BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c8066_g1_i1 len=163 path=[141:0-162]

Length=163
                                                                      Score     E

ref|XP_004292936.1|  PREDICTED: subtilisin-like protease-like         85.5    1e-17   
ref|XP_010933350.1|  PREDICTED: LOW QUALITY PROTEIN: CO(2)-respon...  84.7    3e-17   
emb|CBI19918.3|  unnamed protein product                              84.3    4e-17   
ref|XP_002269753.1|  PREDICTED: CO(2)-response secreted protease-...  84.3    4e-17   Vitis vinifera
ref|XP_008800183.1|  PREDICTED: subtilisin-like protease SBT5.3       83.6    7e-17   
ref|XP_008809445.1|  PREDICTED: subtilisin-like protease SBT5.3       83.6    7e-17   
emb|CDP07365.1|  unnamed protein product                              82.0    2e-16   
ref|XP_008221224.1|  PREDICTED: subtilisin-like protease              82.0    2e-16   
ref|XP_010095549.1|  Subtilisin-like protease                         81.6    3e-16   
dbj|BAJ53097.1|  JHL20J20.3                                           81.3    5e-16   
ref|XP_011034984.1|  PREDICTED: CO(2)-response secreted protease      80.1    1e-15   
ref|XP_003603807.1|  Subtilisin-type protease                         80.1    1e-15   
ref|XP_004500923.1|  PREDICTED: subtilisin-like protease-like         79.7    2e-15   
ref|XP_002510578.1|  Cucumisin precursor, putative                    79.0    2e-15   Ricinus communis
ref|XP_006846917.1|  hypothetical protein AMTR_s00152p00071630        79.3    2e-15   
gb|KDO84931.1|  hypothetical protein CISIN_1g004113mg                 79.0    2e-15   
ref|XP_011003069.1|  PREDICTED: CO(2)-response secreted protease-...  79.3    2e-15   
dbj|BAJ93850.1|  predicted protein                                    79.0    2e-15   
ref|XP_010266013.1|  PREDICTED: CO(2)-response secreted protease-...  79.0    3e-15   
ref|XP_006435228.1|  hypothetical protein CICLE_v10000339mg           79.0    3e-15   
gb|KDO84930.1|  hypothetical protein CISIN_1g004113mg                 79.0    3e-15   
gb|EMT05539.1|  Subtilisin-like protease                              78.2    4e-15   
ref|XP_008375386.1|  PREDICTED: subtilisin-like protease              78.6    4e-15   
ref|XP_009780984.1|  PREDICTED: subtilisin-like protease SBT5.3       78.6    4e-15   
ref|XP_003603196.1|  Subtilisin-type protease                         78.6    4e-15   
ref|XP_006348565.1|  PREDICTED: subtilisin-like protease-like         78.6    4e-15   
gb|KEH34337.1|  subtilisin-like serine protease                       78.2    5e-15   
ref|XP_009614808.1|  PREDICTED: cucumisin-like                        78.2    6e-15   
gb|EAZ09528.1|  hypothetical protein OsI_31804                        78.2    6e-15   Oryza sativa Indica Group [Indian rice]
gb|KDO48662.1|  hypothetical protein CISIN_1g0368301mg                76.3    7e-15   
ref|XP_009614807.1|  PREDICTED: subtilisin-like protease SBT5.3       77.8    8e-15   
ref|XP_004500924.1|  PREDICTED: subtilisin-like protease-like         77.4    8e-15   
ref|XP_009757105.1|  PREDICTED: subtilisin-like protease SBT5.3       77.4    1e-14   
gb|KDO48660.1|  hypothetical protein CISIN_1g040558mg                 75.9    1e-14   
ref|XP_010229422.1|  PREDICTED: CO(2)-response secreted protease-...  76.6    1e-14   
ref|XP_003523395.1|  PREDICTED: subtilisin-like protease-like         77.0    2e-14   
gb|AES74057.2|  subtilisin-like serine protease                       76.6    2e-14   
ref|XP_009605223.1|  PREDICTED: subtilisin-like protease              76.6    2e-14   
ref|XP_006658495.1|  PREDICTED: subtilisin-like protease-like         76.6    2e-14   
ref|XP_009397604.1|  PREDICTED: subtilisin-like protease              76.6    2e-14   
ref|XP_007220237.1|  hypothetical protein PRUPE_ppa001918mg           76.3    2e-14   
ref|XP_008231725.1|  PREDICTED: subtilisin-like protease              76.3    2e-14   
ref|XP_004956009.1|  PREDICTED: subtilisin-like protease-like         76.3    2e-14   
ref|XP_006432517.1|  hypothetical protein CICLE_v10003851mg           75.9    3e-14   
ref|XP_006471314.1|  PREDICTED: subtilisin-like protease-like         75.9    3e-14   
ref|XP_004308189.1|  PREDICTED: subtilisin-like protease-like         75.9    3e-14   
ref|XP_004238378.1|  PREDICTED: CO(2)-response secreted protease      75.9    3e-14   
ref|XP_004228919.2|  PREDICTED: CO(2)-response secreted protease-...  75.9    3e-14   
ref|XP_010543788.1|  PREDICTED: CO(2)-response secreted protease ...  75.9    3e-14   
emb|CDY70447.1|  BnaAnng33720D                                        73.6    4e-14   
ref|XP_006342240.1|  PREDICTED: subtilisin-like protease-like         75.9    4e-14   
ref|XP_010091320.1|  Subtilisin-like protease                         75.9    4e-14   
gb|KHN06934.1|  Subtilisin-like protease                              73.2    5e-14   
ref|XP_010536423.1|  PREDICTED: CO(2)-response secreted protease-...  75.1    6e-14   
ref|XP_007017870.1|  Subtilisin-like serine endopeptidase family ...  75.1    6e-14   
ref|XP_007017871.1|  Subtilisin-like serine endopeptidase family ...  74.7    7e-14   
ref|XP_002300693.2|  putative subtilisin precursor family protein     74.7    8e-14   Populus trichocarpa [western balsam poplar]
ref|XP_009768389.1|  PREDICTED: cucumisin-like                        74.7    8e-14   
ref|XP_008346279.1|  PREDICTED: subtilisin-like protease              74.7    1e-13   
ref|XP_002461867.1|  hypothetical protein SORBIDRAFT_02g009600        74.3    1e-13   Sorghum bicolor [broomcorn]
ref|XP_009355089.1|  PREDICTED: subtilisin-like protease SBT5.3       74.3    1e-13   
ref|XP_003541678.1|  PREDICTED: subtilisin-like protease-like iso...  74.3    1e-13   
ref|XP_008445401.1|  PREDICTED: subtilisin-like protease              74.3    1e-13   
ref|XP_006594524.1|  PREDICTED: subtilisin-like protease-like iso...  74.3    1e-13   
gb|KGN47766.1|  hypothetical protein Csa_6G401370                     74.3    1e-13   
ref|XP_004165291.1|  PREDICTED: subtilisin-like protease-like         73.9    1e-13   
ref|XP_004146802.1|  PREDICTED: subtilisin-like protease-like         73.9    1e-13   
ref|XP_007028364.1|  Subtilisin-like serine endopeptidase family ...  73.9    1e-13   
gb|KDP40600.1|  hypothetical protein JCGZ_24599                       73.9    1e-13   
ref|NP_001238252.1|  subtilisin-type protease precursor               73.9    2e-13   
