BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c8066_g2_i1 len=146 path=[447:0-145]

Length=146
                                                                      Score     E

ref|XP_006342240.1|  PREDICTED: subtilisin-like protease-like         49.7    3e-05   
ref|XP_009614807.1|  PREDICTED: subtilisin-like protease SBT5.3       49.3    5e-05   
ref|XP_004238378.1|  PREDICTED: CO(2)-response secreted protease      49.3    5e-05   
ref|WP_028784438.1|  peptidase S8                                     48.5    6e-05   
ref|XP_009780984.1|  PREDICTED: subtilisin-like protease SBT5.3       48.9    7e-05   
ref|XP_003523395.1|  PREDICTED: subtilisin-like protease-like         47.8    1e-04   
ref|WP_032088184.1|  peptidase S8                                     47.4    1e-04   
gb|KHG24601.1|  Cucumisin                                             47.8    1e-04   
ref|XP_002269753.1|  PREDICTED: CO(2)-response secreted protease-...  47.8    2e-04   Vitis vinifera
emb|CBI19918.3|  unnamed protein product                              47.8    2e-04   
ref|XP_009757105.1|  PREDICTED: subtilisin-like protease SBT5.3       47.8    2e-04   
ref|XP_010029506.1|  PREDICTED: subtilisin-like protease              47.8    2e-04   
gb|KCW56428.1|  hypothetical protein EUGRSUZ_I02156                   47.4    2e-04   
ref|XP_009605223.1|  PREDICTED: subtilisin-like protease              47.4    2e-04   
ref|XP_011083454.1|  PREDICTED: CO(2)-response secreted protease-...  47.4    2e-04   
ref|XP_011072681.1|  PREDICTED: subtilisin-like protease              47.4    2e-04   
ref|XP_009381912.1|  PREDICTED: subtilisin-like protease              47.4    2e-04   
ref|XP_009410252.1|  PREDICTED: subtilisin-like protease              47.0    3e-04   
ref|XP_007226628.1|  hypothetical protein PRUPE_ppa022764mg           47.0    3e-04   
ref|XP_008357123.1|  PREDICTED: subtilisin-like protease              47.0    3e-04   
ref|XP_008221224.1|  PREDICTED: subtilisin-like protease              46.6    3e-04   
gb|KHN45941.1|  Subtilisin-like protease                              46.2    4e-04   
emb|CDP07365.1|  unnamed protein product                              46.6    4e-04   
ref|XP_008807400.1|  PREDICTED: subtilisin-like protease              46.2    4e-04   
gb|EPS64737.1|  hypothetical protein M569_10042                       46.2    5e-04   
ref|XP_007797860.1|  putative subtilisin-like protease protein        46.2    5e-04   
ref|XP_009357900.1|  PREDICTED: subtilisin-like protease isoform X2   46.2    5e-04   
ref|XP_011036534.1|  PREDICTED: subtilisin-like protease              46.2    5e-04   
ref|XP_008228336.1|  PREDICTED: subtilisin-like protease              46.2    5e-04   
ref|WP_037498860.1|  hypothetical protein                             45.4    5e-04   
ref|XP_009357945.1|  PREDICTED: subtilisin-like protease              46.2    5e-04   
ref|XP_007217030.1|  hypothetical protein PRUPE_ppa001661mg           46.2    6e-04   
ref|XP_008392153.1|  PREDICTED: subtilisin-like protease              46.2    6e-04   
ref|XP_010266013.1|  PREDICTED: CO(2)-response secreted protease-...  46.2    6e-04   
ref|XP_009357899.1|  PREDICTED: subtilisin-like protease isoform X1   45.8    7e-04   
ref|WP_039807604.1|  peptidase S8                                     45.4    7e-04   
gb|KDO84931.1|  hypothetical protein CISIN_1g004113mg                 45.4    8e-04   
gb|KHN32321.1|  Subtilisin-like protease                              45.1    8e-04   
gb|KDO84930.1|  hypothetical protein CISIN_1g004113mg                 45.4    8e-04   
gb|KCW79387.1|  hypothetical protein EUGRSUZ_C00799                   45.4    8e-04   
ref|XP_006435228.1|  hypothetical protein CICLE_v10000339mg           45.4    8e-04   
ref|XP_004164801.1|  PREDICTED: cucumisin-like                        45.4    9e-04   
ref|XP_010552189.1|  PREDICTED: subtilisin-like protease              45.4    9e-04   
ref|XP_006847107.1|  hypothetical protein AMTR_s00017p00219220        45.4    9e-04   
ref|XP_004136374.1|  PREDICTED: subtilisin-like protease-like         45.4    0.001   
ref|XP_009419476.1|  PREDICTED: subtilisin-like protease SDD1         45.4    0.001   
ref|WP_012964763.1|  peptidase S8 and S53 subtilisin kexin sedolisin  45.4    0.001   
ref|XP_002510578.1|  Cucumisin precursor, putative                    45.1    0.001   Ricinus communis
gb|KFA63713.1|  hypothetical protein S40285_07108                     45.4    0.001   



