLFMVVSGSDDLANTYFTIGIRRYQYDINSYTDLL  744
             K F++Y+ KL  MVGE+    II N+LFMV+ GS+D+ NTYF +   ++QYD+ S+T L+
Sbjct  460   KLFEQYIEKLKEMVGEERTTFIIKNSLFMVICGSNDITNTYFALPSVQHQYDVASFTTLM  519

Query  743   LEGASNFLQELYSLGARRIGFFGIPPVGCLPSQRTLAGGSERECVENYNQAAQLANAKFS  564
              + A +F Q+L+  GARRI  FG PP+GC+PSQRTLAGG  R CV  +N A +L NAK +
Sbjct  520   ADNARSFAQKLHEYGARRIQVFGAPPLGCVPSQRTLAGGPTRNCVVRFNDATKLYNAKLA  579

Query  563   AEIKILSKKLPNSKLIFIDIYEDFLDMIKNPAKYGFEVVNLGCCGTGTIEVTMLCNKLSG  384
             A ++ LS+ L    +I++DIY+   D+I +P +YGF+VV+ GCCGTG IEVT+LCN  + 
Sbjct  580   ANLESLSRTLGEKTIIYVDIYDSLFDIILDPQQYGFKVVDRGCCGTGLIEVTVLCNNFAA  639

Query  383   -TCPDRNKYLFWDSYHPTEKGYRIIVNRIITKYI  285
               C +R++Y+FWDS+HPTEK YRI+  + I +Y+
Sbjct  640   DVCQNRDEYVFWDSFHPTEKTYRIMATKYIERYV  673


 Score =   335 bits (860),  Expect = 9e-104, Method: Compositional matrix adjust.
 Identities = 163/309 (53%), Positives = 215/309 (70%), Gaps = 2/309 (1%)
 Frame = -2

Query  1301  FLVL--AGCSEAKIKLPNGLVVKAVIAFGDSIVDQGMNNNLSTMIKTNFPPYGQDFMGGK  1128
             FLVL     + A +K+P    V AVI FGDSIVD G N+++ T  + ++ PYG DF GG 
Sbjct  29    FLVLLFTTTTNALVKIPKNTTVPAVIVFGDSIVDAGNNDDMITEARCDYAPYGIDFDGGV  88

Query  1127  HTGRYSNGKTPPDLVAEELGIKELVPAYLDPHLQPEDIKTGVSFASGASGYDPQTAALMS  948
              TGR+SNGK P D+VAEELGIK  +PAY DP+L+PED+ TGV+FASG +GY P T  +  
Sbjct  89    ATGRFSNGKVPGDIVAEELGIKPNIPAYRDPNLKPEDLLTGVTFASGGAGYVPLTTKIAG  148

Query  947   VIPLSEQLKYFKEYLGKLNAMVGEKEAKSIINNTLFMVVSGSDDLANTYFTIGIRRYQYD  768
              IPL +QLKYF+EY+ KL  MVGE+  K II N+LF+V+ GS+D+ N +F +   +  Y 
Sbjct  149   GIPLPQQLKYFEEYIKKLKGMVGEERTKFIIKNSLFVVICGSNDIVNNFFALPPVQLHYT  208

Query  767   INSYTDLLLEGASNFLQELYSLGARRIGFFGIPPVGCLPSQRTLAGGSERECVENYNQAA  588
             + S+T L+ + A +F Q LY  GARRI  FG PP+GC+PSQRT+AGG  R+CV  +N A+
Sbjct  209   VASFTALMADNARSFAQTLYGYGARRILVFGAPPIGCVPSQRTVAGGPTRDCVARFNDAS  268

Query  587   QLANAKFSAEIKILSKKLPNSKLIFIDIYEDFLDMIKNPAKYGFEVVNLGCCGTGTIEVT  408
             +L N K SA I +LS+ L +  +I+IDIY   LD+I NP +YGF+V N GCCGTG IEVT
Sbjct  269   KLFNTKLSANIDVLSRTLRDPTIIYIDIYSPLLDLILNPHQYGFKVANKGCCGTGLIEVT  328