ref|XP_003541562.1|  PREDICTED: subtilisin-like protease-like         73.9    2e-13   
gb|KHN10324.1|  Subtilisin-like protease                              73.9    2e-13   
ref|XP_002307740.1|  putative subtilisin precursor family protein     73.9    2e-13   Populus trichocarpa [western balsam poplar]
ref|XP_006432515.1|  hypothetical protein CICLE_v10000349mg           73.6    2e-13   
ref|XP_006432516.1|  hypothetical protein CICLE_v10000349mg           73.6    2e-13   
ref|XP_006471277.1|  PREDICTED: subtilisin-like protease-like         73.6    2e-13   
ref|XP_009149504.1|  PREDICTED: subtilisin-like protease              73.6    2e-13   
emb|CDY44210.1|  BnaC05g15670D                                        73.6    2e-13   
ref|XP_009769238.1|  PREDICTED: subtilisin-like protease SBT5.3 i...  73.6    2e-13   
ref|NP_001031070.1|  serine-type endopeptidase SBT5.2                 73.2    2e-13   Arabidopsis thaliana [mouse-ear cress]
gb|AAM65424.1|  subtilisin-like serine protease                       73.2    3e-13   Arabidopsis thaliana [mouse-ear cress]
ref|NP_564107.1|  serine-type endopeptidase SBT5.2                    73.2    3e-13   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006416425.1|  hypothetical protein EUTSA_v10006877mg           73.2    3e-13   
ref|XP_011083454.1|  PREDICTED: CO(2)-response secreted protease-...  72.8    4e-13   
ref|XP_002893091.1|  subtilase                                        72.8    4e-13   
ref|XP_010498448.1|  PREDICTED: CO(2)-response secreted protease-...  72.8    4e-13   
ref|XP_006306824.1|  hypothetical protein CARUB_v10008367mg           72.4    5e-13   
gb|KFK44143.1|  hypothetical protein AALP_AA1G220600                  72.4    5e-13   
ref|XP_002273703.1|  PREDICTED: CO(2)-response secreted protease      72.4    5e-13   Vitis vinifera
ref|XP_009619450.1|  PREDICTED: subtilisin-like protease isoform X2   72.4    5e-13   
ref|XP_004514295.1|  PREDICTED: subtilisin-like protease-like         72.0    7e-13   
ref|XP_007133571.1|  hypothetical protein PHAVU_011G190300g           71.6    8e-13   
gb|AES74035.2|  subtilisin-like serine protease                       70.9    1e-12   
gb|KHN10158.1|  Subtilisin-like protease                              71.6    1e-12   
ref|XP_003603784.1|  Subtilisin-like serine protease                  71.2    1e-12   
ref|XP_004164801.1|  PREDICTED: cucumisin-like                        71.6    1e-12   
ref|XP_007136108.1|  hypothetical protein PHAVU_009G018500g           71.2    1e-12   
ref|XP_003545787.1|  PREDICTED: subtilisin-like protease-like         71.2    1e-12   
gb|KEH36679.1|  subtilisin-like serine protease                       71.2    1e-12   
gb|AIC80766.1|  subtilase                                             71.2    1e-12   
ref|XP_004136374.1|  PREDICTED: subtilisin-like protease-like         71.2    1e-12   
ref|XP_004486283.1|  PREDICTED: subtilisin-like protease-like         71.2    2e-12   
ref|XP_010477246.1|  PREDICTED: CO(2)-response secreted protease ...  70.9    2e-12   
ref|XP_010477247.1|  PREDICTED: CO(2)-response secreted protease ...  70.9    2e-12   
gb|KEH36678.1|  subtilisin-like serine protease                       70.9    2e-12   
ref|XP_002525580.1|  Xylem serine proteinase 1 precursor, putative    70.5    2e-12   Ricinus communis
gb|KHG24601.1|  Cucumisin                                             70.5    3e-12   
ref|XP_007213640.1|  hypothetical protein PRUPE_ppa001689mg           70.5    3e-12   
gb|KEH19202.1|  subtilisin-like serine protease                       69.7    4e-12   
ref|XP_003603806.1|  Subtilisin-like serine protease                  69.7    4e-12   
gb|KEH19203.1|  subtilisin-like serine protease                       69.7    4e-12   
ref|XP_010251788.1|  PREDICTED: CO(2)-response secreted protease-...  69.7    4e-12   
ref|XP_011074702.1|  PREDICTED: CO(2)-response secreted protease-...  69.7    4e-12   
ref|XP_006652630.1|  PREDICTED: subtilisin-like protease-like         69.7    5e-12   
ref|XP_011074701.1|  PREDICTED: CO(2)-response secreted protease-...  69.7    5e-12   
gb|EAY95140.1|  hypothetical protein OsI_16958                        68.9    7e-12   Oryza sativa Indica Group [Indian rice]
emb|CAH68048.1|  B0103C08-B0602B01.5                                  68.9    7e-12   Oryza sativa [red rice]
ref|NP_001053537.1|  Os04g0559000                                     68.9    8e-12   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008225402.1|  PREDICTED: subtilisin-like protease              68.9    8e-12   
ref|XP_002303965.2|  hypothetical protein POPTR_0003s18830g           68.6    1e-11   Populus trichocarpa [western balsam poplar]
ref|XP_004134922.1|  PREDICTED: subtilisin-like protease-like         68.9    1e-11   
ref|XP_007136109.1|  hypothetical protein PHAVU_009G018600g           68.6    1e-11   
ref|XP_010273518.1|  PREDICTED: subtilisin-like protease SBT5.4       68.6    1e-11   
ref|XP_010692513.1|  PREDICTED: CO(2)-response secreted protease      68.6    1e-11   
gb|KEH19205.1|  subtilisin-like serine protease                       68.6    1e-11   
ref|XP_010091321.1|  Subtilisin-like protease                         68.6    1e-11   
gb|KEH19206.1|  subtilisin-like serine protease                       68.2    1e-11   
ref|XP_004309900.1|  PREDICTED: subtilisin-like protease-like         68.2    1e-11   
ref|XP_009771512.1|  PREDICTED: subtilisin-like protease              67.4    2e-11   
ref|XP_009607188.1|  PREDICTED: subtilisin-like protease SBT5.3       67.8    2e-11   
gb|KDP40601.1|  hypothetical protein JCGZ_24600                       67.4    3e-11   
ref|XP_009408716.1|  PREDICTED: subtilisin-like protease SBT5.3       67.4    3e-11   
ref|XP_007147961.1|  hypothetical protein PHAVU_006G168800g           67.4    3e-11   
gb|KHN45945.1|  Subtilisin-like protease                              67.0    3e-11   
ref|XP_003567246.1|  PREDICTED: CO(2)-response secreted protease-...  67.4    3e-11   
ref|XP_011085840.1|  PREDICTED: CO(2)-response secreted protease-...  67.4    3e-11   
ref|XP_007025242.1|  Subtilase family protein, putative isoform 1     67.0    4e-11   
ref|XP_004295413.1|  PREDICTED: subtilisin-like protease-like         67.0    5e-11   
ref|XP_011020517.1|  PREDICTED: CO(2)-response secreted protease-...  67.0    5e-11   
