BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c80674_g1_i1 len=2434 path=[2412:0-2433]

Length=2434
                                                                      Score     E

ref|XP_009772119.1|  PREDICTED: leucine-rich repeat receptor prot...    993   0.0      
ref|XP_004229807.1|  PREDICTED: probable LRR receptor-like serine...    989   0.0      
ref|XP_006347874.1|  PREDICTED: LRR receptor-like serine/threonin...    986   0.0      
ref|XP_009629432.1|  PREDICTED: LRR receptor-like serine/threonin...    985   0.0      
emb|CDO97695.1|  unnamed protein product                                947   0.0      
ref|XP_011093359.1|  PREDICTED: LRR receptor-like serine/threonin...    944   0.0      
gb|EYU30556.1|  hypothetical protein MIMGU_mgv1a002343mg                911   0.0      
emb|CAN72186.1|  hypothetical protein VITISV_012898                     859   0.0      Vitis vinifera
ref|XP_002279998.1|  PREDICTED: protein NSP-INTERACTING KINASE 3        857   0.0      Vitis vinifera
ref|XP_010255622.1|  PREDICTED: somatic embryogenesis receptor ki...    854   0.0      
gb|EPS73352.1|  hypothetical protein M569_01401                         853   0.0      
ref|XP_006445272.1|  hypothetical protein CICLE_v10019056mg             849   0.0      
ref|XP_007052072.1|  Leucine-rich repeat receptor protein kinase        847   0.0      
ref|XP_007220017.1|  hypothetical protein PRUPE_ppa002366mg             843   0.0      
gb|KDP28763.1|  hypothetical protein JCGZ_14534                         840   0.0      
ref|XP_002320058.2|  leucine-rich repeat transmembrane protein ki...    839   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_008232645.1|  PREDICTED: protein NSP-INTERACTING KINASE 2 ...    840   0.0      
ref|XP_011034207.1|  PREDICTED: LRR receptor-like serine/threonin...    835   0.0      
gb|KHF99663.1|  nsp-interacting kinase 2 -like protein                  834   0.0      
ref|XP_002301282.2|  hypothetical protein POPTR_0002s14800g             833   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_010276701.1|  PREDICTED: probable leucine-rich repeat rece...    833   0.0      
ref|XP_004170265.1|  PREDICTED: probable leucine-rich repeat rece...    832   0.0      
ref|XP_011017487.1|  PREDICTED: probable leucine-rich repeat rece...    830   0.0      
ref|XP_009338105.1|  PREDICTED: somatic embryogenesis receptor ki...    828   0.0      
ref|XP_006445273.1|  hypothetical protein CICLE_v10019056mg             830   0.0      
ref|XP_009346807.1|  PREDICTED: probable LRR receptor-like serine...    826   0.0      
ref|XP_008467276.1|  PREDICTED: BRASSINOSTEROID INSENSITIVE 1-ass...    826   0.0      
ref|XP_004143652.1|  PREDICTED: LOW QUALITY PROTEIN: protein NSP-...    825   0.0      
ref|XP_008343327.1|  PREDICTED: probable LRR receptor-like serine...    823   0.0      
ref|XP_010098918.1|  LRR receptor-like serine/threonine-protein k...    823   0.0      
ref|XP_010053898.1|  PREDICTED: LRR receptor-like serine/threonin...    819   0.0      
ref|XP_008356288.1|  PREDICTED: protein NSP-INTERACTING KINASE 2-...    820   0.0      
ref|XP_007038447.1|  Leucine-rich repeat protein kinase family pr...    817   0.0      
ref|XP_011041704.1|  PREDICTED: LRR receptor-like serine/threonin...    816   0.0      
ref|XP_002267632.1|  PREDICTED: probable LRR receptor-like serine...    816   0.0      Vitis vinifera
ref|XP_010101735.1|  Leucine-rich repeat receptor protein kinase EXS    813   0.0      
ref|XP_007220018.1|  hypothetical protein PRUPE_ppa002373mg             806   0.0      
ref|XP_008354209.1|  PREDICTED: BRASSINOSTEROID INSENSITIVE 1-ass...    800   0.0      
ref|XP_008234364.1|  PREDICTED: somatic embryogenesis receptor ki...    798   0.0      
ref|XP_009374517.1|  PREDICTED: probable LRR receptor-like serine...    795   0.0      
ref|XP_008376456.1|  PREDICTED: somatic embryogenesis receptor ki...    791   0.0      
ref|XP_004309271.1|  PREDICTED: probable LRR receptor-like serine...    790   0.0      
ref|XP_009370496.1|  PREDICTED: somatic embryogenesis receptor ki...    790   0.0      
ref|XP_004512590.1|  PREDICTED: leucine-rich repeat receptor-like...    790   0.0      
ref|XP_003548248.1|  PREDICTED: LRR receptor-like serine/threonin...    789   0.0      
ref|XP_004308453.1|  PREDICTED: LRR receptor-like serine/threonin...    788   0.0      
ref|XP_006490241.1|  PREDICTED: somatic embryogenesis receptor ki...    788   0.0      
ref|XP_006421744.1|  hypothetical protein CICLE_v10004478mg             784   0.0      
gb|KHN24426.1|  Protein NSP-INTERACTING KINASE 2                        784   0.0      
ref|XP_003534047.1|  PREDICTED: somatic embryogenesis receptor ki...    783   0.0      
ref|XP_007152413.1|  hypothetical protein PHAVU_004G128100g             783   0.0      
ref|XP_011076309.1|  PREDICTED: BRASSINOSTEROID INSENSITIVE 1-ass...    781   0.0      
ref|XP_009791302.1|  PREDICTED: somatic embryogenesis receptor ki...    781   0.0      
ref|XP_008438169.1|  PREDICTED: probable LRR receptor-like serine...    780   0.0      
gb|KDP22393.1|  hypothetical protein JCGZ_26224                         780   0.0      
gb|AES75836.2|  LRR receptor-like kinase                                780   0.0      
ref|XP_004133916.1|  PREDICTED: probable LRR receptor-like serine...    776   0.0      
emb|CBI24527.3|  unnamed protein product                                774   0.0      
ref|XP_010524368.1|  PREDICTED: LOW QUALITY PROTEIN: leucine-rich...    775   0.0      
ref|XP_004234946.1|  PREDICTED: LRR receptor-like serine/threonin...    773   0.0      
gb|KHG05851.1|  protein strubbelig-receptor family 8                    772   0.0      
ref|XP_011029975.1|  PREDICTED: probable LRR receptor-like serine...    769   0.0      
ref|XP_010692238.1|  PREDICTED: LRR receptor-like serine/threonin...    769   0.0      
ref|XP_007143904.1|  hypothetical protein PHAVU_007G112100g             769   0.0      
ref|XP_009593156.1|  PREDICTED: probable LRR receptor-like serine...    768   0.0      
ref|XP_006365244.1|  PREDICTED: somatic embryogenesis receptor ki...    766   0.0      
ref|XP_003536190.1|  PREDICTED: somatic embryogenesis receptor ki...    765   0.0      
ref|XP_009372936.1|  PREDICTED: probable LRR receptor-like serine...    765   0.0      
gb|KHG09358.1|  Leucine-rich repeat receptor protein kinase EXS         764   0.0      
ref|XP_003556401.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    761   0.0      
ref|XP_002318874.2|  hypothetical protein POPTR_0012s14430g             759   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_009382934.1|  PREDICTED: BRASSINOSTEROID INSENSITIVE 1-ass...    758   0.0      
ref|XP_003619618.1|  Receptor-like protein kinase                       759   0.0      
ref|XP_010941035.1|  PREDICTED: probable leucine-rich repeat rece...    758   0.0      
gb|KFK37319.1|  hypothetical protein AALP_AA4G241600                    758   0.0      
ref|XP_002510917.1|  leucine rich repeat receptor kinase, putative      751   0.0      Ricinus communis
ref|XP_008803990.1|  PREDICTED: somatic embryogenesis receptor ki...    753   0.0      
emb|CDP05303.1|  unnamed protein product                                750   0.0      
ref|XP_006397716.1|  hypothetical protein EUTSA_v10001341mg             750   0.0      
ref|NP_182059.1|  putative leucine-rich repeat transmembrane prot...    750   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_009143131.1|  PREDICTED: probable LRR receptor-like serine...    750   0.0      
ref|XP_010671985.1|  PREDICTED: probable LRR receptor-like serine...    749   0.0      
ref|XP_010910517.1|  PREDICTED: somatic embryogenesis receptor ki...    748   0.0      
emb|CDY51809.1|  BnaC04g53150D                                          745   0.0      
emb|CDX74732.1|  BnaA05g04780D                                          745   0.0      
ref|XP_009142330.1|  PREDICTED: protein NSP-INTERACTING KINASE 2-...    746   0.0      
emb|CDY37035.1|  BnaA04g26130D                                          744   0.0      
gb|KEH22283.1|  LRR receptor-like kinase                                744   0.0      
ref|XP_010934669.1|  PREDICTED: leucine-rich repeat receptor prot...    744   0.0      
ref|XP_006293447.1|  hypothetical protein CARUB_v10022725mg             746   0.0      
ref|XP_008794535.1|  PREDICTED: LRR receptor-like serine/threonin...    741   0.0      
ref|XP_010037998.1|  PREDICTED: probable LRR receptor-like serine...    741   0.0      
emb|CDY57103.1|  BnaC04g56910D                                          739   0.0      
ref|XP_002880173.1|  hypothetical protein ARALYDRAFT_346338             733   0.0      
ref|XP_007038448.1|  Leucine-rich repeat protein kinase family pr...    730   0.0      
ref|XP_010532258.1|  PREDICTED: somatic embryogenesis receptor ki...    732   0.0      
gb|KFK26770.1|  hypothetical protein AALP_AA8G291500                    731   0.0      
ref|XP_007210306.1|  hypothetical protein PRUPE_ppa002356mg             730   0.0      
ref|XP_002522411.1|  leucine rich repeat receptor kinase, putative      729   0.0      Ricinus communis
gb|EYU24994.1|  hypothetical protein MIMGU_mgv1a002428mg                730   0.0      
ref|XP_009362126.1|  PREDICTED: probable leucine-rich repeat rece...    729   0.0      
ref|XP_004300723.1|  PREDICTED: probable leucine-rich repeat rece...    728   0.0      
ref|XP_008345369.1|  PREDICTED: probable leucine-rich repeat rece...    726   0.0      
ref|XP_010518150.1|  PREDICTED: probable LRR receptor-like serine...    726   0.0      
ref|XP_004495431.1|  PREDICTED: probable leucine-rich repeat rece...    725   0.0      
ref|XP_010506476.1|  PREDICTED: probable LRR receptor-like serine...    726   0.0      
ref|XP_006401961.1|  hypothetical protein EUTSA_v10012874mg             724   0.0      
ref|XP_007039978.1|  Leucine-rich repeat protein kinase family pr...    722   0.0      
ref|NP_199969.1|  leucine-rich repeat protein kinase                    719   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_002511706.1|  leucine rich repeat receptor kinase, putative      717   0.0      Ricinus communis
ref|XP_010662200.1|  PREDICTED: probable leucine-rich repeat rece...    719   0.0      
ref|XP_010512840.1|  PREDICTED: probable LRR receptor-like serine...    724   0.0      
ref|XP_002862982.1|  hypothetical protein ARALYDRAFT_920855             718   0.0      
ref|XP_004513505.1|  PREDICTED: probable leucine-rich repeat rece...    717   0.0      
gb|AAM62629.1|  receptor-like protein kinase                            717   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_010482493.1|  PREDICTED: BRASSINOSTEROID INSENSITIVE 1-ass...    717   0.0      
ref|XP_006279482.1|  hypothetical protein CARUB_v10026012mg             714   0.0      
ref|XP_010442662.1|  PREDICTED: probable leucine-rich repeat rece...    713   0.0      
ref|XP_007140941.1|  hypothetical protein PHAVU_008G154200g             712   0.0      
ref|XP_008238646.1|  PREDICTED: probable LRR receptor-like serine...    710   0.0      
ref|XP_003561214.1|  PREDICTED: leucine-rich repeat receptor prot...    708   0.0      
ref|XP_010443441.1|  PREDICTED: probably inactive leucine-rich re...    708   0.0      
emb|CDY00487.1|  BnaA10g07860D                                          706   0.0      
gb|KHG14855.1|  nsp-interacting kinase 2 -like protein                  706   0.0      
ref|XP_009107333.1|  PREDICTED: somatic embryogenesis receptor ki...    706   0.0      
ref|XP_011042292.1|  PREDICTED: probable LRR receptor-like serine...    706   0.0      
emb|CDX99903.1|  BnaC09g28020D                                          704   0.0      
ref|XP_006857826.1|  hypothetical protein AMTR_s00069p00033900          704   0.0      
gb|AES78411.2|  LRR receptor-like kinase                                702   0.0      
ref|XP_002303531.2|  leucine-rich repeat transmembrane protein ki...    701   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_006368702.1|  leucine-rich repeat transmembrane protein ki...    703   0.0      
ref|XP_002509606.1|  leucine rich repeat receptor kinase, putative      703   0.0      Ricinus communis
ref|XP_003622193.1|  Receptor-like protein kinase                       699   0.0      
ref|XP_006440406.1|  hypothetical protein CICLE_v10019076mg             701   0.0      
gb|KDO63769.1|  hypothetical protein CISIN_1g005586mg                   697   0.0      
ref|XP_006477275.1|  PREDICTED: probable LRR receptor-like serine...    698   0.0      
gb|KDP25598.1|  hypothetical protein JCGZ_20754                         694   0.0      
ref|XP_008448908.1|  PREDICTED: LRR receptor-like serine/threonin...    694   0.0      
ref|XP_004147946.1|  PREDICTED: LRR receptor-like serine/threonin...    691   0.0      
ref|XP_010024716.1|  PREDICTED: LRR receptor-like serine/threonin...    690   0.0      
ref|XP_009383987.1|  PREDICTED: BRASSINOSTEROID INSENSITIVE 1-ass...    690   0.0      
ref|XP_004973001.1|  PREDICTED: probable LRR receptor-like serine...    689   0.0      
ref|XP_011081121.1|  PREDICTED: LRR receptor-like serine/threonin...    688   0.0      
ref|XP_010056326.1|  PREDICTED: probable LRR receptor-like serine...    689   0.0      
ref|XP_010108139.1|  LRR receptor-like serine/threonine-protein k...    688   0.0      
ref|XP_010056327.1|  PREDICTED: probable LRR receptor-like serine...    687   0.0      
ref|XP_010055541.1|  PREDICTED: probable leucine-rich repeat rece...    684   0.0      
ref|XP_010676667.1|  PREDICTED: probable LRR receptor-like serine...    685   0.0      
ref|XP_009382007.1|  PREDICTED: probable LRR receptor-like serine...    682   0.0      
emb|CDP09887.1|  unnamed protein product                                681   0.0      
ref|XP_006655759.1|  PREDICTED: somatic embryogenesis receptor ki...    676   0.0      
ref|XP_002443773.1|  hypothetical protein SORBIDRAFT_07g001690          677   0.0      Sorghum bicolor [broomcorn]
gb|EAY99548.1|  hypothetical protein OsI_21521                          676   0.0      Oryza sativa Indica Group [Indian rice]
ref|NP_001056717.1|  Os06g0134700                                       675   0.0      Oryza sativa Japonica Group [Japonica rice]
ref|XP_009789637.1|  PREDICTED: probable leucine-rich repeat rece...    675   0.0      
ref|XP_006374656.1|  hypothetical protein POPTR_0015s14480g             668   0.0      
ref|XP_009593141.1|  PREDICTED: leucine-rich repeat receptor-like...    673   0.0      
ref|XP_004964453.1|  PREDICTED: probable LRR receptor-like serine...    672   0.0      
dbj|BAD68873.1|  putative somatic embryogenesis protein kinase 1        671   0.0      Oryza sativa Japonica Group [Japonica rice]
ref|XP_008658219.1|  PREDICTED: uncharacterized protein LOC100272...    672   0.0      
ref|XP_007157320.1|  hypothetical protein PHAVU_002G060200g             663   0.0      
ref|XP_003517433.1|  PREDICTED: somatic embryogenesis receptor ki...    662   0.0      
ref|XP_006573733.1|  PREDICTED: somatic embryogenesis receptor ki...    660   0.0      
ref|XP_003573305.1|  PREDICTED: leucine-rich repeat receptor prot...    659   0.0      
ref|XP_006413630.1|  hypothetical protein EUTSA_v10024592mg             657   0.0      
ref|XP_010529507.1|  PREDICTED: probable LRR receptor-like serine...    654   0.0      
ref|XP_006363735.1|  PREDICTED: leucine-rich repeat receptor prot...    652   0.0      
ref|XP_004245714.1|  PREDICTED: probable LRR receptor-like serine...    650   0.0      
emb|CDX82961.1|  BnaC01g14110D                                          650   0.0      
gb|KHN34965.1|  Protein NSP-INTERACTING KINASE 2                        649   0.0      
ref|XP_003538634.1|  PREDICTED: LRR receptor-like serine/threonin...    649   0.0      
emb|CDX79173.1|  BnaA01g12400D                                          648   0.0      
gb|KFK28836.1|  hypothetical protein AALP_AA7G055200                    646   0.0      
ref|XP_004511651.1|  PREDICTED: LRR receptor-like serine/threonin...    645   0.0      
ref|NP_194004.1|  leucine-rich repeat protein kinase-like protein       644   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_002869809.1|  hypothetical protein ARALYDRAFT_492596             643   0.0      
ref|XP_003611243.1|  Receptor-like protein kinase                       642   0.0      
ref|XP_010448856.1|  PREDICTED: protein NSP-INTERACTING KINASE 2-...    639   0.0      
ref|XP_006659770.1|  PREDICTED: LOW QUALITY PROTEIN: probable LRR...    639   0.0      
ref|XP_006285866.1|  hypothetical protein CARUB_v10007360mg             638   0.0      
ref|XP_010434007.1|  PREDICTED: somatic embryogenesis receptor ki...    637   0.0      
ref|XP_010100886.1|  putative LRR receptor-like serine/threonine-...    634   0.0      
emb|CDM83247.1|  unnamed protein product                                635   0.0      
ref|XP_003525760.1|  PREDICTED: probable leucine-rich repeat rece...    633   0.0      
gb|KEH22284.1|  LRR receptor-like kinase                                629   0.0      
ref|XP_009136073.1|  PREDICTED: somatic embryogenesis receptor ki...    629   0.0      
ref|NP_001060863.1|  Os08g0117700                                       630   0.0      Oryza sativa Japonica Group [Japonica rice]
ref|NP_001043393.1|  Os01g0577600                                       629   0.0      Oryza sativa Japonica Group [Japonica rice]
ref|XP_010439303.1|  PREDICTED: somatic embryogenesis receptor ki...    622   0.0      
ref|XP_008660396.1|  PREDICTED: somatic embryogenesis receptor ki...    621   0.0      
ref|XP_003550887.1|  PREDICTED: probable leucine-rich repeat rece...    618   0.0      
ref|XP_008232646.1|  PREDICTED: putative receptor-like protein ki...    610   0.0      
ref|XP_008647994.1|  PREDICTED: uncharacterized protein LOC100304...    614   0.0      
gb|EMT04404.1|  Leucine-rich repeat receptor protein kinase EXS         613   0.0      
ref|XP_003569250.1|  PREDICTED: LOW QUALITY PROTEIN: somatic embr...    614   0.0      
ref|XP_002458036.1|  hypothetical protein SORBIDRAFT_03g025880          612   0.0      Sorghum bicolor [broomcorn]
ref|XP_002436427.1|  hypothetical protein SORBIDRAFT_10g002300          603   0.0      Sorghum bicolor [broomcorn]
ref|XP_006646028.1|  PREDICTED: LRR receptor-like serine/threonin...    602   0.0      
ref|XP_007155588.1|  hypothetical protein PHAVU_003G214800g             605   0.0      
gb|EMT21475.1|  Putative LRR receptor-like serine/threonine-prote...    598   0.0      
ref|XP_008791357.1|  PREDICTED: somatic embryogenesis receptor ki...    591   0.0      
gb|EAZ41323.1|  hypothetical protein OsJ_25834                          596   0.0      Oryza sativa Japonica Group [Japonica rice]
gb|AFW83078.1|  putative leucine-rich repeat protein kinase famil...    586   0.0      
ref|XP_008438170.1|  PREDICTED: LRR receptor-like serine/threonin...    577   0.0      
ref|XP_008656611.1|  PREDICTED: probable leucine-rich repeat rece...    586   0.0      
gb|KEH27456.1|  LRR receptor-like kinase                                576   0.0      
ref|XP_004969430.1|  PREDICTED: LRR receptor-like serine/threonin...    577   0.0      
ref|NP_001146186.1|  uncharacterized LOC100279756 precursor             576   0.0      Zea mays [maize]
gb|EMT10973.1|  Leucine-rich repeat receptor protein kinase EXS         577   0.0      
gb|KDO63770.1|  hypothetical protein CISIN_1g005586mg                   563   0.0      
ref|XP_008377897.1|  PREDICTED: probable LRR receptor-like serine...    557   0.0      
gb|EYU24995.1|  hypothetical protein MIMGU_mgv1a002428mg                553   0.0      
ref|XP_010676668.1|  PREDICTED: protein NSP-INTERACTING KINASE 2 ...    555   0.0      
ref|XP_002880175.1|  hypothetical protein ARALYDRAFT_346342             550   0.0      
gb|KCW49798.1|  hypothetical protein EUGRSUZ_K03279                     551   0.0      
ref|XP_002880174.1|  hypothetical protein ARALYDRAFT_346340             536   8e-179   
ref|NP_001140286.1|  uncharacterized protein LOC100272330               534   6e-178   Zea mays [maize]
gb|EPS61496.1|  hypothetical protein M569_13300                         530   1e-174   
ref|XP_002511696.1|  leucine rich repeat receptor kinase, putative      515   9e-173   Ricinus communis
ref|XP_006590549.1|  PREDICTED: LRR receptor-like serine/threonin...    522   9e-172   
gb|KEH27457.1|  LRR receptor-like kinase                                501   5e-165   
ref|XP_002509720.1|  leucine rich repeat receptor kinase, putative      489   1e-161   Ricinus communis
gb|EMS50357.1|  Leucine-rich repeat receptor protein kinase EXS         496   2e-161   
gb|KDO63771.1|  hypothetical protein CISIN_1g005586mg                   486   3e-160   
gb|EPS73880.1|  hypothetical protein M569_00875                         421   2e-135   
ref|XP_002985490.1|  hypothetical protein SELMODRAFT_122408             426   2e-133   
ref|XP_002987081.1|  hypothetical protein SELMODRAFT_125338             424   2e-132   
gb|EYU30450.1|  hypothetical protein MIMGU_mgv1a026158mg                405   6e-129   
ref|XP_001785536.1|  predicted protein                                  408   8e-127   
gb|KDO65398.1|  hypothetical protein CISIN_1g044913mg                   396   3e-126   
gb|ACN31808.1|  unknown                                                 343   7e-106   Zea mays [maize]
gb|KCW82134.1|  hypothetical protein EUGRSUZ_C035232                    323   1e-98    
dbj|BAJ93229.1|  predicted protein                                      320   2e-98    
emb|CBI38873.3|  unnamed protein product                                315   1e-96    
ref|XP_002509610.1|  leucine rich repeat receptor kinase, putative      286   2e-86    Ricinus communis
ref|XP_008812839.1|  PREDICTED: probable receptor-like protein ki...    279   3e-84    
ref|NP_001159136.1|  uncharacterized protein LOC100304214               265   1e-78    Zea mays [maize]
gb|EPS72502.1|  hypothetical protein M569_02256                         238   5e-69    
dbj|BAJ91470.1|  predicted protein                                      245   8e-67    
ref|XP_007033440.1|  NSP-interacting kinase 1                           245   9e-67    
ref|XP_006474063.1|  PREDICTED: probable LRR receptor-like serine...    244   2e-66    
ref|XP_004149147.1|  PREDICTED: somatic embryogenesis receptor ki...    243   2e-66    
gb|AHF18212.1|  brassinosteroid insensitive 1-associated receptor...    243   5e-66    
ref|XP_008453749.1|  PREDICTED: somatic embryogenesis receptor ki...    242   6e-66    
ref|XP_010236002.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...    241   1e-65    
ref|XP_003572984.2|  PREDICTED: protein NSP-INTERACTING KINASE 1-...    241   1e-65    
ref|XP_006576501.1|  PREDICTED: probable inactive leucine-rich re...    243   2e-65    
ref|XP_002452616.1|  hypothetical protein SORBIDRAFT_04g029170          241   3e-65    Sorghum bicolor [broomcorn]
emb|CDX90696.1|  BnaA03g23760D                                          242   6e-65    
ref|XP_008446051.1|  PREDICTED: probable inactive leucine-rich re...    241   1e-64    
ref|XP_004159709.1|  PREDICTED: probable inactive leucine-rich re...    239   2e-64    
gb|KGN51683.1|  hypothetical protein Csa_5G590000                       239   3e-64    
ref|XP_004135515.1|  PREDICTED: probable inactive leucine-rich re...    239   3e-64    
ref|XP_004310210.1|  PREDICTED: probable inactive leucine-rich re...    239   4e-64    
gb|KFK32690.1|  hypothetical protein AALP_AA6G276300                    236   1e-63    
ref|XP_007134648.1|  hypothetical protein PHAVU_010G064900g             237   2e-63    
ref|XP_007154851.1|  hypothetical protein PHAVU_003G152900g             234   3e-63    
gb|KCW89011.1|  hypothetical protein EUGRSUZ_A01333                     240   5e-63    
ref|XP_007045046.1|  Leucine-rich repeat protein kinase family pr...    235   1e-62    
gb|KCW89014.1|  hypothetical protein EUGRSUZ_A01339                     239   2e-62    
ref|XP_010068524.1|  PREDICTED: probable LRR receptor-like serine...    238   2e-62    
ref|XP_003516395.1|  PREDICTED: probable inactive leucine-rich re...    233   3e-62    
ref|XP_007038365.1|  Leucine-rich repeat receptor-like protein ki...    235   5e-62    
ref|XP_010548642.1|  PREDICTED: probable LRR receptor-like serine...    231   6e-62    
ref|XP_009773743.1|  PREDICTED: LRR receptor-like serine/threonin...    230   6e-62    
gb|KFK41150.1|  hypothetical protein AALP_AA2G092300                    231   3e-61    
gb|AFW74368.1|  putative leucine-rich repeat protein kinase famil...    217   4e-61    
ref|XP_006443767.1|  hypothetical protein CICLE_v10018560mg             234   7e-61    
ref|XP_001772778.1|  predicted protein                                  229   1e-60    
ref|XP_010068462.1|  PREDICTED: probable LRR receptor-like serine...    233   1e-60    
ref|XP_010905760.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...    227   2e-60    
gb|KCW89004.1|  hypothetical protein EUGRSUZ_A01326                     232   2e-60    
ref|XP_009626861.1|  PREDICTED: leucine-rich repeat receptor-like...    231   3e-60    
ref|XP_008796642.1|  PREDICTED: LRR receptor-like serine/threonin...    225   5e-60    
ref|XP_010048149.1|  PREDICTED: probable LRR receptor-like serine...    231   5e-60    
ref|XP_006397251.1|  hypothetical protein EUTSA_v10028381mg             230   6e-60    
ref|XP_003552276.1|  PREDICTED: probable inactive leucine-rich re...    227   6e-60    
ref|XP_010068354.1|  PREDICTED: probable LRR receptor-like serine...    220   6e-60    
ref|NP_001050035.1|  Os03g0335500                                       229   6e-60    Oryza sativa Japonica Group [Japonica rice]
gb|EAZ26832.1|  hypothetical protein OsJ_10748                          229   6e-60    
gb|KFK24158.1|  hypothetical protein AALP_AAs61366U000100               229   6e-60    
gb|EEC75203.1|  hypothetical protein OsI_11455                          229   8e-60    
emb|CDP13327.1|  unnamed protein product                                226   9e-60    
ref|NP_001169737.1|  uncharacterized LOC100383618 precursor             225   1e-59    
ref|XP_009384784.1|  PREDICTED: probably inactive leucine-rich re...    228   1e-59    
emb|CDP21356.1|  unnamed protein product                                223   2e-59    
gb|EEC69743.1|  hypothetical protein OsI_39273                          224   2e-59    
ref|XP_003562443.1|  PREDICTED: probable inactive receptor kinase...    224   2e-59    
ref|NP_001067376.1|  Os12g0638100                                       223   2e-59    
ref|XP_006286977.1|  hypothetical protein CARUB_v10000124mg             228   3e-59    
ref|XP_008340196.1|  PREDICTED: LOW QUALITY PROTEIN: probable ina...    225   3e-59    
ref|XP_009134111.1|  PREDICTED: probable LRR receptor-like serine...    228   3e-59    
dbj|BAK07296.1|  predicted protein                                      223   3e-59    
ref|XP_009344527.1|  PREDICTED: probable LRR receptor-like serine...    227   3e-59    
ref|XP_004491002.1|  PREDICTED: probably inactive leucine-rich re...    226   4e-59    
gb|EYU38215.1|  hypothetical protein MIMGU_mgv1a000518mg                228   4e-59    
ref|XP_010692915.1|  PREDICTED: probable leucine-rich repeat rece...    225   6e-59    
ref|XP_002514942.1|  protein with unknown function                      225   6e-59    
ref|XP_011041520.1|  PREDICTED: probable inactive leucine-rich re...    224   8e-59    
ref|XP_008350956.1|  PREDICTED: probable inactive leucine-rich re...    224   8e-59    
ref|XP_006354069.1|  PREDICTED: probable LRR receptor-like serine...    227   8e-59    
dbj|BAJ93317.1|  predicted protein                                      222   9e-59    
ref|XP_003529180.1|  PREDICTED: probable inactive leucine-rich re...    223   1e-58    
ref|XP_010933597.1|  PREDICTED: LRR receptor-like serine/threonin...    221   1e-58    
ref|XP_006664782.1|  PREDICTED: LRR receptor-like serine/threonin...    221   2e-58    
ref|NP_849538.2|  probable LRR receptor-like serine/threonine-pro...    225   2e-58    
emb|CAB78010.1|  receptor protein kinase-like protein                   225   2e-58    
ref|XP_010415324.1|  PREDICTED: probable inactive leucine-rich re...    222   3e-58    
ref|XP_002865012.1|  hypothetical protein ARALYDRAFT_496872             222   3e-58    
ref|XP_010068602.1|  PREDICTED: probable LRR receptor-like serine...    224   3e-58    
ref|XP_007225190.1|  hypothetical protein PRUPE_ppa002123mg             222   3e-58    
ref|XP_002445573.1|  hypothetical protein SORBIDRAFT_07g021820          221   4e-58    
ref|XP_002520879.1|  ATP binding protein, putative                      224   4e-58    
ref|XP_010230509.1|  PREDICTED: protein NSP-INTERACTING KINASE 3 ...    220   4e-58    
ref|XP_009372312.1|  PREDICTED: probable inactive leucine-rich re...    222   4e-58    
ref|XP_001774136.1|  predicted protein                                  226   4e-58    
gb|KCW89016.1|  hypothetical protein EUGRSUZ_A01341                     224   5e-58    
ref|XP_002871261.1|  extra sporogenous cells                            225   5e-58    
gb|KCW89006.1|  hypothetical protein EUGRSUZ_A01327                     224   6e-58    
gb|KDO81950.1|  hypothetical protein CISIN_1g005226mg                   221   7e-58    
ref|XP_002278590.1|  PREDICTED: probable LRR receptor-like serine...    224   7e-58    
ref|XP_002513911.1|  receptor protein kinase, putative                  223   7e-58    
ref|XP_004488711.1|  PREDICTED: leucine-rich repeat receptor-like...    224   7e-58    
emb|CDX96089.1|  BnaA07g26420D                                          221   7e-58    
ref|XP_011029672.1|  PREDICTED: probable inactive leucine-rich re...    221   8e-58    
ref|XP_006658137.1|  PREDICTED: probable inactive receptor kinase...    219   8e-58    
ref|XP_006438068.1|  hypothetical protein CICLE_v10030842mg             220   9e-58    
emb|CAD42912.1|  extra sporogenous cells                                224   9e-58    
gb|EAZ05160.1|  hypothetical protein OsI_27356                          219   1e-57    
ref|XP_002888603.1|  predicted protein                                  220   1e-57    
ref|XP_008369305.1|  PREDICTED: probably inactive leucine-rich re...    221   1e-57    
ref|NP_001060650.1|  Os07g0681100                                       219   1e-57    
ref|XP_010068445.1|  PREDICTED: probable LRR receptor-like serine...    224   1e-57    
ref|XP_010100900.1|  Protein NSP-INTERACTING KINASE 1                   219   1e-57    
ref|NP_196345.1|  leucine-rich repeat receptor protein kinase EMS1      223   2e-57    
ref|XP_006438322.1|  hypothetical protein CICLE_v10030967mg             218   2e-57    
ref|XP_010436295.1|  PREDICTED: probable LRR receptor-like serine...    222   2e-57    
gb|KDO82334.1|  hypothetical protein CISIN_1g006968mg                   218   2e-57    
ref|XP_009145117.1|  PREDICTED: probable LRR receptor-like serine...    222   2e-57    
ref|XP_010061931.1|  PREDICTED: BRASSINOSTEROID INSENSITIVE 1-ass...    209   3e-57    
ref|XP_002975820.1|  hypothetical protein SELMODRAFT_103725             224   3e-57    
emb|CBI27592.3|  unnamed protein product                                218   3e-57    
ref|XP_006484071.1|  PREDICTED: probable inactive leucine-rich re...    219   3e-57    
ref|XP_002973771.1|  hypothetical protein SELMODRAFT_99902              223   3e-57    
emb|CDX73350.1|  BnaC05g27560D                                          219   3e-57    
ref|XP_008451910.1|  PREDICTED: LRR receptor-like serine/threonin...    216   4e-57    
ref|XP_010061930.1|  PREDICTED: probable leucine-rich repeat rece...    209   4e-57    
ref|XP_010455295.1|  PREDICTED: probable LRR receptor-like serine...    221   4e-57    
ref|XP_004492498.1|  PREDICTED: probable inactive leucine-rich re...    218   5e-57    
ref|XP_010279368.1|  PREDICTED: probable inactive leucine-rich re...    218   5e-57    
ref|XP_009105290.1|  PREDICTED: probable inactive leucine-rich re...    218   6e-57    
ref|XP_004137674.1|  PREDICTED: probably inactive leucine-rich re...    220   6e-57    
ref|XP_010542990.1|  PREDICTED: probable LRR receptor-like serine...    222   6e-57    
ref|XP_002874556.1|  hypothetical protein ARALYDRAFT_489780             221   7e-57    
ref|XP_001763842.1|  predicted protein                                  217   7e-57    
gb|EMT18823.1|  Putative LRR receptor-like serine/threonine-prote...    220   7e-57    
ref|XP_008226273.1|  PREDICTED: leucine-rich repeat receptor-like...    221   7e-57    
gb|KFK32111.1|  hypothetical protein AALP_AA6G200000                    220   8e-57    
gb|EPS59286.1|  hypothetical protein M569_15521                         216   8e-57    
ref|XP_008222077.1|  PREDICTED: probable inactive leucine-rich re...    218   8e-57    
ref|XP_010436287.1|  PREDICTED: probable LRR receptor-like serine...    220   1e-56    
ref|XP_008810949.1|  PREDICTED: LRR receptor-like serine/threonin...    215   1e-56    
ref|XP_006585065.1|  PREDICTED: serine/threonine-protein kinase B...    221   1e-56    
ref|XP_008219676.1|  PREDICTED: probable LRR receptor-like serine...    219   1e-56    
ref|XP_008219746.1|  PREDICTED: probable LRR receptor-like serine...    219   1e-56    
ref|NP_201529.1|  receptor-like kinase                                  218   1e-56    
ref|XP_009343456.1|  PREDICTED: LRR receptor-like serine/threonin...    215   1e-56    
ref|XP_004488712.1|  PREDICTED: leucine-rich repeat receptor-like...    220   2e-56    
ref|XP_006483905.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...    215   2e-56    
gb|EMT12910.1|  Putative inactive receptor kinase                       215   2e-56    
ref|XP_002319878.2|  leucine-rich repeat transmembrane protein ki...    218   2e-56    
gb|KDP26784.1|  hypothetical protein JCGZ_17942                         216   2e-56    
gb|KHG08504.1|  hypothetical protein F383_35684                         216   2e-56    
ref|XP_008810950.1|  PREDICTED: LRR receptor-like serine/threonin...    214   3e-56    
ref|XP_010105787.1|  putative inactive leucine-rich repeat recept...    216   3e-56    
ref|XP_004239201.1|  PREDICTED: probable inactive leucine-rich re...    216   3e-56    
ref|XP_010236962.1|  PREDICTED: LRR receptor-like serine/threonin...    214   3e-56    
ref|XP_011095143.1|  PREDICTED: probably inactive leucine-rich re...    218   4e-56    
ref|XP_010421795.1|  PREDICTED: probable LRR receptor-like serine...    218   4e-56    
ref|XP_010539262.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    215   4e-56    
ref|XP_002323672.2|  hypothetical protein POPTR_0016s14410g             218   5e-56    
ref|XP_006827421.1|  hypothetical protein AMTR_s00009p00076890          220   5e-56    
gb|AAL06915.1|  AT5g67280/K3G17_4                                       216   5e-56    
ref|XP_001783845.1|  predicted protein                                  215   6e-56    
ref|XP_004148980.1|  PREDICTED: LRR receptor-like serine/threonin...    213   6e-56    
ref|XP_009369360.1|  PREDICTED: LRR receptor-like serine/threonin...    213   6e-56    
ref|XP_006391267.1|  hypothetical protein EUTSA_v10018190mg             215   7e-56    
ref|NP_001239730.1|  probably inactive leucine-rich repeat recept...    217   8e-56    
gb|EMT09037.1|  Putative inactive receptor kinase                       213   1e-55    
ref|XP_010481721.1|  PREDICTED: LRR receptor-like serine/threonin...    218   1e-55    
ref|XP_004308984.1|  PREDICTED: probably inactive leucine-rich re...    216   1e-55    
ref|XP_011076470.1|  PREDICTED: probable leucine-rich repeat rece...    214   1e-55    
ref|XP_010092789.1|  Probably inactive leucine-rich repeat recept...    216   1e-55    
ref|XP_008219745.1|  PREDICTED: probable leucine-rich repeat rece...    216   1e-55    
emb|CDY01814.1|  BnaC06g28540D                                          214   1e-55    
gb|KHG07759.1|  hypothetical protein F383_34545                         213   1e-55    
ref|XP_006340921.1|  PREDICTED: probable leucine-rich repeat rece...    217   1e-55    
ref|XP_010099162.1|  Protein STRUBBELIG-RECEPTOR FAMILY 8               214   1e-55    
ref|NP_001050019.1|  Os03g0332900                                       213   2e-55    
ref|XP_006280060.1|  hypothetical protein CARUB_v10025940mg             214   2e-55    
emb|CDX70023.1|  BnaA10g23720D                                          215   2e-55    
ref|XP_006489937.1|  PREDICTED: leucine-rich repeat receptor-like...    215   2e-55    
ref|XP_007141726.1|  hypothetical protein PHAVU_008G220100g             214   2e-55    
gb|KDO41799.1|  hypothetical protein CISIN_1g018440mg                   204   3e-55    
ref|XP_009403261.1|  PREDICTED: probable inactive leucine-rich re...    212   4e-55    
ref|XP_003522510.2|  PREDICTED: probably inactive leucine-rich re...    215   4e-55    
ref|XP_010253067.1|  PREDICTED: probably inactive leucine-rich re...    214   4e-55    
ref|XP_002870895.1|  hypothetical protein ARALYDRAFT_486880             214   5e-55    
gb|EPS63883.1|  hypothetical protein M569_10899                         216   5e-55    
gb|AID60133.1|  leucine-rich repeat protein kinase family protein       212   7e-55    
gb|KHN28891.1|  Serine/threonine-protein kinase BRI1-like 2             215   7e-55    
ref|XP_006286925.1|  hypothetical protein CARUB_v10000068mg             216   8e-55    
ref|XP_010923293.1|  PREDICTED: LRR receptor-like serine/threonin...    210   8e-55    
gb|EEE65024.1|  hypothetical protein OsJ_19993                          213   8e-55    
ref|NP_001061919.1|  Os08g0442700                                       211   8e-55    
ref|XP_006442129.1|  hypothetical protein CICLE_v10024387mg             214   8e-55    
ref|XP_010670069.1|  PREDICTED: probably inactive leucine-rich re...    214   8e-55    
emb|CDY54466.1|  BnaA09g52710D                                          211   9e-55    
emb|CDY17621.1|  BnaA06g34400D                                          215   1e-54    
ref|XP_006358746.1|  PREDICTED: probably inactive leucine-rich re...    213   1e-54    
ref|XP_009123232.1|  PREDICTED: receptor protein kinase-like prot...    211   1e-54    
ref|XP_002265151.2|  PREDICTED: probable inactive leucine-rich re...    211   1e-54    
ref|XP_011002596.1|  PREDICTED: probably inactive leucine-rich re...    213   1e-54    
dbj|BAD44800.1|  putative transmembrane protein kinase                  213   1e-54    
ref|XP_006481449.1|  PREDICTED: putative serine/threonine-protein...    202   1e-54    
gb|AHZ44761.1|  LRRX.BRI-like protein                                   211   2e-54    
ref|XP_009757206.1|  PREDICTED: probably inactive leucine-rich re...    212   2e-54    
ref|XP_009115347.1|  PREDICTED: receptor protein kinase-like prot...    211   2e-54    
ref|XP_004506333.1|  PREDICTED: probable LRR receptor-like serine...    213   2e-54    
gb|KDP21644.1|  hypothetical protein JCGZ_03315                         213   2e-54    
gb|EEC81030.1|  hypothetical protein OsI_23812                          210   2e-54    
ref|XP_006845210.1|  hypothetical protein AMTR_s00005p00251950          210   2e-54    
ref|XP_006363236.1|  PREDICTED: LRR receptor-like serine/threonin...    214   2e-54    
ref|XP_009800742.1|  PREDICTED: probable inactive leucine-rich re...    210   2e-54    
ref|XP_002439964.1|  hypothetical protein SORBIDRAFT_09g023480          212   3e-54    
ref|XP_010228524.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    210   3e-54    
emb|CDY04822.1|  BnaAnng00040D                                          212   3e-54    
gb|ACY07616.1|  stress-induced protein kinase                           212   3e-54    
ref|XP_010100604.1|  LRR receptor-like serine/threonine-protein k...    214   3e-54    
ref|XP_002984179.1|  hypothetical protein SELMODRAFT_156455             208   3e-54    
ref|XP_007216492.1|  hypothetical protein PRUPE_ppa025153mg             213   3e-54    
ref|XP_010252506.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    210   3e-54    
ref|XP_004951618.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    210   3e-54    
ref|XP_003608983.1|  LRR receptor-like serine/threonine-protein k...    208   3e-54    
ref|XP_004239381.1|  PREDICTED: LRR receptor-like serine/threonin...    214   4e-54    
ref|XP_009101656.1|  PREDICTED: serine/threonine-protein kinase B...    209   4e-54    
ref|XP_010244139.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    210   4e-54    
gb|KHN38550.1|  Probably inactive leucine-rich repeat receptor-li...    208   5e-54    
ref|XP_002468017.1|  hypothetical protein SORBIDRAFT_01g038140          211   5e-54    
ref|XP_006398567.1|  hypothetical protein EUTSA_v10012579mg             211   5e-54    
ref|XP_010913297.1|  PREDICTED: probable inactive leucine-rich re...    208   5e-54    
emb|CDY03088.1|  BnaC07g21390D                                          213   6e-54    
ref|XP_010242337.1|  PREDICTED: LRR receptor-like serine/threonin...    207   6e-54    
ref|NP_195809.1|  leucine-rich receptor-like protein kinase             211   6e-54    
emb|CDP04441.1|  unnamed protein product                                209   7e-54    
gb|KDO71127.1|  hypothetical protein CISIN_1g047739mg                   212   7e-54    
dbj|BAK06250.1|  predicted protein                                      211   7e-54    
ref|XP_009623562.1|  PREDICTED: probably inactive leucine-rich re...    210   8e-54    
ref|NP_001064502.1|  Os10g0389800                                       209   8e-54    
ref|XP_007147687.1|  hypothetical protein PHAVU_006G146100g             209   8e-54    
gb|KHN25964.1|  Serine/threonine-protein kinase BRI1-like 2             212   9e-54    
ref|XP_010673268.1|  PREDICTED: leucine-rich repeat receptor prot...    213   9e-54    
ref|XP_010271102.1|  PREDICTED: serine/threonine-protein kinase B...    212   1e-53    
ref|XP_002869840.1|  kinase                                             208   1e-53    
ref|XP_004248037.1|  PREDICTED: leucine-rich repeat receptor prot...    212   1e-53    
ref|XP_008786507.1|  PREDICTED: LOW QUALITY PROTEIN: systemin rec...    211   1e-53    
emb|CDY52422.1|  BnaCnng22430D                                          208   1e-53    
ref|XP_006279331.1|  hypothetical protein CARUB_v10012717mg             210   1e-53    
gb|ABA91103.2|  Leucine Rich Repeat family protein, expressed           209   1e-53    
gb|ACM89468.1|  ATP-binding/protein serine/threonine kinase             211   1e-53    
ref|NP_001237994.1|  ATP binding/protein serine/threonine kinase        212   1e-53    
ref|XP_009351609.1|  PREDICTED: serine/threonine-protein kinase B...    212   1e-53    
ref|XP_008659801.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    208   1e-53    
gb|KFK24685.1|  hypothetical protein AALP_AA8G011600                    210   1e-53    
ref|XP_006413689.1|  hypothetical protein EUTSA_v10024563mg             207   2e-53    
emb|CDX75634.1|  BnaA01g00680D                                          208   2e-53    
ref|XP_006420663.1|  hypothetical protein CICLE_v10004191mg             211   2e-53    
ref|XP_010066684.1|  PREDICTED: probable inactive leucine-rich re...    207   2e-53    
ref|XP_010484520.1|  PREDICTED: probable LRR receptor-like serine...    208   2e-53    
ref|XP_009600475.1|  PREDICTED: leucine-rich repeat receptor prot...    211   2e-53    
gb|KDO57805.1|  hypothetical protein CISIN_1g036815mg                   210   2e-53    
ref|XP_006364697.1|  PREDICTED: leucine-rich repeat receptor prot...    211   2e-53    
ref|XP_006650037.1|  PREDICTED: probable inactive receptor kinase...    206   2e-53    
gb|EEC72655.1|  hypothetical protein OsI_06182                          207   3e-53    
ref|XP_010448928.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    207   3e-53    
ref|XP_004965804.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    207   3e-53    
ref|XP_011008219.1|  PREDICTED: LRR receptor-like serine/threonin...    211   3e-53    
ref|XP_009388759.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    207   3e-53    
ref|XP_006602866.1|  PREDICTED: probable LRR receptor-like serine...    210   4e-53    
ref|XP_009337700.1|  PREDICTED: probable LRR receptor-like serine...    210   4e-53    
ref|XP_010544056.1|  PREDICTED: probable LRR receptor-like serine...    208   4e-53    
ref|XP_011010875.1|  PREDICTED: probably inactive leucine-rich re...    209   4e-53    
ref|XP_009402208.1|  PREDICTED: probably inactive leucine-rich re...    209   4e-53    
ref|XP_007158820.1|  hypothetical protein PHAVU_002G184800g             210   4e-53    
ref|XP_009101284.1|  PREDICTED: serine/threonine-protein kinase B...    210   5e-53    
ref|XP_004300048.1|  PREDICTED: serine/threonine-protein kinase B...    209   5e-53    
gb|EMT22713.1|  Putative LRR receptor-like serine/threonine-prote...    209   5e-53    
ref|XP_003518420.1|  PREDICTED: probably inactive leucine-rich re...    207   5e-53    
ref|XP_010276923.1|  PREDICTED: LRR receptor-like serine/threonin...    204   6e-53    
ref|XP_006466917.1|  PREDICTED: probable LRR receptor-like serine...    209   6e-53    



>ref|XP_009772119.1| PREDICTED: leucine-rich repeat receptor protein kinase EXS [Nicotiana 
sylvestris]
Length=684

 Score =   993 bits (2568),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 497/642 (77%), Positives = 555/642 (86%), Gaps = 3/642 (0%)
 Frame = -3

Query  2207  VSLLMAIKASLDPGNLVLSSWSPNVTDPCSVSSFEGIACNDLGQVVNISLQGKGLYGKIP  2028
             +SLLM+IKASLDP NL+LSSWS N TDPC+  SFEGIACN+LGQVVNISLQGK L GKIP
Sbjct  35    LSLLMSIKASLDPKNLILSSWSANATDPCN-GSFEGIACNELGQVVNISLQGKDLSGKIP  93

Query  2027  PEIGQLNGLSGLYLHFNNLHGVIPKEIASLTQLSDLYLNMNDLSGFIPSEIGNMPNLQVL  1848
             PEIGQL  LSGLYLHFN LHGV+PKEIA+LTQLSDLYLN+N+LSG IP+E+GNM NLQVL
Sbjct  94    PEIGQLQSLSGLYLHFNKLHGVVPKEIANLTQLSDLYLNVNNLSGVIPTEVGNMSNLQVL  153

Query  1847  QLCYNRFEGCIPNKLGSLKNLTVLALQSNQLTGAIPASlggltlltrldLSFNRLFGSIP  1668
             QLCYN+  G IPN++G+LK L+VLALQ NQLTGAIPASLG L +LTRLDLSFN  FGSIP
Sbjct  154   QLCYNQLTGSIPNQIGALKKLSVLALQVNQLTGAIPASLGDLEMLTRLDLSFNNFFGSIP  213

Query  1667  VKLSEASKLEVLDLRNNTLSGNVPLGLKRLNEGFRYENNPGLCGTGFPSLALCSDSSLNP  1488
             VKL+ A KLEVLD+RNNTLSGNVPL LKRLNEGF+Y NNP LCG  F SL LC+ S LN 
Sbjct  214   VKLANAPKLEVLDIRNNTLSGNVPLALKRLNEGFQYANNPDLCGIEFSSLKLCTVSGLNQ  273

Query  1487  TKPEPFGQGSNRLPTKDIPESANI-PHQLNQNRKPQAAAAVVGVIGLFVILAVAGLFTFS  1311
              +P+PF  GSNRLPTKDIPESAN+   Q++Q+RK Q A  VVGVI LFV +AV GLFTFS
Sbjct  274   NRPQPFQPGSNRLPTKDIPESANVQAKQMSQSRKSQTAV-VVGVIALFVAVAVTGLFTFS  332

Query  1310  WYRRRKQQIGSTVDISESRVSTDQPKVLCRRSTSPLISLEYSNGWDPLAKDQSGSALSQE  1131
             WYRRRKQ+IG T+D S+ R+STD+ K + RRS SPLISLEYSNGWDPL K + GSA SQE
Sbjct  333   WYRRRKQKIGGTLDSSDRRLSTDEVKEVSRRSASPLISLEYSNGWDPLGKGRGGSAFSQE  392

Query  1130  VLESFMFNLDEVESATQYFSETNLLGKSSFSAVYKGTLRDGSAVAVKCISKTSCKSDEAE  951
             V ESFMFNLDEVESAT YFSE NLLGKS+F+AVYKGTLRDGS+VA+KCISKTSCKSDE E
Sbjct  393   VFESFMFNLDEVESATLYFSEANLLGKSNFTAVYKGTLRDGSSVAIKCISKTSCKSDETE  452

Query  950   FRKGLTLLTSLKHENLLRLRGFCCSKGRGECFLIYDFVSNGNLLRYLDVKDEKGKVLDWS  771
             F KGL LLTSLKHENLLRLRGFCCSKGRGECFLIYDFV NGNLL+YLDVKD KGKVLDWS
Sbjct  453   FLKGLKLLTSLKHENLLRLRGFCCSKGRGECFLIYDFVPNGNLLQYLDVKDGKGKVLDWS  512

Query  770   TRTAIIKGIARGIKYLHGNKRNKPALVHRNISADKVLIDHLYKPLLSDSGLHKLLADDIV  591
             TR  IIKG+ARGI+YLHGNK NKPALVHRNISA+KVLID  Y PLLSDSGL KLLADDIV
Sbjct  513   TRLHIIKGVARGIQYLHGNKGNKPALVHRNISAEKVLIDQRYNPLLSDSGLPKLLADDIV  572

Query  590   FSTLKGSAANGYLAPEYAITGRFTEKSDMYAFGVIILQILSGSCVVTQSNHQGAELCRFE  411
             FSTLK SAA GYLAPEY  TGRFTEKSD+YAFGVII QILSG   +T SNHQGAELCR+E
Sbjct  573   FSTLKESAAMGYLAPEYTTTGRFTEKSDLYAFGVIIFQILSGKRRITHSNHQGAELCRYE  632

Query  410   DFVDAKLGKDFVESEAAKLGKIALLCTHDSPSRRPAIDVVIQ  285
             DF+D KLG +FVE+EA ++ K+ALLCT +SP++RP I++V+Q
Sbjct  633   DFIDPKLGGNFVEAEAVQMAKVALLCTQESPNQRPNIEIVMQ  674



>ref|XP_004229807.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g34110 [Solanum lycopersicum]
Length=686

 Score =   989 bits (2558),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 498/652 (76%), Positives = 557/652 (85%), Gaps = 5/652 (1%)
 Frame = -3

Query  2231  ETSNNAS--TVSLLMAIKASLDPGNLVLSSWSPNVTDPCSVSSFEGIACNDLGQVVNISL  2058
             ET N+++  ++SLLM IKASLDP +L+LSSWSP  TDPC+  SFEGIACN+LGQVVNISL
Sbjct  27    ETINDSTKTSLSLLMTIKASLDPKSLILSSWSPTSTDPCN-DSFEGIACNELGQVVNISL  85

Query  2057  QGKGLYGKIPPEIGQLNGLSGLYLHFNNLHGVIPKEIASLTQLSDLYLNMNDLSGFIPSE  1878
             QGK L GKIPPEIGQL  LSGLYLHFN LHGV+PKEIA+LTQLSDLYLN+N+LSG IP E
Sbjct  86    QGKDLTGKIPPEIGQLQSLSGLYLHFNKLHGVVPKEIANLTQLSDLYLNVNNLSGVIPPE  145

Query  1877  IGNMPNLQVLQLCYNRFEGCIPNKLGSLKNLTVLALQSNQLTGAIPASlggltlltrldL  1698
             +GNM +LQVLQLCYN+  G IPN+LG LK L+VLALQ NQLTGAIPASLG L +LTRLDL
Sbjct  146   VGNMSSLQVLQLCYNQLTGSIPNQLGVLKKLSVLALQVNQLTGAIPASLGDLEMLTRLDL  205

Query  1697  SFNRLFGSIPVKLSEASKLEVLDLRNNTLSGNVPLGLKRLNEGFRYENNPGLCGTGFPSL  1518
             SFN LFGSIPVKL++A KLEVLD+RNNTLSGNVP  LKRLNEGF+Y NNP LCG  F SL
Sbjct  206   SFNNLFGSIPVKLADAPKLEVLDIRNNTLSGNVPQALKRLNEGFQYANNPDLCGIEFSSL  265

Query  1517  ALCSDSSLNPTKPEPFGQGSNRLPTKDIPESANI-PHQLNQNRKPQAAAAVVGVIGLFVI  1341
              LC+ SSLN  +P+PF  GSNRLPTKDIPESAN+   Q +Q+RK Q A  VVGVI LFV 
Sbjct  266   KLCTVSSLNQNRPQPFEPGSNRLPTKDIPESANVQTKQTSQSRKSQTAV-VVGVIALFVA  324

Query  1340  LAVAGLFTFSWYRRRKQQIGSTVDISESRVSTDQPKVLCRRSTSPLISLEYSNGWDPLAK  1161
             +AV GLFTFS YRRRKQ+IG T+D S+ R+STD+ K + RRS SPLISLEYSNGWDPL K
Sbjct  325   VAVTGLFTFSLYRRRKQKIGGTLDTSDRRLSTDEVKEISRRSASPLISLEYSNGWDPLGK  384

Query  1160  DQSGSALSQEVLESFMFNLDEVESATQYFSETNLLGKSSFSAVYKGTLRDGSAVAVKCIS  981
              + GSA SQEV ESFMFNLDEVESATQYFSE NLLGKS+F+AVYKGTLRDGS VA+KCIS
Sbjct  385   GRGGSAFSQEVFESFMFNLDEVESATQYFSEANLLGKSNFTAVYKGTLRDGSVVAIKCIS  444

Query  980   KTSCKSDEAEFRKGLTLLTSLKHENLLRLRGFCCSKGRGECFLIYDFVSNGNLLRYLDVK  801
             KTSCKSDE EF KGL LLTSL HENLLRLRGFCCSKGRGECFLIYDFV NGNLL+YLDVK
Sbjct  445   KTSCKSDETEFLKGLKLLTSLNHENLLRLRGFCCSKGRGECFLIYDFVPNGNLLQYLDVK  504

Query  800   DEKGKVLDWSTRTAIIKGIARGIKYLHGNKRNKPALVHRNISADKVLIDHLYKPLLSDSG  621
             D KGKVLDWSTR  IIKGIARGI YLHGNK  KPALVHRNISA+KVL+D  Y PLLSDSG
Sbjct  505   DGKGKVLDWSTRLRIIKGIARGIHYLHGNKGGKPALVHRNISAEKVLVDQHYNPLLSDSG  564

Query  620   LHKLLADDIVFSTLKGSAANGYLAPEYAITGRFTEKSDMYAFGVIILQILSGSCVVTQSN  441
             LHKLLADDIVFSTLK SAA GYLAPEY  TGRFTEKSD+YAFG+II Q+LSG C +T SN
Sbjct  565   LHKLLADDIVFSTLKESAAMGYLAPEYTTTGRFTEKSDLYAFGMIIFQVLSGRCKITPSN  624

Query  440   HQGAELCRFEDFVDAKLGKDFVESEAAKLGKIALLCTHDSPSRRPAIDVVIQ  285
             HQGAELCRFEDF+D  L  +FVE+EA ++ K+ALLCTH+SP++RP I++V+Q
Sbjct  625   HQGAELCRFEDFIDPNLWGNFVEAEAVQMAKVALLCTHESPNQRPDIEIVMQ  676



>ref|XP_006347874.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
GSO1-like [Solanum tuberosum]
Length=686

 Score =   986 bits (2548),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 493/644 (77%), Positives = 554/644 (86%), Gaps = 3/644 (0%)
 Frame = -3

Query  2213  STVSLLMAIKASLDPGNLVLSSWSPNVTDPCSVSSFEGIACNDLGQVVNISLQGKGLYGK  2034
             +++SLLM IKASLDP +L+LSSWSP  TDPC+  SFEGIACN+LGQVVNISLQGK L GK
Sbjct  35    TSLSLLMTIKASLDPKSLILSSWSPTSTDPCN-DSFEGIACNELGQVVNISLQGKDLTGK  93

Query  2033  IPPEIGQLNGLSGLYLHFNNLHGVIPKEIASLTQLSDLYLNMNDLSGFIPSEIGNMPNLQ  1854
             IPPEIGQL  LSGLYLHFN LHGV+PKEIA+LTQLSDLYLN+N+LSG IP E+GNM +LQ
Sbjct  94    IPPEIGQLQSLSGLYLHFNKLHGVVPKEIANLTQLSDLYLNVNNLSGVIPPEVGNMSSLQ  153

Query  1853  VLQLCYNRFEGCIPNKLGSLKNLTVLALQSNQLTGAIPASlggltlltrldLSFNRLFGS  1674
             VLQLCYN+  G IPN+LG++K L+VLALQ NQLTGAIPASLG L +LTRLDLSFN LFGS
Sbjct  154   VLQLCYNQLTGSIPNQLGAVKKLSVLALQVNQLTGAIPASLGDLEMLTRLDLSFNNLFGS  213

Query  1673  IPVKLSEASKLEVLDLRNNTLSGNVPLGLKRLNEGFRYENNPGLCGTGFPSLALCSDSSL  1494
             IPVKL++A KLEVLD+RNNTLSGNVP  LKRLNEGF+Y NNP LCG  F SL LC+ SSL
Sbjct  214   IPVKLADALKLEVLDIRNNTLSGNVPQALKRLNEGFQYANNPDLCGIEFSSLKLCTVSSL  273

Query  1493  NPTKPEPFGQGSNRLPTKDIPESANI-PHQLNQNRKPQAAAAVVGVIGLFVILAVAGLFT  1317
             N  +P+PF  GSNRLPTKDIPESAN+   Q++Q+RK Q A  VVGVI LFV +AV GLFT
Sbjct  274   NQNRPQPFEPGSNRLPTKDIPESANVQTKQMSQSRKSQTAV-VVGVIALFVAVAVTGLFT  332

Query  1316  FSWYRRRKQQIGSTVDISESRVSTDQPKVLCRRSTSPLISLEYSNGWDPLAKDQSGSALS  1137
             FS YRRRKQ+IG T+D S+ R+STD+ K + RRS SPLISLEYSNGWDPL K + GSA S
Sbjct  333   FSLYRRRKQKIGGTLDTSDRRLSTDEVKEISRRSASPLISLEYSNGWDPLGKGRGGSAFS  392

Query  1136  QEVLESFMFNLDEVESATQYFSETNLLGKSSFSAVYKGTLRDGSAVAVKCISKTSCKSDE  957
             QEV ESFMFNLDEVESATQYFSE NLLGKS+F+AVYKGTLRDGS VA+KCISKTSCKSDE
Sbjct  393   QEVFESFMFNLDEVESATQYFSEANLLGKSNFTAVYKGTLRDGSVVAIKCISKTSCKSDE  452

Query  956   AEFRKGLTLLTSLKHENLLRLRGFCCSKGRGECFLIYDFVSNGNLLRYLDVKDEKGKVLD  777
              EF KGL LLTSLKHENLLRLRGFCCSKGRGECFLIYDFV NGNLL+YLDVKD KGK+LD
Sbjct  453   TEFLKGLKLLTSLKHENLLRLRGFCCSKGRGECFLIYDFVPNGNLLQYLDVKDGKGKILD  512

Query  776   WSTRTAIIKGIARGIKYLHGNKRNKPALVHRNISADKVLIDHLYKPLLSDSGLHKLLADD  597
             WSTR +IIKGIARGI YLH NK  KPALVHRNISA+KVL+D  Y PLLSDSGLHKLLADD
Sbjct  513   WSTRFSIIKGIARGIHYLHRNKGGKPALVHRNISAEKVLVDQHYNPLLSDSGLHKLLADD  572

Query  596   IVFSTLKGSAANGYLAPEYAITGRFTEKSDMYAFGVIILQILSGSCVVTQSNHQGAELCR  417
             IVFSTLK SAA GYLAPEY  TGRFTEKSD+YAFG+II QILSG   +T SNHQGAELCR
Sbjct  573   IVFSTLKESAAMGYLAPEYTTTGRFTEKSDLYAFGMIIFQILSGRRKITPSNHQGAELCR  632

Query  416   FEDFVDAKLGKDFVESEAAKLGKIALLCTHDSPSRRPAIDVVIQ  285
             FEDF+D  L  +FVE+EA ++ K+ALLCTH+SP++RP I++V+Q
Sbjct  633   FEDFIDPNLWGNFVEAEAVQMAKVALLCTHESPNQRPDIEIVMQ  676



>ref|XP_009629432.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
GSO1 [Nicotiana tomentosiformis]
Length=684

 Score =   985 bits (2546),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 491/642 (76%), Positives = 554/642 (86%), Gaps = 3/642 (0%)
 Frame = -3

Query  2207  VSLLMAIKASLDPGNLVLSSWSPNVTDPCSVSSFEGIACNDLGQVVNISLQGKGLYGKIP  2028
             +SLLM+IK+SLDP NL+LSSWS N TDPC+  SFEGIACN+LGQVVNISLQGK L GKIP
Sbjct  35    LSLLMSIKSSLDPKNLILSSWSANATDPCN-GSFEGIACNELGQVVNISLQGKDLSGKIP  93

Query  2027  PEIGQLNGLSGLYLHFNNLHGVIPKEIASLTQLSDLYLNMNDLSGFIPSEIGNMPNLQVL  1848
             PEIGQL  LSGLYLHFN LHGV+PKEIA+LTQLSDLYLN+N+LS  IP+E+GNM NLQVL
Sbjct  94    PEIGQLQSLSGLYLHFNKLHGVVPKEIANLTQLSDLYLNVNNLSSVIPTEVGNMSNLQVL  153

Query  1847  QLCYNRFEGCIPNKLGSLKNLTVLALQSNQLTGAIPASlggltlltrldLSFNRLFGSIP  1668
             QLCYN+  G IPN++G+LK L+VLALQ NQLTGAIPASLG L +LTRLDLSFN  FGSIP
Sbjct  154   QLCYNQLTGSIPNQIGALKKLSVLALQVNQLTGAIPASLGDLEMLTRLDLSFNNFFGSIP  213

Query  1667  VKLSEASKLEVLDLRNNTLSGNVPLGLKRLNEGFRYENNPGLCGTGFPSLALCSDSSLNP  1488
             VKL+ A KLEVLD+RNNTLSGNVPL LKRLN+GF+Y NNP LCG  F SL LC+ S LN 
Sbjct  214   VKLANAPKLEVLDIRNNTLSGNVPLALKRLNKGFQYANNPDLCGIEFSSLKLCTVSGLNQ  273

Query  1487  TKPEPFGQGSNRLPTKDIPESANI-PHQLNQNRKPQAAAAVVGVIGLFVILAVAGLFTFS  1311
              +P+PF  GSNRLPTKDIPESAN+   Q++Q+RK Q A  VVGVI LFV +AV GLFTFS
Sbjct  274   NRPQPFQPGSNRLPTKDIPESANVQAKQMSQSRKSQTAV-VVGVIALFVAVAVTGLFTFS  332

Query  1310  WYRRRKQQIGSTVDISESRVSTDQPKVLCRRSTSPLISLEYSNGWDPLAKDQSGSALSQE  1131
             WYRRRKQ+IG T+D ++ R+STD+ K + RRS SPLISLEYSNGWDPL K + G+A SQE
Sbjct  333   WYRRRKQKIGGTLDSADRRLSTDEVKEVSRRSASPLISLEYSNGWDPLGKGRDGTAFSQE  392

Query  1130  VLESFMFNLDEVESATQYFSETNLLGKSSFSAVYKGTLRDGSAVAVKCISKTSCKSDEAE  951
             V ESFMFNLDEVESATQYFSE NLLGKS+F+AVYKGTLRDGS+VA+KCISKTSCKSDE E
Sbjct  393   VFESFMFNLDEVESATQYFSEANLLGKSNFTAVYKGTLRDGSSVAIKCISKTSCKSDETE  452

Query  950   FRKGLTLLTSLKHENLLRLRGFCCSKGRGECFLIYDFVSNGNLLRYLDVKDEKGKVLDWS  771
             F KGL LLTSLKHENL RLRGFCCSKGRGECFLIYDFV NGNLL+YLDVKD KGKVLDWS
Sbjct  453   FLKGLKLLTSLKHENLPRLRGFCCSKGRGECFLIYDFVPNGNLLQYLDVKDGKGKVLDWS  512

Query  770   TRTAIIKGIARGIKYLHGNKRNKPALVHRNISADKVLIDHLYKPLLSDSGLHKLLADDIV  591
             T+  IIKG+ARGI+YLHGNK +KPALVHRNISA+KVLID  Y PLLSDSGL KLLADDIV
Sbjct  513   TKLHIIKGVARGIQYLHGNKGSKPALVHRNISAEKVLIDQRYNPLLSDSGLPKLLADDIV  572

Query  590   FSTLKGSAANGYLAPEYAITGRFTEKSDMYAFGVIILQILSGSCVVTQSNHQGAELCRFE  411
             FSTLK SAA GYLAPEY  TGRFTEKSD+YAFGVII QILSG   +T SNHQGAELCR+E
Sbjct  573   FSTLKESAAMGYLAPEYTTTGRFTEKSDLYAFGVIIFQILSGKRRITHSNHQGAELCRYE  632

Query  410   DFVDAKLGKDFVESEAAKLGKIALLCTHDSPSRRPAIDVVIQ  285
             DF+D KLG +F E+EA ++ K+ALLCTH+SP++RP I+VV+Q
Sbjct  633   DFIDPKLGGNFEEAEAVQMAKVALLCTHESPNQRPNIEVVMQ  674



>emb|CDO97695.1| unnamed protein product [Coffea canephora]
Length=679

 Score =   947 bits (2448),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 472/646 (73%), Positives = 548/646 (85%), Gaps = 3/646 (0%)
 Frame = -3

Query  2219  NASTVSLLMAIKASLDPGNLVLSSWSPNVTDPCSVSSFEGIACNDLGQVVNISLQGKGLY  2040
             +++T+S+L++IK  LDP + +LSSWSPN TDPC+  SF GIACN  GQV+NISLQGKGL 
Sbjct  27    DSTTLSILLSIKVWLDPSDHILSSWSPNATDPCN-GSFVGIACNGNGQVLNISLQGKGLA  85

Query  2039  GKIPPEIGQLNGLSGLYLHFNNLHGVIPKEIASLTQLSDLYLNMNDLSGFIPSEIGNMPN  1860
             GKIPPEIGQL  LSGLYLHFN LHG +PKEIA+LT+LSDLYLN+N+L+G IP E+GNMP+
Sbjct  86    GKIPPEIGQLKSLSGLYLHFNQLHGGVPKEIANLTELSDLYLNVNNLTGEIPPELGNMPS  145

Query  1859  LQVLQLCYNRFEGCIPNKLGSLKNLTVLALQSNQLTGAIPASlggltlltrldLSFNRLF  1680
             LQV+QLCYN+  G IP +LG LK L VLALQ NQL+GAIPASLGGL  LTR+DLSFN LF
Sbjct  146   LQVMQLCYNKLTGSIPTQLGFLKKLNVLALQYNQLSGAIPASLGGLVNLTRMDLSFNGLF  205

Query  1679  GSIPVKLSEASKLEVLDLRNNTLSGNVPLGLKRLNEGFRYENNPGLCGTGFPSLALCSDS  1500
             GSIPVKL+ +  LE LD+RNNTLSGNVP+ LKRLNEGF++ NNPGLCG GF +L +C+DS
Sbjct  206   GSIPVKLANSPNLEFLDIRNNTLSGNVPIALKRLNEGFQFANNPGLCGIGFSTLNVCTDS  265

Query  1499  SLNPTKPEPFGQGSNRLPTKDIPESANI-PHQLNQNRKPQAAAAVVGVIGLFVILAVAGL  1323
              +NP KPEPFG GS+RLP+K IPESAN+ P+ LNQ+R+PQ A  +VG+IGLF ++AV G+
Sbjct  266   GINPNKPEPFGPGSSRLPSKAIPESANVQPNSLNQSRRPQTAI-IVGLIGLFAVVAVIGV  324

Query  1322  FTFSWYRRRKQQIGSTVDISESRVSTDQPKVLCRRSTSPLISLEYSNGWDPLAKDQSGSA  1143
             FTF WYRR+KQ+IGST D S+SR+STDQ K +CRRS SPLISLEYS+GWDPLA+ Q G  
Sbjct  325   FTFFWYRRQKQKIGSTYDASDSRLSTDQVKEVCRRSASPLISLEYSHGWDPLARRQIGHG  384

Query  1142  LSQEVLESFMFNLDEVESATQYFSETNLLGKSSFSAVYKGTLRDGSAVAVKCISKTSCKS  963
              SQE  +SFMFNLDEVESATQ+FS+TNLLGKSSFSA YKG LRDGS VA+KCISKTSCKS
Sbjct  385   FSQEEFDSFMFNLDEVESATQHFSDTNLLGKSSFSATYKGILRDGSIVAIKCISKTSCKS  444

Query  962   DEAEFRKGLTLLTSLKHENLLRLRGFCCSKGRGECFLIYDFVSNGNLLRYLDVKDEKGKV  783
             DE+EF KGL LLTSLKHEN+LRLRGFCCSKGRGECFLIYDFV NGNLL+YLD K  K KV
Sbjct  445   DESEFLKGLNLLTSLKHENVLRLRGFCCSKGRGECFLIYDFVPNGNLLQYLDTKGGKVKV  504

Query  782   LDWSTRTAIIKGIARGIKYLHGNKRNKPALVHRNISADKVLIDHLYKPLLSDSGLHKLLA  603
             L+WSTRT+IIKGIARGI+YLHGN+  KPALVHRNISA+KVLID  Y P+LSD GLHKLLA
Sbjct  505   LEWSTRTSIIKGIARGIEYLHGNQGKKPALVHRNISAEKVLIDQHYHPMLSDCGLHKLLA  564

Query  602   DDIVFSTLKGSAANGYLAPEYAITGRFTEKSDMYAFGVIILQILSGSCVVTQSNHQGAEL  423
             DDIV+STLKGSAA GYLAPEY  TGR TEKSD+YAFG+II QILSG C ++Q N QGAEL
Sbjct  565   DDIVYSTLKGSAAMGYLAPEYTTTGRCTEKSDIYAFGMIIFQILSGKCKISQLNRQGAEL  624

Query  422   CRFEDFVDAKLGKDFVESEAAKLGKIALLCTHDSPSRRPAIDVVIQ  285
              R EDFVD  L  +F ESEA KLGKIALLCTH++ + RP I+ V+Q
Sbjct  625   GRTEDFVDTNLEGNFRESEAVKLGKIALLCTHEALNHRPTIETVMQ  670



>ref|XP_011093359.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
GSO1 [Sesamum indicum]
Length=681

 Score =   944 bits (2440),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 476/650 (73%), Positives = 545/650 (84%), Gaps = 3/650 (0%)
 Frame = -3

Query  2231  ETSNNASTVSLLMAIKASLDPGNLVLSSWSPNVTDPCSVSSFEGIACNDLGQVVNISLQG  2052
             ++S    ++SLLMAIK+SLDP N +LSSWS N TDPCS  SFEGIACN+ GQVVNISLQG
Sbjct  25    QSSKTNISLSLLMAIKSSLDPENRLLSSWSVNATDPCS-GSFEGIACNEYGQVVNISLQG  83

Query  2051  KGLYGKIPPEIGQLNGLSGLYLHFNNLHGVIPKEIASLTQLSDLYLNMNDLSGFIPSEIG  1872
             KGL G+IPPEIGQL  LSGLYLHFN LHG++PKE+A+LT+LSDLYLN+N+LSG IP EIG
Sbjct  84    KGLSGQIPPEIGQLKSLSGLYLHFNKLHGLVPKELANLTELSDLYLNVNNLSGDIPPEIG  143

Query  1871  NMPNLQVLQLCYNRFEGCIPNKLGSLKNLTVLALQSNQLTGAIPASlggltlltrldLSF  1692
             +M NLQV+QLCYN+  G IP + GSLK L VLALQSNQLTGAIPASLGGL +LTRLDLS+
Sbjct  144   DMSNLQVMQLCYNKLTGNIPTQFGSLKKLNVLALQSNQLTGAIPASLGGLMMLTRLDLSY  203

Query  1691  NRLFGSIPVKLSEASKLEVLDLRNNTLSGNVPLGLKRLNEGFRYENNPGLCGTGFPSLAL  1512
             N LFGSIP+KL+    L+VLD+RNNTLSGNVPL LKRL+EGF+YENN GLCG GFP L +
Sbjct  204   NHLFGSIPLKLAGLPMLKVLDIRNNTLSGNVPLALKRLDEGFQYENNTGLCGIGFPPLQI  263

Query  1511  CSDSSLNPTKPEPFGQGSNRLPTKDIPESANIPHQ-LNQNRKPQAAAAVVGVIGLFVILA  1335
             CS S  N  KPEPFG G++ LP+KDIPESAN+    +N++RKPQ A  VVG++GL V  A
Sbjct  264   CSASGKNSNKPEPFGPGTSHLPSKDIPESANVEQNGVNKSRKPQPAV-VVGILGLIVAFA  322

Query  1334  VAGLFTFSWYRRRKQQIGSTVDISESRVSTDQPKVLCRRSTSPLISLEYSNGWDPLAKDQ  1155
             V GLFTFSWYRR+KQ+IGST D S+SR+STDQ + +CRRS SPLISLEYSNGWDPLAK Q
Sbjct  323   VVGLFTFSWYRRQKQKIGSTFDSSDSRLSTDQSREVCRRSASPLISLEYSNGWDPLAKRQ  382

Query  1154  SGSALSQEVLESFMFNLDEVESATQYFSETNLLGKSSFSAVYKGTLRDGSAVAVKCISKT  975
               ++ SQEVLES MFNLDEVESATQYFS+ NLLGK SF A YKG LRDGS VAVKCI K 
Sbjct  383   DVNSFSQEVLESHMFNLDEVESATQYFSDMNLLGKGSFLATYKGVLRDGSFVAVKCILKI  442

Query  974   SCKSDEAEFRKGLTLLTSLKHENLLRLRGFCCSKGRGECFLIYDFVSNGNLLRYLDVKDE  795
             SCKSDE+EF KGL LLTSLKHENLLRLRGFCCSKGRGECFLIYDFV NGNLL+YLD+K+ 
Sbjct  443   SCKSDESEFLKGLKLLTSLKHENLLRLRGFCCSKGRGECFLIYDFVPNGNLLQYLDLKEG  502

Query  794   KGKVLDWSTRTAIIKGIARGIKYLHGNKRNKPALVHRNISADKVLIDHLYKPLLSDSGLH  615
             K  VLDW  R +II+GIA+GI+YLHG+++NKP LVHRNISA+KVLID  Y PLLSDSGLH
Sbjct  503   KRNVLDWPIRKSIIRGIAKGIEYLHGSQKNKPTLVHRNISAEKVLIDQHYNPLLSDSGLH  562

Query  614   KLLADDIVFSTLKGSAANGYLAPEYAITGRFTEKSDMYAFGVIILQILSGSCVVTQSNHQ  435
             KLLADDIVFSTLKGSAA GYLAPEY  TGRFTEKSD+YAFG+II QILSG   +TQ N  
Sbjct  563   KLLADDIVFSTLKGSAAMGYLAPEYTTTGRFTEKSDVYAFGMIIFQILSGKSRITQLNCH  622

Query  434   GAELCRFEDFVDAKLGKDFVESEAAKLGKIALLCTHDSPSRRPAIDVVIQ  285
             GAE+ RFEDF+DA L   F ESEAA+LG++ALLCTH+SP+ RP I  V+Q
Sbjct  623   GAEISRFEDFIDANLAGKFNESEAARLGEVALLCTHESPNHRPNIGTVMQ  672



>gb|EYU30556.1| hypothetical protein MIMGU_mgv1a002343mg [Erythranthe guttata]
Length=686

 Score =   911 bits (2355),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 463/646 (72%), Positives = 542/646 (84%), Gaps = 3/646 (0%)
 Frame = -3

Query  2219  NASTVSLLMAIKASLDPGNLVLSSWSPNVTDPCSVSSFEGIACNDLGQVVNISLQGKGLY  2040
             N +++SLL+ IK+ LDP NL+L++WSPN T PC+  SFEGIACN+ GQVVNISLQGKGLY
Sbjct  33    NTTSLSLLIKIKSLLDPQNLILTTWSPNATQPCN-GSFEGIACNEYGQVVNISLQGKGLY  91

Query  2039  GKIPPEIGQLNGLSGLYLHFNNLHGVIPKEIASLTQLSDLYLNMNDLSGFIPSEIGNMPN  1860
             G+IPPEIGQLN LSGLYLHFN LHGV+PKE+A+LTQLSDLYLN+N+LSG IP +IG MPN
Sbjct  92    GQIPPEIGQLNSLSGLYLHFNKLHGVVPKELANLTQLSDLYLNVNNLSGHIPPQIGLMPN  151

Query  1859  LQVLQLCYNRFEGCIPNKLGSLKNLTVLALQSNQLTGAIPASlggltlltrldLSFNRLF  1680
             LQVLQLCYN+  G IP ++GSLK L VLALQSNQL+GAIPASLG L LL RLDLSFN LF
Sbjct  152   LQVLQLCYNKLSGNIPTQVGSLKKLNVLALQSNQLSGAIPASLGELLLLNRLDLSFNHLF  211

Query  1679  GSIPVKLSEASKLEVLDLRNNTLSGNVPLGLKRLNEGFRYENNPGLCGTGFPSLALCSDS  1500
             GSIP+KL++   L+VLD+RNNTLSGNVPL LK+L+EGF+Y NN  LCG+GFPSL +CS S
Sbjct  212   GSIPLKLADLPLLKVLDIRNNTLSGNVPLALKKLDEGFQYSNNAELCGSGFPSLQICSAS  271

Query  1499  SLNPTKPEPFGQGSNRLPTKDIPESANI-PHQLNQNRKPQAAAAVVGVIGLFVILAVAGL  1323
             + N  KPEPFG  +N LP+K+IPESAN+  ++LN +RK   +A VVGV G+ + LAVAGL
Sbjct  272   TPNSNKPEPFGADTNHLPSKNIPESANVRDNKLNNSRK-SLSAVVVGVAGVIIALAVAGL  330

Query  1322  FTFSWYRRRKQQIGSTVDISESRVSTDQPKVLCRRSTSPLISLEYSNGWDPLAKDQSGSA  1143
              TF+W+RR+KQ+IGST D  +SR+STD    + RRS SPLISLEYSNGWDPL K    S+
Sbjct  331   LTFTWHRRQKQKIGSTCDNGDSRLSTDDVMEVRRRSASPLISLEYSNGWDPLGKRDEVSS  390

Query  1142  LSQEVLESFMFNLDEVESATQYFSETNLLGKSSFSAVYKGTLRDGSAVAVKCISKTSCKS  963
              SQEV ES+MFNLDEVESATQYFSETNLLGKS FSA+YKG LRDGS VA+KC+SK SCKS
Sbjct  391   FSQEVFESYMFNLDEVESATQYFSETNLLGKSGFSAIYKGMLRDGSIVAIKCVSKVSCKS  450

Query  962   DEAEFRKGLTLLTSLKHENLLRLRGFCCSKGRGECFLIYDFVSNGNLLRYLDVKDEKGKV  783
             DEAEF KGL +LTSLKHENLLRLRGFCCSKGRGECFLIY+FVSNGNLL++LDVK+   KV
Sbjct  451   DEAEFVKGLKVLTSLKHENLLRLRGFCCSKGRGECFLIYEFVSNGNLLQHLDVKEGGRKV  510

Query  782   LDWSTRTAIIKGIARGIKYLHGNKRNKPALVHRNISADKVLIDHLYKPLLSDSGLHKLLA  603
             LDW TR +II+GIA+GI+YLHG+K  KP LVHRNISA+K+LID  Y PLLSDSG+HKLLA
Sbjct  511   LDWPTRKSIIRGIAKGIEYLHGSKNGKPTLVHRNISAEKILIDQHYNPLLSDSGIHKLLA  570

Query  602   DDIVFSTLKGSAANGYLAPEYAITGRFTEKSDMYAFGVIILQILSGSCVVTQSNHQGAEL  423
             DDIVFSTLKGSAA GYLAPEY  TGRFTEKSD+YAFG+II QILSG   +TQ N  GA +
Sbjct  571   DDIVFSTLKGSAAMGYLAPEYTTTGRFTEKSDIYAFGMIIFQILSGKSRITQLNCHGAGI  630

Query  422   CRFEDFVDAKLGKDFVESEAAKLGKIALLCTHDSPSRRPAIDVVIQ  285
              RFEDF+D  L  +F ESEAA+LG++ALLCTH+SP+ RP I  V+Q
Sbjct  631   SRFEDFIDVSLAGNFKESEAARLGEVALLCTHESPNLRPEIGAVMQ  676



>emb|CAN72186.1| hypothetical protein VITISV_012898 [Vitis vinifera]
Length=702

 Score =   859 bits (2220),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 447/645 (69%), Positives = 510/645 (79%), Gaps = 12/645 (2%)
 Frame = -3

Query  2201  LLMAIKASLDPGNLVLSSWSPNVTDPCSVSSFEGIACNDLGQVVNISLQGKGLYGKIPPE  2022
             +LMA+KASLDP N  LSSW+ +  DPCS  SFEG+ACN+ G VVNISLQGKGL G+IP E
Sbjct  30    VLMAMKASLDPENRFLSSWTSD-NDPCS-DSFEGVACNEYGHVVNISLQGKGLMGQIPKE  87

Query  2021  IGQLNGLSGLYLHFNNLHGVIPKEIASLTQLSDLYLNMNDLSGFIPSEIGNMPNLQVLQL  1842
             I +L  LSGL+LHFN+L G IPKEI++L +LSDLYLN+N+LSG I   IGNM NLQVLQL
Sbjct  88    IAELKSLSGLFLHFNSLXGEIPKEISALAELSDLYLNVNNLSGVIHPGIGNMSNLQVLQL  147

Query  1841  CYNRFEGCIPNKLGSLKNLTVLALQSNQLTGAIPASlggltlltrldLSFNRLFGSIPVK  1662
             CYN+  G IP +LGSLK L+VLALQSN+LTGAIPASLG L +LTRLDLSFN LFG IPVK
Sbjct  148   CYNKLTGGIPTQLGSLKKLSVLALQSNELTGAIPASLGDLEMLTRLDLSFNNLFGPIPVK  207

Query  1661  LSEASKLEVLDLRNNTLSGNVPLGLKRLNEGFRYENNPGLCGTGFPSLALCSDS-SLNPT  1485
             L+ A  LE+LD+RNNTLSGNVP  LKRLN+GF+Y NNPGLCG GF +L +CS S  LNP 
Sbjct  208   LANAPMLEILDIRNNTLSGNVPQALKRLNDGFQYRNNPGLCGDGFLALDVCSASDQLNPN  267

Query  1484  KPEPFGQGSNRLPTKDIPESANIPHQLNQNR-----KPQAAAAVVGVIGLFVILAVAGLF  1320
             +PEPFG   N      +PESAN+    ++       K    A V GVIG+     V+GLF
Sbjct  268   RPEPFG--PNGTDKNGLPESANLQPDCSKTHCSTPSKTSQIAXVCGVIGVIXAFTVSGLF  325

Query  1319  TFSWYRRRKQQIGSTVDISESRVSTDQPKVLCRRSTSPLISLEYSNGWDPLAKDQSGSAL  1140
              FSWYRRRKQ+IGS  D S+SR+STDQ K + R+S SPLISLEYS+GWDPL   QSG+  
Sbjct  326   AFSWYRRRKQKIGSAFDASDSRLSTDQVKEVYRKSASPLISLEYSHGWDPLG--QSGNGF  383

Query  1139  SQEVLESFMFNLDEVESATQYFSETNLLGKSSFSAVYKGTLRDGSAVAVKCISKTSCKSD  960
             SQEV  SFMFNL++VESATQYFS+ NLLGKS+FSA+YKG LRDGS VA+KCI+K SCKSD
Sbjct  384   SQEVPGSFMFNLEDVESATQYFSDLNLLGKSNFSAIYKGILRDGSVVAIKCIAKISCKSD  443

Query  959   EAEFRKGLTLLTSLKHENLLRLRGFCCSKGRGECFLIYDFVSNGNLLRYLDVKDEKGKVL  780
             EAEF KGL  L SLKHENL+RLRGFCCSKGRGECFLIYDFV NGNLL+YLDV D  GKVL
Sbjct  444   EAEFLKGLKTLASLKHENLVRLRGFCCSKGRGECFLIYDFVPNGNLLQYLDVTDNSGKVL  503

Query  779   DWSTRTAIIKGIARGIKYLHGNKRNKPALVHRNISADKVLIDHLYKPLLSDSGLHKLLAD  600
             +WSTR +II GIA+GI YLHG K NK ALVH+NISA+KVLID  Y PLLSDSGLHKLLAD
Sbjct  504   EWSTRISIINGIAKGIGYLHGKKGNKCALVHQNISAEKVLIDQHYNPLLSDSGLHKLLAD  563

Query  599   DIVFSTLKGSAANGYLAPEYAITGRFTEKSDMYAFGVIILQILSGSCVVTQSNHQGAELC  420
             DIVFSTLK +AA GYLAPEY  TGRFTEKSD+YAFG+I+ QILSG   +    H GAE  
Sbjct  564   DIVFSTLKATAAMGYLAPEYTTTGRFTEKSDVYAFGMIVFQILSGKRKIAHLTHNGAESG  623

Query  419   RFEDFVDAKLGKDFVESEAAKLGKIALLCTHDSPSRRPAIDVVIQ  285
             RFEDF+DA L   F ESEAAKLGKIALLC HDSPS RPAI+ V+Q
Sbjct  624   RFEDFIDANLAGKFSESEAAKLGKIALLCIHDSPSHRPAIENVMQ  668



>ref|XP_002279998.1| PREDICTED: protein NSP-INTERACTING KINASE 3 [Vitis vinifera]
Length=677

 Score =   857 bits (2215),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 447/645 (69%), Positives = 511/645 (79%), Gaps = 12/645 (2%)
 Frame = -3

Query  2201  LLMAIKASLDPGNLVLSSWSPNVTDPCSVSSFEGIACNDLGQVVNISLQGKGLYGKIPPE  2022
             +LMA+KASLDP N  LSSW+ +  DPCS  SFEG+ACN+ G VVNISLQGKGL G+IP E
Sbjct  30    VLMAMKASLDPENRFLSSWTSD-NDPCS-DSFEGVACNEYGHVVNISLQGKGLMGQIPKE  87

Query  2021  IGQLNGLSGLYLHFNNLHGVIPKEIASLTQLSDLYLNMNDLSGFIPSEIGNMPNLQVLQL  1842
             I +L  LSGL+LHFN+L+G IPKEI++L +LSDLYLN+N+LSG I   IGNM NLQVLQL
Sbjct  88    IAELKSLSGLFLHFNSLYGEIPKEISALAELSDLYLNVNNLSGVIHPGIGNMSNLQVLQL  147

Query  1841  CYNRFEGCIPNKLGSLKNLTVLALQSNQLTGAIPASlggltlltrldLSFNRLFGSIPVK  1662
             CYN+  G IP +LGSLK L+VLALQSN+LTGAIPASLG L +LTRLDLSFN LFG IPVK
Sbjct  148   CYNKLTGGIPTQLGSLKKLSVLALQSNELTGAIPASLGDLEMLTRLDLSFNNLFGPIPVK  207

Query  1661  LSEASKLEVLDLRNNTLSGNVPLGLKRLNEGFRYENNPGLCGTGFPSLALCSDS-SLNPT  1485
             L+ A  LE+LD+RNNTLSGNVP  LKRLN+GF+Y NNP LCG GF +L +CS S  LNP 
Sbjct  208   LANAPMLEILDIRNNTLSGNVPQALKRLNDGFQYRNNPSLCGDGFLALDVCSASDQLNPN  267

Query  1484  KPEPFGQGSNRLPTKDIPESANIPHQLNQNR-----KPQAAAAVVGVIGLFVILAVAGLF  1320
             +PEPFG   N      +PESAN+    ++       K    A V GVIG+ V L V+GLF
Sbjct  268   RPEPFG--PNGTDKNGLPESANLQPDCSKTHCSTPSKTSQIAIVCGVIGVIVALTVSGLF  325

Query  1319  TFSWYRRRKQQIGSTVDISESRVSTDQPKVLCRRSTSPLISLEYSNGWDPLAKDQSGSAL  1140
              FSWYRRRKQ+IGS  D S+SR+STDQ K + R+S SPLISLEYS+GWDPL   QSG+  
Sbjct  326   AFSWYRRRKQKIGSAFDASDSRLSTDQVKEVYRKSASPLISLEYSHGWDPLG--QSGNGF  383

Query  1139  SQEVLESFMFNLDEVESATQYFSETNLLGKSSFSAVYKGTLRDGSAVAVKCISKTSCKSD  960
             SQEV  S MFNL++VESATQYFS+ NLLGKS+FSA+YKG LRDGS VA+KCI+K SCKSD
Sbjct  384   SQEVPGSVMFNLEDVESATQYFSDLNLLGKSNFSAIYKGILRDGSVVAIKCIAKISCKSD  443

Query  959   EAEFRKGLTLLTSLKHENLLRLRGFCCSKGRGECFLIYDFVSNGNLLRYLDVKDEKGKVL  780
             EAEF KGL  L SLKHENL+RLRGFCCSKGRGECFLIYDFV NGNLL+YLDV D  GKVL
Sbjct  444   EAEFLKGLKTLASLKHENLVRLRGFCCSKGRGECFLIYDFVPNGNLLQYLDVTDNSGKVL  503

Query  779   DWSTRTAIIKGIARGIKYLHGNKRNKPALVHRNISADKVLIDHLYKPLLSDSGLHKLLAD  600
             +WSTR +II GIA+GI YLHG K NK ALVH+NISA+KVLID  Y PLLSDSGLHKLLAD
Sbjct  504   EWSTRISIINGIAKGIGYLHGKKGNKCALVHQNISAEKVLIDQHYNPLLSDSGLHKLLAD  563

Query  599   DIVFSTLKGSAANGYLAPEYAITGRFTEKSDMYAFGVIILQILSGSCVVTQSNHQGAELC  420
             DIVFSTLK +AA GYLAPEY  TGRFTEKSD+YAFG+I+ QILSG   +      GAE  
Sbjct  564   DIVFSTLKATAAMGYLAPEYTTTGRFTEKSDVYAFGMIVFQILSGKRKIAHLTRNGAESG  623

Query  419   RFEDFVDAKLGKDFVESEAAKLGKIALLCTHDSPSRRPAIDVVIQ  285
             RFEDF+DA L   F ESEAAKLGKIALLCTHDSPS RPAI+ V+Q
Sbjct  624   RFEDFIDANLAGKFSESEAAKLGKIALLCTHDSPSHRPAIENVMQ  668



>ref|XP_010255622.1| PREDICTED: somatic embryogenesis receptor kinase 1-like [Nelumbo 
nucifera]
Length=681

 Score =   854 bits (2207),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 439/644 (68%), Positives = 516/644 (80%), Gaps = 8/644 (1%)
 Frame = -3

Query  2198  LMAIKASLDPGNLVLSSWSPNVTDPCSVSSFEGIACNDLGQVVNISLQGKGLYGKIPPEI  2019
             LM +KA+LDP N  LSSW+ +  +PCS  SFEG+ACN+LG+V NISL GKGL G++PP +
Sbjct  31    LMEMKAALDPENRFLSSWTSD-GEPCS-GSFEGVACNELGKVANISLVGKGLTGRLPPAV  88

Query  2018  GQLNGLSGLYLHFNNLHGVIPKEIASLTQLSDLYLNMNDLSGFIPSEIGNMPNLQVLQLC  1839
               L  LSGLYLHFN+L G IP+EI++LT+LSDLYLN+N+ SG IPSEIGNM +LQVLQLC
Sbjct  89    AGLKSLSGLYLHFNSLSGGIPREISNLTELSDLYLNVNNFSGNIPSEIGNMASLQVLQLC  148

Query  1838  YNRFEGCIPNKLGSLKNLTVLALQSNQLTGAIPASlggltlltrldLSFNRLFGSIPVKL  1659
             YN+  G IP +LGSLK LTVLALQ NQL+GAIPASLG L +L RLDLSFNRLFGSIPVKL
Sbjct  149   YNQLTGSIPTQLGSLKRLTVLALQFNQLSGAIPASLGDLEMLMRLDLSFNRLFGSIPVKL  208

Query  1658  SEASKLEVLDLRNNTLSGNVPLGLKRLNEGFRYENNPGLCGTGFPSLALCSDSS-LNPTK  1482
             ++   LEVLD+RNNTLSGNVP  LKRLNEGF+Y NN  LCG GF +L +CS S  LNP +
Sbjct  209   ADVPTLEVLDVRNNTLSGNVPPALKRLNEGFQYGNNSNLCGVGFSTLQVCSASDHLNPNR  268

Query  1481  PEPFGQGSNRLPTKDIPESANIPHQLNQNR-----KPQAAAAVVGVIGLFVILAVAGLFT  1317
             PEPFG G+N L T+DIPESAN+    NQ       K    A  VGV+ + V LAV GL T
Sbjct  269   PEPFGPGTNGLATRDIPESANLQAHCNQTHCLNSTKTSQIAVTVGVVSVTVALAVTGLLT  328

Query  1316  FSWYRRRKQQIGSTVDISESRVSTDQPKVLCRRSTSPLISLEYSNGWDPLAKDQSGSALS  1137
             FSWYRRRKQ+IGS  D  +SR+STDQ K + R+S SPLISLEYSNGWDPLA ++SGS  S
Sbjct  329   FSWYRRRKQKIGSAFDSLDSRLSTDQAKEVYRKSASPLISLEYSNGWDPLADERSGSGFS  388

Query  1136  QEVLESFMFNLDEVESATQYFSETNLLGKSSFSAVYKGTLRDGSAVAVKCISKTSCKSDE  957
             QE L++F FNLDEVESATQYFSE NLL KS+FSA+YKG LRDGS VA+K ISKTSCKS+E
Sbjct  389   QESLKTFRFNLDEVESATQYFSEVNLLDKSNFSAIYKGILRDGSVVAIKSISKTSCKSEE  448

Query  956   AEFRKGLTLLTSLKHENLLRLRGFCCSKGRGECFLIYDFVSNGNLLRYLDVKDEKGKVLD  777
             A+F KGL +L SL+HENL+RLRGFCCS+ RGECFLIYDFV NGNL  YLDVKD   +VL+
Sbjct  449   ADFLKGLNILASLRHENLVRLRGFCCSRARGECFLIYDFVPNGNLSWYLDVKDSNARVLE  508

Query  776   WSTRTAIIKGIARGIKYLHGNKRNKPALVHRNISADKVLIDHLYKPLLSDSGLHKLLADD  597
             WSTR +II GIA+GI+YLH NK NKPALVH+NISA+KVLID  + PLLSDSGLHKLLADD
Sbjct  509   WSTRVSIIIGIAKGIEYLHSNKANKPALVHQNISAEKVLIDQRFNPLLSDSGLHKLLADD  568

Query  596   IVFSTLKGSAANGYLAPEYAITGRFTEKSDMYAFGVIILQILSGSCVVTQSNHQGAELCR  417
             IVFS LK SAA GYLAPEY  TGRFTEKSD++AFG+I+LQIL+G  ++T S   GAE CR
Sbjct  569   IVFSALKASAAMGYLAPEYTTTGRFTEKSDVFAFGMIMLQILAGKRMITHSMRLGAESCR  628

Query  416   FEDFVDAKLGKDFVESEAAKLGKIALLCTHDSPSRRPAIDVVIQ  285
             FEDF+D  L   F E EAA L +IAL+CTH+SP++RP +++VIQ
Sbjct  629   FEDFMDGNLQGKFSEPEAAGLVRIALVCTHESPNQRPNMEMVIQ  672



>gb|EPS73352.1| hypothetical protein M569_01401, partial [Genlisea aurea]
Length=665

 Score =   853 bits (2203),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 433/645 (67%), Positives = 512/645 (79%), Gaps = 7/645 (1%)
 Frame = -3

Query  2207  VSLLMAIKASLDPGNLVLSSWSPNVTDPC--SVSSFEGIACNDLGQVVNISLQGKGLYGK  2034
             VS+LMAIKASLDP NL+L+SWSPN TDPC  S SSFEGIAC+  GQVVNISLQGK L G+
Sbjct  22    VSILMAIKASLDPQNLILNSWSPNATDPCMPSSSSFEGIACDGFGQVVNISLQGKRLAGE  81

Query  2033  IPPEIGQLNGLSGLYLHFNNLHGVIPKEIASLTQLSDLYLNMNDLSGFIPSEIGNMPNLQ  1854
             IPPEIGQL  LSGLYLHFN LHGVIP+EIA L  L+DLYL++N+L+G IP EIG MPNLQ
Sbjct  82    IPPEIGQLKALSGLYLHFNELHGVIPREIADLNALTDLYLDVNNLTGDIPPEIGAMPNLQ  141

Query  1853  VLQLCYNRFEGCIPNKLGSLKNLTVLALQSNQLTGAIPASlggltlltrldLSFNRLFGS  1674
             VLQLCYN+  G IP++LG LKNLTVLALQSNQL+GAIPA+LG L  LTRLDLSFNRLFGS
Sbjct  142   VLQLCYNKLTGNIPSQLGQLKNLTVLALQSNQLSGAIPATLGELASLTRLDLSFNRLFGS  201

Query  1673  IPVKLSEASKLEVLDLRNNTLSGNVPLGLKRLNEGFRYENNPGLCGTGFPSLALCSDSSL  1494
             IP+ LS  S L++ D+ NNTLSGNVP  LK L  GF+Y NNP LCG G+PSL  CS SS 
Sbjct  202   IPLALSTLSSLKIFDITNNTLSGNVPQALKGLGVGFQYSNNPDLCGNGYPSLLTCSKSSE  261

Query  1493  NPTKPEPFGQGSNRLPTKDIPESANIPHQLNQNRKPQAAAAVV--GVIGLFVILAVAGLF  1320
             N    +PFG      P+KDIPESAN+  Q NQ ++ Q +  +V   ++ L ++L   G+F
Sbjct  262   NSMNQQPFGTDPIHPPSKDIPESANV--QRNQKKQAQNSQPIVVFSILSLLLVLGAIGVF  319

Query  1319  TFSWYRRRKQQIGSTVDISESRVSTDQPKVLCRRSTSPLISLEYSNGWDPLAKDQSGSAL  1140
             TF+ YRRRKQ++ +    S++R STD+     R + SPL+ LEYSN WDPLAK +  S L
Sbjct  320   TFTRYRRRKQKVAAGYGSSDNRQSTDRIIEAGRNNVSPLVGLEYSNDWDPLAKREEISTL  379

Query  1139  SQEVLESFMFNLDEVESATQYFSETNLLGKSSFSAVYKGTLRDGSAVAVKCISKTSCKSD  960
             SQE+LES+MFNLDE+ESATQYFS  N+LGK SFSA+YKG LRDGS VA+KCISK SC+ D
Sbjct  380   SQEILESYMFNLDEIESATQYFSGANILGKGSFSAIYKGCLRDGSLVAIKCISKVSCRFD  439

Query  959   EAEFRKGLTLLTSLKHENLLRLRGFCCSKGRGECFLIYDFVSNGNLLRYLDVKDEKGKVL  780
               EF KGL LL SLKHENLLRLRGFCCSK RGECFLIYD+V+NGNL  YLDVK ++ KVL
Sbjct  440   ADEFLKGLKLLISLKHENLLRLRGFCCSKDRGECFLIYDYVANGNLSEYLDVKGQE-KVL  498

Query  779   DWSTRTAIIKGIARGIKYLHGNKRNKPALVHRNISADKVLIDHLYKPLLSDSGLHKLLAD  600
             DW+TR +II+GIA+G++YLHG++ ++P LVHRNISA+K+LID  Y PLLSDSGL KLLAD
Sbjct  499   DWNTRKSIIRGIAKGMEYLHGSQNSRPKLVHRNISAEKILIDKDYNPLLSDSGLFKLLAD  558

Query  599   DIVFSTLKGSAANGYLAPEYAITGRFTEKSDMYAFGVIILQILSGSCVVTQSNHQGAELC  420
             DIVFSTLKGSAA GYLAPEY  TGRFTEKSD+YAFG+II QILSG   +TQ N  GAEL 
Sbjct  559   DIVFSTLKGSAAMGYLAPEYTTTGRFTEKSDVYAFGMIIFQILSGKTRITQLNAHGAELS  618

Query  419   RFEDFVDAKLGKDFVESEAAKLGKIALLCTHDSPSRRPAIDVVIQ  285
             RFEDF+DA L  +FVE+EA +LG++ALLCTH+ P RRP I  ++Q
Sbjct  619   RFEDFIDANLSGNFVETEATRLGEVALLCTHELPDRRPDIGTLMQ  663



>ref|XP_006445272.1| hypothetical protein CICLE_v10019056mg [Citrus clementina]
 ref|XP_006490913.1| PREDICTED: leucine-rich repeat receptor protein kinase EXS-like 
[Citrus sinensis]
 gb|ESR58512.1| hypothetical protein CICLE_v10019056mg [Citrus clementina]
 gb|KDO85808.1| hypothetical protein CISIN_1g005859mg [Citrus sinensis]
Length=673

 Score =   849 bits (2193),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 439/655 (67%), Positives = 512/655 (78%), Gaps = 14/655 (2%)
 Frame = -3

Query  2228  TSNNASTVSLLMAIKASLDPGNLVLSSWSPNVTDPCSVSSFEGIACNDLGQVVNISLQGK  2049
             T ++ S V +LM IK SLDP N +L+SW+PN  DPCS  SF+G+AC++ G+V NISLQGK
Sbjct  17    TLSSTSEVDILMHIKDSLDPENRLLTSWAPNA-DPCSSDSFDGVACDENGRVANISLQGK  75

Query  2048  GLYGKIPPEIGQLNGLSGLYLHFNNLHGVIPKEIASLTQLSDLYLNMNDLSGFIPSEIGN  1869
             GL G+IP  +G L  L+GLYLHFN L+GVIPKEIASL++LSDLYLN+N+LSG IPS+IGN
Sbjct  76    GLSGEIPAAVGGLKSLTGLYLHFNALNGVIPKEIASLSELSDLYLNVNNLSGKIPSQIGN  135

Query  1868  MPNLQVLQLCYNRFEGCIPNKLGSLKNLTVLALQSNQLTGAIPASlggltlltrldLSFN  1689
             M NLQVLQLCYN+  G IP +LGSL+ L+VLALQ NQLTGAIPASLG L +L RLDLSFN
Sbjct  136   MTNLQVLQLCYNKLTGNIPTQLGSLRKLSVLALQYNQLTGAIPASLGDLGMLMRLDLSFN  195

Query  1688  RLFGSIPVKLSEASKLEVLDLRNNTLSGNVPLGLKRLNEGFRYENNPGLCGTGFPSLALC  1509
              LFG +PVKL+   KLEVLD+RNN+ SGNVP  LKRLN GF+Y+NN  LCGTGF +L  C
Sbjct  196   NLFGPVPVKLANVPKLEVLDIRNNSFSGNVPPALKRLNGGFQYDNNAALCGTGFTNLKNC  255

Query  1508  SDSSL-NPTKPEPFGQGSNRLPTKDIPESANIPHQLNQ------NRKPQAAAAVVGVIGL  1350
             + S    P KPEPF    N L TKDIPESA +P    Q       R+P      VGVI +
Sbjct  256   TASDHPTPGKPEPFE--PNGLSTKDIPESAKLPANCGQPGCSSPARRPHTGV-FVGVIAV  312

Query  1349  FVILAVAGLFTFSWYRRRKQQIGSTVDISESRVSTDQPKVLCRRSTSPLISLEYSNGWDP  1170
             F+IL V GLFTF+WYRRRKQ+IG+  D S+SR+STDQ K +CRR++SPLISLEYSNGWDP
Sbjct  313   FIILTVTGLFTFTWYRRRKQKIGNAFDNSDSRLSTDQVKEVCRRNSSPLISLEYSNGWDP  372

Query  1169  LAKDQSGSALSQEVLESFMFNLDEVESATQYFSETNLLGKSSFSAVYKGTLRDGSAVAVK  990
             LAK QSG+  SQEVLESFMFNL+EVE ATQ FSE NLLGKSSFSA YKG LRDGS VAVK
Sbjct  373   LAKGQSGNGFSQEVLESFMFNLEEVERATQCFSEANLLGKSSFSATYKGILRDGSVVAVK  432

Query  989   CISKTSCKSDEAEFRKGLTLLTSLKHENLLRLRGFCCSKGRGECFLIYDFVSNGNLLRYL  810
             CI+KTSCKSDE EF KGL +LTSLKHENL  LRG CCSKGRGECFLIYDFV NGNLL++L
Sbjct  433   CIAKTSCKSDEGEFLKGLKILTSLKHENLASLRGICCSKGRGECFLIYDFVPNGNLLQHL  492

Query  809   DVKDEKGKVLDWSTRTAIIKGIARGIKYLHGNKRNKPALVHRNISADKVLIDHLYKPLLS  630
             D++    KVL+W+TR ++IKGIA+GI YLHG    +P LVH N+SA+KVLI   Y PLLS
Sbjct  493   DLEAGSEKVLEWATRISVIKGIAKGISYLHG---KRPGLVHPNLSAEKVLIHRRYNPLLS  549

Query  629   DSGLHKLLADDIVFSTLKGSAANGYLAPEYAITGRFTEKSDMYAFGVIILQILSGSCVVT  450
             DSGLHKLLADDIVFS LK SAA GYLAPEY  TGRFTEKSD+YAFG+I+ QILSG C +T
Sbjct  550   DSGLHKLLADDIVFSMLKASAAMGYLAPEYTTTGRFTEKSDIYAFGMIVFQILSGKCSIT  609

Query  449   QSNHQGAELCRFEDFVDAKLGKDFVESEAAKLGKIALLCTHDSPSRRPAIDVVIQ  285
                 Q AE  + EDF+D  L   F  SEA+ LG+IAL CTH+SPS RP+I+ V+Q
Sbjct  610   PFTRQAAESSKVEDFIDPNLEGKFSVSEASNLGQIALHCTHESPSHRPSIENVMQ  664



>ref|XP_007052072.1| Leucine-rich repeat receptor protein kinase [Theobroma cacao]
 gb|EOX96229.1| Leucine-rich repeat receptor protein kinase [Theobroma cacao]
Length=677

 Score =   847 bits (2188),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 439/647 (68%), Positives = 511/647 (79%), Gaps = 12/647 (2%)
 Frame = -3

Query  2201  LLMAIKASLDPGNLVLSSWSPNVTDPCSVSSFEGIACNDLGQVVNISLQGKGLYGKIPPE  2022
             LL+ IKASLDP N  LSSW+P  TDPCS  SF+G+ACN+ G V NISLQGKGL G+IP  
Sbjct  26    LLLQIKASLDPQNRFLSSWTP-YTDPCSSGSFDGVACNEEGHVANISLQGKGLSGQIPAA  84

Query  2021  IGQLNGLSGLYLHFNNLHGVIPKEIASLTQLSDLYLNMNDLSGFIPSEIGNMPNLQVLQL  1842
             +G L  L+GLYLHFN L G IPKEIA+L+QLSDLYLN+NDLSG IPS+IGNM NLQVLQL
Sbjct  85    LGGLKSLTGLYLHFNALSGGIPKEIATLSQLSDLYLNVNDLSGEIPSQIGNMANLQVLQL  144

Query  1841  CYNRFEGCIPNKLGSLKNLTVLALQSNQLTGAIPASlggltlltrldLSFNRLFGSIPVK  1662
             CYN+  G IP +LGSLK L VLALQ N+LTGAIPASLG L +LTRLDLSFN LFG +PVK
Sbjct  145   CYNKLTGSIPTQLGSLKKLNVLALQYNRLTGAIPASLGDLEMLTRLDLSFNSLFGPVPVK  204

Query  1661  LSEASKLEVLDLRNNTLSGNVPLGLKRLNEGFRYENNPGLCGTGFPSLALCSDS-SLNPT  1485
             L++A  L+VLD+RNNTLSGNVP  LKRLN GF+YENN GLCG GF  L  C+DS  +   
Sbjct  205   LADAPMLKVLDIRNNTLSGNVPPVLKRLNSGFQYENNLGLCGVGFSDLKDCADSGKIYRD  264

Query  1484  KPEPFG-QGSNRLPTKDIPESANI------PHQLNQNRKPQAAAAVVGVIGLFVILAVAG  1326
             +PEPF   G NR    DIPESA++          +++ K      + G++G+ ++L VA 
Sbjct  265   RPEPFKPSGLNR---TDIPESADLQPADCSKTNCSRSSKSLTIGVISGMVGVVLVLTVAA  321

Query  1325  LFTFSWYRRRKQQIGSTVDISESRVSTDQPKVLCRRSTSPLISLEYSNGWDPLAKDQSGS  1146
             LFTF+WYRRRKQ+IGS  D S+ R+STDQ K + RRS SPLISLEYSNGWDPL K +SG+
Sbjct  322   LFTFAWYRRRKQKIGSAFDTSDGRLSTDQAKEVYRRSASPLISLEYSNGWDPLDKGRSGN  381

Query  1145  ALSQEVLESFMFNLDEVESATQYFSETNLLGKSSFSAVYKGTLRDGSAVAVKCISKTSCK  966
               SQEV ESFMFNL+EVE ATQ FSE NLLGKS+FSA+YKG LRDGS V VKCI+KTSCK
Sbjct  382   GFSQEVFESFMFNLEEVERATQCFSEVNLLGKSNFSAIYKGFLRDGSVVVVKCIAKTSCK  441

Query  965   SDEAEFRKGLTLLTSLKHENLLRLRGFCCSKGRGECFLIYDFVSNGNLLRYLDVKDEKGK  786
             SDE+EF  GL +LTSLKHENL+RLRGFCCSKGRGECFLIYDFV NGNLL++LDVK   GK
Sbjct  442   SDESEFLHGLKILTSLKHENLVRLRGFCCSKGRGECFLIYDFVHNGNLLQHLDVKPGSGK  501

Query  785   VLDWSTRTAIIKGIARGIKYLHGNKRNKPALVHRNISADKVLIDHLYKPLLSDSGLHKLL  606
             VL+WSTR +II GIA+GI YLHG+K +KPALVH+NISA+KVLID+   PLLSDSGLHKL 
Sbjct  502   VLEWSTRVSIIYGIAKGIGYLHGSKGSKPALVHQNISAEKVLIDNRSNPLLSDSGLHKLR  561

Query  605   ADDIVFSTLKGSAANGYLAPEYAITGRFTEKSDMYAFGVIILQILSGSCVVTQSNHQGAE  426
              DDIVFSTLK SAA GYLAPEY  TGRFTEKSD+YAFG+I+ QILSG   +TQ    GAE
Sbjct  562   TDDIVFSTLKASAAMGYLAPEYTTTGRFTEKSDVYAFGMILFQILSGKRKITQLIRLGAE  621

Query  425   LCRFEDFVDAKLGKDFVESEAAKLGKIALLCTHDSPSRRPAIDVVIQ  285
              C+ EDF+D  L   + +SEA KLG+IALLCTH+SPS RP++D VIQ
Sbjct  622   SCKVEDFIDMNLEGKYSDSEATKLGRIALLCTHESPSHRPSMDNVIQ  668



>ref|XP_007220017.1| hypothetical protein PRUPE_ppa002366mg [Prunus persica]
 gb|EMJ21216.1| hypothetical protein PRUPE_ppa002366mg [Prunus persica]
Length=681

 Score =   843 bits (2177),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 435/651 (67%), Positives = 513/651 (79%), Gaps = 17/651 (3%)
 Frame = -3

Query  2198  LMAIKASLDPGNLVLSSWSPNVTDPCSVSSFEGIACNDLGQVVNISLQGKGLYGKIPPEI  2019
             LMA+KASLDP N  L+SW+P+ ++PCS  +FEG+ACN+ G V NISLQGKGL+G+IPP +
Sbjct  27    LMAMKASLDPQNQFLTSWTPH-SEPCS-GAFEGVACNEQGLVTNISLQGKGLWGQIPPAV  84

Query  2018  GQLNGLSGLYLHFNNLHGVIPKEIASLTQLSDLYLNMNDLSGFIPSEIGNMPNLQVLQLC  1839
             G L  L+GLYLHFN L G IPKEIA L QLSDLYLN+N+LSG IP EIGNMPNLQVLQLC
Sbjct  85    GGLKSLTGLYLHFNALSGKIPKEIARLNQLSDLYLNVNNLSGGIPREIGNMPNLQVLQLC  144

Query  1838  YNRFEGCIPNKLGSLKNLTVLALQSNQLTGAIPASlggltlltrldLSFNRLFGSIPVKL  1659
             YN+  G +P +LG LK L+VLA+QSNQLTGAIPASLG L  LTRLDLSFN  FG IP +L
Sbjct  145   YNKLTGGLPTQLGDLKRLSVLAVQSNQLTGAIPASLGELGTLTRLDLSFNSFFGPIPARL  204

Query  1658  SEASKLEVLDLRNNTLSGNVPLGLKRLNEGFRYENNPGLCGTGFPSLALCSDSSL-NPTK  1482
             + A  L+VLD+R+N+LSGN+PL LKRLN GF+YENNP LCG GF  L +C+ ++  NP K
Sbjct  205   AHAPMLQVLDVRSNSLSGNIPLALKRLNGGFQYENNPSLCGVGFSGLKICTATTTRNPNK  264

Query  1481  PEPFGQG---SNRLP----TKDIPESANIPHQLNQNR-----KPQAAAAVVGVIGLFVIL  1338
             P+PF  G   +  LP     K+IPESAN+    +Q       K Q    V GVIG+   L
Sbjct  265   PQPFEPGNFSAKNLPDSPTAKEIPESANLESNCSQTHCSRASKSQQIGIVFGVIGVIAAL  324

Query  1337  AVAGLFTFSWYRRRKQQIGSTVDISESRVSTDQPKVLCRRSTSPLISLEYSNGWDPLAKD  1158
             AV+GLF FSWYRRRKQ+IGST+D S+SR STDQ K + +++ SPLI+LEYSNGWDPLAK 
Sbjct  325   AVSGLFAFSWYRRRKQKIGSTLDTSDSRHSTDQAKEVYKKNASPLINLEYSNGWDPLAKG  384

Query  1157  QSGSALSQEVLESFMFNLDEVESATQYFSETNLLGKSSFSAVYKGTLRDGSAVAVKCISK  978
              +G   SQEVLESFMFNL+EVE ATQ FSE NLL KS+FSA+YKG LRDGS VA+ CISK
Sbjct  385   SAG--YSQEVLESFMFNLEEVERATQSFSEGNLLRKSNFSAIYKGILRDGSVVAINCISK  442

Query  977   TSCKSDEAEFRKGLTLLTSLKHENLLRLRGFCCSKGRGECFLIYDFVSNGNLLRYLDVKD  798
             TSCK DEAEF KGL +L SLKHENL+RLRGFCCSKGRGE FLIYDFV N +LL+YLD+K 
Sbjct  443   TSCKPDEAEFLKGLKILPSLKHENLVRLRGFCCSKGRGEWFLIYDFVPNESLLQYLDIKV  502

Query  797   EKGKVLDWSTRTAIIKGIARGIKYLHGNKRNKPALVHRNISADKVLIDHLYKPLLSDSGL  618
               G+VL+WSTR +II GIA+GI YLHG+  NKPA+VH+ ISA+KVLID  Y PLLSDSGL
Sbjct  503   GSGEVLEWSTRVSIITGIAKGIGYLHGSMGNKPAIVHQTISAEKVLIDSHYNPLLSDSGL  562

Query  617   HKLLADDIVFSTLKGSAANGYLAPEYAITGRFTEKSDMYAFGVIILQILSGSCVVTQSNH  438
             HKLLADDIVFS LK SAA GYLAPEY ITGRFT KSD+YAFG+I+ QILSG   +TQ N 
Sbjct  563   HKLLADDIVFSMLKASAAMGYLAPEYTITGRFTAKSDIYAFGMIVFQILSGKRKITQVNR  622

Query  437   QGAELCRFEDFVDAKLGKDFVESEAAKLGKIALLCTHDSPSRRPAIDVVIQ  285
             QGAE  RFEDF+DA L  +F ESEA KLG++ALLCT +SPS RP+I+ V++
Sbjct  623   QGAEAGRFEDFIDANLEGNFSESEATKLGRLALLCTQESPSYRPSIENVVK  673



>gb|KDP28763.1| hypothetical protein JCGZ_14534 [Jatropha curcas]
Length=673

 Score =   840 bits (2171),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 437/650 (67%), Positives = 505/650 (78%), Gaps = 10/650 (2%)
 Frame = -3

Query  2216  ASTVSLLMAIKASLDPGNLVLSSWSPNVTDPCSVSSFEGIACNDLGQVVNISLQGKGLYG  2037
             A+ + LLM IKASLDP N  L+SW  N  DPC   SFEG+ACN+ G+V NISLQGKGL G
Sbjct  19    AAELELLMQIKASLDPQNRFLTSWQHNA-DPCG-GSFEGVACNEEGRVANISLQGKGLSG  76

Query  2036  KIPPEIGQLNGLSGLYLHFNNLHGVIPKEIASLTQLSDLYLNMNDLSGFIPSEIGNMPNL  1857
             +IP  +G L  L+GLYLHFN L G IPKEIA L+QLSDLYLN+N+LSG IP +IGNM NL
Sbjct  77    RIPAALGGLKSLTGLYLHFNALTGDIPKEIAQLSQLSDLYLNVNNLSGQIPHQIGNMSNL  136

Query  1856  QVLQLCYNRFEGCIPNKLGSLKNLTVLALQSNQLTGAIPASlggltlltrldLSFNRLFG  1677
             QVLQLCYN+  G IP +LGSLK L VLALQ NQLT AIPASLG L LLTRLDLSFN LFG
Sbjct  137   QVLQLCYNKLTGSIPTQLGSLKKLNVLALQYNQLTSAIPASLGDLGLLTRLDLSFNGLFG  196

Query  1676  SIPVKLSEASKLEVLDLRNNTLSGNVPLGLKRLNEGFRYENNPGLCGTGFPSLALCSDS-  1500
             SIPVKL++A  L+ LD+RNN+LSGNVP  LKRL+ GF+Y NNP LCG GF +L  C+ S 
Sbjct  197   SIPVKLADAPMLQALDIRNNSLSGNVPPALKRLSSGFQYTNNPELCGDGFANLQTCTASG  256

Query  1499  SLNPTKPEPFGQGSNRLPTKDIPESANIPHQLNQNR-----KPQAAAAVVGVIGLFVILA  1335
              LN  +PEPF    N    KDIPESANIP   +Q       K      V G+IG+F++L 
Sbjct  257   QLNANRPEPFK--PNGTLQKDIPESANIPSNCSQTHCLSSSKNSQYGVVFGIIGVFIVLT  314

Query  1334  VAGLFTFSWYRRRKQQIGSTVDISESRVSTDQPKVLCRRSTSPLISLEYSNGWDPLAKDQ  1155
               GLFTFSWYRR+KQ+IGS +DIS+ R+ST+Q K + R++ SPLISLEYSNGWDPLA  Q
Sbjct  315   GTGLFTFSWYRRQKQKIGSALDISDGRLSTEQVKEVYRKNVSPLISLEYSNGWDPLAVGQ  374

Query  1154  SGSALSQEVLESFMFNLDEVESATQYFSETNLLGKSSFSAVYKGTLRDGSAVAVKCISKT  975
             + + LSQE LESFMFNL+EVE ATQ FSE NLLGKS+FSA YKGTLRDGS V VKCI+KT
Sbjct  375   NKNGLSQEFLESFMFNLEEVERATQCFSEVNLLGKSNFSATYKGTLRDGSVVVVKCITKT  434

Query  974   SCKSDEAEFRKGLTLLTSLKHENLLRLRGFCCSKGRGECFLIYDFVSNGNLLRYLDVKDE  795
             SCKSDEA+F KGL +LTSLKHENL+RLRGFCCSKGRGECFLIYDFV NGNLL YLD+K+ 
Sbjct  435   SCKSDEADFLKGLKILTSLKHENLVRLRGFCCSKGRGECFLIYDFVPNGNLLLYLDIKEG  494

Query  794   KGKVLDWSTRTAIIKGIARGIKYLHGNKRNKPALVHRNISADKVLIDHLYKPLLSDSGLH  615
              GKVL+WSTR +II GIA+GI YLHGN+ NKPAL H+NISA+KV ID  Y PLLS SGLH
Sbjct  495   TGKVLEWSTRISIINGIAKGIGYLHGNRGNKPALFHQNISAEKVFIDRRYNPLLSYSGLH  554

Query  614   KLLADDIVFSTLKGSAANGYLAPEYAITGRFTEKSDMYAFGVIILQILSGSCVVTQSNHQ  435
             K+LADDI+FS LK SAA GYLAPEY  TGRFTEKSD+YAFGVIILQ+LSG   VT     
Sbjct  555   KILADDIIFSMLKASAAMGYLAPEYTTTGRFTEKSDVYAFGVIILQLLSGKHNVTPLTCH  614

Query  434   GAELCRFEDFVDAKLGKDFVESEAAKLGKIALLCTHDSPSRRPAIDVVIQ  285
               E C  EDF+DA L   + E +AA LG++ALLCTH+SP+ RP I+ V+Q
Sbjct  615   AGESCNVEDFIDANLEGKYSELDAATLGRLALLCTHESPNHRPNIETVLQ  664



>ref|XP_002320058.2| leucine-rich repeat transmembrane protein kinase [Populus trichocarpa]
 gb|EEE98373.2| leucine-rich repeat transmembrane protein kinase [Populus trichocarpa]
Length=644

 Score =   839 bits (2167),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 432/643 (67%), Positives = 510/643 (79%), Gaps = 14/643 (2%)
 Frame = -3

Query  2195  MAIKASLDPGNLVLSSWSPNVTDPCSVSSFEGIACNDLGQVVNISLQGKGLYGKIPPEIG  2016
             M IKASLDP N +L+SW  N  DPCS  SFEG+ACN+LG V NISLQGKGL G+IP  +G
Sbjct  1     MEIKASLDPQNRLLTSWETN-KDPCS-GSFEGVACNELGHVANISLQGKGLLGQIPAALG  58

Query  2015  QLNGLSGLYLHFNNLHGVIPKEIASLTQLSDLYLNMNDLSGFIPSEIGNMPNLQVLQLCY  1836
              L  L+GLYLHFN L+GVIPKEIA L++LSDLYLN+N+LSG IP  +GNM NLQVLQLCY
Sbjct  59    GLKSLTGLYLHFNALNGVIPKEIAELSELSDLYLNVNNLSGEIPPHVGNMSNLQVLQLCY  118

Query  1835  NRFEGCIPNKLGSLKNLTVLALQSNQLTGAIPASlggltlltrldLSFNRLFGSIPVKLS  1656
             N+  G IP +LGSL+ L+VLALQ NQLTGAIPASLG L LL+RLDLSFN LFG IPVKL+
Sbjct  119   NKLTGSIPTQLGSLEKLSVLALQYNQLTGAIPASLGDLELLSRLDLSFNGLFGPIPVKLA  178

Query  1655  EASKLEVLDLRNNTLSGNVPLGLKRLNEGFRYENNPGLCGTGFPSLALCSDSSLNPTKPE  1476
             +A  L  LD+RNN+LSGN+P  LKRL  GF+Y NNP LCG GF +L  C+ S  +P +PE
Sbjct  179   KAPLLHSLDIRNNSLSGNIPPALKRLTTGFQYGNNPDLCGVGFSNLETCATS--DPNRPE  236

Query  1475  PFGQGSNRLPT-KDIPESANIPHQL-----NQNRKPQAAAAVVGVIGLFVILAVAGLFTF  1314
             P      R+ T KDIPESAN  +       N ++ P+    + GVIG+F+ ++V GL  F
Sbjct  237   P---SEPRVATEKDIPESANPSYCSKSDCSNLSKTPRYGI-IFGVIGVFIAMSVTGLLMF  292

Query  1313  SWYRRRKQQIGSTVDISESRVSTDQPKVLCRRSTSPLISLEYSNGWDPLAKDQSGSALSQ  1134
             SW+RRRKQ+IGS +D  + R+STDQ K + RRS SPLISLEY NGWDPLA  +S S  SQ
Sbjct  293   SWHRRRKQKIGSALDTFDGRLSTDQAKEVSRRSASPLISLEYPNGWDPLAIGRSKSGFSQ  352

Query  1133  EVLESFMFNLDEVESATQYFSETNLLGKSSFSAVYKGTLRDGSAVAVKCISKTSCKSDEA  954
             EVLESFMFNL+EVE ATQ FSE NLLGKS+FSA+YKG LRDGS VA+KCI+KTSCKSDEA
Sbjct  353   EVLESFMFNLEEVERATQCFSEMNLLGKSNFSAIYKGILRDGSVVAIKCITKTSCKSDEA  412

Query  953   EFRKGLTLLTSLKHENLLRLRGFCCSKGRGECFLIYDFVSNGNLLRYLDVKDEKGKVLDW  774
             +F KGL +LTSLKHENL+RLRGFCCSKGRGECFLIYDFV NGNL++YLDVKD  GKVL+W
Sbjct  413   DFLKGLKILTSLKHENLVRLRGFCCSKGRGECFLIYDFVPNGNLVQYLDVKDGSGKVLEW  472

Query  773   STRTAIIKGIARGIKYLHGNKRNKPALVHRNISADKVLIDHLYKPLLSDSGLHKLLADDI  594
             STR +II GIA+GI +LH +K NK ALVH+NISA+KV ID  Y P+LSDSGLHKLLADD+
Sbjct  473   STRISIINGIAKGIAHLHVSKGNKHALVHQNISAEKVFIDRWYNPMLSDSGLHKLLADDV  532

Query  593   VFSTLKGSAANGYLAPEYAITGRFTEKSDMYAFGVIILQILSGSCVVTQSNHQGAELCRF  414
             VFS LK SAA GYLAPEY  TGRFTEKSD+YAFG+I+LQILSG   +TQ  H  AE C+F
Sbjct  533   VFSMLKASAAMGYLAPEYTTTGRFTEKSDVYAFGIIVLQILSGKRNITQLTHHAAEACKF  592

Query  413   EDFVDAKLGKDFVESEAAKLGKIALLCTHDSPSRRPAIDVVIQ  285
             EDF+DAKL  +F ESEAAKLG+IAL CT++SP+ RP ++ V+Q
Sbjct  593   EDFIDAKLEGNFSESEAAKLGRIALCCTNESPNHRPTMETVMQ  635



>ref|XP_008232645.1| PREDICTED: protein NSP-INTERACTING KINASE 2 isoform X1 [Prunus 
mume]
Length=681

 Score =   840 bits (2169),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 432/651 (66%), Positives = 514/651 (79%), Gaps = 17/651 (3%)
 Frame = -3

Query  2198  LMAIKASLDPGNLVLSSWSPNVTDPCSVSSFEGIACNDLGQVVNISLQGKGLYGKIPPEI  2019
             LMA+KASLDP N  L+SW+P+ ++PCS  +FEG+ACN+ G V NISLQGKGL+G+IPP +
Sbjct  27    LMAMKASLDPQNQFLTSWTPH-SEPCS-GAFEGVACNEQGLVTNISLQGKGLWGQIPPAV  84

Query  2018  GQLNGLSGLYLHFNNLHGVIPKEIASLTQLSDLYLNMNDLSGFIPSEIGNMPNLQVLQLC  1839
             G L  L+GLYLHFN L G IPKEIA L QLSDLYLN+N+LSG IP EIGNMPNLQVLQLC
Sbjct  85    GGLKSLTGLYLHFNALSGKIPKEIARLNQLSDLYLNVNNLSGGIPREIGNMPNLQVLQLC  144

Query  1838  YNRFEGCIPNKLGSLKNLTVLALQSNQLTGAIPASlggltlltrldLSFNRLFGSIPVKL  1659
             YN+  G +P +LG LK L+VLA+QSNQLTGAIPASLG L  LTRLDLSFN  FG IP +L
Sbjct  145   YNKLTGGLPTQLGDLKRLSVLAVQSNQLTGAIPASLGELGTLTRLDLSFNSFFGPIPARL  204

Query  1658  SEASKLEVLDLRNNTLSGNVPLGLKRLNEGFRYENNPGLCGTGFPSLALCSDSSL-NPTK  1482
             + A  L+VLD+R+N+LSGN+P  LKRLN GF+YENNP LCG GF  L +C+ ++  NP K
Sbjct  205   AHAPMLQVLDVRSNSLSGNIPPDLKRLNGGFQYENNPSLCGVGFSGLKVCTATTTRNPNK  264

Query  1481  PEPFGQG---SNRLP----TKDIPESANIPHQLNQNR-----KPQAAAAVVGVIGLFVIL  1338
             P+PF  G   +  LP     ++IPESAN+    +Q       K Q    V GVIG+   L
Sbjct  265   PQPFEPGNFTAKNLPDSPTAREIPESANLESNCSQTHCSRASKSQQIGIVFGVIGVIAAL  324

Query  1337  AVAGLFTFSWYRRRKQQIGSTVDISESRVSTDQPKVLCRRSTSPLISLEYSNGWDPLAKD  1158
             AV+GLFTFSWYRRRKQ+IGST+D S+SR+STDQ K + +++ SPLI+LEYSNGWDPLAK 
Sbjct  325   AVSGLFTFSWYRRRKQKIGSTLDTSDSRLSTDQAKEVYKKNASPLINLEYSNGWDPLAKG  384

Query  1157  QSGSALSQEVLESFMFNLDEVESATQYFSETNLLGKSSFSAVYKGTLRDGSAVAVKCISK  978
              +G   SQEVLESFMFNL+EVE ATQ FSE NLL KS+FSA+YKG +RDGS VA+ CISK
Sbjct  385   SAG--YSQEVLESFMFNLEEVERATQSFSEGNLLRKSNFSAIYKGIIRDGSVVAINCISK  442

Query  977   TSCKSDEAEFRKGLTLLTSLKHENLLRLRGFCCSKGRGECFLIYDFVSNGNLLRYLDVKD  798
             TSCK DEAEF KGL +L SLKHENL+RLRGFCCSKGRGE FLIYDFV N +LL+YLD+K 
Sbjct  443   TSCKPDEAEFLKGLKILPSLKHENLVRLRGFCCSKGRGEWFLIYDFVPNESLLQYLDIKV  502

Query  797   EKGKVLDWSTRTAIIKGIARGIKYLHGNKRNKPALVHRNISADKVLIDHLYKPLLSDSGL  618
               G++L+WSTR +II GIA+GI YLHG+  NKPA+VH+ ISA+KVLID  Y PLLSDSGL
Sbjct  503   GSGEILEWSTRVSIITGIAKGIGYLHGSMGNKPAIVHQTISAEKVLIDSHYNPLLSDSGL  562

Query  617   HKLLADDIVFSTLKGSAANGYLAPEYAITGRFTEKSDMYAFGVIILQILSGSCVVTQSNH  438
             HKLLADDIVFS LK SAA GYLAPEY ITGRFT KSD+YAFG+I+ QILSG   +TQ N 
Sbjct  563   HKLLADDIVFSMLKASAAMGYLAPEYTITGRFTAKSDIYAFGMIVFQILSGKRKITQVNR  622

Query  437   QGAELCRFEDFVDAKLGKDFVESEAAKLGKIALLCTHDSPSRRPAIDVVIQ  285
             QGAE  RFEDF+DA L  +F ESEA KLG++ALLCT +SPS RP+I+ V++
Sbjct  623   QGAEAGRFEDFIDANLEGNFSESEATKLGRLALLCTQESPSYRPSIENVVK  673



>ref|XP_011034207.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
GSO1 [Populus euphratica]
Length=671

 Score =   835 bits (2156),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 427/648 (66%), Positives = 509/648 (79%), Gaps = 12/648 (2%)
 Frame = -3

Query  2213  STVSLLMAIKASLDPGNLVLSSWSPNVTDPCSVSSFEGIACNDLGQVVNISLQGKGLYGK  2034
             + + LLM IKASLDP N +L+SW  N  DPC   SFEG+ACN+LG V NISLQGKGL G+
Sbjct  22    TELELLMEIKASLDPQNRLLTSWETN-KDPCG-GSFEGVACNELGHVANISLQGKGLLGQ  79

Query  2033  IPPEIGQLNGLSGLYLHFNNLHGVIPKEIASLTQLSDLYLNMNDLSGFIPSEIGNMPNLQ  1854
             IP  +G L  L+GLYLHFN L+GVIPKEIA L++LSDLYLN+N+LSG IP ++GNM NLQ
Sbjct  80    IPAALGGLKSLTGLYLHFNALNGVIPKEIAELSELSDLYLNVNNLSGEIPPQVGNMSNLQ  139

Query  1853  VLQLCYNRFEGCIPNKLGSLKNLTVLALQSNQLTGAIPASlggltlltrldLSFNRLFGS  1674
             VLQLCYN+  G IP +LGSL+ L+VLALQ NQLTGAIPASLG L LL+RLDLSFN LFG 
Sbjct  140   VLQLCYNKLTGSIPTELGSLEKLSVLALQYNQLTGAIPASLGDLELLSRLDLSFNDLFGP  199

Query  1673  IPVKLSEASKLEVLDLRNNTLSGNVPLGLKRLNEGFRYENNPGLCGTGFPSLALCSDSSL  1494
             IPVKL++A  L  LD+RNN+LSGN+P  LKRL  GF+Y NNP LCG GF +L  C+ S  
Sbjct  200   IPVKLAKAPLLRTLDIRNNSLSGNIPPALKRLTTGFQYGNNPDLCGVGFSNLETCATS--  257

Query  1493  NPTKPEPFGQGSNRLPTKDIPESANIPHQL-----NQNRKPQAAAAVVGVIGLFVILAVA  1329
             +P +PEP     +    KDIPESAN  +       N ++ P+    + GVIG+F+ ++V 
Sbjct  258   DPNRPEP--SEPHVAMEKDIPESANPSYCSKSDCSNLSKTPRYGI-IFGVIGVFIAMSVT  314

Query  1328  GLFTFSWYRRRKQQIGSTVDISESRVSTDQPKVLCRRSTSPLISLEYSNGWDPLAKDQSG  1149
             GL  FSW+RR KQ+IGS  D  + R+STDQ K + RRS SPLISLEY NGWDP+A  +S 
Sbjct  315   GLLMFSWHRRHKQKIGSASDTFDGRLSTDQAKEVSRRSASPLISLEYPNGWDPMAIGRSK  374

Query  1148  SALSQEVLESFMFNLDEVESATQYFSETNLLGKSSFSAVYKGTLRDGSAVAVKCISKTSC  969
             S  SQEVLESFMFNL+EVE ATQ FSE NLLGKS+FSA+YKG LRDGSAVA+KCI+KT+C
Sbjct  375   SGFSQEVLESFMFNLEEVERATQCFSEVNLLGKSNFSAIYKGILRDGSAVAIKCITKTNC  434

Query  968   KSDEAEFRKGLTLLTSLKHENLLRLRGFCCSKGRGECFLIYDFVSNGNLLRYLDVKDEKG  789
             KSDEA+F KGL +LTSLKHENL+RLRGFCCSKGRGECFLIYDFV NGNL++YLDVKD  G
Sbjct  435   KSDEADFLKGLKILTSLKHENLVRLRGFCCSKGRGECFLIYDFVPNGNLVQYLDVKDGSG  494

Query  788   KVLDWSTRTAIIKGIARGIKYLHGNKRNKPALVHRNISADKVLIDHLYKPLLSDSGLHKL  609
             KVL+WSTR +II GIA+GI +LHG+K NK ALVH+NISA+KV ID  Y P+LSDSGLHKL
Sbjct  495   KVLEWSTRISIINGIAKGIAHLHGSKGNKHALVHQNISAEKVFIDRWYNPMLSDSGLHKL  554

Query  608   LADDIVFSTLKGSAANGYLAPEYAITGRFTEKSDMYAFGVIILQILSGSCVVTQSNHQGA  429
             LADD+VFS LK SAA GYLAPEY  TGRFTEKSD+YAFG+I+LQILSG   +TQ  H  A
Sbjct  555   LADDVVFSMLKASAAMGYLAPEYTTTGRFTEKSDVYAFGIIVLQILSGKRNITQLTHHAA  614

Query  428   ELCRFEDFVDAKLGKDFVESEAAKLGKIALLCTHDSPSRRPAIDVVIQ  285
             E C+FEDF+DA L  +F E EAAKL +IAL CT++SP+ RP ++ V+Q
Sbjct  615   EACKFEDFIDANLEGNFSELEAAKLARIALCCTNESPNHRPTMETVMQ  662



>gb|KHF99663.1| nsp-interacting kinase 2 -like protein [Gossypium arboreum]
Length=674

 Score =   834 bits (2155),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 430/649 (66%), Positives = 516/649 (80%), Gaps = 9/649 (1%)
 Frame = -3

Query  2213  STVSLLMAIKASLDPGNLVLSSWSPNVTDPCSVSSFEGIACNDLGQVVNISLQGKGLYGK  2034
             + + LL+ IKASLDP N  LSSW+P  +D CS  SF+G+ACN  G+VVNISLQGKGL G+
Sbjct  20    TELDLLLQIKASLDPDNRFLSSWTP-YSDHCSTGSFDGVACNGQGRVVNISLQGKGLSGQ  78

Query  2033  IPPEIGQLNGLSGLYLHFNNLHGVIPKEIASLTQLSDLYLNMNDLSGFIPSEIGNMPNLQ  1854
             IPP +G L  L+GLYLHFN L G IPKEI SL+QL+DLYLN+N+LSG IP  IGN+ +LQ
Sbjct  79    IPPALGGLKSLTGLYLHFNALSGEIPKEIVSLSQLTDLYLNVNNLSGEIPPYIGNLTDLQ  138

Query  1853  VLQLCYNRFEGCIPNKLGSLKNLTVLALQSNQLTGAIPASlggltlltrldLSFNRLFGS  1674
             VLQLCYNR  G +P +LGSL  LTVLALQ N+LTGAIPASLG L +LTRLDLSFN LFGS
Sbjct  139   VLQLCYNRLTGGLPTQLGSLHKLTVLALQDNRLTGAIPASLGDLGMLTRLDLSFNNLFGS  198

Query  1673  IPVKLSEASKLEVLDLRNNTLSGNVPLGLKRLNEGFRYENNPGLCGTGFPSLALCSDSS-  1497
             +PVKL+ A  L+VLD+RNNTLSGNVP  LKRL+ GF+YENN GLCG GFP+L  C+DSS 
Sbjct  199   VPVKLANAPMLKVLDIRNNTLSGNVPPVLKRLHAGFQYENNLGLCGVGFPNLKDCADSSK  258

Query  1496  LNPTKPEPFGQGSNRLPTKDIPESANIPHQLNQNR--KPQAA---AAVVGVIGLFVILAV  1332
             +  ++PEPF    N L  K+IPESA++P + ++     P  +     V G++G+ ++L V
Sbjct  259   IYRSRPEPFK--PNGLNQKNIPESADLPTECSKANCSSPSGSTKIGVVSGIVGVALVLTV  316

Query  1331  AGLFTFSWYRRRKQQIGSTVDISESRVSTDQPKVLCRRSTSPLISLEYSNGWDPLAKDQS  1152
             A LFTF+WYRRRKQ+IGS  D S+SR+STDQ K + RRS SPLISLEYSNGWDPL K +S
Sbjct  317   AALFTFAWYRRRKQKIGSAFDSSDSRLSTDQVKEVNRRSASPLISLEYSNGWDPLDKGRS  376

Query  1151  GSALSQEVLESFMFNLDEVESATQYFSETNLLGKSSFSAVYKGTLRDGSAVAVKCISKTS  972
             G+  SQEV ESFMFNL+EVE ATQ FSETNLLGKS+FSA+YKG+LRD SAV VKCI+KTS
Sbjct  377   GNGFSQEVFESFMFNLEEVERATQCFSETNLLGKSNFSAIYKGSLRDSSAVVVKCIAKTS  436

Query  971   CKSDEAEFRKGLTLLTSLKHENLLRLRGFCCSKGRGECFLIYDFVSNGNLLRYLDVKDEK  792
             CKSDE+EF +GL +LTSLKHENL+RLRGFCCSKGRGECFLIYD+V NGNLL+YLDVK   
Sbjct  437   CKSDESEFLQGLKILTSLKHENLVRLRGFCCSKGRGECFLIYDYVPNGNLLQYLDVKQGN  496

Query  791   GKVLDWSTRTAIIKGIARGIKYLHGNKRNKPALVHRNISADKVLIDHLYKPLLSDSGLHK  612
             GKVL+WSTR +II GIA+GI+YLH ++ +K ALVH+N+SA+KVLID+   PLL DSGLHK
Sbjct  497   GKVLEWSTRISIIYGIAKGIRYLHESRGSKQALVHQNLSAEKVLIDNRSNPLLLDSGLHK  556

Query  611   LLADDIVFSTLKGSAANGYLAPEYAITGRFTEKSDMYAFGVIILQILSGSCVVTQSNHQG  432
             L+ADDIVFSTLK SAA GYLAPEY  TGRFTEKSD+YAFG+I+ QILSG   +TQ     
Sbjct  557   LVADDIVFSTLKASAAMGYLAPEYTTTGRFTEKSDVYAFGMILFQILSGKRKITQQIRHA  616

Query  431   AELCRFEDFVDAKLGKDFVESEAAKLGKIALLCTHDSPSRRPAIDVVIQ  285
             AE  + ED +D  L   + +SEA +LG+IALLC H+SP  RP+ID VIQ
Sbjct  617   AETSKVEDLIDMNLEGKYSDSEATRLGRIALLCIHESPYHRPSIDNVIQ  665



>ref|XP_002301282.2| hypothetical protein POPTR_0002s14800g [Populus trichocarpa]
 gb|EEE80555.2| hypothetical protein POPTR_0002s14800g [Populus trichocarpa]
Length=671

 Score =   833 bits (2153),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 432/653 (66%), Positives = 507/653 (78%), Gaps = 12/653 (2%)
 Frame = -3

Query  2231  ETSNNASTVSLLMAIKASLDPGNLVLSSWSPNVTDPCSVSSFEGIACNDLGQVVNISLQG  2052
             +T  + + + LLM IKASLDP N +L+SW PN  DPCS  +FEG+ACN+ G V NISLQG
Sbjct  16    QTLASPTELELLMQIKASLDPQNRLLTSWEPN-KDPCS-GAFEGVACNEQGHVANISLQG  73

Query  2051  KGLYGKIPPEIGQLNGLSGLYLHFNNLHGVIPKEIASLTQLSDLYLNMNDLSGFIPSEIG  1872
             KGL G+IP  +G L  LSGL+LHFN L+G IPKEIA L++LSDLYLN+N+LSG IP +IG
Sbjct  74    KGLSGQIPAALGGLKSLSGLFLHFNALNGAIPKEIAELSELSDLYLNVNNLSGEIPPQIG  133

Query  1871  NMPNLQVLQLCYNRFEGCIPNKLGSLKNLTVLALQSNQLTGAIPASlggltlltrldLSF  1692
             NM NLQVLQLCYN+  G IP +LGSL+ L+VLALQ NQLTGAIPASLG L  L+ L LSF
Sbjct  134   NMSNLQVLQLCYNKLAGSIPTQLGSLEKLSVLALQYNQLTGAIPASLGDLEFLSTLVLSF  193

Query  1691  NRLFGSIPVKLSEASKLEVLDLRNNTLSGNVPLGLKRLNEGFRYENNPGLCGTGFPSLAL  1512
             N LFG IPVKL+ A  L+ LD+RNN+LSGNVP  LKRL  GF+Y NNP LCG GF +L  
Sbjct  194   NGLFGPIPVKLARAPLLKTLDIRNNSLSGNVPPALKRLTTGFQYGNNPDLCGVGFSNLET  253

Query  1511  CSDSSLNPTKPEPFGQGSNRLPTKDIPESANIPHQLNQN-----RKPQAAAAVVGVIGLF  1347
             C  S  +P KPEP  + +  LP KDIPESAN P   +++      K      + GVIG+F
Sbjct  254   CVTS--DPNKPEP-SKPNVALP-KDIPESAN-PSNCSKSDCSHLTKTPRYGIIFGVIGVF  308

Query  1346  VILAVAGLFTFSWYRRRKQQIGSTVDISESRVSTDQPKVLCRRSTSPLISLEYSNGWDPL  1167
             + ++V+G   FSWYRR KQ+IGS  D  +SR+STDQ K + R+S SPLISLEYSNGWDPL
Sbjct  309   IAMSVSGFLMFSWYRRHKQKIGSASDTLDSRLSTDQAKEVYRKSVSPLISLEYSNGWDPL  368

Query  1166  AKDQSGSALSQEVLESFMFNLDEVESATQYFSETNLLGKSSFSAVYKGTLRDGSAVAVKC  987
             A D+S S  SQEVLESFMFNL+EVE ATQ FSE NLLGKS+FSA YKG LRDGS VA+KC
Sbjct  369   AIDRSKSGFSQEVLESFMFNLEEVERATQCFSEVNLLGKSNFSATYKGILRDGSVVAIKC  428

Query  986   ISKTSCKSDEAEFRKGLTLLTSLKHENLLRLRGFCCSKGRGECFLIYDFVSNGNLLRYLD  807
             I+KTSCKSDEA+F KGL +LTSLKHENL+RLRGFCCSKGRGECFLIYDFV NGNL++YLD
Sbjct  429   ITKTSCKSDEADFLKGLKILTSLKHENLVRLRGFCCSKGRGECFLIYDFVPNGNLVQYLD  488

Query  806   VKDEKGKVLDWSTRTAIIKGIARGIKYLHGNKRNKPALVHRNISADKVLIDHLYKPLLSD  627
             VKD  GKVL+WS R +II GIA GI YLHG+K NK ALVH+NISA+KV I+  Y PL+SD
Sbjct  489   VKDGSGKVLEWSARISIINGIATGIAYLHGSKGNKHALVHQNISAEKVFINRPYDPLISD  548

Query  626   SGLHKLLADDIVFSTLKGSAANGYLAPEYAITGRFTEKSDMYAFGVIILQILSGSCVVTQ  447
             SGLHKLLADDIVFS LK SAA GYLAPEY  TGRFTEKSD+YAFG+I+LQILSG   +TQ
Sbjct  549   SGLHKLLADDIVFSMLKASAAMGYLAPEYTTTGRFTEKSDVYAFGMIVLQILSGKRNITQ  608

Query  446   SNHQGAELCRFEDFVDAKLGKDFVESEAAKLGKIALLCTHDSPSRRPAIDVVI  288
                  AE CR+EDF+DA LG +F ESEA KLG+IAL CT++SP  RP  + V+
Sbjct  609   LTLHAAESCRYEDFIDANLGGNFSESEADKLGRIALRCTNESPIHRPTAETVM  661



>ref|XP_010276701.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g63930 [Nelumbo nucifera]
Length=682

 Score =   833 bits (2153),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 426/644 (66%), Positives = 510/644 (79%), Gaps = 8/644 (1%)
 Frame = -3

Query  2198  LMAIKASLDPGNLVLSSWSPNVTDPCSVSSFEGIACNDLGQVVNISLQGKGLYGKIPPEI  2019
             LM +KASLDPGN  LSSW+ +   PCS  SFEG+ CN+ G+V NISL GKGL G+IPP +
Sbjct  32    LMEMKASLDPGNRFLSSWTSD-GHPCS-GSFEGVVCNEHGKVANISLVGKGLSGRIPPAV  89

Query  2018  GQLNGLSGLYLHFNNLHGVIPKEIASLTQLSDLYLNMNDLSGFIPSEIGNMPNLQVLQLC  1839
               L  LSGLYLHFN+L G IP+EI++LT+LSDLYLN+N+LSG IP EIGNM +LQVLQLC
Sbjct  90    AGLKCLSGLYLHFNSLSGEIPREISNLTELSDLYLNVNNLSGSIPPEIGNMASLQVLQLC  149

Query  1838  YNRFEGCIPNKLGSLKNLTVLALQSNQLTGAIPASlggltlltrldLSFNRLFGSIPVKL  1659
             YN+  G +P +LGSLK L+VLALQ N L+GAIPASLG L +L RLDLSFNRLFGSIPVKL
Sbjct  150   YNQLTGSVPTQLGSLKKLSVLALQFNHLSGAIPASLGDLEMLMRLDLSFNRLFGSIPVKL  209

Query  1658  SEASKLEVLDLRNNTLSGNVPLGLKRLNEGFRYENNPGLCGTGFPSLALCSDSS-LNPTK  1482
             ++   LEVLD+RNN+LSGNVP  LKRLNEGF+Y NN  LCG GF +L++CS S  LNP +
Sbjct  210   ADIPALEVLDVRNNSLSGNVPPALKRLNEGFQYGNNSDLCGVGFSTLSVCSASDRLNPNR  269

Query  1481  PEPFGQGSNRLPTKDIPESANIPHQLN-----QNRKPQAAAAVVGVIGLFVILAVAGLFT  1317
             PEPFG   N L T+ IPESAN+P   N      + +    A V GVI + + L   GLFT
Sbjct  270   PEPFGPSKNGLATRAIPESANLPQHCNGTHCSSSSRTSQIAVVGGVIVVVISLTATGLFT  329

Query  1316  FSWYRRRKQQIGSTVDISESRVSTDQPKVLCRRSTSPLISLEYSNGWDPLAKDQSGSALS  1137
             F WYRRRKQ+IGS  D S+ R+S DQ K + R+S SPLISLEYSNGWDPLA  +SGS  S
Sbjct  330   FMWYRRRKQKIGSAFDNSDCRLSIDQTKEVYRKSASPLISLEYSNGWDPLADGRSGSGFS  389

Query  1136  QEVLESFMFNLDEVESATQYFSETNLLGKSSFSAVYKGTLRDGSAVAVKCISKTSCKSDE  957
             +EVL++F FNL+E+E ATQYFSE NLLGKS+FSA+YKG LR+GS VA+K I+KTSCKS+E
Sbjct  390   KEVLQTFRFNLEEIEYATQYFSEINLLGKSNFSAIYKGILRNGSVVAIKSINKTSCKSEE  449

Query  956   AEFRKGLTLLTSLKHENLLRLRGFCCSKGRGECFLIYDFVSNGNLLRYLDVKDEKGKVLD  777
             AEF KGL +L SL+HENL+RLRGFCCS+GRGECFL+YDFV NGNL RYLDVKD  G+VL+
Sbjct  450   AEFLKGLNILASLRHENLVRLRGFCCSRGRGECFLVYDFVQNGNLSRYLDVKDANGQVLE  509

Query  776   WSTRTAIIKGIARGIKYLHGNKRNKPALVHRNISADKVLIDHLYKPLLSDSGLHKLLADD  597
             W TR +II GIA+GI+YLH NK NKPALVH+NISA+KVLID  + PL+++SGLHKLLADD
Sbjct  510   WPTRVSIINGIAKGIEYLHSNKVNKPALVHQNISAEKVLIDQRFNPLIANSGLHKLLADD  569

Query  596   IVFSTLKGSAANGYLAPEYAITGRFTEKSDMYAFGVIILQILSGSCVVTQSNHQGAELCR  417
             IVFS LK SAA GYLAPEY  TGRFTEKSD+YAFG++ILQILSG   ++ S   GAE C+
Sbjct  570   IVFSALKASAAMGYLAPEYTTTGRFTEKSDIYAFGMLILQILSGKRRISHSMRLGAESCK  629

Query  416   FEDFVDAKLGKDFVESEAAKLGKIALLCTHDSPSRRPAIDVVIQ  285
             FEDF+DA L   F E EAA+L +IALLCTH+S ++RP +D V+Q
Sbjct  630   FEDFMDANLEGKFSEPEAARLARIALLCTHESSNQRPNMDTVVQ  673



>ref|XP_004170265.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At1g35710-like [Cucumis sativus]
 gb|KGN50379.1| hypothetical protein Csa_5G171130 [Cucumis sativus]
Length=679

 Score =   832 bits (2148),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 420/643 (65%), Positives = 508/643 (79%), Gaps = 8/643 (1%)
 Frame = -3

Query  2198  LMAIKASLDPGNLVLSSWSPNVTDPCSVSSFEGIACNDLGQVVNISLQGKGLYGKIPPEI  2019
             LM +KA+LDP N  L+SW+ N  DPCS  SFEGI CN+ GQV N+SLQGKGL GK+ P I
Sbjct  31    LMDLKAALDPDNQYLASWTAN-GDPCS--SFEGIGCNEKGQVTNMSLQGKGLSGKLSPAI  87

Query  2018  GQLNGLSGLYLHFNNLHGVIPKEIASLTQLSDLYLNMNDLSGFIPSEIGNMPNLQVLQLC  1839
               L  L+GLYLH+N+L G IPKEIA+LT LSDLYLN+N+ SG IPSEIGNM +LQVLQLC
Sbjct  88    AGLKHLTGLYLHYNSLFGDIPKEIANLTLLSDLYLNVNNFSGEIPSEIGNMESLQVLQLC  147

Query  1838  YNRFEGCIPNKLGSLKNLTVLALQSNQLTGAIPASlggltlltrldLSFNRLFGSIPVKL  1659
             YN+  G IP +L SLK LTV+ALQ+NQLTGAIPASLG L LL R+DLS N LFGS+P +L
Sbjct  148   YNQLSGSIPTQLSSLKKLTVIALQTNQLTGAIPASLGRLDLLVRVDLSSNHLFGSVPSRL  207

Query  1658  SEASKLEVLDLRNNTLSGNVPLGLKRLNEGFRYENNPGLCGTGFPSLALCSDSS-LNPTK  1482
             ++A  LEVLD+RNNTLSGNVP  LKRLNEGF YENN GLCG GFPSL  C+ SS +N  +
Sbjct  208   ADAPSLEVLDVRNNTLSGNVPPALKRLNEGFLYENNLGLCGVGFPSLKDCAGSSHVNQNQ  267

Query  1481  PEPFGQGSNRLPTKDIPESANIPHQLNQNRKPQAA----AAVVGVIGLFVILAVAGLFTF  1314
             PEPF   +  +PT+DIPE+AN+    N  R P ++    A++VGV+ + + L+  G+ TF
Sbjct  268   PEPFAGSAGSMPTRDIPETANVQLPCNHTRCPSSSKSRNASIVGVVVVTIALSAIGILTF  327

Query  1313  SWYRRRKQQIGSTVDISESRVSTDQPKVLCRRSTSPLISLEYSNGWDPLAKDQSGSALSQ  1134
             + YRRRKQ++GS+ DI + R+STDQ K   R++ SPL+SLEY+NGWDPLA  Q  S  +Q
Sbjct  328   TQYRRRKQKLGSSFDICDHRLSTDQAKATYRKNGSPLVSLEYANGWDPLADGQGLSIFAQ  387