Query  407   MLCNKLSGT  381
              LCN  + +
Sbjct  329   ALCNNYTAS  337



>ref|NP_188100.2| GDSL esterase/lipase [Arabidopsis thaliana]
 sp|Q9LH73.2|GDL52_ARATH RecName: Full=GDSL esterase/lipase At3g14820; AltName: Full=Extracellular 
lipase At3g14820; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AEE75570.1| GDSL esterase/lipase [Arabidopsis thaliana]
Length=351

 Score =   355 bits (912),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 169/321 (53%), Positives = 233/321 (73%), Gaps = 5/321 (2%)
 Frame = -2

Query  1247  VVKAVIAFGDSIVDQGMNNNLSTMIKTNFPPYGQDFMGGKHTGRYSNGKTPPDLVAEELG  1068
              + A+I FGDSI+D G NN++ T++K+NFPPYG+DF G   TGR+S+GK P D++AE LG
Sbjct  29    TIPALIVFGDSIMDTGNNNDIPTLLKSNFPPYGRDFPGAIPTGRFSDGKVPSDIIAESLG  88

Query  1067  IKELVPAYLDPHLQPEDIKTGVSFASGASGYDPQTAALMSVIPLSEQLKYFKEYLGKLNA  888
             I + +P YL  +L+P D+  GV FASG SGYDP T+ L+SV+ +S+QLKYF+EYL K+  
Sbjct  89    IAKTLPPYLGSNLKPHDLLKGVIFASGGSGYDPLTSTLLSVVSMSDQLKYFQEYLAKIKQ  148

Query  887   MVGEKEAKSIINNTLFMVVSGSDDLANTYFTIGIRRYQYDINSYTDLLLEGASNFLQELY  708
               GE++ K I+  ++F+VVS S+DLA TY+   +R  +YD NSY + L+E AS F++EL 
Sbjct  149   HFGEEKVKFILEKSVFLVVSSSNDLAETYW---VRSVEYDRNSYAEYLVELASEFIKELS  205

Query  707   SLGARRIGFFGIPPVGCLPSQRTLAGGSERECVENYNQAAQLANAKFSAEIKILSKKLPN  528
              LGA+ IG F   PVGCLP+QRTL GG ER+C E  N  A   N+K S+ +  L K+LP 
Sbjct  206   ELGAKNIGLFSGVPVGCLPAQRTLFGGFERKCYEKLNNMALHFNSKLSSSLDTLKKELP-  264

Query  527   SKLIFIDIYEDFLDMIKNPAKYGFEVVNLGCCGTGTIEVTMLCNKLSG-TCPDRNKYLFW  351
             S+LIFID+Y+  LD+IKNP  YGF+V + GCCGTG IE+  LCNK +  TC D + ++F+
Sbjct  265   SRLIFIDVYDTLLDIIKNPTNYGFKVADKGCCGTGKIELMELCNKFTPFTCSDASTHVFF  324

Query  350   DSYHPTEKGYRIIVNRIITKY  288
             DSYHP+EK Y+II ++++ KY
Sbjct  325   DSYHPSEKAYQIITHKLLAKY  345



>gb|ACG32957.1| anther-specific proline-rich protein APG precursor [Zea mays]
Length=353

 Score =   355 bits (912),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 170/325 (52%), Positives = 226/325 (70%), Gaps = 8/325 (2%)
 Frame = -2

Query  1244  VKAVIAFGDSIVDQGMNNNLSTMIKTNFPPYGQDFMGGKHTGRYSNGKTPPDLVAEELGI  1065
             V A++ FGDSIVD G NN + T+ K+NF PYG+D  GG  TGR+SNG+ P D VA  LG+
Sbjct  34    VPAILVFGDSIVDTGNNNAVLTLTKSNFRPYGKDLNGGVPTGRFSNGRIPTDFVASRLGL  93

Query  1064  KELVPAYLDPHLQPEDIKTGVSFASGASGYDPQTAALMSVIPLSEQLKYFKEYLGKLNAM  885
             K+LVPAYL   L  +D+ TGVSFASG +GYDP T+ L+      E+L  F EY  +L  +
Sbjct  94    KDLVPAYLGTDLSDDDLCTGVSFASGGTGYDPLTSTLV------EELNMFAEYKERLAGV  147