gb|KFK32412.1|  hypothetical protein AALP_AA6G238800                  66.6    5e-11   
ref|XP_002974964.1|  hypothetical protein SELMODRAFT_415194           66.6    5e-11   
ref|XP_002977384.1|  hypothetical protein SELMODRAFT_417382           66.6    5e-11   
ref|XP_010061088.1|  PREDICTED: subtilisin-like protease SBT5.3       66.6    5e-11   
ref|XP_007025243.1|  Subtilase family protein isoform 2               66.6    6e-11   
ref|XP_004985590.1|  PREDICTED: subtilisin-like protease-like         66.6    6e-11   
ref|XP_006857977.1|  hypothetical protein AMTR_s00069p00178740        66.6    6e-11   
ref|XP_010909887.1|  PREDICTED: subtilisin-like protease SDD1         66.6    6e-11   
ref|XP_009140769.1|  PREDICTED: subtilisin-like protease SBT5.4       66.6    6e-11   
emb|CDY57477.1|  BnaAnng14590D                                        66.2    7e-11   
ref|XP_008439697.1|  PREDICTED: LOW QUALITY PROTEIN: subtilisin-l...  66.2    7e-11   
emb|CDP18817.1|  unnamed protein product                              65.9    9e-11   
ref|XP_010095116.1|  Subtilisin-like protease                         65.9    1e-10   
ref|XP_009769237.1|  PREDICTED: subtilisin-like protease isoform X1   65.9    1e-10   
gb|KFK31539.1|  hypothetical protein AALP_AA6G125500                  65.9    1e-10   
ref|XP_006398246.1|  hypothetical protein EUTSA_v10000784mg           65.9    1e-10   
ref|XP_004232973.1|  PREDICTED: subtilisin-like protease SBT5.3       65.5    1e-10   
ref|XP_006347851.1|  PREDICTED: subtilisin-like protease-like         65.5    1e-10   
gb|KHG30296.1|  Subtilisin-like protease                              65.5    1e-10   
ref|XP_009803454.1|  PREDICTED: subtilisin-like protease SBT5.3       65.5    2e-10   
ref|XP_006355620.1|  PREDICTED: subtilisin-like protease-like         65.5    2e-10   
emb|CBI30770.3|  unnamed protein product                              65.1    2e-10   
ref|XP_002269375.1|  PREDICTED: subtilisin-like protease SBT5.3       65.1    2e-10   Vitis vinifera
ref|XP_009604273.1|  PREDICTED: subtilisin-like protease SBT5.3       65.1    2e-10   
ref|XP_002981864.1|  hypothetical protein SELMODRAFT_115574           65.1    2e-10   
ref|XP_002991849.1|  hypothetical protein SELMODRAFT_236400           65.1    2e-10   
emb|CAN61728.1|  hypothetical protein VITISV_036029                   65.1    2e-10   Vitis vinifera
ref|XP_002982832.1|  hypothetical protein SELMODRAFT_234125           65.1    2e-10   
ref|XP_002993007.1|  hypothetical protein SELMODRAFT_236650           65.1    2e-10   
ref|XP_006857959.1|  hypothetical protein AMTR_s00069p00172550        65.1    2e-10   
ref|XP_010683779.1|  PREDICTED: xylem serine proteinase 1             64.7    2e-10   
ref|XP_009619449.1|  PREDICTED: subtilisin-like protease isoform X1   65.1    2e-10   
ref|XP_002457657.1|  hypothetical protein SORBIDRAFT_03g011300        64.7    3e-10   Sorghum bicolor [broomcorn]
ref|XP_010103418.1|  Subtilisin-like protease                         64.7    3e-10   
ref|XP_006851499.1|  hypothetical protein AMTR_s00040p00151440        64.3    3e-10   
ref|XP_010067650.1|  PREDICTED: subtilisin-like protease              64.3    4e-10   
ref|XP_010694663.1|  PREDICTED: CO(2)-response secreted protease-...  64.3    4e-10   
gb|EYU38296.1|  hypothetical protein MIMGU_mgv1a0026491mg             63.5    4e-10   
ref|XP_009351978.1|  PREDICTED: subtilisin-like protease SBT5.3       63.9    4e-10   
emb|CBI30775.3|  unnamed protein product                              63.9    4e-10   
dbj|BAA89562.1|  putative subtilisin-like protein                     63.9    4e-10   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008238729.1|  PREDICTED: subtilisin-like protease              63.9    4e-10   
gb|EAY73513.1|  hypothetical protein OsI_01395                        63.9    4e-10   Oryza sativa Indica Group [Indian rice]
ref|XP_009604279.1|  PREDICTED: subtilisin-like protease              63.9    4e-10   
ref|XP_009391454.1|  PREDICTED: subtilisin-like protease SBT5.3       63.9    5e-10   
ref|XP_006645770.1|  PREDICTED: subtilisin-like protease-like         63.5    5e-10   
ref|XP_008371534.1|  PREDICTED: subtilisin-like protease              63.9    5e-10   
ref|XP_007210956.1|  hypothetical protein PRUPE_ppa023717mg           63.9    5e-10   
gb|KCW76039.1|  hypothetical protein EUGRSUZ_D00408                   63.9    5e-10   
ref|XP_002325705.1|  hypothetical protein POPTR_0019s00970g           63.9    5e-10   Populus trichocarpa [western balsam poplar]
gb|EEE54331.1|  hypothetical protein OsJ_01304                        63.9    5e-10   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010052139.1|  PREDICTED: subtilisin-like protease SBT5.3       63.9    5e-10   
ref|XP_002269555.2|  PREDICTED: subtilisin-like protease SBT5.3       63.9    5e-10   Vitis vinifera
gb|EMT03593.1|  Subtilisin-like protease                              62.4    6e-10   
ref|XP_010529231.1|  PREDICTED: subtilisin-like protease              63.5    6e-10   
ref|XP_008464322.1|  PREDICTED: subtilisin-like protease              63.5    6e-10   
ref|XP_008809520.1|  PREDICTED: subtilisin-like protease              63.5    6e-10   
ref|XP_002965691.1|  hypothetical protein SELMODRAFT_407291           63.5    7e-10   
gb|KDP25558.1|  hypothetical protein JCGZ_20714                       63.5    7e-10   
gb|EMT32761.1|  Subtilisin-like protease                              63.5    7e-10   
ref|XP_002971639.1|  hypothetical protein SELMODRAFT_412127           63.5    7e-10   
ref|XP_009360803.1|  PREDICTED: subtilisin-like protease SBT5.3       63.2    8e-10   
emb|CDM82985.1|  unnamed protein product                              63.2    8e-10   
ref|XP_002972044.1|  hypothetical protein SELMODRAFT_96495            63.2    9e-10   
ref|XP_008383532.1|  PREDICTED: subtilisin-like protease              63.2    9e-10   
ref|XP_002522297.1|  Xylem serine proteinase 1 precursor, putative    63.2    9e-10   Ricinus communis
dbj|BAA13135.1|  subtilisin-like protein                              63.2    9e-10   Picea abies
gb|ACN36528.1|  unknown                                               62.0    9e-10   Zea mays [maize]
gb|EMS62609.1|  Subtilisin-like protease                              62.8    9e-10   
ref|XP_010925147.1|  PREDICTED: subtilisin-like protease              63.2    9e-10   
gb|EPS68445.1|  hypothetical protein M569_06321                       62.8    9e-10   