Query  1133  EVLESFMFNLDEVESATQYFSETNLLGKSSFSAVYKGTLRDGSAVAVKCISKTSCKSDEA  954
             EV +SF FNL+EVE+ATQYFSE NLLGKS+FSA YKG LRDGS VAVK I KTSCKS+EA
Sbjct  388   EVFQSFRFNLEEVETATQYFSEVNLLGKSNFSATYKGILRDGSVVAVKSICKTSCKSEEA  447

Query  953   EFRKGLTLLTSLKHENLLRLRGFCCSKGRGECFLIYDFVSNGNLLRYLDVKDEKGKVLDW  774
             EF KGL LLTSL+HENL+RLRGFCCS+GRGECFLIYDFV NGNLLRYLDVKD  G+VL+W
Sbjct  448   EFLKGLNLLTSLRHENLVRLRGFCCSRGRGECFLIYDFVPNGNLLRYLDVKDGDGQVLEW  507

Query  773   STRTAIIKGIARGIKYLHGNKRNKPALVHRNISADKVLIDHLYKPLLSDSGLHKLLADDI  594
             STR +II+GIA+G+ YLH N+ NKPALVH+NISA+KVLID  + PLLSDSGL KLL +DI
Sbjct  508   STRVSIIRGIAKGVAYLHKNEANKPALVHQNISAEKVLIDQRFNPLLSDSGLQKLLTNDI  567

Query  593   VFSTLKGSAANGYLAPEYAITGRFTEKSDMYAFGVIILQILSGSCVVTQSNHQGAELCRF  414
             VFS LK SAA GYLAPEY  TGRFTE+SD+YAFGV++ QILSG+  +T S    AE CR+
Sbjct  568   VFSELKASAARGYLAPEYTTTGRFTERSDVYAFGVLVFQILSGTRKITSSLRGAAEACRY  627

Query  413   EDFVDAKLGKDFVESEAAKLGKIALLCTHDSPSRRPAIDVVIQ  285
              + +D+KL   F E EAAKL +IALLCTH+S S RP+++ ++Q
Sbjct  628   TELLDSKLHGRFFEYEAAKLCRIALLCTHESQSERPSMEAIVQ  670



>ref|XP_011017487.1| PREDICTED: probable leucine-rich repeat receptor-like serine/threonine-protein 
kinase At3g14840 [Populus euphratica]
Length=671

 Score =   830 bits (2143),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 429/648 (66%), Positives = 505/648 (78%), Gaps = 12/648 (2%)
 Frame = -3

Query  2213  STVSLLMAIKASLDPGNLVLSSWSPNVTDPCSVSSFEGIACNDLGQVVNISLQGKGLYGK  2034
             + + LLM IKASLDP N +L+SW PN  DPCS  +FEG+ACN+ G V NISLQGKGL G+
Sbjct  22    TELELLMQIKASLDPQNRLLTSWEPN-KDPCS-GAFEGVACNEQGHVANISLQGKGLSGQ  79

Query  2033  IPPEIGQLNGLSGLYLHFNNLHGVIPKEIASLTQLSDLYLNMNDLSGFIPSEIGNMPNLQ  1854
             IP  +G L  LSGL+LHFN L+GVIPKEIA L++LSDLYLN+N+LSG IP +IGNM NLQ
Sbjct  80    IPAALGGLKSLSGLFLHFNALNGVIPKEIAELSELSDLYLNVNNLSGEIPPQIGNMSNLQ  139

Query  1853  VLQLCYNRFEGCIPNKLGSLKNLTVLALQSNQLTGAIPASlggltlltrldLSFNRLFGS  1674
             VLQLCYN+  G IP +LGSL+ ++VLALQ NQLTGAIPASLG L  L+ L LSFN LFG 
Sbjct  140   VLQLCYNKLAGSIPTQLGSLEKISVLALQYNQLTGAIPASLGDLEFLSTLVLSFNGLFGP  199

Query  1673  IPVKLSEASKLEVLDLRNNTLSGNVPLGLKRLNEGFRYENNPGLCGTGFPSLALCSDSSL  1494
             IPVKL+ A  L+ LD+RNN+LSGNVP  LKRL  GF+Y NNP LCG GF +L  C  S  
Sbjct  200   IPVKLARAPLLKTLDIRNNSLSGNVPPALKRLTTGFQYGNNPDLCGVGFSNLETCVTS--  257

Query  1493  NPTKPEPFGQGSNRLPTKDIPESANIPHQLNQN-----RKPQAAAAVVGVIGLFVILAVA  1329
             +P KPEP  + +  LP KDIPESAN P   +++      K      + GVIG+F+ ++ +
Sbjct  258   DPNKPEP-SKPNVALP-KDIPESAN-PSNCSKSDCSHLTKTPRNGIIFGVIGVFIAMSGS  314

Query  1328  GLFTFSWYRRRKQQIGSTVDISESRVSTDQPKVLCRRSTSPLISLEYSNGWDPLAKDQSG  1149
             G   FSWYRR KQ+IGS  D  +SR+STDQ K + R+S SPLISLEYS GWDPLA D+S 
Sbjct  315   GFLMFSWYRRHKQKIGSASDTLDSRLSTDQAKEVYRKSASPLISLEYSTGWDPLAIDRSR  374

Query  1148  SALSQEVLESFMFNLDEVESATQYFSETNLLGKSSFSAVYKGTLRDGSAVAVKCISKTSC  969
             S  SQEVLESFMFNL+EVE ATQ FSE NLLGK++FSA YKG LRD S VA+KCI+KTSC
Sbjct  375   SGFSQEVLESFMFNLEEVERATQCFSEVNLLGKNNFSATYKGILRDRSVVAIKCITKTSC  434

Query  968   KSDEAEFRKGLTLLTSLKHENLLRLRGFCCSKGRGECFLIYDFVSNGNLLRYLDVKDEKG  789
             KSDEA+F KGL +LTSLKHENL+RLRGFCCSKGRGECFLIYDFV NGNL++YLDVKD  G
Sbjct  435   KSDEADFLKGLKILTSLKHENLVRLRGFCCSKGRGECFLIYDFVPNGNLVQYLDVKDGSG  494

Query  788   KVLDWSTRTAIIKGIARGIKYLHGNKRNKPALVHRNISADKVLIDHLYKPLLSDSGLHKL  609
             KVL+WS R +II GIA+GI YLHG+K NK ALVH+NISA+KV I+ LY PL+SDSGLHKL
Sbjct  495   KVLEWSARISIINGIAKGIAYLHGSKGNKHALVHQNISAEKVFINRLYNPLISDSGLHKL  554

Query  608   LADDIVFSTLKGSAANGYLAPEYAITGRFTEKSDMYAFGVIILQILSGSCVVTQSNHQGA  429
             LADDIVFS LK SAA GYLAPEY  TGRFTEKSD+YAFG+I+LQILSG   +TQ     A
Sbjct  555   LADDIVFSMLKASAAMGYLAPEYTTTGRFTEKSDVYAFGMIVLQILSGKRNITQLTLHAA  614

Query  428   ELCRFEDFVDAKLGKDFVESEAAKLGKIALLCTHDSPSRRPAIDVVIQ  285
             E CR+EDF+DA LG +F ESEA KLG+IAL CT++SP  RP  + V+Q
Sbjct  615   ESCRYEDFIDANLGGNFSESEADKLGRIALRCTNESPVHRPTAETVMQ  662



>ref|XP_009338105.1| PREDICTED: somatic embryogenesis receptor kinase 4-like [Pyrus 
x bretschneideri]
Length=653

 Score =   828 bits (2138),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 427/649 (66%), Positives = 505/649 (78%), Gaps = 16/649 (2%)
 Frame = -3

Query  2195  MAIKASLDPGNLVLSSWSPNVTDPCSVSSFEGIACNDLGQVVNISLQGKGLYGKIPPEIG  2016
             MA+KASLDP N  L+SW+P+  DPC   +FEG+ACN+ G+V NISLQGKGL+G+IPP +G
Sbjct  1     MAMKASLDPRNQFLTSWTPHA-DPCG-GAFEGVACNEQGRVTNISLQGKGLWGQIPPAVG  58

Query  2015  QLNGLSGLYLHFNNLHGVIPKEIASLTQLSDLYLNMNDLSGFIPSEIGNMPNLQVLQLCY  1836
              L  L+GLYLHFN L G IPK+IA L QL+DLYLN+N+LSG IP EIG MPNLQVLQLCY
Sbjct  59    GLRNLTGLYLHFNALTGKIPKQIADLNQLADLYLNVNNLSGAIPREIGKMPNLQVLQLCY  118

Query  1835  NRFEGCIPNKLGSLKNLTVLALQSNQLTGAIPASlggltlltrldLSFNRLFGSIPVKLS  1656
             N+  G IP +LG LK L+VLA+QSNQLTGAIPASLG L  LTRLDLSFN  FG IP KL+
Sbjct  119   NKLTGGIPTELGQLKRLSVLAVQSNQLTGAIPASLGELGTLTRLDLSFNSFFGPIPAKLA  178

Query  1655  EASKLEVLDLRNNTLSGNVPLGLKRLNEGFRYENNPGLCGTGFPSLALCSDSSLNPTKPE  1476
             +AS LEVLD+R+NTLSGN+P  LKRLNEGF+YENNP LCG GF  L  C+ ++ NP  P+
Sbjct  179   DASMLEVLDVRSNTLSGNIPPALKRLNEGFQYENNPNLCGVGFSGLEPCTATARNPNMPQ  238

Query  1475  PF------GQGSNRLPT-KDIPESANIPHQLNQNRKPQAAAA-----VVGVIGLFVILAV  1332
             PF      G+G     T K+IPE+ANI    +Q    +A+ +     V GVIG+ V L V
Sbjct  239   PFEPSNFSGKGLPDSSTPKEIPETANIHSNCSQTHCSEASNSPEIGLVFGVIGVVVALTV  298

Query  1331  AGLFTFSWYRRRKQQIGSTVDISESRVSTDQPKVLCRRSTSPLISLEYSNGWDPLAKDQS  1152
             +GLF F WYRR+KQ+IGST D S+SR+STDQ K L ++S SPLI+LEYSNGWDPLA+  S
Sbjct  299   SGLFLFCWYRRQKQKIGSTFDSSDSRLSTDQAKELHKKSVSPLINLEYSNGWDPLARGSS  358

Query  1151  GSALSQEVLESFMFNLDEVESATQYFSETNLLGKSSFSAVYKGTLRDGSAVAVKCISKTS  972
             G   SQEVLESFM NL+EVE ATQ FSE NLL K +FSA+YKG LRDGS V + CISKTS
Sbjct  359   G--YSQEVLESFMINLEEVERATQSFSEVNLLRKGNFSAIYKGILRDGSVVTMNCISKTS  416

Query  971   CKSDEAEFRKGLTLLTSLKHENLLRLRGFCCSKGRGECFLIYDFVSNGNLLRYLDVKDEK  792
             CK DEAEF KGL +LTSLKHENL+RLRGFCCSKGRGE FLIYDF+ N +LL+YLD+KD  
Sbjct  417   CKPDEAEFLKGLKILTSLKHENLVRLRGFCCSKGRGEWFLIYDFIPNESLLQYLDIKDGS  476

Query  791   GKVLDWSTRTAIIKGIARGIKYLHGNKRNKPALVHRNISADKVLIDHLYKPLLSDSGLHK  612
              + L+WSTR +IIKGIA+GI YLHGN  NKPA+VH+ ISA+KVLID  Y PLLS+SGLHK
Sbjct  477   AEALEWSTRVSIIKGIAKGIGYLHGNAGNKPAIVHQTISAEKVLIDSHYNPLLSESGLHK  536

Query  611   LLADDIVFSTLKGSAANGYLAPEYAITGRFTEKSDMYAFGVIILQILSGSCVVTQSNHQG  432
             LLADDIVFS LK SAA GYLAPEY  TGRFT KSD+YAFG+I+ Q+L G   +TQ   QG
Sbjct  537   LLADDIVFSMLKASAAMGYLAPEYTTTGRFTSKSDIYAFGMIVFQLLCGKRKITQVTRQG  596

Query  431   AELCRFEDFVDAKLGKDFVESEAAKLGKIALLCTHDSPSRRPAIDVVIQ  285
             AE  RFEDF+DA L   F ESEA+KLG++ALLCTH+SP  RP I+ V++
Sbjct  597   AEAGRFEDFIDANLEGKFSESEASKLGRLALLCTHESPIYRPPIENVVK  645



>ref|XP_006445273.1| hypothetical protein CICLE_v10019056mg [Citrus clementina]
 gb|ESR58513.1| hypothetical protein CICLE_v10019056mg [Citrus clementina]
Length=714

 Score =   830 bits (2144),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 440/696 (63%), Positives = 513/696 (74%), Gaps = 55/696 (8%)
 Frame = -3

Query  2228  TSNNASTVSLLMAIKASLDPGNLVLSSWSPNVTDPCSVSSFEGIACNDLGQVVNISLQGK  2049
             T ++ S V +LM IK SLDP N +L+SW+PN  DPCS  SF+G+AC++ G+V NISLQGK
Sbjct  17    TLSSTSEVDILMHIKDSLDPENRLLTSWAPNA-DPCSSDSFDGVACDENGRVANISLQGK  75

Query  2048  GLYGKIPPEIGQLNGLSGLYLHFNNLHGVIPKEIASLTQLSDLYLNMNDLSGFIPSEIGN  1869
             GL G+IP  +G L  L+GLYLHFN L+GVIPKEIASL++LSDLYLN+N+LSG IPS+IGN
Sbjct  76    GLSGEIPAAVGGLKSLTGLYLHFNALNGVIPKEIASLSELSDLYLNVNNLSGKIPSQIGN  135

Query  1868  MPNLQVLQLCYNRFEGCIPNKLGSLKNLTVLALQSNQLTGAIPASlggltlltrldLSFN  1689
             M NLQVLQLCYN+  G IP +LGSL+ L+VLALQ NQLTGAIPASLG L +L RLDLSFN
Sbjct  136   MTNLQVLQLCYNKLTGNIPTQLGSLRKLSVLALQYNQLTGAIPASLGDLGMLMRLDLSFN  195

Query  1688  RLFGSIPVKLSEASKLEVLDLRNNTLSGNVPLG---------------------------  1590
              LFG +PVKL+   KLEVLD+RNN+ SGNVP G                           
Sbjct  196   NLFGPVPVKLANVPKLEVLDIRNNSFSGNVPPGIMVFPNISCSVMGFSISFVKRKLGCIK  255

Query  1589  --------------LKRLNEGFRYENNPGLCGTGFPSLALCSDSSL-NPTKPEPFGQGSN  1455
                           LKRLN GF+Y+NN  LCGTGF +L  C+ S    P KPEPF    N
Sbjct  256   FNLDFLPLVHGYEALKRLNGGFQYDNNAALCGTGFTNLKNCTASDHPTPGKPEPFE--PN  313

Query  1454  RLPTKDIPESANIPHQLNQ------NRKPQAAAAVVGVIGLFVILAVAGLFTFSWYRRRK  1293
              L TKDIPESA +P    Q       R+P      VGVI +F+IL V GLFTF+WYRRRK
Sbjct  314   GLSTKDIPESAKLPANCGQPGCSSPARRPHTGV-FVGVIAVFIILTVTGLFTFTWYRRRK  372

Query  1292  QQIGSTVDISESRVSTDQPKVLCRRSTSPLISLEYSNGWDPLAKDQSGSALSQEVLESFM  1113
             Q+IG+  D S+SR+STDQ K +CRR++SPLISLEYSNGWDPLAK QSG+  SQEVLESFM
Sbjct  373   QKIGNAFDNSDSRLSTDQVKEVCRRNSSPLISLEYSNGWDPLAKGQSGNGFSQEVLESFM  432

Query  1112  FNLDEVESATQYFSETNLLGKSSFSAVYKGTLRDGSAVAVKCISKTSCKSDEAEFRKGLT  933
             FNL+EVE ATQ FSE NLLGKSSFSA YKG LRDGS VAVKCI+KTSCKSDE EF KGL 
Sbjct  433   FNLEEVERATQCFSEANLLGKSSFSATYKGILRDGSVVAVKCIAKTSCKSDEGEFLKGLK  492

Query  932   LLTSLKHENLLRLRGFCCSKGRGECFLIYDFVSNGNLLRYLDVKDEKGKVLDWSTRTAII  753
             +LTSLKHENL  LRG CCSKGRGECFLIYDFV NGNLL++LD++    KVL+W+TR ++I
Sbjct  493   ILTSLKHENLASLRGICCSKGRGECFLIYDFVPNGNLLQHLDLEAGSEKVLEWATRISVI  552

Query  752   KGIARGIKYLHGNKRNKPALVHRNISADKVLIDHLYKPLLSDSGLHKLLADDIVFSTLKG  573
             KGIA+GI YLHG    +P LVH N+SA+KVLI   Y PLLSDSGLHKLLADDIVFS LK 
Sbjct  553   KGIAKGISYLHG---KRPGLVHPNLSAEKVLIHRRYNPLLSDSGLHKLLADDIVFSMLKA  609

Query  572   SAANGYLAPEYAITGRFTEKSDMYAFGVIILQILSGSCVVTQSNHQGAELCRFEDFVDAK  393
             SAA GYLAPEY  TGRFTEKSD+YAFG+I+ QILSG C +T    Q AE  + EDF+D  
Sbjct  610   SAAMGYLAPEYTTTGRFTEKSDIYAFGMIVFQILSGKCSITPFTRQAAESSKVEDFIDPN  669

Query  392   LGKDFVESEAAKLGKIALLCTHDSPSRRPAIDVVIQ  285
             L   F  SEA+ LG+IAL CTH+SPS RP+I+ V+Q
Sbjct  670   LEGKFSVSEASNLGQIALHCTHESPSHRPSIENVMQ  705



>ref|XP_009346807.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g34110 [Pyrus x bretschneideri]
Length=653

 Score =   826 bits (2134),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 426/649 (66%), Positives = 504/649 (78%), Gaps = 16/649 (2%)
 Frame = -3

Query  2195  MAIKASLDPGNLVLSSWSPNVTDPCSVSSFEGIACNDLGQVVNISLQGKGLYGKIPPEIG  2016
             MA+KASLDP N  L+SW+P+  DPC   +FEG+ACN+ G+V NISLQGKGL G+IPP +G
Sbjct  1     MAMKASLDPQNQFLTSWTPHA-DPCG-GAFEGVACNEQGRVTNISLQGKGLCGQIPPAVG  58

Query  2015  QLNGLSGLYLHFNNLHGVIPKEIASLTQLSDLYLNMNDLSGFIPSEIGNMPNLQVLQLCY  1836
              L  L+GLYLHFN L G IPK+IA L QL+DLYLN+N+LSG IP EIG MPNLQVLQLCY
Sbjct  59    GLKNLTGLYLHFNALTGKIPKQIADLNQLADLYLNVNNLSGAIPREIGKMPNLQVLQLCY  118

Query  1835  NRFEGCIPNKLGSLKNLTVLALQSNQLTGAIPASlggltlltrldLSFNRLFGSIPVKLS  1656
             N+  G IP +LG LK L+VLA+QSNQLTGAIPASLG L  LTRLDLSFN  FG IP KL+
Sbjct  119   NKLTGGIPTELGQLKRLSVLAVQSNQLTGAIPASLGELGTLTRLDLSFNSFFGPIPAKLA  178

Query  1655  EASKLEVLDLRNNTLSGNVPLGLKRLNEGFRYENNPGLCGTGFPSLALCSDSSLNPTKPE  1476
             +AS LEVLD+R+NTLSGN+P  LKRLNEGF+YENNP LCG GF  L  C+ ++ NP  P+
Sbjct  179   DASMLEVLDVRSNTLSGNIPPALKRLNEGFQYENNPNLCGVGFSGLEPCTATARNPNMPQ  238

Query  1475  PF------GQGSNRLPT-KDIPESANIPHQLNQNRKPQAAAA-----VVGVIGLFVILAV  1332
             PF      G+G     T K+IPE+ANI    +Q    +A+ +     V GVIG+ V L V
Sbjct  239   PFEPSNFSGKGLPDSSTPKEIPETANIHSNCSQTHCSEASNSPEIGLVFGVIGVVVALTV  298

Query  1331  AGLFTFSWYRRRKQQIGSTVDISESRVSTDQPKVLCRRSTSPLISLEYSNGWDPLAKDQS  1152
             +GLF F WYRR+KQ+IGST D S+SR+STDQ K + ++S SPLI+LEYSNGWDPLA+  S
Sbjct  299   SGLFLFCWYRRQKQKIGSTFDSSDSRLSTDQAKEVHKKSVSPLINLEYSNGWDPLARGSS  358

Query  1151  GSALSQEVLESFMFNLDEVESATQYFSETNLLGKSSFSAVYKGTLRDGSAVAVKCISKTS  972
             G   SQEVLESFM NL+EVE ATQ FSE NLL K +FSA+YKG LRDGS V + CISKTS
Sbjct  359   G--YSQEVLESFMINLEEVERATQSFSEVNLLRKGNFSAIYKGILRDGSVVTMNCISKTS  416

Query  971   CKSDEAEFRKGLTLLTSLKHENLLRLRGFCCSKGRGECFLIYDFVSNGNLLRYLDVKDEK  792
             CK DEAEF KGL +LTSLKHENL+RLRGFCCSKGRGE FLIYDF+ N +LL+YLD+KD  
Sbjct  417   CKPDEAEFLKGLKILTSLKHENLVRLRGFCCSKGRGEWFLIYDFIPNESLLQYLDIKDGS  476

Query  791   GKVLDWSTRTAIIKGIARGIKYLHGNKRNKPALVHRNISADKVLIDHLYKPLLSDSGLHK  612
              + L+WSTR +IIKGIA+GI YLHGN  NKPA+VH+ ISA+KVLID  Y PLLS+SGLHK
Sbjct  477   AEALEWSTRVSIIKGIAKGIGYLHGNAGNKPAIVHQTISAEKVLIDSHYNPLLSESGLHK  536

Query  611   LLADDIVFSTLKGSAANGYLAPEYAITGRFTEKSDMYAFGVIILQILSGSCVVTQSNHQG  432
             LLADDIVFS LK SAA GYLAPEY  TGRFT KSD+YAFG+I+ Q+L G   +TQ   QG
Sbjct  537   LLADDIVFSMLKASAAMGYLAPEYTTTGRFTSKSDIYAFGMIVFQLLCGKRKITQVTRQG  596

Query  431   AELCRFEDFVDAKLGKDFVESEAAKLGKIALLCTHDSPSRRPAIDVVIQ  285
             AE  RFEDF+DA L   F ESEA+KLG++ALLCTH+SP  RP I+ V++
Sbjct  597   AEAGRFEDFIDANLEGKFSESEASKLGRLALLCTHESPIYRPPIENVVK  645



>ref|XP_008467276.1| PREDICTED: BRASSINOSTEROID INSENSITIVE 1-associated receptor 
kinase 1 [Cucumis melo]
Length=679

 Score =   826 bits (2134),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 419/643 (65%), Positives = 505/643 (79%), Gaps = 8/643 (1%)
 Frame = -3

Query  2198  LMAIKASLDPGNLVLSSWSPNVTDPCSVSSFEGIACNDLGQVVNISLQGKGLYGKIPPEI  2019
             LM +KA+LDP N  L+SWS N   PCS  SFEGI CN+ GQV N+SLQGKGL GK+ P I
Sbjct  31    LMDLKAALDPDNQYLASWSAN-GYPCS--SFEGIGCNEKGQVTNMSLQGKGLSGKLSPAI  87

Query  2018  GQLNGLSGLYLHFNNLHGVIPKEIASLTQLSDLYLNMNDLSGFIPSEIGNMPNLQVLQLC  1839
               L  L+GLYLH+N+L G IPKEIA+LT LSDLYLN+N+ SG IPSEIGNM +LQVLQLC
Sbjct  88    AGLKHLTGLYLHYNSLFGDIPKEIANLTLLSDLYLNVNNFSGEIPSEIGNMESLQVLQLC  147

Query  1838  YNRFEGCIPNKLGSLKNLTVLALQSNQLTGAIPASlggltlltrldLSFNRLFGSIPVKL  1659
             YN+  G IP +L SLK LTV+ALQSNQLTGAIPASLG L LL R+DLS N LFGS+P +L
Sbjct  148   YNQLSGSIPTQLSSLKKLTVIALQSNQLTGAIPASLGRLDLLVRVDLSSNHLFGSVPSRL  207

Query  1658  SEASKLEVLDLRNNTLSGNVPLGLKRLNEGFRYENNPGLCGTGFPSLALCSDSS-LNPTK  1482
             ++A  LEVLD+RNNTLSGNVP  LKRL EGF YENN GLCG GFPSL  C+ SS +N  +
Sbjct  208   ADAPSLEVLDVRNNTLSGNVPPALKRLKEGFLYENNLGLCGVGFPSLKDCAGSSHVNQNQ  267

Query  1481  PEPFGQGSNRLPTKDIPESANIPHQLNQNRKPQAA----AAVVGVIGLFVILAVAGLFTF  1314
             PEPF   +  +PT+DIPE+AN+    N  R P ++    A++VGV+ + + L+  G+ TF
Sbjct  268   PEPFAGSAGSMPTRDIPETANVQLPCNHTRCPSSSKSRNASIVGVVVVTIALSAIGILTF  327

Query  1313  SWYRRRKQQIGSTVDISESRVSTDQPKVLCRRSTSPLISLEYSNGWDPLAKDQSGSALSQ  1134
             + YRRRKQ++GS+ DI + R+STDQ K   R++ SPL+SLEY+NGWDPLA  Q  S  +Q
Sbjct  328   TQYRRRKQKLGSSFDICDHRLSTDQAKATYRKNGSPLVSLEYANGWDPLADGQGLSIFAQ  387

Query  1133  EVLESFMFNLDEVESATQYFSETNLLGKSSFSAVYKGTLRDGSAVAVKCISKTSCKSDEA  954
             EV +SF FNL+EVE+ATQYFSE NLLGKS+FSA YKG LRDGS VAVK I KTSCKS+EA
Sbjct  388   EVFQSFRFNLEEVETATQYFSEVNLLGKSNFSATYKGILRDGSVVAVKSICKTSCKSEEA  447

Query  953   EFRKGLTLLTSLKHENLLRLRGFCCSKGRGECFLIYDFVSNGNLLRYLDVKDEKGKVLDW  774
             EF KGL LLTSL+HENL+RLRGFCCS+GRGECFLIYDFV NGNLLRYLDVKD  G+VL+W
Sbjct  448   EFLKGLNLLTSLRHENLVRLRGFCCSRGRGECFLIYDFVPNGNLLRYLDVKDGDGQVLEW  507

Query  773   STRTAIIKGIARGIKYLHGNKRNKPALVHRNISADKVLIDHLYKPLLSDSGLHKLLADDI  594
             STR +II+GIA+G+ YLH N+ NKPALVH+NISA+KVLID  + PLLSDSGL KLL +DI
Sbjct  508   STRVSIIRGIAKGVAYLHKNEANKPALVHQNISAEKVLIDQRFNPLLSDSGLQKLLTNDI  567

Query  593   VFSTLKGSAANGYLAPEYAITGRFTEKSDMYAFGVIILQILSGSCVVTQSNHQGAELCRF  414
             VFS LK SAA GYLAPEY  TGRFTE SD+YAFGV++ QILSG+  +T S    AE CR+
Sbjct  568   VFSELKASAARGYLAPEYTTTGRFTETSDVYAFGVLVFQILSGTRKITSSLRGAAEACRY  627

Query  413   EDFVDAKLGKDFVESEAAKLGKIALLCTHDSPSRRPAIDVVIQ  285
              + +D+KL   + E EAAKL +IALLCTH+S S RP+++ ++Q
Sbjct  628   TELIDSKLHGRYFEYEAAKLCRIALLCTHESQSERPSMEAIVQ  670



>ref|XP_004143652.1| PREDICTED: LOW QUALITY PROTEIN: protein NSP-INTERACTING KINASE 
3-like [Cucumis sativus]
Length=684

 Score =   825 bits (2131),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 420/648 (65%), Positives = 508/648 (78%), Gaps = 13/648 (2%)
 Frame = -3

Query  2198  LMAIKASLDPGNLVLSSWSPNVTDPCSVSSFEGIACNDLGQVVNISLQGKGLYGKIPPEI  2019
             LM +KA+LDP N  L+SW+ N  DPCS  SFEGI CN+ GQV N+SLQGKGL GK+ P I
Sbjct  31    LMDLKAALDPDNQYLASWTAN-GDPCS--SFEGIGCNEKGQVTNMSLQGKGLSGKLSPAI  87

Query  2018  GQLNGLSGLYLHFNNLHGVIPKEIASLTQLSD-----LYLNMNDLSGFIPSEIGNMPNLQ  1854
               L  L+GLYLH+N+L G IPKEIA+LT LSD     LYLN+N+ SG IPSEIGNM +LQ
Sbjct  88    AGLKHLTGLYLHYNSLFGDIPKEIANLTLLSDVFECYLYLNVNNFSGEIPSEIGNMESLQ  147

Query  1853  VLQLCYNRFEGCIPNKLGSLKNLTVLALQSNQLTGAIPASlggltlltrldLSFNRLFGS  1674
             VLQLCYN+  G IP +L SLK LTV+ALQ+NQLTGAIPASLG L LL R+DLS N LFGS
Sbjct  148   VLQLCYNQLSGSIPTQLSSLKKLTVIALQTNQLTGAIPASLGRLDLLVRVDLSSNHLFGS  207

Query  1673  IPVKLSEASKLEVLDLRNNTLSGNVPLGLKRLNEGFRYENNPGLCGTGFPSLALCSDSS-  1497
             +P +L++A  LEVLD+RNNTLSGNVP  LKRLNEGF YENN GLCG GFPSL  C+ SS 
Sbjct  208   VPSRLADAPSLEVLDVRNNTLSGNVPPALKRLNEGFLYENNLGLCGVGFPSLKDCAGSSH  267

Query  1496  LNPTKPEPFGQGSNRLPTKDIPESANIPHQLNQNRKPQAA----AAVVGVIGLFVILAVA  1329
             +N  +PEPF   +  +PT+DIPE+AN+    N  R P ++    A++VGV+ + + L+  
Sbjct  268   VNQNQPEPFAGSAGSMPTRDIPETANVQLPCNHTRCPSSSKSRNASIVGVVVVTIALSAI  327

Query  1328  GLFTFSWYRRRKQQIGSTVDISESRVSTDQPKVLCRRSTSPLISLEYSNGWDPLAKDQSG  1149
             G+ TF+ YRRRKQ++GS+ DI + R+STDQ K   R++ SPL+SLEY+NGWDPLA  Q  
Sbjct  328   GILTFTQYRRRKQKLGSSFDICDHRLSTDQAKATYRKNGSPLVSLEYANGWDPLADGQGL  387

Query  1148  SALSQEVLESFMFNLDEVESATQYFSETNLLGKSSFSAVYKGTLRDGSAVAVKCISKTSC  969
             S  +QEV +SF FNL+EVE+ATQYFSE NLLGKS+FSA YKG LRDGS VAVK I KTSC
Sbjct  388   SIFAQEVFQSFRFNLEEVETATQYFSEVNLLGKSNFSATYKGILRDGSVVAVKSICKTSC  447

Query  968   KSDEAEFRKGLTLLTSLKHENLLRLRGFCCSKGRGECFLIYDFVSNGNLLRYLDVKDEKG  789
             KS+EAEF KGL LLTSL+HENL+RLRGFCCS+GRGECFLIYDFV NGNLLRYLDVKD  G
Sbjct  448   KSEEAEFLKGLNLLTSLRHENLVRLRGFCCSRGRGECFLIYDFVPNGNLLRYLDVKDGDG  507

Query  788   KVLDWSTRTAIIKGIARGIKYLHGNKRNKPALVHRNISADKVLIDHLYKPLLSDSGLHKL  609
             +VL+WSTR +II+GIA+G+ YLH N+ NKPALVH+NISA+KVLID  + PLLSDSGL KL
Sbjct  508   QVLEWSTRVSIIRGIAKGVAYLHKNEANKPALVHQNISAEKVLIDQRFNPLLSDSGLQKL  567

Query  608   LADDIVFSTLKGSAANGYLAPEYAITGRFTEKSDMYAFGVIILQILSGSCVVTQSNHQGA  429
             L +DIVFS LK SAA GYLAPEY  TGRFTE+SD+YAFGV++ QILSG+  +T S    A
Sbjct  568   LTNDIVFSELKASAARGYLAPEYTTTGRFTERSDVYAFGVLVFQILSGTRKITSSLRGAA  627

Query  428   ELCRFEDFVDAKLGKDFVESEAAKLGKIALLCTHDSPSRRPAIDVVIQ  285
             E CR+ + +D+KL   F E EAAKL +IALLCTH+S S RP+++ ++Q
Sbjct  628   EACRYTELLDSKLHGRFFEYEAAKLCRIALLCTHESQSERPSMEAIVQ  675



>ref|XP_008343327.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At4g36180 [Malus domestica]
Length=681

 Score =   823 bits (2125),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 424/650 (65%), Positives = 506/650 (78%), Gaps = 16/650 (2%)
 Frame = -3

Query  2198  LMAIKASLDPGNLVLSSWSPNVTDPCSVSSFEGIACNDLGQVVNISLQGKGLYGKIPPEI  2019
             LMA+KASLDP N  L+SW+P+  DPC   +FEG+ACN+ G+V NISLQGKGL+G+IPP +
Sbjct  28    LMAMKASLDPQNQFLTSWTPHA-DPCG-GAFEGVACNEQGRVTNISLQGKGLWGQIPPTV  85

Query  2018  GQLNGLSGLYLHFNNLHGVIPKEIASLTQLSDLYLNMNDLSGFIPSEIGNMPNLQVLQLC  1839
             G L  L+GLYLHFN L G IPK++A L QL+DLYLN+N+LSG IP EIG MPNLQVLQLC
Sbjct  86    GGLKSLTGLYLHFNALSGKIPKQLAGLNQLADLYLNVNNLSGAIPREIGKMPNLQVLQLC  145

Query  1838  YNRFEGCIPNKLGSLKNLTVLALQSNQLTGAIPASlggltlltrldLSFNRLFGSIPVKL  1659
             YN+  G IP +LG LK L+VLA+QSNQLTGAIPASLG L  LTRLDLSFN LFG IP +L
Sbjct  146   YNKLTGGIPTQLGQLKRLSVLAVQSNQLTGAIPASLGELGTLTRLDLSFNSLFGPIPARL  205

Query  1658  SEASKLEVLDLRNNTLSGNVPLGLKRLNEGFRYENNPGLCGTGFPSLALCSDS-SLNPTK  1482
             ++A  LEVLD+R N LSGNVP  LKRLNEGF YENNP LCG GF  L LC+ + + NP  
Sbjct  206   ADAPMLEVLDVRTNILSGNVPPALKRLNEGFLYENNPSLCGVGFSGLELCTATNTRNPNI  265

Query  1481  PEPF------GQGSNRLPTKDIPESANIPHQLNQNRKPQAAAA-----VVGVIGLFVILA  1335
             P+PF       +  +    K+IP+SANI    +Q R  +A+ +     + GVIG+ V L 
Sbjct  266   PQPFEPSNLSAKDPDSSTAKEIPKSANIHSNCSQTRCSEASKSPQIGIIFGVIGVIVALT  325

Query  1334  VAGLFTFSWYRRRKQQIGSTVDISESRVSTDQPKVLCRRSTSPLISLEYSNGWDPLAKDQ  1155
             V+GLF F W RR+KQ+IGST D S+SR+STDQ K + ++S SPLI+LEYSNGWDPLAK  
Sbjct  326   VSGLFLFFWCRRQKQKIGSTFDSSDSRLSTDQAKEVYKKSVSPLINLEYSNGWDPLAK--  383

Query  1154  SGSALSQEVLESFMFNLDEVESATQYFSETNLLGKSSFSAVYKGTLRDGSAVAVKCISKT  975
              GS  SQEVLESFM NL+EVE ATQ FSE NLL KS+FSA+YKG LRDGS VA+ CISKT
Sbjct  384   GGSGYSQEVLESFMINLEEVERATQSFSEVNLLRKSNFSAIYKGILRDGSVVAINCISKT  443

Query  974   SCKSDEAEFRKGLTLLTSLKHENLLRLRGFCCSKGRGECFLIYDFVSNGNLLRYLDVKDE  795
             SCK DEAEF KG+ +LTSLKHENL+RLRGFCCSKGRGE FLIYDF+ N +LL+YLD+KD 
Sbjct  444   SCKPDEAEFLKGMKILTSLKHENLVRLRGFCCSKGRGEWFLIYDFIPNDSLLQYLDIKDG  503

Query  794   KGKVLDWSTRTAIIKGIARGIKYLHGNKRNKPALVHRNISADKVLIDHLYKPLLSDSGLH  615
              G+VL+WSTR +II GIA+GI YLHGN  NKPA+VH+ +SA+KVLID  Y PLLSDSGLH
Sbjct  504   SGEVLEWSTRVSIINGIAKGIGYLHGNVGNKPAIVHQTMSAEKVLIDSHYNPLLSDSGLH  563

Query  614   KLLADDIVFSTLKGSAANGYLAPEYAITGRFTEKSDMYAFGVIILQILSGSCVVTQSNHQ  435
             KLLADDIVFS LK SAA GYLAPEY  TGR T KSD+YAFG+I+ QILSG   +TQ   Q
Sbjct  564   KLLADDIVFSMLKASAAMGYLAPEYTTTGRSTAKSDIYAFGMIVFQILSGKHKITQVARQ  623

Query  434   GAELCRFEDFVDAKLGKDFVESEAAKLGKIALLCTHDSPSRRPAIDVVIQ  285
             GAE  RFEDF+DA L  +F ESEA+KLG++ALLC H+SP  RP+++ V++
Sbjct  624   GAEAGRFEDFMDANLEGNFSESEASKLGRLALLCMHESPIYRPSMENVVK  673



>ref|XP_010098918.1| LRR receptor-like serine/threonine-protein kinase RCH1 [Morus 
notabilis]
 gb|EXB76220.1| LRR receptor-like serine/threonine-protein kinase RCH1 [Morus 
notabilis]
Length=691

 Score =   823 bits (2126),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 427/655 (65%), Positives = 512/655 (78%), Gaps = 23/655 (4%)
 Frame = -3

Query  2195  MAIKASLDPGNLVLSSWSPNVTDPCSVSSFEGIACNDLGQVVNISLQGKGLYGKIPPEIG  2016
             MA+KASLDP N  L+SW+ +  +PC    FEG+AC++ G+VVNISLQGKGL+G+IP  +G
Sbjct  34    MALKASLDPQNQFLTSWTRSA-NPCG-GDFEGVACDERGRVVNISLQGKGLWGRIPAAVG  91

Query  2015  QLNGLSGLYLHFNNLHGVIPKEIASLTQLSDLYLNMNDLSGFIPSEIGNMPNLQ-VLQLC  1839
              L  L+GLYLHFN+L+G IPKEI +L++L+DLYLN+N+LSG IP +  NMPNLQ VLQLC
Sbjct  92    GLKSLTGLYLHFNSLNGEIPKEITNLSELTDLYLNVNNLSGEIPPQFANMPNLQGVLQLC  151

Query  1838  YNRFEGCIPNKLGSLKNLTVLALQSNQLTGAIPASlggltlltrldLSFNRLFGSIPVKL  1659
             YN   G IP +L +LK L+VLALQ NQLTGAIPASLG L  LTRLDLSFN LFGS+P KL
Sbjct  152   YNTLTGSIPLQLRNLKRLSVLALQYNQLTGAIPASLGELKALTRLDLSFNSLFGSVPAKL  211

Query  1658  SEASKLEVLDLRNNTLSGNVPLGLKRLNEGFRYENNPGLCGTGFPSLALCSDSS-LNPTK  1482
             ++A  L+VLD+RNN+LSG VP  LKRLN GF+Y+NNP LCG GF  L +CS S   +P +
Sbjct  212   ADAPMLQVLDIRNNSLSGTVPQALKRLNGGFQYKNNPHLCGVGFSDLHVCSASDGWDPNR  271

Query  1481  PEP----------FGQGSNRLPTKDIPESANIPHQLNQ------NRKPQAAAAVVGVIGL  1350
             PEP          F   +     +D+PES N+    ++      ++ PQ   A+ GVIGL
Sbjct  272   PEPYQPSNLSANGFPHSAQNRTAEDLPESVNLNPDCSRTSCSKTSKSPQVGVAL-GVIGL  330

Query  1349  FVILAVAGLFTFSWYRRRKQQIGSTVDISESRVSTDQPKVLCRRSTSPLISLEYSNGWDP  1170
             FV   V+GLFTFSWYRRRKQ+IGS  D S+SR+STDQ K +  +S SPLISLEYSNGWDP
Sbjct  331   FVAFTVSGLFTFSWYRRRKQKIGSAFDSSDSRLSTDQAKEVYMKSASPLISLEYSNGWDP  390

Query  1169  LAKDQSGSALSQEVLESFMFNLDEVESATQYFSETNLLGKSSFSAVYKGTLRDGSAVAVK  990
             +AK  SG   SQEVLESFMFNL+EVE ATQ FSE NLL KS+FSA+YKG LRDGS VAVK
Sbjct  391   VAKGCSG--FSQEVLESFMFNLEEVERATQCFSEVNLLEKSNFSAIYKGILRDGSVVAVK  448

Query  989   CISKTSCKSDEAEFRKGLTLLTSLKHENLLRLRGFCCSKGRGECFLIYDFVSNGNLLRYL  810
             CI+KTSCKSDEAEF KGL +LTSLKHENL+RLRGFCCSKGRGECFLIYDF+ NG+LL+YL
Sbjct  449   CIAKTSCKSDEAEFLKGLKILTSLKHENLVRLRGFCCSKGRGECFLIYDFIPNGSLLQYL  508

Query  809   DVKDEKGKVLDWSTRTAIIKGIARGIKYLHGNKRNKPALVHRNISADKVLIDHLYKPLLS  630
             DV++  G  L+WSTR +II GIA+GI YLHGNK NKPA+VH+NISA+K LID  YKP++S
Sbjct  509   DVEEGSGTALEWSTRVSIINGIAKGIAYLHGNKGNKPAMVHQNISAEKALIDTNYKPMIS  568

Query  629   DSGLHKLLADDIVFSTLKGSAANGYLAPEYAITGRFTEKSDMYAFGVIILQILSGSCVVT  450
             +SGLHKLLADDI+FS LK SAA GYLAPEY  TGRFT KSD+YAFG+IILQILSG   +T
Sbjct  569   NSGLHKLLADDIIFSLLKASAAMGYLAPEYTTTGRFTGKSDVYAFGMIILQILSGKRKIT  628

Query  449   QSNHQGAELCRFEDFVDAKLGKDFVESEAAKLGKIALLCTHDSPSRRPAIDVVIQ  285
             Q   QGAE CRFEDF+D  L   F ESEAAKLGK+ALLCT++SP+ RP+++ V+Q
Sbjct  629   QFVRQGAEFCRFEDFIDQNLEGKFSESEAAKLGKLALLCTNESPNHRPSMENVMQ  683



>ref|XP_010053898.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
GSO1 [Eucalyptus grandis]
 gb|KCW78275.1| hypothetical protein EUGRSUZ_D02458 [Eucalyptus grandis]
Length=673

 Score =   819 bits (2116),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 424/650 (65%), Positives = 499/650 (77%), Gaps = 11/650 (2%)
 Frame = -3

Query  2216  ASTVSLLMAIKASLDPGNLVLSSWSPNVTDPCSVSSFEGIACNDLGQVVNISLQGKGLYG  2037
             A  ++ LMA+K+SLDP   VL+SW+    DPC   SFEG+AC+ +G+V N+SLQGKGL G
Sbjct  23    APELAALMAMKSSLDPEGRVLTSWALGA-DPCDGGSFEGVACDGMGRVTNVSLQGKGLTG  81

Query  2036  KIPPEIGQLNGLSGLYLHFNNLHGVIPKEIASLTQLSDLYLNMNDLSGFIPSEIGNMPNL  1857
             ++P  +G L  L+GLYLHFN L G IPKEI  L+ LSDLYLN+N+LSG IP EIGN+ NL
Sbjct  82    RLPAAVGGLRSLTGLYLHFNGLSGEIPKEIGELSSLSDLYLNVNNLSGEIPPEIGNLSNL  141

Query  1856  QVLQLCYNRFEGCIPNKLGSLKNLTVLALQSNQLTGAIPASlggltlltrldLSFNRLFG  1677
             QVLQLCYN+ EG +P +LGS+K L+VLA Q NQL GAIPA+LG L  LTRLD+SFN LFG
Sbjct  142   QVLQLCYNKLEGSLPTQLGSMKKLSVLAFQYNQLAGAIPATLGDLENLTRLDMSFNNLFG  201

Query  1676  SIPVKLSEASKLEVLDLRNNTLSGNVPLGLKRLNEGFRYENNPGLCGTGFPSLALCSDSS  1497
             SIP +L++   LE LD+RNN+LSGNV   LKRLN GFRYENN GLCG GFP L +C    
Sbjct  202   SIPTRLADVPLLEFLDIRNNSLSGNVSPALKRLNAGFRYENNYGLCGNGFPDLEICGSPD  261

Query  1496  L-NPTKPEPFGQGSNRLPTKDIPESANIPHQLNQNR-----KPQAAAAVVGVIGLFVILA  1335
             L NP +PE FG  ++   TKDIPESA +P   ++ R     K   A+ VVGVIG  V L 
Sbjct  262   LINPNRPEAFGPKNHS--TKDIPESAKVPSNCSEARCSNPSKSPQASLVVGVIGTIVALT  319

Query  1334  VAGLFTFSWYRRRKQQIGSTVDISESRVSTDQPKVLCRRSTSPLISLEYSNGWDPLAKDQ  1155
             V GLF FS YRRRKQ+IGST D S+SR+STDQ K + RRS SPLI+LEYS+GWDPLAK  
Sbjct  320   VIGLFAFSAYRRRKQKIGSTFDTSDSRLSTDQVKEVYRRSASPLINLEYSSGWDPLAK--  377

Query  1154  SGSALSQEVLESFMFNLDEVESATQYFSETNLLGKSSFSAVYKGTLRDGSAVAVKCISKT  975
              G+  SQEV ESFMFNL++VE AT  FSETNLLGKS+FSA YKG LRDGS VAVKCI+KT
Sbjct  378   GGTGFSQEVFESFMFNLEDVERATHCFSETNLLGKSNFSATYKGILRDGSVVAVKCIAKT  437

Query  974   SCKSDEAEFRKGLTLLTSLKHENLLRLRGFCCSKGRGECFLIYDFVSNGNLLRYLDVKDE  795
             SC++DEAEF KGL LLTSLKH NL+RLRGFCCSKGRGECFLIY+FV+NGNLL+YLDV   
Sbjct  438   SCRTDEAEFLKGLKLLTSLKHTNLVRLRGFCCSKGRGECFLIYEFVANGNLLQYLDVNKG  497

Query  794   KGKVLDWSTRTAIIKGIARGIKYLHGNKRNKPALVHRNISADKVLIDHLYKPLLSDSGLH  615
               KVL+WSTR +II GIA GIKY+H NK  KPA+VH+NI A+KVLIDH   PLLSDSGLH
Sbjct  498   SDKVLEWSTRVSIINGIAEGIKYIHANKGKKPAIVHQNICAEKVLIDHWNNPLLSDSGLH  557

Query  614   KLLADDIVFSTLKGSAANGYLAPEYAITGRFTEKSDMYAFGVIILQILSGSCVVTQSNHQ  435
             KLLADDIVFSTLK SAA GYLAPEY  TGRFTEKSD+YAFG ++LQI+ G   +T    Q
Sbjct  558   KLLADDIVFSTLKASAAMGYLAPEYTTTGRFTEKSDVYAFGKLVLQIIIGKRNITPGMWQ  617

Query  434   GAELCRFEDFVDAKLGKDFVESEAAKLGKIALLCTHDSPSRRPAIDVVIQ  285
             GAE C+FEDF+D  L  +F E EAAKL  IAL C  +SP  RP+++ V+Q
Sbjct  618   GAENCKFEDFMDPNLEGNFSEREAAKLVAIALRCIQESPFCRPSMENVVQ  667



>ref|XP_008356288.1| PREDICTED: protein NSP-INTERACTING KINASE 2-like [Malus domestica]
Length=683

 Score =   820 bits (2117),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 423/650 (65%), Positives = 502/650 (77%), Gaps = 16/650 (2%)
 Frame = -3

Query  2198  LMAIKASLDPGNLVLSSWSPNVTDPCSVSSFEGIACNDLGQVVNISLQGKGLYGKIPPEI  2019
             L+A+KASLDP N  L+SW+P+  DPC   +FEG+ACN+ G+V NISLQGKGL+G+IPP +
Sbjct  30    LIAMKASLDPQNQFLTSWTPHA-DPCG-GAFEGVACNEQGRVTNISLQGKGLWGQIPPAV  87

Query  2018  GQLNGLSGLYLHFNNLHGVIPKEIASLTQLSDLYLNMNDLSGFIPSEIGNMPNLQVLQLC  1839
             G L  L+GLYLHFN L G IPK+IA+L QL+DLYLN+N+LS  IP EIG MPNLQVLQLC
Sbjct  88    GGLKNLTGLYLHFNALTGKIPKQIAALNQLADLYLNVNNLSXEIPREIGKMPNLQVLQLC  147

Query  1838  YNRFEGCIPNKLGSLKNLTVLALQSNQLTGAIPASlggltlltrldLSFNRLFGSIPVKL  1659
             YN+  G IP +LG LK L+VLA+QSN+LTGAIPASLG L  LTRLDLSFN  FG IP KL
Sbjct  148   YNKLTGGIPTELGQLKRLSVLAVQSNELTGAIPASLGELGTLTRLDLSFNSFFGPIPAKL  207

Query  1658  SEASKLEVLDLRNNTLSGNVPLGLKRLNEGFRYENNPGLCGTGFPSLALCSDSSLNPTKP  1479
             ++AS LEVLD+R+NTLSGN+P  LKRLNEGF+YENNP LCG GF  L  C+ ++ NP  P
Sbjct  208   ADASMLEVLDVRSNTLSGNIPPALKRLNEGFQYENNPNLCGVGFSGLEPCTATTRNPNMP  267

Query  1478  EPF------GQG-SNRLPTKDIPESANIPHQLNQNRKPQAAAA-----VVGVIGLFVILA  1335
             +PF      G+G  +    K+IPE+ANI    +Q +  +A+ +     V GVIG  V LA
Sbjct  268   QPFEPSNFSGKGLPDSSTAKEIPETANIHSNCSQTQCSEASNSPEIGFVFGVIGAVVALA  327

Query  1334  VAGLFTFSWYRRRKQQIGSTVDISESRVSTDQPKVLCRRSTSPLISLEYSNGWDPLAKDQ  1155
             V+GLF FSW RR+KQ+IGST D S+SR+ST Q K + ++S SPLI+LEYSNGWDPLAK  
Sbjct  328   VSGLFLFSWCRRQKQKIGSTFDSSDSRLSTGQAKAVYKKSVSPLINLEYSNGWDPLAKGS  387

Query  1154  SGSALSQEVLESFMFNLDEVESATQYFSETNLLGKSSFSAVYKGTLRDGSAVAVKCISKT  975
             SG   SQEVLESFM NL+EVE ATQ F E NLL K  FSA+YKG LRDGS V + CISKT
Sbjct  388   SG--YSQEVLESFMINLEEVERATQSFLEVNLLRKGKFSAIYKGILRDGSVVTINCISKT  445

Query  974   SCKSDEAEFRKGLTLLTSLKHENLLRLRGFCCSKGRGECFLIYDFVSNGNLLRYLDVKDE  795
             SCK DEAEF KGL +LTSLKHENL+RLRGFCCSKGRGE FLIYDF+ N +LL+YLD+KD 
Sbjct  446   SCKPDEAEFLKGLKILTSLKHENLVRLRGFCCSKGRGEWFLIYDFIPNESLLQYLDIKDG  505

Query  794   KGKVLDWSTRTAIIKGIARGIKYLHGNKRNKPALVHRNISADKVLIDHLYKPLLSDSGLH  615
               + L+WSTR +II GIA+GI YLHGN  NKPA+VH+ ISA+KVLID  Y PLLSDSGLH
Sbjct  506   SAEALEWSTRVSIINGIAKGIGYLHGNADNKPAIVHQTISAEKVLIDSHYNPLLSDSGLH  565

Query  614   KLLADDIVFSTLKGSAANGYLAPEYAITGRFTEKSDMYAFGVIILQILSGSCVVTQSNHQ  435
             KLLADDIVFS LK SAA GYLAPEY   GRFT KSD+YAFG+I+ Q+L G   +TQ   Q
Sbjct  566   KLLADDIVFSMLKASAAMGYLAPEYTTIGRFTSKSDIYAFGMIVFQLLCGKRKITQVTRQ  625

Query  434   GAELCRFEDFVDAKLGKDFVESEAAKLGKIALLCTHDSPSRRPAIDVVIQ  285
             GAE  RFEDF+DA L   F ESEA+KLGK+ALLCTH+SP  RP I+ V++
Sbjct  626   GAEAGRFEDFIDANLEGKFSESEASKLGKLALLCTHESPIYRPPIENVVK  675



>ref|XP_007038447.1| Leucine-rich repeat protein kinase family protein isoform 1 [Theobroma 
cacao]
 gb|EOY22948.1| Leucine-rich repeat protein kinase family protein isoform 1 [Theobroma 
cacao]
Length=678

 Score =   817 bits (2110),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 417/644 (65%), Positives = 507/644 (79%), Gaps = 9/644 (1%)
 Frame = -3

Query  2198  LMAIKASLDPGNLVLSSWSPNVTDPCSVSSFEGIACNDLGQVVNISLQGKGLYGKIPPEI  2019
             L+ +KA+LDP +  LSSW+ N  DPC   SFEG+ CN  GQ+ NISLQGKGL GK+   I
Sbjct  29    LLDMKAALDPDDKYLSSWTIN-GDPCD-RSFEGVGCNQKGQIANISLQGKGLSGKVSSAI  86

Query  2018  GQLNGLSGLYLHFNNLHGVIPKEIASLTQLSDLYLNMNDLSGFIPSEIGNMPNLQVLQLC  1839
               L  L+GLYLH+N+L+G IP+EIA+LT LSDLYLNMN+LSG IP EIGNM +LQVLQLC
Sbjct  87    TGLKHLTGLYLHYNSLYGDIPREIANLTLLSDLYLNMNNLSGEIPPEIGNMGSLQVLQLC  146

Query  1838  YNRFEGCIPNKLGSLKNLTVLALQSNQLTGAIPASlggltlltrldLSFNRLFGSIPVKL  1659
             YN+  G IP +LGSLK L VLALQSNQLTGAIPASLG +  L RLDLSFNRLFGSIP+K+
Sbjct  147   YNQLTGSIPTQLGSLKKLNVLALQSNQLTGAIPASLGDVGTLMRLDLSFNRLFGSIPMKI  206

Query  1658  SEASKLEVLDLRNNTLSGNVPLGLKRLNEGFRYENNPGLCGTGFPSLALCSDSS-LNPTK  1482
             ++A  LEVLD+RNN+LSGNVPL LKRLN+GF ++NN GLCG+GF SL  C+ S  +NP +
Sbjct  207   ADAPLLEVLDIRNNSLSGNVPLALKRLNDGFLFQNNLGLCGSGFSSLEACNTSDHINPNR  266

Query  1481  PEPFGQGSNRLPTKDIPESANI-----PHQLNQNRKPQAAAAVVGVIGLFVILAVAGLFT  1317
             PE +G G+   P ++IPE+AN+     P Q ++  K Q    +VG+I + V L+  G+ T
Sbjct  267   PEAYGPGTTGRP-REIPETANLQLPCEPTQCSKPSKSQRGPILVGLIVVTVALSAIGILT  325

Query  1316  FSWYRRRKQQIGSTVDISESRVSTDQPKVLCRRSTSPLISLEYSNGWDPLAKDQSGSALS  1137
             F+ YRRRKQ++GS+ +IS+ R+STDQ K + R++ SPLISLEY+NGWDPLA  ++ +  +
Sbjct  326   FTQYRRRKQKLGSSFEISDRRLSTDQAKGVYRKNGSPLISLEYANGWDPLADSRNFTGFA  385

Query  1136  QEVLESFMFNLDEVESATQYFSETNLLGKSSFSAVYKGTLRDGSAVAVKCISKTSCKSDE  957
             Q+V +SF FNL+EVE+ATQYFSE NLLGKS+FSA YKG LRDGSAVA+K ISKTSCKSD+
Sbjct  386   QDVFQSFRFNLEEVETATQYFSEVNLLGKSNFSATYKGILRDGSAVAIKSISKTSCKSDD  445

Query  956   AEFRKGLTLLTSLKHENLLRLRGFCCSKGRGECFLIYDFVSNGNLLRYLDVKDEKGKVLD  777
             AEF KGL +L SLKHENL+RLRGFCCSK RGECFLIYDFV NGNLLR LDVKD  G+VL+
Sbjct  446   AEFLKGLNILASLKHENLVRLRGFCCSKARGECFLIYDFVPNGNLLRCLDVKDGDGQVLE  505

Query  776   WSTRTAIIKGIARGIKYLHGNKRNKPALVHRNISADKVLIDHLYKPLLSDSGLHKLLADD  597
             WSTR +I+KGIA+GI YLHG K NKPALVH+NISA+KVLID  + PLLSDSGLH LL +D
Sbjct  506   WSTRVSIVKGIAKGIAYLHGYKANKPALVHQNISAEKVLIDQRFNPLLSDSGLHNLLTND  565

Query  596   IVFSTLKGSAANGYLAPEYAITGRFTEKSDMYAFGVIILQILSGSCVVTQSNHQGAELCR  417
             IVF+ LK SAA GYLAPEY  TGRFTEKSD+YA+GV++ Q+LSG   VT     GAE CR
Sbjct  566   IVFAALKASAAMGYLAPEYTSTGRFTEKSDVYAYGVLVFQVLSGKRKVTSLVRLGAESCR  625

Query  416   FEDFVDAKLGKDFVESEAAKLGKIALLCTHDSPSRRPAIDVVIQ  285
             F+DF+D  L   F E EAAKL +IA LCTHDSP  RP++D V+Q
Sbjct  626   FQDFIDPNLHGRFFEYEAAKLARIAWLCTHDSPIERPSMDAVVQ  669



>ref|XP_011041704.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
GSO2 [Populus euphratica]
Length=677

 Score =   816 bits (2109),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 411/648 (63%), Positives = 506/648 (78%), Gaps = 8/648 (1%)
 Frame = -3

Query  2213  STVSLLMAIKASLDPGNLVLSSWSPNVTDPCSVSSFEGIACNDLGQVVNISLQGKGLYGK  2034
             + +  LM +KA+LDP N  L+SW+ N + PC   SFEG+ACN+ GQV NISLQGKGLYGK
Sbjct  24    TEIRALMDMKAALDPENRYLTSWTINGS-PCD-GSFEGVACNEKGQVANISLQGKGLYGK  81

Query  2033  IPPEIGQLNGLSGLYLHFNNLHGVIPKEIASLTQLSDLYLNMNDLSGFIPSEIGNMPNLQ  1854
             + P I  L  L+GLYLHFN+L+G +P+EIA+LT+LSDLYLN+N+LSG IP EIGNM NLQ
Sbjct  82    VSPAIAGLRHLTGLYLHFNSLYGDVPREIANLTELSDLYLNVNNLSGEIPPEIGNMANLQ  141

Query  1853  VLQLCYNRFEGCIPNKLGSLKNLTVLALQSNQLTGAIPASlggltlltrldLSFNRLFGS  1674
             VLQLCYN+F G IP ++GSL+ LTVL LQSN LTGAIPASLGGL +L RLDLS+N LFGS
Sbjct  142   VLQLCYNQFTGSIPTEMGSLEKLTVLTLQSNHLTGAIPASLGGLGMLMRLDLSYNHLFGS  201

Query  1673  IPVKLSEASKLEVLDLRNNTLSGNVPLGLKRLNEGFRYENNPGLCGTGFPSLALCSDSSL  1494
             IP K+++A  LE LD+RNNTLSGNVPL LKRLN+GF YENN GLCG GF SL  C+ S L
Sbjct  202   IPTKVADAPLLEFLDIRNNTLSGNVPLALKRLNDGFLYENNLGLCGAGFVSLNACNASEL  261

Query  1493  NPTKPEPFGQGSNRLPTKDIPESANIPHQLNQNR-----KPQAAAAVVGVIGLFVILAVA  1329
             NP++P+PFG G N  P ++IPE+A++P   NQ       K   A+A V  + + ++LA  
Sbjct  262   NPSRPQPFGTGVNGQP-REIPETASLPLLCNQTHCSNPSKSHHASAAVATVVITILLAAI  320

Query  1328  GLFTFSWYRRRKQQIGSTVDISESRVSTDQPKVLCRRSTSPLISLEYSNGWDPLAKDQSG  1149
             G+ TF+ YRRRKQ++ S+ ++S+SR+STDQ K + R++ SPLISLEY NGWDPLA  ++ 
Sbjct  321   GILTFTQYRRRKQKLASSYEVSDSRLSTDQAKGVYRKNGSPLISLEYPNGWDPLADGRNF  380

Query  1148  SALSQEVLESFMFNLDEVESATQYFSETNLLGKSSFSAVYKGTLRDGSAVAVKCISKTSC  969
             S  +Q+V +SF FNL+EVE+ATQYFSE NLLGKS+FSA Y+G LRDGS VA+K ISK SC
Sbjct  381   SGNAQDVFQSFRFNLEEVETATQYFSEVNLLGKSNFSATYRGILRDGSVVAIKSISKNSC  440

Query  968   KSDEAEFRKGLTLLTSLKHENLLRLRGFCCSKGRGECFLIYDFVSNGNLLRYLDVKDEKG  789
             KS+E EF KGL  LTSL+HENL+RLRGFCCS+GRGECFLIYDFV NGNLLRYLDVKD  G
Sbjct  441   KSEETEFLKGLNTLTSLRHENLVRLRGFCCSRGRGECFLIYDFVPNGNLLRYLDVKDGDG  500

Query  788   KVLDWSTRTAIIKGIARGIKYLHGNKRNKPALVHRNISADKVLIDHLYKPLLSDSGLHKL  609
              VL+WSTR +I++GIA+GI YLHG K NKP+L+H+NI+A+KVLID    PLL+DSGL  L
Sbjct  501   HVLEWSTRVSIVRGIAKGIAYLHGYKANKPSLIHQNITAEKVLIDQRCSPLLADSGLQNL  560

Query  608   LADDIVFSTLKGSAANGYLAPEYAITGRFTEKSDMYAFGVIILQILSGSCVVTQSNHQGA  429
             L +DIVFS LK SAA GYLAPEY  TGRFT+KSD+YAFGVI+ Q+LSG   VT     GA
Sbjct  561   LTNDIVFSALKTSAAMGYLAPEYTTTGRFTDKSDVYAFGVIVFQVLSGKRKVTNLVRLGA  620

Query  428   ELCRFEDFVDAKLGKDFVESEAAKLGKIALLCTHDSPSRRPAIDVVIQ  285
             + CRF+D++D  L   F E EAAKL +IA LCTH+SP  RP+ + V+ 
Sbjct  621   DACRFQDYIDPNLHGRFFEYEAAKLARIAWLCTHESPIERPSTEAVVH  668



>ref|XP_002267632.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At5g45780 [Vitis vinifera]
Length=681

 Score =   816 bits (2108),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 419/644 (65%), Positives = 505/644 (78%), Gaps = 8/644 (1%)
 Frame = -3

Query  2198  LMAIKASLDPGNLVLSSWSPNVTDPCSVSSFEGIACNDLGQVVNISLQGKGLYGKIPPEI  2019
             LM IK++LDP NL LSSW+ N  DPC   SFEG+ACN+ GQV NISLQGKGL GK+ P I
Sbjct  31    LMVIKSTLDPHNLFLSSWTIN-GDPCD-GSFEGVACNERGQVANISLQGKGLTGKLSPAI  88

Query  2018  GQLNGLSGLYLHFNNLHGVIPKEIASLTQLSDLYLNMNDLSGFIPSEIGNMPNLQVLQLC  1839
               L  L+GLYLH+N+L+G IP EIA+LTQLSDLYLN+N+LSG IP+E+G M  LQVLQLC
Sbjct  89    AGLKHLTGLYLHYNSLYGEIPVEIANLTQLSDLYLNVNNLSGTIPAELGKMATLQVLQLC  148

Query  1838  YNRFEGCIPNKLGSLKNLTVLALQSNQLTGAIPASlggltlltrldLSFNRLFGSIPVKL  1659
             YN+  G IP +LGSLK L+VLALQSNQLTGAIPASLG L +L RLDLSFNRLFGSIP +L
Sbjct  149   YNQLTGSIPTQLGSLKKLSVLALQSNQLTGAIPASLGDLGMLVRLDLSFNRLFGSIPRRL  208

Query  1658  SEASKLEVLDLRNNTLSGNVPLGLKRLNEGFRYENNPGLCGTGFPSLALCSDSSL-NPTK  1482
             ++   LEVLD+RNNTLSG +P  LKRLN GF+Y+NN  LCG GF  L +C+   L N ++
Sbjct  209   ADVVSLEVLDIRNNTLSGKIPPALKRLNGGFQYKNNARLCGDGFSYLKVCNSLDLTNQSR  268

Query  1481  PEPFGQGSNRLPTKDIPESANIPHQLNQNR-----KPQAAAAVVGVIGLFVILAVAGLFT  1317
             PEP+G GSN   T DIPE+AN+    ++       K   A  VVG++ + + L+  G+ +
Sbjct  269   PEPYGAGSNTQSTGDIPETANVQLHCDKAHCSNPSKSSHAPVVVGMVVVTIALSAIGILS  328

Query  1316  FSWYRRRKQQIGSTVDISESRVSTDQPKVLCRRSTSPLISLEYSNGWDPLAKDQSGSALS  1137
             F+ YRRRKQ++GS+ DIS+SR+STDQ K + R++ SPL+SLEYSNGWDPLA  ++     
Sbjct  329   FAQYRRRKQKLGSSFDISDSRLSTDQGKEVYRKNGSPLVSLEYSNGWDPLADGRNYGGFP  388

Query  1136  QEVLESFMFNLDEVESATQYFSETNLLGKSSFSAVYKGTLRDGSAVAVKCISKTSCKSDE  957
             QEV +SF FNL+EVESATQ+FSE NLLGKS+FSA+YKG LRDGS VA+K I+KTSCKS++
Sbjct  389   QEVFQSFRFNLEEVESATQHFSEVNLLGKSNFSAIYKGILRDGSLVAIKSINKTSCKSED  448

Query  956   AEFRKGLTLLTSLKHENLLRLRGFCCSKGRGECFLIYDFVSNGNLLRYLDVKDEKGKVLD  777
             AEF KGL +LTSL+HENL+RLRG CCSKGRGECFLIYDF+ NGNLL YLD+KD   KVL+
Sbjct  449   AEFLKGLNILTSLRHENLVRLRGLCCSKGRGECFLIYDFIPNGNLLSYLDLKDGDSKVLE  508

Query  776   WSTRTAIIKGIARGIKYLHGNKRNKPALVHRNISADKVLIDHLYKPLLSDSGLHKLLADD  597
             WSTR ++I GIA+GI+YLHG K NKPALVH+NISA+KVLID    PLLSDSGLHKLL DD
Sbjct  509   WSTRVSMISGIAKGIEYLHGYKLNKPALVHQNISAEKVLIDQRLNPLLSDSGLHKLLTDD  568

Query  596   IVFSTLKGSAANGYLAPEYAITGRFTEKSDMYAFGVIILQILSGSCVVTQSNHQGAELCR  417
             IVFS LK SAA GYLAPEY  TGRFTEKSD+YAFGV++ QILSG    T S H GAE CR
Sbjct  569   IVFSALKASAAMGYLAPEYTTTGRFTEKSDLYAFGVLVFQILSGKRKFTSSIHLGAETCR  628

Query  416   FEDFVDAKLGKDFVESEAAKLGKIALLCTHDSPSRRPAIDVVIQ  285
             F+DF+DA L   F E EAAKL +IAL+CTH+SP  RP+++ VI 
Sbjct  629   FQDFIDANLHGRFSEYEAAKLARIALMCTHESPIERPSMETVIH  672



>ref|XP_010101735.1| Leucine-rich repeat receptor protein kinase EXS [Morus notabilis]
 gb|EXB89490.1| Leucine-rich repeat receptor protein kinase EXS [Morus notabilis]
Length=679

 Score =   813 bits (2099),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 409/649 (63%), Positives = 507/649 (78%), Gaps = 8/649 (1%)
 Frame = -3

Query  2213  STVSLLMAIKASLDPGNLVLSSWSPNVTDPCSVSSFEGIACNDLGQVVNISLQGKGLYGK  2034
             S +  LM IKASLDP +L LSSW+ N  DPC   SFEG+ACN +G V NISLQGKGL GK
Sbjct  24    SELVALMDIKASLDPESLYLSSWTFN-GDPCD-GSFEGVACNGMGHVANISLQGKGLSGK  81

Query  2033  IPPEIGQLNGLSGLYLHFNNLHGVIPKEIASLTQLSDLYLNMNDLSGFIPSEIGNMPNLQ  1854
             + P I +L  L+GLYLH+N+L+G IP+EIA+LT L DLYLN+N+L+G IP EIG   NLQ
Sbjct  82    LSPAIAELKHLTGLYLHYNSLYGEIPREIANLTDLGDLYLNVNNLTGEIPPEIGTTVNLQ  141

Query  1853  VLQLCYNRFEGCIPNKLGSLKNLTVLALQSNQLTGAIPASlggltlltrldLSFNRLFGS  1674
             VLQLCYN+  G IP +LGSLK LTVLALQSNQLTGAIPASLG L +L R+DLSFN LFGS
Sbjct  142   VLQLCYNQLIGSIPTQLGSLKKLTVLALQSNQLTGAIPASLGDLEMLMRVDLSFNHLFGS  201

Query  1673  IPVKLSEASKLEVLDLRNNTLSGNVPLGLKRLNEGFRYENNPGLCGTGFPSLALCSDS-S  1497
             IP KL++   LE+LD+RNNTLSG+VPL LK+LNEGF Y+NN GLCG GF SL  C+ S  
Sbjct  202   IPTKLADTPLLEILDIRNNTLSGSVPLALKKLNEGFAYQNNLGLCGVGFASLNPCNFSVH  261

Query  1496  LNPTKPEPFGQGSNRLPTKDIPESANIPHQLNQN-----RKPQAAAAVVGVIGLFVILAV  1332
             ++P++PEP+G G+N + T++IPE+AN+     Q       K   A+ VVG I + + L  
Sbjct  262   VDPSRPEPYGSGANGISTRNIPETANVNLPCRQTGCANAAKSHQASVVVGTIAVTIALLA  321

Query  1331  AGLFTFSWYRRRKQQIGSTVDISESRVSTDQPKVLCRRSTSPLISLEYSNGWDPLAKDQS  1152
              G+ +F+ YRRRKQ++G++ D+S++R+STDQ K + R++ SPLISLEY+NGWDPLA  ++
Sbjct  322   IGILSFTQYRRRKQKLGTSFDVSDARLSTDQAKGVTRKNGSPLISLEYANGWDPLADGRN  381

Query  1151  GSALSQEVLESFMFNLDEVESATQYFSETNLLGKSSFSAVYKGTLRDGSAVAVKCISKTS  972
              SA +QEV  SF FNL+E+E+AT YFSE NLLGKS+FSA YKG LRDGS VA+K I KT 
Sbjct  382   LSAFAQEVFHSFRFNLEEIETATHYFSEVNLLGKSNFSATYKGILRDGSVVAIKGIGKTC  441

Query  971   CKSDEAEFRKGLTLLTSLKHENLLRLRGFCCSKGRGECFLIYDFVSNGNLLRYLDVKDEK  792
             CKS+EAEF KGL +LTSL+HENL+RLRGFCCS+GRGEC+L+YDFV NGNLL+YLDVKD  
Sbjct  442   CKSEEAEFLKGLNILTSLRHENLVRLRGFCCSRGRGECYLVYDFVPNGNLLQYLDVKDGD  501

Query  791   GKVLDWSTRTAIIKGIARGIKYLHGNKRNKPALVHRNISADKVLIDHLYKPLLSDSGLHK  612
             G+VL+WSTR +I+KGIA+G+ YLH  K NKPALVH+NISA+KVLID  + PLLSDSGLHK
Sbjct  502   GQVLEWSTRVSIVKGIAKGVAYLHAYKPNKPALVHQNISAEKVLIDQRFNPLLSDSGLHK  561

Query  611   LLADDIVFSTLKGSAANGYLAPEYAITGRFTEKSDMYAFGVIILQILSGSCVVTQSNHQG  432
             LL +D+VFS LK +AA GYLAPEY  TGRFT+KSD+YAFGV++ QILSG   VT     G
Sbjct  562   LLTNDVVFSALKSTAAMGYLAPEYTTTGRFTDKSDVYAFGVLVFQILSGKRRVTSPARLG  621

Query  431   AELCRFEDFVDAKLGKDFVESEAAKLGKIALLCTHDSPSRRPAIDVVIQ  285
             A+  RF +++D  L   F E EAAKL KIALLCTH+SP  RP+++ V+Q
Sbjct  622   ADSGRFHNYIDPNLHGRFFEYEAAKLTKIALLCTHESPLERPSMESVVQ  670



>ref|XP_007220018.1| hypothetical protein PRUPE_ppa002373mg [Prunus persica]
 gb|EMJ21217.1| hypothetical protein PRUPE_ppa002373mg [Prunus persica]
Length=680

 Score =   806 bits (2081),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 422/648 (65%), Positives = 504/648 (78%), Gaps = 15/648 (2%)
 Frame = -3

Query  2198  LMAIKASLDPGNLVLSSWSPNVTDPCSVSSFEGIACNDLGQVVNISLQGKGLYGKIPPEI  2019
             L+ ++  LDP +L LSSW+ N  DPC   SFEGI CN+ GQV NISLQGKGL GK+ P I
Sbjct  29    LLDMRTVLDPESLYLSSWTVN-GDPCD-GSFEGIGCNEAGQVANISLQGKGLSGKLSPAI  86

Query  2018  GQLNGLSGLYLHFNNLHGVIPKEIASLTQLSDLYLNMNDLSGFIPSEIGNMPNLQVLQLC  1839
               L  L+GLY+H+N+L+G IP+EIA+LT+LSDLYLN+N+LSG IP EIG+M +LQVLQLC
Sbjct  87    AGLKHLTGLYMHYNSLYGEIPREIANLTELSDLYLNVNNLSGEIPPEIGSMGSLQVLQLC  146

Query  1838  YNRFEGCIPNKLGSLKNLTVLALQSNQLTGAIPASlggltlltrldLSFNRLFGSIPVKL  1659
             YN+  G IP +LGSLKNLTVLALQSN+LTGAIPASLG L +L RLDLS N LFGSIP KL
Sbjct  147   YNQLTGSIPTQLGSLKNLTVLALQSNRLTGAIPASLGDLEMLMRLDLSVNHLFGSIPTKL  206

Query  1658  SEASKLEVLDLRNNTLSGNVPLGLKRLNEGFRYENNPGLCGTGFPSLALCSDSS-LNPTK  1482
             ++A  LEVLD+RNNTLSGNVPL LKRLNEGF YENN GLCG GF SL  CS S  LN  +
Sbjct  207   ADAPVLEVLDVRNNTLSGNVPLALKRLNEGFSYENNLGLCGAGFMSLTACSASGHLNANR  266

Query  1481  PEPFGQGSNRLPTKDIPESANIPHQLNQNR------KPQAAAAVVGVIGLFVI-LAVAGL  1323
             PEPFG G+   PT+DIPE+AN+P   NQ R        QA+ AVV  + +  I L+  G+
Sbjct  267   PEPFGAGA---PTRDIPETANVPLPCNQTRCSNLSKSHQASVAVVVGVLVVTIALSAIGV  323

Query  1322  FTFSWYRRRKQQIGSTVDISESRVSTDQPKV--LCRRSTSPLISLEYSNGWDPLAKDQSG  1149
               F+ +RRRKQ++GS+ DIS+ R+STD+ K   + R++ SPLISLEYSNGWDPLA  ++ 
Sbjct  324   LFFTQHRRRKQKLGSSFDISDGRLSTDEAKGKGVYRKNGSPLISLEYSNGWDPLADGRNL  383

Query  1148  SALSQEVLESFMFNLDEVESATQYFSETNLLGKSSFSAVYKGTLRDGSAVAVKCISKTSC  969
             S  +QEV  SF FNL+EVE+ATQYFSE NLL KS+FSA YKG LRDGS VA+K I K+ C
Sbjct  384   SLFAQEVFHSFRFNLEEVETATQYFSEMNLLDKSNFSATYKGILRDGSVVAIKSIGKSCC  443

Query  968   KSDEAEFRKGLTLLTSLKHENLLRLRGFCCSKGRGECFLIYDFVSNGNLLRYLDVKDEKG  789
             K++EAEF KGL +LTSL+HENL+RLRGFCCSKGRGECFLIYDFV NGNLLRYLDVKD   
Sbjct  444   KTEEAEFLKGLNMLTSLRHENLVRLRGFCCSKGRGECFLIYDFVPNGNLLRYLDVKDGDS  503

Query  788   KVLDWSTRTAIIKGIARGIKYLHGNKRNKPALVHRNISADKVLIDHLYKPLLSDSGLHKL  609
              VL+W+TR +I+KGIA+G+ YLHG K NKPALVH+NISA+KVLID  Y PLLSDSGLHKL
Sbjct  504   HVLEWTTRVSIVKGIAKGLSYLHGYKPNKPALVHQNISAEKVLIDQRYNPLLSDSGLHKL  563

Query  608   LADDIVFSTLKGSAANGYLAPEYAITGRFTEKSDMYAFGVIILQILSGSCVVTQSNHQGA  429
             L +D+VFS LK SAA GYLAPEY  TGRFTEKSD+YAFGV++ Q+LSG   VT S   GA
Sbjct  564   LTNDVVFSALKASAAMGYLAPEYTTTGRFTEKSDVYAFGVLVFQVLSGKRKVTSSMRLGA  623

Query  428   ELCRFEDFVDAKLGKDFVESEAAKLGKIALLCTHDSPSRRPAIDVVIQ  285
             E   F+DF+D  L   F E EA+KL K ALLCTH+SP  RP+++ V+Q
Sbjct  624   ESVTFQDFIDQNLNGRFFEYEASKLAKTALLCTHESPIERPSMEEVVQ  671



>ref|XP_008354209.1| PREDICTED: BRASSINOSTEROID INSENSITIVE 1-associated receptor 
kinase 1-like [Malus domestica]
Length=680

 Score =   800 bits (2065),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 417/648 (64%), Positives = 502/648 (77%), Gaps = 15/648 (2%)
 Frame = -3

Query  2198  LMAIKASLDPGNLVLSSWSPNVTDPCSVSSFEGIACNDLGQVVNISLQGKGLYGKIPPEI  2019
             L+ +K+ LDP +L LSSW+ N  +PC   SFEGI CN+ GQV NISLQGKGL GK+ P I
Sbjct  29    LLDMKSLLDPQSLYLSSWTVN-GNPCG-GSFEGIXCNEAGQVXNISLQGKGLTGKLSPAI  86

Query  2018  GQLNGLSGLYLHFNNLHGVIPKEIASLTQLSDLYLNMNDLSGFIPSEIGNMPNLQVLQLC  1839
               L  L+G+YLH+N+LHG IP+EIA+LT+LSDLYLN+N+LSG IP EIGNM NLQVLQLC
Sbjct  87    AGLKHLTGIYLHYNSLHGEIPREIANLTELSDLYLNVNNLSGVIPPEIGNMSNLQVLQLC  146

Query  1838  YNRFEGCIPNKLGSLKNLTVLALQSNQLTGAIPASlggltlltrldLSFNRLFGSIPVKL  1659
             YN+  G IP +LGSLKNL+VLALQSN LTGAIPASLG L +L RLDLS N LFGSIP KL
Sbjct  147   YNQLTGSIPTQLGSLKNLSVLALQSNHLTGAIPASLGDLXMLMRLDLSVNHLFGSIPTKL  206

Query  1658  SEASKLEVLDLRNNTLSGNVPLGLKRLNEGFRYENNPGLCGTGFPSLALCSDSSL-NPTK  1482
             ++A  LEVLD+RNNTLSGNVPL LKRLNEGF YENN GLCG GF SL  C+ S   N ++
Sbjct  207   ADAPVLEVLDVRNNTLSGNVPLALKRLNEGFSYENNLGLCGAGFMSLTACTTSGHPNASR  266

Query  1481  PEPFGQGSNRLPTKDIPESANIPHQLNQNR-----KPQAAAAVVGVIGLFVILAVAGL--  1323
             PEPFG G   +PT+D PE+AN+P   NQ R     K   A+  V V  + V +A++G+  
Sbjct  267   PEPFGAG---VPTRDFPETANVPLPCNQTRCSNLSKSHQASVAVVVGVIVVTIALSGVGF  323

Query  1322  FTFSWYRRRKQQIGSTVDISESRVSTDQPKV--LCRRSTSPLISLEYSNGWDPLAKDQSG  1149
               F+ +RRRKQ++G++ D +E R STD+ K   + R++ SPLISLEY+NGWDPLA  ++ 
Sbjct  324   VFFTQHRRRKQKLGNSFDTAEGRFSTDEAKANGVYRKNGSPLISLEYANGWDPLANGRNL  383

Query  1148  SALSQEVLESFMFNLDEVESATQYFSETNLLGKSSFSAVYKGTLRDGSAVAVKCISKTSC  969
             S  +QEV  SF FNL+EVE+ATQYFSE NLLGKS+FSA YKG LRDGSAVA+K I K+ C
Sbjct  384   SVFAQEVFGSFRFNLEEVETATQYFSEVNLLGKSNFSATYKGILRDGSAVAIKSIGKSCC  443

Query  968   KSDEAEFRKGLTLLTSLKHENLLRLRGFCCSKGRGECFLIYDFVSNGNLLRYLDVKDEKG  789
             K++E+EF KGL +LTSL+HENL++LRGFCCSKGRGECFLIYDFV NGNLL+YLDVKD   
Sbjct  444   KTEESEFLKGLNMLTSLRHENLVKLRGFCCSKGRGECFLIYDFVPNGNLLQYLDVKDGDN  503

Query  788   KVLDWSTRTAIIKGIARGIKYLHGNKRNKPALVHRNISADKVLIDHLYKPLLSDSGLHKL  609
              VL+W+TR  I+KGIA+G+ YLHG K NKP LVH+NISA+KVLID  Y PLLSDSGLHKL
Sbjct  504   HVLEWTTRVCIVKGIAKGLSYLHGYKPNKPPLVHQNISAEKVLIDQRYNPLLSDSGLHKL  563

Query  608   LADDIVFSTLKGSAANGYLAPEYAITGRFTEKSDMYAFGVIILQILSGSCVVTQSNHQGA  429
             L +D+VFS LK SAA GYLAPEY  TGRFTEKSD+YAFGV+ILQILSG   VT +   GA
Sbjct  564   LTNDVVFSALKASAAMGYLAPEYTTTGRFTEKSDVYAFGVLILQILSGKRKVTSAMRXGA  623

Query  428   ELCRFEDFVDAKLGKDFVESEAAKLGKIALLCTHDSPSRRPAIDVVIQ  285
             E  RF+DF+D  L   F E EA+KL K ALLCTH+S   RP+++ V+Q
Sbjct  624   ESGRFQDFIDQNLNGRFFEYEASKLAKTALLCTHESAIERPSMEEVVQ  671



>ref|XP_008234364.1| PREDICTED: somatic embryogenesis receptor kinase 4 [Prunus mume]
Length=680

 Score =   798 bits (2061),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 420/648 (65%), Positives = 504/648 (78%), Gaps = 15/648 (2%)
 Frame = -3

Query  2198  LMAIKASLDPGNLVLSSWSPNVTDPCSVSSFEGIACNDLGQVVNISLQGKGLYGKIPPEI  2019
             L+ ++A LDP +L LSSW+ N  DPC   SFEGI CN+ GQV NISLQGKGL GK+ P I
Sbjct  29    LLDMRAVLDPESLYLSSWTVN-GDPCD-GSFEGIGCNEAGQVANISLQGKGLSGKLSPAI  86

Query  2018  GQLNGLSGLYLHFNNLHGVIPKEIASLTQLSDLYLNMNDLSGFIPSEIGNMPNLQVLQLC  1839
               L  L+GLY+H+N+L+G IP+EIA+LT+LSDLYLN+N+LSG IP EIG+M +LQVLQLC
Sbjct  87    AGLKHLTGLYMHYNSLYGEIPREIANLTELSDLYLNVNNLSGEIPPEIGSMGSLQVLQLC  146

Query  1838  YNRFEGCIPNKLGSLKNLTVLALQSNQLTGAIPASlggltlltrldLSFNRLFGSIPVKL  1659
             YN+  G IP +LGSLKNLTVLALQSN+LTGAIPASLG L +L RLDLS N LFGSIP KL
Sbjct  147   YNQLTGSIPTQLGSLKNLTVLALQSNRLTGAIPASLGDLEMLMRLDLSVNHLFGSIPTKL  206

Query  1658  SEASKLEVLDLRNNTLSGNVPLGLKRLNEGFRYENNPGLCGTGFPSLALCSDSS-LNPTK  1482
             ++A  LEVLD+RNNTLSGNVPL LKRLNEGF YENN GLCG+GF SL  CS S  LN ++
Sbjct  207   ADAPVLEVLDVRNNTLSGNVPLALKRLNEGFSYENNLGLCGSGFMSLTACSASGHLNASR  266

Query  1481  PEPFGQGSNRLPTKDIPESANIP------HQLNQNRKPQAAAAVVGVIGLFVI-LAVAGL  1323
             PEPFG  +   PT+DIPE+AN+P      H  N ++  QA+ AVV  + +  I L+  G+
Sbjct  267   PEPFGAAA---PTRDIPETANVPLPCNQTHCSNLSKSHQASVAVVVGVLVVTIALSAIGV  323

Query  1322  FTFSWYRRRKQQIGSTVDISESRVSTDQPKV--LCRRSTSPLISLEYSNGWDPLAKDQSG  1149
               F  +RRRKQ++GS+ DI + R+STD+ K   + R++ SPLISLEYSNGWDPLA  ++ 
Sbjct  324   LFFIQHRRRKQKLGSSFDICDGRLSTDEAKGKGVYRKNGSPLISLEYSNGWDPLADGRNL  383

Query  1148  SALSQEVLESFMFNLDEVESATQYFSETNLLGKSSFSAVYKGTLRDGSAVAVKCISKTSC  969
             S  +QEV  SF FNL+EVE+ATQYFSE NLL KS+FSA YKG LRDGS VAVK I K+ C
Sbjct  384   SLFAQEVFHSFRFNLEEVETATQYFSEMNLLDKSNFSATYKGILRDGSVVAVKSIGKSCC  443

Query  968   KSDEAEFRKGLTLLTSLKHENLLRLRGFCCSKGRGECFLIYDFVSNGNLLRYLDVKDEKG  789
             K++EAEF KGL +LTSL+HENL+RLRGFCCSKGRGECFLIYDFV NGNLLRYLDVKD   
Sbjct  444   KTEEAEFLKGLNMLTSLRHENLVRLRGFCCSKGRGECFLIYDFVPNGNLLRYLDVKDGDS  503

Query  788   KVLDWSTRTAIIKGIARGIKYLHGNKRNKPALVHRNISADKVLIDHLYKPLLSDSGLHKL  609
              VL+W+TR +I+KGIA+G+ YLHG K NKPALVH+NISA+KVLID  Y PLLSDSGLHKL
Sbjct  504   HVLEWTTRVSIVKGIAKGLSYLHGYKPNKPALVHQNISAEKVLIDQRYNPLLSDSGLHKL  563

Query  608   LADDIVFSTLKGSAANGYLAPEYAITGRFTEKSDMYAFGVIILQILSGSCVVTQSNHQGA  429
             L +D+VFS LK SAA GYLAPEY  TGRFTEKSD+YAFGV++ Q+LSG   VT S   GA
Sbjct  564   LTNDVVFSALKASAAMGYLAPEYTTTGRFTEKSDVYAFGVLVFQVLSGKRKVTSSMCLGA  623

Query  428   ELCRFEDFVDAKLGKDFVESEAAKLGKIALLCTHDSPSRRPAIDVVIQ  285
             E   F+DF+D  L   F E EA+KL K ALLCT +SP  RP+++ V+Q
Sbjct  624   ESVTFQDFIDQNLNGRFFEYEASKLAKTALLCTRESPIERPSMEEVVQ  671



>ref|XP_009374517.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At5g10290 [Pyrus x bretschneideri]
Length=680

 Score =   795 bits (2052),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 414/648 (64%), Positives = 500/648 (77%), Gaps = 15/648 (2%)
 Frame = -3

Query  2198  LMAIKASLDPGNLVLSSWSPNVTDPCSVSSFEGIACNDLGQVVNISLQGKGLYGKIPPEI  2019
             L+ +KA LDP +L LSSW+ N  DPC   SFEGI CN+ GQV NISLQGKG  GK+ P I
Sbjct  29    LLDMKALLDPQSLYLSSWTVN-GDPCG-GSFEGIGCNEAGQVANISLQGKGFTGKLSPSI  86

Query  2018  GQLNGLSGLYLHFNNLHGVIPKEIASLTQLSDLYLNMNDLSGFIPSEIGNMPNLQVLQLC  1839
               L  L+G+YLH+N+LHG IP+EIA+LT+LSDLYLN+N+LSG IP EIGNM NLQVLQLC
Sbjct  87    AGLKHLTGIYLHYNSLHGEIPREIANLTELSDLYLNVNNLSGVIPPEIGNMSNLQVLQLC  146

Query  1838  YNRFEGCIPNKLGSLKNLTVLALQSNQLTGAIPASlggltlltrldLSFNRLFGSIPVKL  1659
             YN+  G IP +LGSLKNL+VLALQSN LTGAIPASLG L +L RLDLS N LFGSIP KL
Sbjct  147   YNQLTGSIPTQLGSLKNLSVLALQSNHLTGAIPASLGDLEMLMRLDLSVNHLFGSIPTKL  206

Query  1658  SEASKLEVLDLRNNTLSGNVPLGLKRLNEGFRYENNPGLCGTGFPSLALCSDSSL-NPTK  1482
             ++A  LEVLD+RNN+LSGNVPL LKRLNEGF YENN GLCG GF SL  C+ S   N ++
Sbjct  207   ADAPVLEVLDVRNNSLSGNVPLALKRLNEGFSYENNLGLCGAGFMSLTACTTSGHPNASR  266

Query  1481  PEPFGQGSNRLPTKDIPESANIPHQLNQNR-----KPQAAAAVVGVIGLFVILAVAGLFT  1317
             PEPFG G   +PT+D PE+AN+P   NQ       K   A+  V V  + V +A++G+  
Sbjct  267   PEPFGAG---VPTRDFPETANVPLPCNQTHCSNLSKSHQASVAVVVGVIVVTIALSGVVF  323

Query  1316  --FSWYRRRKQQIGSTVDISESRVSTDQPKV--LCRRSTSPLISLEYSNGWDPLAKDQSG  1149
               F+ +RRRKQ++G++ DI++ R STD+ K   + R++ SPLISLEY+NGWDPLA  ++ 
Sbjct  324   VFFTQHRRRKQKLGNSFDIADGRFSTDEAKANGVYRKNGSPLISLEYANGWDPLANGRNL  383

Query  1148  SALSQEVLESFMFNLDEVESATQYFSETNLLGKSSFSAVYKGTLRDGSAVAVKCISKTSC  969
             SA +QEV   F FNL+EVE+ATQYFSE NLLG+S+FSA YKG LRDGSAVA+K I K+ C
Sbjct  384   SAFAQEVFGGFRFNLEEVETATQYFSEVNLLGRSNFSATYKGILRDGSAVAIKSIGKSCC  443

Query  968   KSDEAEFRKGLTLLTSLKHENLLRLRGFCCSKGRGECFLIYDFVSNGNLLRYLDVKDEKG  789
             K++E+EF KGL +LT L+HENL++LRGFCCSKGRGECFLIYDFV NGNLL+YLDVKD   
Sbjct  444   KTEESEFLKGLNMLTLLRHENLVKLRGFCCSKGRGECFLIYDFVPNGNLLQYLDVKDGDS  503

Query  788   KVLDWSTRTAIIKGIARGIKYLHGNKRNKPALVHRNISADKVLIDHLYKPLLSDSGLHKL  609
              VL+W+TR  I+KGIA+G+ YLHG K NKP LVH+NISA+KVLID  Y PLLSDSGLHKL
Sbjct  504   HVLEWTTRVCIVKGIAKGLSYLHGYKPNKPPLVHQNISAEKVLIDQRYNPLLSDSGLHKL  563

Query  608   LADDIVFSTLKGSAANGYLAPEYAITGRFTEKSDMYAFGVIILQILSGSCVVTQSNHQGA  429
             L +D+VFS LK SAA GYLAPEY  TGRFTEKSD+YAFGV+ILQILSG   VT +   GA
Sbjct  564   LTNDVVFSALKASAAMGYLAPEYTTTGRFTEKSDVYAFGVLILQILSGKRKVTSAMRIGA  623

Query  428   ELCRFEDFVDAKLGKDFVESEAAKLGKIALLCTHDSPSRRPAIDVVIQ  285
             E  RF+DF+D  L   F E EA+KL K ALLCTH+S   RP+++ V+Q
Sbjct  624   ESGRFQDFIDQNLNGRFFEYEASKLAKTALLCTHESAIERPSMEEVVQ  671



>ref|XP_008376456.1| PREDICTED: somatic embryogenesis receptor kinase 1 [Malus domestica]
Length=680

 Score =   791 bits (2044),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 410/648 (63%), Positives = 503/648 (78%), Gaps = 15/648 (2%)
 Frame = -3

Query  2198  LMAIKASLDPGNLVLSSWSPNVTDPCSVSSFEGIACNDLGQVVNISLQGKGLYGKIPPEI  2019
             L+ +KA LDP +L LSSW+ +  DPC   SFEGI CN+ GQV NISLQGK L GK+ P I
Sbjct  29    LLDMKALLDPQSLYLSSWTVS-GDPCD-GSFEGIGCNEAGQVANISLQGKRLSGKLSPAI  86

Query  2018  GQLNGLSGLYLHFNNLHGVIPKEIASLTQLSDLYLNMNDLSGFIPSEIGNMPNLQVLQLC  1839
              +L  L+G+Y+H+N+L G IP+EIA+LT+LSDLYLN+N+LSG IP EIG+M +LQVLQLC
Sbjct  87    AELKHLTGIYMHYNSLQGEIPREIANLTELSDLYLNVNNLSGVIPPEIGSMSSLQVLQLC  146

Query  1838  YNRFEGCIPNKLGSLKNLTVLALQSNQLTGAIPASlggltlltrldLSFNRLFGSIPVKL  1659
             YN+  G IP +LGSLKNL+VLALQSNQLTGAIPASLG L +L RLDLS N LFGSIP KL
Sbjct  147   YNQLTGSIPTQLGSLKNLSVLALQSNQLTGAIPASLGDLEMLMRLDLSVNHLFGSIPTKL  206

Query  1658  SEASKLEVLDLRNNTLSGNVPLGLKRLNEGFRYENNPGLCGTGFPSLALCSDSS-LNPTK  1482
             ++A  LEVLD+RNNTLSGNVPL LKRLNEGF YENN GLCG GF SL  C+ S  LN ++
Sbjct  207   ADAPVLEVLDVRNNTLSGNVPLALKRLNEGFSYENNLGLCGAGFMSLTACTTSGHLNTSR  266

Query  1481  PEPFGQGSNRLPTKDIPESANIPHQLNQNR-----KPQAAAAVVGVIGLFVILAVAGL--  1323
             PEPFG G   +PT+DIPE+A++P   NQ R     K   A+  V V  + V +A++G+  
Sbjct  267   PEPFGAG---VPTRDIPETAHVPLPCNQTRCSNLSKSHQASVAVVVGLIVVTIALSGVGF  323

Query  1322  FTFSWYRRRKQQIGSTVDISESRVSTDQPKV--LCRRSTSPLISLEYSNGWDPLAKDQSG  1149
               F+ +RRRKQ++G++ D ++ R+STD+ K   + R++ SPLISLEY+NGWDPLA  ++ 
Sbjct  324   LFFAQHRRRKQKLGNSFDTADGRLSTDEAKANGVYRKNGSPLISLEYANGWDPLADGRNL  383

Query  1148  SALSQEVLESFMFNLDEVESATQYFSETNLLGKSSFSAVYKGTLRDGSAVAVKCISKTSC  969
             S  +QEV +SF FNL+EVE+ATQYFSE NLLG+S+FSA YKG LRDGS V++K I K+ C
Sbjct  384   SVFAQEVFQSFRFNLEEVETATQYFSEVNLLGRSNFSATYKGILRDGSVVSIKSIGKSCC  443

Query  968   KSDEAEFRKGLTLLTSLKHENLLRLRGFCCSKGRGECFLIYDFVSNGNLLRYLDVKDEKG  789
             K++E+EF KGL +LTSL HENL+RLRGFCCSKGRGECFLIYDFV NGNL +YLDVKD   
Sbjct  444   KTEESEFLKGLNMLTSLTHENLVRLRGFCCSKGRGECFLIYDFVPNGNLQQYLDVKDGDS  503

Query  788   KVLDWSTRTAIIKGIARGIKYLHGNKRNKPALVHRNISADKVLIDHLYKPLLSDSGLHKL  609
               L+W+TR +I+KGIA+G+ YLHG K NKPALVH+NISA+KV ID  Y PLLSD GLHKL
Sbjct  504   HALEWTTRVSIVKGIAKGLSYLHGYKPNKPALVHQNISAEKVQIDEQYNPLLSDPGLHKL  563

Query  608   LADDIVFSTLKGSAANGYLAPEYAITGRFTEKSDMYAFGVIILQILSGSCVVTQSNHQGA  429
             L +D+VFS LK SAA GYLAPEY  TGRFTEKSD+YAFGV++LQILSG   VT S   GA
Sbjct  564   LTNDVVFSALKASAAMGYLAPEYTTTGRFTEKSDVYAFGVLVLQILSGKRKVTSSMRLGA  623

Query  428   ELCRFEDFVDAKLGKDFVESEAAKLGKIALLCTHDSPSRRPAIDVVIQ  285
             E  RF+DF+D  L   F E EA+KL K ALLCTH+SP  RP+++ V+Q
Sbjct  624   ESGRFQDFIDQNLNGRFFEYEASKLAKTALLCTHESPIERPSMEEVVQ  671



>ref|XP_004309271.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At5g63710-like [Fragaria vesca subsp. vesca]
Length=682

 Score =   790 bits (2041),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 412/649 (63%), Positives = 507/649 (78%), Gaps = 16/649 (2%)
 Frame = -3

Query  2198  LMAIKASLDPGNLVLSSWSPNVTDPCSVSSFEGIACNDLGQVVNISLQGKGLYGKIPPEI  2019
             LM IKA LDP +L LSSW+ +  DPC  +SFEG+ACN+ G+V NISLQGKGL GK+ P I
Sbjct  30    LMDIKALLDPQSLYLSSWTVH-GDPCD-TSFEGVACNEAGRVSNISLQGKGLDGKLSPAI  87

Query  2018  GQLNGLSGLYLHFNNLHGVIPKEIASLTQLSDLYLNMNDLSGFIPSEIGNMPNLQVLQLC  1839
             G+L  L+G+Y+H+N+L G IPKEIA+LTQLSDLYLN+N+LSG IP EIGNM +L+VLQLC
Sbjct  88    GELKDLTGIYMHYNSLKGEIPKEIANLTQLSDLYLNVNNLSGEIPPEIGNMGSLEVLQLC  147

Query  1838  YNRFEGCIPNKLGSLKNLTVLALQSNQLTGAIPASlggltlltrldLSFNRLFGSIPVKL  1659
             YN+  G IP +LGSLKNL+VLALQSNQLTGAIPASLG L +L RLDLS+N LFGSIP+K+
Sbjct  148   YNQLTGSIPTQLGSLKNLSVLALQSNQLTGAIPASLGNLEMLMRLDLSYNNLFGSIPMKV  207

Query  1658  SEASKLEVLDLRNNTLSGNVPLGLKRLNEGFRYENNPGLCGTGFPSLALCSDSS-LNPTK  1482
             ++A  LEVLD+RNNTLSGNVPL LKRLN+GF YENN GLCG GF SL  C+ SS LN ++
Sbjct  208   ADAPLLEVLDIRNNTLSGNVPLALKRLNDGFSYENNLGLCGAGFMSLTACNTSSHLNASR  267

Query  1481  PEPFGQGSNRLPTKDIPESANIPHQLNQNR-----KPQAAAAVVGVIGLFVILAVA--GL  1323
             PEPFG       T+ IPE+AN+    NQ+R     K   A+  V V  + + +A++  G+
Sbjct  268   PEPFGSTGT---TRAIPETANVQLPCNQSRCSNMSKSHQASVAVVVGIVVLTVALSAIGI  324

Query  1322  FTFSWYRRRKQQIGSTVDISESRVSTDQPK---VLCRRSTSPLISLEYSNGWDPLAKDQS  1152
               F+ +RR+KQ++GS+ D+S++R+S D+ K   V  R+  SPL+SLEYS GWDPLA  ++
Sbjct  325   LLFTQHRRQKQKLGSSFDVSDARLSVDETKAKGVAHRKYGSPLMSLEYSQGWDPLADGRN  384

Query  1151  GSALSQEVLESFMFNLDEVESATQYFSETNLLGKSSFSAVYKGTLRDGSAVAVKCISKTS  972
              SA +Q+V  SF FNLDEVE+ATQYFSE NLLGKS+FSA YKG LRDG+ VAVK I KT 
Sbjct  385   LSAFAQDVFHSFKFNLDEVETATQYFSEVNLLGKSNFSATYKGILRDGTVVAVKSIGKTC  444

Query  971   CKSDEAEFRKGLTLLTSLKHENLLRLRGFCCSKGRGECFLIYDFVSNGNLLRYLDVKDEK  792
             CK++EAEF KGL +LTSL+HENL++LRGFCCS+GRGECFLIY++V NG+LLRYLDVK+  
Sbjct  445   CKTEEAEFLKGLNMLTSLRHENLVKLRGFCCSRGRGECFLIYEYVPNGSLLRYLDVKEGD  504

Query  791   GKVLDWSTRTAIIKGIARGIKYLHGNKRNKPALVHRNISADKVLIDHLYKPLLSDSGLHK  612
               VL+WSTR +I+KGIA+G+ YLHG K NKPALVH+NISA+KVLID  + PLLS+SGLHK
Sbjct  505   SHVLEWSTRVSIVKGIAKGLSYLHGYKPNKPALVHQNISAEKVLIDQRFNPLLSNSGLHK  564

Query  611   LLADDIVFSTLKGSAANGYLAPEYAITGRFTEKSDMYAFGVIILQILSGSCVVTQSNHQG  432
             LL +D+VFS LK SAA GYLAPEY  TGRFTEKSD+YAFGV++ QILSG   VT S   G
Sbjct  565   LLTNDVVFSALKASAAMGYLAPEYTTTGRFTEKSDVYAFGVLVFQILSGKRKVTNSMRLG  624

Query  431   AELCRFEDFVDAKLGKDFVESEAAKLGKIALLCTHDSPSRRPAIDVVIQ  285
             AE  RFED++D  L   F E EA+KL   ALLCTH+SP  RP+I  V+Q
Sbjct  625   AESGRFEDYIDQNLNGRFFEYEASKLANTALLCTHESPIERPSIGEVVQ  673



>ref|XP_009370496.1| PREDICTED: somatic embryogenesis receptor kinase 2-like [Pyrus 
x bretschneideri]
Length=680

 Score =   790 bits (2041),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 411/648 (63%), Positives = 502/648 (77%), Gaps = 15/648 (2%)
 Frame = -3

Query  2198  LMAIKASLDPGNLVLSSWSPNVTDPCSVSSFEGIACNDLGQVVNISLQGKGLYGKIPPEI  2019
             L+ +KA LDP  L LSSW+ N  DPC   SFEGI CN  G V NISLQGK L GK+ P I
Sbjct  29    LLDMKALLDPQGLYLSSWTVN-GDPCD-GSFEGIGCNKAGHVANISLQGKRLSGKLSPAI  86

Query  2018  GQLNGLSGLYLHFNNLHGVIPKEIASLTQLSDLYLNMNDLSGFIPSEIGNMPNLQVLQLC  1839
              QL  L+G+Y+H+N+L G IP+EIA+LT+L+DLYLN+N+LSG IP EIG+M +LQVLQLC
Sbjct  87    AQLKHLTGIYMHYNSLQGEIPREIANLTELTDLYLNVNNLSGVIPPEIGSMSSLQVLQLC  146

Query  1838  YNRFEGCIPNKLGSLKNLTVLALQSNQLTGAIPASlggltlltrldLSFNRLFGSIPVKL  1659
             YN+  G IP +LGSLKNL+VLALQSNQLTGAIPASLG L +L RLDLS N LFGSIP KL
Sbjct  147   YNQLTGSIPTQLGSLKNLSVLALQSNQLTGAIPASLGDLEMLMRLDLSVNHLFGSIPTKL  206

Query  1658  SEASKLEVLDLRNNTLSGNVPLGLKRLNEGFRYENNPGLCGTGFPSLALCSDSS-LNPTK  1482
             ++A  LEVLD+RNNTLSGNVPL LKRLNEGF YENN GLCG GF SL  C+ S  LN ++
Sbjct  207   ADAPVLEVLDVRNNTLSGNVPLALKRLNEGFSYENNLGLCGAGFMSLTACTTSGHLNTSR  266

Query  1481  PEPFGQGSNRLPTKDIPESANIPHQLNQNR-----KPQAAAAVVGVIGLFVILAVAGL--  1323
             PEPF  G   +PT+DIPE+A++P   NQ R     K   A+  V V  + V +A++G+  
Sbjct  267   PEPFRAG---VPTRDIPETAHVPLPCNQTRCSNLSKSHQASVAVVVGLIVVTIALSGVGF  323

Query  1322  FTFSWYRRRKQQIGSTVDISESRVSTDQPKV--LCRRSTSPLISLEYSNGWDPLAKDQSG  1149
               F+ +RRRKQ++G++ D ++ R+STD+ K   + R++ SPLISLEY+NGWDPLA  ++ 
Sbjct  324   LFFAQHRRRKQKLGNSFDTADGRLSTDEAKGNGVYRKNGSPLISLEYANGWDPLADGRNL  383

Query  1148  SALSQEVLESFMFNLDEVESATQYFSETNLLGKSSFSAVYKGTLRDGSAVAVKCISKTSC  969
             SA +QEV +SF FNL+EVE+ATQYFSE NLLGKS+FSA YKG LRDGS V++K I K+ C
Sbjct  384   SAFAQEVFQSFRFNLEEVETATQYFSEVNLLGKSNFSATYKGILRDGSVVSIKSIGKSCC  443

Query  968   KSDEAEFRKGLTLLTSLKHENLLRLRGFCCSKGRGECFLIYDFVSNGNLLRYLDVKDEKG  789
             K++E+EF KGL +LTSL+HENL+ LRGFCCSKGRGECFLIYDFV NGNLL+YLDVKD   
Sbjct  444   KTEESEFLKGLNMLTSLRHENLVSLRGFCCSKGRGECFLIYDFVPNGNLLQYLDVKDGDS  503

Query  788   KVLDWSTRTAIIKGIARGIKYLHGNKRNKPALVHRNISADKVLIDHLYKPLLSDSGLHKL  609
              VL+W+TR +I+KGIA+G+ YLHG K NKPALVH+NISA+KV ID  Y PL+SD GLHKL
Sbjct  504   HVLEWTTRVSIVKGIAKGLSYLHGYKPNKPALVHQNISAEKVQIDQRYSPLVSDPGLHKL  563

Query  608   LADDIVFSTLKGSAANGYLAPEYAITGRFTEKSDMYAFGVIILQILSGSCVVTQSNHQGA  429
             L +D+VFS LK SAA GYLAPEY  TGRFTEKSD+YAFGV++LQILSG   VT S   GA
Sbjct  564   LTNDVVFSALKASAAMGYLAPEYTTTGRFTEKSDVYAFGVLVLQILSGKRKVTSSMRLGA  623

Query  428   ELCRFEDFVDAKLGKDFVESEAAKLGKIALLCTHDSPSRRPAIDVVIQ  285
             E  RF+DF+D  L   F E EA+KL K ALLCTH+SP  RP+++ V+Q
Sbjct  624   ESGRFQDFIDQNLKGRFFEYEASKLAKTALLCTHESPIERPSMEEVVQ  671



>ref|XP_004512590.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase At1g17230-like [Cicer arietinum]
Length=681

 Score =   790 bits (2039),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 402/645 (62%), Positives = 501/645 (78%), Gaps = 10/645 (2%)
 Frame = -3

Query  2198  LMAIKASLDPGNLVLSSWSPNVTDPCSVSSFEGIACNDLGQVVNISLQGKGLYGKIPPEI  2019
             L+ +K+SLDP    LSSW+ NV +PC   SFEG+ACN+ GQV NISLQGKGL+GK+ P I
Sbjct  31    LLDLKSSLDPHGHFLSSWTINV-NPCD-DSFEGVACNEKGQVANISLQGKGLFGKLSPAI  88

Query  2018  GQLNGLSGLYLHFNNLHGVIPKEIASLTQLSDLYLNMNDLSGFIPSEIGNMPNLQVLQLC  1839
             G L  L+GLYLH+N+L+G IP+EIA+LT LSDLYLN+N LSG IP EI  M NLQVLQLC
Sbjct  89    GDLKHLTGLYLHYNSLYGDIPREIANLTLLSDLYLNVNHLSGEIPHEISKMENLQVLQLC  148

Query  1838  YNRFEGCIPNKLGSLKNLTVLALQSNQLTGAIPASlggltlltrldLSFNRLFGSIPVKL  1659
             YN+  G IP +LG LK L+VLALQSN+LTGAIPASLG L +LTRLDLS N LFGSIP +L
Sbjct  149   YNQLTGSIPTQLGDLKKLSVLALQSNKLTGAIPASLGDLGMLTRLDLSSNNLFGSIPTRL  208

Query  1658  SEASKLEVLDLRNNTLSGNVPLGLKRLNEGFRYENNPGLCGTGFPSLALCSDSS-LNPTK  1482
             ++   L VLD+ NNTLSGNVP  LKRL+EGF YE N GLCG GF SL  C+ S  +NP +
Sbjct  209   ADVPLLHVLDVHNNTLSGNVPPALKRLDEGFVYEYNLGLCGDGFSSLKACNASEHVNPNR  268

Query  1481  PEPFGQGSNRLPTKDIPESANIPHQLNQNR------KPQAAAAVVGVIGLFVILAVAGLF  1320
             PEP+G G   + +K+IPE+ANI    N  R        +AA+  +G++   + ++  G+ 
Sbjct  269   PEPYGAGVGSI-SKEIPETANIKLPCNTTRCQNSSKSKKAASITIGIVLATIAVSAIGIL  327

Query  1319  TFSWYRRRKQQIGSTVDISESRVSTDQPKVLCRRSTSPLISLEYSNGWDPLAKDQSGSAL  1140
             +F+ YRRRKQ++GS  DI+ESR+STDQ K + R++ SPL+SLEY+NGWDPLA  ++ +  
Sbjct  328   SFTMYRRRKQKLGSAFDITESRLSTDQTKGIYRKNGSPLVSLEYANGWDPLADSRNFNGD  387

Query  1139  SQEVLESFMFNLDEVESATQYFSETNLLGKSSFSAVYKGTLRDGSAVAVKCISKTSCKSD  960
              +++ +SF FNL+EVESATQYFSE+NLLGKS+FSA YKG LRDGS VAVK ISKTSCKSD
Sbjct  388   REDMFQSFRFNLEEVESATQYFSESNLLGKSNFSATYKGILRDGSVVAVKSISKTSCKSD  447

Query  959   EAEFRKGLTLLTSLKHENLLRLRGFCCSKGRGECFLIYDFVSNGNLLRYLDVKDEKGKVL  780
             E EF KGL +LTSL+++NL+R RGFCCS+GRGECFL+YDFVSNGNL RYLD+K+  G+VL
Sbjct  448   EGEFLKGLNILTSLRNDNLVRFRGFCCSRGRGECFLVYDFVSNGNLSRYLDIKEGNGEVL  507

Query  779   DWSTRTAIIKGIARGIKYLHGNKRNKPALVHRNISADKVLIDHLYKPLLSDSGLHKLLAD  600
             +WSTR +I+KGIA+GI YLH  K NKPALVH+NISA+KVLID    P+LSDSGL+KLL +
Sbjct  508   EWSTRVSIVKGIAKGIAYLHAYKANKPALVHQNISAEKVLIDQRQNPVLSDSGLYKLLTN  567

Query  599   DIVFSTLKGSAANGYLAPEYAITGRFTEKSDMYAFGVIILQILSGSCVVTQSNHQGAELC  420
             DIVFS+LKGSAA GYLAPEY  TGRFTEKSD+YAFGV++ QIL+G   +T S    AE  
Sbjct  568   DIVFSSLKGSAAKGYLAPEYTTTGRFTEKSDVYAFGVLLFQILTGKHKITTSMRLAAESF  627

Query  419   RFEDFVDAKLGKDFVESEAAKLGKIALLCTHDSPSRRPAIDVVIQ  285
             +F++F+D  L   F E EAAKL K+ALLC+HDSP  RP ++ ++Q
Sbjct  628   KFQEFIDENLHGRFFEYEAAKLAKMALLCSHDSPFERPTMEAIVQ  672



>ref|XP_003548248.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
GSO2-like [Glycine max]
Length=684

 Score =   789 bits (2038),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 402/645 (62%), Positives = 500/645 (78%), Gaps = 10/645 (2%)
 Frame = -3

Query  2198  LMAIKASLDPGNLVLSSWSPNVTDPCSVSSFEGIACNDLGQVVNISLQGKGLYGKIPPEI  2019
             L+ +K+SLDP    LSSW+    +PC   SFEG+ACN+ GQV N+SLQGKGL GK+ P I
Sbjct  34    LLDLKSSLDPEGHFLSSWTMG-GNPCD-GSFEGVACNEKGQVANVSLQGKGLSGKLSPAI  91

Query  2018  GQLNGLSGLYLHFNNLHGVIPKEIASLTQLSDLYLNMNDLSGFIPSEIGNMPNLQVLQLC  1839
               L  L+GLYLH+N+L+G IP+E+A+LT+LSDLYLN+N LSG IP EIG M NLQVLQLC
Sbjct  92    AGLKHLTGLYLHYNSLYGEIPREVANLTELSDLYLNVNHLSGEIPPEIGKMENLQVLQLC  151

Query  1838  YNRFEGCIPNKLGSLKNLTVLALQSNQLTGAIPASlggltlltrldLSFNRLFGSIPVKL  1659
             YN+  G IP +LG LK L+VLALQSN L GAIPASLG L +L RLDLS N LFGSIP+KL
Sbjct  152   YNQLTGSIPTQLGDLKKLSVLALQSNLLGGAIPASLGDLGMLMRLDLSSNNLFGSIPIKL  211

Query  1658  SEASKLEVLDLRNNTLSGNVPLGLKRLNEGFRYENNPGLCGTGFPSLALCSDSS-LNPTK  1482
             ++   L+VLD+ NNTLSGNVP  LKRL EGF +E+N GLCG GF SL  C+ S  +N T+
Sbjct  212   ADLPSLQVLDVHNNTLSGNVPPALKRLEEGFVFEHNMGLCGVGFSSLKACTASDHVNLTR  271

Query  1481  PEPFGQGSNRLPTKDIPESANIP------HQLNQNRKPQAAAAVVGVIGLFVILAVAGLF  1320
             PEP+G G   L ++DIPE+AN+       H  N ++  QA +  VG++ L + ++  G+ 
Sbjct  272   PEPYGAGVGGL-SRDIPETANVKLPCNTTHCQNSSKSKQATSITVGIVLLTIAVSAIGIL  330

Query  1319  TFSWYRRRKQQIGSTVDISESRVSTDQPKVLCRRSTSPLISLEYSNGWDPLAKDQSGSAL  1140
             TF+ YRRRKQ++GST DISE  +STDQ K + R++ SPL+SLEYSNGWDPLA  ++ S  
Sbjct  331   TFTVYRRRKQKLGSTFDISEGCLSTDQAKSIYRKNGSPLVSLEYSNGWDPLADSKNFSGD  390

Query  1139  SQEVLESFMFNLDEVESATQYFSETNLLGKSSFSAVYKGTLRDGSAVAVKCISKTSCKSD  960
              Q++ +SF FNL+E+ESATQYFSE NLLGKS+FSA YKG LRDGS VAVK ISKTSCKSD
Sbjct  391   RQDMFQSFRFNLEEMESATQYFSELNLLGKSNFSATYKGVLRDGSVVAVKSISKTSCKSD  450

Query  959   EAEFRKGLTLLTSLKHENLLRLRGFCCSKGRGECFLIYDFVSNGNLLRYLDVKDEKGKVL  780
             EAEF KGL +LTSL++ENL+RLRGFCCS+GRGECFL+YDFVSNGNL RYLDVK+  G+VL
Sbjct  451   EAEFLKGLNILTSLRNENLVRLRGFCCSRGRGECFLVYDFVSNGNLTRYLDVKEGDGEVL  510

Query  779   DWSTRTAIIKGIARGIKYLHGNKRNKPALVHRNISADKVLIDHLYKPLLSDSGLHKLLAD  600
             +WSTR +I+KGIA+GI YLH  K NKPALVH++ISA+KVLID  Y PLLSDSGL+KLL +
Sbjct  511   EWSTRVSIVKGIAKGIAYLHAYKANKPALVHQSISAEKVLIDQRYNPLLSDSGLYKLLTN  570

Query  599   DIVFSTLKGSAANGYLAPEYAITGRFTEKSDMYAFGVIILQILSGSCVVTQSNHQGAELC  420
             D+VFS LKGSAA GYLAPEY  TGRFTEKSD+YAFGV++ QIL+G   +T +    AE  
Sbjct  571   DVVFSALKGSAAKGYLAPEYTTTGRFTEKSDVYAFGVLLFQILTGKQKITSAMRLAAESF  630

Query  419   RFEDFVDAKLGKDFVESEAAKLGKIALLCTHDSPSRRPAIDVVIQ  285
             +F +F+D  L   F E EAAKL ++ALLC+H+SP  RP+++ ++Q
Sbjct  631   KFPEFIDPNLRGKFFEYEAAKLARMALLCSHESPFERPSMEAIVQ  675



>ref|XP_004308453.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
GSO2-like [Fragaria vesca subsp. vesca]
Length=683

 Score =   788 bits (2035),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 418/655 (64%), Positives = 504/655 (77%), Gaps = 16/655 (2%)
 Frame = -3

Query  2216  ASTVSLLMAIKASLDPGNLVLSSWSPNVTDPCSVSSFEGIACNDLGQVVNISLQGKGLYG  2037
              S +  LMA+KASLDP N  L+SW+P ++DPC    FEG+ACN+ G V NISLQGKGL+G
Sbjct  24    VSELHALMAMKASLDPQNQFLTSWTP-LSDPCG-DDFEGVACNEQGLVTNISLQGKGLWG  81

Query  2036  KIPPEIGQLNGLSGLYLHFNNLHGVIPKEIASLTQLSDLYLNMNDLSGFIPSEIGNMPNL  1857
             +IP  +G L  L+GLYLHFN L G IPKEIA L QLSDLYLN+N+LSG IP +IGNMPNL
Sbjct  82    QIPSSVGDLKSLTGLYLHFNALSGKIPKEIADLDQLSDLYLNVNNLSGSIPRQIGNMPNL  141

Query  1856  QVLQLCYNRFEGCIPNKLGSLKNLTVLALQSNQLTGAIPASlggltlltrldLSFNRLFG  1677
             QVLQLCYN+  G IP +LG +++LTVLALQSNQLTGAIPASLG L  LTRLDLSFN  FG
Sbjct  142   QVLQLCYNKLTGGIPTELGHIRSLTVLALQSNQLTGAIPASLGELEALTRLDLSFNSFFG  201

Query  1676  SIPVKLSEASKLEVLDLRNNTLSGNVPLGLKRLNEGFRYENNPGLCGTGFPSLALCSDSS  1497
              IP +L++A  ++VLD+RNN LSGNVP  L+RLN GF+YENNP LCG GF  L +C+ ++
Sbjct  202   PIPARLADAPMIQVLDIRNNILSGNVPPALRRLNGGFQYENNPRLCGVGFSDLKVCNVNA  261

Query  1496  LNPTKPEPFGQGS-------NRLPTKDIPESANIPHQLNQNRKPQAAAAV-----VGVIG  1353
              NP  P+PF   +       N  P K IPESAN+    +Q+R   ++ +      +GVIG
Sbjct  262   QNPNMPQPFEPNNLSAKDLPNSPPAKIIPESANVQSSCSQSRCSGSSKSSQVGIVLGVIG  321

Query  1352  LFVILAVAGLFTFSWYRRRKQQIGSTVDISESRVSTDQPKVLCRRSTSPLISLEYSNGWD  1173
             + V L  AGLF FSWYRRRKQ+IG++ D  + R+STDQ K + ++S SPLISLEYS+GWD
Sbjct  322   VVVALTGAGLFMFSWYRRRKQKIGNSFDTFDIRLSTDQTKEVYKKSVSPLISLEYSSGWD  381

Query  1172  PLAKDQSGSALSQEVLESFMFNLDEVESATQYFSETNLLGKSSFSAVYKGTLRDGSAVAV  993
             PLAK   G   SQEVLESFMF+L+EV+ ATQ FSE NLL K++F +++KG LRDGS VAV
Sbjct  382   PLAKGNGG--YSQEVLESFMFSLEEVQRATQSFSELNLLRKNNFCSMFKGILRDGSVVAV  439

Query  992   KCISKTSCKSDEAEFRKGLTLLTSLKHENLLRLRGFCCSKGRGECFLIYDFVSNGNLLRY  813
              CI KTSCKSDEAEF KGL +LTSLKHENL+RLRGFCCSKGRGE FLIYDFV N +LL+Y
Sbjct  440   NCIGKTSCKSDEAEFLKGLKILTSLKHENLVRLRGFCCSKGRGEWFLIYDFVPNESLLQY  499

Query  812   LDVKDEKGKVLDWSTRTAIIKGIARGIKYLHGNKRNKPALVHRNISADKVLIDHLYKPLL  633
             LD+K   G+VL+WSTR +II GIA+GI YLHGN  NKPA+VH++ISA+KVLID  Y PLL
Sbjct  500   LDIKVGSGEVLEWSTRVSIINGIAKGIGYLHGNIGNKPAIVHQSISAEKVLIDSHYNPLL  559

Query  632   SDSGLHKLLADDIVFSTLKGSAANGYLAPEYAITGRFTEKSDMYAFGVIILQILSGSCVV  453
             SDSGLHKLLADDI++S LK SAA GYLAPEY  TGRFT KSD+YAFG+I+ QILSG   +
Sbjct  560   SDSGLHKLLADDIIYSMLKPSAAMGYLAPEYVTTGRFTGKSDVYAFGMIVFQILSGKRKI  619

Query  452   TQSNHQGAELCRFEDFVDAKLGKDFVESEAAKLGKIALLCTHDSPSRRPAIDVVI  288
             TQ   QGAE  +FEDF+DA L   F ESEA KLG+IAL CT +SP+ RP+I+ V+
Sbjct  620   TQVTRQGAEAGKFEDFIDANLEGKFSESEATKLGRIALHCTQESPNHRPSIEYVV  674



>ref|XP_006490241.1| PREDICTED: somatic embryogenesis receptor kinase 2-like [Citrus 
sinensis]
Length=675

 Score =   788 bits (2034),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 411/653 (63%), Positives = 502/653 (77%), Gaps = 9/653 (1%)
 Frame = -3

Query  2225  SNNASTVSLLMAIKASLDPGNLVLSSWSPNVTDPCSVSSFEGIACNDLGQVVNISLQGKG  2046
             +N  + +  LM +KA+LDP    LSSW+ N  DPC   SFEG+ACN+ GQV NISLQGKG
Sbjct  17    ANADTELRALMDLKAALDPEERYLSSWTIN-GDPCH-GSFEGVACNEKGQVANISLQGKG  74

Query  2045  LYGKIPPEIGQLNGLSGLYLHFNNLHGVIPKEIASLTQLSDLYLNMNDLSGFIPSEIGNM  1866
             LYGK+ P I  L  L+GLYLH+N+L+G IP+EIA+LT+LSDLYLN+N+LSG IP EIG M
Sbjct  75    LYGKVSPAIAGLKHLTGLYLHYNSLYGEIPREIANLTELSDLYLNVNNLSGDIPPEIGYM  134

Query  1865  PNLQVLQLCYNRFEGCIPNKLGSLKNLTVLALQSNQLTGAIPASlggltlltrldLSFNR  1686
              +LQVLQLCYNR  G IP +LGSL+ L+VLALQSNQLTGAIPA+LG L +L RLDLSFN 
Sbjct  135   GSLQVLQLCYNRLTGSIPTQLGSLRKLSVLALQSNQLTGAIPANLGDLGMLMRLDLSFNH  194

Query  1685  LFGSIPVKLSEASKLEVLDLRNNTLSGNVPLGLKRLNEGFRYENNPGLCGTGFPSLALCS  1506
             LFGSIP KL++A  LEVLD+RNNTLSG+VP  LKRLNEGF YENN  LCG GF +L  CS
Sbjct  195   LFGSIPRKLADAPLLEVLDIRNNTLSGSVPPALKRLNEGFLYENNLELCGVGFSALKTCS  254

Query  1505  DSS-LNPTKPEPFGQGSNRLPTKDIPESANIPHQLNQNR-----KPQAAAAVVGVIGLFV  1344
              SS +NP++ EP+G  +    T++IPE+AN+    NQ R     K   A+ V G+I + +
Sbjct  255   ASSNINPSRAEPYGAATTH-STRNIPETANVNFPCNQTRCSSSSKSHQASVVAGIIVVVI  313

Query  1343  ILAVAGLFTFSWYRRRKQQIGSTVDISESRVSTDQPKVLCRRSTSPLISLEYSNGWDPLA  1164
              L+  G+  F+ YRRRKQ++ S+ + ++SR+STDQ K + R++ SPLISLEY+NGWDPLA
Sbjct  314   ALSAIGILAFAQYRRRKQKLVSSFNAADSRLSTDQAKGVYRKNGSPLISLEYANGWDPLA  373

Query  1163  KDQSGSALSQEVLESFMFNLDEVESATQYFSETNLLGKSSFSAVYKGTLRDGSAVAVKCI  984
               ++ +  +QEV +SF FNL+EVE+ATQYFSE NLLGKS+FSA YKG LRDGS VA+K I
Sbjct  374   DGRNLNVFAQEVFQSFRFNLEEVEAATQYFSEVNLLGKSNFSATYKGILRDGSVVAIKSI  433

Query  983   SKTSCKSDEAEFRKGLTLLTSLKHENLLRLRGFCCSKGRGECFLIYDFVSNGNLLRYLDV  804
             SKTSCKSDE+EF KGL +LTSL HEN++RLRGFCCSKGRGECFL+YDFV NGNLL YLD+
Sbjct  434   SKTSCKSDESEFLKGLNILTSLMHENIVRLRGFCCSKGRGECFLVYDFVPNGNLLHYLDL  493

Query  803   KDEKGKVLDWSTRTAIIKGIARGIKYLHGNKRNKPALVHRNISADKVLIDHLYKPLLSDS  624
             KD  G VL+WSTR +I+KGIARGI YLH +  NKPALVH+NISA+ VL D  Y PLLSDS
Sbjct  494   KDGDGHVLEWSTRVSIVKGIARGIAYLHKHTANKPALVHQNISAENVLTDQRYNPLLSDS  553

Query  623   GLHKLLADDIVFSTLKGSAANGYLAPEYAITGRFTEKSDMYAFGVIILQILSGSCVVTQS  444
             GL  LL +DIVFS LK SAA GYLAPEY  TGRFTEKSD+YAFGV++LQ+LSG   VT  
Sbjct  554   GLQNLLTNDIVFSALKASAAMGYLAPEYTTTGRFTEKSDVYAFGVLVLQVLSGKRKVTNL  613

Query  443   NHQGAELCRFEDFVDAKLGKDFVESEAAKLGKIALLCTHDSPSRRPAIDVVIQ  285
                GAE   F++F+D  L   F E EAAKL  IA LCTH+SP  RP+++ ++Q
Sbjct  614   VRLGAESNSFQEFIDPNLHGRFFEYEAAKLASIASLCTHESPMERPSMEAIVQ  666



>ref|XP_006421744.1| hypothetical protein CICLE_v10004478mg [Citrus clementina]
 gb|ESR34984.1| hypothetical protein CICLE_v10004478mg [Citrus clementina]
Length=675

 Score =   784 bits (2025),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 411/653 (63%), Positives = 502/653 (77%), Gaps = 9/653 (1%)
 Frame = -3

Query  2225  SNNASTVSLLMAIKASLDPGNLVLSSWSPNVTDPCSVSSFEGIACNDLGQVVNISLQGKG  2046
             +N  + +  LM +KA+LDP    LSSW+ N  DPC   SFEGIACN+ GQV NISLQGKG
Sbjct  17    ANADTELRALMDMKAALDPEERYLSSWTIN-GDPCD-GSFEGIACNEKGQVANISLQGKG  74

Query  2045  LYGKIPPEIGQLNGLSGLYLHFNNLHGVIPKEIASLTQLSDLYLNMNDLSGFIPSEIGNM  1866
             L GK+ P I  L  L+GLYLH+N+L+G IP+EIA+LT+LSDLYLN+N+LSG IP EIG M
Sbjct  75    LNGKVSPAIAGLKHLTGLYLHYNSLYGQIPREIANLTELSDLYLNVNNLSGDIPPEIGYM  134

Query  1865  PNLQVLQLCYNRFEGCIPNKLGSLKNLTVLALQSNQLTGAIPASlggltlltrldLSFNR  1686
              +LQVLQLCYN+  G IP +LGSL+ L+VLALQSNQLTGAIPA+LG L +L RLDLSFN 
Sbjct  135   GSLQVLQLCYNQLTGSIPTQLGSLRKLSVLALQSNQLTGAIPANLGDLGMLMRLDLSFNH  194

Query  1685  LFGSIPVKLSEASKLEVLDLRNNTLSGNVPLGLKRLNEGFRYENNPGLCGTGFPSLALCS  1506
             LFGSIP KL++A  LEVLD+RNNTLSG+VP  LKRLNEGF YENN  LCG GF +L  CS
Sbjct  195   LFGSIPRKLADAPLLEVLDIRNNTLSGSVPPALKRLNEGFLYENNLELCGVGFSALKTCS  254

Query  1505  DSS-LNPTKPEPFGQGSNRLPTKDIPESANIPHQLNQNR-----KPQAAAAVVGVIGLFV  1344
              SS +NP++PEP+G  +    T++IPE+AN+    NQ +     K   A+ V G+I + V
Sbjct  255   ASSNINPSRPEPYGAATTH-STRNIPETANVNLPCNQTQCSSSSKSHQASVVAGIIVVVV  313

Query  1343  ILAVAGLFTFSWYRRRKQQIGSTVDISESRVSTDQPKVLCRRSTSPLISLEYSNGWDPLA  1164
              L+  G+  F+ Y RRKQ++GS+ + ++SR+STDQ K + R++ SPLISLEY NGWDPLA
Sbjct  314   ALSAIGILAFTQYHRRKQKLGSSFNAADSRLSTDQAKGVYRKNGSPLISLEYGNGWDPLA  373

Query  1163  KDQSGSALSQEVLESFMFNLDEVESATQYFSETNLLGKSSFSAVYKGTLRDGSAVAVKCI  984
               ++ +  +QEV +SF FNL+EVE+ATQYFSE NLLGKS+FSA YKG LRDGS VA+K I
Sbjct  374   DGRNLNVFAQEVFQSFRFNLEEVETATQYFSEVNLLGKSNFSATYKGILRDGSVVAIKSI  433

Query  983   SKTSCKSDEAEFRKGLTLLTSLKHENLLRLRGFCCSKGRGECFLIYDFVSNGNLLRYLDV  804
             SKTSCKSDE+EF KGL +LTSL HEN++RLRGFCCSKGRGECFL+YDFV NGNLL YLD+
Sbjct  434   SKTSCKSDESEFLKGLNILTSLMHENIVRLRGFCCSKGRGECFLVYDFVPNGNLLHYLDL  493

Query  803   KDEKGKVLDWSTRTAIIKGIARGIKYLHGNKRNKPALVHRNISADKVLIDHLYKPLLSDS  624
             KD  G VL+WSTR +I+KGIA+GI YLH +  NKPALVH+NISA+ VL D  Y PLLSDS
Sbjct  494   KDGDGHVLEWSTRVSIVKGIAKGIAYLHKHTANKPALVHQNISAENVLTDQRYNPLLSDS  553

Query  623   GLHKLLADDIVFSTLKGSAANGYLAPEYAITGRFTEKSDMYAFGVIILQILSGSCVVTQS  444
             GL  LL +DIVFS LK SAA GYLAPEY  TGRFTEKSD+YAFGV++LQ+LSG   VT  
Sbjct  554   GLQNLLTNDIVFSALKASAAMGYLAPEYTTTGRFTEKSDVYAFGVLVLQVLSGKRRVTNL  613

Query  443   NHQGAELCRFEDFVDAKLGKDFVESEAAKLGKIALLCTHDSPSRRPAIDVVIQ  285
                GAE  RF++F+D  L   F E EAAKL  IA LCTH+SP+ RP ++ ++Q
Sbjct  614   VRLGAESNRFQEFIDPNLHGRFFEYEAAKLASIASLCTHESPTERPPMEAIVQ  666



>gb|KHN24426.1| Protein NSP-INTERACTING KINASE 2 [Glycine soja]
Length=684

 Score =   784 bits (2025),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 401/645 (62%), Positives = 499/645 (77%), Gaps = 10/645 (2%)
 Frame = -3

Query  2198  LMAIKASLDPGNLVLSSWSPNVTDPCSVSSFEGIACNDLGQVVNISLQGKGLYGKIPPEI  2019
             L+ +K+SLDP    LSSW+    +PC   SFEG+ACN+ GQV N+SLQGKGL GK+ P I
Sbjct  34    LLDLKSSLDPEGHFLSSWTMG-GNPCD-GSFEGVACNEKGQVANVSLQGKGLSGKLSPAI  91

Query  2018  GQLNGLSGLYLHFNNLHGVIPKEIASLTQLSDLYLNMNDLSGFIPSEIGNMPNLQVLQLC  1839
               L  L+GLYLH+N+L+G IP+E+A+LT+LSDLYLN+N LSG IP EIG M NLQVLQLC
Sbjct  92    AGLKHLTGLYLHYNSLYGEIPREVANLTELSDLYLNVNHLSGEIPPEIGKMENLQVLQLC  151

Query  1838  YNRFEGCIPNKLGSLKNLTVLALQSNQLTGAIPASlggltlltrldLSFNRLFGSIPVKL  1659
             YN+  G IP +LG LK L+VLALQSN L GAIPASLG L +L RLDLS N LFGSIP+KL
Sbjct  152   YNQLTGSIPTQLGDLKKLSVLALQSNLLGGAIPASLGDLGMLMRLDLSSNNLFGSIPIKL  211

Query  1658  SEASKLEVLDLRNNTLSGNVPLGLKRLNEGFRYENNPGLCGTGFPSLALCSDSS-LNPTK  1482
             ++   L+VLD+ NNTLSGNV   LKRL EGF +E+N GLCG GF SL  C+ S  +N T+
Sbjct  212   ADLPSLQVLDVHNNTLSGNVHPALKRLEEGFVFEHNMGLCGVGFSSLKACTASDHVNLTR  271

Query  1481  PEPFGQGSNRLPTKDIPESANIP------HQLNQNRKPQAAAAVVGVIGLFVILAVAGLF  1320
             PEP+G G   L ++DIPE+AN+       H  N ++  QA +  VG++ L + ++  G+ 
Sbjct  272   PEPYGAGVGGL-SRDIPETANVKLPCNTTHCQNPSKSKQATSITVGIVLLTIAVSAIGIL  330

Query  1319  TFSWYRRRKQQIGSTVDISESRVSTDQPKVLCRRSTSPLISLEYSNGWDPLAKDQSGSAL  1140
             TF+ YRRRKQ++GST DISE  +STDQ K + R++ SPL+SLEYSNGWDPLA  ++ S  
Sbjct  331   TFTMYRRRKQKLGSTFDISEGCLSTDQAKSIYRKNGSPLVSLEYSNGWDPLADSKNFSGD  390

Query  1139  SQEVLESFMFNLDEVESATQYFSETNLLGKSSFSAVYKGTLRDGSAVAVKCISKTSCKSD  960
              Q++ +SF FNL+E+ESATQYFSE NLLGKS+FSA YKG LRDGS VAVK ISKTSCKSD
Sbjct  391   RQDMFQSFRFNLEEMESATQYFSELNLLGKSNFSATYKGVLRDGSVVAVKSISKTSCKSD  450

Query  959   EAEFRKGLTLLTSLKHENLLRLRGFCCSKGRGECFLIYDFVSNGNLLRYLDVKDEKGKVL  780
             EAEF KGL +LTSL++ENL+RLRGFCCS+GRGECFL+YDFVSNGNL RYLDVK+  G+VL
Sbjct  451   EAEFLKGLNILTSLRNENLVRLRGFCCSRGRGECFLVYDFVSNGNLSRYLDVKEGDGEVL  510

Query  779   DWSTRTAIIKGIARGIKYLHGNKRNKPALVHRNISADKVLIDHLYKPLLSDSGLHKLLAD  600
             +WSTR +I+KGIA+GI YLH  K NKPALVH++ISA+KVLID  Y PLLSDSGL+KLL +
Sbjct  511   EWSTRVSIVKGIAKGIAYLHAYKANKPALVHQSISAEKVLIDQRYNPLLSDSGLYKLLTN  570

Query  599   DIVFSTLKGSAANGYLAPEYAITGRFTEKSDMYAFGVIILQILSGSCVVTQSNHQGAELC  420
             D+VFS LKGSAA GYLAPEY  TGRFTEKSD+YAFGV++ QIL+G   +T +    AE  
Sbjct  571   DVVFSALKGSAAKGYLAPEYTTTGRFTEKSDVYAFGVLLFQILTGKQKITSAMRLAAESF  630

Query  419   RFEDFVDAKLGKDFVESEAAKLGKIALLCTHDSPSRRPAIDVVIQ  285
             +F +F+D  L   F E EAAKL ++ALLC+H+SP  RP+++ ++Q
Sbjct  631   KFPEFIDPNLRGKFFEYEAAKLARMALLCSHESPFERPSMEAIVQ  675



>ref|XP_003534047.1| PREDICTED: somatic embryogenesis receptor kinase 4-like [Glycine 
max]
 gb|KHN27862.1| Protein NSP-INTERACTING KINASE 2 [Glycine soja]
Length=683

 Score =   783 bits (2023),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 404/645 (63%), Positives = 498/645 (77%), Gaps = 10/645 (2%)
 Frame = -3

Query  2198  LMAIKASLDPGNLVLSSWSPNVTDPCSVSSFEGIACNDLGQVVNISLQGKGLYGKIPPEI  2019
             L+ +K+SLDP    LSSW+ + T PC   SFEG+ACN+ GQV N+SLQGKGL GK+ P I
Sbjct  33    LLDLKSSLDPEGHFLSSWTIDGT-PCG-GSFEGVACNEKGQVANVSLQGKGLSGKLSPAI  90

Query  2018  GQLNGLSGLYLHFNNLHGVIPKEIASLTQLSDLYLNMNDLSGFIPSEIGNMPNLQVLQLC  1839
               L  L+GLYLH+N+L+G IP+E+A+LT+LSDLYLN+N LSG IP EIG M +LQVLQLC
Sbjct  91    AGLKHLTGLYLHYNSLYGEIPRELANLTELSDLYLNVNHLSGEIPPEIGMMESLQVLQLC  150

Query  1838  YNRFEGCIPNKLGSLKNLTVLALQSNQLTGAIPASlggltlltrldLSFNRLFGSIPVKL  1659
             YN+  G IP +L  LK L+VLALQSNQ  GAIPASLG L +L RLDLS N LFGSIP KL
Sbjct  151   YNQLTGSIPTQLSDLKKLSVLALQSNQFAGAIPASLGDLGMLMRLDLSSNNLFGSIPTKL  210

Query  1658  SEASKLEVLDLRNNTLSGNVPLGLKRLNEGFRYENNPGLCGTGFPSLALCSDSS-LNPTK  1482
             ++   L+VLD+ NNTLSGNVP  LKRL EGF +E+N GLCG GF SL  C+ S   N T+
Sbjct  211   ADLPLLQVLDVHNNTLSGNVPPALKRLEEGFVFEHNVGLCGVGFSSLKACTASDHANLTR  270

Query  1481  PEPFGQGSNRLPTKDIPESANI--PHQLNQNRKP----QAAAAVVGVIGLFVILAVAGLF  1320
             PEP+G G   L ++DIPE+AN+  P    Q R P    QAA+  VG++ + + ++  G+F
Sbjct  271   PEPYGAGVGGL-SRDIPETANVKLPCNTTQCRNPSRSKQAASITVGIVLVTIAVSAIGIF  329

Query  1319  TFSWYRRRKQQIGSTVDISESRVSTDQPKVLCRRSTSPLISLEYSNGWDPLAKDQSGSAL  1140
             TF+ YRRRKQ++GST DISE R+STDQ K + R++ SPL+SLEYSNGWDPLA  ++ +  
Sbjct  330   TFTMYRRRKQKLGSTFDISEGRLSTDQAKSIYRKNGSPLVSLEYSNGWDPLADGKNVNGD  389

Query  1139  SQEVLESFMFNLDEVESATQYFSETNLLGKSSFSAVYKGTLRDGSAVAVKCISKTSCKSD  960
              Q++ +SF FNL+EVESATQYFSE NLLGKS+FSA YKG LRDGS VAVK ISKTSCKSD
Sbjct  390   RQDMFQSFRFNLEEVESATQYFSELNLLGKSNFSATYKGVLRDGSVVAVKSISKTSCKSD  449

Query  959   EAEFRKGLTLLTSLKHENLLRLRGFCCSKGRGECFLIYDFVSNGNLLRYLDVKDEKGKVL  780
             EAEF KGL +LTSL++ENL+RLRGFCCS+GRGECFL+YDFVSNGNL  YLDVK+  G+VL
Sbjct  450   EAEFLKGLNILTSLRNENLVRLRGFCCSRGRGECFLVYDFVSNGNLSCYLDVKEGDGEVL  509

Query  779   DWSTRTAIIKGIARGIKYLHGNKRNKPALVHRNISADKVLIDHLYKPLLSDSGLHKLLAD  600
             +WSTR +I+KGIA+GI YLH  K  K ALVH+NISA+KVLID  Y PLLSDSGL+KLL +
Sbjct  510   EWSTRVSIVKGIAKGIAYLHAYKAKKQALVHQNISAEKVLIDQRYNPLLSDSGLYKLLTN  569

Query  599   DIVFSTLKGSAANGYLAPEYAITGRFTEKSDMYAFGVIILQILSGSCVVTQSNHQGAELC  420
             DIVFS LKGSAA GYLAPEY  TGRFTEKSD+YAFGV++ QIL+G   +T +    AE  
Sbjct  570   DIVFSALKGSAAKGYLAPEYTTTGRFTEKSDVYAFGVLLFQILTGKQKITSAMRLAAESF  629

Query  419   RFEDFVDAKLGKDFVESEAAKLGKIALLCTHDSPSRRPAIDVVIQ  285
             +F +F+D  L   F E EAAKL ++ALLC+H+SP  RP+++ ++Q
Sbjct  630   KFPEFIDPNLHGKFFEYEAAKLARMALLCSHESPFERPSMEAIVQ  674



>ref|XP_007152413.1| hypothetical protein PHAVU_004G128100g [Phaseolus vulgaris]
 gb|ESW24407.1| hypothetical protein PHAVU_004G128100g [Phaseolus vulgaris]
Length=684

 Score =   783 bits (2021),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 396/645 (61%), Positives = 497/645 (77%), Gaps = 9/645 (1%)
 Frame = -3

Query  2198  LMAIKASLDPGNLVLSSWSPNVTDPCSVSSFEGIACNDLGQVVNISLQGKGLYGKIPPEI  2019
             LM +K+SLDP    LSSW+ +  + C    FEG+ACN++GQV N+SLQGKGL G++ P I
Sbjct  33    LMDLKSSLDPEGQFLSSWTLD-GNACG-GYFEGVACNEMGQVANVSLQGKGLSGRLSPAI  90

Query  2018  GQLNGLSGLYLHFNNLHGVIPKEIASLTQLSDLYLNMNDLSGFIPSEIGNMPNLQVLQLC  1839
               L  L+GLYLH+N+L+G IP+E+A+LT+LSDLYLN+N LSG IP EIG M NLQVLQLC
Sbjct  91    AGLKHLTGLYLHYNSLYGEIPREVANLTELSDLYLNVNHLSGEIPPEIGRMENLQVLQLC  150

Query  1838  YNRFEGCIPNKLGSLKNLTVLALQSNQLTGAIPASlggltlltrldLSFNRLFGSIPVKL  1659
             YN+  G IP +LG LK L+VLALQSNQL GAIPA LG L +LTRLDLS N LFGSIP KL
Sbjct  151   YNQLTGSIPTQLGDLKKLSVLALQSNQLAGAIPAILGDLGMLTRLDLSSNSLFGSIPTKL  210

Query  1658  SEASKLEVLDLRNNTLSGNVPLGLKRLNEGFRYENNPGLCGTGFPSLALCSDS-SLNPTK  1482
             +    L+VLD+ NNTLSGNVP  LKRL  GF YE+N GLCG GF SL  C+ S ++N T+
Sbjct  211   ANLPSLQVLDVHNNTLSGNVPTALKRLEGGFVYEHNVGLCGVGFSSLKACTASGNVNLTR  270

Query  1481  PEPFGQGSNRLPTKDIPESANIP------HQLNQNRKPQAAAAVVGVIGLFVILAVAGLF  1320
             PEP+G G     T+DIPE+AN+       H  N ++  QA +  VG++   + ++  G+ 
Sbjct  271   PEPYGAGVGSSITRDIPETANVKSPCNTSHCQNPSKSKQATSITVGIVLATIAISAIGIL  330

Query  1319  TFSWYRRRKQQIGSTVDISESRVSTDQPKVLCRRSTSPLISLEYSNGWDPLAKDQSGSAL  1140
             TF+ YRR+KQ++GS  DISE R+ST+Q K + R++ SPL+SLEYSNGWDPLA  ++ +  
Sbjct  331   TFTMYRRQKQKLGSAFDISEGRLSTEQAKSIYRKNGSPLVSLEYSNGWDPLADSRNFNGD  390

Query  1139  SQEVLESFMFNLDEVESATQYFSETNLLGKSSFSAVYKGTLRDGSAVAVKCISKTSCKSD  960
              Q++ +SF FNL+EVESATQYFSE NLLGKS+FSA YKG LRDGSAVAVK ISKTSCKSD
Sbjct  391   KQDLFQSFRFNLEEVESATQYFSELNLLGKSNFSATYKGVLRDGSAVAVKSISKTSCKSD  450

Query  959   EAEFRKGLTLLTSLKHENLLRLRGFCCSKGRGECFLIYDFVSNGNLLRYLDVKDEKGKVL  780
             EAEF KGL +LTSL++E+L+RLRGFCCS+GRGECFL+YDFV NGNL RYLDVK+  G+VL
Sbjct  451   EAEFLKGLNILTSLRNEHLVRLRGFCCSRGRGECFLVYDFVPNGNLTRYLDVKEGDGEVL  510

Query  779   DWSTRTAIIKGIARGIKYLHGNKRNKPALVHRNISADKVLIDHLYKPLLSDSGLHKLLAD  600
             +WSTR +I+KGIA+GI YLH +K NKPALVH+NISA+KVLID  Y P+LSDSGL+KLL +
Sbjct  511   EWSTRISIVKGIAKGIAYLHAHKANKPALVHQNISAEKVLIDQRYNPMLSDSGLYKLLTN  570

Query  599   DIVFSTLKGSAANGYLAPEYAITGRFTEKSDMYAFGVIILQILSGSCVVTQSNHQGAELC  420
             DIVFS LKGSAA GYLAPEY  TGRFTEKSD+YAFGV++ QI++G   +T +    AE  
Sbjct  571   DIVFSALKGSAAKGYLAPEYTTTGRFTEKSDVYAFGVLLFQIITGKQKITSAMRLAAESF  630

Query  419   RFEDFVDAKLGKDFVESEAAKLGKIALLCTHDSPSRRPAIDVVIQ  285
              F++F+D  L   F E EAAKL ++ALLC+H+S   RP+++ ++Q
Sbjct  631   TFQEFIDPNLRGKFFEYEAAKLARMALLCSHESQFERPSMEAIVQ  675



>ref|XP_011076309.1| PREDICTED: BRASSINOSTEROID INSENSITIVE 1-associated receptor 
kinase 1 [Sesamum indicum]
Length=671

 Score =   781 bits (2017),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 406/649 (63%), Positives = 495/649 (76%), Gaps = 10/649 (2%)
 Frame = -3

Query  2213  STVSLLMAIKASLDPGNLVLSSWSPNVTDPCSVSSFEGIACNDLGQVVNISLQGKGLYGK  2034
             S ++ LM +KASLDP NL L SW      PC   SFEG+ACN+ GQV NISLQGKGL GK
Sbjct  23    SELTSLMDLKASLDPENLHLGSWVV-AGHPCD-GSFEGVACNEKGQVANISLQGKGLAGK  80

Query  2033  IPPEIGQLNGLSGLYLHFNNLHGVIPKEIASLTQLSDLYLNMNDLSGFIPSEIGNMPNLQ  1854
             + P +G L  L+GLYLH+N+L+G IP EIA+LT+L+DLYLN+N+LSG IP  +GNM NLQ
Sbjct  81    LSPAVGGLKHLTGLYLHYNSLYGEIPVEIANLTELTDLYLNVNNLSGEIPPVLGNMANLQ  140

Query  1853  VLQLCYNRFEGCIPNKLGSLKNLTVLALQSNQLTGAIPASlggltlltrldLSFNRLFGS  1674
             VLQLCYN+F G IP +L  LK L VLALQSN LTGAIPASLG L +L RLDLSFN+LFGS
Sbjct  141   VLQLCYNQFTGSIPTQLSYLKKLNVLALQSNLLTGAIPASLGNLGVLMRLDLSFNQLFGS  200

Query  1673  IPVKLSEASKLEVLDLRNNTLSGNVPLGLKRLNEGFRYENNPGLCGTGFPSLALCSDSSL  1494
             IP KL++A  LEVLD+RNNTLSGNVPL LKRL +GF YENNPGLCG+GF SL  CSDS  
Sbjct  201   IPAKLADAPMLEVLDVRNNTLSGNVPLALKRLVDGFLYENNPGLCGSGFSSLRSCSDSGR  260

Query  1493  -NPTKPEPFGQGSNRLPTKDIPESANIPHQLN-----QNRKPQAAAAVVGVIGLFVILAV  1332
              N  +PEP+  G+  LPT+DIPE+A++    N     +  K   A+  VGVI   VIL+ 
Sbjct  261   PNSDRPEPYAGGATGLPTRDIPETADLNLNCNGSPCSKKSKTSQASVAVGVIVATVILSA  320

Query  1331  AGLFTFSWYRRRKQQIGSTVDISESRVSTDQPKVLCRRSTSPLISLEYSNGWDPLAKDQS  1152
              G+ +F  YRRRKQ++GS  DISESR+STD  K   R++ SPL+SLEY+NGWDPLA+ + 
Sbjct  321   LGIMSFLLYRRRKQKLGSAFDISESRLSTDHVKETYRKNGSPLVSLEYANGWDPLAEGRR  380

Query  1151  GSALSQEVLESFMFNLDEVESATQYFSETNLLGKSSFSAVYKGTLRDGSAVAVKCISKTS  972
                +SQEV+++F  NL EVESATQYF+E NLLGKS++S  YKG LRDGS VAVK I+K+S
Sbjct  381   -FGVSQEVMQNFRLNLQEVESATQYFAEKNLLGKSNYSVTYKGMLRDGSVVAVKRITKSS  439

Query  971   CKSDEAEFRKGLTLLTSLKHENLLRLRGFCCSKGRGECFLIYDFVSNGNLLRYLDVKDEK  792
             CKS+EAEF KGL +LTSL+HENL+ LRGFCCSKGRGECFL+YDFV NG+L RYLD+K+  
Sbjct  440   CKSEEAEFLKGLNILTSLRHENLVMLRGFCCSKGRGECFLVYDFVPNGSLFRYLDLKEGD  499

Query  791   GKVLDWSTRTAIIKGIARGIKYLHGNKRNKPALVHRNISADKVLIDHLYKPLLSDSGLHK  612
             G++L+WSTR +IIKGIA+GI+YLH  K NKP+LVH+NISA  VLIDH  KP+LSDS LHK
Sbjct  500   GQILEWSTRVSIIKGIAKGIEYLHDCKVNKPSLVHQNISAKNVLIDHRLKPVLSDSCLHK  559

Query  611   LLADDIVFSTLKGSAANGYLAPEYAITGRFTEKSDMYAFGVIILQILSGSCVVTQSNHQG  432
             LL +D +FS LK SAA GYLAPEY  TGRFT+KSD+YAFGV++ QILSG    + S    
Sbjct  560   LLTNDTIFSALKASAAMGYLAPEYTTTGRFTKKSDIYAFGVLVFQILSGKRKYSTSMRAT  619

Query  431   AELCRFEDFVDAKLGKDFVESEAAKLGKIALLCTHDSPSRRPAIDVVIQ  285
             AE    E F+D  L   F E EAA L K+A+LCTH+SP  RP+++ ++Q
Sbjct  620   AESSSLE-FIDGNLHGKFYEPEAAMLTKVAILCTHESPDDRPSMETLVQ  667



>ref|XP_009791302.1| PREDICTED: somatic embryogenesis receptor kinase 4 [Nicotiana 
sylvestris]
Length=681

 Score =   781 bits (2018),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 405/645 (63%), Positives = 503/645 (78%), Gaps = 10/645 (2%)
 Frame = -3

Query  2198  LMAIKASLDPGNLVLSSWSPNVTDPCSVSSFEGIACNDLGQVVNISLQGKGLYGKIPPEI  2019
             LM +KASLDP N +L SW+ +  DPC   SFEG+ACN+ GQV NISLQGK L GK+ P I
Sbjct  31    LMDLKASLDPENALLISWTVS-GDPCD-GSFEGVACNEKGQVANISLQGKRLSGKLSPAI  88

Query  2018  GQLNGLSGLYLHFNNLHGVIPKEIASLTQLSDLYLNMNDLSGFIPSEIGNMPNLQVLQLC  1839
               L+ L+GLYLH+N+L+G IP+EI+SL +LSDLYLN+N+LSG IP E+GNM +LQVLQLC
Sbjct  89    AGLSHLTGLYLHYNSLYGEIPREISSLIELSDLYLNVNNLSGEIPPELGNMSSLQVLQLC  148

Query  1838  YNRFEGCIPNKLGSLKNLTVLALQSNQLTGAIPASlggltlltrldLSFNRLFGSIPVKL  1659
             YN+F G IP +LG+LK L VLALQSNQLTGAIPASLG L +L R+DLS N LFGSIP KL
Sbjct  149   YNQFSGSIPTQLGTLKKLNVLALQSNQLTGAIPASLGELGVLMRVDLSSNHLFGSIPTKL  208

Query  1658  SEASKLEVLDLRNNTLSGNVPLGLKRLNEGFRYENNPGLCGTGFPSLALCS--DSSLNPT  1485
             ++A  LEVLD+R+N LSGNVPL LKRL  GF+YENNPGLCG GFPSL +C+  D S NP 
Sbjct  209   ADAPLLEVLDIRSNKLSGNVPLALKRLVGGFQYENNPGLCGVGFPSLRVCTSLDRS-NPN  267

Query  1484  KPEPFGQGSNRLPTKDIPESANIPHQLNQN-----RKPQAAAAVVGVIGLFVILAVAGLF  1320
             +PEP+G GS+ L T+DIPE+AN+    + N      K   A+ VVGVI + VI +  G+ 
Sbjct  268   RPEPYGGGSSGLSTRDIPETANLNLNCSGNGCAKSSKTSQASVVVGVIVVTVIASAIGVL  327

Query  1319  TFSWYRRRKQQIGSTVDISESRVSTDQPKVLCRRSTSPLISLEYSNGWDPLAKDQSGSAL  1140
             TF+ YRRRKQ++G  +D+ +SR+STDQ K + R++ SPL+SLEYS+GWDPLA+ +    +
Sbjct  328   TFTHYRRRKQKLGGGLDMCDSRLSTDQTKEVNRKNGSPLVSLEYSSGWDPLAEGRRYGGV  387