Query  884   VG-EKEAKSIINNTLFMVVSGSDDLANTYFTIGIRRYQYDINSYTDLLLEGASNFLQELY  708
             VG E  A  I+  +LF+V +GSDD+AN Y+   +R  QYDI++Y D L+E A +F+++LY
Sbjct  148   VGDEAAAAGIVAESLFLVCAGSDDIANNYYLAPVRPLQYDISAYVDFLVEQACDFIRQLY  207

Query  707   SLGARRIGFFGIPPVGCLPSQRTLAGGSERECVENYNQAAQLANAKFSAEIKILSKKLPN  528
               GARRI   G+PPVGC+PSQRTLAGG  R+C    N AAQL N++   E+ +L K+L  
Sbjct  208   QQGARRIAVLGMPPVGCVPSQRTLAGGLARDCDPARNHAAQLYNSRLKEEVVLLQKELAC  267

Query  527   SKLIFIDIYEDFLDMIKNPAKYGFEVVNLGCCGTGTIEVTMLCNKLSG-TCPDRNKYLFW  351
              ++ ++DIY+   DMI NP KYGFEV   GCCGTG +EV++LCN+L+  TCPD  KY+FW
Sbjct  268   QRIGYVDIYDVLQDMITNPCKYGFEVSTRGCCGTGDLEVSLLCNQLTAPTCPDDRKYVFW  327

Query  350   DSYHPTEKGYRIIVNRIITKYINSF  276
             DS+HPTEK Y IIV+ +  +YI + 
Sbjct  328   DSFHPTEKAYEIIVDYLFPRYIENL  352



>ref|XP_010266977.1| PREDICTED: GDSL esterase/lipase At3g14820-like [Nelumbo nucifera]
Length=660

 Score =   365 bits (938),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 176/333 (53%), Positives = 239/333 (72%), Gaps = 11/333 (3%)
 Frame = -2

Query  1277  EAKIKLPNGLVVKAVIAFGDSIVDQGMNNNLSTMIKTNFPPYGQDFMGGKHTGRYSNGKT  1098
             EAKI LP  + V A+I FGDSIVD G NN+L+T+ K NFPPYG+DF+GG+ TGR+SNG+ 
Sbjct  22    EAKIILPKNVTVPALIMFGDSIVDTGNNNHLATLFKCNFPPYGKDFLGGEPTGRFSNGRI  81

Query  1097  PPDLVAEELGIKELVPAYLDPHLQPEDIKTGVSFASGASGYDPQTAALMSVIPLSEQLKY  918
             P D++AEELGIKE +PAYLDP+LQ E++ TGV FAS  +GYDP T+ + SV+ LS+QLK 
Sbjct  82    PSDILAEELGIKEFLPAYLDPNLQTEELLTGVCFASSGTGYDPLTSQVTSVLSLSDQLKL  141

Query  917   FKEYLGKLNAMVGEKEAKSIINNTLFMVVSGSDDLANTYFTIGIRRYQYDINSYTDLLLE  738
             FKEY+ KL  +VGE+   +II+ +L++V +GS+D   TYF   +RR +YD+ +YTD +++
Sbjct  142   FKEYIEKLKTLVGEERTATIISQSLYVVCAGSNDFLITYFLTPLRRAKYDVPAYTDFMIQ  201

Query  737   GASNFL----QELYSLGARRIGFFGIPPVGCLPSQRTL------AGGSERECVENYNQAA  588
              AS FL    QELY LGARRI    +P VGC+P  R+L        G +  C+E+ N+AA
Sbjct  202   SASTFLQVSIQELYDLGARRIAVLSVPSVGCVPYARSLLGGIGGGRGGDGGCIEDVNEAA  261

Query  587   QLANAKFSAEIKILSKKLPNSKLIFIDIYEDFLDMIKNPAKYGFEVVNLGCCGTGTIEVT  408
             QL NAK S+++  L+ K P +++++ID+Y   L + + P  YGFE V+ GCCGTG IEV 
Sbjct  262   QLFNAKLSSQMDWLNNKFPEARMVYIDVYFPLLHLNRRPRDYGFEEVSKGCCGTGKIEVA  321