>ref|XP_006342240.1| PREDICTED: subtilisin-like protease-like [Solanum tuberosum]
Length=773

 Score = 49.7 bits (117),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 26/47 (55%), Positives = 33/47 (70%), Gaps = 1/47 (2%)
 Frame = -3

Query  144  WPDNLDGGEIIPIKSHLGYNLISGTSMATPHTSGIVATVKAQNPNFS  4
            WP N D  E +  ++   YN+ISGTSM+ PH SGI A VKAQNP++S
Sbjct  528  WPGN-DTNEAVAGQAPPLYNIISGTSMSCPHVSGIAALVKAQNPSWS  573



>ref|XP_009614807.1| PREDICTED: subtilisin-like protease SBT5.3 [Nicotiana tomentosiformis]
Length=768

 Score = 49.3 bits (116),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 26/47 (55%), Positives = 32/47 (68%), Gaps = 1/47 (2%)
 Frame = -3

Query  144  WPDNLDGGEIIPIKSHLGYNLISGTSMATPHTSGIVATVKAQNPNFS  4
            WP N D  E +P +    +NL+SGTSM+ PH SGI ATVKA NP +S
Sbjct  527  WPGN-DTSEALPGQKPPIFNLLSGTSMSCPHVSGIAATVKAVNPTWS  572



>ref|XP_004238378.1| PREDICTED: CO(2)-response secreted protease [Solanum lycopersicum]
Length=783

 Score = 49.3 bits (116),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 26/47 (55%), Positives = 33/47 (70%), Gaps = 1/47 (2%)
 Frame = -3

Query  144  WPDNLDGGEIIPIKSHLGYNLISGTSMATPHTSGIVATVKAQNPNFS  4
            WP N D  E +  ++   YN+ISGTSM+ PH SGI A VKAQNP++S
Sbjct  528  WPGN-DTTEAVAGQALPLYNIISGTSMSCPHVSGIAALVKAQNPSWS  573



>ref|WP_028784438.1| peptidase S8 [Thalassobacillus devorans]
Length=417

 Score = 48.5 bits (114),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 22/30 (73%), Positives = 24/30 (80%), Gaps = 0/30 (0%)
 Frame = -3

Query  93   GYNLISGTSMATPHTSGIVATVKAQNPNFS  4
            GYN ISGTSMATPH SG+ A + AQNP FS
Sbjct  349  GYNTISGTSMATPHVSGLAAKIWAQNPGFS  378



>ref|XP_009780984.1| PREDICTED: subtilisin-like protease SBT5.3 [Nicotiana sylvestris]
Length=768

 Score = 48.9 bits (115),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 26/47 (55%), Positives = 32/47 (68%), Gaps = 1/47 (2%)
 Frame = -3

Query  144  WPDNLDGGEIIPIKSHLGYNLISGTSMATPHTSGIVATVKAQNPNFS  4
            WP N D  E +P +    +NL+SGTSM+ PH SGI ATVKA NP +S
Sbjct  527  WPGN-DTSEALPGQKPPIFNLLSGTSMSCPHVSGIAATVKAVNPAWS  572



>ref|XP_003523395.1| PREDICTED: subtilisin-like protease-like [Glycine max]
 gb|KHN45942.1| Subtilisin-like protease [Glycine soja]
Length=769

 Score = 47.8 bits (112),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 21/29 (72%), Positives = 26/29 (90%), Gaps = 0/29 (0%)
 Frame = -3

Query  90   YNLISGTSMATPHTSGIVATVKAQNPNFS  4
            YN+ISGTSMATPH SG+V +VK QNP++S
Sbjct  546  YNIISGTSMATPHVSGLVCSVKTQNPSWS  574