Query  1139  SQEVLESFMFNLDEVESATQYFSETNLLGKSSFSAVYKGTLRDGSAVAVKCISKTSCKSD  960
             SQEVL+S+ FNL+EVESATQYF++ N L KSSFS  Y+GTLRDGS +AV  I+K SCKS+
Sbjct  388   SQEVLQSYRFNLEEVESATQYFADKNRLAKSSFSTTYRGTLRDGSLIAVTRITKISCKSE  447

Query  959   EAEFRKGLTLLTSLKHENLLRLRGFCCSKGRGECFLIYDFVSNGNLLRYLDVKDEKGKVL  780
             EAEF +GL +LTSL+HENL+RLRGFCCSK RGECFL+YDFV  GNLL YLDVK+++ + L
Sbjct  448   EAEFLRGLNILTSLRHENLVRLRGFCCSKSRGECFLVYDFVPRGNLLHYLDVKEDEARAL  507

Query  779   DWSTRTAIIKGIARGIKYLHGNKRNKPALVHRNISADKVLIDHLYKPLLSDSGLHKLLAD  600
             +WSTR +II G A+G++YLHG K NKPALVH+NI A+ VL+D  +KPLLS+SGLHKLL +
Sbjct  508   EWSTRVSIISGTAKGLEYLHGGKVNKPALVHQNICAENVLLDQRFKPLLSNSGLHKLLTN  567

Query  599   DIVFSTLKGSAANGYLAPEYAITGRFTEKSDMYAFGVIILQILSGSCVVTQSNHQGAELC  420
             DIVFS LK SAA GYLAPEY+ TGRFTE+SD+YAFGV+I QILSG    T S    AE C
Sbjct  568   DIVFSALKASAAMGYLAPEYSTTGRFTERSDIYAFGVLIFQILSGKRKFTSSMRAAAESC  627

Query  419   RFEDFVDAKLGKDFVESEAAKLGKIALLCTHDSPSRRPAIDVVIQ  285
             +  D +DA L   F ESEAAKL KIALLCTH+ P  RP ++ +++
Sbjct  628   KLHDLMDANLRGRFSESEAAKLAKIALLCTHECPEERPTMETIVR  672



>ref|XP_008438169.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g34110 isoform X1 [Cucumis melo]
Length=691

 Score =   780 bits (2015),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 402/652 (62%), Positives = 492/652 (75%), Gaps = 10/652 (2%)
 Frame = -3

Query  2216  ASTVSLLMAIKASLDPGNLVLSSWSPNVTDPCSVSSFEGIACNDLGQVVNISLQGKGLYG  2037
             ++ +S LMAIKASLDP N +L+SWSP+ ++PC    FEG+ACN+ G+VVNISLQG GL G
Sbjct  26    STELSTLMAIKASLDPHNTLLTSWSPS-SNPCG-GYFEGVACNEQGKVVNISLQGMGLSG  83

Query  2036  KIPPEIGQLNGLSGLYLHFNNLHGVIPKEIASLTQLSDLYLNMNDLSGFIPSEIGNMPNL  1857
              IP  +  L  L+GLYLHFN L G IPKEIASL QL+DLYLN+N LSG IP EIGNM NL
Sbjct  84    YIPAAVAGLRSLTGLYLHFNALIGEIPKEIASLNQLTDLYLNVNQLSGEIPFEIGNMANL  143

Query  1856  QVLQLCYNRFEGCIPNKLGSLKNLTVLALQSNQLTGAIPASlggltlltrldLSFNRLFG  1677
             QVLQLCYN+  G IP+++G++K L+VLALQ NQLTGAIPASLG LT LTRL+LS N+ FG
Sbjct  144   QVLQLCYNKLTGGIPSQVGNMKVLSVLALQYNQLTGAIPASLGNLTALTRLNLSNNKFFG  203

Query  1676  SIPVKLSEASKLEVLDLRNNTLSGNVPLGLKRLNEGFRYENNPGLCGTGFPSLALCSD-S  1500
              IPV L++A  LEV ++ NN+L+GNVP G KRL E F Y NNP LCG GF  L  CS   
Sbjct  204   PIPVILADAPALEVFNVENNSLTGNVPPGFKRLKEKFMYLNNPSLCGVGFQDLNPCSKLK  263

Query  1499  SLNPTKPEPF--GQGSNRLPTKDIPESANIPHQLN-----QNRKPQAAAAVVGVIGLFVI  1341
             SLNP++PEPF      N    +DIPESAN+    N     +  K       +GVIG+F  
Sbjct  264   SLNPSRPEPFLPQLPGNDPSARDIPESANLRSNCNGGNCSRQSKSSRVGVALGVIGVFAA  323

Query  1340  LAVAGLFTFSWYRRRKQQIGSTVDISESRVSTDQPKVLCRRSTSPLISLEYSNGWDPLAK  1161
              +  GL TFSWYRR + + GST +    R+ T Q + + RR+ SPLI+LEYSNGWDPLAK
Sbjct  324   FSAIGLATFSWYRRNEHKFGSTSNGISRRIITSQVREVYRRNASPLINLEYSNGWDPLAK  383

Query  1160  DQSGSALSQEVLESFMFNLDEVESATQYFSETNLLGKSSFSAVYKGTLRDGSAVAVKCIS  981
             D  GSA S+E+ +SFMFNL++VE ATQ FS++NLLG+++FSA+YKG LRDGS VA+KCI 
Sbjct  384   DHGGSASSREIFKSFMFNLEDVERATQCFSKSNLLGRNNFSALYKGKLRDGSVVAIKCIG  443

Query  980   KTSCKSDEAEFRKGLTLLTSLKHENLLRLRGFCCSKGRGECFLIYDFVSNGNLLRYLDVK  801
             KTSCKSDEAEF KGL +L S+ HENL++ RG CCSK RGEC+LIYDF +NG L++YLD  
Sbjct  444   KTSCKSDEAEFLKGLKILISMNHENLVKFRGLCCSKDRGECYLIYDFAANGTLMQYLDDS  503

Query  800   DEKGKVLDWSTRTAIIKGIARGIKYLHGNKRNKPALVHRNISADKVLIDHLYKPLLSDSG  621
             +  GKVLDWSTR +II GIA+G+ YLH     KPAL+H+NISADKVLID  Y PLLSDSG
Sbjct  504   NGSGKVLDWSTRVSIIFGIAKGLGYLHRKIGKKPALIHQNISADKVLIDANYNPLLSDSG  563

Query  620   LHKLLADDIVFSTLKGSAANGYLAPEYAITGRFTEKSDMYAFGVIILQILSGSCVVTQSN  441
             LHKLLADDI+FS LK SAA GYL PEY  TGRFTEKSD+YAFG+I+LQ++SG   + + N
Sbjct  564   LHKLLADDIIFSMLKVSAALGYLPPEYTTTGRFTEKSDIYAFGMIVLQVISGKTNIMKLN  623

Query  440   HQGAELCRFEDFVDAKLGKDFVESEAAKLGKIALLCTHDSPSRRPAIDVVIQ  285
             +   EL RFEDF+D+KL   F+ESEAAKLGK+A++CTH+ P  RP IDVV++
Sbjct  624   YNTIELRRFEDFIDSKLEGRFLESEAAKLGKLAVICTHEYPELRPTIDVVVE  675



>gb|KDP22393.1| hypothetical protein JCGZ_26224 [Jatropha curcas]
Length=679

 Score =   780 bits (2013),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 407/644 (63%), Positives = 502/644 (78%), Gaps = 8/644 (1%)
 Frame = -3

Query  2198  LMAIKASLDPGNLVLSSWSPNVTDPCSVSSFEGIACNDLGQVVNISLQGKGLYGKIPPEI  2019
             LM +KA+LDP +  +SSW+ N  DPC   SFEG+ACN+ GQV NISLQGKGL+GK+   +
Sbjct  29    LMDMKAALDPEDKYISSWTIN-GDPCG-GSFEGVACNEKGQVANISLQGKGLHGKLSSSV  86

Query  2018  GQLNGLSGLYLHFNNLHGVIPKEIASLTQLSDLYLNMNDLSGFIPSEIGNMPNLQVLQLC  1839
               L  L+GLYLH+N+L+G IP+EIA+LT+LSDLYLN+N+ SG IP EIGNM NLQVLQLC
Sbjct  87    AGLKNLTGLYLHYNSLYGEIPREIANLTELSDLYLNVNNFSGEIPPEIGNMGNLQVLQLC  146

Query  1838  YNRFEGCIPNKLGSLKNLTVLALQSNQLTGAIPASlggltlltrldLSFNRLFGSIPVKL  1659
             YN+F G IP +LG+LK L VLALQSN+ TGAIPASLG L +L RLDLSFN  FGSIP KL
Sbjct  147   YNQFTGSIPTQLGTLKKLNVLALQSNKFTGAIPASLGNLGVLMRLDLSFNHFFGSIPTKL  206

Query  1658  SEASKLEVLDLRNNTLSGNVPLGLKRLNEGFRYENNPGLCGTGFPSLALCSDSS-LNPTK  1482
             ++A  LE LD+RNN+LSGNVPL LKRLN+GF Y NN GLCG GF  L  C+DS  LNP++
Sbjct  207   ADAPLLEALDVRNNSLSGNVPLALKRLNDGFLYGNNLGLCGAGFMYLQACNDSDHLNPSR  266

Query  1481  PEPFGQGSNRLPTKDIPESANIPHQLNQNR-----KPQAAAAVVGVIGLFVILAVAGLFT  1317
             PEPFG GS+ +P+++IPE+AN+    NQ R     K   A+ VVG + + V L   G+ +
Sbjct  267   PEPFGPGSSGMPSREIPETANLQLHCNQTRCSNSSKSHQASVVVGTVVVTVALLAMGILS  326

Query  1316  FSWYRRRKQQIGSTVDISESRVSTDQPKVLCRRSTSPLISLEYSNGWDPLAKDQSGSALS  1137
             F+ YRRRKQ++GS+ +IS+SR+STDQ K + R++ SPLISLEY NGWDPLA  ++     
Sbjct  327   FTQYRRRKQKLGSSFEISDSRLSTDQAKGVYRKNGSPLISLEYPNGWDPLADGRNFIGYE  386

Query  1136  QEVLESFMFNLDEVESATQYFSETNLLGKSSFSAVYKGTLRDGSAVAVKCISKTSCKSDE  957
             Q+V ++F FNLDEVE+ATQYFSE NLLGKS+FSA YKG LRDGS VA+K ISK+SCKS+E
Sbjct  387   QDVFQNFRFNLDEVETATQYFSEVNLLGKSNFSATYKGILRDGSVVAIKSISKSSCKSEE  446

Query  956   AEFRKGLTLLTSLKHENLLRLRGFCCSKGRGECFLIYDFVSNGNLLRYLDVKDEKGKVLD  777
              EF KGL +LTSL+HENL+RLRGFCCS+GRGECFLIYDFV NG+LL+YLDVKD  G VL+
Sbjct  447   TEFLKGLNILTSLRHENLVRLRGFCCSRGRGECFLIYDFVPNGSLLQYLDVKDGDGHVLE  506

Query  776   WSTRTAIIKGIARGIKYLHGNKRNKPALVHRNISADKVLIDHLYKPLLSDSGLHKLLADD  597
             WSTR +I+KGIA+GI +LHG+K  KPAL+H+NI A+KVL+D    PLL+DSGL  LL +D
Sbjct  507   WSTRVSIVKGIAKGISFLHGHKVKKPALIHQNIKAEKVLVDQRCNPLLADSGLQNLLTND  566

Query  596   IVFSTLKGSAANGYLAPEYAITGRFTEKSDMYAFGVIILQILSGSCVVTQSNHQGAELCR  417
             IVFS LK SAA GYLAPEY  TGRFTEKSD+YAFGVI+ Q+LSG   VT     GAE CR
Sbjct  567   IVFSALKASAAMGYLAPEYTTTGRFTEKSDVYAFGVIVFQVLSGKRKVTSLVRLGAEACR  626

Query  416   FEDFVDAKLGKDFVESEAAKLGKIALLCTHDSPSRRPAIDVVIQ  285
             F+D++D  L   F E EA+KL +IA LCT++SP  RP ++ V+Q
Sbjct  627   FQDYIDPNLHGRFFEYEASKLARIAWLCTNESPVERPTMEAVVQ  670



>gb|AES75836.2| LRR receptor-like kinase [Medicago truncatula]
Length=684

 Score =   780 bits (2013),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 395/645 (61%), Positives = 498/645 (77%), Gaps = 10/645 (2%)
 Frame = -3

Query  2198  LMAIKASLDPGNLVLSSWSPNVTDPCSVSSFEGIACNDLGQVVNISLQGKGLYGKIPPEI  2019
             L+ +K+SLDP    LSSW  +  +PC   SFEG+ACN+ GQV N+SLQGKGL GK+ P I
Sbjct  34    LLDLKSSLDPEGHFLSSWKIH-GNPCD-DSFEGVACNEKGQVANVSLQGKGLSGKLSPAI  91

Query  2018  GQLNGLSGLYLHFNNLHGVIPKEIASLTQLSDLYLNMNDLSGFIPSEIGNMPNLQVLQLC  1839
             G L  L+GLYLH+N+L+G IPKEIA+LTQLSDLYLN+N LSG IPSEIG M NLQVLQLC
Sbjct  92    GDLKHLTGLYLHYNSLYGDIPKEIANLTQLSDLYLNVNHLSGEIPSEIGKMENLQVLQLC  151

Query  1838  YNRFEGCIPNKLGSLKNLTVLALQSNQLTGAIPASlggltlltrldLSFNRLFGSIPVKL  1659
             YN+  G IP +LG LK L+VLALQSN+L GAIPASLG L +L RLDLS N LFGSIP KL
Sbjct  152   YNQLTGSIPTQLGDLKKLSVLALQSNKLAGAIPASLGDLGMLMRLDLSSNNLFGSIPTKL  211

Query  1658  SEASKLEVLDLRNNTLSGNVPLGLKRLNEGFRYENNPGLCGTGFPSLALCSDSS-LNPTK  1482
             ++   L+VLD+ NNTLSGNVP GLK+L++ F YE N GLCG GF SL  C+ S  +NP +
Sbjct  212   ADVPFLQVLDVHNNTLSGNVPPGLKKLDDKFMYEYNLGLCGVGFSSLKACNASDHVNPNR  271

Query  1481  PEPFGQGSNRLPTKDIPESANIPHQLNQNR------KPQAAAAVVGVIGLFVILAVAGLF  1320
             PEP+G G   + +K+IPE+A+I    N  R        + A+  VG++   + ++   + 
Sbjct  272   PEPYGAGVGSM-SKEIPETADIKLPCNTTRCQNSSKSKKTASITVGIVLATIAVSAIAIL  330

Query  1319  TFSWYRRRKQQIGSTVDISESRVSTDQPKVLCRRSTSPLISLEYSNGWDPLAKDQSGSAL  1140
             +F+ YRRRKQ++GS  DI+ESR+STDQ K + R++ SPL+SLEY+NGWDPLA  ++ +  
Sbjct  331   SFTMYRRRKQKLGSAFDITESRLSTDQTKGIYRKNGSPLVSLEYANGWDPLADSRNFNGD  390

Query  1139  SQEVLESFMFNLDEVESATQYFSETNLLGKSSFSAVYKGTLRDGSAVAVKCISKTSCKSD  960
              Q++ +SF FNL+EVESATQYFSE NLLGKS+FSA YKG LRDGS VA+K ISKTSCKSD
Sbjct  391   KQDMFQSFRFNLEEVESATQYFSELNLLGKSNFSATYKGVLRDGSIVAIKSISKTSCKSD  450

Query  959   EAEFRKGLTLLTSLKHENLLRLRGFCCSKGRGECFLIYDFVSNGNLLRYLDVKDEKGKVL  780
             E EF KGL +LTSL+++NL+RLRGFCCS+GRGECFL+YDFVSNGNL +YLDVK+  G+VL
Sbjct  451   EGEFLKGLNILTSLRNDNLVRLRGFCCSRGRGECFLVYDFVSNGNLSQYLDVKEGDGEVL  510

Query  779   DWSTRTAIIKGIARGIKYLHGNKRNKPALVHRNISADKVLIDHLYKPLLSDSGLHKLLAD  600
             +WSTR +I+KGIA+GI YLH  K NKPALVH+NISA+KVLID    P+LSDSGL+KLL +
Sbjct  511   EWSTRVSIVKGIAKGISYLHAYKANKPALVHQNISAEKVLIDQRQNPVLSDSGLYKLLTN  570

Query  599   DIVFSTLKGSAANGYLAPEYAITGRFTEKSDMYAFGVIILQILSGSCVVTQSNHQGAELC  420
             DIVFS+LKGSAA GYLAPEY  TGRFT+KSD+YAFG+++ QIL+G   +T S    AE  
Sbjct  571   DIVFSSLKGSAAKGYLAPEYTTTGRFTDKSDVYAFGILLFQILTGKHKITSSLRLAAESF  630

Query  419   RFEDFVDAKLGKDFVESEAAKLGKIALLCTHDSPSRRPAIDVVIQ  285
             +F++F+D  L   F E EAAKL ++A+LC+HDSP  RP ++ ++Q
Sbjct  631   KFQEFIDQNLHGRFFEYEAAKLARMAILCSHDSPFERPTMEAIVQ  675



>ref|XP_004133916.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g34110-like [Cucumis sativus]
 ref|XP_004155789.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g34110-like [Cucumis sativus]
 gb|KGN56604.1| hypothetical protein Csa_3G126190 [Cucumis sativus]
Length=691

 Score =   776 bits (2005),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 399/652 (61%), Positives = 492/652 (75%), Gaps = 10/652 (2%)
 Frame = -3

Query  2216  ASTVSLLMAIKASLDPGNLVLSSWSPNVTDPCSVSSFEGIACNDLGQVVNISLQGKGLYG  2037
             ++ +S LM+IKASLDP + +L+SW+P+ ++PC    FEG+ACN+ G+VVNISLQG GL G
Sbjct  26    STELSTLMSIKASLDPHSTLLTSWNPS-SNPCG-GYFEGVACNEQGKVVNISLQGMGLSG  83

Query  2036  KIPPEIGQLNGLSGLYLHFNNLHGVIPKEIASLTQLSDLYLNMNDLSGFIPSEIGNMPNL  1857
              IP  +  L  L+GLYLHFN L G IPKEIASL QL+DLYLN+N LSG IP EIGNM NL
Sbjct  84    NIPSAVAGLRSLTGLYLHFNALVGEIPKEIASLNQLTDLYLNVNQLSGEIPFEIGNMANL  143

Query  1856  QVLQLCYNRFEGCIPNKLGSLKNLTVLALQSNQLTGAIPASlggltlltrldLSFNRLFG  1677
             QVLQLCYN+  G IP+++G++K L VLALQ NQLTGAIPASLG LT LTRL+LS N+ FG
Sbjct  144   QVLQLCYNKLTGGIPSQVGNMKVLNVLALQYNQLTGAIPASLGNLTALTRLNLSNNKFFG  203

Query  1676  SIPVKLSEASKLEVLDLRNNTLSGNVPLGLKRLNEGFRYENNPGLCGTGFPSLALCSD-S  1500
              IPV L++A  LEV ++ NN+L+GNVP G KRL E F Y NNP LCG GF  L  CS   
Sbjct  204   PIPVILADAPALEVFNVENNSLTGNVPPGFKRLKEKFMYLNNPSLCGVGFQDLNPCSKLK  263

Query  1499  SLNPTKPEPF--GQGSNRLPTKDIPESANIPHQLN-----QNRKPQAAAAVVGVIGLFVI  1341
             SLNP++PEPF      N    +DIPESAN+    N     +  K       +GVIG+F  
Sbjct  264   SLNPSRPEPFLPQLPGNDHSARDIPESANLGSNCNGGNCSRQSKSSRVGVALGVIGVFAA  323

Query  1340  LAVAGLFTFSWYRRRKQQIGSTVDISESRVSTDQPKVLCRRSTSPLISLEYSNGWDPLAK  1161
              +  GL TFSWYRR + + GST +    R+ T Q + + RR+ SPLI+LEYSNGWDPLAK
Sbjct  324   FSAIGLATFSWYRRNEHKFGSTSNGISRRIITSQVREVYRRNASPLINLEYSNGWDPLAK  383

Query  1160  DQSGSALSQEVLESFMFNLDEVESATQYFSETNLLGKSSFSAVYKGTLRDGSAVAVKCIS  981
             DQ GSA S+E+ +SFMFNL++VE ATQ FS++NLLG+++FSA+YKG LRDGS VA+KCI 
Sbjct  384   DQGGSASSREIFKSFMFNLEDVERATQCFSKSNLLGRNNFSALYKGKLRDGSVVAIKCIG  443

Query  980   KTSCKSDEAEFRKGLTLLTSLKHENLLRLRGFCCSKGRGECFLIYDFVSNGNLLRYLDVK  801
             KTSCKSDEAEF KGL +L S+ HENL++ RG CCSK RGEC+LIYDF +NG L++YLD  
Sbjct  444   KTSCKSDEAEFLKGLKILISMNHENLVKFRGLCCSKDRGECYLIYDFAANGTLMQYLDDS  503

Query  800   DEKGKVLDWSTRTAIIKGIARGIKYLHGNKRNKPALVHRNISADKVLIDHLYKPLLSDSG  621
             +  GKVLDWSTR +II GIA+G+ YLH     KPAL+H+NISADKVLID  Y PLLSDSG
Sbjct  504   NGSGKVLDWSTRVSIICGIAKGLGYLHRKIGKKPALIHQNISADKVLIDANYNPLLSDSG  563

Query  620   LHKLLADDIVFSTLKGSAANGYLAPEYAITGRFTEKSDMYAFGVIILQILSGSCVVTQSN  441
             LHKLLADDI+FS LK SAA GYL PEY  TGRFTEKSD+YAFG+I+LQ++SG   + + N
Sbjct  564   LHKLLADDIIFSMLKVSAALGYLPPEYTTTGRFTEKSDIYAFGMIVLQVISGKTSIMKLN  623

Query  440   HQGAELCRFEDFVDAKLGKDFVESEAAKLGKIALLCTHDSPSRRPAIDVVIQ  285
             +   EL +FEDF+D+KL   F+ESEAAKLGK+A++CTH+ P  RP IDVV++
Sbjct  624   YNTIELRQFEDFIDSKLEGRFLESEAAKLGKLAVICTHEYPELRPTIDVVVE  675



>emb|CBI24527.3| unnamed protein product [Vitis vinifera]
Length=659

 Score =   774 bits (1999),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 403/644 (63%), Positives = 487/644 (76%), Gaps = 30/644 (5%)
 Frame = -3

Query  2198  LMAIKASLDPGNLVLSSWSPNVTDPCSVSSFEGIACNDLGQVVNISLQGKGLYGKIPPEI  2019
             LM IK++LDP NL LSSW+ N  DPC                       KGL GK+ P I
Sbjct  31    LMVIKSTLDPHNLFLSSWTIN-GDPC-----------------------KGLTGKLSPAI  66

Query  2018  GQLNGLSGLYLHFNNLHGVIPKEIASLTQLSDLYLNMNDLSGFIPSEIGNMPNLQVLQLC  1839
               L  L+GLYLH+N+L+G IP EIA+LTQLSDLYLN+N+LSG IP+E+G M  LQVLQLC
Sbjct  67    AGLKHLTGLYLHYNSLYGEIPVEIANLTQLSDLYLNVNNLSGTIPAELGKMATLQVLQLC  126

Query  1838  YNRFEGCIPNKLGSLKNLTVLALQSNQLTGAIPASlggltlltrldLSFNRLFGSIPVKL  1659
             YN+  G IP +LGSLK L+VLALQSNQLTGAIPASLG L +L RLDLSFNRLFGSIP +L
Sbjct  127   YNQLTGSIPTQLGSLKKLSVLALQSNQLTGAIPASLGDLGMLVRLDLSFNRLFGSIPRRL  186

Query  1658  SEASKLEVLDLRNNTLSGNVPLGLKRLNEGFRYENNPGLCGTGFPSLALCSDSSL-NPTK  1482
             ++   LEVLD+RNNTLSG +P  LKRLN GF+Y+NN  LCG GF  L +C+   L N ++
Sbjct  187   ADVVSLEVLDIRNNTLSGKIPPALKRLNGGFQYKNNARLCGDGFSYLKVCNSLDLTNQSR  246

Query  1481  PEPFGQGSNRLPTKDIPESANIPHQLNQNR-----KPQAAAAVVGVIGLFVILAVAGLFT  1317
             PEP+G GSN   T DIPE+AN+    ++       K   A  VVG++ + + L+  G+ +
Sbjct  247   PEPYGAGSNTQSTGDIPETANVQLHCDKAHCSNPSKSSHAPVVVGMVVVTIALSAIGILS  306

Query  1316  FSWYRRRKQQIGSTVDISESRVSTDQPKVLCRRSTSPLISLEYSNGWDPLAKDQSGSALS  1137
             F+ YRRRKQ++GS+ DIS+SR+STDQ K + R++ SPL+SLEYSNGWDPLA  ++     
Sbjct  307   FAQYRRRKQKLGSSFDISDSRLSTDQGKEVYRKNGSPLVSLEYSNGWDPLADGRNYGGFP  366

Query  1136  QEVLESFMFNLDEVESATQYFSETNLLGKSSFSAVYKGTLRDGSAVAVKCISKTSCKSDE  957
             QEV +SF FNL+EVESATQ+FSE NLLGKS+FSA+YKG LRDGS VA+K I+KTSCKS++
Sbjct  367   QEVFQSFRFNLEEVESATQHFSEVNLLGKSNFSAIYKGILRDGSLVAIKSINKTSCKSED  426

Query  956   AEFRKGLTLLTSLKHENLLRLRGFCCSKGRGECFLIYDFVSNGNLLRYLDVKDEKGKVLD  777
             AEF KGL +LTSL+HENL+RLRG CCSKGRGECFLIYDF+ NGNLL YLD+KD   KVL+
Sbjct  427   AEFLKGLNILTSLRHENLVRLRGLCCSKGRGECFLIYDFIPNGNLLSYLDLKDGDSKVLE  486

Query  776   WSTRTAIIKGIARGIKYLHGNKRNKPALVHRNISADKVLIDHLYKPLLSDSGLHKLLADD  597
             WSTR ++I GIA+GI+YLHG K NKPALVH+NISA+KVLID    PLLSDSGLHKLL DD
Sbjct  487   WSTRVSMISGIAKGIEYLHGYKLNKPALVHQNISAEKVLIDQRLNPLLSDSGLHKLLTDD  546

Query  596   IVFSTLKGSAANGYLAPEYAITGRFTEKSDMYAFGVIILQILSGSCVVTQSNHQGAELCR  417
             IVFS LK SAA GYLAPEY  TGRFTEKSD+YAFGV++ QILSG    T S H GAE CR
Sbjct  547   IVFSALKASAAMGYLAPEYTTTGRFTEKSDLYAFGVLVFQILSGKRKFTSSIHLGAETCR  606

Query  416   FEDFVDAKLGKDFVESEAAKLGKIALLCTHDSPSRRPAIDVVIQ  285
             F+DF+DA L   F E EAAKL +IAL+CTH+SP  RP+++ VI 
Sbjct  607   FQDFIDANLHGRFSEYEAAKLARIALMCTHESPIERPSMETVIH  650



>ref|XP_010524368.1| PREDICTED: LOW QUALITY PROTEIN: leucine-rich repeat receptor 
protein kinase EXS [Tarenaya hassleriana]
Length=683

 Score =   775 bits (2000),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 406/658 (62%), Positives = 501/658 (76%), Gaps = 13/658 (2%)
 Frame = -3

Query  2228  TSNNASTVSLLMAIKASLDPGNLVLSSWSPNVTDPCSVSSFEGIACNDLGQVVNISLQGK  2049
             T +++S   +L+ IKASLDP    L SW+P   DPC+  SF+G+AC++ G+V NISLQG 
Sbjct  20    TVSSSSERDILLDIKASLDPETRFLFSWAPG-GDPCAAGSFDGVACDEHGRVANISLQGM  78

Query  2048  GLYGKIPPEIGQLNGLSGLYLHFNNLHGVIPKEIASLTQLSDLYLNMNDLSGFIPSEIGN  1869
             GL G IP  +G+L GL+GLYLHFN+LHG IPKEI+ L  LSDLYLN+NDLSG IP EIGN
Sbjct  79    GLSGNIPAAVGRLTGLTGLYLHFNSLHGEIPKEISHLPLLSDLYLNVNDLSGEIPPEIGN  138

Query  1868  MPNLQVLQLCYNRFEGCIPNKLGSLKNLTVLALQSNQLTGAIPASlggltlltrldLSFN  1689
             + NLQVLQ+CYN+  G IP +LGSLK ++VLALQSNQL+GAIPASLGGL  LTRLDLSFN
Sbjct  139   LGNLQVLQICYNKLSGSIPTQLGSLKKISVLALQSNQLSGAIPASLGGLDSLTRLDLSFN  198

Query  1688  RLFGSIPVKLSEASKLEVLDLRNNTLSGNVPLGLKRLNEGFRYENNPGLCGTGFPSLALC  1509
              LFG +PVKL+EA  LEVLD+RNN+ SGNVP GLKRL  GF++ NNP LCG GF  L  C
Sbjct  199   HLFGPVPVKLAEAPLLEVLDIRNNSFSGNVPTGLKRLENGFQFANNPALCGVGFLGLKAC  258

Query  1508  SDSS-LNPTKPEPFGQGSNRLPTKDIPESANIPHQLNQN-----RKPQAAAAVVGVIGLF  1347
             + S  +N  +P+P    S    T   PESA++  +   N     +  ++   +VG+I   
Sbjct  259   AVSDGMNLNRPDPSNPKS--FSTDIKPESADLQRRNCSNSGRCSKSSKSFGVIVGLIITV  316

Query  1346  VILAVAGLFTFSWYRRRKQQIGSTVDISESRVSTD-QPKVLCR-RSTSPLISLEYSNGWD  1173
             + +A  G FTF+W+RRRKQ+IGS +D  + R+ST+ Q K + R +  SPLISLEY++GWD
Sbjct  317   IAVAAFGGFTFAWHRRRKQKIGSNLDPVDGRLSTEYQFKEVSRKKGASPLISLEYASGWD  376

Query  1172  PLAKDQ-SGSALSQEVLESFMFNLDEVESATQYFSETNLLGKSSFSAVYKGTLRDGSAVA  996
             PLA+ Q S SALSQEV ESFMFNL++VE ATQ FSE N+LGKS+FS+VY+G LRDGS  A
Sbjct  377   PLARGQNSNSALSQEVFESFMFNLEDVERATQSFSEVNMLGKSNFSSVYRGILRDGSVAA  436

Query  995   VKCISKTSCKSDEAEFRKGLTLLTSLKHENLLRLRGFCCSKGRGECFLIYDFVSNGNLLR  816
             +KCI+K+SCKSDE+EF KGL +LT LKHENL+RLRGFCCSK RGECFLIYDFV NGNLL+
Sbjct  437   IKCIAKSSCKSDESEFLKGLKILTLLKHENLVRLRGFCCSKSRGECFLIYDFVPNGNLLQ  496

Query  815   YLDVKDEK-GKVLDWSTRTAIIKGIARGIKYLHGNKRNKPALVHRNISADKVLIDHLYKP  639
             YLDVK+E+ G+VL+WSTR +II GIARGI YLHG   NKPA+VH+NISA+K+LIDH Y P
Sbjct  497   YLDVKEEEGGEVLEWSTRVSIINGIARGIHYLHGQNGNKPAIVHQNISAEKILIDHWYNP  556

Query  638   LLSDSGLHKLLADDIVFSTLKGSAANGYLAPEYAITGRFTEKSDMYAFGVIILQILSGSC  459
              L DSGLHKL  DDIVFS LK SAA GYLAPEY  TGRFTEKSD+YAFG+I+LQILSG  
Sbjct  557   SLGDSGLHKLFTDDIVFSKLKASAAXGYLAPEYITTGRFTEKSDVYAFGMIVLQILSGKS  616

Query  458   VVTQSNHQGAELCRFEDFVDAKLGKDFVESEAAKLGKIALLCTHDSPSRRPAIDVVIQ  285
              V     Q  E    E F+D+ L  +F+E+EAA+L ++ LLCTH+S S RP+++ V+Q
Sbjct  617   KVGHLPIQVIESGGLESFMDSNLKGNFLEAEAAQLARLGLLCTHESSSHRPSMEEVMQ  674



>ref|XP_004234946.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
GSO1 [Solanum lycopersicum]
Length=678

 Score =   773 bits (1995),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 396/645 (61%), Positives = 498/645 (77%), Gaps = 10/645 (2%)
 Frame = -3

Query  2198  LMAIKASLDPGNLVLSSWSPNVTDPCSVSSFEGIACNDLGQVVNISLQGKGLYGKIPPEI  2019
             LM +KASLDP N +L+SW+ +  +PC   SFEGIACN+ GQV NISLQGKGL GK+ P I
Sbjct  28    LMDLKASLDPANALLTSWTVS-GNPCD-GSFEGIACNEKGQVANISLQGKGLKGKLSPAI  85

Query  2018  GQLNGLSGLYLHFNNLHGVIPKEIASLTQLSDLYLNMNDLSGFIPSEIGNMPNLQVLQLC  1839
               L  L+GLYLH+N+L+G IP+EI++L +LSDLYLN+NDLSG IP E+GNM NLQVLQLC
Sbjct  86    AGLTHLTGLYLHYNSLYGEIPREISNLVELSDLYLNVNDLSGEIPQELGNMSNLQVLQLC  145

Query  1838  YNRFEGCIPNKLGSLKNLTVLALQSNQLTGAIPASlggltlltrldLSFNRLFGSIPVKL  1659
             YN F G IP +LG+L  L VLALQSNQLTGAIPASLG L +L R+DLS+N LFGSIP KL
Sbjct  146   YNHFTGSIPTQLGTLTKLNVLALQSNQLTGAIPASLGDLGVLMRVDLSYNSLFGSIPSKL  205

Query  1658  SEASKLEVLDLRNNTLSGNVPLGLKRLNEGFRYENNPGLCGTGFPSLALCS--DSSLNPT  1485
             ++A  LEVLD+RNN +SGNVPL LKRL  GF+YENNPGLCG GFPSL +C+  D S NP 
Sbjct  206   ADAPLLEVLDIRNNKISGNVPLALKRLVGGFQYENNPGLCGVGFPSLRVCTSFDRS-NPN  264

Query  1484  KPEPFGQGSNRLPTKDIPESANIPHQLNQN-----RKPQAAAAVVGVIGLFVILAVAGLF  1320
             +PEP+G GS+ L T+DIPE+AN+    + N      K   A+ VVGVI + +I +  G+ 
Sbjct  265   RPEPYGVGSSGLSTRDIPETANLNLNCSGNACTTSSKTSQASVVVGVIVVTIIASAIGIL  324

Query  1319  TFSWYRRRKQQIGSTVDISESRVSTDQPKVLCRRSTSPLISLEYSNGWDPLAKDQSGSAL  1140
             +F+ YRRRKQ++G  +++ +SR+S DQ K + R++ SPL+SLEYS GWDPLA+ +    +
Sbjct  325   SFTHYRRRKQKLGGGLEMCDSRLSIDQAKEVNRKNGSPLVSLEYSIGWDPLAEGRRYGGV  384

Query  1139  SQEVLESFMFNLDEVESATQYFSETNLLGKSSFSAVYKGTLRDGSAVAVKCISKTSCKSD  960
             SQE+L+ + FNL+EVESATQYF++ NLL KS+FS  Y+GTLRDGS VAV  I+K SCKS+
Sbjct  385   SQEILQRYRFNLEEVESATQYFADKNLLAKSNFSTTYRGTLRDGSLVAVTRIAKISCKSE  444

Query  959   EAEFRKGLTLLTSLKHENLLRLRGFCCSKGRGECFLIYDFVSNGNLLRYLDVKDEKGKVL  780
             EAEF +GL +LTSL+H+NL+RLRGFCCSK RGECFL+YDFV  GNLL YLD+K+++ + L
Sbjct  445   EAEFLRGLNVLTSLRHDNLVRLRGFCCSKSRGECFLVYDFVPRGNLLHYLDLKEDEARAL  504

Query  779   DWSTRTAIIKGIARGIKYLHGNKRNKPALVHRNISADKVLIDHLYKPLLSDSGLHKLLAD  600
             +WSTR +II G A+G++YLHG K NKPALVH+NI A+ VL+D  +KPLLS+SGLHKLL +
Sbjct  505   EWSTRVSIISGTAKGVEYLHGCKVNKPALVHQNICAENVLLDQRFKPLLSNSGLHKLLTN  564

Query  599   DIVFSTLKGSAANGYLAPEYAITGRFTEKSDMYAFGVIILQILSGSCVVTQSNHQGAELC  420
             D VFS LK SAA GYLAPEY+ TGRFTE+SD+YAFGV+I QILSG    T S    AE  
Sbjct  565   DTVFSALKASAAMGYLAPEYSTTGRFTERSDIYAFGVLIFQILSGKRKFTSSMRSAAESS  624

Query  419   RFEDFVDAKLGKDFVESEAAKLGKIALLCTHDSPSRRPAIDVVIQ  285
             +F D +D  L   F ESEA KL KIALLCTH+ P  RP ++ +++
Sbjct  625   KFHDLMDVNLHGRFSESEATKLAKIALLCTHECPEERPTMETIVR  669



>gb|KHG05851.1| protein strubbelig-receptor family 8 [Gossypium arboreum]
Length=669

 Score =   772 bits (1993),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 402/646 (62%), Positives = 494/646 (76%), Gaps = 17/646 (3%)
 Frame = -3

Query  2198  LMAIKASLDPGNLVLSSWSPNVTDPCSVSSFEGIACNDLGQVVNISLQGKGLYGKIPPEI  2019
             LM IKA LDP N  LSSW+ N  DPC   SFEG+ CN+ GQ+ NISLQGKGL GK+ P I
Sbjct  29    LMEIKAGLDPENKYLSSWTFN-GDPCD-GSFEGLCCNEKGQIANISLQGKGLSGKLSPAI  86

Query  2018  GQLNGLSGLYLHFNNLHGVIPKEIASLTQLSDLYLNMNDLSGFIPSEIGNMPNLQVLQLC  1839
              +L  L+GLYLH+N+L+GVIPKEIA+LT L+DLYLNMN+LSG IP +IG + +L+VLQLC
Sbjct  87    AELKHLTGLYLHYNSLYGVIPKEIANLTLLTDLYLNMNNLSGQIPPQIGELGSLKVLQLC  146

Query  1838  YNRFEGCIPNKLGSLKNLTVLALQSNQLTGAIPASlggltlltrldLSFNRLFGSIPVKL  1659
             YN+  G IP ++GSLK L VLALQSNQLTGAIPASLG L  L RLDLSFN  FGSIP KL
Sbjct  147   YNQLTGSIPTQVGSLKKLNVLALQSNQLTGAIPASLGDLGTLIRLDLSFNSFFGSIPTKL  206

Query  1658  SEASKLEVLDLRNNTLSGNVPLGLKRLNEGFRYENNPGLCGTGFPSLALCSDSS-LNPTK  1482
             ++A  L+VLD+RNN+LSGNVPL LKRLN+GF ++NNPGLCG+GF SL +C+DS  +NP+K
Sbjct  207   ADAPLLQVLDIRNNSLSGNVPLALKRLNDGFLFQNNPGLCGSGFASLKVCNDSDHINPSK  266

Query  1481  PEPFGQGSNRLPTKDIPESANIPHQLNQNRKP-------QAAAAVVGVIGLFVILAVAGL  1323
             PE +G  +  + T++IPE+AN+  QL   +KP       Q    +V +I + V L+V GL
Sbjct  267   PEVYGSEAAGV-TREIPETANL--QLPCEQKPCSKPSKSQRGPILVALIVVIVALSVIGL  323

Query  1322  FTFSWYRRRKQQIGSTVDISESRVSTDQPKVLCRRSTSPLISLEYSNGWDPLAKDQSGSA  1143
              TF  Y R+KQ++ S  ++ E+R+STDQ K   R++ SPLISLEY+NGWDPLA  ++ + 
Sbjct  324   VTFMQYHRQKQKLSSLSEVPENRLSTDQTKEFSRKNGSPLISLEYANGWDPLADGRNYNG  383

Query  1142  LSQEVLESFMFNLDEVESATQYFSETNLLGKSSFSAVYKGTLRDGSAVAVKCISKTSCKS  963
              +    ESF FNL+EVE+ATQYFSE NLLGKS+FSA Y+G LRDGSA+A+K I KTSCKS
Sbjct  384   FA----ESFRFNLEEVETATQYFSELNLLGKSNFSATYRGFLRDGSAIAIKSIGKTSCKS  439

Query  962   DEAEFRKGLTLLTSLKHENLLRLRGFCCSKGRGECFLIYDFVSNGNLLRYLDVKDEKGKV  783
             D+AEF KGL +L SLKHENL+ LRGFCCSK RGECFLIYDFV NGNLL  LDVKD  G+V
Sbjct  440   DDAEFLKGLNVLASLKHENLVGLRGFCCSKARGECFLIYDFVPNGNLLSCLDVKDGNGQV  499

Query  782   LDWSTRTAIIKGIARGIKYLHGNKRNKPALVHRNISADKVLIDHLYKPLLSDSGLHKLLA  603
             L+WSTR +I+KGIA+GI YLH N+ NKPALVH+NISA KVLID  + PLLSDSGLH LL 
Sbjct  500   LEWSTRVSIVKGIAKGIAYLHRNEVNKPALVHQNISAQKVLIDDQFNPLLSDSGLHNLLT  559

Query  602   DDIVFSTLKGSAANGYLAPEYAITGRFTEKSDMYAFGVIILQILSGSCVVTQSNHQGAEL  423
             +DIVF+ LKGSAA GYLAPEY  TG FTEKSD+YAFGV++ Q+L G   VT     G E 
Sbjct  560   NDIVFAALKGSAAMGYLAPEYTSTGWFTEKSDVYAFGVVVFQVLCGKRNVTSLVRVGGEC  619

Query  422   CRFEDFVDAKLGKDFVESEAAKLGKIALLCTHDSPSRRPAIDVVIQ  285
             CR +DF+D  L   ++E EAAKL +IA  CTH+ P  RP+++ V+Q
Sbjct  620   CRIQDFIDPNLHGRYLEYEAAKLARIAWHCTHECPVERPSMEAVVQ  665



>ref|XP_011029975.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g34110 [Populus euphratica]
Length=677

 Score =   769 bits (1987),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 402/646 (62%), Positives = 499/646 (77%), Gaps = 8/646 (1%)
 Frame = -3

Query  2207  VSLLMAIKASLDPGNLVLSSWSPNVTDPCSVSSFEGIACNDLGQVVNISLQGKGLYGKIP  2028
             +  LM +K +LDP    LSSW+ N + PC   SFEG+ACN+ GQV NISLQGKGL GK+ 
Sbjct  26    IRALMDMKDALDPEARYLSSWNINGS-PCD-GSFEGVACNEKGQVANISLQGKGLNGKVS  83

Query  2027  PEIGQLNGLSGLYLHFNNLHGVIPKEIASLTQLSDLYLNMNDLSGFIPSEIGNMPNLQVL  1848
             P +  L  L+GLYLH+N+L+G IP+EIA+LT LSDLYLN+N+LSG IP EIGNM NLQVL
Sbjct  84    PAVAGLKYLTGLYLHYNSLYGEIPREIANLTALSDLYLNVNNLSGEIPPEIGNMANLQVL  143

Query  1847  QLCYNRFEGCIPNKLGSLKNLTVLALQSNQLTGAIPASlggltlltrldLSFNRLFGSIP  1668
             QLCYN+F G IP++LGSL+ L+VLALQSN LTGAIPASLG L +L RLDLS+N LFGS+P
Sbjct  144   QLCYNQFTGSIPSELGSLERLSVLALQSNHLTGAIPASLGDLGMLMRLDLSYNHLFGSVP  203

Query  1667  VKLSEASKLEVLDLRNNTLSGNVPLGLKRLNEGFRYENNPGLCGTGFPSLALCSDSSLNP  1488
              K+++A  LE LD+RNN+LSGNVPL LKRL++GF YENN GLCG GF SL  C+ S L P
Sbjct  204   TKVADAPLLEFLDIRNNSLSGNVPLALKRLDDGFLYENNLGLCGAGFMSLKACNASGLMP  263

Query  1487  TKPEPFGQGSNRLPTKDIPESANIPHQLNQNR-----KPQAAAAVVGVIGLFVILAVAGL  1323
             ++PEP+G   N LP ++IPE+AN+  + NQ++     K   A+A V    + ++LA  G+
Sbjct  264   SRPEPYGTKVNGLP-REIPETANLQLRCNQSQCSNQSKAHHASAAVVTFVVTILLAAIGI  322

Query  1322  FTFSWYRRRKQQIGSTVDISESRVSTDQPKVLCRRSTSPLISLEYSNGWDPLAKDQSGSA  1143
              TF  YRRRKQ++ S  +IS+SR+STDQ K + R++ SPLISLEY NGWDPLA  ++ S 
Sbjct  323   LTFIQYRRRKQKLASPYEISDSRLSTDQAKGVYRKNGSPLISLEYPNGWDPLADGRNLSG  382

Query  1142  LSQEVLESFMFNLDEVESATQYFSETNLLGKSSFSAVYKGTLRDGSAVAVKCISKTSCKS  963
              +Q+V +SF FNL+EVE+ATQYFS+ NLLGK +FSA Y+G LRDGS VA+K ISK+SCKS
Sbjct  383   NAQDVFQSFRFNLEEVETATQYFSKVNLLGKINFSATYRGILRDGSTVAIKSISKSSCKS  442

Query  962   DEAEFRKGLTLLTSLKHENLLRLRGFCCSKGRGECFLIYDFVSNGNLLRYLDVKDEKGKV  783
             +EAEF KGL  LTSL+HENL+RLRGFCCS+GRGECFLIYDFV NGNLLRYLDVKD  G V
Sbjct  443   EEAEFLKGLNTLTSLRHENLVRLRGFCCSRGRGECFLIYDFVPNGNLLRYLDVKDGDGHV  502

Query  782   LDWSTRTAIIKGIARGIKYLHGNKRNKPALVHRNISADKVLIDHLYKPLLSDSGLHKLLA  603
             L+WSTR +I++GIARGI YLHG   NKP+L+H+NI+A+KVLID    PLL+DSG   LL 
Sbjct  503   LEWSTRVSIVRGIARGIAYLHGYSANKPSLIHQNITAEKVLIDQRCNPLLADSGFQNLLT  562

Query  602   DDIVFSTLKGSAANGYLAPEYAITGRFTEKSDMYAFGVIILQILSGSCVVTQSNHQGAEL  423
             DDIVFS LK SAA GYLAPEY  TGRFT+KSD+YAFGVI+ Q+LSG   V+     GA+ 
Sbjct  563   DDIVFSALKTSAAMGYLAPEYTTTGRFTDKSDVYAFGVIVFQVLSGKQKVSNLVRLGADA  622

Query  422   CRFEDFVDAKLGKDFVESEAAKLGKIALLCTHDSPSRRPAIDVVIQ  285
             CRF+D++D  L   F E EAAKL +IA LCT +SP  RP+++ V+ 
Sbjct  623   CRFQDYIDPNLHGRFFEYEAAKLARIAWLCTLESPMERPSMEAVVH  668



>ref|XP_010692238.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
GSO1 [Beta vulgaris subsp. vulgaris]
Length=676

 Score =   769 bits (1986),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 404/643 (63%), Positives = 489/643 (76%), Gaps = 13/643 (2%)
 Frame = -3

Query  2198  LMAIKASLDPGNLVLSSWSPNVTDPCSVSSFEGIACNDLGQVVNISLQGKGLYGKIPPEI  2019
             L+ +K SLDP    LSSW+ N  DPCS  +FEG+ACN+LG+V NISLQGKGL G +P  I
Sbjct  33    LIELKTSLDPHKTFLSSWTDN-GDPCS-GTFEGVACNELGKVANISLQGKGLDGVLPAAI  90

Query  2018  GQLNGLSGLYLHFNNLHGVIPKEIASLTQLSDLYLNMNDLSGFIPSEIGNMPNLQVLQLC  1839
               L  LSGLYLHFN L G IPKEI  LTQL+DLYL++N  +G IP  IGNM NLQVLQLC
Sbjct  91    AGLKSLSGLYLHFNRLTGHIPKEIGGLTQLTDLYLDVNYFTGTIPDVIGNMSNLQVLQLC  150

Query  1838  YNRFEGCIPNKLGSLKNLTVLALQSNQLTGAIPASlggltlltrldLSFNRLFGSIPVKL  1659
             YN+  G +P ++GSLK L VLALQ NQLTGAIPASLG L +LTRLDLSFN+ FG IPVKL
Sbjct  151   YNKLSGNVPTQIGSLKKLNVLALQYNQLTGAIPASLGELDMLTRLDLSFNKFFGPIPVKL  210

Query  1658  SEASKLEVLDLRNNTLSGNVPLGLKRLNEGFRYENNPGLCGTGFPSLALCSDSS-LNPTK  1482
             +EA  L +LD+RNNTLSGNVP  L RL++ F+Y NN  LCG GF SL +C+DS+  +  K
Sbjct  211   AEAPLLRILDVRNNTLSGNVPAALHRLSDQFQYANNQDLCGVGFASLRVCTDSNHQSKNK  270

Query  1481  PEPFGQGSNRLPTKDIPESANIPHQLNQNRKPQAA----AAVVGVIGLFVILAVAGLFTF  1314
             PE F  GS    +KDIPESA +P   ++++   ++    A ++  + +  ++ V GL TF
Sbjct  271   PEAFTPGSPGYGSKDIPESAALPSNCSKSQCSNSSKSSHAGIISGVVVIALVTVIGLSTF  330

Query  1313  SWYRRRKQQIGSTVDISESRVSTDQPKVLCRRSTSPLISLEYSNGWDPLAKDQSGSALSQ  1134
             SWYRRRKQ+I S +D ++ R+STDQ K   RRS +PLISLEYSNGWDPLAK       S 
Sbjct  331   SWYRRRKQKIASNLDTTDGRLSTDQGKDGYRRSAAPLISLEYSNGWDPLAKG------SH  384

Query  1133  EVLESFMFNLDEVESATQYFSETNLLGKSSFSAVYKGTLRDGSAVAVKCISKTSCKSDEA  954
             E+ E++MFNL++VESATQ+ SE N LG+S++SAVYKG LRDGS VA+K I+KT CK+DEA
Sbjct  385   ELFENYMFNLEDVESATQHLSEVNFLGRSNYSAVYKGVLRDGSTVAIKRIAKTGCKTDEA  444

Query  953   EFRKGLTLLTSLKHENLLRLRGFCCSKGRGECFLIYDFVSNGNLLRYLDVKDEKGKVLDW  774
             EF KGL +LTSL+H NL+RLRGFCCSKGRGECFLIYDFV NGNLL+YLDVKD   KVL+W
Sbjct  445   EFLKGLKILTSLQHGNLVRLRGFCCSKGRGECFLIYDFVPNGNLLQYLDVKDGNDKVLNW  504

Query  773   STRTAIIKGIARGIKYLHGNKRNKPALVHRNISADKVLIDHLYKPLLSDSGLHKLLADDI  594
             STR AIIKGIA+GI YLH  + +KPALVH+NISA+KVLID    PLL  S L+KLLADDI
Sbjct  505   STRVAIIKGIAKGIDYLHTPQGSKPALVHQNISAEKVLIDWRLNPLLVGSCLYKLLADDI  564

Query  593   VFSTLKGSAANGYLAPEYAITGRFTEKSDMYAFGVIILQILSGSCVVTQSNHQGAELCRF  414
             VFS LK SAA GYLAPEY  TG+FT+KSD+YAFG +ILQILSG   +  S HQGAE  RF
Sbjct  565   VFSMLKASAAMGYLAPEYTTTGKFTDKSDVYAFGTLILQILSGKTKIDLSIHQGAESGRF  624

Query  413   EDFVDAKLGKDFVESEAAKLGKIALLCTHDSPSRRPAIDVVIQ  285
             E+F+DA L  ++ ESEA +LGKIA LCTH+ P +RP+I+ V Q
Sbjct  625   EEFIDANLHGNYSESEACELGKIASLCTHELPHQRPSINTVRQ  667



>ref|XP_007143904.1| hypothetical protein PHAVU_007G112100g [Phaseolus vulgaris]
 gb|ESW15898.1| hypothetical protein PHAVU_007G112100g [Phaseolus vulgaris]
Length=676

 Score =   769 bits (1985),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 391/645 (61%), Positives = 492/645 (76%), Gaps = 14/645 (2%)
 Frame = -3

Query  2198  LMAIKASLDPGNLVLSSWSPNVTDPCSVSSFEGIACNDLGQVVNISLQGKGLYGKIPPEI  2019
             LM +KASLDP +L L SW+ N  DPC    FEG+ACN+ GQV N+SLQGKGL GK+ P I
Sbjct  30    LMDMKASLDPESLYLPSWTIN-GDPCD-GYFEGVACNEKGQVANVSLQGKGLSGKLSPAI  87

Query  2018  GQLNGLSGLYLHFNNLHGVIPKEIASLTQLSDLYLNMNDLSGFIPSEIGNMPNLQVLQLC  1839
               L  L+GLYLH+N+L+G IP+EIA+LT+L DLYLN+N+LSG IP EI +M NLQVLQLC
Sbjct  88    AGLKHLTGLYLHYNSLYGDIPREIANLTELVDLYLNVNNLSGEIPREIASMENLQVLQLC  147

Query  1838  YNRFEGCIPNKLGSLKNLTVLALQSNQLTGAIPASlggltlltrldLSFNRLFGSIPVKL  1659
             YNR  G IP +LG+LK L+V+ALQSN LTGAIPASLG L +L RLDLS N LFGSIP  L
Sbjct  148   YNRLTGSIPTQLGALKKLSVVALQSNMLTGAIPASLGDLGMLARLDLSSNNLFGSIPTSL  207

Query  1658  SEASKLEVLDLRNNTLSGNVPLGLKRLNEGFRYENNPGLCGTGFPSLALCSDSS-LNPTK  1482
             +EA  L VLD+ NNTLSGNVP  LKRL++GF YE N GLCG GF SL  C+ S  + P++
Sbjct  208   AEAISLRVLDVHNNTLSGNVPPALKRLDDGFLYEYNLGLCGVGFSSLKACNASDHVIPSR  267

Query  1481  PEPFGQGSNRLPTKDIPESANIP------HQLNQNRKPQAAAAVVGVIGLFVILAVAGLF  1320
             PEP+G       T+DIPE+AN+         LN ++  Q+ +  VG+  + + ++  G+ 
Sbjct  268   PEPYGAA-----TRDIPETANVKLPCNGTQCLNSSKSNQSTSIAVGIFVVIIAMSAIGVL  322

Query  1319  TFSWYRRRKQQIGSTVDISESRVSTDQPKVLCRRSTSPLISLEYSNGWDPLAKDQSGSAL  1140
             TF+ YRRRKQ++G +  IS++R ST++   + R++ SPL+SLEYS GWDPLA+ ++ S  
Sbjct  323   TFTLYRRRKQKLGGSFHISDNRQSTEEAMGVYRKNGSPLVSLEYSTGWDPLAESRNLSGY  382

Query  1139  SQEVLESFMFNLDEVESATQYFSETNLLGKSSFSAVYKGTLRDGSAVAVKCISKTSCKSD  960
             SQ++ +S  FNL+EVESATQYFSE NLLGK+SFSA Y+G LRDGS VAVK ISKTSCKSD
Sbjct  383   SQDMFQSLRFNLEEVESATQYFSELNLLGKNSFSATYRGVLRDGSVVAVKSISKTSCKSD  442

Query  959   EAEFRKGLTLLTSLKHENLLRLRGFCCSKGRGECFLIYDFVSNGNLLRYLDVKDEKGKVL  780
             EAEF KGL +LTSL+++N++RLRGFCCS+GRGECFLIYDFVSNGNL R LDVK+  G+VL
Sbjct  443   EAEFMKGLNMLTSLRNDNVVRLRGFCCSRGRGECFLIYDFVSNGNLSRLLDVKEGDGEVL  502

Query  779   DWSTRTAIIKGIARGIKYLHGNKRNKPALVHRNISADKVLIDHLYKPLLSDSGLHKLLAD  600
             +WSTR +I+KG+A+G+ YLH  K NKP +VH+NISADKVLID  Y PLL+ SGL+KLL +
Sbjct  503   EWSTRVSIVKGVAKGMAYLHAYKANKPVIVHQNISADKVLIDQRYNPLLAGSGLYKLLTN  562

Query  599   DIVFSTLKGSAANGYLAPEYAITGRFTEKSDMYAFGVIILQILSGSCVVTQSNHQGAELC  420
             DIVFS LKGSAA GYLAPEYA TGR  + SD+YAFGV++ QILSG   +T S    AE  
Sbjct  563   DIVFSALKGSAAKGYLAPEYATTGRLAQTSDVYAFGVLLFQILSGKQEITSSIRLAAESS  622

Query  419   RFEDFVDAKLGKDFVESEAAKLGKIALLCTHDSPSRRPAIDVVIQ  285
             +F++F+D  L   + E EAAKL KIALLC+H+SP  RPA++ ++Q
Sbjct  623   KFQEFMDPNLHGRYFEYEAAKLAKIALLCSHESPFERPAMEAIVQ  667



>ref|XP_009593156.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g34110 [Nicotiana tomentosiformis]
Length=681

 Score =   768 bits (1983),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 400/645 (62%), Positives = 498/645 (77%), Gaps = 10/645 (2%)
 Frame = -3

Query  2198  LMAIKASLDPGNLVLSSWSPNVTDPCSVSSFEGIACNDLGQVVNISLQGKGLYGKIPPEI  2019
             LM +KASLDP N +L SW+ +  DPC   SFEG+ACN+ GQV NISLQGK L GK+ P I
Sbjct  31    LMDLKASLDPENALLISWTVS-GDPCD-GSFEGVACNEKGQVANISLQGKRLSGKLSPAI  88

Query  2018  GQLNGLSGLYLHFNNLHGVIPKEIASLTQLSDLYLNMNDLSGFIPSEIGNMPNLQVLQLC  1839
               L+ L+GLYLH+N+L+G IP+EI+SL +L+DLYLN+N+LSG IPSE+GNM +LQVLQLC
Sbjct  89    SGLSHLTGLYLHYNSLYGEIPREISSLIELTDLYLNVNNLSGEIPSELGNMSSLQVLQLC  148

Query  1838  YNRFEGCIPNKLGSLKNLTVLALQSNQLTGAIPASlggltlltrldLSFNRLFGSIPVKL  1659
             YN+F G IP +LG+LK L VLALQSNQLTGAIPASLG L +L R+DLS N LFGSIP KL
Sbjct  149   YNQFSGSIPTQLGTLKKLNVLALQSNQLTGAIPASLGELGVLMRVDLSSNHLFGSIPSKL  208

Query  1658  SEASKLEVLDLRNNTLSGNVPLGLKRLNEGFRYENNPGLCGTGFPSLALCS--DSSLNPT  1485
             ++A  LE LD+RNN LSGNVPL LKRL  GF+YENNPGLCG GFPSL +C+  D S NP 
Sbjct  209   ADAPLLEALDIRNNKLSGNVPLALKRLVGGFQYENNPGLCGVGFPSLRVCTSLDRS-NPN  267

Query  1484  KPEPFGQGSNRLPTKDIPESANIPHQLNQN-----RKPQAAAAVVGVIGLFVILAVAGLF  1320
             +PEP+G GS+ L T+DIPE+AN+    + N      K   A+ VVGVI + VI +  G+ 
Sbjct  268   RPEPYGGGSSGLSTRDIPETANLNLNCSGNGCAKSSKTSQASVVVGVIVVTVIASAIGVL  327

Query  1319  TFSWYRRRKQQIGSTVDISESRVSTDQPKVLCRRSTSPLISLEYSNGWDPLAKDQSGSAL  1140
             TF+ YRRR Q++   +D+ +SR+STDQ K + R++ SPL+SLEYS+GWDPLA+ +    +
Sbjct  328   TFTHYRRRNQKLRGGLDMCDSRLSTDQAKEVNRKNGSPLVSLEYSSGWDPLAEGRRYGGV  387

Query  1139  SQEVLESFMFNLDEVESATQYFSETNLLGKSSFSAVYKGTLRDGSAVAVKCISKTSCKSD  960
             SQEVL+S+ FNL+EVESATQYF++ N L KS+FS  Y+GTLRDGS VAV  ++K SCKS+
Sbjct  388   SQEVLQSYRFNLEEVESATQYFADKNRLAKSNFSTTYRGTLRDGSLVAVTRLTKISCKSE  447

Query  959   EAEFRKGLTLLTSLKHENLLRLRGFCCSKGRGECFLIYDFVSNGNLLRYLDVKDEKGKVL  780
             EAEF +GL +LTSL+HENL+RLRGFCCSK RGECFL+YDFV  GNLL YLDVK++  + L
Sbjct  448   EAEFLRGLNILTSLRHENLVRLRGFCCSKSRGECFLVYDFVPRGNLLHYLDVKEDDARAL  507

Query  779   DWSTRTAIIKGIARGIKYLHGNKRNKPALVHRNISADKVLIDHLYKPLLSDSGLHKLLAD  600
             +WSTR +II G A+GI+YLHG K NKPALVH+NI A+ VL+D  +KPLLS+SGLHKLL +
Sbjct  508   EWSTRVSIISGTAKGIEYLHGCKVNKPALVHQNICAENVLLDQRFKPLLSNSGLHKLLTN  567

Query  599   DIVFSTLKGSAANGYLAPEYAITGRFTEKSDMYAFGVIILQILSGSCVVTQSNHQGAELC  420
             DIVFS LK SAA GYLAPEY+ TGRFTE+SD+YAFGV+I QILSG    T S    AE C
Sbjct  568   DIVFSALKASAAMGYLAPEYSTTGRFTERSDIYAFGVLIFQILSGKRKFTSSMRAAAESC  627

Query  419   RFEDFVDAKLGKDFVESEAAKLGKIALLCTHDSPSRRPAIDVVIQ  285
             +  D +DA L   F + EAAKL  IALLCTH+ P  RP ++ +++
Sbjct  628   KLHDLMDANLRGRFSDPEAAKLANIALLCTHECPEERPTMETIVR  672



>ref|XP_006365244.1| PREDICTED: somatic embryogenesis receptor kinase 1-like [Solanum 
tuberosum]
Length=678

 Score =   766 bits (1979),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 394/645 (61%), Positives = 496/645 (77%), Gaps = 10/645 (2%)
 Frame = -3

Query  2198  LMAIKASLDPGNLVLSSWSPNVTDPCSVSSFEGIACNDLGQVVNISLQGKGLYGKIPPEI  2019
             LM +KASLDP N +L+SW+ +  +PC   SFEGIACN+ GQV NISLQGKGL GK+ P I
Sbjct  28    LMDLKASLDPENALLTSWTVS-GNPCD-GSFEGIACNEKGQVANISLQGKGLKGKLSPAI  85

Query  2018  GQLNGLSGLYLHFNNLHGVIPKEIASLTQLSDLYLNMNDLSGFIPSEIGNMPNLQVLQLC  1839
               L  L+GLYLH+N+L+G IP+EI++L +L+DLYLN+NDLSG IP E+G M  LQVLQLC
Sbjct  86    AGLTHLTGLYLHYNSLYGEIPREISNLVELTDLYLNVNDLSGEIPQELGTMSKLQVLQLC  145

Query  1838  YNRFEGCIPNKLGSLKNLTVLALQSNQLTGAIPASlggltlltrldLSFNRLFGSIPVKL  1659
             YN F G IP +LG+L  L VLALQSNQLTGAIPASLG L +L R+DLS+N LFGSIP KL
Sbjct  146   YNHFTGSIPTQLGTLTKLNVLALQSNQLTGAIPASLGDLGVLMRVDLSYNSLFGSIPSKL  205

Query  1658  SEASKLEVLDLRNNTLSGNVPLGLKRLNEGFRYENNPGLCGTGFPSLALCS--DSSLNPT  1485
             ++A  LEVLD+RNN +SGNVPL LKRL  GF+YENNPGLCG GFPSL +C+  D S NP 
Sbjct  206   ADAPLLEVLDIRNNKISGNVPLALKRLVGGFQYENNPGLCGVGFPSLRVCTSLDRS-NPN  264

Query  1484  KPEPFGQGSNRLPTKDIPESANIPHQLNQN-----RKPQAAAAVVGVIGLFVILAVAGLF  1320
             +PEP+G GS+ L T+DIPE+AN+    + N      K   A+ VVGVI + +I +  G+ 
Sbjct  265   RPEPYGVGSSGLSTRDIPETANLNLNCSGNACTTSSKTSQASVVVGVIVVTIIASAIGIL  324

Query  1319  TFSWYRRRKQQIGSTVDISESRVSTDQPKVLCRRSTSPLISLEYSNGWDPLAKDQSGSAL  1140
             +F+ YRRRKQ++G  +++ +SR+S DQ K + R++ SPL+SLEYS GWDPLA+ +    +
Sbjct  325   SFTHYRRRKQKLGGGLEMCDSRLSIDQAKEVNRKNGSPLVSLEYSIGWDPLAEGRRYGGV  384

Query  1139  SQEVLESFMFNLDEVESATQYFSETNLLGKSSFSAVYKGTLRDGSAVAVKCISKTSCKSD  960
             SQE+L+ + FNL+EVESATQYF++ NLL KS+FS  Y+GTLRDGS VAV  I+K SCKS+
Sbjct  385   SQEILQRYRFNLEEVESATQYFADKNLLAKSNFSTTYRGTLRDGSLVAVTRIAKISCKSE  444

Query  959   EAEFRKGLTLLTSLKHENLLRLRGFCCSKGRGECFLIYDFVSNGNLLRYLDVKDEKGKVL  780
             EAEF +GL +LTSL+H+NL+RLRGFCCSK RGECFL+YDFV  GNLL YLD+K+++   L
Sbjct  445   EAEFLRGLNILTSLRHDNLVRLRGFCCSKSRGECFLVYDFVPRGNLLHYLDLKEDEAHAL  504

Query  779   DWSTRTAIIKGIARGIKYLHGNKRNKPALVHRNISADKVLIDHLYKPLLSDSGLHKLLAD  600
             +WSTR +II G A+G++YLHG K NKPALVH+NI A+ VL+D  +KPLLS+SGLHKLL +
Sbjct  505   EWSTRVSIISGTAKGVEYLHGCKVNKPALVHQNICAENVLLDQRFKPLLSNSGLHKLLTN  564

Query  599   DIVFSTLKGSAANGYLAPEYAITGRFTEKSDMYAFGVIILQILSGSCVVTQSNHQGAELC  420
             D VFSTLK SAA GYLAPEY+ TGRFTE+SD+YAFGV+I QILSG    T S    AE  
Sbjct  565   DTVFSTLKASAAMGYLAPEYSTTGRFTERSDIYAFGVLIFQILSGKRKFTSSMRAAAESS  624

Query  419   RFEDFVDAKLGKDFVESEAAKLGKIALLCTHDSPSRRPAIDVVIQ  285
             +F D +D  L   F ESEA KL KIALLCTH+ P  RP ++ +++
Sbjct  625   KFHDLMDVNLRGRFSESEATKLAKIALLCTHECPEERPTMETIVR  669



>ref|XP_003536190.1| PREDICTED: somatic embryogenesis receptor kinase 5-like [Glycine 
max]
 gb|KHN30538.1| Protein NSP-INTERACTING KINASE 2 [Glycine soja]
Length=677

 Score =   765 bits (1976),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 392/645 (61%), Positives = 491/645 (76%), Gaps = 14/645 (2%)
 Frame = -3

Query  2198  LMAIKASLDPGNLVLSSWSPNVTDPCSVSSFEGIACNDLGQVVNISLQGKGLYGKIPPEI  2019
             LM +KASLDP +L L SWS N  DPC   SFEG+ACN+ GQV NISLQGKGL+GK+   I
Sbjct  31    LMDMKASLDPESLYLPSWSIN-GDPCD-GSFEGVACNEKGQVANISLQGKGLFGKLSAAI  88

Query  2018  GQLNGLSGLYLHFNNLHGVIPKEIASLTQLSDLYLNMNDLSGFIPSEIGNMPNLQVLQLC  1839
               L  L+GLYLH+N+L+G IP+EIA+LT+L DLYLN+N+LSG IP +I +M NLQVLQLC
Sbjct  89    AGLKHLTGLYLHYNSLYGEIPREIANLTELVDLYLNVNNLSGEIPRKIASMENLQVLQLC  148

Query  1838  YNRFEGCIPNKLGSLKNLTVLALQSNQLTGAIPASlggltlltrldLSFNRLFGSIPVKL  1659
             YN+  G IP +LG+L+ L V+ALQSN LTGAIPA+LG L +L RLDLS N LFGSIP  L
Sbjct  149   YNQLTGSIPTQLGALEKLRVVALQSNNLTGAIPANLGELGMLVRLDLSSNNLFGSIPTSL  208

Query  1658  SEASKLEVLDLRNNTLSGNVPLGLKRLNEGFRYENNPGLCGTGFPSLALCSDSS-LNPTK  1482
             ++A  L+VLD+ NNTLSGNVP  LKRL++GF YE N GLCG GF SL  C+ S  +NP++
Sbjct  209   ADAPSLKVLDVHNNTLSGNVPPALKRLDDGFLYEYNLGLCGVGFSSLKACNASDHVNPSR  268

Query  1481  PEPFGQGSNRLPTKDIPESANI------PHQLNQNRKPQAAAAVVGVIGLFVILAVAGLF  1320
             PEP+G       T+DIPE+AN+         LN ++  Q+ +  V +  + + L   G+ 
Sbjct  269   PEPYGAA-----TRDIPETANVKLPCRGAQCLNSSKSNQSTSITVSIFVVMIALCAIGVL  323

Query  1319  TFSWYRRRKQQIGSTVDISESRVSTDQPKVLCRRSTSPLISLEYSNGWDPLAKDQSGSAL  1140
             TF+ YRRRKQ++G +  IS+S +STD+     R++ SPL+SLEYS GWDPLA  ++ +  
Sbjct  324   TFTIYRRRKQKLGDSFHISDSHLSTDEAIGAYRKNGSPLVSLEYSTGWDPLADSRNFNGY  383

Query  1139  SQEVLESFMFNLDEVESATQYFSETNLLGKSSFSAVYKGTLRDGSAVAVKCISKTSCKSD  960
             SQE+ +S  FNL+EVESATQYFSE NLLGK+SFSA Y+G LRDGS VAVK ISKTSCKSD
Sbjct  384   SQEMFQSLRFNLEEVESATQYFSELNLLGKNSFSATYRGVLRDGSVVAVKSISKTSCKSD  443

Query  959   EAEFRKGLTLLTSLKHENLLRLRGFCCSKGRGECFLIYDFVSNGNLLRYLDVKDEKGKVL  780
             E EF KGL +LTSL+ +N++RLRGFCCS+GRGECFLIYDFV NGNL R+LDVK+  G+VL
Sbjct  444   EGEFMKGLHMLTSLRSDNVVRLRGFCCSRGRGECFLIYDFVPNGNLSRFLDVKEGDGEVL  503

Query  779   DWSTRTAIIKGIARGIKYLHGNKRNKPALVHRNISADKVLIDHLYKPLLSDSGLHKLLAD  600
             +WSTR +I+KGIA+G+ YLH  K NKP LVH+NISADKVLID  Y PLL+DSGL+KLL +
Sbjct  504   EWSTRVSIVKGIAKGMAYLHAYKANKPVLVHQNISADKVLIDQRYNPLLADSGLYKLLTN  563

Query  599   DIVFSTLKGSAANGYLAPEYAITGRFTEKSDMYAFGVIILQILSGSCVVTQSNHQGAELC  420
             DIVFS LKGSAA GYLAPEYA TGRF+E SD+YAFGV++ QILSG   +T S    AE  
Sbjct  564   DIVFSALKGSAAKGYLAPEYATTGRFSETSDVYAFGVMLFQILSGKHEITSSIRLAAESS  623

Query  419   RFEDFVDAKLGKDFVESEAAKLGKIALLCTHDSPSRRPAIDVVIQ  285
             +F++F+D  L   + E EAAKL KIALLC+H+SP  RP+++ ++Q
Sbjct  624   KFQEFMDPNLHGRYFEYEAAKLAKIALLCSHESPFERPSMEGIVQ  668



>ref|XP_009372936.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At5g10290 [Pyrus x bretschneideri]
Length=668

 Score =   765 bits (1975),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 403/648 (62%), Positives = 494/648 (76%), Gaps = 27/648 (4%)
 Frame = -3

Query  2198  LMAIKASLDPGNLVLSSWSPNVTDPCSVSSFEGIACNDLGQVVNISLQGKGLYGKIPPEI  2019
             L+ +KA LDP  L LSSW+ N  DPC   SFEGI CN            K L GK+ P I
Sbjct  29    LLDMKALLDPQGLYLSSWTVN-GDPCD-GSFEGIGCN------------KRLSGKLSPAI  74

Query  2018  GQLNGLSGLYLHFNNLHGVIPKEIASLTQLSDLYLNMNDLSGFIPSEIGNMPNLQVLQLC  1839
              QL  L+G+Y+H+N+L G IP+EIA+LT+L+DLYLN+N+LSG IP EIG+M +LQVLQLC
Sbjct  75    AQLKHLTGIYMHYNSLQGEIPREIANLTELTDLYLNVNNLSGVIPPEIGSMSSLQVLQLC  134

Query  1838  YNRFEGCIPNKLGSLKNLTVLALQSNQLTGAIPASlggltlltrldLSFNRLFGSIPVKL  1659
             YN+  G IP +LGSLKNL+VLALQSNQLTGAIPASLG L +L RLDLS N LFGSIP KL
Sbjct  135   YNQLTGSIPTQLGSLKNLSVLALQSNQLTGAIPASLGDLEMLMRLDLSVNHLFGSIPTKL  194

Query  1658  SEASKLEVLDLRNNTLSGNVPLGLKRLNEGFRYENNPGLCGTGFPSLALCSDSS-LNPTK  1482
             ++A  LEVLD+RNNTLSGNVPL LKRLNEGF YENN GLCG GF SL  C+ S  LN ++
Sbjct  195   ADAPVLEVLDVRNNTLSGNVPLALKRLNEGFSYENNLGLCGAGFMSLTACTTSGHLNTSR  254

Query  1481  PEPFGQGSNRLPTKDIPESANIPHQLNQNR-----KPQAAAAVVGVIGLFVILAVAGL--  1323
             PEPF  G   +PT+DIPE+A++P   NQ R     K   A+  V V  + V +A++G+  
Sbjct  255   PEPFRAG---VPTRDIPETAHVPLPCNQTRCSNLSKSHQASVAVVVGLIVVTIALSGVGF  311

Query  1322  FTFSWYRRRKQQIGSTVDISESRVSTDQPKV--LCRRSTSPLISLEYSNGWDPLAKDQSG  1149
               F+ +RRRKQ++G++ D ++ R+STD+ K   + R++ SPLISLEY+NGWDPLA  ++ 
Sbjct  312   LFFAQHRRRKQKLGNSFDTADGRLSTDEAKGNGVYRKNGSPLISLEYANGWDPLADGRNL  371

Query  1148  SALSQEVLESFMFNLDEVESATQYFSETNLLGKSSFSAVYKGTLRDGSAVAVKCISKTSC  969
             SA +QEV +SF FNL+EVE+ATQYFSE NLLGKS+FSA YKG LRDGS V++K I K+ C
Sbjct  372   SAFAQEVFQSFRFNLEEVETATQYFSEVNLLGKSNFSATYKGILRDGSVVSIKSIGKSCC  431

Query  968   KSDEAEFRKGLTLLTSLKHENLLRLRGFCCSKGRGECFLIYDFVSNGNLLRYLDVKDEKG  789
             K++E+EF KGL +LTSL+HENL+ LRGFCCSKGRGECFLIYDFV NGNLL+YLDV+D   
Sbjct  432   KTEESEFLKGLNMLTSLRHENLVSLRGFCCSKGRGECFLIYDFVPNGNLLQYLDVQDGDS  491

Query  788   KVLDWSTRTAIIKGIARGIKYLHGNKRNKPALVHRNISADKVLIDHLYKPLLSDSGLHKL  609
              VL+W+TR +I+KGIA+G+ YLHG K NKPALVH+NISA+KV ID  Y PLLSD GLHKL
Sbjct  492   HVLEWTTRVSIVKGIAKGLSYLHGYKPNKPALVHQNISAEKVQIDQRYSPLLSDPGLHKL  551

Query  608   LADDIVFSTLKGSAANGYLAPEYAITGRFTEKSDMYAFGVIILQILSGSCVVTQSNHQGA  429
             L +D+VFS LK SAA GYLAPEY  TGRFTEKSD+YAFGV++LQILSG   VT S   GA
Sbjct  552   LTNDVVFSALKASAAMGYLAPEYTTTGRFTEKSDVYAFGVLVLQILSGKRKVTSSMRLGA  611

Query  428   ELCRFEDFVDAKLGKDFVESEAAKLGKIALLCTHDSPSRRPAIDVVIQ  285
             E  RF+DF+D  L   F E EA+KL K ALLCTH+SP  RP+++ V+Q
Sbjct  612   ESGRFQDFIDQNLKGRFFEYEASKLAKTALLCTHESPIERPSMEEVVQ  659



>gb|KHG09358.1| Leucine-rich repeat receptor protein kinase EXS [Gossypium arboreum]
Length=672

 Score =   764 bits (1973),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 394/653 (60%), Positives = 497/653 (76%), Gaps = 18/653 (3%)
 Frame = -3

Query  2225  SNNASTVSLLMAIKASLDPGNLVLSSWSPNVTDPCSVSSFEGIACNDLGQVVNISLQGKG  2046
             S+N S +  LM IKASLDP N  L+SW+   +DPCS   FEG+ACN+ GQV NISLQGKG
Sbjct  23    SSNTSELRALMDIKASLDPDNQYLTSWTTK-SDPCS---FEGLACNEQGQVANISLQGKG  78

Query  2045  LYGKIPPEIGQLNGLSGLYLHFNNLHGVIPKEIASLTQLSDLYLNMNDLSGFIPSEIGNM  1866
             L GKI P I +L  L+GL+LH+N+L+G +P+EIA+LTQL+DLYLNMN+LSG IP EI  M
Sbjct  79    LSGKISPAIAELQNLTGLFLHYNSLYGEVPREIANLTQLADLYLNMNNLSGEIPPEIAQM  138

Query  1865  PNLQVLQLCYNRFEGCIPNKLGSLKNLTVLALQSNQLTGAIPASlggltlltrldLSFNR  1686
              +L+VLQLCYN+  G IP + GSLK L VLALQSNQLTGAIPASLG L  L RLDLSFN 
Sbjct  139   DSLRVLQLCYNQLTGSIPTQFGSLKKLNVLALQSNQLTGAIPASLGDLGTLIRLDLSFND  198

Query  1685  LFGSIPVKLSEASKLEVLDLRNNTLSGNVPLGLKRLNEGFRYENNPGLCGTGFPSLALCS  1506
             LFGSIP KL++A  LEVLD+RNN+LSGNVPL LKRLN+GF ++NN GLCG+GF SL  C+
Sbjct  199   LFGSIPTKLADAPLLEVLDIRNNSLSGNVPLALKRLNDGFLFQNNLGLCGSGFASLEPCN  258

Query  1505  DS-SLNPTKPEPFGQGSNRLPTKDIPESANI--PHQLNQNRKP---QAAAAVVGVIGLFV  1344
              S   NPT+PE +GQG   + +++IPE+AN+  P + +Q  KP   +    +VG++ + V
Sbjct  259   TSYQTNPTRPEAYGQGVTGM-SREIPETANLRLPCEQSQCSKPSKSRKGPILVGLVVVTV  317

Query  1343  ILAVAGLFTFSWYRRRKQQIGSTVDISESRVSTDQPKVLCRRSTSPLISLEYSNGWDPLA  1164
              L+  GL  F  YR RK ++G++ +  E++          R+  SPL+S EY+NGWDPL 
Sbjct  318   ALSAIGLLIFKQYRNRKPKLGTSFEEPEAKEGY-------RKKGSPLVSFEYTNGWDPLD  370

Query  1163  KDQSGSALSQEVLESFMFNLDEVESATQYFSETNLLGKSSFSAVYKGTLRDGSAVAVKCI  984
               ++ +  +Q+VL+SF FNL+E+E+ATQYFSE+NLLGKS+F++ YKG LRDGSAV +K I
Sbjct  371   GSRNFNGFTQDVLQSFRFNLEEIETATQYFSESNLLGKSNFASTYKGFLRDGSAVVIKSI  430

Query  983   SKTSCKSDEAEFRKGLTLLTSLKHENLLRLRGFCCSKGRGECFLIYDFVSNGNLLRYLDV  804
             +KTSCKSD++EF KGL +L SLKHEN++RLRGFCCSK RG CFL+YDFV NGNLL+YLDV
Sbjct  431   NKTSCKSDDSEFLKGLNVLASLKHENVVRLRGFCCSKARGGCFLVYDFVPNGNLLQYLDV  490

Query  803   KDEKGKVLDWSTRTAIIKGIARGIKYLHGNKRNKPALVHRNISADKVLIDHLYKPLLSDS  624
             K+  G VLDWSTR +I+KGIA+GI YLH  K NKPALVH+NISA+KVL+DH + PLLSDS
Sbjct  491   KNGDGTVLDWSTRVSIVKGIAKGIAYLHEYKVNKPALVHQNISAEKVLVDHRFNPLLSDS  550

Query  623   GLHKLLADDIVFSTLKGSAANGYLAPEYAITGRFTEKSDMYAFGVIILQILSGSCVVTQS  444
             GLH +L  DIVF +LK SAA GYLAPEYA TGRFTEKSD+YAFG ++LQ+LSG   VT S
Sbjct  551   GLHNILTIDIVFGSLKASAAMGYLAPEYANTGRFTEKSDVYAFGTLVLQLLSGKQKVTSS  610

Query  443   NHQGAELCRFEDFVDAKLGKDFVESEAAKLGKIALLCTHDSPSRRPAIDVVIQ  285
                GAE  +++DF+D  L   F E EAAKL +IA LC H+ P  RP+++ V+Q
Sbjct  611   VRLGAETRKYQDFIDPNLHGRFFEHEAAKLARIAWLCIHECPIERPSMEEVVQ  663



>ref|XP_003556401.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8-like [Glycine 
max]
 gb|KHN05033.1| Protein NSP-INTERACTING KINASE 2 [Glycine soja]
Length=677

 Score =   761 bits (1965),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 392/645 (61%), Positives = 491/645 (76%), Gaps = 14/645 (2%)
 Frame = -3

Query  2198  LMAIKASLDPGNLVLSSWSPNVTDPCSVSSFEGIACNDLGQVVNISLQGKGLYGKIPPEI  2019
             LM +KASLDP +L L SWS N  DPC   SFEGIACN+ GQV N+SLQGKGL GK+ P I
Sbjct  31    LMDMKASLDPESLYLPSWSIN-GDPCD-GSFEGIACNEKGQVANVSLQGKGLLGKLSPAI  88

Query  2018  GQLNGLSGLYLHFNNLHGVIPKEIASLTQLSDLYLNMNDLSGFIPSEIGNMPNLQVLQLC  1839
               L  L+GLYLH+N+L+G IP+EI +LT+L DLYLN+N+LSG IP EI +M NLQVLQLC
Sbjct  89    AGLKHLTGLYLHYNSLYGEIPREIGNLTELVDLYLNVNNLSGEIPREIASMENLQVLQLC  148

Query  1838  YNRFEGCIPNKLGSLKNLTVLALQSNQLTGAIPASlggltlltrldLSFNRLFGSIPVKL  1659
             YN+  G IP +LG+L+ L V+ALQSN LTGAIPASLG L +L RLDLS N LFGSIP  L
Sbjct  149   YNQLTGSIPTQLGALEKLRVVALQSNNLTGAIPASLGDLGMLVRLDLSSNNLFGSIPTSL  208

Query  1658  SEASKLEVLDLRNNTLSGNVPLGLKRLNEGFRYENNPGLCGTGFPSLALCSDSS-LNPTK  1482
             ++A  L+VLD+ NNTLSGNVP  LKRL++GF YE N GLCG GF SL  C+ S  +NP++
Sbjct  209   ADALSLKVLDVHNNTLSGNVPPALKRLDDGFLYEYNLGLCGVGFSSLKACNASDRVNPSR  268

Query  1481  PEPFGQGSNRLPTKDIPESANIP------HQLNQNRKPQAAAAVVGVIGLFVILAVAGLF  1320
             PEP+G       T+DIPE+AN+         LN ++  Q+ +   G+  + + L   G++
Sbjct  269   PEPYGAA-----TRDIPETANVKLPCRGTQCLNSSKSSQSTSVTAGIFVVIIALCAIGVW  323

Query  1319  TFSWYRRRKQQIGSTVDISESRVSTDQPKVLCRRSTSPLISLEYSNGWDPLAKDQSGSAL  1140
             TF+ YRRRKQ++G +  IS+S ++TD+     R++ SPL+SLEYS GWDPLA  ++ +  
Sbjct  324   TFAIYRRRKQKLGDSFHISDSHLNTDEAIGAYRKNGSPLVSLEYSTGWDPLADSRNFNGY  383

Query  1139  SQEVLESFMFNLDEVESATQYFSETNLLGKSSFSAVYKGTLRDGSAVAVKCISKTSCKSD  960
             +Q++ +S  FNL+EVESATQYFSE NLLGKSSFSA Y+G LRDGS VAVK ISKTSCKSD
Sbjct  384   NQDIFQSLRFNLEEVESATQYFSELNLLGKSSFSATYRGVLRDGSVVAVKSISKTSCKSD  443

Query  959   EAEFRKGLTLLTSLKHENLLRLRGFCCSKGRGECFLIYDFVSNGNLLRYLDVKDEKGKVL  780
             EAEF KGL +LTSL+++N++RLRGFCCS+GRGECFLIYDFV NGNL R+LDVK   G+VL
Sbjct  444   EAEFMKGLHMLTSLRNDNVVRLRGFCCSRGRGECFLIYDFVPNGNLSRFLDVKVGGGEVL  503

Query  779   DWSTRTAIIKGIARGIKYLHGNKRNKPALVHRNISADKVLIDHLYKPLLSDSGLHKLLAD  600
             +WSTR +I+KGIA+G+ YLH  K NKP LVH+NISADKVLID  Y PLL+DSG++KLL +
Sbjct  504   EWSTRVSIVKGIAKGMAYLHAYKANKPVLVHQNISADKVLIDQRYNPLLADSGMYKLLTN  563

Query  599   DIVFSTLKGSAANGYLAPEYAITGRFTEKSDMYAFGVIILQILSGSCVVTQSNHQGAELC  420
             DIVFS LKGSAA GYLAPEYA TGRF E SD+YAFGV++ QILSG   +T S    AE  
Sbjct  564   DIVFSALKGSAAKGYLAPEYATTGRFAETSDVYAFGVLLFQILSGKHEITSSIRLAAESS  623

Query  419   RFEDFVDAKLGKDFVESEAAKLGKIALLCTHDSPSRRPAIDVVIQ  285
             ++++F+D  L   + E EAAKL KIALLC+H+SP  RP++D ++Q
Sbjct  624   KYQEFMDPNLHGRYFEYEAAKLAKIALLCSHESPFERPSMDAIVQ  668



>ref|XP_002318874.2| hypothetical protein POPTR_0012s14430g [Populus trichocarpa]
 gb|EEE97094.2| hypothetical protein POPTR_0012s14430g [Populus trichocarpa]
Length=677

 Score =   759 bits (1959),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 400/648 (62%), Positives = 496/648 (77%), Gaps = 8/648 (1%)
 Frame = -3

Query  2213  STVSLLMAIKASLDPGNLVLSSWSPNVTDPCSVSSFEGIACNDLGQVVNISLQGKGLYGK  2034
             + +  LM +K +LDP    LSSW+ N + PC   SFEG+ACN+ GQV NISLQGKGL GK
Sbjct  24    TEIRALMDMKDALDPEARYLSSWNINGS-PCD-GSFEGVACNENGQVANISLQGKGLNGK  81

Query  2033  IPPEIGQLNGLSGLYLHFNNLHGVIPKEIASLTQLSDLYLNMNDLSGFIPSEIGNMPNLQ  1854
             + P I  L  L+GLYLH+N+L+G IP+EIA+LT LSDLYLN+N+LSG IP EIGNM NLQ
Sbjct  82    VSPAITGLKYLTGLYLHYNSLYGEIPREIANLTALSDLYLNVNNLSGEIPPEIGNMANLQ  141

Query  1853  VLQLCYNRFEGCIPNKLGSLKNLTVLALQSNQLTGAIPASlggltlltrldLSFNRLFGS  1674
             VLQLCYN+F G IP++LGSL+ L VLALQSN LTGAIPASLG L +L RLDLS+N  FGS
Sbjct  142   VLQLCYNQFTGSIPSELGSLERLGVLALQSNHLTGAIPASLGDLGMLMRLDLSYNHFFGS  201

Query  1673  IPVKLSEASKLEVLDLRNNTLSGNVPLGLKRLNEGFRYENNPGLCGTGFPSLALCSDSSL  1494
             +P K+++A  LE LD+RNN+LSGNVPL LKRL++GF YENN GLCG GF SL  C+ S L
Sbjct  202   VPTKVADAPLLEFLDIRNNSLSGNVPLALKRLDDGFLYENNLGLCGAGFMSLKACNASGL  261

Query  1493  NPTKPEPFGQGSNRLPTKDIPESANIPHQLNQNR-----KPQAAAAVVGVIGLFVILAVA  1329
              P +PEP+G   N LP ++IPE+AN+    NQ++     K   A+A V    + ++LA  
Sbjct  262   MPGRPEPYGTKVNGLP-REIPETANLRLPCNQSQCSNQSKAHHASAAVVTFVVTILLAAI  320

Query  1328  GLFTFSWYRRRKQQIGSTVDISESRVSTDQPKVLCRRSTSPLISLEYSNGWDPLAKDQSG  1149
             G+ TF   RRRKQ++ S+ +IS+SR+STDQ K + R++ SPLISLEY NGWDPLA  ++ 
Sbjct  321   GILTFIQCRRRKQKLASSFEISDSRLSTDQAKGVYRKNGSPLISLEYPNGWDPLADGRNL  380

Query  1148  SALSQEVLESFMFNLDEVESATQYFSETNLLGKSSFSAVYKGTLRDGSAVAVKCISKTSC  969
             S  +Q+V +SF FNL+EVE+ATQYFS+ NLLGK +FSA Y+G LRDGS VA+K ISK+SC
Sbjct  381   SGNAQDVFQSFRFNLEEVETATQYFSKVNLLGKINFSATYRGILRDGSTVAIKSISKSSC  440

Query  968   KSDEAEFRKGLTLLTSLKHENLLRLRGFCCSKGRGECFLIYDFVSNGNLLRYLDVKDEKG  789
             KS+EAEF KGL  LTSL+HENL+RLRGFCCS+GRGECFLIYDFV NGNLLRYLDVKD  G
Sbjct  441   KSEEAEFLKGLNTLTSLRHENLVRLRGFCCSRGRGECFLIYDFVPNGNLLRYLDVKDGDG  500

Query  788   KVLDWSTRTAIIKGIARGIKYLHGNKRNKPALVHRNISADKVLIDHLYKPLLSDSGLHKL  609
              VL+WSTR +I++GIARGI YLHG   NKP+L+H+NI+A+KVLID    PLL+DSG   L
Sbjct  501   HVLEWSTRVSIVRGIARGIAYLHGYNANKPSLIHQNITAEKVLIDQRCNPLLADSGFQNL  560

Query  608   LADDIVFSTLKGSAANGYLAPEYAITGRFTEKSDMYAFGVIILQILSGSCVVTQSNHQGA  429
             L +DIVFS LK SAA GYLAPEY  TGRFT+KSD+YAFGVI+ Q+LSG   V+     GA
Sbjct  561   LTNDIVFSALKTSAAMGYLAPEYTTTGRFTDKSDVYAFGVIVFQVLSGKQKVSNWVRLGA  620

Query  428   ELCRFEDFVDAKLGKDFVESEAAKLGKIALLCTHDSPSRRPAIDVVIQ  285
             + CRF+D++D  L   F E EAAKL +IA LCT +SP  RP+++ V+ 
Sbjct  621   DACRFQDYIDPNLHGRFFEYEAAKLARIAWLCTLESPMERPSMEAVVH  668



>ref|XP_009382934.1| PREDICTED: BRASSINOSTEROID INSENSITIVE 1-associated receptor 
kinase 1-like [Musa acuminata subsp. malaccensis]
Length=677

 Score =   758 bits (1957),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 402/647 (62%), Positives = 489/647 (76%), Gaps = 9/647 (1%)
 Frame = -3

Query  2207  VSLLMAIKASLDPGNLVLSSWSPNVTDPCSVSSFEGIACNDLGQVVNISLQGKGLYGKIP  2028
             V  LM +KA+LDP + +LSSW+    DPC   +FEG+ACN+ G+V NISLQGKGL G I 
Sbjct  28    VRALMEVKAALDPEDRILSSWTSE-GDPCR-GNFEGVACNEHGKVANISLQGKGLTGSIS  85

Query  2027  PEIGQLNGLSGLYLHFNNLHGVIPKEIASLTQLSDLYLNMNDLSGFIPSEIGNMPNLQVL  1848
             P +  L  LSGLYLH+N + G IP EIA+LT+LSDLYLN+N+LSG IP E+G M +LQVL
Sbjct  86    PAVAGLKCLSGLYLHYNAISGKIPTEIANLTELSDLYLNVNNLSGSIPVELGTMTSLQVL  145

Query  1847  QLCYNRFEGCIPNKLGSLKNLTVLALQSNQLTGAIPASlggltlltrldLSFNRLFGSIP  1668
             QLCYN+  G IP +LG LK L+VLALQSNQL+GAIPASLG LT LTRLDLSFNRLFGSIP
Sbjct  146   QLCYNQLTGSIPTQLGRLKKLSVLALQSNQLSGAIPASLGDLTQLTRLDLSFNRLFGSIP  205

Query  1667  VKLSEASKLEVLDLRNNTLSGNVPLGLKRLNEGFRYENNPGLCGTGFPSLALC-SDSSLN  1491
             VKL+   +L VLD+RNN+LSGNVP GL+RL+ GF Y NN GLCG GF SL +C SD  L 
Sbjct  206   VKLARIPQLTVLDVRNNSLSGNVPSGLRRLSGGFHYGNNKGLCGVGFASLGVCDSDDPLM  265

Query  1490  PTKPEPFGQGSNRLPTKDIPESANIPHQLNQNRKPQAAAAVVGVIGLFVILAV-----AG  1326
             P KPEPFG  S     + IPESAN+    N +R   +  A  G + + +++        G
Sbjct  266   PNKPEPFGPDSRGFRPQQIPESANLNSNCNASRCLNSPKAFSGTVIVGIVVVAVGVMVCG  325

Query  1325  LFTFSWYRRRKQQIGSTVDISESRVSTDQPKVLCRRSTSPLISLEYSNGWDPLAKDQSGS  1146
             LF F WYRRRKQ+IGS +++S SR STDQPK + R+S SPLISLEYSNGWDPLA  +SG 
Sbjct  326   LFAFVWYRRRKQKIGSALEVSNSRCSTDQPKEMFRKSASPLISLEYSNGWDPLADGRSGV  385

Query  1145  ALSQEVLESFMFNLDEVESATQYFSETNLLGKSSFSAVYKGTLRDGSAVAVKCISKTSCK  966
               SQEV  SF FNL+EVE ATQYFSE NLLGKS+F+A YKG LRDGS VA+K I+KTSCK
Sbjct  386   GFSQEVSRSFRFNLEEVECATQYFSEVNLLGKSNFAATYKGILRDGSIVAIKSINKTSCK  445

Query  965   SDEAEFRKGLTLLTSLKHENLLRLRGFCCSKGRGECFLIYDFVSNGNLLRYLDVKDEKGK  786
             ++EAEF KGL LLT L HENL+ LRGFCCS+GRGECFL+YDFV+NG+LL+YLDVKD   +
Sbjct  446   TEEAEFLKGLKLLTLLHHENLIALRGFCCSRGRGECFLVYDFVTNGSLLQYLDVKDNAQR  505

Query  785   VLDWSTRTAIIKGIARGIKYLHGNKRNKPALVHRNISADKVLIDHLYKPLLSDSGLHKLL  606
             VLDW TR +IIKGIA+GI YLH ++ NKP++VH+NISA+K+LID  + P LS SGLHKLL
Sbjct  506   VLDWPTRVSIIKGIAKGIHYLHSSRPNKPSIVHQNISAEKILIDQHFAPRLSGSGLHKLL  565

Query  605   ADDIVFSTLKGSAANGYLAPEYAITGRFTEKSDMYAFGVIILQILSGSCVVTQSNHQGAE  426
             ADD+VFSTLK SAA GYLAPEY   GRFTEKSD+Y+FGV+I QIL+G   VTQ    G +
Sbjct  566   ADDVVFSTLKASAAMGYLAPEYTTVGRFTEKSDVYSFGVVIFQILTGKTNVTQL-RPGPD  624

Query  425   LCRFEDFVDAKLGKDFVESEAAKLGKIALLCTHDSPSRRPAIDVVIQ  285
               + ED +D  L  +F + EAAKL  IA++C  +  ++RP ++ V+Q
Sbjct  625   SIKLEDTLDENLHGNFSKPEAAKLVGIAMICMSEMVNQRPTMEAVLQ  671



>ref|XP_003619618.1| Receptor-like protein kinase [Medicago truncatula]
Length=720

 Score =   759 bits (1960),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 395/681 (58%), Positives = 498/681 (73%), Gaps = 46/681 (7%)
 Frame = -3

Query  2198  LMAIKASLDPGNLVLSSWSPNVTDPCSVSSFEGIACNDLGQVVNISLQGKGLYGKIPPEI  2019
             L+ +K+SLDP    LSSW  +  +PC   SFEG+ACN+ GQV N+SLQGKGL GK+ P I
Sbjct  34    LLDLKSSLDPEGHFLSSWKIH-GNPCD-DSFEGVACNEKGQVANVSLQGKGLSGKLSPAI  91

Query  2018  GQLNGLSGLYLHFNNLHGVIPKEIASLTQLSDLYLNMNDLSGFIPSEIGNMPNLQVLQLC  1839
             G L  L+GLYLH+N+L+G IPKEIA+LTQLSDLYLN+N LSG IPSEIG M NLQVLQLC
Sbjct  92    GDLKHLTGLYLHYNSLYGDIPKEIANLTQLSDLYLNVNHLSGEIPSEIGKMENLQVLQLC  151

Query  1838  YNRFEGCIPNKLGSLKNLTVLALQSNQLTGAIPASlggltlltrldLSFNRLFGSIPVKL  1659
             YN+  G IP +LG LK L+VLALQSN+L GAIPASLG L +L RLDLS N LFGSIP KL
Sbjct  152   YNQLTGSIPTQLGDLKKLSVLALQSNKLAGAIPASLGDLGMLMRLDLSSNNLFGSIPTKL  211

Query  1658  SEASKLEVLDLRNNTLSGNVPLGLKRLNEGFRYENNPGLCGTGFPSLALCSDSS-LNPTK  1482
             ++   L+VLD+ NNTLSGNVP GLK+L++ F YE N GLCG GF SL  C+ S  +NP +
Sbjct  212   ADVPFLQVLDVHNNTLSGNVPPGLKKLDDKFMYEYNLGLCGVGFSSLKACNASDHVNPNR  271

Query  1481  PEPFGQGSNRLPTKDIPESANIPHQLNQNR------KPQAAAAVVGVIGLFVILAVAGLF  1320
             PEP+G G   + +K+IPE+A+I    N  R        + A+  VG++   + ++   + 
Sbjct  272   PEPYGAGVGSM-SKEIPETADIKLPCNTTRCQNSSKSKKTASITVGIVLATIAVSAIAIL  330

Query  1319  TFSWYRRRKQQIGSTVDISESRVSTDQPKVLCRRSTSPLISLEYSNGWDPLAKDQSGSAL  1140
             +F+ YRRRKQ++GS  DI+ESR+STDQ K + R++ SPL+SLEY+NGWDPLA  ++ +  
Sbjct  331   SFTMYRRRKQKLGSAFDITESRLSTDQTKGIYRKNGSPLVSLEYANGWDPLADSRNFNGD  390

Query  1139  SQEVLESFMFNLDEVESATQYFSETNLLGKSSFSAVYKGTLRDGSAVAVKCISKTSCKSD  960
              Q++ +SF FNL+EVESATQYFSE NLLGKS+FSA YKG LRDGS VA+K ISKTSCKSD
Sbjct  391   KQDMFQSFRFNLEEVESATQYFSELNLLGKSNFSATYKGVLRDGSIVAIKSISKTSCKSD  450

Query  959   EAEFRKGLTLLTSLKHENLLRLRGFCCSKGRGECFLIYDFVSNGNLLRYLDVKDEKGKVL  780
             E EF KGL +LTSL+++NL+RLRGFCCS+GRGECFL+YDFVSNGNL +YLDVK+  G+VL
Sbjct  451   EGEFLKGLNILTSLRNDNLVRLRGFCCSRGRGECFLVYDFVSNGNLSQYLDVKEGDGEVL  510

Query  779   DWSTRTAIIKGIAR------------------------------------GIKYLHGNKR  708
             +WSTR +I+KGIA+                                    GI YLH  K 
Sbjct  511   EWSTRVSIVKGIAKGNSFYPLFYYQNIYFCFFTTTNICFKEAKPWHYCHYGISYLHAYKA  570

Query  707   NKPALVHRNISADKVLIDHLYKPLLSDSGLHKLLADDIVFSTLKGSAANGYLAPEYAITG  528
             NKPALVH+NISA+KVLID    P+LSDSGL+KLL +DIVFS+LKGSAA GYLAPEY  TG
Sbjct  571   NKPALVHQNISAEKVLIDQRQNPVLSDSGLYKLLTNDIVFSSLKGSAAKGYLAPEYTTTG  630

Query  527   RFTEKSDMYAFGVIILQILSGSCVVTQSNHQGAELCRFEDFVDAKLGKDFVESEAAKLGK  348
             RFT+KSD+YAFG+++ QIL+G   +T S    AE  +F++F+D  L   F E EAAKL +
Sbjct  631   RFTDKSDVYAFGILLFQILTGKHKITSSLRLAAESFKFQEFIDQNLHGRFFEYEAAKLAR  690

Query  347   IALLCTHDSPSRRPAIDVVIQ  285
             +A+LC+HDSP  RP ++ ++Q
Sbjct  691   MAILCSHDSPFERPTMEAIVQ  711



>ref|XP_010941035.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g63930 [Elaeis guineensis]
Length=682

 Score =   758 bits (1956),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 399/645 (62%), Positives = 486/645 (75%), Gaps = 10/645 (2%)
 Frame = -3

Query  2198  LMAIKASLDPGNLVLSSWSPNVTDPCSVSSFEGIACNDLGQVVNISLQGKGLYGKIPPEI  2019
             LM +KA+LDP   +L+SW+    DPC    FEG+ACN+  +V NISLQGKGL G I P +
Sbjct  35    LMEVKAALDPEGRILASWTSE-GDPCR-GDFEGVACNEQSKVANISLQGKGLSGFISPAV  92

Query  2018  GQLNGLSGLYLHFNNLHGVIPKEIASLTQLSDLYLNMNDLSGFIPSEIGNMPNLQVLQLC  1839
              +L  LSGLYLH+N L G IP+EI++LT+LSDLYLN+NDLSG IP EIG M +LQVLQLC
Sbjct  93    AELRCLSGLYLHYNALRGEIPREISNLTELSDLYLNVNDLSGRIPVEIGKMASLQVLQLC  152

Query  1838  YNRFEGCIPNKLGSLKNLTVLALQSNQLTGAIPASlggltlltrldLSFNRLFGSIPVKL  1659
             YN+  G IP +LG LK LTVLALQSN LTGAIPA+LG LT L RLDLSFN LFGSIPVKL
Sbjct  153   YNQLTGSIPPQLGLLKKLTVLALQSNHLTGAIPATLGDLTQLMRLDLSFNHLFGSIPVKL  212

Query  1658  SEASKLEVLDLRNNTLSGNVPLGLKRLNEGFRYENNPGLCGTGFPSLALCS-DSSLNPTK  1482
             ++   + V DLRNN+LSG+VP  LKRLNEGF+Y NN GLCG GF SL +CS D  L P K
Sbjct  213   AQLPHVVVFDLRNNSLSGSVPSDLKRLNEGFQYSNNTGLCGVGFTSLEVCSSDDLLKPGK  272

Query  1481  PEPFGQGSNRLPTKDIPESANIPHQLNQNR-----KPQAAAAVVGVIGLFVILAVAGLFT  1317
             PEPFG  +  L   +IP+SAN+    N        K  A   V+G++ + V   V  L  
Sbjct  273   PEPFGSDATGLRQPEIPQSANLNAHCNDTHCSNSSKSSAGNVVIGIVAVAVGGMVIILLA  332

Query  1316  FSWYRRRKQQIGSTVDISESRVSTDQPKVLCRRSTSPLISLEYSNGWDPLAKDQSGSALS  1137
              + +RRRKQ+IGS ++ ++SR+STDQP+ L R+  SPLISLEYSNGWDPLA  +SG   S
Sbjct  333   IALHRRRKQKIGSALEATDSRLSTDQPRDLYRKCASPLISLEYSNGWDPLADGRSGVGFS  392

Query  1136  QEVLESFMFNLDEVESATQYFSETNLLGKSSFSAVYKGTLRDGSAVAVKCISKTSCKSDE  957
             QEV +SF FNL+EVE ATQYFSE NL+GKS+F+A YKG LRDG+ VA+K I+KTSCK++E
Sbjct  393   QEVSQSFRFNLEEVECATQYFSEVNLVGKSNFAATYKGILRDGTMVAIKSINKTSCKTEE  452

Query  956   AEFRKGLTLLTSLKHENLLRLRGFCCSKGRGECFLIYDFVSNGNLLRYLDVKDE-KGKVL  780
             AEF KGL +LT L+HENL+ LRGFCCS+GRGECFL+YDFVSNGNL +YLDVKD   G+VL
Sbjct  453   AEFLKGLKILTLLQHENLVGLRGFCCSRGRGECFLVYDFVSNGNLSQYLDVKDHVNGRVL  512

Query  779   DWSTRTAIIKGIARGIKYLHGNKRNKPALVHRNISADKVLIDHLYKPLLSDSGLHKLLAD  600
             DW TR +IIKGIA+GI+YLH N+ NKP+LVH+NISA+KVLIDH + P LS S LHKLLAD
Sbjct  513   DWPTRVSIIKGIAQGIEYLHSNRANKPSLVHQNISAEKVLIDHHFTPQLSGSCLHKLLAD  572

Query  599   DIVFSTLKGSAANGYLAPEYAITGRFTEKSDMYAFGVIILQILSGSCVVTQSNHQGAELC  420
             D+VFSTLK SAA GYLAPEY   GRFTEKSD+YAFGV+I QIL+G   V+       E  
Sbjct  573   DVVFSTLKASAAMGYLAPEYTTIGRFTEKSDVYAFGVLIFQILAGKSSVSHL-RLNPESA  631

Query  419   RFEDFVDAKLGKDFVESEAAKLGKIALLCTHDSPSRRPAIDVVIQ  285
             + E+ +D  L  +F + EAAKL  IALLCT ++PS+RP ++ V+Q
Sbjct  632   KLENLLDENLNGNFSKPEAAKLAGIALLCTSETPSQRPTMEAVLQ  676



>gb|KFK37319.1| hypothetical protein AALP_AA4G241600 [Arabis alpina]
Length=694

 Score =   758 bits (1956),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 399/659 (61%), Positives = 497/659 (75%), Gaps = 27/659 (4%)
 Frame = -3

Query  2189  IKASLDPGNLVLSSWSPNVTDPCSVSSFEGIACNDLGQVVNISLQGKGLYGKIPPEIGQL  2010
             IK+SLDP N  L+SW+PN TDPCS  SF+G+AC+   +V NISLQG GL G IPP IG L
Sbjct  30    IKSSLDPQNRFLTSWTPN-TDPCSSGSFDGVACDGNHRVANISLQGMGLTGTIPPSIGLL  88

Query  2009  NGLSGLYLHFNNLHGVIPKEIASLTQLSDLYLNMNDLSGFIPSEIGNMPNLQVLQLCYNR  1830
               L+GLYLHFN+L G IPK+I++L  L+DLYLN+N+LSG IP +IGN+ NLQV+QLCYN+
Sbjct  89    TSLTGLYLHFNSLTGQIPKDISNLPLLTDLYLNVNNLSGEIPPQIGNLENLQVVQLCYNK  148

Query  1829  FEGCIPNKLGSLKNLTVLALQSNQLTGAIPASlggltlltrldLSFNRLFGSIPVKLSEA  1650
               G IP +LGSLK +TVLALQ NQL+GAIPASLG +  LTRLDLSFN LFG +PVKL+ A
Sbjct  149   LSGSIPTQLGSLKKITVLALQYNQLSGAIPASLGDIFTLTRLDLSFNHLFGPVPVKLAGA  208

Query  1649  SKLEVLDLRNNTLSGNVPLGLKRLNEGFRYENNPGLCGTGFPSLALCSDSS---LN---P  1488
               LEVLD+RNN+ SG VP  LKRLN GF+Y NN GLCG  F  L  C+ S+   LN   P
Sbjct  209   PLLEVLDIRNNSFSGFVPSALKRLNNGFQYSNNHGLCGEDFTDLKPCTGSNEPNLNRPDP  268

Query  1487  TKPEPFGQGSNRLPTKDIPESANIPHQ-----------LNQNRKPQAAAAVVGVIGLFVI  1341
             T P+ F   ++    K  PESA++               ++  K  +   V+G+IG  + 
Sbjct  269   TNPKSFTTTTDNNDVK--PESADLQRSNCTSNNGGTKCSSKASKSTSFGIVIGLIGSILA  326

Query  1340  LAVAGLFTFSWYRRRKQQIGSTVDISESRVSTDQ--PKVLCRRSTSPLISLEYSNGWDPL  1167
             +A+ G  TF+WYRRRKQ+IG+++D  +SRVST+    +   R+S+SPLISLEY++GWDPL
Sbjct  327   IAIFGGSTFTWYRRRKQRIGTSLDTMDSRVSTEYNFKEASRRKSSSPLISLEYASGWDPL  386

Query  1166  AKDQSGS---ALSQEVLESFMFNLDEVESATQYFSETNLLGKSSFSAVYKGTLRDGSAVA  996
              + Q+ S   ALSQEV ESFMFNL+E+E ATQ FSE NLLGKS+ S+VYKG LRDGS  A
Sbjct  387   GRGQNNSNNSALSQEVFESFMFNLEEIERATQSFSEVNLLGKSNVSSVYKGKLRDGSVAA  446

Query  995   VKCISKTSCKSDEAEFRKGLTLLTSLKHENLLRLRGFCCSKGRGECFLIYDFVSNGNLLR  816
             VKCI+K+SCKS+E+EF KGL +LT LKHENL+RLRGFCCSKGRGECFLIY+FV NGNLL+
Sbjct  447   VKCIAKSSCKSNESEFLKGLKMLTLLKHENLVRLRGFCCSKGRGECFLIYEFVPNGNLLQ  506

Query  815   YLDVKDEKGKVLDWSTRTAIIKGIARGIKYLHGNKRNKPALVHRNISADKVLIDHLYKPL  636
             YLDVKDE G+VL+W+TR +II GIARGI YLHG   NKPA+VH+N+SA+K+LIDH Y P 
Sbjct  507   YLDVKDETGEVLEWTTRVSIINGIARGIVYLHGENGNKPAIVHQNLSAEKILIDHWYNPS  566

Query  635   LSDSGLHKLLADDIVFSTLKGSAANGYLAPEYAITGRFTEKSDMYAFGVIILQILSGSCV  456
             L+DSGLHKL  DDIVFS LK SAA GYLAPEY  TGRFT+KSD+YAFG+I+LQILSG   
Sbjct  567   LADSGLHKLFTDDIVFSKLKASAAMGYLAPEYITTGRFTDKSDVYAFGMILLQILSGKSK  626

Query  455   VTQ-SNHQGAELCRF-EDFVDAKLGKDFVESEAAKLGKIALLCTHDSPSRRPAIDVVIQ  285
             ++     Q  E  R  EDF+D  L K+F E+EAA+L ++ LLCTH+S ++RP+++VV+Q
Sbjct  627   ISHLMILQAVESGRLSEDFIDPNLRKNFPEAEAAQLARLGLLCTHESSNQRPSMEVVMQ  685



>ref|XP_002510917.1| leucine rich repeat receptor kinase, putative [Ricinus communis]
 gb|EEF51519.1| leucine rich repeat receptor kinase, putative [Ricinus communis]
Length=603

 Score =   751 bits (1940),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 379/579 (65%), Positives = 459/579 (79%), Gaps = 6/579 (1%)
 Frame = -3

Query  2003  LSGLYLHFNNLHGVIPKEIASLTQLSDLYLNMNDLSGFIPSEIGNMPNLQVLQLCYNRFE  1824
             L GLYLH+N+L+G IPKE+A+LT+LSDLYLN+N+LSG IP E+G M NLQVLQLCYN+F 
Sbjct  16    LKGLYLHYNSLYGEIPKELANLTELSDLYLNVNNLSGEIPPEVGKMENLQVLQLCYNQFT  75

Query  1823  GCIPNKLGSLKNLTVLALQSNQLTGAIPASlggltlltrldLSFNRLFGSIPVKLSEASK  1644
             G IP  +GSLK LTVL+LQSNQLTGAIPASLG L +L RLDLSFN  FGSIP KL++A  
Sbjct  76    GSIPTHIGSLKKLTVLSLQSNQLTGAIPASLGDLGMLMRLDLSFNHFFGSIPTKLADAPV  135

Query  1643  LEVLDLRNNTLSGNVPLGLKRLNEGFRYENNPGLCGTGFPSLALCSDSS-LNPTKPEPFG  1467
             LEVLD+RNN+LSGNVPL LKRLNEGF Y NN GLCG GF  L  C+ S  LNP++PEPFG
Sbjct  136   LEVLDVRNNSLSGNVPLALKRLNEGFLYGNNLGLCGAGFRHLNACNVSDRLNPSRPEPFG  195

Query  1466  QGSNRLPTKDIPESANIPHQLNQNR-----KPQAAAAVVGVIGLFVILAVAGLFTFSWYR  1302
              GS  LPT++IPE+AN+    N        K   A+ VVG I L +   V G+ TF+ YR
Sbjct  196   PGSTGLPTREIPETANLRLACNHTHCSSSSKSHQASVVVGTIILTIAFIVIGILTFTQYR  255

Query  1301  RRKQQIGSTVDISESRVSTDQPKVLCRRSTSPLISLEYSNGWDPLAKDQSGSALSQEVLE  1122
             RRKQ++GS++++S++ VS DQ K + R++ SPLISLEYSNGWDPLA  +S S   Q+V +
Sbjct  256   RRKQRLGSSLEVSDNHVSIDQAKGVYRKNGSPLISLEYSNGWDPLADGRSFSGNEQDVFQ  315

Query  1121  SFMFNLDEVESATQYFSETNLLGKSSFSAVYKGTLRDGSAVAVKCISKTSCKSDEAEFRK  942
             SF FNLDEVE+ATQYFSE NLLGKS+FSA Y+G LRDGS VA K ISKTSCKS+E EF K
Sbjct  316   SFRFNLDEVETATQYFSEVNLLGKSNFSATYRGILRDGSVVAFKSISKTSCKSEETEFLK  375

Query  941   GLTLLTSLKHENLLRLRGFCCSKGRGECFLIYDFVSNGNLLRYLDVKDEKGKVLDWSTRT  762
             GL +LTSL+HENL+RLRGFCCS+GRGECFLIYD+V NGNLL+YLD+KD  G VL+WSTR 
Sbjct  376   GLNILTSLRHENLVRLRGFCCSRGRGECFLIYDYVPNGNLLQYLDLKDGDGHVLEWSTRV  435

Query  761   AIIKGIARGIKYLHGNKRNKPALVHRNISADKVLIDHLYKPLLSDSGLHKLLADDIVFST  582
             +I+KGIA+GI YLHG+K NKPALVH+NI+A+KVL D  Y PLL+DSGL  LL +D+VFS 
Sbjct  436   SIVKGIAKGIAYLHGHKVNKPALVHQNITAEKVLFDQRYNPLLADSGLQNLLTNDVVFSA  495

Query  581   LKGSAANGYLAPEYAITGRFTEKSDMYAFGVIILQILSGSCVVTQSNHQGAELCRFEDFV  402
             LK SAA GYLAPEYA TGRFT+KSD+YAFGVI+ Q+LSG   V+     GAE+CRF+D++
Sbjct  496   LKVSAAMGYLAPEYATTGRFTDKSDVYAFGVIVFQVLSGKRKVSDLVRLGAEVCRFQDYI  555

Query  401   DAKLGKDFVESEAAKLGKIALLCTHDSPSRRPAIDVVIQ  285
             D+ L   F E EAAKL +IA LCTH+SP  RP+++ V+Q
Sbjct  556   DSCLHGKFFEYEAAKLARIAWLCTHESPIERPSMEAVVQ  594



>ref|XP_008803990.1| PREDICTED: somatic embryogenesis receptor kinase 1 [Phoenix dactylifera]
Length=683

 Score =   753 bits (1944),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 395/646 (61%), Positives = 485/646 (75%), Gaps = 11/646 (2%)
 Frame = -3

Query  2198  LMAIKASLDPGNLVLSSWSPNVTDPCSVSSFEGIACNDLGQVVNISLQGKGLYGKIPPEI  2019
             LM +KA LDP   +L+SW+    DPC    FEG+ACN+ G+V NISLQGKGL G I P +
Sbjct  35    LMHVKAVLDPEGRILASWTSE-GDPCR-GDFEGVACNEHGKVANISLQGKGLSGFISPAV  92

Query  2018  GQLNGLSGLYLHFNNLHGVIPKEIASLTQLSDLYLNMNDLSGFIPSEIGNMPNLQVLQLC  1839
              +L  LSGLYLH+N L G IP+EI++LT L DLYLN+N+LSG IP EIG M +LQVLQLC
Sbjct  93    AELRYLSGLYLHYNALRGEIPREISNLTDLFDLYLNVNNLSGRIPVEIGKMASLQVLQLC  152

Query  1838  YNRFEGCIPNKLGSLKNLTVLALQSNQLTGAIPASlggltlltrldLSFNRLFGSIPVKL  1659
             YN+  G IP +LG LK LTVLALQSN LTGAIPA+LG L  L RLDLSFN LFGSIPVK+
Sbjct  153   YNQLTGSIPPQLGLLKKLTVLALQSNHLTGAIPATLGDLAQLMRLDLSFNNLFGSIPVKV  212

Query  1658  SEASKLEVLDLRNNTLSGNVPLGLKRLNEGFRYENNPGLCGTGFPSLALCS-DSSLNPTK  1482
             ++  +L V DLRNN+LSG+VP  LKRL EGF+Y NN GLCG GF SL +CS D  L P+K
Sbjct  213   AQLPRLAVFDLRNNSLSGSVPSDLKRLKEGFQYRNNTGLCGVGFASLEVCSSDDILKPSK  272

Query  1481  PEPFGQGSN-RLPTKDIPESANIPHQLNQNRKPQAAAAVVGVIGLFVILAVA-----GLF  1320
             PEPFG  S    P  +IP SAN+    + +    ++ +    + + V+         GL 
Sbjct  273   PEPFGPDSTGPRPQPEIPRSANLSAHCHDSHCSNSSKSSAVNVAIGVVAVAVGGMVIGLS  332

Query  1319  TFSWYRRRKQQIGSTVDISESRVSTDQPKVLCRRSTSPLISLEYSNGWDPLAKDQSGSAL  1140
              F+ +RRRKQ+IGS ++++ESR+STDQPK  CR+  SPLISLEYSNGWDPLA  +SG+  
Sbjct  333   AFALHRRRKQKIGSALEVAESRLSTDQPKEFCRKGGSPLISLEYSNGWDPLADGRSGAGF  392

Query  1139  SQEVLESFMFNLDEVESATQYFSETNLLGKSSFSAVYKGTLRDGSAVAVKCISKTSCKSD  960
             SQEV +SF FNL+EVE ATQYFSE NLL +S+F+A YKG LRDG+AVA+K I+KTSC+S+
Sbjct  393   SQEVSQSFRFNLEEVECATQYFSEVNLLERSNFAATYKGVLRDGTAVAIKSINKTSCRSE  452

Query  959   EAEFRKGLTLLTSLKHENLLRLRGFCCSKGRGECFLIYDFVSNGNLLRYLDVKDE-KGKV  783
             EAEF KGL +LT L+HENL+  RGFCCS+GRGECFL+YDFVSNG+L +YLDVKD   G+V
Sbjct  453   EAEFLKGLKMLTLLQHENLIGFRGFCCSRGRGECFLVYDFVSNGSLSQYLDVKDNVNGRV  512

Query  782   LDWSTRTAIIKGIARGIKYLHGNKRNKPALVHRNISADKVLIDHLYKPLLSDSGLHKLLA  603
             LDW  R +IIKGIA+GI+YLH N+ NKPALVH+NISA+KVLIDH + P LS SGLHKLLA
Sbjct  513   LDWPRRVSIIKGIAKGIEYLHSNRANKPALVHQNISAEKVLIDHHFFPRLSGSGLHKLLA  572

Query  602   DDIVFSTLKGSAANGYLAPEYAITGRFTEKSDMYAFGVIILQILSGSCVVTQSNHQGAEL  423
             DD+VFSTLK SAA GYLAPEY  TGRFTEKSD+YAFGV++ QIL+G   V+       E 
Sbjct  573   DDVVFSTLKASAAMGYLAPEYTTTGRFTEKSDVYAFGVLVFQILTGKSSVSHL-RLNPES  631

Query  422   CRFEDFVDAKLGKDFVESEAAKLGKIALLCTHDSPSRRPAIDVVIQ  285
              + E+ +D  L  +F + EAAKL  IALLCT ++PS+RP +D V+Q
Sbjct  632   GKLENLLDENLNGNFSKPEAAKLAGIALLCTSEAPSQRPTMDAVLQ  677



>emb|CDP05303.1| unnamed protein product [Coffea canephora]
Length=649

 Score =   750 bits (1936),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 396/643 (62%), Positives = 489/643 (76%), Gaps = 9/643 (1%)
 Frame = -3

Query  2195  MAIKASLDPGNLVLSSWSPNVTDPCSVSSFEGIACNDLGQVVNISLQGKGLYGKIPPEIG  2016
             M++KASLDP + +L SW+ +  DPC   SF G+ACN  GQV NISLQGKGL GK+ P + 
Sbjct  1     MSLKASLDPESRLLVSWTGS-GDPCG-GSFVGVACNRRGQVANISLQGKGLSGKLCPAVA  58

Query  2015  QLNGLSGLYLHFNNLHGVIPKEIASLTQLSDLYLNMNDLSGFIPSEIGNMPNLQVLQLCY  1836
             +L  L+GLYLH+N L+G IP+EI+SL++L+DLYLN+N+LSG IP E+GNM +LQVLQLCY
Sbjct  59    ELRHLTGLYLHYNALYGEIPREISSLSELTDLYLNVNNLSGEIPPELGNMDSLQVLQLCY  118

Query  1835  NRFEGCIPNKLGSLKNLTVLALQSNQLTGAIPASlggltlltrldLSFNRLFGSIPVKLS  1656
             N+F G IP +LG+LK L VLALQ N+LTGAIPASLG L  L RLDLSFNRLFGSIP KL+
Sbjct  119   NQFTGSIPTQLGALKKLNVLALQFNELTGAIPASLGDLGSLMRLDLSFNRLFGSIPTKLA  178

Query  1655  EASKLEVLDLRNNTLSGNVPLGLKRLNEGFRYENNPGLCGTGFPSLALCSDSSL-NPTKP  1479
             +A  LEVLD+RNN+LSGNVP  LKRL  GF+YENNPGLCG GF SL  C+ S   NP++P
Sbjct  179   DAPILEVLDVRNNSLSGNVPNALKRLIGGFQYENNPGLCGAGFSSLRACTASDRPNPSRP  238

Query  1478  EPFGQGSNRLPTKDIPESANI-----PHQLNQNRKPQAAAAVVGVIGLFVILAVAGLFTF  1314
             EP+G G   L T+DIPE+AN+         +++ K   A+ +VGV+ + +I+ V G+ +F
Sbjct  239   EPYGGGPTGLSTRDIPETANLRLNCSETHCSKSSKALQASVIVGVLVVCIIVLVIGILSF  298

Query  1313  SWYRRRKQQIGSTVDISESRVSTDQPKVLCRRSTSPLISLEYSNGWDPLAKDQSGSALSQ  1134
             S Y R KQ++ +  D  +SR+ TD  K   R++ SPLISLEY +GWDPLA+ +    +SQ
Sbjct  299   SHYHR-KQKLENASDAQDSRLPTDHAKGAQRKNGSPLISLEYPSGWDPLAEGRHFGDVSQ  357

Query  1133  EVLESFMFNLDEVESATQYFSETNLLGKSSFSAVYKGTLRDGSAVAVKCISKTSCKSDEA  954
             E ++SF FNL+EVESAT+YF+E NLL KS FSA Y+G+LRDGS VAVK ISKT CKS+E 
Sbjct  358   EFMQSFRFNLEEVESATRYFAEKNLLSKSYFSATYRGSLRDGSVVAVKSISKTCCKSEEL  417

Query  953   EFRKGLTLLTSLKHENLLRLRGFCCSKGRGECFLIYDFVSNGNLLRYLDVKDEKGKVLDW  774
             EF KGL +LTSL+HEN++RLRGFCCSK R ECFLIYDFV NGNLL+Y DV D    VLDW
Sbjct  418   EFLKGLNILTSLRHENVVRLRGFCCSKDRKECFLIYDFVQNGNLLQYFDVVDGSDHVLDW  477

Query  773   STRTAIIKGIARGIKYLHGNKRNKPALVHRNISADKVLIDHLYKPLLSDSGLHKLLADDI  594
             STR +II GIARGI+YLHG K NKPA+VH+NISA  VLID   +PLLSDSGLHKLL +D 
Sbjct  478   STRVSIINGIARGIEYLHGYKVNKPAIVHQNISAASVLIDQRNRPLLSDSGLHKLLTNDT  537

Query  593   VFSTLKGSAANGYLAPEYAITGRFTEKSDMYAFGVIILQILSGSCVVTQSNHQGAELCRF  414
             VFSTLK SAA GYLAPEY+ TGRFTEKSD+YAFGV++ QILSG   VT S    A+L + 
Sbjct  538   VFSTLKDSAAMGYLAPEYSTTGRFTEKSDIYAFGVLLFQILSGVRKVTSSMQAAADLGKT  597

Query  413   EDFVDAKLGKDFVESEAAKLGKIALLCTHDSPSRRPAIDVVIQ  285
             +DF+D  L   F E EA ++GK+AL C H+SP  RP I+ V+Q
Sbjct  598   QDFMDRNLHGKFSEPEAIRVGKVALWCIHESPEERPGIETVLQ  640



>ref|XP_006397716.1| hypothetical protein EUTSA_v10001341mg [Eutrema salsugineum]
 gb|ESQ39169.1| hypothetical protein EUTSA_v10001341mg [Eutrema salsugineum]
Length=693

 Score =   750 bits (1936),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 390/652 (60%), Positives = 488/652 (75%), Gaps = 18/652 (3%)
 Frame = -3

Query  2189  IKASLDPGNLVLSSWSPNVTDPCSVSSFEGIACNDLGQVVNISLQGKGLYGKIPPEIGQL  2010
             IK+SLDP    L+SW+P+  DPCS  SF+G+AC+   +V NISLQG GL G IPP IG L
Sbjct  34    IKSSLDPEKRFLTSWTPDA-DPCSSGSFDGVACDGNRRVANISLQGMGLTGTIPPSIGLL  92

Query  2009  NGLSGLYLHFNNLHGVIPKEIASLTQLSDLYLNMNDLSGFIPSEIGNMPNLQVLQLCYNR  1830
               L+GLYLHFN+L G IPK+I++L  L+DLYLN+N+LSG IP +IGN+ NLQVLQLCYN+
Sbjct  93    TSLTGLYLHFNSLTGQIPKDISNLPLLADLYLNVNNLSGEIPPQIGNLDNLQVLQLCYNK  152

Query  1829  FEGCIPNKLGSLKNLTVLALQSNQLTGAIPASlggltlltrldLSFNRLFGSIPVKLSEA  1650
               G IP +LGSLK +TVLALQ NQL+GAIPASLG +  LTRLDLSFN LFG +PVKL+ A
Sbjct  153   LSGSIPTQLGSLKKITVLALQYNQLSGAIPASLGDIDTLTRLDLSFNDLFGPVPVKLAGA  212

Query  1649  SKLEVLDLRNNTLSGNVPLGLKRLNEGFRYENNPGLCGTGFPSLALCSDSS-LNPTKPEP  1473
               LEVLD+RNN+ SG VP  LKRLN GF+Y NN GLCG GF  L  C+ S+  N  +P+P
Sbjct  213   PLLEVLDIRNNSFSGFVPSALKRLNNGFQYSNNHGLCGDGFTDLKACTGSNDPNLNRPDP  272

Query  1472  FGQGSNRLPTKDIPESANIPHQLN----------QNRKPQAAAAVVGVIGLFVILAVAGL  1323
                 + R      PESA++               +  K      V+G+IG  + +A+ G 
Sbjct  273   TNPKNFRTTDDVKPESADLQRNNCSNNNNGGCSSKTSKSSPLGIVMGLIGSILAVAIFGG  332

Query  1322  FTFSWYRRRKQQIGSTVDISESRVSTDQ--PKVLCRRSTSPLISLEYSNGWDPLAKDQSG  1149
              TF+WYRRRKQ+IGS++D  + R+ST+    +   R+S+SPLISLEY++GWDPL + Q+ 
Sbjct  333   STFTWYRRRKQKIGSSLDAMDGRISTEYNFKEASRRKSSSPLISLEYASGWDPLGRGQNS  392

Query  1148  --SALSQEVLESFMFNLDEVESATQYFSETNLLGKSSFSAVYKGTLRDGSAVAVKCISKT  975
               SALSQEV ESFMFNL+E+E ATQ FSE N+LGKS+ S+VYKG LRDGS  A+KCI+K+
Sbjct  393   NNSALSQEVFESFMFNLEEIERATQSFSEVNMLGKSNVSSVYKGILRDGSVAAIKCIAKS  452

Query  974   SCKSDEAEFRKGLTLLTSLKHENLLRLRGFCCSKGRGECFLIYDFVSNGNLLRYLDVKDE  795
             SCKSDE+EF KGL +LT LKH+NL+RLRGFCCSKGRGECFLIY+FV NGNLL+YLDVKDE
Sbjct  453   SCKSDESEFLKGLKMLTLLKHDNLVRLRGFCCSKGRGECFLIYEFVPNGNLLQYLDVKDE  512

Query  794   KGKVLDWSTRTAIIKGIARGIKYLHGNKRNKPALVHRNISADKVLIDHLYKPLLSDSGLH  615
              G+VL+W+TR +II GIARGI YLHG   NKPA+VH+N+SA+K+LIDH Y P L+DSGLH
Sbjct  513   TGEVLEWTTRVSIINGIARGIVYLHGENGNKPAIVHQNLSAEKILIDHWYNPSLADSGLH  572

Query  614   KLLADDIVFSTLKGSAANGYLAPEYAITGRFTEKSDMYAFGVIILQILSGSCVVTQ-SNH  438
             KL  DDIVFS LK SAA GYLAPEY  TGRFT+KSD+YAFG+I+LQILSG   ++     
Sbjct  573   KLFTDDIVFSKLKASAAMGYLAPEYITTGRFTDKSDVYAFGMILLQILSGKSKISHLMIL  632

Query  437   QGAELCRF-EDFVDAKLGKDFVESEAAKLGKIALLCTHDSPSRRPAIDVVIQ  285
             Q  E  R  EDF+D  L K+F E+EAA+  ++ LLCTH+S ++RP+++ V+Q
Sbjct  633   QAVESGRLNEDFIDPNLRKNFPEAEAAQFARLGLLCTHESSNQRPSMEYVMQ  684



>ref|NP_182059.1| putative leucine-rich repeat transmembrane protein kinase [Arabidopsis 
thaliana]
 gb|AAB82629.1| putative receptor-like protein kinase [Arabidopsis thaliana]
 gb|ACN59309.1| leucine-rich repeat receptor-like protein kinase [Arabidopsis 
thaliana]
 gb|AEC10541.1| putative leucine-rich repeat transmembrane protein kinase [Arabidopsis 
thaliana]
Length=691

 Score =   750 bits (1936),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 396/657 (60%), Positives = 489/657 (74%), Gaps = 21/657 (3%)
 Frame = -3

Query  2201  LLMAIKASLDPGNLVLSSWSPNVTDPCSVSSFEGIACNDLGQVVNISLQGKGLYGKIPPE  2022
             +L+ IK+SLDP    L+SW+P+  DPCS  SF+G+AC+   +V NISLQG GL G IPP 
Sbjct  29    ILLDIKSSLDPEKRFLTSWTPDA-DPCSSGSFDGVACDGNRRVANISLQGMGLTGTIPPS  87

Query  2021  IGQLNGLSGLYLHFNNLHGVIPKEIASLTQLSDLYLNMNDLSGFIPSEIGNMPNLQVLQL  1842
             IG L  L+GLYLHFN+L G IPK+I++L  L+DLYLN+N+LSG IP  IGN+ NLQV+QL
Sbjct  88    IGLLTSLTGLYLHFNSLTGHIPKDISNLPLLTDLYLNVNNLSGEIPPLIGNLDNLQVIQL  147

Query  1841  CYNRFEGCIPNKLGSLKNLTVLALQSNQLTGAIPASlggltlltrldLSFNRLFGSIPVK  1662
             CYN+  G IP + GSLK +TVLALQ NQL+GAIPASLG +  LTRLDLSFN LFG +PVK
Sbjct  148   CYNKLSGSIPTQFGSLKKITVLALQYNQLSGAIPASLGDIDTLTRLDLSFNNLFGPVPVK  207

Query  1661  LSEASKLEVLDLRNNTLSGNVPLGLKRLNEGFRYENNPGLCGTGFPSLALCSD-SSLNPT  1485
             L+ A  LEVLD+RNN+ SG VP  LKRLN GF+Y NN GLCG GF  L  C+  +  NP 
Sbjct  208   LAGAPLLEVLDIRNNSFSGFVPSALKRLNNGFQYSNNHGLCGDGFTDLKACTGLNGPNPN  267

Query  1484  KPEPFGQGSNRLPTKDI-PESANIPHQLNQNRK---------PQAAAAVVGVIGLFVILA  1335
             +P+P         T D+ PESA++      N                 V+G+IG  + +A
Sbjct  268   RPDP--TNPTNFTTVDVKPESADLQRSNCSNNNGGCSSKSLKSSPLGIVMGLIGSILAVA  325

Query  1334  VAGLFTFSWYRRRKQQIGSTVDISESRVSTDQ--PKVLCRRSTSPLISLEYSNGWDPLAK  1161
             + G  TF+WYRRRKQ+IGS++D  + R+ST+    +V  R+S+SPLISLEY++GWDPL +
Sbjct  326   IFGGSTFTWYRRRKQKIGSSLDAMDGRISTEYNFKEVSRRKSSSPLISLEYASGWDPLGR  385

Query  1160  DQSG---SALSQEVLESFMFNLDEVESATQYFSETNLLGKSSFSAVYKGTLRDGSAVAVK  990
              QS    SALSQEV ESFMFNL+E+E ATQ FSE NLLGKS+ S+VYKG LRDGS  A+K
Sbjct  386   GQSSNNNSALSQEVFESFMFNLEEIERATQSFSEINLLGKSNVSSVYKGILRDGSVAAIK  445

Query  989   CISKTSCKSDEAEFRKGLTLLTSLKHENLLRLRGFCCSKGRGECFLIYDFVSNGNLLRYL  810
             CI+K+SCKSDE+EF KGL +LT LKHENL RLRGFCCSKGRGECFLIY+FV NGNLL+YL
Sbjct  446   CIAKSSCKSDESEFLKGLKMLTLLKHENLARLRGFCCSKGRGECFLIYEFVPNGNLLQYL  505

Query  809   DVKDEKGKVLDWSTRTAIIKGIARGIKYLHGNKRNKPALVHRNISADKVLIDHLYKPLLS  630
             DVKDE G+VL+W+TR +II GIARGI YLHG   NKPA+VH+N+SA+K+LIDH Y P L+
Sbjct  506   DVKDETGEVLEWATRVSIINGIARGIVYLHGENGNKPAIVHQNLSAEKILIDHWYNPSLA  565

Query  629   DSGLHKLLADDIVFSTLKGSAANGYLAPEYAITGRFTEKSDMYAFGVIILQILSGSCVVT  450
             DSGLHKL  DDIVFS LK SAA GYLAPEY  TGRFT+KSD+YAFG+I+LQILSG   ++
Sbjct  566   DSGLHKLFTDDIVFSKLKASAAMGYLAPEYITTGRFTDKSDVYAFGMILLQILSGKSKIS  625

Query  449   Q-SNHQGAELCRF-EDFVDAKLGKDFVESEAAKLGKIALLCTHDSPSRRPAIDVVIQ  285
                  Q  E  R  EDF+D  L K+F E EAA+L ++ LLCTH+S ++RP+++ VIQ
Sbjct  626   HLMILQAVESGRLNEDFMDPNLRKNFPEVEAAQLARLGLLCTHESSNQRPSMEDVIQ  682



>ref|XP_009143131.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g34110 [Brassica rapa]
Length=690

 Score =   750 bits (1936),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 396/660 (60%), Positives = 490/660 (74%), Gaps = 22/660 (3%)
 Frame = -3

Query  2207  VSLLMAIKASLDPGNLVLSSWSPNVTDPCSVSSFEGIACNDLGQVVNISLQGKGLYGKIP  2028
             + +L+ IK+SLDP    L+SW+P+ +DPCS  SF+G+AC+   +V NISLQG GL G IP
Sbjct  28    LDILLDIKSSLDPQKRFLTSWTPD-SDPCSPGSFDGVACDGNRRVANISLQGMGLTGTIP  86

Query  2027  PEIGQLNGLSGLYLHFNNLHGVIPKEIASLTQLSDLYLNMNDLSGFIPSEIGNMPNLQVL  1848
             P IG L  L+GLYLHFN+L G IPK+I++L  L+DLYLN+N+LSG IP +IG++ NLQVL
Sbjct  87    PSIGLLTSLTGLYLHFNSLTGQIPKDISNLPFLADLYLNVNNLSGEIPPQIGDLDNLQVL  146

Query  1847  QLCYNRFEGCIPNKLGSLKNLTVLALQSNQLTGAIPASlggltlltrldLSFNRLFGSIP  1668
             QLCYN+  G IP +LGSL  +TVLALQ NQL+GAIPASLG +  LTRLDLSFN LFG +P
Sbjct  147   QLCYNKLSGSIPTQLGSLNKITVLALQYNQLSGAIPASLGDIRTLTRLDLSFNDLFGPVP  206

Query  1667  VKLSEASKLEVLDLRNNTLSGNVPLGLKRLNEGFRYENNPGLCGTGFPSLALCSDSSL-N  1491
             VKL+ A  LEVLD+RNN+ SG VP GLKRLN GF Y NN GLCG GF  L  C+ S+  N
Sbjct  207   VKLAGAPLLEVLDIRNNSFSGFVPSGLKRLNNGFHYTNNHGLCGDGFTDLKPCTGSNEPN  266

Query  1490  PTKPEPFGQGSNRLPTKDIPESANIPHQLNQNR---------KPQAAAAVVGVIGLFVIL  1338
               +P+P    + R      PESA++      N          K      V+G+IG  + +
Sbjct  267   LNRPDPTNPKTFRTTDDVKPESADLQRSNCSNNNGGCSSKASKSAPLGVVMGLIGSLLAV  326

Query  1337  AVAGLFTFSWYRRRKQQIGSTVDISESRVSTD----QPKVLCRRSTSPLISLEYSNGWDP  1170
             AV    TF+WYRRRKQ+IGS++D  +SRVST+    +P    R+S+SPLISLEYS GWDP
Sbjct  327   AVFAGSTFTWYRRRKQRIGSSLDAMDSRVSTEYNFKEPSR--RKSSSPLISLEYSRGWDP  384

Query  1169  LAKDQSG---SALSQEVLESFMFNLDEVESATQYFSETNLLGKSSFSAVYKGTLRDGSAV  999
             L + Q+    SALSQEV +SFMFNL+E+E ATQ FSE NLLGKS+ S+VYKGTLRDGS  
Sbjct  385   LGRGQNSNNNSALSQEVFDSFMFNLEEIERATQSFSEVNLLGKSNVSSVYKGTLRDGSVA  444

Query  998   AVKCISKTSCKSDEAEFRKGLTLLTSLKHENLLRLRGFCCSKGRGECFLIYDFVSNGNLL  819
             A+KCI+K+SCKSDE+EF +GL +LT LKHENL+RLRGFCCSKGRGECFLIY+FV NGNLL
Sbjct  445   AIKCIAKSSCKSDESEFLRGLKMLTLLKHENLVRLRGFCCSKGRGECFLIYEFVPNGNLL  504

Query  818   RYLDVKDEKGKVLDWSTRTAIIKGIARGIKYLHGNKRNKPALVHRNISADKVLIDHLYKP  639
             +YLDVKDE G VL+W+TR  II GIARGI YLHG   NKPA+VH+N+SA+K+LIDH Y P
Sbjct  505   QYLDVKDESGDVLEWTTRVTIINGIARGIVYLHGENGNKPAIVHQNLSAEKILIDHWYNP  564

Query  638   LLSDSGLHKLLADDIVFSTLKGSAANGYLAPEYAITGRFTEKSDMYAFGVIILQILSGSC  459
              L+DSGLHKL  DDIVFS LK SAA GYLAPEY  TGRFT+KSD+YAFG+I+LQILSG  
Sbjct  565   SLADSGLHKLFTDDIVFSKLKASAAMGYLAPEYITTGRFTDKSDVYAFGMILLQILSGKS  624

Query  458   VVTQ-SNHQGAELCRF-EDFVDAKLGKDFVESEAAKLGKIALLCTHDSPSRRPAIDVVIQ  285
              ++     Q  E  R  EDF+D  L K F E+EAA+L ++ LLCTH+S ++RP++  V++
Sbjct  625   KISHLMILQAVESGRLNEDFIDPNLRKKFPETEAAQLARLGLLCTHESSNQRPSMADVVK  684



>ref|XP_010671985.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At5g10290 [Beta vulgaris subsp. vulgaris]
Length=691

 Score =   749 bits (1935),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 395/651 (61%), Positives = 492/651 (76%), Gaps = 19/651 (3%)
 Frame = -3

Query  2198  LMAIKASLDPGNLVLSSWSPNVTDPCSVSSFEGIACNDLGQVVNISLQGKGLYGKIPPEI  2019
             L+ +K+SLDP N  LSSWS N  DPC   +FEG+ CN+ GQV NISLQGKGL G++ P I
Sbjct  33    LVNLKSSLDPSNTYLSSWSNN-GDPCD-GTFEGVGCNENGQVANISLQGKGLKGQLSPAI  90

Query  2018  GQLNGLSGLYLHFNNLHGVIPKEIASLTQLSDLYLNMNDLSGFIPSEIGNMPNLQVLQLC  1839
               L  L+G+YLH+N+L G IPKEI+SLT L DLYL++N+LSG IP +IGNM NLQVLQLC
Sbjct  91    SGLKHLTGIYLHYNSLFGEIPKEISSLTHLVDLYLDVNNLSGVIPPQIGNMENLQVLQLC  150

Query  1838  YNRFEGCIPNKLGSLKNLTVLALQSNQLTGAIPASlggltlltrldLSFNRLFGSIPVKL  1659
             YN+  G IP +LGSLK L+VLALQSN LTGAIPASLG +  L RLDLSFN LFGSIP  +
Sbjct  151   YNKLTGSIPTQLGSLKKLSVLALQSNNLTGAIPASLGEIETLLRLDLSFNHLFGSIPTPI  210

Query  1658  SEASKLEVLDLRNNTLSGNVPLGLKRLNEGFRYENNPGLCGTGFPSLALCSDSS-LNPTK  1482
             +EA  LE LD+RNNTLSGNVP  L RLNEGF+Y NNPGLCG GF +L +C DS  +   +
Sbjct  211   AEAPLLESLDIRNNTLSGNVPPALLRLNEGFQYANNPGLCGVGFLTLKVCPDSDHIGQIR  270

Query  1481  PEPFGQG---SNRLPTKDIPESANI----------PHQLNQNRKPQAAAAVVGVIGLFVI  1341
             PEP+G G   SN LP K+IPE+AN+          P+  N  +    A+  VGV+ + + 
Sbjct  271   PEPYGGGVATSNGLPRKEIPETANVKLPDCNQTGCPN--NARKSSHNASIAVGVVVVALA  328

Query  1340  LAVAGLFTFSWYRRRKQQIGSTVDISESRVSTDQPKVLCRRSTSPLISLEYSNGWDPLAK  1161
             +++  +F F+ YRR KQ++GS+ ++S++R+STDQP+   R++ SPLISLEY NGWDPL+ 
Sbjct  329   MSLISVFIFTKYRRTKQKLGSSFELSDTRLSTDQPREFGRKNGSPLISLEYPNGWDPLSD  388

Query  1160  DQSGSALSQEVLESFMFNLDEVESATQYFSETNLLGKSSFSAVYKGTLRDGSAVAVKCIS  981
              +S +  S +V++ F FNL+EVE ATQYFS +NLLGKS  SAV++G LRDGS VAVK IS
Sbjct  389   VRSFNGFSNDVIQGFRFNLEEVECATQYFSPSNLLGKSGLSAVFRGVLRDGSVVAVKRIS  448

Query  980   KTSCKSDEAEFRKGLTLLTSLKHENLLRLRGFCCSKGRGECFLIYDFVSNGNLLRYLDVK  801
             K+SCKS+EAEF KGL +LTSL HENL+RLRGFCCS+GRGECFL+YDFVSNGNLL YLD+K
Sbjct  449   KSSCKSEEAEFLKGLNVLTSLTHENLVRLRGFCCSRGRGECFLVYDFVSNGNLLSYLDLK  508

Query  800   DEKGKVLDWSTRTAIIKGIARGIKYLHGNKRNKPALVHRNISADKVLIDHLYKPLLSDSG  621
             D    VL+WSTR  II GIA+GI+YLH +K NKP LVH+NISA+KVLID  + P+L+DSG
Sbjct  509   DGDASVLEWSTRVWIIHGIAKGIQYLHSSKVNKP-LVHQNISAEKVLIDQRFNPMLADSG  567

Query  620   LHKLLADDIVFSTLKGSAANGYLAPEYAITGRFTEKSDMYAFGVIILQILSGSCVVTQSN  441
             L+KLL +D VFSTLK SAA GYLAPEY  TG+FTE SD+YAFG+++ Q+LSG   +T S 
Sbjct  568   LYKLLTNDTVFSTLKASAAMGYLAPEYTTTGKFTELSDVYAFGMVVFQVLSGRRKITNSI  627

Query  440   HQGAELCRFEDFVDAKLGKDFVESEAAKLGKIALLCTHDSPSRRPAIDVVI  288
               GAE  R ++FVD  L   F E EAAKL KIAL CT + P+ RP++D +I
Sbjct  628   RVGAESLRSQEFVDPNLHGRFSEFEAAKLAKIALNCTLELPNERPSMDAII  678



>ref|XP_010910517.1| PREDICTED: somatic embryogenesis receptor kinase 1-like [Elaeis 
guineensis]
Length=675

 Score =   748 bits (1931),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 395/645 (61%), Positives = 487/645 (76%), Gaps = 14/645 (2%)
 Frame = -3

Query  2198  LMAIKASLDPGNLVLSSWSPNVTDPCSVSSFEGIACNDLGQVVNISLQGKGLYGKIPPEI  2019
             LM +K +LDP   +LS+W+ +  DPC   SFEG+ACN+ G+V NISLQGKGL G I P +
Sbjct  32    LMEVKTALDPEGRILSTWTSD-GDPCG-GSFEGVACNEHGKVANISLQGKGLAGSISPAV  89

Query  2018  GQLNGLSGLYLHFNNLHGVIPKEIASLTQLSDLYLNMNDLSGFIPSEIGNMPNLQVLQLC  1839
               L  LSGLYLH+N L G IP+EIA L +LSDLYL++N+LSG IP EIGNM +LQVLQLC
Sbjct  90    ADLRCLSGLYLHYNALSGKIPREIAKLNELSDLYLDVNNLSGGIPEEIGNMASLQVLQLC  149

Query  1838  YNRFEGCIPNKLGSLKNLTVLALQSNQLTGAIPASlggltlltrldLSFNRLFGSIPVKL  1659
              N+  G IP +LG LK LTVLALQSN LTGAIPA LG LT L RLDLSFN+LFGSIPVKL
Sbjct  150   CNQLTGSIPTQLGLLKKLTVLALQSNHLTGAIPACLGDLTQLMRLDLSFNQLFGSIPVKL  209

Query  1658  SEASKLEVLDLRNNTLSGNVPLGLKRLNEGFRYENNPGLCGTGFPSLALCSDSS-LNPTK  1482
             ++ S+L   D+RNNTLSG+VP  LKRL++GF+Y NN  LCG GFPSL +C+ S  LNP +
Sbjct  210   AQLSQLVAFDVRNNTLSGSVPSDLKRLDDGFQYWNNADLCGDGFPSLRVCTSSDLLNPHR  269

Query  1481  PEPFGQGSNRLPTKDIPESANIPHQLNQNRKPQAAAAVVGVIGLFVILAVAG----LFTF  1314
             PEP+G G   LP +D P+SAN+    N      ++ + V ++     +   G    L  F
Sbjct  270   PEPYGAGI--LP-QDNPQSANLNVHCNNTHCSHSSKSAVAIVVAIAAVVFGGTISSLLAF  326

Query  1313  SWYRRRKQQIGSTVDISESRVSTDQPKVLCRRSTSPLISLEYSNGWDPLAKDQSGSALSQ  1134
             SWYRRRKQ+IGS +++S+  +S DQ K   RRS+SPLISLEYSNGWDPLA  +SG   SQ
Sbjct  327   SWYRRRKQKIGSPLEVSDRWLSIDQTKDFYRRSSSPLISLEYSNGWDPLADAKSGIGFSQ  386

Query  1133  EVLESFMFNLDEVESATQYFSETNLLGKSS-FSAVYKGTLRDGSAVAVKCISKTSCKSDE  957
             EVL+SF FNL+EVE ATQYFSE NLLGK + F+A YKG LRDG+ VAVK ISKTSCKS+E
Sbjct  387   EVLQSFRFNLEEVECATQYFSEVNLLGKKAHFAATYKGILRDGTMVAVKRISKTSCKSEE  446

Query  956   AEFRKGLTLLTSLKHENLLRLRGFCCSKGRGECFLIYDFVSNGNLLRYLDVK-DEKGKVL  780
             AEF  GL LLTSL+HENL+ LRGFCCS+GRGECFL+Y+FV+NG+L RYLD K DE  ++L
Sbjct  447   AEFLMGLKLLTSLRHENLVGLRGFCCSRGRGECFLVYNFVANGSLSRYLDAKGDENSQIL  506

Query  779   DWSTRTAIIKGIARGIKYLHGNKRNKPALVHRNISADKVLIDHLYKPLLSDSGLHKLLAD  600
             DW TR +I KGIA+GI+YLH NK NKP+L+H++ISA++VLID  + PLLSDSGL+KLLAD
Sbjct  507   DWPTRVSITKGIAKGIEYLHSNKTNKPSLIHQSISAERVLIDSHFNPLLSDSGLYKLLAD  566

Query  599   DIVFSTLKGSAANGYLAPEYAITGRFTEKSDMYAFGVIILQILSGSCVVTQSNHQGAELC  420
             D+VFSTLK SAA GYLAPEYA  GRFTEKSD+YAFG+I+ QIL+G    T     G E  
Sbjct  567   DVVFSTLKASAAMGYLAPEYATVGRFTEKSDVYAFGIIVFQILTGK--RTTHLRVGTEPG  624

Query  419   RFEDFVDAKLGKDFVESEAAKLGKIALLCTHDSPSRRPAIDVVIQ  285
               ED +D  L  +F + EAAKL  IALLCT+++P++RP ++ ++Q
Sbjct  625   NLEDLIDENLKGNFSKPEAAKLASIALLCTNEAPNQRPTMEAILQ  669



>emb|CDY51809.1| BnaC04g53150D [Brassica napus]
Length=681

 Score =   745 bits (1924),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 391/664 (59%), Positives = 493/664 (74%), Gaps = 23/664 (3%)
 Frame = -3

Query  2231  ETSNNASTVSLLMAIKASLDPGNLVLSSWSPNVTDPCSVSSFEGIACNDLGQVVNISLQG  2052
              + ++ S + +L+ IK+SLDP   +L+SW+P+ +DPCS  SF+G+AC+   +V NISLQG
Sbjct  20    HSQSSPSELDILLDIKSSLDPQKRLLTSWTPD-SDPCSPGSFDGVACDGNRRVANISLQG  78

Query  2051  KGLYGKIPPEIGQLNGLSGLYLHFNNLHGVIPKEIASLTQLSDLYLNMNDLSGFIPSEIG  1872
              GL G IPP IG L  L+GLYLHFN+L G IPK+I++L  L+DLYLN+N+LSG IP +IG
Sbjct  79    MGLTGTIPPSIGLLTSLTGLYLHFNSLTGQIPKDISNLPFLADLYLNVNNLSGEIPPQIG  138

Query  1871  NMPNLQVLQLCYNRFEGCIPNKLGSLKNLTVLALQSNQLTGAIPASlggltlltrldLSF  1692
             ++ NLQVLQLCYN+  G IP +LGSL  +TVLALQ NQL+GAIPASLG +  LTRLDLSF
Sbjct  139   DLDNLQVLQLCYNKLSGSIPTQLGSLNKITVLALQYNQLSGAIPASLGDIRTLTRLDLSF  198

Query  1691  NRLFGSIPVKLSEASKLEVLDLRNNTLSGNVPLGLKRLNEGFRYENNPGLCGTGFPSLAL  1512
             N LFG +PVKL+ A  LEVLD+RNN+ SG VP GLKRLN GF Y NN GLCG GF  L  
Sbjct  199   NDLFGPVPVKLAGAPLLEVLDIRNNSFSGFVPSGLKRLNNGFHYANNHGLCGDGFTDLKP  258

Query  1511  CSDSSL-NPTKPEPFGQGSNRLPTKDIPESANIPHQLNQNRK---------PQAAAAVVG  1362
             C+ S+  N  +P+P    + R      PESA++      N+            +   V+G
Sbjct  259   CTGSNEPNLNRPDPTNPNTFRTTNDVKPESADLQRSNCSNKNGGCSSKAAKSSSLGTVMG  318

Query  1361  VIGLFVILAVAGLFTFSWYRRRKQQIGSTVDISESRVSTDQPKVLCRRSTSPLISLEYSN  1182
             +IG  + +A+ G   F+WYRRRKQ+IGS++D  +SRVST+       +S+SPLISLEYS 
Sbjct  319   LIGSILAVAIFGGSMFTWYRRRKQRIGSSLDGMDSRVSTE-------KSSSPLISLEYSR  371

Query  1181  GWDPLAKDQSG---SALSQEVLESFMFNLDEVESATQYFSETNLLGKSSFSAVYKGTLRD  1011
             GWDPL + Q+    SALSQEV +SFMFNL+E+E ATQ FSE NLLG+S+ S+VYKGTLRD
Sbjct  372   GWDPLGRGQNSNNNSALSQEVFDSFMFNLEEIERATQSFSEVNLLGRSNVSSVYKGTLRD  431

Query  1010  GSAVAVKCISKTSCKSDEAEFRKGLTLLTSLKHENLLRLRGFCCSKGRGECFLIYDFVSN  831
             GS  A+KCI+K+SCKSDE+EF +GL +LT LKHENL+RLRGFCCSKGRGECFLIY+FV N
Sbjct  432   GSVAAIKCIAKSSCKSDESEFLRGLKMLTLLKHENLVRLRGFCCSKGRGECFLIYEFVPN  491

Query  830   GNLLRYLDVKDEKGKVLDWSTRTAIIKGIARGIKYLHGNKRNKPALVHRNISADKVLIDH  651
             GNLL+YLDVKDE G VL+W+TR  II GIARGI YLHG   NKPA+VH+N+SA+K+LIDH
Sbjct  492   GNLLQYLDVKDESGDVLEWTTRVTIINGIARGIVYLHGENGNKPAIVHQNLSAEKILIDH  551

Query  650   LYKPLLSDSGLHKLLADDIVFSTLKGSAANGYLAPEYAITGRFTEKSDMYAFGVIILQIL  471
              Y P L+DSGL KL  DDIVFS LK SAA GYLAPEY  TGRFT+KSD+YAFG+I+LQIL
Sbjct  552   WYNPSLADSGLQKLFTDDIVFSKLKASAAMGYLAPEYITTGRFTDKSDVYAFGMILLQIL  611