gb|EYU28144.1|  hypothetical protein MIMGU_mgv1a001682mg              63.2    1e-09   
gb|AES88343.2|  subtilisin-like serine protease                       63.2    1e-09   
ref|NP_001065109.1|  Os10g0524600                                     63.2    1e-09   Oryza sativa Japonica Group [Japonica rice]
gb|KEH29866.1|  subtilisin-like serine protease                       62.8    1e-09   
gb|EAY79268.1|  hypothetical protein OsI_34383                        63.2    1e-09   Oryza sativa Indica Group [Indian rice]
emb|CAA07250.1|  serine protease                                      62.8    1e-09   Solanum lycopersicum
ref|XP_004159123.1|  PREDICTED: LOW QUALITY PROTEIN: subtilisin-l...  62.8    1e-09   
ref|XP_002972591.1|  hypothetical protein SELMODRAFT_97292            62.8    1e-09   
ref|XP_010918054.1|  PREDICTED: subtilisin-like protease              62.8    1e-09   
ref|XP_011044970.1|  PREDICTED: subtilisin-like protease SBT5.3       62.8    1e-09   
ref|NP_001234257.1|  subtilisin-like endoprotease precursor           62.8    1e-09   
ref|XP_010910904.1|  PREDICTED: subtilisin-like protease              62.8    1e-09   
gb|EPS69827.1|  hypothetical protein M569_04935                       62.8    1e-09   
ref|XP_003625338.1|  Subtilisin-like serine protease                  62.8    1e-09   
ref|XP_010911578.1|  PREDICTED: subtilisin-like protease              62.0    1e-09   
ref|XP_002509669.1|  Cucumisin precursor, putative                    62.8    1e-09   Ricinus communis
ref|XP_010052138.1|  PREDICTED: subtilisin-like protease SBT5.3       62.8    1e-09   
ref|XP_006416427.1|  hypothetical protein EUTSA_v10006858mg           62.4    1e-09   
ref|XP_006601388.1|  PREDICTED: subtilisin-like protease-like         62.4    1e-09   
ref|XP_006358147.1|  PREDICTED: subtilisin-like protease SDD1-like    62.4    2e-09   
gb|KFK31536.1|  hypothetical protein AALP_AA6G125100                  62.4    2e-09   
ref|XP_006859003.1|  hypothetical protein AMTR_s00068p00149940        62.4    2e-09   
ref|NP_001142096.1|  uncharacterized protein LOC100274260             62.0    2e-09   Zea mays [maize]
ref|XP_006424267.1|  hypothetical protein CICLE_v10030373mg           62.0    2e-09   
ref|XP_006355621.1|  PREDICTED: subtilisin-like protease-like         62.4    2e-09   
ref|XP_010272679.1|  PREDICTED: subtilisin-like protease SBT5.4       62.4    2e-09   
tpg|DAA42972.1|  TPA: putative subtilase family protein               62.4    2e-09   
ref|NP_001145938.1|  uncharacterized protein LOC100279461 precursor   62.4    2e-09   Zea mays [maize]
ref|XP_004967678.1|  PREDICTED: subtilisin-like protease-like         62.4    2e-09   
gb|KFK44142.1|  hypothetical protein AALP_AA1G220500                  62.0    2e-09   
gb|KHN03560.1|  Subtilisin-like protease                              62.0    2e-09   
ref|XP_008672702.1|  PREDICTED: uncharacterized protein LOC100279...  62.0    2e-09   
ref|XP_004300737.1|  PREDICTED: subtilisin-like protease SDD1-like    62.0    2e-09   
ref|XP_002523127.1|  Xylem serine proteinase 1 precursor, putative    62.0    2e-09   Ricinus communis
ref|XP_004296128.1|  PREDICTED: subtilisin-like protease-like         62.0    2e-09   
ref|XP_007132414.1|  hypothetical protein PHAVU_011G092600g           62.0    2e-09   
ref|XP_008802988.1|  PREDICTED: subtilisin-like protease SDD1         62.0    2e-09   
ref|XP_009114399.1|  PREDICTED: subtilisin-like protease SBT5.3       62.0    2e-09   
ref|XP_007132413.1|  hypothetical protein PHAVU_011G092600g           62.0    2e-09   
ref|XP_004959107.1|  PREDICTED: cucumisin-like                        62.0    2e-09   
ref|XP_004232982.1|  PREDICTED: subtilisin-like protease              62.0    2e-09   
gb|KHN45943.1|  Subtilisin-like protease                              61.6    2e-09   
ref|XP_002974998.1|  hypothetical protein SELMODRAFT_150329           62.0    2e-09   
ref|XP_002465976.1|  hypothetical protein SORBIDRAFT_01g049280        62.0    2e-09   Sorghum bicolor [broomcorn]
ref|XP_002977415.1|  hypothetical protein SELMODRAFT_232973           61.6    2e-09   
ref|XP_004300734.1|  PREDICTED: subtilisin-like protease-like         62.0    3e-09   
emb|CDY08996.1|  BnaC01g30950D                                        58.9    3e-09   
ref|XP_004139597.1|  PREDICTED: subtilisin-like protease-like         61.6    3e-09   
ref|XP_010918181.1|  PREDICTED: subtilisin-like protease              61.6    3e-09   
gb|AAF79898.1|AC022472_7  Contains similarity to p69c gene from L...  61.6    3e-09   Arabidopsis thaliana [mouse-ear cress]
ref|NP_564106.1|  subtilisin-like serine endopeptidase family pro...  61.6    3e-09   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009136129.1|  PREDICTED: subtilisin-like protease SBT5.3       61.6    3e-09   
ref|XP_011029125.1|  PREDICTED: subtilisin-like protease SDD1         61.6    3e-09   
ref|XP_010096499.1|  Subtilisin-like protease                         61.6    3e-09   
gb|KGN64982.1|  hypothetical protein Csa_1G171040                     61.6    3e-09   
ref|XP_010053374.1|  PREDICTED: subtilisin-like protease SDD1         61.6    3e-09   
ref|XP_002533546.1|  Xylem serine proteinase 1 precursor, putative    61.6    3e-09   Ricinus communis
ref|XP_002893090.1|  predicted protein                                61.6    3e-09   
ref|XP_004985952.1|  PREDICTED: subtilisin-like protease SDD1-like    61.6    3e-09   
emb|CDY65487.1|  BnaA03g57660D                                        61.6    3e-09   
ref|XP_002986919.1|  hypothetical protein SELMODRAFT_125066           61.6    3e-09   
gb|KCW77653.1|  hypothetical protein EUGRSUZ_D01951                   61.6    3e-09   
gb|ACN39811.1|  unknown                                               61.6    3e-09   Picea sitchensis
ref|XP_004300735.1|  PREDICTED: subtilisin-like protease-like         61.6    3e-09   
gb|KHN40225.1|  Subtilisin-like protease                              61.6    3e-09   
ref|XP_003528716.1|  PREDICTED: subtilisin-like protease-like         61.6    3e-09   
ref|XP_010647741.1|  PREDICTED: subtilisin-like protease              61.6    3e-09   
emb|CDX77071.1|  BnaC04g38660D                                        61.6    3e-09   
emb|CDP06942.1|  unnamed protein product                              61.6    3e-09   
emb|CAN64995.1|  hypothetical protein VITISV_001779                   61.6    3e-09   