>ref|WP_032088184.1| peptidase S8 [Bacillus aquimaris]
Length=413

 Score = 47.4 bits (111),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 21/30 (70%), Positives = 24/30 (80%), Gaps = 0/30 (0%)
 Frame = -3

Query  90   YNLISGTSMATPHTSGIVATVKAQNPNFSV  1
            YN ISGTSMATPH SG+ A + A+NPNFS 
Sbjct  345  YNTISGTSMATPHVSGLAAKIWAENPNFSA  374



>gb|KHG24601.1| Cucumisin [Gossypium arboreum]
Length=768

 Score = 47.8 bits (112),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 22/29 (76%), Positives = 25/29 (86%), Gaps = 0/29 (0%)
 Frame = -3

Query  90   YNLISGTSMATPHTSGIVATVKAQNPNFS  4
            YNLISGTSMA PH SGI ATVK++NP +S
Sbjct  540  YNLISGTSMACPHVSGIAATVKSKNPTWS  568



>ref|XP_002269753.1| PREDICTED: CO(2)-response secreted protease-like [Vitis vinifera]
Length=768

 Score = 47.8 bits (112),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 21/29 (72%), Positives = 26/29 (90%), Gaps = 0/29 (0%)
 Frame = -3

Query  90   YNLISGTSMATPHTSGIVATVKAQNPNFS  4
            +NL+SGTSMA PH SGI ATVK+QNP++S
Sbjct  541  FNLLSGTSMACPHVSGIAATVKSQNPSWS  569



>emb|CBI19918.3| unnamed protein product [Vitis vinifera]
Length=743

 Score = 47.8 bits (112),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 21/29 (72%), Positives = 26/29 (90%), Gaps = 0/29 (0%)
 Frame = -3

Query  90   YNLISGTSMATPHTSGIVATVKAQNPNFS  4
            +NL+SGTSMA PH SGI ATVK+QNP++S
Sbjct  516  FNLLSGTSMACPHVSGIAATVKSQNPSWS  544



>ref|XP_009757105.1| PREDICTED: subtilisin-like protease SBT5.3 [Nicotiana sylvestris]
Length=769

 Score = 47.8 bits (112),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 25/47 (53%), Positives = 33/47 (70%), Gaps = 1/47 (2%)
 Frame = -3

Query  144  WPDNLDGGEIIPIKSHLGYNLISGTSMATPHTSGIVATVKAQNPNFS  4
            WP N D  E +  +    +N++SGTSM+ PH SGIVA VKAQNP++S
Sbjct  527  WPGN-DTKEAVLGQEPPLFNILSGTSMSCPHVSGIVAIVKAQNPSWS  572



>ref|XP_010029506.1| PREDICTED: subtilisin-like protease [Eucalyptus grandis]
Length=780

 Score = 47.8 bits (112),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 21/47 (45%), Positives = 30/47 (64%), Gaps = 0/47 (0%)
 Frame = -3

Query  144  WPDNLDGGEIIPIKSHLGYNLISGTSMATPHTSGIVATVKAQNPNFS  4
            WPDN+    +   K    +N++SGTSMA PH SG+ A +KA +P +S
Sbjct  529  WPDNIGPSGVASDKRKTEFNILSGTSMACPHVSGLAALLKAAHPEWS  575



>gb|KCW56428.1| hypothetical protein EUGRSUZ_I02156 [Eucalyptus grandis]
Length=897

 Score = 47.4 bits (111),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 21/47 (45%), Positives = 30/47 (64%), Gaps = 0/47 (0%)
 Frame = -3

Query  144  WPDNLDGGEIIPIKSHLGYNLISGTSMATPHTSGIVATVKAQNPNFS  4
            WPDN+    +   K    +N++SGTSMA PH SG+ A +KA +P +S
Sbjct  646  WPDNIGPSGVASDKRKTEFNILSGTSMACPHVSGLAALLKAAHPEWS  692



>ref|XP_009605223.1| PREDICTED: subtilisin-like protease [Nicotiana tomentosiformis]
Length=783

 Score = 47.4 bits (111),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 25/47 (53%), Positives = 33/47 (70%), Gaps = 1/47 (2%)
 Frame = -3

Query  144  WPDNLDGGEIIPIKSHLGYNLISGTSMATPHTSGIVATVKAQNPNFS  4
            WP N D  E +  +    +N++SGTSM+ PH SGIVA VKAQNP++S
Sbjct  527  WPGN-DTKEAVLGQEPPLFNILSGTSMSCPHVSGIVAIVKAQNPSWS  572