Query  407   MLCNKLSG-TCPDRNKYLFWDSYHPTEKGYRII  312
              LCN L+  TC D +KY++WDS HPTEK Y+II
Sbjct  322   ELCNDLNPFTCTDVSKYVYWDSVHPTEKAYQII  354


 Score =   301 bits (772),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 141/264 (53%), Positives = 197/264 (75%), Gaps = 0/264 (0%)
 Frame = -2

Query  1250  LVVKAVIAFGDSIVDQGMNNNLSTMIKTNFPPYGQDFMGGKHTGRYSNGKTPPDLVAEEL  1071
             + V AV  FGDSIVD G NN L +++K NFPPYG+DFMGG+ TGR SNG+ P DL+A +L
Sbjct  393   ITVPAVYVFGDSIVDTGNNNYLFSVVKCNFPPYGRDFMGGRATGRCSNGRLPSDLLARKL  452

Query  1070  GIKELVPAYLDPHLQPEDIKTGVSFASGASGYDPQTAALMSVIPLSEQLKYFKEYLGKLN  891
             GIKE +PAYLDP+LQPED+ TG+SFAS ++GYDP TA + SV+ LS+QLK FKEY  K+ 
Sbjct  453   GIKETLPAYLDPNLQPEDLVTGISFASSSTGYDPLTAKVSSVLSLSDQLKLFKEYKDKVK  512

Query  890   AMVGEKEAKSIINNTLFMVVSGSDDLANTYFTIGIRRYQYDINSYTDLLLEGASNFLQEL  711
              +VGE+ + +II+++L++V +GS+D   TYFT  +RR +YD+ +YTDL+L  AS+FLQ+L
Sbjct  513   TLVGEERSATIISHSLYVVCAGSNDFLITYFTTPLRRKKYDVPAYTDLMLRSASSFLQKL  572

Query  710   YSLGARRIGFFGIPPVGCLPSQRTLAGGSERECVENYNQAAQLANAKFSAEIKILSKKLP  531
             Y LGARRI  F IP VGC+P+ R + GG +  CV++ NQA ++ NAK  +++  L+ K P
Sbjct  573   YGLGARRIAVFSIPAVGCVPTARFIFGGGQGGCVKSVNQAGEIFNAKLYSKLDSLNNKFP  632

Query  530   NSKLIFIDIYEDFLDMIKNPAKYG  459
              +++ +ID+Y  FL + + P  YG
Sbjct  633   QARMAYIDVYFPFLRLNQKPHDYG  656



>gb|ACR34471.1| unknown [Zea mays]
Length=353

 Score =   355 bits (911),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 170/325 (52%), Positives = 226/325 (70%), Gaps = 8/325 (2%)
 Frame = -2

Query  1244  VKAVIAFGDSIVDQGMNNNLSTMIKTNFPPYGQDFMGGKHTGRYSNGKTPPDLVAEELGI  1065
             V A++ FGDSIVD G NN + T+ K+NF PYG+D  GG  TGR+SNG+ P D VA  LG+
Sbjct  34    VPAILVFGDSIVDTGNNNAVLTLTKSNFRPYGKDLNGGVPTGRFSNGRIPTDFVASRLGL  93

Query  1064  KELVPAYLDPHLQPEDIKTGVSFASGASGYDPQTAALMSVIPLSEQLKYFKEYLGKLNAM  885
             K+LVPAYL   L  +D+ TGVSFASG +GYDP T+ L+      E+L  F EY  +L  +
Sbjct  94    KDLVPAYLGTDLSDDDLCTGVSFASGGTGYDPLTSTLV------EELNMFAEYKERLAGV  147

Query  884   VG-EKEAKSIINNTLFMVVSGSDDLANTYFTIGIRRYQYDINSYTDLLLEGASNFLQELY  708
             VG E  A  I+  +LF+V +GSDD+AN Y+   +R  QYDI++Y D L+E A +F+++LY
Sbjct  148   VGDEAAAAGIVAESLFLVCAGSDDIANNYYLAPVRPLQYDISAYVDFLVEQACDFIRQLY  207