Query  470   SGSCVVTQ-SNHQGAELCRF-EDFVDAKLGKDFVESEAAKLGKIALLCTHDSPSRRPAID  297
             SG   ++     Q  E  R  EDF+D  L K F E+EAA+L ++ LLCTH+S ++RP+++
Sbjct  612   SGKSKISHLMILQAVESGRLNEDFIDPNLRKKFPETEAAQLARLGLLCTHESSNQRPSME  671

Query  296   VVIQ  285
              V++
Sbjct  672   DVVK  675



>emb|CDX74732.1| BnaA05g04780D [Brassica napus]
Length=680

 Score =   745 bits (1924),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 393/664 (59%), Positives = 490/664 (74%), Gaps = 23/664 (3%)
 Frame = -3

Query  2231  ETSNNASTVSLLMAIKASLDPGNLVLSSWSPNVTDPCSVSSFEGIACNDLGQVVNISLQG  2052
              + ++ S + +L+ IK+SLDP    L SW+P+ +DPCS  SF+G+AC+   +V NISLQG
Sbjct  19    HSQSSPSELDILLDIKSSLDPQKRFLISWTPD-SDPCSPGSFDGVACDGNRRVANISLQG  77

Query  2051  KGLYGKIPPEIGQLNGLSGLYLHFNNLHGVIPKEIASLTQLSDLYLNMNDLSGFIPSEIG  1872
              GL G IPP IG L  L+GLYLHFN+L G IPK+I++L  L+DLYLN+N+LSG IP +IG
Sbjct  78    MGLTGTIPPSIGLLTSLTGLYLHFNSLTGQIPKDISNLPFLADLYLNVNNLSGEIPPQIG  137

Query  1871  NMPNLQVLQLCYNRFEGCIPNKLGSLKNLTVLALQSNQLTGAIPASlggltlltrldLSF  1692
             ++ NLQVLQLCYN+  G IP +LGSL  +TVLALQ NQL+GAIPASLG +  LTRLDLSF
Sbjct  138   DLDNLQVLQLCYNQLSGSIPTQLGSLNKITVLALQYNQLSGAIPASLGDIRTLTRLDLSF  197

Query  1691  NRLFGSIPVKLSEASKLEVLDLRNNTLSGNVPLGLKRLNEGFRYENNPGLCGTGFPSLAL  1512
             N LFG +PVKL+ A  LEVLD+RNN+ SG VP GLKRLN GF Y NN GLCG GF  L  
Sbjct  198   NDLFGPVPVKLAGAPLLEVLDIRNNSFSGFVPSGLKRLNNGFHYTNNHGLCGDGFTDLKP  257

Query  1511  CSDSSL-NPTKPEPFGQGSNRLPTKDIPESANIPHQLNQNR---------KPQAAAAVVG  1362
             C+ S+  N  +P+P    + +      PESA++      N          K      V+G
Sbjct  258   CTGSNEPNLNRPDPTNPKTFKTTDDVKPESADLQRSNCSNNNGGCSSKASKSAPLGVVMG  317

Query  1361  VIGLFVILAVAGLFTFSWYRRRKQQIGSTVDISESRVSTDQPKVLCRRSTSPLISLEYSN  1182
             +IG  + +AV    TF+WYRRRKQ+IGS++D  +SRVST+       +S+SPLISLEYS 
Sbjct  318   LIGSLLAVAVFAGSTFTWYRRRKQRIGSSLDAMDSRVSTE-------KSSSPLISLEYSR  370

Query  1181  GWDPLAKDQSG---SALSQEVLESFMFNLDEVESATQYFSETNLLGKSSFSAVYKGTLRD  1011
             GWDPL + Q+    SALSQEV +SFMFNL+E+E ATQ FSE NLLGKS+ S+VYKG LRD
Sbjct  371   GWDPLGRGQNSNNNSALSQEVFDSFMFNLEEIERATQSFSEVNLLGKSNVSSVYKGVLRD  430

Query  1010  GSAVAVKCISKTSCKSDEAEFRKGLTLLTSLKHENLLRLRGFCCSKGRGECFLIYDFVSN  831
             GS  A+KCI+K+SCKSDE+EF +GL +LT LKHENL+RLRGFCCSKGRGECFLIY+FV N
Sbjct  431   GSVAAIKCIAKSSCKSDESEFLRGLKMLTLLKHENLVRLRGFCCSKGRGECFLIYEFVPN  490

Query  830   GNLLRYLDVKDEKGKVLDWSTRTAIIKGIARGIKYLHGNKRNKPALVHRNISADKVLIDH  651
             GNLL+YLDVKDE G VL+W+TR  II GIARGI YLHG   NKPA+VH+N+SA+K+LIDH
Sbjct  491   GNLLQYLDVKDESGDVLEWTTRVTIINGIARGIVYLHGENGNKPAIVHQNLSAEKILIDH  550

Query  650   LYKPLLSDSGLHKLLADDIVFSTLKGSAANGYLAPEYAITGRFTEKSDMYAFGVIILQIL  471
              Y P L+DSGLHKL  DDIVFS LK SAA GYLAPEY  TGRFT+KSD+YAFG+I+LQIL
Sbjct  551   WYNPSLADSGLHKLFTDDIVFSKLKASAAMGYLAPEYITTGRFTDKSDVYAFGMILLQIL  610

Query  470   SGSCVVTQ-SNHQGAELCRF-EDFVDAKLGKDFVESEAAKLGKIALLCTHDSPSRRPAID  297
             SG   ++     Q  E  R  EDF+D  L K F E+EAA+L ++ LLCTH+S ++RP+++
Sbjct  611   SGKSKISHLMILQAVESGRLNEDFIDPNLRKKFPETEAAQLARLGLLCTHESSNQRPSME  670

Query  296   VVIQ  285
              V++
Sbjct  671   DVVK  674



>ref|XP_009142330.1| PREDICTED: protein NSP-INTERACTING KINASE 2-like [Brassica rapa]
Length=693

 Score =   746 bits (1925),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 394/668 (59%), Positives = 494/668 (74%), Gaps = 31/668 (5%)
 Frame = -3

Query  2216  ASTVSLLMAIKASLDPGNLVLSSWSPNVTDPCSVSSFEGIACNDLGQVVNISLQGKGLYG  2037
             +S + +L+ IK+SLDP    L+SW+PN  DPCS  SF+G+AC+   +V NISLQG GL G
Sbjct  24    SSELDILLDIKSSLDPQKRFLTSWTPNA-DPCSPGSFDGVACDGNRRVANISLQGMGLTG  82

Query  2036  KIPPEIGQLNGLSGLYLHFNNLHGVIPKEIASLTQLSDLYLNMNDLSGFIPSEIGNMPNL  1857
              IPP IG L  L+GLYLHFN+L G IPK+I++L  L+DLYLN+N+LSG IP +IGN+ NL
Sbjct  83    TIPPSIGLLTSLTGLYLHFNSLTGQIPKDISNLPLLTDLYLNVNNLSGEIPPQIGNLDNL  142

Query  1856  QVLQLCYNRFEGCIPNKLGSLKNLTVLALQSNQLTGAIPASlggltlltrldLSFNRLFG  1677
             QVLQLCYN+  G IP +LGSLK +TVLALQ NQL+GA+PASLG +  LTRLDLSFN LFG
Sbjct  143   QVLQLCYNKLSGSIPTQLGSLKKITVLALQYNQLSGAVPASLGDVGTLTRLDLSFNDLFG  202

Query  1676  SIPVKLSEASKLEVLDLRNNTLSGNVPLGLKRLNEGFRYENNPGLCGTGFPSLALCSDSS  1497
              +PVKL+ A  L+VLD+RNN+ SG VP  LKRLN GF+Y NN GLCG GF  L  C+ S+
Sbjct  203   PVPVKLAAAPSLQVLDIRNNSFSGFVPSALKRLNNGFQYSNNHGLCGDGFTDLKPCTGSN  262

Query  1496  L------NPTKPEPFGQGSNRLPTKDI-PESANIPHQLNQNRKPQAAAA----------V  1368
             +      +PT P+ F      + T D+ PESA +      N    A ++          V
Sbjct  263   VPNLNRPDPTNPKSF------ITTNDVKPESAVVQRSNCTNNNNGACSSKASKSSSLGIV  316

Query  1367  VGVIGLFVILAVAGLFTFSWYRRRKQQIGSTVDISESRVSTDQ--PKVLCRRSTSPLISL  1194
             +G++G  + +AV G  TF+WYRRRKQ+IGS++D  + RVST+    +   R+S+SPLISL
Sbjct  317   MGLLGSILAVAVFGGSTFTWYRRRKQRIGSSLDAIDGRVSTEYNFKEASRRKSSSPLISL  376

Query  1193  EYSNGWDPLAKDQSG---SALSQEVLESFMFNLDEVESATQYFSETNLLGKSSFSAVYKG  1023
             EY+NGWDPL + Q+    SALSQEV ESFMFNL+E+E ATQ FSE NLLGKS+ S+VYKG
Sbjct  377   EYANGWDPLGRGQNSGNNSALSQEVFESFMFNLEEIERATQSFSEVNLLGKSNVSSVYKG  436

Query  1022  TLRDGSAVAVKCISKTSCKSDEAEFRKGLTLLTSLKHENLLRLRGFCCSKGRGECFLIYD  843
              LRDGS  A+KCI+K+SCKSDE EF KGL +LT LKHENL+RLRGFCCSKGRGECFLIY+
Sbjct  437   ILRDGSVAAIKCIAKSSCKSDETEFLKGLKMLTLLKHENLVRLRGFCCSKGRGECFLIYE  496

Query  842   FVSNGNLLRYLDVKDEKGKVLDWSTRTAIIKGIARGIKYLHGNKRNKPALVHRNISADKV  663
             FV NGNLL+YLDVKDE G+VL+W++R +II GIARGI YLHG    KPA+VH+N+SA+K+
Sbjct  497   FVPNGNLLQYLDVKDESGEVLEWTSRVSIINGIARGIVYLHGENGKKPAIVHQNLSAEKI  556

Query  662   LIDHLYKPLLSDSGLHKLLADDIVFSTLKGSAANGYLAPEYAITGRFTEKSDMYAFGVII  483
             LIDH Y P L+DS LHKL  DDIVFS LK SAA GYLAPEY  TGR T+KSD+YAFG+I+
Sbjct  557   LIDHWYNPSLADSALHKLFTDDIVFSKLKASAAMGYLAPEYITTGRLTDKSDVYAFGMIL  616

Query  482   LQILSGSCVVTQ-SNHQGAELCRF-EDFVDAKLGKDFVESEAAKLGKIALLCTHDSPSRR  309
             LQILSG   ++     Q  E  R  EDF+D  L K F E+EA +L ++ LLCTH+S ++R
Sbjct  617   LQILSGKSRISHLMILQAVESGRLNEDFIDPNLRKSFPEAEAEQLARLGLLCTHESSNQR  676

Query  308   PAIDVVIQ  285
             P+++ V+Q
Sbjct  677   PSMEDVMQ  684



>emb|CDY37035.1| BnaA04g26130D [Brassica napus]
Length=684

 Score =   744 bits (1922),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 392/666 (59%), Positives = 493/666 (74%), Gaps = 36/666 (5%)
 Frame = -3

Query  2216  ASTVSLLMAIKASLDPGNLVLSSWSPNVTDPCSVSSFEGIACNDLGQVVNISLQGKGLYG  2037
             +S   +L+ IK+SLDP    L+SW+P+  DPCS  SF+G+AC+   +V NISLQG GL G
Sbjct  24    SSEFDILLDIKSSLDPQKRFLTSWTPDA-DPCSPGSFDGVACDGNRRVANISLQGMGLTG  82

Query  2036  KIPPEIGQLNGLSGLYLHFNNLHGVIPKEIASLTQLSDLYLNMNDLSGFIPSEIGNMPNL  1857
              IPP IG L  L+GLYLHFN+L G IPK+I++L  L+DLYLN+N+LSG IP +IGN+ NL
Sbjct  83    TIPPSIGLLTSLTGLYLHFNSLTGQIPKDISNLPLLTDLYLNVNNLSGEIPPQIGNLDNL  142

Query  1856  QVLQLCYNRFEGCIPNKLGSLKNLTVLALQSNQLTGAIPASlggltlltrldLSFNRLFG  1677
             QVLQLCYN+  G IP +LGSLK +TVLALQ NQL+GA+PASLG +  LTRLDLSFN LFG
Sbjct  143   QVLQLCYNKLSGSIPTQLGSLKKITVLALQYNQLSGAVPASLGDVGTLTRLDLSFNDLFG  202

Query  1676  SIPVKLSEASKLEVLDLRNNTLSGNVPLGLKRLNEGFRYENNPGLCGTGFPSLALCSDSS  1497
              +PVKL+ A  L+VLD+RNN+ SG VP  LKRLN GF+Y NN GLCG GF  L  C+ S+
Sbjct  203   PVPVKLAAAPSLQVLDIRNNSFSGFVPSALKRLNNGFQYSNNHGLCGDGFTDLKPCTGSN  262

Query  1496  L------NPTKPEPFGQGSNRLPTKDI-PESANIPHQLNQNRKPQAAAA----------V  1368
             +      +PT P+ F      + T D+ PESA +      N    A ++          V
Sbjct  263   VPNLNRPDPTNPKSF------ITTNDVKPESAVVQRSNCSNNNNGACSSKASKSSSLGIV  316

Query  1367  VGVIGLFVILAVAGLFTFSWYRRRKQQIGSTVDISESRVSTDQPKVLCRRSTSPLISLEY  1188
             +G++G  + +AV G  TF+WYRRRKQ+IGS++D  + R+ST+       +S+SPLISLEY
Sbjct  317   MGLLGSILAVAVFGGSTFTWYRRRKQRIGSSLDAMDGRISTE-------KSSSPLISLEY  369

Query  1187  SNGWDPLAKDQSG---SALSQEVLESFMFNLDEVESATQYFSETNLLGKSSFSAVYKGTL  1017
             +NGWDPL + Q+    SALSQEV ESFMFNL+E+E ATQ FSE NLLGKS+ S+VYKG L
Sbjct  370   ANGWDPLGRGQNSGNNSALSQEVFESFMFNLEEIERATQSFSEVNLLGKSNVSSVYKGIL  429

Query  1016  RDGSAVAVKCISKTSCKSDEAEFRKGLTLLTSLKHENLLRLRGFCCSKGRGECFLIYDFV  837
             RDGS  A+KCI+K+SCKSDE EF KGL +LT LKHENL+RLRGFCCSKGRGECFLIY+FV
Sbjct  430   RDGSVAAIKCIAKSSCKSDETEFLKGLKMLTLLKHENLVRLRGFCCSKGRGECFLIYEFV  489

Query  836   SNGNLLRYLDVKDEKGKVLDWSTRTAIIKGIARGIKYLHGNKRNKPALVHRNISADKVLI  657
              NGNLL+YLDVKDE G+VL+W++R +II GIARGI YLHG    KPA+VH+N+SA+K+LI
Sbjct  490   PNGNLLQYLDVKDESGEVLEWTSRVSIINGIARGIVYLHGENGKKPAIVHQNLSAEKILI  549

Query  656   DHLYKPLLSDSGLHKLLADDIVFSTLKGSAANGYLAPEYAITGRFTEKSDMYAFGVIILQ  477
             DH Y P L+DS LHKL  DDIVFS LK SAA GYLAPEY  TGRFT+KSD+YAFG+I+LQ
Sbjct  550   DHWYNPSLADSALHKLFTDDIVFSKLKASAAMGYLAPEYITTGRFTDKSDVYAFGMILLQ  609

Query  476   ILSGSCVVTQ-SNHQGAELCRF-EDFVDAKLGKDFVESEAAKLGKIALLCTHDSPSRRPA  303
             ILSG   ++     Q  E  R  EDF+D  L + F E+EAA+L ++ LLCTH+S ++RP+
Sbjct  610   ILSGKSKISHLMILQAVESGRLNEDFMDPNLRESFPEAEAAQLARLGLLCTHESSNQRPS  669

Query  302   IDVVIQ  285
             ++ V+Q
Sbjct  670   MEDVMQ  675



>gb|KEH22283.1| LRR receptor-like kinase [Medicago truncatula]
Length=669

 Score =   744 bits (1920),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 391/642 (61%), Positives = 480/642 (75%), Gaps = 9/642 (1%)
 Frame = -3

Query  2198  LMAIKASLDPGNLVLSSWSPNVTDPCSVSSFEGIACNDLGQVVNISLQGKGLYGKIPPEI  2019
             LM IK SLDP N VL SW+ N +DPCS  +F+G+ACN+ G V NISLQGKGL G+IP  I
Sbjct  25    LMLIKDSLDPENHVLLSWN-NHSDPCS-GTFDGVACNEQGLVTNISLQGKGLSGEIPSVI  82

Query  2018  GQLNGLSGLYLHFNNLHGVIPKEIASLTQLSDLYLNMNDLSGFIPSEIGNMPNLQVLQLC  1839
             G+L  L+GLYLHFN L+G++PKEIA LTQLSDLYLN+N+LSGFIP EIGNM NLQVLQLC
Sbjct  83    GKLKSLTGLYLHFNALNGILPKEIAGLTQLSDLYLNVNNLSGFIPHEIGNMSNLQVLQLC  142

Query  1838  YNRFEGCIPNKLGSLKNLTVLALQSNQLTGAIPASlggltlltrldLSFNRLFGSIPVKL  1659
             +N   G IP +LG LK L+VLALQ N L+GAIPASLG L  L RLDLSFN L G IPV L
Sbjct  143   HNELNGSIPTELGKLKRLSVLALQYNHLSGAIPASLGELETLERLDLSFNTLLGPIPVTL  202

Query  1658  SEASKLEVLDLRNNTLSGNVPLGLKRLNEGFRYENNPGLCGTGFPSLALCSD-SSLNPTK  1482
             + A KLE LD+RNN+LSG+VP  LKRL EGF+Y NN GLCGTGF  L  C   S+ +P +
Sbjct  203   ANAPKLETLDIRNNSLSGSVPTDLKRLKEGFQYFNNHGLCGTGFAHLDSCQIVSNSDPVR  262

Query  1481  PEPFGQG---SNRLPTKDIPESANIPHQLNQNRKPQAAAAVV-GVIGLFVILAVAGLFTF  1314
             PEP+      +   PT   P S N  +   + R   +   +V  VIG+  + A+ GLF  
Sbjct  263   PEPYDPSNISTIEFPTTPEPTSKNCGNSGCRRRSDSSTIGLVFAVIGVVSVSALTGLFLI  322

Query  1313  SWYRRRKQQIGSTVDISESRVSTDQPKVLCRRSTSPLISLEYSNGWDPLAKDQSGSALSQ  1134
               +RR KQ+IG+TV+IS++R+STD+ K + R+  SPLI+LEYS+GWDPL+KD    + SQ
Sbjct  323   LRHRRLKQKIGNTVEISDNRLSTDKIKEVYRKKASPLINLEYSSGWDPLSKDLG--SYSQ  380

Query  1133  EVLESFMFNLDEVESATQYFSETNLLGKSSFSAVYKGTLRDGSAVAVKCISKTSCKSDEA  954
             E L+SFMFNL+EV+ ATQ FSE NLL K++ S+ Y+G LRDGS V +KCI KTSCKSDE 
Sbjct  381   EFLQSFMFNLEEVDRATQCFSEMNLLAKNNISSNYRGILRDGSIVVIKCIPKTSCKSDET  440

Query  953   EFRKGLTLLTSLKHENLLRLRGFCCSKGRGECFLIYDFVSNGNLLRYLDVKDEKGKVLDW  774
             EF  GL +LTSLKHENL+RLRGFCCSK RGECFL+YDFVSNG L +YLDV+ E  +VL+W
Sbjct  441   EFLNGLKILTSLKHENLVRLRGFCCSKSRGECFLVYDFVSNGRLSKYLDVQRESAEVLEW  500

Query  773   STRTAIIKGIARGIKYLHGNKRNKPALVHRNISADKVLIDHLYKPLLSDSGLHKLLADDI  594
             STR +II GIA+GI YLHG K  K +LVH++ISA+KVL+D  YK LL+DSGLHKLLADD+
Sbjct  501   STRVSIIHGIAKGIFYLHGKKGRKHSLVHQSISAEKVLLDSRYKSLLADSGLHKLLADDV  560

Query  593   VFSTLKGSAANGYLAPEYAITGRFTEKSDMYAFGVIILQILSGSCVVTQSNHQGAELCRF  414
             VFSTLK SAA GYLAPEY  TGRFTEKSD+YAFG+I+ QIL+G   +TQ + Q  E    
Sbjct  561   VFSTLKASAAMGYLAPEYTTTGRFTEKSDVYAFGMIVFQILTGKHDITQLSRQCVETGTL  620

Query  413   EDFVDAKLGKDFVESEAAKLGKIALLCTHDSPSRRPAIDVVI  288
             +D +D  L   F+ESEA KL ++AL+CT +SP  RP ++ V+
Sbjct  621   KDIIDENLEGKFLESEAEKLARLALVCTDESPHLRPTMENVM  662



>ref|XP_010934669.1| PREDICTED: leucine-rich repeat receptor protein kinase EXS [Elaeis 
guineensis]
Length=673

 Score =   744 bits (1921),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 390/645 (60%), Positives = 486/645 (75%), Gaps = 18/645 (3%)
 Frame = -3

Query  2198  LMAIKASLDPGNLVLSSWSPNVTDPCSVSSFEGIACNDLGQVVNISLQGKGLYGKIPPEI  2019
             LM +KA+LD    +L+SW+ +  DPC    FEG+ACN+ G+V NISLQGKGL G I P +
Sbjct  34    LMEVKAALDKEGRILASWTSD-GDPCR-GDFEGVACNEYGKVANISLQGKGLSGFISPAV  91

Query  2018  GQLNGLSGLYLHFNNLHGVIPKEIASLTQLSDLYLNMNDLSGFIPSEIGNMPNLQVLQLC  1839
              +L  LSGLYLH+N L G IP+EI++LT+LS+LYLN N+L G IP E+G M +LQVLQLC
Sbjct  92    AELRCLSGLYLHYNALRGEIPREISNLTELSELYLNNNNLPGRIPVELGKMESLQVLQLC  151

Query  1838  YNRFEGCIPNKLGSLKNLTVLALQSNQLTGAIPASlggltlltrldLSFNRLFGSIPVKL  1659
             YN+  G IP +LG LK LTVLALQ N L GAIPA+LG LT LTRLDLSFN LFGSIPVKL
Sbjct  152   YNQLTGGIPPQLGLLKKLTVLALQCNHLNGAIPATLGDLTQLTRLDLSFNHLFGSIPVKL  211

Query  1658  SEASKLEVLDLRNNTLSGNVPLGLKRLNEGFRYENNPGLCGTGFPSLALCS-DSSLNPTK  1482
             ++  +L V D+RNN+LSGNVP  LKRLN GF+Y NN  LCG GF SL +CS D  LNP+K
Sbjct  212   AQVPQLVVFDVRNNSLSGNVPSDLKRLNGGFQYGNNTELCGVGFTSLKVCSSDDVLNPSK  271

Query  1481  PEPFGQGSNRLPTKDIPESANIPHQLNQNR-----KPQAAAAVVGVIGLFVILAVAGLFT  1317
             PEPFGQ        +IP+SANI    N +      K  A   V+G++ L     V  L  
Sbjct  272   PEPFGQ--------EIPQSANITAHCNGSHCSKSSKSSAVKVVIGIVALAFGGLVISLLA  323

Query  1316  FSWYRRRKQQIGSTVDISESRVSTDQPKVLCRRSTSPLISLEYSNGWDPLAKDQSGSALS  1137
             F+ YRRRKQ+IGS +++S+SR+STDQPK   R+S SPLISLEYSNGWD L   + G  LS
Sbjct  324   FALYRRRKQKIGSALEVSDSRLSTDQPKDFYRKSASPLISLEYSNGWDSLVDGRGGVGLS  383

Query  1136  QEVLESFMFNLDEVESATQYFSETNLLGKSSFSAVYKGTLRDGSAVAVKCISKTSCKSDE  957
             QEV +SF FNL+EVE ATQYFS+ NLLGKS+F+A +KG LRDG+ VAVK I+KTSCK++E
Sbjct  384   QEVSQSFRFNLEEVECATQYFSDVNLLGKSNFAASFKGLLRDGTVVAVKSINKTSCKTEE  443

Query  956   AEFRKGLTLLTSLKHENLLRLRGFCCSKGRGECFLIYDFVSNGNLLRYLDVKDE-KGKVL  780
             A+F KGL +LT L+HENL+ LRGFCCS+GRGECFL+YDFV+NG+L +YLD+KD   G+VL
Sbjct  444   ADFLKGLKILTLLRHENLVGLRGFCCSRGRGECFLVYDFVTNGSLSQYLDMKDNVNGRVL  503

Query  779   DWSTRTAIIKGIARGIKYLHGNKRNKPALVHRNISADKVLIDHLYKPLLSDSGLHKLLAD  600
             DW TR +I+KGIA+GI+YLH N+ NKPALVH+NISA+KVLIDH + P LS SGLHKLLAD
Sbjct  504   DWPTRVSIVKGIAKGIEYLHSNRSNKPALVHQNISAEKVLIDHNFAPRLSGSGLHKLLAD  563

Query  599   DIVFSTLKGSAANGYLAPEYAITGRFTEKSDMYAFGVIILQILSGSCVVTQSNHQGAELC  420
             D+VFSTLK SAA GYLAPEY   GRFTEKSD+YAFGV++ QIL+G   V+      +E  
Sbjct  564   DVVFSTLKASAAMGYLAPEYTTVGRFTEKSDVYAFGVLVFQILTGKSNVSHL-RLNSEYA  622

Query  419   RFEDFVDAKLGKDFVESEAAKLGKIALLCTHDSPSRRPAIDVVIQ  285
             + E+ +D  L  ++ + EA+KL  IAL+CT ++PS+RP ++ V+Q
Sbjct  623   KLENLIDENLDGNYSKPEASKLAGIALVCTSETPSQRPTMEAVLQ  667



>ref|XP_006293447.1| hypothetical protein CARUB_v10022725mg [Capsella rubella]
 gb|EOA26345.1| hypothetical protein CARUB_v10022725mg [Capsella rubella]
Length=723

 Score =   746 bits (1925),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 394/653 (60%), Positives = 487/653 (75%), Gaps = 21/653 (3%)
 Frame = -3

Query  2189  IKASLDPGNLVLSSWSPNVTDPCSVSSFEGIACNDLGQVVNISLQGKGLYGKIPPEIGQL  2010
             IK+SLDP    L+SW+P+  DPCS  SF+G+AC+   +V NISLQG GL G IPP IG L
Sbjct  65    IKSSLDPQKRFLTSWTPDA-DPCSSGSFDGVACDGNHRVANISLQGMGLTGTIPPSIGLL  123

Query  2009  NGLSGLYLHFNNLHGVIPKEIASLTQLSDLYLNMNDLSGFIPSEIGNMPNLQVLQLCYNR  1830
               L+GLYLHFN+L G IPK I++L  L+DLYLN+N+LSG IP +IGN+ NLQV+QLCYN+
Sbjct  124   TSLTGLYLHFNSLTGQIPKAISNLPLLADLYLNVNNLSGEIPPQIGNLDNLQVVQLCYNK  183

Query  1829  FEGCIPNKLGSLKNLTVLALQSNQLTGAIPASlggltlltrldLSFNRLFGSIPVKLSEA  1650
               G IP +LGSLK +TVLALQ NQL+GAIPASLG +  LTRLDLSFN LFG +PVKL+ A
Sbjct  184   LSGSIPTQLGSLKKVTVLALQYNQLSGAIPASLGNINTLTRLDLSFNNLFGPVPVKLAGA  243

Query  1649  SKLEVLDLRNNTLSGNVPLGLKRLNEGFRYENNPGLCGTGFPSLALCSD-SSLNPTKPEP  1473
               LEVLD+RNN+ SG VP  LKRLN GF+Y NN GLCG GF  L  C+  +  N  +P+P
Sbjct  244   PLLEVLDIRNNSFSGFVPSALKRLNNGFQYSNNHGLCGDGFTDLKACTGLNGPNLDRPDP  303

Query  1472  FGQGSNRLPTKDI-PESANIPHQLNQNR---------KPQAAAAVVGVIGLFVILAVAGL  1323
                      T D+ PESA++      N          K      V+G+IG  + +A+ G 
Sbjct  304   --TNPKNFTTVDVKPESADLQRSNCSNNNGGCSSKTSKSSPFGIVMGLIGSILAVAIFGG  361

Query  1322  FTFSWYRRRKQQIGSTVDISESRVSTDQ--PKVLCRRSTSPLISLEYSNGWDPLAKDQSG  1149
              TF+WYRRRKQ+IGS++D  + R+ST+    +   R+S+SPLISLEY++GWDPL + Q+ 
Sbjct  362   STFTWYRRRKQKIGSSLDAMDGRISTEYNFKEASRRKSSSPLISLEYASGWDPLGRGQNS  421

Query  1148  ---SALSQEVLESFMFNLDEVESATQYFSETNLLGKSSFSAVYKGTLRDGSAVAVKCISK  978
                SALSQEV ESFMFNL+E+E ATQ FSE NLLGKS+ S+VYKG LRDGS  AVKCI+K
Sbjct  422   NNNSALSQEVFESFMFNLEEIERATQSFSEVNLLGKSNVSSVYKGILRDGSVAAVKCIAK  481

Query  977   TSCKSDEAEFRKGLTLLTSLKHENLLRLRGFCCSKGRGECFLIYDFVSNGNLLRYLDVKD  798
             +SCKSDE EF KGL +LT LKHENL+RLRGFCCSKGRGECFLIY+FV NGNLL+YLDVKD
Sbjct  482   SSCKSDETEFLKGLKMLTLLKHENLVRLRGFCCSKGRGECFLIYEFVPNGNLLQYLDVKD  541

Query  797   EKGKVLDWSTRTAIIKGIARGIKYLHGNKRNKPALVHRNISADKVLIDHLYKPLLSDSGL  618
             E G+VL+W+TR +II GIARGI YLHG   NKPA+VH+N+SA+KVLIDH + P L+DSGL
Sbjct  542   ETGEVLEWTTRVSIINGIARGIVYLHGENGNKPAIVHQNLSAEKVLIDHWFNPSLADSGL  601

Query  617   HKLLADDIVFSTLKGSAANGYLAPEYAITGRFTEKSDMYAFGVIILQILSGSCVVTQ-SN  441
             HKL  DDIVFS LK SAA GYLAPEY  TGRFT+KSD+YAFG+I+LQILSG   ++    
Sbjct  602   HKLFTDDIVFSKLKASAAMGYLAPEYITTGRFTDKSDVYAFGMILLQILSGKSKISHLMI  661

Query  440   HQGAELCRF-EDFVDAKLGKDFVESEAAKLGKIALLCTHDSPSRRPAIDVVIQ  285
              Q  E  R  EDF+D  L K+F E+EAA+L ++ LLCTH+S ++RP+++ V+Q
Sbjct  662   LQAVESGRLNEDFMDPNLRKNFPEAEAAQLARLGLLCTHESSNQRPSMEDVMQ  714



>ref|XP_008794535.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
GSO1 [Phoenix dactylifera]
Length=672

 Score =   741 bits (1912),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 392/645 (61%), Positives = 486/645 (75%), Gaps = 17/645 (3%)
 Frame = -3

Query  2198  LMAIKASLDPGNLVLSSWSPNVTDPCSVSSFEGIACNDLGQVVNISLQGKGLYGKIPPEI  2019
             LM +KA+LDPG  +LS+W+ +  DPC   SFEG+ACN+ G+V NISLQGKGL G I P +
Sbjct  32    LMEVKAALDPGGRILSTWTSD-GDPCG-GSFEGVACNENGKVANISLQGKGLAGSISPAV  89

Query  2018  GQLNGLSGLYLHFNNLHGVIPKEIASLTQLSDLYLNMNDLSGFIPSEIGNMPNLQVLQLC  1839
              +L  LSGLYLH+N L G IP+EIA+L +LSDLYL++N+LSG IP EIGNM +LQVLQLC
Sbjct  90    AELRYLSGLYLHYNALSGKIPREIANLNELSDLYLDVNNLSGVIPEEIGNMASLQVLQLC  149

Query  1838  YNRFEGCIPNKLGSLKNLTVLALQSNQLTGAIPASlggltlltrldLSFNRLFGSIPVKL  1659
              N+  G IP +LG LK + VLALQSN LTGAIPASLG LT L RLDLSFN+LFGSIPVKL
Sbjct  150   CNQLSGSIPTQLGLLKKINVLALQSNHLTGAIPASLGDLTQLMRLDLSFNQLFGSIPVKL  209

Query  1658  SEASKLEVLDLRNNTLSGNVPLGLKRLNEGFRYENNPGLCGTGFPSLALCSDSSL-NPTK  1482
             ++ S+L V D+RNNTLSG+VP  LKRL +GF+Y NN  LCG GFPSL +C+ S L NP +
Sbjct  210   AQLSQLVVFDVRNNTLSGSVPSDLKRLADGFQYGNNADLCGNGFPSLRVCTSSDLFNPNR  269

Query  1481  PEPFGQGSNRLPTKDIPESANIPHQLNQNRKPQAAAAVVGVIGLFVIL----AVAGLFTF  1314
             P     G+  LP ++ P SAN+    N      ++ + V ++     +     ++GL  F
Sbjct  270   P-----GAGILPQEN-PYSANLNVHCNNTHCSNSSKSAVAIVVAIAAVVFGGTISGLLAF  323

Query  1313  SWYRRRKQQIGSTVDISESRVSTDQPKVLCRRSTSPLISLEYSNGWDPLAKDQSGSALSQ  1134
             SWYRRRKQ+IGS  ++S+ R+S DQ K   +RS SPLISLEYSNGWDPLA  +S    SQ
Sbjct  324   SWYRRRKQKIGSPSEVSDRRLSADQTKDFYQRSVSPLISLEYSNGWDPLADGRSSVGFSQ  383

Query  1133  EVLESFMFNLDEVESATQYFSETNLLG-KSSFSAVYKGTLRDGSAVAVKCISKTSCKSDE  957
             EVL+SF FNL+EVESATQYFS+ N LG KSSF+A YKG LRDG+ VAVK I+KTSCKS+E
Sbjct  384   EVLQSFRFNLEEVESATQYFSDVNFLGKKSSFAATYKGILRDGTMVAVKRINKTSCKSEE  443

Query  956   AEFRKGLTLLTSLKHENLLRLRGFCCSKGRGECFLIYDFVSNGNLLRYLDVK-DEKGKVL  780
             AEF KGL +LT L+HENL+ LRGFCCS GRGECFL+Y+FV+NG+L RYLDVK DE G++L
Sbjct  444   AEFLKGLKILTLLRHENLVGLRGFCCSTGRGECFLVYNFVANGSLSRYLDVKGDENGRIL  503

Query  779   DWSTRTAIIKGIARGIKYLHGNKRNKPALVHRNISADKVLIDHLYKPLLSDSGLHKLLAD  600
             DW  R +IIKGIA+GI+YLH N  NKP+LVH++ISA+KVLID+ + PLLS SGL+KLLAD
Sbjct  504   DWPARVSIIKGIAKGIEYLHSNMTNKPSLVHQSISAEKVLIDYHFNPLLSGSGLYKLLAD  563

Query  599   DIVFSTLKGSAANGYLAPEYAITGRFTEKSDMYAFGVIILQILSGSCVVTQSNHQGAELC  420
             D+VFSTLK SAA GYLAPEY   GR TEKSD+YAFG+I+ QIL+G    T     GAE  
Sbjct  564   DVVFSTLKASAAMGYLAPEYTTVGRLTEKSDVYAFGIIVFQILTGK--RTTHLRLGAESG  621

Query  419   RFEDFVDAKLGKDFVESEAAKLGKIALLCTHDSPSRRPAIDVVIQ  285
               ED +D  L  +F + EAAKL  IALLCT ++P++RP ++ ++Q
Sbjct  622   NLEDLIDENLNGNFSKPEAAKLASIALLCTSEAPNQRPTMEAILQ  666



>ref|XP_010037998.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g34110 [Eucalyptus grandis]
 gb|KCW49797.1| hypothetical protein EUGRSUZ_K03279 [Eucalyptus grandis]
Length=690

 Score =   741 bits (1912),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 380/644 (59%), Positives = 485/644 (75%), Gaps = 9/644 (1%)
 Frame = -3

Query  2198  LMAIKASLDPGNLVLSSWSPNVTDPCSVSSFEGIACNDLGQVVNISLQGKGLYGKIPPEI  2019
             LM +KASLDP +  LSSW+ +  DPC   SF+G+ C+D G+V N+SLQG+ L G++ P I
Sbjct  41    LMDMKASLDPESRYLSSWTVD-GDPCD-GSFQGVCCDDEGRVANVSLQGRRLTGRLSPAI  98

Query  2018  GQLNGLSGLYLHFNNLHGVIPKEIASLTQLSDLYLNMNDLSGFIPSEIGNMPNLQVLQLC  1839
               L  L+GLYLH+N+L G IP+E+ +L+ LSDLYLNMN+LSG IP E+ ++ +LQV+QL 
Sbjct  99    AGLTHLTGLYLHYNSLCGEIPRELGNLSALSDLYLNMNNLSGQIPPEMADIASLQVMQLS  158

Query  1838  YNRFEGCIPNKLGSLKNLTVLALQSNQLTGAIPASlggltlltrldLSFNRLFGSIPVKL  1659
             YN+  G IP KLGSLK L+VLALQSNQLTGAIPASLG L  LTRL LSFNRLFGSIP+K+
Sbjct  159   YNQLTGSIPTKLGSLKKLSVLALQSNQLTGAIPASLGDLGTLTRLYLSFNRLFGSIPMKI  218

Query  1658  SEASKLEVLDLRNNTLSGNVPLGLKRLNEGFRYENNPGLCGTGFPSLALCSD-SSLNPTK  1482
             ++   LEVLD++NNTLSGNVP  LKRLNEGF YENN  LCGTGF SL  C+      P++
Sbjct  219   ADLPLLEVLDVQNNTLSGNVPPALKRLNEGFLYENNFDLCGTGFLSLRTCNALEGRKPSQ  278

Query  1481  PEPFGQGSNRLPTKDIPESANI--PHQLNQ-NRKPQAA--AAVVGVIGLFVILAVAGLFT  1317
             P+P+G  +  +P+  IPE+AN+  P  L + +  P++A  +A++G I   V L+  G   
Sbjct  279   PQPYGAATT-VPSTSIPETANVVLPCNLTECSSLPKSAHPSALIGSILATVALSAIGFLL  337

Query  1316  FSWYRRRKQQIGSTVDISESRVSTDQPKVLCRRSTSPLISLEYSNGWDPLAKDQSGSALS  1137
             F+ YRRRKQ++G + ++ +  +STDQPK   +++ SPL SLEYSNGWDPLA  +  +  S
Sbjct  338   FTHYRRRKQKLGFSAEVCDGHLSTDQPKSAYKKNGSPLASLEYSNGWDPLADARIFNEFS  397

Query  1136  QEVLESFMFNLDEVESATQYFSETNLLGKSSFSAVYKGTLRDGSAVAVKCISKTSCKSDE  957
             +E  +SF FNL+EVESATQYFSE N+LGKS+FS  Y+G LRDGS V++KCI+KTSCK+DE
Sbjct  398   EEAFQSFRFNLEEVESATQYFSELNVLGKSNFSTTYRGILRDGSVVSIKCINKTSCKADE  457

Query  956   AEFRKGLTLLTSLKHENLLRLRGFCCSKGRGECFLIYDFVSNGNLLRYLDVKDEKGKVLD  777
             +EF KGL +LTSL+HENL+RLRGFCCS  RGECFLIYD+V NG LL +LD+++     L+
Sbjct  458   SEFLKGLNMLTSLRHENLVRLRGFCCSTARGECFLIYDYVPNGTLLSFLDLEEGDSGTLE  517

Query  776   WSTRTAIIKGIARGIKYLHGNKRNKPALVHRNISADKVLIDHLYKPLLSDSGLHKLLADD  597
             WSTR +I+KGIA+GI YLH +K NK  L+H+NISADKVLID  + PLL  SGLH+LL +D
Sbjct  518   WSTRVSIVKGIAKGIAYLHAHKPNKAPLLHQNISADKVLIDQRFNPLLYQSGLHRLLTND  577

Query  596   IVFSTLKGSAANGYLAPEYAITGRFTEKSDMYAFGVIILQILSGSCVVTQSNHQGAELCR  417
             +VFS LK SAA GYLAPEY  TGRFTEKSD+YAFG+I+ QILSG   V  S    AE CR
Sbjct  578   VVFSLLKASAAMGYLAPEYMSTGRFTEKSDVYAFGMIVFQILSGKQKVDHSMRLAAESCR  637

Query  416   FEDFVDAKLGKDFVESEAAKLGKIALLCTHDSPSRRPAIDVVIQ  285
             F++F+DA +   F E EAAKL KIA LCT++SP  RP++D VI 
Sbjct  638   FQEFIDANIHGRFFEYEAAKLAKIASLCTNESPYDRPSMDAVIH  681



>emb|CDY57103.1| BnaC04g56910D [Brassica napus]
Length=695

 Score =   739 bits (1909),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 393/661 (59%), Positives = 492/661 (74%), Gaps = 33/661 (5%)
 Frame = -3

Query  2189  IKASLDPGNLVLSSWSPNVTDPCSVSSFEGIACNDLGQVVNISLQGKGLYGKIPPEIGQL  2010
             IK+SLDP N  L+SW+P+  DPCS  SF+G+AC+   +V NISLQG GL G IPP IG L
Sbjct  33    IKSSLDPQNRFLTSWTPDA-DPCSPGSFDGVACDGNRRVANISLQGMGLTGTIPPSIGLL  91

Query  2009  NGLSGLYLHFNNLHGVIPKEIASLTQLSDLYLNMNDLSGFIPSEIGNMPNLQVLQLCYNR  1830
               L+GLYLHFN+L G IPK+I++L  L+DLYLN+N+LSG IP +IGN+ NLQVLQLCYN+
Sbjct  92    TSLTGLYLHFNSLTGQIPKDISNLPLLTDLYLNVNNLSGEIPPQIGNLDNLQVLQLCYNK  151

Query  1829  FEGCIPNKLGSLKNLTVLALQSNQLTGAIPASlggltlltrldLSFNRLFGSIPVKLSEA  1650
               G IP +LGSLK +TVLALQ NQL+GA+PASLG +  LTRLDLSFN LFG +PVKL+ A
Sbjct  152   LSGSIPTQLGSLKKITVLALQYNQLSGAVPASLGDVGTLTRLDLSFNNLFGPVPVKLAAA  211

Query  1649  SKLEVLDLRNNTLSGNVPLGLKRLNEGFRYENNPGLCGTGFPSLALCSDSSL------NP  1488
               L+VLD+RNN+ SG VP  LKRLN GF+Y NN GLCG GF  L  C+ S++      +P
Sbjct  212   PSLQVLDIRNNSFSGFVPSALKRLNSGFQYSNNLGLCGDGFTDLKACTGSNVPNLNRPDP  271

Query  1487  TKPEPFGQGSNRLPTKDI-PESANIPHQLNQNRKPQAAAA----------VVGVIGLFVI  1341
             T P+ F      + T D+ PESA +      N    A ++          V+G+IG  + 
Sbjct  272   TNPKSF------ITTNDVKPESAVVQRSNCSNNNNGACSSKTSKSSSLGIVMGLIGSILA  325

Query  1340  LAVAGLFTFSWYRRRKQQIGSTVDIS-ESRVSTDQ--PKVLCRRSTSPLISLEYSNGWDP  1170
             +A+ G  TF+WYRRRKQ+IGS++D + + RVST+    +   R+S+SPLISLEY+NGWDP
Sbjct  326   VAIFGGSTFTWYRRRKQRIGSSLDATMDGRVSTEYNFKEASRRKSSSPLISLEYANGWDP  385

Query  1169  LAKDQSG---SALSQEVLESFMFNLDEVESATQYFSETNLLGKSSFSAVYKGTLRDGSAV  999
             L + Q+    SALSQEV ESFMFNL+E+E ATQ FSE NLLGKS+ S+VYKG LRDGS  
Sbjct  386   LGRGQNSGNNSALSQEVFESFMFNLEEIERATQSFSEVNLLGKSNVSSVYKGVLRDGSVA  445

Query  998   AVKCISKTSCKSDEAEFRKGLTLLTSLKHENLLRLRGFCCSKGRGECFLIYDFVSNGNLL  819
             A+KCI+K+SCKSDE+EF KGL +LT LKHENL+RLRGFCCSKGRGECFLIY+FV NGNLL
Sbjct  446   AIKCIAKSSCKSDESEFLKGLKMLTLLKHENLVRLRGFCCSKGRGECFLIYEFVPNGNLL  505

Query  818   RYLDVKDEK-GKVLDWSTRTAIIKGIARGIKYLHGNKRNKPALVHRNISADKVLIDHLYK  642
             +YLDVK+E  G+VL+W+TR +II GIARGI YLHG    KPA+VH+N+SA+K+LIDH Y 
Sbjct  506   QYLDVKEESGGEVLEWTTRVSIINGIARGIVYLHGENGKKPAIVHQNLSAEKILIDHWYN  565

Query  641   PLLSDSGLHKLLADDIVFSTLKGSAANGYLAPEYAITGRFTEKSDMYAFGVIILQILSGS  462
             P L+DS LHKL  DDIVFS LK SAA GYLAPEY  TGRFT+KSD+YAFG+I+LQILSG 
Sbjct  566   PSLADSALHKLFTDDIVFSKLKASAAMGYLAPEYITTGRFTDKSDVYAFGMILLQILSGK  625

Query  461   CVVTQ-SNHQGAELCRF-EDFVDAKLGKDFVESEAAKLGKIALLCTHDSPSRRPAIDVVI  288
               ++     Q  E  R  EDF+D  L K F E+EA +L ++ LLCTH+S ++RP+++ V+
Sbjct  626   SRISHLMILQAVESGRLNEDFIDLNLRKRFPEAEAEQLARLGLLCTHESSNQRPSMEDVM  685

Query  287   Q  285
             Q
Sbjct  686   Q  686



>ref|XP_002880173.1| hypothetical protein ARALYDRAFT_346338 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH56432.1| hypothetical protein ARALYDRAFT_346338 [Arabidopsis lyrata subsp. 
lyrata]
Length=692

 Score =   733 bits (1893),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 394/653 (60%), Positives = 490/653 (75%), Gaps = 21/653 (3%)
 Frame = -3

Query  2189  IKASLDPGNLVLSSWSPNVTDPCSVSSFEGIACNDLGQVVNISLQGKGLYGKIPPEIGQL  2010
             IK+SLDP    L+SW+P+  DPCS  SF+G+AC+   +V NISLQG GL G IPP IG L
Sbjct  34    IKSSLDPEKRFLTSWTPDA-DPCSSGSFDGVACDGNRRVANISLQGMGLTGTIPPSIGLL  92

Query  2009  NGLSGLYLHFNNLHGVIPKEIASLTQLSDLYLNMNDLSGFIPSEIGNMPNLQVLQLCYNR  1830
               L+GLYLHFN+L G IPK+I++L  L+DLYLN+N+LSG IP +IGN+ NLQV+QLCYN+
Sbjct  93    TSLTGLYLHFNSLTGHIPKDISNLPLLTDLYLNVNNLSGEIPPQIGNLDNLQVIQLCYNK  152

Query  1829  FEGCIPNKLGSLKNLTVLALQSNQLTGAIPASlggltlltrldLSFNRLFGSIPVKLSEA  1650
               G IP +LGSL+ +TVLALQ NQL+GAIPASLG ++ LTRLDLSFN LFG +PVKL+ A
Sbjct  153   LSGSIPTQLGSLQKITVLALQYNQLSGAIPASLGDISTLTRLDLSFNNLFGPVPVKLAGA  212

Query  1649  SKLEVLDLRNNTLSGNVPLGLKRLNEGFRYENNPGLCGTGFPSLALCSD-SSLNPTKPEP  1473
               LEVLD+RNN+ SG VP  LKRLN GF+Y NN GLCG GF  L  C+  +  N  +P+P
Sbjct  213   PLLEVLDIRNNSFSGFVPSALKRLNNGFQYSNNHGLCGDGFTDLNACTGLNGPNLNRPDP  272

Query  1472  FGQGSNRLPTKDI-PESANIPHQLNQNR---------KPQAAAAVVGVIGLFVILAVAGL  1323
                      T D+ PESA++      N          K      V+G++G  + +A+ G 
Sbjct  273   --TNPTNFTTVDVKPESADLQRSNCSNNNGGCSSKTSKSSPLGIVMGLMGSILAVAIFGG  330

Query  1322  FTFSWYRRRKQQIGSTVDISESRVSTDQ--PKVLCRRSTSPLISLEYSNGWDPLAKDQSG  1149
              TF+WYRRRKQ+IGS++D  + R+ST+    +V  R+S+SPLISLEY++GWDPL + QS 
Sbjct  331   STFTWYRRRKQKIGSSLDAMDGRISTEYNFKEVSRRKSSSPLISLEYASGWDPLGRGQSS  390

Query  1148  ---SALSQEVLESFMFNLDEVESATQYFSETNLLGKSSFSAVYKGTLRDGSAVAVKCISK  978
                SALSQEV ESFMFNL+E+E ATQ FSE NLLGKS+ S+VYKG LRDGS  AVKCI+K
Sbjct  391   NNNSALSQEVFESFMFNLEEIERATQSFSEVNLLGKSNVSSVYKGILRDGSVAAVKCIAK  450

Query  977   TSCKSDEAEFRKGLTLLTSLKHENLLRLRGFCCSKGRGECFLIYDFVSNGNLLRYLDVKD  798
             +SCKSDE+EF KGL  LT LKHENL+RLRGFCCSKGRGECFLIY+FV NGNLL+YLDVKD
Sbjct  451   SSCKSDESEFLKGLKTLTLLKHENLVRLRGFCCSKGRGECFLIYEFVPNGNLLQYLDVKD  510

Query  797   EKGKVLDWSTRTAIIKGIARGIKYLHGNKRNKPALVHRNISADKVLIDHLYKPLLSDSGL  618
             E G+VL+W+TR +II GIARGI YLHG   NKPA+VH+N+SA+K+LIDH Y P L+DSGL
Sbjct  511   ETGEVLEWTTRVSIINGIARGIVYLHGENGNKPAIVHQNLSAEKILIDHWYNPSLADSGL  570

Query  617   HKLLADDIVFSTLKGSAANGYLAPEYAITGRFTEKSDMYAFGVIILQILSGSCVVTQ-SN  441
             HKL  DDIVFS LK SAA GYLAPEY  TGRFT+KSD+YAFG+I+LQILSG   ++    
Sbjct  571   HKLFTDDIVFSKLKASAAMGYLAPEYITTGRFTDKSDVYAFGMILLQILSGKSKISHLMI  630

Query  440   HQGAELCRF-EDFVDAKLGKDFVESEAAKLGKIALLCTHDSPSRRPAIDVVIQ  285
              Q  E  R  EDF+D  L K+F E+EAA+L ++ LLCTH+S ++RP+++ V+Q
Sbjct  631   LQAVESGRLNEDFMDPNLRKNFPEAEAAELARLGLLCTHESSNQRPSMEDVMQ  683



>ref|XP_007038448.1| Leucine-rich repeat protein kinase family protein isoform 2 [Theobroma 
cacao]
 gb|EOY22949.1| Leucine-rich repeat protein kinase family protein isoform 2 [Theobroma 
cacao]
Length=636

 Score =   730 bits (1885),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 383/644 (59%), Positives = 470/644 (73%), Gaps = 51/644 (8%)
 Frame = -3

Query  2198  LMAIKASLDPGNLVLSSWSPNVTDPCSVSSFEGIACNDLGQVVNISLQGKGLYGKIPPEI  2019
             L+ +KA+LDP +  LSSW+ N  DPC   SFEG+ CN  GQ+ NISLQGKGL GK+   I
Sbjct  29    LLDMKAALDPDDKYLSSWTIN-GDPCD-RSFEGVGCNQKGQIANISLQGKGLSGKVSSAI  86

Query  2018  GQLNGLSGLYLHFNNLHGVIPKEIASLTQLSDLYLNMNDLSGFIPSEIGNMPNLQVLQLC  1839
               L  L+GLYLH+N+L+G IP+EIA+LT LSDLYLNMN+LSG IP EIGNM +LQVLQLC
Sbjct  87    TGLKHLTGLYLHYNSLYGDIPREIANLTLLSDLYLNMNNLSGEIPPEIGNMGSLQVLQLC  146

Query  1838  YNRFEGCIPNKLGSLKNLTVLALQSNQLTGAIPASlggltlltrldLSFNRLFGSIPVKL  1659
             YN+  G IP +LGSLK L VLALQSNQLTGAIPASLG +  L RLDLSFNRLFGSIP+K+
Sbjct  147   YNQLTGSIPTQLGSLKKLNVLALQSNQLTGAIPASLGDVGTLMRLDLSFNRLFGSIPMKI  206

Query  1658  SEASKLEVLDLRNNTLSGNVPLGLKRLNEGFRYENNPGLCGTGFPSLALCSDSS-LNPTK  1482
             ++A  LEVLD+RNN+LSGNVPL LKRLN+GF ++NN GLCG+GF SL  C+ S  +NP +
Sbjct  207   ADAPLLEVLDIRNNSLSGNVPLALKRLNDGFLFQNNLGLCGSGFSSLEACNTSDHINPNR  266

Query  1481  PEPFGQGSNRLPTKDIPESANI-----PHQLNQNRKPQAAAAVVGVIGLFVILAVAGLFT  1317
             PE +G G+   P ++IPE+AN+     P Q ++  K Q    +VG+I + V L+  G+ T
Sbjct  267   PEAYGPGTTGRP-REIPETANLQLPCEPTQCSKPSKSQRGPILVGLIVVTVALSAIGILT  325

Query  1316  FSWYRRRKQQIGSTVDISESRVSTDQPKVLCRRSTSPLISLEYSNGWDPLAKDQSGSALS  1137
             F+ YRRRKQ++GS+ +IS+ R+STDQ K + R++ SPLISLEY+NGWDPLA  ++ +  +
Sbjct  326   FTQYRRRKQKLGSSFEISDRRLSTDQAKGVYRKNGSPLISLEYANGWDPLADSRNFTGFA  385

Query  1136  QEVLESFMFNLDEVESATQYFSETNLLGKSSFSAVYKGTLRDGSAVAVKCISKTSCKSDE  957
             Q+V +SF FNL+EVE+ATQYFSE                                     
Sbjct  386   QDVFQSFRFNLEEVETATQYFSE-------------------------------------  408

Query  956   AEFRKGLTLLTSLKHENLLRLRGFCCSKGRGECFLIYDFVSNGNLLRYLDVKDEKGKVLD  777
                  GL +L SLKHENL+RLRGFCCSK RGECFLIYDFV NGNLLR LDVKD  G+VL+
Sbjct  409   -----GLNILASLKHENLVRLRGFCCSKARGECFLIYDFVPNGNLLRCLDVKDGDGQVLE  463

Query  776   WSTRTAIIKGIARGIKYLHGNKRNKPALVHRNISADKVLIDHLYKPLLSDSGLHKLLADD  597
             WSTR +I+KGIA+GI YLHG K NKPALVH+NISA+KVLID  + PLLSDSGLH LL +D
Sbjct  464   WSTRVSIVKGIAKGIAYLHGYKANKPALVHQNISAEKVLIDQRFNPLLSDSGLHNLLTND  523

Query  596   IVFSTLKGSAANGYLAPEYAITGRFTEKSDMYAFGVIILQILSGSCVVTQSNHQGAELCR  417
             IVF+ LK SAA GYLAPEY  TGRFTEKSD+YA+GV++ Q+LSG   VT     GAE CR
Sbjct  524   IVFAALKASAAMGYLAPEYTSTGRFTEKSDVYAYGVLVFQVLSGKRKVTSLVRLGAESCR  583

Query  416   FEDFVDAKLGKDFVESEAAKLGKIALLCTHDSPSRRPAIDVVIQ  285
             F+DF+D  L   F E EAAKL +IA LCTHDSP  RP++D V+Q
Sbjct  584   FQDFIDPNLHGRFFEYEAAKLARIAWLCTHDSPIERPSMDAVVQ  627



>ref|XP_010532258.1| PREDICTED: somatic embryogenesis receptor kinase 1 [Tarenaya 
hassleriana]
Length=688

 Score =   732 bits (1890),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 378/648 (58%), Positives = 478/648 (74%), Gaps = 16/648 (2%)
 Frame = -3

Query  2198  LMAIKASLDPGNLVLSSWSPNVTDPCSVSSFEGIACNDLGQVVNISLQGKGLYGKIPPEI  2019
             LM +KA LDP    L+SWS N  D C   SFEG+ C++ G V NISLQGKGL GKI P I
Sbjct  38    LMNVKAELDPEEKHLASWSVN-GDFCK--SFEGVGCDENGHVSNISLQGKGLSGKISPTI  94

Query  2018  GQLNGLSGLYLHFNNLHGVIPKEIASLTQLSDLYLNMNDLSGFIPSEIGNMPNLQVLQLC  1839
             G+L  L+GL+LH+N L G IP+E+ +L++L+DLYLN+N+LSG IP EIG + +LQVLQLC
Sbjct  95    GELKHLTGLFLHYNALVGEIPREMGNLSKLTDLYLNVNNLSGEIPPEIGKIESLQVLQLC  154

Query  1838  YNRFEGCIPNKLGSLKNLTVLALQSNQLTGAIPASlggltlltrldLSFNRLFGSIPVKL  1659
             YN   G IP +LGSLKNL+VLALQSN+LTGAIPASLG +  L RLDLSFNRLFGSIP KL
Sbjct  155   YNHLTGSIPTELGSLKNLSVLALQSNKLTGAIPASLGEINTLERLDLSFNRLFGSIPSKL  214

Query  1658  SEASKLEVLDLRNNTLSGNVPLGLKRLNEGFRYENNPGLCGTGFPSLALCSDS-SLNPTK  1482
             ++ + L VLD++NN+LSGNVP  LKRLNEGF +ENN GLCG  F  L  C+D+      K
Sbjct  215   ADPALLRVLDIQNNSLSGNVPPSLKRLNEGFAFENNLGLCGEQFSPLKSCNDTVQAESGK  274

Query  1481  PEPFGQGSNRLPTKDIPESANIPHQLNQNR-----KPQAAAAVVGVIGLFVILAVAGLFT  1317
             P+P+      LP +DI ESAN+    N +      +    A +VG++ + ++L+  G+  
Sbjct  275   PKPYSASVTGLPARDISESANLRLPCNASNCTDPPRSHQGAVLVGLVVMTILLSAIGVLL  334

Query  1316  FSWYRRRKQQIGSTVDISESRVSTDQ----PKVLCRRSTSPLISLEYSNGWDPLAKDQSG  1149
             F+ YRRRKQ++ +  +IS++   TDQ     +   + + SPLISLEY+NGWDPL+ +++ 
Sbjct  335   FTQYRRRKQRLSTPCEISDT---TDQFAKGNREFRKNNGSPLISLEYTNGWDPLSDNKNL  391

Query  1148  SALSQEVLESFMFNLDEVESATQYFSETNLLGKSSFSAVYKGTLRDGSAVAVKCISKTSC  969
             +  +QEV++SF FNL+EVE+ATQYFSE NLLG+S+FS  YKG LRDGS VA+K  SKT+C
Sbjct  392   NVFAQEVIQSFRFNLEEVETATQYFSEVNLLGRSNFSTTYKGILRDGSVVAIKSFSKTAC  451

Query  968   KSDEAEFRKGLTLLTSLKHENLLRLRGFCCSKGRGECFLIYDFVSNGNLLRYLDVKDEKG  789
             K++E EF KGL +L SLKHENL RLRGFCCS+GRGECFLIYDF  NG++L YLD+K+   
Sbjct  452   KAEEPEFLKGLNMLASLKHENLARLRGFCCSRGRGECFLIYDFAPNGSVLNYLDLKNGDP  511

Query  788   KVLDWSTRTAIIKGIARGIKYLHGNKRNKPALVHRNISADKVLIDHLYKPLLSDSGLHKL  609
              VLDWSTR +I KGIA+GI YLH  K NKPALVH+NISA+KVLID  Y PLLS+SGLH L
Sbjct  512   HVLDWSTRVSIAKGIAKGIGYLHSYKANKPALVHQNISAEKVLIDQRYNPLLSNSGLHTL  571

Query  608   LADDIVFSTLKGSAANGYLAPEYAITGRFTEKSDMYAFGVIILQILSGSCVVTQSNHQGA  429
             L++DI+FS LK SAA GYLAPEY +TGRFTEKSD+YAFGV++ QILSG   V+     G 
Sbjct  572   LSNDIIFSALKDSAAMGYLAPEYTLTGRFTEKSDVYAFGVLVFQILSGKLKVSNLVRLGT  631

Query  428   ELCRFEDFVDAKLGKDFVESEAAKLGKIALLCTHDSPSRRPAIDVVIQ  285
             E CRF+D++D  L   F E EA KL +IA LCTH+S   RP++D V+ 
Sbjct  632   EACRFQDYIDPNLNGRFFEYEATKLARIAWLCTHESAIERPSMDAVVH  679



>gb|KFK26770.1| hypothetical protein AALP_AA8G291500 [Arabis alpina]
Length=680

 Score =   731 bits (1886),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 385/649 (59%), Positives = 476/649 (73%), Gaps = 11/649 (2%)
 Frame = -3

Query  2213  STVSLLMAIKASLDPGNLVLSSWSPNVTDPCSVSSFEGIACNDLGQVVNISLQGKGLYGK  2034
             S +  L+ IK  LDP N  L+SWS N  DPC    FEG+ C+  GQV NI+LQGKGL GK
Sbjct  28    SELQTLLDIKKELDPENKHLASWSIN-GDPCK--DFEGVGCDWKGQVSNITLQGKGLPGK  84

Query  2033  IPPEIGQLNGLSGLYLHFNNLHGVIPKEIASLTQLSDLYLNMNDLSGFIPSEIGNMPNLQ  1854
             I P I +L  L+GL+LH+N L G IPKEI +L++L+DLYLN+N+LSG IPS IG M  LQ
Sbjct  85    ISPAIAELKHLTGLFLHYNALVGDIPKEIGNLSELTDLYLNVNNLSGEIPSHIGKMQGLQ  144

Query  1853  VLQLCYNRFEGCIPNKLGSLKNLTVLALQSNQLTGAIPASlggltlltrldLSFNRLFGS  1674
             VLQLCYN   G IP ++GSLK L+VLALQSN+LTGAIPA+LG L +L RLDLSFN LFGS
Sbjct  145   VLQLCYNNLTGSIPREIGSLKKLSVLALQSNKLTGAIPATLGDLDVLERLDLSFNHLFGS  204

Query  1673  IPVKLSEASKLEVLDLRNNTLSGNVPLGLKRLNEGFRYENNPGLCGTGFPSLALCSDSSL  1494
             +P KL+    L VLD+RNN+LSGNVP  LKRLN+GF +ENN GLCG  F  L  C+ ++ 
Sbjct  205   VPGKLAGPPLLRVLDIRNNSLSGNVPPVLKRLNDGFAFENNLGLCGAEFSPLKSCNGTA-  263

Query  1493  NPTKPEPFGQGSNRLPTKDIPESANIPHQLNQ---NRKPQA--AAAVVGVIGLFVILAVA  1329
              P +P+P+       P++DIPESAN+    N    N  PQ+   + +VG++   + L+  
Sbjct  264   -PEQPKPYSATVTGFPSRDIPESANLRLPCNGTDCNAPPQSHQGSILVGLVVSTIALSAI  322

Query  1328  GLFTFSWYRRRKQQIGSTVDISESRVSTDQPKVLCRR-STSPLISLEYSNGWDPLAKDQS  1152
              +  F+ YRRRKQ++ +  ++SE+R++T       R+ S SPL SLEYSNGWDPL+ +++
Sbjct  323   SILLFTHYRRRKQKLSTAYEMSETRLNTLGGGGGFRKNSGSPLASLEYSNGWDPLSDNRN  382

Query  1151  GSALSQEVLESFMFNLDEVESATQYFSETNLLGKSSFSAVYKGTLRDGSAVAVKCISKTS  972
              S  +QEV++SF FNL+EVE+ATQYFSE NLLG+S+FSA YKG LRDGSAVA+K  SKTS
Sbjct  383   LSVFAQEVIQSFRFNLEEVETATQYFSEVNLLGRSNFSATYKGILRDGSAVAIKRFSKTS  442

Query  971   CKSDEAEFRKGLTLLTSLKHENLLRLRGFCCSKGRGECFLIYDFVSNGNLLRYLDVKDEK  792
             CKS+E EF KGL +L SLKHENL++LRGFCCS+GRGECFLIYDF  NGNLL YLD+ D  
Sbjct  443   CKSEEPEFLKGLNMLASLKHENLVKLRGFCCSRGRGECFLIYDFAPNGNLLSYLDLSDGD  502

Query  791   GKVLDWSTRTAIIKGIARGIKYLHGNKRNKPALVHRNISADKVLIDHLYKPLLSDSGLHK  612
               VLDWSTR +I KGIA+GI YLH  K +KPALVH+NISA+KVLID  Y PLLS+SGLH 
Sbjct  503   AHVLDWSTRVSIAKGIAKGIAYLHSYKGSKPALVHQNISAEKVLIDQRYNPLLSNSGLHT  562

Query  611   LLADDIVFSTLKGSAANGYLAPEYAITGRFTEKSDMYAFGVIILQILSGSCVVTQSNHQG  432
             LL +DIVFS LK SAA GYLAPEY  TGRFTEKSD+YAFGV+I QI+SG   VT     G
Sbjct  563   LLTNDIVFSALKDSAAMGYLAPEYTTTGRFTEKSDVYAFGVVIFQIISGKQKVTNLVRLG  622

Query  431   AELCRFEDFVDAKLGKDFVESEAAKLGKIALLCTHDSPSRRPAIDVVIQ  285
              E CRF D++D  L   F E EA KL +IA LCTH+SP  RP+++ V+ 
Sbjct  623   TEACRFHDYIDPNLQGRFFEYEATKLARIAWLCTHESPIERPSVEAVVH  671



>ref|XP_007210306.1| hypothetical protein PRUPE_ppa002356mg [Prunus persica]
 gb|EMJ11505.1| hypothetical protein PRUPE_ppa002356mg [Prunus persica]
Length=682

 Score =   730 bits (1885),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 376/645 (58%), Positives = 475/645 (74%), Gaps = 11/645 (2%)
 Frame = -3

Query  2198  LMAIKASLDPGNLVLSSWSPNVTDPCSVSSFEGIACNDLGQVVNISLQGKGLYGKIPPEI  2019
             LM +K+SLDP + +L SW+    DPCS   FEG+ACN+  +V NISLQGKGLYG++ P +
Sbjct  31    LMKLKSSLDPEDRLLKSWTKE-GDPCS-GLFEGVACNEHRKVANISLQGKGLYGEVSPAV  88

Query  2018  GQLNGLSGLYLHFNNLHGVIPKEIASLTQLSDLYLNMNDLSGFIPSEIGNMPNLQVLQLC  1839
              +L  LSGLYLH+NNL G IPKEI+ LT+L+DLYLN+N+LSG IPSEIG+M +LQVLQLC
Sbjct  89    AELKCLSGLYLHYNNLSGEIPKEISYLTELNDLYLNVNNLSGGIPSEIGDMTSLQVLQLC  148

Query  1838  YNRFEGCIPNKLGSLKNLTVLALQSNQLTGAIPASlggltlltrldLSFNRLFGSIPVKL  1659
              N+  G IP ++G LK L+VLALQ N+LTG IPASLG L +L RLDLSFN+ FG+IP KL
Sbjct  149   CNQLTGNIPTQMGFLKRLSVLALQHNKLTGQIPASLGDLGMLKRLDLSFNKFFGTIPAKL  208

Query  1658  SEASKLEVLDLRNNTLSGNVPLGLKRLNEGFRYENNPGLCGTGFPSLALCSDSSLNPTKP  1479
             +    LEVLD+++N+LSG  PL LKRL E F+ +NNP LCG GF +L  C+   ++    
Sbjct  209   ASVPSLEVLDIQSNSLSGVAPLDLKRLKERFQCKNNPHLCGVGFSTLRACTAFDMDKVNV  268

Query  1478  E--PFGQGSNRLPTKDIPESANIP------HQLNQNRKPQAAAAVVGVIGLFVILAVAGL  1323
             +  P G      P K  P+ A+        H     + PQAA  V GVI L V LA A  
Sbjct  269   DGLPLGPNITDSPPKANPKPADFKAPCSQTHCTKSTKLPQAAV-VAGVISLSVTLAAAVF  327

Query  1322  FTFSWYRRRKQQIGSTVDISESRVSTDQPKVLCRRSTSPLISLEYSNGWDPLAKDQSGSA  1143
                  YRR KQ++ +T D S+ R+STDQ K   R++ SPL+SLEYSNGWDPLA  ++G A
Sbjct  328   LALIRYRRHKQKVSNTSDPSDGRLSTDQAKDFYRKTASPLVSLEYSNGWDPLADGRNGIA  387

Query  1142  LSQEVLESFMFNLDEVESATQYFSETNLLGKSSFSAVYKGTLRDGSAVAVKCISKTSCKS  963
              SQE L  + FN+++VESATQYFSE NLLG+S FS+VYKG LRDGS VAV+ I+ TSCKS
Sbjct  388   FSQEYLSKYWFNMEDVESATQYFSEVNLLGRSKFSSVYKGVLRDGSLVAVRIINVTSCKS  447

Query  962   DEAEFRKGLTLLTSLKHENLLRLRGFCCSKGRGECFLIYDFVSNGNLLRYLDVKDEKGKV  783
             +EAEF KGL LL SL+HEN+++L+GFCCS+GRGECFLIYDF+  GNL +YLDV+DE+ +V
Sbjct  448   EEAEFVKGLDLLFSLRHENVVKLKGFCCSRGRGECFLIYDFIPMGNLSQYLDVEDERNQV  507

Query  782   LDWSTRTAIIKGIARGIKYLHGNKRNKPALVHRNISADKVLIDHLYKPLLSDSGLHKLLA  603
             L+WS R +I+ GIA+GI YLH ++ +KPA++H+NIS +KVLIDH + P +SD GL KLLA
Sbjct  508   LEWSNRVSIVNGIAKGIGYLHSSEADKPAIIHQNISVEKVLIDHHFNPYISDPGLPKLLA  567

Query  602   DDIVFSTLKGSAANGYLAPEYAITGRFTEKSDMYAFGVIILQILSGSCVVTQSNHQGAEL  423
             DD+VFSTLK SAA GYLAPEY  TGRFTEKSD+YAFGVI+LQ+LSG   ++ S    AE 
Sbjct  568   DDVVFSTLKISAAMGYLAPEYITTGRFTEKSDVYAFGVIVLQVLSGKLQLSSSMRLAAEA  627

Query  422   CRFEDFVDAKLGKDFVESEAAKLGKIALLCTHDSPSRRPAIDVVI  288
             CR+E+F+D  L   F+ESEAA L KIAL+CTH+ P  RP +  VI
Sbjct  628   CRYEEFIDTNLKGKFLESEAAALAKIALVCTHELPDHRPTMQEVI  672



>ref|XP_002522411.1| leucine rich repeat receptor kinase, putative [Ricinus communis]
 gb|EEF39903.1| leucine rich repeat receptor kinase, putative [Ricinus communis]
Length=648

 Score =   729 bits (1881),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 394/649 (61%), Positives = 471/649 (73%), Gaps = 40/649 (6%)
 Frame = -3

Query  2210  TVSLLMAIKASLDPGNLVLSSWSPNVTDPCSVSSFEGIACNDLGQVVNISLQGKGLYGKI  2031
             T  L + +   L+P      S S  + DP  +    G+ACN  G V NISLQGKGL G  
Sbjct  24    TTHLTVIMDQKLEP------SISTLIIDPHWM--LWGVACNGQGNVANISLQGKGLSG--  73

Query  2030  PPEIGQLNGLSGLYLHFNNLHGVIPKEIASLTQLSDLYLNMNDLSGFIPSEIGNMPNLQV  1851
                  Q+ G S     F+    +IPKEIA LT+LSDLY N+N+LS  IP +IGNM NLQV
Sbjct  74    -----QITGCSRWAQEFD----LIPKEIAQLTELSDLYPNVNNLSAEIPRQIGNMSNLQV  124

Query  1850  LQLCYNRFEGCIPNKLGSLKNLTVLALQSNQLTGAIPASlggltlltrldLSFNRLFGSI  1671
             LQLCYN+  G IP +LGSL+ L VLALQ NQLT AIPASLG L  LTRLDLSFN LFGS+
Sbjct  125   LQLCYNKLTGSIPTQLGSLRKLNVLALQYNQLTSAIPASLGDLKFLTRLDLSFNGLFGSV  184

Query  1670  PVKLSEASKLEVLDLRNNTLSGNVPLGLKRLNEGFRYENNPGLCGTGFPSLALCSDS-SL  1494
             PVKL+ A  L+VLD+RNN+LSGN+P  L+RL+ GF+Y+NNP +CG GFP+L  C+ S +L
Sbjct  185   PVKLATAPMLQVLDIRNNSLSGNLPAALRRLDNGFQYDNNPDVCGIGFPNLETCTASGNL  244

Query  1493  NPTKPEPFGQGSNRLPTKDIPESANIP------HQLNQNRKPQAAAAVVGVIGLFVILAV  1332
             NP +PEPF    N    +DIPESAN        H  N ++ PQ    + GVIG+F++L +
Sbjct  245   NPNRPEPFK--PNGTLQRDIPESANFTSNCGQTHCSNSSKNPQFGI-IFGVIGVFIVLTI  301

Query  1331  AGLFTFSWYRRRKQQIGSTVDISESRVSTDQPKVLCRRSTSPLISLEYSNGWDPLAKDQS  1152
               +FTF+WY R+KQ+IGS  D S+ R+STDQ K            LEYSNGWDPLA  Q+
Sbjct  302   IVIFTFTWYCRQKQKIGSAFDASDGRLSTDQAK-----------KLEYSNGWDPLAIGQN  350

Query  1151  GSALSQEVLESFMFNLDEVESATQYFSETNLLGKSSFSAVYKGTLRDGSAVAVKCISKTS  972
              + LSQE LESFMFNL+EVE ATQ FSE NLLGKS+F A YKG LRDGS VAVKCI+KTS
Sbjct  351   KNGLSQEFLESFMFNLEEVERATQCFSEVNLLGKSNFCATYKGILRDGSVVAVKCITKTS  410

Query  971   CKSDEAEFRKGLTLLTSLKHENLLRLRGFCCSKGRGECFLIYDFVSNGNLLRYLDVKDEK  792
             CKSDEA+F KGL +LTSLKHENL+RLRGFCCSKGRGECFLIYDFV NGNLL+YLDVK+  
Sbjct  411   CKSDEADFLKGLKILTSLKHENLVRLRGFCCSKGRGECFLIYDFVQNGNLLQYLDVKEGT  470

Query  791   GKVLDWSTRTAIIKGIARGIKYLHGNKRNKPALVHRNISADKVLIDHLYKPLLSDSGLHK  612
              +VL+WSTR +II GIA+GI YLHGNK +K AL H+NISA+KV ID  Y PLLSDSGLHK
Sbjct  471   ERVLEWSTRVSIINGIAKGIGYLHGNKGSKRALFHQNISAEKVFIDIRYNPLLSDSGLHK  530

Query  611   LLADDIVFSTLKGSAANGYLAPEYAITGRFTEKSDMYAFGVIILQILSGSCVVTQSNHQG  432
             LLADDIVFS LK SAA GYLAPEY  TGRFTEKSD+Y+FG+I+LQILSG   +T      
Sbjct  531   LLADDIVFSILKASAAMGYLAPEYTTTGRFTEKSDVYSFGMIVLQILSGKRNITAMILHA  590

Query  431   AELCRFEDFVDAKLGKDFVESEAAKLGKIALLCTHDSPSRRPAIDVVIQ  285
              E C+ E F+DAKL   F E EA +LGK+ALLCTH+SP +RP ++ V++
Sbjct  591   VESCKVELFIDAKLEGKFSELEAIELGKLALLCTHESPDQRPTVETVLR  639



>gb|EYU24994.1| hypothetical protein MIMGU_mgv1a002428mg [Erythranthe guttata]
Length=676

 Score =   730 bits (1884),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 386/657 (59%), Positives = 486/657 (74%), Gaps = 21/657 (3%)
 Frame = -3

Query  2216  ASTVSLLMAIKASLDPGNLVLSSWSPNVTDPCSVSSFEGIACNDLGQVVNISLQGKGLYG  2037
             +S ++ L+ +KASLDP NL L SW  +  DPC   +FEG+ACN+  QV NISLQGKGL G
Sbjct  22    SSELTSLLDLKASLDPENLHLGSWVGS-GDPCG-GTFEGVACNEKRQVANISLQGKGLAG  79

Query  2036  KIPPEIGQLNGLSGLYLHFNNLHGVIPKEIASLTQLSDLYLNMNDLSGFIPSEIGNMPNL  1857
             K+ P +G L  L+GLYLH+N+L+G IP EIA LT+LSDLYLN+N+LSG IP  + +M NL
Sbjct  80    KLSPAVGGLKHLTGLYLHYNSLYGEIPLEIADLTELSDLYLNVNNLSGEIPPALEHMQNL  139

Query  1856  QVLQLCYNRFEGCIPNKLGSLKNLTVLALQSNQLTGAIPASlggltlltrldLSFNRLFG  1677
             QVLQLCYN   G IP +L SL  L VLA+QSNQLTGAIPASLG L +L RLDLSFNRLFG
Sbjct  140   QVLQLCYNHLTGSIPTQLASLTKLNVLAIQSNQLTGAIPASLGDLPVLMRLDLSFNRLFG  199

Query  1676  SIPVKLSEASKLEVLDLRNNTLSGNVPLGLKRLNEGFRYENNPGLCGTGFPSLALCSDSS  1497
             SIP KL++A  LEVLD+RNNTLSGNVPL LKRL +GF YENNP LCG+GF SL  C    
Sbjct  200   SIPTKLADAPLLEVLDVRNNTLSGNVPLALKRLVDGFHYENNPELCGSGFSSLQTCGP--  257

Query  1496  LNPTKPEPFGQGSNRLPTKDIPESANIPHQLNQNRKPQA--------AAAVVGVIGLFVI  1341
              N  +PEP+  GS    TK+IPE+A++   LN ++   +        A+  VG+I + V+
Sbjct  258   -NSERPEPYSGGSMGSTTKNIPETADL--NLNCSQSSCSNKSSKTSQASVAVGIIVITVM  314

Query  1340  LAVAGLFTFSWYRRRKQQIGSTV-DISESRVSTDQP---KVLCRRSTSPLISLEYSNGWD  1173
             ++ A + TFS YRRRKQ++GS   D SESR+STD     +   R++ SPL+SLEYSNGWD
Sbjct  315   VSFAAILTFSIYRRRKQKLGSAAFDASESRLSTDNHVNNETYNRKNGSPLVSLEYSNGWD  374

Query  1172  PLAKDQSG-SALSQEVLESFMFNLDEVESATQYFSETNLLGKSSFSAVYKGTLRDGSAVA  996
             PL+ D+     +S EV+++F  NL EVE+ATQYF++ N+LGKS++S  Y+G LRDGS VA
Sbjct  375   PLSDDRRFLGFVSHEVVKNFRLNLQEVETATQYFADKNILGKSNYSVTYRGNLRDGSVVA  434

Query  995   VKCISKTSCKSDEAEFRKGLTLLTSLKHENLLRLRGFCCSKGRGECFLIYDFVSNGNLLR  816
             VK I+K+SCKS+E+EF KGL +LTSL+HENL+ LRGFCCSKGRGECFL+YDFV NG+LLR
Sbjct  435   VKRITKSSCKSEESEFLKGLNMLTSLRHENLVMLRGFCCSKGRGECFLVYDFVPNGSLLR  494

Query  815   YLDVKDEKGKVLDWSTRTAIIKGIARGIKYLHGNKRNKPALVHRNISADKVLIDHLYKPL  636
             YLD++    ++L WSTR +II GIA+GIKYLH +K NKP+LVH+NISA  VLID    P+
Sbjct  495   YLDLEKGDARILGWSTRVSIINGIAKGIKYLHDSKANKPSLVHQNISAKNVLIDQKSNPV  554

Query  635   LSDSGLHKLLADDIVFSTLKGSAANGYLAPEYAITGRFTEKSDMYAFGVIILQILSGSCV  456
             LSDS LHKLL +D VFS LK SAA GYLAPEY  TGRFTEKSD+YAFGV++ QILSG   
Sbjct  555   LSDSCLHKLLTNDTVFSALKASAAMGYLAPEYTTTGRFTEKSDVYAFGVLVFQILSGRKT  614

Query  455   VTQSNHQGAELCRFEDFVDAKLGKDFVESEAAKLGKIALLCTHDSPSRRPAIDVVIQ  285
              + S    AE+C   DF+D  L  +F E EAA L K+A++CT + P  RP ++ +++
Sbjct  615   YSSSMRASAEMCSL-DFIDGNLFGNFDELEAAMLAKVAVVCTSECPDERPFLETIVE  670



>ref|XP_009362126.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g63930 isoform X1 [Pyrus x bretschneideri]
 ref|XP_009362127.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g63930 isoform X2 [Pyrus x bretschneideri]
Length=682

 Score =   729 bits (1881),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 381/645 (59%), Positives = 469/645 (73%), Gaps = 9/645 (1%)
 Frame = -3

Query  2198  LMAIKASLDPGNLVLSSWSPNVTDPCSVSSFEGIACNDLGQVVNISLQGKGLYGKIPPEI  2019
             LM +KASLDP   VL SW+    DPCS  SFEG+ACN+  +V N+SL GKGL G++ P +
Sbjct  31    LMELKASLDPEGRVLKSWTKE-GDPCS-GSFEGVACNEHRKVANVSLVGKGLSGRVSPAV  88

Query  2018  GQLNGLSGLYLHFNNLHGVIPKEIASLTQLSDLYLNMNDLSGFIPSEIGNMPNLQVLQLC  1839
              +L  LSGLYLH+N+L G IPKEI+ LT+L+DLYLN+N+L+G IPSEIGNM +LQVLQLC
Sbjct  89    AKLKCLSGLYLHYNSLSGEIPKEISYLTELTDLYLNVNNLTGGIPSEIGNMTSLQVLQLC  148

Query  1838  YNRFEGCIPNKLGSLKNLTVLALQSNQLTGAIPASlggltlltrldLSFNRLFGSIPVKL  1659
              N+  G IP ++GSLK L+V+ALQ N+LTG IPASLG L +L RLDLSFN+ FG+IP KL
Sbjct  149   CNQLTGNIPTQMGSLKRLSVIALQHNKLTGQIPASLGNLGVLKRLDLSFNKFFGTIPAKL  208

Query  1658  SEASKLEVLDLRNNTLSGNVPLGLKRLNEGFRYENNPGLCGTGFPSLALCSDSSLNPTKP  1479
             ++   LE LD+R+N+LSG  PL LKRL EGF+ ENNP LCG GF  L  C+   ++    
Sbjct  209   ADIPSLEALDIRSNSLSGVAPLALKRLKEGFQCENNPTLCGVGFSKLRACTPFDMDNVNV  268

Query  1478  E--PFGQGSNRLPTKDIPESANIPHQLNQNR-----KPQAAAAVVGVIGLFVILAVAGLF  1320
                P G        K  PES +     NQ       K   AA V GVI L V LA A   
Sbjct  269   HGLPLGPNITDSTPKANPESVDFQASCNQTHCRKSTKFPKAAVVAGVIALSVTLAGAVFL  328

Query  1319  TFSWYRRRKQQIGSTVDISESRVSTDQPKVLCRRSTSPLISLEYSNGWDPLAKDQSGSAL  1140
                 YR+RKQ+IG+T D S+ R+STDQ +   RRS SPL+SLEY+NGWDPLA  ++G  L
Sbjct  329   ALIRYRQRKQKIGNTSDPSDGRLSTDQARDFYRRSPSPLVSLEYANGWDPLADGRNGIGL  388

Query  1139  SQEVLESFMFNLDEVESATQYFSETNLLGKSSFSAVYKGTLRDGSAVAVKCISKTSCKSD  960
             SQE L  + FN+++VESATQYFSE NLLG+S FS+VYKG LRDGS VAV+ I+ TSCKS+
Sbjct  389   SQEYLNKYWFNMEDVESATQYFSEVNLLGRSKFSSVYKGVLRDGSLVAVRSINVTSCKSE  448

Query  959   EAEFRKGLTLLTSLKHENLLRLRGFCCSKGRGECFLIYDFVSNGNLLRYLDVKDEKGKVL  780
             E+EF KGL LL SL+HEN+++L+GFCCS+GRGECFLIYDF+  GNL +YLDV D   KVL
Sbjct  449   ESEFLKGLELLFSLRHENIVKLKGFCCSRGRGECFLIYDFIPKGNLSQYLDVGDGTNKVL  508

Query  779   DWSTRTAIIKGIARGIKYLHGNKRNKPALVHRNISADKVLIDHLYKPLLSDSGLHKLLAD  600
             +WS R AII GIA+GI YLH ++  KP ++H+NIS +KVL+D    PL+ DSGL KLLAD
Sbjct  509   EWSKRVAIINGIAKGIGYLHSSEATKPGIIHQNISVEKVLLDQQSNPLILDSGLPKLLAD  568

Query  599   DIVFSTLKGSAANGYLAPEYAITGRFTEKSDMYAFGVIILQILSGSCVVTQSNHQGAELC  420
             D+VFSTLK SAA GYLAPEY  TGRFTEKSD+YAFGVIILQ++SG   ++ S    AE C
Sbjct  569   DVVFSTLKTSAAMGYLAPEYITTGRFTEKSDIYAFGVIILQVISGRLQLSSSMRSAAESC  628

Query  419   RFEDFVDAKLGKDFVESEAAKLGKIALLCTHDSPSRRPAIDVVIQ  285
             RFE+FVDA L  +F E EAA L KIAL+CTH+ P  RP ++ VIQ
Sbjct  629   RFEEFVDANLKGNFSEPEAAALAKIALVCTHELPDNRPTMEQVIQ  673



>ref|XP_004300723.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g63930-like [Fragaria vesca subsp. vesca]
Length=687

 Score =   728 bits (1878),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 383/652 (59%), Positives = 471/652 (72%), Gaps = 18/652 (3%)
 Frame = -3

Query  2198  LMAIKASLDPGNLVLSSWSPNVTDPCSVSSFEGIACNDLGQVVNISLQGKGLYGKIPPEI  2019
             L+ +KASLDP    LSSW+ +  DPCS  +FEG+ACN+  +V N+SLQGKGL G++ P +
Sbjct  31    LLQLKASLDPEGKYLSSWTED-GDPCS-GTFEGVACNEHSKVANVSLQGKGLSGQVSPAV  88

Query  2018  GQLNGLSGLYLHFNNLHGVIPKEIASLTQLSDLYLNMNDLSGFIPSEIGNMPNLQVLQLC  1839
              +L  LSGLYLH+NNL G IPKEI +LT+L+DLYLN+N LSG IP EIGNM +LQVLQLC
Sbjct  89    AELRCLSGLYLHYNNLSGEIPKEIGALTELTDLYLNVNSLSGGIPHEIGNMTSLQVLQLC  148

Query  1838  YNRFEGCIPNKLGSLKNLTVLALQSNQLTGAIPASlggltlltrldLSFNRLFGSIPVKL  1659
              N+  G IP ++GSL  L+VLALQ N++TG IPASLG L +L RLDL FN+ FG+IP KL
Sbjct  149   CNQLNGSIPTQMGSLTRLSVLALQYNRITGQIPASLGNLGMLKRLDLGFNKFFGTIPAKL  208

Query  1658  SEASKLEVLDLRNNTLSGNVPLGLKRLNEGFRYENNPGLCGTGFPSLALCSDSSLN----  1491
             +    LEVLD+RNN+LSG V    KRLNEGF   NNPGLCG GF +L  C+   ++    
Sbjct  209   ASIPSLEVLDVRNNSLSGVVSPAFKRLNEGFESANNPGLCGVGFSTLRACTAFDMDRVNV  268

Query  1490  ---PTKPEPFGQGSNRLPTKDIPESANIPHQLNQN-----RKPQAAAAVVGVIGLFVILA  1335
                P  P   G  S   P K  PES +I     QN     + PQAA  + GVI L + L+
Sbjct  269   DGLPLGPNLNGTASTA-PPKANPESVDINAHCKQNCTKSTKFPQAAV-IAGVISLTITLS  326

Query  1334  VAGLFTFSWYRRRKQQIGSTVDISESRVSTDQPKVLCRRSTSPLISLEYSNGWDPLAKDQ  1155
             V       W RR+KQ+IG+T D S+ ++STDQ K   RRS SPL+SLEYSN WDPLA  Q
Sbjct  327   VGVFLALVWNRRKKQKIGNTSDPSDGQLSTDQAKEFYRRSPSPLVSLEYSNAWDPLADGQ  386

Query  1154  SG--SALSQEVLESFMFNLDEVESATQYFSETNLLGKSSFSAVYKGTLRDGSAVAVKCIS  981
             +G   + SQE L+ + FN+++VESATQYFSE NLLGKS FS+VYKG LRDGS VAVK I+
Sbjct  387   NGLGFSFSQEYLKGYWFNMEDVESATQYFSEVNLLGKSKFSSVYKGVLRDGSLVAVKSIN  446

Query  980   KTSCKSDEAEFRKGLTLLTSLKHENLLRLRGFCCSKGRGECFLIYDFVSNGNLLRYLDVK  801
              TSCKS+EAEF KGL LL SL HENL++L+GFCCS+GRGECFLIYD+V NG L +YLDV 
Sbjct  447   VTSCKSEEAEFVKGLHLLFSLSHENLVKLKGFCCSRGRGECFLIYDYVPNGRLSQYLDVI  506

Query  800   DEKGKVLDWSTRTAIIKGIARGIKYLHGNKRNKPALVHRNISADKVLIDHLYKPLLSDSG  621
             D K +VL+WS R +I+ GIA+GI YLH    NKPA++H+NIS +KVLID  ++PL+SDSG
Sbjct  507   DGKNQVLEWSKRVSILNGIAKGIGYLHSRVENKPAMIHQNISVEKVLIDQQFRPLISDSG  566

Query  620   LHKLLADDIVFSTLKGSAANGYLAPEYAITGRFTEKSDMYAFGVIILQILSGSCVVTQSN  441
             L KLLADDIVFSTLK SAA GYLAPEY  TGRFTEKSD+YAFGVI+LQ++SG+  +  S 
Sbjct  567   LPKLLADDIVFSTLKTSAAMGYLAPEYITTGRFTEKSDVYAFGVIVLQVISGNLQLNTSM  626

Query  440   HQGAELCRFEDFVDAKLGKDFVESEAAKLGKIALLCTHDSPSRRPAIDVVIQ  285
                AE  R+E+FVD  L   F E EAA LGK+ L+ TH+ P +RP +  VIQ
Sbjct  627   KLAAESSRYEEFVDTNLKGQFSEPEAAALGKLGLISTHELPDQRPTMQTVIQ  678



>ref|XP_008345369.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g63930 [Malus domestica]
Length=682

 Score =   726 bits (1875),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 377/645 (58%), Positives = 467/645 (72%), Gaps = 9/645 (1%)
 Frame = -3

Query  2198  LMAIKASLDPGNLVLSSWSPNVTDPCSVSSFEGIACNDLGQVVNISLQGKGLYGKIPPEI  2019
             LM +KASLDP   VL SW+    DPCS  SFEG+ACN+  +V N+SL GKGL G++ P +
Sbjct  31    LMELKASLDPEGRVLKSWTKE-GDPCS-GSFEGVACNEHRKVANVSLVGKGLSGRVSPAV  88

Query  2018  GQLNGLSGLYLHFNNLHGVIPKEIASLTQLSDLYLNMNDLSGFIPSEIGNMPNLQVLQLC  1839
              +L  LSGLYLH+NNL G IPKEI+ LT+L+DLYLN+N+L+G +PSEIGNM +LQVLQLC
Sbjct  89    AELKCLSGLYLHYNNLSGEIPKEISYLTELTDLYLNINNLTGGVPSEIGNMTSLQVLQLC  148

Query  1838  YNRFEGCIPNKLGSLKNLTVLALQSNQLTGAIPASlggltlltrldLSFNRLFGSIPVKL  1659
              N+  G IP ++GSLK L+V+ALQ N+LTG IPASLG L +L RLDLSFN+ FG+IP KL
Sbjct  149   CNQLTGNIPTQMGSLKRLSVIALQYNKLTGQIPASLGNLGVLKRLDLSFNKFFGTIPAKL  208

Query  1658  SEASKLEVLDLRNNTLSGNVPLGLKRLNEGFRYENNPGLCGTGFPSLALCSDSSLNPTKP  1479
             ++   LEVLD+R+N+LSG  P  LKRL EGF+ ENNP LCG GF  L  C+   ++    
Sbjct  209   ADIPSLEVLDIRSNSLSGVAPHALKRLKEGFQCENNPRLCGVGFSKLRACTSFDMDNVNA  268

Query  1478  E--PFGQGSNRLPTKDIPESANIPHQLNQNR-----KPQAAAAVVGVIGLFVILAVAGLF  1320
                P G        K  PES ++    NQ       K    A V GVI L V LA A   
Sbjct  269   HGLPLGPNITDSTPKANPESVDVQASCNQTHCRKSTKFPKGAVVAGVIALSVTLAGAVFL  328

Query  1319  TFSWYRRRKQQIGSTVDISESRVSTDQPKVLCRRSTSPLISLEYSNGWDPLAKDQSGSAL  1140
                 YR+RKQ+IG+T D S+ R+STDQ +   RRS SPL+SLEY+NGWDPLA  ++G  L
Sbjct  329   ALIRYRQRKQKIGNTSDPSDGRLSTDQARDFYRRSPSPLVSLEYANGWDPLADGRNGIGL  388

Query  1139  SQEVLESFMFNLDEVESATQYFSETNLLGKSSFSAVYKGTLRDGSAVAVKCISKTSCKSD  960
             SQE L  + FN+++VESATQYFSE NLLG+S FS+VYKG LRDGS VAV+ ++ TSCKS+
Sbjct  389   SQEYLNKYWFNMEDVESATQYFSEVNLLGRSKFSSVYKGVLRDGSLVAVRSVNVTSCKSE  448

Query  959   EAEFRKGLTLLTSLKHENLLRLRGFCCSKGRGECFLIYDFVSNGNLLRYLDVKDEKGKVL  780
             E+EF KGL LL SL+HEN+++L+GFCCS+GRGECFLIYDF+  GNL RYLDV D   +VL
Sbjct  449   ESEFLKGLELLFSLRHENIVKLKGFCCSRGRGECFLIYDFIPKGNLSRYLDVGDGTNEVL  508

Query  779   DWSTRTAIIKGIARGIKYLHGNKRNKPALVHRNISADKVLIDHLYKPLLSDSGLHKLLAD  600
             +WS R AI+ GI++GI YLH ++  KP ++H+NIS DKVL+D    PL+ DSGL KLLAD
Sbjct  509   EWSKRVAIVNGISKGIGYLHSSEATKPGIIHQNISVDKVLLDQQSNPLILDSGLPKLLAD  568

Query  599   DIVFSTLKGSAANGYLAPEYAITGRFTEKSDMYAFGVIILQILSGSCVVTQSNHQGAELC  420
             D+VFSTLK SAA GYLAPEY  TGRFTEKSD+YAFGVIILQ++SG   ++ S    AE C
Sbjct  569   DVVFSTLKTSAAMGYLAPEYITTGRFTEKSDIYAFGVIILQVISGKLQLSSSMRSAAESC  628

Query  419   RFEDFVDAKLGKDFVESEAAKLGKIALLCTHDSPSRRPAIDVVIQ  285
             R+E+FVDA L   F E EAA L KIAL+CTH+ P  RP +  VIQ
Sbjct  629   RYEEFVDANLKGKFSEPEAAALAKIALVCTHELPDNRPTMAEVIQ  673



>ref|XP_010518150.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g34110 isoform X1 [Camelina sativa]
 ref|XP_010518151.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g34110 isoform X2 [Camelina sativa]
Length=690

 Score =   726 bits (1874),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 392/659 (59%), Positives = 490/659 (74%), Gaps = 21/659 (3%)
 Frame = -3

Query  2207  VSLLMAIKASLDPGNLVLSSWSPNVTDPCSVSSFEGIACNDLGQVVNISLQGKGLYGKIP  2028
             + +L+ IK+SLDP    L+SW+P+  DPCS+ SF+G+AC+   +V NISLQG GL G IP
Sbjct  26    LDILLDIKSSLDPQKRFLTSWTPDA-DPCSLGSFDGVACDGNHRVANISLQGMGLTGTIP  84

Query  2027  PEIGQLNGLSGLYLHFNNLHGVIPKEIASLTQLSDLYLNMNDLSGFIPSEIGNMPNLQVL  1848
             P IG L  L+GLYLHFN+L G IPK I++L  L+DLYLN+N+LSG IP +IGN+ NLQV+
Sbjct  85    PSIGLLTSLTGLYLHFNSLTGQIPKAISNLPLLTDLYLNVNNLSGEIPPQIGNLDNLQVV  144

Query  1847  QLCYNRFEGCIPNKLGSLKNLTVLALQSNQLTGAIPASlggltlltrldLSFNRLFGSIP  1668
             QLCYN+  G IP +LGSLK +TVLALQ NQL+GAIPASLG +  LTRLDLSFN LFG +P
Sbjct  145   QLCYNKLSGSIPTQLGSLKKVTVLALQYNQLSGAIPASLGDINTLTRLDLSFNHLFGPVP  204

Query  1667  VKLSEASKLEVLDLRNNTLSGNVPLGLKRLNEGFRYENNPGLCGTGFPSLALCSD-SSLN  1491
             VKL+ A  LEVLD+RNN+ SG VP  LKRLN GF+Y NN GLCG GF  L  C+  +  N
Sbjct  205   VKLAGAPLLEVLDIRNNSFSGFVPSALKRLNNGFQYSNNHGLCGDGFTDLKACTGLNGPN  264

Query  1490  PTKPEPFGQGSNRLPTKDI-PESANIPHQLNQNR---------KPQAAAAVVGVIGLFVI  1341
               +P+P         T D+ PESA++      N          K      V+G+ G  + 
Sbjct  265   LDRPDP--TNPKNFTTVDVKPESADLQRSNCSNNNGGCSSKTSKSSPFGIVMGLTGSILA  322

Query  1340  LAVAGLFTFSWYRRRKQQIGSTVDISESRVSTDQ--PKVLCRRSTSPLISLEYSNGWDPL  1167
             +A+ G  TF+WYRRRKQ+IGS++D  + R+ST+    +   R+S+SPLISLEY++GWDPL
Sbjct  323   VAIFGGSTFTWYRRRKQKIGSSLDAMDGRISTEYNFKEASRRKSSSPLISLEYASGWDPL  382

Query  1166  AKDQSG---SALSQEVLESFMFNLDEVESATQYFSETNLLGKSSFSAVYKGTLRDGSAVA  996
              + Q+    SALSQEV ESFMFNL+E+E ATQ FSE NLLGKS+ S+VYKG LRDGS  A
Sbjct  383   GRGQNSNNNSALSQEVFESFMFNLEEIERATQSFSEVNLLGKSNVSSVYKGILRDGSVAA  442

Query  995   VKCISKTSCKSDEAEFRKGLTLLTSLKHENLLRLRGFCCSKGRGECFLIYDFVSNGNLLR  816
             VKCI+K+SCKSDE EF KGL +LT LKHENL+RLRGFCCSKGRGECFLIY+FV NGNLL+
Sbjct  443   VKCIAKSSCKSDETEFLKGLKMLTLLKHENLVRLRGFCCSKGRGECFLIYEFVPNGNLLQ  502

Query  815   YLDVKDEKGKVLDWSTRTAIIKGIARGIKYLHGNKRNKPALVHRNISADKVLIDHLYKPL  636
             YLDVKDE  +VL+W+TR +II GIARGI YLHG   NKPA+VH+N+SA+K+LIDH Y P 
Sbjct  503   YLDVKDETAEVLEWTTRVSIINGIARGIVYLHGENGNKPAIVHQNLSAEKILIDHWYNPS  562

Query  635   LSDSGLHKLLADDIVFSTLKGSAANGYLAPEYAITGRFTEKSDMYAFGVIILQILSGSCV  456
             L+DSGLHKL  DDIVFS LK SAA GYLAPEY  TGRFT+KSD+YAFG+I+LQILSG   
Sbjct  563   LADSGLHKLFTDDIVFSKLKASAAMGYLAPEYITTGRFTDKSDVYAFGMILLQILSGKSK  622

Query  455   VTQ-SNHQGAELCRF-EDFVDAKLGKDFVESEAAKLGKIALLCTHDSPSRRPAIDVVIQ  285
             ++     Q  E  R  EDF+D  L ++F E+EAA L +++LLCTH+S ++RP+++ V+Q
Sbjct  623   ISHLMILQAVESGRLNEDFMDPNLRRNFPEAEAALLARLSLLCTHESSNQRPSMEDVMQ  681



>ref|XP_004495431.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g63930-like [Cicer arietinum]
Length=676

 Score =   725 bits (1872),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 379/648 (58%), Positives = 477/648 (74%), Gaps = 25/648 (4%)
 Frame = -3

Query  2198  LMAIKASLDPGNLVLSSWSPNVTDPCSVSSFEGIACNDLGQVVNISLQGKGLYGKIPPEI  2019
             LM IKASLDP N  L SW+ N  +PC   SFEG+ACN  GQV NISLQGKGL GK+ P I
Sbjct  35    LMEIKASLDPNNHFLHSWTIN-GNPCD-GSFEGVACNKEGQVANISLQGKGLSGKLSPTI  92

Query  2018  GQLNGLSGLYLHFNNLHGVIPKEIASLTQLSDLYLNMNDLSGFIPSEIGNMPNLQVLQLC  1839
               L  L+GLYLH+N+L+G IP+EI++LTQL +LYLN+N LSG IP EIG+M +LQVLQLC
Sbjct  93    VALKHLTGLYLHYNSLNGEIPREISNLTQLGELYLNVNHLSGEIPPEIGSMESLQVLQLC  152

Query  1838  YNRFEGCIPNKLGSLKNLTVLALQSNQLTGAIPASlggltlltrldLSFNRLFGSIPVKL  1659
             YN+  G IP +LG+LK L+V+ALQSNQLTGAIPASLG L +L RLDLS N LFGSIP  L
Sbjct  153   YNQLTGSIPAQLGALKKLSVVALQSNQLTGAIPASLGDLGMLVRLDLSSNNLFGSIPTGL  212

Query  1658  SEASKLEVLDLRNNTLSGNVPLGLKRLNEGFRYENNPGLCGTGFPSLALCSDSSLNPTKP  1479
             +  S L+VLD+ NN+LSGNVP  LKRLN+GF Y++N GLCG GFP L  C+ S       
Sbjct  213   ASVSSLKVLDVHNNSLSGNVPPALKRLNDGFLYKHNLGLCGVGFPFLKTCNTSK------  266

Query  1478  EPFGQGSNRLPTKDIPESANIPHQLNQ------NRKPQAAAAVVGVIGLFVILAVAGLFT  1317
                    +  PT++IPE+AN+    N+      ++  QA    +GV  + + +    + T
Sbjct  267   -------DGAPTRNIPETANVKLPCNETQCFHSSKSNQATPITLGVSVVIIAVLAIVILT  319

Query  1316  FSWY-RRRKQQIGSTVDISESRVSTDQPKVLCRRSTSPLISLEYSNGWDPLAKDQSGSAL  1140
             F+ Y RRRKQ++G++  I +SR STD+ KV+ R+S SPL SLEY+ GWDPLA  ++ +  
Sbjct  320   FTLYMRRRKQKLGNSTHILDSRPSTDEAKVIYRKSGSPLASLEYTTGWDPLAYYRNFNVE  379

Query  1139  SQEV---LESFMFNLDEVESATQYFSETNLLGKSSFSAVYKGTLRDGSAVAVKCISKTSC  969
             +QE      +F FNL+EVESATQ+FS++NLLGKS+F A YKG LRDGS VAVK ISKTSC
Sbjct  380   NQEAQDRFHNFRFNLEEVESATQHFSDSNLLGKSNFCATYKGVLRDGSVVAVKSISKTSC  439

Query  968   KSDEAEFRKGLTLLTSLKHENLLRLRGFCCSKGRGECFLIYDFVSNGNLLRYLDVKDEKG  789
             KSDE EF KGL +L S+++ NL+RLRGFCCS+ RGECFLIYDFV NGNL R+LD  +  G
Sbjct  440   KSDEVEFLKGLNILASMRNNNLVRLRGFCCSRERGECFLIYDFVPNGNLSRFLDKTENDG  499

Query  788   KVLDWSTRTAIIKGIARGIKYLHGNKRNKPALVHRNISADKVLIDHLYKPLLSDSGLHKL  609
             +VL+WSTR +I+KGIA+G+ YLH  K NKP +VH+NISA+K+LID  Y PLL DSGL+KL
Sbjct  500   EVLEWSTRVSIVKGIAKGMAYLHSYKPNKPVIVHQNISAEKILIDQRYNPLLDDSGLYKL  559

Query  608   LADDIVFSTLKGSAANGYLAPEYAITGRFTEKSDMYAFGVIILQILSGSCVVTQSNHQGA  429
             L +DIVFS LKGSAA GYLAPEY  TGRF E SD+YAFGV++ QILSG  V+T S    A
Sbjct  560   LTNDIVFSALKGSAAKGYLAPEYITTGRFAEASDVYAFGVVLFQILSGKKVITNSIRHAA  619

Query  428   ELCRFEDFVDAKLGKDFVESEAAKLGKIALLCTHDSPSRRPAIDVVIQ  285
             E  +F++F+D  +   F E EAAKL KIALLCTH+SP  RP+++ +++
Sbjct  620   ESLKFKEFIDQNVDGRFFEYEAAKLAKIALLCTHESPFERPSMEAIVK  667



>ref|XP_010506476.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g34110 [Camelina sativa]
Length=690

 Score =   726 bits (1873),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 392/662 (59%), Positives = 492/662 (74%), Gaps = 21/662 (3%)
 Frame = -3

Query  2216  ASTVSLLMAIKASLDPGNLVLSSWSPNVTDPCSVSSFEGIACNDLGQVVNISLQGKGLYG  2037
             +S + +L+ IK+SLDP    L+SW+P+  DPCS  SF+G+AC+   +V NISLQG GL G
Sbjct  23    SSELDILLDIKSSLDPQKRFLTSWTPDA-DPCSPGSFDGVACDGNHRVANISLQGMGLTG  81

Query  2036  KIPPEIGQLNGLSGLYLHFNNLHGVIPKEIASLTQLSDLYLNMNDLSGFIPSEIGNMPNL  1857
              IPP IG L  L+GLYLHFN+L G IPK I++L  L+DLYLN+N+LSG IP ++GN+ NL
Sbjct  82    TIPPSIGLLTSLTGLYLHFNSLTGQIPKAISNLPLLTDLYLNVNNLSGEIPPQVGNLDNL  141

Query  1856  QVLQLCYNRFEGCIPNKLGSLKNLTVLALQSNQLTGAIPASlggltlltrldLSFNRLFG  1677
             QV+QLCYN+  G IP +LGSLK +TVLALQ NQL+GAIPASLG +  LTRLDLSFN LFG
Sbjct  142   QVVQLCYNKLSGSIPTQLGSLKKVTVLALQYNQLSGAIPASLGDINTLTRLDLSFNHLFG  201

Query  1676  SIPVKLSEASKLEVLDLRNNTLSGNVPLGLKRLNEGFRYENNPGLCGTGFPSLALCSD-S  1500
              +PVKL+ A  LEVL++RNN+ SG VP  LKRLN GF+Y NN GLCG GF  L  C+  +
Sbjct  202   PVPVKLAGAPLLEVLNIRNNSFSGFVPSALKRLNNGFQYSNNHGLCGDGFTDLKACTGLN  261

Query  1499  SLNPTKPEPFGQGSNRLPTKDI-PESANIPHQLNQNRK---------PQAAAAVVGVIGL  1350
               N  +P+P         T D+ PESA++      N              +  V+G+IG 
Sbjct  262   GPNLDRPDP--TNPKNFTTVDVKPESADLQRSNCSNNNGGCSSKASKSSPSGIVMGLIGS  319

Query  1349  FVILAVAGLFTFSWYRRRKQQIGSTVDISESRVSTDQ--PKVLCRRSTSPLISLEYSNGW  1176
              + +A+ G  TF+WYRRRKQ+IGS++D  + R+ST+    +   R+S+SPLISLEY++GW
Sbjct  320   ILAVAIFGGSTFTWYRRRKQKIGSSLDAMDGRISTEYNFKEASRRKSSSPLISLEYASGW  379

Query  1175  DPLAKDQSG---SALSQEVLESFMFNLDEVESATQYFSETNLLGKSSFSAVYKGTLRDGS  1005
             DPL + Q+    SALSQEV ESFMFNL+E+E ATQ FSE NLLGKS+ S+VYKG LRDGS
Sbjct  380   DPLGRGQNSNNNSALSQEVFESFMFNLEEIERATQSFSEVNLLGKSNVSSVYKGILRDGS  439

Query  1004  AVAVKCISKTSCKSDEAEFRKGLTLLTSLKHENLLRLRGFCCSKGRGECFLIYDFVSNGN  825
               AVKCI+K+SCKSDE EF KGL +LT LKHENL+RLRGFCCSKGRGECFLIY+FV NGN
Sbjct  440   VAAVKCIAKSSCKSDETEFLKGLKMLTLLKHENLVRLRGFCCSKGRGECFLIYEFVPNGN  499

Query  824   LLRYLDVKDEKGKVLDWSTRTAIIKGIARGIKYLHGNKRNKPALVHRNISADKVLIDHLY  645
             LL+YLDVKDE G+VL+W+TR +II GIARGI YLHG   NKPA+VH+N+SA+K+LIDH Y
Sbjct  500   LLQYLDVKDETGEVLEWTTRVSIINGIARGIVYLHGENGNKPAIVHQNLSAEKILIDHWY  559

Query  644   KPLLSDSGLHKLLADDIVFSTLKGSAANGYLAPEYAITGRFTEKSDMYAFGVIILQILSG  465
              P L+DSGLHKL  DDIVFS LK SAA GYLAPEY  TGRFT+KSD+YAFG+I+LQILSG
Sbjct  560   NPSLADSGLHKLFTDDIVFSKLKASAAMGYLAPEYITTGRFTDKSDVYAFGMILLQILSG  619

Query  464   SCVVTQ-SNHQGAELCRF-EDFVDAKLGKDFVESEAAKLGKIALLCTHDSPSRRPAIDVV  291
                ++     Q  E  R  EDF+D  L ++F E+EAA L ++ LLCTH+S ++RP+++ V
Sbjct  620   KSKISHLMILQAVESGRLNEDFMDPNLRRNFPEAEAALLARLGLLCTHESSNQRPSMEDV  679

Query  290   IQ  285
             +Q
Sbjct  680   MQ  681



>ref|XP_006401961.1| hypothetical protein EUTSA_v10012874mg [Eutrema salsugineum]
 gb|ESQ43414.1| hypothetical protein EUTSA_v10012874mg [Eutrema salsugineum]
Length=676

 Score =   724 bits (1870),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 380/648 (59%), Positives = 468/648 (72%), Gaps = 12/648 (2%)
 Frame = -3

Query  2213  STVSLLMAIKASLDPGNLVLSSWSPNVTDPCSVSSFEGIACNDLGQVVNISLQGKGLYGK  2034
             S +  LM IK  LDP N  L+SWS N  D C   SFEG+ C+  GQV NISLQGKGL GK
Sbjct  27    SELRTLMEIKKELDPENKHLASWSIN-EDLCK--SFEGVGCDWKGQVSNISLQGKGLSGK  83

Query  2033  IPPEIGQLNGLSGLYLHFNNLHGVIPKEIASLTQLSDLYLNMNDLSGFIPSEIGNMPNLQ  1854
             I P I +L  L+GL+LH+N L G IP+EI +L++L+DLYLN+N+LSG IPS IG M +LQ
Sbjct  84    ISPAIAELKHLTGLFLHYNALVGDIPREIGNLSELTDLYLNVNNLSGEIPSHIGKMESLQ  143

Query  1853  VLQLCYNRFEGCIPNKLGSLKNLTVLALQSNQLTGAIPASlggltlltrldLSFNRLFGS  1674
             VLQLCYN   G IP +LGSLK L+VLALQSN+LTGAIPASLG L  L RLDLS+N LFGS
Sbjct  144   VLQLCYNNLTGSIPGELGSLKKLSVLALQSNKLTGAIPASLGDLNALERLDLSYNHLFGS  203

Query  1673  IPVKLSEASKLEVLDLRNNTLSGNVPLGLKRLNEGFRYENNPGLCGTGFPSLALCSDSSL  1494
             +P KL+    L VLD+RNN+LSGNVP  LKRL+EGF +ENN GLCG  F  L  C+ ++ 
Sbjct  204   VPGKLAGPPLLRVLDIRNNSLSGNVPPVLKRLSEGFSFENNLGLCGAEFTPLKSCNGTA-  262

Query  1493  NPTKPEPFGQGSNRLPTKDIPESANIPH-----QLNQNRKPQAAAAVVGVIGLFVILAVA  1329
              P +P+P+       P++DIPESAN+         N        + ++G++   + L+  
Sbjct  263   -PEQPKPYSATVTGFPSRDIPESANLRSPCNGTDCNAPSNSHQGSILIGLVVSTIALSAI  321

Query  1328  GLFTFSWYRRRKQQIGSTVDISESRVSTDQPKVLCRRSTSPLISLEYSNGWDPLAKDQSG  1149
              +  F+ YRRRKQ++ +  ++SE  ++T       + S SPL SLEY+NGWDPL+ +++ 
Sbjct  322   SILLFTHYRRRKQKLSTAYEMSEPGLNTRGG--FRKNSGSPLASLEYTNGWDPLSDNRNL  379

Query  1148  SALSQEVLESFMFNLDEVESATQYFSETNLLGKSSFSAVYKGTLRDGSAVAVKCISKTSC  969
             S  +QEV++SF FNL+EVE+ATQYFSE NLLG+S+FSA YKG LRDGSAVA+K  SKTSC
Sbjct  380   SVFAQEVIQSFRFNLEEVETATQYFSEVNLLGRSNFSATYKGILRDGSAVAIKQFSKTSC  439

Query  968   KSDEAEFRKGLTLLTSLKHENLLRLRGFCCSKGRGECFLIYDFVSNGNLLRYLDVKDEKG  789
             KS+E EF KGL +L SLKHENL RLRGFCCS+GRGECFLIYDF  NGNLL YLD+KD   
Sbjct  440   KSEEPEFLKGLNMLASLKHENLARLRGFCCSRGRGECFLIYDFAPNGNLLSYLDLKDSDA  499

Query  788   KVLDWSTRTAIIKGIARGIKYLHGNKRNKPALVHRNISADKVLIDHLYKPLLSDSGLHKL  609
              VLDWSTR +I KGIA+GI YLH  K NKPALVH+NISA+KVLID  Y PLLS+SGLH L
Sbjct  500   HVLDWSTRVSIAKGIAKGIAYLHSYKGNKPALVHQNISAEKVLIDQRYNPLLSNSGLHTL  559

Query  608   LADDIVFSTLKGSAANGYLAPEYAITGRFTEKSDMYAFGVIILQILSGSCVVTQSNHQGA  429
             L +DIVFS +K SAA GYLAPEY  TGRFTEKSD+YAFGV++ QI+SG   V      G 
Sbjct  560   LTNDIVFSGVKDSAAMGYLAPEYTTTGRFTEKSDVYAFGVLVFQIISGKQKVRNLVKLGT  619

Query  428   ELCRFEDFVDAKLGKDFVESEAAKLGKIALLCTHDSPSRRPAIDVVIQ  285
             E CRF D++D  L   F E EA KL +IA LCTH+SP  RP+++ V+ 
Sbjct  620   EACRFHDYIDPNLQGRFFEYEATKLARIAWLCTHESPIERPSVEAVVH  667



>ref|XP_007039978.1| Leucine-rich repeat protein kinase family protein [Theobroma 
cacao]
 gb|EOY24479.1| Leucine-rich repeat protein kinase family protein [Theobroma 
cacao]
Length=683

 Score =   722 bits (1864),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 377/651 (58%), Positives = 478/651 (73%), Gaps = 11/651 (2%)
 Frame = -3

Query  2213  STVSLLMAIKASLDPGNLVLSSWSPNVTDPCSVSSFEGIACNDLGQVVNISLQGKGLYGK  2034
             + V  LM +KASLDP N+VL SW  +  DPC   SF G+ACN+  +V NISLQGKGL GK
Sbjct  27    TEVRALMELKASLDPTNMVLESWKSD-GDPCG-GSFVGVACNEHRKVANISLQGKGLSGK  84

Query  2033  IPPEIGQLNGLSGLYLHFNNLHGVIPKEIASLTQLSDLYLNMNDLSGFIPSEIGNMPNLQ  1854
             + P +  L  LSGLYLH+N+L G IPKE+++L +L+DLYLN+N+LSG IP EIGNM +LQ
Sbjct  85    VSPAVAGLKCLSGLYLHYNSLSGEIPKELSNLRELTDLYLNVNNLSGSIPPEIGNMADLQ  144

Query  1853  VLQLCYNRFEGCIPNKLGSLKNLTVLALQSNQLTGAIPASlggltlltrldLSFNRLFGS  1674
             VLQLC N+  G IP ++GSLK L+VLALQ N+L G IPAS+G L +L RLDLS+NRL G+
Sbjct  145   VLQLCCNQLTGNIPTEIGSLKKLSVLALQYNRLDGKIPASIGNLGMLRRLDLSYNRLSGA  204

Query  1673  IPVKLSEASKLEVLDLRNNTLSGNVPLGLKRLNEGFRYENNPGLCGTGFPSLALCSD-SS  1497
             IP  L++  +LE+L++RNNTL G+VP GLKRLN GF+ ENNPGLCGTGF +L  C+    
Sbjct  205   IPTTLADIPQLEILEIRNNTLYGSVPSGLKRLNGGFQGENNPGLCGTGFSTLRDCTPFDG  264

Query  1496  LNPTKPEPFGQGSNRLPTKDIPESANIPHQLNQ------NRKPQAAAAVVGVIGLFVILA  1335
             LN  + EPF    N   T    +++NI    N       +R P+    + G+I +  +  
Sbjct  265   LNINQLEPFRSHLNGTATGVTSQTSNIQGDCNHTDCSNPSRFPKIPV-IAGIITVSFVFV  323

Query  1334  VAGLFTFSWYRRRKQQIGSTVDISESRVSTDQPKVLCRR-STSPLISLEYSNGWDPLAKD  1158
             V G   F  YRR+KQ+IG+T D S+ R+STDQ K   R  S SPL++LEYS GWDPL   
Sbjct  324   VGGFLAFVHYRRQKQKIGNTSDPSDGRLSTDQAKEFHRNGSVSPLVTLEYSYGWDPLGDG  383

Query  1157  QSGSALSQEVLESFMFNLDEVESATQYFSETNLLGKSSFSAVYKGTLRDGSAVAVKCISK  978
               G   S+E L  F FNL+EVESATQ FSE NLLG+S+FS+VYKG LRDGS VA++ I+ 
Sbjct  384   WKGIGFSEEHLNKFRFNLEEVESATQCFSEMNLLGRSNFSSVYKGILRDGSLVAIRSINV  443

Query  977   TSCKSDEAEFRKGLTLLTSLKHENLLRLRGFCCSKGRGECFLIYDFVSNGNLLRYLDVKD  798
             TSCKS+EAEF KGL LLTSL+HEN++RLRGFCCS+GRGECFL+YDF S GNL +YLD++ 
Sbjct  444   TSCKSEEAEFVKGLYLLTSLRHENIVRLRGFCCSRGRGECFLMYDFASKGNLSKYLDIEG  503

Query  797   EKGKVLDWSTRTAIIKGIARGIKYLHGNKRNKPALVHRNISADKVLIDHLYKPLLSDSGL  618
                ++LDWSTR +II GIA+G++YLH ++ NK  +VHRNIS +KV ID  + PL++DSGL
Sbjct  504   GGEQILDWSTRISIINGIAKGMEYLHRSEANKQPIVHRNISVEKVFIDQQFNPLIADSGL  563

Query  617   HKLLADDIVFSTLKGSAANGYLAPEYAITGRFTEKSDMYAFGVIILQILSGSCVVTQSNH  438
             HK+LADD+V+STLK SAA GYLAPEY  TGRFTEK+D++AFGVIILQILSG   +T S  
Sbjct  564   HKILADDVVYSTLKVSAAMGYLAPEYITTGRFTEKTDIFAFGVIILQILSGKLQLTSSMR  623

Query  437   QGAELCRFEDFVDAKLGKDFVESEAAKLGKIALLCTHDSPSRRPAIDVVIQ  285
              GAE  +FEDF+D  L  +F ES AAKLGKIAL CTH+ P  RP+++ +I+
Sbjct  624   LGAESSKFEDFIDTNLRGEFSESMAAKLGKIALSCTHEHPDDRPSMETIIK  674



>ref|NP_199969.1| leucine-rich repeat protein kinase [Arabidopsis thaliana]
 dbj|BAB08672.1| receptor-like protein kinase [Arabidopsis thaliana]
 gb|ACN59391.1| leucine-rich repeat receptor-like protein kinase [Arabidopsis 
thaliana]
 gb|AED96098.1| leucine-rich repeat protein kinase [Arabidopsis thaliana]
Length=680

 Score =   719 bits (1857),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 373/646 (58%), Positives = 472/646 (73%), Gaps = 11/646 (2%)
 Frame = -3

Query  2207  VSLLMAIKASLDPGNLVLSSWSPNVTDPCSVSSFEGIACNDLGQVVNISLQGKGLYGKIP  2028
             ++ LM +K  LDP +  L+SWS N  D C    FEG+ C+  G+V NISLQGKGL GKI 
Sbjct  32    LATLMEVKTELDPEDKHLASWSVN-GDLCK--DFEGVGCDWKGRVSNISLQGKGLSGKIS  88

Query  2027  PEIGQLNGLSGLYLHFNNLHGVIPKEIASLTQLSDLYLNMNDLSGFIPSEIGNMPNLQVL  1848
             P IG+L  L+GL+LH+N L G IP+E+ +L++L+DLYLN+N+LSG IPS IG M  LQVL
Sbjct  89    PNIGKLKHLTGLFLHYNALVGDIPRELGNLSELTDLYLNVNNLSGEIPSNIGKMQGLQVL  148

Query  1847  QLCYNRFEGCIPNKLGSLKNLTVLALQSNQLTGAIPASlggltlltrldLSFNRLFGSIP  1668
             QLCYN   G IP +L SL+ L+VLALQSN+LTGAIPASLG L+ L RLDLS+N LFGS+P
Sbjct  149   QLCYNNLTGSIPRELSSLRKLSVLALQSNKLTGAIPASLGDLSALERLDLSYNHLFGSVP  208

Query  1667  VKLSEASKLEVLDLRNNTLSGNVPLGLKRLNEGFRYENNPGLCGTGFPSLALCSDSSLNP  1488
              KL+    L VLD+RNN+L+GNVP  LKRLNEGF +ENN GLCG  F  L  C+ ++  P
Sbjct  209   GKLASPPLLRVLDIRNNSLTGNVPPVLKRLNEGFSFENNLGLCGAEFSPLKSCNGTA--P  266

Query  1487  TKPEPFGQGSNRLPTKDIPESANIPHQLNQNR-----KPQAAAAVVGVIGLFVILAVAGL  1323
              +P+P+G      P++DIPESAN+    N        K    A ++G++   + L+   +
Sbjct  267   EEPKPYGATVFGFPSRDIPESANLRSPCNGTNCNTPPKSHQGAILIGLVVSTIALSAISI  326

Query  1322  FTFSWYRRRKQQIGSTVDISESRVSTDQPKVLCRRSTSPLISLEYSNGWDPLAKDQSGSA  1143
               F+ YRRRKQ++ +T ++S++R++T       + + SPL SLEY+NGWDPL+ +++ S 
Sbjct  327   LLFTHYRRRKQKLSTTYEMSDNRLNTVGGGFR-KNNGSPLASLEYTNGWDPLSDNRNLSV  385

Query  1142  LSQEVLESFMFNLDEVESATQYFSETNLLGKSSFSAVYKGTLRDGSAVAVKCISKTSCKS  963
              +QEV++SF FNL+EVE+ATQYFSE NLLG+S+FSA YKG LRDGSAVA+K  SKTSCKS
Sbjct  386   FAQEVIQSFRFNLEEVETATQYFSEVNLLGRSNFSATYKGILRDGSAVAIKRFSKTSCKS  445

Query  962   DEAEFRKGLTLLTSLKHENLLRLRGFCCSKGRGECFLIYDFVSNGNLLRYLDVKDEKGKV  783
             +E EF KGL +L SLKHENL +LRGFCCS+GRGECFLIYDF  NGNLL YLD+KD    V
Sbjct  446   EEPEFLKGLNMLASLKHENLSKLRGFCCSRGRGECFLIYDFAPNGNLLSYLDLKDGDAHV  505

Query  782   LDWSTRTAIIKGIARGIKYLHGNKRNKPALVHRNISADKVLIDHLYKPLLSDSGLHKLLA  603
             LDWSTR +I KGIA+GI YLH  K +KPALVH+NISA+KVLID  Y PLLS+SGLH LL 
Sbjct  506   LDWSTRVSIAKGIAKGIAYLHSYKGSKPALVHQNISAEKVLIDQRYSPLLSNSGLHTLLT  565

Query  602   DDIVFSTLKGSAANGYLAPEYAITGRFTEKSDMYAFGVIILQILSGSCVVTQSNHQGAEL  423
             +DIVFS LK SAA GYLAPEY  TGRFTEK+D+YAFG+++ QI+SG   V      G E 
Sbjct  566   NDIVFSALKDSAAMGYLAPEYTTTGRFTEKTDVYAFGILVFQIISGKQKVRHLVKLGTEA  625

Query  422   CRFEDFVDAKLGKDFVESEAAKLGKIALLCTHDSPSRRPAIDVVIQ  285
             CRF D++D  L   F E EA KL +IA LCTH+SP  RP+++ V+ 
Sbjct  626   CRFNDYIDPNLQGRFFEYEATKLARIAWLCTHESPIERPSVEAVVH  671



>ref|XP_002511706.1| leucine rich repeat receptor kinase, putative [Ricinus communis]
 gb|EEF50375.1| leucine rich repeat receptor kinase, putative [Ricinus communis]
Length=627

 Score =   717 bits (1852),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 388/656 (59%), Positives = 468/656 (71%), Gaps = 61/656 (9%)
 Frame = -3

Query  2231  ETSNNASTVSLLMAIKASLDPGNLVLSSWSPNVTDPCSVSSFEGIACNDLGQVVNISLQG  2052
             +T ++ + + LLM IKASLDP N  L+SW PN T+PCS  SFEG+ACN  G V NISLQG
Sbjct  17    QTLSSPTELELLMQIKASLDPNNRFLTSWEPN-TNPCS-GSFEGVACNGQGNVANISLQG  74

Query  2051  KGLYGKIPPEIGQLNGLSGLYLHFNNLHGVIPKEIASLTQLSDLYLNMNDLSGFIPSEIG  1872
             KGL G+IP  +G L  L+GLYLHFN L+G IPKEIA LT+LSDLYLN+N+LSG IPS+IG
Sbjct  75    KGLSGQIPAALGGLKSLTGLYLHFNALNGEIPKEIAELTELSDLYLNVNNLSGEIPSQIG  134

Query  1871  NMPNLQVLQLCYNRFEGCIPNKLGSLKNLTVLALQSNQLTGAIPASlggltlltrldLSF  1692
             NM NLQVLQLCYN+  G IP +LGSL+ L VLALQ NQLT AIPASLG L  LTRLDLSF
Sbjct  135   NMSNLQVLQLCYNKLTGSIPTQLGSLRKLNVLALQYNQLTSAIPASLGDLKFLTRLDLSF  194

Query  1691  NRLFGSIPVKLSEASKLEVLDLRNNTLSGNVPLGLKRLNEGFRYENNPGLCGTGFPSLAL  1512
             N LFGS+PVKL+ A  L+VLD+RNN+LSGN+P  L+RL+ GF+Y+NNP LCG GFP+L  
Sbjct  195   NGLFGSVPVKLASAPMLQVLDIRNNSLSGNLPAALRRLDNGFQYDNNPDLCGIGFPNLET  254

Query  1511  CSDS-SLNPTKPEPFGQGSNRLPTKDIPESANIP------HQLNQNRKPQAAAAVVGVIG  1353
             C+ S +LNP +PEPF    N    +DIPESAN        H  N ++ PQ    + GVIG
Sbjct  255   CTASGNLNPNRPEPFK--PNGTLQRDIPESANFTSNCGQTHCSNSSKNPQFGI-IFGVIG  311

Query  1352  LFVILAVAGLFTFSWYRRRKQQIGSTVDISESRVSTDQPKVLCRRSTSPLISLEYSNGWD  1173
             +F++L +  LFTF+WYRR+KQ+IGS  D S+ R+STDQ K + R+S SPLISLEYSNGWD
Sbjct  312   VFIVLTIIVLFTFTWYRRQKQKIGSAFDASDGRLSTDQAKEVYRKSASPLISLEYSNGWD  371

Query  1172  PLAKDQSGSALSQEVLESFMFNLDEVESATQYFSETNLLGKSSFSAVYKGTLRDGSAVAV  993
             PLA  Q+ + LSQE LESFMFNL+EVE ATQ FSE NLLGKS+F A YKG LRDGS VAV
Sbjct  372   PLAIGQNKNGLSQEFLESFMFNLEEVERATQCFSEVNLLGKSNFCATYKGILRDGSVVAV  431

Query  992   KCISKTSCKSDEAEFRKGLTLLTSLKHENLLRLRGFCCSKGRGECFLIYDFVSNGNLLRY  813
             KCI+KTSCKSDEA+F KGL +LTSLKHENL                       N NLL+Y
Sbjct  432   KCITKTSCKSDEADFLKGLKILTSLKHENL-----------------------NENLLQY  468

Query  812   LDVKDEKGKVLDWSTRTAIIKGIARGIKYLHGNKRNKPALVHRNISADKVLIDHLYKPLL  633
             LDVK+   +VL+WSTR +II GIA+GI YLHGNK +K AL H+NISA+KV+ID       
Sbjct  469   LDVKEGTERVLEWSTRVSIINGIAKGIGYLHGNKGSKRALFHQNISAEKVIIDI------  522

Query  632   SDSGLHKLLADDIVFSTLKGSAANGYLAPEYAITGRFTEKSDMYAFGVIILQILSGSCVV  453
                                  AA GYLAPEY  TGRFTEKSD+Y+FG+I+LQILSG   +
Sbjct  523   --------------------RAAMGYLAPEYTTTGRFTEKSDVYSFGMIVLQILSGKRNI  562

Query  452   TQSNHQGAELCRFEDFVDAKLGKDFVESEAAKLGKIALLCTHDSPSRRPAIDVVIQ  285
             T       E C+ E F+DAKL   F E EA +LGK+ALLCTH+SP +RP ++ V++
Sbjct  563   TAMIRHAVESCKVELFIDAKLEGKFSELEAIELGKLALLCTHESPDQRPTVETVLR  618



>ref|XP_010662200.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g63930 [Vitis vinifera]
 emb|CBI22150.3| unnamed protein product [Vitis vinifera]
Length=680

 Score =   719 bits (1856),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 388/650 (60%), Positives = 474/650 (73%), Gaps = 9/650 (1%)
 Frame = -3

Query  2213  STVSLLMAIKASLDPGNLVLSSWSPNVTDPCSVSSFEGIACNDLGQVVNISLQGKGLYGK  2034
             S +  LM +KASLDP N  LSSW+ +  DPCS  SFEG+ CN+  +V NI+LQGKGL GK
Sbjct  29    SELRALMEMKASLDPVNRFLSSWTSDA-DPCS-GSFEGVHCNEHRKVANITLQGKGLSGK  86

Query  2033  IPPEIGQLNGLSGLYLHFNNLHGVIPKEIASLTQLSDLYLNMNDLSGFIPSEIGNMPNLQ  1854
             +PP +  L  LSGLYLH+N+L G IP+EI+SLT+LSDLYL+ N+LSG IP EIGNM +LQ
Sbjct  87    VPPAVAGLKCLSGLYLHYNSLSGEIPREISSLTELSDLYLDFNNLSGAIPPEIGNMASLQ  146

Query  1853  VLQLCYNRFEGCIPNKLGSLKNLTVLALQSNQLTGAIPASlggltlltrldLSFNRLFGS  1674
             VLQLC N+  G IP+++G LK L+V++LQ N LTG IP SLG L +L  L+LSFNRL G+
Sbjct  147   VLQLCSNQLTGAIPSEIGFLKKLSVVSLQKNNLTGKIPPSLGNLGMLRMLNLSFNRLSGT  206

Query  1673  IPVKLSEASKLEVLDLRNNTLSGNVPLGLKRLNEGFRYENN-PGLCGTGFPSLALCSD-S  1500
             IP  L++A  LE LD+RNN+L G VP GLK+L EGF++ NN  GLCG GF SL +CS   
Sbjct  207   IPANLAQAPALEFLDVRNNSLWGIVPSGLKKLKEGFQHANNSAGLCGVGFSSLRVCSYWD  266

Query  1499  SLNPTKPEPFGQGSNRLPTKDIPESANIPHQLNQNRKPQAA-----AAVVGVIGLFVILA  1335
              +N  + E F   +        P S+N     NQ   P  +       V GV  + V L+
Sbjct  267   GMNINQSETFPATNTDFTPTIYPVSSNFRPHCNQTHCPNVSKFPRIVLVSGVTTVTVTLS  326

Query  1334  VAGLFTFSWYRRRKQQIGSTVDISESRVSTDQPKVLCRRSTSPLISLEYSNGWDPLAKDQ  1155
               GL TF  YRRRKQ+IGS+ D SE ++STD+     R+  SPL+SLEYS GWDPLA  +
Sbjct  327   AVGLLTFLCYRRRKQKIGSSFDTSECQLSTDRSIDCHRKIASPLVSLEYSTGWDPLADGR  386

Query  1154  SGSALSQEVLESFMFNLDEVESATQYFSETNLLGKSSFSAVYKGTLRDGSAVAVKCISKT  975
             +G+  SQE  ++  FNLDE+ESATQYFSE NLLGKS F +VYKG LRDGS VA++ IS T
Sbjct  387   NGNVFSQEFCQNPRFNLDEIESATQYFSEVNLLGKSKFWSVYKGILRDGSLVAIRSISAT  446

Query  974   SCKSDEAEFRKGLTLLTSLKHENLLRLRGFCCSKGRGECFLIYDFVSNGNLLRYLDVKDE  795
             SCKS+EA+F KGL LL+SL+HENL+RLRGFCCSKGRGEC+LI+DFV NG+L RYLD+++ 
Sbjct  447   SCKSEEADFLKGLNLLSSLRHENLVRLRGFCCSKGRGECYLIHDFVPNGSLSRYLDLEEG  506

Query  794   KGKVLDWSTRTAIIKGIARGIKYLHGNKRNKPALVHRNISADKVLIDHLYKPLLSDSGLH  615
               +VL+WSTR +II GIA+GI YLH ++ NKP+LVHR+ISADKVLID  + PL+SDSGL 
Sbjct  507   SSQVLNWSTRVSIIHGIAKGIGYLHSSEENKPSLVHRSISADKVLIDQRFNPLISDSGLP  566

Query  614   KLLADDIVFSTLKGSAANGYLAPEYAITGRFTEKSDMYAFGVIILQILSGSCVVTQSNHQ  435
             KLLADDIVFS LK SAA GYLAPEY  TG FTEKSD+YAFGVIILQILSG   +T S   
Sbjct  567   KLLADDIVFSALKTSAALGYLAPEYITTGSFTEKSDIYAFGVIILQILSGKQQLTNSMRL  626

Query  434   GAELCRFEDFVDAKLGKDFVESEAAKLGKIALLCTHDSPSRRPAIDVVIQ  285
              AE CRF DFVD  L  +F ESEAAKL KI L CTH+ P  RP ++ VIQ
Sbjct  627   AAESCRFADFVDTNLKGEFSESEAAKLAKIGLACTHELPDNRPIMETVIQ  676



>ref|XP_010512840.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g34110 [Camelina sativa]
Length=835

 Score =   724 bits (1870),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 385/640 (60%), Positives = 474/640 (74%), Gaps = 22/640 (3%)
 Frame = -3

Query  2216  ASTVSLLMAIKASLDPGNLVLSSWSPNVTDPCSVSSFEGIACNDLGQVVNISLQGKGLYG  2037
             +S + +L+ IK+SLDP    L+SW+P+  DPCS  SF+G+AC+   +V NISLQG GL G
Sbjct  24    SSELDILLDIKSSLDPQKRFLTSWTPDA-DPCSPGSFDGVACDGNHRVANISLQGMGLTG  82

Query  2036  KIPPEIGQLNGLSGLYLHFNNLHGVIPKEIASLTQLSDLYLNMNDLSGFIPSEIGNMPNL  1857
              IPP IG L  L+GLYLHFN+L G IPK I++L  L+DLYLN+N+LSG IP +IGN+ NL
Sbjct  83    TIPPSIGFLTSLTGLYLHFNSLTGQIPKAISNLPLLTDLYLNVNNLSGEIPPQIGNLDNL  142

Query  1856  QVLQLCYNRFEGCIPNKLGSLKNLTVLALQSNQLTGAIPASlggltlltrldLSFNRLFG  1677
             QV+QLCYN+  G IP +LGSLK +TVLALQ NQL+GAIPASLG +  LTRLDLSFN LFG
Sbjct  143   QVVQLCYNKLSGSIPTQLGSLKKVTVLALQYNQLSGAIPASLGDINTLTRLDLSFNHLFG  202

Query  1676  SIPVKLSEASKLEVLDLRNNTLSGNVPLGLKRLNEGFRYENNPGLCGTGFPSLALCSDSS  1497
              +PVKL+ A  LEVLD+RNN+ SG VP  LKRLN GF+Y NN GLCG GF  L  C+  +
Sbjct  203   PVPVKLAGAPLLEVLDIRNNSFSGFVPSALKRLNNGFQYSNNHGLCGEGFTDLKACT--A  260

Query  1496  LN-PTKPEPFGQGSNRLPTKDI-PESANIPHQLN----------QNRKPQAAAAVVGVIG  1353
             LN P    P       L T D+ PESA++               +  K      V+G+IG
Sbjct  261   LNGPNLDRPDPTNPKNLTTVDVKPESADLQRSNCSNNNNGGCSSKASKSSPFGIVMGLIG  320

Query  1352  LFVILAVAGLFTFSWYRRRKQQIGSTVDISESRVSTDQ--PKVLCRRSTSPLISLEYSNG  1179
               + +A+ G  TF+WYRRRKQ+IG+++D  + R+ST+    +   R+S+SPLISLEY++G
Sbjct  321   SILAVAIFGGSTFTWYRRRKQKIGNSLDAMDGRISTEYNFKEASRRKSSSPLISLEYASG  380

Query  1178  WDPLAKDQSG---SALSQEVLESFMFNLDEVESATQYFSETNLLGKSSFSAVYKGTLRDG  1008
             WDPL + Q+    SALSQEV ESFMFNL+E+E ATQ FSE NLLGKS+ S+VYKG LRDG
Sbjct  381   WDPLGRGQNSNNNSALSQEVFESFMFNLEEIERATQSFSEVNLLGKSNVSSVYKGILRDG  440

Query  1007  SAVAVKCISKTSCKSDEAEFRKGLTLLTSLKHENLLRLRGFCCSKGRGECFLIYDFVSNG  828
             S  AVKCI+K+SCKSDE EF KGL +LT LKHENL+RLRGFCCSKGRGECFLIY+FV NG
Sbjct  441   SVAAVKCIAKSSCKSDETEFLKGLKMLTLLKHENLVRLRGFCCSKGRGECFLIYEFVPNG  500

Query  827   NLLRYLDVKDEKGKVLDWSTRTAIIKGIARGIKYLHGNKRNKPALVHRNISADKVLIDHL  648
             NLL+YLDVKDE G+VL+W+TR +II GIARGI YLHG   NKPA+VH+N+SA+K+LIDH 
Sbjct  501   NLLQYLDVKDETGEVLEWTTRVSIINGIARGIVYLHGENGNKPAIVHQNLSAEKILIDHW  560

Query  647   YKPLLSDSGLHKLLADDIVFSTLKGSAANGYLAPEYAITGRFTEKSDMYAFGVIILQILS  468
             Y P L+DSGLHKL  DDIVFS LK SAA GYLAPEY  TGRFT+KSD+YAFG+I+LQILS
Sbjct  561   YNPSLADSGLHKLFTDDIVFSKLKASAAMGYLAPEYITTGRFTDKSDVYAFGMILLQILS  620

Query  467   GSCVVTQ-SNHQGAELCRF-EDFVDAKLGKDFVESEAAKL  354
             G   ++     Q  E  R  EDF+D  L ++F E+EAA+L
Sbjct  621   GKSKISHLMILQAVESGRLNEDFMDLNLRRNFPEAEAAQL  660


 Score =   203 bits (516),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 99/165 (60%), Positives = 127/165 (77%), Gaps = 2/165 (1%)
 Frame = -3

Query  773  STRTAIIKGIARGIKYLHGNKRNKPALVHRNISADKVLIDHLYKPLLSDSGLHKLLADDI  594
            +TR +II GIARGI YLHG   NKPA+VH+N+SA+K+LIDH Y P L+DSGLHKL  DDI
Sbjct  662  TTRVSIINGIARGIVYLHGENGNKPAIVHQNLSAEKILIDHWYNPSLADSGLHKLFTDDI  721

Query  593  VFSTLKGSAANGYLAPEYAITGRFTEKSDMYAFGVIILQILSGSCVVTQ-SNHQGAELCR  417
            VFS LK SAA GYLAPEY  TGRFT+KSD+YAFG+I+LQILSG   ++     Q  E  R
Sbjct  722  VFSKLKASAAMGYLAPEYITTGRFTDKSDVYAFGMILLQILSGKSKISHLMILQAVESGR  781

Query  416  F-EDFVDAKLGKDFVESEAAKLGKIALLCTHDSPSRRPAIDVVIQ  285
              EDF+D  L ++F E+EAA+L ++ LLCTH+S ++RP+++ V+Q
Sbjct  782  LNEDFMDLNLRRNFPEAEAAQLARLGLLCTHESSNQRPSMEDVMQ  826



>ref|XP_002862982.1| hypothetical protein ARALYDRAFT_920855 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH39241.1| hypothetical protein ARALYDRAFT_920855 [Arabidopsis lyrata subsp. 
lyrata]
Length=680

 Score =   718 bits (1854),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 370/646 (57%), Positives = 471/646 (73%), Gaps = 11/646 (2%)
 Frame = -3

Query  2207  VSLLMAIKASLDPGNLVLSSWSPNVTDPCSVSSFEGIACNDLGQVVNISLQGKGLYGKIP  2028
             ++ L+ +K  LDP +  L+SWS N  D C    FEG+ C+  G+V NISLQGKGL GKI 
Sbjct  32    LTTLLEVKTELDPEDKHLASWSIN-GDLCK--DFEGVGCDWKGRVSNISLQGKGLSGKIS  88

Query  2027  PEIGQLNGLSGLYLHFNNLHGVIPKEIASLTQLSDLYLNMNDLSGFIPSEIGNMPNLQVL  1848
             P I +L  L+GL+LH+N L G IP+E+ +L++L+DLYLN+N+LSG IPS IG M  LQVL
Sbjct  89    PNIAKLKHLTGLFLHYNALVGDIPRELGNLSELTDLYLNVNNLSGEIPSNIGKMQGLQVL  148

Query  1847  QLCYNRFEGCIPNKLGSLKNLTVLALQSNQLTGAIPASlggltlltrldLSFNRLFGSIP  1668
             QLCYN   G IP +LGSL+ L+VLALQSN+LTGAIPASLG ++ L RLDLS+N LFGS+P
Sbjct  149   QLCYNNLTGSIPRELGSLRKLSVLALQSNKLTGAIPASLGEISALERLDLSYNHLFGSVP  208

Query  1667  VKLSEASKLEVLDLRNNTLSGNVPLGLKRLNEGFRYENNPGLCGTGFPSLALCSDSSLNP  1488
              KL+    L VLD+RNN+L+GNVP  LKRLNEGF +ENN GLCG  F  L  C+ ++  P
Sbjct  209   GKLASPPLLRVLDIRNNSLTGNVPPVLKRLNEGFSFENNLGLCGAEFSPLKSCNGTA--P  266

Query  1487  TKPEPFGQGSNRLPTKDIPESANIPHQLNQNR-----KPQAAAAVVGVIGLFVILAVAGL  1323
              +P+P+G      P++DIPESAN+    N        K    A ++G++   + L+   +
Sbjct  267   EEPKPYGATVFGFPSRDIPESANLRSPCNGTNCNAPPKSHQGAILIGLVVSTIALSAISI  326

Query  1322  FTFSWYRRRKQQIGSTVDISESRVSTDQPKVLCRRSTSPLISLEYSNGWDPLAKDQSGSA  1143
               F+ YRRRKQ++ +  ++S++RV+T       + + SPL SLEY+NGWDPL+ +++ S 
Sbjct  327   LLFTHYRRRKQKLSTAYEMSDTRVNTVGGGFR-KNNGSPLASLEYTNGWDPLSDNRNLSV  385

Query  1142  LSQEVLESFMFNLDEVESATQYFSETNLLGKSSFSAVYKGTLRDGSAVAVKCISKTSCKS  963
              +QEV++SF FNL+EVE+ATQYFSE NLLG+S+FSA YKG LRDGSAVA+K  SKTSCKS
Sbjct  386   FAQEVIQSFRFNLEEVETATQYFSEVNLLGRSNFSATYKGILRDGSAVAIKRFSKTSCKS  445

Query  962   DEAEFRKGLTLLTSLKHENLLRLRGFCCSKGRGECFLIYDFVSNGNLLRYLDVKDEKGKV  783
             +E EF KG+ +L SLKHENL +LRGFCCS+GRGECFLIYDF  NGNLL YLD+KD    V
Sbjct  446   EEPEFLKGVNMLASLKHENLAKLRGFCCSRGRGECFLIYDFAPNGNLLSYLDLKDGDAHV  505

Query  782   LDWSTRTAIIKGIARGIKYLHGNKRNKPALVHRNISADKVLIDHLYKPLLSDSGLHKLLA  603
             LDWSTR +I KGIA+GI YLH  K +KPALVH+NISA+KVLID  Y PLLS+SGLH LL 
Sbjct  506   LDWSTRVSIAKGIAKGIAYLHSYKGSKPALVHQNISAEKVLIDQRYNPLLSNSGLHTLLT  565

Query  602   DDIVFSTLKGSAANGYLAPEYAITGRFTEKSDMYAFGVIILQILSGSCVVTQSNHQGAEL  423
             +DIVFS LK SAA GYLAPEY  TGRFTEK+D+YAFG+++ QI+SG   V      G E 
Sbjct  566   NDIVFSALKDSAAMGYLAPEYTTTGRFTEKTDVYAFGILVFQIISGKQKVRHLVKLGTEA  625

Query  422   CRFEDFVDAKLGKDFVESEAAKLGKIALLCTHDSPSRRPAIDVVIQ  285
             CRF D++D  L   F E EA KL +IA LCTH+SP  RP+++ V+ 
Sbjct  626   CRFNDYIDPNLQGRFFEYEATKLARIAWLCTHESPIERPSVEAVVH  671



>ref|XP_004513505.1| PREDICTED: probable leucine-rich repeat receptor-like serine/threonine-protein 
kinase At3g14840-like [Cicer arietinum]
Length=664

 Score =   717 bits (1851),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 382/641 (60%), Positives = 474/641 (74%), Gaps = 19/641 (3%)
 Frame = -3

Query  2198  LMAIKASLDPGNLVLSSWSPNVTDPCSVSSFEGIACNDLGQVVNISLQGKGLYGKIPPEI  2019
             LM IK SLDP N VL SW+ N +DPCS   FEGI CN+ G V NISLQGKGLYGKIP  I
Sbjct  32    LMTIKESLDPENRVLISWN-NHSDPCS-GVFEGIGCNEKGFVSNISLQGKGLYGKIPSVI  89

Query  2018  GQLNGLSGLYLHFNNLHGVIPKEIASLTQLSDLYLNMNDLSGFIPSEIGNMPNLQVLQLC  1839
             G L  L+ +YLHFN L+G++PKEIASLTQLSDLYL+ N+LSG IP +IGNM NLQVLQLC
Sbjct  90    GSLKSLTAVYLHFNALNGILPKEIASLTQLSDLYLSFNNLSGNIPHDIGNMSNLQVLQLC  149

Query  1838  YNRFEGCIPNKLGSLKNLTVLALQSNQLTGAIPASlggltlltrldLSFNRLFGSIPVKL  1659
             YN   G IP++LG LK LT++ALQ+N L+GAIPASLG L  L RLDLSFN LFG IPV L
Sbjct  150   YNELNGSIPSELGRLKRLTIVALQNNHLSGAIPASLGELETLERLDLSFNTLFGPIPVTL  209

Query  1658  SEASKLEVLDLRNNTLSGNVPLGLKRLNEGFRYENNPGLCGTGFPSLALCSD-SSLNPTK  1482
             + A KL+ LD+ NN+LSG+VP  L+RL  GF+Y NN GLCGTGF  L  C   S+ +P +
Sbjct  210   ANAPKLQTLDITNNSLSGSVPTALQRLKGGFKYINNHGLCGTGFSDLDSCRIVSNSDPVR  269

Query  1481  PEPFGQGSNRLPTKDIP-ESANIPHQLNQNRKPQAAAAVVGVIGLFVILAVAGLFTFSWY  1305
             PEP+ +  N + ++D P ES      + ++       A V +IG+  + +V G+F F WY
Sbjct  270   PEPY-EPINNITSRDFPAESCGDADCIKRSETSTIGLAFV-MIGVVSVFSVTGVFLFLWY  327

Query  1304  RRRKQQIGSTVDISESRVSTDQPKVLCRRS-TSPLISLEYSNGWDPLAKDQSGSALSQEV  1128
               +KQ+IGST +      S+D+ K + R++  SPLISLEYS+GWDPL+K      ++++ 
Sbjct  328   HHKKQKIGSTDE------SSDKIKKVYRKNYASPLISLEYSSGWDPLSK-----GVNEDF  376

Query  1127  LESFMFNLDEVESATQYFSETNLLGKSSFSAVYKGTLRDGSAVAVKCISKTSCKSDEAEF  948
             L+SFMFNL+EVE ATQ FSE NLL K++ SA Y+G LRDGS V +KCI+KTSCKSDE EF
Sbjct  377   LQSFMFNLEEVERATQCFSEMNLLTKNNISANYRGILRDGSVVVIKCIAKTSCKSDETEF  436

Query  947   RKGLTLLTSLKHENLLRLRGFCCSKGRGECFLIYDFVSNGNLLRYLDVK-DEKGKVLDWS  771
              KGL  LTSLKHEN++RLRGFCCSKGRGECFLIYDFVSNG+L +YLDVK     +VL+WS
Sbjct  437   LKGLKTLTSLKHENVVRLRGFCCSKGRGECFLIYDFVSNGSLSKYLDVKRGSDHEVLEWS  496

Query  770   TRTAIIKGIARGIKYLHGNKRNKPALVHRNISADKVLIDHLYKPLLSDSGLHKLLADDIV  591
             TR +II+GIA+GI YLHG K +K +LVH+NIS++KVL+D  Y  LL+DSGLHKLLADD++
Sbjct  497   TRVSIIRGIAKGIGYLHGKKGSKHSLVHQNISSEKVLVDFRYNSLLADSGLHKLLADDVI  556

Query  590   FSTLKGSAANGYLAPEYAITGRFTEKSDMYAFGVIILQILSGSCVVTQSNHQGAELCRFE  411
             FSTLK SAA GYLAPEY  TGRFTE+SD+YAFGVI+ Q+L+G   +TQ + Q  E    +
Sbjct  557   FSTLKASAAKGYLAPEYTTTGRFTEESDVYAFGVIVFQLLAGKHDITQLSRQWIETASLK  616

Query  410   DFVDAKLGKDFVESEAAKLGKIALLCTHDSPSRRPAIDVVI  288
               +D  L   F ESEA KL +IA LCTH+SP  RP +D V+
Sbjct  617   YVIDENLEGKFGESEAEKLARIACLCTHESPHDRPTMDNVM  657



>gb|AAM62629.1| receptor-like protein kinase [Arabidopsis thaliana]
Length=680

 Score =   717 bits (1850),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 372/646 (58%), Positives = 471/646 (73%), Gaps = 11/646 (2%)
 Frame = -3

Query  2207  VSLLMAIKASLDPGNLVLSSWSPNVTDPCSVSSFEGIACNDLGQVVNISLQGKGLYGKIP  2028
             ++ LM +K  LDP +  L+SWS N  D C    FEG+ C+  G+V NISLQGKGL GKI 
Sbjct  32    LATLMEVKTELDPEDKHLASWSVN-GDLCK--DFEGVGCDWKGRVSNISLQGKGLSGKIS  88

Query  2027  PEIGQLNGLSGLYLHFNNLHGVIPKEIASLTQLSDLYLNMNDLSGFIPSEIGNMPNLQVL  1848
             P IG+L  L+GL+LH+N L G IP+E+ +L++L+ LYLN+N+LSG IPS IG M  LQVL
Sbjct  89    PNIGKLKHLTGLFLHYNALVGDIPRELGNLSELTGLYLNVNNLSGEIPSNIGKMQGLQVL  148

Query  1847  QLCYNRFEGCIPNKLGSLKNLTVLALQSNQLTGAIPASlggltlltrldLSFNRLFGSIP  1668
             QLCYN   G IP +L SL+ L+VLALQSN+LTGAIPASLG L+ L RLDLS+N LFGS+P
Sbjct  149   QLCYNNLTGSIPRELSSLRKLSVLALQSNKLTGAIPASLGDLSALERLDLSYNHLFGSVP  208

Query  1667  VKLSEASKLEVLDLRNNTLSGNVPLGLKRLNEGFRYENNPGLCGTGFPSLALCSDSSLNP  1488
              KL+    L VLD+RNN+L+GNVP  LKRLNEGF +ENN GLCG  F  L  C+ ++  P
Sbjct  209   GKLASPPLLRVLDIRNNSLTGNVPPVLKRLNEGFSFENNLGLCGAEFSPLKSCNGTA--P  266

Query  1487  TKPEPFGQGSNRLPTKDIPESANIPHQLNQNR-----KPQAAAAVVGVIGLFVILAVAGL  1323
              +P+P+G      P++DIPESAN+    N        K    A ++G++   + L+   +
Sbjct  267   EEPKPYGATVFGFPSRDIPESANLRSPCNGTNCNTPPKSHQGAILIGLVVSTIALSAISI  326

Query  1322  FTFSWYRRRKQQIGSTVDISESRVSTDQPKVLCRRSTSPLISLEYSNGWDPLAKDQSGSA  1143
               F+ YRRRKQ++ +T ++S++R++T       + + SPL SLEY+NGWDPL+ +++ S 
Sbjct  327   LLFTHYRRRKQKLSTTYEMSDNRLNTVGGGFR-KNNGSPLASLEYTNGWDPLSDNRNLSV  385

Query  1142  LSQEVLESFMFNLDEVESATQYFSETNLLGKSSFSAVYKGTLRDGSAVAVKCISKTSCKS  963
              +QEV++SF FNL+EVE+ATQYFSE NLLG+S+FSA YKG LRDGSAVA+K  SKTSCKS
Sbjct  386   FAQEVIQSFRFNLEEVETATQYFSEVNLLGRSNFSATYKGILRDGSAVAIKRFSKTSCKS  445

Query  962   DEAEFRKGLTLLTSLKHENLLRLRGFCCSKGRGECFLIYDFVSNGNLLRYLDVKDEKGKV  783
             +E EF KGL +L SLKHENL +LRGFCCS+GRGECFLIYDF  NGNLL YLD+KD    V
Sbjct  446   EEPEFLKGLNMLASLKHENLSKLRGFCCSRGRGECFLIYDFAPNGNLLSYLDLKDGDAHV  505

Query  782   LDWSTRTAIIKGIARGIKYLHGNKRNKPALVHRNISADKVLIDHLYKPLLSDSGLHKLLA  603
             LDWSTR +I KGIA+GI YLH  K +KPALVH+NISA+KVLID  Y PLLS+SGLH LL 
Sbjct  506   LDWSTRVSIAKGIAKGIAYLHSYKGSKPALVHQNISAEKVLIDQRYSPLLSNSGLHTLLT  565

Query  602   DDIVFSTLKGSAANGYLAPEYAITGRFTEKSDMYAFGVIILQILSGSCVVTQSNHQGAEL  423
             +DIVFS LK SAA GYLAPEY  TGRFTEK+D+YAFG+++ QI+SG   V      G E 
Sbjct  566   NDIVFSALKDSAAMGYLAPEYTTTGRFTEKTDVYAFGILVFQIISGKQKVRHLVKLGTEA  625