>ref|XP_011083454.1| PREDICTED: CO(2)-response secreted protease-like [Sesamum indicum]
Length=729

 Score = 47.4 bits (111),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 23/47 (49%), Positives = 32/47 (68%), Gaps = 1/47 (2%)
 Frame = -3

Query  144  WPDNLDGGEIIPIKSHLGYNLISGTSMATPHTSGIVATVKAQNPNFS  4
            WP N D  E +P K    ++++SGTSMA PH SG+ A VK+Q+P +S
Sbjct  489  WPSN-DKREALPEKEPPVFDILSGTSMACPHVSGLAAMVKSQHPTWS  534



>ref|XP_011072681.1| PREDICTED: subtilisin-like protease [Sesamum indicum]
Length=792

 Score = 47.4 bits (111),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 22/47 (47%), Positives = 30/47 (64%), Gaps = 0/47 (0%)
 Frame = -3

Query  144  WPDNLDGGEIIPIKSHLGYNLISGTSMATPHTSGIVATVKAQNPNFS  4
            WPDN+    I   K    +N++SGTSMA PH SG+ A +KA +P +S
Sbjct  541  WPDNVGPSGIPSDKRRTEFNILSGTSMACPHVSGLAALLKAAHPEWS  587



>ref|XP_009381912.1| PREDICTED: subtilisin-like protease [Musa acuminata subsp. malaccensis]
Length=1224

 Score = 47.4 bits (111),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 21/47 (45%), Positives = 31/47 (66%), Gaps = 0/47 (0%)
 Frame = -3

Query  144   WPDNLDGGEIIPIKSHLGYNLISGTSMATPHTSGIVATVKAQNPNFS  4
             WPDN+    I   +    +N++SGTSMA PH SG+ A +KA +P++S
Sbjct  970   WPDNVGPAGIPSDQRKTEFNILSGTSMACPHVSGLAALLKAAHPDWS  1016



>ref|XP_009410252.1| PREDICTED: subtilisin-like protease [Musa acuminata subsp. malaccensis]
Length=790

 Score = 47.0 bits (110),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 21/47 (45%), Positives = 31/47 (66%), Gaps = 0/47 (0%)
 Frame = -3

Query  144  WPDNLDGGEIIPIKSHLGYNLISGTSMATPHTSGIVATVKAQNPNFS  4
            WPDN+    I   +    +N++SGTSMA PH SG+ A +KA +P++S
Sbjct  536  WPDNVGPASIPSDQRRTEFNILSGTSMACPHVSGLAALLKAAHPDWS  582



>ref|XP_007226628.1| hypothetical protein PRUPE_ppa022764mg [Prunus persica]
 gb|EMJ27827.1| hypothetical protein PRUPE_ppa022764mg [Prunus persica]
Length=722

 Score = 47.0 bits (110),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 21/29 (72%), Positives = 25/29 (86%), Gaps = 0/29 (0%)
 Frame = -3

Query  90   YNLISGTSMATPHTSGIVATVKAQNPNFS  4
            +N+ISGTSMA PH SGI ATVK+QNP +S
Sbjct  495  FNVISGTSMACPHVSGIAATVKSQNPTWS  523



>ref|XP_008357123.1| PREDICTED: subtilisin-like protease [Malus domestica]
Length=794

 Score = 47.0 bits (110),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 21/29 (72%), Positives = 25/29 (86%), Gaps = 0/29 (0%)
 Frame = -3

Query  90   YNLISGTSMATPHTSGIVATVKAQNPNFS  4
            YN++SGTSM+ PH SGI ATVKAQNP +S
Sbjct  569  YNVLSGTSMSCPHVSGIAATVKAQNPAWS  597



>ref|XP_008221224.1| PREDICTED: subtilisin-like protease [Prunus mume]
Length=776

 Score = 46.6 bits (109),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 21/29 (72%), Positives = 25/29 (86%), Gaps = 0/29 (0%)
 Frame = -3

Query  90   YNLISGTSMATPHTSGIVATVKAQNPNFS  4
            +N+ISGTSMA PH SGI ATVK+QNP +S
Sbjct  551  FNVISGTSMACPHVSGIAATVKSQNPTWS  579



>gb|KHN45941.1| Subtilisin-like protease [Glycine soja]
Length=417

 Score = 46.2 bits (108),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 20/29 (69%), Positives = 24/29 (83%), Gaps = 0/29 (0%)
 Frame = -3