ref|XP_010908011.1|  PREDICTED: CO(2)-response secreted protease-...  61.2    4e-09   
ref|XP_002269456.2|  PREDICTED: subtilisin-like protease SBT5.4       61.2    4e-09   
emb|CBI29567.3|  unnamed protein product                              61.2    4e-09   
ref|XP_006304500.1|  hypothetical protein CARUB_v10011271mg           61.2    4e-09   
gb|KHN38643.1|  Subtilisin-like protease                              61.2    4e-09   
ref|XP_008776598.1|  PREDICTED: subtilisin-like protease              61.2    4e-09   
ref|XP_002509661.1|  Xylem serine proteinase 1 precursor, putative    61.2    4e-09   
ref|XP_004506157.1|  PREDICTED: subtilisin-like protease-like         61.2    4e-09   
gb|KDP27283.1|  hypothetical protein JCGZ_21014                       61.2    4e-09   
ref|XP_003538129.1|  PREDICTED: subtilisin-like protease-like         61.2    4e-09   
ref|XP_010518867.1|  PREDICTED: subtilisin-like protease SBT5.3       61.2    4e-09   
ref|XP_008218944.1|  PREDICTED: subtilisin-like protease              61.2    4e-09   
ref|XP_011039898.1|  PREDICTED: subtilisin-like protease SBT5.4       61.2    4e-09   
ref|XP_009768078.1|  PREDICTED: subtilisin-like protease SBT5.3       61.2    4e-09   
ref|XP_007137352.1|  hypothetical protein PHAVU_009G120000g           61.2    4e-09   
ref|XP_009362845.1|  PREDICTED: subtilisin-like protease              61.2    4e-09   
ref|XP_010917817.1|  PREDICTED: subtilisin-like protease SBT3.5       61.2    5e-09   
ref|XP_010928976.1|  PREDICTED: subtilisin-like protease SBT3.5       61.2    5e-09   
ref|XP_002523782.1|  Xylem serine proteinase 1 precursor, putative    61.2    5e-09   
ref|XP_009400152.1|  PREDICTED: subtilisin-like protease SBT5.4       60.8    5e-09   
emb|CDM84531.1|  unnamed protein product                              60.8    5e-09   
ref|XP_006452711.1|  hypothetical protein CICLE_v10010711mg           60.8    5e-09   
gb|KDP25556.1|  hypothetical protein JCGZ_20712                       60.8    5e-09   
ref|XP_004244591.1|  PREDICTED: subtilisin-like protease              60.8    5e-09   
ref|XP_006358902.1|  PREDICTED: subtilisin-like protease SDD1-like    60.5    5e-09   
ref|XP_010542042.1|  PREDICTED: subtilisin-like protease SBT5.3       60.8    5e-09   
ref|XP_006661975.1|  PREDICTED: subtilisin-like protease-like         60.8    5e-09   
tpg|DAA43449.1|  TPA: putative subtilase family protein               60.8    5e-09   
ref|XP_011032222.1|  PREDICTED: cucumisin-like isoform X2             60.8    6e-09   
ref|XP_008647217.1|  PREDICTED: uncharacterized protein LOC100501...  60.8    6e-09   
ref|XP_008647226.1|  PREDICTED: uncharacterized protein LOC100501...  60.8    6e-09   
ref|XP_008647212.1|  PREDICTED: uncharacterized protein LOC100501...  60.8    6e-09   
ref|XP_006363699.1|  PREDICTED: subtilisin-like protease SDD1-like    60.8    6e-09   
emb|CDY02841.1|  BnaC02g10480D                                        60.8    6e-09   
ref|XP_011032221.1|  PREDICTED: cucumisin-like isoform X1             60.8    6e-09   
ref|XP_008647202.1|  PREDICTED: uncharacterized protein LOC100501...  60.8    6e-09   
tpg|DAA43450.1|  TPA: putative subtilase family protein               60.8    6e-09   
ref|XP_010488664.1|  PREDICTED: subtilisin-like protease SBT5.3 i...  60.8    6e-09   
ref|XP_010488663.1|  PREDICTED: subtilisin-like protease SBT5.3 i...  60.8    6e-09   
ref|XP_011045348.1|  PREDICTED: subtilisin-like protease SBT5.3 i...  60.8    6e-09   
ref|XP_010514315.1|  PREDICTED: subtilisin-like protease SBT5.3       60.8    6e-09   
ref|XP_008647207.1|  PREDICTED: uncharacterized protein LOC100501...  60.8    6e-09   
ref|XP_008647197.1|  PREDICTED: uncharacterized protein LOC100501...  60.8    6e-09   
ref|XP_010466978.1|  PREDICTED: subtilisin-like protease SBT5.3       60.8    6e-09   
emb|CDY67543.1|  BnaCnng55400D                                        60.8    6e-09   
emb|CAA76726.1|  P69C protein                                         60.5    6e-09   
tpg|DAA43452.1|  TPA: putative subtilase family protein               60.8    6e-09   
ref|XP_010919953.1|  PREDICTED: subtilisin-like protease              60.8    6e-09   
emb|CDY01388.1|  BnaA07g11610D                                        60.5    7e-09   
emb|CDP10008.1|  unnamed protein product                              60.8    7e-09   
emb|CDY23110.1|  BnaC09g18640D                                        60.5    7e-09   
ref|XP_009103352.1|  PREDICTED: subtilisin-like protease SBT5.3 i...  60.5    7e-09   
ref|XP_002317314.1|  subtilase family protein                         60.5    7e-09   
emb|CDY13044.1|  BnaA09g17730D                                        60.5    7e-09   
ref|XP_011045349.1|  PREDICTED: subtilisin-like protease SBT5.3 i...  60.5    7e-09   
ref|XP_010068943.1|  PREDICTED: xylem serine proteinase 1-like        60.8    7e-09   
ref|XP_010694466.1|  PREDICTED: subtilisin-like protease SBT5.4       60.5    7e-09   
ref|XP_002980088.1|  hypothetical protein SELMODRAFT_111859           60.5    7e-09   
ref|XP_006355622.1|  PREDICTED: subtilisin-like protease-like         60.5    7e-09   
ref|XP_011010424.1|  PREDICTED: subtilisin-like protease SBT5.3       60.5    7e-09   
ref|XP_008385530.1|  PREDICTED: subtilisin-like protease              60.5    7e-09   
ref|XP_004300736.1|  PREDICTED: subtilisin-like protease SDD1-like    60.5    7e-09   
emb|CDP06138.1|  unnamed protein product                              60.5    8e-09   
ref|XP_002994537.1|  hypothetical protein SELMODRAFT_432452           60.5    8e-09   
ref|XP_002980086.1|  hypothetical protein SELMODRAFT_419592           60.5    8e-09   
ref|XP_010498446.1|  PREDICTED: CO(2)-response secreted protease-...  60.5    8e-09   
ref|XP_002987482.1|  hypothetical protein SELMODRAFT_426261           60.5    8e-09   
ref|XP_010498447.1|  PREDICTED: CO(2)-response secreted protease-...  60.5    8e-09   
gb|KCW89219.1|  hypothetical protein EUGRSUZ_A01524                   60.5    8e-09   
ref|XP_010244395.1|  PREDICTED: subtilisin-like protease SBT5.3       60.5    8e-09   
dbj|BAJ34472.1|  unnamed protein product                              59.7    8e-09   
ref|XP_006297035.1|  hypothetical protein CARUB_v10013025mg           60.5    8e-09   
ref|XP_002987481.1|  hypothetical protein SELMODRAFT_426260           60.5    8e-09   