Query  422   CRFEDFVDAKLGKDFVESEAAKLGKIALLCTHDSPSRRPAIDVVIQ  285
             CRF D++D  L   F E EA KL +IA LCTH+SP  RP+++ V+ 
Sbjct  626   CRFNDYIDPNLQGRFFEYEATKLARIAWLCTHESPIERPSVEAVVH  671



>ref|XP_010482493.1| PREDICTED: BRASSINOSTEROID INSENSITIVE 1-associated receptor 
kinase 1-like [Camelina sativa]
Length=682

 Score =   717 bits (1851),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 374/650 (58%), Positives = 470/650 (72%), Gaps = 10/650 (2%)
 Frame = -3

Query  2219  NASTVSLLMAIKASLDPGNLVLSSWSPNVTDPCSVSSFEGIACNDLGQVVNISLQGKGLY  2040
             N   +  LM +K  LDP +  L+SWS    D C    FEG+ C+  GQV NISLQGKGL 
Sbjct  29    NTDELQTLMEVKTELDPEDKHLASWSIR-GDLCK--DFEGVGCDWKGQVSNISLQGKGLS  85

Query  2039  GKIPPEIGQLNGLSGLYLHFNNLHGVIPKEIASLTQLSDLYLNMNDLSGFIPSEIGNMPN  1860
             GKI P I +L  L+GL+LH+N L G IP+E+ +L++L+DLYLN+N+LSG IP   G M  
Sbjct  86    GKISPNIAKLKHLTGLFLHYNALVGDIPRELGNLSELTDLYLNVNNLSGEIPPNFGKMQG  145

Query  1859  LQVLQLCYNRFEGCIPNKLGSLKNLTVLALQSNQLTGAIPASlggltlltrldLSFNRLF  1680
             LQVLQLCYN   G IP +LGSL  L+VLALQSN+LTGAIPASLG L+ L RLDLS+N LF
Sbjct  146   LQVLQLCYNNLTGSIPRELGSLSKLSVLALQSNKLTGAIPASLGDLSALERLDLSYNHLF  205

Query  1679  GSIPVKLSEASKLEVLDLRNNTLSGNVPLGLKRLNEGFRYENNPGLCGTGFPSLALCSDS  1500
             GS+P KL+    L VLD+RNN+L+GNVP  LKRLNEGF ++NN GLCG  FPSL  C+ +
Sbjct  206   GSVPGKLANPPLLRVLDIRNNSLTGNVPPVLKRLNEGFAFDNNLGLCGVEFPSLKSCNGT  265

Query  1499  SLNPTKPEPFGQGSNRLPTKDIPESANIP---HQLNQNRKPQA--AAAVVGVIGLFVILA  1335
             +    KP  FG     +P++DIP+SA +    +  N N  P++   A ++G++   + L+
Sbjct  266   AHVGAKP--FGATVTDVPSRDIPQSATLRLPCNGTNCNAPPKSHQGAILIGLVVTTIALS  323

Query  1334  VAGLFTFSWYRRRKQQIGSTVDISESRVSTDQPKVLCRRSTSPLISLEYSNGWDPLAKDQ  1155
                +  F+ YRRRKQ++ +  ++S++R +        + S SPL SLEY++GWDPL+ ++
Sbjct  324   AVSILLFTHYRRRKQKLSTAYEMSDTRPNNSVRGGFRKNSGSPLASLEYTHGWDPLSDNR  383

Query  1154  SGSALSQEVLESFMFNLDEVESATQYFSETNLLGKSSFSAVYKGTLRDGSAVAVKCISKT  975
             + S  +QEV++SF FNL+EVE+ATQYFSE NLLGKS+FSA YKG LRDGSAVA+K  SKT
Sbjct  384   NLSVFAQEVIQSFRFNLEEVETATQYFSEVNLLGKSNFSATYKGILRDGSAVAIKRFSKT  443

Query  974   SCKSDEAEFRKGLTLLTSLKHENLLRLRGFCCSKGRGECFLIYDFVSNGNLLRYLDVKDE  795
             SCKS+E EF KGLT+LTSLKHENL RLRGFCCS+GRGECF+IYDF  NGNLL YLD+KD 
Sbjct  444   SCKSEEPEFLKGLTMLTSLKHENLARLRGFCCSRGRGECFIIYDFAPNGNLLSYLDLKDG  503

Query  794   KGKVLDWSTRTAIIKGIARGIKYLHGNKRNKPALVHRNISADKVLIDHLYKPLLSDSGLH  615
                VLDWSTR +I KGIA+GI YLH  K +KPALVH+NISA+KVLID  Y PLLS+SGLH
Sbjct  504   DTHVLDWSTRVSIAKGIAKGIAYLHSYKGSKPALVHQNISAEKVLIDQRYNPLLSNSGLH  563

Query  614   KLLADDIVFSTLKGSAANGYLAPEYAITGRFTEKSDMYAFGVIILQILSGSCVVTQSNHQ  435
              LL +DIVFS LK SAA GYLAPEY  TGRFTEK+D+YAFGV++ QI+SG   V      
Sbjct  564   TLLTNDIVFSALKDSAAMGYLAPEYTTTGRFTEKTDVYAFGVLVFQIISGKQKVRHLVKL  623

Query  434   GAELCRFEDFVDAKLGKDFVESEAAKLGKIALLCTHDSPSRRPAIDVVIQ  285
             G E CRF D++D  L   F E EA KL +IA LCTH+SP  RP+++ V+ 
Sbjct  624   GTEACRFNDYIDPNLQGRFFEYEATKLARIAWLCTHESPIERPSVEAVVH  673



>ref|XP_006279482.1| hypothetical protein CARUB_v10026012mg [Capsella rubella]
 gb|EOA12380.1| hypothetical protein CARUB_v10026012mg [Capsella rubella]
Length=681

 Score =   714 bits (1843),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 372/643 (58%), Positives = 468/643 (73%), Gaps = 11/643 (2%)
 Frame = -3

Query  2198  LMAIKASLDPGNLVLSSWSPNVTDPCSVSSFEGIACNDLGQVVNISLQGKGLYGKIPPEI  2019
             LM +K  LDP +  L+SWS N  DPC    FEG+ C+  GQV NISLQGK L GKI P I
Sbjct  36    LMEVKTELDPEDKHLASWSIN-GDPCK--DFEGVGCDWKGQVSNISLQGKALSGKISPNI  92

Query  2018  GQLNGLSGLYLHFNNLHGVIPKEIASLTQLSDLYLNMNDLSGFIPSEIGNMPNLQVLQLC  1839
              +L  L+GL+LH+N L G IP+E+ +L++L+DLYLN+N+LSG IP  IG M  LQVLQLC
Sbjct  93    AKLRHLTGLFLHYNALVGDIPRELGNLSELTDLYLNVNNLSGEIPPNIGKMQGLQVLQLC  152

Query  1838  YNRFEGCIPNKLGSLKNLTVLALQSNQLTGAIPASlggltlltrldLSFNRLFGSIPVKL  1659
             YN   G IP +LGSL+ L+VLALQSN+LTGAIPASLG L+ L RLDLS+N LFGS+P KL
Sbjct  153   YNNLTGSIPRELGSLRKLSVLALQSNKLTGAIPASLGDLSALERLDLSYNHLFGSVPGKL  212

Query  1658  SEASKLEVLDLRNNTLSGNVPLGLKRLNEGFRYENNPGLCGTGFPSLALCSDSSLNPTKP  1479
             +    L V D+RNN+L+GNVP  LKRLNEGF ++NN GLCG  F SL  C+ ++    +P
Sbjct  213   ANPPMLRVFDIRNNSLTGNVPPVLKRLNEGFAFDNNLGLCGAEFSSLKSCNGTA--HEEP  270

Query  1478  EPFGQGSNRLPTKDIPESANIP---HQLNQNRKPQA--AAAVVGVIGLFVILAVAGLFTF  1314
             +P+       P++DIPESAN+    +  N N  P++   A ++G++   + L+   +  F
Sbjct  271   KPYSATVTGFPSRDIPESANLRLPCNGTNCNAPPKSHQGAILIGLVVSTIALSAVSILLF  330

Query  1313  SWYRRRKQQIGSTVDISESRVSTDQPKVLCRRSTSPLISLEYSNGWDPLAKDQSGSALSQ  1134
             + YRRR+Q++ +  ++S++  +T       + + SPL SLEY+NGWDPL+ +++ S  +Q
Sbjct  331   THYRRRRQKLSTAYEMSDTPSNT-LGGGFRKNNGSPLASLEYTNGWDPLSDNRNLSVFAQ  389

Query  1133  EVLESFMFNLDEVESATQYFSETNLLGKSSFSAVYKGTLRDGSAVAVKCISKTSCKSDEA  954
             EV++SF FNL+EVE+ATQYFSE NLLGKS+FSA YKG LRDGSAVA+K  SKTSCKS+E 
Sbjct  390   EVIQSFRFNLEEVETATQYFSEVNLLGKSNFSATYKGILRDGSAVAIKRFSKTSCKSEEP  449

Query  953   EFRKGLTLLTSLKHENLLRLRGFCCSKGRGECFLIYDFVSNGNLLRYLDVKDEKGKVLDW  774
             EF KGL +L SLKHENL RLRGFCCS+GRGECFLIYDF  NGNLL YLD+KD    VLDW
Sbjct  450   EFLKGLNMLASLKHENLARLRGFCCSRGRGECFLIYDFAPNGNLLSYLDLKDGDTHVLDW  509

Query  773   STRTAIIKGIARGIKYLHGNKRNKPALVHRNISADKVLIDHLYKPLLSDSGLHKLLADDI  594
             STR +I KGIA+GI YLH  K NK ALVH+NISA+KVLIDH Y PLLS+SGLH LL +DI
Sbjct  510   STRVSIAKGIAKGIAYLHSYKGNKLALVHQNISAEKVLIDHRYNPLLSNSGLHTLLTNDI  569

Query  593   VFSTLKGSAANGYLAPEYAITGRFTEKSDMYAFGVIILQILSGSCVVTQSNHQGAELCRF  414
             VFS LK SAA GYLAPEY  TGRFTEK+D+YAFGV++ QI+SG   V      G E CRF
Sbjct  570   VFSALKDSAAMGYLAPEYTTTGRFTEKTDVYAFGVLVFQIISGKQKVRHLVKLGTEACRF  629

Query  413   EDFVDAKLGKDFVESEAAKLGKIALLCTHDSPSRRPAIDVVIQ  285
              D++D  L   F E EA KL +IA LCTH+SP  RP+++ V+ 
Sbjct  630   NDYIDPNLQGRFFEYEATKLARIAWLCTHESPIERPSVEAVVH  672



>ref|XP_010442662.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At2g33170 isoform X1 [Camelina sativa]
 ref|XP_010442663.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At2g33170 isoform X2 [Camelina sativa]
Length=682

 Score =   713 bits (1841),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 371/643 (58%), Positives = 470/643 (73%), Gaps = 10/643 (2%)
 Frame = -3

Query  2198  LMAIKASLDPGNLVLSSWSPNVTDPCSVSSFEGIACNDLGQVVNISLQGKGLYGKIPPEI  2019
             LM +K  LDP +  L+SWS    D C    FEG+ C+  GQV NISLQGKGL GKI P I
Sbjct  36    LMEVKTELDPEDKHLASWSIR-GDLCK--DFEGVGCDWKGQVSNISLQGKGLSGKISPNI  92

Query  2018  GQLNGLSGLYLHFNNLHGVIPKEIASLTQLSDLYLNMNDLSGFIPSEIGNMPNLQVLQLC  1839
              +L  L+GL+LH+N L G IP+E+ +L++L+DLYLN+N+LSG IP   G M  LQVLQLC
Sbjct  93    AKLKHLTGLFLHYNALVGDIPRELGNLSELTDLYLNVNNLSGEIPPNFGKMQGLQVLQLC  152

Query  1838  YNRFEGCIPNKLGSLKNLTVLALQSNQLTGAIPASlggltlltrldLSFNRLFGSIPVKL  1659
             YN   G IP +LGSL  L+VLALQSN+LTGAIPAS+G L+ L RLDLS+N LFGS+P KL
Sbjct  153   YNNLTGSIPRELGSLSKLSVLALQSNKLTGAIPASIGDLSALERLDLSYNHLFGSVPGKL  212

Query  1658  SEASKLEVLDLRNNTLSGNVPLGLKRLNEGFRYENNPGLCGTGFPSLALCSDSSLNPTKP  1479
             +    L VLD+RNN+L+G+VP  LKRLNEGF ++NN GLCG  FPSL  C+ ++    KP
Sbjct  213   ANPPLLRVLDIRNNSLTGSVPPVLKRLNEGFAFDNNLGLCGAEFPSLNSCNGTAHVGAKP  272

Query  1478  EPFGQGSNRLPTKDIPESANIP---HQLNQNRKPQA--AAAVVGVIGLFVILAVAGLFTF  1314
               FG     +P++DIP+SA +    +  N N  P++   A ++G++   + L+   +  F
Sbjct  273   --FGATVTDVPSRDIPQSATLRLPCNGTNCNAPPKSHQGAILIGLVVSTIALSAVSILLF  330

Query  1313  SWYRRRKQQIGSTVDISESRVSTDQPKVLCRRSTSPLISLEYSNGWDPLAKDQSGSALSQ  1134
             + YRRRKQ++ ++ ++S++R +        + S SPL SLEY++GWDPL+ +++ S  +Q
Sbjct  331   THYRRRKQKLSTSYEMSDTRPNNSVRGGFRKNSGSPLASLEYTHGWDPLSDNRNLSVFAQ  390

Query  1133  EVLESFMFNLDEVESATQYFSETNLLGKSSFSAVYKGTLRDGSAVAVKCISKTSCKSDEA  954
             EV++SF FNL+EVE+ATQYFSE NLLGKS+FSA YKG LRDGSAVA+K +SKTSCKS+E 
Sbjct  391   EVIQSFRFNLEEVETATQYFSEVNLLGKSNFSATYKGILRDGSAVAIKRLSKTSCKSEEP  450

Query  953   EFRKGLTLLTSLKHENLLRLRGFCCSKGRGECFLIYDFVSNGNLLRYLDVKDEKGKVLDW  774
             EF KGLT+LTSLKHENL RLRGFCCS+GRGECF+IYDF  NGNLL YLD+KD    VLDW
Sbjct  451   EFLKGLTMLTSLKHENLARLRGFCCSRGRGECFIIYDFAPNGNLLSYLDLKDGDTHVLDW  510

Query  773   STRTAIIKGIARGIKYLHGNKRNKPALVHRNISADKVLIDHLYKPLLSDSGLHKLLADDI  594
             STR +I KGIA+GI YLH  K +KPALVH+NISA+KVLID  Y PLLS+SGLH LL +DI
Sbjct  511   STRVSIAKGIAKGISYLHSYKGSKPALVHQNISAEKVLIDQRYNPLLSNSGLHTLLTNDI  570

Query  593   VFSTLKGSAANGYLAPEYAITGRFTEKSDMYAFGVIILQILSGSCVVTQSNHQGAELCRF  414
             VFS LK SAA GYLAPEY  TGRFTEK+D+YAFGV++ QI+SG   V      G E CRF
Sbjct  571   VFSALKDSAAMGYLAPEYITTGRFTEKTDVYAFGVLVFQIISGKQKVRHLVKLGTEACRF  630

Query  413   EDFVDAKLGKDFVESEAAKLGKIALLCTHDSPSRRPAIDVVIQ  285
              D++D  L   F E EA KL +IA LCTH+SP  RP+++ V+ 
Sbjct  631   NDYIDPNLQGRFFEYEATKLARIAWLCTHESPIERPSVEAVVH  673



>ref|XP_007140941.1| hypothetical protein PHAVU_008G154200g [Phaseolus vulgaris]
 gb|ESW12935.1| hypothetical protein PHAVU_008G154200g [Phaseolus vulgaris]
Length=661

 Score =   712 bits (1838),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 372/653 (57%), Positives = 468/653 (72%), Gaps = 26/653 (4%)
 Frame = -3

Query  2225  SNNASTVSLLMAIKASLDPGNLVLSSWSPNVTDPCSVSSFEGIACNDLGQVVNISLQGKG  2046
             S + + +  L+AI+ SLDP N VL SW+ + +DPCS +SFEG+ACN+ G V NISLQGKG
Sbjct  21    STSITQLDTLLAIRDSLDPENRVLLSWNSH-SDPCSSASFEGVACNEQGLVTNISLQGKG  79

Query  2045  LYGKIPPEIGQLNGLSGLYLHFNNLHGVIPKEIASLTQLSDLYLNMNDLSGFIPSEIGNM  1866
             LYG +P  +  L  L+GL+LHFN LHG++PK+I +LT L+DLYLN+N+LSG IP EIGNM
Sbjct  80    LYGTVPHALAALKSLTGLFLHFNALHGILPKQITTLTDLTDLYLNVNNLSGDIPREIGNM  139

Query  1865  PNLQVLQLCYNRFEGCIPNKLGSLKNLTVLALQSNQLTGAIPASlggltlltrldLSFNR  1686
              NLQVLQLCYN+F G IP++LG L+ L+V+ALQ N+L  AIPASLG +  L RLDLSFN 
Sbjct  140   SNLQVLQLCYNKFRGNIPSELGRLRKLSVVALQYNELNSAIPASLGEVGTLARLDLSFNS  199

Query  1685  LFGSIPVKLSEASKLEVLDLRNNTLSGNVPLGLKRLNEGFRYENNPGLCGTGFPSLALCS  1506
             L G IPV L++A+KL+ L++RNN+LSG VP  L+RL  GF Y NNPGLCGTGF  L  C 
Sbjct  200   LLGPIPVTLADAAKLQSLNVRNNSLSGRVPSALRRLKGGFEYMNNPGLCGTGFDDLDSCK  259

Query  1505  D-SSLNPTKPEPFGQGSNRLPTKDIPESANIPHQLNQNRKPQAAAAVVGVIGLFVILAV-  1332
             + S+  P +PEP+  G     TKD+P S    H+   + K  + ++ +G++  F ++AV 
Sbjct  260   EVSTSEPVRPEPYEPGDT--STKDLPASMEPQHESCGHCKRTSKSSKIGLV--FTVIAVV  315

Query  1331  -----AGLFTFSWYRRRKQQIGSTVDISESRVSTDQPKVLCRRSTSPLISLEYSNGWDPL  1167
                  AGL    W R + Q+IGS         S + PK +C++S  PLISLEYS+GWDPL
Sbjct  316   FASTVAGLLLLFWRRSQNQKIGS---------SDNGPKQVCQKSAFPLISLEYSDGWDPL  366

Query  1166  AKDQSGSALSQEVLESFMFNLDEVESATQYFSETNLLGKSSFSAVYKGTLRDGSAVAVKC  987
              K   GS  S EVLE FMFNL+EVE ATQ FSE NLLGKS +SAVY+G LRDGS V +KC
Sbjct  367   EK--GGSGYSWEVLEGFMFNLEEVERATQMFSEVNLLGKSDYSAVYRGVLRDGSVVTIKC  424

Query  986   ISKTSCKSDEAEFRKGLTLLTSLKHENLLRLRGFCCSKGRGECFLIYDFVSNGNLLRYLD  807
             I+KTSCKSDE EF KGL +LTSL+HEN++RLRGFCCSKGRGECFLIYD  SNGNLL+YLD
Sbjct  425   IAKTSCKSDEGEFLKGLKILTSLRHENVVRLRGFCCSKGRGECFLIYDSFSNGNLLQYLD  484

Query  806   VKDEKGKVLDWSTRTAIIKGIARGIKYLHGNKRNKPALVHRNISADKVLIDHLYKPLLSD  627
              K   G+VLDWSTR  II+GIA+G+ YLH  K  +   V  NISA+ +++D  YK L+ D
Sbjct  485   AKRNSGRVLDWSTRVWIIRGIAKGMDYLHRKKGRQHGRVQENISAENIVLDSGYKALIGD  544

Query  626   SGLHKLLADDIVFSTLKGSAANGYLAPEYAITGRFTEKSDMYAFGVIILQILSGSCVVTQ  447
             SGLH +L DD+VFS LKGSA  GYL PEY  +G  +EKSD+YAFGVI+ Q+LSG   + Q
Sbjct  545   SGLHNILEDDVVFSALKGSAGMGYLPPEYRRSGGLSEKSDVYAFGVIVFQVLSGKRDMRQ  604

Query  446   SNHQGAELCRFEDFVDAKLGKDFVESEAAKLGKIALLCTHDSPSRRPAIDVVI  288
              N +   L   +D VD  L   F ESEAAKL ++ALLCTHDSP  RP++D ++
Sbjct  605   LNLESGSL---KDIVDENLEGMFSESEAAKLRRVALLCTHDSPHLRPSMDTLM  654



>ref|XP_008238646.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g34110 [Prunus mume]
Length=681

 Score =   710 bits (1833),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 370/645 (57%), Positives = 472/645 (73%), Gaps = 12/645 (2%)
 Frame = -3

Query  2198  LMAIKASLDPGNLVLSSWSPNVTDPCSVSSFEGIACNDLGQVVNISLQGKGLYGKIPPEI  2019
             LM +KASLDP + +L SW+    DPCS   FEG+ACN+  +V NISLQGKGLYG++ P +
Sbjct  31    LMKLKASLDPEDRLLKSWTKE-GDPCS-GLFEGVACNEHRKVANISLQGKGLYGEVSPAV  88

Query  2018  GQLNGLSGLYLHFNNLHGVIPKEIASLTQLSDLYLNMNDLSGFIPSEIGNMPNLQVLQLC  1839
              +L  LSGLYLH+NNL G IPKEI+ LT+L+DLYLN+N+LSG IPSEIG+M +LQVLQLC
Sbjct  89    AELKCLSGLYLHYNNLSGEIPKEISYLTELNDLYLNVNNLSGGIPSEIGDMTSLQVLQLC  148

Query  1838  YNRFEGCIPNKLGSLKNLTVLALQSNQLTGAIPASlggltlltrldLSFNRLFGSIPVKL  1659
              N+  G IP ++G LK L+VLALQ N+LTG IPASLG L +L RLDLSFN+ FG+IP KL
Sbjct  149   CNQLTGNIPTQMGFLKRLSVLALQHNELTGQIPASLGDLGMLKRLDLSFNKFFGTIPAKL  208

Query  1658  SEASKLEVLDLRNNTLSGNVPLGLKRLNEGFRYENNPGLCGTGFPSLALCSDSSLNPTKP  1479
             +    LE+LD+++N+ SG  P  LKRL EGF+ +NNP LCG  F +L  C+   ++    
Sbjct  209   ASVPSLELLDIQSNSFSGVAPRDLKRLKEGFQCKNNPRLCGE-FSTLRACTPFDMDNVNV  267

Query  1478  EPFGQGSNRL--PTKDIPESANIP------HQLNQNRKPQAAAAVVGVIGLFVILAVAGL  1323
                 +G N    P K  P+ A+        H     + PQAA  V GVI L V LA A  
Sbjct  268   NGLPRGPNITDSPPKSNPKPADFEAPCSQTHCTKSTKLPQAAV-VAGVISLSVTLAAAVF  326

Query  1322  FTFSWYRRRKQQIGSTVDISESRVSTDQPKVLCRRSTSPLISLEYSNGWDPLAKDQSGSA  1143
                  YRR KQ++ +T D S+ R+STDQ K   R++ SPL+SLEYSNGWDPLA  ++G A
Sbjct  327   LALIRYRRHKQKVSNTSDPSDGRLSTDQAKDFYRKTASPLVSLEYSNGWDPLADGRNGIA  386

Query  1142  LSQEVLESFMFNLDEVESATQYFSETNLLGKSSFSAVYKGTLRDGSAVAVKCISKTSCKS  963
              SQE L  + FN+++VESATQYFSE NLLG+S FS+VYKG LRDGS VAV+ I+ TSCKS
Sbjct  387   FSQEYLSKYWFNMEDVESATQYFSEVNLLGRSKFSSVYKGVLRDGSLVAVRIINVTSCKS  446

Query  962   DEAEFRKGLTLLTSLKHENLLRLRGFCCSKGRGECFLIYDFVSNGNLLRYLDVKDEKGKV  783
             +EAEF KGL LL SL+HEN+++L+GFCCS+GRGECFLIYDF+  GNL +YLD++D + +V
Sbjct  447   EEAEFVKGLDLLFSLRHENVVKLKGFCCSRGRGECFLIYDFIPMGNLSQYLDIEDGRNQV  506

Query  782   LDWSTRTAIIKGIARGIKYLHGNKRNKPALVHRNISADKVLIDHLYKPLLSDSGLHKLLA  603
             L+WS R +II GIA+GI YLH ++ +KPA++H+NIS +KVLIDH + P +SD GL KLLA
Sbjct  507   LEWSNRVSIINGIAKGIGYLHSSEADKPAIIHQNISVEKVLIDHHFNPYISDPGLPKLLA  566

Query  602   DDIVFSTLKGSAANGYLAPEYAITGRFTEKSDMYAFGVIILQILSGSCVVTQSNHQGAEL  423
             DD+VFSTLK SAA GYLAPEY  TGRFTEKSD+YAFGVI+LQ++SG   ++ S    AE 
Sbjct  567   DDVVFSTLKISAAMGYLAPEYITTGRFTEKSDVYAFGVIVLQVISGKLQLSSSMRLAAES  626

Query  422   CRFEDFVDAKLGKDFVESEAAKLGKIALLCTHDSPSRRPAIDVVI  288
              ++E+F+D  L   F ESEAA L KIAL+CTH+ P+ RP ++ VI
Sbjct  627   RKYEEFIDTNLKGKFSESEAAALAKIALVCTHELPNHRPTMEEVI  671



>ref|XP_003561214.1| PREDICTED: leucine-rich repeat receptor protein kinase EXS [Brachypodium 
distachyon]
Length=674

 Score =   708 bits (1827),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 371/637 (58%), Positives = 467/637 (73%), Gaps = 14/637 (2%)
 Frame = -3

Query  2174  DPGNLVLSSWSPNVTDPCSVSSFEGIACNDL--GQVVNISLQGKGLYGKIPPEIGQLNGL  2001
             DP   VL SW P   DPC   SF G+ C+    G+V  +SLQG+GL G +PP I  L  L
Sbjct  41    DPSGRVLGSWDPARGDPCG-GSFVGVTCDRGAGGRVTGVSLQGRGLSGTLPPAIAGLRRL  99

Query  2000  SGLYLHFNNLHGVIPKEIASLTQLSDLYLNMNDLSGFIPSEIGNMPNLQVLQLCYNRFEG  1821
              GLYLH+N + G IP+EI  L++L+DLYL++N LSG +P EI  M NLQVLQL YN+  G
Sbjct  100   KGLYLHYNGIKGAIPREIGKLSELADLYLDVNHLSGPVPVEIAAMGNLQVLQLGYNQLTG  159

Query  1820  CIPNKLGSLKNLTVLALQSNQLTGAIPASlggltlltrldLSFNRLFGSIPVKLSEASKL  1641
              IP +LG+L  L VLALQSNQLTGAIPA+LG LT LTRLDLSFNRLFGSIP K++EA  L
Sbjct  160   SIPPQLGNLNKLAVLALQSNQLTGAIPATLGDLTRLTRLDLSFNRLFGSIPSKIAEAPLL  219

Query  1640  EVLDLRNNTLSGNVPLGLKRLNEGFRYENNPGLCGTGFPSLALC--SDSSLNPTKPEPFG  1467
             EV D+RNNTLSG+VP GLKRLN GF+Y NN  LCG  F  L LC  S++ LNP+KPEPFG
Sbjct  220   EVFDVRNNTLSGSVPAGLKRLNGGFQYVNNRELCGVDFSLLDLCTSSENGLNPSKPEPFG  279

Query  1466  QGSNRLPTKDIPESANIPHQLNQNRKPQAAAAVVGVIGLFVILAVAGLFTFSWYRRRKQQ  1287
                  +    +P+S N      ++ K  +   +VG++ + +  A  G+F FS+YRR+KQ+
Sbjct  280   P-DGTIKRGQVPQSVN--PDTTRSSKASSGVLIVGIVAVVIGAAFCGIFAFSYYRRQKQK  336

Query  1286  IGSTVDISESRVSTD--QPKVLCRRSTSPLISLEYSNGWDPLAKDQSGSALSQEVLESFM  1113
             IGS++++S+SR+STD  Q K  CRRS SPLIS+EYSNGWDPL+        S EV +SF 
Sbjct  337   IGSSLEVSDSRLSTDHYQQKEACRRSASPLISIEYSNGWDPLSSGG--CGSSGEVGDSFR  394

Query  1112  FNLDEVESATQYFSETNLLGKSSFSAVYKGTLRDGSAVAVKCISKTSCKSDEAEFRKGLT  933
             FNL+EVE ATQYF E NLLGKS F+A YKG LRDGS VAVK ++KTSCK +E++F +GL 
Sbjct  395   FNLEEVECATQYFCEVNLLGKSGFAATYKGMLRDGSVVAVKSLNKTSCKQEESDFLRGLK  454

Query  932   LLTSLKHENLLRLRGFCCSKGRGECFLIYDFVSNGNLLRYLDVKDEKG-KVLDWSTRTAI  756
              LT L+HENL+ LRGFCCS+GRGECFL+YDF+ NG+L RYLDVKD  G  VLDW TR +I
Sbjct  455   TLTILRHENLVGLRGFCCSRGRGECFLVYDFMVNGSLSRYLDVKDGSGASVLDWPTRVSI  514

Query  755   IKGIARGIKYLHGNKRNKPALVHRNISADKVLIDHLYKPLLSDSGLHKLLADDIVFSTLK  576
             I+GIA+GI+YLH  K NKP+LVH+NISA+K+L+DH + P LS  GLHKLLADD+VFSTLK
Sbjct  515   IRGIAKGIEYLHSKKSNKPSLVHQNISAEKILLDHHFIPRLSVPGLHKLLADDVVFSTLK  574

Query  575   GSAANGYLAPEYAITGRFTEKSDMYAFGVIILQILSGSCVVTQSNHQGAELCRFEDFVDA  396
              SAA GYLAPEYA TGRFTEKSD++AFG+++LQ+++G   V+Q    G  +   E  VD 
Sbjct  575   ASAAMGYLAPEYANTGRFTEKSDVFAFGIVVLQVITGRRAVSQLK-VGTAVSDLEGLVDL  633

Query  395   KLGKDFVESEAAKLGKIALLCTHDSPSRRPAIDVVIQ  285
              L   F  +EAAKL  +A+ CT+++PS+RP ++ V+Q
Sbjct  634   NLDGVFSRTEAAKLAAVAVHCTNEAPSQRPTMEAVVQ  670



>ref|XP_010443441.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase IMK2 [Camelina sativa]
Length=682

 Score =   708 bits (1827),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 370/642 (58%), Positives = 467/642 (73%), Gaps = 10/642 (2%)
 Frame = -3

Query  2198  LMAIKASLDPGNLVLSSWSPNVTDPCSVSSFEGIACNDLGQVVNISLQGKGLYGKIPPEI  2019
             LM +K  LDP +  L+SWS    D C    FEG+ C+  GQV NISLQGKGL GKI P I
Sbjct  36    LMEVKTELDPEDKHLASWSIR-GDLCK--DFEGVGCDWKGQVSNISLQGKGLSGKISPNI  92

Query  2018  GQLNGLSGLYLHFNNLHGVIPKEIASLTQLSDLYLNMNDLSGFIPSEIGNMPNLQVLQLC  1839
              +L  L+GL+LH+N L G IP+E+ +L++L+DLYLN+N+LSG+IPS  G M  LQVLQL 
Sbjct  93    AKLKHLTGLFLHYNALVGDIPRELGNLSELTDLYLNVNNLSGWIPSSFGKMQGLQVLQLG  152

Query  1838  YNRFEGCIPNKLGSLKNLTVLALQSNQLTGAIPASlggltlltrldLSFNRLFGSIPVKL  1659
             YN   GCIP +LGSL NL+VL LQSN+LTGAIPASLG L+ L RLDLS+N  FGS+P +L
Sbjct  153   YNNLTGCIPRELGSLSNLSVLTLQSNKLTGAIPASLGDLSALERLDLSYNLFFGSVPERL  212

Query  1658  SEASKLEVLDLRNNTLSGNVPLGLKRLNEGFRYENNPGLCGTGFPSLALCSDSSLNPTKP  1479
             +    L VLD+RNN+L+G+VP  LKRLNEGF ++NN  LCG  FPSL  C+ S+    KP
Sbjct  213   ANPPLLRVLDIRNNSLTGSVPPVLKRLNEGFAFDNNSRLCGAEFPSLKPCNGSARLGAKP  272

Query  1478  EPFGQGSNRLPTKDIPES--ANIP-HQLNQNRKPQA--AAAVVGVIGLFVILAVAGLFTF  1314
               FG     +P++DIP+S    +P +  N N  P++   A ++G++   + L+   +  F
Sbjct  273   --FGATVTNVPSRDIPQSDILRLPCNGTNCNAPPKSHQGAILIGLVVSTIALSAVSILLF  330

Query  1313  SWYRRRKQQIGSTVDISESRVSTDQPKVLCRRSTSPLISLEYSNGWDPLAKDQSGSALSQ  1134
             + YRRRKQ++ +  ++S++R++        + + SPL SLEY+NGWDPL+ + + S  +Q
Sbjct  331   THYRRRKQKLSTAYEMSDTRLNNSVVGGFRKNNGSPLASLEYTNGWDPLSDNMNLSVFAQ  390

Query  1133  EVLESFMFNLDEVESATQYFSETNLLGKSSFSAVYKGTLRDGSAVAVKCISKTSCKSDEA  954
             EV++SF FNL+EVE+ATQYFSE NLLGKS+FSA YKG LRDGSAVA+K  SKTSCKS+E 
Sbjct  391   EVIQSFRFNLEEVETATQYFSEVNLLGKSNFSATYKGILRDGSAVAIKRFSKTSCKSEEP  450

Query  953   EFRKGLTLLTSLKHENLLRLRGFCCSKGRGECFLIYDFVSNGNLLRYLDVKDEKGKVLDW  774
             EF KGLT+LTSLKHENL RLRGFCCS+GR ECF+IYDF  NGNLL YLD+KD    VLDW
Sbjct  451   EFLKGLTMLTSLKHENLARLRGFCCSRGRRECFIIYDFAPNGNLLSYLDLKDGDTHVLDW  510

Query  773   STRTAIIKGIARGIKYLHGNKRNKPALVHRNISADKVLIDHLYKPLLSDSGLHKLLADDI  594
             STR +I KGIA+GI YLH  K +KPALVH+NISA+KVLID  Y PLLS+SGLH LL +DI
Sbjct  511   STRVSIAKGIAKGIAYLHSYKGSKPALVHQNISAEKVLIDQRYNPLLSNSGLHTLLTNDI  570

Query  593   VFSTLKGSAANGYLAPEYAITGRFTEKSDMYAFGVIILQILSGSCVVTQSNHQGAELCRF  414
             VFS LK SAA GYLAPEY  TGRFTEK+D+YAFGV++ QI+SG   V      G E CRF
Sbjct  571   VFSVLKDSAAMGYLAPEYTTTGRFTEKTDVYAFGVLVFQIISGKQKVRHLVKLGTEACRF  630

Query  413   EDFVDAKLGKDFVESEAAKLGKIALLCTHDSPSRRPAIDVVI  288
              D++D  L   F E EA KL +IA LCTH+SP  RP+++ V+
Sbjct  631   NDYIDPNLQGRFFEYEATKLARIAWLCTHESPIERPSVEAVV  672



>emb|CDY00487.1| BnaA10g07860D [Brassica napus]
Length=677

 Score =   706 bits (1822),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 369/645 (57%), Positives = 463/645 (72%), Gaps = 15/645 (2%)
 Frame = -3

Query  2198  LMAIKASLDPGNLVLSSWSPNVTDPCSVSSFEGIACNDLGQVVNISLQGKGLYGKIPPEI  2019
             L+ IK  LDP    L SWS N  D C    FEG+ C+  GQV NISLQGKGL GK+ P I
Sbjct  32    LLDIKKELDPEGKHLVSWSIN-GDLCK--DFEGVGCDWKGQVSNISLQGKGLSGKLSPAI  88

Query  2018  GQLNGLSGLYLHFNNLHGVIPKEIASLTQLSDLYLNMNDLSGFIPSEIGNMPNLQVLQLC  1839
              +L  L+GL+LH+N L G IP+E+ +L++L+DLYLN+N+LSG IPS IG M +LQVLQLC
Sbjct  89    AELKHLTGLFLHYNALVGDIPRELGNLSELTDLYLNVNNLSGEIPSHIGKMESLQVLQLC  148

Query  1838  YNRFEGCIPNKLGSLKNLTVLALQSNQLTGAIPASlggltlltrldLSFNRLFGSIPVKL  1659
             YN   G IP ++GSLK L+VLALQSN+L+GAIPASLG L  L RLDLS+N LFGS+P KL
Sbjct  149   YNNLTGSIPREIGSLKKLSVLALQSNKLSGAIPASLGDLNALERLDLSYNHLFGSVPGKL  208

Query  1658  SEASKLEVLDLRNNTLSGNVPLGLKRLNEGFRYENNPGLCGTGFPSLALCSDSSLNPTKP  1479
             +    L VLD+RNN+LSGNVP  LKRLNEGF +ENN GLCG  F  L  C+ ++  P +P
Sbjct  209   AVPPLLRVLDIRNNSLSGNVPPVLKRLNEGFAFENNLGLCGAEFSPLKPCNGTA--PEEP  266

Query  1478  EPFGQGSNRLPTKDIPESANIPHQLNQNR-------KPQAAAAVVGVIGLFVILAVAGLF  1320
             +P+    N  P++ IPESA++    N               + ++G++   + L+   + 
Sbjct  267   KPYSATVNGFPSRAIPESADLQLPCNGTECSGAPSPNSHQGSILIGLVVSTIALSAVSIL  326

Query  1319  TFSWYRRRKQQIGSTVDISESRVSTDQPKVLCRRSTSPLISLEYSNGWDPLAKDQSGSAL  1140
              F+ YRRRKQ++ +  ++SE+ ++    K    + +SPL SLEYS+GWDPL+ +++ S  
Sbjct  327   LFTHYRRRKQKLSTAYEMSETGLNAKGRK---NKGSSPLASLEYSSGWDPLSDNRNLSIF  383

Query  1139  SQEVLESFMFNLDEVESATQYFSETNLLGKSSFSAVYKGTLRDGSAVAVKCISKTSCKSD  960
              QEV++SF FNL+EVE+ATQYFSE NLLG+S+FSA YKG LRDGSAVA+K  SKTSC+S+
Sbjct  384   DQEVIQSFRFNLEEVETATQYFSEVNLLGRSNFSATYKGILRDGSAVAIKRFSKTSCRSE  443

Query  959   EAEFRKGLTLLTSLKHENLLRLRGFCCSKGRGECFLIYDFVSNGNLLRYLDVKDEKGKVL  780
             E EF KGL +L SLKHENL RLRGFCCS+GRGECFLIYD+  NGNLL YLD+KD    VL
Sbjct  444   EPEFLKGLNMLASLKHENLARLRGFCCSRGRGECFLIYDYAPNGNLLSYLDLKDGDTHVL  503

Query  779   DWSTRTAIIKGIARGIKYLHGNKRNKPALVHRNISADKVLIDHLYKPLLSDSGLHKLLAD  600
             DWSTR +I KGIA+GI YLH  K NKPALVH+NISA+KVLID  Y PLL++SGLH LL +
Sbjct  504   DWSTRVSIAKGIAKGIAYLHSYKGNKPALVHQNISAEKVLIDQRYSPLLANSGLHTLLTN  563

Query  599   DIVFSTLKGSAANGYLAPEYAITGRFTEKSDMYAFGVIILQILSGSCVVTQSNHQGAELC  420
             DIVFS +K SAA GYLAPEY  TGRFTEKSD+YAFGV++ QILSG   V      G E C
Sbjct  564   DIVFSAVKDSAAMGYLAPEYTTTGRFTEKSDVYAFGVLVFQILSGKQEVRSLVKLGTEAC  623

Query  419   RFEDFVDAKLGKDFVESEAAKLGKIALLCTHDSPSRRPAIDVVIQ  285
             RF D++D  L   F E EA KL +IA LCTH+SP  RP+++ V+ 
Sbjct  624   RFHDYIDPNLQGKFFEYEATKLARIAWLCTHESPIERPSVEAVVH  668



>gb|KHG14855.1| nsp-interacting kinase 2 -like protein [Gossypium arboreum]
Length=684

 Score =   706 bits (1823),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 381/652 (58%), Positives = 469/652 (72%), Gaps = 21/652 (3%)
 Frame = -3

Query  2198  LMAIKASLDPGNLVLSSWSPNVTDPCSVSSFEGIACNDLGQVVNISLQGKGLYGKIPPEI  2019
             LM +KASLDP N VL SW  +  DPCS  SF G+ACN+  +V NISLQGKGL GK+ P I
Sbjct  31    LMELKASLDPTNKVLESWRSD-GDPCS-GSFMGVACNEHRKVANISLQGKGLSGKLSPAI  88

Query  2018  GQLNGLSGLYLHFNNLHGVIPKEIASLTQLSDLYLNMNDLSGFIPSEIGNMPNLQVLQLC  1839
                  LSGLYLH+N+L G IP+E++ L +L+DLYLN+N+LSG IP +IGNM  LQVLQLC
Sbjct  89    AGFKCLSGLYLHYNSLSGKIPQELSQLQELTDLYLNVNNLSGSIPPQIGNMAGLQVLQLC  148

Query  1838  YNRFEGCIPNKLGSLKNLTVLALQSNQLTGAIPASlggltlltrldLSFNRLFGSIPVKL  1659
              N+  G IP ++GSLK L V+ALQ N+L G IP SLG L +L RLDLSFN LF +IP  L
Sbjct  149   CNQLTGNIPTQIGSLKQLNVVALQYNRLDGKIPPSLGNLRMLKRLDLSFNSLFDAIPPTL  208

Query  1658  SEASKLEVLDLRNNTLSGNVPLGLKRLNEGFRYENNPGLCGTGFPSLALCS---------  1506
             ++  +LE+LD+RNNTLSG VP GLKRLNEGF+ +NNPGLCG GFP L  C          
Sbjct  209   ADIPELEILDVRNNTLSGLVPSGLKRLNEGFQGDNNPGLCGAGFPLLRRCGPFDGVNINQ  268

Query  1505  ----DSSLNPTKPEPFGQGSNRLPTKDIPESANIPHQLNQNRKPQAAAAVVGVIGLFVIL  1338
                    LN T PEP   G N  P+ ++    N  H    +R P+    + GV  +  I 
Sbjct  269   VEPFRPHLNNTAPEP---GVNSHPS-NVQRHCNHTHCSRPSRFPEMPV-ISGVTTVVFIF  323

Query  1337  AVAGLFTFSWYRRRKQQIGSTVDISESRVSTDQPKVLCRR-STSPLISLEYSNGWDPLAK  1161
              VAGLF    YRR+KQ+IG+T   S+   S DQ K + R  S SPLI+LEYS GWDPL  
Sbjct  324   TVAGLFAVIHYRRQKQKIGNTSGSSDESFSIDQKKEILRNGSVSPLITLEYSYGWDPLGD  383

Query  1160  DQSGSALSQEVLESFMFNLDEVESATQYFSETNLLGKSSFSAVYKGTLRDGSAVAVKCIS  981
               SG   SQE L  F FNL+EVESAT+ FSE NLLGK++FSAVYKG L+D S VA++ I+
Sbjct  384   GWSGIGFSQEHLNKFRFNLEEVESATRCFSELNLLGKTNFSAVYKGVLKDRSIVAIRSIN  443

Query  980   KTSCKSDEAEFRKGLTLLTSLKHENLLRLRGFCCSKGRGECFLIYDFVSNGNLLRYLDVK  801
              TSCKS+EAEF KGL LLTSL+HENL+RLRGFC S+GRGECFLIYDF S GNL +YLD++
Sbjct  444   VTSCKSEEAEFVKGLYLLTSLRHENLVRLRGFCFSRGRGECFLIYDFASKGNLSKYLDLE  503

Query  800   DEKGKVLDWSTRTAIIKGIARGIKYLHGNKRNKPALVHRNISADKVLIDHLYKPLLSDSG  621
             D    VLDWSTR +II G A+G++YLH ++ NKP +VHRNIS +KVLID  + PL++DSG
Sbjct  504   DGSEPVLDWSTRISIINGTAKGLEYLHKSEANKPPIVHRNISVEKVLIDQQFNPLIADSG  563

Query  620   LHKLLADDIVFSTLKGSAANGYLAPEYAITGRFTEKSDMYAFGVIILQILSGSCVVTQSN  441
             LHK+ ADDIV+STLK SAA GYLAPEY +TGRFTEK+D++AFGVIILQILSG  ++T S 
Sbjct  564   LHKIFADDIVYSTLKVSAAMGYLAPEYIMTGRFTEKTDVFAFGVIILQILSGKLLLTSSM  623

Query  440   HQGAELCRFEDFVDAKLGKDFVESEAAKLGKIALLCTHDSPSRRPAIDVVIQ  285
               GAE  +FEDFVD  L  +F ES A+KLGKIAL CT++ P+ RP+++ +I+
Sbjct  624   RSGAETSKFEDFVDKNLRGEFSESMASKLGKIALNCTNEEPNDRPSMETIIK  675



>ref|XP_009107333.1| PREDICTED: somatic embryogenesis receptor kinase 2 [Brassica 
rapa]
Length=677

 Score =   706 bits (1822),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 369/645 (57%), Positives = 463/645 (72%), Gaps = 15/645 (2%)
 Frame = -3

Query  2198  LMAIKASLDPGNLVLSSWSPNVTDPCSVSSFEGIACNDLGQVVNISLQGKGLYGKIPPEI  2019
             L+ IK  LDP    L SWS N  D C    FEG+ C+  GQV NISLQGKGL GK+ P I
Sbjct  32    LLDIKKELDPEGKHLVSWSIN-GDLCK--DFEGVGCDWKGQVSNISLQGKGLSGKLSPAI  88

Query  2018  GQLNGLSGLYLHFNNLHGVIPKEIASLTQLSDLYLNMNDLSGFIPSEIGNMPNLQVLQLC  1839
              +L  L+GL+LH+N L G IP+E+ +L++L+DLYLN+N+LSG IPS IG M +LQVLQLC
Sbjct  89    AELKHLTGLFLHYNALVGDIPRELGNLSELTDLYLNVNNLSGEIPSHIGKMESLQVLQLC  148

Query  1838  YNRFEGCIPNKLGSLKNLTVLALQSNQLTGAIPASlggltlltrldLSFNRLFGSIPVKL  1659
             YN   G IP ++GSLK L+VLALQSN+L+GAIPASLG L  L RLDLS+N LFGS+P KL
Sbjct  149   YNNLTGSIPREIGSLKKLSVLALQSNKLSGAIPASLGDLNALERLDLSYNHLFGSVPGKL  208

Query  1658  SEASKLEVLDLRNNTLSGNVPLGLKRLNEGFRYENNPGLCGTGFPSLALCSDSSLNPTKP  1479
             +    L VLD+RNN+LSGNVP  LKRLNEGF +ENN GLCG  F  L  C+ ++  P +P
Sbjct  209   AVPPLLRVLDIRNNSLSGNVPPVLKRLNEGFAFENNLGLCGAEFSPLKPCNGTA--PEEP  266

Query  1478  EPFGQGSNRLPTKDIPESANIPHQLNQNR-------KPQAAAAVVGVIGLFVILAVAGLF  1320
             +P+    N  P++ IPESA++    N               + ++G++   + L+   + 
Sbjct  267   KPYSATVNGFPSRAIPESADLQLPCNGTECSGAPSPNSHQGSILIGLVVSTIALSAVSIL  326

Query  1319  TFSWYRRRKQQIGSTVDISESRVSTDQPKVLCRRSTSPLISLEYSNGWDPLAKDQSGSAL  1140
              F+ YRRRKQ++ +  ++SE+ ++    K    + +SPL SLEYS+GWDPL+ +++ S  
Sbjct  327   LFTHYRRRKQKLSTAYEMSEAGLNAKGRK---NKGSSPLASLEYSSGWDPLSDNRNLSIF  383

Query  1139  SQEVLESFMFNLDEVESATQYFSETNLLGKSSFSAVYKGTLRDGSAVAVKCISKTSCKSD  960
              QEV++SF FNL+EVE+ATQYFSE NLLG+S+FSA YKG LRDGSAVA+K  SKTSC+S+
Sbjct  384   DQEVIQSFRFNLEEVETATQYFSEVNLLGRSNFSATYKGILRDGSAVAIKRFSKTSCRSE  443

Query  959   EAEFRKGLTLLTSLKHENLLRLRGFCCSKGRGECFLIYDFVSNGNLLRYLDVKDEKGKVL  780
             E EF KGL +L SLKHENL RLRGFCCS+GRGECFLIYD+  NGNLL YLD+KD    VL
Sbjct  444   EPEFLKGLNMLASLKHENLARLRGFCCSRGRGECFLIYDYAPNGNLLSYLDLKDGDTHVL  503

Query  779   DWSTRTAIIKGIARGIKYLHGNKRNKPALVHRNISADKVLIDHLYKPLLSDSGLHKLLAD  600
             DWSTR +I KGIA+GI YLH  K NKPALVH+NISA+KVLID  Y PLL++SGLH LL +
Sbjct  504   DWSTRVSIAKGIAKGIAYLHSYKGNKPALVHQNISAEKVLIDQRYSPLLANSGLHTLLTN  563

Query  599   DIVFSTLKGSAANGYLAPEYAITGRFTEKSDMYAFGVIILQILSGSCVVTQSNHQGAELC  420
             DIVFS +K SAA GYLAPEY  TGRFTEKSD+YAFGV++ QILSG   V      G E C
Sbjct  564   DIVFSAVKDSAAMGYLAPEYTTTGRFTEKSDVYAFGVLVFQILSGKQEVRSLVKLGTEAC  623

Query  419   RFEDFVDAKLGKDFVESEAAKLGKIALLCTHDSPSRRPAIDVVIQ  285
             RF D++D  L   F E EA KL +IA LCTH+SP  RP+++ V+ 
Sbjct  624   RFHDYIDPNLQGKFFEYEATKLARIAWLCTHESPIERPSVEAVVH  668



>ref|XP_011042292.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g34110 [Populus euphratica]
Length=682

 Score =   706 bits (1822),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 382/659 (58%), Positives = 470/659 (71%), Gaps = 16/659 (2%)
 Frame = -3

Query  2231  ETSNNASTVSLLMAIKASLDPGNLVLSSWSPNVTDPCSVSSFEGIACNDLGQVVNISLQG  2052
             + S   + +  L+ +K +LDP N  L SW+    DPCS   FEG+ACN+ GQV NISLQG
Sbjct  21    QISGKNTELEALVKLKFALDPTNKYLQSWTSE-GDPCS-DLFEGVACNEHGQVANISLQG  78

Query  2051  KGLYGKIPPEIGQLNGLSGLYLHFNNLHGVIPKEIASLTQLSDLYLNMNDLSGFIPSEIG  1872
             KGL G I P + +L  LSGLYLH+N+L G IPKEI +L  LSDLYLN+N+LSG IP EIG
Sbjct  79    KGLSGTISPAVAELKSLSGLYLHYNSLSGEIPKEIVNLAGLSDLYLNVNNLSGSIPPEIG  138

Query  1871  NMPNLQVLQLCYNRFEGCIPNKLGSLKNLTVLALQSNQLTGAIPASlggltlltrldLSF  1692
             +M +LQVL+LC N+  G IP ++GSLK L+VLALQ N+L+G IPASLG L +L RLD+SF
Sbjct  139   SMASLQVLELCCNQLAGYIPTEMGSLKKLSVLALQYNRLSGQIPASLGTLGMLKRLDMSF  198

Query  1691  NRLFGSIPVKLSEASKLEVLDLRNNTLSGNVPLGLKRLNEGFRYENNPGLCGTGFPSLAL  1512
             N L G+IP  ++   +LEVLD+RNN+LSG VP  LKRLN GF++ENN GLCGTGFP L  
Sbjct  199   NYLSGTIPQGIANIPRLEVLDVRNNSLSGTVPFPLKRLNGGFQFENNEGLCGTGFPLLRA  258

Query  1511  CS---DSSLNPTKP-EPFGQGSNRLPTKDIPESANIPHQLNQ------NRKPQAAAAVVG  1362
             CS   + ++N     EP    S R   K IP+SA +    NQ      ++ PQAA     
Sbjct  259   CSAFDNMNINQVGSLEPIANNSAR---KVIPQSAILQAHCNQTLCSNSSKLPQAAIVAGV  315

Query  1361  VIGLFVILAVAGLFTFSWYRRRKQQIGSTVDISESRVSTDQPKVLCRRSTSPLISLEYSN  1182
             +I +  ++A AG      YRR+KQ+IG+T D S+ R+STDQ K   R   SPL SLEYSN
Sbjct  316   IIVIITLMA-AGFLIIFCYRRKKQKIGNTSDSSDGRLSTDQAKEFHRAGASPLASLEYSN  374

Query  1181  GWDPLAKDQSGSALSQEVLESFMFNLDEVESATQYFSETNLLGKSSFSAVYKGTLRDGSA  1002
             GWDPL   ++G   S E L +F FNL+E+ESATQ FSE N+LGKS+FS VYKG LRDGS 
Sbjct  375   GWDPLGDSRNGIEFSVEHLNNFRFNLEEIESATQCFSEVNVLGKSNFSTVYKGVLRDGSL  434

Query  1001  VAVKCISKTSCKSDEAEFRKGLTLLTSLKHENLLRLRGFCCSKGRGECFLIYDFVSNGNL  822
             VA+K I+ TSCK +EAEF KGL LLTSL+H+NL RLRGFCCS+GRGECFLIYDF   G+L
Sbjct  435   VAIKSINVTSCKPEEAEFLKGLNLLTSLRHDNLTRLRGFCCSRGRGECFLIYDFAPKGDL  494

Query  821   LRYLDVKDEKGKVLDWSTRTAIIKGIARGIKYLHGNKRNKPALVHRNISADKVLIDHLYK  642
              RYLD++D   +VLDWSTR +II GIA+GI+YLH  +  KPA++HR IS +KVL+D    
Sbjct  495   SRYLDLEDGSNQVLDWSTRVSIINGIAKGIRYLHSIEEKKPAIIHRRISVEKVLLDQQVN  554

Query  641   PLLSDSGLHKLLADDIVFSTLKGSAANGYLAPEYAITGRFTEKSDMYAFGVIILQILSGS  462
             PL++DSGL KLLADDIVFST+K SAA GYLAPEY  TG FTEKSD+YAFGVIILQILSG 
Sbjct  555   PLIADSGLAKLLADDIVFSTIKISAAMGYLAPEYVTTGLFTEKSDIYAFGVIILQILSGK  614

Query  461   CVVTQSNHQGAELCRFEDFVDAKLGKDFVESEAAKLGKIALLCTHDSPSRRPAIDVVIQ  285
              +++ S    A  CR+ DF+D  L  +F E EAAKL KIAL CT D P +RP +  VIQ
Sbjct  615   QLLSNSMRLAAACCRYNDFIDKSLRGNFSEPEAAKLAKIALTCTDDLPDQRPTMKEVIQ  673



>emb|CDX99903.1| BnaC09g28020D [Brassica napus]
Length=676

 Score =   704 bits (1816),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 369/645 (57%), Positives = 459/645 (71%), Gaps = 16/645 (2%)
 Frame = -3

Query  2198  LMAIKASLDPGNLVLSSWSPNVTDPCSVSSFEGIACNDLGQVVNISLQGKGLYGKIPPEI  2019
             L+ IK  LDP    L SWS N  D C    FEG+ C+  GQV NISLQGKGL GK+ P I
Sbjct  32    LLDIKKMLDPEGKHLVSWSIN-GDLCK--DFEGVGCDWKGQVSNISLQGKGLSGKLSPAI  88

Query  2018  GQLNGLSGLYLHFNNLHGVIPKEIASLTQLSDLYLNMNDLSGFIPSEIGNMPNLQVLQLC  1839
              +L  L+GL+LH+N L G IP+E+ +L++L+DLYLN+N+LSG IPS IG M +LQVLQLC
Sbjct  89    AELKHLTGLFLHYNALVGDIPRELGNLSELTDLYLNVNNLSGDIPSHIGKMESLQVLQLC  148

Query  1838  YNRFEGCIPNKLGSLKNLTVLALQSNQLTGAIPASlggltlltrldLSFNRLFGSIPVKL  1659
             YN   G IP ++GSLK L VLALQSN+LTGAIPASLG L  L RLDLS+N LFGS+P KL
Sbjct  149   YNNLTGSIPREIGSLKKLIVLALQSNKLTGAIPASLGDLNALERLDLSYNHLFGSVPGKL  208

Query  1658  SEASKLEVLDLRNNTLSGNVPLGLKRLNEGFRYENNPGLCGTGFPSLALCSDSSLNPTKP  1479
             +    L VLD+RNN+LSGNVP  LKRLNEGF +ENN GLCG  F  L  C+ ++  P +P
Sbjct  209   AVPPLLRVLDIRNNSLSGNVPPVLKRLNEGFAFENNLGLCGAEFSPLKPCNGTA--PEEP  266

Query  1478  EPFGQGSNRLPTKDIPESANIPHQLNQNR-------KPQAAAAVVGVIGLFVILAVAGLF  1320
             +P+       P++ IPESA++    N               + ++G++   + L+   + 
Sbjct  267   KPYSATVKGFPSRAIPESADLQLPCNGTECSGAPSPNSHQGSILIGLVVSTIALSAVSIL  326

Query  1319  TFSWYRRRKQQIGSTVDISESRVSTDQPKVLCRRSTSPLISLEYSNGWDPLAKDQSGSAL  1140
              F+ YRRRKQ++ +  ++SE+ ++    K     + SPL S EYSNGWDPL+ +++ S  
Sbjct  327   LFTHYRRRKQKLSTAYEMSETGLNAKGRK----NNGSPLASFEYSNGWDPLSDNRNLSIF  382

Query  1139  SQEVLESFMFNLDEVESATQYFSETNLLGKSSFSAVYKGTLRDGSAVAVKCISKTSCKSD  960
              QEV++SF FNL+EVE+ATQYFSE NLLG+SSFSA YKG LRDGSAVA+K  SKTSC+S+
Sbjct  383   DQEVIQSFRFNLEEVETATQYFSEVNLLGRSSFSATYKGILRDGSAVAIKRFSKTSCRSE  442

Query  959   EAEFRKGLTLLTSLKHENLLRLRGFCCSKGRGECFLIYDFVSNGNLLRYLDVKDEKGKVL  780
             E EF KGL +L SLKHENL RLRGFCCS+GRGECFLIYD+  NGNLL YLD+KD    VL
Sbjct  443   EPEFLKGLNMLASLKHENLARLRGFCCSRGRGECFLIYDYAPNGNLLSYLDLKDGDTHVL  502

Query  779   DWSTRTAIIKGIARGIKYLHGNKRNKPALVHRNISADKVLIDHLYKPLLSDSGLHKLLAD  600
             DWSTR +I KGIA+GI YLH  K NKPAL+H+NISA+KVLID  Y PLL++SGLH LL +
Sbjct  503   DWSTRVSIAKGIAKGIAYLHSYKGNKPALIHQNISAEKVLIDQRYSPLLANSGLHTLLTN  562

Query  599   DIVFSTLKGSAANGYLAPEYAITGRFTEKSDMYAFGVIILQILSGSCVVTQSNHQGAELC  420
             DIVFS +K SAA GYLAPEY  TGRFTEKSD+YAFGV++ QILSG   V      G E C
Sbjct  563   DIVFSAVKDSAAMGYLAPEYTTTGRFTEKSDVYAFGVLVFQILSGKQEVRSLVKLGTEAC  622

Query  419   RFEDFVDAKLGKDFVESEAAKLGKIALLCTHDSPSRRPAIDVVIQ  285
             RF D++D  L   F E EA KL +IA LCTH+SP  RP+++ V+ 
Sbjct  623   RFHDYIDPNLQGKFFEYEATKLARIAWLCTHESPIERPSVEAVVH  667



>ref|XP_006857826.1| hypothetical protein AMTR_s00069p00033900 [Amborella trichopoda]
 gb|ERN19293.1| hypothetical protein AMTR_s00069p00033900 [Amborella trichopoda]
Length=696

 Score =   704 bits (1817),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 379/662 (57%), Positives = 471/662 (71%), Gaps = 32/662 (5%)
 Frame = -3

Query  2198  LMAIKASLDPGNLVLSSWSPNVTDPCSVSSFEGIACNDLGQVVNISLQGKGLYGKIPPEI  2019
             LMA+K++LDP N +L SW+    DPCS   F+G+ACN+ G+V NISLQGKGL G +P  I
Sbjct  34    LMAMKSALDPDNRLLGSWTKG-GDPCS-GEFQGVACNENGKVANISLQGKGLSGSVPAAI  91

Query  2018  GQLNGLSGLYLHFNNLHGVIPKEIASLTQLSDLYLNMNDLSGFIPSEIGNMPNLQVLQLC  1839
               L  L+GLYLH+N+L G IPKE+++LT L+DLYLN+N LSG IP ++G++PNLQ L+LC
Sbjct  92    SGLKSLTGLYLHYNSLTGPIPKELSNLTLLTDLYLNVNSLSGSIPPDLGSLPNLQALELC  151

Query  1838  YNRFEGCIPNKLGSLKNLTVLALQSNQLTGAIPASlggltlltrldLSFNRLFGSIPVKL  1659
              N+  G IP +LGSLK L VLALQ N L GAIPASLG ++ LTRLDLSFN LFGSIP +L
Sbjct  152   CNQLTGSIPKELGSLKKLNVLALQHNHLRGAIPASLGEISQLTRLDLSFNLLFGSIPGRL  211

Query  1658  SEASKLEVLDLRNNTLSGNVPLGLKRLNEGFRYENNPGLCGTGFPSLALCSDSSLNPTKP  1479
             +    L VLD+RNNTLSGNVP   KRLN+GF+Y NN  LCG  F  L  C  S L P +P
Sbjct  212   TALPLLNVLDVRNNTLSGNVPTAFKRLNDGFQYGNNSDLCGADFLGLQGCKSSDLQPIRP  271

Query  1478  EPFGQGSNR---LPTKDIPESANIP-------------HQLNQNRKPQAAAAVVGVIGLF  1347
             + FG  S      PTK  PES N+              H  +++ K    A V+ V+ + 
Sbjct  272   DAFGPDSTPNGVQPTK--PESVNVQTTPTITGCEQGSGHCSSRSSKSPEIAIVMAVVAVT  329

Query  1346  VILAVAGLFTFSWYRRRKQQIGSTVDISESRVSTDQ-------PKVLCRRSTSPLISLEY  1188
               + + GL  FSWYRRRKQ+IGS  + S+SR+S+DQ            R+S SPLISLEY
Sbjct  330   AGMILGGLLLFSWYRRRKQKIGSAFEPSDSRLSSDQVAKDFSITTTNNRKSASPLISLEY  389

Query  1187  SNGWDPLAKDQSGSALSQEVLESFMFNLDEVESATQYFSETNLLGKSSFSAVYKGTLRDG  1008
             +NGWDPLA +Q GS+L  E L+SF FNL+EVESATQYFS+ NLLGKSSF+AVY+G LRDG
Sbjct  390   ANGWDPLA-EQGGSSL--EGLQSFRFNLEEVESATQYFSDVNLLGKSSFAAVYRGMLRDG  446

Query  1007  SAVAVKCISKTSCKSDEAEFRKGLTLLTSLKHENLLRLRGFCCSKGRGECFLIYDFVSNG  828
             S VA+K I+KTSCK++E EF KGL +LTSL+HENL+ LRGFCCSKGRGECFL+YDF+ NG
Sbjct  447   SVVALKSINKTSCKTEEVEFLKGLKILTSLRHENLVGLRGFCCSKGRGECFLVYDFMPNG  506

Query  827   NLLRYLDVKDEKG-KVLDWSTRTAIIKGIARGIKYLHGNKRNKPALVHRNISADKVLIDH  651
              L RYLD     G +VLDW TR  II GIA+GI+YLHG+  NKPALVH+NISA+KVL+DH
Sbjct  507   TLARYLDGGATSGRRVLDWPTRVKIINGIAKGIEYLHGDMSNKPALVHQNISAEKVLLDH  566

Query  650   LYKPLLSDSGLHKLLADDIVFSTLKGSAANGYLAPEYAITGRFTEKSDMYAFGVIILQIL  471
              + P LSDSG HKLLADD+VFSTLKG AA GYLAPEY   GRFT+KSD+YAFGV++L +L
Sbjct  567   HFNPRLSDSGQHKLLADDVVFSTLKGCAAMGYLAPEYTTVGRFTDKSDVYAFGVLVLHVL  626

Query  470   SGSCVVTQSNHQGAELCRFEDFVDAKLGKDFVESEAAKLGKIALLCTHDSPSRRPAIDVV  291
             +G        H  AE     D +D  L  ++ + EA  +  IAL CT ++PS+RP + +V
Sbjct  627   AGKATSFGGCHL-AESGNLGDLMDPNLKGNYSKEEATHVVSIALRCTSEAPSQRPTMSMV  685

Query  290   IQ  285
             +Q
Sbjct  686   VQ  687



>gb|AES78411.2| LRR receptor-like kinase [Medicago truncatula]
Length=653

 Score =   702 bits (1812),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 376/642 (59%), Positives = 463/642 (72%), Gaps = 25/642 (4%)
 Frame = -3

Query  2198  LMAIKASLDPGNLVLSSWSPNVTDPCSVSSFEGIACNDLGQVVNISLQGKGLYGKIPPEI  2019
             LM IK SLDP N VL SW+ N +DPCS  +F+G+ACN+ G V NISLQGKGL G+IP  I
Sbjct  25    LMLIKDSLDPENHVLLSWN-NHSDPCS-GTFDGVACNEQGLVTNISLQGKGLSGEIPSVI  82

Query  2018  GQLNGLSGLYLHFNNLHGVIPKEIASLTQLSDLYLNMNDLSGFIPSEIGNMPNLQVLQLC  1839
             G+L  L+GLYLHFN L+G++PKEIA LTQLSDLYLN+N+LSGFIP EIGNM NLQVLQLC
Sbjct  83    GKLKSLTGLYLHFNALNGILPKEIAGLTQLSDLYLNVNNLSGFIPHEIGNMSNLQVLQLC  142

Query  1838  YNRFEGCIPNKLGSLKNLTVLALQSNQLTGAIPASlggltlltrldLSFNRLFGSIPVKL  1659
             +N   G IP +LG LK L+VLALQ N L+GAIPASLG L  L RLDLSFN L G IPV L
Sbjct  143   HNELNGSIPTELGKLKRLSVLALQYNHLSGAIPASLGELETLERLDLSFNTLLGPIPVTL  202

Query  1658  SEASKLEVLDLRNNTLSGNVPLGLKRLNEGFRYENNPGLCGTGFPSLALCSD-SSLNPTK  1482
             + A KLE LD+RNN+LSG+VP  LKRL EGF+Y NN GLCGTGF  L  C   S+ +P +
Sbjct  203   ANAPKLETLDIRNNSLSGSVPTDLKRLKEGFQYFNNHGLCGTGFAHLDSCQIVSNSDPVR  262

Query  1481  PEPFGQ---GSNRLPTKDIPESANIPHQLNQNRKPQAAAAVV-GVIGLFVILAVAGLFTF  1314
             PEP+      +   PT   P S N  +   + R   +   +V  VIG+  + A+ GLF  
Sbjct  263   PEPYDPSNISTIEFPTTPEPTSKNCGNSGCRRRSDSSTIGLVFAVIGVVSVSALTGLFLI  322

Query  1313  SWYRRRKQQIGSTVDISESRVSTDQPKVLCRRSTSPLISLEYSNGWDPLAKDQSGSALSQ  1134
               +RR KQ+IG+TV+IS++R+STD+ K + R+  SPLI+LEYS+GWDPL+KD    + SQ
Sbjct  323   LRHRRLKQKIGNTVEISDNRLSTDKIKEVYRKKASPLINLEYSSGWDPLSKDL--GSYSQ  380

Query  1133  EVLESFMFNLDEVESATQYFSETNLLGKSSFSAVYKGTLRDGSAVAVKCISKTSCKSDEA  954
             E L+SFMFNL+EV+ ATQ FSE NLL K++ S+ Y+G LRDGS V +KCI KTSCKSDE 
Sbjct  381   EFLQSFMFNLEEVDRATQCFSEMNLLAKNNISSNYRGILRDGSIVVIKCIPKTSCKSDET  440

Query  953   EFRKGLTLLTSLKHENLLRLRGFCCSKGRGECFLIYDFVSNGNLLRYLDVKDEKGKVLDW  774
             EF  GL +LTSLKHENL+RLRGFCCSK RGECFL+YDFVSNG L +YLDV+ E  +VL+W
Sbjct  441   EFLNGLKILTSLKHENLVRLRGFCCSKSRGECFLVYDFVSNGRLSKYLDVQRESAEVLEW  500

Query  773   STRTAIIKGIARGIKYLHGNKRNKPALVHRNISADKVLIDHLYKPLLSDSGLHKLLADDI  594
             STR +II GIA+GI YLHG K  K  LVH++ISA+KVL+D  YK LL+DSG         
Sbjct  501   STRVSIIHGIAKGIFYLHGKKGRKHXLVHQSISAEKVLLDSRYKSLLADSGF--------  552

Query  593   VFSTLKGSAANGYLAPEYAITGRFTEKSDMYAFGVIILQILSGSCVVTQSNHQGAELCRF  414
                     AA GYLAPEY  TGRFTEKSD+YAFG+I+ QIL+G   +TQ + Q  E    
Sbjct  553   --------AAMGYLAPEYTTTGRFTEKSDVYAFGMIVFQILTGKHDITQLSRQCVETGTL  604

Query  413   EDFVDAKLGKDFVESEAAKLGKIALLCTHDSPSRRPAIDVVI  288
             +D +D  L   F+ESEA KL ++AL+CT +SP  RP ++ V+
Sbjct  605   KDIIDENLEGKFLESEAEKLARLALVCTDESPHLRPTMENVM  646



>ref|XP_002303531.2| leucine-rich repeat transmembrane protein kinase [Populus trichocarpa]
 gb|EEE78510.2| leucine-rich repeat transmembrane protein kinase [Populus trichocarpa]
Length=631

 Score =   701 bits (1810),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 368/626 (59%), Positives = 456/626 (73%), Gaps = 11/626 (2%)
 Frame = -3

Query  2195  MAIKASLDPGNLVLSSWSPNVTDPCSVSSFEGIACNDLGQVVNISLQGKGLYGKIPPEIG  2016
             M +K++LDP N  L SW+ +  DPCS   FEG+ACN+ G V NISLQGKGL G + P + 
Sbjct  1     MELKSALDPTNKYLKSWASD-GDPCS-GLFEGVACNEHGNVANISLQGKGLSGTLSPAVA  58

Query  2015  QLNGLSGLYLHFNNLHGVIPKEIASLTQLSDLYLNMNDLSGFIPSEIGNMPNLQVLQLCY  1836
             +L  LSGLYLH+N+L G IPKEIA LT+LSDLYLN+N++SG IP E+GNM +LQVL+LC 
Sbjct  59    ELKSLSGLYLHYNSLSGEIPKEIADLTELSDLYLNVNNISGSIPPEMGNMASLQVLELCC  118

Query  1835  NRFEGCIPNKLGSLKNLTVLALQSNQLTGAIPASlggltlltrldLSFNRLFGSIPVKLS  1656
             N+  G IP ++GSLK L+VLALQ N+LT  IPASLG L +L  L +SFN L GSIP  ++
Sbjct  119   NQLAGNIPPEMGSLKRLSVLALQYNRLTDQIPASLGTLGMLKMLYMSFNHLSGSIPQGIA  178

Query  1655  EASKLEVLDLRNNTLSGNVPLGLKRLNEGFRYENNPGLCGTGFPSLALCSDSSLNPTKPE  1476
                ++EVLD+RNN+LSG VP  LKRLN GF++ENNPGLCGTGFP L  C ++  +  +  
Sbjct  179   NIPQMEVLDVRNNSLSGIVPSALKRLNGGFQFENNPGLCGTGFPLLRAC-NAVFDINQVG  237

Query  1475  PFGQGSNRLPTKDIPES------ANIPHQLNQNRKPQAAAAVVGVIGLFVILAVAGLFTF  1314
             P G  +N    K IP+S       N+ H  N ++ PQAA  V GVI + V L  AG    
Sbjct  238   PLGPIANNTAQKVIPQSEILQAHCNLTHCSNSSKLPQAAI-VAGVITVTVTLMGAGFMII  296

Query  1313  SWYRRRKQQIGSTVDISESRVSTDQPKVLCRRSTSPLISLEYSNGWDPLAKDQSGSALSQ  1134
               YRR+KQ+IG+T D SE R+ST Q K   R   SPL+SLEYSNGWDPL   ++G  +S 
Sbjct  297   FLYRRKKQKIGNTSDFSEGRLSTHQAKEFHRAGASPLVSLEYSNGWDPLGDSRNGIEISG  356

Query  1133  EVLESFMFNLDEVESATQYFSETNLLGKSSFSAVYKGTLRDGSAVAVKCISKTSCKSDEA  954
             E L +F FNL+E+ESAT+ FSE N+LGKSSFS VYKG LRDGS VA++ I+ TSCK +EA
Sbjct  357   EHLNNFRFNLEEIESATRCFSEVNVLGKSSFSTVYKGILRDGSLVAIRSINLTSCKPEEA  416

Query  953   EFRKGLTLLTSLKHENLLRLRGFCCSKGRGECFLIYDFVSNGNLLRYLDVKDEKGKVLDW  774
             EF KGL LLTSL+H NL RLRGFCCS+GRGECFLIYDF   G+L RYLD++D   +VLDW
Sbjct  417   EFVKGLDLLTSLRHNNLTRLRGFCCSRGRGECFLIYDFAPRGDLSRYLDLEDGSNQVLDW  476

Query  773   STRTAIIKGIARGIKYLHGNKRNKPALVHRNISADKVLIDHLYKPLLSDSGLHKLLADDI  594
             S R  II GIA+GI+YLH ++ NKP ++HR IS +KVL+D  + PL++DSGL KLLADD+
Sbjct  477   SARVYIINGIAKGIRYLHSSEENKPVMIHRRISVEKVLLDQQFNPLIADSGLAKLLADDV  536

Query  593   VFSTLKGSAANGYLAPEYAITGRFTEKSDMYAFGVIILQILSG-SCVVTQSNHQGAELCR  417
             VFST+K SAA GYL+PEY  TG FTEKSD+YAFGVIILQILSG   + ++S    A  C 
Sbjct  537   VFSTIKISAAMGYLSPEYVTTGLFTEKSDIYAFGVIILQILSGKQMLYSKSMRLAAACCM  596

Query  416   FEDFVDAKLGKDFVESEAAKLGKIAL  339
             ++DFVD  L  +F ESEAAKL KIAL
Sbjct  597   YDDFVDTSLQGNFSESEAAKLAKIAL  622



>ref|XP_006368702.1| leucine-rich repeat transmembrane protein kinase [Populus trichocarpa]
 gb|ERP65271.1| leucine-rich repeat transmembrane protein kinase [Populus trichocarpa]
Length=682

 Score =   703 bits (1814),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 384/656 (59%), Positives = 470/656 (72%), Gaps = 10/656 (2%)
 Frame = -3

Query  2231  ETSNNASTVSLLMAIKASLDPGNLVLSSWSPNVTDPCSVSSFEGIACNDLGQVVNISLQG  2052
             + S N + +  L+ +K +LDP N  L SW+ +  DPCS   FEG+ACN+ GQV NISLQG
Sbjct  21    KISGNNTELEALVKLKFALDPNNKYLQSWTSD-GDPCS-GLFEGVACNEHGQVANISLQG  78

Query  2051  KGLYGKIPPEIGQLNGLSGLYLHFNNLHGVIPKEIASLTQLSDLYLNMNDLSGFIPSEIG  1872
             KGL G I P + +L  LSGLYLH+N+L G IPKEI +L  LSDLYLN+N+LSG IP EIG
Sbjct  79    KGLSGTISPAVAELKSLSGLYLHYNSLSGEIPKEIVNLVGLSDLYLNVNNLSGSIPPEIG  138

Query  1871  NMPNLQVLQLCYNRFEGCIPNKLGSLKNLTVLALQSNQLTGAIPASlggltlltrldLSF  1692
             +M +LQVL+LC N+  G IP ++GSLK L+VLALQ N+L G IPASLG L +L RLD+SF
Sbjct  139   SMASLQVLELCCNQLAGYIPTEMGSLKRLSVLALQYNRLVGQIPASLGTLGMLKRLDMSF  198

Query  1691  NRLFGSIPVKLSEASKLEVLDLRNNTLSGNVPLGLKRLNEGFRYENNPGLCGTGFPSLAL  1512
             N L G+IP  ++   +LEVLD+RNN+LSG VP  LKRLN GF++ENN GLCGTGF  L  
Sbjct  199   NYLSGTIPQGIANIPRLEVLDVRNNSLSGTVPFALKRLNGGFQFENNQGLCGTGFHPLRA  258

Query  1511  CSD-SSLNPTKPEPFGQGSNRLPTKDIPESA------NIPHQLNQNRKPQAAAAVVGVIG  1353
             CS   ++N  +    G  +N    K  P+SA      N  H  N ++ PQAA  V GVI 
Sbjct  259   CSAFDNMNINQVGSLGPIANNSAKKVTPQSAILQAHCNQTHCSNSSKLPQAAI-VAGVII  317

Query  1352  LFVILAVAGLFTFSWYRRRKQQIGSTVDISESRVSTDQPKVLCRRSTSPLISLEYSNGWD  1173
             + + L  AG      YRR+KQ+IG+T D S+ R+STDQ K   R   SPL SLEYSNGWD
Sbjct  318   VTITLMGAGFLIIFCYRRKKQKIGNTSDSSDGRLSTDQAKEFHRAGASPLASLEYSNGWD  377

Query  1172  PLAKDQSGSALSQEVLESFMFNLDEVESATQYFSETNLLGKSSFSAVYKGTLRDGSAVAV  993
             PL   ++G   S E L +F FNL+E+ESATQ FSE N+LGKSSFS VYKG LRDGS VA+
Sbjct  378   PLGDSRNGIEFSVEHLNNFRFNLEEIESATQCFSEVNVLGKSSFSTVYKGVLRDGSIVAI  437

Query  992   KCISKTSCKSDEAEFRKGLTLLTSLKHENLLRLRGFCCSKGRGECFLIYDFVSNGNLLRY  813
             K I+ TSCK +EAEF KGL LLTSL+H+NL RLRGFCCS+GRGECFLIYDF   G+L RY
Sbjct  438   KSINVTSCKPEEAEFVKGLNLLTSLRHDNLTRLRGFCCSRGRGECFLIYDFAPKGDLSRY  497

Query  812   LDVKDEKGKVLDWSTRTAIIKGIARGIKYLHGNKRNKPALVHRNISADKVLIDHLYKPLL  633
             LD++D   +VLDWSTR +II GIA+GI+YLH  +  KPA++HR IS +KVL+D    PL+
Sbjct  498   LDLEDGSNQVLDWSTRVSIINGIAKGIRYLHSIEEKKPAIIHRRISVEKVLLDQQVNPLI  557

Query  632   SDSGLHKLLADDIVFSTLKGSAANGYLAPEYAITGRFTEKSDMYAFGVIILQILSGSCVV  453
             +DSGL KLLADDIVFST+K SAA GYLAPEY  TG FTEKSD+Y+FGVIILQILSG  ++
Sbjct  558   ADSGLAKLLADDIVFSTIKISAAMGYLAPEYVTTGLFTEKSDIYSFGVIILQILSGKQLL  617

Query  452   TQSNHQGAELCRFEDFVDAKLGKDFVESEAAKLGKIALLCTHDSPSRRPAIDVVIQ  285
             + S    A  CR+ DF+D  L  +F ESEAAKL KIAL CT D P +RP +  VIQ
Sbjct  618   SNSMRLAAACCRYNDFIDTSLRGNFSESEAAKLAKIALACTDDLPDQRPTMKEVIQ  673



>ref|XP_002509606.1| leucine rich repeat receptor kinase, putative [Ricinus communis]
 gb|EEF50993.1| leucine rich repeat receptor kinase, putative [Ricinus communis]
Length=693

 Score =   703 bits (1814),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 369/644 (57%), Positives = 467/644 (73%), Gaps = 8/644 (1%)
 Frame = -3

Query  2198  LMAIKASLDPGNLVLSSWSPNVTDPCSVSSFEGIACNDLGQVVNISLQGKGLYGKIPPEI  2019
             L+ +K++LDP N  L SW+ +  DPCS  SFEG+ACN+  +V NISLQG+GL G I P +
Sbjct  47    LIELKSALDPTNKFLQSWAAD-GDPCS-GSFEGVACNEHRKVANISLQGRGLSGSISPAV  104

Query  2018  GQLNGLSGLYLHFNNLHGVIPKEIASLTQLSDLYLNMNDLSGFIPSEIGNMPNLQVLQLC  1839
              +L  LSGLYLH+N+L G IPKE+A+LT+LSD+YLN+N+LSG IP EIG M +LQVL+LC
Sbjct  105   AKLKCLSGLYLHYNSLSGEIPKELANLTELSDVYLNVNNLSGSIPPEIGGMASLQVLELC  164

Query  1838  YNRFEGCIPNKLGSLKNLTVLALQSNQLTGAIPASlggltlltrldLSFNRLFGSIPVKL  1659
              N+  G IP ++ SLK LTV+ALQ N+LT  IPA LG L +L RLDL FN L G IP+ L
Sbjct  165   CNQLTGSIPREMDSLKRLTVVALQYNRLTDQIPAGLGNLGMLRRLDLGFNNLSGPIPITL  224

Query  1658  SEASKLEVLDLRNNTLSGNVPLGLKRLNEGFRYENNPGLCGTGFPSLALCSD-SSLNPTK  1482
             + A +L+VLD+RNN+LSG VP  L++LN GF++ENN GLCG GFP L  C+   ++N  +
Sbjct  225   ANAPQLQVLDVRNNSLSGMVPSALQKLNGGFQFENNKGLCGAGFPELRACTAFDNMNINQ  284

Query  1481  PEPFGQGSNRLPTKDIPESANIPHQLNQNR-----KPQAAAAVVGVIGLFVILAVAGLFT  1317
              EP G  +N   +K+IP SA +    +Q +     K    A + GV    +IL       
Sbjct  285   VEPSGSITNTTTSKNIPVSAILQAPCDQTKCSNSSKFPQVAIISGVTTATIILIGVAFLI  344

Query  1316  FSWYRRRKQQIGSTVDISESRVSTDQPKVLCRRSTSPLISLEYSNGWDPLAKDQSGSALS  1137
               +YRR+KQ+IG+  + SE R+STD+ K   R   SPL+SLEYSNGWDP    ++G  +S
Sbjct  345   IFFYRRQKQKIGNISESSEGRLSTDKAKEFHRAGASPLVSLEYSNGWDPFRGCRNGVGIS  404

Query  1136  QEVLESFMFNLDEVESATQYFSETNLLGKSSFSAVYKGTLRDGSAVAVKCISKTSCKSDE  957
             +  L +F FNL+EVESATQ FSE NLLGKSSFS+VYKG LR GS VAV+ I+ TSCKS+E
Sbjct  405   EPSLNNFRFNLEEVESATQCFSEVNLLGKSSFSSVYKGILRGGSLVAVRSINITSCKSEE  464

Query  956   AEFRKGLTLLTSLKHENLLRLRGFCCSKGRGECFLIYDFVSNGNLLRYLDVKDEKGKVLD  777
              EF KGL LLTSL+H+NL+RLRGFCCSKGRGECFLIYDF   GNL RYLD++D    +L+
Sbjct  465   DEFVKGLNLLTSLRHDNLVRLRGFCCSKGRGECFLIYDFAPMGNLSRYLDLEDGSSHILE  524

Query  776   WSTRTAIIKGIARGIKYLHGNKRNKPALVHRNISADKVLIDHLYKPLLSDSGLHKLLADD  597
             WSTR +II GIA+GI+YLH  + NKPA++HR +S +KVL+D  +KPL++DSGLHKLLADD
Sbjct  525   WSTRVSIINGIAKGIEYLHRREVNKPAIIHRRVSIEKVLLDQEFKPLMADSGLHKLLADD  584

Query  596   IVFSTLKGSAANGYLAPEYAITGRFTEKSDMYAFGVIILQILSGSCVVTQSNHQGAELCR  417
             IVFS LK SAA GYLAPEY  TG FTEKSD+YAFGVIILQILSG  +++      A   R
Sbjct  585   IVFSGLKTSAAMGYLAPEYVTTGHFTEKSDIYAFGVIILQILSGQHMLSNLMRLAAASSR  644

Query  416   FEDFVDAKLGKDFVESEAAKLGKIALLCTHDSPSRRPAIDVVIQ  285
             +EDF+D  L  +F ESEAA L KIAL CT + P +RP ++ VIQ
Sbjct  645   YEDFIDTNLKGNFSESEAAMLSKIALDCTQELPEQRPTMEAVIQ  688



>ref|XP_003622193.1| Receptor-like protein kinase [Medicago truncatula]
Length=656

 Score =   699 bits (1805),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 377/645 (58%), Positives = 464/645 (72%), Gaps = 28/645 (4%)
 Frame = -3

Query  2198  LMAIKASLDPGNLVLSSWSPNVTDPCSVSSFEGIACNDLGQVVNISLQGKGLYGKIPPEI  2019
             LM IK SLDP N VL SW+ N +DPCS  +F+G+ACN+ G V NISLQGKGL G+IP  I
Sbjct  25    LMLIKDSLDPENHVLLSWN-NHSDPCS-GTFDGVACNEQGLVTNISLQGKGLSGEIPSVI  82

Query  2018  GQLNGLSGLYLHFNNLHGVIPKEIASLTQLSDLYLNMNDLSGFIPSEIGNMPNLQVLQLC  1839
             G+L  L+GLYLHFN L+G++PKEIA LTQLSDLYLN+N+LSGFIP EIGNM NLQVLQLC
Sbjct  83    GKLKSLTGLYLHFNALNGILPKEIAGLTQLSDLYLNVNNLSGFIPHEIGNMSNLQVLQLC  142

Query  1838  YNRFEGCIPNKLGSLKNLTVLALQSNQLTGAIPASlggltlltrldLSFNRLFGSIPVKL  1659
             +N   G IP +LG LK L+VLALQ N L+GAIPASLG L  L RLDLSFN L G IPV L
Sbjct  143   HNELNGSIPTELGKLKRLSVLALQYNHLSGAIPASLGELETLERLDLSFNTLLGPIPVTL  202

Query  1658  SEASKLEVLDLRNNTLSGNVPLG---LKRLNEGFRYENNPGLCGTGFPSLALCSD-SSLN  1491
             + A KLE LD+RNN+LSG+VP G   LKRL EGF+Y NN GLCGTGF  L  C   S+ +
Sbjct  203   ANAPKLETLDIRNNSLSGSVPTGNKNLKRLKEGFQYFNNHGLCGTGFAHLDSCQIVSNSD  262

Query  1490  PTKPEPFGQG---SNRLPTKDIPESANIPHQLNQNRKPQAAAAVV-GVIGLFVILAVAGL  1323
             P +PEP+      +   PT   P S N  +   + R   +   +V  VIG+  + A+ GL
Sbjct  263   PVRPEPYDPSNISTIEFPTTPEPTSKNCGNSGCRRRSDSSTIGLVFAVIGVVSVSALTGL  322

Query  1322  FTFSWYRRRKQQIGSTVDISESRVSTDQPKVLCRRSTSPLISLEYSNGWDPLAKDQSGSA  1143
             F    +RR KQ+IG+TV+IS++R+STD+ K + R+  SPLI+LEYS+GWDPL+KD    +
Sbjct  323   FLILRHRRLKQKIGNTVEISDNRLSTDKIKEVYRKKASPLINLEYSSGWDPLSKDLG--S  380

Query  1142  LSQEVLESFMFNLDEVESATQYFSETNLLGKSSFSAVYKGTLRDGSAVAVKCISKTSCKS  963
              SQE L+SFMFNL+EV+ ATQ FSE NLL K++ S+ Y+G LRDGS V +KCI KTSCKS
Sbjct  381   YSQEFLQSFMFNLEEVDRATQCFSEMNLLAKNNISSNYRGILRDGSIVVIKCIPKTSCKS  440

Query  962   DEAEFRKGLTLLTSLKHENLLRLRGFCCSKGRGECFLIYDFVSNGNLLRYLDVKDEKGKV  783
             DE EF  GL +LTSLKHENL+RLRGFCCSK RGECFL+YDFVSNG L +YLDV+ E  +V
Sbjct  441   DETEFLNGLKILTSLKHENLVRLRGFCCSKSRGECFLVYDFVSNGRLSKYLDVQRESAEV  500

Query  782   LDWSTRTAIIKGIARGIKYLHGNKRNKPALVHRNISADKVLIDHLYKPLLSDSGLHKLLA  603
             L+WSTR +II GIA+GI YLHG K  K  LVH++ISA+KVL+D  YK LL+DSG      
Sbjct  501   LEWSTRVSIIHGIAKGIFYLHGKKGRKHXLVHQSISAEKVLLDSRYKSLLADSGF-----  555

Query  602   DDIVFSTLKGSAANGYLAPEYAITGRFTEKSDMYAFGVIILQILSGSCVVTQSNHQGAEL  423
                        AA GYLAPEY  TGRFTEKSD+YAFG+I+ QIL+G   +TQ + Q  E 
Sbjct  556   -----------AAMGYLAPEYTTTGRFTEKSDVYAFGMIVFQILTGKHDITQLSRQCVET  604

Query  422   CRFEDFVDAKLGKDFVESEAAKLGKIALLCTHDSPSRRPAIDVVI  288
                +D +D  L   F+ESEA KL ++AL+CT +SP  RP ++ V+
Sbjct  605   GTLKDIIDENLEGKFLESEAEKLARLALVCTDESPHLRPTMENVM  649



>ref|XP_006440406.1| hypothetical protein CICLE_v10019076mg [Citrus clementina]
 gb|ESR53646.1| hypothetical protein CICLE_v10019076mg [Citrus clementina]
Length=708

 Score =   701 bits (1808),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 382/648 (59%), Positives = 473/648 (73%), Gaps = 14/648 (2%)
 Frame = -3

Query  2198  LMAIKASLDPGNLVLSSWSPNVTDPCSVSSFEGIACNDLGQVVNISLQGKGLYGKIPPEI  2019
             L+ +KASLDP N +L SW+ N  DPCS  SFEGIACN+  +V NISLQGKGL GK+ P +
Sbjct  50    LLDLKASLDPENKLLQSWTEN-GDPCS-GSFEGIACNEHRKVANISLQGKGLTGKLSPSL  107

Query  2018  GQLNGLSGLYLHFNNLHGVIPKEIASLTQLSDLYLNMNDLSGFIPSEIGNMPNLQVLQLC  1839
               L  LSGLYLH+N+L G IPKEI +LT+L+DLYL++N+LSG IP EIG+M +LQVLQLC
Sbjct  108   SGLKCLSGLYLHYNSLSGEIPKEIRNLTELTDLYLDVNNLSGNIPPEIGSMASLQVLQLC  167

Query  1838  YNRFEGCIPNKLGSLKNLTVLALQSNQLTGAIPASlggltlltrldLSFNRLFGSIPVKL  1659
              N+  G IP ++GSLK+L+VL LQ N+L G IP SLG L  L RLDLSFN LFG+IP  L
Sbjct  168   CNQLTGNIPAQIGSLKSLSVLTLQHNRLNGGIPDSLGNLGKLKRLDLSFNSLFGTIPESL  227

Query  1658  SEASKLEVLDLRNNTLSGNVPLGLKRLNEGFRYENNPGLCGTGFPSLALCS---DSSLNP  1488
             +  ++L  LD++NNTLSG VP  LKRLN GF+++NNPGLCG G  SL  C+   ++ +NP
Sbjct  228   ANNAELLFLDVQNNTLSGIVPSALKRLNGGFQFQNNPGLCGDGIASLRACTVYDNTQINP  287

Query  1487  TKPEPFGQGSNRLPTKDIPESANIPHQLNQNR-----KPQAAAAVVGVIGLFVILAVAGL  1323
              KP  FG  SN     DI E +      NQ++     K    A +  V  + VILA  G+
Sbjct  288   VKP--FGSHSNDTTPIDISEPSGFKEHCNQSQCSNSSKFPQIAVLAAVTSVTVILAGTGI  345

Query  1322  FTFSWYRRRKQQIGSTVDISESRVSTDQ--PKVLCRRSTSPLISLEYSNGWDPLAKDQSG  1149
               F  YRRRKQ+IG+T + S+ ++STD    K   R   SPL+SLEY +GWDPL    +G
Sbjct  346   LIFFRYRRRKQKIGNTSESSDWQLSTDLTLAKDFNRNGASPLVSLEYCHGWDPLGDYLNG  405

Query  1148  SALSQEVLESFMFNLDEVESATQYFSETNLLGKSSFSAVYKGTLRDGSAVAVKCISKTSC  969
             +  S+E L SF  NL+EVESATQ FSE NLLGK +FS+VYKGTLRDGS VA++ I+ TSC
Sbjct  406   TGFSREHLNSFRLNLEEVESATQCFSEVNLLGKGNFSSVYKGTLRDGSLVAIRSINVTSC  465

Query  968   KSDEAEFRKGLTLLTSLKHENLLRLRGFCCSKGRGECFLIYDFVSNGNLLRYLDVKDEKG  789
             KS+EAEF KGL LLTSL+HEN++RLRGFCCS+GRGECFLIYDF   G L +YLD ++   
Sbjct  466   KSEEAEFVKGLYLLTSLRHENIIRLRGFCCSRGRGECFLIYDFAPKGKLSKYLDQEEGSS  525

Query  788   KVLDWSTRTAIIKGIARGIKYLHGNKRNKPALVHRNISADKVLIDHLYKPLLSDSGLHKL  609
              VLDWSTR +II GIA+GI YLH ++ NKPA+VHRN+S +KVLID  + PL++D GLHKL
Sbjct  526   NVLDWSTRVSIIIGIAKGIGYLHSSEVNKPAIVHRNLSVEKVLIDQQFNPLIADCGLHKL  585

Query  608   LADDIVFSTLKGSAANGYLAPEYAITGRFTEKSDMYAFGVIILQILSGSCVVTQSNHQGA  429
             LADDIVFS LK SAA GYLAPEY  TGRF+E+SD++AFGVIILQILSGS V+T S    A
Sbjct  586   LADDIVFSVLKTSAAMGYLAPEYVTTGRFSERSDVFAFGVIILQILSGSLVLTSSMRLAA  645

Query  428   ELCRFEDFVDAKLGKDFVESEAAKLGKIALLCTHDSPSRRPAIDVVIQ  285
             E   FE+F+D  L   F ESEAAKLGK+AL+CTH+ P  RP ++ VI+
Sbjct  646   ESATFENFIDRNLKGKFSESEAAKLGKMALVCTHEDPENRPTMEAVIE  693



>gb|KDO63769.1| hypothetical protein CISIN_1g005586mg [Citrus sinensis]
Length=689

 Score =   697 bits (1800),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 380/648 (59%), Positives = 472/648 (73%), Gaps = 14/648 (2%)
 Frame = -3

Query  2198  LMAIKASLDPGNLVLSSWSPNVTDPCSVSSFEGIACNDLGQVVNISLQGKGLYGKIPPEI  2019
             L+ +KASLDP N +L SW+ N  DPCS  SFEGIACN+  +V NISLQGKGL GK+ P +
Sbjct  31    LLDLKASLDPENKLLQSWTEN-GDPCS-GSFEGIACNEHRKVANISLQGKGLTGKLSPSL  88

Query  2018  GQLNGLSGLYLHFNNLHGVIPKEIASLTQLSDLYLNMNDLSGFIPSEIGNMPNLQVLQLC  1839
               L  LSGLYLH+N+L G IPKEI +LT+L+DLYL++N+LSG IP EIG+M +LQVLQLC
Sbjct  89    SGLKCLSGLYLHYNSLSGEIPKEIRNLTELTDLYLDVNNLSGNIPPEIGSMASLQVLQLC  148

Query  1838  YNRFEGCIPNKLGSLKNLTVLALQSNQLTGAIPASlggltlltrldLSFNRLFGSIPVKL  1659
              N+  G IP ++GSLK+L+VL LQ N+L G IP SLG L  L RLDLSFN LFG+IP  L
Sbjct  149   CNQLTGNIPAQIGSLKSLSVLTLQHNRLNGGIPDSLGNLGKLKRLDLSFNSLFGTIPESL  208

Query  1658  SEASKLEVLDLRNNTLSGNVPLGLKRLNEGFRYENNPGLCGTGFPSLALCS---DSSLNP  1488
             +  ++L  LD++NNTLSG VP  LKRLN GF+++NNPGLCG G  SL  C+   ++ +NP
Sbjct  209   ANNAELLFLDVQNNTLSGIVPSALKRLNGGFQFQNNPGLCGDGIASLRACTVYDNTQINP  268

Query  1487  TKPEPFGQGSNRLPTKDIPESANIPHQLNQNR-----KPQAAAAVVGVIGLFVILAVAGL  1323
              KP  FG  SN     DI E +      NQ++     K    A +  V  + VILA  G+
Sbjct  269   VKP--FGSHSNDTTPIDISEPSGFKEHCNQSQCSNSSKFPQIAVLAAVTSVTVILAGTGI  326

Query  1322  FTFSWYRRRKQQIGSTVDISESRVSTDQ--PKVLCRRSTSPLISLEYSNGWDPLAKDQSG  1149
               F  YRR KQ+IG+T + S+ ++STD    K   R   SPL+SLEY +GWDPL    +G
Sbjct  327   LIFFRYRRHKQKIGNTSESSDWQLSTDLTLAKDFNRNGASPLVSLEYCHGWDPLGDYLNG  386

Query  1148  SALSQEVLESFMFNLDEVESATQYFSETNLLGKSSFSAVYKGTLRDGSAVAVKCISKTSC  969
             +  S+E L SF  NL+EVESATQ FSE NLLGK +FS+VYKGTLRDG+ VA++ I+ TSC
Sbjct  387   TGFSREHLNSFRLNLEEVESATQCFSEVNLLGKGNFSSVYKGTLRDGTLVAIRSINVTSC  446

Query  968   KSDEAEFRKGLTLLTSLKHENLLRLRGFCCSKGRGECFLIYDFVSNGNLLRYLDVKDEKG  789
             KS+EAEF KGL LLTSL+HEN++RLRGFCCS+GRGECFLIYDF   G L +YLD ++   
Sbjct  447   KSEEAEFVKGLYLLTSLRHENIIRLRGFCCSRGRGECFLIYDFAPKGKLSKYLDQEEGSS  506

Query  788   KVLDWSTRTAIIKGIARGIKYLHGNKRNKPALVHRNISADKVLIDHLYKPLLSDSGLHKL  609
              VLDWSTR +II GIA+GI YLH ++ NKPA+VHRN+S +KVLID  + PL++D GLHKL
Sbjct  507   NVLDWSTRVSIIIGIAKGIGYLHSSEVNKPAIVHRNLSVEKVLIDQQFNPLIADCGLHKL  566

Query  608   LADDIVFSTLKGSAANGYLAPEYAITGRFTEKSDMYAFGVIILQILSGSCVVTQSNHQGA  429
             LADDIVFS LK SAA GYLAPEY  TGRFTE+SD++AFGVIILQIL+GS V+T S    A
Sbjct  567   LADDIVFSVLKTSAAMGYLAPEYVTTGRFTERSDIFAFGVIILQILTGSLVLTSSMRLAA  626

Query  428   ELCRFEDFVDAKLGKDFVESEAAKLGKIALLCTHDSPSRRPAIDVVIQ  285
             E   FE+F+D  L   F ESEAAKLGK+AL+CTH+ P  RP ++ VI+
Sbjct  627   ESATFENFIDRNLKGKFSESEAAKLGKMALVCTHEDPENRPTMEAVIE  674



>ref|XP_006477275.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g34110-like [Citrus sinensis]
Length=720

 Score =   698 bits (1801),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 380/648 (59%), Positives = 472/648 (73%), Gaps = 14/648 (2%)
 Frame = -3

Query  2198  LMAIKASLDPGNLVLSSWSPNVTDPCSVSSFEGIACNDLGQVVNISLQGKGLYGKIPPEI  2019
             L+ +KASLDP N +L SW+ N  DPCS  SFEGIACN+  +V NISLQGKGL GK+ P +
Sbjct  62    LLDLKASLDPENKLLQSWTEN-GDPCS-GSFEGIACNEHRKVANISLQGKGLTGKLSPAL  119

Query  2018  GQLNGLSGLYLHFNNLHGVIPKEIASLTQLSDLYLNMNDLSGFIPSEIGNMPNLQVLQLC  1839
               L  LSGLYLH+N+L G IPKEI +LT+L+DLY+++N+LSG IP EIG+M +LQVLQLC
Sbjct  120   SGLKCLSGLYLHYNSLSGEIPKEIRNLTELTDLYVDVNNLSGNIPPEIGSMASLQVLQLC  179

Query  1838  YNRFEGCIPNKLGSLKNLTVLALQSNQLTGAIPASlggltlltrldLSFNRLFGSIPVKL  1659
              N+  G IP ++GSLK+L VL LQ N+L GAIP SLG L  L RLDLSFN LFG+IP  L
Sbjct  180   CNQLTGNIPAQIGSLKSLNVLTLQHNRLNGAIPDSLGNLGKLKRLDLSFNSLFGTIPESL  239

Query  1658  SEASKLEVLDLRNNTLSGNVPLGLKRLNEGFRYENNPGLCGTGFPSLALCS---DSSLNP  1488
             +  ++L  LD++NNTLSG VP  LKRLN GF+++NNPGLCG G  SL  C+   ++ +NP
Sbjct  240   ANNAELLFLDVQNNTLSGIVPSALKRLNGGFQFQNNPGLCGDGIASLRACTVYDNTQINP  299

Query  1487  TKPEPFGQGSNRLPTKDIPESANIPHQLNQNR-----KPQAAAAVVGVIGLFVILAVAGL  1323
              KP  FG  SN     DI E +      NQ++     K    A +  V  + VILA  G+
Sbjct  300   VKP--FGSHSNDTTPIDISEPSGFKEHCNQSQCSNSSKFPQIAVLAAVTSVTVILAGTGI  357

Query  1322  FTFSWYRRRKQQIGSTVDISESRVSTDQ--PKVLCRRSTSPLISLEYSNGWDPLAKDQSG  1149
               F  YRR KQ+IG+T + S+ ++STD    K   R   SPL+SLEY +GWDPL    +G
Sbjct  358   LIFFRYRRHKQKIGNTSESSDWQLSTDLTLAKDFNRNGASPLVSLEYCHGWDPLGDYLNG  417

Query  1148  SALSQEVLESFMFNLDEVESATQYFSETNLLGKSSFSAVYKGTLRDGSAVAVKCISKTSC  969
             +  S+E L SF  NL+EVESATQ FSE NLLGK +FS+VYKGTLRDG+ VA++ I+ TSC
Sbjct  418   TGFSREHLNSFRLNLEEVESATQCFSEVNLLGKGNFSSVYKGTLRDGTLVAIRSINVTSC  477

Query  968   KSDEAEFRKGLTLLTSLKHENLLRLRGFCCSKGRGECFLIYDFVSNGNLLRYLDVKDEKG  789
             KS+EAEF KGL LLTSL+HEN++RLRGFCCS+GRGECFLIYDF   G L +YLD ++   
Sbjct  478   KSEEAEFVKGLYLLTSLRHENIIRLRGFCCSRGRGECFLIYDFAPKGKLSKYLDQEEGSS  537

Query  788   KVLDWSTRTAIIKGIARGIKYLHGNKRNKPALVHRNISADKVLIDHLYKPLLSDSGLHKL  609
              VLDWSTR +II GIA+GI YLH ++ NKPA+VHRN+S +KVLID  + PL++D GLHKL
Sbjct  538   NVLDWSTRVSIIIGIAKGIGYLHSSEVNKPAIVHRNLSVEKVLIDQQFNPLIADCGLHKL  597

Query  608   LADDIVFSTLKGSAANGYLAPEYAITGRFTEKSDMYAFGVIILQILSGSCVVTQSNHQGA  429
             LADDIVFS LK SAA GYLAPEY  TGRFTE+SD++AFGVIILQIL+GS V+T S    A
Sbjct  598   LADDIVFSVLKTSAAMGYLAPEYVTTGRFTERSDIFAFGVIILQILTGSLVLTSSMRLAA  657

Query  428   ELCRFEDFVDAKLGKDFVESEAAKLGKIALLCTHDSPSRRPAIDVVIQ  285
             E   FE+F+D  L   F ESEAAKLGK+AL+CTH+ P  RP ++ VI+
Sbjct  658   ESATFENFIDRNLKGKFSESEAAKLGKMALVCTHEDPENRPTMEAVIE  705



>gb|KDP25598.1| hypothetical protein JCGZ_20754 [Jatropha curcas]
Length=651

 Score =   694 bits (1791),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 367/646 (57%), Positives = 470/646 (73%), Gaps = 12/646 (2%)
 Frame = -3

Query  2195  MAIKASLDPGNLVLSSWSPNVTDPCSVSSFEGIACNDLGQVVNISLQGKGLYGKIPPEIG  2016
             M +K++LDP N  L SW+ +  DPCS  SFEG+ACN+  +V NISLQGKGL GKI P + 
Sbjct  1     MELKSALDPNNKFLQSWNSD-GDPCS-GSFEGVACNEHRKVANISLQGKGLSGKISPAVA  58

Query  2015  QLNGLSGLYLHFNNLHGVIPKEIASLTQLSDLYLNMNDLSGFIPSEIGNMPNLQVLQLCY  1836
             +L  LSG+YLH+N L G IPKE+++LT+L+DLYLN+N+LSG IP+EIGNM +LQVL+LC 
Sbjct  59    ELKCLSGVYLHYNKLSGEIPKELSNLTELTDLYLNVNNLSGSIPAEIGNMASLQVLELCC  118

Query  1835  NRFEGCIPNKLGSLKNLTVLALQSNQLTGAIPASlggltlltrldLSFNRLFGSIPVKLS  1656
             N+  G IP ++GSLK LTVLALQ N++T  IP SLG L +L RLDL FN LFG IP  ++
Sbjct  119   NQLTGKIPTEMGSLKRLTVLALQYNRITDQIPTSLGNLGMLRRLDLGFNSLFGPIPSSIT  178

Query  1655  EASKLEVLDLRNNTLSGNVPLGLKRLNEGFRYENNPGLCGTGFPSLALCSD-SSLNPTKP  1479
             +A +L+VLD+RNN+LSG VP  L+RLNEGF+++NN GLCG GFP L  CS    +N  + 
Sbjct  179   KAPQLQVLDVRNNSLSGMVPSALQRLNEGFQFKNNKGLCGVGFPQLRACSAFDKMNTNQI  238

Query  1478  EPFG--QGSNRLPTKDIPESANIPHQLNQNRKPQAAA-----AVVGVIGLFVILAVAGLF  1320
             +P G   GS+   +K+IP S       NQ     ++       V GVI + ++L  AG  
Sbjct  239   DPSGPIAGSSN-TSKNIPISTVFHSPCNQTNCSHSSKFPQILIVAGVITVTILLIGAGFL  297

Query  1319  TFSWYRRRKQQIGSTVDISESRVSTDQPKVLCRRSTSPLISL-EYSNGWDPLAKDQSGSA  1143
                +YRR+KQ+IG+T + S+ R+STDQ K L R   SPL+SL EYSNGWDP  + ++G  
Sbjct  298   IIFFYRRKKQKIGNTSEPSDGRLSTDQAKELPRGGASPLVSLVEYSNGWDPFGEGRNGIR  357

Query  1142  LSQEVLESFMFNLDEVESATQYFSETNLLGKSSFSAVYKGTLRDGSAVAVKCISKTSCKS  963
             +S+  L +F FNL+E+ESATQ FSE NLLGKSSFS VYKG LRDGS VA++ I+ TSCKS
Sbjct  358   ISEGCLNNFRFNLEEIESATQCFSEVNLLGKSSFSCVYKGILRDGSLVAIRSINITSCKS  417

Query  962   DEAEFRKGLTLLTSLKHENLLRLRGFCCSKGRGECFLIYDFVSNGNLLRYLDVKDEKGKV  783
             +E EF KGL LLTSL+H+NL RLRGFCCS+ RGECFLIYDF   G+L +YLDV+D    V
Sbjct  418   EEDEFLKGLNLLTSLRHDNLARLRGFCCSRSRGECFLIYDFAPKGSLSKYLDVEDGSSYV  477

Query  782   LDWSTRTAIIKGIARGIKYLHGNKRNKPALVHRNISADKVLIDHLYKPLLSDSGLHKLLA  603
             L+WS R +II GIA+GI+YLH ++ N+PA++HR IS +KVL+D  + PL++DSGL KLLA
Sbjct  478   LNWSLRVSIISGIAKGIEYLHSSEANRPAIIHRRISVEKVLLDQQFNPLIADSGLPKLLA  537

Query  602   DDIVFSTLKGSAANGYLAPEYAITGRFTEKSDMYAFGVIILQILSGSCVVTQSNHQGAEL  423
             DDIVFS LK SAA GYLAPEY  TG FTEK D+YAFGVI+LQILSG  +++ S    A  
Sbjct  538   DDIVFSALKISAAMGYLAPEYITTGHFTEKGDVYAFGVIVLQILSGKQMLSSSMRVAAAS  597

Query  422   CRFEDFVDAKLGKDFVESEAAKLGKIALLCTHDSPSRRPAIDVVIQ  285
              ++E FVD  L  +F ESEAAK+ KIAL CT + P  RP ++ VI+
Sbjct  598   YKYEGFVDTNLNGNFSESEAAKMAKIALACTQELPENRPTMEAVIR  643



>ref|XP_008448908.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
GSO2 [Cucumis melo]
Length=681

 Score =   694 bits (1792),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 367/655 (56%), Positives = 470/655 (72%), Gaps = 16/655 (2%)
 Frame = -3

Query  2213  STVSLLMAIKASLDPGNLVLSSWSPNVTDPCSVSSFEGIACNDLGQVVNISLQGKGLYGK  2034
             S V  LM +KASLDP N VL SW+ +  DPC    F G+ACN+  +V NISLQG+GL GK
Sbjct  26    SEVKALMELKASLDPENRVLRSWTID-GDPCG-GKFVGVACNEHRKVANISLQGRGLSGK  83

Query  2033  IPPEIGQLNGLSGLYLHFNNLHGVIPKEIASLTQLSDLYLNMNDLSGFIPSEIGNMPNLQ  1854
             + P + +L  LSGLYLH+NNL G IP+EI+SL +L+DLYL++N L+G IP EIGNM +LQ
Sbjct  84    VSPAVAELKCLSGLYLHYNNLSGEIPREISSLNELADLYLDVNSLTGDIPEEIGNMSSLQ  143

Query  1853  VLQLCYNRFEGCIPNKLGSLKNLTVLALQSNQLTGAIPASlggltlltrldLSFNRLFGS  1674
             VLQ+C N+  G IP ++GSL+ LTVLALQ N+L+G IP SLG L +L RL LSFN   G 
Sbjct  144   VLQICCNQLSGKIPTQIGSLRKLTVLALQHNRLSGEIPTSLGSLEVLKRLYLSFNNFSGR  203

Query  1673  IPVKLSEASKLEVLDLRNNTLSGNVPLGLKRLNEGFRYENNPGLCGTGFPSLALCS---D  1503
             IP  L+   +LEV+D+RNN+  G+VP GL++LNEGF+ ENNPGLCG GF ++  C+   +
Sbjct  204   IPFSLATIPQLEVVDVRNNSFFGHVPSGLRKLNEGFQGENNPGLCGVGFVTVRNCTVFDN  263

Query  1502  SSLNPTKPEPFGQGSNRLPT--KDIPESA-------NIPHQLNQNRKPQAAAAVVGVIGL  1350
              ++     +PF    N   T  K+IP+SA       N  H     R P+ A  V  V+ +
Sbjct  264   ENIKGEGFQPFLSEPNNTATTQKNIPQSADFYNANCNQLHCSKSTRVPKIAV-VSAVLIV  322

Query  1349  FVILAVAGLFTFSWYRRRKQQIGSTVDISESRVSTDQPKVLCRRSTSPLISLEYSNGWDP  1170
              VIL V+ + T  WYRRRKQ+IG++    + R+STDQ + L  +S SPL+ LEYS+GWD 
Sbjct  323   SVILMVSMILTVFWYRRRKQKIGNSSLSCDDRLSTDQARELYSKSASPLVCLEYSHGWDS  382

Query  1169  LAKDQSGSALSQEVLESFMFNLDEVESATQYFSETNLLGKSSFSAVYKGTLRDGSAVAVK  990
             LA    G  LSQ  L  F+FN++EVESATQYFSE NLLG+SSFS VYKG L+DGS VA++
Sbjct  383   LADGIKGLGLSQ-YLSKFIFNIEEVESATQYFSEANLLGRSSFSMVYKGVLKDGSCVAIR  441

Query  989   CISKTSCKSDEAEFRKGLTLLTSLKHENLLRLRGFCCSKGRGECFLIYDFVSNGNLLRYL  810
              I+ TSCKS+EAEF +GL LL+SL+HENL+ LRGFCCS+GRGE FL+YDFVS G+L RYL
Sbjct  442   SINMTSCKSEEAEFLRGLDLLSSLRHENLVSLRGFCCSRGRGEFFLVYDFVSRGSLSRYL  501

Query  809   DVKDEKGKVLDWSTRTAIIKGIARGIKYLHGNKRNKPALVHRNISADKVLIDHLYKPLLS  630
             DV+D    VL+WS R +II GIA+GI YLH  + NKPA+VH++IS +K+LIDH +  L+S
Sbjct  502   DVEDSSSHVLEWSKRVSIINGIAKGIAYLHHEEANKPAMVHKSISIEKILIDHQFNALIS  561

Query  629   DSGLHKLLADDIVFSTLKGSAANGYLAPEYAITGRFTEKSDMYAFGVIILQILSGSCVVT  450
             DSGL KLLADDI+FS+LK SAA GYLAPEY   GRFTEKSD+YAFGVII QILSG+  + 
Sbjct  562   DSGLSKLLADDIIFSSLKTSAAMGYLAPEYITIGRFTEKSDIYAFGVIIFQILSGTRRLA  621

Query  449   QSNHQGAELCRFEDFVDAKLGKDFVESEAAKLGKIALLCTHDSPSRRPAIDVVIQ  285
              S     E+C+FEDF+D  L  +F ES+A KL  +AL CT++ P  RP I+ +I+
Sbjct  622   NSLLLETEVCKFEDFIDKNLKGNFSESQATKLANLALSCTNELPINRPTIEDLIE  676



>ref|XP_004147946.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
GSO2-like [Cucumis sativus]
 ref|XP_004159511.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
GSO2-like [Cucumis sativus]
 gb|KGN55915.1| Leucine rich repeat receptor kinase [Cucumis sativus]
Length=683

 Score =   691 bits (1784),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 366/655 (56%), Positives = 470/655 (72%), Gaps = 16/655 (2%)
 Frame = -3

Query  2213  STVSLLMAIKASLDPGNLVLSSWSPNVTDPCSVSSFEGIACNDLGQVVNISLQGKGLYGK  2034
             S V  LM +K SLDP N VL SW+ +  DPC    F G+ACN+  +V NISLQG+GL GK
Sbjct  28    SEVKALMELKVSLDPENRVLRSWTID-GDPCG-GKFVGVACNEHRKVANISLQGRGLSGK  85

Query  2033  IPPEIGQLNGLSGLYLHFNNLHGVIPKEIASLTQLSDLYLNMNDLSGFIPSEIGNMPNLQ  1854
             + P + +L  LSGLYLH+NNL G IP+EI+SL +L+DLYL++N L+G IP EIGNM +LQ
Sbjct  86    VSPAVAELKCLSGLYLHYNNLSGEIPREISSLNELADLYLDVNSLTGDIPEEIGNMSSLQ  145

Query  1853  VLQLCYNRFEGCIPNKLGSLKNLTVLALQSNQLTGAIPASlggltlltrldLSFNRLFGS  1674
             VLQ+C N+  G IP ++GSL+ LTVLALQ N+L+G IP SLG L +L RL LSFN   G 
Sbjct  146   VLQICCNQLSGKIPTQIGSLRKLTVLALQHNRLSGEIPTSLGSLEMLKRLYLSFNNFSGR  205

Query  1673  IPVKLSEASKLEVLDLRNNTLSGNVPLGLKRLNEGFRYENNPGLCGTGFPSLALCS---D  1503
             IP  L+   +LEV+D+RNN+  G+VP GL++LNEGF+ ENNPGLCG GF ++  C+   +
Sbjct  206   IPFNLATIPQLEVVDVRNNSFFGHVPSGLRKLNEGFQGENNPGLCGVGFVTVRKCTVFDN  265

Query  1502  SSLNPTKPEPFGQGSNRLPT--KDIPESA-------NIPHQLNQNRKPQAAAAVVGVIGL  1350
              ++     +PF    N   T  K+IP+SA       N  H     R P+ A  V  V+ +
Sbjct  266   ENIKGDGFQPFLSEPNNTATTQKNIPQSADFYNANCNQLHCSKSTRVPKIAV-VSAVLIV  324

Query  1349  FVILAVAGLFTFSWYRRRKQQIGSTVDISESRVSTDQPKVLCRRSTSPLISLEYSNGWDP  1170
              VIL V+ + T  WYRRRKQ+IG++    + R+STDQ + L  +S SPL+ LEYS+GWD 
Sbjct  325   SVILMVSMILTVFWYRRRKQKIGNSSLSCDDRLSTDQARELYSKSASPLVCLEYSHGWDS  384

Query  1169  LAKDQSGSALSQEVLESFMFNLDEVESATQYFSETNLLGKSSFSAVYKGTLRDGSAVAVK  990
             LA    G  LSQ  L  F+FN++EVESATQYFSE NLLG+SSFS VYKG L+DGS VA++
Sbjct  385   LADGIKGLGLSQ-YLGKFIFNVEEVESATQYFSEANLLGRSSFSMVYKGVLKDGSCVAIR  443

Query  989   CISKTSCKSDEAEFRKGLTLLTSLKHENLLRLRGFCCSKGRGECFLIYDFVSNGNLLRYL  810
              I+ TSCKS+EAEF +GL LL+SL+HENL+ LRGFCCS+GRGE FL+YDFVS G+L +YL
Sbjct  444   SINMTSCKSEEAEFLRGLNLLSSLRHENLVTLRGFCCSRGRGEFFLVYDFVSRGSLSQYL  503

Query  809   DVKDEKGKVLDWSTRTAIIKGIARGIKYLHGNKRNKPALVHRNISADKVLIDHLYKPLLS  630
             DV+D    VL+WS R +II GIA+GI YLH  + NKPA+VH++IS +K+LIDH +  L+S
Sbjct  504   DVEDGSSHVLEWSKRVSIINGIAKGIAYLHHEEANKPAMVHKSISIEKILIDHQFNALIS  563

Query  629   DSGLHKLLADDIVFSTLKGSAANGYLAPEYAITGRFTEKSDMYAFGVIILQILSGSCVVT  450
             DSGL KLLADDI+FS+LK SAA GYLAPEY   GRFTEKSD+YAFGVII QILSG+  + 
Sbjct  564   DSGLSKLLADDIIFSSLKSSAAMGYLAPEYITIGRFTEKSDIYAFGVIIFQILSGTRRLA  623

Query  449   QSNHQGAELCRFEDFVDAKLGKDFVESEAAKLGKIALLCTHDSPSRRPAIDVVIQ  285
              S    AE+C+FEDF+D  L  +F ES+A KL  +AL CT++ P  RP I+ +I+
Sbjct  624   NSLLLQAEVCKFEDFIDRNLKGNFSESQATKLANLALSCTNELPINRPTIEDLIE  678



>ref|XP_010024716.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
GSO2 [Eucalyptus grandis]
 gb|KCW61180.1| hypothetical protein EUGRSUZ_H03944 [Eucalyptus grandis]
Length=669

 Score =   690 bits (1780),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 367/641 (57%), Positives = 467/641 (73%), Gaps = 15/641 (2%)
 Frame = -3

Query  2198  LMAIKASLDPGNLVLSSWSPNVTDPCSVSSFEGIACNDLGQVVNISLQGKGLYGKIPPEI  2019
             LM IKASLDP N VL+SW+ N  DPC   SF+G+ACN+  +V NISLQGKGL GK+PP +
Sbjct  31    LMEIKASLDPENKVLTSWTGN-GDPCG-GSFDGVACNEHQKVANISLQGKGLSGKVPPAM  88

Query  2018  GQLNGLSGLYLHFNNLHGVIPKEIASLTQLSDLYLNMNDLSGFIPSEIGNMPNLQVLQLC  1839
              QL  LSGLYLH+N L G IP+EI+ LT+L+DLYL++N+L+G IPSEIG+M +LQVLQLC
Sbjct  89    AQLKCLSGLYLHYNYLTGEIPREISRLTELTDLYLDVNNLTGSIPSEIGSMASLQVLQLC  148

Query  1838  YNRFEGCIPNKLGSLKNLTVLALQSNQLTGAIPASlggltlltrldLSFNRLFGSIPVKL  1659
             YN+  G IP ++GSLK L+VLALQ N+L+G I   L  L  L RL L FN   G+ PV++
Sbjct  149   YNQLNGTIPPQIGSLKKLSVLALQHNKLSGDI-HGLANLQTLKRLVLGFNGFNGTFPVEI  207

Query  1658  SEASKLEVLDLRNNTLSGNVPLGLKRLNEGFRYENNPGLCGTGFPSLALCS--DSSLNPT  1485
             ++  +L+ LD++NN+LSG VP  LK+L E F Y+NNPGLCG+GFPSL  C+  D +L+P 
Sbjct  208   AKIPELQTLDVQNNSLSGFVPAALKKL-ERFNYQNNPGLCGSGFPSLRNCNNFDPNLHPN  266

Query  1484  KPEPFGQGSNRLP-TKDIPESANIPHQLNQNRKPQAAAAVVGVIGLFVILAVAGLFTFSW  1308
                P       +P T D+    N  H  N ++ PQAA  V G++ + V L  AGL TF  
Sbjct  267   GVNPI----VLIPRTPDVKTHCNQSHCSNPSKLPQAAL-VAGIVSVTVTLVGAGLLTFYR  321

Query  1307  YRRRKQQIGSTVDISESRVSTDQPKVLCRRSTSPLISLEYSNGWDPLAKDQSGSALSQEV  1128
             YRR KQ+IGST D S+ R+STDQ K L  RS SPL+ LEYS+GWDPL   + G+ LS   
Sbjct  322   YRRGKQKIGSTADASDGRLSTDQSKDLYSRSASPLVCLEYSSGWDPLDDGRCGNGLS---  378

Query  1127  LESFMFNLDEVESATQYFSETNLLGKSSFSAVYKGTLRDGSAVAVKCISKTSCKSDEAEF  948
             L++  + L+EVESATQYFSE NLLG+S+F +VYKG LRDG+ VA++ I+ TSCKS+E +F
Sbjct  379   LQAPRYTLEEVESATQYFSEVNLLGRSTFLSVYKGILRDGTLVAIRSINVTSCKSEEVDF  438

Query  947   RKGLTLLTSLKHENLLRLRGFCCSKGRGECFLIYDFVSNGNLLRYLDVKDEKGKVLDWST  768
               GL L+TSL+HENL+RLRG CCSKGRGECFL+YDF   G L +YLD++D   +VLDWST
Sbjct  439   VNGLNLVTSLRHENLIRLRGVCCSKGRGECFLVYDFAPKGTLSQYLDLEDRSIQVLDWST  498

Query  767   RTAIIKGIARGIKYLHGNKRNKPALVHRNISADKVLIDHLYKPLLSDSGLHKLLADDIVF  588
             R +IIKGIA GI YLH  + +KPA+VH+NISA+K+LID    PL+ DSGL KLLADD+++
Sbjct  499   RVSIIKGIAEGIGYLHNGEGSKPAVVHQNISAEKILIDQQLNPLIMDSGLPKLLADDVIY  558

Query  587   STLKGSAANGYLAPEYAITGRFTEKSDMYAFGVIILQILSGSCVVTQSNHQGAELCRFED  408
             S LK SAA GY+APEY  TGRFTEKSD++A+GVII QILSG  +++ S    AE C  E+
Sbjct  559   SALKTSAAMGYMAPEYITTGRFTEKSDVFAYGVIIFQILSGKRLLSSSMRSAAECCSSEN  618

Query  407   FVDAKLGKDFVESEAAKLGKIALLCTHDSPSRRPAIDVVIQ  285
             F+D+ L  +F E EAA LGKIAL CT + P  RP I  VI+
Sbjct  619   FIDSNLKGNFTEPEAAILGKIALRCTSELPDNRPTIFRVIE  659



>ref|XP_009383987.1| PREDICTED: BRASSINOSTEROID INSENSITIVE 1-associated receptor 
kinase 1-like [Musa acuminata subsp. malaccensis]
Length=675

 Score =   690 bits (1780),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 372/649 (57%), Positives = 465/649 (72%), Gaps = 26/649 (4%)
 Frame = -3

Query  2207  VSLLMAIKASLDPGNLVLSSWSPNVTDPCSVSSFEGIACNDLGQVVNISLQGKGLYGKIP  2028
             ++ LM +KASLDP N +L++W+ +  + C    FEG+AC++ G+V NISLQGKGL G I 
Sbjct  34    LTALMELKASLDPENRILTTWAGD-GEACR-RGFEGVACDEKGKVSNISLQGKGLSGCIS  91

Query  2027  PEIGQLNGLSGLYLHFNNLHGVIPKEIASLTQLSDLYLNMNDLSGFIPSEIGNMPNLQVL  1848
             P + +L  L+GLY HFNN+ G IP+ IA+LT+LS+LYLN+N+LSG IP EIG+M  LQVL
Sbjct  92    PAVARLKSLTGLYFHFNNISGEIPRGIANLTELSELYLNVNNLSGSIPEEIGDMDGLQVL  151

Query  1847  QLCYNRFEGCIPNKLGSLKNLTVLALQSNQLTGAIPASlggltlltrldLSFNRLFGSIP  1668
             QL  N+  G IP KLG LK L +L LQSN L+GAIPA+LG L  LT LDLSFN+LFGSIP
Sbjct  152   QLSNNKLSGSIPPKLGLLKKLNMLDLQSNHLSGAIPATLGDLIGLTWLDLSFNQLFGSIP  211

Query  1667  VKLSEASKLEVLDLRNNTLSGNVPLGLKRLNEGFRYENNPGLCGTGFPSLALCSDSS-LN  1491
             VKLS+  +L VL ++NN+LSG++P  LKRL E F+Y +N  LCGTGF  L +C+ +  LN
Sbjct  212   VKLSQLPQLTVLYVQNNSLSGSIPPELKRLGENFKYGSNTDLCGTGFTDLRICTSADLLN  271

Query  1490  PTKPEPFGQGSNRLPTKDIPESANIPHQLNQNR----KPQAAAAVVGVIGLFVI-LAVAG  1326
              ++PEPF  G   L  +DIP   NI    N          A  AV   I + V  + ++G
Sbjct  272   ASRPEPFSAG---LTPQDIPHFVNISSHCNTTHCSSSSKSANLAVFITITVVVFGIMISG  328

Query  1325  LFTFSWYRRRKQQIGSTVDISESRVSTDQPKVLCRRSTSPLISLEYSNGWDPLAKDQSGS  1146
             L  F WYRRRKQ+ G         +STD  K   +RS SPLISLEYSN WDP+    SG 
Sbjct  329   LMAFVWYRRRKQKNG--------LLSTDLAKFSYQRSASPLISLEYSNRWDPMTDQSSGI  380

Query  1145  ALSQEVLESFMFNLDEVESATQYFSETNLLG-KSSFSAVYKGTLRDGSAVAVKCISKTSC  969
             +LSQE+ +++ FNL+EVE ATQYFSE NLLG K SF+A YKG LRDG+ VAVK ISKTSC
Sbjct  381   SLSQEISQNYKFNLEEVECATQYFSEVNLLGRKGSFAATYKGILRDGTKVAVKRISKTSC  440

Query  968   KSDEAEFRKGLTLLTSLKHENLLRLRGFCCSKGRGECFLIYDFVSNGNLLRYLDVK-DEK  792
             KSDE EF KGL +LT L+HENL+RL+GFC S+ RGECFLIYDFV+NG+L +YLDVK DE 
Sbjct  441   KSDEVEFLKGLKILTLLRHENLIRLKGFCYSRARGECFLIYDFVANGSLSQYLDVKGDEI  500

Query  791   GKVLDWSTRTAIIKGIARGIKYLHGNKRNKPALVHRNISADKVLIDHLYKPLLSDSGLHK  612
              KVL+W TR +II+GIA+GI+YLH N+ NKP L H+N+SA KVLIDH   PLLS SG+HK
Sbjct  501   QKVLEWPTRVSIIRGIAKGIEYLHSNRTNKPPLFHQNLSATKVLIDHQSNPLLSGSGIHK  560

Query  611   LLADDIVFSTLKGSAANGYLAPEYAITGRFTEKSDMYAFGVIILQILSGSCVVTQSNHQG  432
             LLADD+VFSTLK SAA GYLAPEYA  GRFTEKSD+YAFGVI+ QIL+G   +T      
Sbjct  561   LLADDVVFSTLKTSAAMGYLAPEYATVGRFTEKSDVYAFGVIVFQILTGKTRITH-----  615

Query  431   AELCRFEDFVDAKLGKDFVESEAAKLGKIALLCTHDSPSRRPAIDVVIQ  285
              E  + ED +D  L  ++ + EAAKL  +ALLCT + P +RP ++ V+Q
Sbjct  616   LESGKLEDLIDENLQGNYPKPEAAKLAGVALLCTSEVPDQRPTMEAVLQ  664



>ref|XP_004973001.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g53440-like [Setaria italica]
Length=689

 Score =   689 bits (1779),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 374/652 (57%), Positives = 470/652 (72%), Gaps = 20/652 (3%)
 Frame = -3

Query  2198  LMAIKASLDPGNLVLSSWSPNVTDPCSVSS-FEGIACNDLGQVVNISLQGKGLYGKIPPE  2022
             LM +KA+LDP    L+SW+    DPC     FEG+ C+  G+V  ISLQGKGL G +PP 
Sbjct  38    LMDLKAALDPSGRALASWARG-GDPCGRGDYFEGVTCDARGRVATISLQGKGLAGAVPPA  96

Query  2021  IGQLNGLSGLYLHFNNLHGVIPKEIASLTQLSDLYLNMNDLSGFIPSEIGNMPNLQVLQL  1842
             +  L GL+GLYLH+N+L G IP+E+  L  L++LYL +N+LSG IP+E+G + +LQVLQL
Sbjct  97    VAMLPGLTGLYLHYNDLGGAIPRELGGLPDLAELYLGVNNLSGDIPAELGRLASLQVLQL  156

Query  1841  CYNRFEGCIPNKLGSLKNLTVLALQSNQLTGAIPASlggltlltrldLSFNRLFGSIPVK  1662
              YN+  G IP +LG LK LTVLALQSNQLTGAIPASLG L  LTRLDLS N+LFGSIP K
Sbjct  157   GYNQLSGSIPTQLGQLKKLTVLALQSNQLTGAIPASLGDLPALTRLDLSSNQLFGSIPSK  216

Query  1661  LSEASKLEVLDLRNNTLSGNVPLGLKRLNEGFRYENNPGLCGTGFPSLALCSDSSLN---  1491
             L+E  +L  L+LRNNTLSG+VP GLK+L+EGFRYENN  LCG  F SL  C D S +   
Sbjct  217   LAEIPQLSTLNLRNNTLSGSVPSGLKKLHEGFRYENNSELCGAQFDSLKPCPDDSNDDGK  276

Query  1490  -PTKPEPFGQGSNRLPTKDIPESANIPHQLNQN--RKP---QAAAAVVGVIGLFVILAVA  1329
              P KPE     S  +  + I ++A++    +     KP    A A + G I +    A  
Sbjct  277   MPHKPE-----STSVKPQQIQKTADLNRNCDNGGCSKPSTLSAGAVIAGTIIIVAGAAAC  331

Query  1328  GLFTFSWYRRRKQQIGSTVDISESRVSTDQPKVLCRRSTSPLISLEYSNGWDPLAK-DQS  1152
             GL  FSW+RR+KQ++GS+V+  E R+S DQ K  C+RS S LI++EYS+GWD  ++  Q 
Sbjct  332   GLSVFSWHRRQKQKVGSSVEHLEGRLSLDQSKETCQRSASSLINVEYSSGWDTSSEGSQH  391

Query  1151  GSALSQEVLESFMFNLDEVESATQYFSETNLLGKSSFSAVYKGTLRDGSAVAVKCISKTS  972
             G+ LS E   S  FNL+EVE ATQYFS+ NLLGKS+F+A YKG +RDGS VAVK I+K+S
Sbjct  392   GARLSSEGSPSVRFNLEEVECATQYFSDVNLLGKSNFAATYKGIMRDGSVVAVKSINKSS  451

Query  971   CKSDEAEFRKGLTLLTSLKHENLLRLRGFCCSKGRGECFLIYDFVSNGNLLRYLDVKD-E  795
             CKS+EA+F KGL LLTSL+HENL+ LRGFC S+ RGECFLIY+F++NG+L RYLDVKD E
Sbjct  452   CKSEEADFLKGLRLLTSLRHENLVGLRGFCRSRARGECFLIYEFMANGSLSRYLDVKDGE  511

Query  794   KGK-VLDWSTRTAIIKGIARGIKYLHGNKRNKPALVHRNISADKVLIDHLYKPLLSDSGL  618
              G  VLDW TR +IIKGIA+GI YLH +K NKP LVH++ISADKVLIDHL+ P LS +G+
Sbjct  512   AGATVLDWPTRVSIIKGIAKGIDYLHSSKPNKPPLVHQSISADKVLIDHLFVPHLSGAGI  571

Query  617   HKLLADDIVFSTLKGSAANGYLAPEYAITGRFTEKSDMYAFGVIILQILSGSCVVTQSNH  438
             HKLLADD+VFSTLK SAA GYLAPEY  TGR T+K D+YAFGV++LQ+L+G   V+    
Sbjct  572   HKLLADDVVFSTLKDSAAMGYLAPEYTTTGRSTDKGDVYAFGVVVLQVLTGRRAVSAHLR  631

Query  437   QG-AELCRFEDFVDAKLGKDFVESEAAKLGKIALLCTHDSPSRRPAIDVVIQ  285
              G AE    +D VD +LG  F   EAA+L  +ALLCT + P++RPA+  V+Q
Sbjct  632   LGAAEPGTLDDLVDPRLGGRFSRPEAAQLAGVALLCTAEEPAQRPAMFAVLQ  683



>ref|XP_011081121.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
GSO2 [Sesamum indicum]
Length=685

 Score =   688 bits (1776),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 377/646 (58%), Positives = 469/646 (73%), Gaps = 11/646 (2%)
 Frame = -3

Query  2198  LMAIKASLDPGNLVLSSWSPNVTDPCSVSSFEGIACNDLGQVVNISLQGKGLYGKIPPEI  2019
             LM IK+SLDP N  LSSW+ +  DPC   +FEG+ACN+  +V NISLQGKGL GK+PP +
Sbjct  35    LMEIKSSLDPENKYLSSWTAD-GDPCG-GAFEGVACNEHRKVANISLQGKGLTGKVPPAV  92

Query  2018  GQLNGLSGLYLHFNNLHGVIPKEIASLTQLSDLYLNMNDLSGFIPSEIGNMPNLQVLQLC  1839
              +L  LSGLYLH+N+L G IP+EIA+LT+L+DLYLN+N+L+G IP EIG+M +LQVLQLC
Sbjct  93    AELKCLSGLYLHYNSLSGEIPREIANLTELTDLYLNVNNLTGTIPPEIGSMASLQVLQLC  152

Query  1838  YNRFEGCIPNKLGSLKNLTVLALQSNQLTGAIPASlggltlltrldLSFNRLFGSIPVKL  1659
              N   G IP ++G L+ L+VLAL+SN LTG IPASLG L +L RL LSFN+L G IPV+L
Sbjct  153   CNHLTGSIPTQMGFLQRLSVLALESNGLTGQIPASLGDLGMLKRLYLSFNQLSGPIPVRL  212

Query  1658  SEASKLEVLDLRNNTLSGNVPLGLKRLNEGFRYENNPGLCGTGFPSLALCSD-SSLNPTK  1482
             +    LEVLD++NNTLSG VP GL+RLNEGF ++NNPGLCGTGF SL  C+   +LN  +
Sbjct  213   ANNPSLEVLDVQNNTLSGVVPSGLRRLNEGFHFDNNPGLCGTGFSSLRACTAWDNLNINQ  272

Query  1481  PEPFGQGSNRLPTKDIPESANIPHQLNQN-------RKPQAAAAVVGVIGLFVILAVAGL  1323
              +P    +NR    ++P+SA  P   NQ+       R PQ    V GVI + V L V   
Sbjct  273   VDPSTPVANRTAPTNVPQSAAFPLPCNQSDCSRSSSRLPQIGI-VAGVITVTVGLTVVVF  331

Query  1322  FTFSWYRRRKQQIGSTVDISESRVSTDQPKVLCRRSTSPLISLEYSNGWDPLAKDQSGSA  1143
                  YRRRKQ++G+  D S+ R+S DQ K + +RS SPL++LEYSN W+P    Q  + 
Sbjct  332   VCVVRYRRRKQKVGNKSDTSDDRLSIDQVKDVYKRSPSPLVALEYSNSWNPTNAAQDCNG  391

Query  1142  LSQEVLESFMFNLDEVESATQYFSETNLLGKSSFSAVYKGTLRDGSAVAVKCISKTSCKS  963
             L    L+   FNL+EVESATQ+FSE NLLG+S FSAVYKG L+DGS VA+K I+KTSCKS
Sbjct  392   LCHVFLQGSKFNLEEVESATQHFSEVNLLGESKFSAVYKGILKDGSLVAIKSINKTSCKS  451

Query  962   DEAEFRKGLTLLTSLKHENLLRLRGFCCSKGRGECFLIYDFVSNGNLLRYLDVKDEKGKV  783
             DE EF KGL+LL SLKHENLL+LRGFCCSK RGECFLIYDF SNGNL +YLD +D+   V
Sbjct  452   DEDEFMKGLSLLNSLKHENLLKLRGFCCSKARGECFLIYDFASNGNLSQYLDAEDDTSSV  511

Query  782   LDWSTRTAIIKGIARGIKYLHGNKRNKPALVHRNISADKVLIDHLYKPLLSDSGLHKLLA  603
             LDW TR +II GIA+GIKYLH N  NKP +VH+NIS +KVL+D  ++PL+ DSGL KLLA
Sbjct  512   LDWPTRVSIIHGIAKGIKYLHSNATNKPPIVHQNISVEKVLLDQHFRPLILDSGLLKLLA  571

Query  602   DDIVFSTLKGSAANGYLAPEYAITGRFTEKSDMYAFGVIILQILSGSCVVTQSNHQGAEL  423
             DD+V+S LK SAA GY+APEY  TGRFTEKSD+YAFGVIILQ+LSG   +T      AE 
Sbjct  572   DDVVYSALKVSAALGYMAPEYITTGRFTEKSDVYAFGVIILQVLSGQRKLTSLMRTAAES  631

Query  422   CRFEDFVDAKLGKDFVESEAAKLGKIALLCTHDSPSRRPAIDVVIQ  285
              +  + VD  L   F E+EAA+L KIAL CT + P  RP++  V++
Sbjct  632   GKLGELVDPGLQGKFSETEAAQLTKIALDCTDELPDSRPSMASVVR  677



>ref|XP_010056326.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At4g30520 isoform X1 [Eucalyptus grandis]
Length=715

 Score =   689 bits (1779),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 390/687 (57%), Positives = 474/687 (69%), Gaps = 47/687 (7%)
 Frame = -3

Query  2225  SNNASTVSLLMAIKASLDPGNLVLSSWSPNVTDPCSVSS---FEGIACNDLGQVVNISLQ  2055
             S+  S +  LMA+KA+LDP   VL+SWS    DPC       FEG+AC++ G+VVN+SLQ
Sbjct  27    SSPLSELHALMALKAALDPSCRVLTSWSRGA-DPCGGGGGSSFEGVACDERGRVVNVSLQ  85

Query  2054  GKGLYGKIPPEIGQLNGLSGLYLHFNNLHGVIPKEIASLTQLSDLYLNMNDLSGFIPSEI  1875
             GKGL G+IPPEIG L  L+GLYLHFN L G +P EI  L  L+DLYL++N  SG IPS+I
Sbjct  86    GKGLRGRIPPEIGGLGSLTGLYLHFNALGGEVPGEIGGLRMLTDLYLDVNGFSGEIPSDI  145

Query  1874  GNMPNLQVLQLCYNRFEGCIPNKLGSLKNLTVLALQSNQLTGAIPASlggltlltrldLS  1695
              N+ NLQVLQL YNRF G IP +LGSL  LTVLALQ N+LTGAIPASLG    L RLDLS
Sbjct  146   ANLTNLQVLQLGYNRFSGGIPRQLGSLPKLTVLALQYNRLTGAIPASLGDSASLKRLDLS  205

Query  1694  FNRLFGSIPVKLSEASKLEVLDLRNNTLSGNVPLGLKRLNEGFRYENNPGLCGTGFPSLA  1515
             +N  FGSIP  L+ AS LEVLD+RNNTLSG VP GLKRL++GF+YENNP LCG GFP++ 
Sbjct  206   YNNFFGSIPATLTNASSLEVLDVRNNTLSGYVPTGLKRLDDGFQYENNPDLCGVGFPNVR  265

Query  1514  LCSDSSLNPTKPEPFGQGSNRLPTKDIPESANI---------PHQLNQNRKPQAAAAVVG  1362
              C    L+  +PEP     + L  K+IPESA++         P++L+  R       V  
Sbjct  266   PCPTVYLD--RPEPLR--PDTLSKKNIPESADLNSTCGKAHCPNRLSGRRAGVVLGVVAV  321

Query  1361  VIGLFVILAVAGLFTFSWYRRRKQQIGSTVDISESRVSTDQPKVLCRRSTSPLISLEYSN  1182
             V    +  AV G  TFSW++ RKQ+  S++D+ + RV   +      +  S LISLEYSN
Sbjct  322   VA--AIGFAVVGFLTFSWHQHRKQRNSSSLDVLDKRVRASRALENRSKRASALISLEYSN  379

Query  1181  GWDPLAKDQSGSALSQEVLESFMFNLDEVESATQYFSETNLLGKSSFSAVYKGTLRDGSA  1002
             GWDPLAK   GSA SQEV E+FMFNL++VE ATQ F E+NLL KSSFS+V++G LRDGS 
Sbjct  380   GWDPLAKGGGGSAFSQEVFENFMFNLEDVERATQSFLESNLLEKSSFSSVHRGILRDGST  439

Query  1001  VAVKCISKTSCKSDEAEFRKGLTLLTSLKHENLLRLRGFCCSKGRGECFLIYDFVSNGNL  822
             V VK  +K +CKSDEAEF KGL LLT LKHENL+RLRGFCCSKGRGECFLIY+ V NGNL
Sbjct  440   VTVKRYAKMNCKSDEAEFLKGLKLLTKLKHENLVRLRGFCCSKGRGECFLIYELVPNGNL  499

Query  821   LRYLDVKDEKGKVLDWSTRTAIIKGIARG----------------------------IKY  726
             L+YLD K   GKVL+W TR AII GIA+G                            I Y
Sbjct  500   LQYLDAKPGSGKVLEWHTRVAIIIGIAQGQCYSTALIHRLGTLEKLLSFHLRFFFTGISY  559

Query  725   LHGNKRNKPALVHRNISADKVLIDHLYKPLLSDSGLHKLLADDIVFSTLKGSAANGYLAP  546
             +H ++ +KP LVH++ISA+KVLID+   PLLSD GLH LLADD+VF+ LK SAA GYLAP
Sbjct  560   IHEDEGDKPRLVHQSISAEKVLIDYWNNPLLSDPGLHHLLADDVVFAMLKASAAMGYLAP  619

Query  545   EYAITGRFTEKSDMYAFGVIILQILSGSCVVTQSNHQGAELCRFEDFVDAKLGKDFVESE  366
             EYA TG  TEKSD YAFGV++LQILSG  V+T S   G E C F++F+D  L  +F+E+E
Sbjct  620   EYASTGYLTEKSDAYAFGVLVLQILSGKRVITPSIRHGVEACCFDEFIDENLEGNFLETE  679

Query  365   AAKLGKIALLCTHDSPSRRPAIDVVIQ  285
             A +L +IALLCT DSP  RP +  V+Q
Sbjct  680   ATQLARIALLCTRDSPIDRPLMRTVVQ  706



>ref|XP_010108139.1| LRR receptor-like serine/threonine-protein kinase GSO2 [Morus 
notabilis]
 gb|EXC17871.1| LRR receptor-like serine/threonine-protein kinase GSO2 [Morus 
notabilis]
Length=684

 Score =   688 bits (1775),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 371/654 (57%), Positives = 468/654 (72%), Gaps = 15/654 (2%)
 Frame = -3

Query  2213  STVSLLMAIKASLDPGNLVLSSWSPNVTDPCSVSSFEGIACNDLGQVVNISLQGKGLYGK  2034
             + V  LM +K+SLDP N  LSSW+ +  +PCS  SFEG+ACN+  +V NISLQGKGL GK
Sbjct  27    AEVEALMELKSSLDPENKFLSSWTKD-GEPCS-GSFEGVACNEHHKVANISLQGKGLSGK  84

Query  2033  IPPEIGQLNGLSGLYLHFNNLHGVIPKEIASLTQLSDLYLNMNDLSGFIPSEIGNMPNLQ  1854
             +   + +L  LSGLYLH+NNL G IP+E+++LT+L+DLYLN+N+LSG IPS+IG M +LQ
Sbjct  85    LSSAVAELRCLSGLYLHYNNLSGEIPRELSNLTELTDLYLNVNNLSGDIPSQIGKMASLQ  144

Query  1853  VLQLCYNRFEGCIPNKLGSLKNLTVLALQSNQLTGAIPASlggltlltrldLSFNRLFGS  1674
             VLQLC N+  G IP ++G LK L+V+ALQ N+LTG IP SLG L +L RLDLSFN L G 
Sbjct  145   VLQLCCNQLSGKIPTEMGLLKKLSVVALQYNKLTGEIPPSLGNLGILKRLDLSFNTLSGK  204

Query  1673  IPVKLSEASKLEVLDLRNNTLSGNVPLGLKRLNEGFRYENNPGLCGTGFPSLALCS---D  1503
             IP  L     L+VLDL+NN+LSG VP GL+RLNEGF  ENNP LCG GF  L  C+   +
Sbjct  205   IPTTLGTIQSLQVLDLKNNSLSGFVPPGLRRLNEGFHAENNPSLCGVGFAKLRACTSFDN  264

Query  1502  SSLNPTKPEPFGQGSNRL--PTKDIPESANI------PHQLNQNRKPQAAAAVVGVIGLF  1347
              +++     P G   N    PT++ PESAN        H     R   AA   V +    
Sbjct  265   YNMDVGVFGPSGSNGNATDGPTQN-PESANFHSTCNRAHCARSTRFSLAAVVAVVIAVTI  323

Query  1346  VILAVAGLFTFSWYRRRKQQIGSTVDISESRVSTDQPKVLCRRSTSPLISLEYSNGWDPL  1167
              ++A+  L     YRR+KQ+IG+  D S+ R+S DQ K    +S SPL+SLEY NGWDPL
Sbjct  324   SMIAIVFLIIIR-YRRQKQKIGNHCDPSDGRLSIDQAKEFRSKSASPLVSLEYCNGWDPL  382

Query  1166  AKDQSGSALSQEVLESFMFNLDEVESATQYFSETNLLGKSSFSAVYKGTLRDGSAVAVKC  987
                  G  LSQE L +  FN++++ESATQYFS+ NLLGKS FSAVYKG LRDGS VA++ 
Sbjct  383   GDGLKGIGLSQEYLNNKKFNMEDIESATQYFSDVNLLGKSKFSAVYKGVLRDGSVVAIRS  442

Query  986   ISKTSCKSDEAEFRKGLTLLTSLKHENLLRLRGFCCSKGRGECFLIYDFVSNGNLLRYLD  807
             ++ TSCKS+E EF +GL LL SL+HENL++LRGFCCS+ RGECFLIYDF  NG+L RYLD
Sbjct  443   LNVTSCKSEEDEFLRGLNLLFSLRHENLVKLRGFCCSRSRGECFLIYDFAPNGSLSRYLD  502

Query  806   VKDEKGKVLDWSTRTAIIKGIARGIKYLHGNKRNKPALVHRNISADKVLIDHLYKPLLSD  627
             +++    VL WS R  II GIA+GI+YLH ++ N+PA+VH+NISA+KVLID  + PL+SD
Sbjct  503   LEEGSDGVLSWSKRVTIISGIAKGIQYLHSSEANRPAIVHQNISAEKVLIDQQFDPLISD  562

Query  626   SGLHKLLADDIVFSTLKGSAANGYLAPEYAITGRFTEKSDMYAFGVIILQILSGSCVVTQ  447
             SGL KLLA+DIVFS LK SAA GYLAPEY  TGRFT+KSD+YAFGVI+LQ+LSG  ++T 
Sbjct  563   SGLPKLLANDIVFSALKTSAAMGYLAPEYITTGRFTQKSDIYAFGVIVLQVLSGQLMLTN  622

Query  446   SNHQGAELCRFEDFVDAKLGKDFVESEAAKLGKIALLCTHDSPSRRPAIDVVIQ  285
             S   GA+   FEDF+DAKL  +F ES AAKLG++AL CTH+ P  RP ++ VIQ
Sbjct  623   SMRTGAKSGSFEDFMDAKLKGEFSESAAAKLGQLALTCTHEVPEERPTVEEVIQ  676



>ref|XP_010056327.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At4g30520 isoform X2 [Eucalyptus grandis]
 gb|KCW73007.1| hypothetical protein EUGRSUZ_E01442 [Eucalyptus grandis]
Length=687

 Score =   687 bits (1772),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 390/659 (59%), Positives = 474/659 (72%), Gaps = 19/659 (3%)
 Frame = -3

Query  2225  SNNASTVSLLMAIKASLDPGNLVLSSWSPNVTDPCSVSS---FEGIACNDLGQVVNISLQ  2055
             S+  S +  LMA+KA+LDP   VL+SWS    DPC       FEG+AC++ G+VVN+SLQ
Sbjct  27    SSPLSELHALMALKAALDPSCRVLTSWSRGA-DPCGGGGGSSFEGVACDERGRVVNVSLQ  85

Query  2054  GKGLYGKIPPEIGQLNGLSGLYLHFNNLHGVIPKEIASLTQLSDLYLNMNDLSGFIPSEI  1875
             GKGL G+IPPEIG L  L+GLYLHFN L G +P EI  L  L+DLYL++N  SG IPS+I
Sbjct  86    GKGLRGRIPPEIGGLGSLTGLYLHFNALGGEVPGEIGGLRMLTDLYLDVNGFSGEIPSDI  145

Query  1874  GNMPNLQVLQLCYNRFEGCIPNKLGSLKNLTVLALQSNQLTGAIPASlggltlltrldLS  1695
              N+ NLQVLQL YNRF G IP +LGSL  LTVLALQ N+LTGAIPASLG    L RLDLS
Sbjct  146   ANLTNLQVLQLGYNRFSGGIPRQLGSLPKLTVLALQYNRLTGAIPASLGDSASLKRLDLS  205

Query  1694  FNRLFGSIPVKLSEASKLEVLDLRNNTLSGNVPLGLKRLNEGFRYENNPGLCGTGFPSLA  1515
             +N  FGSIP  L+ AS LEVLD+RNNTLSG VP GLKRL++GF+YENNP LCG GFP++ 
Sbjct  206   YNNFFGSIPATLTNASSLEVLDVRNNTLSGYVPTGLKRLDDGFQYENNPDLCGVGFPNVR  265

Query  1514  LCSDSSLNPTKPEPFGQGSNRLPTKDIPESANI---------PHQLNQNRKPQAAAAVVG  1362
              C    L+  +PEP     + L  K+IPESA++         P++L+  R       V  
Sbjct  266   PCPTVYLD--RPEPLR--PDTLSKKNIPESADLNSTCGKAHCPNRLSGRRAGVVLGVVAV  321

Query  1361  VIGLFVILAVAGLFTFSWYRRRKQQIGSTVDISESRVSTDQPKVLCRRSTSPLISLEYSN  1182
             V    +  AV G  TFSW++ RKQ+  S++D+ + RV   +      +  S LISLEYSN
Sbjct  322   VA--AIGFAVVGFLTFSWHQHRKQRNSSSLDVLDKRVRASRALENRSKRASALISLEYSN  379

Query  1181  GWDPLAKDQSGSALSQEVLESFMFNLDEVESATQYFSETNLLGKSSFSAVYKGTLRDGSA  1002
             GWDPLAK   GSA SQEV E+FMFNL++VE ATQ F E+NLL KSSFS+V++G LRDGS 
Sbjct  380   GWDPLAKGGGGSAFSQEVFENFMFNLEDVERATQSFLESNLLEKSSFSSVHRGILRDGST  439

Query  1001  VAVKCISKTSCKSDEAEFRKGLTLLTSLKHENLLRLRGFCCSKGRGECFLIYDFVSNGNL  822
             V VK  +K +CKSDEAEF KGL LLT LKHENL+RLRGFCCSKGRGECFLIY+ V NGNL
Sbjct  440   VTVKRYAKMNCKSDEAEFLKGLKLLTKLKHENLVRLRGFCCSKGRGECFLIYELVPNGNL  499

Query  821   LRYLDVKDEKGKVLDWSTRTAIIKGIARGIKYLHGNKRNKPALVHRNISADKVLIDHLYK  642
             L+YLD K   GKVL+W TR AII GIA+GI Y+H ++ +KP LVH++ISA+KVLID+   
Sbjct  500   LQYLDAKPGSGKVLEWHTRVAIIIGIAQGISYIHEDEGDKPRLVHQSISAEKVLIDYWNN  559

Query  641   PLLSDSGLHKLLADDIVFSTLKGSAANGYLAPEYAITGRFTEKSDMYAFGVIILQILSGS  462
             PLLSD GLH LLADD+VF+ LK SAA GYLAPEYA TG  TEKSD YAFGV++LQILSG 
Sbjct  560   PLLSDPGLHHLLADDVVFAMLKASAAMGYLAPEYASTGYLTEKSDAYAFGVLVLQILSGK  619

Query  461   CVVTQSNHQGAELCRFEDFVDAKLGKDFVESEAAKLGKIALLCTHDSPSRRPAIDVVIQ  285
              V+T S   G E C F++F+D  L  +F+E+EA +L +IALLCT DSP  RP +  V+Q
Sbjct  620   RVITPSIRHGVEACCFDEFIDENLEGNFLETEATQLARIALLCTRDSPIDRPLMRTVVQ  678



>ref|XP_010055541.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g63930 [Eucalyptus grandis]
 gb|KCW72023.1| hypothetical protein EUGRSUZ_E00473 [Eucalyptus grandis]
Length=660

 Score =   684 bits (1766),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 363/639 (57%), Positives = 461/639 (72%), Gaps = 20/639 (3%)
 Frame = -3

Query  2198  LMAIKASLDPGNLVLSSWSPNVTDPCSVSSFEGIACNDLGQVVNISLQGKGLYGKIPPEI  2019
             LM IKASLDP N VL+SW+ N  DPC   SF+G+ACN+  +V  ISLQGK L GK+PP +
Sbjct  31    LMEIKASLDPENKVLTSWTSN-GDPCG-GSFDGVACNEHQKVATISLQGKRLSGKVPPAV  88

Query  2018  GQLNGLSGLYLHFNNLHGVIPKEIASLTQLSDLYLNMNDLSGFIPSEIGNMPNLQVLQLC  1839
              QL  LSGLYLH+N+L G IP+EI+SLT+L+DLYL++N+L+G IPSEIG+M +L+VLQLC
Sbjct  89    AQLKCLSGLYLHYNSLTGEIPREISSLTELTDLYLDVNNLTGSIPSEIGSMASLEVLQLC  148

Query  1838  YNRFEGCIPNKLGSLKNLTVLALQSNQLTGAIPASlggltlltrldLSFNRLFGSIPVKL  1659
              N+  G IP ++ SLK L+VLALQ N  +G I   L  L  L  LDL+FNR  G+ PV++
Sbjct  149   CNQLNGTIPLQIKSLKKLSVLALQHNNFSGDI-IGLADLQSLKSLDLAFNRFSGTFPVEI  207

Query  1658  SEASKLEVLDLRNNTLSGNVPLGLKRLNEGFRYENNPGLCGTGFPSLALCSDSSLNPTKP  1479
             ++   L+ LD+RNN+LSG VP  LK L E F Y+NNPGLCG+GF SL  C++        
Sbjct  208   AKIPHLQTLDIRNNSLSGFVPPALKNLGERFNYQNNPGLCGSGFHSLRNCNN--------  259