Query  90   YNLISGTSMATPHTSGIVATVKAQNPNFS  4
            YN+ISGTSMATPH SG+  +VK QNP +S
Sbjct  231  YNIISGTSMATPHVSGLACSVKTQNPTWS  259



>emb|CDP07365.1| unnamed protein product [Coffea canephora]
Length=762

 Score = 46.6 bits (109),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 22/47 (47%), Positives = 31/47 (66%), Gaps = 0/47 (0%)
 Frame = -3

Query  144  WPDNLDGGEIIPIKSHLGYNLISGTSMATPHTSGIVATVKAQNPNFS  4
            WP N+        ++   +N++SGTSMA PH SGI ATVK+Q P++S
Sbjct  521  WPSNVTEDATEDAETSPPFNILSGTSMACPHASGIAATVKSQYPSWS  567



>ref|XP_008807400.1| PREDICTED: subtilisin-like protease [Phoenix dactylifera]
Length=699

 Score = 46.2 bits (108),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 19/47 (40%), Positives = 31/47 (66%), Gaps = 0/47 (0%)
 Frame = -3

Query  144  WPDNLDGGEIIPIKSHLGYNLISGTSMATPHTSGIVATVKAQNPNFS  4
            WPD +   E+   +    +N+ISGTSM+ PH +G+ A +KA +P++S
Sbjct  545  WPDGVSPTELKADRRRTEFNIISGTSMSCPHVAGVAALLKAAHPDWS  591



>gb|EPS64737.1| hypothetical protein M569_10042, partial [Genlisea aurea]
Length=572

 Score = 46.2 bits (108),  Expect = 5e-04, Method: Composition-based stats.
 Identities = 22/47 (47%), Positives = 31/47 (66%), Gaps = 0/47 (0%)
 Frame = -3

Query  144  WPDNLDGGEIIPIKSHLGYNLISGTSMATPHTSGIVATVKAQNPNFS  4
            WPDN+    I   K    +N++SGTSMA PH SG+ A +KA +P++S
Sbjct  522  WPDNVGPSGIPSDKRRTEFNILSGTSMACPHVSGLGALLKAAHPDWS  568



>ref|XP_007797860.1| putative subtilisin-like protease protein [Eutypa lata UCREL1]
 gb|EMR63045.1| putative subtilisin-like protease protein [Eutypa lata UCREL1]
Length=955

 Score = 46.2 bits (108),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 24/44 (55%), Positives = 30/44 (68%), Gaps = 3/44 (7%)
 Frame = -3

Query  126  GGEII---PIKSHLGYNLISGTSMATPHTSGIVATVKAQNPNFS  4
            GG I+   PI    GY LISGTSM+TPHT+G+ A VK  +P+ S
Sbjct  523  GGNILNTWPITDGTGYALISGTSMSTPHTAGVYALVKQAHPDLS  566



>ref|XP_009357900.1| PREDICTED: subtilisin-like protease isoform X2 [Pyrus x bretschneideri]
Length=797

 Score = 46.2 bits (108),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 20/47 (43%), Positives = 31/47 (66%), Gaps = 0/47 (0%)
 Frame = -3

Query  144  WPDNLDGGEIIPIKSHLGYNLISGTSMATPHTSGIVATVKAQNPNFS  4
            WPD +    +   K +  +N++SGTSMA PH SG+ A +KA +P++S
Sbjct  546  WPDKIGPSGVASDKRNTEFNILSGTSMACPHVSGLAALLKAAHPDWS  592



>ref|XP_011036534.1| PREDICTED: subtilisin-like protease [Populus euphratica]
Length=773

 Score = 46.2 bits (108),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 21/47 (45%), Positives = 30/47 (64%), Gaps = 0/47 (0%)
 Frame = -3

Query  144  WPDNLDGGEIIPIKSHLGYNLISGTSMATPHTSGIVATVKAQNPNFS  4
            WPD +    I   K  + +N++SGTSMA PH SG+ A +KA +P +S
Sbjct  522  WPDKIGPSGIPSDKRKIEFNILSGTSMACPHVSGLAALLKAAHPEWS  568



>ref|XP_008228336.1| PREDICTED: subtilisin-like protease [Prunus mume]
Length=764

 Score = 46.2 bits (108),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 20/47 (43%), Positives = 31/47 (66%), Gaps = 0/47 (0%)
 Frame = -3