ref|XP_011081071.1|  PREDICTED: subtilisin-like protease              60.5    8e-09   
ref|XP_002303551.2|  hypothetical protein POPTR_0003s11870g           60.5    8e-09   
ref|XP_009781100.1|  PREDICTED: subtilisin-like protease SDD1         60.1    8e-09   
ref|XP_010665649.1|  PREDICTED: subtilisin-like protease SBT5.3       60.5    8e-09   
ref|XP_002303548.2|  hypothetical protein POPTR_0003s11840g           60.5    8e-09   
ref|XP_008811118.1|  PREDICTED: subtilisin-like protease SDD1         60.5    9e-09   
ref|XP_002987480.1|  hypothetical protein SELMODRAFT_126065           60.1    9e-09   
ref|XP_003632376.1|  PREDICTED: subtilisin-like protease              60.5    9e-09   
ref|XP_007206786.1|  hypothetical protein PRUPE_ppa025514mg           60.1    9e-09   
ref|XP_006430257.1|  hypothetical protein CICLE_v10013548mg           60.1    9e-09   
gb|KDO61088.1|  hypothetical protein CISIN_1g045363mg                 60.1    9e-09   
ref|XP_003523384.1|  PREDICTED: subtilisin-like protease-like         60.1    9e-09   
emb|CDY14583.1|  BnaC02g25300D                                        59.7    9e-09   
gb|KEH32715.1|  subtilisin-like serine protease                       60.1    1e-08   
ref|XP_002509656.1|  Xylem serine proteinase 1 precursor, putative    60.1    1e-08   
gb|EMT13355.1|  Subtilisin-like protease                              60.1    1e-08   
ref|XP_006481881.1|  PREDICTED: xylem serine proteinase 1-like        60.1    1e-08   
ref|XP_006381297.1|  subtilase family protein                         60.1    1e-08   
gb|EMS54035.1|  Subtilisin-like protease                              59.7    1e-08   
emb|CBI36893.3|  unnamed protein product                              60.1    1e-08   
ref|XP_011019233.1|  PREDICTED: xylem serine proteinase 1-like        60.1    1e-08   
gb|KDP21172.1|  hypothetical protein JCGZ_21643                       60.1    1e-08   
ref|XP_002972374.1|  hypothetical protein SELMODRAFT_413072           60.1    1e-08   
ref|XP_002971846.1|  hypothetical protein SELMODRAFT_412516           60.1    1e-08   
ref|XP_007201744.1|  hypothetical protein PRUPE_ppa001956mg           60.1    1e-08   
ref|XP_006358961.1|  PREDICTED: subtilisin-like protease-like         60.1    1e-08   
ref|XP_002962719.1|  hypothetical protein SELMODRAFT_61337            60.1    1e-08   
emb|CBI28350.3|  unnamed protein product                              60.1    1e-08   
gb|EMS63058.1|  Subtilisin-like protease                              60.1    1e-08   
gb|KCW77656.1|  hypothetical protein EUGRSUZ_D01954                   60.1    1e-08   
ref|XP_010651909.1|  PREDICTED: cucumisin-like                        60.1    1e-08   
dbj|BAF95887.1|  subtilase                                            60.1    1e-08   
ref|XP_010053378.1|  PREDICTED: subtilisin-like protease SDD1         60.1    1e-08   
ref|XP_008359025.1|  PREDICTED: subtilisin-like protease              59.7    1e-08   
ref|XP_004292430.1|  PREDICTED: subtilisin-like protease-like         60.1    1e-08   
gb|EAY88301.1|  hypothetical protein OsI_09758                        59.7    1e-08   
gb|KDP25551.1|  hypothetical protein JCGZ_20707                       60.1    1e-08   
ref|XP_007210332.1|  hypothetical protein PRUPE_ppa002068mg           59.7    1e-08   
ref|XP_003611192.1|  Subtilisin-like serine protease                  60.1    1e-08   
gb|AES94150.2|  subtilisin-like serine protease                       60.1    1e-08   
ref|XP_010262465.1|  PREDICTED: subtilisin-like protease SDD1         60.1    1e-08   
gb|AAK74005.1|  At2g04160/T16B23.1                                    59.3    1e-08   
ref|XP_007155591.1|  hypothetical protein PHAVU_003G215100g           59.7    1e-08   
ref|XP_002980373.1|  hypothetical protein SELMODRAFT_112475           59.7    1e-08   
ref|XP_002282304.3|  PREDICTED: subtilisin-like protease              59.7    1e-08   
ref|XP_002520491.1|  peptidase, putative                              60.1    1e-08   
gb|KFK31799.1|  hypothetical protein AALP_AA6G160400                  59.7    1e-08   
ref|XP_009762964.1|  PREDICTED: subtilisin-like protease SDD1         59.7    1e-08   
gb|KDP29034.1|  hypothetical protein JCGZ_16423                       59.7    1e-08   
gb|EMT21983.1|  Subtilisin-like protease                              59.3    1e-08   
ref|XP_008384613.1|  PREDICTED: subtilisin-like protease              59.7    1e-08   
ref|XP_004244590.1|  PREDICTED: subtilisin-like protease              59.7    1e-08   
ref|XP_008802434.1|  PREDICTED: subtilisin-like protease SDD1         59.7    1e-08   
ref|XP_006650980.1|  PREDICTED: subtilisin-like protease SDD1-like    59.7    1e-08   
ref|XP_008810058.1|  PREDICTED: subtilisin-like protease SDD1         59.7    1e-08   
ref|XP_004977944.1|  PREDICTED: subtilisin-like protease-like         59.7    1e-08   
gb|KDP39759.1|  hypothetical protein JCGZ_02779                       59.7    1e-08   
ref|XP_006418604.1|  hypothetical protein EUTSA_v10002408mg           59.7    1e-08   
ref|XP_004969820.1|  PREDICTED: subtilisin-like protease-like         59.7    1e-08   
ref|XP_007042043.1|  Subtilase family protein, putative isoform 2     59.7    1e-08   
ref|XP_009382355.1|  PREDICTED: subtilisin-like protease              59.7    1e-08   
ref|XP_006358372.1|  PREDICTED: subtilisin-like protease-like         59.7    1e-08   
ref|XP_009608768.1|  PREDICTED: subtilisin-like protease SDD1         59.7    1e-08   
ref|XP_007208831.1|  hypothetical protein PRUPE_ppa025337mg           59.7    1e-08   
ref|NP_001048778.1|  Os03g0119300                                     59.7    1e-08   
ref|XP_007042042.1|  Subtilase family protein, putative isoform 1     59.7    1e-08   
ref|XP_009608769.1|  PREDICTED: subtilisin-like protease SDD1         59.7    1e-08   
ref|XP_007020377.1|  Xylem serine proteinase 1, putative              59.7    2e-08   
ref|XP_010108074.1|  Subtilisin-like protease SDD1                    59.7    2e-08   
ref|XP_009762965.1|  PREDICTED: subtilisin-like protease SDD1         59.7    2e-08   
ref|XP_008238728.1|  PREDICTED: subtilisin-like protease SDD1         59.7    2e-08   
ref|XP_003608824.1|  Subtilisin-like protease                         59.7    2e-08   
ref|XP_006365833.1|  PREDICTED: subtilisin-like protease-like         59.7    2e-08   
emb|CDY02839.1|  BnaC02g10500D                                        59.7    2e-08   