Query  707   SLGARRIGFFGIPPVGCLPSQRTLAGGSERECVENYNQAAQLANAKFSAEIKILSKKLPN  528
               GARRI   G+PPVGC+PSQRTLAGG  R+C    N AAQL N++   E+ +L K+L  
Sbjct  208   QQGARRIAVLGMPPVGCVPSQRTLAGGLARDCDPARNHAAQLYNSRLKEEVVLLQKELAC  267

Query  527   SKLIFIDIYEDFLDMIKNPAKYGFEVVNLGCCGTGTIEVTMLCNKLSG-TCPDRNKYLFW  351
              ++ ++DIY+   DMI NP KYGFEV   GCCGTG +EV++LCN+L+  TCPD  KY+FW
Sbjct  268   QRIGYVDIYDVLQDMITNPCKYGFEVSTRGCCGTGDLEVSLLCNQLTAPTCPDDRKYVFW  327

Query  350   DSYHPTEKGYRIIVNRIITKYINSF  276
             DS+HPTEK Y IIV+ +  +YI + 
Sbjct  328   DSFHPTEKAYEIIVDYLFPRYIENL  352



>emb|CDY12974.1| BnaC02g29810D [Brassica napus]
Length=541

 Score =   361 bits (927),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 177/340 (52%), Positives = 245/340 (72%), Gaps = 9/340 (3%)
 Frame = -2

Query  1301  FLVLAGCSEAKIKLPNGLVVKAVIAFGDSIVDQGMNNNLSTMIKTNFPPYGQDFMGGKHT  1122
             +LV+A  +   IKLP  + +  VIAFGDSIVD G NNNL T++K+NFPPYGQDF G   T
Sbjct  206   YLVVASIT---IKLPRNVTIPGVIAFGDSIVDSGNNNNLRTILKSNFPPYGQDFRGKFAT  262

Query  1121  GRYSNGKTPPDLVAEELGIKELVPAYLDPHLQPEDIKTGVSFASGASGYDPQTAALMSVI  942
             GR+++G+ P D VAE LGI + +PAYLDP L+ +D+  G++FASG SGYDP TA ++ V+
Sbjct  263   GRFTDGRVPSDFVAERLGIAKTIPAYLDPALKGKDLLKGINFASGGSGYDPLTAKIVRVV  322

Query  941   PLSEQLKYFKEYLGKLNAMVGEKEAKSIINNTLFMVVSGSDDLANTYFTIGIRRYQYDIN  762
              L +QLKYF+EY  K+ A+VGE++AK ++ N+L++VV+ S+DLA+TY     R  +Y+  
Sbjct  323   SLEDQLKYFQEYKEKIKAIVGEEKAKFMVENSLYLVVASSNDLAHTYIA---RSLRYNST  379

Query  761   SYTDLLLEGASNFLQELYSLGARRIGFFGIPPVGCLPSQRTLAGGSERECVENYNQAAQL  582
              Y D L + +S F+++LY LGARRI  F   PVGCLPS+RTL  G +R+C EN N+ A  
Sbjct  380   EYPDYLADMSSKFVKKLYGLGARRIAIFSAVPVGCLPSRRTL-NGVKRKCSENLNKMALQ  438

Query  581   ANAKFSAEIKILSKKLPNSKLIFIDIYEDFLDMIKNPAKYGFEVVNLGCCGTGTIEVTML  402
              NAK S  +  L KK P SK++F+D+Y+   +MI+NP KYGFEV N G CGTG  EV +L
Sbjct  439   FNAKLSPGLVALRKKSPGSKIVFVDVYDILHNMIENPKKYGFEVANRG-CGTGLFEVLIL  497

Query  401   CNKLSG-TCPDRNKYLFWDSYHPTEKGYRIIVNRIITKYI  285
             CNK++  TC + + ++FWDSYHPTEK Y++IV++++  YI
Sbjct  498   CNKINPFTCKNASSHVFWDSYHPTEKAYQVIVDKLLGIYI  537


 Score =   183 bits (465),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 84/150 (56%), Positives = 114/150 (76%), Gaps = 0/150 (0%)
 Frame = -2