Query  144  WPDNLDGGEIIPIKSHLGYNLISGTSMATPHTSGIVATVKAQNPNFS  4
            WPD +    +   K +  +N++SGTSMA PH SG+ A +KA +P++S
Sbjct  513  WPDRVGPSGVASDKRNTEFNILSGTSMACPHVSGLAALLKAAHPDWS  559



>ref|WP_037498860.1| hypothetical protein, partial [Solirubrobacter soli]
Length=334

 Score = 45.4 bits (106),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 20/42 (48%), Positives = 28/42 (67%), Gaps = 0/42 (0%)
 Frame = -3

Query  126  GGEIIPIKSHLGYNLISGTSMATPHTSGIVATVKAQNPNFSV  1
            G +++  K   GY   SGTSMATPH +G+ A ++AQNP  +V
Sbjct  258  GVDVLSTKRGGGYVKFSGTSMATPHVAGVAALIRAQNPGLTV  299



>ref|XP_009357945.1| PREDICTED: subtilisin-like protease [Pyrus x bretschneideri]
Length=691

 Score = 46.2 bits (108),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 20/47 (43%), Positives = 31/47 (66%), Gaps = 0/47 (0%)
 Frame = -3

Query  144  WPDNLDGGEIIPIKSHLGYNLISGTSMATPHTSGIVATVKAQNPNFS  4
            WPD +    +   K +  +N++SGTSMA PH SG+ A +KA +P++S
Sbjct  440  WPDKIGPSGVASDKRNTEFNILSGTSMACPHVSGLAALLKAAHPDWS  486



>ref|XP_007217030.1| hypothetical protein PRUPE_ppa001661mg [Prunus persica]
 gb|EMJ18229.1| hypothetical protein PRUPE_ppa001661mg [Prunus persica]
Length=784

 Score = 46.2 bits (108),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 20/47 (43%), Positives = 31/47 (66%), Gaps = 0/47 (0%)
 Frame = -3

Query  144  WPDNLDGGEIIPIKSHLGYNLISGTSMATPHTSGIVATVKAQNPNFS  4
            WPD +    +   K +  +N++SGTSMA PH SG+ A +KA +P++S
Sbjct  533  WPDKVGPSGVASDKRNTEFNILSGTSMACPHVSGLAALLKAAHPDWS  579



>ref|XP_008392153.1| PREDICTED: subtilisin-like protease [Malus domestica]
Length=815

 Score = 46.2 bits (108),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 20/47 (43%), Positives = 31/47 (66%), Gaps = 0/47 (0%)
 Frame = -3

Query  144  WPDNLDGGEIIPIKSHLGYNLISGTSMATPHTSGIVATVKAQNPNFS  4
            WPD +    +   K +  +N++SGTSMA PH SG+ A +KA +P++S
Sbjct  564  WPDKIGPSGVASDKRNTEFNILSGTSMACPHVSGLAALLKAAHPDWS  610



>ref|XP_010266013.1| PREDICTED: CO(2)-response secreted protease-like [Nelumbo nucifera]
Length=780

 Score = 46.2 bits (108),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 19/29 (66%), Positives = 26/29 (90%), Gaps = 0/29 (0%)
 Frame = -3

Query  90   YNLISGTSMATPHTSGIVATVKAQNPNFS  4
            +NL+SGTSMA PH SGI AT+K++NP++S
Sbjct  553  FNLLSGTSMACPHVSGIAATIKSKNPDWS  581



>ref|XP_009357899.1| PREDICTED: subtilisin-like protease isoform X1 [Pyrus x bretschneideri]
Length=797

 Score = 45.8 bits (107),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 20/47 (43%), Positives = 31/47 (66%), Gaps = 0/47 (0%)
 Frame = -3

Query  144  WPDNLDGGEIIPIKSHLGYNLISGTSMATPHTSGIVATVKAQNPNFS  4
            WPD +    +   K +  +N++SGTSMA PH SG+ A +KA +P++S
Sbjct  546  WPDKIGPSGVASDKRNTEFNILSGTSMACPHLSGLAALLKAAHPDWS  592



>ref|WP_039807604.1| peptidase S8 [Jeotgalibacillus sp. D5]
 gb|AJD90296.1| peptidase S8 [Jeotgalibacillus sp. D5]
Length=422