ref|XP_008229443.1|  PREDICTED: cucumisin-like                        59.7    2e-08   
gb|EYU39048.1|  hypothetical protein MIMGU_mgv1a002011mg              59.7    2e-08   
gb|KFK42754.1|  hypothetical protein AALP_AA1G035200                  59.7    2e-08   
gb|EYU28961.1|  hypothetical protein MIMGU_mgv1a020058mg              59.7    2e-08   
ref|XP_006358371.1|  PREDICTED: subtilisin-like protease-like         59.7    2e-08   
ref|XP_010688246.1|  PREDICTED: subtilisin-like protease SBT5.4       59.7    2e-08   
ref|XP_002530614.1|  Cucumisin precursor, putative                    59.7    2e-08   
ref|XP_010933213.1|  PREDICTED: subtilisin-like protease SDD1         59.7    2e-08   
ref|XP_008238738.1|  PREDICTED: subtilisin-like protease              59.3    2e-08   
ref|XP_004300738.1|  PREDICTED: subtilisin-like protease SDD1-like    59.3    2e-08   
ref|XP_010271749.1|  PREDICTED: subtilisin-like protease SBT5.3       59.3    2e-08   
ref|XP_002313716.1|  hypothetical protein POPTR_0009s13590g           59.3    2e-08   
ref|XP_010101169.1|  Subtilisin-like protease                         59.3    2e-08   
emb|CDP20400.1|  unnamed protein product                              59.3    2e-08   
gb|EAZ42320.1|  hypothetical protein OsJ_26892                        59.7    2e-08   
ref|XP_006286453.1|  hypothetical protein CARUB_v10000284mg           59.3    2e-08   
ref|XP_011046353.1|  PREDICTED: LOW QUALITY PROTEIN: subtilisin-l...  59.3    2e-08   
ref|XP_006422999.1|  hypothetical protein CICLE_v10027863mg           59.3    2e-08   
ref|XP_002509667.1|  Xylem serine proteinase 1 precursor, putative    59.3    2e-08   
gb|KDO74051.1|  hypothetical protein CISIN_1g044682mg                 59.3    2e-08   
ref|XP_003580309.1|  PREDICTED: subtilisin-like protease SDD1         59.3    2e-08   
gb|EYU29563.1|  hypothetical protein MIMGU_mgv1a022413mg              59.3    2e-08   
emb|CBI32393.3|  unnamed protein product                              59.3    2e-08   
gb|AAM15440.1|  subtilisin-like serine protease AIR3                  59.3    2e-08   
ref|XP_009587381.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...  59.7    2e-08   
ref|XP_011071709.1|  PREDICTED: subtilisin-like protease              59.7    2e-08   
ref|XP_009126729.1|  PREDICTED: cucumisin-like                        59.3    2e-08   
ref|XP_002299578.1|  hypothetical protein POPTR_0001s08340g           59.3    2e-08   
ref|XP_010919425.1|  PREDICTED: subtilisin-like protease              59.3    2e-08   
ref|XP_010943002.1|  PREDICTED: subtilisin-like protease              58.9    2e-08   
ref|XP_010684867.1|  PREDICTED: subtilisin-like protease SDD1         59.3    2e-08   
ref|NP_565309.2|  subtilisin-like serine endopeptidase family pro...  59.3    2e-08   
gb|EEC83379.1|  hypothetical protein OsI_28793                        59.3    2e-08   
ref|XP_010108994.1|  Subtilisin-like protease                         59.3    2e-08   
emb|CDY32681.1|  BnaA02g07430D                                        59.3    2e-08   
ref|XP_002461614.1|  hypothetical protein SORBIDRAFT_02g005460        59.3    2e-08   
dbj|BAK05599.1|  predicted protein                                    59.3    2e-08   
gb|AAM15483.1|  subtilisin-like serine protease AIR3                  59.3    2e-08   
tpg|DAA59905.1|  TPA: putative subtilase family protein               59.3    2e-08   
emb|CDP03800.1|  unnamed protein product                              59.3    2e-08   
ref|XP_002459999.1|  hypothetical protein SORBIDRAFT_02g020470        59.3    2e-08   
ref|NP_001044124.1|  Os01g0727800                                     58.5    2e-08   
ref|XP_006826300.1|  hypothetical protein AMTR_s00004p00071240        59.3    2e-08   
ref|XP_010063230.1|  PREDICTED: subtilisin-like protease SBT5.4       59.3    2e-08   
ref|XP_004963825.1|  PREDICTED: subtilisin-like protease-like         58.9    2e-08   
emb|CDY15084.1|  BnaC03g44450D                                        58.9    2e-08   
ref|XP_008652529.1|  PREDICTED: subtilisin-like protease              58.9    2e-08   
ref|XP_011077880.1|  PREDICTED: xylem serine proteinase 1             58.9    2e-08   
ref|XP_010248425.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...  59.3    2e-08   
gb|AIC80771.1|  subtilase                                             58.9    2e-08   
ref|XP_010240233.1|  PREDICTED: subtilisin-like protease SDD1         58.9    2e-08   
emb|CAN68827.1|  hypothetical protein VITISV_029978                   58.9    2e-08   
ref|XP_002282333.2|  PREDICTED: subtilisin-like protease              58.9    2e-08   
ref|XP_006363697.1|  PREDICTED: subtilisin-like protease-like         58.9    3e-08   
ref|XP_008464289.1|  PREDICTED: LOW QUALITY PROTEIN: subtilisin-l...  58.9    3e-08   
ref|XP_009396709.1|  PREDICTED: subtilisin-like protease SBT5.3       58.9    3e-08   
ref|XP_004983865.1|  PREDICTED: subtilisin-like protease SDD1-like    58.9    3e-08   
gb|KDP25559.1|  hypothetical protein JCGZ_20715                       58.9    3e-08   
ref|XP_004499342.1|  PREDICTED: subtilisin-like protease-like         58.9    3e-08   
ref|XP_008653652.1|  PREDICTED: cucumisin-like                        58.9    3e-08   
ref|XP_010456309.1|  PREDICTED: xylem serine proteinase 1-like        58.9    3e-08   
ref|XP_009339280.1|  PREDICTED: subtilisin-like protease SBT5.4       58.9    3e-08   
ref|XP_002982819.1|  hypothetical protein SELMODRAFT_179856           58.9    3e-08   
emb|CDY32679.1|  BnaA02g07410D                                        58.9    3e-08   
ref|XP_010676115.1|  PREDICTED: subtilisin-like protease SBT5.4       58.9    3e-08   
ref|XP_002980085.1|  hypothetical protein SELMODRAFT_111799           58.9    3e-08   
gb|KDO37962.1|  hypothetical protein CISIN_1g036163mg                 58.2    3e-08   
gb|KHN25195.1|  Xylem serine proteinase 1                             58.5    3e-08   
ref|XP_007155580.1|  hypothetical protein PHAVU_003G214100g           58.9    3e-08   
ref|XP_004231226.1|  PREDICTED: CO(2)-response secreted protease-...  58.9    3e-08   
ref|XP_007206725.1|  hypothetical protein PRUPE_ppa024702mg           58.9    3e-08   
ref|XP_010426748.1|  PREDICTED: xylem serine proteinase 1             58.9    3e-08   
ref|XP_008669035.1|  PREDICTED: subtilisin-like protease              58.9    3e-08   