Query  1478  EPFGQGSNRLP-TKDIPESANIPHQLNQNRKPQAAAAVVGVIGLFVILAVAGLFTFSWYR  1302
               FGQ  N +P T D+ +  N  H    ++ PQAA  V G++ + V L  AGL TF  YR
Sbjct  260   --FGQ--NLIPKTADVKKHCNQSHCSEPSKLPQAAL-VAGIVSVTVTLVGAGLITFYRYR  314

Query  1301  RRKQQIGSTVDISESRVSTDQPKVLCRRSTSPLISLEYSNGWDPLAKDQSGSALSQEVLE  1122
             R KQ+IGST D S+ R+STDQ K L  RS SPL+ LEYS+GWDPL   + G+ LS   L+
Sbjct  315   RGKQKIGSTADASDGRLSTDQSKDLYSRSASPLVCLEYSSGWDPLDDGRCGNGLS---LQ  371

Query  1121  SFMFNLDEVESATQYFSETNLLGKSSFSAVYKGTLRDGSAVAVKCISKTSCKSDEAEFRK  942
             +  + L+EVESATQYFSE NLLG+S+FS+VY+G LRDG+ VA++ I+ TSCKS+E +F  
Sbjct  372   APRYTLEEVESATQYFSEVNLLGRSTFSSVYRGILRDGTLVAIRSINVTSCKSEEVDFVN  431

Query  941   GLTLLTSLKHENLLRLRGFCCSKGRGECFLIYDFVSNGNLLRYLDVKDEKGKVLDWSTRT  762
             GL L+TSL+HENL+RLRG CCSKGRGECFL YDF   G L +YLD++D   +VLDWSTR 
Sbjct  432   GLNLVTSLRHENLIRLRGVCCSKGRGECFLAYDFAPKGTLSQYLDLEDGSIQVLDWSTRV  491

Query  761   AIIKGIARGIKYLHGNKRNKPALVHRNISADKVLIDHLYKPLLSDSGLHKLLADDIVFST  582
             +IIKGIA GI YLH  + +KPA+VH+NIS +K+LID    PL+ DSGL KLLADD+++S 
Sbjct  492   SIIKGIAEGIGYLHNGEGSKPAVVHQNISVEKILIDQQLNPLIMDSGLPKLLADDVIYSA  551

Query  581   LKGSAANGYLAPEYAITGRFTEKSDMYAFGVIILQILSGSCVVTQSNHQGAELCRFEDFV  402
             LK SAA GY+APEY  TGRFTEKSD++AFGVII QILSG  +++ S    AE C FE+F+
Sbjct  552   LKTSAAMGYMAPEYITTGRFTEKSDVFAFGVIIFQILSGKRLLSSSMRSAAECCSFENFI  611

Query  401   DAKLGKDFVESEAAKLGKIALLCTHDSPSRRPAIDVVIQ  285
             D+ L  +F E EAA LGKIAL CT + P  RP I  VI+
Sbjct  612   DSNLKGNFTEPEAAILGKIALRCTSELPDNRPTIFRVIE  650



>ref|XP_010676667.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g34110 isoform X1 [Beta vulgaris subsp. vulgaris]
Length=684

 Score =   685 bits (1768),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 357/649 (55%), Positives = 454/649 (70%), Gaps = 13/649 (2%)
 Frame = -3

Query  2198  LMAIKASLDPGNLVLSSWSPNVTDPCSVSSFEGIACNDLGQVVNISLQGKGLYGKIPPEI  2019
             LM IKASLDP N VL +W  N  DPCS  SF G+ACND  +V NISLQG+GL GK+ P I
Sbjct  30    LMDIKASLDPLNKVLKTWQ-NDGDPCS-GSFVGVACNDHRKVANISLQGRGLAGKLSPAI  87

Query  2018  GQLNGLSGLYLHFNNLHGVIPKEIASLTQLSDLYLNMNDLSGFIPSEIGNMPNLQVLQLC  1839
             G L  LSG+YLH+N++ G IP+E+  LT+L+DLYLN N+LSG +P EI +M +LQVL LC
Sbjct  88    GDLKCLSGIYLHYNSISGEIPREVGKLTELTDLYLNYNNLSGIVPPEITHMISLQVLDLC  147

Query  1838  YNRFEGCIPNKLGSLKNLTVLALQSNQLTGAIPASlggltlltrldLSFNRLFGSIPVKL  1659
              N   G IP +L SL  L  L LQ+NQL G+IP SLG L +L RLDLS+N L G IPV L
Sbjct  148   CNHLTGNIPTQLSSLSKLGALYLQNNQLNGSIPPSLGSLDMLKRLDLSYNHLSGPIPVTL  207

Query  1658  SEASKLEVLDLRNNTLSGNVPLGLKRLNEGFRYENNPGLCGTGFPSLALCS---DSSLNP  1488
             +    L++LD+RNN+LSG +P  LKRL+ GF Y+NN  LCG  F  L  C+   +++++ 
Sbjct  208   ANIQPLKILDVRNNSLSGAIPTSLKRLDTGFLYQNNTKLCGPAFFKLRACTAFDNANVDV  267

Query  1487  TKPEPFGQ--GSNRLPTKDIPESAN------IPHQLNQNRKPQAAAAVVGVIGLFVILAV  1332
               P PFG    ++  P  + P++A        P   +Q  K      V+GVI   V LA 
Sbjct  268   NTPRPFGLILNNHTTPKHEEPKNATDLQTDCSPSTCSQPTKFPRIVIVIGVITGLVTLAA  327

Query  1331  AGLFTFSWYRRRKQQIGSTVDISESRVSTDQPKVLCRRSTSPLISLEYSNGWDPLAKDQS  1152
              G  T+  YRR+KQ+IG+TVD SESR STD    L  ++ SPL+SL YS GWDPLA   +
Sbjct  328   VGFLTYIRYRRQKQKIGTTVDASESRFSTDHANELHSKNASPLVSLAYSTGWDPLADGLN  387

Query  1151  GSALSQEVLESFMFNLDEVESATQYFSETNLLGKSSFSAVYKGTLRDGSAVAVKCISKTS  972
                LSQE L++F +NL+EVESATQYFSE N+LG+ +FS V+KG LRDGS VA+K IS  S
Sbjct  388   SGDLSQEALQNFRYNLEEVESATQYFSEANVLGRGNFSTVFKGVLRDGSVVAIKSISVNS  447

Query  971   CKSDEAEFRKGLTLLTSLKHENLLRLRGFCCSKGRGECFLIYDFVSNGNLLRYLDVKDEK  792
             CKS+EAEF KGL LL SL+HENL  LRGFCCS+GRGECF IYDF   GNLL+YLDV +  
Sbjct  448   CKSEEAEFVKGLNLLVSLRHENLAGLRGFCCSRGRGECFFIYDFAPKGNLLKYLDVSNGN  507

Query  791   GKVLDWSTRTAIIKGIARGIKYLHGNKRNKPALVHRNISADKVLIDHLYKPLLSDSGLHK  612
              +VLDW+TR  I+KGIA+G++YLH    NK  +VH+NISA+K+ ID+ Y PL+ DSGL K
Sbjct  508   DRVLDWTTRVNIVKGIAKGLRYLHEENENKAPVVHQNISAEKIAIDNHYNPLILDSGLRK  567

Query  611   LLADDIVFSTLKGSAANGYLAPEYAITGRFTEKSDMYAFGVIILQILSGSCVVTQSNHQG  432
             +LADD +FS LK SAA GYLAPEY  TGRFTEKSD+Y+FGV++L I++G   +T +    
Sbjct  568   ILADDTIFSALKMSAAMGYLAPEYITTGRFTEKSDVYSFGVVVLHIITGKQQLTNALRSA  627

Query  431   AELCRFEDFVDAKLGKDFVESEAAKLGKIALLCTHDSPSRRPAIDVVIQ  285
             AE C+ EDFVD  L  +F  +EAA+L ++AL CTH+ P  RP ++VV+Q
Sbjct  628   AESCKLEDFVDQNLNGNFSMTEAARLVRLALACTHELPDERPNMEVVVQ  676



>ref|XP_009382007.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g34110 [Musa acuminata subsp. malaccensis]
Length=689

 Score =   682 bits (1761),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 373/651 (57%), Positives = 473/651 (73%), Gaps = 23/651 (4%)
 Frame = -3

Query  2198  LMAIKASLDPGNLVLSSWSPNVTDPCSVSSFEGIACNDLGQVVNISLQGKGLYGKIPPEI  2019
             LM +K SLDP N +L+SW+    + C    FEG+AC++ G+V NISLQG+GL G I P +
Sbjct  36    LMELKVSLDPENRLLTSWTSE-GEHCR-GDFEGVACDESGKVANISLQGRGLSGSIAPVV  93

Query  2018  GQLNGLSGLYLHFNNLHGVIPKEIASLTQLSDLYLNMNDLSGFIPSEIGNMPNLQVLQLC  1839
              +L GL+GLYLHFN + GVIP+EI +L++LSDLYLN+N+LSG IP EIGNM  LQVLQL 
Sbjct  94    AELEGLTGLYLHFNKISGVIPREIGNLSRLSDLYLNVNNLSGSIPEEIGNMGGLQVLQLS  153

Query  1838  YNRFEGCIPNKLGSLKNLTVLALQSNQLTGAIPASlggltlltrldLSFNRLFGSIPVKL  1659
              N+  G +P KL  LKNL +LALQSN L GAIPA+LG LT LT LD+SFN+LFGSIPVKL
Sbjct  154   NNKLSGSVPPKLALLKNLNMLALQSNHLNGAIPATLGDLTELTWLDVSFNQLFGSIPVKL  213

Query  1658  SEASKLEVLDLRNNTLSGNVPLGLKRLNEGFRYENNPGLCGTGFPSLALCSDSS-LNPTK  1482
             S+  +L VLD+++N LSGNVP  LK+L   F+Y NN  LCGTGF  L  C+ +  LN ++
Sbjct  214   SQLPQLTVLDVQSNLLSGNVPSELKKLGGNFKYGNNTDLCGTGFTDLRACTSADLLNASR  273

Query  1481  PEPFGQGSNRLPTKDIPESANI------PHQLNQNRKPQAAAAVVGVIGLFVILAVAGLF  1320
             PEPF  G   L  +DIP+S NI       H  + ++       V   I +F ++ V GL 
Sbjct  274   PEPFSAG---LAPQDIPQSVNISADCSATHCSSSSKSTNVVIVVATTIVVFGVM-VCGLM  329

Query  1319  TFSWYRRRKQQIGSTVDISESRVSTDQPKVLCRRSTSPLISLEYSNGWDPLAKDQSG--S  1146
              F W+R RKQ+IG   ++S   +S D P     R+ SPLISLEYS+ WDP+  ++SG  +
Sbjct  330   AFLWFRLRKQKIGGLFEVSNGLLSAD-PTKFSYRAASPLISLEYSSHWDPMTDERSGGIN  388

Query  1145  ALSQEVLESFMFNLDEVESATQYFSETNLLG-KSSFSAVYKGTLRDGSAVAVKCISKTSC  969
              LSQEV + + FNL+EVE ATQYFSE NLLG KSSF+A YKG LRDG+ +AVK I+KTSC
Sbjct  389   GLSQEVSQIYRFNLEEVECATQYFSEVNLLGKKSSFAATYKGILRDGTQIAVKRINKTSC  448

Query  968   KSDEAEFRKGLTLLTSLKHENLLRLRGFCCSKGRGECFLIYDFVSNGNLLRYLDVK-DEK  792
             KS+EAEF KGL  LT L+HENL+ LRGFC S+ RGECFLIYDFV+NG+L  YLDVK D  
Sbjct  449   KSEEAEFLKGLRTLTLLRHENLVGLRGFCYSRARGECFLIYDFVANGSLPEYLDVKGDGI  508

Query  791   GKVLDWSTRTAIIKGIARGIKYLHGNKRNKPALVHRNISADKVLIDHLYKPLLSDSGLHK  612
              KVLDW  R +IIKGIA+GI+YLHG++ NKP+L+H+N+SA KVLIDH + PLLS SGLHK
Sbjct  509   HKVLDWPMRVSIIKGIAKGIEYLHGDRANKPSLLHQNLSAAKVLIDHQFNPLLSGSGLHK  568

Query  611   LLADDIVFSTLKGSAANGYLAPEYAITGRFTEKSDMYAFGVIILQILSGSCVVTQSNH--  438
             LLADD+VFS+LK SAA GY+APEYA  GRF+EKSD+YAFGVI+ QIL+G+   T+++H  
Sbjct  569   LLADDVVFSSLKTSAAMGYMAPEYATVGRFSEKSDVYAFGVIVFQILTGN---TRTSHLR  625

Query  437   QGAELCRFEDFVDAKLGKDFVESEAAKLGKIALLCTHDSPSRRPAIDVVIQ  285
               AE  + ED +D  L  ++ + EAA L  IALLCT + PS+RP ++ V+Q
Sbjct  626   PEAESGKLEDLIDENLQGNYSKPEAATLVGIALLCTSEVPSQRPTMEAVLQ  676



>emb|CDP09887.1| unnamed protein product [Coffea canephora]
Length=679

 Score =   681 bits (1758),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 371/645 (58%), Positives = 465/645 (72%), Gaps = 11/645 (2%)
 Frame = -3

Query  2198  LMAIKASLDPGNLVLSSWSPNVTDPCSVSSFEGIACNDLGQVVNISLQGKGLYGKIPPEI  2019
             LM IK SLDP N  LSSW+ +  DPC+  +F G+ACN+  +V NISLQ KGL GK+PP +
Sbjct  31    LMDIKTSLDPENKYLSSWTSD-GDPCA-GTFLGVACNEHRKVANISLQSKGLTGKVPPAL  88

Query  2018  GQLNGLSGLYLHFNNLHGVIPKEIASLTQLSDLYLNMNDLSGFIPSEIGNMPNLQVLQLC  1839
              +L  LSGLYLH+N+L G IPKEIA+L +L+DLYLN+N+LSG IP E+G+M +LQVLQL 
Sbjct  89    ARLECLSGLYLHYNSLTGQIPKEIANLNELNDLYLNVNNLSGTIPPELGSMASLQVLQLS  148

Query  1838  YNRFEGCIPNKLGSLKNLTVLALQSNQLTGAIPASlggltlltrldLSFNRLFGSIPVKL  1659
              N+  G IP ++G L+ L VLAL+ N LTG+IPA+LG L +L RL LSFN+L GSIPV L
Sbjct  149   GNQLTGNIPTEMGFLRKLNVLALEYNGLTGSIPANLGNLGMLRRLYLSFNQLSGSIPVAL  208

Query  1658  SEASKLEVLDLRNNTLSGNVPLGLKRLNEGFRYENNPGLCGTGFPSLALCSD-SSLNPTK  1482
             + A  LEVLD++NNTLSG VP  L++LNEGF +ENNP LCG GF SL  C+   +LN  +
Sbjct  209   AGAPNLEVLDVQNNTLSGVVPPALQKLNEGFHFENNPDLCGVGFTSLRNCTAWDNLNINQ  268

Query  1481  PEPFGQGSNRLPTKDIPESANIPHQLNQNR-----KPQAAAAVVGVIGLFVILAVAGLFT  1317
               P    SN      +P+ A +    NQ R     K    A V GV  L   L +A   +
Sbjct  269   VAPLAPTSNN-NASPLPQFAYVHVHCNQTRCSSSSKLPRIAIVSGVTALTGSLMIAAFLS  327

Query  1316  FSWYRRRKQQIGSTVDISESRVSTDQPKVLCRRSTSPLISLEYSNGWDPLAKDQSGSALS  1137
                +RR+KQ+IG+T DIS+ R S  Q K  CR S SPL+ LEYS GWD +  +Q+   L 
Sbjct  328   IFRHRRQKQRIGNTSDISDDRCSIGQIKESCR-SPSPLVCLEYSKGWDQMIAEQNCHGLC  386

Query  1136  -QEVLESFMFNLDEVESATQYFSETNLLGKSSFSAVYKGTLRDGSAVAVKCISKTSCKSD  960
               E+ +   FNLDE+ESATQ+FSE NLLGKS  S VYKG L+DGS VA+K I+ TSCKS+
Sbjct  387   PTELPKGLKFNLDEIESATQHFSEMNLLGKSKVSFVYKGILKDGSVVAIKSINVTSCKSE  446

Query  959   EAEFRKGLTLLTSLKHENLLRLRGFCCSKGRGECFLIYDFVSNGNLLRYLDVKDEKGKVL  780
             EAEF KGL LLTSLKHENL+RLRGFCCSKGRGECFLIYDF S GNL +YLDV+D++  +L
Sbjct  447   EAEFMKGLNLLTSLKHENLVRLRGFCCSKGRGECFLIYDFASRGNLSQYLDVEDDRSSIL  506

Query  779   DWSTRTAIIKGIARGIKYLHGNKRNKPALVHRNISADKVLIDHLYKPLLSDSGLHKLLAD  600
             DW+TR ++I GIA+GI YLH +++NK  +VH+NIS +KVL+D  + PL+SD GL KLLAD
Sbjct  507   DWATRVSVINGIAKGIGYLHSSEQNKLPMVHQNISVEKVLVDEQFTPLISDCGLLKLLAD  566

Query  599   DIVFSTLKGSAANGYLAPEYAITGRFTEKSDMYAFGVIILQILSGSCVVTQSNHQGAELC  420
             D+V+S LK SAA GY+APEY  TGRFTEKSD+YAFGVIILQILSG   +T S    AE C
Sbjct  567   DVVYSALKVSAALGYMAPEYITTGRFTEKSDVYAFGVIILQILSGRRKLTNSILLEAESC  626

Query  419   RFEDFVDAKLGKDFVESEAAKLGKIALLCTHDSPSRRPAIDVVIQ  285
             +FEDF+D  L  ++ + EA++L KIAL CT++SP  RP+I  VIQ
Sbjct  627   KFEDFIDPNLKGNYSKYEASRLTKIALDCTNESPDGRPSIASVIQ  671



>ref|XP_006655759.1| PREDICTED: somatic embryogenesis receptor kinase 4-like [Oryza 
brachyantha]
Length=646

 Score =   676 bits (1745),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 369/646 (57%), Positives = 471/646 (73%), Gaps = 15/646 (2%)
 Frame = -3

Query  2195  MAIKASLDPGNLVLSSWSPNVTDPCSVSSFEGIACNDLGQVVNISLQGKGLYGKIPPEIG  2016
             MA+K SLDP   VL SW  +  +PC   SF G+ C+  G V  ISLQG+GL G +PP I 
Sbjct  1     MALKGSLDPSGRVLGSWD-DSGEPCG-GSFVGVTCDRGGHVTAISLQGRGLSGTLPPAIS  58

Query  2015  QLNGLSGLYLHFNNLHGVIPKEIASLTQLSDLYLNMNDLSGFIPSEIGNMPNLQVLQLCY  1836
              L  L+GLYLH+N + G IP+EI SL++L+DLYL++N LSG +P EI  M NLQVLQL Y
Sbjct  59    GLRRLAGLYLHYNGIKGSIPREIGSLSELTDLYLDVNHLSGPVPVEIAAMANLQVLQLGY  118

Query  1835  NRFEGCIPNKLGSLKNLTVLALQSNQLTGAIPASlggltlltrldLSFNRLFGSIPVKLS  1656
             N+  G IP +LG L NL VLALQSNQLTGAIPA+LG L LLTRLDLSFN LFGSIP K++
Sbjct  119   NQLTGSIPPQLGKLNNLAVLALQSNQLTGAIPATLGDLALLTRLDLSFNSLFGSIPSKIA  178

Query  1655  EASKLEVLDLRNNTLSGNVPLGLKRLNEGFRYENNPGLCGTGFPSLALC--SDSSLNPTK  1482
             E   LEV D+RNN+LSG+VP GL RLN GF+Y NN GLCG GF  L LC  S+  L P+K
Sbjct  179   EVPLLEVFDVRNNSLSGSVPAGLGRLNGGFQYVNNKGLCGVGFSLLDLCLSSEDGLKPSK  238

Query  1481  PEPFGQGSNRLPTKDIPESANIPH----QLNQNRKPQAAAAVVGVIGLFVILAVAGLFTF  1314
             PEPFG     + T+++P+SAN  H    + +++        +VGV+ + +  A  G F F
Sbjct  239   PEPFGP-DGTVKTREVPQSANTDHCEGSRCSRSSNSSTGVLIVGVVAVVIGAAFCGTFAF  297

Query  1313  SWYRRRKQQIGSTVDISESRVSTD--QPKVLCRRSTSPLISLEYSNGWDPLAKDQSGSAL  1140
             S+YRR+KQ+IGS++++S+SR+STD  Q K +CRRS SPLIS+EYSNGWDPL+        
Sbjct  298   SYYRRQKQKIGSSLEVSDSRLSTDHYQQKEVCRRSASPLISVEYSNGWDPLSSGG--VGS  355

Query  1139  SQEVLESFMFNLDEVESATQYFSETNLLGKSSFSAVYKGTLRDGSAVAVKCISKTSCKSD  960
             S EV +SF FNL+EVE ATQYFSE NLLGKS F+A YKG LRDGS VA+K ++KTSCK +
Sbjct  356   SGEVGDSFRFNLEEVECATQYFSEVNLLGKSGFAATYKGILRDGSVVAIKSLNKTSCKQE  415

Query  959   EAEFRKGLTLLTSLKHENLLRLRGFCCSKGRGECFLIYDFVSNGNLLRYLDVKD-EKGKV  783
             E++F +GL +LT L+HENL+ LRGFCCS+GRGECFL+YD++ NG L +YLDVKD     V
Sbjct  416   ESDFLRGLKMLTVLRHENLVSLRGFCCSRGRGECFLVYDYMVNGCLSQYLDVKDGSSANV  475

Query  782   LDWSTRTAIIKGIARGIKYLHGNKRNKPALVHRNISADKVLIDHLYKPLLSDSGLHKLLA  603
             LDW TR +II+GIA+G++Y+H  K NKP++VH+NISA+K+L+DH   P LS  GLHKLLA
Sbjct  476   LDWPTRVSIIRGIAKGVEYMHSKKTNKPSVVHQNISAEKILLDHHLTPRLSVPGLHKLLA  535

Query  602   DDIVFSTLKGSAANGYLAPEYAITGRFTEKSDMYAFGVIILQILSGSCVVTQSNHQGAEL  423
             DD+VFSTLK SAA GYLAPEYA TGRFTEKSD++AFG+++LQ+++G   V+Q     A  
Sbjct  536   DDVVFSTLKASAAMGYLAPEYATTGRFTEKSDVFAFGIVVLQVMTGRRAVSQLKVSTAA-  594

Query  422   CRFEDFVDAKLGKDFVESEAAKLGKIALLCTHDSPSRRPAIDVVIQ  285
                E  +D  L   F  +EAA L  +A LCT ++ S+RP ++ V+Q
Sbjct  595   NDLESLIDENLNGIFSRTEAANLAAVAALCTSEAASQRPTMEAVVQ  640



>ref|XP_002443773.1| hypothetical protein SORBIDRAFT_07g001690 [Sorghum bicolor]
 gb|EES13268.1| hypothetical protein SORBIDRAFT_07g001690 [Sorghum bicolor]
Length=699

 Score =   677 bits (1748),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 376/671 (56%), Positives = 465/671 (69%), Gaps = 46/671 (7%)
 Frame = -3

Query  2198  LMAIKASLDPGNLVLSSWSPNVTDPCSVSS-FEGIACNDLGQVVNISLQGKGLYGKIPPE  2022
             LM +KA+LDP    L+SW+    DPC     FEG+ C+  G+V  ISLQGKGL G +PP 
Sbjct  35    LMELKAALDPSGRALASWARG-GDPCGRGDYFEGVTCDARGRVATISLQGKGLSGTVPPA  93

Query  2021  IGQLNGLSGLYLHFNNLHGVIPKEIASLTQLSDLYLNMNDLSGFIPSEIGNMPNLQVLQL  1842
             +  L  L+GLYLH+NNL G IP+E+  L  L++LYL +N+LSG IP E+G + +LQVLQL
Sbjct  94    VAMLPALTGLYLHYNNLGGEIPRELGGLPDLAELYLGVNNLSGAIPVELGRLGSLQVLQL  153

Query  1841  CYNRFEGCIPNKLGSLKNLTVLALQSNQLTGAIPASlggltlltrldLSFNRLFGSIPVK  1662
              YN+  G IP +LG L  LTVLALQSNQLTGAIPASLG L  LTRLDLS N+LFGSIP K
Sbjct  154   GYNQLSGSIPTQLGELNKLTVLALQSNQLTGAIPASLGDLPALTRLDLSSNQLFGSIPAK  213

Query  1661  LSEASKLEVLDLRNNTLSGNVPLGLKRLNEGFRYENNPGLCGTGFPSLALCSDSSLNPTK  1482
             L+E   L  LDLRNNTLSG+VP GLK+LNEGF YENN  LCG  F SL  C +       
Sbjct  214   LAEIPHLATLDLRNNTLSGSVPSGLKKLNEGFLYENNSELCGAQFGSLKACPND------  267

Query  1481  PEPFGQGSNRLPTKDIPESANI-PHQ------LNQN------RKPQA---AAAVVGVIGL  1350
                 G    ++P K  PES ++ P Q      LN+N       KP +    A + G + +
Sbjct  268   ----GNDDGKMPRK--PESTSVKPQQIQKTIDLNRNCDNGVCTKPSSLSTGAVIAGTVII  321

Query  1349  FVILAVAGLFTFSWYRRRKQQIGSTVDISESRVSTDQPKVLCRRSTSPLISLEYSNGWDP  1170
                 A  GL  FSW+RR+KQ++GS+V+  E R S DQ K   +RS S LI++EYS+GWD 
Sbjct  322   VAGAAACGLSVFSWHRRQKQKVGSSVEHLEGRPSLDQSKETYQRSASSLINVEYSSGWDT  381

Query  1169  LAK-DQSGSALSQEVLESFMFNLDEVESATQYFSETNLLGKSSFSAVYKGTLRDGSAVAV  993
              ++  Q G  LS E   S  FNL+EVE ATQYFS+ NLLGKS+F+A YKG +RDGS VAV
Sbjct  382   SSEGSQHGVRLSSEGSPSVRFNLEEVECATQYFSDMNLLGKSNFAATYKGIMRDGSVVAV  441

Query  992   KCISKTSCKSDEAEFRKGLTLLTSLKHENLLRLRGFCCSKGRGECFLIYDFVSNGNLLRY  813
             K I+K+SCKS+EA+F KGL +LTSL+HENL+ LRGFC S+ RGECFL+Y+F++NG+L RY
Sbjct  442   KSINKSSCKSEEADFLKGLRMLTSLRHENLVGLRGFCRSRARGECFLVYEFMANGSLSRY  501

Query  812   LDVK--DEKGKVLDWSTRTAIIKGIARGIKYLHGNKRNKPALVHRNISADKVLIDHLYKP  639
             LDVK  D    VLDW TR +IIKGIA+GI+YLH +K NKP+LVH++ISADKVLIDHLY  
Sbjct  502   LDVKEGDVDAAVLDWPTRVSIIKGIAKGIEYLHSSKANKPSLVHQSISADKVLIDHLYTA  561

Query  638   LLSDSGLHKLLADDIVFSTLKGSAANGYLAPEYAITGRFTEKSDMYAFGVIILQILSGSC  459
              LS +GLHKLLADD+VFSTLK SAA GYLAPEY  TGRFT+KSD+YAFGV++LQ+LSG  
Sbjct  562   RLSGAGLHKLLADDVVFSTLKDSAAMGYLAPEYTTTGRFTDKSDVYAFGVVVLQVLSGRR  621

Query  458   VVTQSNHQG---------AELC----RFEDFVDAKLGKDFVESEAAKLGKIALLCTHDSP  318
              V+    QG         AE      R +D VD +L   F   EAAKL  +ALLCT D+P
Sbjct  622   AVSPHLRQGCCGGGAAVAAESSSGGGRLDDLVDPRLCGRFSRPEAAKLAGVALLCTADAP  681

Query  317   SRRPAIDVVIQ  285
             ++RPA+  V+Q
Sbjct  682   TQRPAMAAVLQ  692



>gb|EAY99548.1| hypothetical protein OsI_21521 [Oryza sativa Indica Group]
 gb|EAZ35739.1| hypothetical protein OsJ_20030 [Oryza sativa Japonica Group]
Length=678

 Score =   676 bits (1745),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 370/658 (56%), Positives = 476/658 (72%), Gaps = 16/658 (2%)
 Frame = -3

Query  2228  TSNNASTVSLLMAIKASLDPGNLVLSSWSPNVTDPCSVSSFEGIACNDLGQVVNISLQGK  2049
             +S N      LMA+K SLDP   VL SW+ +  +PC   SF G+ C+  G+V  ISLQG+
Sbjct  21    SSRNDEEARALMALKESLDPAGRVLGSWARS-GEPCG-GSFVGVTCDSGGRVTAISLQGR  78

Query  2048  GLYGKIPPEIGQLNGLSGLYLHFNNLHGVIPKEIASLTQLSDLYLNMNDLSGFIPSEIGN  1869
             GL G +PP I  L  L+GLYLH+N + G IP+EI SL++L+DLYL++N L+G +P EI  
Sbjct  79    GLSGTLPPAIAGLRRLTGLYLHYNGIKGAIPREIGSLSELTDLYLDVNHLTGPLPVEIAA  138

Query  1868  MPNLQVLQLCYNRFEGCIPNKLGSLKNLTVLALQSNQLTGAIPASlggltlltrldLSFN  1689
             M NLQVLQL YN+  G IP +LG L  L VLALQSNQLTGAIPA+LG LT L RLDLSFN
Sbjct  139   MENLQVLQLGYNQLTGSIPPQLGKLNKLAVLALQSNQLTGAIPATLGDLTQLARLDLSFN  198

Query  1688  RLFGSIPVKLSEASKLEVLDLRNNTLSGNVPLGLKRLNEGFRYENNPGLCGTGFPSLALC  1509
              LFGSIP K++E   LEV D+RNN+LSG+VP GL+RLN GF+Y NN GLCG GF  L LC
Sbjct  199   SLFGSIPSKIAEVPLLEVFDVRNNSLSGSVPAGLRRLNGGFQYVNNKGLCGVGFSLLDLC  258

Query  1508  --SDSSLNPTKPEPFGQGSNRLPTKDIPESANIPHQ-----LNQNRKPQAAAAVVGVIGL  1350
               S+  L P+KPEPFG     + T+ +P+SAN  +       +++        VVGV+ +
Sbjct  259   LSSEDGLKPSKPEPFGP-DGTVKTRQVPQSANTDNHCEGSGCSKSSNASVGVLVVGVVAV  317

Query  1349  FVILAVAGLFTFSWYRRRKQQIGSTVDISESRVSTD--QPKVLCRRSTSPLISLEYSNGW  1176
              +  A  G+F FS+YRR+KQ+IGS++++S+SR+STD  Q K +CRRS SPLIS+EYSNGW
Sbjct  318   VIGAAFCGIFAFSYYRRQKQKIGSSLEVSDSRLSTDHYQQKEVCRRSASPLISVEYSNGW  377

Query  1175  DPLAKDQSGSALSQEVLESFMFNLDEVESATQYFSETNLLGKSSFSAVYKGTLRDGSAVA  996
             DPL+        S EV +SF FNL+EVE ATQYFSE NLLGKS F+A YKG LRDGS VA
Sbjct  378   DPLSGGG--VGSSGEVGDSFRFNLEEVECATQYFSEVNLLGKSGFAATYKGILRDGSVVA  435

Query  995   VKCISKTSCKSDEAEFRKGLTLLTSLKHENLLRLRGFCCSKGRGECFLIYDFVSNGNLLR  816
             VK ++KTSCK +E++F +GL +LT L+HENL+ LRGFCCS+GRGECFL+YD++ NG L +
Sbjct  436   VKSLNKTSCKQEESDFLRGLKMLTVLRHENLVGLRGFCCSRGRGECFLVYDYMVNGCLSQ  495

Query  815   YLDVKDEKG-KVLDWSTRTAIIKGIARGIKYLHGNKRNKPALVHRNISADKVLIDHLYKP  639
             YLDVK+  G  VLDW TR +II+GIA+G++Y+H  K NKP++VH+NISA+K+L+DH   P
Sbjct  496   YLDVKEGSGANVLDWPTRVSIIRGIAKGVEYMHSKKANKPSVVHQNISAEKILLDHHLTP  555

Query  638   LLSDSGLHKLLADDIVFSTLKGSAANGYLAPEYAITGRFTEKSDMYAFGVIILQILSGSC  459
              LS  GLHKLLADD+VFSTLK SAA GYLAPEYA TGRFTEKSD++AFG+++LQ+++G  
Sbjct  556   RLSVPGLHKLLADDVVFSTLKASAAMGYLAPEYATTGRFTEKSDVFAFGIVVLQVITGRR  615

Query  458   VVTQSNHQGAELCRFEDFVDAKLGKDFVESEAAKLGKIALLCTHDSPSRRPAIDVVIQ  285
              V+Q           +  +D  L   F  +EAAKL  IA LCT ++ S+RP ++ V+Q
Sbjct  616   AVSQLKVSTVA-NDLDSLIDENLNGVFSRTEAAKLAAIAALCTSETASQRPTMEAVVQ  672



>ref|NP_001056717.1| Os06g0134700 [Oryza sativa Japonica Group]
 dbj|BAF18631.1| Os06g0134700, partial [Oryza sativa Japonica Group]
Length=672

 Score =   675 bits (1741),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 370/658 (56%), Positives = 476/658 (72%), Gaps = 16/658 (2%)
 Frame = -3

Query  2228  TSNNASTVSLLMAIKASLDPGNLVLSSWSPNVTDPCSVSSFEGIACNDLGQVVNISLQGK  2049
             +S N      LMA+K SLDP   VL SW+ +  +PC   SF G+ C+  G+V  ISLQG+
Sbjct  15    SSRNDEEARALMALKESLDPAGRVLGSWARS-GEPCG-GSFVGVTCDSGGRVTAISLQGR  72

Query  2048  GLYGKIPPEIGQLNGLSGLYLHFNNLHGVIPKEIASLTQLSDLYLNMNDLSGFIPSEIGN  1869
             GL G +PP I  L  L+GLYLH+N + G IP+EI SL++L+DLYL++N L+G +P EI  
Sbjct  73    GLSGTLPPAIAGLRRLTGLYLHYNGIKGAIPREIGSLSELTDLYLDVNHLTGPLPVEIAA  132

Query  1868  MPNLQVLQLCYNRFEGCIPNKLGSLKNLTVLALQSNQLTGAIPASlggltlltrldLSFN  1689
             M NLQVLQL YN+  G IP +LG L  L VLALQSNQLTGAIPA+LG LT L RLDLSFN
Sbjct  133   MENLQVLQLGYNQLTGSIPPQLGKLNKLAVLALQSNQLTGAIPATLGDLTQLARLDLSFN  192

Query  1688  RLFGSIPVKLSEASKLEVLDLRNNTLSGNVPLGLKRLNEGFRYENNPGLCGTGFPSLALC  1509
              LFGSIP K++E   LEV D+RNN+LSG+VP GL+RLN GF+Y NN GLCG GF  L LC
Sbjct  193   SLFGSIPSKIAEVPLLEVFDVRNNSLSGSVPAGLRRLNGGFQYVNNKGLCGVGFSLLDLC  252

Query  1508  --SDSSLNPTKPEPFGQGSNRLPTKDIPESANIPHQ-----LNQNRKPQAAAAVVGVIGL  1350
               S+  L P+KPEPFG     + T+ +P+SAN  +       +++        VVGV+ +
Sbjct  253   LSSEDGLKPSKPEPFGP-DGTVKTRQVPQSANTDNHCEGSGCSKSSNASVGVLVVGVVAV  311

Query  1349  FVILAVAGLFTFSWYRRRKQQIGSTVDISESRVSTD--QPKVLCRRSTSPLISLEYSNGW  1176
              +  A  G+F FS+YRR+KQ+IGS++++S+SR+STD  Q K +CRRS SPLIS+EYSNGW
Sbjct  312   VIGAAFCGIFAFSYYRRQKQKIGSSLEVSDSRLSTDHYQQKEVCRRSASPLISVEYSNGW  371

Query  1175  DPLAKDQSGSALSQEVLESFMFNLDEVESATQYFSETNLLGKSSFSAVYKGTLRDGSAVA  996
             DPL+        S EV +SF FNL+EVE ATQYFSE NLLGKS F+A YKG LRDGS VA
Sbjct  372   DPLSGGG--VGSSGEVGDSFRFNLEEVECATQYFSEVNLLGKSGFAATYKGILRDGSVVA  429

Query  995   VKCISKTSCKSDEAEFRKGLTLLTSLKHENLLRLRGFCCSKGRGECFLIYDFVSNGNLLR  816
             VK ++KTSCK +E++F +GL +LT L+HENL+ LRGFCCS+GRGECFL+YD++ NG L +
Sbjct  430   VKSLNKTSCKQEESDFLRGLKMLTVLRHENLVGLRGFCCSRGRGECFLVYDYMVNGCLSQ  489

Query  815   YLDVKDEKG-KVLDWSTRTAIIKGIARGIKYLHGNKRNKPALVHRNISADKVLIDHLYKP  639
             YLDVK+  G  VLDW TR +II+GIA+G++Y+H  K NKP++VH+NISA+K+L+DH   P
Sbjct  490   YLDVKEGSGANVLDWPTRVSIIRGIAKGVEYMHSKKANKPSVVHQNISAEKILLDHHLTP  549

Query  638   LLSDSGLHKLLADDIVFSTLKGSAANGYLAPEYAITGRFTEKSDMYAFGVIILQILSGSC  459
              LS  GLHKLLADD+VFSTLK SAA GYLAPEYA TGRFTEKSD++AFG+++LQ+++G  
Sbjct  550   RLSVPGLHKLLADDVVFSTLKASAAMGYLAPEYATTGRFTEKSDVFAFGIVVLQVITGRR  609

Query  458   VVTQSNHQGAELCRFEDFVDAKLGKDFVESEAAKLGKIALLCTHDSPSRRPAIDVVIQ  285
              V+Q           +  +D  L   F  +EAAKL  IA LCT ++ S+RP ++ V+Q
Sbjct  610   AVSQLKVSTVA-NDLDSLIDENLNGVFSRTEAAKLAAIAALCTSETASQRPTMEAVVQ  666



>ref|XP_009789637.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g63930 [Nicotiana sylvestris]
Length=684

 Score =   675 bits (1742),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 360/652 (55%), Positives = 464/652 (71%), Gaps = 14/652 (2%)
 Frame = -3

Query  2225  SNNASTVSLLMAIKASLDPGNLVLSSWSPNVTDPCSVSSFEGIACNDLGQVVNISLQGKG  2046
             +N  + V  LM IK++LD  N  L SW+ N  DPCS  SF G+ CN+  ++ NISLQGKG
Sbjct  24    TNGNAEVRALMEIKSTLDSENKKLFSWTSN-GDPCS-GSFLGVFCNEHHKIANISLQGKG  81

Query  2045  LYGKIPPEIGQLNGLSGLYLHFNNLHGVIPKEIASLTQLSDLYLNMNDLSGFIPSEIGNM  1866
             L GK+ P + +L  LSGLYLH+N L G IPKE+ +LT+L+DLYLN N+LSG IP EIG M
Sbjct  82    LTGKLSPAMAELKCLSGLYLHYNLLSGEIPKELGNLTELTDLYLNDNNLSGTIPPEIGRM  141

Query  1865  PNLQVLQLCYNRFEGCIPNKLGSLKNLTVLALQSNQLTGAIPASlggltlltrldLSFNR  1686
              +LQ L L  N+ +G IP ++G LK L VLAL+ N LTG IP++LG   +L RL L FN+
Sbjct  142   ASLQALVLSCNQLKGSIPTEIGFLKKLIVLALEHNMLTGEIPSNLGIQGMLKRLYLGFNQ  201

Query  1685  LFGSIPVKLSEASKLEVLDLRNNTLSGNVPLGLKRLNEGFRYENNPGLCGTGFPSLALCS  1506
             L G IP KL+ A +LEVL+++NNTL+G VP  L+RL+  F YE+NPGLCGTGF SL +C+
Sbjct  202   LSGPIPSKLATAPQLEVLEIQNNTLTGVVPPALRRLSGKFNYESNPGLCGTGFASLRVCT  261

Query  1505  ---DSSLNPTKPEPFGQGSNRLPTKDIPESANI-------PHQLNQNRKPQAAAAVVGVI  1356
                + ++N   P      +N +P KD+PE+AN+        H    +R PQ    V  VI
Sbjct  262   AWDNVNVNQVDPNEPNSNNNGVP-KDVPETANVSRLHCNQTHCSRSSRFPQVII-VASVI  319

Query  1355  GLFVILAVAGLFTFSWYRRRKQQIGSTVDISESRVSTDQPKVLCRRSTSPLISLEYSNGW  1176
              + V L VA +F     RR KQ++G+T D S+ R+STDQ K + +RS SPL+++EYSN W
Sbjct  320   TVTVTLIVAVVFGIFRRRRFKQRVGNTSDASDDRLSTDQTKEIYKRSPSPLLTVEYSNHW  379

Query  1175  DPLAKDQSGSALSQEVLESFMFNLDEVESATQYFSETNLLGKSSFSAVYKGTLRDGSAVA  996
             DP+  ++   ++  E L  F FNL+EVESATQ+F+E NLLG+S+FSAVYKG L+DGS VA
Sbjct  380   DPMTPEKGYGSMRYEFLHGFKFNLEEVESATQHFTEVNLLGRSNFSAVYKGILKDGSIVA  439

Query  995   VKCISKTSCKSDEAEFRKGLTLLTSLKHENLLRLRGFCCSKGRGECFLIYDFVSNGNLLR  816
             VK IS TSCKS+E EF +GL+LLTSLKHENL++LRGFCCSKGRGECFLIYDF S GNL +
Sbjct  440   VKMISVTSCKSEETEFMEGLSLLTSLKHENLVKLRGFCCSKGRGECFLIYDFASKGNLSQ  499

Query  815   YLDVKDEKGKVLDWSTRTAIIKGIARGIKYLHGNKRNKPALVHRNISADKVLIDHLYKPL  636
             +LDV++    VLDWSTR +IIKGIA+G+ YLH ++ NKP++VHRNIS +KVL+D  + PL
Sbjct  500   FLDVEENSSHVLDWSTRVSIIKGIAKGLGYLHSSEPNKPSMVHRNISVEKVLLDQQFTPL  559

Query  635   LSDSGLHKLLADDIVFSTLKGSAANGYLAPEYAITGRFTEKSDMYAFGVIILQILSGSCV  456
             + D GL KLLADD+V+S LK SAA GY+APEY  TGRFTEKSD+YAFGVIILQ+LSG  +
Sbjct  560   ILDCGLLKLLADDVVYSALKVSAALGYMAPEYITTGRFTEKSDVYAFGVIILQVLSGKGL  619

Query  455   VTQSNHQGAELCRFEDFVDAKLGKDFVESEAAKLGKIALLCTHDSPSRRPAI  300
             +  S    AE C FE+F+D  L   F  SEA  L K+A  CT + P  RP++
Sbjct  620   LDCSMRLAAESCNFENFIDPNLKGTFSVSEATLLTKLATSCTLEDPDSRPSM  671



>ref|XP_006374656.1| hypothetical protein POPTR_0015s14480g [Populus trichocarpa]
 gb|ERP52453.1| hypothetical protein POPTR_0015s14480g [Populus trichocarpa]
Length=546

 Score =   668 bits (1724),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 339/526 (64%), Positives = 418/526 (79%), Gaps = 8/526 (2%)
 Frame = -3

Query  2213  STVSLLMAIKASLDPGNLVLSSWSPNVTDPCSVSSFEGIACNDLGQVVNISLQGKGLYGK  2034
             + +  LM +KA+LDP N  L+SW+ N + PC   SFEG+ACN+ GQV NISLQGKGLYGK
Sbjct  24    TEIGALMDMKAALDPENRYLTSWTINGS-PCD-GSFEGVACNEKGQVANISLQGKGLYGK  81

Query  2033  IPPEIGQLNGLSGLYLHFNNLHGVIPKEIASLTQLSDLYLNMNDLSGFIPSEIGNMPNLQ  1854
             + P I  L  L+GLYLHFN+L+G +P+EIA+LT+LSDLYLN+N+LSG IP EIG M NLQ
Sbjct  82    VSPAIAGLKHLTGLYLHFNSLYGDVPREIANLTELSDLYLNVNNLSGDIPPEIGIMANLQ  141

Query  1853  VLQLCYNRFEGCIPNKLGSLKNLTVLALQSNQLTGAIPASlggltlltrldLSFNRLFGS  1674
             VLQLCYN+F G IP ++GSL+ L+VL LQSN LTGAIPASLGGL +L RLDLS+N LFGS
Sbjct  142   VLQLCYNQFTGSIPTEMGSLEKLSVLTLQSNHLTGAIPASLGGLGMLMRLDLSYNHLFGS  201

Query  1673  IPVKLSEASKLEVLDLRNNTLSGNVPLGLKRLNEGFRYENNPGLCGTGFPSLALCSDSSL  1494
             IP K+++A  LE LD+RNNTLSGNVPL LKRLN+GF YENN GLCG GF SL  C+ S L
Sbjct  202   IPTKVADAPLLEFLDIRNNTLSGNVPLALKRLNDGFLYENNLGLCGAGFVSLNACNASEL  261

Query  1493  NPTKPEPFGQGSNRLPTKDIPESANIPHQLNQNR-----KPQAAAAVVGVIGLFVILAVA  1329
             NP++PEPFG G N LP ++IPE+A++P   NQ       K   A+A V  + + ++LA  
Sbjct  262   NPSRPEPFGTGVNGLP-REIPETASLPLLCNQTHCSNPSKSHHASAAVATVVITILLAAI  320

Query  1328  GLFTFSWYRRRKQQIGSTVDISESRVSTDQPKVLCRRSTSPLISLEYSNGWDPLAKDQSG  1149
             G+ TF+ YRRRKQ++ S+ ++S+SR+STDQ K   R++ SPLISLEY NGWDPLA  ++ 
Sbjct  321   GILTFTQYRRRKQKLASSYEVSDSRLSTDQAKGAYRKNGSPLISLEYPNGWDPLADGRNL  380

Query  1148  SALSQEVLESFMFNLDEVESATQYFSETNLLGKSSFSAVYKGTLRDGSAVAVKCISKTSC  969
             S  +Q+V +SF FNL+EVE+ATQYFSE NLLGKS+FSA Y+G LRDGS VA+K ISK SC
Sbjct  381   SGNAQDVFQSFRFNLEEVETATQYFSEVNLLGKSNFSATYRGILRDGSVVAIKSISKNSC  440

Query  968   KSDEAEFRKGLTLLTSLKHENLLRLRGFCCSKGRGECFLIYDFVSNGNLLRYLDVKDEKG  789
             KS+E EF KGL  LTSL+HENL+RLRGFCCS+GRGECFLIYDFV NGNLLRYLDVKD  G
Sbjct  441   KSEETEFLKGLNTLTSLRHENLVRLRGFCCSRGRGECFLIYDFVPNGNLLRYLDVKDGDG  500

Query  788   KVLDWSTRTAIIKGIARGIKYLHGNKRNKPALVHRNISADKVLIDH  651
              VL+WSTR +I++GIA+GI YLHG K NKP+L+H+NI+A+KVLID 
Sbjct  501   HVLEWSTRVSIVRGIAKGIAYLHGYKANKPSLIHQNITAEKVLIDQ  546



>ref|XP_009593141.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase At1g17230 [Nicotiana tomentosiformis]
Length=681

 Score =   673 bits (1737),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 363/655 (55%), Positives = 470/655 (72%), Gaps = 17/655 (3%)
 Frame = -3

Query  2225  SNNASTVSLLMAIKASLDPGNLVLSSWSPNVTDPCSVSSFEGIACNDLGQVVNISLQGKG  2046
             SN  + V  LM IK++LDP N  L SW+ N  DPCS  SF G+ CN+  +V NISL+ KG
Sbjct  24    SNGNAEVRALMEIKSTLDPDNKKLFSWTSN-GDPCS-GSFLGVVCNEHHKVANISLESKG  81

Query  2045  LYGKIPPEIGQLNGLSGLYLHFNNLHGVIPKEIASLTQLSDLYLNMNDLSGFIPSEIGNM  1866
             L GK+ P + +L  LSGLYLH+N L G IPKE+ +LT+L+DLYLN N+LSG IP EIG+M
Sbjct  82    LTGKLSPAMAELKCLSGLYLHYNLLSGEIPKELGNLTELTDLYLNANNLSGTIPPEIGSM  141

Query  1865  PNLQVLQLCYNRFEGCIPNKLGSLKNLTVLALQSNQLTGAIPASlggltlltrldLSFNR  1686
              +LQ L L  N+  G IP ++G LK L++LAL+ N LTG IP++LG   +L RL L FN+
Sbjct  142   ASLQALDLSCNQLTGSIPTEIGFLKKLSILALEHNMLTGEIPSNLGIQGMLKRLYLGFNQ  201

Query  1685  LFGSIPVKLSEASKLEVLDLRNNTLSGNVPLGLKRLNEGFRYENNPGLCGTGFPSLALCS  1506
             L G IP+KL+ A +LEVL+++NNTLSG VP  L+RL+  F YE+NPGLCGTGF SL +C+
Sbjct  202   LSGPIPLKLATAPQLEVLEVQNNTLSGIVPPALRRLSGKFNYESNPGLCGTGFTSLRVCT  261

Query  1505  ---DSSLNPTKPEPFGQGSNRLPTKDIPESANI-------PHQLNQNRKPQAAAAVVGVI  1356
                + ++N   P      +N +P +D+PE+AN+        H    +R PQA   V  VI
Sbjct  262   AWDNVNVNQVDPNGPNTNNNGVP-RDVPETANVSRLHCNQTHCSRSSRFPQAII-VASVI  319

Query  1355  GLFVILAVAGLFTFSWYRRRKQQIGSTVDISESRVSTDQPKVLCRRSTSPLISLEYSNGW  1176
              + V L VA +F     RR KQ++G+T   S+ R+STDQ K + +RS SPL+++EYSN W
Sbjct  320   TVTVTLIVAVVFGIFRRRRFKQRVGNT---SDDRLSTDQTKEIYKRSPSPLLTVEYSNHW  376

Query  1175  DPLAKDQSGSALSQEVLESFMFNLDEVESATQYFSETNLLGKSSFSAVYKGTLRDGSAVA  996
             DP+  ++S  ++  + L  F FNL+EVESATQ+F+E NLLG+S+FSAVYKG L+DGS VA
Sbjct  377   DPMTPEKSCGSMRYDFLHGFKFNLEEVESATQHFTEVNLLGRSNFSAVYKGILKDGSIVA  436

Query  995   VKCISKTSCKSDEAEFRKGLTLLTSLKHENLLRLRGFCCSKGRGECFLIYDFVSNGNLLR  816
             VK IS TSCKS+E EF +GL+LLTSLKHENL++LRGFCCSKGRGECFLIYDF S GNL +
Sbjct  437   VKMISVTSCKSEETEFMEGLSLLTSLKHENLVKLRGFCCSKGRGECFLIYDFASKGNLSQ  496

Query  815   YLDVKDEKGKVLDWSTRTAIIKGIARGIKYLHGNKRNKPALVHRNISADKVLIDHLYKPL  636
             YLDV+     VLDWSTR +IIKGIA+G+ YLHG++ NKP++VHRNIS +KVL+D  + PL
Sbjct  497   YLDVEGNSSHVLDWSTRVSIIKGIAKGLGYLHGSEPNKPSMVHRNISVEKVLLDQQFTPL  556

Query  635   LSDSGLHKLLADDIVFSTLKGSAANGYLAPEYAITGRFTEKSDMYAFGVIILQILSGSCV  456
             + D GL KLLADD+V+S LK SAA GY+APEY  TGRFTEKSD+YAFGVIILQ+LSG  +
Sbjct  557   ILDCGLLKLLADDVVYSALKVSAALGYMAPEYITTGRFTEKSDVYAFGVIILQVLSGKGL  616

Query  455   VTQSNHQGAELCRFEDFVDAKLGKDFVESEAAKLGKIALLCTHDSPSRRPAIDVV  291
             +  S    AE C FE+F+D  L   F  SEA  L K+A+ CT + P  RP++ +V
Sbjct  617   LDCSMRLAAESCNFENFIDPNLKGTFSVSEATLLTKLAINCTLEDPDSRPSMVLV  671



>ref|XP_004964453.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g34110-like [Setaria italica]
Length=676

 Score =   672 bits (1735),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 358/640 (56%), Positives = 469/640 (73%), Gaps = 16/640 (3%)
 Frame = -3

Query  2174  DPGNLVLSSWSPNVTDPCSVSSFEGIACNDLGQVVNISLQGKGLYGKIPPEIGQLNGLSG  1995
             DP   VL SW+P+  DPC   SF G+ C+  G+V  +SLQG+GL G +PP +  L  L G
Sbjct  39    DPAGRVLGSWNPS-GDPCG-GSFVGVTCDTAGRVTAVSLQGRGLSGSLPPAVAGLRRLQG  96

Query  1994  LYLHFNNLHGVIPKEIASLTQLSDLYLNMNDLSGFIPSEIGNMPNLQVLQLCYNRFEGCI  1815
             LYLH+N + G IP+EI  L++L+DLYL++N L+G +P EI +M NLQVLQL YN+  G I
Sbjct  97    LYLHYNGIKGPIPREIGKLSELTDLYLDVNHLTGPVPVEIASMANLQVLQLGYNQLTGSI  156

Query  1814  PNKLGSLKNLTVLALQSNQLTGAIPASlggltlltrldLSFNRLFGSIPVKLSEASKLEV  1635
             P +LG+L  LTVLA+QSNQLTGAIPA+LG LT L RLDLSFN LFGSIP K++E   LEV
Sbjct  157   PPQLGNLNKLTVLAMQSNQLTGAIPATLGELTQLRRLDLSFNSLFGSIPSKIAEVPLLEV  216

Query  1634  LDLRNNTLSGNVPLGLKRLNEGFRYENNPGLCGTGFPSLALC--SDSSLNPTKPEPFGQG  1461
              D+RNNTLSG+VP+GL+R+N GF+Y NN GLCG GF  L LC  S+  L P+KPEPFG  
Sbjct  217   FDIRNNTLSGSVPVGLRRMNGGFQYMNNKGLCGVGFSLLELCPSSEDGLKPSKPEPFGP-  275

Query  1460  SNRLPTKDIPESANIPHQLNQNRKPQAA-----AAVVGVIGLFVILAVAGLFTFSWYRRR  1296
                + T+++P+S N P   + +R  ++A       +V V+ + +  A  GLF FSWYRR+
Sbjct  276   DGTVKTREVPQSVN-PENCSGSRCSKSANGSEGVLIVAVVAVVIGAAFCGLFAFSWYRRQ  334

Query  1295  KQQIGSTVDISESRVSTD--QPKVLCRRSTSPLISLEYSNGWDPLAKDQSGSALSQEVLE  1122
             KQ+IGS++++S+SR+STD  Q K  CRRS SPLIS+EYSN WDPL+        S EV +
Sbjct  335   KQKIGSSLEVSDSRLSTDHFQQKEACRRSASPLISVEYSNSWDPLSGGG--VGSSGEVGD  392

Query  1121  SFMFNLDEVESATQYFSETNLLGKSSFSAVYKGTLRDGSAVAVKCISKTSCKSDEAEFRK  942
             SF FNL+EVE ATQYFS+ NLLGKS F+A YKG LRDGS VAVK ++KTSCK +E++F +
Sbjct  393   SFRFNLEEVECATQYFSDVNLLGKSGFAATYKGILRDGSVVAVKSLNKTSCKQEESDFLR  452

Query  941   GLTLLTSLKHENLLRLRGFCCSKGRGECFLIYDFVSNGNLLRYLDVKD-EKGKVLDWSTR  765
             GL +L+ L+H+NL+ LRGFCCS+GRGECFL+YDF+ NG L +YLDVKD     VLDW TR
Sbjct  453   GLKMLSLLRHDNLVSLRGFCCSRGRGECFLVYDFMVNGCLSQYLDVKDGSSASVLDWPTR  512

Query  764   TAIIKGIARGIKYLHGNKRNKPALVHRNISADKVLIDHLYKPLLSDSGLHKLLADDIVFS  585
              +I++GIA+GI+YLH  K +KP +VH+NISA+K+L+DH + P LS  GLHKLLADD+VFS
Sbjct  513   VSIVRGIAKGIEYLHSKKSSKPPVVHQNISAEKILLDHHFAPRLSVPGLHKLLADDVVFS  572

Query  584   TLKGSAANGYLAPEYAITGRFTEKSDMYAFGVIILQILSGSCVVTQSNHQGAELCRFEDF  405
             TLK SAA GYLAPEYA TGRFT+KSD++AFG+++LQ+++G   V+Q     A +   +  
Sbjct  573   TLKASAAMGYLAPEYATTGRFTDKSDVFAFGIVVLQVITGKRDVSQLKVGAAAVSDLDGL  632

Query  404   VDAKLGKDFVESEAAKLGKIALLCTHDSPSRRPAIDVVIQ  285
             VD  L   F  +EAA+L  +A  CT + P++RP ++ V+Q
Sbjct  633   VDGNLNGVFSRTEAARLAAVAAYCTSEVPNQRPTMEAVVQ  672



>dbj|BAD68873.1| putative somatic embryogenesis protein kinase 1 [Oryza sativa 
Japonica Group]
Length=647

 Score =   671 bits (1732),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 367/647 (57%), Positives = 472/647 (73%), Gaps = 16/647 (2%)
 Frame = -3

Query  2195  MAIKASLDPGNLVLSSWSPNVTDPCSVSSFEGIACNDLGQVVNISLQGKGLYGKIPPEIG  2016
             MA+K SLDP   VL SW+ +  +PC   SF G+ C+  G+V  ISLQG+GL G +PP I 
Sbjct  1     MALKESLDPAGRVLGSWARS-GEPCG-GSFVGVTCDSGGRVTAISLQGRGLSGTLPPAIA  58

Query  2015  QLNGLSGLYLHFNNLHGVIPKEIASLTQLSDLYLNMNDLSGFIPSEIGNMPNLQVLQLCY  1836
              L  L+GLYLH+N + G IP+EI SL++L+DLYL++N L+G +P EI  M NLQVLQL Y
Sbjct  59    GLRRLTGLYLHYNGIKGAIPREIGSLSELTDLYLDVNHLTGPLPVEIAAMENLQVLQLGY  118

Query  1835  NRFEGCIPNKLGSLKNLTVLALQSNQLTGAIPASlggltlltrldLSFNRLFGSIPVKLS  1656
             N+  G IP +LG L  L VLALQSNQLTGAIPA+LG LT L RLDLSFN LFGSIP K++
Sbjct  119   NQLTGSIPPQLGKLNKLAVLALQSNQLTGAIPATLGDLTQLARLDLSFNSLFGSIPSKIA  178

Query  1655  EASKLEVLDLRNNTLSGNVPLGLKRLNEGFRYENNPGLCGTGFPSLALC--SDSSLNPTK  1482
             E   LEV D+RNN+LSG+VP GL+RLN GF+Y NN GLCG GF  L LC  S+  L P+K
Sbjct  179   EVPLLEVFDVRNNSLSGSVPAGLRRLNGGFQYVNNKGLCGVGFSLLDLCLSSEDGLKPSK  238

Query  1481  PEPFGQGSNRLPTKDIPESANIPHQ-----LNQNRKPQAAAAVVGVIGLFVILAVAGLFT  1317
             PEPFG     + T+ +P+SAN  +       +++        VVGV+ + +  A  G+F 
Sbjct  239   PEPFGP-DGTVKTRQVPQSANTDNHCEGSGCSKSSNASVGVLVVGVVAVVIGAAFCGIFA  297

Query  1316  FSWYRRRKQQIGSTVDISESRVSTD--QPKVLCRRSTSPLISLEYSNGWDPLAKDQSGSA  1143
             FS+YRR+KQ+IGS++++S+SR+STD  Q K +CRRS SPLIS+EYSNGWDPL+       
Sbjct  298   FSYYRRQKQKIGSSLEVSDSRLSTDHYQQKEVCRRSASPLISVEYSNGWDPLSGGG--VG  355

Query  1142  LSQEVLESFMFNLDEVESATQYFSETNLLGKSSFSAVYKGTLRDGSAVAVKCISKTSCKS  963
              S EV +SF FNL+EVE ATQYFSE NLLGKS F+A YKG LRDGS VAVK ++KTSCK 
Sbjct  356   SSGEVGDSFRFNLEEVECATQYFSEVNLLGKSGFAATYKGILRDGSVVAVKSLNKTSCKQ  415

Query  962   DEAEFRKGLTLLTSLKHENLLRLRGFCCSKGRGECFLIYDFVSNGNLLRYLDVKDEKG-K  786
             +E++F +GL +LT L+HENL+ LRGFCCS+GRGECFL+YD++ NG L +YLDVK+  G  
Sbjct  416   EESDFLRGLKMLTVLRHENLVGLRGFCCSRGRGECFLVYDYMVNGCLSQYLDVKEGSGAN  475

Query  785   VLDWSTRTAIIKGIARGIKYLHGNKRNKPALVHRNISADKVLIDHLYKPLLSDSGLHKLL  606
             VLDW TR +II+GIA+G++Y+H  K NKP++VH+NISA+K+L+DH   P LS  GLHKLL
Sbjct  476   VLDWPTRVSIIRGIAKGVEYMHSKKANKPSVVHQNISAEKILLDHHLTPRLSVPGLHKLL  535

Query  605   ADDIVFSTLKGSAANGYLAPEYAITGRFTEKSDMYAFGVIILQILSGSCVVTQSNHQGAE  426
             ADD+VFSTLK SAA GYLAPEYA TGRFTEKSD++AFG+++LQ+++G   V+Q       
Sbjct  536   ADDVVFSTLKASAAMGYLAPEYATTGRFTEKSDVFAFGIVVLQVITGRRAVSQLKVSTVA  595

Query  425   LCRFEDFVDAKLGKDFVESEAAKLGKIALLCTHDSPSRRPAIDVVIQ  285
                 +  +D  L   F  +EAAKL  IA LCT ++ S+RP ++ V+Q
Sbjct  596   -NDLDSLIDENLNGVFSRTEAAKLAAIAALCTSETASQRPTMEAVVQ  641



>ref|XP_008658219.1| PREDICTED: uncharacterized protein LOC100272330 isoform X1 [Zea 
mays]
 gb|AFW85974.1| putative leucine-rich repeat protein kinase family protein [Zea 
mays]
Length=682

 Score =   672 bits (1735),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 365/643 (57%), Positives = 464/643 (72%), Gaps = 17/643 (3%)
 Frame = -3

Query  2174  DPGNLVLSSWSPNVTDPCSVSSFEGIACNDLGQVVNISLQGKGLYGKIPPEIGQLNGLSG  1995
             DP   VL SW P+  DPC+  SF G+ C   G+V  +SLQG+GL G +PP +  L  L G
Sbjct  38    DPAGRVLGSWDPS-GDPCA-GSFVGLTCGRDGRVTAVSLQGRGLSGTLPPAVAGLRRLQG  95

Query  1994  LYLHFNNLHGVIPKEIASLTQLSDLYLNMNDLSGFIPSEIGNMPNLQVLQLCYNRFEGCI  1815
             LYLH+N + G IP+EI  L++L+DLYL++N L+G +P EI  + NLQVLQL YN+  G I
Sbjct  96    LYLHYNGIKGPIPREIGKLSELTDLYLDVNHLTGPVPVEIAAIANLQVLQLGYNQLTGSI  155

Query  1814  PNKLGSLKNLTVLALQSNQLTGAIPASlggltlltrldLSFNRLFGSIPVKLSEASKLEV  1635
             P +LG+L  LTVLA+QSNQL GAIPA+LG LT L RLDLSFN LFGSIP K++E   LEV
Sbjct  156   PPQLGNLNKLTVLAMQSNQLDGAIPATLGELTQLRRLDLSFNSLFGSIPSKIAEVPLLEV  215

Query  1634  LDLRNNTLSGNVPLGLKRLNEGFRYENNPGLCGTGFPSLALC--SDSSLNPTKPEPFGQG  1461
              D+RNNTLSG+VP+GL+RLN GF+Y NN GLCG GF  L LC  S+  L P+KPEPFG  
Sbjct  216   FDVRNNTLSGSVPVGLRRLNGGFQYMNNKGLCGAGFSLLELCLSSEDGLKPSKPEPFGP-  274

Query  1460  SNRLPTKDIPESANIPHQLNQNRKPQAAAA-----VVGVIGLFVILAVAGLFTFSWYRRR  1296
                + T+ +P+SAN P   +     ++A A     +V V+   +  A  GLF FSWYRR+
Sbjct  275   DGTVKTRQVPQSAN-PDGCSGASCSKSANASQGVLIVAVVAAVIGAAFCGLFAFSWYRRQ  333

Query  1295  KQQIGSTVDISESRVSTD--QPKVLCRRSTSPLISLEYSNGWDPLAKDQSG-SALSQEVL  1125
             KQ+IGS++++S+SR+STD  Q K  CRRS SPLIS+EYSN WDPL+   +G  +  Q V 
Sbjct  334   KQKIGSSLEVSDSRLSTDHFQQKEACRRSASPLISVEYSNSWDPLSAGGAGVGSPGQVVG  393

Query  1124  ESFMFNLDEVESATQYFSETNLLGKSSF-SAVYKGTLRDGSAVAVKCISKTSCKSDEAEF  948
             +SF FNL+EVE ATQYFS+ NLLGKS F +A YKG LRDGS VAVK +SKTSCK +E++F
Sbjct  394   DSFRFNLEEVECATQYFSDVNLLGKSGFAAATYKGILRDGSVVAVKSLSKTSCKQEESDF  453

Query  947   RKGLTLLTSLKHENLLRLRGFCCSKGRGECFLIYDFVSNGNLLRYLDVKD--EKGKVLDW  774
              +GL +LT L+H+NL+ LRGFCCS+GRGECFL+YDF+ NG L RYLDVKD      VLDW
Sbjct  454   LRGLKMLTLLQHDNLVSLRGFCCSRGRGECFLVYDFMVNGCLSRYLDVKDGSSGATVLDW  513

Query  773   STRTAIIKGIARGIKYLHGNKRNKPALVHRNISADKVLIDHLYKPLLSDSGLHKLLADDI  594
              TR +II+GIA+GI+YLH  K +KP +VH+NISADK+L+DH   P LS  GLHKLLADD+
Sbjct  514   PTRVSIIRGIAKGIEYLHSKKGSKPPVVHQNISADKILLDHHLAPRLSVPGLHKLLADDV  573

Query  593   VFSTLKGSAANGYLAPEYAITGRFTEKSDMYAFGVIILQILSGSCVVTQSNHQGAELCRF  414
             VFS LK SAA GYLAPEYA TGRFT+KSD++AFGV++LQ+L+G   V+Q     A +   
Sbjct  574   VFSALKASAAMGYLAPEYAATGRFTDKSDVFAFGVVVLQVLTGRRDVSQLKVGAAAVSDL  633

Query  413   EDFVDAKLGKDFVESEAAKLGKIALLCTHDSPSRRPAIDVVIQ  285
                VDA L   F  +EAA+L  +A  CT ++P +RP ++ V+Q
Sbjct  634   GGLVDANLDGAFSRTEAARLAAVAAYCTSETPGQRPTMEAVVQ  676



>ref|XP_007157320.1| hypothetical protein PHAVU_002G060200g [Phaseolus vulgaris]
 gb|ESW29314.1| hypothetical protein PHAVU_002G060200g [Phaseolus vulgaris]
Length=683

 Score =   663 bits (1711),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 357/651 (55%), Positives = 454/651 (70%), Gaps = 13/651 (2%)
 Frame = -3

Query  2207  VSLLMAIKASLDPGNLVLSSWSPNVTDPCSVSSFEGIACNDLGQVVNISLQGKGLYGKIP  2028
             +S LM +K+SLDP   +L+SW  +  DPCS   F+G+ACN   +V NISLQGKGL G + 
Sbjct  27    LSALMELKSSLDPDGKILASWISD-GDPCS-GFFQGVACNQNQKVANISLQGKGLSGWLS  84

Query  2027  PEIGQLNGLSGLYLHFNNLHGVIPKEIASLTQLSDLYLNMNDLSGFIPSEIGNMPNLQVL  1848
             P + +L  LSGLYLH+NNL G IP  I++LT L DLYL++N LSG IP E+GNM +LQVL
Sbjct  85    PALAELKCLSGLYLHYNNLSGEIPPHISNLTDLVDLYLDVNSLSGTIPPELGNMASLQVL  144

Query  1847  QLCYNRFEGCIPNKLGSLKNLTVLALQSNQLTGAIPASlggltlltrldLSFNRLFGSIP  1668
             QL  N+  G IP ++GSLK L+ LALQ N+LTG IP SLG L  L RL+LSFN   G++P
Sbjct  145   QLGDNQLVGNIPTQMGSLKQLSTLALQYNKLTGQIPLSLGTLEKLRRLNLSFNNFNGTVP  204

Query  1667  VKLSEASKLEVLDLRNNTLSGNVPLGLKRLNEGFRYENNPGLCGTGFPSLALCS-DSSLN  1491
               L+    LEVLD++NN+LSG VP  LKRL EGF+  NNPGLCG  F +L  C+ D +LN
Sbjct  205   ATLAHIEHLEVLDVQNNSLSGIVPSALKRLGEGFQGANNPGLCGVEFSTLKACNKDQNLN  264

Query  1490  PTKPEPFG--QGSNRLPTKDIPESANIP-----HQLNQNRKPQAAAAVVGVIGLFVILAV  1332
                 +     Q  +R  +K +PE AN+         +++R PQ      GVI + +    
Sbjct  265   VNHIDTLDRDQPKSRNSSKALPEPANVQLHCDHTHCSKSRFPQIVI-TAGVIAVSLTFIC  323

Query  1331  AGLFTFSWYRRRKQQIGSTVDISESRVSTDQPKVLCRRSTSPLISLEYSNGWDPLAKDQS  1152
             AG  TF  YRR+KQ+I +T   S+ ++S D+PK L  +S S L+++EY +GWD L+  Q+
Sbjct  324   AGFLTFFRYRRQKQRISNTSSSSQGKLSPDKPKELYTKSPSALVNIEYYSGWDHLSNGQN  383

Query  1151  GSA--LSQEVLESFMFNLDEVESATQYFSETNLLGKSSFSAVYKGTLRDGSAVAVKCISK  978
               A  L  + L  F FN+DEVESATQY SE +LLGKS FSAVYKG LRDGS VA++ IS 
Sbjct  384   ADAGGLLNDYLSQFRFNVDEVESATQYLSEASLLGKSKFSAVYKGVLRDGSLVAIRSISV  443

Query  977   TSCKSDEAEFRKGLTLLTSLKHENLLRLRGFCCSKGRGECFLIYDFVSNGNLLRYLDVKD  798
             T CK++EAEF KGL LLTSL+HENL+RLRGFCCS+ RGECFLIYDF + GNL +YLD++D
Sbjct  444   TCCKTEEAEFVKGLNLLTSLRHENLVRLRGFCCSRSRGECFLIYDFATMGNLSQYLDLED  503

Query  797   EKGKVLDWSTRTAIIKGIARGIKYLHGNKRNKPALVHRNISADKVLIDHLYKPLLSDSGL  618
               G VL+WS R +II GIA+GI YLH N+ +KP +VH+NIS + VL+DH + PL+ D+GL
Sbjct  504   GSGNVLEWSKRVSIINGIAKGIGYLHSNEASKPTIVHQNISVENVLLDHQFNPLIMDAGL  563

Query  617   HKLLADDIVFSTLKGSAANGYLAPEYAITGRFTEKSDMYAFGVIILQILSGSCVVTQSNH  438
              KLLADD+VFS LK SAA GYLAPEY  TGRFTEKSD+YAFGVIILQ+LSG   +  S  
Sbjct  564   PKLLADDVVFSALKVSAAMGYLAPEYITTGRFTEKSDIYAFGVIILQVLSGKTTIGSSIR  623

Query  437   QGAELCRFEDFVDAKLGKDFVESEAAKLGKIALLCTHDSPSRRPAIDVVIQ  285
                E  RF+D VDA L   + +SEAA L K+A+ CTH+ P +RP +  VIQ
Sbjct  624   TAVESFRFDDSVDANLRGRYSKSEAATLSKLAIQCTHEFPDQRPTVVDVIQ  674



>ref|XP_003517433.1| PREDICTED: somatic embryogenesis receptor kinase 2-like isoform 
X1 [Glycine max]
 gb|KHN42717.1| Protein NSP-INTERACTING KINASE 2 [Glycine soja]
Length=689

 Score =   662 bits (1707),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 357/649 (55%), Positives = 447/649 (69%), Gaps = 13/649 (2%)
 Frame = -3

Query  2198  LMAIKASLDPGNLVLSSWSPNVTDPCSVSSFEGIACNDLGQVVNISLQGKGLYGKIPPEI  2019
             LM +K+SLDP   +L SW  +  DPCS   FEG+ACN+  +V NISLQGKGL G + P +
Sbjct  34    LMELKSSLDPEGKILGSWISD-GDPCS-GFFEGVACNEHRKVANISLQGKGLSGWLSPAL  91

Query  2018  GQLNGLSGLYLHFNNLHGVIPKEIASLTQLSDLYLNMNDLSGFIPSEIGNMPNLQVLQLC  1839
              +L  LSGLYLH+NNL G IP  I++LT+L DLYL++N LSG IP EI NM +LQVLQL 
Sbjct  92    AELKCLSGLYLHYNNLSGEIPPRISNLTELVDLYLDVNSLSGAIPPEISNMASLQVLQLG  151

Query  1838  YNRFEGCIPNKLGSLKNLTVLALQSNQLTGAIPASlggltlltrldLSFNRLFGSIPVKL  1659
              N+  G IP ++GSLK+L+ LALQ N+LTG IP SLG L  L+RL+LSFN   G++P  L
Sbjct  152   DNQLVGNIPTQMGSLKHLSTLALQYNKLTGQIPLSLGNLEKLSRLNLSFNNFSGTVPATL  211

Query  1658  SEASKLEVLDLRNNTLSGNVPLGLKRLNEGFRYENNPGLCGTGFPSLALCS---DSSLNP  1488
             +    LEVLD++NN LSG VP  LKRL E F+  NNPGLCG GF +L  C+   D ++N 
Sbjct  212   AHIEHLEVLDIQNNYLSGIVPSALKRLGERFQGANNPGLCGVGFSTLRACNKDQDLNVNH  271

Query  1487  TKPEPFGQGSNRLPTKDIPESANIPHQLNQ-----NRKPQAAAAVVGVIGLFVILAVAGL  1323
                    Q  N   +K +PE A +     Q     +R+        GVI + +    AG 
Sbjct  272   IDTSDGDQPENSDSSKALPEPAYVQSHCGQTHCSKSRRFPHTVITAGVIIVALAFICAGF  331

Query  1322  FTFSWYRRRKQQIGSTVDIS-ESRVSTDQPKVLCRRSTSPLISLEYSNGWDPLAKDQSGS  1146
              TF  YRR+KQ+I +T   S E +VS DQPK    +S S L+++EY +GWDPL+  Q+  
Sbjct  332   LTFFRYRRQKQRISNTSSSSSEGKVSPDQPKEFYTKSPSALVNIEYYSGWDPLSNGQNAD  391

Query  1145  --ALSQEVLESFMFNLDEVESATQYFSETNLLGKSSFSAVYKGTLRDGSAVAVKCISKTS  972
                L  E L  F FN+DEVESATQY SETNLLGKS FSAVYKG LRDGS VA++ IS T 
Sbjct  392   VGGLCNEYLNQFRFNVDEVESATQYLSETNLLGKSKFSAVYKGVLRDGSLVAIRSISVTC  451

Query  971   CKSDEAEFRKGLTLLTSLKHENLLRLRGFCCSKGRGECFLIYDFVSNGNLLRYLDVKDEK  792
             CK++EAEF KGL LLTSL HENL+RLRGFCCS+ RGECFLIYDF + GNL +YLD++D  
Sbjct  452   CKTEEAEFVKGLNLLTSLTHENLVRLRGFCCSRSRGECFLIYDFATMGNLSQYLDIEDGS  511

Query  791   GKVLDWSTRTAIIKGIARGIKYLHGNKRNKPALVHRNISADKVLIDHLYKPLLSDSGLHK  612
             G VL+WS R +IIKGIA+GI+YLH  + +KP +VH+NIS + VL+DH + PL+ D+GL K
Sbjct  512   GHVLEWSKRVSIIKGIAKGIEYLHSKEESKPTIVHQNISVENVLLDHQFNPLIMDAGLPK  571

Query  611   LLADDIVFSTLKGSAANGYLAPEYAITGRFTEKSDMYAFGVIILQILSGSCVVTQSNHQG  432
             LLADD+VFS LK SAA GYLAPEY  TGRFTEKSD+YAFGVIILQ+LSG   +  S    
Sbjct  572   LLADDVVFSALKVSAAMGYLAPEYITTGRFTEKSDIYAFGVIILQVLSGKTTIGSSIRTA  631

Query  431   AELCRFEDFVDAKLGKDFVESEAAKLGKIALLCTHDSPSRRPAIDVVIQ  285
              E  RF++ VD  L   + +SEAA L K+A+ CTH+ P +RP +  VIQ
Sbjct  632   VESFRFDESVDTNLKGRYSKSEAATLSKLAIQCTHELPDQRPTMVDVIQ  680



>ref|XP_006573733.1| PREDICTED: somatic embryogenesis receptor kinase 2-like isoform 
X2 [Glycine max]
Length=655

 Score =   660 bits (1702),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 356/648 (55%), Positives = 446/648 (69%), Gaps = 13/648 (2%)
 Frame = -3

Query  2195  MAIKASLDPGNLVLSSWSPNVTDPCSVSSFEGIACNDLGQVVNISLQGKGLYGKIPPEIG  2016
             M +K+SLDP   +L SW  +  DPCS   FEG+ACN+  +V NISLQGKGL G + P + 
Sbjct  1     MELKSSLDPEGKILGSWISD-GDPCS-GFFEGVACNEHRKVANISLQGKGLSGWLSPALA  58

Query  2015  QLNGLSGLYLHFNNLHGVIPKEIASLTQLSDLYLNMNDLSGFIPSEIGNMPNLQVLQLCY  1836
             +L  LSGLYLH+NNL G IP  I++LT+L DLYL++N LSG IP EI NM +LQVLQL  
Sbjct  59    ELKCLSGLYLHYNNLSGEIPPRISNLTELVDLYLDVNSLSGAIPPEISNMASLQVLQLGD  118

Query  1835  NRFEGCIPNKLGSLKNLTVLALQSNQLTGAIPASlggltlltrldLSFNRLFGSIPVKLS  1656
             N+  G IP ++GSLK+L+ LALQ N+LTG IP SLG L  L+RL+LSFN   G++P  L+
Sbjct  119   NQLVGNIPTQMGSLKHLSTLALQYNKLTGQIPLSLGNLEKLSRLNLSFNNFSGTVPATLA  178

Query  1655  EASKLEVLDLRNNTLSGNVPLGLKRLNEGFRYENNPGLCGTGFPSLALCS---DSSLNPT  1485
                 LEVLD++NN LSG VP  LKRL E F+  NNPGLCG GF +L  C+   D ++N  
Sbjct  179   HIEHLEVLDIQNNYLSGIVPSALKRLGERFQGANNPGLCGVGFSTLRACNKDQDLNVNHI  238

Query  1484  KPEPFGQGSNRLPTKDIPESANIPHQLNQ-----NRKPQAAAAVVGVIGLFVILAVAGLF  1320
                   Q  N   +K +PE A +     Q     +R+        GVI + +    AG  
Sbjct  239   DTSDGDQPENSDSSKALPEPAYVQSHCGQTHCSKSRRFPHTVITAGVIIVALAFICAGFL  298

Query  1319  TFSWYRRRKQQIGSTVDIS-ESRVSTDQPKVLCRRSTSPLISLEYSNGWDPLAKDQSGS-  1146
             TF  YRR+KQ+I +T   S E +VS DQPK    +S S L+++EY +GWDPL+  Q+   
Sbjct  299   TFFRYRRQKQRISNTSSSSSEGKVSPDQPKEFYTKSPSALVNIEYYSGWDPLSNGQNADV  358

Query  1145  -ALSQEVLESFMFNLDEVESATQYFSETNLLGKSSFSAVYKGTLRDGSAVAVKCISKTSC  969
               L  E L  F FN+DEVESATQY SETNLLGKS FSAVYKG LRDGS VA++ IS T C
Sbjct  359   GGLCNEYLNQFRFNVDEVESATQYLSETNLLGKSKFSAVYKGVLRDGSLVAIRSISVTCC  418

Query  968   KSDEAEFRKGLTLLTSLKHENLLRLRGFCCSKGRGECFLIYDFVSNGNLLRYLDVKDEKG  789
             K++EAEF KGL LLTSL HENL+RLRGFCCS+ RGECFLIYDF + GNL +YLD++D  G
Sbjct  419   KTEEAEFVKGLNLLTSLTHENLVRLRGFCCSRSRGECFLIYDFATMGNLSQYLDIEDGSG  478

Query  788   KVLDWSTRTAIIKGIARGIKYLHGNKRNKPALVHRNISADKVLIDHLYKPLLSDSGLHKL  609
              VL+WS R +IIKGIA+GI+YLH  + +KP +VH+NIS + VL+DH + PL+ D+GL KL
Sbjct  479   HVLEWSKRVSIIKGIAKGIEYLHSKEESKPTIVHQNISVENVLLDHQFNPLIMDAGLPKL  538

Query  608   LADDIVFSTLKGSAANGYLAPEYAITGRFTEKSDMYAFGVIILQILSGSCVVTQSNHQGA  429
             LADD+VFS LK SAA GYLAPEY  TGRFTEKSD+YAFGVIILQ+LSG   +  S     
Sbjct  539   LADDVVFSALKVSAAMGYLAPEYITTGRFTEKSDIYAFGVIILQVLSGKTTIGSSIRTAV  598

Query  428   ELCRFEDFVDAKLGKDFVESEAAKLGKIALLCTHDSPSRRPAIDVVIQ  285
             E  RF++ VD  L   + +SEAA L K+A+ CTH+ P +RP +  VIQ
Sbjct  599   ESFRFDESVDTNLKGRYSKSEAATLSKLAIQCTHELPDQRPTMVDVIQ  646



>ref|XP_003573305.1| PREDICTED: leucine-rich repeat receptor protein kinase EXS-like 
[Brachypodium distachyon]
Length=710

 Score =   659 bits (1700),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 365/672 (54%), Positives = 473/672 (70%), Gaps = 34/672 (5%)
 Frame = -3

Query  2213  STVSLLMAIKASLDPGNLV--LSSWSPNVTDPCSVSS-FEGIACNDLGQVVNISLQGKGL  2043
             + V  LM +KA+LDP      LSSW+  V  PC     FEG+AC+  G+V  +SLQG+GL
Sbjct  38    AEVDALMDLKAALDPAGQAPALSSWARGVGGPCGGEGYFEGVACDARGRVSVVSLQGRGL  97

Query  2042  YGKIPPEIGQLNGLSGLYLHFNNLHGVIPKEIASLTQLSDLYLNMNDLSGFIPSEIGNMP  1863
              G +PP +  L GL+GLYLH+N L G IP+E+  L  L++LYL +N L+G +P E+G + 
Sbjct  98    AGTVPPAVAMLPGLTGLYLHYNRLGGSIPRELGELPDLAELYLGVNSLNGSVPVELGRLR  157

Query  1862  NLQVLQLCYNRFEGCIPNKLGSLKNLTVLALQSNQLTGAIPASlggltlltrldLSFNRL  1683
              LQVLQL YN+  G IP +LG LK LTVLALQSNQLTGAIPASLG L  +TRLDLS NRL
Sbjct  158   CLQVLQLGYNQLSGSIPTQLGQLKKLTVLALQSNQLTGAIPASLGDLPEMTRLDLSSNRL  217

Query  1682  FGSIPVKLSEASKLEVLDLRNNTLSGNVPLGLKRLNEGFRYENNPGLCGTGFPSLALC--  1509
             FGSIP KL++   L+ LDLRNNTLSG+VP GLK+L+ GFR+ENNP LCG  F SL  C  
Sbjct  218   FGSIPSKLADIPNLKTLDLRNNTLSGSVPSGLKKLHRGFRFENNPELCGARFDSLKPCPN  277

Query  1508  SDSSLN---PTKPEPFGQGSNRLPTKDIPESANIPHQLNQN--RKP---QAAAAVVGVIG  1353
              D+S++   P KPE     S  +  + I ++A++    +     +P    + A + G I 
Sbjct  278   GDNSIDDQVPHKPE-----STSVKPQQIAQTADLSRNCDNGACSRPSNLSSGAVLAGTII  332

Query  1352  LFVILAVAGLFTFSWYRRRKQQIGSTVDISESRVSTDQPKVLCRRSTSPLISLEYSNGWD  1173
             +   +A  GL  FSW+RR+KQ++GS+V+ SE R S DQPK   ++S S LI++EYS+GWD
Sbjct  333   IVAGVAACGLSVFSWHRRQKQKVGSSVENSECRFSLDQPKEAYQKSASSLINVEYSSGWD  392

Query  1172  PLAK-DQSGSALSQEVLESFMFNLDEVESATQYFSETNLLGKSSFSAVYKGTLRDGSAVA  996
               ++  Q G  LS E   S  FNL+EVE ATQ+FS+ NLLGKS+F+A Y+G +RDGS VA
Sbjct  393   TSSEGSQHGVRLSPEGSPSIRFNLEEVECATQHFSDINLLGKSTFAATYRGIMRDGSVVA  452

Query  995   VKCISKTSCKSDEAEFRKGLTLLTSLKHENLLRLRGFCCSKGRGECFLIYDFVSNGNLLR  816
             VK I+K+SCKS+EA+F KGL L+TSLKHENL+ LRGFC S+ RGECFL+Y+F++NG+L R
Sbjct  453   VKSINKSSCKSEEADFLKGLRLMTSLKHENLVGLRGFCRSRLRGECFLVYEFMANGSLSR  512

Query  815   YLDVKDEKGK--VLDWSTRTAIIKGIARGIKYLHGNKRNKPALVHRNISADKVLIDHLYK  642
             YLDVKD  G   VLDW TR +II GIA+GI+YLH +K +KP LVH+NISADKVL+DH   
Sbjct  513   YLDVKDGDGDAMVLDWPTRVSIITGIAKGIEYLHSSKPSKPPLVHQNISADKVLLDHQLA  572

Query  641   PLLSDSGLHKLLADDIVFSTLKGSAANGYLAPEY-AITGRFTEKSDMYAFGVIILQILSG  465
             P +S +G H+LLADD+VFS LKGSAA GYLAPEY   TGRFT+KSD+YAFGV++ Q+L+G
Sbjct  573   PRVSGAGTHRLLADDVVFSALKGSAAMGYLAPEYTTTTGRFTDKSDVYAFGVLVFQVLTG  632

Query  464   SCVVTQ----------SNHQGAEL--CRFEDFVDAKLGKDFVESEAAKLGKIALLCTHDS  321
                V+Q          ++  GAE    + +D VD +LG  F   EAAKL  IALLCT ++
Sbjct  633   KKTVSQHLLLRAPVNAASGTGAEFGGSKLDDVVDPRLGGRFSRPEAAKLAGIALLCTSEA  692

Query  320   PSRRPAIDVVIQ  285
             P++RPA+  V+Q
Sbjct  693   PAQRPAMASVVQ  704



>ref|XP_006413630.1| hypothetical protein EUTSA_v10024592mg [Eutrema salsugineum]
 gb|ESQ55083.1| hypothetical protein EUTSA_v10024592mg [Eutrema salsugineum]
Length=681

 Score =   657 bits (1694),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 358/647 (55%), Positives = 460/647 (71%), Gaps = 16/647 (2%)
 Frame = -3

Query  2198  LMAIKASLDPGNLVLSSWSPNVTDPCSVSSFEGIACNDLGQVVNISLQGKGLYGKIPPEI  2019
             LM +K+SLDP N +L SW+ +  DPC   SFEGIACN   +V NISLQGK L GK+ P +
Sbjct  31    LMELKSSLDPENKLLRSWTLD-GDPCD-GSFEGIACNQHLKVANISLQGKRLAGKLSPAV  88

Query  2018  GQLNGLSGLYLHFNNLHGVIPKEIASLTQLSDLYLNMNDLSGFIPSEIGNMPNLQVLQLC  1839
              +L  LSGLYLH+N+L G IP+EI +LT+LSDLYLN+N+ SG IP+EIG+M  LQV+ LC
Sbjct  89    AELKCLSGLYLHYNSLSGEIPQEITNLTELSDLYLNVNNFSGEIPAEIGSMAGLQVMDLC  148

Query  1838  YNRFEGCIPNKLGSLKNLTVLALQSNQLTGAIPASlggltlltrldLSFNRLFGSIPVKL  1659
              N   G IPN +GSLK L VL+LQ N+LTG +P+SLGGL+LL+RLDLSFN L GSIP  L
Sbjct  149   CNSLTGKIPNNIGSLKKLNVLSLQHNKLTGEVPSSLGGLSLLSRLDLSFNNLLGSIPKTL  208

Query  1658  SEASKLEVLDLRNNTLSGNVPLGLKRLNEGFRYENNPGLCGTGFPSLALCS---DSSLNP  1488
                 +L+ LDLRNNTLSG VP GLK+LNE F++ENN GLCG  FPSL  CS   D ++  
Sbjct  209   DNIPELDTLDLRNNTLSGFVPPGLKKLNEKFKFENNIGLCGVDFPSLRACSAFDDETIQQ  268

Query  1487  TKPEPFGQGSNRLPTKDIPESANIPHQLNQNRKPQAAAAVVGVIGLFVILAVAGLFTFSW  1308
              K  P    +N+    +I ES     Q + ++ PQ  A +  VI + + L  AGL TF  
Sbjct  269   LKQPPGELDTNKSTLHNISESVYHQKQKSSSKLPQ-VALISSVITVGITLIGAGLLTFFR  327

Query  1307  YRRRKQQIGSTVDISESRVSTDQPKVLCRRSTSPLISLEYSNGWDPLAKDQSGSALSQE-  1131
             YRRRKQ+I +T +ISE R+STDQ K       SPL+SL Y+  WDPL   ++G+  SQE 
Sbjct  328   YRRRKQKISNTGEISEGRLSTDQQKDF---RASPLVSLAYTKEWDPLGDSRNGAEFSQEP  384

Query  1130  ----VLESFMFNLDEVESATQYFSETNLLGKSSFSAVYKGTLRDGSAVAVKCISKTSCKS  963
                 V  SF FNL+EVESATQ FSE NLL ++SF++V+KG LRDGS VA++ I+ +SCK+
Sbjct  385   HLFVVNSSFRFNLEEVESATQCFSEANLLSRNSFTSVFKGILRDGSLVAIRSINISSCKN  444

Query  962   DEAEFRKGLTLLTSLKHENLLRLRGFCCSKGRGECFLIYDFVSNGNLLRYLDVKD-EKGK  786
             +E EF  GL LL+SL HENL++LRGFCCS+GRGECFLIYDF S G L  +LD+++ E  +
Sbjct  445   EEVEFMNGLKLLSSLSHENLVKLRGFCCSRGRGECFLIYDFASKGKLSNFLDLQENETNR  504

Query  785   VLDWSTRTAIIKGIARGIKYLHG-NKRNKPALVHRNISADKVLIDHLYKPLLSDSGLHKL  609
             VLDW  R +IIKGIA+GI YLHG +++ KP  VHRNIS +K+L+D  + PL++DSGLH L
Sbjct  505   VLDWPARVSIIKGIAKGIAYLHGSDQQKKPITVHRNISVEKILLDEQFNPLIADSGLHNL  564

Query  608   LADDIVFSTLKGSAANGYLAPEYAITGRFTEKSDMYAFGVIILQILSGSCVVTQSNHQGA  429
             LADD+VFS LK SAA GYLAPEY  TG+FTEK+D++AFGVIILQILSG  ++T S    A
Sbjct  565   LADDLVFSALKTSAAMGYLAPEYVTTGKFTEKTDIFAFGVIILQILSGKLMLTSSLRIAA  624

Query  428   ELCRFEDFVDAKLGKDFVESEAAKLGKIALLCTHDSPSRRPAIDVVI  288
             E      F+D  L ++F +SEA  + +I + CT + P+ RP I+ ++
Sbjct  625   ENGEHCGFIDEYLREEFDKSEAIAMARIGISCTQEIPNNRPNIETLL  671



>ref|XP_010529507.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At5g45780 [Tarenaya hassleriana]
Length=688

 Score =   654 bits (1686),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 352/654 (54%), Positives = 457/654 (70%), Gaps = 20/654 (3%)
 Frame = -3

Query  2198  LMAIKASLDPGNLVLSSWSPNVTDPCSVSSFEGIACNDLGQVVNISLQGKGLYGKIPPEI  2019
             LM +K+SLDP N +L +W+ N  DPC   SF GIACN+  +V N+SLQGKGL GK+ P +
Sbjct  31    LMELKSSLDPENKLLQTWTLN-GDPCD-GSFVGIACNEHRKVANVSLQGKGLTGKLSPAV  88

Query  2018  GQLNGLSGLYLHFNNLHGVIPKEIASLTQLSDLYLNMNDLSGFIPSEIGNMPNLQVLQLC  1839
              +L  LSGLYLH+N+L G IP+EI +LT+L DLYLN+N+ SG IP++IG M +LQV+ LC
Sbjct  89    AELKCLSGLYLHYNSLWGEIPEEITNLTELLDLYLNVNNFSGQIPAKIGAMTSLQVVDLC  148

Query  1838  YNRFEGCIPNKLGSLKNLTVLALQSNQLTGAIPASlggltlltrldLSFNRLFGSIPVKL  1659
              N+  G IP ++GSLK LTVL+LQ N LTG IP+SLG L +L+RLD+SFN L G IP  L
Sbjct  149   CNQLTGKIPEQMGSLKKLTVLSLQYNNLTGEIPSSLGNLDMLSRLDVSFNDLLGPIPKTL  208

Query  1658  SEASKLEVLDLRNNTLSGNVPLGLKRLNEGFRYENNPGLCGTGFPSLALCSDSSLNPTKP  1479
             S+  +L+ LDLRNN+LSG VP GLK L+  F++ENNPGLCGTGFPSL  C  S+ +    
Sbjct  209   SDIPQLDTLDLRNNSLSGIVPPGLKELSGRFQFENNPGLCGTGFPSLRAC--SAFDNVNI  266

Query  1478  EPFGQ-----GSNRLPTKDIPESANIPHQLNQNR-----KPQAAAAVVGVIGLFVILAVA  1329
             E   Q     GS++   +DIP++       NQ R     K      +  VI + + L   
Sbjct  267   EQLKQPSPQIGSDKSSLQDIPKTVYFHGHCNQTRCKKSSKLPQVVLISSVITVSITLIGT  326

Query  1328  GLFTFSWYRRRKQQIGSTVDISESRVSTDQPKVLCRRSTSPLISLEYSNGWDPLAKDQSG  1149
             G  TF  YRRRKQ+I +T ++SE R+STD  K +     SPL  L YS  WDPL   ++G
Sbjct  327   GFLTFLRYRRRKQKISNTTEVSEGRLSTDLQKDMSVNGASPLTGLGYSKEWDPLGDSRNG  386

Query  1148  SALSQE----VLESFMFNLDEVESATQYFSETNLLGKSSFSAVYKGTLRDGSAVAVKCIS  981
             +  SQ+       SF F+L+++ESATQ FSE+NL+ +SSFS+V+KG LRDGS VA+K I+
Sbjct  387   AGFSQDHHFLANSSFRFSLEDIESATQCFSESNLMSRSSFSSVFKGNLRDGSLVAIKRIN  446

Query  980   KTSCKSDEAEFRKGLTLLTSLKHENLLRLRGFCCSKGRGECFLIYDFVSNGNLLRYLDVK  801
              TSCK++EAEF KGL LL SL HENL++LRGFCCS+GRGECFL+YDF   G L  +L+++
Sbjct  447   ITSCKNEEAEFLKGLNLLISLSHENLVKLRGFCCSRGRGECFLVYDFAHKGKLSDFLEIQ  506

Query  800   DE-KGKVLDWSTRTAIIKGIARGIKYLHGNKRNKPALVHRNISADKVLIDHLYKPLLSDS  624
             D   G+VLDW TR  IIKGIA+GI +LHGN+ NKPA+VHRNIS +K+L+D  + PL++DS
Sbjct  507   DYGSGQVLDWPTRICIIKGIAKGIAFLHGNEPNKPAIVHRNISVEKILLDENFNPLMADS  566

Query  623   GLHKLLADDIVFSTLKGSAANGYLAPEYAITGRFTEKSDMYAFGVIILQILSGSCVVTQS  444
             GLH LLADD VFS LK SAA GYLAPEY   GRFTEK+D++AFGVIILQILSG  ++T S
Sbjct  567   GLHYLLADDFVFSALKTSAAMGYLAPEYITGGRFTEKTDIFAFGVIILQILSGKLMLTNS  626

Query  443   NHQGAELCR-FEDFVDAKLGKDFVESEAAKLGKIALLCTHDSPSRRPAIDVVIQ  285
                 AE     + F+D  L  +F E +A ++ KI + CT + P+ RP I+ V+Q
Sbjct  627   MRAAAENGENHKGFIDENLQGEFDELQAREMAKIGISCTQEIPNNRPNIETVLQ  680



>ref|XP_006363735.1| PREDICTED: leucine-rich repeat receptor protein kinase EXS-like 
[Solanum tuberosum]
Length=685

 Score =   652 bits (1681),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 352/650 (54%), Positives = 464/650 (71%), Gaps = 12/650 (2%)
 Frame = -3

Query  2213  STVSLLMAIKASLDPGNLVLSSWSPNVTDPCSVSSFEGIACNDLGQVVNISLQGKGLYGK  2034
             + V  LM IK++LDP +  LSSW+ +  DPCS  SF G+ CN+  +V NI+L  KGL GK
Sbjct  29    AEVRALMEIKSALDPESKKLSSWTSD-GDPCS-GSFLGVICNEHHKVTNITLTDKGLTGK  86

Query  2033  IPPEIGQLNGLSGLYLHFNNLHGVIPKEIASLTQLSDLYLNMNDLSGFIPSEIGNMPNLQ  1854
             + P I +L  LSGLYLH+N+L G IPKE+ +LT+L+DLYLN+N+LSG IP E+ NM +LQ
Sbjct  87    LSPAIAELKCLSGLYLHYNSLTGEIPKELGNLTELNDLYLNVNNLSGIIPPELRNMASLQ  146

Query  1853  VLQLCYNRFEGCIPNKLGSLKNLTVLALQSNQLTGAIPASlggltlltrldLSFNRLFGS  1674
             VL L  N+  G IP ++G LK L+VL LQ N+LT  IP +LG L  L +L L FN+L G 
Sbjct  147   VLDLSCNQLTGSIPTEIGFLKKLSVLELQRNRLTDKIPENLGVLGTLKKLYLGFNQLSGP  206

Query  1673  IPVKLSEASKLEVLDLRNNTLSGNVPLGLKRLNEGFRYENNPGLCGTGFPSLALCS---D  1503
             IP+KL+ A +LEVL+++NNTLSG +P  L+RLNE F YE+NPGLCGTGF SL +C+    
Sbjct  207   IPLKLAAAPQLEVLEVQNNTLSGVIPPALRRLNEKFNYESNPGLCGTGFTSLRVCTAWDH  266

Query  1502  SSLNPTKPEPFGQGSNRLPTKDIPESANI-PHQLNQ---NRKPQAAAAVVGVIGLFVILA  1335
              ++N    +     +N +P  D+P +A+I P   NQ   +R  +   A++    + V + 
Sbjct  267   VNVNQVGSDVPDSNNNGVPI-DVPGAAHISPLPCNQTHCSRSSKFPQAIIVASVITVTVT  325

Query  1334  VAGLFTFSWYRRR--KQQIGSTVDISESRVSTDQPKVLCRRSTSPLISLEYSNGWDPLAK  1161
             +     F  +RRR  KQ++G+T D S+ R+STDQ K + +RS SPL+++EYSN WDP+  
Sbjct  326   LVVAVVFGIFRRRRLKQRVGNTSDASDDRLSTDQAKEIYKRSPSPLLTVEYSNRWDPMTP  385

Query  1160  DQSGSALSQEVLESFMFNLDEVESATQYFSETNLLGKSSFSAVYKGTLRDGSAVAVKCIS  981
             ++S +++  E L  F FNL+EVESATQ+F+ETNLLG+S+FSAVYKG L+DGS VAVK IS
Sbjct  386   EKSCNSMFNEFLSGFKFNLEEVESATQHFTETNLLGRSNFSAVYKGILKDGSTVAVKSIS  445

Query  980   KTSCKSDEAEFRKGLTLLTSLKHENLLRLRGFCCSKGRGECFLIYDFVSNGNLLRYLDVK  801
              TSCKS+E EF +GL+LLTSLKHENL++LRGFCCSKGRGECFLIYD  S GNL +YLDV+
Sbjct  446   VTSCKSEETEFMEGLSLLTSLKHENLVKLRGFCCSKGRGECFLIYDLASKGNLSQYLDVE  505

Query  800   DEKGKVLDWSTRTAIIKGIARGIKYLHGNKRNKPALVHRNISADKVLIDHLYKPLLSDSG  621
                  VLDWS R +IIKGIA+G+ YLH  + +KP++VHRNIS +KVL+D  + PL+ D G
Sbjct  506   VNSNHVLDWSKRVSIIKGIAKGLGYLHSTEPDKPSMVHRNISVEKVLLDQQFTPLILDCG  565

Query  620   LHKLLADDIVFSTLKGSAANGYLAPEYAITGRFTEKSDMYAFGVIILQILSGSCVVTQSN  441
             L KLLADD+V+S LK SAA GY+APEY  TGRFTEKSD+YAFGVIILQ+LSG  ++  S 
Sbjct  566   LLKLLADDVVYSALKVSAALGYMAPEYITTGRFTEKSDVYAFGVIILQVLSGKGLLDCSM  625

Query  440   HQGAELCRFEDFVDAKLGKDFVESEAAKLGKIALLCTHDSPSRRPAIDVV  291
                AE   FE+F+D  L   F  SEA  L K+A+ CT + P  RP++ +V
Sbjct  626   RLAAESFNFENFIDPNLKGAFSISEATMLTKLAVSCTLEDPDSRPSMVLV  675



>ref|XP_004245714.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g34110 [Solanum lycopersicum]
Length=683

 Score =   650 bits (1677),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 354/649 (55%), Positives = 463/649 (71%), Gaps = 12/649 (2%)
 Frame = -3

Query  2213  STVSLLMAIKASLDPGNLVLSSWSPNVTDPCSVSSFEGIACNDLGQVVNISLQGKGLYGK  2034
             + V  LM IK++LDP +  LSSW+ +  DPCS  SF G+ CN+  +V NI+L  KGL GK
Sbjct  29    AEVRALMEIKSALDPESKKLSSWTSD-GDPCS-GSFLGVICNEHHKVTNITLTDKGLTGK  86

Query  2033  IPPEIGQLNGLSGLYLHFNNLHGVIPKEIASLTQLSDLYLNMNDLSGFIPSEIGNMPNLQ  1854
             + P I +L  LSGL+LH+N+L G IPKE+ +LT+L+DLYLN+N+LSG IP E+GNM +LQ
Sbjct  87    LSPAIAELKCLSGLFLHYNSLTGEIPKELGNLTELNDLYLNVNNLSGIIPPELGNMESLQ  146

Query  1853  VLQLCYNRFEGCIPNKLGSLKNLTVLALQSNQLTGAIPASlggltlltrldLSFNRLFGS  1674
             VL L  N+  G IP ++G L+ L+VL LQ N+LTG IP  LG    L +L L FN+L G 
Sbjct  147   VLDLSCNQLTGSIPTEIGFLRKLSVLELQHNRLTGEIPVKLGIPGTLKKLYLGFNQLSGP  206

Query  1673  IPVKLSEASKLEVLDLRNNTLSGNVPLGLKRLNEGFRYENNPGLCGTGFPSLALCSD-SS  1497
             IP KL+ A +LEVL+++NNTLSG VP  L+RLNE F  E+NPGLCGTGF SL +C+    
Sbjct  207   IPSKLAAAPQLEVLEVQNNTLSGVVPPALRRLNEKFNCESNPGLCGTGFTSLRVCTAWDH  266

Query  1496  LNPTKPEPFGQGSNRLPTKDIPESANI-PHQLNQ------NRKPQAAAAVVGVIGLFVIL  1338
             +N  +       +N  P  D+P +A+I P   NQ      ++ PQA   V  VI + + L
Sbjct  267   VNVNQVGSDVPNNNGDPI-DVPGAAHISPLPCNQIHCSRSSKFPQAII-VASVITVTLTL  324

Query  1337  AVAGLFTFSWYRRRKQQIGSTVDISESRVSTDQPKVLCRRSTSPLISLEYSNGWDPLAKD  1158
              VA +F     RR KQ++G+T D S+ R+STDQ K + +RS SPL+++EYSN WDP+  +
Sbjct  325   VVAVVFGIFRRRRLKQRVGNTSDASDDRLSTDQAKEMYKRSPSPLLTVEYSNRWDPMTPE  384

Query  1157  QSGSALSQEVLESFMFNLDEVESATQYFSETNLLGKSSFSAVYKGTLRDGSAVAVKCISK  978
             +S +++  + L  F FNL+EVESATQ+F+E NLLG+S+FSAVYKG L+DGS VAVK IS 
Sbjct  385   KSCNSMFNDFLNGFKFNLEEVESATQHFTEINLLGRSNFSAVYKGILKDGSMVAVKSISV  444

Query  977   TSCKSDEAEFRKGLTLLTSLKHENLLRLRGFCCSKGRGECFLIYDFVSNGNLLRYLDVKD  798
             TSCKS+E EF +GL+LLTSLKHENL++LRGFCCSKGRGECFLIYDF S GNL +YLDV+ 
Sbjct  445   TSCKSEETEFMEGLSLLTSLKHENLVKLRGFCCSKGRGECFLIYDFASKGNLSQYLDVEV  504

Query  797   EKGKVLDWSTRTAIIKGIARGIKYLHGNKRNKPALVHRNISADKVLIDHLYKPLLSDSGL  618
                 VLDWS R +IIKGIA+G+ YLH  + +KP+++HRNIS +KVL+D  + PL+ D GL
Sbjct  505   NSNHVLDWSKRVSIIKGIAKGLGYLHSTEADKPSMIHRNISVEKVLLDQQFTPLILDCGL  564

Query  617   HKLLADDIVFSTLKGSAANGYLAPEYAITGRFTEKSDMYAFGVIILQILSGSCVVTQSNH  438
              KLLADD+V+S LK SAA GY+APEY  TGRFTEKSD+YAFGVIILQ+LSG  ++  S  
Sbjct  565   LKLLADDVVYSALKVSAALGYMAPEYITTGRFTEKSDVYAFGVIILQVLSGKGLLDCSMR  624

Query  437   QGAELCRFEDFVDAKLGKDFVESEAAKLGKIALLCTHDSPSRRPAIDVV  291
               AE C FE+F+D  +   F  SEA  L K+A+ CT + P  RP++ +V
Sbjct  625   LAAESCNFENFIDPNIKDTFPISEATMLTKLAVSCTVEDPDSRPSMVLV  673



>emb|CDX82961.1| BnaC01g14110D [Brassica napus]
Length=687

 Score =   650 bits (1676),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 351/654 (54%), Positives = 462/654 (71%), Gaps = 23/654 (4%)
 Frame = -3

Query  2198  LMAIKASLDPGNLVLSSWSPNVTDPCSVSSFEGIACNDLGQVVNISLQGKGLYGKIPPEI  2019
             LM +K+SLDP N +L SW+ N  DPC   SFEGIACN   +V NISLQGK L GK+ P +
Sbjct  31    LMELKSSLDPENKLLQSWTFN-GDPCD-GSFEGIACNQHLKVANISLQGKRLTGKLSPAV  88

Query  2018  GQLNGLSGLYLHFNNLHGVIPKEIASLTQLSDLYLNMNDLSGFIPSEIGNMPNLQVLQLC  1839
              +L  LSGLYLH+N+L G IP+EI +LT+LSDLYLN+N+ SG IP+ IG+M  LQV+ LC
Sbjct  89    AELKCLSGLYLHYNSLFGEIPQEITNLTELSDLYLNVNNFSGEIPAGIGSMAGLQVMDLC  148

Query  1838  YNRFEGCIPNKLGSLKNLTVLALQSNQLTGAIPASlggltlltrldLSFNRLFGSIPVKL  1659
              N   G IP  +GSLK L+VL+LQ N+LTG +P SLG L++L+R+DLSFN L G+IP  L
Sbjct  149   CNSLTGKIPKSIGSLKKLSVLSLQHNKLTGEVPWSLGNLSMLSRIDLSFNDLSGTIPKTL  208

Query  1658  SEASKLEVLDLRNNTLSGNVPLGLKRLNEGFRYENNPGLCGTGFPSLALCS---DSSLNP  1488
             +   +LE LDLRNNTLSG VP GLK+LNE F++ENN GLCG   PSL  CS   DS++  
Sbjct  209   ANIPQLETLDLRNNTLSGFVPPGLKKLNERFQFENNTGLCGIDIPSLRACSAFDDSTIEV  268

Query  1487  TKPEPFGQGSNRLPTKDIPESANIPHQLNQN--RKPQA----AAAVVGVIGLFVILAVAG  1326
              +P+   + +++    +I +S  +    NQ    KP +     A +  VI + + L  AG
Sbjct  269   KQPQG-EKDTDKSTLHNISDSVYLKIHCNQTHCHKPSSKLPQVALISSVITVTITLFGAG  327

Query  1325  LFTFSWYRRRKQQIGSTVDISESRVSTDQPKVLCRRSTSPLISLEYSNGWDPLAKDQSGS  1146
             L TF  YRRRKQ+I +T ++SE R+STDQ K      +SPL+SL Y+  WDPL   ++G+
Sbjct  328   LLTFLRYRRRKQKISNTAELSEGRLSTDQQKDF---RSSPLVSLAYTKEWDPLGDSRNGA  384

Query  1145  ALSQE------VLESFMFNLDEVESATQYFSETNLLGKSSFSAVYKGTLRDGSAVAVKCI  984
                QE      V  SF FNL+EVESATQ FSE NLL ++SF++VYKG LRDGS VA++ I
Sbjct  385   EFLQEPHHLFVVNSSFRFNLEEVESATQCFSEANLLSRNSFTSVYKGVLRDGSLVAIRSI  444

Query  983   SKTSCKSDEAEFRKGLTLLTSLKHENLLRLRGFCCSKGRGECFLIYDFVSNGNLLRYLDV  804
             + +SCK++E EF  GL LL+S+ HENL++LRGFCCS+GRGECFLIYDF S G L  +LD+
Sbjct  445   NISSCKNEEVEFMNGLKLLSSMSHENLVKLRGFCCSRGRGECFLIYDFASKGKLSSFLDL  504

Query  803   KD-EKGKVLDWSTRTAIIKGIARGIKYLHG-NKRNKPALVHRNISADKVLIDHLYKPLLS  630
             ++ E G+VL W  R +I+KGIA+GI YLHG ++ NK A+VHRNIS +K+L+D L+ PL++
Sbjct  505   QERETGRVLAWPARVSILKGIAKGIAYLHGSDQENKHAIVHRNISVEKILLDELFNPLIA  564

Query  629   DSGLHKLLADDIVFSTLKGSAANGYLAPEYAITGRFTEKSDMYAFGVIILQILSGSCVVT  450
             DSGLH LLADD+VFS LK SAA GYLAPEY  TGRFTEK+D++AFGVIILQILSG  ++T
Sbjct  565   DSGLHNLLADDLVFSALKTSAAMGYLAPEYVTTGRFTEKTDVFAFGVIILQILSGKLMLT  624

Query  449   QSNHQGAELCRFEDFVDAKLGKDFVESEAAKLGKIALLCTHDSPSRRPAIDVVI  288
              S    AE      F+D  LG+ F ++EA  + ++ + CT + P+ RP I+ ++
Sbjct  625   SSLRTAAENGEHFGFMDEYLGEGFDKTEAVAMARMGISCTQEIPNNRPNIETLL  678



>gb|KHN34965.1| Protein NSP-INTERACTING KINASE 2 [Glycine soja]
Length=689

 Score =   649 bits (1675),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 352/650 (54%), Positives = 443/650 (68%), Gaps = 15/650 (2%)
 Frame = -3

Query  2198  LMAIKASLDPGNLVLSSWSPNVTDPCSVSSFEGIACNDLGQVVNISLQGKGLYGKIPPEI  2019
             LM +K+SLDP   +L SW  +  DPCS   FEG+ACND  +V NISLQGKGL G + P +
Sbjct  34    LMELKSSLDPEGKILGSWISD-GDPCS-GFFEGVACNDHRKVANISLQGKGLSGWLSPAL  91

Query  2018  GQLNGLSGLYLHFNNLHGVIPKEIASLTQLSDLYLNMNDLSGFIPSEIGNMPNLQVLQLC  1839
              +L  LSGLYLH+NNL G IP  I++LT+L DLYL++N LSG IP EI NM +LQVLQL 
Sbjct  92    AELKCLSGLYLHYNNLSGEIPPHISNLTELLDLYLDVNTLSGTIPPEIANMASLQVLQLG  151

Query  1838  YNRFEGCIPNKLGSLKNLTVLALQSNQLTGAIPASlggltlltrldLSFNRLFGSIPVKL  1659
              N+  G IP ++ SLK L+ LALQ N+LTG IP SLG L  L+RL+LSFN   G++P  L
Sbjct  152   DNQLVGTIPTQMSSLKQLSTLALQYNKLTGQIPLSLGNLEKLSRLNLSFNNFSGTVPATL  211

Query  1658  SEASKLEVLDLRNNTLSGNVPLGLKRLNEGFRYENNPGLCGTGFPSLALCS---DSSLNP  1488
             +    LEVLD++NN+LSG VP  LKRL EGF+  NNPGLCG GF +L  C+   D ++N 
Sbjct  212   AHIEHLEVLDIQNNSLSGIVPSALKRLGEGFQGANNPGLCGVGFSTLRACNKDQDLNVNH  271

Query  1487  TKPEPFGQGSNRLPTKDIPESANI------PHQLNQNRKPQAAAAVVGVIGLFVILAVAG  1326
                    Q  N   +K +PE A +       H     R PQ      GV+ + +    AG
Sbjct  272   IDTSDGDQPKNSNSSKALPEPAYVQLHCGQTHCSKSRRFPQTVI-TAGVVIVTLTFICAG  330

Query  1325  LFTFSWYRRRKQQIGSTVDIS-ESRVSTDQPKVLCRRSTSPLISLEYSNGWDPLAKDQSG  1149
               TF  YRR+KQ+I +T+  S E +VS DQPK    +S S L++++Y +GWD L+  Q+ 
Sbjct  331   FLTFFRYRRQKQRISNTLSSSSEGKVSLDQPKEFYTKSPSALVNIDYYSGWDQLSNGQNA  390

Query  1148  SA--LSQEVLESFMFNLDEVESATQYFSETNLLGKSSFSAVYKGTLRDGSAVAVKCISKT  975
              A  LS E L  F FN+DEVESAT YFSE NLL +S F+A YKG LRDGS VA++ IS T
Sbjct  391   DAGGLSHEYLNQFRFNVDEVESATHYFSEANLLNRSKFAAGYKGVLRDGSLVAIRSISVT  450

Query  974   SCKSDEAEFRKGLTLLTSLKHENLLRLRGFCCSKGRGECFLIYDFVSNGNLLRYLDVKDE  795
              CK++EAEF KGL LLTSL+HENL+RLRGFCCS+ RGECFLIYDF + GNL +YLD++D 
Sbjct  451   CCKTEEAEFVKGLNLLTSLRHENLVRLRGFCCSRSRGECFLIYDFATMGNLSQYLDIEDG  510

Query  794   KGKVLDWSTRTAIIKGIARGIKYLHGNKRNKPALVHRNISADKVLIDHLYKPLLSDSGLH  615
                VL+WS R +IIKGIA GI YLH N+ +KP +VH+NIS + VL+D+ + PL+ D+GL 
Sbjct  511   SSHVLEWSKRVSIIKGIANGIGYLHSNEESKPTIVHQNISVENVLLDYQFNPLIRDAGLP  570

Query  614   KLLADDIVFSTLKGSAANGYLAPEYAITGRFTEKSDMYAFGVIILQILSGSCVVTQSNHQ  435
              LLADD+VFS LK SAA GYLAPEY  TGRFTEKSD+YAFGVIILQ+LSG   +  S   
Sbjct  571   MLLADDVVFSALKVSAAMGYLAPEYITTGRFTEKSDIYAFGVIILQVLSGKTTIGSSIRT  630

Query  434   GAELCRFEDFVDAKLGKDFVESEAAKLGKIALLCTHDSPSRRPAIDVVIQ  285
               E  RF+D VD  L   + +SEAA L K+A+ CT++ P  RP +  VIQ
Sbjct  631   AVESFRFDDSVDTNLKGIYSKSEAATLSKLAIQCTNELPDERPTMVDVIQ  680



>ref|XP_003538634.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
GSO2-like isoform X1 [Glycine max]
Length=689

 Score =   649 bits (1674),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 352/650 (54%), Positives = 443/650 (68%), Gaps = 15/650 (2%)
 Frame = -3

Query  2198  LMAIKASLDPGNLVLSSWSPNVTDPCSVSSFEGIACNDLGQVVNISLQGKGLYGKIPPEI  2019
             LM +K+SLDP   +L SW  +  DPCS   FEG+ACND  +V NISLQGKGL G + P +
Sbjct  34    LMELKSSLDPEGKILGSWISD-GDPCS-GFFEGVACNDHRKVANISLQGKGLSGWLSPAL  91

Query  2018  GQLNGLSGLYLHFNNLHGVIPKEIASLTQLSDLYLNMNDLSGFIPSEIGNMPNLQVLQLC  1839
              +L  LSGLYLH+NNL G IP  I++LT+L DLYL++N LSG IP EI NM +LQVLQL 
Sbjct  92    AELKCLSGLYLHYNNLSGEIPPHISNLTELLDLYLDVNTLSGTIPPEIANMASLQVLQLG  151

Query  1838  YNRFEGCIPNKLGSLKNLTVLALQSNQLTGAIPASlggltlltrldLSFNRLFGSIPVKL  1659
              N+  G IP ++ SLK L+ LALQ N+LTG IP SLG L  L+RL+LSFN   G++P  L
Sbjct  152   DNQLVGTIPTQMSSLKQLSTLALQYNKLTGQIPLSLGNLEKLSRLNLSFNNFSGTVPATL  211

Query  1658  SEASKLEVLDLRNNTLSGNVPLGLKRLNEGFRYENNPGLCGTGFPSLALCS---DSSLNP  1488
             +    LEVLD++NN+LSG VP  LKRL EGF+  NNPGLCG GF +L  C+   D ++N 
Sbjct  212   AHIEHLEVLDIQNNSLSGIVPSALKRLGEGFQGANNPGLCGVGFSTLRACNKDQDLNVNH  271

Query  1487  TKPEPFGQGSNRLPTKDIPESANIPHQLNQN------RKPQAAAAVVGVIGLFVILAVAG  1326
                    Q  N   +K +PE A +     Q       R PQ      GV+ + +    AG
Sbjct  272   IDTSDGDQPKNSNSSKALPEPAYVQLHCGQTHCSKSRRFPQTVI-TAGVVIVTLTFICAG  330

Query  1325  LFTFSWYRRRKQQIGSTVDIS-ESRVSTDQPKVLCRRSTSPLISLEYSNGWDPLAKDQSG  1149
               TF  YRR+KQ+I +T+  S E +VS DQPK    +S S L++++Y +GWD L+  Q+ 
Sbjct  331   FLTFFRYRRQKQRISNTLSSSSEGKVSLDQPKEFYTKSPSALVNIDYYSGWDQLSNGQNA  390

Query  1148  SA--LSQEVLESFMFNLDEVESATQYFSETNLLGKSSFSAVYKGTLRDGSAVAVKCISKT  975
              A  LS E L  F FN+DEVESAT YFSE NLL +S F+A YKG LRDGS VA++ IS T
Sbjct  391   DAGGLSNEYLNQFRFNVDEVESATHYFSEANLLNRSKFAAGYKGVLRDGSLVAIRSISVT  450

Query  974   SCKSDEAEFRKGLTLLTSLKHENLLRLRGFCCSKGRGECFLIYDFVSNGNLLRYLDVKDE  795
              CK++EAEF KGL LLTSL+HENL+RLRGFCCS+ RGECFLIYDF + GNL +YLD++D 
Sbjct  451   CCKTEEAEFVKGLNLLTSLRHENLVRLRGFCCSRSRGECFLIYDFATMGNLSQYLDIEDG  510

Query  794   KGKVLDWSTRTAIIKGIARGIKYLHGNKRNKPALVHRNISADKVLIDHLYKPLLSDSGLH  615
                VL+WS R +IIKGIA GI YLH N+ +KP +VH+NIS + VL+D+ + PL+ D+GL 
Sbjct  511   SSHVLEWSKRVSIIKGIANGIGYLHSNEESKPTIVHQNISVENVLLDYQFNPLIRDAGLP  570

Query  614   KLLADDIVFSTLKGSAANGYLAPEYAITGRFTEKSDMYAFGVIILQILSGSCVVTQSNHQ  435
              LLADD+VFS LK SAA GYLAPEY  TGRFTEKSD+YAFGVIILQ+LSG   +  S   
Sbjct  571   MLLADDVVFSALKVSAAMGYLAPEYITTGRFTEKSDIYAFGVIILQVLSGKTTIGSSIRT  630

Query  434   GAELCRFEDFVDAKLGKDFVESEAAKLGKIALLCTHDSPSRRPAIDVVIQ  285
               E  RF+D VD  L   + +SEAA L K+A+ CT++ P  RP +  VIQ
Sbjct  631   AVESFRFDDSVDTNLKGIYSKSEAATLSKLAIQCTNELPDERPTMVDVIQ  680



>emb|CDX79173.1| BnaA01g12400D [Brassica napus]
Length=687

 Score =   648 bits (1671),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 352/655 (54%), Positives = 460/655 (70%), Gaps = 23/655 (4%)
 Frame = -3

Query  2198  LMAIKASLDPGNLVLSSWSPNVTDPCSVSSFEGIACNDLGQVVNISLQGKGLYGKIPPEI  2019
             LM +K+SLDP N +L SW+ N  DPC   SFEGIACN   +V NISLQGK L GK+ P +
Sbjct  31    LMELKSSLDPENNLLKSWTFN-GDPCD-GSFEGIACNQHLKVANISLQGKRLTGKLSPAV  88

Query  2018  GQLNGLSGLYLHFNNLHGVIPKEIASLTQLSDLYLNMNDLSGFIPSEIGNMPNLQVLQLC  1839
              +L  LSGLYLH+N+L G IP+EI +LT+LSDLYLN+N+ SG IP+ IG+M  LQV+ LC
Sbjct  89    AELKCLSGLYLHYNSLSGEIPQEITNLTELSDLYLNVNNFSGEIPAGIGSMVGLQVMDLC  148

Query  1838  YNRFEGCIPNKLGSLKNLTVLALQSNQLTGAIPASlggltlltrldLSFNRLFGSIPVKL  1659
              N   G IP  +GSLK L+VL+LQ N+LTG +P SLG L+ L+R+DLSFN L G+IP  L
Sbjct  149   CNSLAGKIPKSIGSLKKLSVLSLQHNKLTGEVPWSLGNLSTLSRIDLSFNDLSGTIPKTL  208

Query  1658  SEASKLEVLDLRNNTLSGNVPLGLKRLNEGFRYENNPGLCGTGFPSLALCS---DSSLNP  1488
             +   +LE LDLRNNTLSG VP GL++LNE F++ENN GLCG  FPSL  CS   DS++  
Sbjct  209   ANIPQLETLDLRNNTLSGFVPPGLEKLNERFQFENNAGLCGINFPSLRACSAFDDSTIEV  268

Query  1487  TKPEPFGQGSNRLPTKDIPESANIPHQLNQN--RKPQA----AAAVVGVIGLFVILAVAG  1326
              +P+   + +++    +I +S  +    NQ    KP +     A +  VI + + L  AG
Sbjct  269   KQPQG-EKDTDKSTLHNISDSVYLKSHCNQTHCHKPSSKLPQVALISSVITVTITLFGAG  327

Query  1325  LFTFSWYRRRKQQIGSTVDISESRVSTDQPKVLCRRSTSPLISLEYSNGWDPLAKDQSGS  1146
             L TF  YRRRKQ+I +T +ISE R+STDQ K       SPL+SL Y+  WDPL   ++G+
Sbjct  328   LLTFLRYRRRKQKISNTAEISEGRLSTDQQKDF---RASPLMSLAYTKEWDPLGDSRNGA  384

Query  1145  ALSQE------VLESFMFNLDEVESATQYFSETNLLGKSSFSAVYKGTLRDGSAVAVKCI  984
               SQE      V  SF FNL+EVESATQ FSE NLL ++SF++V+KG LRDGS VA++ I
Sbjct  385   EFSQEPHHLFVVNSSFRFNLEEVESATQCFSEANLLSRNSFTSVFKGVLRDGSLVAIRSI  444

Query  983   SKTSCKSDEAEFRKGLTLLTSLKHENLLRLRGFCCSKGRGECFLIYDFVSNGNLLRYLDV  804
             + +SCK++E EF  GL LL+S+ HENL++LRGFCCS+GRGECFLIYDF S G L  +LD+
Sbjct  445   NISSCKNEEVEFMNGLKLLSSMSHENLVKLRGFCCSRGRGECFLIYDFASKGKLSSFLDL  504

Query  803   KD-EKGKVLDWSTRTAIIKGIARGIKYLHG-NKRNKPALVHRNISADKVLIDHLYKPLLS  630
             ++ E G+VL W  R +IIKGIA+GI YLHG ++  K A+VHRNIS +K+L+D  + PL++
Sbjct  505   QESETGRVLAWPARVSIIKGIAKGIAYLHGSDQEKKHAIVHRNISVEKILLDEQFNPLIA  564

Query  629   DSGLHKLLADDIVFSTLKGSAANGYLAPEYAITGRFTEKSDMYAFGVIILQILSGSCVVT  450
             DSGLH LLADD+VFS LK SAA GYLAPEY  TGRFTEK+D++AFGVIILQILSG  ++T
Sbjct  565   DSGLHNLLADDLVFSALKTSAAMGYLAPEYVTTGRFTEKTDVFAFGVIILQILSGKLMLT  624

Query  449   QSNHQGAELCRFEDFVDAKLGKDFVESEAAKLGKIALLCTHDSPSRRPAIDVVIQ  285
              S    AE      F+D  LG+ F  +EA  L ++ + CT + P+ RP I+ +++
Sbjct  625   SSLRIAAENGEHCGFIDEHLGEGFDITEAVALARMGISCTQEIPNNRPNIESLLR  679



>gb|KFK28836.1| hypothetical protein AALP_AA7G055200 [Arabis alpina]
Length=688

 Score =   646 bits (1666),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 352/655 (54%), Positives = 456/655 (70%), Gaps = 23/655 (4%)
 Frame = -3

Query  2198  LMAIKASLDPGNLVLSSWSPNVTDPCSVSSFEGIACNDLGQVVNISLQGKGLYGKIPPEI  2019
             LM +K+SLDP N +L SW+ N  DPC   SFEGIACN   +V NISLQGK L GK+ P +
Sbjct  31    LMELKSSLDPENKLLRSWTFN-GDPCD-GSFEGIACNQHLKVANISLQGKRLTGKLSPAV  88

Query  2018  GQLNGLSGLYLHFNNLHGVIPKEIASLTQLSDLYLNMNDLSGFIPSEIGNMPNLQVLQLC  1839
              +L  LSGLYLH+N+L+G IP+EI +LT+LSDLYLN+N+ SG IP +IG+M +LQV+ LC
Sbjct  89    AELKCLSGLYLHYNSLYGEIPQEITNLTELSDLYLNVNNFSGEIPVQIGSMASLQVMDLC  148

Query  1838  YNRFEGCIPNKLGSLKNLTVLALQSNQLTGAIPASlggltlltrldLSFNRLFGSIPVKL  1659
              N   G IP  +GSLK L+VL+LQ N+LTG IP SLG L++L+RLD+S+N L G IP  L
Sbjct  149   CNSLTGKIPKNIGSLKKLSVLSLQHNKLTGEIPTSLGDLSMLSRLDMSYNNLLGLIPKTL  208

Query  1658  SEASKLEVLDLRNNTLSGNVPLGLKRLNEGFRYENNPGLCGTGFPSLALCS--DSSLNPT  1485
             +   +L+ LDLRNNTLSG VP   K+LN  F++ENN GLCG  FP L  C+  D++    
Sbjct  209   ANIPQLDTLDLRNNTLSGFVPPDFKKLNGKFQFENNTGLCGMDFPFLRACTAFDNANIEQ  268

Query  1484  KPEPFGQ-GSNRLPTKDIPESANIPHQLNQ-------NRKPQAAAAVVGVIGLFVILAVA  1329
               +P G+  +N+    +I ES  +    NQ       ++ PQ  A +  VI + + L  A
Sbjct  269   LEQPSGEIDTNKSALHNISESVYLQRHCNQTHCKKSSSKLPQ-VALISSVITVTITLIGA  327

Query  1328  GLFTFSWYRRRKQQIGSTVDISESRVSTDQPKVLCRRSTSPLISLEYSNGWDPLAKDQSG  1149
             GL TF  YRRRKQ+I +TV+ SE R+S DQ K       SPL+SL Y+  WDPL   ++G
Sbjct  328   GLLTFFRYRRRKQKISNTVEFSEGRLSIDQQKDF---RASPLVSLAYTKEWDPLGDSRNG  384

Query  1148  SALSQE-----VLESFMFNLDEVESATQYFSETNLLGKSSFSAVYKGTLRDGSAVAVKCI  984
             +  SQE     V  SF FNL+EVESATQ FSE NLL ++SF++V+KG LRDGS VA++ I
Sbjct  385   AEFSQESHLFVVNSSFRFNLEEVESATQCFSEANLLSRNSFTSVFKGNLRDGSPVAIRSI  444

Query  983   SKTSCKSDEAEFRKGLTLLTSLKHENLLRLRGFCCSKGRGECFLIYDFVSNGNLLRYLDV  804
             + TSCK++E EF  GL LL+SL HENL++LRGFCCS+GRGECFLIYD  S G L  +LD 
Sbjct  445   NITSCKNEEVEFMNGLRLLSSLSHENLVKLRGFCCSRGRGECFLIYDLASKGKLSNFLDF  504

Query  803   KD-EKGKVLDWSTRTAIIKGIARGIKYLHG-NKRNKPALVHRNISADKVLIDHLYKPLLS  630
             ++ E  +VLDWSTR +IIKGIA+GI YLHG +   KP +VHRNIS +K+L+D  + PL++
Sbjct  505   QEHETDRVLDWSTRVSIIKGIAKGIAYLHGSDNSKKPTIVHRNISVEKILLDEQFNPLIA  564

Query  629   DSGLHKLLADDIVFSTLKGSAANGYLAPEYAITGRFTEKSDMYAFGVIILQILSGSCVVT  450
             DSGLH LLADD+VFS LK SAA GYLAPEY  TG+FTEK+D++AFGVIILQILSG  ++T
Sbjct  565   DSGLHNLLADDMVFSALKTSAAMGYLAPEYVTTGKFTEKTDIFAFGVIILQILSGKVMLT  624

Query  449   QSNHQGAELCRFEDFVDAKLGKDFVESEAAKLGKIALLCTHDSPSRRPAIDVVIQ  285
              S    AE      FVD  L ++F + EA+ +  I + CT + P+ RP I+ +IQ
Sbjct  625   SSLRIAAENGEHCGFVDEYLREEFDKVEASAMAGIGISCTQEIPNNRPDIETLIQ  679



>ref|XP_004511651.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
GSO2-like [Cicer arietinum]
Length=682

 Score =   645 bits (1663),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 357/659 (54%), Positives = 448/659 (68%), Gaps = 15/659 (2%)
 Frame = -3

Query  2231  ETSNNASTVSLLMAIKASLDPGNLVLSSWSPNVTDPCSVSSFEGIACNDLGQVVNISLQG  2052
             +T N  + +  LM +K+SLDP   +L+SW  +  DPCS  SFEGIACN+  +V NISLQG
Sbjct  20    QTVNGNAELRALMDLKSSLDPEGKILTSWISD-GDPCS-GSFEGIACNEHWKVANISLQG  77

Query  2051  KGLYGKIPPEIGQLNGLSGLYLHFNNLHGVIPKEIASLTQLSDLYLNMNDLSGFIPSEIG  1872
             KGL G I P + +L  LSGLYLH+NNL G IP +I++LT+L DLYL++N LSG IP E+G
Sbjct  78    KGLSGWISPAVSELKCLSGLYLHYNNLSGEIPSQISNLTELVDLYLDVNSLSGTIPHEVG  137

Query  1871  NMPNLQVLQLCYNRFEGCIPNKLGSLKNLTVLALQSNQLTGAIPASlggltlltrldLSF  1692
             NM +LQVLQL  N+  G IP ++GSLK LT LALQ N+LTG IP SLG L  L+RL+LSF
Sbjct  138   NMASLQVLQLGDNQLVGNIPTQMGSLKQLTTLALQYNKLTGQIPLSLGNLENLSRLNLSF  197

Query  1691  NRLFGSIPVKLSEASKLEVLDLRNNTLSGNVPLGLKRLNEGFRYENNPGLCGTGFPSLAL  1512
             N   GSIP  L+  + LEVLD++NN+LSG VP  LKRL EGF+  NNPGLCG G  +   
Sbjct  198   NNFTGSIPATLATIAHLEVLDIQNNSLSGIVPSALKRLGEGFQGRNNPGLCGVGLSNSRA  257

Query  1511  C-SDSSLNP----TKPEPFGQGSNRLPTKDIPESANIPHQLNQ-----NRKPQAAAAVVG  1362
             C +D  LN     T  +   +  N   T   PE ANI    NQ     +R    +   V 
Sbjct  258   CENDPDLNASDVGTTDQDHLKNINNTATPR-PEPANIQVHCNQTHCSKSRSFPLSVITVS  316

Query  1361  VIGLFVILAVAGLFTFSWYRRRKQQIGSTVDISESRVSTDQPKVLCRRSTSPLISLEYSN  1182
             V+ + + +   GLF    YRRRKQ+I  T + SE + S  QPK L R+S S  ++L+Y N
Sbjct  317   VVAITLSIIGFGLFKLVRYRRRKQRI--TSNSSEGKFSPQQPKELYRKSPSTFVNLDYYN  374

Query  1181  GWDPLAKDQSGSALSQEVLESFMFNLDEVESATQYFSETNLLGKSSFSAVYKGTLRDGSA  1002
             G  PL  DQ+   L+ E L  F FN+DEVESATQYFSE NLL KS FSA+YKG LRDGS 
Sbjct  375   GCYPLPNDQNADGLANEYLNQFRFNVDEVESATQYFSEANLLCKSKFSAMYKGVLRDGSL  434

Query  1001  VAVKCISKTSCKSDEAEFRKGLTLLTSLKHENLLRLRGFCCSKGRGECFLIYDFVSNGNL  822
             VA++ I+ T CK++EAEF KGL+LLTSL+HEN++RLRGFCCS  RGEC+LIYDF   GNL
Sbjct  435   VAIRSINMTCCKTEEAEFAKGLSLLTSLRHENVVRLRGFCCSSSRGECYLIYDFAPMGNL  494

Query  821   LRYLDVKDEKGKVLDWSTRTAIIKGIARGIKYLHGNKRNKPALVHRNISADKVLIDHLYK  642
              +YLD++D  G VLDWS R +IIKGIA+GI YLH N+ +KP +VH+NIS + V +D  + 
Sbjct  495   SQYLDIEDTSGHVLDWSKRVSIIKGIAKGIGYLHSNEGSKPTIVHQNISVENVHLDKEFN  554

Query  641   PLLSDSGLHKLLADDIVFSTLKGSAANGYLAPEYAITGRFTEKSDMYAFGVIILQILSGS  462
             PL+ ++GL KLLADD+VFS LK SAA GYLAPEY  TGRFTEKSD+YAFGVI+LQ+LSG 
Sbjct  555   PLIMEAGLPKLLADDVVFSALKVSAAMGYLAPEYITTGRFTEKSDIYAFGVIVLQVLSGK  614

Query  461   CVVTQSNHQGAELCRFEDFVDAKLGKDFVESEAAKLGKIALLCTHDSPSRRPAIDVVIQ  285
               +  S     E  +F+D +D  L      SEA  L K+A+ C H+SP  RP+   VIQ
Sbjct  615   KAIGGSIRIAFESFKFDDCIDTDLRGRCSISEATILTKLAMQCIHESPDERPSTVDVIQ  673



>ref|NP_194004.1| leucine-rich repeat protein kinase-like protein [Arabidopsis 
thaliana]
 emb|CAA16558.1| leucine rich repeat receptor kinase-like protein [Arabidopsis 
thaliana]
 emb|CAB79228.1| leucine rich repeat receptor kinase-like protein [Arabidopsis 
thaliana]
 gb|AAR23717.1| At4g22730 [Arabidopsis thaliana]
 dbj|BAD44629.1| leucine rich repeat receptor kinase-like protein [Arabidopsis 
thaliana]
 gb|ACN59346.1| leucine-rich repeat receptor-like protein kinase [Arabidopsis 
thaliana]
 gb|AEE84645.1| leucine-rich repeat protein kinase-like protein [Arabidopsis 
thaliana]
Length=688

 Score =   644 bits (1662),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 350/657 (53%), Positives = 455/657 (69%), Gaps = 26/657 (4%)
 Frame = -3

Query  2198  LMAIKASLDPGNLVLSSWSPNVTDPCSVSSFEGIACNDLGQVVNISLQGKGLYGKIPPEI  2019
             LM +K+SLDP N +L SW+ N  DPC   SFEGIACN   +V NISLQGK L GK+ P +
Sbjct  31    LMELKSSLDPENKLLRSWTFN-GDPCD-GSFEGIACNQHLKVANISLQGKRLVGKLSPAV  88

Query  2018  GQLNGLSGLYLHFNNLHGVIPKEIASLTQLSDLYLNMNDLSGFIPSEIGNMPNLQVLQLC  1839
              +L  LSGLYLH+N+L G IP+EI +LT+LSDLYLN+N+ SG IP++IG+M  LQV+ LC
Sbjct  89    AELKCLSGLYLHYNSLSGEIPQEITNLTELSDLYLNVNNFSGEIPADIGSMAGLQVMDLC  148

Query  1838  YNRFEGCIPNKLGSLKNLTVLALQSNQLTGAIPASlggltlltrldLSFNRLFGSIPVKL  1659
              N   G IP  +GSLK L VL+LQ N+LTG +P +LG L++L+RLDLSFN L G IP  L
Sbjct  149   CNSLTGKIPKNIGSLKKLNVLSLQHNKLTGEVPWTLGNLSMLSRLDLSFNNLLGLIPKTL  208

Query  1658  SEASKLEVLDLRNNTLSGNVPLGLKRLNEGFRYENNPGLCGTGFPSLALCSDSSLNPTKP  1479
             +   +L+ LDLRNNTLSG VP GLK+LN  F++ENN GLCG  FPSL  CS    N    
Sbjct  209   ANIPQLDTLDLRNNTLSGFVPPGLKKLNGSFQFENNTGLCGIDFPSLRACSAFD-NANNI  267

Query  1478  EPFGQGSNRLPT-----KDIPESANIPHQLNQ-------NRKPQAAAAVVGVIGLFVILA  1335
             E F Q    + T      +IPES  +    NQ       ++ PQ  A +  VI + + L 
Sbjct  268   EQFKQPPGEIDTDKSALHNIPESVYLQKHCNQTHCKKSSSKLPQ-VALISSVITVTITLI  326

Query  1334  VAGLFTFSWYRRRKQQIGSTVDISESRVSTDQPKVLCRRSTSPLISLEYSNGWDPLAKDQ  1155
              AG+ TF  YRRRKQ+I +T + SE R+STDQ K       SPL+SL Y+  WDPL   +
Sbjct  327   GAGILTFFRYRRRKQKISNTPEFSEGRLSTDQQKEF---RASPLVSLAYTKEWDPLGDSR  383

Query  1154  SGSALSQE-----VLESFMFNLDEVESATQYFSETNLLGKSSFSAVYKGTLRDGSAVAVK  990
             +G+  SQE     V  SF FNL+++ESATQ FSE NLL ++SF++V+KG LRDGS VA++
Sbjct  384   NGAEFSQEPHLFVVNSSFRFNLEDIESATQCFSEANLLSRNSFTSVFKGVLRDGSPVAIR  443

Query  989   CISKTSCKSDEAEFRKGLTLLTSLKHENLLRLRGFCCSKGRGECFLIYDFVSNGNLLRYL  810
              I+ +SCK++E EF  GL LL+SL HENL++LRGFCCS+GRGECFLIYDF S G L  +L
Sbjct  444   SINISSCKNEEVEFMNGLKLLSSLSHENLVKLRGFCCSRGRGECFLIYDFASKGKLSNFL  503

Query  809   DVKD-EKGKVLDWSTRTAIIKGIARGIKYLHG-NKRNKPALVHRNISADKVLIDHLYKPL  636
             D+++ E   VL WS R +IIKGIA+GI YLHG +++ KP +VHRNIS +K+L+D  + PL
Sbjct  504   DLQERETNLVLAWSARISIIKGIAKGIAYLHGSDQQKKPTIVHRNISVEKILLDEQFNPL  563

Query  635   LSDSGLHKLLADDIVFSTLKGSAANGYLAPEYAITGRFTEKSDMYAFGVIILQILSGSCV  456
             ++DSGLH LLADD+VFS LK SAA GYLAPEY  TG+FTEK+D++AFGVIILQILSG  +
Sbjct  564   IADSGLHNLLADDMVFSALKTSAAMGYLAPEYVTTGKFTEKTDIFAFGVIILQILSGKLM  623

Query  455   VTQSNHQGAELCRFEDFVDAKLGKDFVESEAAKLGKIALLCTHDSPSRRPAIDVVIQ  285
             +T S    AE      F+D  L ++F + EA  + +I + CT + P+ RP I+ +++
Sbjct  624   LTSSLRNAAENGEHNGFIDEDLREEFDKPEATAMARIGISCTQEIPNNRPNIETLLE  680



>ref|XP_002869809.1| hypothetical protein ARALYDRAFT_492596 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH46068.1| hypothetical protein ARALYDRAFT_492596 [Arabidopsis lyrata subsp. 
lyrata]
Length=687

 Score =   643 bits (1658),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 344/654 (53%), Positives = 455/654 (70%), Gaps = 21/654 (3%)
 Frame = -3

Query  2198  LMAIKASLDPGNLVLSSWSPNVTDPCSVSSFEGIACNDLGQVVNISLQGKGLYGKIPPEI  2019
             LM +K+SLDP N +L SW+ N  DPC   SFEGIACN   +V NISLQGK L GK+ P +
Sbjct  31    LMELKSSLDPENKLLRSWTFN-GDPCD-GSFEGIACNQHLKVANISLQGKRLAGKLSPAV  88

Query  2018  GQLNGLSGLYLHFNNLHGVIPKEIASLTQLSDLYLNMNDLSGFIPSEIGNMPNLQVLQLC  1839
              +L  LSGLYLH+N+L G IP+EI +LT+LSDLYLN+N+ SG IP++IG+M  LQV+ LC
Sbjct  89    AELKCLSGLYLHYNSLSGEIPQEITNLTELSDLYLNVNNFSGEIPADIGSMDGLQVMDLC  148

Query  1838  YNRFEGCIPNKLGSLKNLTVLALQSNQLTGAIPASlggltlltrldLSFNRLFGSIPVKL  1659
              N   G IP  +G+LK L VL+LQ NQLTG +P SLG L++L+R+DLSFN L G IP  L
Sbjct  149   CNSLTGKIPKNIGTLKKLNVLSLQHNQLTGEVPWSLGNLSMLSRIDLSFNNLLGLIPKTL  208

Query  1658  SEASKLEVLDLRNNTLSGNVPLGLKRLNEGFRYENNPGLCGTGFPSLALCS---DSSLNP  1488
             +   +LE LDLRNNTLSG VP GLK+LN  F++ENN GLCG  FPSL  CS   ++++  
Sbjct  209   ANIPQLETLDLRNNTLSGFVPSGLKKLNGSFQFENNTGLCGMDFPSLRACSAFDNANIEQ  268

Query  1487  TKPEPFGQGSNRLPTKDIPESANIPHQLNQNR------KPQAAAAVVGVIGLFVILAVAG  1326
              K  P    +++    +I ES  +    N+ +      K    A +  VI + + L  AG
Sbjct  269   FKQPPGEIDTDKSALHNISESVYLQKHCNKTQCKKSSSKLPQVALISSVITVTITLLGAG  328

Query  1325  LFTFSWYRRRKQQIGSTVDISESRVSTDQPKVLCRRSTSPLISLEYSNGWDPLAKDQSGS  1146
             + TF  YRRRKQ+I +T + SE R+STD  K       SPL+SL Y+  WDPL   ++G+
Sbjct  329   ILTFFRYRRRKQKISNTPEFSEGRLSTDLQKDF---RASPLVSLAYTKEWDPLGDSRNGA  385

Query  1145  ALSQE-----VLESFMFNLDEVESATQYFSETNLLGKSSFSAVYKGTLRDGSAVAVKCIS  981
               SQE     V  SF FNL+++ESATQ FSE NLL ++SF++V+KG LRDGS VA++ I+
Sbjct  386   EFSQEPHLFVVNSSFRFNLEDIESATQCFSEANLLSRNSFTSVFKGVLRDGSPVAIRSIN  445

Query  980   KTSCKSDEAEFRKGLTLLTSLKHENLLRLRGFCCSKGRGECFLIYDFVSNGNLLRYLDVK  801
              +SCK++E EF  GL LL+SL HENL++LRGFCCS+GRGECFLIYDF S G L  +LD++
Sbjct  446   ISSCKNEEVEFMNGLKLLSSLSHENLMKLRGFCCSRGRGECFLIYDFASKGKLSNFLDIQ  505

Query  800   D-EKGKVLDWSTRTAIIKGIARGIKYLHG-NKRNKPALVHRNISADKVLIDHLYKPLLSD  627
             + E  +VLDW  R +IIKGIA+GI YLHG +++ KP +VHRNIS +K+L+D  + PL++D
Sbjct  506   EHETNQVLDWPARISIIKGIAKGIAYLHGSDQQKKPTIVHRNISVEKILLDEQFNPLIAD  565

Query  626   SGLHKLLADDIVFSTLKGSAANGYLAPEYAITGRFTEKSDMYAFGVIILQILSGSCVVTQ  447
             SGLH LLADD+VFS LK SAA GYLAPEY  TG+FTEK+D++AFGVIILQILSG  ++T 
Sbjct  566   SGLHNLLADDMVFSALKTSAAMGYLAPEYVTTGKFTEKTDIFAFGVIILQILSGKLMLTS  625

Query  446   SNHQGAELCRFEDFVDAKLGKDFVESEAAKLGKIALLCTHDSPSRRPAIDVVIQ  285
             S    AE      F+D  L ++F + EA  + +I + CT + P+ RP I+ +++
Sbjct  626   SLRIAAENGEHSGFIDEYLREEFDKPEAIAMARIGISCTQEIPNNRPNIETLLE  679



>ref|XP_003611243.1| Receptor-like protein kinase [Medicago truncatula]
 gb|AES94201.1| LRR receptor-like kinase [Medicago truncatula]
Length=683

 Score =   642 bits (1657),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 349/649 (54%), Positives = 447/649 (69%), Gaps = 17/649 (3%)
 Frame = -3

Query  2198  LMAIKASLDPGNLVLSSWSPNVTDPCSVSSFEGIACNDLGQVVNISLQGKGLYGKIPPEI  2019
             LM +KASLDP   +L+SW  +  +PCS  SFEGIACN+  +V NISLQGKGL+G +   +
Sbjct  31    LMDLKASLDPEGKILTSWIGD-GNPCS-GSFEGIACNEHWKVANISLQGKGLFGSLSSSV  88

Query  2018  GQLNGLSGLYLHFNNLHGVIPKEIASLTQLSDLYLNMNDLSGFIPSEIGNMPNLQVLQLC  1839
              +L  LSGLYLH+NNL G IP +I++LT+L DLYL++N LSG IP EIGNM +LQVLQL 
Sbjct  89    AELKCLSGLYLHYNNLSGEIPSQISNLTELVDLYLDVNSLSGRIPPEIGNMASLQVLQLG  148

Query  1838  YNRFEGCIPNKLGSLKNLTVLALQSNQLTGAIPASlggltlltrldLSFNRLFGSIPVKL  1659
              N+  G IP ++GSLK LT LALQ N+LTG IP SLG L  L+RL+LSFN   G+IP  L
Sbjct  149   DNQLVGNIPTQMGSLKQLTTLALQYNKLTGQIPLSLGNLENLSRLNLSFNNFSGAIPATL  208

Query  1658  SEASKLEVLDLRNNTLSGNVPLGLKRLNEGFRYENNPGLCGTGFPSLALCS-DSSLNPTK  1482
             +  + LEVLD++NN+LSG VP  L+RL EGF+  NN GLCG G  +L  C+ +  LN + 
Sbjct  209   ANIAHLEVLDIQNNSLSGTVPSVLQRLGEGFQGANNQGLCGVGISTLRACNKEPDLNVSN  268

Query  1481  PEPFGQG--SNRLPTKDIPESANIPHQLNQNRKPQA--------AAAVVGVIGLFVILAV  1332
              +   Q    N  P    PE AN     NQ    ++         A+V+ +I L +I   
Sbjct  269   IDTSDQDHLKNSNPATPRPEPANFQMHCNQKHCSKSRSVPTSVITASVIAIITLTII--G  326

Query  1331  AGLFTFSWYRRRKQQIGSTVDISESRVSTDQPKVLCRRSTSPLISLEYSNGWDPLAKDQS  1152
             AGLFTF  YRRRKQ+I S  + SE ++S  QPK L ++S S L++L+Y NG  P+  DQ+
Sbjct  327   AGLFTFVKYRRRKQKISS--NSSEGKLSPQQPKELYQKSPSTLVNLDYYNGCYPMPDDQN  384

Query  1151  GSALSQEVLESFMFNLDEVESATQYFSETNLLGKSSFSAVYKGTLRDGSAVAVKCISKTS  972
                LS E L  F FN+DEVESATQYFSE NLL KS FSA YKG LRDGS VA+  I+ + 
Sbjct  385   AGGLSNEYLNQFRFNVDEVESATQYFSEVNLLRKSKFSATYKGVLRDGSLVAITSINMSC  444

Query  971   CKSDEAEFRKGLTLLTSLKHENLLRLRGFCCSKGRGECFLIYDFVSNGNLLRYLDVKDEK  792
             CK++EAEF KGL+LLTSL+HEN+++LRGFCCS  RGEC+LI DF   G+L +YLD++D  
Sbjct  445   CKTEEAEFVKGLSLLTSLRHENVVKLRGFCCSSSRGECYLINDFAMMGDLSQYLDIEDRS  504

Query  791   GKVLDWSTRTAIIKGIARGIKYLHGNKRNKPALVHRNISADKVLIDHLYKPLLSDSGLHK  612
             G +LDWS R  IIKGIA+GI YLH N+ +KP +VH+NIS + VL+D  + PL+ ++GL K
Sbjct  505   GHLLDWSKRVTIIKGIAKGIGYLHSNEASKPTIVHQNISVENVLLDKDFNPLIMNAGLPK  564

Query  611   LLADDIVFSTLKGSAANGYLAPEYAITGRFTEKSDMYAFGVIILQILSGSCVVTQSNHQG  432
             LLADD+VFS LK SAA GYLAPEY  TGRFTEKSD+YAFGVI+LQ+LSG   +  S    
Sbjct  565   LLADDVVFSALKVSAAMGYLAPEYITTGRFTEKSDIYAFGVIVLQVLSGKTAIGGSIRTA  624

Query  431   AELCRFEDFVDAKLGKDFVESEAAKLGKIALLCTHDSPSRRPAIDVVIQ  285
              +  +F+D +D  L   +  SEA+ L K+ + C H+SP  RP +  VIQ
Sbjct  625   FQSFKFDDCIDTNLKGRYSNSEASILTKLGMQCIHESPDERPNMVDVIQ  673



>ref|XP_010448856.1| PREDICTED: protein NSP-INTERACTING KINASE 2-like [Camelina sativa]
Length=687

 Score =   639 bits (1648),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 346/654 (53%), Positives = 453/654 (69%), Gaps = 21/654 (3%)
 Frame = -3

Query  2198  LMAIKASLDPGNLVLSSWSPNVTDPCSVSSFEGIACNDLGQVVNISLQGKGLYGKIPPEI  2019
             LM +K+SLDP N +L SW+ N  DPC   SFEGIACN   +V NISLQGK L GK+ P +
Sbjct  31    LMELKSSLDPENKLLRSWTFN-GDPCD-GSFEGIACNQHLKVANISLQGKRLTGKLSPAV  88

Query  2018  GQLNGLSGLYLHFNNLHGVIPKEIASLTQLSDLYLNMNDLSGFIPSEIGNMPNLQVLQLC  1839
              +L  LSGLYLH+N+L G IP+EI +LT+LSDLYLN+N+LSG IP+EIG+M  LQV+ LC
Sbjct  89    AELKCLSGLYLHYNSLSGEIPQEITNLTELSDLYLNVNNLSGEIPAEIGSMAGLQVMDLC  148

Query  1838  YNRFEGCIPNKLGSLKNLTVLALQSNQLTGAIPASlggltlltrldLSFNRLFGSIPVKL  1659
              N   G IPN +GSLK L VL+LQ N+LTG +P SLG L++L RLDLSFN L G IP  L
Sbjct  149   CNSLTGNIPNNIGSLKKLNVLSLQHNKLTGEVPWSLGNLSMLCRLDLSFNSLLGLIPKTL  208

Query  1658  SEASKLEVLDLRNNTLSGNVPLGLKRLNEGFRYENNPGLCGTGFPSLALCSD-SSLNPTK  1482
             +  ++L+ LDLRNNTLSG VP GLK+LN  F++ENN GLCG  FPSL  CS     N   
Sbjct  209   ANIAQLDTLDLRNNTLSGFVPPGLKKLNGRFQFENNTGLCGIDFPSLRACSAFEEANIEF  268

Query  1481  PEPFGQ-GSNRLPTKDIPESANIPHQLNQNR------KPQAAAAVVGVIGLFVILAVAGL  1323
              +P G+  +++    +I ES  +    NQ        K    A +  VI + + L  AG+
Sbjct  269   KQPPGEIDTDKSTLHNISESVYLQKHCNQTHCHKSSSKLTQVAVISSVITVAITLIGAGI  328

Query  1322  FTFSWYRRRKQQIGSTVDISESRVSTDQPKVLCRRSTSPLISLEYSNGWDPLAKDQSGSA  1143
              TF  YRRRKQ+I +T + SE R+STDQ K L     SPL+SL Y+  WDPL   ++G+ 
Sbjct  329   LTFFRYRRRKQKISNTPEFSEGRLSTDQQKDL---RASPLVSLAYTKEWDPLGDSRNGAE  385

Query  1142  LSQE------VLESFMFNLDEVESATQYFSETNLLGKSSFSAVYKGTLRDGSAVAVKCIS  981
              SQ+      V  SF FNL+++ESATQ FSE NL+ ++SF++V+KG LRDGS VA++ I+
Sbjct  386   FSQQEPHLFVVNSSFRFNLEDIESATQCFSEANLMSRNSFTSVFKGVLRDGSPVAIRSIN  445

Query  980   KTSCKSDEAEFRKGLTLLTSLKHENLLRLRGFCCSKGRGECFLIYDFVSNGNLLRYLDVK  801
              +SCK++E EF  GL LL+SL HENL++LRGFCCS+GRGECFLIYDF S G L  +LD++
Sbjct  446   ISSCKNEEVEFMNGLKLLSSLSHENLVKLRGFCCSRGRGECFLIYDFASKGKLSNFLDLQ  505

Query  800   D-EKGKVLDWSTRTAIIKGIARGIKYLHG-NKRNKPALVHRNISADKVLIDHLYKPLLSD  627
             + E  +VL W  R +IIKGIA+GI YLHG +++ K  ++HRNIS +K+L+D    PL++D
Sbjct  506   EKETNQVLAWPARISIIKGIAKGIAYLHGSDQQKKHTIIHRNISVEKILLDEQLNPLIAD  565

Query  626   SGLHKLLADDIVFSTLKGSAANGYLAPEYAITGRFTEKSDMYAFGVIILQILSGSCVVTQ  447
             SGLH LLADD+VFS LK SAA GYLAPEY  TG+FTEK+D++AFGVIILQI+SG  ++T 
Sbjct  566   SGLHNLLADDMVFSALKTSAAMGYLAPEYVTTGKFTEKTDVFAFGVIILQIISGKLMLTT  625