Query  1277  EAKIKLPNGLVVKAVIAFGDSIVDQGMNNNLSTMIKTNFPPYGQDFMGGKHTGRYSNGKT  1098
             E  IKLP  + +  VIAFGDSIVD G NNNL T++K NFPPYGQDF G   TGR+++G+ 
Sbjct  61    EVTIKLPRNVTIPGVIAFGDSIVDSGNNNNLRTILKCNFPPYGQDFQGKFATGRFTDGRV  120

Query  1097  PPDLVAEELGIKELVPAYLDPHLQPEDIKTGVSFASGASGYDPQTAALMSVIPLSEQLKY  918
             P D VAE LGI + +PAYLDP L+ +D+  G++FASG SGYDP TA ++ V+ L +QLKY
Sbjct  121   PSDFVAERLGIAKTIPAYLDPALKGKDLLKGINFASGGSGYDPLTAKIVRVVSLEDQLKY  180

Query  917   FKEYLGKLNAMVGEKEAKSIINNTLFMVVS  828
             F+EY  K+ A+VGE++AK ++ N+L++VV+
Sbjct  181   FQEYKEKIKAIVGEEKAKFMVENSLYLVVA  210



>ref|XP_010471733.1| PREDICTED: GDSL esterase/lipase EXL1-like isoform X3 [Camelina 
sativa]
 ref|XP_010471736.1| PREDICTED: GDSL esterase/lipase EXL1-like isoform X3 [Camelina 
sativa]
 ref|XP_010471739.1| PREDICTED: GDSL esterase/lipase EXL1-like isoform X3 [Camelina 
sativa]
Length=360

 Score =   355 bits (910),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 173/342 (51%), Positives = 232/342 (68%), Gaps = 15/342 (4%)
 Frame = -2

Query  1298  LVLAGCSEAKIKLPNGLVVKAVIAFGDSIVDQGMNNNLSTMIKTNFPPYGQDFMGGKHTG  1119
             L+    + A +KLP    V AVI FGDSIVD G N+++ T  + ++ PYG DF GG  TG
Sbjct  32    LLFTTTTHALVKLPENTTVPAVIVFGDSIVDAGNNDDMITEARCDYAPYGIDFDGGVATG  91

Query  1118  RYSNGKTPPDLVAEELGIKELVPAYLDPHLQPEDIKTGVSFASGASGYDPQTAALMSVIP  939
             R+SNGK P D+VAEELGIK  +PAY DP+L+PED+ TGV+FASG +GY          +P
Sbjct  92    RFSNGKVPGDIVAEELGIKPSIPAYRDPNLKPEDLLTGVTFASGGAGY----------VP  141

Query  938   LSEQLKYFKEYLGKLNAMVGEKEAKSIINNTLFMVVSGSDDLANTYFTIGIRRYQYDINS  759
             L+ +L Y    + KL AMVGE+  + II N+LF+V+ GS+D+AN +F +   +  Y + S
Sbjct  142   LTTKLAY----IAKLKAMVGEERTQFIIKNSLFVVICGSNDIANDFFALPPVQLHYTVAS  197

Query  758   YTDLLLEGASNFLQELYSLGARRIGFFGIPPVGCLPSQRTLAGGSERECVENYNQAAQLA  579
             +T L+ + A +F Q LY  GARRI  FG PP+GC+PSQRT+AGG  R+CV  +N A++L 
Sbjct  198   FTALMADNARSFAQTLYGYGARRILVFGAPPIGCVPSQRTVAGGPTRDCVARFNDASKLF  257

Query  578   NAKFSAEIKILSKKLPNSKLIFIDIYEDFLDMIKNPAKYGFEVVNLGCCGTGTIEVTMLC  399
             N+K SA I  LS  L +  +I+IDIY   LD+I +P +YGF+V + GCCGTG IEVT LC
Sbjct  258   NSKLSANIDALSTTLQDPTIIYIDIYSPLLDLILSPQQYGFKVGDKGCCGTGLIEVTALC  317

Query  398   NKLS-GTCPDRNKYLFWDSYHPTEKGYRIIVNRIITKYINSF  276
             N  +   CP R+ Y+FWDS+HPTEK YRIIV ++  KY + F
Sbjct  318   NNYTAAVCPIRSDYVFWDSFHPTEKAYRIIVAKLFDKYFDRF  359



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 3685527018540