 Score = 45.4 bits (106),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 20/30 (67%), Positives = 24/30 (80%), Gaps = 0/30 (0%)
 Frame = -3

Query  93   GYNLISGTSMATPHTSGIVATVKAQNPNFS  4
            GYN ISGTSMA+PH +G+ A V A+NP FS
Sbjct  354  GYNTISGTSMASPHVAGLAAKVWAENPGFS  383



>gb|KDO84931.1| hypothetical protein CISIN_1g004113mg [Citrus sinensis]
Length=606

 Score = 45.4 bits (106),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 25/47 (53%), Positives = 30/47 (64%), Gaps = 1/47 (2%)
 Frame = -3

Query  144  WPDNLDGGEIIPIKSHLGYNLISGTSMATPHTSGIVATVKAQNPNFS  4
            W  N D GE    K    +N+ISGTSM+ PH SG+VA +K QNP FS
Sbjct  358  WMGN-DTGEAPEGKEPPLFNVISGTSMSCPHISGVVAAIKHQNPTFS  403



>gb|KHN32321.1| Subtilisin-like protease [Glycine soja]
Length=315

 Score = 45.1 bits (105),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 20/30 (67%), Positives = 26/30 (87%), Gaps = 0/30 (0%)
 Frame = -3

Query  90   YNLISGTSMATPHTSGIVATVKAQNPNFSV  1
            YNL+SGTSMA PH SG+VA +KA +P++SV
Sbjct  192  YNLLSGTSMACPHASGVVALLKAAHPDWSV  221



>gb|KDO84930.1| hypothetical protein CISIN_1g004113mg [Citrus sinensis]
Length=773

 Score = 45.4 bits (106),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 25/47 (53%), Positives = 30/47 (64%), Gaps = 1/47 (2%)
 Frame = -3

Query  144  WPDNLDGGEIIPIKSHLGYNLISGTSMATPHTSGIVATVKAQNPNFS  4
            W  N D GE    K    +N+ISGTSM+ PH SG+VA +K QNP FS
Sbjct  525  WMGN-DTGEAPEGKEPPLFNVISGTSMSCPHISGVVAAIKHQNPTFS  570



>gb|KCW79387.1| hypothetical protein EUGRSUZ_C00799 [Eucalyptus grandis]
Length=729

 Score = 45.4 bits (106),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 21/47 (45%), Positives = 30/47 (64%), Gaps = 0/47 (0%)
 Frame = -3

Query  144  WPDNLDGGEIIPIKSHLGYNLISGTSMATPHTSGIVATVKAQNPNFS  4
            WPD +   E+   K  + +N+ISGTSM+ PH SG+ A  KA +P +S
Sbjct  514  WPDYVSPTELPIDKRSVQFNIISGTSMSCPHVSGVAALFKAAHPTWS  560



>ref|XP_006435228.1| hypothetical protein CICLE_v10000339mg [Citrus clementina]
 gb|ESR48468.1| hypothetical protein CICLE_v10000339mg [Citrus clementina]
Length=787

 Score = 45.4 bits (106),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 25/47 (53%), Positives = 30/47 (64%), Gaps = 1/47 (2%)
 Frame = -3

Query  144  WPDNLDGGEIIPIKSHLGYNLISGTSMATPHTSGIVATVKAQNPNFS  4
            W  N D GE    K    +N+ISGTSM+ PH SG+VA +K QNP FS
Sbjct  539  WMGN-DTGEAPEGKEPPLFNVISGTSMSCPHISGVVAAIKHQNPTFS  584



>ref|XP_004164801.1| PREDICTED: cucumisin-like [Cucumis sativus]
Length=777

 Score = 45.4 bits (106),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 19/29 (66%), Positives = 26/29 (90%), Gaps = 0/29 (0%)
 Frame = -3

Query  90   YNLISGTSMATPHTSGIVATVKAQNPNFS  4
            +N+ISGTSM+ PH SG+VA+VK+QNP +S
Sbjct  548  FNVISGTSMSCPHVSGVVASVKSQNPTWS  576



>ref|XP_010552189.1| PREDICTED: subtilisin-like protease [Tarenaya hassleriana]
Length=790

 Score = 45.4 bits (106),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 20/47 (43%), Positives = 30/47 (64%), Gaps = 0/47 (0%)
 Frame = -3