Query  446   SNHQGAELCRFEDFVDAKLGKDFVESEAAKLGKIALLCTHDSPSRRPAIDVVIQ  285
             S    AE      F+D  L  +F + EA  + +I + CT + P+ RP I+ ++Q
Sbjct  626   SLRLAAEDGEVNGFIDEYLCGEFDKEEAVAMARIGISCTQEIPNNRPNIETLLQ  679



>ref|XP_006659770.1| PREDICTED: LOW QUALITY PROTEIN: probable LRR receptor-like serine/threonine-protein 
kinase At1g53420-like, partial [Oryza 
brachyantha]
Length=693

 Score =   639 bits (1648),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 354/679 (52%), Positives = 458/679 (67%), Gaps = 43/679 (6%)
 Frame = -3

Query  2213  STVSLLMAIKASLDPGNLVLSSWSPNVTDPCSVSS-FEGIACNDLGQVVNISLQGKGLYG  2037
             + V  LM +KA+LDP    L SW+    DPC     FEG++C+  G+V  +SLQGKGL G
Sbjct  16    AEVDALMELKAALDPSGRSLPSWARG-GDPCGRGDYFEGVSCDARGRVATVSLQGKGLAG  74

Query  2036  KIPPEIGQLNGLSGLYLHFNNLHGVIPKEIASLTQLSDLYLNMNDLSGFIPSEIGNMPNL  1857
              I P +  L GL+GLYLH+N L G IP+++  L  L++LYL +N+LSG IP E+G + +L
Sbjct  75    AISPAVAMLPGLTGLYLHYNALSGAIPRQLGDLPLLAELYLGVNNLSGAIPVELGRLSSL  134

Query  1856  QVLQLCYNRFEGCIPNKLGSLKNLTVLALQSNQLTGAIPASlggltlltrldLSFNRLFG  1677
             QVLQL YN+  G IP +LG LK LTVLALQSNQL GAIPASLG L  L RLDLS N LFG
Sbjct  135   QVLQLGYNQLSGSIPTQLGQLKKLTVLALQSNQLAGAIPASLGDLPELARLDLSSNHLFG  194

Query  1676  SIPVKLSEASKLEVLDLRNNTLSGNVPLGLKRLNEGFRYENNPGLCGTGFPSLALCSDSS  1497
             SIP KL+   KL  LDLRNNTLSG+VP GLK+LNEGF Y+NN  LCG  F SL  C++  
Sbjct  195   SIPSKLAAIPKLVALDLRNNTLSGSVPSGLKKLNEGFHYDNNSELCGARFDSLKPCANGD  254

Query  1496  LNPTKPEPFGQGSNRLPTKDIPESANI-----PHQLNQNRK-------------------  1389
              +  +         ++P K    S N+     P  +N NR                    
Sbjct  255   GDDNED------GGKMPRKPESTSVNVKPLQPPQTMNVNRDCDNGGCSTSSSSSSSTATT  308

Query  1388  PQAAAAVVGVIGLFVILAVAGLFTFSWYRRRKQQIGSTVDISESRVSTDQPKVLCRRS--  1215
               + A + G I +   +A  GL  FSW RR+KQ++GSTV+  E R S D+ K  C+RS  
Sbjct  309   LSSGAILAGTIVIVGGVAACGLSVFSWRRRQKQKVGSTVESLEGRGSMDKQKEACQRSNA  368

Query  1214  TSPLI--SLEYSNGWDPLAK-DQSGSALSQEVLESFMFNLDEVESATQYFSETNLLGKSS  1044
             +S LI  S+E S+GWD  ++  Q G  LS E   S  FNL+EVE ATQYFS+ NLLG+S 
Sbjct  369   SSSLINWSVESSSGWDTSSEGSQQGVRLSPEWSPSVRFNLEEVECATQYFSDVNLLGRSG  428

Query  1043  FSAVYKGTLRDGSAVAVKCISKTSCKSDEAEFRKGLTLLTSLKHENLLRLRGFCCSKGRG  864
             F+A Y+GT+RDG+AVAVK I+K+SCK++EA+F +GL ++TSL+H+NL+ LRGFC S+ RG
Sbjct  429   FAATYRGTMRDGTAVAVKSINKSSCKAEEADFLRGLRVITSLRHDNLVGLRGFCRSRARG  488

Query  863   ECFLIYDFVSNGNLLRYLDVKDEK---GKVLDWSTRTAIIKGIARGIKYLHGNKRNKPAL  693
             ECFL+Y+F++NG L RYLDVKD +     VLDW TR +IIKG+A+GI+YLH +K NK AL
Sbjct  489   ECFLVYEFMANGCLSRYLDVKDGEAAAAAVLDWPTRVSIIKGVAKGIEYLHSSKANKAAL  548

Query  692   VHRNISADKVLIDHLYKPLLSDSGLHKLLADDIVFSTLKGSAANGYLAPEYAITGRFTEK  513
             VH+NISADK+L+DH + P LS +G HKL+ADD+VFSTLK SAA GYLAPEY  TGRFT++
Sbjct  549   VHQNISADKILMDHHFTPHLSGAGEHKLVADDVVFSTLKDSAAMGYLAPEYTTTGRFTDR  608

Query  512   SDMYAFGVIILQILSGSCVVTQSNH--QGAELC-RFEDFVDAKLGKDFVESEAAKLGKIA  342
             SD+YAFGV++ Q+L+G   V+       GAE   + +D VD +L   F   EAAKL  +A
Sbjct  609   SDVYAFGVVVFQVLTGRKAVSSQLRLLGGAEYSGKLDDLVDPRLAGRFSRPEAAKLAGVA  668

Query  341   LLCTHDSPSRRPAIDVVIQ  285
             LLCT +SP++RP +  V+Q
Sbjct  669   LLCTSESPAQRPDMAAVLQ  687



>ref|XP_006285866.1| hypothetical protein CARUB_v10007360mg [Capsella rubella]
 gb|EOA18764.1| hypothetical protein CARUB_v10007360mg [Capsella rubella]
Length=686

 Score =   638 bits (1646),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 345/653 (53%), Positives = 449/653 (69%), Gaps = 20/653 (3%)
 Frame = -3

Query  2198  LMAIKASLDPGNLVLSSWSPNVTDPCSVSSFEGIACNDLGQVVNISLQGKGLYGKIPPEI  2019
             LM +K+SLDP N +L SW+ N  DPC   SFEGIACN   +V NISLQGK L GK+ P +
Sbjct  31    LMELKSSLDPENKLLRSWTFN-GDPCD-GSFEGIACNQHLKVANISLQGKRLTGKLSPAV  88

Query  2018  GQLNGLSGLYLHFNNLHGVIPKEIASLTQLSDLYLNMNDLSGFIPSEIGNMPNLQVLQLC  1839
              +L  LSGLYLH+N+L G IP+EI +LT+LSDLYLN+N+ SG IP+EIG+M  LQV+ LC
Sbjct  89    AELKCLSGLYLHYNSLSGEIPQEITNLTELSDLYLNVNNFSGEIPAEIGSMAGLQVMDLC  148

Query  1838  YNRFEGCIPNKLGSLKNLTVLALQSNQLTGAIPASlggltlltrldLSFNRLFGSIPVKL  1659
              N   G +PN +G+LK L VL+LQ N+LTG +P SLG L++L RLDLSFN L G IP  L
Sbjct  149   CNSLTGKLPNGIGTLKKLNVLSLQHNKLTGEVPWSLGNLSMLNRLDLSFNYLLGLIPKTL  208

Query  1658  SEASKLEVLDLRNNTLSGNVPLGLKRLNEGFRYENNPGLCGTGFPSLALCS--DSSLNPT  1485
             +   +L+ LDLRNNTLSG VP GLK+LN  F++ENN GLCG  FPSL  CS  D +    
Sbjct  209   ANIPQLDTLDLRNNTLSGFVPTGLKKLNGRFQFENNTGLCGIDFPSLRACSAFDQANIEF  268

Query  1484  KPEPFGQGSNRLPTKDIPESANIPHQLNQNR------KPQAAAAVVGVIGLFVILAVAGL  1323
             K  P    +++    +I ES  +    NQ        K    A +  VI + + L  AG+
Sbjct  269   KQPPGEIDTDKSSLHNISESVYLQKHCNQTHCHKSSSKLAQVALISSVITVTITLIGAGI  328

Query  1322  FTFSWYRRRKQQIGSTVDISESRVSTDQPKVLCRRSTSPLISLEYSNGWDPLAKDQSGSA  1143
              TF  YRRRKQ+I +T + SE R+STDQ K       SPL+SL Y+  WDPL   ++G+ 
Sbjct  329   LTFFRYRRRKQKISNTPEFSEGRLSTDQQKDF---RASPLVSLAYTKEWDPLGDSRNGAE  385

Query  1142  LSQE-----VLESFMFNLDEVESATQYFSETNLLGKSSFSAVYKGTLRDGSAVAVKCISK  978
              SQE     V  SF FNL+++ESATQ FSE NL+ ++SF++V+KG LRDGS VA++ I+ 
Sbjct  386   FSQEPHLFVVNSSFRFNLEDIESATQCFSEANLMSRNSFTSVFKGVLRDGSPVAIRSINI  445

Query  977   TSCKSDEAEFRKGLTLLTSLKHENLLRLRGFCCSKGRGECFLIYDFVSNGNLLRYLDVKD  798
             +SCK++E EF  GL LL+SL HENL++LRGFCCS+GRGECFLIYDF S G L  +LD+++
Sbjct  446   SSCKNEEVEFMNGLKLLSSLSHENLVKLRGFCCSRGRGECFLIYDFASKGKLSNFLDLQE  505

Query  797   -EKGKVLDWSTRTAIIKGIARGIKYLHG-NKRNKPALVHRNISADKVLIDHLYKPLLSDS  624
              E   VLDWS R +IIKGIA+GI YLHG +++ KP +VHRNIS +K+L+D    PL++DS
Sbjct  506   QETNHVLDWSARVSIIKGIAKGIAYLHGSDQQKKPTIVHRNISVEKILLDEQLNPLIADS  565

Query  623   GLHKLLADDIVFSTLKGSAANGYLAPEYAITGRFTEKSDMYAFGVIILQILSGSCVVTQS  444
             GLH LLADD+VFS LK SAA GYLAPEY  TG+FTEK+D++AFGVIILQI+SG  ++T S
Sbjct  566   GLHNLLADDMVFSALKTSAAMGYLAPEYVTTGKFTEKTDIFAFGVIILQIISGKLMLTSS  625

Query  443   NHQGAELCRFEDFVDAKLGKDFVESEAAKLGKIALLCTHDSPSRRPAIDVVIQ  285
                 A       F+D  L + F + E   + +I + CT + P+ RP I+ ++Q
Sbjct  626   LRIAAGNGELNGFIDEYLREAFDKPEVVAMARIGISCTQEIPNNRPDIETLLQ  678



>ref|XP_010434007.1| PREDICTED: somatic embryogenesis receptor kinase 4-like [Camelina 
sativa]
Length=687

 Score =   637 bits (1644),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 345/655 (53%), Positives = 455/655 (69%), Gaps = 23/655 (4%)
 Frame = -3

Query  2198  LMAIKASLDPGNLVLSSWSPNVTDPCSVSSFEGIACNDLGQVVNISLQGKGLYGKIPPEI  2019
             LM +K+SLDP N +L SW+ N  DPC   SFEGIACN   +V NISLQGK L GK+ P +
Sbjct  31    LMELKSSLDPENKLLRSWTFN-GDPCD-GSFEGIACNQHLKVANISLQGKRLTGKLSPAV  88

Query  2018  GQLNGLSGLYLHFNNLHGVIPKEIASLTQLSDLYLNMNDLSGFIPSEIGNMPNLQVLQLC  1839
              +L  LSGLYLH+N+L G IP+EI +LT+LSDLYLN+N+ SG IP+EIG+M  LQV+ LC
Sbjct  89    AELKCLSGLYLHYNSLSGEIPQEITNLTELSDLYLNVNNFSGEIPAEIGSMAGLQVMDLC  148

Query  1838  YNRFEGCIPNKLGSLKNLTVLALQSNQLTGAIPASlggltlltrldLSFNRLFGSIPVKL  1659
              N   G IPN +GSLK L VL+LQ N+LTG +P S+G L++L+RLDLSFN L G IP  L
Sbjct  149   CNSLTGKIPNNIGSLKKLNVLSLQHNKLTGEVPWSVGNLSMLSRLDLSFNSLLGLIPKTL  208

Query  1658  SEASKLEVLDLRNNTLSGNVPLGLKRLNEGFRYENNPGLCGTGFPSLALCS--DSSLNPT  1485
             +   +L+ LDLRNNTLSG VP GLK+LN  F++ENN GLCG  FPSL  CS  D +    
Sbjct  209   ANIPQLDTLDLRNNTLSGFVPPGLKKLNGRFQFENNTGLCGIDFPSLRDCSAFDEANIEF  268

Query  1484  KPEPFGQGSNRLPTKDIPESANIPHQLNQ-------NRKPQAAAAVVGVIGLFVILAVAG  1326
             K  P    +++    +I ES  I    NQ       ++ PQ  A +  VI + + L  A 
Sbjct  269   KQPPGETDTDKSSLHNISESVYIQKHCNQTHCHKSSSKLPQ-VALISSVITVSITLIGAA  327

Query  1325  LFTFSWYRRRKQQIGSTVDISESRVSTDQPKVLCRRSTSPLISLEYSNGWDPLAKDQSGS  1146
             + TF  YRRRKQ+I +T + S+ R+STDQ K L     SPL+SL Y+  WDPL   ++G+
Sbjct  328   ILTFFRYRRRKQKISNTPEFSKGRLSTDQQKDL---RASPLVSLAYTKEWDPLGDSRNGA  384

Query  1145  ALSQE------VLESFMFNLDEVESATQYFSETNLLGKSSFSAVYKGTLRDGSAVAVKCI  984
               SQ+      V  SF FNL+++ESATQ FSE N++ ++SF++V+KG LRDGS VA++ I
Sbjct  385   EFSQQEPHLFVVNSSFRFNLEDIESATQCFSEANIMSRNSFTSVFKGVLRDGSPVAIRSI  444

Query  983   SKTSCKSDEAEFRKGLTLLTSLKHENLLRLRGFCCSKGRGECFLIYDFVSNGNLLRYLDV  804
             + +SCK++E EF  GL LL+SL HENL++LRGFCCS+GRGECFLIYDF S G L  +LD+
Sbjct  445   NISSCKNEEVEFMNGLKLLSSLSHENLVKLRGFCCSRGRGECFLIYDFASKGKLSNFLDL  504

Query  803   KD-EKGKVLDWSTRTAIIKGIARGIKYLHG-NKRNKPALVHRNISADKVLIDHLYKPLLS  630
             ++ E  +VL W TR +IIKGIA+GI YLHG +++ KP ++HRNIS +K+L+D    PL++
Sbjct  505   QEKETNQVLAWPTRISIIKGIAKGIAYLHGSDQQKKPTIIHRNISVEKILLDEQLNPLIA  564

Query  629   DSGLHKLLADDIVFSTLKGSAANGYLAPEYAITGRFTEKSDMYAFGVIILQILSGSCVVT  450
             DSGLH LLADD+VFS LK SAA GYLAPEY  TG+FTEK+D++AFGVIILQI+SG  ++T
Sbjct  565   DSGLHNLLADDMVFSALKTSAAMGYLAPEYVTTGKFTEKTDVFAFGVIILQIISGKLMLT  624

Query  449   QSNHQGAELCRFEDFVDAKLGKDFVESEAAKLGKIALLCTHDSPSRRPAIDVVIQ  285
              S    AE      F+D  L  +F + EA  + +I + CT + P+ RP I+ ++Q
Sbjct  625   TSLRLAAEDGEVNGFIDEYLRGEFDKQEAIGMARIGISCTQEIPNNRPNIETLLQ  679



>ref|XP_010100886.1| putative LRR receptor-like serine/threonine-protein kinase [Morus 
notabilis]
 gb|EXB85810.1| putative LRR receptor-like serine/threonine-protein kinase [Morus 
notabilis]
Length=614

 Score =   634 bits (1634),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 336/514 (65%), Positives = 390/514 (76%), Gaps = 20/514 (4%)
 Frame = -3

Query  1844  LCYNRFEGCIPNKLGSLKNLTVLALQSNQLTGAIPASlggltlltrldLSFNRLFGSIPV  1665
             LCYN   G  P +L +LK L+VLALQ NQLTGAIPASLG L  LTRLDLSFN LFGS+P 
Sbjct  45    LCYNTLTGSTPLQLRNLKRLSVLALQYNQLTGAIPASLGELKALTRLDLSFNSLFGSVPA  104

Query  1664  KLSEASKLEVLDLRNNTLSGNVPLGLKRLNEGFRYENNPGLCGTGFPSLALCSDSS-LNP  1488
             KL++A  L+VLD+RNN+LSG VP  LKRLN GF+ ENNP LCG GFP L +CS S    P
Sbjct  105   KLADAPMLQVLDIRNNSLSGTVPQALKRLNGGFQCENNPHLCGVGFPDLHVCSASDGWEP  164

Query  1487  TKPEP----------FGQGSNRLPTKDIPESANIPHQLNQ------NRKPQAAAAVVGVI  1356
              +PEP          F   +  L  +D+PESAN+    ++      ++ PQ   A+ GVI
Sbjct  165   NRPEPYQPSNLSANGFPHSAQNLTAEDLPESANLNPDCSRTSCSKTSKSPQVGVAL-GVI  223

Query  1355  GLFVILAVAGLFTFSWYRRRKQQIGSTVDISESRVSTDQPKVLCRRSTSPLISLEYSNGW  1176
             GLFV   V+GLFTFSWYRRRKQ+IGS  + S+SR+STDQ K + R+S SPLISLEYSNGW
Sbjct  224   GLFVAFTVSGLFTFSWYRRRKQKIGSAFNSSDSRLSTDQAKEVYRKSASPLISLEYSNGW  283

Query  1175  DPLAKDQSGSALSQEVLESFMFNLDEVESATQYFSETNLLGKSSFSAVYKGTLRDGSAVA  996
             DP+AK  SG   SQEVLESFMFNL+EVE ATQ FSE NLL KS+FSA+YKG LRD S VA
Sbjct  284   DPVAKGCSG--FSQEVLESFMFNLEEVERATQCFSEVNLLEKSNFSAIYKGILRDRSVVA  341

Query  995   VKCISKTSCKSDEAEFRKGLTLLTSLKHENLLRLRGFCCSKGRGECFLIYDFVSNGNLLR  816
             VKCI+KTSCKSDEAEF KGL +LTSLKHENL+RLRGFCCSKGRGECFLIYDF+ NG+LL+
Sbjct  342   VKCIAKTSCKSDEAEFLKGLKILTSLKHENLVRLRGFCCSKGRGECFLIYDFIPNGSLLQ  401

Query  815   YLDVKDEKGKVLDWSTRTAIIKGIARGIKYLHGNKRNKPALVHRNISADKVLIDHLYKPL  636
             YLDV++  G  L+WSTR +II GIA+GI +LHGNK NKPA+VH+NISA+K L D  YKP+
Sbjct  402   YLDVEEGSGTALEWSTRISIINGIAKGIAHLHGNKGNKPAMVHQNISAEKGLTDTNYKPM  461

Query  635   LSDSGLHKLLADDIVFSTLKGSAANGYLAPEYAITGRFTEKSDMYAFGVIILQILSGSCV  456
             +S+SGLHKLLADDI+FS LK SAA GYLAPEY   GRFT KSD+YAFGVIILQILSG   
Sbjct  462   ISNSGLHKLLADDIIFSLLKASAAMGYLAPEYTTAGRFTGKSDVYAFGVIILQILSGKRK  521

Query  455   VTQSNHQGAELCRFEDFVDAKLGKDFVESEAAKL  354
             +TQ   QGAE CRFED +D  L   F ESE   L
Sbjct  522   ITQFVRQGAEFCRFEDVIDQNLEGKFSESEERNL  555



>emb|CDM83247.1| unnamed protein product [Triticum aestivum]
Length=693

 Score =   635 bits (1638),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 347/667 (52%), Positives = 450/667 (67%), Gaps = 35/667 (5%)
 Frame = -3

Query  2207  VSLLMAIKASLDPGNLVLSSWSPNVTDPCSVSSFEGIACNDLGQVVNISLQGKGLYGKIP  2028
             V  L+ +KA+LDP   +L SW+P   DPC+   FEG+ C+  G V N+SLQGKGL G + 
Sbjct  31    VRALLELKAALDPTGRLLPSWAPG-RDPCARGGFEGVVCDGSGAVANVSLQGKGLPGTLS  89

Query  2027  PEIGQLNGLSGLYLHFNNLHGVIPKEIASLTQLSDLYLNMNDLSGFIPSEIGNMPNLQVL  1848
             P +  L  L+GLYLH+N L G +P+E+A LT L+D+YLN+N+ SG IP+EIG M +LQVL
Sbjct  90    PAVAGLRALTGLYLHYNALRGGVPRELARLTWLTDVYLNVNNFSGPIPAEIGAMASLQVL  149

Query  1847  QLCYNRFEGCIPNKLGSLKNLTVLALQSNQLTGAIPASlggltlltrldLSFNRLFGSIP  1668
             QLCYN+  G IP +LG L  LTVLALQSN L GAIPASLG L  L RLDLSFN LFGSIP
Sbjct  150   QLCYNQLTGSIPTQLGLLNRLTVLALQSNHLNGAIPASLGNLPELRRLDLSFNHLFGSIP  209

Query  1667  VKLSEASKLEVLDLRNNTLSGNVPLGLKRLNEGFRYENNPGLCGTGFPSLALCSDSSL-N  1491
             V+L+   ++  LD+RNN+L+G+VP  L +L  GF+Y NN  LCGTG P L  C+ + L +
Sbjct  210   VRLARLPQITALDVRNNSLTGSVPSELAKLEGGFQYGNNTDLCGTGLPDLRPCTPADLID  269

Query  1490  PTKPEPFGQGSNRLPTKDIPESANIPHQLNQNRKPQAAAAVVGVIGLFVILAVAGLFTFS  1311
             P +P+PF  G   +  +  P+ A      +    P +  A+  V+ + VIL  AGL  FS
Sbjct  270   PDRPQPFSAG---IAPQITPDGAR--GHCSGTHCPPSTKALAAVVVVAVILLAAGLLVFS  324

Query  1310  WYRRRKQQIGS---TVDISESRVSTD---QPKVLCRRSTSPLISLEYSNGWDPLAKDQSG  1149
             W+R RKQ+  +    +     R ST+     +   + ++S L+SLEYSNGWDPLA  +SG
Sbjct  325   WHRWRKQRTAAGAPPMTTVGGRCSTEGEANKESFRKSASSTLVSLEYSNGWDPLADGRSG  384

Query  1148  SALSQEVLESFMFNLDEVESATQYFSETNLLGK----------SSFSAVYKGTLRDGSAV  999
                SQEV  S  FN++E+ESATQYFSE NLLGK          SSF+A Y+GTLRDG+ V
Sbjct  385   VGFSQEVSPSLRFNMEELESATQYFSELNLLGKKNSKSKGGAGSSFAATYRGTLRDGAPV  444

Query  998   AVKCISKTSCKSDEAEFRKGLTLLTSLKHENLLRLRGFCCSKGRGECFLIYDFVSNGNLL  819
              V  + KT CK +EAEF KGL LL  L+H+N++ LRGFCCS+ RGECFL++DFV NG+L 
Sbjct  445   VVTRLGKTCCKQEEAEFLKGLKLLAELRHDNIVGLRGFCCSRARGECFLVHDFVPNGSLS  504

Query  818   RYLDVK---------DEKGKVLDWSTRTAIIKGIARGIKYLHGNKRNKPALVHRNISADK  666
              +LDV             G+VL+WSTR +IIKGIA+GI YLH  + NKP LVH+NISADK
Sbjct  505   HFLDVAGEDGGGGALGHGGRVLEWSTRVSIIKGIAKGIGYLHSTRANKPPLVHQNISADK  564

Query  665   VLIDHLYKPLLSDSGLHKLLADDIVFSTLKGSAANGYLAPEYAITGRFTEKSDMYAFGVI  486
             VL+D+ YKPL+S SGLHKLL DD+VFSTLK SAA GYLAPEY   GRF+EKSD+YAFGVI
Sbjct  565   VLVDYTYKPLISGSGLHKLLVDDLVFSTLKASAAMGYLAPEYTTVGRFSEKSDVYAFGVI  624

Query  485   ILQILSGSCVVTQSNHQGAELCRFEDFVDAKLGKDFVESEAAKLGKIALLCTHDSPSRRP  306
             + QIL+G     Q   +   +    D +D  +   +  +EAAKL KIAL+CT ++P +RP
Sbjct  625   VFQILTGKSKTMQLPFESGNV---HDLIDGNMKGCYSATEAAKLAKIALVCTSENPEQRP  681

Query  305   AIDVVIQ  285
              ++ ++Q
Sbjct  682   NMEELLQ  688



>ref|XP_003525760.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At2g33170-like [Glycine max]
 gb|KHN04759.1| Protein NSP-INTERACTING KINASE 2 [Glycine soja]
Length=683

 Score =   633 bits (1632),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 337/645 (52%), Positives = 444/645 (69%), Gaps = 10/645 (2%)
 Frame = -3

Query  2198  LMAIKASLDPGNLVLSSWSPNVTDPCSVSSFEGIACNDLGQVVNISLQGKGLYGKIPPEI  2019
             LM +K+SLDP + +L SW+ +  DPCS  SF G+ CN+  +V NISL G+GL G++ P +
Sbjct  30    LMDLKSSLDPKDKLLGSWTSD-GDPCS-GSFLGVVCNEHNKVANISLPGRGLSGRVSPAV  87

Query  2018  GQLNGLSGLYLHFNNLHGVIPKEIASLTQLSDLYLNMNDLSGFIPSEIGNMPNLQVLQLC  1839
              +L  LSGLYLH+N L G IP EIA+L +L DLYLN N+LSG IPS+IGNM +LQVLQL 
Sbjct  88    AELKCLSGLYLHYNLLSGDIPGEIANLKELLDLYLNFNNLSGTIPSDIGNMTSLQVLQLG  147

Query  1838  YNRFEGCIPNKLGSLKNLTVLALQSNQLTGAIPASlggltlltrldLSFNRLFGSIPVKL  1659
             YN+ EG IP +LGSLK L V++LQ N+LTG IP SLG L  L +L LS+N   G+IPVKL
Sbjct  148   YNQLEGTIPEELGSLKQLNVISLQHNKLTGEIPQSLGHLEKLRKLYLSYNNFSGTIPVKL  207

Query  1658  SEASKLEVLDLRNNTLSGNVPLGLKRLNEGFRYENNPGLCGTGFPSLALCS-DSSLNPTK  1482
             ++ + LEVLD++NN LSG +P  L+RL EGF+  NN  LCG  F +L  C+ D     ++
Sbjct  208   ADVANLEVLDIQNNHLSGTIPSALQRLREGFQGANNRDLCGDDFSALKTCNKDRIFGVSQ  267

Query  1481  PEPFGQGSNRLPTKDIPESANIPHQLNQNRKPQAAAAVVGVIGLFVILAV-----AGLFT  1317
                      R P    P+  N     NQ    ++ + ++ VI   V   V     +G+F 
Sbjct  268   ISAPNISIYRNPPITFPKPVNAHLHCNQTHCSKSRSFLLLVIAASVTTTVITLISSGIFI  327

Query  1316  FSWYRRRKQQIGSTVDISESRVSTDQPKVLCRRSTSPLISLE-YSNGWDPLAKDQSGSAL  1140
             F  YRR++Q++ +  D SE + S  QPK    RS+SPL++LE Y  GWD LA   + S L
Sbjct  328   FVRYRRQRQKVRNPSDYSEGQHSPYQPKEF-YRSSSPLVNLEHYYTGWDSLADGHNESGL  386

Query  1139  SQEVLESFMFNLDEVESATQYFSETNLLGKSSFSAVYKGTLRDGSAVAVKCISKTSCKSD  960
             S E L  F FN+DE+ESA+ + SE NLL KS FSAVYKG LRDGS VA++ IS T CK++
Sbjct  387   SLEYLNRFRFNIDEIESASGHLSEANLLSKSKFSAVYKGILRDGSLVAIRSISVTCCKAE  446

Query  959   EAEFRKGLTLLTSLKHENLLRLRGFCCSKGRGECFLIYDFVSNGNLLRYLDVKDEKGKVL  780
             E EF KGL+LLTSL+HEN++++RGFCCS+ RGE F + DF + GNL +YLD +D    V+
Sbjct  447   EGEFLKGLSLLTSLRHENIVKMRGFCCSRSRGEWFFVCDFATRGNLSQYLDKEDGSAHVI  506

Query  779   DWSTRTAIIKGIARGIKYLHGNKRNKPALVHRNISADKVLIDHLYKPLLSDSGLHKLLAD  600
             +WS R +II+GIA+GI YLH N+ +KP +VH+NIS +KV++DH + PL++D+GL KLLAD
Sbjct  507   EWSKRVSIIRGIAKGIGYLHSNEASKPTIVHQNISVEKVILDHEFNPLITDAGLPKLLAD  566

Query  599   DIVFSTLKGSAANGYLAPEYAITGRFTEKSDMYAFGVIILQILSGSCVVTQSNHQGAELC  420
             D+VFS LK SAA GYLAPEY  TGRFTEKSD+YAFGVI+LQ+LSG  ++  +     E  
Sbjct  567   DVVFSALKASAAMGYLAPEYLTTGRFTEKSDIYAFGVIVLQVLSGKVLMGGTIRVAVEAF  626

Query  419   RFEDFVDAKLGKDFVESEAAKLGKIALLCTHDSPSRRPAIDVVIQ  285
             RFEDFVD  L  D+ +SEAA L K+A+ CT + P +RP +  VIQ
Sbjct  627   RFEDFVDTNLKGDYSKSEAAILSKLAIQCTLEVPEQRPTMVEVIQ  671



>gb|KEH22284.1| LRR receptor-like kinase [Medicago truncatula]
Length=614

 Score =   629 bits (1623),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 351/642 (55%), Positives = 432/642 (67%), Gaps = 64/642 (10%)
 Frame = -3

Query  2198  LMAIKASLDPGNLVLSSWSPNVTDPCSVSSFEGIACNDLGQVVNISLQGKGLYGKIPPEI  2019
             LM IK SLDP N VL SW+ N +DPCS  +F+G+ACN+ G V NISLQGKG         
Sbjct  25    LMLIKDSLDPENHVLLSWN-NHSDPCS-GTFDGVACNEQGLVTNISLQGKG---------  73

Query  2018  GQLNGLSGLYLHFNNLHGVIPKEIASLTQLSDLYLNMNDLSGFIPSEIGNMPNLQVLQLC  1839
                                                    LSG IPS I       VLQLC
Sbjct  74    ---------------------------------------LSGEIPSVI-------VLQLC  87

Query  1838  YNRFEGCIPNKLGSLKNLTVLALQSNQLTGAIPASlggltlltrldLSFNRLFGSIPVKL  1659
             +N   G IP +LG LK L+VLALQ N L+GAIPASLG L  L RLDLSFN L G IPV L
Sbjct  88    HNELNGSIPTELGKLKRLSVLALQYNHLSGAIPASLGELETLERLDLSFNTLLGPIPVTL  147

Query  1658  SEASKLEVLDLRNNTLSGNVPLGLKRLNEGFRYENNPGLCGTGFPSLALCSD-SSLNPTK  1482
             + A KLE LD+RNN+LSG+VP  LKRL EGF+Y NN GLCGTGF  L  C   S+ +P +
Sbjct  148   ANAPKLETLDIRNNSLSGSVPTDLKRLKEGFQYFNNHGLCGTGFAHLDSCQIVSNSDPVR  207

Query  1481  PEPFGQG---SNRLPTKDIPESANIPHQLNQNRKPQAAAAVV-GVIGLFVILAVAGLFTF  1314
             PEP+      +   PT   P S N  +   + R   +   +V  VIG+  + A+ GLF  
Sbjct  208   PEPYDPSNISTIEFPTTPEPTSKNCGNSGCRRRSDSSTIGLVFAVIGVVSVSALTGLFLI  267

Query  1313  SWYRRRKQQIGSTVDISESRVSTDQPKVLCRRSTSPLISLEYSNGWDPLAKDQSGSALSQ  1134
               +RR KQ+IG+TV+IS++R+STD+ K + R+  SPLI+LEYS+GWDPL+KD    + SQ
Sbjct  268   LRHRRLKQKIGNTVEISDNRLSTDKIKEVYRKKASPLINLEYSSGWDPLSKDLG--SYSQ  325

Query  1133  EVLESFMFNLDEVESATQYFSETNLLGKSSFSAVYKGTLRDGSAVAVKCISKTSCKSDEA  954
             E L+SFMFNL+EV+ ATQ FSE NLL K++ S+ Y+G LRDGS V +KCI KTSCKSDE 
Sbjct  326   EFLQSFMFNLEEVDRATQCFSEMNLLAKNNISSNYRGILRDGSIVVIKCIPKTSCKSDET  385

Query  953   EFRKGLTLLTSLKHENLLRLRGFCCSKGRGECFLIYDFVSNGNLLRYLDVKDEKGKVLDW  774
             EF  GL +LTSLKHENL+RLRGFCCSK RGECFL+YDFVSNG L +YLDV+ E  +VL+W
Sbjct  386   EFLNGLKILTSLKHENLVRLRGFCCSKSRGECFLVYDFVSNGRLSKYLDVQRESAEVLEW  445

Query  773   STRTAIIKGIARGIKYLHGNKRNKPALVHRNISADKVLIDHLYKPLLSDSGLHKLLADDI  594
             STR +II GIA+GI YLHG K  K +LVH++ISA+KVL+D  YK LL+DSGLHKLLADD+
Sbjct  446   STRVSIIHGIAKGIFYLHGKKGRKHSLVHQSISAEKVLLDSRYKSLLADSGLHKLLADDV  505

Query  593   VFSTLKGSAANGYLAPEYAITGRFTEKSDMYAFGVIILQILSGSCVVTQSNHQGAELCRF  414
             VFSTLK SAA GYLAPEY  TGRFTEKSD+YAFG+I+ QIL+G   +TQ + Q  E    
Sbjct  506   VFSTLKASAAMGYLAPEYTTTGRFTEKSDVYAFGMIVFQILTGKHDITQLSRQCVETGTL  565

Query  413   EDFVDAKLGKDFVESEAAKLGKIALLCTHDSPSRRPAIDVVI  288
             +D +D  L   F+ESEA KL ++AL+CT +SP  RP ++ V+
Sbjct  566   KDIIDENLEGKFLESEAEKLARLALVCTDESPHLRPTMENVM  607



>ref|XP_009136073.1| PREDICTED: somatic embryogenesis receptor kinase 4 [Brassica 
rapa]
Length=687

 Score =   629 bits (1623),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 352/655 (54%), Positives = 459/655 (70%), Gaps = 23/655 (4%)
 Frame = -3

Query  2198  LMAIKASLDPGNLVLSSWSPNVTDPCSVSSFEGIACNDLGQVVNISLQGKGLYGKIPPEI  2019
             LM +K+SLDP N +L SW+ N  DPC   SFEGIACN   +V NISLQGK L GK+ P +
Sbjct  31    LMELKSSLDPENNLLKSWTFN-GDPCD-GSFEGIACNQHLKVANISLQGKRLTGKLSPAV  88

Query  2018  GQLNGLSGLYLHFNNLHGVIPKEIASLTQLSDLYLNMNDLSGFIPSEIGNMPNLQVLQLC  1839
              +L  LSGLYLH+N+L G IP+EI +LT+LSDLYLN+N+ SG IP+ IG+M  LQV+ LC
Sbjct  89    AELKCLSGLYLHYNSLSGEIPQEITNLTELSDLYLNVNNFSGEIPAGIGSMVGLQVMDLC  148

Query  1838  YNRFEGCIPNKLGSLKNLTVLALQSNQLTGAIPASlggltlltrldLSFNRLFGSIPVKL  1659
              N   G IP  +GSLK L+VL+LQ N+LTG +P SLG L+ L+R+DLSFN L G+IP  L
Sbjct  149   CNSLAGKIPKSIGSLKKLSVLSLQHNKLTGEVPWSLGNLSTLSRIDLSFNDLSGTIPKTL  208

Query  1658  SEASKLEVLDLRNNTLSGNVPLGLKRLNEGFRYENNPGLCGTGFPSLALCS---DSSLNP  1488
             +   +LE LDLRNNTLSG VP GL++LNE F++ENN GLCG  FPSL  CS   DS++  
Sbjct  209   ANIPQLETLDLRNNTLSGFVPPGLEKLNERFQFENNAGLCGIDFPSLRACSAFDDSTIEV  268

Query  1487  TKPEPFGQGSNRLPTKDIPESANIPHQLNQN--RKPQA----AAAVVGVIGLFVILAVAG  1326
              +P+   + +++    +I +S  +    NQ    KP +     A +  VI + + L  AG
Sbjct  269   KQPQG-EKDTDKSTLHNISDSVYLKSHCNQTHCHKPSSKLPQVALISSVITVTITLFGAG  327

Query  1325  LFTFSWYRRRKQQIGSTVDISESRVSTDQPKVLCRRSTSPLISLEYSNGWDPLAKDQSGS  1146
             L T   YRRRKQ+I +T +ISE R+STDQ K       SPL+SL Y+  WDPL   ++G+
Sbjct  328   LLTLLRYRRRKQKISNTAEISEGRLSTDQQKDF---RASPLMSLAYTKEWDPLGDSRNGA  384

Query  1145  ALSQE------VLESFMFNLDEVESATQYFSETNLLGKSSFSAVYKGTLRDGSAVAVKCI  984
               SQE      V  SF FNL+EVESATQ FSE NLL ++SF++V+KG LRDGS VA++ I
Sbjct  385   EFSQEPHHLFVVNSSFRFNLEEVESATQCFSEANLLSRNSFTSVFKGVLRDGSLVAIRSI  444

Query  983   SKTSCKSDEAEFRKGLTLLTSLKHENLLRLRGFCCSKGRGECFLIYDFVSNGNLLRYLDV  804
             + +SCK++E EF  GL LL+S+ HENL++LRGFCCS+GRGECFLIYDF S G L R+LD+
Sbjct  445   NISSCKNEEVEFMNGLKLLSSMSHENLVKLRGFCCSRGRGECFLIYDFASKGKLSRFLDL  504

Query  803   KD-EKGKVLDWSTRTAIIKGIARGIKYLHG-NKRNKPALVHRNISADKVLIDHLYKPLLS  630
             ++ E G+VL W  R  IIKGIA+GI YLHG ++  K A+VHRNIS +K+L+D  + PL++
Sbjct  505   QESETGRVLAWPARVFIIKGIAKGIAYLHGSDQEKKHAIVHRNISVEKILLDEQFNPLIA  564

Query  629   DSGLHKLLADDIVFSTLKGSAANGYLAPEYAITGRFTEKSDMYAFGVIILQILSGSCVVT  450
             DSGLH LLADD+VFS LK SAA GYLAPEY  TGRFTEK+D++AFGVIILQILSG  ++T
Sbjct  565   DSGLHNLLADDLVFSALKTSAAMGYLAPEYVTTGRFTEKTDVFAFGVIILQILSGKLMLT  624

Query  449   QSNHQGAELCRFEDFVDAKLGKDFVESEAAKLGKIALLCTHDSPSRRPAIDVVIQ  285
              S    AE      F+D  LG+ F  +EA  L ++ + CT + P+ RP I+ +++
Sbjct  625   SSLRIAAENGEHCGFIDEHLGEGFDITEAVALARMGISCTQEIPNNRPNIESLLR  679



>ref|NP_001060863.1| Os08g0117700 [Oryza sativa Japonica Group]
 dbj|BAD33103.1| putative SERK1 protein [Oryza sativa Japonica Group]
 dbj|BAF22777.1| Os08g0117700 [Oryza sativa Japonica Group]
 gb|EAZ05404.1| hypothetical protein OsI_27613 [Oryza sativa Indica Group]
Length=702

 Score =   630 bits (1624),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 351/671 (52%), Positives = 454/671 (68%), Gaps = 47/671 (7%)
 Frame = -3

Query  2207  VSLLMAIKASLDPGNLVLSSWSPNVTDPCSVSS-FEGIACNDLGQVVNISLQGKGLYGKI  2031
             V  LM +KA+LDP   +L SW+    DPC     FEG++C+  G+V  +SLQGKGL G I
Sbjct  43    VDALMELKAALDPSGRLLPSWARG-GDPCGRGDYFEGVSCDARGRVAAVSLQGKGLAGAI  101

Query  2030  PPEIGQLNGLSGLYLHFNNLHGVIPKEIASLTQLSDLYLNMNDLSGFIPSEIGNMPNLQV  1851
              P +  L GL+GLYLH+N L G IP+++  L  L++LYL +N+LSG IP E+G +P LQV
Sbjct  102   SPAVAMLPGLTGLYLHYNELAGAIPRQLGDLPMLAELYLGVNNLSGTIPVELGRLPALQV  161

Query  1850  LQLCYNRFEGCIPNKLGSLKNLTVLALQSNQLTGAIPASlggltlltrldLSFNRLFGSI  1671
             LQL YN+  G IP +LG LK LTVLALQSNQLTGAIPASLG L  L RLDLS NRLFGSI
Sbjct  162   LQLGYNQLSGSIPTQLGQLKKLTVLALQSNQLTGAIPASLGDLPELARLDLSSNRLFGSI  221

Query  1670  PVKLSEASKLEVLDLRNNTLSGNVPLGLKRLNEGFRYENNPGLCGTGFPSLALCSDSSLN  1491
             P KL+   KL  LDLRNNTLSG+VP GLK+LNEGF ++NN  LCG  F SL  C++    
Sbjct  222   PSKLAAIPKLATLDLRNNTLSGSVPSGLKKLNEGFHFDNNSELCGAHFDSLKPCANGD--  279

Query  1490  PTKPEPFGQGSNRLPTKDIPESANI-----PHQLNQNRK---------------PQAAAA  1371
                 E   +  +++  K  PES N+     P  +N NR                  + A 
Sbjct  280   ----EDDNEEGSKMARK--PESTNVKPLQAPQTMNVNRDCDNGGCSRSSSSSTTLSSGAI  333

Query  1370  VVGVIGLFVILAVAGLFTFSWYRRRKQQI--GSTVDISESRVSTDQPKVLCRRSTSPLIS  1197
             + G I +    A  G+   SW RR+KQ++  G TV+  E R S+         ++S LI+
Sbjct  334   LAGTIIIIGGAAACGISVISWRRRQKQKVGGGGTVESLEGRASSSN-------ASSSLIN  386

Query  1196  LEYSNGWDPLAK-DQSGSALSQEVLESFMFNLDEVESATQYFSETNLLGKSSFSAVYKGT  1020
             +EYS+GWD  ++  Q G  LS E   S  +N++EVE ATQYF+  NLLG+S F+A Y+G 
Sbjct  387   VEYSSGWDTSSEGSQQGLRLSPEWSPSVRYNMEEVECATQYFAGANLLGRSGFAATYRGA  446

Query  1019  LRDGSAVAVKCISKTSCKSDEAEFRKGLTLLTSLKHENLLRLRGFCCSKGRGECFLIYDF  840
             +RDG+AVAVK I K+SCK++EA+F +GL  +TSL+H+NL+ LRGFC S+ RGECFL+Y+F
Sbjct  447   MRDGAAVAVKSIGKSSCKAEEADFLRGLRAITSLRHDNLVALRGFCRSRARGECFLVYEF  506

Query  839   VSNGNLLRYLDVKDEKGKVLDWSTRTAIIKGIARGIKYLHGNKRNKPALVHRNISADKVL  660
             ++NG+L RYLDVKD    VLDW+TR +IIKGIA+GI+YLH +K NK ALVH+NI ADK+L
Sbjct  507   MANGSLSRYLDVKDGD-VVLDWATRVSIIKGIAKGIEYLHSSKANKAALVHQNICADKIL  565

Query  659   IDHLYKPLLSDSGLHKLLADDIVFSTLKGSAANGYLAPEYAITGRFTEKSDMYAFGVIIL  480
             +DHL+ P LS +G HKLLADD+VFSTLK SAA GYLAPEY  TGRFT++SD+YAFGV++ 
Sbjct  566   MDHLFVPHLSGAGEHKLLADDVVFSTLKDSAAMGYLAPEYTTTGRFTDRSDVYAFGVVVF  625

Query  479   QILSGSCVVTQS-----NHQGAELC-RFEDFVDAKLGKDFVESEAAKLGKIALLCTHDSP  318
             Q+L+G   V+          GAE   + +D VD +LG  F   EAAKL  IALLCT +SP
Sbjct  626   QVLTGRKAVSSELRLLGGGGGAEYSGKLDDLVDPRLGGRFSRPEAAKLAGIALLCTSESP  685

Query  317   SRRPAIDVVIQ  285
             ++RPA+  V+Q
Sbjct  686   AQRPAMAAVLQ  696



>ref|NP_001043393.1| Os01g0577600 [Oryza sativa Japonica Group]
 dbj|BAB32930.1| extra sporogenous cells-like [Oryza sativa Japonica Group]
 dbj|BAB91809.1| extra sporogenous cells-like [Oryza sativa Japonica Group]
 dbj|BAF05307.1| Os01g0577600 [Oryza sativa Japonica Group]
 gb|EAY74647.1| hypothetical protein OsI_02539 [Oryza sativa Indica Group]
 gb|EAZ12433.1| hypothetical protein OsJ_02327 [Oryza sativa Japonica Group]
Length=689

 Score =   629 bits (1622),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 354/660 (54%), Positives = 458/660 (69%), Gaps = 27/660 (4%)
 Frame = -3

Query  2207  VSLLMAIKASLDPGNLVLSSWSPNVTDPCSVSSFEG---IACND-LGQVVNISLQGKGLY  2040
             V  L+ + A LDP   +L SW+P   DPC      G   +AC+   G V N+SLQGKGL 
Sbjct  33    VRALLDLAAGLDPTGRLLPSWAPG-RDPCGREGGGGFEGVACDGATGAVANVSLQGKGLA  91

Query  2039  GKIPPEIGQLNGLSGLYLHFNNLHGVIPKEIASLTQLSDLYLNMNDLSGFIPSEIGNMPN  1860
             G +PP +  L  L+GLYLH+N L G +P+E+A+L++L+DLYLN+N+ SG IP EI  MP+
Sbjct  92    GTLPPAVAGLTALTGLYLHYNRLTGALPRELAALSRLTDLYLNVNNFSGPIPPEIAAMPS  151

Query  1859  LQVLQLCYNRFEGCIPNKLGSLKNLTVLALQSNQLTGAIPASlggltlltrldLSFNRLF  1680
             LQV+QLCYN+  G +P +LG LK LTVL LQSN L+GAIPASLG L  L RLDLSFN LF
Sbjct  152   LQVVQLCYNQLTGGVPTQLGLLKRLTVLELQSNHLSGAIPASLGDLPQLVRLDLSFNNLF  211

Query  1679  GSIPVKLSEASKLEVLDLRNNTLSGNVPLGLKRLNEGFRYENNPGLCGTGFPSLALCSDS  1500
             GSIPV+L+   +L  LD+RNNTL+G+VP  L +L  GF+Y NN  LCGTG P+L  C+ +
Sbjct  212   GSIPVRLALLPRLLALDVRNNTLTGSVPSELAKLQGGFQYANNTDLCGTGLPALRPCTPA  271

Query  1499  SL-NPTKPEPFGQGSNRLPTKDIPESANIPH-QLNQNRKPQAAAAVVGVIGLFVILAV--  1332
              L +P  P+PF  G   +  +  P S++  H        P +  A+  V+ + VIL    
Sbjct  272   DLISPDMPQPFSAG---ISPQITPGSSSDGHGHCTGTHCPPSTKALAAVVVVAVILLAVT  328

Query  1331  -AGLFTFSWYRRRKQQI--GSTVDISESRVSTDQP-KVLCRRS-TSPLISLEYSNGWDPL  1167
              AG+F  SWYR RKQ++  GS   +   R STD   K   R+S +S L+SLEYSNGWDPL
Sbjct  329   GAGMFALSWYRWRKQRVVAGSPAAVG-GRCSTDAAGKDSFRKSASSTLVSLEYSNGWDPL  387

Query  1166  AKDQSGSALSQEVLESFMFNLDEVESATQYFSETNLLGKS-SFSAVYKGTLRDGSAVAVK  990
             A  + G   SQEV +SF FN+++VESATQYFSE N+LGK+ +F+A Y+GTLRDG++V VK
Sbjct  388   ADGRGGIGFSQEVAQSFRFNMEDVESATQYFSELNILGKNGNFAATYRGTLRDGTSVVVK  447

Query  989   CISKTSCKSDEAEFRKGLTLLTSLKHENLLRLRGFCCSKGRGECFLIYDFVSNGNLLRYL  810
              + KT CK +EAEF KGL LL  L+HEN++ LRGFCCS+ RGECFL+YDFV NG+L ++L
Sbjct  448   RLGKTCCKQEEAEFLKGLKLLAELQHENIVGLRGFCCSRARGECFLVYDFVPNGSLSQFL  507

Query  809   DVKDE-----KGKVLDWSTRTAIIKGIARGIKYLHGNKRNKPALVHRNISADKVLIDHLY  645
             D+  +      G+VL+WSTR +II+GIA+GI+YLH  + NKP LVH+NISADKVL+D+ Y
Sbjct  508   DIDADDVARSNGRVLEWSTRISIIRGIAKGIEYLHSTRANKPPLVHQNISADKVLVDYTY  567

Query  644   KPLLSDSGLHKLLADDIVFSTLKGSAANGYLAPEYAITGRFTEKSDMYAFGVIILQILSG  465
             +PL+S SGLHKLL DD+VFSTLK SAA GYLAPEY  TGRF+EKSD+YAFGVI+ QIL+G
Sbjct  568   RPLISGSGLHKLLVDDLVFSTLKASAAMGYLAPEYTTTGRFSEKSDVYAFGVIVFQILTG  627

Query  464   SCVVTQSNHQGAELCRFEDFVDAKLGKDFVESEAAKLGKIALLCTHDSPSRRPAIDVVIQ  285
                + Q      E    ED +D  L   +  +EAAKL KIA  CT ++P  RP ++ +IQ
Sbjct  628   KSKIMQLP---LESSNDEDLIDGNLRGCYSAAEAAKLAKIASACTSENPDHRPTMEELIQ  684



>ref|XP_010439303.1| PREDICTED: somatic embryogenesis receptor kinase 4 [Camelina 
sativa]
Length=688

 Score =   622 bits (1604),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 338/656 (52%), Positives = 453/656 (69%), Gaps = 25/656 (4%)
 Frame = -3

Query  2198  LMAIKASLDPGNLVLSSWSPNVTDPCSVSSFEGIACNDLGQVVNISLQGKGLYGKIPPEI  2019
             LM +K+SLDP N +L SW+ N  DPC   SFEGIACN   +V NISLQGK L GK+ P +
Sbjct  31    LMELKSSLDPENKLLRSWTFN-GDPCD-GSFEGIACNQHLKVANISLQGKRLTGKLSPAV  88

Query  2018  GQLNGLSGLYLHFNNLHGVIPKEIASLTQLSDLYLNMNDLSGFIPSEIGNMPNLQVLQLC  1839
              +L  LSGLYLH+N+L G IP+EI +LT+LSDLYLN+N+ SG IP+ IG+M  LQV+ LC
Sbjct  89    AELKCLSGLYLHYNSLSGEIPQEITNLTELSDLYLNVNNFSGEIPAAIGSMTGLQVMDLC  148

Query  1838  YNRFEGCIPNKLGSLKNLTVLALQSNQLTGAIPASlggltlltrldLSFNRLFGSIPVKL  1659
              N   G IPN +GSLK L VL+LQ N+LTG +P SLG L++L+RLDLSFN L G IP  L
Sbjct  149   CNSLTGKIPNNIGSLKKLNVLSLQHNKLTGEVPWSLGNLSMLSRLDLSFNSLLGLIPKTL  208

Query  1658  SEASKLEVLDLRNNTLSGNVPLGLKRLNEGFRYENNPGLCGTGFPSLALCS---DSSLNP  1488
             +   +L+ LDLRNNTLSG VP GLK+L+  F++ENN GL G  FPSL  CS   ++++  
Sbjct  209   ANIPQLDTLDLRNNTLSGFVPPGLKKLSGRFQFENNTGLYGIDFPSLRACSAFNEANIEF  268

Query  1487  TKPEPFGQGSNRLPTKDIPESANIPHQLNQ-------NRKPQAAAAVVGVIGLFVILAVA  1329
              +P P    +++    +I ES  +    NQ       ++ PQ  A +  VI + + L  A
Sbjct  269   KQP-PGETDTDKTSLHNISESVYLQKHCNQTHCHKSSSKLPQ-VALISSVITVSITLIGA  326

Query  1328  GLFTFSWYRRRKQQIGSTVDISESRVSTDQPKVLCRRSTSPLISLEYSNGWDPLAKDQSG  1149
              + TF  YRRRKQ+I +T + SE R+STDQ K L     SPL+SL Y+  WDPL   ++G
Sbjct  327   AILTFFRYRRRKQKISNTPEFSEGRLSTDQQKDL---RASPLVSLAYTKEWDPLGDSRNG  383

Query  1148  SALSQE------VLESFMFNLDEVESATQYFSETNLLGKSSFSAVYKGTLRDGSAVAVKC  987
             +  SQ+      V  SF FNL+++ESATQ FSE NL+ ++SF++V+KG LRDGS VA++ 
Sbjct  384   AEFSQQEPHLFVVNSSFRFNLEDIESATQCFSEANLMSRNSFTSVFKGVLRDGSPVAIRS  443

Query  986   ISKTSCKSDEAEFRKGLTLLTSLKHENLLRLRGFCCSKGRGECFLIYDFVSNGNLLRYLD  807
             I+ +SCK++E EF  GL LL+SL HENL++LRGFCCS+GRGECFLIYDF S G L  +LD
Sbjct  444   INISSCKNEEVEFMNGLKLLSSLSHENLVKLRGFCCSRGRGECFLIYDFASKGKLSNFLD  503

Query  806   VKD-EKGKVLDWSTRTAIIKGIARGIKYLHG-NKRNKPALVHRNISADKVLIDHLYKPLL  633
             +++ E  ++L W  R +I+KGIA+GI YLHG +++ K   +HRNIS +K+L+D    PL+
Sbjct  504   LQEKETNQILAWPARISIMKGIAKGIAYLHGSDQQKKHTTIHRNISVEKILLDEQLNPLI  563

Query  632   SDSGLHKLLADDIVFSTLKGSAANGYLAPEYAITGRFTEKSDMYAFGVIILQILSGSCVV  453
             +DSGLH LLADD+VFS LK SAA GYLAPEY  TG+FTEK+D++AFGVIILQI+SG  ++
Sbjct  564   ADSGLHNLLADDMVFSALKTSAAMGYLAPEYVTTGKFTEKTDVFAFGVIILQIISGKLML  623

Query  452   TQSNHQGAELCRFEDFVDAKLGKDFVESEAAKLGKIALLCTHDSPSRRPAIDVVIQ  285
             T S    AE      F+D  L  +F + EA  + +I + CT + P+ RP ++ ++Q
Sbjct  624   TTSLRLAAEDGEVNGFIDEYLRGEFDKQEAVAMARIGISCTQEIPNNRPNMETLLQ  679



>ref|XP_008660396.1| PREDICTED: somatic embryogenesis receptor kinase 2-like [Zea 
mays]
 gb|AFW89180.1| putative leucine-rich repeat protein kinase family protein [Zea 
mays]
Length=693

 Score =   621 bits (1602),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 356/670 (53%), Positives = 456/670 (68%), Gaps = 47/670 (7%)
 Frame = -3

Query  2198  LMAIKASLDPGNLVLSSWSPNVTDPCSVSS-FEGIACNDLGQVVNISLQGKGLYGKIPPE  2022
             LM +KA+LDP    L+SW+    DPC     FEG+AC+  G+V  ISLQGKGL G +PP 
Sbjct  32    LMELKAALDPAGRALASWARG-GDPCGRGDYFEGVACDARGRVATISLQGKGLAGAVPPA  90

Query  2021  IGQLNGLSGLYLHFNNLHGVIPKEIASLTQLSDLYLNMNDLSGFIPSEIGNMPNLQVLQL  1842
             +  L  L+GLYLH+N L G IP+E+ +L  L++LYL +N+LSG IP E+G + +LQVLQL
Sbjct  91    LAMLPALTGLYLHYNALRGEIPRELGALPGLAELYLGVNNLSGPIPVELGRLGSLQVLQL  150

Query  1841  CYNRFEGCIPNKLGSLKNLTVLALQSNQLTGAIPASlggltlltrldLSFNRLFGSIPVK  1662
              YN+  G IP +LG L  LTVLALQSNQL+GAIPASLG L  L RLDLS N+LFGSIP K
Sbjct  151   GYNQLTGSIPTQLGHLNKLTVLALQSNQLSGAIPASLGDLPALARLDLSSNQLFGSIPSK  210

Query  1661  LSEASKLEVLDLRNNTLSGNVPLGLKRLNEGFRYENNPGLCGTGFPSLALC----SDSSL  1494
             L+E  +L  LDLRNNTLSG+VP GLK+LNEGF YENNP LCG  F SL  C    +D   
Sbjct  211   LAEIPRLATLDLRNNTLSGSVPSGLKKLNEGFLYENNPELCGAQFDSLKACPNDGNDDGR  270

Query  1493  NPTKPEPFGQGSNRLPTKDIPESANIPHQLNQN------RKPQAAAAVVGVIGLFVILAV  1332
              P KPE     S  +  + I ++A+    LN+N       KP   +    V G  VI+A 
Sbjct  271   TPRKPE-----STSVKPQQIQKTAD----LNRNCGDGGCSKPSTLSTGAVVAGTVVIVAG  321

Query  1331  A---GLFTFSWYRRRKQQIG-STVDISESRVSTDQPKVLCRRST-SPLISLEYSN-GWDP  1170
             A   GL  FSW+RR+KQ++G S+V+  E R S D+ K   +RS  S L+++EYS+ GWD 
Sbjct  322   AAACGLSAFSWHRRQKQKVGSSSVEHLEGRPSLDRSKEAYQRSAVSSLMNVEYSSGGWDT  381

Query  1169  L---AKDQSGSALSQEVLES-----FMFNLDEVESATQYFSETNLLGKSSFSAVYKGTLR  1014
                 ++ Q G A      E        FNL+EVE ATQYFS+ NL+GKS F+A YKG LR
Sbjct  382   SSEGSQSQHGVARLSSSTEGGSPSVRSFNLEEVECATQYFSDANLIGKSGFAATYKGVLR  441

Query  1013  DGSAVAVKCISKTSCKSDEAEFRKGLTLLTSLKHENLLRLRGFCCSKGRGECFLIYDFVS  834
             DG+AVAVK ISK SCKS+EA+F +GL  LTSL+HENL+ LRGFC S+  G CFL+Y+F++
Sbjct  442   DGTAVAVKSISKNSCKSEEADFLRGLRTLTSLRHENLVGLRGFCRSRASGGCFLVYEFMA  501

Query  833   NGNLLRYLDVKD----EKGKVLDWSTRTAIIKGIARGIKYLHGNKRNKPALVHRNISADK  666
             NG+L RYLD K+    +   VLDW TR +IIKG+A+GI+YLH +K     L H++ISADK
Sbjct  502   NGSLSRYLDAKEGDAADAAAVLDWPTRVSIIKGVAKGIEYLHSSK-----LAHQSISADK  556

Query  665   VLIDHLYKPLLSDSGLHKLLADDIVFSTLKGSAANGYLAPEYAITGRFTEKS-DMYAFGV  489
             VL+DHLY P LS +GLH+LLADD+VF+ LK SAA GYLAPEYA TGR T+K  D+YAFGV
Sbjct  557   VLLDHLYAPRLSGAGLHRLLADDVVFAALKDSAAMGYLAPEYATTGRSTDKQGDVYAFGV  616

Query  488   IILQILSGSCVVTQSNHQ--GAELCRFEDFVDAKLGKDFVESEAAKLGKIALLCTHDSPS  315
             ++LQ+L+G   V+  + Q  G    R +D VD +L   F  +EAAKL  +ALLCT ++P+
Sbjct  617   VVLQVLAGRRAVSPPHLQQGGGGGGRLDDLVDPRLRGRFSRAEAAKLAGVALLCTAEAPA  676

Query  314   RRPAIDVVIQ  285
             +RP +  V+Q
Sbjct  677   QRPTMTAVLQ  686



>ref|XP_003550887.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g63930-like [Glycine max]
 gb|KHN09757.1| Protein NSP-INTERACTING KINASE 2 [Glycine soja]
Length=685

 Score =   618 bits (1594),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 338/645 (52%), Positives = 440/645 (68%), Gaps = 10/645 (2%)
 Frame = -3

Query  2198  LMAIKASLDPGNLVLSSWSPNVTDPCSVSSFEGIACNDLGQVVNISLQGKGLYGKIPPEI  2019
             LM +K+SLDP + +L SW  +  DPCS  SF G+ CN+  +V NISL G+GL G + P +
Sbjct  31    LMDLKSSLDPQDKLLGSWISD-GDPCS-GSFLGVVCNEHNKVANISLPGRGLSGVVSPAV  88

Query  2018  GQLNGLSGLYLHFNNLHGVIPKEIASLTQLSDLYLNMNDLSGFIPSEIGNMPNLQVLQLC  1839
              +L  LSGLYLH+N L G IP+EI +L +L DLYLN N+LSG IP +I NM +LQVLQL 
Sbjct  89    AELKCLSGLYLHYNYLSGDIPREIVNLKELLDLYLNFNNLSGTIPPDIANMTSLQVLQLG  148

Query  1838  YNRFEGCIPNKLGSLKNLTVLALQSNQLTGAIPASlggltlltrldLSFNRLFGSIPVKL  1659
             YN+ EG IP +LGSLK L  ++LQ N+L G IP SLG L  L RL LS+N   G+IP  L
Sbjct  149   YNQLEGNIPEELGSLKQLNDISLQHNKLAGQIPQSLGSLEKLRRLYLSYNNFNGTIPAAL  208

Query  1658  SEASKLEVLDLRNNTLSGNVPLGLKRLNEGFRYENNPGLCGTGFPSLALCS-DSSLNPTK  1482
             ++ + LE+LD++NN+LSG VP  L+RL EGF+  NN GLCG GF +L  C+ D+    ++
Sbjct  209   ADIANLEILDIQNNSLSGTVPSALQRLREGFQGANNQGLCGDGFSTLKACNKDTIFGVSQ  268

Query  1481  PEPFGQGSNRLPTKDIPESANIPHQLNQ-----NRKPQAAAAVVGVIGLFVILAVAGLFT  1317
                     NR+P    P+  N     NQ     +R          V    + L  +GLF 
Sbjct  269   ISAPNISINRIPPITFPKPVNTHLHCNQTPCSKSRSFLHLVIAASVTTTVITLISSGLFI  328

Query  1316  FSWYRRRKQQIGSTVDISESRVSTDQPKVLCRRSTSPLISLEYS-NGWDPLAKDQSGSAL  1140
             F  YRR++Q++ +T D SE + S  QPK    RS+SPL++LEY  +GWD LA  Q+ S L
Sbjct  329   FVRYRRQRQRVRNTSDYSEGQRSPYQPKEF-YRSSSPLVNLEYYYDGWDSLADGQNESGL  387

Query  1139  SQEVLESFMFNLDEVESATQYFSETNLLGKSSFSAVYKGTLRDGSAVAVKCISKTSCKSD  960
             S E L  F FN+DE+ESATQ+ SE NLL KS FSAVYKG  RDGS VA+  IS T CK++
Sbjct  388   SLEYLNRFRFNIDEIESATQHLSEANLLSKSKFSAVYKGVHRDGSLVAIISISVTCCKTE  447

Query  959   EAEFRKGLTLLTSLKHENLLRLRGFCCSKGRGECFLIYDFVSNGNLLRYLDVKDEKGKVL  780
             E EF KGL+LLTSL+HEN++++RGFC S+ RGE F +YDF + GNL +YLD +D    V+
Sbjct  448   EGEFLKGLSLLTSLRHENIVKMRGFCYSRSRGEWFFVYDFATRGNLSQYLDKEDGSDHVI  507

Query  779   DWSTRTAIIKGIARGIKYLHGNKRNKPALVHRNISADKVLIDHLYKPLLSDSGLHKLLAD  600
             +WS R +IIKGIA+GI YLH N+ +KP +VH+NIS +KV++DH + PL++D+GL KLLAD
Sbjct  508   EWSKRVSIIKGIAKGIGYLHNNEASKPIIVHQNISVEKVILDHEFNPLITDAGLPKLLAD  567

Query  599   DIVFSTLKGSAANGYLAPEYAITGRFTEKSDMYAFGVIILQILSGSCVVTQSNHQGAELC  420
             D+VFS LK SAA GYLAPEY  TGRFTEKSD+YAFGVI+LQ+LSG  ++  S  +  E  
Sbjct  568   DVVFSALKASAAMGYLAPEYITTGRFTEKSDIYAFGVIVLQVLSGKALIGGSIREAVEAF  627

Query  419   RFEDFVDAKLGKDFVESEAAKLGKIALLCTHDSPSRRPAIDVVIQ  285
             RFEDFVD  L   + +SEAA L K+A+ CT + P +RP +  VIQ
Sbjct  628   RFEDFVDTNLKGAYSKSEAAILSKLAIQCTLEVPEQRPTMVEVIQ  672



>ref|XP_008232646.1| PREDICTED: putative receptor-like protein kinase At4g00960 isoform 
X2 [Prunus mume]
Length=473

 Score =   610 bits (1573),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 305/466 (65%), Positives = 365/466 (78%), Gaps = 15/466 (3%)
 Frame = -3

Query  1643  LEVLDLRNNTLSGNVPLGLKRLNEGFRYENNPGLCGTGFPSLALCSDSSL-NPTKPEPFG  1467
             L+VLD+R+N+LSGN+P  LKRLN GF+YENNP LCG GF  L +C+ ++  NP KP+PF 
Sbjct  2     LQVLDVRSNSLSGNIPPDLKRLNGGFQYENNPSLCGVGFSGLKVCTATTTRNPNKPQPFE  61

Query  1466  QG---SNRLP----TKDIPESANIPHQLNQNR-----KPQAAAAVVGVIGLFVILAVAGL  1323
              G   +  LP     ++IPESAN+    +Q       K Q    V GVIG+   LAV+GL
Sbjct  62    PGNFTAKNLPDSPTAREIPESANLESNCSQTHCSRASKSQQIGIVFGVIGVIAALAVSGL  121

Query  1322  FTFSWYRRRKQQIGSTVDISESRVSTDQPKVLCRRSTSPLISLEYSNGWDPLAKDQSGSA  1143
             FTFSWYRRRKQ+IGST+D S+SR+STDQ K + +++ SPLI+LEYSNGWDPLAK  +G  
Sbjct  122   FTFSWYRRRKQKIGSTLDTSDSRLSTDQAKEVYKKNASPLINLEYSNGWDPLAKGSAG--  179

Query  1142  LSQEVLESFMFNLDEVESATQYFSETNLLGKSSFSAVYKGTLRDGSAVAVKCISKTSCKS  963
              SQEVLESFMFNL+EVE ATQ FSE NLL KS+FSA+YKG +RDGS VA+ CISKTSCK 
Sbjct  180   YSQEVLESFMFNLEEVERATQSFSEGNLLRKSNFSAIYKGIIRDGSVVAINCISKTSCKP  239

Query  962   DEAEFRKGLTLLTSLKHENLLRLRGFCCSKGRGECFLIYDFVSNGNLLRYLDVKDEKGKV  783
             DEAEF KGL +L SLKHENL+RLRGFCCSKGRGE FLIYDFV N +LL+YLD+K   G++
Sbjct  240   DEAEFLKGLKILPSLKHENLVRLRGFCCSKGRGEWFLIYDFVPNESLLQYLDIKVGSGEI  299

Query  782   LDWSTRTAIIKGIARGIKYLHGNKRNKPALVHRNISADKVLIDHLYKPLLSDSGLHKLLA  603
             L+WSTR +II GIA+GI YLHG+  NKPA+VH+ ISA+KVLID  Y PLLSDSGLHKLLA
Sbjct  300   LEWSTRVSIITGIAKGIGYLHGSMGNKPAIVHQTISAEKVLIDSHYNPLLSDSGLHKLLA  359

Query  602   DDIVFSTLKGSAANGYLAPEYAITGRFTEKSDMYAFGVIILQILSGSCVVTQSNHQGAEL  423
             DDIVFS LK SAA GYLAPEY ITGRFT KSD+YAFG+I+ QILSG   +TQ N QGAE 
Sbjct  360   DDIVFSMLKASAAMGYLAPEYTITGRFTAKSDIYAFGMIVFQILSGKRKITQVNRQGAEA  419

Query  422   CRFEDFVDAKLGKDFVESEAAKLGKIALLCTHDSPSRRPAIDVVIQ  285
              RFEDF+DA L  +F ESEA KLG++ALLCT +SPS RP+I+ V++
Sbjct  420   GRFEDFIDANLEGNFSESEATKLGRLALLCTQESPSYRPSIENVVK  465



>ref|XP_008647994.1| PREDICTED: uncharacterized protein LOC100304214 isoform X1 [Zea 
mays]
 gb|AFW74369.1| putative leucine-rich repeat protein kinase family protein [Zea 
mays]
Length=691

 Score =   614 bits (1583),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 355/664 (53%), Positives = 458/664 (69%), Gaps = 36/664 (5%)
 Frame = -3

Query  2198  LMAIKASLDPGNLVLSSWSPNVTDPCSVSS-FEGIACNDLGQVVNISLQGKGLYGKIPPE  2022
             LM +KA+LDP    L+SW+    DPC     FEG+AC+  G+V  ISLQGKGL G +PP 
Sbjct  32    LMELKAALDPAGRALASWARG-GDPCGRGDYFEGVACDARGRVATISLQGKGLAGAVPPA  90

Query  2021  IGQLNGLSGLYLHFNNLHGVIPKEIASLTQLSDLYLNMNDLSGFIPSEIGNMPNLQVLQL  1842
             +  L  L+GLYLH+N L G IP+E+A+L  L++LYL +N+LSG +P+E+G + +LQVLQL
Sbjct  91    VAMLPALTGLYLHYNALRGEIPRELAALPGLAELYLGVNNLSGPVPAELGRLGSLQVLQL  150

Query  1841  CYNRFEGCIPNKLGSLKNLTVLALQSNQLTGAIPASlggltlltrldLSFNRLFGSIPVK  1662
              YN+  G IP +LG L  LTVLALQSNQL+GAIPASLG L  L RLDLS N+LFGSIP K
Sbjct  151   GYNQLTGSIPTQLGQLNKLTVLALQSNQLSGAIPASLGDLPALARLDLSSNQLFGSIPSK  210

Query  1661  LSEASKLEVLDLRNNTLSGNVPLGLKRLNEGFRYENNPGLCGTGFPSLALC----SDSSL  1494
             L+E  +L  LDLRNNTLSG+VP GLK+LNEGF YENNP LCG  F SL  C    +D   
Sbjct  211   LAEIPRLATLDLRNNTLSGSVPSGLKKLNEGFLYENNPELCGAQFDSLKACPNDGNDDGR  270

Query  1493  NPTKPEPFGQGSNRLPTKDIPESANIPHQLNQNR---KPQAAAAVVGVIGLFVILAVA--  1329
              P KPE     ++ +  + I ++A++      +    KP        V G FVI+A A  
Sbjct  271   TPRKPE----STSVIKPQQIQKAADLNRNCGDDGGCLKPSTLPTGAVVAGTFVIVAGAAA  326

Query  1328  -GLFTFSWYRRRKQQIG-STVDISESRVSTDQPKVLCRRST-SPLISLEYSN-GWDPL--  1167
              GL  FSW+RR+KQ+IG S+V+  E R S D+ K    RS  S LI++EYS+ GWD    
Sbjct  327   CGLSAFSWHRRQKQKIGSSSVEHLEGRPSLDRSKEAYERSAVSSLINVEYSSGGWDTSSE  386

Query  1166  -AKDQSGSALSQEVLE----SFMFNLDEVESATQYFSETNLLGKSSFSAVYKGTLRDGSA  1002
              ++ Q G A      E    S  FNL+EVE ATQYFS+ NLLGKSSF+A YKG +RDG+A
Sbjct  387   GSQSQHGVARLSSAAECGSPSVRFNLEEVECATQYFSDVNLLGKSSFAATYKGVMRDGTA  446

Query  1001  VAVKCISKTSCKSDEAEFRKGLTLLTSLKHENLLRLRGFCCSKGRGECFLIYDFVSNGNL  822
             VAVK ISK+SCKS+EA+F +GL  LTSL+HENL+ L+GFC S+  G CFL+Y+F++NG+L
Sbjct  447   VAVKSISKSSCKSEEADFLRGLRALTSLRHENLVGLKGFCRSRASGGCFLVYEFMTNGSL  506

Query  821   LRYLDVKDE----KGKVLDWSTRTAIIKGIARGIKYLHGNKRNKPALVHRNISADKVLID  654
              RYLD K+        VLDW TR +IIKG+A+GI+YLH +K     L H++ISADKVL+D
Sbjct  507   SRYLDAKESDAADAAAVLDWPTRVSIIKGVAKGIEYLHSSK-----LAHQSISADKVLLD  561

Query  653   HLYKPLLSDSGLHKLLADDIVFSTLKGSAANGYLAPEYAITGRFTEKS-DMYAFGVIILQ  477
             HL+ P LS +GLH+LLADD+VF+ LK SAA GYLAPEYA TGR T+K  D+YAFGV++LQ
Sbjct  562   HLHAPRLSGAGLHRLLADDVVFAALKDSAAMGYLAPEYATTGRSTDKQGDVYAFGVVVLQ  621

Query  476   ILSGSCVVTQSNHQGAELCRFEDFVDAKLGKDFVESEAAKLGKIALLCTHDSPSRRPAID  297
             +L+G   V+  + Q     R +D VD +L   F  +EAAKL  +ALLCT ++P++RPA+ 
Sbjct  622   VLAGRRAVSPPHLQQDGGGRLDDLVDPRLRGRFSRAEAAKLAGVALLCTAEAPAQRPAMA  681

Query  296   VVIQ  285
              V+Q
Sbjct  682   AVLQ  685



>gb|EMT04404.1| Leucine-rich repeat receptor protein kinase EXS [Aegilops tauschii]
Length=699

 Score =   613 bits (1582),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 349/684 (51%), Positives = 446/684 (65%), Gaps = 63/684 (9%)
 Frame = -3

Query  2207  VSLLMAIKASLDPGNLVLSSWSPNVTDPCSVSSFEGIACNDLGQVVNISLQGKGLYGKIP  2028
             V  L+ +KA+LDP   +L SW+P   DPC+   FEG+AC+  G V N+SLQGKGL G + 
Sbjct  31    VRALLELKAALDPTGRLLPSWAPG-RDPCARGGFEGVACDGSGAVANVSLQGKGLAGTLS  89

Query  2027  PEIGQLNGLSGLYLHFNNLHGVIPKEIASLTQLSDLYLNMNDLSGFIPSEIGNMPNLQVL  1848
             P +  L  L+GLYLH+N L G +P+E+A LT+L+D+YLN+N+LSG IP+EIG M +LQVL
Sbjct  90    PAVAGLRALTGLYLHYNALRGGVPRELARLTRLTDVYLNVNNLSGPIPAEIGAMASLQVL  149

Query  1847  QLCYNRFEGCIPNKLGSLKNLTVLALQSNQLTGAIPASlggltlltrldLSFNRLFGSIP  1668
             QLCYN+  G IP +LG    LTVLALQSN L GAIPASLG L  L RLDLSFN LFGSIP
Sbjct  150   QLCYNQLTGSIPTQLGLPNRLTVLALQSNHLNGAIPASLGDLPELRRLDLSFNHLFGSIP  209

Query  1667  VKLSEASKLEVLDLRNNTLSGNVPLGLKRLNEGFRYENNPGLCGTGFPSLALCSDSSL-N  1491
             V+L+   +L  LD+RNN+L+G+VP  L +L  GF+Y NN  LCGTG P L  C+ + L +
Sbjct  210   VRLARLPQLAALDVRNNSLTGSVPSELAKLEGGFQYGNNSDLCGTGLPDLRPCTPADLID  269

Query  1490  PTKPEPFGQGSNRLPTKDIPESANIPHQLNQNRKP--QAAAAVVGVIGLFVILAVAGLFT  1317
             P +P+P   G   +  +  P+ A   H    +  P  +A AAVV V  + +    AGL  
Sbjct  270   PDRPQPLSAG---IAPQITPDGAR-GHCSGTHCPPSTKALAAVVVVAVILLAATAAGLLA  325

Query  1316  FSWYRRRKQQIGSTVDISESRVSTDQPKVLCRRSTSPLISLEYSNGWDPLAKDQSGSALS  1137
             FSW+R RKQ           R +   P +   R+ + L+SLEYSNGWDPLA  +SG   S
Sbjct  326   FSWHRWRKQ-----------RTAAGAPPMTTSRAPT-LVSLEYSNGWDPLADGRSGVGFS  373

Query  1136  QEVLESFMFNLDEVESATQYFSETNLLGK----------SSFSAVYKGTLRDGSAVAVKC  987
              EV  S  FN++EVESATQYFSE NLLGK          SSF+A Y+GTLRDG+ V V  
Sbjct  374   HEVSPSLRFNMEEVESATQYFSELNLLGKKNSKSKGGAGSSFAATYRGTLRDGTPVVVTR  433

Query  986   ISKTSCKSDEAEFRKGLTLLTSLKHENLLRLRGFCCSKGRGECFLIYDFVSNGNLLRYLD  807
             + KT CK +EAEF KGL LL  L+H+N++ LRGFCCS+ RGECFL++DFV NG+L  +LD
Sbjct  434   LGKTCCKQEEAEFLKGLKLLAELQHDNIVGLRGFCCSRARGECFLVHDFVPNGSLSHFLD  493

Query  806   VK---------DEKGKVLDWSTRTAIIKGIAR---------------------GIKYLHG  717
             V             G+VL+WSTR +IIKGIA+                     GI YLH 
Sbjct  494   VAGEDGGGGALGHGGRVLEWSTRVSIIKGIAKVVTQIVLAFAEARLRIDVYFTGIGYLHS  553

Query  716   NKRNKPALVHRNISADKVLIDHLYKPLLSDSGLHKLLADDIVFSTLKGSAANGYLAPEYA  537
              + NKP LVH+NISADKVL+D+ YKPL+S SGLHKLL DD+VFSTLK SAA GYLAPEY 
Sbjct  554   TRANKPPLVHQNISADKVLVDYTYKPLISGSGLHKLLVDDLVFSTLKASAAMGYLAPEYT  613

Query  536   ITGRFTEKSDMYAFGVIILQILSGSCVVTQSNHQGAELCRFEDFVDAKLGKDFVESEAAK  357
               GRF+EKSD+YAFGVI+ QIL+G     Q   +   +    D +D  +   +  +EAAK
Sbjct  614   TVGRFSEKSDVYAFGVIVFQILAGKSKTMQLPFESGNV---HDLIDGNMKGCYSATEAAK  670

Query  356   LGKIALLCTHDSPSRRPAIDVVIQ  285
             L KIAL+CT ++P +RP ++ ++Q
Sbjct  671   LAKIALVCTSENPEQRPNMEELLQ  694



>ref|XP_003569250.1| PREDICTED: LOW QUALITY PROTEIN: somatic embryogenesis receptor 
kinase 2 [Brachypodium distachyon]
Length=711

 Score =   614 bits (1583),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 345/679 (51%), Positives = 443/679 (65%), Gaps = 42/679 (6%)
 Frame = -3

Query  2207  VSLLMAIKASLDPGNLVLSSWSPNVTDPCSVSS--FEGIACNDLGQVVNISLQGKGLYGK  2034
             V  L+ +KA+LDP   +L SW+P   DPC      FEG+AC+  G V N+SLQGKGL G 
Sbjct  32    VRALLELKAALDPTGRLLPSWAPG-RDPCGGGGGGFEGVACDARGGVANLSLQGKGLSGT  90

Query  2033  IPPEIGQLNGLSGLYLHFNNLHGVIPKEIASLTQLSDLYLNMNDLSGFIPSEIGNMPNLQ  1854
             + P +  L  L+GLYLH+N L G +P+E+  L+QL+DLYL++N+ SG IP EIG M +LQ
Sbjct  91    LSPAVAGLRALTGLYLHYNALRGAVPRELTGLSQLTDLYLDVNNFSGAIPPEIGTMASLQ  150

Query  1853  VLQLCYNRFEGCIPNKLGSLKNLTVLALQSNQLTGAIPASlggltlltrldLSFNRLFGS  1674
             VLQLCYN+  G IP +LG L  LTVLALQSN L GAIPASLG L  L RLDLSFN LFGS
Sbjct  151   VLQLCYNQLTGSIPTQLGLLNKLTVLALQSNHLNGAIPASLGDLPELMRLDLSFNHLFGS  210

Query  1673  IPVKLSEASKLEVLDLRNNTLSGNVPLGLK----------RLNEGFRYENNPGLCGTGFP  1524
             IPV+L++   L   D+RNN+L+G+VP  L            L  GF+Y NN  LCGTG P
Sbjct  211   IPVRLAKLPLLAAFDVRNNSLTGSVPAELNVXFCLVPRIGELEGGFQYGNNTDLCGTGLP  270

Query  1523  SLALCSDSSL-NPTKPEPFGQGSNRLPTKDIPESANIPHQLNQNRKP--QAAAAVVGVIG  1353
              L  C+ + L +P +P+PF  G     T      A   H    +  P  +A AA V V  
Sbjct  271   DLRPCTPADLIDPDRPQPFSAGIAPDITPGSSSDAGRGHCSGTHCPPSTKALAAAVVVAV  330

Query  1352  LFVILAVAGLFTFSWYRRRKQQIGSTVDISE--------SRVSTDQPKVLCRRSTSPLIS  1197
             + +    AGLF FSWYR RKQ+       +         S  +T +P    + ++S L+S
Sbjct  331   VILAATAAGLFAFSWYRWRKQRTAGAAAGAPPAPAGGRCSTEATKEPSSFRKSASSTLVS  390

Query  1196  LEYSNGWDPLAKDQSGSALSQEVLESFMFNLDEVESATQYFSETNLLGK--------SSF  1041
             LEYSNGWDPL+  +SG+  S+EV  S  FN++EVESATQYFSE NLLGK        S  
Sbjct  391   LEYSNGWDPLSDGRSGAGFSKEVSPSLRFNMEEVESATQYFSELNLLGKKKNRKSSASVS  450

Query  1040  SAVYKGTLRDGSAVAVKCISKTSCKSDEAEFRKGLTLLTSLKHENLLRLRGFCCSKGRGE  861
              A Y+GTLRDG+ V V  + KT CK +EAEF KGL LL  L+H+N++ LRGFCCS+ RGE
Sbjct  451   KATYRGTLRDGTPVVVTRLGKTCCKQEEAEFLKGLKLLAELRHDNVVGLRGFCCSRARGE  510

Query  860   CFLIYDFVSNGNLLRYLDV-------KDEKGKVLDWSTRTAIIKGIARGIKYLHGNKRNK  702
             CFL++DFV NG+L ++LDV           G VL+WSTR +II GIA+GI+YLH ++ NK
Sbjct  511   CFLVHDFVPNGSLSQFLDVHNGGGGAPGHGGHVLEWSTRVSIINGIAKGIEYLHSSRANK  570

Query  701   PALVHRNISADKVLIDHLYKPLLSDSGLHKLLADDIVFSTLKGSAANGYLAPEYAITGRF  522
             P LVH+NISADK+L+D+ YKPL+S SGLHKLL DD+VFSTLK SAA GYLAPEY   GRF
Sbjct  571   PPLVHQNISADKILVDYTYKPLISGSGLHKLLVDDLVFSTLKASAAMGYLAPEYTTVGRF  630

Query  521   TEKSDMYAFGVIILQILSGSCVVTQSNHQGAELCRFEDFVDAKLGKDFVESEAAKLGKIA  342
             +EKSD+YAFGVI+ QIL+G     Q      E    ++ +D+ L   +  +EA KL KIA
Sbjct  631   SEKSDVYAFGVIVFQILTGKRKTMQLPF---EFGNADELIDSNLKGCYSLTEATKLAKIA  687

Query  341   LLCTHDSPSRRPAIDVVIQ  285
             L+CT ++P +RP ++ +I+
Sbjct  688   LVCTSENPDQRPTMEELIK  706



>ref|XP_002458036.1| hypothetical protein SORBIDRAFT_03g025880 [Sorghum bicolor]
 gb|EES03156.1| hypothetical protein SORBIDRAFT_03g025880 [Sorghum bicolor]
Length=693

 Score =   612 bits (1577),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 341/656 (52%), Positives = 440/656 (67%), Gaps = 38/656 (6%)
 Frame = -3

Query  2174  DPGNLVLSSWSPNVTDPC-----SVSSFEGIACNDLGQVVNISLQGKGLYGKIPPEIGQL  2010
             DP   +L SW+P   DPC     S   FEG+AC+  G V N+SLQGKGL G + P +  L
Sbjct  45    DPTGRLLPSWAPG-RDPCAPPPSSGGGFEGVACDARGAVANVSLQGKGLAGTLTPAVAGL  103

Query  2009  NGLSGLYLHFNNLHGVIPKEIASLTQLSDLYLNMNDLSGFIPSEIGNMPNLQVLQLCYNR  1830
               L+GLYLH+N L G IP+E+A+L  L+DLYL++N+ SG IP EIG M +LQV+QLCYN+
Sbjct  104   RSLTGLYLHYNALRGGIPRELAALDALTDLYLDVNNFSGPIPPEIGAMASLQVVQLCYNQ  163

Query  1829  FEGCIPNKLGSLKNLTVLALQSNQLTGAIPASlggltlltrldLSFNRLFGSIPVKLSEA  1650
               G IP +LG+L  LTVLALQSNQL GAIPASLGGL LL RLDLSFNRLFGSIPV+L++ 
Sbjct  164   LTGSIPTQLGNLTRLTVLALQSNQLNGAIPASLGGLPLLARLDLSFNRLFGSIPVRLAQL  223

Query  1649  SKLEVLDLRNNTLSGNVPLGL-KRLNEGFRYENNPGLCGTGFPSLALCSDSSL-NPTKPE  1476
               L  LD+RNN+L+G+VP  L  +L  GF+Y NN  LCG G P+L  C+ + L +P +P+
Sbjct  224   PSLAALDVRNNSLTGSVPAELAAKLQAGFQYGNNSDLCGAGLPALRPCTPADLIDPDRPQ  283

Query  1475  PFGQGSNRLPTKDIPESANIPHQLNQNRKPQAAAAVVGVIGLFVILAVAGLFTFSWYRRR  1296
             PF  G     T     +   P          AA A++   G+       GLF  SW R R
Sbjct  284   PFSAGIASQVTPSGGGNGRAPSTRALAAVVVAAVALLAATGV-------GLFALSWRRWR  336

Query  1295  KQQI--GSTVDISESRVSTDQPKVLCRRS-------TSPLISLEYSNGWDPLAKDQSGSA  1143
             +Q++  GS   IS  R ST+      + S       +S L SLEYSN WDPLA  + G  
Sbjct  337   RQRVAGGSPSTISGGRCSTENAPSAAKASPSARKSASSALASLEYSNAWDPLADARGGLG  396

Query  1142  -LSQEVL-ESFMFNLDEVESATQYFSETNLLGK-----SSFSAVYKGTLRDGSAVAVKCI  984
              LSQ+VL +S   + +EVESAT+YFSE NLLGK        +A Y+GTLRDG++VAVK +
Sbjct  397   FLSQDVLAQSLRISTEEVESATRYFSELNLLGKRGKKAGGLAATYRGTLRDGTSVAVKRL  456

Query  983   SKTSCKSDEAEFRKGLTLLTSLKHENLLRLRGFCCSKGRGECFLIYDFVSNGNLLRYLDV  804
              KT C+ +EA+F KGL LL  L+H+N++ LRGFCCS+ RGECFL+YDFV NG+L ++LDV
Sbjct  457   GKTCCRQEEADFLKGLRLLAELRHDNVVALRGFCCSRARGECFLVYDFVPNGSLSQFLDV  516

Query  803   KDEK---GKVLDWSTRTAIIKGIARGIKYLHGNKRNKPALVHRNISADKVLIDHLYKPLL  633
               +    G+VL+W TR +IIKGIA+GI+YLH  + NKPALVH+NISADKVL+D+ Y+PL+
Sbjct  517   DADTGGGGRVLEWPTRISIIKGIAKGIEYLHSTRTNKPALVHQNISADKVLLDYTYRPLI  576

Query  632   SDSGLHKLLADDIVFSTLKGSAANGYLAPEYAITGRFTEKSDMYAFGVIILQILSGSCVV  453
             S  GLHKLL DD+VFSTLK SAA GYLAPEY   GRF+EKSD+YAFGVI+LQ+L+G   V
Sbjct  577   SGCGLHKLLVDDLVFSTLKASAAMGYLAPEYTTVGRFSEKSDVYAFGVIVLQVLTGRRKV  636

Query  452   TQSNHQGAELCRFEDFVDAKLGKDFVESEAAKLGKIALLCTHDSPSRRPAIDVVIQ  285
             T +          ++ VD  L  ++  +EAAKL KI   CT ++P +RP +  ++Q
Sbjct  637   TTTQLPD----NVDELVDGNLEGNYSATEAAKLAKIGSACTSENPDQRPTMAELLQ  688



>ref|XP_002436427.1| hypothetical protein SORBIDRAFT_10g002300 [Sorghum bicolor]
 gb|EER87794.1| hypothetical protein SORBIDRAFT_10g002300 [Sorghum bicolor]
Length=561

 Score =   603 bits (1554),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 321/557 (58%), Positives = 410/557 (74%), Gaps = 13/557 (2%)
 Frame = -3

Query  1925  DLYLNMNDLSGFIPSEIGNMPNLQVLQLCYNRFEGCIPNKLGSLKNLTVLALQSNQLTGA  1746
             DLYL++N L+G +P EI  + NLQVLQL YN+  G IP +LG++  LTVLA+QSNQL GA
Sbjct  2     DLYLDVNHLTGPVPVEIAAIVNLQVLQLGYNQLTGSIPPQLGNMNKLTVLAMQSNQLAGA  61

Query  1745  IPASlggltlltrldLSFNRLFGSIPVKLSEASKLEVLDLRNNTLSGNVPLGLKRLNEGF  1566
             IPA+LG LT L RLDLSFN LFGSIP K++E   LEV D+RNNTLSG+VP+GL+RLN GF
Sbjct  62    IPATLGELTQLRRLDLSFNSLFGSIPSKIAEVPLLEVFDVRNNTLSGSVPVGLRRLNGGF  121

Query  1565  RYENNPGLCGTGFPSLALCSDSS--LNPTKPEPFGQGSNRLPTKDIPESANIPHQLNQNR  1392
             +Y NN GLCG  F  L LCS S   L P+KPEPFG     + T+ +P+SAN P   + + 
Sbjct  122   QYMNNKGLCGADFSLLELCSSSEDGLKPSKPEPFGPDGT-VKTRQVPQSAN-PDNCSGSG  179

Query  1391  KPQAAAA-----VVGVIGLFVILAVAGLFTFSWYRRRKQQIGSTVDISESRVSTD--QPK  1233
               ++A A     +V V+ + +  A  GLF FSWYRR+KQ+IGS++++S+SR+STD  Q K
Sbjct  180   CSKSANASEGVLIVAVVAVVIGAAFCGLFAFSWYRRQKQKIGSSLEVSDSRLSTDHFQQK  239

Query  1232  VLCRRSTSPLISLEYSNGWDPLAKDQSGSALSQEVLESFMFNLDEVESATQYFSETNLLG  1053
               CRRS SPLIS+EYSN WDPL+        S EV +SF FNL+EVE ATQYFS+ NLLG
Sbjct  240   EACRRSASPLISVEYSNSWDPLSGGAG-VGSSGEVGDSFRFNLEEVECATQYFSDVNLLG  298

Query  1052  KSSFSAVYKGTLRDGSAVAVKCISKTSCKSDEAEFRKGLTLLTSLKHENLLRLRGFCCSK  873
             KS F+A YKG LRDGS VAVK ++KTSCK +E++F +GL +LT L+H+NL+ LRGFCCS+
Sbjct  299   KSGFAATYKGILRDGSVVAVKSLNKTSCKQEESDFLRGLKMLTLLQHDNLVSLRGFCCSR  358

Query  872   GRGECFLIYDFVSNGNLLRYLDVKD-EKGKVLDWSTRTAIIKGIARGIKYLHGNKRNKPA  696
             GRGECFL+YDF+ NG L +YLDVKD     VLDW TR +II+GIA+GI+YLH  K +KP 
Sbjct  359   GRGECFLVYDFMVNGCLSQYLDVKDGSSATVLDWPTRVSIIRGIAKGIEYLHSKKSSKPP  418

Query  695   LVHRNISADKVLIDHLYKPLLSDSGLHKLLADDIVFSTLKGSAANGYLAPEYAITGRFTE  516
             +VH+NISA+K+L+DH + P LS  GLHKLLADD++FSTLK SAA GYLAPEYA TGRFT+
Sbjct  419   VVHQNISAEKILLDHHFAPRLSVPGLHKLLADDVIFSTLKASAAMGYLAPEYATTGRFTD  478

Query  515   KSDMYAFGVIILQILSGSCVVTQSNHQGAELCRFEDFVDAKLGKDFVESEAAKLGKIALL  336
             KSD++AFG+++LQ+L+G   V+Q     A +      VD  L   F  +EA KL  +A  
Sbjct  479   KSDVFAFGIVVLQVLTGRRDVSQLKVGAAAVSDLTALVDGNLNGAFSRAEAVKLAAVAAY  538

Query  335   CTHDSPSRRPAIDVVIQ  285
             CT +SPS+RP ++ V+Q
Sbjct  539   CTSESPSQRPTMEAVVQ  555



>ref|XP_006646028.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
GSO1-like, partial [Oryza brachyantha]
Length=592

 Score =   602 bits (1553),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 329/593 (55%), Positives = 430/593 (73%), Gaps = 17/593 (3%)
 Frame = -3

Query  2030  PPEIGQLNGLSGLYLHFNNLHGVIPKEIASLTQLSDLYLNMNDLSGFIPSEIGNMPNLQV  1851
             PP +  L GL+GLYLH+N L G +P+E+A LT+L+DLYLN+N+ SG IP EIG M +LQV
Sbjct  1     PPAVAGLRGLTGLYLHYNRLTGALPRELAGLTRLTDLYLNVNNFSGAIPPEIGAMASLQV  60

Query  1850  LQLCYNRFEGCIPNKLGSLKNLTVLALQSNQLTGAIPASlggltlltrldLSFNRLFGSI  1671
             +QLCYN+  G +P +LG LK L+VLALQSN L GAIPASLG L  L RLDLSFN LFGSI
Sbjct  61    VQLCYNQLTGGVPTQLGLLKRLSVLALQSNHLNGAIPASLGDLPQLVRLDLSFNNLFGSI  120

Query  1670  PVKLSEASKLEVLDLRNNTLSGNVPLGLKRLNEGFRYENNPGLCGTGFPSLALCSDSSL-  1494
             PV+L++  +L  LD+RNNTL+G+VP  L +L  GF+Y NN  LCGTG P+L  C+ + L 
Sbjct  121   PVRLAQLPRLAALDVRNNTLTGSVPSELAKLQGGFQYANNTDLCGTGLPALRPCTPADLI  180

Query  1493  NPTKPEPFGQGSNRLPTKDIPESANIPHQLNQNRKP---QAAAAVVGVIGLFVILAVAGL  1323
             +P +P+PF  G   +  +  P S +   + +  R P   +A AAVV +  + + +  AGL
Sbjct  181   SPDRPQPFSAG---ISPQITPGSPDGHGRCSGARCPPSTKALAAVVVIAVILLAVTAAGL  237

Query  1322  FTFSWYRRRKQQIGSTVDISESRVSTDQP-KVLCRRS-TSPLISLEYSNGWDPLAKDQSG  1149
             F FSWYR RKQ++  +  +   R ST+   K   R+S +S L+SLEYSNGWDPLA  + G
Sbjct  238   FAFSWYRWRKQRVAGSPVVVGGRCSTEAAVKESFRKSVSSTLVSLEYSNGWDPLADGRGG  297

Query  1148  SALSQEVLESFMFNLDEVESATQYFSETNLLGKS-SFSAVYKGTLRDGSAVAVKCISKTS  972
             +  SQEV ++F FN+++VESATQYFSE NLLGK+ +F+A Y+GTLRDG++VAVK + KT 
Sbjct  298   AGFSQEVAQNFRFNMEDVESATQYFSELNLLGKNGNFAATYRGTLRDGTSVAVKRLGKTC  357

Query  971   CKSDEAEFRKGLTLLTSLKHENLLRLRGFCCSKGRGECFLIYDFVSNGNLLRYLDVKDE-  795
             CK +E+EF KGL LL  L+HEN++ LRGFCCS+ RGECFL+YDFV NG+L ++LD+ DE 
Sbjct  358   CKQEESEFLKGLKLLAKLRHENIVGLRGFCCSRARGECFLVYDFVPNGSLSQFLDINDEV  417

Query  794   ---KGKVLDWSTRTAIIKGIARGIKYLHGNKRNKPALVHRNISADKVLIDHLYKPLLSDS  624
                 G+VL+WSTR +IIKGIA+GI+YLH N+ NKP LVH+NISADKVL+D+ YKPL+S S
Sbjct  418   ARSNGRVLEWSTRISIIKGIAKGIEYLHSNRANKPPLVHQNISADKVLVDYTYKPLISGS  477

Query  623   GLHKLLADDIVFSTLKGSAANGYLAPEYAITGRFTEKSDMYAFGVIILQILSGSCVVTQS  444
             GLHKLL DD+VFSTLK SAA GYLAPEY   GR +EKSD+YAFGVI+ QIL+G    +++
Sbjct  478   GLHKLLVDDLVFSTLKESAAMGYLAPEYTTIGRLSEKSDVYAFGVIVFQILTGK---SKN  534

Query  443   NHQGAELCRFEDFVDAKLGKDFVESEAAKLGKIALLCTHDSPSRRPAIDVVIQ  285
                  E    ED +D+ L   +   EAAKL KIA  CT ++P  RP ++ ++Q
Sbjct  535   AQLPVESDNIEDLIDSNLKGCYSAVEAAKLAKIASACTSENPDHRPTMEELLQ  587



>ref|XP_007155588.1| hypothetical protein PHAVU_003G214800g [Phaseolus vulgaris]
 gb|ESW27582.1| hypothetical protein PHAVU_003G214800g [Phaseolus vulgaris]
Length=681

 Score =   605 bits (1560),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 334/645 (52%), Positives = 439/645 (68%), Gaps = 10/645 (2%)
 Frame = -3

Query  2198  LMAIKASLDPGNLVLSSWSPNVTDPCSVSSFEGIACNDLGQVVNISLQGKGLYGKIPPEI  2019
             LM +K SLDP + +L SW+ +  DPCS  SF G+ACN   +V NISL G+GL G++ P +
Sbjct  30    LMDLKKSLDPEDTLLGSWTSD-GDPCS-GSFLGVACNQHNKVANISLPGRGLSGRVSPAV  87

Query  2018  GQLNGLSGLYLHFNNLHGVIPKEIASLTQLSDLYLNMNDLSGFIPSEIGNMPNLQVLQLC  1839
              +L  LSGLYL FN L G IP+EIA+L +L DLYLN+N LSG IP +IGNM +LQVLQL 
Sbjct  88    AELRCLSGLYLQFNRLSGDIPREIANLKELLDLYLNVNYLSGTIPPDIGNMTSLQVLQLG  147

Query  1838  YNRFEGCIPNKLGSLKNLTVLALQSNQLTGAIPASlggltlltrldLSFNRLFGSIPVKL  1659
             YN+ EG IP +LGSLK L  ++LQ N+LTG IP +LG L  L  L LS N   G IP  L
Sbjct  148   YNQLEGKIPKELGSLKQLNAMSLQHNKLTGQIPLTLGSLEKLKMLYLSSNNFNGIIPATL  207

Query  1658  SEASKLEVLDLRNNTLSGNVPLGLKRLNEGFRYENNPGLCGTGFPSLALC-SDSSLNPTK  1482
             ++ + LEVLD++NN+LSG VP  LKRL EGF+ ENNP LC  GF +L  C SD  L   +
Sbjct  208   ADIANLEVLDIQNNSLSGTVPSALKRLGEGFKGENNPDLCAVGFSTLKACNSDKILGIGQ  267

Query  1481  PEPFGQGSNRLPTKDIPESANIPHQLNQNRKPQAAAAVVGVIGLFVILAV-----AGLFT  1317
                     N  P+  +   AN   Q NQ    ++   +  VI   V   +     +G+F 
Sbjct  268   ISSPNISLNNNPSVTLTNPANTHSQSNQIHCSKSRGFLHLVIAASVTTTIITFLSSGIFI  327

Query  1316  FSWYRRRKQQIGSTVDISESRVSTDQPKVLCRRSTSPLISLE-YSNGWDPLAKDQSGSAL  1140
             F  YRR+++++ +T D SES++S   PK    RS+SPL++LE Y NG D  A  Q+ + L
Sbjct  328   FVRYRRQRERVRNTSDCSESQLSPYLPKDF-YRSSSPLVNLENYYNGMDSPADGQNANGL  386

Query  1139  SQEVLESFMFNLDEVESATQYFSETNLLGKSSFSAVYKGTLRDGSAVAVKCISKTSCKSD  960
             S E L  F FN+DE+ESATQ+ SE NLLGKS  SAVYKG  RDGS VA++ IS T CK++
Sbjct  387   SLEYLHRFRFNIDEIESATQHLSEANLLGKSKLSAVYKGVHRDGSLVAIRSISVTCCKTE  446

Query  959   EAEFRKGLTLLTSLKHENLLRLRGFCCSKGRGECFLIYDFVSNGNLLRYLDVKDEKGKVL  780
             E EF KGL LLT+L+HEN+++++GFC S+ RGE + +YDF + GNL +YLD +D    VL
Sbjct  447   EDEFLKGLILLTTLRHENIVKMKGFCYSRSRGEWYFVYDFATRGNLSQYLDKEDGSDSVL  506

Query  779   DWSTRTAIIKGIARGIKYLHGNKRNKPALVHRNISADKVLIDHLYKPLLSDSGLHKLLAD  600
             +WS R +II+GIA+GI YLH N+ +KP +VH+N+S +KV++D+ + PL+ D+GL KLLAD
Sbjct  507   EWSKRVSIIRGIAKGIGYLHSNEASKPTIVHQNVSVEKVILDNEFNPLIMDAGLPKLLAD  566

Query  599   DIVFSTLKGSAANGYLAPEYAITGRFTEKSDMYAFGVIILQILSGSCVVTQSNHQGAELC  420
             D+VFS LK SAA GYLAPEY  TG FTEKSD+YAFGVI+LQ+LSG  ++  S     E  
Sbjct  567   DVVFSALKASAAMGYLAPEYITTGCFTEKSDIYAFGVIVLQLLSGKALIGGSIRAAVEAF  626

Query  419   RFEDFVDAKLGKDFVESEAAKLGKIALLCTHDSPSRRPAIDVVIQ  285
             +FEDFVD  L  D+ +SEAA L K+A+ CTH+ P +RP +  VI+
Sbjct  627   KFEDFVDTNLKGDYSKSEAAILSKLAIGCTHELPEQRPTMVEVIE  671



>gb|EMT21475.1| Putative LRR receptor-like serine/threonine-protein kinase [Aegilops 
tauschii]
Length=531

 Score =   598 bits (1541),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 313/533 (59%), Positives = 396/533 (74%), Gaps = 11/533 (2%)
 Frame = -3

Query  1868  MPNLQVLQLCYNRFEGCIPNKLGSLKNLTVLALQSNQLTGAIPASlggltlltrldLSFN  1689
             M NLQVLQL YN+  G IP +LG+L  L VLALQSNQLTGAIPA+LG LT LTR+DLSFN
Sbjct  1     MANLQVLQLGYNQLTGSIPPQLGNLNKLAVLALQSNQLTGAIPATLGDLTQLTRVDLSFN  60

Query  1688  RLFGSIPVKLSEASKLEVLDLRNNTLSGNVPLGLKRLNEGFRYENNPGLCGTGFPSLALC  1509
              LFGSIP K+++   LEV D+RNNTLSG+VP GLKRLN GF+Y NN GLCG  F SL LC
Sbjct  61    NLFGSIPSKIADVPSLEVFDVRNNTLSGSVPAGLKRLNGGFQYVNNKGLCGAEFISLDLC  120

Query  1508  S--DSSLNPTKPEPFGQGSNRLPTKDIPESANIPHQLNQNRKPQAAAAVVGVIGLFVILA  1335
             +  +  L P+KPEPFG     + T  +P+S + PH   ++ K  A   +VGV+ + +  A
Sbjct  121   TSTEDGLRPSKPEPFGP-DGTVKTGQVPQSVD-PHT-TKSAKASAGVLIVGVLAVVIGAA  177

Query  1334  VAGLFTFSWYRRRKQQIGSTVDISESRVSTD--QPKVLCRRSTSPLISLEYSNGWDPLAK  1161
               G+F FS+YRR+KQ+IGS++++S+SR+STD  Q K  CRRS SPLIS+EYSNGWD ++ 
Sbjct  178   FCGIFAFSYYRRQKQKIGSSLEVSDSRLSTDHFQQKEACRRSASPLISVEYSNGWDTMSG  237

Query  1160  DQSGSALSQEVLESFMFNLDEVESATQYFSETNLLGKSSFSAVYKGTLRDGSAVAVKCIS  981
                    S EV +SF FNL+EVE ATQYFSE NLLGKS F+A +KG LRDGS VAVK ++
Sbjct  238   GGC--GSSGEVGDSFRFNLEEVECATQYFSEVNLLGKSGFAATFKGILRDGSVVAVKSLN  295

Query  980   KTSCKSDEAEFRKGLTLLTSLKHENLLRLRGFCCSKGRGECFLIYDFVSNGNLLRYLDVK  801
             KTSCK +E++F +GL  LT L+HENL+ LRGFCCS+GRGECFL+YDF+ NG L  YLDVK
Sbjct  296   KTSCKQEESDFLRGLKTLTMLRHENLVGLRGFCCSRGRGECFLVYDFMVNGCLSHYLDVK  355

Query  800   D-EKGKVLDWSTRTAIIKGIARGIKYLHGNKRNKPALVHRNISADKVLIDHLYKPLLSDS  624
             +  +  VLDW TR +II+GIA+GI+YLH  K NKP+LVH+NISA+K+L+D  + P LS  
Sbjct  356   EGSEASVLDWPTRVSIIRGIAKGIEYLHSKKSNKPSLVHQNISAEKILLDQHFAPRLSVP  415

Query  623   GLHKLLADDIVFSTLKGSAANGYLAPEYAITGRFTEKSDMYAFGVIILQILSGSCVVTQS  444
             GLHKLLADD+VFSTLK SAA GYLAPEYA TGRFTEKSD++AFG+++LQ+++G   V+Q 
Sbjct  416   GLHKLLADDVVFSTLKASAAMGYLAPEYANTGRFTEKSDVFAFGIVVLQVITGRRAVSQV  475

Query  443   NHQGAELCRFEDFVDAKLGKDFVESEAAKLGKIALLCTHDSPSRRPAIDVVIQ  285
                G      E  +D  LG  F  +EAAKL ++A  CT ++ S+RP +D V+Q
Sbjct  476   K-IGTATSDLEGLIDPSLGGIFSRTEAAKLAEVAAHCTSEAASQRPMMDAVVQ  527


 Score = 70.1 bits (170),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 36/84 (43%), Positives = 51/84 (61%), Gaps = 0/84 (0%)
 Frame = -3

Query  2045  LYGKIPPEIGQLNGLSGLYLHFNNLHGVIPKEIASLTQLSDLYLNMNDLSGFIPSEIGNM  1866
             L G IPP++G LN L+ L L  N L G IP  +  LTQL+ + L+ N+L G IPS+I ++
Sbjct  14    LTGSIPPQLGNLNKLAVLALQSNQLTGAIPATLGDLTQLTRVDLSFNNLFGSIPSKIADV  73

Query  1865  PNLQVLQLCYNRFEGCIPNKLGSL  1794
             P+L+V  +  N   G +P  L  L
Sbjct  74    PSLEVFDVRNNTLSGSVPAGLKRL  97



>ref|XP_008791357.1| PREDICTED: somatic embryogenesis receptor kinase 1-like, partial 
[Phoenix dactylifera]
Length=513

 Score =   591 bits (1523),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 307/508 (60%), Positives = 383/508 (75%), Gaps = 16/508 (3%)
 Frame = -3

Query  1787  LTVLALQSNQLTGAIPASlggltlltrldLSFNRLFGSIPVKLSEASKLEVLDLRNNTLS  1608
               VL L  NQLTGAIPA+LG LT LTRL LSFN LFGSIPVKL++  +L V D++NN+LS
Sbjct  9     FVVLQLGYNQLTGAIPATLGDLTQLTRLYLSFNHLFGSIPVKLAQVPQLVVFDVQNNSLS  68

Query  1607  GNVPLGLKRLNEGFRYENNPGLCGTGFPSLALC-SDSSLNPTKPEPFGQGSNRLPTKDIP  1431
             G+VP  LKRLNEGF+Y NN GLCG GF SL  C SD  L P+KPEPFGQ        +IP
Sbjct  69    GSVPSDLKRLNEGFQYGNNTGLCGVGFTSLKGCPSDDPLKPSKPEPFGQ--------EIP  120

Query  1430  ESANIPHQLNQNRKPQ-----AAAAVVGVIGLFVILAVAGLFTFSWYRRRKQQIGSTVDI  1266
             +SAN+    N +  P+     A   V+G++ + V   V  L  F+ YRRRKQ+IGS +++
Sbjct  121   QSANVTTHCNHSHCPKSSKSSAVKVVIGIVAMAVGGLVISLLAFALYRRRKQKIGSALEV  180

Query  1265  SESRVSTDQPKVLCRRSTSPLISLEYSNGWDPLAKDQSGSALSQEVLESFMFNLDEVESA  1086
             S+SR+STDQPK   R+S SPLISLEYS+GWD L   + G+ +SQEV +SF FNL+EVE A
Sbjct  181   SDSRLSTDQPKDFYRKSASPLISLEYSSGWDSLVDGRGGAGISQEVSQSFRFNLEEVECA  240

Query  1085  TQYFSETNLLGKSSFSAVYKGTLRDGSAVAVKCISKTSCKSDEAEFRKGLTLLTSLKHEN  906
             TQYFS+ NLLGKS+F+A YKG LRDG+ VAVK I+KTSCK++EA+F KGL +LT L+HEN
Sbjct  241   TQYFSDVNLLGKSNFAATYKGLLRDGTVVAVKSINKTSCKTEEADFLKGLKILTLLRHEN  300

Query  905   LLRLRGFCCSKGRGECFLIYDFVSNGNLLRYLDVKDE-KGKVLDWSTRTAIIKGIARGIK  729
             L+ LRGFCCS+GRGECFL+YDFV NG+L +YLD+KD   G+VLDW TR +IIKGIA+GI+
Sbjct  301   LVGLRGFCCSRGRGECFLVYDFVINGSLSQYLDMKDNVNGRVLDWPTRVSIIKGIAKGIE  360

Query  728   YLHGNKRNKPALVHRNISADKVLIDHLYKPLLSDSGLHKLLADDIVFSTLKGSAANGYLA  549
             YLH N+ NKPALVH+NI+A+KVLIDH + P LS SGLHKLLADD+V+STLK SAA GYLA
Sbjct  361   YLHSNRPNKPALVHQNIAAEKVLIDHNFTPRLSGSGLHKLLADDVVYSTLKASAAMGYLA  420

Query  548   PEYAITGRFTEKSDMYAFGVIILQILSGSCVVTQSNHQGAELCRFEDFVDAKLGKDFVES  369
             PEY   GRFTEKSD+YAFGV++ QIL+G   V+      +E  + E+ +D  L  +F   
Sbjct  421   PEYTTIGRFTEKSDVYAFGVLVFQILTGKSNVSHL-RLNSESAKLENLLDENLAGNFSIP  479

Query  368   EAAKLGKIALLCTHDSPSRRPAIDVVIQ  285
             EAAKL  IAL+CT +SPS+RP ++ V+Q
Sbjct  480   EAAKLAGIALVCTGESPSQRPTMEAVLQ  507


 Score = 52.8 bits (125),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 27/67 (40%), Positives = 37/67 (55%), Gaps = 0/67 (0%)
 Frame = -3

Query  1994  LYLHFNNLHGVIPKEIASLTQLSDLYLNMNDLSGFIPSEIGNMPNLQVLQLCYNRFEGCI  1815
             L L +N L G IP  +  LTQL+ LYL+ N L G IP ++  +P L V  +  N   G +
Sbjct  12    LQLGYNQLTGAIPATLGDLTQLTRLYLSFNHLFGSIPVKLAQVPQLVVFDVQNNSLSGSV  71

Query  1814  PNKLGSL  1794
             P+ L  L
Sbjct  72    PSDLKRL  78



>gb|EAZ41323.1| hypothetical protein OsJ_25834 [Oryza sativa Japonica Group]
Length=678

 Score =   596 bits (1536),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 339/670 (51%), Positives = 436/670 (65%), Gaps = 69/670 (10%)
 Frame = -3

Query  2207  VSLLMAIKASLDPGNLVLSSWSPNVTDPCSVSSFEGIACNDLGQVVNISLQGKGLYGKIP  2028
             V  LM +KA+LDP   +L SW                              GKGL G I 
Sbjct  43    VDALMELKAALDPSGRLLPSWGAR------------------------RRPGKGLAGAIS  78

Query  2027  PEIGQLNGLSGLYLHFNNLHGVIPKEIASLTQLSDLYLNMNDLSGFIPSEIGNMPNLQVL  1848
             P +  L GL+GLYLH+N L G IP+++  L  L++LYL +N+LSG IP E+G +P LQVL
Sbjct  79    PAVAMLPGLTGLYLHYNELAGAIPRQLGDLPMLAELYLGVNNLSGTIPVELGRLPALQVL  138

Query  1847  QLCYNRFEGCIPNKLGSLKNLTVLALQSNQLTGAIPASlggltlltrldLSFNRLFGSIP  1668
             QL YN+  G IP +LG LK LTVLALQSNQLTGAIPASLG L  L RLDLS NRLFGSIP
Sbjct  139   QLGYNQLSGSIPTQLGQLKKLTVLALQSNQLTGAIPASLGDLPELARLDLSSNRLFGSIP  198

Query  1667  VKLSEASKLEVLDLRNNTLSGNVPLGLKRLNEGFRYENNPGLCGTGFPSLALCSDSSLNP  1488
              KL+   KL  LDLRNNTLSG+VP GLK+LNEGF ++NN  LCG  F SL  C++     
Sbjct  199   SKLAAIPKLATLDLRNNTLSGSVPSGLKKLNEGFHFDNNSELCGAHFDSLKPCANGD---  255

Query  1487  TKPEPFGQGSNRLPTKDIPESANI-----PHQLNQNRK---------------PQAAAAV  1368
                E   +  +++  K  PES N+     P  +N NR                  + A +
Sbjct  256   ---EDDNEEGSKMARK--PESTNVKPLQAPQTMNVNRDCDNGGCSRSSSSSTTLSSGAIL  310

Query  1367  VGVIGLFVILAVAGLFTFSWYRRRKQQI--GSTVDISESRVSTDQPKVLCRRSTSPLISL  1194
              G I +    A  G+   SW RR+KQ++  G TV+  E R S+         ++S LI++
Sbjct  311   AGTIIIIGGAAACGISVISWRRRQKQKVGGGGTVESLEGRASSSN-------ASSSLINV  363

Query  1193  EYSNGWDPLAK-DQSGSALSQEVLESFMFNLDEVESATQYFSETNLLGKSSFSAVYKGTL  1017
             EYS+GWD  ++  Q G  LS E   S  +N++EVE ATQYF+  NLLG+S F+A Y+G +
Sbjct  364   EYSSGWDTSSEGSQQGLRLSPEWSPSVRYNMEEVECATQYFAGANLLGRSGFAATYRGAM  423

Query  1016  RDGSAVAVKCISKTSCKSDEAEFRKGLTLLTSLKHENLLRLRGFCCSKGRGECFLIYDFV  837
             RDG+AVAVK I K+SCK++EA+F +GL  +TSL+H+NL+ LRGFC S+ RGECFL+Y+F+
Sbjct  424   RDGAAVAVKSIGKSSCKAEEADFLRGLRAITSLRHDNLVALRGFCRSRARGECFLVYEFM  483

Query  836   SNGNLLRYLDVKDEKGKVLDWSTRTAIIKGIARGIKYLHGNKRNKPALVHRNISADKVLI  657
             +NG+L RYLDVKD    VLDW+TR +IIKGIA+GI+YLH +K NK ALVH+NI ADK+L+
Sbjct  484   ANGSLSRYLDVKDGD-VVLDWATRVSIIKGIAKGIEYLHSSKANKAALVHQNICADKILM  542

Query  656   DHLYKPLLSDSGLHKLLADDIVFSTLKGSAANGYLAPEYAITGRFTEKSDMYAFGVIILQ  477
             DHL+ P LS +G HKLLADD+VFSTLK SAA GYLAPEY  TGRFT++SD+YAFGV++ Q
Sbjct  543   DHLFVPHLSGAGEHKLLADDVVFSTLKDSAAMGYLAPEYTTTGRFTDRSDVYAFGVVVFQ  602

Query  476   ILSGSCVVTQS-----NHQGAELC-RFEDFVDAKLGKDFVESEAAKLGKIALLCTHDSPS  315
             +L+G   V+          GAE   + +D VD +LG  F   EAAKL  IALLCT +SP+
Sbjct  603   VLTGRKAVSSELRLLGGGGGAEYSGKLDDLVDPRLGGRFSRPEAAKLAGIALLCTSESPA  662

Query  314   RRPAIDVVIQ  285
             +RPA+  V+Q
Sbjct  663   QRPAMAAVLQ  672



>gb|AFW83078.1| putative leucine-rich repeat protein kinase family protein [Zea 
mays]
Length=692

 Score =   586 bits (1510),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 331/656 (50%), Positives = 441/656 (67%), Gaps = 38/656 (6%)
 Frame = -3

Query  2174  DPGNLVLSSWSPNVTDPCS---VSSFEGIACNDLGQVVNISLQGKGLYGKIPPEIGQLNG  2004
             DP   +L SW+P   DPC+      F+G+AC+D G V N+SLQGKGL G +PP +  L  
Sbjct  44    DPTGRLLPSWAPG-RDPCAPPPSGGFDGVACDDSGAVANVSLQGKGLAGTLPPAVAGLRS  102

Query  2003  LSGLYLHFNNLHGVIPKEIASLTQLSDLYLNMNDLSGFIPSEIGNMPNLQVLQLCYNRFE  1824
             L+GLYLH+N L G IP+E+A+L  L+DLYL++N+ SG +P EIG M +LQV+QLCYN+  
Sbjct  103   LTGLYLHYNALRGGIPRELAALAALTDLYLDVNNFSGPVPPEIGAMASLQVVQLCYNQLT  162

Query  1823  GCIPNKLGSLKNLTVLALQSNQLTGAIPASlggltlltrldLSFNRLFGSIPVKLSEASK  1644
             G IP +LG+L  LTVLALQSN+L GAIPASLG L LL RLDLSFNRLFGSIPV+L++   
Sbjct  163   GSIPTQLGNLSRLTVLALQSNRLNGAIPASLGDLPLLARLDLSFNRLFGSIPVRLAQLPS  222

Query  1643  LEVLDLRNNTLSGNVPLGL-KRLNEGFRYENNPGLCGTGFPSLALCSDSSL-NPTKPEPF  1470
             L  LD+RNN+L+G+VP  L  +L  GF+Y NN  LCG G P+L  C+ + L +P +P+PF
Sbjct  223   LVALDVRNNSLTGSVPAELAAKLQAGFQYGNNSDLCGAGLPALRPCTPADLIDPDRPQPF  282

Query  1469  GQGSNRLPTKDIPESANIPHQLNQNRKPQAAAAVVGVIGLFVILAVAGLFTFSWYRRRKQ  1290
               G   +  +  P     P           A A++   G+       GL   SW R R+Q
Sbjct  283   SAG---IAPQVRPSDGRAPSTRALAAVVVVAVALLAATGV-------GLLALSWRRWRRQ  332

Query  1289  QI--GSTVDISESRVSTD------QPKVLCRRSTSPLISLEYSNGWDPLAKDQSGSAL-S  1137
             ++  GS   +S  R ST+      +     + ++S L SLEYSN WDPLA  + G  L S
Sbjct  333   RVAGGSPSTVSGGRCSTEAAPSAAKASSARKSASSALASLEYSNAWDPLADARGGLGLFS  392

Query  1136  QEVL-ESFMFNLDEVESATQYFSETNLLGK-----SSFSAVYKGTLRDGSAVAVKCISKT  975
             Q+ L +S   + +EVESAT+YFSE NLLG+        +  Y+GTLRDG++VAVK + KT
Sbjct  393   QDALAQSLRISTEEVESATRYFSELNLLGRRGKKAGGLAGTYRGTLRDGTSVAVKRLGKT  452

Query  974   SCKSDEAEFRKGLTLLTSLKHENLLRLRGFCCSKGRGECFLIYDFVSNGNLLRYLDVKDE  795
              C+ +EA+F  GL LL  L+H+N++ LRGFCCS+ RGECFL+YDFV NG+L ++LDV  +
Sbjct  453   CCRQEEADFLSGLRLLAELRHDNVVALRGFCCSRARGECFLVYDFVPNGSLSQFLDVDAD  512

Query  794   -----KGKVLDWSTRTAIIKGIARGIKYLHGNKRNKPALVHRNISADKVLIDHLYKPLLS  630
                   G+VL WSTR +IIKGIA+GI+YLH  + NKPALVH+NISADKVL+D+ Y+PL+S
Sbjct  513   NAGGGSGRVLQWSTRISIIKGIAKGIEYLHSTRTNKPALVHQNISADKVLLDYAYRPLIS  572

Query  629   DSGLHKLLADDIVFSTLKGSAANGYLAPEYAITGRFTEKSDMYAFGVIILQILSGSCVVT  450
               GLHKLL DD+VFSTLK SAA GYLAPEY   GRF+EKSD+YAFGVI+ Q+L+G   VT
Sbjct  573   GCGLHKLLVDDLVFSTLKASAAMGYLAPEYTTVGRFSEKSDVYAFGVIVFQVLTGKSKVT  632

Query  449   QSNHQGAELCRFEDFVDAKL-GKDFVESEAAKLGKIALLCTHDSPSRRPAIDVVIQ  285
              ++ Q  +    ++ VD  L G ++  +EAA+L KI   CT ++P +RP +  ++Q
Sbjct  633   TTHAQLPD-NDVDELVDGNLQGDNYSAAEAAQLAKIGSACTSENPDQRPTMAELLQ  687



>ref|XP_008438170.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
GSO2 isoform X2 [Cucumis melo]
Length=531

 Score =   577 bits (1488),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 305/508 (60%), Positives = 375/508 (74%), Gaps = 11/508 (2%)
 Frame = -3

Query  2216  ASTVSLLMAIKASLDPGNLVLSSWSPNVTDPCSVSSFEGIACNDLGQVVNISLQGKGLYG  2037
             ++ +S LMAIKASLDP N +L+SWSP+ ++PC    FEG+ACN+ G+VVNISLQG GL G
Sbjct  26    STELSTLMAIKASLDPHNTLLTSWSPS-SNPCG-GYFEGVACNEQGKVVNISLQGMGLSG  83

Query  2036  KIPPEIGQLNGLSGLYLHFNNLHGVIPKEIASLTQLSDLYLNMNDLSGFIPSEIGNMPNL  1857
              IP  +  L  L+GLYLHFN L G IPKEIASL QL+DLYLN+N LSG IP EIGNM NL
Sbjct  84    YIPAAVAGLRSLTGLYLHFNALIGEIPKEIASLNQLTDLYLNVNQLSGEIPFEIGNMANL  143

Query  1856  QVLQLCYNRFEGCIPNKLGSLKNLTVLALQSNQLTGAIPASlggltlltrldLSFNRLFG  1677
             QVLQLCYN+  G IP+++G++K L+VLALQ NQLTGAIPASLG LT LTRL+LS N+ FG
Sbjct  144   QVLQLCYNKLTGGIPSQVGNMKVLSVLALQYNQLTGAIPASLGNLTALTRLNLSNNKFFG  203

Query  1676  SIPVKLSEASKLEVLDLRNNTLSGNVPLGLKRLNEGFRYENNPGLCGTGFPSLALCSD-S  1500
              IPV L++A  LEV ++ NN+L+GNVP G KRL E F Y NNP LCG GF  L  CS   
Sbjct  204   PIPVILADAPALEVFNVENNSLTGNVPPGFKRLKEKFMYLNNPSLCGVGFQDLNPCSKLK  263

Query  1499  SLNPTKPEPF--GQGSNRLPTKDIPESANIPHQLN-----QNRKPQAAAAVVGVIGLFVI  1341
             SLNP++PEPF      N    +DIPESAN+    N     +  K       +GVIG+F  
Sbjct  264   SLNPSRPEPFLPQLPGNDPSARDIPESANLRSNCNGGNCSRQSKSSRVGVALGVIGVFAA  323

Query  1340  LAVAGLFTFSWYRRRKQQIGSTVDISESRVSTDQPKVLCRRSTSPLISLEYSNGWDPLAK  1161
              +  GL TFSWYRR + + GST +    R+ T Q + + RR+ SPLI+LEYSNGWDPLAK
Sbjct  324   FSAIGLATFSWYRRNEHKFGSTSNGISRRIITSQVREVYRRNASPLINLEYSNGWDPLAK  383

Query  1160  DQSGSALSQEVLESFMFNLDEVESATQYFSETNLLGKSSFSAVYKGTLRDGSAVAVKCIS  981
             D  GSA S+E+ +SFMFNL++VE ATQ FS++NLLG+++FSA+YKG LRDGS VA+KCI 
Sbjct  384   DHGGSASSREIFKSFMFNLEDVERATQCFSKSNLLGRNNFSALYKGKLRDGSVVAIKCIG  443

Query  980   KTSCKSDEAEFRKGLTLLTSLKHENLLRLRGFCCSKGRGECFLIYDFVSNGNLLRYLDVK  801
             KTSCKSDEAEF KGL +L S+ HENL++ RG CCSK RGEC+LIYDF +NG L++YLD  
Sbjct  444   KTSCKSDEAEFLKGLKILISMNHENLVKFRGLCCSKDRGECYLIYDFAANGTLMQYLDDS  503

Query  800   DEKGKVLDWSTRTAIIKGIARGI-KYLH  720
             +  GKVLDWSTR +II GIA+G   + H
Sbjct  504   NGSGKVLDWSTRVSIIFGIAKGFCSFFH  531



>ref|XP_008656611.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g63930 [Zea mays]
Length=786

 Score =   586 bits (1511),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 331/656 (50%), Positives = 441/656 (67%), Gaps = 38/656 (6%)
 Frame = -3

Query  2174  DPGNLVLSSWSPNVTDPCS---VSSFEGIACNDLGQVVNISLQGKGLYGKIPPEIGQLNG  2004
             DP   +L SW+P   DPC+      F+G+AC+D G V N+SLQGKGL G +PP +  L  
Sbjct  138   DPTGRLLPSWAPG-RDPCAPPPSGGFDGVACDDSGAVANVSLQGKGLAGTLPPAVAGLRS  196

Query  2003  LSGLYLHFNNLHGVIPKEIASLTQLSDLYLNMNDLSGFIPSEIGNMPNLQVLQLCYNRFE  1824
             L+GLYLH+N L G IP+E+A+L  L+DLYL++N+ SG +P EIG M +LQV+QLCYN+  
Sbjct  197   LTGLYLHYNALRGGIPRELAALAALTDLYLDVNNFSGPVPPEIGAMASLQVVQLCYNQLT  256

Query  1823  GCIPNKLGSLKNLTVLALQSNQLTGAIPASlggltlltrldLSFNRLFGSIPVKLSEASK  1644
             G IP +LG+L  LTVLALQSN+L GAIPASLG L LL RLDLSFNRLFGSIPV+L++   
Sbjct  257   GSIPTQLGNLSRLTVLALQSNRLNGAIPASLGDLPLLARLDLSFNRLFGSIPVRLAQLPS  316

Query  1643  LEVLDLRNNTLSGNVPLGL-KRLNEGFRYENNPGLCGTGFPSLALCSDSSL-NPTKPEPF  1470
             L  LD+RNN+L+G+VP  L  +L  GF+Y NN  LCG G P+L  C+ + L +P +P+PF
Sbjct  317   LVALDVRNNSLTGSVPAELAAKLQAGFQYGNNSDLCGAGLPALRPCTPADLIDPDRPQPF  376

Query  1469  GQGSNRLPTKDIPESANIPHQLNQNRKPQAAAAVVGVIGLFVILAVAGLFTFSWYRRRKQ  1290
               G   +  +  P     P           A A++   G+       GL   SW R R+Q
Sbjct  377   SAG---IAPQVRPSDGRAPSTRALAAVVVVAVALLAATGV-------GLLALSWRRWRRQ  426

Query  1289  QI--GSTVDISESRVSTD------QPKVLCRRSTSPLISLEYSNGWDPLAKDQSGSAL-S  1137
             ++  GS   +S  R ST+      +     + ++S L SLEYSN WDPLA  + G  L S
Sbjct  427   RVAGGSPSTVSGGRCSTEAAPSAAKASSARKSASSALASLEYSNAWDPLADARGGLGLFS  486

Query  1136  QEVL-ESFMFNLDEVESATQYFSETNLLGK-----SSFSAVYKGTLRDGSAVAVKCISKT  975
             Q+ L +S   + +EVESAT+YFSE NLLG+        +  Y+GTLRDG++VAVK + KT
Sbjct  487   QDALAQSLRISTEEVESATRYFSELNLLGRRGKKAGGLAGTYRGTLRDGTSVAVKRLGKT  546

Query  974   SCKSDEAEFRKGLTLLTSLKHENLLRLRGFCCSKGRGECFLIYDFVSNGNLLRYLDVKDE  795
              C+ +EA+F  GL LL  L+H+N++ LRGFCCS+ RGECFL+YDFV NG+L ++LDV  +
Sbjct  547   CCRQEEADFLSGLRLLAELRHDNVVALRGFCCSRARGECFLVYDFVPNGSLSQFLDVDAD  606

Query  794   -----KGKVLDWSTRTAIIKGIARGIKYLHGNKRNKPALVHRNISADKVLIDHLYKPLLS  630
                   G+VL WSTR +IIKGIA+GI+YLH  + NKPALVH+NISADKVL+D+ Y+PL+S
Sbjct  607   NAGGGSGRVLQWSTRISIIKGIAKGIEYLHSTRTNKPALVHQNISADKVLLDYAYRPLIS  666

Query  629   DSGLHKLLADDIVFSTLKGSAANGYLAPEYAITGRFTEKSDMYAFGVIILQILSGSCVVT  450
               GLHKLL DD+VFSTLK SAA GYLAPEY   GRF+EKSD+YAFGVI+ Q+L+G   VT
Sbjct  667   GCGLHKLLVDDLVFSTLKASAAMGYLAPEYTTVGRFSEKSDVYAFGVIVFQVLTGKSKVT  726

Query  449   QSNHQGAELCRFEDFVDAKL-GKDFVESEAAKLGKIALLCTHDSPSRRPAIDVVIQ  285
              ++ Q  +    ++ VD  L G ++  +EAA+L KI   CT ++P +RP +  ++Q
Sbjct  727   TTHAQLPD-NDVDELVDGNLQGDNYSAAEAAQLAKIGSACTSENPDQRPTMAELLQ  781



>gb|KEH27456.1| LRR receptor-like kinase [Medicago truncatula]
Length=645

 Score =   576 bits (1484),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 325/649 (50%), Positives = 416/649 (64%), Gaps = 55/649 (8%)
 Frame = -3

Query  2198  LMAIKASLDPGNLVLSSWSPNVTDPCSVSSFEGIACNDLGQVVNISLQGKGLYGKIPPEI  2019
             LM +KASLDP   +L+SW  +  +PCS  SFEGIACN+  +V NISLQGKGL+G +   +
Sbjct  31    LMDLKASLDPEGKILTSWIGD-GNPCS-GSFEGIACNEHWKVANISLQGKGLFGSLSSSV  88

Query  2018  GQLNGLSGLYLHFNNLHGVIPKEIASLTQLSDLYLNMNDLSGFIPSEIGNMPNLQVLQLC  1839
              +L  LSGLYLH+N                                      NL VLQL 
Sbjct  89    AELKCLSGLYLHYN--------------------------------------NLSVLQLG  110

Query  1838  YNRFEGCIPNKLGSLKNLTVLALQSNQLTGAIPASlggltlltrldLSFNRLFGSIPVKL  1659
              N+  G IP ++GSLK LT LALQ N+LTG IP SLG L  L+RL+LSFN   G+IP  L
Sbjct  111   DNQLVGNIPTQMGSLKQLTTLALQYNKLTGQIPLSLGNLENLSRLNLSFNNFSGAIPATL  170

Query  1658  SEASKLEVLDLRNNTLSGNVPLGLKRLNEGFRYENNPGLCGTGFPSLALCS-DSSLNPTK  1482
             +  + LEVLD++NN+LSG VP  L+RL EGF+  NN GLCG G  +L  C+ +  LN + 
Sbjct  171   ANIAHLEVLDIQNNSLSGTVPSVLQRLGEGFQGANNQGLCGVGISTLRACNKEPDLNVSN  230

Query  1481  PEPFGQG--SNRLPTKDIPESANIPHQLNQNRKPQA--------AAAVVGVIGLFVILAV  1332
              +   Q    N  P    PE AN     NQ    ++         A+V+ +I L +I   
Sbjct  231   IDTSDQDHLKNSNPATPRPEPANFQMHCNQKHCSKSRSVPTSVITASVIAIITLTII--G  288

Query  1331  AGLFTFSWYRRRKQQIGSTVDISESRVSTDQPKVLCRRSTSPLISLEYSNGWDPLAKDQS  1152
             AGLFTF  YRRRKQ+I S  + SE ++S  QPK L ++S S L++L+Y NG  P+  DQ+
Sbjct  289   AGLFTFVKYRRRKQKISS--NSSEGKLSPQQPKELYQKSPSTLVNLDYYNGCYPMPDDQN  346

Query  1151  GSALSQEVLESFMFNLDEVESATQYFSETNLLGKSSFSAVYKGTLRDGSAVAVKCISKTS  972
                LS E L  F FN+DEVESATQYFSE NLL KS FSA YKG LRDGS VA+  I+ + 
Sbjct  347   AGGLSNEYLNQFRFNVDEVESATQYFSEVNLLRKSKFSATYKGVLRDGSLVAITSINMSC  406

Query  971   CKSDEAEFRKGLTLLTSLKHENLLRLRGFCCSKGRGECFLIYDFVSNGNLLRYLDVKDEK  792
             CK++EAEF KGL+LLTSL+HEN+++LRGFCCS  RGEC+LI DF   G+L +YLD++D  
Sbjct  407   CKTEEAEFVKGLSLLTSLRHENVVKLRGFCCSSSRGECYLINDFAMMGDLSQYLDIEDRS  466

Query  791   GKVLDWSTRTAIIKGIARGIKYLHGNKRNKPALVHRNISADKVLIDHLYKPLLSDSGLHK  612
             G +LDWS R  IIKGIA+GI YLH N+ +KP +VH+NIS + VL+D  + PL+ ++GL K
Sbjct  467   GHLLDWSKRVTIIKGIAKGIGYLHSNEASKPTIVHQNISVENVLLDKDFNPLIMNAGLPK  526

Query  611   LLADDIVFSTLKGSAANGYLAPEYAITGRFTEKSDMYAFGVIILQILSGSCVVTQSNHQG  432
             LLADD+VFS LK SAA GYLAPEY  TGRFTEKSD+YAFGVI+LQ+LSG   +  S    
Sbjct  527   LLADDVVFSALKVSAAMGYLAPEYITTGRFTEKSDIYAFGVIVLQVLSGKTAIGGSIRTA  586

Query  431   AELCRFEDFVDAKLGKDFVESEAAKLGKIALLCTHDSPSRRPAIDVVIQ  285
              +  +F+D +D  L   +  SEA+ L K+ + C H+SP  RP +  VIQ
Sbjct  587   FQSFKFDDCIDTNLKGRYSNSEASILTKLGMQCIHESPDERPNMVDVIQ  635



>ref|XP_004969430.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
GSO1-like [Setaria italica]
Length=696

 Score =   577 bits (1488),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 335/666 (50%), Positives = 432/666 (65%), Gaps = 56/666 (8%)
 Frame = -3

Query  2174  DPGNLVLSSWSPNVTDPCSV-SSFEGIACNDLGQVVNISLQGKGLYGKIPPEIGQLNGLS  1998
             DP   +L SW+P   DPC+    FEG+AC+  G V N+SLQGKGL G +PP +  L  L+
Sbjct  46    DPTGRLLPSWAPG-RDPCAARGGFEGVACDARGAVANVSLQGKGLAGTLPPAVAGLRALT  104

Query  1997  GLYLHFNNLHGVIPKEIASLTQLSDLYLNMNDLSGFIPSEIGNMPNLQVLQLCYNRFEGC  1818
             GLYLH+N L G IP+E+A+L  L+DLYL++N+LSG IP EIG M +LQV+QLCYN+  G 
Sbjct  105   GLYLHYNALRGGIPRELAALGALTDLYLDVNNLSGPIPPEIGAMASLQVVQLCYNQLTGS  164

Query  1817  IPNKLGSLKNLTVLALQSNQLTGAIPASlggltlltrldLSFNRLFGSIPVKLSEASKLE  1638
             IP +LG+L  LTVLALQSN+L GAIPASLG L LL+RLDL FN LFGSIPV+L+   +L 
Sbjct  165   IPTQLGNLTRLTVLALQSNRLNGAIPASLGDLPLLSRLDLGFNNLFGSIPVRLARLPRLV  224

Query  1637  VLDLRNNTLSGNVPLGL-KRLNEGFRYENNPGLCGTGFPSLALCSDSSL-NPTKPEPFGQ  1464
              LD+RNN+L+G+VP  L   L  GF+Y NN  LCG G P+L  C+ + L +P +P+PF  
Sbjct  225   ALDVRNNSLTGSVPAELAANLQAGFQYGNNTDLCGAGLPALRPCTPADLIDPDRPQPFSA  284

Query  1463  GSNRLPTKDIPESANIPHQLNQNRKP--QAAAAVVGVIGLFVILAVAGLFTFSWYRRRKQ  1290
             G        I      P    + R P  +A AAVV V    +     GLF  SW R R Q
Sbjct  285   G--------ISPQVTSPDGGGRGRAPSTKALAAVVVVAVALLAATAVGLFALSWRRWRGQ  336

Query  1289  QIGSTVDISESRVSTDQPKVLC-------------RRSTSPLISLEYSNGWDP-------  1170
             ++          VS   P   C             + ++S L SLEYSN WDP       
Sbjct  337   RV----------VSGGSPPTACGVTEAAAKASSARKSASSALASLEYSNAWDPLAGARGG  386

Query  1169  -LAKDQSGSALSQEVL-ESFMFNLDEVESATQYFSETNLLGK------SSFSAVYKGTLR  1014
               A   S S+ SQ+VL +S   + +EVESAT+YFSE NLLG+         +A Y+GTLR
Sbjct  387   ASAGLGSPSSSSQDVLAQSLRISTEEVESATRYFSELNLLGRRGRNKAGGLAATYRGTLR  446

Query  1013  DGSAVAVKCISKTSCKSDEAEFRKGLTLLTSLKHENLLRLRGFCCSKGRGECFLIYDFVS  834
             DG+ VAVK + KT C+ +EAEF +GL LL  L+H+N++ LRGFCCS+ RGECFL+YDFV 
Sbjct  447   DGTPVAVKRLGKTCCRQEEAEFLRGLKLLAELRHDNVVALRGFCCSRARGECFLVYDFVP  506

Query  833   NGNLLRYLDVKDEK---GKVLDWSTRTAIIKGIARGIKYLHGNKRNKPALVHRNISADKV  663
             NG L ++LDV  +    G+VL+WSTR +IIKGIARGI+YLH  +  KPALVH++ISADKV
Sbjct  507   NGCLSQFLDVDADDTAGGRVLEWSTRISIIKGIARGIEYLHSTRPGKPALVHQSISADKV  566

Query  662   LIDHLYKPLLSDSGLHKLLADDIVFSTLKGSAANGYLAPEYAITGRFTEKSDMYAFGVII  483
             L+D+ Y+PL+S  GLHKLL DD+VFSTLK SAA GYLAPEY   GR +EKSD+YAFGVI+
Sbjct  567   LLDYTYRPLISGCGLHKLLVDDLVFSTLKASAAMGYLAPEYTTVGRLSEKSDVYAFGVIV  626

Query  482   LQILSGSCVVTQSNHQGAELCRFEDFVDAKLGKDFVESEAAKLGKIALLCTHDSPSRRPA  303
             LQ+L+G   V  +           + VD  L   +  +EAA+L KIAL CT + P +RP 
Sbjct  627   LQVLTGRRKVATATAMQLP-GDVGELVDGNLHGSYSAAEAARLAKIALACTSEDPDQRPT  685

Query  302   IDVVIQ  285
             ++ ++Q
Sbjct  686   MEELLQ  691



>ref|NP_001146186.1| uncharacterized LOC100279756 precursor [Zea mays]
 gb|ACL53424.1| unknown [Zea mays]
 tpg|DAA58650.1| TPA: putative leucine-rich repeat protein kinase family protein 
[Zea mays]
Length=696

 Score =   576 bits (1484),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 330/656 (50%), Positives = 436/656 (66%), Gaps = 34/656 (5%)
 Frame = -3

Query  2174  DPGNLVLSSWSPNVTDPCSVS---SFEGIACNDLGQVVNISLQGKGLYGKIPPEIGQLNG  2004
             DP   +L SW+P   DPC+ +    FEG+AC+  G V N+SLQGKGL G +PP +  L  
Sbjct  44    DPTGRLLPSWAPG-RDPCAPAPSGGFEGVACDARGAVANVSLQGKGLAGTLPPAVAGLRS  102

Query  2003  LSGLYLHFNNLHGVIPKEIASLTQLSDLYLNMNDLSGFIPSEIGNMPNLQVLQLCYNRFE  1824
             L+GLYLH+N L G IP+E+A+L  L+DLYL++N+ SG IPSEIG M +LQV+QLCYN+  
Sbjct  103   LTGLYLHYNALRGGIPRELAALAALTDLYLDVNNFSGPIPSEIGAMASLQVVQLCYNQLT  162

Query  1823  GCIPNKLGSLKNLTVLALQSNQLTGAIPASlggltlltrldLSFNRLFGSIPVKLSE-AS  1647
             G IP +LG+L  LTVLALQSN+  GAIPASLG L LL RLDLSFNRLFGSIPV+L++   
Sbjct  163   GSIPTQLGNLTRLTVLALQSNRFNGAIPASLGDLPLLARLDLSFNRLFGSIPVRLAQLPC  222

Query  1646  KLEVLDLRNNTLSGNVPLGLK-RLNEGFRYENNPGLCGTGFPSLALCSDSSL-NPTKPEP  1473
              L VLD+RNN+L+G+VP  L  +L  GF+Y NN  LCG G P+L  C+ + L +P +P+P
Sbjct  223   SLVVLDVRNNSLTGSVPAELAAKLQAGFQYGNNSDLCGAGLPALRPCTPADLIDPDRPQP  282

Query  1472  FGQG-SNRLPTKDIPESANIPHQLNQNRKPQAAAAVVGVIGLFVILAVAGLFTFSWYRRR  1296
             F  G + ++   D   +  +P           A A++   G+       GLF  SW R  
Sbjct  283   FSAGIAPQVTPSDGRGNGRVPSTRALAAVVVVAVALLLTTGV-------GLFALSWRRWH  335

Query  1295  KQQIG--STVDISESRVSTD------QPKVLCRRSTSPLISLEYSNGWDPLAKDQSGSA-  1143
             +Q++   S   IS  R ST+      +     + ++S L SLEYSN WDPLA  + G   
Sbjct  336   RQKVAGASPSTISGGRCSTEVVPSAAKASSARKSASSALASLEYSNAWDPLADARGGLGF  395

Query  1142  LSQEV--LESFMFNLDEVESATQYFSETNLLG-----KSSFSAVYKGTLRDGSAVAVKCI  984
             +SQ+V   +S   + +EVESAT+YFSE NLLG         +A Y+GTLRDG++VAVK +
Sbjct  396   VSQDVQLAQSLRISTEEVESATRYFSELNLLGGHGKKAGGLAATYRGTLRDGTSVAVKRL  455

Query  983   SKTSCKSDEAEFRKGLTLLTSLKHENLLRLRGFCCSKGRGECFLIYDFVSNGNLLRYLDV  804
              KT C+ +EA+F  GL LL  L+H+N++ LRGFCCS+ RGECFL+YDFV NG+L ++LD 
Sbjct  456   GKTCCRQEEADFLSGLRLLAELRHDNVVALRGFCCSRARGECFLVYDFVPNGSLSQFLDA  515

Query  803   KDE---KGKVLDWSTRTAIIKGIARGIKYLHGNKRNKPALVHRNISADKVLIDHLYKPLL  633
                    G+VL WSTR +II+GIA+GI+YLH  + NKPALVH+NISADKVL+D+ Y+PL+
Sbjct  516   DTTAGGSGRVLQWSTRISIIRGIAKGIEYLHSTRTNKPALVHQNISADKVLLDYAYRPLV  575

Query  632   SDSGLHKLLADDIVFSTLKGSAANGYLAPEYAITGRFTEKSDMYAFGVIILQILSGSCVV  453
             S  GLHKLL DD+VFSTLK SAA GYLAPEY   GR +EKSD+YAFGVI+LQ+L+G   V
Sbjct  576   SGCGLHKLLVDDLVFSTLKASAAMGYLAPEYTTVGRLSEKSDVYAFGVIVLQVLTGRRKV  635

Query  452   TQSNHQGAELCRFEDFVDAKLGKDFVESEAAKLGKIALLCTHDSPSRRPAIDVVIQ  285
             T +    A     ++ VD  L   +  +EAA L KI   CT + P +RP +  ++Q
Sbjct  636   TATAQLLAGNVDDDELVDGNLQGSYSAAEAAMLAKIGSACTSEDPDQRPTMAELLQ  691



>gb|EMT10973.1| Leucine-rich repeat receptor protein kinase EXS [Aegilops tauschii]
Length=766

 Score =   577 bits (1487),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 328/649 (51%), Positives = 437/649 (67%), Gaps = 28/649 (4%)
 Frame = -3

Query  2198  LMAIKASLDPGNLV--LSSWSPNVTDPCSVSS-FEGIACNDLGQVVNISLQGKGLYGKIP  2028
             LM IKA+LDP      L+SWS    DPC     FEG++C+  G+V  +SLQG+ L G + 
Sbjct  33    LMEIKAALDPSGRAPALASWSRG-GDPCGRGDYFEGVSCDASGRVSVVSLQGRRLSGSVS  91

Query  2027  PEIGQLNGLSGLYLHFNNLHGVIPKEIASLTQLSDLYLNMNDLSGFIPSEIGNMPNLQVL  1848
             P    L GL+GLYLH+N+L G IP+E+  L  L++LYL +N+LSG IP E+G +  LQVL
Sbjct  92    PAGAMLPGLTGLYLHYNDLGGAIPRELGDLPDLAELYLGVNNLSGGIPVELGRLHRLQVL  151

Query  1847  QLCYNRFEGCIPNKLGSLKNLTVLALQSNQLTGAIPASlggltlltrldLSFNRLFGSIP  1668
             QL YN+  G IP +LG LK LTVLA+QSNQLTGAIPASLG L  LTRLDLS N LFGSIP
Sbjct  152   QLGYNQLSGSIPTQLGELKKLTVLAVQSNQLTGAIPASLGDLPELTRLDLSSNHLFGSIP  211

Query  1667  VKLSEASKLEVLDLRNNTLSGNVPLGLKRLNEGFRYENNPGLCGTGFPSLALC-SDSSLN  1491
              KL+   +L  LDLRNNTLSG+VP GLK+L  GF+++NN  LCG+ F SL  C +D +++
Sbjct  212   SKLAGIPQLATLDLRNNTLSGSVPSGLKKLGHGFKFDNNLELCGSHFGSLKACPNDDNVD  271

Query  1490  ---PTKPEPFGQGSNRLPTKDIPESANIP-HQLNQNRKPQAAAAVVGVIGLFVILAVAGL  1323
                P KPE       + P ++I ++ N      +++    + A + G I +   +A  GL
Sbjct  272   EQMPHKPESTSIKPQQTP-QNISQNTNCDIGACSRSSTLSSGAVLAGTIIIIAGVAACGL  330

Query  1322  FTFSWYRRRKQQIGSTVDISESRVSTDQPKVLCRRSTSPLISLEYSNGWDPLAK-DQSGS  1146
               FSW+RR+KQ++G +V+  E R S +Q K   ++S S LI++EYS+GWD  ++  Q G 
Sbjct  331   SVFSWHRRQKQKVGCSVESLEGRPSLEQSKETYQKSASSLINVEYSSGWDTSSEGSQHGV  390

Query  1145  ALSQEVLESFMFNLDEVESATQYFSETNLLGKSSFSAVYKGTLRDGSAVAVKCISKTSCK  966
              LS E   S  FNL+EVE ATQYFS+ N+LGKS+F+A ++G +RDGS VAVK I+K+SCK
Sbjct  391   RLSPEGSPSVRFNLEEVECATQYFSDINVLGKSTFAATHRGIMRDGSVVAVKSINKSSCK  450

Query  965   SDEAEFRKGLTLLTSLKHENLLRLRGFCCSKGRGECFLIYDFVSNGNLLRYLDVK--DEK  792
             S+EA+F KGL +LTSL+HENL+ LRGFC S+ RGECFL+Y+F++ G+L +YLD+K  D +
Sbjct  451   SEEADFLKGLRVLTSLRHENLVGLRGFCRSRARGECFLVYEFMATGSLSQYLDIKDGDAE  510

Query  791   GKVLDWSTRTAIIKGIARGIKYLHGNKRNKPALVHRNISADKVLIDHLYKPLLSDSGLHK  612
              ++LDWSTR +IIKGIA+GI YLH +K +KP LVH+NISADKVL+DH+  P LS SG+HK
Sbjct  511   TRILDWSTRVSIIKGIAKGIDYLHSSKPSKPPLVHQNISADKVLLDHMLVPRLSGSGVHK  570

Query  611   LLADDIVFSTLKGSAANGYLAPEYAITGRFTEKSDMYAFGVIILQILSGSCVVTQSNHQG  432
             LLADD+VFSTLKG    G       +TG+      +              C +  +   G
Sbjct  571   LLADDVVFSTLKGPPGGGRRR-HGVLTGKKAVSQHLL------------RCTMDGAEPGG  617

Query  431   AELCRFEDFVDAKLGKDFVESEAAKLGKIALLCTHDSPSRRPAIDVVIQ  285
             A   + +D VD +LG  F   EAAKL  IALLCT ++P +RPA+  V+Q
Sbjct  618   A--AKLDDLVDHRLGARFSRPEAAKLAGIALLCTSEAPGQRPAMAAVLQ  664



>gb|KDO63770.1| hypothetical protein CISIN_1g005586mg [Citrus sinensis]
Length=589

 Score =   563 bits (1452),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 308/533 (58%), Positives = 382/533 (72%), Gaps = 12/533 (2%)
 Frame = -3

Query  1853  VLQLCYNRFEGCIPNKLGSLKNLTVLALQSNQLTGAIPASlggltlltrldLSFNRLFGS  1674
             VLQLC N+  G IP ++GSLK+L+VL LQ N+L G IP SLG L  L RLDLSFN LFG+
Sbjct  44    VLQLCCNQLTGNIPAQIGSLKSLSVLTLQHNRLNGGIPDSLGNLGKLKRLDLSFNSLFGT  103

Query  1673  IPVKLSEASKLEVLDLRNNTLSGNVPLGLKRLNEGFRYENNPGLCGTGFPSLALCS---D  1503
             IP  L+  ++L  LD++NNTLSG VP  LKRLN GF+++NNPGLCG G  SL  C+   +
Sbjct  104   IPESLANNAELLFLDVQNNTLSGIVPSALKRLNGGFQFQNNPGLCGDGIASLRACTVYDN  163

Query  1502  SSLNPTKPEPFGQGSNRLPTKDIPESANIPHQLNQNR-----KPQAAAAVVGVIGLFVIL  1338
             + +NP KP  FG  SN     DI E +      NQ++     K    A +  V  + VIL
Sbjct  164   TQINPVKP--FGSHSNDTTPIDISEPSGFKEHCNQSQCSNSSKFPQIAVLAAVTSVTVIL  221

Query  1337  AVAGLFTFSWYRRRKQQIGSTVDISESRVSTDQ--PKVLCRRSTSPLISLEYSNGWDPLA  1164
             A  G+  F  YRR KQ+IG+T + S+ ++STD    K   R   SPL+SLEY +GWDPL 
Sbjct  222   AGTGILIFFRYRRHKQKIGNTSESSDWQLSTDLTLAKDFNRNGASPLVSLEYCHGWDPLG  281

Query  1163  KDQSGSALSQEVLESFMFNLDEVESATQYFSETNLLGKSSFSAVYKGTLRDGSAVAVKCI  984
                +G+  S+E L SF  NL+EVESATQ FSE NLLGK +FS+VYKGTLRDG+ VA++ I
Sbjct  282   DYLNGTGFSREHLNSFRLNLEEVESATQCFSEVNLLGKGNFSSVYKGTLRDGTLVAIRSI  341

Query  983   SKTSCKSDEAEFRKGLTLLTSLKHENLLRLRGFCCSKGRGECFLIYDFVSNGNLLRYLDV  804
             + TSCKS+EAEF KGL LLTSL+HEN++RLRGFCCS+GRGECFLIYDF   G L +YLD 
Sbjct  342   NVTSCKSEEAEFVKGLYLLTSLRHENIIRLRGFCCSRGRGECFLIYDFAPKGKLSKYLDQ  401

Query  803   KDEKGKVLDWSTRTAIIKGIARGIKYLHGNKRNKPALVHRNISADKVLIDHLYKPLLSDS  624
             ++    VLDWSTR +II GIA+GI YLH ++ NKPA+VHRN+S +KVLID  + PL++D 
Sbjct  402   EEGSSNVLDWSTRVSIIIGIAKGIGYLHSSEVNKPAIVHRNLSVEKVLIDQQFNPLIADC  461

Query  623   GLHKLLADDIVFSTLKGSAANGYLAPEYAITGRFTEKSDMYAFGVIILQILSGSCVVTQS  444
             GLHKLLADDIVFS LK SAA GYLAPEY  TGRFTE+SD++AFGVIILQIL+GS V+T S
Sbjct  462   GLHKLLADDIVFSVLKTSAAMGYLAPEYVTTGRFTERSDIFAFGVIILQILTGSLVLTSS  521

Query  443   NHQGAELCRFEDFVDAKLGKDFVESEAAKLGKIALLCTHDSPSRRPAIDVVIQ  285
                 AE   FE+F+D  L   F ESEAAKLGK+AL+CTH+ P  RP ++ VI+
Sbjct  522   MRLAAESATFENFIDRNLKGKFSESEAAKLGKMALVCTHEDPENRPTMEAVIE  574



>ref|XP_008377897.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At4g36180, partial [Malus domestica]
Length=500

 Score =   557 bits (1435),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 298/523 (57%), Positives = 359/523 (69%), Gaps = 66/523 (13%)
 Frame = -3

Query  1859  LQVLQLCYNRFEGCIPNKLGSLKNLTVLALQSNQLTGAIPASlggltlltrldLSFNRLF  1680
               VLQLCYN+  G IP +LGSLKNL+VLALQSN LTGAIPA+                  
Sbjct  31    FSVLQLCYNQLTGSIPTQLGSLKNLSVLALQSNHLTGAIPAT------------------  72

Query  1679  GSIPVKLSEASKLEVLDLRNNTLSGNVPLGLKRLNEGFRYENNPGLCGTGFPSLALCSDS  1500
                     +A  LEVLD+RNNTLSGNVPL LKRLNEGF YENN GLCG GF SL  C+ S
Sbjct  73    --------DAPVLEVLDVRNNTLSGNVPLALKRLNEGFSYENNLGLCGAGFMSLTACTTS  124

Query  1499  SL-NPTKPEPFGQGSNRLPTKDIPESANIPHQLNQNR-----KPQAAAAVVGVIGLFVIL  1338
                N ++PEPFG G   +PT+D PE+AN+P   NQ R     K   A+  V V  + V +
Sbjct  125   GHPNASRPEPFGAG---VPTRDFPETANVPLPCNQTRCSNLSKSHQASVAVVVGVIVVTI  181

Query  1337  AVAGL--FTFSWYRRRKQQIGSTVDISESRVSTDQPKV--LCRRSTSPLISLEYSNGWDP  1170
             A++G+    F+ +RRRKQ++G++ D +E R STD+ K   + R++ SPLISLEY+NGWDP
Sbjct  182   ALSGVGFVFFTQHRRRKQKLGNSFDTAEGRFSTDEAKANGVYRKNGSPLISLEYANGWDP  241

Query  1169  LAKDQSGSALSQEVLESFMFNLDEVESATQYFSETNLLGKSSFSAVYKGTLRDGSAVAVK  990
             LA  ++ S  +QEV  SF FNL+EV                           DGSAVA+K
Sbjct  242   LANGRNLSVFAQEVFGSFRFNLEEV---------------------------DGSAVAIK  274

Query  989   CISKTSCKSDEAEFRKGLTLLTSLKHENLLRLRGFCCSKGRGECFLIYDFVSNGNLLRYL  810
              I K+ CK++E+EF KGL +LTSL+HENL++LRGFCCSKGRGECFLIYDFV NGNLL+YL
Sbjct  275   SIGKSCCKTEESEFLKGLNMLTSLRHENLVKLRGFCCSKGRGECFLIYDFVPNGNLLQYL  334

Query  809   DVKDEKGKVLDWSTRTAIIKGIARGIKYLHGNKRNKPALVHRNISADKVLIDHLYKPLLS  630
             DVKD    VL+W+TR  I+KGIA+G+ YLHG K NKP LVH+NISA+KVLID  Y PLLS
Sbjct  335   DVKDGDSHVLEWTTRVCIVKGIAKGLSYLHGYKPNKPPLVHQNISAEKVLIDQRYNPLLS  394

Query  629   DSGLHKLLADDIVFSTLKGSAANGYLAPEYAITGRFTEKSDMYAFGVIILQILSGSCVVT  450
             DSGLHKLL +D+VFS LK SAA GYLAPEY  TGRFTEKSD+YAFGV+ILQILSG   VT
Sbjct  395   DSGLHKLLTNDVVFSALKASAAMGYLAPEYTTTGRFTEKSDVYAFGVLILQILSGKRKVT  454

Query  449   QSNHQGAELCRFEDFVDAKLGKDFVESEAAKLGKIALLCTHDS  321
              +   GAE  RF+DF+D  L   F E EA+KL K ALLCTH+S
Sbjct  455   SAMRVGAESGRFQDFIDQNLNGRFFEYEASKLAKTALLCTHES  497



>gb|EYU24995.1| hypothetical protein MIMGU_mgv1a002428mg [Erythranthe guttata]
Length=521

 Score =   553 bits (1426),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 299/506 (59%), Positives = 378/506 (75%), Gaps = 20/506 (4%)
 Frame = -3

Query  2216  ASTVSLLMAIKASLDPGNLVLSSWSPNVTDPCSVSSFEGIACNDLGQVVNISLQGKGLYG  2037
             +S ++ L+ +KASLDP NL L SW  +  DPC   +FEG+ACN+  QV NISLQGKGL G
Sbjct  22    SSELTSLLDLKASLDPENLHLGSWVGS-GDPCG-GTFEGVACNEKRQVANISLQGKGLAG  79

Query  2036  KIPPEIGQLNGLSGLYLHFNNLHGVIPKEIASLTQLSDLYLNMNDLSGFIPSEIGNMPNL  1857
             K+ P +G L  L+GLYLH+N+L+G IP EIA LT+LSDLYLN+N+LSG IP  + +M NL
Sbjct  80    KLSPAVGGLKHLTGLYLHYNSLYGEIPLEIADLTELSDLYLNVNNLSGEIPPALEHMQNL  139

Query  1856  QVLQLCYNRFEGCIPNKLGSLKNLTVLALQSNQLTGAIPASlggltlltrldLSFNRLFG  1677
             QVLQLCYN   G IP +L SL  L VLA+QSNQLTGAIPASLG L +L RLDLSFNRLFG
Sbjct  140   QVLQLCYNHLTGSIPTQLASLTKLNVLAIQSNQLTGAIPASLGDLPVLMRLDLSFNRLFG  199

Query  1676  SIPVKLSEASKLEVLDLRNNTLSGNVPLGLKRLNEGFRYENNPGLCGTGFPSLALCSDSS  1497
             SIP KL++A  LEVLD+RNNTLSGNVPL LKRL +GF YENNP LCG+GF SL  C    
Sbjct  200   SIPTKLADAPLLEVLDVRNNTLSGNVPLALKRLVDGFHYENNPELCGSGFSSLQTCGP--  257

Query  1496  LNPTKPEPFGQGSNRLPTKDIPESANIPHQLNQNRKPQA--------AAAVVGVIGLFVI  1341
              N  +PEP+  GS    TK+IPE+A++   LN ++   +        A+  VG+I + V+
Sbjct  258   -NSERPEPYSGGSMGSTTKNIPETADL--NLNCSQSSCSNKSSKTSQASVAVGIIVITVM  314

Query  1340  LAVAGLFTFSWYRRRKQQIGSTV-DISESRVSTDQP---KVLCRRSTSPLISLEYSNGWD  1173
             ++ A + TFS YRRRKQ++GS   D SESR+STD     +   R++ SPL+SLEYSNGWD
Sbjct  315   VSFAAILTFSIYRRRKQKLGSAAFDASESRLSTDNHVNNETYNRKNGSPLVSLEYSNGWD  374

Query  1172  PLAKDQSG-SALSQEVLESFMFNLDEVESATQYFSETNLLGKSSFSAVYKGTLRDGSAVA  996
             PL+ D+     +S EV+++F  NL EVE+ATQYF++ N+LGKS++S  Y+G LRDGS VA
Sbjct  375   PLSDDRRFLGFVSHEVVKNFRLNLQEVETATQYFADKNILGKSNYSVTYRGNLRDGSVVA  434

Query  995   VKCISKTSCKSDEAEFRKGLTLLTSLKHENLLRLRGFCCSKGRGECFLIYDFVSNGNLLR  816
             VK I+K+SCKS+E+EF KGL +LTSL+HENL+ LRGFCCSKGRGECFL+YDFV NG+LLR
Sbjct  435   VKRITKSSCKSEESEFLKGLNMLTSLRHENLVMLRGFCCSKGRGECFLVYDFVPNGSLLR  494

Query  815   YLDVKDEKGKVLDWSTRTAIIKGIAR  738
             YLD++    ++L WSTR +II GIA+
Sbjct  495   YLDLEKGDARILGWSTRVSIINGIAK  520



>ref|XP_010676668.1| PREDICTED: protein NSP-INTERACTING KINASE 2 isoform X2 [Beta 
vulgaris subsp. vulgaris]
Length=575

 Score =   555 bits (1429),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 288/536 (54%), Positives = 369/536 (69%), Gaps = 11/536 (2%)
 Frame = -3

Query  1859  LQVLQLCYNRFEGCIPNKLGSLKNLTVLALQSNQLTGAIPASlggltlltrldLSFNRLF  1680
             + VL LC N   G IP +L SL  L  L LQ+NQL G+IP SLG L +L RLDLS+N L 
Sbjct  32    IDVLDLCCNHLTGNIPTQLSSLSKLGALYLQNNQLNGSIPPSLGSLDMLKRLDLSYNHLS  91

Query  1679  GSIPVKLSEASKLEVLDLRNNTLSGNVPLGLKRLNEGFRYENNPGLCGTGFPSLALCS--  1506
             G IPV L+    L++LD+RNN+LSG +P  LKRL+ GF Y+NN  LCG  F  L  C+  
Sbjct  92    GPIPVTLANIQPLKILDVRNNSLSGAIPTSLKRLDTGFLYQNNTKLCGPAFFKLRACTAF  151

Query  1505  -DSSLNPTKPEPFGQ--GSNRLPTKDIPESAN------IPHQLNQNRKPQAAAAVVGVIG  1353
              +++++   P PFG    ++  P  + P++A        P   +Q  K      V+GVI 
Sbjct  152   DNANVDVNTPRPFGLILNNHTTPKHEEPKNATDLQTDCSPSTCSQPTKFPRIVIVIGVIT  211

Query  1352  LFVILAVAGLFTFSWYRRRKQQIGSTVDISESRVSTDQPKVLCRRSTSPLISLEYSNGWD  1173
               V LA  G  T+  YRR+KQ+IG+TVD SESR STD    L  ++ SPL+SL YS GWD
Sbjct  212   GLVTLAAVGFLTYIRYRRQKQKIGTTVDASESRFSTDHANELHSKNASPLVSLAYSTGWD  271

Query  1172  PLAKDQSGSALSQEVLESFMFNLDEVESATQYFSETNLLGKSSFSAVYKGTLRDGSAVAV  993
             PLA   +   LSQE L++F +NL+EVESATQYFSE N+LG+ +FS V+KG LRDGS VA+
Sbjct  272   PLADGLNSGDLSQEALQNFRYNLEEVESATQYFSEANVLGRGNFSTVFKGVLRDGSVVAI  331

Query  992   KCISKTSCKSDEAEFRKGLTLLTSLKHENLLRLRGFCCSKGRGECFLIYDFVSNGNLLRY  813
             K IS  SCKS+EAEF KGL LL SL+HENL  LRGFCCS+GRGECF IYDF   GNLL+Y
Sbjct  332   KSISVNSCKSEEAEFVKGLNLLVSLRHENLAGLRGFCCSRGRGECFFIYDFAPKGNLLKY  391

Query  812   LDVKDEKGKVLDWSTRTAIIKGIARGIKYLHGNKRNKPALVHRNISADKVLIDHLYKPLL  633
             LDV +   +VLDW+TR  I+KGIA+G++YLH    NK  +VH+NISA+K+ ID+ Y PL+
Sbjct  392   LDVSNGNDRVLDWTTRVNIVKGIAKGLRYLHEENENKAPVVHQNISAEKIAIDNHYNPLI  451

Query  632   SDSGLHKLLADDIVFSTLKGSAANGYLAPEYAITGRFTEKSDMYAFGVIILQILSGSCVV  453
              DSGL K+LADD +FS LK SAA GYLAPEY  TGRFTEKSD+Y+FGV++L I++G   +
Sbjct  452   LDSGLRKILADDTIFSALKMSAAMGYLAPEYITTGRFTEKSDVYSFGVVVLHIITGKQQL  511

Query  452   TQSNHQGAELCRFEDFVDAKLGKDFVESEAAKLGKIALLCTHDSPSRRPAIDVVIQ  285
             T +    AE C+ EDFVD  L  +F  +EAA+L ++AL CTH+ P  RP ++VV+Q
Sbjct  512   TNALRSAAESCKLEDFVDQNLNGNFSMTEAARLVRLALACTHELPDERPNMEVVVQ  567



>ref|XP_002880175.1| hypothetical protein ARALYDRAFT_346342 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH56434.1| hypothetical protein ARALYDRAFT_346342 [Arabidopsis lyrata subsp. 
lyrata]
Length=503

 Score =   550 bits (1417),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 287/489 (59%), Positives = 357/489 (73%), Gaps = 23/489 (5%)
 Frame = -3

Query  1697  SFNRLFGSIPVKLSEASKLEVLDLRNNTLSGNVPLGLKRLNEGFRYENNPGLCGTGFPSL  1518
             SFN LFG +PVKL+ A  LEVLD+RNN L  + PL   RLN GF+Y NN GLCG GF  L
Sbjct  11    SFNNLFGPVPVKLAGAPLLEVLDIRNNPLPASFPL---RLNNGFQYSNNHGLCGDGFTDL  67

Query  1517  ALCSD-SSLNPTKPEPFGQGSNRLPTKDI-PESANIPHQLNQNR---------KPQAAAA  1371
               C+  +  N  +P+P         T D+ PESA++      N          K      
Sbjct  68    NACTGLNGPNLNRPDP--TNPTNFTTVDVKPESADLQRSNCSNNNGVCSSKTSKSSPLGI  125

Query  1370  VVGVIGLFVILAVAGLFTFSWYRRRKQQIGSTVDISESRVSTDQ--PKVLCRRSTSPLIS  1197
             V+G++G  + +A+ G  TF+WYRRRKQ+IGS++D  + R+ST+    +V  R+S+SPLIS
Sbjct  126   VMGLMGSILAVAIFGGSTFTWYRRRKQKIGSSLDAMDGRISTEYNFKEVSRRKSSSPLIS  185

Query  1196  LEYSNGWDPLAKDQS---GSALSQEVLESFMFNLDEVESATQYFSETNLLGKSSFSAVYK  1026
             LEY++GWDPL + QS    SALSQEV ESFMFNL+E E ATQ FSE NLLGKS+ S+VYK
Sbjct  186   LEYASGWDPLGRGQSSNNNSALSQEVFESFMFNLEENERATQSFSEVNLLGKSNVSSVYK  245

Query  1025  GTLRDGSAVAVKCISKTSCKSDEAEFRKGLTLLTSLKHENLLRLRGFCCSKGRGECFLIY  846
             G LRDGS  AVKCI+K+SCKSDE+EF KGL +LT LKHENL+RLRGFCCSKGRGECFLIY
Sbjct  246   GILRDGSVAAVKCIAKSSCKSDESEFLKGLKMLTLLKHENLVRLRGFCCSKGRGECFLIY  305

Query  845   DFVSNGNLLRYLDVKDEKGKVLDWSTRTAIIKGIARGIKYLHGNKRNKPALVHRNISADK  666
             +FV NGNLL+YLDVKDE G+VL+W+TR +II GIARGI YLHG   NKPA+VH+N+SA+K
Sbjct  306   EFVPNGNLLQYLDVKDETGEVLEWTTRVSIINGIARGIVYLHGENGNKPAIVHQNLSAEK  365

Query  665   VLIDHLYKPLLSDSGLHKLLADDIVFSTLKGSAANGYLAPEYAITGRFTEKSDMYAFGVI  486
             +LIDH Y P L+DSGLHKL  DDIVFS LK SAA GYLAPEY  TGRFT+KSD+YAFG+I
Sbjct  366   ILIDHWYNPSLADSGLHKLFTDDIVFSKLKASAAMGYLAPEYITTGRFTDKSDVYAFGMI  425

Query  485   ILQILSGSCVVTQ-SNHQGAELCRF-EDFVDAKLGKDFVESEAAKLGKIALLCTHDSPSR  312
             +LQILSG   ++     Q  E  R  EDF+D  L K+F E+EAA+L ++ LLCTH+S ++
Sbjct  426   LLQILSGKSKISHLMILQAVESGRLNEDFMDPNLRKNFPEAEAAELARLGLLCTHESSNQ  485

Query  311   RPAIDVVIQ  285
             RP+++ V+Q
Sbjct  486   RPSMEDVMQ  494



>gb|KCW49798.1| hypothetical protein EUGRSUZ_K03279 [Eucalyptus grandis]
Length=550

 Score =   551 bits (1420),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 287/494 (58%), Positives = 374/494 (76%), Gaps = 9/494 (2%)
 Frame = -3

Query  2198  LMAIKASLDPGNLVLSSWSPNVTDPCSVSSFEGIACNDLGQVVNISLQGKGLYGKIPPEI  2019
             LM +KASLDP +  LSSW+ +  DPC   SF+G+ C+D G+V N+SLQG+ L G++ P I
Sbjct  41    LMDMKASLDPESRYLSSWTVD-GDPCD-GSFQGVCCDDEGRVANVSLQGRRLTGRLSPAI  98

Query  2018  GQLNGLSGLYLHFNNLHGVIPKEIASLTQLSDLYLNMNDLSGFIPSEIGNMPNLQVLQLC  1839
               L  L+GLYLH+N+L G IP+E+ +L+ LSDLYLNMN+LSG IP E+ ++ +LQV+QL 
Sbjct  99    AGLTHLTGLYLHYNSLCGEIPRELGNLSALSDLYLNMNNLSGQIPPEMADIASLQVMQLS  158

Query  1838  YNRFEGCIPNKLGSLKNLTVLALQSNQLTGAIPASlggltlltrldLSFNRLFGSIPVKL  1659
             YN+  G IP KLGSLK L+VLALQSNQLTGAIPASLG L  LTRL LSFNRLFGSIP+K+
Sbjct  159   YNQLTGSIPTKLGSLKKLSVLALQSNQLTGAIPASLGDLGTLTRLYLSFNRLFGSIPMKI  218

Query  1658  SEASKLEVLDLRNNTLSGNVPLGLKRLNEGFRYENNPGLCGTGFPSLALCSD-SSLNPTK  1482
             ++   LEVLD++NNTLSGNVP  LKRLNEGF YENN  LCGTGF SL  C+      P++
Sbjct  219   ADLPLLEVLDVQNNTLSGNVPPALKRLNEGFLYENNFDLCGTGFLSLRTCNALEGRKPSQ  278

Query  1481  PEPFGQGSNRLPTKDIPESANI--PHQLNQ-NRKPQAA--AAVVGVIGLFVILAVAGLFT  1317
             P+P+G  +  +P+  IPE+AN+  P  L + +  P++A  +A++G I   V L+  G   
Sbjct  279   PQPYGAATT-VPSTSIPETANVVLPCNLTECSSLPKSAHPSALIGSILATVALSAIGFLL  337

Query  1316  FSWYRRRKQQIGSTVDISESRVSTDQPKVLCRRSTSPLISLEYSNGWDPLAKDQSGSALS  1137
             F+ YRRRKQ++G + ++ +  +STDQPK   +++ SPL SLEYSNGWDPLA  +  +  S
Sbjct  338   FTHYRRRKQKLGFSAEVCDGHLSTDQPKSAYKKNGSPLASLEYSNGWDPLADARIFNEFS  397

Query  1136  QEVLESFMFNLDEVESATQYFSETNLLGKSSFSAVYKGTLRDGSAVAVKCISKTSCKSDE  957
             +E  +SF FNL+EVESATQYFSE N+LGKS+FS  Y+G LRDGS V++KCI+KTSCK+DE
Sbjct  398   EEAFQSFRFNLEEVESATQYFSELNVLGKSNFSTTYRGILRDGSVVSIKCINKTSCKADE  457

Query  956   AEFRKGLTLLTSLKHENLLRLRGFCCSKGRGECFLIYDFVSNGNLLRYLDVKDEKGKVLD  777
             +EF KGL +LTSL+HENL+RLRGFCCS  RGECFLIYD+V NG LL +LD+++     L+
Sbjct  458   SEFLKGLNMLTSLRHENLVRLRGFCCSTARGECFLIYDYVPNGTLLSFLDLEEGDSGTLE  517

Query  776   WSTRTAIIKGIARG  735
             WSTR +I+KGIA+G
Sbjct  518   WSTRVSIVKGIAKG  531



>ref|XP_002880174.1| hypothetical protein ARALYDRAFT_346340 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH56433.1| hypothetical protein ARALYDRAFT_346340 [Arabidopsis lyrata subsp. 
lyrata]
Length=503

 Score =   536 bits (1380),  Expect = 8e-179, Method: Compositional matrix adjust.
 Identities = 286/489 (58%), Positives = 356/489 (73%), Gaps = 23/489 (5%)
 Frame = -3

Query  1697  SFNRLFGSIPVKLSEASKLEVLDLRNNTLSGNVPLGLKRLNEGFRYENNPGLCGTGFPSL  1518
             SFN LFG +PVKL+ A  LEVLD+RNN L  + PL   RLN GF+Y NN GLCG GF  L
Sbjct  11    SFNNLFGPVPVKLAGAPLLEVLDIRNNPLPASFPL---RLNNGFQYSNNHGLCGDGFTDL  67

Query  1517  ALCSD-SSLNPTKPEPFGQGSNRLPTKDI-PESANIPHQLNQNR---------KPQAAAA  1371
               C+  +  N  +P+P         T D+ PESA++      N          K      
Sbjct  68    NACTGLNGPNLNRPDP--TNPTNFTTVDVKPESADLQRSNCSNNNGVCSSKTSKSSPLGI  125

Query  1370  VVGVIGLFVILAVAGLFTFSWYRRRKQQIGSTVDISESRVSTDQ--PKVLCRRSTSPLIS  1197
             V+G++G  + +A+ G  TF+WYRRRKQ+IGS++D  + R+ST+    +V  R+S+SPLIS
Sbjct  126   VMGLMGSILAVAIFGGSTFTWYRRRKQKIGSSLDAMDGRISTEYNFKEVSRRKSSSPLIS  185

Query  1196  LEYSNGWDPLAKDQS---GSALSQEVLESFMFNLDEVESATQYFSETNLLGKSSFSAVYK  1026
             LEY++GWDPL + QS    SALSQEV ESFMFNL+E+E ATQ FSE NLLGKS+ S+VYK
Sbjct  186   LEYASGWDPLGRGQSSNNNSALSQEVFESFMFNLEEIERATQSFSEVNLLGKSNVSSVYK  245

Query  1025  GTLRDGSAVAVKCISKTSCKSDEAEFRKGLTLLTSLKHENLLRLRGFCCSKGRGECFLIY  846
             G LRDGS  AVKCI+K+SCKSDE+EF KGL  LT LKHENL+RLRGFCCSKGRGECFLIY
Sbjct  246   GILRDGSVAAVKCIAKSSCKSDESEFLKGLKTLTLLKHENLVRLRGFCCSKGRGECFLIY  305

Query  845   DFVSNGNLLRYLDVKDEKGKVLDWSTRTAIIKGIARGIKYLHGNKRNKPALVHRNISADK  666
             +FV NGNLL+YLDVKDE G+VL+W+TR +II GIARGI YLHG   NKPA+VH+N+SA+K
Sbjct  306   EFVPNGNLLQYLDVKDETGEVLEWTTRVSIINGIARGIVYLHGENGNKPAIVHQNLSAEK  365

Query  665   VLIDHLYKPLLSDSGLHKLLADDIVFSTLKGSAANGYLAPEYAITGRFTEKSDMYAFGVI  486
             +LIDH Y P L+DSGLHKL  DDIVFS LK SAA GYLAPEY  TGRFT+KSD+YAFG+I
Sbjct  366   ILIDHWYNPSLADSGLHKLFTDDIVFSKLKASAAMGYLAPEYITTGRFTDKSDVYAFGMI  425

Query  485   ILQILSGSCVVTQ-SNHQGAELCRF-EDFVDAKLGKDFVESEAAKLGKIALLCTHDSPSR  312
             +LQILSG   ++     Q  E  R  EDF+D  L K+F E+E A+L ++ LLCTH+S ++
Sbjct  426   LLQILSGKSKISHLMILQAVESGRLNEDFMDPNLRKNFPEAEGAELARLGLLCTHESSNQ  485

Query  311   RPAIDVVIQ  285
             RP+++ V+Q
Sbjct  486   RPSMEDVMQ  494



>ref|NP_001140286.1| uncharacterized protein LOC100272330 [Zea mays]
 gb|ACN32044.1| unknown [Zea mays]
Length=513

 Score =   534 bits (1375),  Expect = 6e-178, Method: Compositional matrix adjust.
 Identities = 295/509 (58%), Positives = 372/509 (73%), Gaps = 15/509 (3%)
 Frame = -3

Query  1772  LQSNQLTGAIPASlggltlltrldLSFNRLFGSIPVKLSEASKLEVLDLRNNTLSGNVPL  1593
             +QSNQL GAIPA+LG LT L RLDLSFN LFGSIP K++E   LEV D+RNNTLSG+VP+
Sbjct  1     MQSNQLDGAIPATLGELTQLRRLDLSFNSLFGSIPSKIAEVPLLEVFDVRNNTLSGSVPV  60

Query  1592  GLKRLNEGFRYENNPGLCGTGFPSLALC--SDSSLNPTKPEPFGQGSNRLPTKDIPESAN  1419
             GL+RLN GF+Y NN GLCG GF  L LC  S+  L P+KPEPFG     + T+ +P+SAN
Sbjct  61    GLRRLNGGFQYMNNKGLCGAGFSLLELCLSSEDGLKPSKPEPFGP-DGTVKTRQVPQSAN  119

Query  1418  IPHQLNQNRKPQAAAA-----VVGVIGLFVILAVAGLFTFSWYRRRKQQIGSTVDISESR  1254
              P   +     ++A A     +V V+   +  A  GLF FSWYRR+KQ+IGS++++S+SR
Sbjct  120   -PDGCSGASCSKSANASQGVLIVAVVAAVIGAAFCGLFAFSWYRRQKQKIGSSLEVSDSR  178

Query  1253  VSTD--QPKVLCRRSTSPLISLEYSNGWDPLAKDQSG-SALSQEVLESFMFNLDEVESAT  1083
             +STD  Q K  CRRS SPLIS+EYSN WDPL+   +G  +  Q V +SF FNL+EVE AT
Sbjct  179   LSTDHFQQKEACRRSASPLISVEYSNSWDPLSAGGAGVGSPGQVVGDSFRFNLEEVECAT  238

Query  1082  QYFSETNLLGKSSFSA-VYKGTLRDGSAVAVKCISKTSCKSDEAEFRKGLTLLTSLKHEN  906
             QYFS+ NLLGKS F+A  YKG LRDGS VAVK +SKTSCK +E++F +GL +LT L+H+N
Sbjct  239   QYFSDVNLLGKSGFAAATYKGILRDGSVVAVKSLSKTSCKQEESDFLRGLKMLTLLQHDN  298

Query  905   LLRLRGFCCSKGRGECFLIYDFVSNGNLLRYLDVKD--EKGKVLDWSTRTAIIKGIARGI  732
             L+ LRGFCCS+GRGECFL+YDF+ NG L RYLDVKD      VLDW TR +II+GIA+GI
Sbjct  299   LVSLRGFCCSRGRGECFLVYDFMVNGCLSRYLDVKDGSSGATVLDWPTRVSIIRGIAKGI  358

Query  731   KYLHGNKRNKPALVHRNISADKVLIDHLYKPLLSDSGLHKLLADDIVFSTLKGSAANGYL  552
             +YLH  K +KP +VH+NISADK+L+DH   P LS  GLHKLLADD+VFS LK SAA GYL
Sbjct  359   EYLHSKKGSKPPVVHQNISADKILLDHHLAPRLSVPGLHKLLADDVVFSALKASAAMGYL  418

Query  551   APEYAITGRFTEKSDMYAFGVIILQILSGSCVVTQSNHQGAELCRFEDFVDAKLGKDFVE  372
             APEYA TGRFT+KSD++AFGV++LQ+L+G   V+Q     A +      VDA L   F  
Sbjct  419   APEYAATGRFTDKSDVFAFGVVVLQVLTGRRDVSQLKVGAAAVSDLGGLVDANLDGAFSR  478

Query  371   SEAAKLGKIALLCTHDSPSRRPAIDVVIQ  285
             +EAA+L  +A  CT ++P +RP ++ V+Q
Sbjct  479   TEAARLAAVAAYCTSETPGQRPTMEAVVQ  507



>gb|EPS61496.1| hypothetical protein M569_13300 [Genlisea aurea]
Length=650

 Score =   530 bits (1366),  Expect = 1e-174, Method: Compositional matrix adjust.
 Identities = 312/664 (47%), Positives = 422/664 (64%), Gaps = 57/664 (9%)
 Frame = -3

Query  2228  TSNNASTVSLLMAIKASLDPGNLVLSSWSPNVTDPCSVSSFEGIACNDLGQVVNISLQGK  2049
              ++ A  +  LM IK+SLDP N  L++W+PN  DPCS  +F+G+ACN   +V N+SLQGK
Sbjct  18    AASGAGELQALMEIKSSLDPENKFLTTWTPN-GDPCS-GNFDGVACNSDRRVENVSLQGK  75

Query  2048  GLYGKIPPEIGQLNGLSGLYLHFNNLHGVIPKEIASLTQLSDLYLNMNDLSGFIPSEIGN  1869
             GL GK+PP + +L  L+GLYLH+N L G +PKEIA LT L+DLYL++N+LSG IP EIG 
Sbjct  76    GLTGKLPPAVARLKSLTGLYLHYNYLSGEVPKEIADLTLLTDLYLDVNNLSGTIPPEIGT  135

Query  1868  MPNLQVLQLCYNRFEGCIPNKLGSLKNLTVLALQSNQLTGAIPASlggltlltrldLSFN  1689
             MP+LQVLQLC NR  G IP  LG L  LTV+AL+ NQL G IP SL  +  L RL LSFN
Sbjct  136   MPSLQVLQLCCNRLTGEIPASLGQLGKLTVMALERNQLAGGIPESLSAVASLNRLYLSFN  195

Query  1688  RLFGSIPVKLSEASKLEVLDLRNNTLSGNVPLGLKRLNEGFRYENNPGLCGTGFPSLALC  1509
             RL GSIP  +++  +LEVLD++ N LSG +P GL RL +GFRY NN GLCG+GFPS+  C
Sbjct  196   RLSGSIPAGVADMPRLEVLDVQFNNLSGVIPSGLSRLKDGFRYGNNSGLCGSGFPSVRGC  255

Query  1508  SD---------SSLNPTK------PEPFGQGSNRLPTKDIPESANIPHQLNQNRKPQAAA  1374
             +          S ++P +      P  F QG          E   IP + + +R P    
Sbjct  256   TQWDYGAAAGISPVDPNRTVFLPTPANFTQGG---------EPPLIPSKSSPSRFPLVDI  306

Query  1373  AVVGVIGLFVILAVAGLFTFSWYRRRKQQIGSTVDISESRVSTDQPKVLCRRSTSPLISL  1194
                 ++   ++L  A     S +RRR++    +    +      + ++  R  +      
Sbjct  307   IAGAIVSTALVLTAAAAILVSTFRRRRRLGRRSELPDQPEQGIGKKRIESRGGS------  360

Query  1193  EYSNGWDPLAKDQSGSALSQEVLESFMFNLDEVESATQYFSETNLLGKSSFSAVYKGTLR  1014
                  W+             E+   +  NL+EVESAT +FSE NLLG+S FS VYKG L+
Sbjct  361   -----WE-------------EIPAHYRLNLEEVESATHHFSEMNLLGRSKFSGVYKGILK  402

Query  1013  DGSAVAVKCISKTSCKSDEAEFRKGLTLLTSLKHENLLRLRGFCCSKGRGECFLIYDFVS  834
             DGSAVA+K ISKTSCK++E EF  GL LL SL + NL +L+GFCCSK RGECFLIY+F  
Sbjct  403   DGSAVAIKSISKTSCKTEEDEFVDGLNLLKSLNNPNLAKLKGFCCSKDRGECFLIYEFAE  462

Query  833   NGNLLRYLDVKDEKGKVLDWSTRTAIIKGIARGIKYLHGNKRNKPALVHRNISADKVLID  654
              G+L +YLD      +VL+W TR +II+GIA+  +YLH +   KP +VH+NISA+KV++D
Sbjct  463   RGSLSQYLD----NDRVLEWPTRVSIIQGIAK--EYLHRDVPEKPRIVHKNISAEKVVLD  516

Query  653   HLYKPLLSDSGLHKLLADDIVFSTLKGSAANGYLAPEYAITGRFTEKSDMYAFGVIILQI  474
               + PL+ DSGL K+LADD+V+S +K SAA GY++PEY  TG+FTEKSD+YAFGVI+LQ+
Sbjct  517   ENWNPLILDSGLRKILADDVVYSAIKVSAALGYMSPEYITTGKFTEKSDVYAFGVIVLQV  576

Query  473   LSGSCVVTQSNHQGAELCRFEDFVDAKLGKDFVE-SEAAKLGKIALLCTHDSPSRRPAID  297
             LSG  +++ S    AE   +ED +D  L  + +  +EAA L K+A+ CT + P  RP + 
Sbjct  577   LSGRKILSNSARAAAEAGNWEDLLDPNLETNSLHPNEAAMLAKLAVDCTDEIPENRPTMA  636

Query  296   VVIQ  285
              V++
Sbjct  637   DVVE  640



>ref|XP_002511696.1| leucine rich repeat receptor kinase, putative [Ricinus communis]
 gb|EEF50365.1| leucine rich repeat receptor kinase, putative [Ricinus communis]
Length=382

 Score =   515 bits (1327),  Expect = 9e-173, Method: Compositional matrix adjust.
 Identities = 247/358 (69%), Positives = 291/358 (81%), Gaps = 0/358 (0%)
 Frame = -3

Query  1358  IGLFVILAVAGLFTFSWYRRRKQQIGSTVDISESRVSTDQPKVLCRRSTSPLISLEYSNG  1179
             + +F++L +  LFTF+WYRR+KQ+IGS  D S+ R+STDQ K + R+S SPLISLEYSNG
Sbjct  16    LAVFIVLTIIVLFTFTWYRRQKQKIGSAFDASDGRLSTDQAKEVYRKSASPLISLEYSNG  75

Query  1178  WDPLAKDQSGSALSQEVLESFMFNLDEVESATQYFSETNLLGKSSFSAVYKGTLRDGSAV  999
             WDPLA  Q+ + LSQE LESFMFNL+EVE ATQ FSE NLLGKS+F A YKG LRDGS V
Sbjct  76    WDPLAIGQNKNGLSQEFLESFMFNLEEVERATQCFSEVNLLGKSNFCATYKGILRDGSIV  135

Query  998   AVKCISKTSCKSDEAEFRKGLTLLTSLKHENLLRLRGFCCSKGRGECFLIYDFVSNGNLL  819
             AVKCI+KTSCKSDEA+F KGL +LTSLKHENL+RLRGFCCSKGRGECFLIYDFV NGNLL
Sbjct  136   AVKCITKTSCKSDEADFLKGLKILTSLKHENLVRLRGFCCSKGRGECFLIYDFVQNGNLL  195

Query  818   RYLDVKDEKGKVLDWSTRTAIIKGIARGIKYLHGNKRNKPALVHRNISADKVLIDHLYKP  639
             +YLDVK+   +VL+WSTR +II GIA+GI YLHGNK +K AL H+NISA+KV ID  Y P
Sbjct  196   QYLDVKEGTERVLEWSTRVSIINGIAKGIGYLHGNKGSKRALFHQNISAEKVFIDIRYSP  255

Query  638   LLSDSGLHKLLADDIVFSTLKGSAANGYLAPEYAITGRFTEKSDMYAFGVIILQILSGSC  459
             LLSDSGLHKLLADDIVFS LK SAA GYLAPEY  TGRFTEKSD+Y+FG+I+LQILSG  
Sbjct  256   LLSDSGLHKLLADDIVFSILKASAAMGYLAPEYTTTGRFTEKSDVYSFGMIVLQILSGKR  315

Query  458   VVTQSNHQGAELCRFEDFVDAKLGKDFVESEAAKLGKIALLCTHDSPSRRPAIDVVIQ  285
              +T       E C+ E F+DAKL   F E EA +LGK+ALLCTH+SP +RP ++ V++
Sbjct  316   NITAMIRHAVESCKVELFIDAKLEGKFSELEAIELGKLALLCTHESPDQRPTVETVLR  373



>ref|XP_006590549.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
GSO2-like isoform X2 [Glycine max]
Length=633

 Score =   522 bits (1345),  Expect = 9e-172, Method: Compositional matrix adjust.
 Identities = 284/539 (53%), Positives = 360/539 (67%), Gaps = 13/539 (2%)
 Frame = -3

Query  1865  PNLQVLQLCYNRFEGCIPNKLGSLKNLTVLALQSNQLTGAIPASlggltlltrldLSFNR  1686
             P   V +L  N+  G IP ++ SLK L+ LALQ N+LTG IP SLG L  L+RL+LSFN 
Sbjct  87    PTWLVSKLGDNQLVGTIPTQMSSLKQLSTLALQYNKLTGQIPLSLGNLEKLSRLNLSFNN  146

Query  1685  LFGSIPVKLSEASKLEVLDLRNNTLSGNVPLGLKRLNEGFRYENNPGLCGTGFPSLALCS  1506
               G++P  L+    LEVLD++NN+LSG VP  LKRL EGF+  NNPGLCG GF +L  C+
Sbjct  147   FSGTVPATLAHIEHLEVLDIQNNSLSGIVPSALKRLGEGFQGANNPGLCGVGFSTLRACN  206

Query  1505  ---DSSLNPTKPEPFGQGSNRLPTKDIPESANI------PHQLNQNRKPQAAAAVVGVIG  1353
                D ++N        Q  N   +K +PE A +       H     R PQ      GV+ 
Sbjct  207   KDQDLNVNHIDTSDGDQPKNSNSSKALPEPAYVQLHCGQTHCSKSRRFPQTVITA-GVVI  265

Query  1352  LFVILAVAGLFTFSWYRRRKQQIGSTVDIS-ESRVSTDQPKVLCRRSTSPLISLEYSNGW  1176
             + +    AG  TF  YRR+KQ+I +T+  S E +VS DQPK    +S S L++++Y +GW
Sbjct  266   VTLTFICAGFLTFFRYRRQKQRISNTLSSSSEGKVSLDQPKEFYTKSPSALVNIDYYSGW  325

Query  1175  DPLAKDQSGSA--LSQEVLESFMFNLDEVESATQYFSETNLLGKSSFSAVYKGTLRDGSA  1002
             D L+  Q+  A  LS E L  F FN+DEVESAT YFSE NLL +S F+A YKG LRDGS 
Sbjct  326   DQLSNGQNADAGGLSNEYLNQFRFNVDEVESATHYFSEANLLNRSKFAAGYKGVLRDGSL  385

Query  1001  VAVKCISKTSCKSDEAEFRKGLTLLTSLKHENLLRLRGFCCSKGRGECFLIYDFVSNGNL  822
             VA++ IS T CK++EAEF KGL LLTSL+HENL+RLRGFCCS+ RGECFLIYDF + GNL
Sbjct  386   VAIRSISVTCCKTEEAEFVKGLNLLTSLRHENLVRLRGFCCSRSRGECFLIYDFATMGNL  445

Query  821   LRYLDVKDEKGKVLDWSTRTAIIKGIARGIKYLHGNKRNKPALVHRNISADKVLIDHLYK  642
              +YLD++D    VL+WS R +IIKGIA GI YLH N+ +KP +VH+NIS + VL+D+ + 
Sbjct  446   SQYLDIEDGSSHVLEWSKRVSIIKGIANGIGYLHSNEESKPTIVHQNISVENVLLDYQFN  505

Query  641   PLLSDSGLHKLLADDIVFSTLKGSAANGYLAPEYAITGRFTEKSDMYAFGVIILQILSGS  462
             PL+ D+GL  LLADD+VFS LK SAA GYLAPEY  TGRFTEKSD+YAFGVIILQ+LSG 
Sbjct  506   PLIRDAGLPMLLADDVVFSALKVSAAMGYLAPEYITTGRFTEKSDIYAFGVIILQVLSGK  565

Query  461   CVVTQSNHQGAELCRFEDFVDAKLGKDFVESEAAKLGKIALLCTHDSPSRRPAIDVVIQ  285
               +  S     E  RF+D VD  L   + +SEAA L K+A+ CT++ P  RP +  VIQ
Sbjct  566   TTIGSSIRTAVESFRFDDSVDTNLKGIYSKSEAATLSKLAIQCTNELPDERPTMVDVIQ  624


 Score = 53.1 bits (126),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 28/73 (38%), Positives = 40/73 (55%), Gaps = 0/73 (0%)
 Frame = -3

Query  2084  LGQVVNISLQGKGLYGKIPPEIGQLNGLSGLYLHFNNLHGVIPKEIASLTQLSDLYLNMN  1905
             L Q+  ++LQ   L G+IP  +G L  LS L L FNN  G +P  +A +  L  L +  N
Sbjct  110   LKQLSTLALQYNKLTGQIPLSLGNLEKLSRLNLSFNNFSGTVPATLAHIEHLEVLDIQNN  169

Query  1904  DLSGFIPSEIGNM  1866
              LSG +PS +  +
Sbjct  170   SLSGIVPSALKRL  182



>gb|KEH27457.1| LRR receptor-like kinase [Medicago truncatula]
Length=524

 Score =   501 bits (1289),  Expect = 5e-165, Method: Compositional matrix adjust.
 Identities = 273/518 (53%), Positives = 350/518 (68%), Gaps = 15/518 (3%)
 Frame = -3

Query  1805  LGSLKNLTVLALQSNQLTGAIPASlggltlltrldLSFNRLFGSIPVKLSEASKLEVLDL  1626
             +GSLK LT LALQ N+LTG IP SLG L  L+RL+LSFN   G+IP  L+  + LEVLD+
Sbjct  1     MGSLKQLTTLALQYNKLTGQIPLSLGNLENLSRLNLSFNNFSGAIPATLANIAHLEVLDI  60

Query  1625  RNNTLSGNVPLGLKRLNEGFRYENNPGLCGTGFPSLALCS-DSSLNPTKPEPFGQG--SN  1455
             +NN+LSG VP  L+RL EGF+  NN GLCG G  +L  C+ +  LN +  +   Q    N
Sbjct  61    QNNSLSGTVPSVLQRLGEGFQGANNQGLCGVGISTLRACNKEPDLNVSNIDTSDQDHLKN  120

Query  1454  RLPTKDIPESANIPHQLNQNRKPQA--------AAAVVGVIGLFVILAVAGLFTFSWYRR  1299
               P    PE AN     NQ    ++         A+V+ +I L +I   AGLFTF  YRR
Sbjct  121   SNPATPRPEPANFQMHCNQKHCSKSRSVPTSVITASVIAIITLTII--GAGLFTFVKYRR  178

Query  1298  RKQQIGSTVDISESRVSTDQPKVLCRRSTSPLISLEYSNGWDPLAKDQSGSALSQEVLES  1119
             RKQ+I S  + SE ++S  QPK L ++S S L++L+Y NG  P+  DQ+   LS E L  
Sbjct  179   RKQKISS--NSSEGKLSPQQPKELYQKSPSTLVNLDYYNGCYPMPDDQNAGGLSNEYLNQ  236

Query  1118  FMFNLDEVESATQYFSETNLLGKSSFSAVYKGTLRDGSAVAVKCISKTSCKSDEAEFRKG  939
             F FN+DEVESATQYFSE NLL KS FSA YKG LRDGS VA+  I+ + CK++EAEF KG
Sbjct  237   FRFNVDEVESATQYFSEVNLLRKSKFSATYKGVLRDGSLVAITSINMSCCKTEEAEFVKG  296

Query  938   LTLLTSLKHENLLRLRGFCCSKGRGECFLIYDFVSNGNLLRYLDVKDEKGKVLDWSTRTA  759
             L+LLTSL+HEN+++LRGFCCS  RGEC+LI DF   G+L +YLD++D  G +LDWS R  
Sbjct  297   LSLLTSLRHENVVKLRGFCCSSSRGECYLINDFAMMGDLSQYLDIEDRSGHLLDWSKRVT  356

Query  758   IIKGIARGIKYLHGNKRNKPALVHRNISADKVLIDHLYKPLLSDSGLHKLLADDIVFSTL  579
             IIKGIA+GI YLH N+ +KP +VH+NIS + VL+D  + PL+ ++GL KLLADD+VFS L
Sbjct  357   IIKGIAKGIGYLHSNEASKPTIVHQNISVENVLLDKDFNPLIMNAGLPKLLADDVVFSAL  416

Query  578   KGSAANGYLAPEYAITGRFTEKSDMYAFGVIILQILSGSCVVTQSNHQGAELCRFEDFVD  399
             K SAA GYLAPEY  TGRFTEKSD+YAFGVI+LQ+LSG   +  S     +  +F+D +D
Sbjct  417   KVSAAMGYLAPEYITTGRFTEKSDIYAFGVIVLQVLSGKTAIGGSIRTAFQSFKFDDCID  476

Query  398   AKLGKDFVESEAAKLGKIALLCTHDSPSRRPAIDVVIQ  285
               L   +  SEA+ L K+ + C H+SP  RP +  VIQ
Sbjct  477   TNLKGRYSNSEASILTKLGMQCIHESPDERPNMVDVIQ  514


 Score = 53.9 bits (128),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 29/68 (43%), Positives = 39/68 (57%), Gaps = 0/68 (0%)
 Frame = -3

Query  2084  LGQVVNISLQGKGLYGKIPPEIGQLNGLSGLYLHFNNLHGVIPKEIASLTQLSDLYLNMN  1905
             L Q+  ++LQ   L G+IP  +G L  LS L L FNN  G IP  +A++  L  L +  N
Sbjct  4     LKQLTTLALQYNKLTGQIPLSLGNLENLSRLNLSFNNFSGAIPATLANIAHLEVLDIQNN  63

Query  1904  DLSGFIPS  1881
              LSG +PS
Sbjct  64    SLSGTVPS  71



>ref|XP_002509720.1| leucine rich repeat receptor kinase, putative [Ricinus communis]
 gb|EEF51107.1| leucine rich repeat receptor kinase, putative [Ricinus communis]
Length=451

 Score =   489 bits (1260),  Expect = 1e-161, Method: Compositional matrix adjust.
 Identities = 248/445 (56%), Positives = 314/445 (71%), Gaps = 6/445 (1%)
 Frame = -3

Query  1601  VPLGLKRLNEGFRYENNPGLCGTGFPSLALCSD-SSLNPTKPEPFGQGSNRLPTKDIPES  1425
             VP  L++LN GF++ENN GLCG GFP L  C+  +++N  + EP G  +N   +K+IP S
Sbjct  2     VPSALQKLNGGFQFENNKGLCGAGFPELRACTAFNNMNINQVEPSGPITNTTTSKNIPVS  61

Query  1424  ANIPHQLNQNR-----KPQAAAAVVGVIGLFVILAVAGLFTFSWYRRRKQQIGSTVDISE  1260
             A +    +Q +     K    A + GV    +IL         +YRR+KQ+IG+  + SE
Sbjct  62    AILQAPCDQTKCSNSSKFPQVAIISGVTTATIILIGVAFLIIFFYRRQKQKIGNISESSE  121

Query  1259  SRVSTDQPKVLCRRSTSPLISLEYSNGWDPLAKDQSGSALSQEVLESFMFNLDEVESATQ  1080
              R+STDQ K       SPL+SLEYSNGWDP    ++G  +S+  L +F FNL+EVESATQ
Sbjct  122   GRLSTDQAKEFHGAGASPLVSLEYSNGWDPFRGCRNGVGISEPSLNNFRFNLEEVESATQ  181

Query  1079  YFSETNLLGKSSFSAVYKGTLRDGSAVAVKCISKTSCKSDEAEFRKGLTLLTSLKHENLL  900
              FSE NLLGKSSFS+VYKG LR GS VAV+ I+ TSCKS+E EF KGL LLTSL+H+NL+
Sbjct  182   CFSEVNLLGKSSFSSVYKGILRGGSLVAVRSINITSCKSEEDEFMKGLNLLTSLRHDNLV  241

Query  899   RLRGFCCSKGRGECFLIYDFVSNGNLLRYLDVKDEKGKVLDWSTRTAIIKGIARGIKYLH  720
             RLRGFCCSKGRG+CFLIYDF   GNL RYLD++D    +L+WSTR +II GIA+GI+YLH
Sbjct  242   RLRGFCCSKGRGKCFLIYDFAPMGNLSRYLDLEDGSSHILEWSTRVSIINGIAKGIEYLH  301

Query  719   GNKRNKPALVHRNISADKVLIDHLYKPLLSDSGLHKLLADDIVFSTLKGSAANGYLAPEY  540
               + NKPA++HR +S +KVL+D  +KPL++DSGL K LADDIVFS +K SAA GYLAPEY
Sbjct  302   RGEANKPAIIHRRVSVEKVLLDQEFKPLMADSGLRKFLADDIVFSGIKTSAAMGYLAPEY  361

Query  539   AITGRFTEKSDMYAFGVIILQILSGSCVVTQSNHQGAELCRFEDFVDAKLGKDFVESEAA  360
               TG FTEKSD+YAFGVIILQILSG  +++ S    A   R+EDF+D  L  +F ESEAA
Sbjct  362   VTTGHFTEKSDIYAFGVIILQILSGQHMLSNSMRLAAASSRYEDFIDTNLKGNFSESEAA  421

Query  359   KLGKIALLCTHDSPSRRPAIDVVIQ  285
              L KIAL CT +   +RP ++ VIQ
Sbjct  422   MLSKIALDCTQELLEQRPTMEAVIQ  446



>gb|EMS50357.1| Leucine-rich repeat receptor protein kinase EXS [Triticum urartu]
Length=643

 Score =   496 bits (1276),  Expect = 2e-161, Method: Compositional matrix adjust.
 Identities = 274/503 (54%), Positives = 359/503 (71%), Gaps = 33/503 (7%)
 Frame = -3

Query  2012  LNGLSGLYLHFNNLHGVIPKEIASLTQLSDLYLNMNDLSGFIPSEIGNMPNLQVLQLCYN  1833
             L GL+GLYLH+N L G IP+E+  L  L++LYL +N+LSG IP E+G +  LQVLQL YN
Sbjct  2     LLGLTGLYLHYNELGGAIPRELGDLPDLAELYLGVNNLSGGIPIELGRLHRLQVLQLGYN  61

Query  1832  RFEGCIPNKLGSLKNLTVLALQSNQLTGAIPASlggltlltrldLSFNRLFGSIPVKLSE  1653
             +  G IP +LG LK LTVLA+QSNQLTGAIPASLG L  LTRLDLS N LFGSIP KL+ 
Sbjct  62    QLSGSIPTQLGELKKLTVLAVQSNQLTGAIPASLGDLPELTRLDLSSNHLFGSIPSKLAG  121

Query  1652  ASKLEVLDLRNNTLSGNVPLGLKRLNEGFRYENNPGLCGTGFPSLALC-SDSSLNPTKPE  1476
               ++  LDLRNNTLSG+VP GLK+L  GF+++NN  LCG+ F +L  C +D +++     
Sbjct  122   IPQIATLDLRNNTLSGSVPSGLKKLGHGFKFDNNLELCGSHFDTLKACPNDENVD-----  176

Query  1475  PFGQGSNRLPTKDIPESANI-----PHQLNQNRKPQ-----------AAAAVVGVIGLFV  1344
                   +++P K  PES +I     P   +QNR              + A + G I +  
Sbjct  177   ------DQMPHK--PESTSIKPQQTPQNTSQNRNCDNGACSRSSTLSSGAVLAGTIIIIA  228

Query  1343  ILAVAGLFTFSWYRRRKQQIGSTVDISESRVSTDQPKVLCRRSTSPLISLEYSNGWDPLA  1164
              +A  GL  FSW+RR+KQ++G +V+  E R S +Q K   ++S S LI++EYS+GWD  +
Sbjct  229   GVAACGLSVFSWHRRQKQKVGCSVESLEGRPSLEQSKETYQKSASSLINVEYSSGWDTSS  288

Query  1163  K-DQSGSALSQEVLESFMFNLDEVESATQYFSETNLLGKSSFSAVYKGTLRDGSAVAVKC  987
             +  Q G  LS E   S  FNL+EVE ATQYFS+ N+LGKS+F+A ++G +RDGS VAVK 
Sbjct  289   EGSQHGVRLSPEGSPSVRFNLEEVECATQYFSDINVLGKSTFAATHRGIMRDGSVVAVKS  348

Query  986   ISKTSCKSDEAEFRKGLTLLTSLKHENLLRLRGFCCSKGRGECFLIYDFVSNGNLLRYLD  807
             I+K+SCKS+EA+F KGL +LTSL+HENL+ LRGFC S+ RGECFL+Y+F++NG+L RYLD
Sbjct  349   INKSSCKSEEADFLKGLRMLTSLRHENLVGLRGFCRSRARGECFLVYEFMANGSLSRYLD  408

Query  806   VK--DEKGKVLDWSTRTAIIKGIARGIKYLHGNKRNKPALVHRNISADKVLIDHLYKPLL  633
             +K  D + ++LDW TR +II GIA+GI+YLH +K +KP LVH+NISADKVL+DHL  P L
Sbjct  409   IKDGDAETRILDWPTRVSIISGIAKGIEYLHSSKPSKPPLVHQNISADKVLLDHLLVPRL  468

Query  632   SDSGLHKLLADDIVFSTLKGSAA  564
             S SG+HKLLADD+VFS LKG+AA
Sbjct  469   SGSGVHKLLADDVVFSPLKGNAA  491



>gb|KDO63771.1| hypothetical protein CISIN_1g005586mg [Citrus sinensis]
Length=464

 Score =   486 bits (1252),  Expect = 3e-160, Method: Compositional matrix adjust.
 Identities = 255/446 (57%), Positives = 319/446 (72%), Gaps = 12/446 (3%)
 Frame = -3

Query  1592  GLKRLNEGFRYENNPGLCGTGFPSLALCS---DSSLNPTKPEPFGQGSNRLPTKDIPESA  1422
              LKRLN GF+++NNPGLCG G  SL  C+   ++ +NP KP  FG  SN     DI E +
Sbjct  6     ALKRLNGGFQFQNNPGLCGDGIASLRACTVYDNTQINPVKP--FGSHSNDTTPIDISEPS  63

Query  1421  NIPHQLNQNRKPQAA-----AAVVGVIGLFVILAVAGLFTFSWYRRRKQQIGSTVDISES  1257
                   NQ++   ++     A +  V  + VILA  G+  F  YRR KQ+IG+T + S+ 
Sbjct  64    GFKEHCNQSQCSNSSKFPQIAVLAAVTSVTVILAGTGILIFFRYRRHKQKIGNTSESSDW  123

Query  1256  RVSTDQ--PKVLCRRSTSPLISLEYSNGWDPLAKDQSGSALSQEVLESFMFNLDEVESAT  1083
             ++STD    K   R   SPL+SLEY +GWDPL    +G+  S+E L SF  NL+EVESAT
Sbjct  124   QLSTDLTLAKDFNRNGASPLVSLEYCHGWDPLGDYLNGTGFSREHLNSFRLNLEEVESAT  183

Query  1082  QYFSETNLLGKSSFSAVYKGTLRDGSAVAVKCISKTSCKSDEAEFRKGLTLLTSLKHENL  903
             Q FSE NLLGK +FS+VYKGTLRDG+ VA++ I+ TSCKS+EAEF KGL LLTSL+HEN+
Sbjct  184   QCFSEVNLLGKGNFSSVYKGTLRDGTLVAIRSINVTSCKSEEAEFVKGLYLLTSLRHENI  243

Query  902   LRLRGFCCSKGRGECFLIYDFVSNGNLLRYLDVKDEKGKVLDWSTRTAIIKGIARGIKYL  723
             +RLRGFCCS+GRGECFLIYDF   G L +YLD ++    VLDWSTR +II GIA+GI YL
Sbjct  244   IRLRGFCCSRGRGECFLIYDFAPKGKLSKYLDQEEGSSNVLDWSTRVSIIIGIAKGIGYL  303

Query  722   HGNKRNKPALVHRNISADKVLIDHLYKPLLSDSGLHKLLADDIVFSTLKGSAANGYLAPE  543
             H ++ NKPA+VHRN+S +KVLID  + PL++D GLHKLLADDIVFS LK SAA GYLAPE
Sbjct  304   HSSEVNKPAIVHRNLSVEKVLIDQQFNPLIADCGLHKLLADDIVFSVLKTSAAMGYLAPE  363

Query  542   YAITGRFTEKSDMYAFGVIILQILSGSCVVTQSNHQGAELCRFEDFVDAKLGKDFVESEA  363
             Y  TGRFTE+SD++AFGVIILQIL+GS V+T S    AE   FE+F+D  L   F ESEA
Sbjct  364   YVTTGRFTERSDIFAFGVIILQILTGSLVLTSSMRLAAESATFENFIDRNLKGKFSESEA  423

Query  362   AKLGKIALLCTHDSPSRRPAIDVVIQ  285
             AKLGK+AL+CTH+ P  RP ++ VI+
Sbjct  424   AKLGKMALVCTHEDPENRPTMEAVIE  449



>gb|EPS73880.1| hypothetical protein M569_00875, partial [Genlisea aurea]
Length=431

 Score =   421 bits (1083),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 225/446 (50%), Positives = 297/446 (67%), Gaps = 26/446 (6%)
 Frame = -3

Query  1592  GLKRLNEGFRYENNPGLCGTGFPSLALCSDSSLNPTKPEPFGQGSNRLPTKDIPESA---  1422
               K L +GFRY NN GLCG+GF SL  CSDS  +  + E          T+DIPE+A   
Sbjct  1     AFKGLADGFRYANNTGLCGSGFSSLPRCSDSLRSDRRKES---------TEDIPETADLN  51

Query  1421  -NIPHQLNQNRKP----QAAAAVVGVIGLFVILAVAGLFTFSWYRRRKQQIGSTVDISES  1257
              N    L   R+     QA+ AV  ++    + AV    +F+ YRRRKQ++    ++ ES
Sbjct  52    VNCTRSLCSTRRSKASSQASVAVAVMLVSAAVSAVGVAASFAVYRRRKQKLVCAFNVMES  111

Query  1256  -RVSTDQPKV-LCRRSTSPLISLEYSNGWDPLAKDQSGSALSQEVLESFMFNLDEVESAT  1083
               +STD     L  ++ SPL+SLEY+NGWDPL++D+     S EV++SF  NL EVE+AT
Sbjct  112   SNLSTDSNGCELNDKNGSPLVSLEYTNGWDPLSEDRR-FGFSHEVMKSFRLNLQEVETAT  170

Query  1082  QYFSETNLLGKSSFSAVYKGTLRDGSAVAVKCISKTSCKSDEAEFRKGLTLLTSLKHENL  903
             QYF++ N LGK+++S  Y+GT RDG  V VK I+K+ C+S+E+EF KGL  L SL+HEN+
Sbjct  171   QYFAKKNFLGKTNYSETYRGTWRDGGIVTVKRIAKSCCRSEESEFLKGLNALASLRHENV  230

Query  902   LRLRGFCCSKGRGECFLIYDFVSNGNLLRYLDVKDEKGKVLDWSTRTAIIKGIARGIKYL  723
             ++LRGFCCSKGRG CFL+Y+FV  G+L RYLD+KD    VLDW+TR  ++ G+A+GI+YL
Sbjct  231   VKLRGFCCSKGRGSCFLVYEFVPQGSLFRYLDLKDGDANVLDWNTRVTVVNGVAKGIEYL  290

Query  722   HGNKRNKP-ALVHRNISADKVLIDHLYKPLLSDSGLHKLLADDIVFSTLKGSAANGYLAP  546
             H +K NKP +LVH+NIS+  VLIDH   PLLSDS LH LL +D VFS+LK SAA GYLAP
Sbjct  291   HSHKTNKPSSLVHQNISSKNVLIDHNSNPLLSDSCLHMLLTNDTVFSSLKASAAMGYLAP  350

Query  545   EYAITGRFTEKSDMYAFGVIILQILSGSCVVTQSNHQGAELCRFEDFVDAKLGKDFVESE  366
             EY +TGRFTEKSD+YAFGV++ QILSG   V  S   G+      +FVDA L     E+E
Sbjct  351   EYTVTGRFTEKSDVYAFGVLVFQILSGKLNVPASARAGS-----LEFVDANLHGKVCEAE  405

Query  365   AAKLGKIALLCTHDSPSRRPAIDVVI  288
              A L K+A+ CT      RP+++ V+
Sbjct  406   FAVLAKLAVRCTDVCSDERPSMECVV  431



>ref|XP_002985490.1| hypothetical protein SELMODRAFT_122408 [Selaginella moellendorffii]
 gb|EFJ13364.1| hypothetical protein SELMODRAFT_122408 [Selaginella moellendorffii]
Length=724

 Score =   426 bits (1095),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 272/670 (41%), Positives = 375/670 (56%), Gaps = 48/670 (7%)
 Frame = -3

Query  2213  STVSLLMAIKASLDPGNLVLSSWSPNVTDPCSVS-SFEGIACNDLGQVVNISLQGKGLYG  2037
             S  ++L+ +K  LDP   VL+SW     DPC     F G+AC+  G+V N+SLQG+GL G
Sbjct  28    SDAAILLDVKRGLDPRGEVLASWVAG-KDPCGAEDGFVGVACDSRGRVTNVSLQGRGLEG  86

Query  2036  KIPPEIGQLNGLSGLYLHFNNLHGVIPKEIASLTQLSDLYLNMNDLSGFIPSEIGNMPNL  1857
              IP  IG+L+ L+ LYLH+N+L G IP  +ASLT L+D+YLN+N LSG IPS++ ++ NL
Sbjct  87    SIPAAIGELSSLTALYLHYNSLSGSIPSSLASLTGLTDVYLNVNKLSGAIPSQLTSLRNL  146

Query  1856  QVLQLCYNRFEGCIPNKLGSLKNLTVLALQSNQLTGAIPASlggltlltrldLSFNRLFG  1677
             Q LQLC N   G IP+ LG L  L +LALQ N L G IPASLG L+ L  LDLSFN L G
Sbjct  147   QALQLCCNDLSGPIPDALGHLGLLNLLALQHNHLDGRIPASLGQLSSLKHLDLSFNSLSG  206

Query  1676  SIPVKLSEASKLEVLDLRNNTLSGNVPLGLKR--------LNEGFRYENNPGLCGTGFPS  1521
              IP  L+  +++ VLD+R+N LSG VP G ++        L  GF Y NN GLCG GFPS
Sbjct  207   PIPAALNNLAQITVLDVRSNKLSGYVPAGKRKLLIASNSNLETGFAYSNNTGLCGVGFPS  266

Query  1520  LALCSDSSLNP-TKPEPFGQGSN-----RLPTKDIPESANIPHQLNQNRKPQAAAAVVGV  1359
             L  CS S  +   +P+PFG   N     +   K  P S N     + +R PQ A     V
Sbjct  267   LPYCSGSGASSLQRPQPFGAPGNAATVAQTVAKRAPLSTN-----SSSRIPQMAVIGGVV  321

Query  1358  IGLFVILAVAGLFTFSWYRRRKQQIGSTVDISESRVSTDQPKVLCRRSTSPLISLEYSNG  1179
                  +L +A L +F W+RR KQ+I ST D S   +      +L    T      +    
Sbjct  322   AVTGGVL-LAMLMSFVWFRRHKQRISSTHD-SSGGIKVAIMDILSPEQTKSKSGGDGGGK  379

Query  1178  WDPLAKDQSGSALSQEVLESFMFNLDEVESATQYFSETNLLGKSSFSAVYKGTLRDGSAV  999
                L     GS+     + SF + L+E+E AT YFS+  LL + S  ++Y+  +RDGS  
Sbjct  380   GSSLHLSLVGSS-----MRSFQYRLEELEVATNYFSDKYLLARKSSLSIYRAVVRDGSTA  434

Query  998   AVKCISKTSCKSDEAEFRKGLTLLTSLKHENLLRLRGFCCSKGRGECFLIYDFVSNGNLL  819
              +K  +KT     E EF   L+    LKH+NL++L+GFCC +G  +C+L+YDFV NG+L 
Sbjct  435   VIKYFTKTRFVGGEEEFEAALSSFVQLKHDNLVKLKGFCCVQGGLQCYLVYDFVPNGSLF  494

Query  818   RYLDVKDEKGKVLDWSTRTAIIKGIARGIKYLHGNKRNKPALVHRNISADKVLIDHLYKP  639
              +L         LDW TR  I  G+A+G+ YLH   RN   ++   + A  VL+D  Y  
Sbjct  495   EHL--HGPSVSPLDWGTRVQIAHGVAKGLDYLH---RNGEQVI---VWASNVLLDESYNA  546

Query  638   LLSDSGLHKLLADDIVFSTLKGSAANGYLAPEYAITGRFTEKSDMYAFGVIILQILSGS-  462
             L+S  G +K+LAD++V++ +K SA  GYLAPEY + G   EKSD+YAFG+++L++L+G  
Sbjct  547   LVSSWGHNKVLADELVYANIKTSAMLGYLAPEYGVIGHLHEKSDVYAFGILLLELLTGRK  606

Query  461   -CVVTQSNHQGAELCRF----------EDFVDAKLGKDFVESEAAKLGKIALLCTHDSPS  315
                   S+     L  F          +  +D  LG  F  + A  +  IA  C    P 
Sbjct  607   PMYADGSSLSVTNLANFVRPLFDSGHLDTAIDPSLGTKFSATGAIGMASIAFSCVAPVPQ  666

Query  314   RRPAIDVVIQ  285
              RP++  V+Q
Sbjct  667   LRPSMGQVVQ  676



>ref|XP_002987081.1| hypothetical protein SELMODRAFT_125338 [Selaginella moellendorffii]
 gb|EFJ11924.1| hypothetical protein SELMODRAFT_125338 [Selaginella moellendorffii]
Length=738

 Score =   424 bits (1089),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 273/678 (40%), Positives = 377/678 (56%), Gaps = 51/678 (8%)
 Frame = -3

Query  2213  STVSLLMAIKASLDPGNLVLSSWSPNVTDPCSVS-SFEGIACNDLGQVVNISLQGKGLYG  2037
             S  ++L+ +K  LDP   VL+SW     DPC     F G+AC+  G+V N+SLQG+GL G
Sbjct  28    SDAAILLDVKRGLDPRGEVLASWVAG-KDPCGAEDGFVGVACDSRGRVTNVSLQGRGLEG  86

Query  2036  KIPPEIGQLNGLSGLYLHFNNLHGVIPKEIASLTQLSDLYLNMNDLSGFIPSEIGNMPNL  1857
              IP  IG+L+ L+ LYLH+N+L G IP  +ASLT L+D+YLN+N LSG IPS++ ++ NL
Sbjct  87    SIPGAIGELSSLTALYLHYNSLSGSIPSSLASLTGLTDVYLNVNKLSGAIPSQLTSLRNL  146

Query  1856  QVLQLCYNRFEGCIPNKLGSLKNLTVLALQSNQLTGAIPASlggltlltrldLSFNRLFG  1677
             Q LQLC N   G IP+ LG L  L +LALQ N L G IPASLG L+ L  LDLSFN L G
Sbjct  147   QALQLCCNDLSGPIPDALGHLGLLNLLALQHNHLDGRIPASLGQLSSLKHLDLSFNSLSG  206

Query  1676  SIPVKLSEASKLEVLDLRNNTLSGNVPLGLKR--------LNEGFRYENNPGLCGTGFPS  1521
              IP  L+  +++ VLD+R+N LSG VP G ++        L  GF Y NN GLCG GFPS
Sbjct  207   PIPAALNNLAQITVLDVRSNKLSGYVPAGKRKLLIASNSNLETGFAYSNNTGLCGVGFPS  266

Query  1520  LALCSDSSLNP-TKPEPFGQGSN-----RLPTKDIPESANIPHQLNQNRKPQAAAAVVGV  1359
             L  CS S  +   +P+PFG   N     +   K  P S N     + +R PQ A     V
Sbjct  267   LPYCSGSGASSLQRPQPFGAPGNAATVAQTVAKRAPLSTN-----SSSRIPQMAVIGGVV  321

Query  1358  IGLFVILAVAGLFTFSWYRRRKQQIGSTVDISESRVSTDQPKVLCRRSTSPLISLEYSNG  1179
                  +L +A L +F W+RR KQ+I ST D S   +      +L    T      +    
Sbjct  322   AVTGGVL-LAMLMSFVWFRRHKQRISSTHD-SSGGIKVATMDILSPEQTKSKSGGDGGGK  379

Query  1178  WD------PLAKD--QSGSALSQEVLESFMFNLDEVESATQYFSETNLLGKSSFSAVYKG  1023
                     PLA     +  +L    + SF + L+E+E AT YFS+  LL + S  ++Y+ 
Sbjct  380   GSSLHLVAPLAMQSINAPKSLVGSSMRSFQYRLEELEVATNYFSDKYLLARKSSLSIYRA  439

Query  1022  TLRDGSAVAVKCISKTSCKSDEAEFRKGLTLLTSLKHENLLRLRGFCCSKGRGECFLIYD  843
              +RDGS   +K  +KT     E EF   L+    LKH+NL++L+GFCC +G  +C+L+YD
Sbjct  440   VVRDGSTAVIKYFTKTRFVGGEEEFEAALSSFVQLKHDNLVKLKGFCCVQGGLQCYLVYD  499

Query  842   FVSNGNLLRYLDVKDEKGKVLDWSTRTAIIKGIARGIKYLHGNKRNKPALVHRNISADKV  663
             FV NG+L  +L         LDW TR  I  G+A+G+ YLH   RN   ++   + A  V
Sbjct  500   FVPNGSLFEHL--HGPSVSPLDWGTRVQIAHGVAKGLDYLH---RNGEQVI---VWASNV  551

Query  662   LIDHLYKPLLSDSGLHKLLADDIVFSTLKGSAANGYLAPEYAITGRFTEKSDMYAFGVII  483
             L+D  Y  L+S  G +K+LAD++V++ +K SA  GYLAPEY + G   EKSD+YAFG+++
Sbjct  552   LLDESYNALVSSWGHNKVLADELVYANIKTSAMLGYLAPEYGVIGHLHEKSDVYAFGILL  611

Query  482   LQILSGS--CVVTQSNHQGAELCRF----------EDFVDAKLGKDFVESEAAKLGKIAL  339
             L++L+G        S+     L  F          +  +D  LG  F  + A  +  IA 
Sbjct  612   LELLTGRKPMYADGSSLSVTNLANFVRPLFDSGHLDTAIDPSLGTKFSATGAIGMASIAF  671

Query  338   LCTHDSPSRRPAIDVVIQ  285
              C    P  RP++  V+Q
Sbjct  672   SCVAPVPQLRPSMGQVVQ  689



>gb|EYU30450.1| hypothetical protein MIMGU_mgv1a026158mg, partial [Erythranthe 
guttata]
Length=442

 Score =   405 bits (1040),  Expect = 6e-129, Method: Compositional matrix adjust.
 Identities = 236/461 (51%), Positives = 312/461 (68%), Gaps = 37/461 (8%)
 Frame = -3

Query  2195  MAIKASLDPGNLVLSSWSPNVTDPCSVSSFEGIACNDLGQVVNISLQGKGLYGKIPPEIG  2016
             M IK+SLDP N  LSSW+ +  DPC   +FEG+ACN+  +V NISLQGKGL GK+P  + 
Sbjct  1     MEIKSSLDPENKYLSSWTAD-GDPCG-GAFEGVACNEHRKVANISLQGKGLAGKVPAAVA  58

Query  2015  QLNGLSGLYLHFNNLHGVIPKEIASLTQLSDLYLNMNDLSGFIPSEIGNMPNLQVLQLCY  1836
             +L  LSGLYLH+N+L G IPKEIA+LT+L+DLYLN+N+LSG IPS+IG+M +LQVLQLC 
Sbjct  59    ELKCLSGLYLHYNSLSGGIPKEIANLTELTDLYLNVNNLSGIIPSQIGSMASLQVLQLCC  118

Query  1835  NRFEGCIPNKLGSLKNLTVLALQSNQLTGAIPASlggltlltrldLSFNRLFGSIPVKLS  1656
             N   G IP ++G LK L+VLAL+SN+LTG IP++LG L LL RL LSFN L G IP+ L+
Sbjct  119   NHLTGTIPTEMGFLKKLSVLALESNKLTGQIPSNLGDLLLLKRLYLSFNYLSGPIPLTLA  178

Query  1655  EASKLEVLDLRNNTLSGNVPLGLKRLNEGFRYENNPGLCGTGFPSLALCSD-SSLNP--T  1485
                 L+VLDL+NN+LSG VP GL++++EGF + NNPGLCG GF SL  C+   +LN   T
Sbjct  179   NLPSLQVLDLQNNSLSGVVPSGLRKMSEGFNFGNNPGLCGNGFSSLRNCTPWDNLNNDIT  238

Query  1484  KPEPFGQGSNRLPTKDIPESANIPHQLNQNRKPQAAAAVVGVIGL--------------F  1347
             +       +N+    +IP+SA  P   NQ+   +++++ +  IG+              F
Sbjct  239   RNNSSVIITNKTSPANIPQSAAFPLPCNQSHCAKSSSSKLPQIGIVAGAAALAATIITAF  298

Query  1346  VILAVAGLFTFSWYRRRKQQIGSTVDISESRVSTDQ-PKVLCRRSTSPLISLEYSNGWDP  1170
             V +A+         RRRKQ+I +  D  +  +S D+  K   +RS SPL+SLEYS GWDP
Sbjct  299   VFVAIFR------RRRRKQKISNKSDSCDEILSVDRGAKDFYKRSPSPLVSLEYSKGWDP  352

Query  1169  LAKDQSGSALSQEVLESFMFNLDEVESATQYFSETNLLGKSSFSAVYKGTLRDGSAVAVK  990
              + D             F FN  EVESATQ+FSE NLLG+S FSAVYKG L+DG+ VA+K
Sbjct  353   PSLDS-----------GFRFNSSEVESATQHFSEGNLLGRSKFSAVYKGMLKDGTTVAIK  401

Query  989   CISKTSCKSDEAEFRKGLTLLTSLKHENLLRLRGFCCSKGR  867
              I+KTSCK++E EF +GL LL +++HENL+RL+GFC S  R
Sbjct  402   SINKTSCKAEEDEFLRGLRLLDTMRHENLVRLKGFCWSNAR  442



>ref|XP_001785536.1| predicted protein [Physcomitrella patens]
 gb|EDQ49646.1| predicted protein [Physcomitrella patens]
Length=694

 Score =   408 bits (1048),  Expect = 8e-127, Method: Compositional matrix adjust.
 Identities = 266/671 (40%), Positives = 373/671 (56%), Gaps = 71/671 (11%)
 Frame = -3

Query  2207  VSLLMAIKASLDPGNLVLSSWSPNVTDPCSVSSFEGIACNDLGQVVNISLQGKGLYGKIP  2028
             V +L+ +KA+LDP  LVL SW   V  PCS  +F+G+ C+  G+V NISLQG+ L G IP
Sbjct  22    VEVLLDVKAALDPHGLVLDSWQTGV-QPCS-GAFDGVLCDSAGRVTNISLQGRSLTGFIP  79

Query  2027  PEIGQLNGLSGLYLHFNNLHGVIPKEIASLTQLSDLYLNMNDLSGFIPSEIGNMPNLQVL  1848
               + +L  L+ L+LHFN L G IP  ++ L  L+D+YLN N LSG IP ++G + +LQVL
Sbjct  80    DAVSELPELTALFLHFNELRGGIPASLSYLEGLTDMYLNWNQLSGAIPPQLGQLASLQVL  139

Query  1847  QLCYNRFEGCIPNKLGSLKNLTVLALQSNQLTGAIPASlggltlltrldLSFNRLFGSIP  1668
             +L  N  EG IP +L SL NL  LA+ +N L G IP+++G +T+L RLD+S N L G IP
Sbjct  140   ELSCNNLEGEIPVELASLSNLETLAVNANNLNGTIPSTIGNMTMLQRLDVSNNTLTGKIP  199

Query  1667  VKLSEASKLEVLDLRNNTLSGNVPLGLKRLNEGFRYENNPGLCGTGFPSLALCSDSSLNP  1488
               +   +KL  LD+ +N LSG VP GL  L  GF+Y NN GLCGTG  +++ C     + 
Sbjct  200   ASVENLTKLIYLDVSHNLLSGPVPTGLFDLRHGFKYSNNSGLCGTGL-NISKCPTPPSSS  258

Query  1487  TKPEPFGQGSNRLPTKDIPESANIPHQLNQNRKPQAAAAVVGVIG--LFVILAVAGLFTF  1314
              +       S   P++   +  +I              A+V  IG   F+IL    L   
Sbjct  259   LE------SSPAEPSQSFKKIMSI------------TTAIVFAIGGSAFLILVYICLKRR  300

Query  1313  SWYRRRKQQIGSTVDISESRVSTDQPK-----------------VLCRRSTSPLISLEYS  1185
             + + R    I S ++     V    PK                 V+  RSTS +     S
Sbjct  301   NAHLRHAFDIKSDINSGIKSVHKSAPKGEKSESINGSTNYLQSSVMSGRSTSTIA----S  356

Query  1184  NGWDPLAKDQSGSALSQEVLESFMFNLDEVESATQYFSETNLLGKSSFSAVYKGTLRDGS  1005
             NG    A+  S              +L E+E+AT YFS+ NLL K+  SAVYKGTLRDG+
Sbjct  357   NGLPSPAEWSS------------WIHLGELETATNYFSDKNLLRKNCHSAVYKGTLRDGT  404

Query  1004  AVAVKCISKTSCKSDEAEFRKGLTLLTSLKHENLLRLRGFCCSKGRGECFLIYDFVSNGN  825
             +VAVK I  T     E +F+  +  L  ++HENL+   GFCCSKG  ECFL+Y FV  G+
Sbjct  405   SVAVKAIYNTRYSFGEQDFQIAIEALLQVRHENLVNFLGFCCSKGGSECFLVYSFVPGGS  464

Query  824   LLRYLDVKDEKGKVLDWSTRTAIIKGIARGIKYLHGNKRNKPALVHRNISADKVLIDHLY  645
             L  +L   D+    L+W  R  II+GIA+G+ +LH        +VH+N+ A  +L+D   
Sbjct  465   LDHHL--HDQSELFLNWGMRVKIIRGIAKGLAHLHEGMTEPMTMVHQNLWAGNILLDKQG  522

Query  644   KPLLSDSGLHKLLADDIVFSTLKGSAANGYLAPEYAITGRFTEKSDMYAFGVIILQILSG  465
               LL+D GL  ++A++++++T K  AA GYLAPEYA TG+ TE SD+YAFG ++L++L+G
Sbjct  523   NALLADYGLSDIVAEEVMYATHKTLAALGYLAPEYAYTGQVTEDSDIYAFGALVLELLTG  582

Query  464   S----------CVVTQSN--HQGAELCRFEDFVDAKLGKDFVESEAAKLGKIALLCTHDS  321
                         +V+ +   H   EL +  +FVD KL  +F  + AA L  IAL C  + 
Sbjct  583   HRPVFFVEATRTLVSMATWVHPLLELGKVREFVDPKLEANFSLAGAAGLAHIALQCMSED  642

Query  320   PSRRP-AIDVV  291
             P  RP  +DVV
Sbjct  643   PGARPNMVDVV  653



>gb|KDO65398.1| hypothetical protein CISIN_1g044913mg, partial [Citrus sinensis]
Length=395

 Score =   396 bits (1017),  Expect = 3e-126, Method: Compositional matrix adjust.
 Identities = 225/382 (59%), Positives = 286/382 (75%), Gaps = 9/382 (2%)
 Frame = -3

Query  2225  SNNASTVSLLMAIKASLDPGNLVLSSWSPNVTDPCSVSSFEGIACNDLGQVVNISLQGKG  2046
             +N  + +  LM +KA+LDP    LSSW+ N  DPC   SFEGIACN+ GQV NISLQGKG
Sbjct  17    ANADTELRALMDMKAALDPEERYLSSWTIN-GDPCD-GSFEGIACNEKGQVANISLQGKG  74

Query  2045  LYGKIPPEIGQLNGLSGLYLHFNNLHGVIPKEIASLTQLSDLYLNMNDLSGFIPSEIGNM  1866
             L GK+ P I  L  L+GLYLH+N+L+G IP+EIA+LT+LSDLYLN+N+LSG IP EIG M
Sbjct  75    LNGKVSPAIAGLKHLTGLYLHYNSLYGQIPREIANLTELSDLYLNVNNLSGDIPPEIGYM  134

Query  1865  PNLQVLQLCYNRFEGCIPNKLGSLKNLTVLALQSNQLTGAIPASlggltlltrldLSFNR  1686
              +LQVLQLCYN+  G IP +LGSL+ L+VLALQSNQLTGAIPA+LG L +L RLDLSFN 
Sbjct  135   GSLQVLQLCYNQLTGSIPTQLGSLRKLSVLALQSNQLTGAIPANLGDLGMLMRLDLSFNH  194

Query  1685  LFGSIPVKLSEASKLEVLDLRNNTLSGNVPLGLKRLNEGFRYENNPGLCGTGFPSLALCS  1506
             LFGSIP KL++A  LEVLD+RNNTLSG+VP  LKRLNEGF YENN  LCG GF +L  CS
Sbjct  195   LFGSIPRKLADAPLLEVLDIRNNTLSGSVPPALKRLNEGFLYENNLELCGVGFSALKTCS  254

Query  1505  DSS-LNPTKPEPFGQGSNRLPTKDIPESANIPHQLNQNR-----KPQAAAAVVGVIGLFV  1344
              SS +NP++PEP+G  +    T++IPE+AN+    NQ +     K   A+ V G+I + V
Sbjct  255   ASSNINPSRPEPYGAATTH-STRNIPETANVNLPCNQTQCSSSSKSHQASVVAGIIVVVV  313

Query  1343  ILAVAGLFTFSWYRRRKQQIGSTVDISESRVSTDQPKVLCRRSTSPLISLEYSNGWDPLA  1164
              L+  G+  F+ YRRRKQ++GS+ + ++SR+STDQ K + R++ SPLISLEY NGWDPLA
Sbjct  314   ALSAIGILAFTQYRRRKQKLGSSFNAADSRLSTDQAKGVYRKNGSPLISLEYGNGWDPLA  373

Query  1163  KDQSGSALSQEVLESFMFNLDE  1098
               ++ +  +QEV +SF FNL+E
Sbjct  374   DGRNLNVFAQEVFQSFRFNLEE  395



>gb|ACN31808.1| unknown [Zea mays]
Length=397

 Score =   343 bits (879),  Expect = 7e-106, Method: Compositional matrix adjust.
 Identities = 206/376 (55%), Positives = 254/376 (68%), Gaps = 45/376 (12%)
 Frame = -3

Query  1772  LQSNQLTGAIPASlggltlltrldLSFNRLFGSIPVKLSEASKLEVLDLRNNTLSGNVP-  1596
             +QSNQL GAIPA+LG LT L RLDLSFN LFGSIP K++E   LEV D+RNNTLSG+VP 
Sbjct  1     MQSNQLDGAIPATLGELTQLRRLDLSFNSLFGSIPSKIAEVPLLEVFDVRNNTLSGSVPV  60

Query  1595  -----------------------------LGLKRLNEGFRYENNPGLCGTGFPSLALC--  1509
                                          LGL+RLN GF+Y NN GLCG GF  L LC  
Sbjct  61    GNNLIAFLKLVLFFVSLHGILTTTILCWMLGLRRLNGGFQYMNNKGLCGAGFSLLELCLS  120

Query  1508  SDSSLNPTKPEPFGQGSNRLPTKDIPESANIPHQLNQNRKPQAAAA-----VVGVIGLFV  1344
             S+  L P+KPEPFG     + T+ +P+SAN P   +     ++A A     +V V+   +
Sbjct  121   SEDGLKPSKPEPFGP-DGTVKTRQVPQSAN-PDGCSGASCSKSANASQGVLIVAVVAAVI  178

Query  1343  ILAVAGLFTFSWYRRRKQQIGSTVDISESRVSTD--QPKVLCRRSTSPLISLEYSNGWDP  1170
               A  GLF FSWYRR+KQ+IGS++++S+SR+STD  Q K  CRRS SPLIS+EYSN WDP
Sbjct  179   GAAFCGLFAFSWYRRQKQKIGSSLEVSDSRLSTDHFQQKEACRRSASPLISVEYSNSWDP  238

Query  1169  LAKDQSG-SALSQEVLESFMFNLDEVESATQYFSETNLLGKSSFSA-VYKGTLRDGSAVA  996
             L+   +G  +  Q V +SF FNL+EVE ATQYFS+ NLLGKS F+A  YKG LRDGS VA
Sbjct  239   LSAGGAGVGSPGQVVGDSFRFNLEEVECATQYFSDVNLLGKSGFAAATYKGILRDGSVVA  298

Query  995   VKCISKTSCKSDEAEFRKGLTLLTSLKHENLLRLRGFCCSKGRGECFLIYDFVSNGNLLR  816
             VK +SKTSCK +E++F +GL +LT L+H+NL+ LRGFCCS+GRGECFL+YDF+ NG L R
Sbjct  299   VKSLSKTSCKQEESDFLRGLKMLTLLQHDNLVSLRGFCCSRGRGECFLVYDFMVNGCLSR  358

Query  815   YLDVKD--EKGKVLDW  774
             YLDVKD      VLDW
Sbjct  359   YLDVKDGSSGATVLDW  374



>gb|KCW82134.1| hypothetical protein EUGRSUZ_C035232, partial [Eucalyptus grandis]
Length=381

 Score =   323 bits (828),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 196/380 (52%), Positives = 252/380 (66%), Gaps = 32/380 (8%)
 Frame = -3

Query  2198  LMAIKASLDPGNLVLSSWSPNVTDPCSVSSFEGIACNDLGQVVNISLQGKGLYGKIPPEI  2019
             LM IKASLDP N VL+SW+ N  DPC   SF+G                 GL GK+PP +
Sbjct  31    LMEIKASLDPENKVLTSWTSN-GDPCG-GSFDG-----------------GLSGKVPPAV  71

Query  2018  GQLNGLSGLYLHFNNLHGVIPKEIASLTQLSDLYLNMNDLSGFIPSEIGNMPNLQVLQLC  1839
              QL  LSGLYLH+    G IP+EI+SLT+L+DLYL++N+L+G IPSEIG+M +LQVLQLC
Sbjct  72    AQLKCLSGLYLHYITWTGEIPREISSLTELTDLYLDVNNLTGSIPSEIGSMASLQVLQLC  131

Query  1838  YNRFEGCIPNKLGSLKNLTVLALQSNQLTGAIPASlggltlltrldLSFNRLFGSIPVKL  1659
             YN+  G IP ++GSLK L+VLALQ N+L+G I   L  L  L RL L FN   G+ PV++
Sbjct  132   YNQLNGTIPPQIGSLKKLSVLALQHNKLSGDI-HGLANLQTLKRLVLGFNGFNGTFPVEI  190

Query  1658  SEASKLEVLDLRNNTLSGNVPLGLKRLNEGFRYENNPGLCGTGFPSLALCS--DSSLNPT  1485
             ++  +L+ LD++NN+LSG VP  LK+L E F Y+NNPGLCG+GFPSL  C+  D +L+P 
Sbjct  191   AKIPELQTLDVQNNSLSGFVPAALKKL-ERFNYQNNPGLCGSGFPSLRNCNNFDPNLHPN  249

Query  1484  KPEPFGQGSNRLP-TKDIPESANIPHQLNQNRKPQAAAAVVGVIGLFVILAVAGLFTFSW  1308
                P       +P T D+    N  H  N ++ PQ AA V G++ + V L  AGL TF  
Sbjct  250   GVNPI----VLIPRTPDVKTHCNQSHCSNPSKLPQ-AALVAGIVSVTVTLVGAGLLTFYR  304

Query  1307  YRRRKQQIGSTVDISESRVSTDQPKVLCRRSTSPLISLEYSNGWDPLAKDQSGSALSQEV  1128
             YRR KQ+IGST D S+ R+STDQ K L  RS SPL+ LEYS+GWDPL   + G+ LS   
Sbjct  305   YRRGKQKIGSTADASDGRLSTDQSKDLYSRSASPLVCLEYSSGWDPLDDGRCGNGLS---  361

Query  1127  LESFMFNLDEVESATQYFSE  1068
             L++  + L+EVESATQYFSE
Sbjct  362   LQAPRYTLEEVESATQYFSE  381



>dbj|BAJ93229.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=298

 Score =   320 bits (819),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 163/293 (56%), Positives = 214/293 (73%), Gaps = 10/293 (3%)
 Frame = -3

Query  1595  LGLKRLNEGFRYENNPGLCGTGFPSLALCS--DSSLNPTKPEPFGQGSNRLPTKDIPESA  1422
             LGLKRLN GF+Y NN GLCG+ F  L LC+  +  L P+KPEPFG     + T  +P+S 
Sbjct  4     LGLKRLNGGFQYVNNKGLCGSEFSLLDLCTSTEDGLRPSKPEPFGP-DGTVKTGQVPQSV  62

Query  1421  NIPHQLNQNRKPQAAAAVVGVIGLFVILAVAGLFTFSWYRRRKQQIGSTVDISESRVSTD  1242
             + PH   ++ K  A   +VG++ + +  A  G+F FS+YRR+KQ+I S++++S+SR+STD
Sbjct  63    D-PHT-TKSAKASAGVLIVGIVAVVIGAAFCGIFAFSYYRRQKQKISSSLEVSDSRLSTD  120

Query  1241  --QPKVLCRRSTSPLISLEYSNGWDPLAKDQSGSALSQEVLESFMFNLDEVESATQYFSE  1068
               Q K  CRRS SPLIS+EYSNGWD ++        S EV +SF FNL+EVE ATQYFSE
Sbjct  121   HFQQKEACRRSASPLISVEYSNGWDTMSGGGC--GSSGEVGDSFRFNLEEVECATQYFSE  178

Query  1067  TNLLGKSSFSAVYKGTLRDGSAVAVKCISKTSCKSDEAEFRKGLTLLTSLKHENLLRLRG  888
              NLLGKS F+A +KG LRDGSAVAVK ++KTSCK +E++F +GL  LT L+H+NL+ LRG
Sbjct  179   VNLLGKSGFAATFKGILRDGSAVAVKSLNKTSCKQEESDFLRGLKTLTMLRHDNLVGLRG  238

Query  887   FCCSKGRGECFLIYDFVSNGNLLRYLDVKD-EKGKVLDWSTRTAIIKGIARGI  732
             FCCS+GRGECFL+YDF+ NG L  YLDVK+  +  VLDW TR +II+GIA+G+
Sbjct  239   FCCSRGRGECFLVYDFMVNGCLSHYLDVKEGSEASVLDWPTRVSIIRGIAKGM  291



>emb|CBI38873.3| unnamed protein product [Vitis vinifera]
Length=316

 Score =   315 bits (808),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 177/261 (68%), Positives = 207/261 (79%), Gaps = 5/261 (2%)
 Frame = -3

Query  2195  MAIKASLDPGNLVLSSWSPNVTDPCSVSSFEGIACNDLGQVVNISLQGKGLYGKIPPEIG  2016
             MA+KASLDP N  LSSW+ +  DPCS  SFEG+ACN+ G VVNISLQGKGL G+IP EI 
Sbjct  1     MAMKASLDPENRFLSSWTSD-NDPCS-DSFEGVACNEYGHVVNISLQGKGLMGQIPKEIA  58

Query  2015  QLNGLSGLYLHFNNLHGVIPKEIASLTQLSDLYLNMNDLSGFIPSEIGNMPNLQVLQLCY  1836
             +L  LSGL+LHFN+L+G IPKEI++L +LSDLYLN+N+LSG I   IGNM NLQVLQLCY
Sbjct  59    ELKSLSGLFLHFNSLYGEIPKEISALAELSDLYLNVNNLSGVIHPGIGNMSNLQVLQLCY  118

Query  1835  NRFEGCIPNKLGSLKNLTVLALQSNQLTGAIPASlggltlltrldLSFNRLFGSIPVKLS  1656
             N+  G IP +LGSLK L+VLALQSN+LTGAIPASLG L +LTRLDLSFN LFG IPVKL+
Sbjct  119   NKLTGGIPTQLGSLKKLSVLALQSNELTGAIPASLGDLEMLTRLDLSFNNLFGPIPVKLA  178

Query  1655  EASKLEVLDLRNNTLSGNVPLGLKRLNEGFRYENNPGLCGTGFPSLALCSDSS-LNPTKP  1479
              A  LE+LD+RNNTLSGNVP  LKRLN+GF+Y NNP LCG GF +L +CS S  LNP +P
Sbjct  179   NAPMLEILDIRNNTLSGNVPQALKRLNDGFQYRNNPSLCGDGFLALDVCSASDQLNPNRP  238

Query  1478  EPFGQGSNRLPTKDIPESANI  1416
             EPF  G N      +PESAN+
Sbjct  239   EPF--GPNGTDKNGLPESANL  257



>ref|XP_002509610.1| leucine rich repeat receptor kinase, putative [Ricinus communis]
 gb|EEF50997.1| leucine rich repeat receptor kinase, putative [Ricinus communis]
Length=240

 Score =   286 bits (731),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 145/254 (57%), Positives = 175/254 (69%), Gaps = 20/254 (8%)
 Frame = -3

Query  1046  SFSAVYKGTLRDGSAVAVKCISKTSCKSDEAEFRKGLTLLTSLKHENLLRLRGFCCSKGR  867
             SFS+VYKG LR GS VAV+ I+ TSCKS+E EF KGL LLTSL+H+NL+RLRGFCCSKGR
Sbjct  2     SFSSVYKGILRGGSLVAVRSINTTSCKSEEDEFVKGLNLLTSLRHDNLVRLRGFCCSKGR  61

Query  866   GECFLIYDFVSNGNLLRYLDVKDEKGKVLDWSTRTAIIKGIARGIKYLHGNKRNKPALVH  687
             GECFLIYDF   GNL RYLD++D    +L+WSTR +II GIA+GI+YLH  + NKPA++H
Sbjct  62    GECFLIYDFALMGNLSRYLDLEDGSSHILEWSTRVSIINGIAKGIEYLHRREANKPAIIH  121

Query  686   RNISADKVLIDHLYKPLLSDSGLHKLLADDIVFSTLKGSAANGYLAPEYAITGRFTEKSD  507
             R +S  K                    +  IVFS LK SAA GYLAPEY  T  FTEKSD
Sbjct  122   RRVSVRK--------------------STXIVFSGLKTSAAIGYLAPEYLTTRHFTEKSD  161

Query  506   MYAFGVIILQILSGSCVVTQSNHQGAELCRFEDFVDAKLGKDFVESEAAKLGKIALLCTH  327
             +Y FGVIILQIL G  V++ S    A   R++DF+D  L  +F ES+AA L KIAL CT 
Sbjct  162   IYTFGVIILQILYGQHVLSNSMRLAAASSRYQDFIDTNLKGNFSESKAAMLSKIALDCTQ  221

Query  326   DSPSRRPAIDVVIQ  285
               P +RP ++ VIQ
Sbjct  222   KLPEQRPTMEAVIQ  235



>ref|XP_008812839.1| PREDICTED: probable receptor-like protein kinase At1g11050 [Phoenix 
dactylifera]
Length=203

 Score =   279 bits (713),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 133/200 (67%), Positives = 161/200 (81%), Gaps = 1/200 (1%)
 Frame = -3

Query  1334  VAGLFTFSWYRRRKQQIGSTVDISESRVSTDQPKVLCRRSTSPLISLEYSNGWDPLAKDQ  1155
             V GL  F+  RRRKQ+IGS +++ ES ++TDQPK  CR+  SPLISLEYSNGWDPLA  +
Sbjct  2     VIGLSAFALRRRRKQKIGSALEVKESWLNTDQPKEFCRKGASPLISLEYSNGWDPLADGR  61

Query  1154  SGSALSQEVLESFMFNLDEVESATQYFSETNLLGKSSFSAVYKGTLRDGSAVAVKCISKT  975
             SG+  SQEV +SF FNL+EVE  T YFSE NLLG+S+F+A YKG LRDG+AVAVK I+KT
Sbjct  62    SGAGFSQEVSQSFRFNLEEVECTTHYFSEVNLLGRSNFAATYKGVLRDGTAVAVKSINKT  121

Query  974   SCKSDEAEFRKGLTLLTSLKHENLLRLRGFCCSKGRGECFLIYDFVSNGNLLRYLDVKDE  795
             SC+S+EAEF  GL +LT L+HENL+  RGFCCS+GRGECFL+YDFVSNG L +YLDVKD 
Sbjct  122   SCRSEEAEFLMGLKMLTLLRHENLVGFRGFCCSRGRGECFLVYDFVSNGILSQYLDVKDS  181

Query  794   -KGKVLDWSTRTAIIKGIAR  738
               G+VLDW  R +IIKGIA+
Sbjct  182   VNGRVLDWPRRVSIIKGIAK  201



>ref|NP_001159136.1| uncharacterized protein LOC100304214 [Zea mays]
 gb|ACN25176.1| unknown [Zea mays]
Length=251

 Score =   265 bits (678),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 141/250 (56%), Positives = 188/250 (75%), Gaps = 10/250 (4%)
 Frame = -3

Query  1019  LRDGSAVAVKCISKTSCKSDEAEFRKGLTLLTSLKHENLLRLRGFCCSKGRGECFLIYDF  840
             +RDG+AVAVK ISK+SCKS+EA+F +GL  LTSL+HENL+ L+GFC S+  G CFL+Y+F
Sbjct  1     MRDGTAVAVKSISKSSCKSEEADFLRGLRALTSLRHENLVGLKGFCRSRASGGCFLVYEF  60

Query  839   VSNGNLLRYLDVKDE----KGKVLDWSTRTAIIKGIARGIKYLHGNKRNKPALVHRNISA  672
             ++NG+L RYLD K+        VLDW TR +IIKG+A+GI+YLH +K     L H++ISA
Sbjct  61    MTNGSLSRYLDAKESDAADAAAVLDWPTRVSIIKGVAKGIEYLHSSK-----LAHQSISA  115

Query  671   DKVLIDHLYKPLLSDSGLHKLLADDIVFSTLKGSAANGYLAPEYAITGRFTEKS-DMYAF  495
             DKVL+DHL+ P LS +GLH+LLADD+VF+ LK SAA GYLAPEYA TGR T+K  D+YAF
Sbjct  116   DKVLLDHLHAPRLSGAGLHRLLADDVVFAALKDSAAMGYLAPEYATTGRSTDKQGDVYAF  175

Query  494   GVIILQILSGSCVVTQSNHQGAELCRFEDFVDAKLGKDFVESEAAKLGKIALLCTHDSPS  315
             GV++LQ+L+G   V+  + Q     R +D VD +L   F  +EAAKL  +ALLCT ++P+
Sbjct  176   GVVVLQVLAGRRAVSPPHLQQDGGGRLDDLVDPRLRGRFSRAEAAKLAGVALLCTAEAPA  235

Query  314   RRPAIDVVIQ  285
             +RPA+  V+Q
Sbjct  236   QRPAMAAVLQ  245



>gb|EPS72502.1| hypothetical protein M569_02256, partial [Genlisea aurea]
Length=226

 Score =   238 bits (608),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 132/201 (66%), Positives = 159/201 (79%), Gaps = 2/201 (1%)
 Frame = -3

Query  2198  LMAIKASLDPGNLVLSSWSPNVTDPCSVSSFEGIACNDLGQVVNISLQGKGLYGKIPPEI  2019
             L+ +K+SLDP NL L SW  +  DPC   +FEG+ACN+ G+VVNISLQGKGL GK+ P +
Sbjct  28    LIDLKSSLDPENLYLGSWVVS-GDPCG-GTFEGVACNENGRVVNISLQGKGLAGKLSPAV  85

Query  2018  GQLNGLSGLYLHFNNLHGVIPKEIASLTQLSDLYLNMNDLSGFIPSEIGNMPNLQVLQLC  1839
             G+L  L+GLYLH+N+L+G IP+EI +L  LSDLYLN+N+LSG IPS +G M NLQVLQLC
Sbjct  86    GRLVHLTGLYLHYNSLYGEIPREIGNLVLLSDLYLNLNNLSGQIPSVLGRMQNLQVLQLC  145

Query  1838  YNRFEGCIPNKLGSLKNLTVLALQSNQLTGAIPASlggltlltrldLSFNRLFGSIPVKL  1659
             YN   G IP +LGSLK L V+ALQ N LTGAIPASLG    LTRLDLSFNRLFGSIP KL
Sbjct  146   YNHLTGSIPTQLGSLKRLNVVALQHNLLTGAIPASLGDSKTLTRLDLSFNRLFGSIPTKL  205

Query  1658  SEASKLEVLDLRNNTLSGNVP  1596
             ++A  L +LD+RNN+LSGNVP
Sbjct  206   ADAKMLGILDVRNNSLSGNVP  226



>dbj|BAJ91470.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ88814.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=644

 Score =   245 bits (626),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 204/663 (31%), Positives = 303/663 (46%), Gaps = 140/663 (21%)
 Frame = -3

Query  2213  STVSLLMAIKASLDPGNLVLSSWSPNVTDPCSVSSFEGIACNDLGQVVNISLQGKGLYGK  2034
             + V  L+AIK  L   + VLS+W  +  DPCS   +  I C+    V+ +    +GL G 
Sbjct  35    AEVMALVAIKQGLVDSHGVLSNWDEDSVDPCS---WAMITCSPHNLVIGLGAPSQGLSGT  91

Query  2033  IPPEIGQLNGLSGLYLHFNNLHGVIPKEIASLTQLSDLYLNMNDLSGFIPSEIGNMPNLQ  1854
                       LSG               IA+LT L  + L  N+++G +P E+G +P LQ
Sbjct  92    ----------LSG--------------RIANLTNLEQVLLQNNNITGRLPPELGALPRLQ  127

Query  1853  VLQLCYNRFEGCIPNKLGSLKNLTVLALQSNQLTGAIPASlggltlltrldLSFNRLFGS  1674
              L L  NRF G +P+ LG L  L  L L +N L+G  PAS                   S
Sbjct  128   TLDLSNNRFSGRVPDTLGHLSKLRYLRLNNNSLSGPFPAS-----------------LAS  170

Query  1673  IPVKLSEASKLEVLDLRNNTLSGNVPLGLKRLNEGFRYENNPGLCGTGFPSLALCSDSSL  1494
             IP       +L  LDL  N LSG VP    R    F    NP +CG    S   C+ + L
Sbjct  171   IP-------QLSFLDLSYNNLSGPVPFFPTRT---FNIVGNPMICG----SRGDCAAALL  216

Query  1493  NP-TKPEPFGQGSNRLPTKDIPESANIPHQLNQNRKPQAAAAVVGVIGLFVILAVAGLFT  1317
              P T P P              ES   P    +++     A         V+ AV+ L  
Sbjct  217   APATGPFPL-------------ESTPTPSSRTRSKAGAVGAGAGLGASALVLFAVSCLL-  262

Query  1316  FSWYRRRKQQIGSTVDISESRVSTDQPKVLCRRSTSPLISLEYSNGWDPLAKDQSGSALS  1137
               W RRR+Q+  S                                    L  +Q G  ++
Sbjct  263   --WRRRRRQRCPS------------------------------------LLLEQGGGEVA  284

Query  1136  QEVLESFMFNLDEVESATQYFSETNLLGKSSFSAVYKGTLRDGSAVAVKCISKTSCKSDE  957
               +     F L E+ +AT  FS  N+LG+  F  VY+G L DG+AVAVK +   S  S E
Sbjct  285   ARLGNVRQFGLRELHAATDGFSGRNILGRGGFGDVYRGRLADGTAVAVKRLKDPSGASGE  344

Query  956   AEFRKGLTLLTSLKHENLLRLRGFCCSKGRGECFLIYDFVSNGNLLRYLDVKDEKGK-VL  780
             A+FR  + +++   H +LLRL GFC +   G+  L+Y F+ NG++   L     +GK  L
Sbjct  345   AQFRTEVEMISLAVHRHLLRLLGFCAA-ASGDRLLVYPFMPNGSVAARL-----RGKPAL  398

Query  779   DWSTRTAIIKGIARGIKYLHGNKRNKPALVHRNISADKVLIDHLYKPLLSDSGLHKLL--  606
             +W TR  I  G ARG+ YLH  ++  P ++HR++ A  VL+D  ++ ++ D GL KLL  
Sbjct  399   EWQTRKRIAVGAARGLLYLH--EQCDPKIIHRDVKAANVLLDEHHEAVVGDFGLAKLLDH  456

Query  605   ADDIVFSTLKGSAANGYLAPEYAITGRFTEKSDMYAFGVIILQILSGSCVVTQSNHQGAE  426
              D  V + ++G+   G++APEY  TG+ ++K+D++ FGV++L++++G   +      G  
Sbjct  457   GDSHVTTAVRGTV--GHIAPEYLSTGQSSDKTDVFGFGVLLLELVTGQRALEVGKGSGLN  514

Query  425   LCR----------------FEDFVDAKLGKDFVESEAAKLGKIALLCTHDSPSRRPAIDV  294
             L                   +  VD +LG  +   E A++ ++ALLCT   PS RP +  
Sbjct  515   LTHKGVMLDWVRKVHQEKMLDLLVDQELGPHYDRIEVAEMVQVALLCTQFQPSHRPRMAE  574

Query  293   VIQ  285
             V++
Sbjct  575   VLR  577



>ref|XP_007033440.1| NSP-interacting kinase 1 [Theobroma cacao]
 gb|EOY04366.1| NSP-interacting kinase 1 [Theobroma cacao]
Length=649

 Score =   245 bits (626),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 192/656 (29%), Positives = 299/656 (46%), Gaps = 134/656 (20%)
 Frame = -3

Query  2207  VSLLMAIKASLDPGNLVLSSWSPNVTDPCSVSSFEGIACNDLGQVVNISLQGKGLYGKIP  2028
             V  LMAIKA+L   + VL +W  +  DPCS   +  + C+    V+ +    + L G + 
Sbjct  40    VQSLMAIKAALHDPHGVLDNWDADAVDPCS---WAMVTCSPESLVIGLGTPSQNLSGTLS  96

Query  2027  PEIGQLNGLSGLYLHFNNLHGVIPKEIASLTQLSDLYLNMNDLSGFIPSEIGNMPNLQVL  1848
             P IG                        +LT L  + L  N+++G IP+E+G +  +Q L
Sbjct  97    PSIG------------------------NLTNLQIVLLQNNNITGPIPTELGKLSKIQTL  132

Query  1847  QLCYNRFEGCIPNKLGSLKNLTVLALQSNQLTGAIPASlggltlltrldLSFNRLFGSIP  1668
              L  N F G IP  LG+L++L  + L +N L+GA P                        
Sbjct  133   DLSDNSFTGEIPTSLGNLRSLQYMRLNNNSLSGACP------------------------  168

Query  1667  VKLSEASKLEVLDLRNNTLSGNVPLGLKRLNEGFRYENNPGLCGTGFPSLALCSDSSLNP  1488
             V L+  ++L  LDL  N LSG VP   +   + F    NP +C TG              
Sbjct  169   VSLANMTQLTFLDLSYNNLSGPVP---RFAAKTFSIVGNPLICATG--------------  211

Query  1487  TKPEPFGQGSNRLPTKDIPESANIPHQLNQNRKPQAAAAVVGVIGLFVILAVAGLFTFSW  1308
                EP   G   +P      S+       +++  + A A    IG   ++ +       W
Sbjct  212   --SEPECHGMTLMPMSMNLNSSQAGRPSGRSKGHKIAIAFGSSIGCVSLMVLILGLLLWW  269

Query  1307  YRRRKQQIGSTVDISESRVSTDQPKVLCRRSTSPLISLEYSNGWDPLAKDQSGSALSQEV  1128
              +RR +QI   V                                    KD+    +S   
Sbjct  270   RQRRNEQIFFDV------------------------------------KDRHHEEVSLGN  293

Query  1127  LESFMFNLDEVESATQYFSETNLLGKSSFSAVYKGTLRDGSAVAVKCISKTSCKSDEAEF  948
             L  F F   E++ AT  FS  N+LGK  F  VYKG L+DG+ VAVK +   +    E +F
Sbjct  294   LRRFQFR--ELQIATHNFSSKNILGKGGFGNVYKGILQDGTIVAVKRLKDGNAAGGEIQF  351

Query  947   RKGLTLLTSLKHENLLRLRGFCCSKGRGECFLIYDFVSNGNLLRYLDVKDEKGK-VLDWS  771
             +  + +++   H NLLRL GFC +    E  L+Y ++SNG++   L     KGK VLDW 
Sbjct  352   QTEVEMISLAVHRNLLRLYGFCITP--TEKLLVYPYMSNGSVASRL-----KGKPVLDWG  404

Query  770   TRTAIIKGIARGIKYLHGNKRNKPALVHRNISADKVLIDHLYKPLLSDSGLHKLL--ADD  597
             TR  I  G ARG+ YLH  ++  P ++HR++ A  +L+D   + ++ D GL KLL   D 
Sbjct  405   TRKRIALGAARGLLYLH--EQCDPKIIHRDVKAANILLDDYCEAVVGDFGLAKLLDHQDS  462

Query  596   IVFSTLKGSAANGYLAPEYAITGRFTEKSDMYAFGVIILQILSGSCVV---TQSNHQGAE  426
              V + ++G+   G++APEY  TG+ +EK+D++ FG+++L++++G   +     +N +GA 
Sbjct  463   HVTTAVRGTV--GHIAPEYLSTGQSSEKTDVFGFGILLLELITGQRALEFGKAANQKGAM  520

Query  425   L---------CRFEDFVDAKLGKDFVESEAAKLGKIALLCTHDSPSRRPAIDVVIQ  285
             L          + E  VD  L  ++   E  ++ ++ALLCT   P  RP +  V++
Sbjct  521   LDWVRKIHQEKKLEGLVDKDLKSNYDRIELEEMVQVALLCTQYLPGHRPKMSEVVR  576



>ref|XP_006474063.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At4g30520-like isoform X1 [Citrus sinensis]
Length=645

 Score =   244 bits (623),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 199/655 (30%), Positives = 310/655 (47%), Gaps = 132/655 (20%)
 Frame = -3

Query  2207  VSLLMAIKASLDPGNLVLSSWSPNVTDPCSVSSFEGIACNDLGQVVNISLQGKGLYGKIP  2028
             V  L++IK +L+  + VL++W  +  DPCS   +  I C+                    
Sbjct  31    VDALVSIKRALNDPHGVLNNWDEDSVDPCS---WAMITCS--------------------  67

Query  2027  PEIGQLNGLSGLYLHFNNLHGVIPKEIASLTQLSDLYLNMNDLSGFIPSEIGNMPNLQVL  1848
             PE    N + GL     +L G +   I +LT L  + L  N++SG IP ++G++P LQ L
Sbjct  68    PE----NLVIGLGAPSQSLSGTLSGSIGNLTNLRQVLLQNNNISGGIPPQLGSLPKLQTL  123

Query  1847  QLCYNRFEGCIPNKLGSLKNLTVLALQSNQLTGAIPASlggltlltrldLSFNRLFGSIP  1668
              L  NR  G IP   G L +L  L L +N L+GA P                        
Sbjct  124   DLSNNRLSGVIPRSFGQLNSLQYLRLNNNSLSGAFP------------------------  159

Query  1667  VKLSEASKLEVLDLRNNTLSGNVPLGLKRLNEGFRYENNPGLCGTGFPSLALCSDSSLNP  1488
             V L++ S+L  LDL  N LSG VP   K     F    NP +CG+   S  +CS S+   
Sbjct  160   VFLAKISELAFLDLSYNNLSGPVP---KFPARTFNVAGNPLICGSS--STNVCSGSA--N  212

Query  1487  TKPEPFGQGSNRLPTKDIPESANIPHQLNQNRKPQAAAAVVGVIGLFVILAVAGLFTFSW  1308
             + P  F   S+             P + N  +   A     GV  L ++LA    F   W
Sbjct  213   SVPLSFSLNSS-------------PGKHNSKKLAIALGVSFGVASL-ILLA----FGLIW  254

Query  1307  YRRRKQQIGSTVDISESRVSTDQPKVLCRRSTSPLISLEYSNGWDPLAKDQSGSALSQEV  1128
             YR+R++ + + ++I                                +A  Q    +S   
Sbjct  255   YRKRQKNL-TILNIGVF-----------------------------VADKQEEGLISLGN  284

Query  1127  LESFMFNLDEVESATQYFSETNLLGKSSFSAVYKGTLRDGSAVAVKCISKTSCKSDEAEF  948
             L +F F   E++ AT+ FS  N+LG   F  VYKG L DG+ +AVK +   +    E++F
Sbjct  285   LRNFTFR--ELQQATENFSSKNILGAGGFGNVYKGKLGDGTVLAVKRLKDVAGTFGESQF  342

Query  947   RKGLTLLTSLKHENLLRLRGFCCSKGRGECFLIYDFVSNGNLLRYLDVKDEKGKVLDWST  768
             R  L +++   H NLLRL G+C +    E  L+Y ++SNG++   L  K      LDW+T
Sbjct  343   RTELEMISLAVHRNLLRLIGYCATP--TERLLVYPYMSNGSVASRLREK----PALDWNT  396

Query  767   RTAIIKGIARGIKYLHGNKRNKPALVHRNISADKVLIDHLYKPLLSDSGLHKLL--ADDI  594
             R  I  G ARG+ YLH  ++  P ++HR++ A  VL+D   + ++ D GL KLL  +D  
Sbjct  397   RKRIAIGAARGLLYLH--EQCDPKIIHRDVKAANVLLDDFCEAIVGDFGLAKLLDHSDSH  454

Query  593   VFSTLKGSAANGYLAPEYAITGRFTEKSDMYAFGVIILQILSGSCVV---TQSNHQGAEL  423
             V + ++G+   G++APEY  TG+ +EK+D++ FG+++L++++G   +      N +GA L
Sbjct  455   VTTAVRGTV--GHIAPEYLSTGQSSEKTDVFGFGILLLELITGMRALEFGKSINQKGAML  512

Query  422   ---------CRFEDFVDAKLGKDFVESEAAKLGKIALLCTHDSPSRRPAIDVVIQ  285
                       + E  VD +LG ++   E  ++ ++ALLCT   P  RP +  V++
Sbjct  513   EWVKKIQQEKKVEVLVDRELGSNYDRIEVGEILQVALLCTQYLPVHRPKMSEVVR  567



>ref|XP_004149147.1| PREDICTED: somatic embryogenesis receptor kinase 2-like [Cucumis 
sativus]
 ref|XP_004167830.1| PREDICTED: somatic embryogenesis receptor kinase 2-like [Cucumis 
sativus]
 gb|KGN53241.1| hypothetical protein Csa_4G036610 [Cucumis sativus]
Length=626

 Score =   243 bits (621),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 192/668 (29%), Positives = 304/668 (46%), Gaps = 136/668 (20%)
 Frame = -3

Query  2225  SNNASTV--SLLMAIKASLDPGNLVLSSWSPNVTDPCSVSSFEGIACNDLGQVVNISLQG  2052
             +N ++TV  ++L   + +L+  N VL SW P + +PC+   +  + CN+   ++ + L  
Sbjct  23    TNVSATVEATVLHIFRLNLEDPNNVLQSWDPTLVNPCT---WFHVTCNNENNIIRVDLGN  79

Query  2051  KGLYGKIPPEIGQLNGLSGLYLHFNNLHGVIPKEIASLTQLSDLYLNMNDLSGFIPSEIG  1872
              GL GK+ P++GQL       L +  L+G                   N++SG IP ++G
Sbjct  80    AGLSGKLVPQLGQLKS-----LQYLELYG-------------------NNISGEIPDDLG  115

Query  1871  NMPNLQVLQLCYNRFEGCIPNKLGSLKNLTVLALQSNQLTGAIPASlggltlltrldLSF  1692
             N+ NL  L L  N   G IP+  G L  L  L L  N+L+G IP S              
Sbjct  116   NLENLVSLDLYLNGLTGPIPDTFGKLTQLRFLRLNDNKLSGLIPIS--------------  161

Query  1691  NRLFGSIPVKLSEASKLEVLDLRNNTLSGNVPL-GLKRLNEGFRYENNPGLCG--TGFPS  1521
                       L   S L+VLDL NN LSG VP  G   L     + NN  LCG  TG P 
Sbjct  162   ----------LINISTLQVLDLSNNLLSGKVPNNGSFSLFTPISFANNLDLCGLVTGKP-  210

Query  1520  LALCSDSSLNPTKPEPFGQGSNRLPTKDIPESANIPHQLNQNRKPQAAAAVVGVIGLFVI  1341
                C         P    Q            S    H+LN            G   LF  
Sbjct  211   ---CPGDPPFSPPPPFVPQ------------STVSSHELNNPNGAIVGGVAAGAALLFAT  255

Query  1340  LAVAGLFTFSWYRRRKQQIGSTVDISE-SRVSTDQPKVLCRRSTSPLISLEYSNGWDPLA  1164
              A+  +F + W+RR+ ++I   V   E S ++  Q K                       
Sbjct  256   PAI--IFVY-WHRRKSREIFFDVPAEEDSEINLGQLK-----------------------  289

Query  1163  KDQSGSALSQEVLESFMFNLDEVESATQYFSETNLLGKSSFSAVYKGTLRDGSAVAVKCI  984
                              F+L +++ AT  F   N+LG+  F  VY+G L DGS VAVK +
Sbjct  290   ----------------RFSLRDLQVATDNFCNKNILGRGGFGKVYRGRLADGSLVAVKRL  333

Query  983   SKTSCKSDEAEFRKGLTLLTSLKHENLLRLRGFCCSKGRGECFLIYDFVSNGNLLRYLDV  804
              +      E +F+  + +++   H NLLRL GFC +    E  L+Y +++NG++   L  
Sbjct  334   KEERTPGGELQFQTEVEMISMAVHRNLLRLHGFCTTS--SERLLVYPYMANGSVASCLRE  391

Query  803   KDEKGKVLDWSTRTAIIKGIARGIKYLHGNKRNKPALVHRNISADKVLIDHLYKPLLSDS  624
             + +    LDW TR  +  G ARG+ YLH      P ++HR++ A  +L+D  ++ ++ D 
Sbjct  392   RPQSEAPLDWPTRKKVALGSARGLSYLHDG--CDPKIIHRDVKAANILLDEEFEAVVGDF  449

Query  623   GLHKLL--ADDIVFSTLKGSAANGYLAPEYAITGRFTEKSDMYAFGVIILQILSGSC---  459
             GL KL+   D  V + ++G+   G++APEY  TG+ +EK+D++ +G+++L++++G     
Sbjct  450   GLAKLMDYKDTHVTTAVRGTI--GHIAPEYLSTGKSSEKTDVFGYGIMLLELITGQRAFD  507

Query  458   VVTQSNHQGAELC----------RFEDFVDAKLGKDFVESEAAKLGKIALLCTHDSPSRR  309
             +   +N +   L           + E  VD  L +++ E E  ++ ++ALLCT  SP  R
Sbjct  508   LARLANDEDVMLLDWVKGLLKEKKLEMLVDPDLKENYDEIEVEQIIQVALLCTQSSPMER  567

Query  308   PAIDVVIQ  285
             P +  V++
Sbjct  568   PKMSDVVR  575



>gb|AHF18212.1| brassinosteroid insensitive 1-associated receptor kinase 1 [Saccharum 
hybrid cultivar]
Length=626

 Score =   243 bits (619),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 197/656 (30%), Positives = 303/656 (46%), Gaps = 134/656 (20%)
 Frame = -3

Query  2207  VSLLMAIKASLDPGNLVLSSWSPNVTDPCSVSSFEGIACNDLGQVVNISLQGKGLYGKIP  2028
             V  LM IK  L   + VL +W  +  DPCS   +  + C+                    
Sbjct  37    VQALMMIKNYLKDPHGVLKNWDQDSVDPCS---WTMVTCS--------------------  73

Query  2027  PEIGQLNGLSGLYLHFNNLHGVIPKEIASLTQLSDLYLNMNDLSGFIPSEIGNMPNLQVL  1848
             PE    N ++GL     NL G++   I +LT L  + L  N+++G IP+EIG +  L+ L
Sbjct  74    PE----NLVTGLEAPSQNLSGILSPSIGNLTNLETVLLQNNNINGLIPAEIGKLRKLKTL  129

Query  1847  QLCYNRFEGCIPNKLGSLKNLTVLALQSNQLTGAIPASlggltlltrldLSFNRLFGSIP  1668
              L  N   G IP+ +G L++L  L L +N L+GA P S                      
Sbjct  130   DLSSNHLSGEIPSSVGHLESLQYLRLNNNTLSGAFPPSS---------------------  168

Query  1667  VKLSEASKLEVLDLRNNTLSGNVPLGLKRLNEGFRYENNPGLCGTGFPSLALCSDSSLNP  1488
                +  S L  LDL  N  SG +P  L R    F    NP +C       A   +     
Sbjct  169   ---ANLSHLIFLDLSYNNFSGPIPGSLTRT---FNIVGNPLIC-------AATMEQDCYG  215

Query  1487  TKPEPFGQGSNRLPTKDIPESANIPHQLNQNRKPQAAAAVVGVIGLFVILAVAGLFTFSW  1308
             + P P   G N        +   +P +   ++   A  A  G I L V LAV  LF   W
Sbjct  216   SLPMPMSYGLNN------TQGTLVPAKAKSHKVAIAFGATTGFISL-VFLAVGLLF---W  265

Query  1307  YRRRKQQIGSTVDISESRVSTDQPKVLCRRSTSPLISLEYSNGWDPLAKDQSGSALSQEV  1128
             +R                         CRR+   L +++          DQ    ++   
Sbjct  266   WR-------------------------CRRNRKTLFNID----------DQHIENVNLGN  290

Query  1127  LESFMFNLDEVESATQYFSETNLLGKSSFSAVYKGTLRDGSAVAVKCISKTSCKSDEAEF  948
             ++ F F   E+++AT+ FS  N+LGK  F  VY+G L DGS VAVK +   +    EA+F
Sbjct  291   MKRFQFR--ELQAATENFSSKNILGKGGFGIVYRGQLPDGSLVAVKRLKHGNAAGGEAQF  348

Query  947   RKGLTLLTSLKHENLLRLRGFCCSKGRGECFLIYDFVSNGNLLRYLDVKDEKGK-VLDWS  771
             +  + +++   H NLLRL GFC +    E  L+Y ++SNG++   L     KGK  LDW 
Sbjct  349   QTEVEMISLAVHRNLLRLYGFCMTA--SERLLVYPYMSNGSVALRL-----KGKPPLDWI  401

Query  770   TRTAIIKGIARGIKYLHGNKRNKPALVHRNISADKVLIDHLYKPLLSDSGLHKLL--ADD  597
             TR  I  G ARG+ YLH  ++  P ++HR++ A  +L+D   + ++ D GL KLL   + 
Sbjct  402   TRKRIALGAARGLLYLH--EQCDPKIIHRDVKAANILLDDCCEAIVGDFGLAKLLDHRES  459

Query  596   IVFSTLKGSAANGYLAPEYAITGRFTEKSDMYAFGVIILQILSGSCVV---TQSNHQGAE  426
              V + ++G+   G++APEY  TG+ +EK+D++ FG+++L++++G   +     SN +GA 
Sbjct  460   HVTTAVRGTV--GHIAPEYLSTGQSSEKTDVFGFGILLLELITGQTALEFGKSSNQKGAM  517

Query  425   L---------CRFEDFVDAKLGKDFVESEAAKLGKIALLCTHDSPSRRPAIDVVIQ  285
             L          + +  VD  LG  +   E  ++ ++ALLCT   P  RP +  V++
Sbjct  518   LDWVKKMHQEKQLDILVDKGLGSKYDRIELEEMVQVALLCTQFLPGHRPKMSEVVR  573



>ref|XP_008453749.1| PREDICTED: somatic embryogenesis receptor kinase 2-like [Cucumis 
melo]
Length=625

 Score =   242 bits (618),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 192/668 (29%), Positives = 302/668 (45%), Gaps = 136/668 (20%)
 Frame = -3

Query  2225  SNNASTV--SLLMAIKASLDPGNLVLSSWSPNVTDPCSVSSFEGIACNDLGQVVNISLQG  2052
             +N ++TV  ++L   + +L+  N VL SW P + +PC+   +  + CN+   ++ + L  
Sbjct  22    TNVSATVEATVLHIFRLNLEDPNNVLQSWDPTLVNPCT---WFHVTCNNENNIIRVDLGN  78

Query  2051  KGLYGKIPPEIGQLNGLSGLYLHFNNLHGVIPKEIASLTQLSDLYLNMNDLSGFIPSEIG  1872
              GL GK+ P++GQL       L +  L+G                   N++SG IP ++G
Sbjct  79    AGLSGKLVPQLGQLKS-----LQYLELYG-------------------NNISGEIPDDLG  114

Query  1871  NMPNLQVLQLCYNRFEGCIPNKLGSLKNLTVLALQSNQLTGAIPASlggltlltrldLSF  1692
             N+ NL  L L  N   G IP+  G L  L  L L  N+L+G IP S              
Sbjct  115   NLENLVSLDLYLNGLTGPIPDTFGKLTQLRFLRLNDNKLSGLIPIS--------------  160

Query  1691  NRLFGSIPVKLSEASKLEVLDLRNNTLSGNVPL-GLKRLNEGFRYENNPGLCG--TGFPS  1521
                       L+  S L+VLDL NN LSG VP  G   L     + NN  LCG  TG P 
Sbjct  161   ----------LTNISTLQVLDLSNNLLSGKVPNNGSFSLFTPISFANNLDLCGLVTGKP-  209

Query  1520  LALCSDSSLNPTKPEPFGQGSNRLPTKDIPESANIPHQLNQNRKPQAAAAVVGVIGLFVI  1341
                C         P    Q            S    H+LN            G   LF  
Sbjct  210   ---CPGDPPFSPPPPFVPQ------------STVSSHELNNPNGAIVGGVAAGAALLFAT  254

Query  1340  LAVAGLFTFSWYRRRKQQIGSTVDISE-SRVSTDQPKVLCRRSTSPLISLEYSNGWDPLA  1164
              A+  +F + W+RRR + I   V   E S ++  Q K                       
Sbjct  255   PAI--IFVY-WHRRRSRDIFFDVPAEEDSEINLGQLK-----------------------  288

Query  1163  KDQSGSALSQEVLESFMFNLDEVESATQYFSETNLLGKSSFSAVYKGTLRDGSAVAVKCI  984
                              F+L +++ AT  F   N+LG+  F  VY+G L DGS VAVK +
Sbjct  289   ----------------RFSLRDLQVATDNFCNKNILGRGGFGKVYRGRLADGSLVAVKRL  332

Query  983   SKTSCKSDEAEFRKGLTLLTSLKHENLLRLRGFCCSKGRGECFLIYDFVSNGNLLRYLDV  804
              +      E +F+  + +++   H NLLRL GFC +    E  L+Y +++NG++   L  
Sbjct  333   KEERTPGGELQFQTEVEMISMAVHRNLLRLHGFCTTS--SERLLVYPYMANGSVASCLRE  390

Query  803   KDEKGKVLDWSTRTAIIKGIARGIKYLHGNKRNKPALVHRNISADKVLIDHLYKPLLSDS  624
             + +    LDW TR  +  G ARG+ YLH      P ++HR++ A  +L+D  ++ ++ D 
Sbjct  391   RPQSEAPLDWPTRKKVALGSARGLSYLHDG--CDPKIIHRDVKAANILLDEEFEAVVGDF  448

Query  623   GLHKLL--ADDIVFSTLKGSAANGYLAPEYAITGRFTEKSDMYAFGVIILQILSGSC---  459
             GL KL+   D  V + ++G+   G++APEY  TG+ +EK+D++ +G+++L++++G     
Sbjct  449   GLAKLMDYKDTHVTTAVRGTI--GHIAPEYLSTGKSSEKTDVFGYGIMLLELITGQRAFD  506

Query  458   VVTQSNHQGAELC----------RFEDFVDAKLGKDFVESEAAKLGKIALLCTHDSPSRR  309
             +   +N +   L           + E  VD  L  ++ E E  ++ ++ALLCT   P  R
Sbjct  507   LARLANDEDVMLLDWVKGLLKEKKLEMLVDPDLKDNYDEIEVEQIIQVALLCTQSLPMER  566

Query  308   PAIDVVIQ  285
             P +  V++
Sbjct  567   PKMSDVVR  574



>ref|XP_010236002.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like isoform X2 [Brachypodium 
distachyon]
Length=627

 Score =   241 bits (616),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 194/656 (30%), Positives = 298/656 (45%), Gaps = 134/656 (20%)
 Frame = -3

Query  2207  VSLLMAIKASLDPGNLVLSSWSPNVTDPCSVSSFEGIACNDLGQVVNISLQGKGLYGKIP  2028
             V  LM IK  L   + VL +W  +  DPCS   +  + C+                    
Sbjct  38    VQALMMIKNYLKDPHGVLRNWDQDSVDPCS---WTMVTCS--------------------  74

Query  2027  PEIGQLNGLSGLYLHFNNLHGVIPKEIASLTQLSDLYLNMNDLSGFIPSEIGNMPNLQVL  1848
                 Q N ++GL     NL G++   I +LT L  + L  N+++G IP++IG +  L+ L
Sbjct  75    ----QENLVTGLEAPSQNLSGLLSPSIGNLTNLEIVLLQNNNINGRIPADIGKLTKLKTL  130

Query  1847  QLCYNRFEGCIPNKLGSLKNLTVLALQSNQLTGAIPASlggltlltrldLSFNRLFGSIP  1668
              L  N F G IP+ +  L++L  L L +N L+GA P++                      
Sbjct  131   DLSSNHFSGEIPSSVSHLRSLQYLRLNNNSLSGAFPSTS---------------------  169

Query  1667  VKLSEASKLEVLDLRNNTLSGNVPLGLKRLNEGFRYENNPGLCGTGFPSLALCSDSSLNP  1488
                +  SKL  LDL  N LSG VP  L R    F    NP +CG         ++     
Sbjct  170   ---ANLSKLVFLDLSYNNLSGPVPGSLART---FNIVGNPLICGAA-------TEQDCYG  216

Query  1487  TKPEPFGQGSNRLPTKDIPESANIPHQLNQNRKPQAAAAVVGVIGLFVILAVAGLFTFSW  1308
             T P P     N      +P          +++  +AA A    IG   IL +     F W
Sbjct  217   TLPMPMSYSLNNTQGTLMPA---------KSKSHKAAIAFGSAIGCISILFLVTGLLFWW  267

Query  1307  YRRRKQQIGSTVDISESRVSTDQPKVLCRRSTSPLISLEYSNGWDPLAKDQSGSALSQEV  1128
                + +QI   VD                                    DQ    ++ E 
Sbjct  268   RHTKHRQILFDVD------------------------------------DQHIENVNLEN  291

Query  1127  LESFMFNLDEVESATQYFSETNLLGKSSFSAVYKGTLRDGSAVAVKCISKTSCKSDEAEF  948
             L+ F F   E+++AT+ FS  N++GK  F  VY+G L DG+ VAVK +   +    E +F
Sbjct  292   LKRFQFR--ELQAATENFSSKNMIGKGGFGNVYRGKLPDGTVVAVKRLKDGNAAGGELQF  349

Query  947   RKGLTLLTSLKHENLLRLRGFCCSKGRGECFLIYDFVSNGNLLRYLDVKDEKGK-VLDWS  771
             +  + +++   H NLLRL GFC +    E  LIY ++SNG++   L     KGK  LDW 
Sbjct  350   QTEVEMISLAVHRNLLRLCGFCMTT--TERLLIYPYMSNGSVASRL-----KGKPPLDWI  402

Query  770   TRTAIIKGIARGIKYLHGNKRNKPALVHRNISADKVLIDHLYKPLLSDSGLHKLL--ADD  597
             TR  I  G ARG+ YLH  ++  P ++HR++ A  VL+D   + ++ D GL KLL   D 
Sbjct  403   TRKGIALGAARGLLYLH--EQCDPKIIHRDVKAANVLLDDFCEAIVGDFGLAKLLDHRDS  460

Query  596   IVFSTLKGSAANGYLAPEYAITGRFTEKSDMYAFGVIILQILSGSCVV---TQSNHQGAE  426
              V + ++G+   G++APEY  TG+ +EK+D++ FG+++L++++G   +     SN +GA 
Sbjct  461   HVTTAVRGTV--GHIAPEYLSTGQSSEKTDVFGFGILLLELITGQTALEFGKSSNQKGAM  518

Query  425   L---------CRFEDFVDAKLGKDFVESEAAKLGKIALLCTHDSPSRRPAIDVVIQ  285
             L          + +  VD  L   +   E  ++ ++ALLCT   P  RP +  V++
Sbjct  519   LDWVKKMHQEKKLDVLVDKGLRNSYDHIELEEMVQVALLCTQYLPGHRPKMSEVVR  574



>ref|XP_003572984.2| PREDICTED: protein NSP-INTERACTING KINASE 1-like isoform X1 [Brachypodium 
distachyon]
Length=628

 Score =   241 bits (616),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 194/656 (30%), Positives = 301/656 (46%), Gaps = 133/656 (20%)
 Frame = -3

Query  2207  VSLLMAIKASLDPGNLVLSSWSPNVTDPCSVSSFEGIACNDLGQVVNISLQGKGLYGKIP  2028
             V  LM IK  L   + VL +W  +  DPCS   +  + C+                    
Sbjct  38    VQALMMIKNYLKDPHGVLRNWDQDSVDPCS---WTMVTCS--------------------  74

Query  2027  PEIGQLNGLSGLYLHFNNLHGVIPKEIASLTQLSDLYLNMNDLSGFIPSEIGNMPNLQVL  1848
                 Q N ++GL     NL G++   I +LT L  + L  N+++G IP++IG +  L+ L
Sbjct  75    ----QENLVTGLEAPSQNLSGLLSPSIGNLTNLEIVLLQNNNINGRIPADIGKLTKLKTL  130

Query  1847  QLCYNRFEGCIPNKLGSLKNLTVLALQSNQLTGAIPASlggltlltrldLSFNRLFGSIP  1668
              L  N F G IP+ +  L++L  L L +N L+GA P++                      
Sbjct  131   DLSSNHFSGEIPSSVSHLRSLQYLRLNNNSLSGAFPSTS---------------------  169

Query  1667  VKLSEASKLEVLDLRNNTLSGNVPLGLKRLNEGFRYENNPGLCGTGFPSLALCSDSSLNP  1488
                +  SKL  LDL  N LSG VP  L R    F    NP +CG         ++     
Sbjct  170   ---ANLSKLVFLDLSYNNLSGPVPGSLART---FNIVGNPLICGAA-------TEQDCYG  216

Query  1487  TKPEPFGQGSNRLPTKDIPESANIPHQLNQNRKPQAAAAVVGVIGLFVILAVAGLFTFSW  1308
             T P P     N     +  E   +P +   ++   A  + +G I   ++  V GL  F W
Sbjct  217   TLPMPMSYSLN-----NTQEGTLMPAKSKSHKAAIAFGSAIGCIS--ILFLVTGLL-FWW  268

Query  1307  YRRRKQQIGSTVDISESRVSTDQPKVLCRRSTSPLISLEYSNGWDPLAKDQSGSALSQEV  1128
                + +QI   VD                                    DQ    ++ E 
Sbjct  269   RHTKHRQILFDVD------------------------------------DQHIENVNLEN  292

Query  1127  LESFMFNLDEVESATQYFSETNLLGKSSFSAVYKGTLRDGSAVAVKCISKTSCKSDEAEF  948
             L+ F F   E+++AT+ FS  N++GK  F  VY+G L DG+ VAVK +   +    E +F
Sbjct  293   LKRFQFR--ELQAATENFSSKNMIGKGGFGNVYRGKLPDGTVVAVKRLKDGNAAGGELQF  350

Query  947   RKGLTLLTSLKHENLLRLRGFCCSKGRGECFLIYDFVSNGNLLRYLDVKDEKGK-VLDWS  771
             +  + +++   H NLLRL GFC +    E  LIY ++SNG++   L     KGK  LDW 
Sbjct  351   QTEVEMISLAVHRNLLRLCGFCMTT--TERLLIYPYMSNGSVASRL-----KGKPPLDWI  403

Query  770   TRTAIIKGIARGIKYLHGNKRNKPALVHRNISADKVLIDHLYKPLLSDSGLHKLL--ADD  597
             TR  I  G ARG+ YLH  ++  P ++HR++ A  VL+D   + ++ D GL KLL   D 
Sbjct  404   TRKGIALGAARGLLYLH--EQCDPKIIHRDVKAANVLLDDFCEAIVGDFGLAKLLDHRDS  461

Query  596   IVFSTLKGSAANGYLAPEYAITGRFTEKSDMYAFGVIILQILSGSCVV---TQSNHQGAE  426
              V + ++G+   G++APEY  TG+ +EK+D++ FG+++L++++G   +     SN +GA 
Sbjct  462   HVTTAVRGTV--GHIAPEYLSTGQSSEKTDVFGFGILLLELITGQTALEFGKSSNQKGAM  519

Query  425   L---------CRFEDFVDAKLGKDFVESEAAKLGKIALLCTHDSPSRRPAIDVVIQ  285
             L          + +  VD  L   +   E  ++ ++ALLCT   P  RP +  V++
Sbjct  520   LDWVKKMHQEKKLDVLVDKGLRNSYDHIELEEMVQVALLCTQYLPGHRPKMSEVVR  575



>ref|XP_006576501.1| PREDICTED: probable inactive leucine-rich repeat receptor-like 
protein kinase At1g66830-like [Glycine max]
Length=711

 Score =   243 bits (619),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 220/709 (31%), Positives = 331/709 (47%), Gaps = 106/709 (15%)
 Frame = -3

Query  2198  LMAIKASLD-PGNLVLSSWSPNVTDPCSVSSFEGIACNDLG-----QVVNISLQGKGLYG  2037
             L+A+K+++D P     S W+     PC+   + GIAC ++      +VV ISL GK L G
Sbjct  31    LLALKSAVDEPSAAAFSDWNNGDPTPCA---WSGIACANVSGEGEPRVVGISLAGKSLSG  87

Query  2036  KIPPEIGQLNGLSGLYLHFNNLHGVIPKEIASLTQLSDLYLNMNDLSGFIPSEIGNMPNL  1857
              +P E+G L  L  L LH N   GV+P ++++ T L  L+L+ N+LSG IPS +  +P L
Sbjct  88    YLPSELGTLRFLRRLNLHDNAFSGVLPAQLSNATALHSLFLHGNNLSGAIPSSLCTLPRL  147

Query  1856  QVLQLCYNRFEGCIPNKLGSLKNLTVLALQSNQLTGAIPASl------------------  1731
             Q L L  N F G IP  L + KNL  L L  N+ +G IPA +                  
Sbjct  148   QNLDLSENAFSGHIPEHLRNCKNLQRLVLAGNKFSGEIPAGVWPDLQNLLQLDLSDNELT  207

Query  1730  --------ggltlltrldLSFNRLFGSIPVKLSEASKLEVLDLRNNTLSGNVPLGLKRLN  1575
                       ++L   L+LSFN L G IP  L +     + DL+NN LSG +P      N
Sbjct  208   GSIPSEIGTLISLSGTLNLSFNHLSGKIPSSLGKLPATVIFDLKNNNLSGEIPQTGSFSN  267

Query  1574  EG-FRYENNPGLCGTGFPSLALCSDSSLNPTKPEPFGQGSNRLPTKDIPESANIPHQLNQ  1398
             +G   +  NP LC  GFP    CS S  N      F  GS+    ++ P++ N    L+ 
Sbjct  268   QGPTAFLGNPDLC--GFPLRKSCSGSDRN------FSSGSD----QNKPDNGNRSKGLSP  315

Query  1397  N---RKPQAAAAVVGVIGLFVILAVAGLFTFSWYRRRKQQIGSTVDISESRVSTDQPKVL  1227
                     A AAVV +IGL ++          W R+  +   S +     R   ++   +
Sbjct  316   GLIILISAADAAVVALIGLVIVY-------IYWKRKDDENACSCI---RKRSFGEEKGNM  365

Query  1226  CRRSTSPLISLEYSNGWDPLAKDQSGSALSQEVL---ESFMFNLDEVESATQYFSETNLL  1056
             C            S+  D    +        E++   +   F LDE+  A+ Y     +L
Sbjct  366   CVCGGLSCFGGVKSDDDDDEEFEGGEGEGEGELVRIDKGLSFELDELLRASAY-----VL  420

Query  1055  GKSSFSAVYKGTLRDGSAVAVKCISKTSCKSDEAEFRKGLTLLTSLKHENLLRLRGFCCS  876
             GKS    VYK  L +G  VAV+ + +   +    EF   +  +  +KH N++RLR +  +
Sbjct  421   GKSGLGIVYKVVLGNGVPVAVRRLGEGG-EQRYKEFAAEVMAIGKVKHPNVVRLRAYYWA  479

Query  875   KGRGECFLIYDFVSNGNLLRYLDVKDEKGKV-LDWSTRTAIIKGIARGIKYLHGNKRNKP  699
                 E  LI DF+SNGNL   L  ++ +    L WSTR  I KG ARG+ YLH     K 
Sbjct  480   --HDEKLLISDFISNGNLAHALRGRNGQPSTNLSWSTRLRIAKGTARGLAYLHECSPRK-  536

Query  698   ALVHRNISADKVLIDHLYKPLLSDSGLHKLLA---DDIVFSTLKGSA-----------AN  561
               VH +I    +L+D+ ++P +SD GL++L++   ++       G A            N
Sbjct  537   -FVHGDIKPSNILLDNDFQPYISDFGLNRLISITGNNPSTGGFMGGALPYMNSSQKERTN  595

Query  560   GYLAPEYAITG-RFTEKSDMYAFGVIILQILSG----SCVVTQSNHQGAELCRF------  414
              Y APE  + G R T+K D+Y+FGV++L+IL+G    S   T ++ +  +L R+      
Sbjct  596   NYKAPEARVPGCRTTQKWDVYSFGVVLLEILTGRSPESSPTTSTSMEVPDLVRWVRKGFD  655

Query  413   -----EDFVDAKLGKDF-VESEAAKLGKIALLCTHDSPSRRPAIDVVIQ  285
                   + VD  L ++  V+ E   +  +AL CT + P  RP +  V +
Sbjct  656   QESPLSEMVDPSLLQEVRVKKEVLAVFHVALSCTEEDPEARPRMKTVCE  704



>ref|XP_002452616.1| hypothetical protein SORBIDRAFT_04g029170 [Sorghum bicolor]
 gb|EES05592.1| hypothetical protein SORBIDRAFT_04g029170 [Sorghum bicolor]
Length=626

 Score =   241 bits (614),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 196/656 (30%), Positives = 303/656 (46%), Gaps = 134/656 (20%)
 Frame = -3

Query  2207  VSLLMAIKASLDPGNLVLSSWSPNVTDPCSVSSFEGIACNDLGQVVNISLQGKGLYGKIP  2028
             V  LM IK  L   + VL +W  +  DPCS   +  + C+                    
Sbjct  37    VQALMMIKNYLKDPHGVLKNWDQDSVDPCS---WTMVTCS--------------------  73

Query  2027  PEIGQLNGLSGLYLHFNNLHGVIPKEIASLTQLSDLYLNMNDLSGFIPSEIGNMPNLQVL  1848
             PE    N ++GL     NL G++   I +LT L  + L  N+++G IP+EIG +  L+ L
Sbjct  74    PE----NLVTGLEAPSQNLSGILSPSIGNLTNLETVLLQNNNINGLIPAEIGKLRKLKTL  129

Query  1847  QLCYNRFEGCIPNKLGSLKNLTVLALQSNQLTGAIPASlggltlltrldLSFNRLFGSIP  1668
              L  N   G IP+ +G L++L  L L +N L+GA P S                      
Sbjct  130   DLSSNHLSGEIPSSVGHLESLQYLRLNNNTLSGAFPPSS---------------------  168

Query  1667  VKLSEASKLEVLDLRNNTLSGNVPLGLKRLNEGFRYENNPGLCGTGFPSLALCSDSSLNP  1488
                +  S L  LDL  N  SG +P  L R    F    NP +C       A   +     
Sbjct  169   ---ANLSHLIFLDLSYNNFSGPIPGSLTRT---FNIVGNPLIC-------AATMEQDCYG  215

Query  1487  TKPEPFGQGSNRLPTKDIPESANIPHQLNQNRKPQAAAAVVGVIGLFVILAVAGLFTFSW  1308
             + P P   G N        +   +P +   ++   A  A  G I L V LA+  LF   W
Sbjct  216   SLPMPMSYGLNN------TQGTLMPAKAKSHKVAIAFGATTGCISL-VFLAIGLLF---W  265

Query  1307  YRRRKQQIGSTVDISESRVSTDQPKVLCRRSTSPLISLEYSNGWDPLAKDQSGSALSQEV  1128
             +R                         CRR+   L +++          DQ    ++   
Sbjct  266   WR-------------------------CRRNRKTLYNVD----------DQHIENVNLGN  290

Query  1127  LESFMFNLDEVESATQYFSETNLLGKSSFSAVYKGTLRDGSAVAVKCISKTSCKSDEAEF  948
             ++ F F   E+++AT+ FS  N+LGK  F  VY+G L DGS VAVK +   +    EA+F
Sbjct  291   MKRFQFR--ELQAATENFSSKNILGKGGFGIVYRGQLPDGSLVAVKRLKDGNAAGGEAQF  348

Query  947   RKGLTLLTSLKHENLLRLRGFCCSKGRGECFLIYDFVSNGNLLRYLDVKDEKGK-VLDWS  771
             +  + +++   H NLLRL GFC +    E  L+Y ++SNG++   L     KGK  LDW 
Sbjct  349   QTEVEMISLAVHRNLLRLYGFCMTA--SERLLVYPYMSNGSVALRL-----KGKPPLDWI  401

Query  770   TRTAIIKGIARGIKYLHGNKRNKPALVHRNISADKVLIDHLYKPLLSDSGLHKLL--ADD  597
             TR  I  G ARG+ YLH  ++  P ++HR++ A  +L+D   + ++ D GL KLL   + 
Sbjct  402   TRKRIALGAARGLLYLH--EQCDPKIIHRDVKAANILLDDCCEAIVGDFGLAKLLDHRES  459

Query  596   IVFSTLKGSAANGYLAPEYAITGRFTEKSDMYAFGVIILQILSGSCVV---TQSNHQGAE  426
              V + ++G+   G++APEY  TG+ +EK+D++ FG+++L++++G   +     SN +GA 
Sbjct  460   HVTTAVRGTV--GHIAPEYLSTGQSSEKTDVFGFGILLLELITGQTALEFGKSSNQKGAM  517

Query  425   L---------CRFEDFVDAKLGKDFVESEAAKLGKIALLCTHDSPSRRPAIDVVIQ  285
             L          + +  VD  LG  +   E  ++ ++ALLCT   P  RP +  V++
Sbjct  518   LDWVKKMHQEKQLDILVDKGLGSKYDRIELEEMVQVALLCTQFLPGHRPKMSEVVR  573



>emb|CDX90696.1| BnaA03g23760D [Brassica napus]
Length=764

 Score =   242 bits (618),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 202/640 (32%), Positives = 302/640 (47%), Gaps = 122/640 (19%)
 Frame = -3

Query  2087  DLGQVVNISLQGKGLYGKIPPEIGQLNGLSGLYLHFNNLHGVIPKEIASLTQLSDLYLNM  1908
             +L  + N+ L    L G IPPEIG L+ L+ L L  N L G IP   A L  ++ L +  
Sbjct  195   NLTNLANLYLFINSLSGPIPPEIGNLSSLAELCLDRNKLTGQIPSSFAKLKNVTLLNMFE  254

Query  1907  NDLSGFIPSEIGNMPNLQVLQLCYNRFEGCIPNKLGSLKNLTVLALQSNQLTGAIPASlg  1728
             N+L+G IP EIG+M  L  L L  N   G IP+ LG+LKNL +L L  N+LTG+IP  LG
Sbjct  255   NNLTGEIPPEIGDMSALDTLSLHTNNLTGSIPSTLGNLKNLAILHLYLNKLTGSIPEELG  314

Query  1727  gltlltrldLSFNRLFGSIPVKLSEASKLEVLDLRNNTLSGNVPLGLKRL----------  1578
              +  +  L++S N+L G IP + S    LE L L++N LSG +P   + +          
Sbjct  315   DMETMIDLEISENKLTGPIPSQFSSLQNLEKLYLQHNNLSGPIPSSFREMKSLTHVDVSH  374

Query  1577  ---------NEGFR------YENNPGLCGTGFPSLALCSDSSLNPTKPEPFGQGSNRLPT  1443
                      N  F        E N  LCG+        +   L P +  P G+       
Sbjct  375   NNLSGPIPDNAAFENARPDALEGNRDLCGSN-------ATQGLKPCEITPSGK-------  420

Query  1442  KDIPESANIPHQLNQNRKPQAAAAVVGVIGLFVILAV-AGLFTFSWYRRRKQQIGSTVDI  1266
                 + +N  + L           +V +IG  VIL+V AG+F    +R+RK QI    D 
Sbjct  421   ----KKSNKDNNL-------LIYILVPIIGAIVILSVCAGIFV--CFRKRKPQIEEEADT  467

Query  1265  SESRVSTDQPKVLCRRSTSPLISLEYSNGWDPLAKDQSGSALSQEVLESFMFNLD-----  1101
                                                 +SG  LS       +F+ D     
Sbjct  468   ------------------------------------ESGETLS-------IFSFDGKVKY  484

Query  1100  -EVESATQYFSETNLLGKSSFSAVYKGTLRDGSAVAVKCISKT-----SCKSDEAEFRKG  939
              E+  AT  F   +L+G   +  VYK  L     +AVK +++T     S  +   EF   
Sbjct  485   QEIIKATGEFDPKHLIGTGGYGKVYKAKL-PAITMAVKKLNETTDEEISKPTVRNEFLNE  543

Query  938   LTLLTSLKHENLLRLRGFCCSKGRGECFLIYDFVSNGNLLRYLDVKDEKGKVLDWSTRTA  759
             +  LT ++H N+++L GFC +  R   FL+Y+++  G+L + L   DE+ K LDW  R  
Sbjct  544   IRALTEIRHRNVVKLFGFCSN--RRNTFLVYEYMERGSLRKVLG-NDEEAKQLDWRRRIN  600

Query  758   IIKGIARGIKYLHGNKRNKPALVHRNISADKVLIDHLYKPLLSDSGLHKLL-ADDIVFST  582
             ++KG+A  + YLH ++   P +VHR+IS+  VLID  Y+  +SD G  KLL  D   +S 
Sbjct  601   VVKGVAHALSYLHHDR--SPPIVHRDISSGNVLIDDDYEAKISDFGTAKLLKVDSSNWSA  658

Query  581   LKGSAANGYLAPEYAITGRFTEKSDMYAFGVIILQILSGS----CVVTQSNHQGAELCRF  414
             + G+   GY+APE A   + TEK D+++FGV+ L+++ G      V T S+         
Sbjct  659   VAGTY--GYVAPELAYAMKVTEKCDVFSFGVLTLEVIKGEHPGDLVSTISSTPLDRTMSL  716

Query  413   EDFVDAKLGKDF--VESEAAKLGKIALLCTHDSPSRRPAI  300
             +   D +L +    ++ E  ++ K+ALLC H  P+ RP +
Sbjct  717   KGISDRRLPEPTPEIKHEILEIMKVALLCLHSDPNSRPTM  756


 Score =   112 bits (281),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 70/170 (41%), Positives = 101/170 (59%), Gaps = 0/170 (0%)
 Frame = -3

Query  2087  DLGQVVNISLQGKGLYGKIPPEIGQLNGLSGLYLHFNNLHGVIPKEIASLTQLSDLYLNM  1908
             D  +++   L    L G+IPPE+G+L+ L  L+L  N L+G IP EI  LT+L ++ L  
Sbjct  123   DFSKLIYFDLSINQLVGEIPPELGKLSNLETLHLVENKLNGSIPSEIGRLTKLHEIALYD  182

Query  1907  NDLSGFIPSEIGNMPNLQVLQLCYNRFEGCIPNKLGSLKNLTVLALQSNQLTGAIPASlg  1728
             N L+G IPS +GN+ NL  L L  N   G IP ++G+L +L  L L  N+LTG IP+S  
Sbjct  183   NLLTGPIPSSLGNLTNLANLYLFINSLSGPIPPEIGNLSSLAELCLDRNKLTGQIPSSFA  242

Query  1727  gltlltrldLSFNRLFGSIPVKLSEASKLEVLDLRNNTLSGNVPLGLKRL  1578
              L  +T L++  N L G IP ++ + S L+ L L  N L+G++P  L  L
Sbjct  243   KLKNVTLLNMFENNLTGEIPPEIGDMSALDTLSLHTNNLTGSIPSTLGNL  292


 Score = 87.8 bits (216),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 70/195 (36%), Positives = 100/195 (51%), Gaps = 6/195 (3%)
 Frame = -3

Query  2156  LSSWSPNVTDPCSVSSFEGIAC--NDLGQVVNISLQGKGLYGKIPPEIGQLNGLSGLYLH  1983
             LSSW    T  CS  S+ G++C  N + ++   +   +G +   P     L  L+ + L 
Sbjct  54    LSSWVNPNTSFCS--SWYGVSCLRNSIIRLNLTNTDIEGTFQDFP--FSALPNLTYVDLS  109

Query  1982  FNNLHGVIPKEIASLTQLSDLYLNMNDLSGFIPSEIGNMPNLQVLQLCYNRFEGCIPNKL  1803
              N   G IP +    ++L    L++N L G IP E+G + NL+ L L  N+  G IP+++
Sbjct  110   MNRFSGTIPPQFGDFSKLIYFDLSINQLVGEIPPELGKLSNLETLHLVENKLNGSIPSEI  169

Query  1802  GSLKNLTVLALQSNQLTGAIPASlggltlltrldLSFNRLFGSIPVKLSEASKLEVLDLR  1623
             G L  L  +AL  N LTG IP+SLG LT L  L L  N L G IP ++   S L  L L 
Sbjct  170   GRLTKLHEIALYDNLLTGPIPSSLGNLTNLANLYLFINSLSGPIPPEIGNLSSLAELCLD  229

Query  1622  NNTLSGNVPLGLKRL  1578
              N L+G +P    +L
Sbjct  230   RNKLTGQIPSSFAKL  244



>ref|XP_008446051.1| PREDICTED: probable inactive leucine-rich repeat receptor-like 
protein kinase At1g66830 [Cucumis melo]
Length=715

 Score =   241 bits (614),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 227/712 (32%), Positives = 336/712 (47%), Gaps = 117/712 (16%)
 Frame = -3

Query  2198  LMAIKASLD--PGNLVLSSWSPNVTDPCSVSSFEGIACNDLG---QVVNISLQGKGLYGK  2034
             L+++K+++D  P   V S W+ N + PC    + GI+C ++    +VV I+L GK L+G 
Sbjct  36    LLSLKSAVDQSPDTSVFSDWNENDSTPCG---WSGISCMNVSGDSRVVGIALSGKNLHGY  92

Query  2033  IPPEIGQLNGLSGLYLHFNNLHGVIPKEIASLTQLSDLYLNMNDLSGFIPSEIGNMPNLQ  1854
             IP E+G L  L  L LH NNL+G IP+++ + T L  L+L  N+LSG  P  I N+P LQ
Sbjct  93    IPSELGSLVYLRRLNLHNNNLYGSIPEQLFNATSLHSLFLYSNNLSGSFPPSICNIPRLQ  152

Query  1853  VLQLCYNRFEGCIPNKLGSLKNLTVLALQSNQLTGAIPASlgg-----------------  1725
              L L  N   G +P++L + K L  L L  NQ  G IP+ +                   
Sbjct  153   NLDLSNNSLAGPVPDELRNCKQLQRLILARNQFDGEIPSGVWSGMDNLVQLDLSSNDFSG  212

Query  1724  ---------ltlltrldLSFNRLFGSIPVKLSEASKLEVLDLRNNTLSGNVPLGLKRLNE  1572
                       TL   L+LSFN L G IP  L +       DLR+N LSG++P      N+
Sbjct  213   SIPEDLGELKTLSGTLNLSFNHLSGKIPKTLGDLPVTVSFDLRSNNLSGSIPQTGSFANQ  272

Query  1571  G-FRYENNPGLCGTGFPSLALCSDSSL-NPTKPEPFGQGSNRLPTKDIPESANIPHQLNQ  1398
             G   + NNP LC  GFP    C +S   +P  P+   + S   P K +  SA +   ++ 
Sbjct  273   GPTAFLNNPELC--GFPLQKSCENSERGSPGNPD--SKPSYITPRKGL--SAGLIILIS-  325

Query  1397  NRKPQAAAAVVGVIGLFVILAVAGLFTFSWYRRRKQQIGSTVDISESRVSTDQPKVLCRR  1218
                  A AA V  IGL ++        + ++RR+    G +   S+ +   +Q   LC  
Sbjct  326   ----AADAAGVAFIGLVIV--------YVYWRRKDSSNGCSC-TSKRKFGGNQKDNLC--  370

Query  1217  STSPLISLEYSNGWDPLAKDQSGSAL----SQE------VLESFMFNLDEVESATQYFSE  1068
                   +    NG D   + +         S+E      V + F F LDE+  A+ Y   
Sbjct  371   ------NFPCMNGNDKNEESEMEEPENSERSREEGGLVAVDKGFTFELDELLRASAY---  421

Query  1067  TNLLGKSSFSAVYKGTLRDGSAVAVKCISKTSCKSDEAEFRKGLTLLTSLKHENLLRLRG  888
               +LGKS    VYK  L +G  VAV+ + +   +    EF   +  +  +KH N+++LR 
Sbjct  422   --VLGKSGLGIVYKVVLGNGIPVAVRRLGEGG-EQRYKEFAAEVQAIGRVKHPNIVKLRA  478

Query  887   FCCSKGRGECFLIYDFVSNGNLLRYLDVKD-EKGKVLDWSTRTAIIKGIARGIKYLHGNK  711
             +  +    E  LI DF+SNGNL   L  K+ +    L WSTR  I KG ARG+ YLH   
Sbjct  479   YYWAP--DEKLLISDFISNGNLASALRGKNGQPSSSLSWSTRLRITKGTARGLAYLHECS  536

Query  710   RNKPALVHRNISADKVLIDHLYKPLLSDSGLHKLLADD------------IVFSTLKG--  573
               K   VH +I    +L+D+ + P +SD GL++L++                FS LK   
Sbjct  537   PRK--FVHGDIKPSNILLDNDFHPHISDFGLNRLISITGNNPSSSGGLIGGAFSYLKSVQ  594

Query  572   -SAANGYLAPE-YAITGRFTEKSDMYAFGVIILQILSGSCVV----TQSNHQGAELCRF-  414
                 N Y APE  A  GR T+K D+Y+FGV++L++L+G        T ++ +  +L R+ 
Sbjct  595   TDRTNNYCAPEARAPGGRPTQKWDVYSFGVMVLELLTGKSPELSPNTSTSLEIPDLVRWV  654

Query  413   -EDFVDAKLGKDFVE----------SEAAKLGKIALLCTHDSPSRRPAIDVV  291
              + F +AK   D V+           E   +  +AL CT   P  RP +  V
Sbjct  655   RKGFEEAKPLSDLVDPALLQEVHAKKEVLAVFHVALACTESDPEVRPRMKTV  706



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 7574500654352