Query  144  WPDNLDGGEIIPIKSHLGYNLISGTSMATPHTSGIVATVKAQNPNFS  4
            WPD +    +   K    +N++SGTSMA PH SG+ A +KA +P++S
Sbjct  539  WPDKIGPSGVPSDKRRTEFNILSGTSMACPHVSGLAALLKAAHPDWS  585



>ref|XP_006847107.1| hypothetical protein AMTR_s00017p00219220 [Amborella trichopoda]
 gb|ERN08688.1| hypothetical protein AMTR_s00017p00219220 [Amborella trichopoda]
Length=757

 Score = 45.4 bits (106),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 21/47 (45%), Positives = 29/47 (62%), Gaps = 0/47 (0%)
 Frame = -3

Query  144  WPDNLDGGEIIPIKSHLGYNLISGTSMATPHTSGIVATVKAQNPNFS  4
            WP N+  G +        +NL+SGTSMA PH SG+ A +KA +P +S
Sbjct  504  WPPNIPAGRLDSKSLFNDFNLLSGTSMACPHVSGVAALLKATHPEWS  550



>ref|XP_004136374.1| PREDICTED: subtilisin-like protease-like [Cucumis sativus]
 gb|KGN60051.1| hypothetical protein Csa_3G873800 [Cucumis sativus]
Length=772

 Score = 45.4 bits (106),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 19/29 (66%), Positives = 26/29 (90%), Gaps = 0/29 (0%)
 Frame = -3

Query  90   YNLISGTSMATPHTSGIVATVKAQNPNFS  4
            +N+ISGTSM+ PH SG+VA+VK+QNP +S
Sbjct  543  FNVISGTSMSCPHVSGVVASVKSQNPTWS  571



>ref|XP_009419476.1| PREDICTED: subtilisin-like protease SDD1 [Musa acuminata subsp. 
malaccensis]
Length=766

 Score = 45.4 bits (106),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 22/47 (47%), Positives = 30/47 (64%), Gaps = 2/47 (4%)
 Frame = -3

Query  144  WPDNLDGGEIIPIKSHLGYNLISGTSMATPHTSGIVATVKAQNPNFS  4
            WP  +  G   P KS   +N +SGTSMA PH SGI A ++ Q+P++S
Sbjct  525  WPFEVGPGAATPSKS--AFNFLSGTSMAAPHVSGITALIRKQHPHWS  569



>ref|WP_012964763.1| peptidase S8 and S53 subtilisin kexin sedolisin [Ferroglobus 
placidus]
 ref|YP_003434691.1| peptidase S8 and S53 subtilisin kexin sedolisin [Ferroglobus 
placidus DSM 10642]
 gb|ADC64416.1| peptidase S8 and S53 subtilisin kexin sedolisin [Ferroglobus 
placidus DSM 10642]
Length=730

 Score = 45.4 bits (106),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 20/30 (67%), Positives = 24/30 (80%), Gaps = 0/30 (0%)
 Frame = -3

Query  93   GYNLISGTSMATPHTSGIVATVKAQNPNFS  4
            GYN +SGTSMA PH SG+ A V +QNP+FS
Sbjct  467  GYNTMSGTSMAVPHVSGVAALVWSQNPSFS  496



>ref|XP_002510578.1| Cucumisin precursor, putative [Ricinus communis]
 gb|EEF52765.1| Cucumisin precursor, putative [Ricinus communis]
Length=578

 Score = 45.1 bits (105),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 24/47 (51%), Positives = 31/47 (66%), Gaps = 1/47 (2%)
 Frame = -3

Query  144  WPDNLDGGEIIPIKSHLGYNLISGTSMATPHTSGIVATVKAQNPNFS  4
            W  N D GE +  +    +N+ISGTSM+ PH SGI A VK+QNP +S
Sbjct  332  WKGN-DTGEALKGQEPPLFNVISGTSMSCPHVSGIAAEVKSQNPTWS  377



>gb|KFA63713.1| hypothetical protein S40285_07108 [Stachybotrys chlorohalonata 
IBT 40285]
Length=907

 Score = 45.4 bits (106),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 24/44 (55%), Positives = 32/44 (73%), Gaps = 2/44 (5%)
 Frame = -3

Query  126  GGEIIPI--KSHLGYNLISGTSMATPHTSGIVATVKAQNPNFSV  1
            GG I+ I   S  G+ ++SGTSMATP+ +G +A VK+Q PNFSV
Sbjct  540  GGMILSIWPLSGTGFAIVSGTSMATPYLAGAIALVKSQFPNFSV  583



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 506149393984