>ref|XP_004292936.1| PREDICTED: subtilisin-like protease-like [Fragaria vesca subsp. 
vesca]
Length=779

 Score = 85.5 bits (210),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 41/54 (76%), Positives = 48/54 (89%), Gaps = 0/54 (0%)
 Frame = -2

Query  162  YISSTKNPLATILPTVTVTESKPAPAVAFFSSRGPSLASVNLLKPDICAPGVDI  1
            YI+ST+NP+ATILPT TVT+ KPAP VA+FSSRGPS A+ N+LKPDI APGVDI
Sbjct  480  YINSTRNPVATILPTETVTKYKPAPTVAYFSSRGPSAATNNILKPDIAAPGVDI  533



>ref|XP_010933350.1| PREDICTED: LOW QUALITY PROTEIN: CO(2)-response secreted protease 
[Elaeis guineensis]
Length=778

 Score = 84.7 bits (208),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 48/54 (89%), Gaps = 0/54 (0%)
 Frame = -2

Query  162  YISSTKNPLATILPTVTVTESKPAPAVAFFSSRGPSLASVNLLKPDICAPGVDI  1
            YI+STKNP+ATILPT+TVT+ KPAP VA+FSSRGPS  + N+LKPD+ APGV+I
Sbjct  479  YINSTKNPVATILPTITVTKYKPAPMVAYFSSRGPSTQTSNILKPDVAAPGVNI  532



>emb|CBI19918.3| unnamed protein product [Vitis vinifera]
Length=743

 Score = 84.3 bits (207),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 40/54 (74%), Positives = 48/54 (89%), Gaps = 0/54 (0%)
 Frame = -2

Query  162  YISSTKNPLATILPTVTVTESKPAPAVAFFSSRGPSLASVNLLKPDICAPGVDI  1
            YI+ST+NP+ATIL TV+V + KPAPAVA+FSSRGPS A+ NLLKPDI APGV+I
Sbjct  442  YINSTRNPVATILATVSVEQYKPAPAVAYFSSRGPSYATKNLLKPDIAAPGVNI  495



>ref|XP_002269753.1| PREDICTED: CO(2)-response secreted protease-like [Vitis vinifera]
Length=768

 Score = 84.3 bits (207),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 40/54 (74%), Positives = 48/54 (89%), Gaps = 0/54 (0%)
 Frame = -2

Query  162  YISSTKNPLATILPTVTVTESKPAPAVAFFSSRGPSLASVNLLKPDICAPGVDI  1
            YI+ST+NP+ATIL TV+V + KPAPAVA+FSSRGPS A+ NLLKPDI APGV+I
Sbjct  467  YINSTRNPVATILATVSVEQYKPAPAVAYFSSRGPSYATKNLLKPDIAAPGVNI  520



>ref|XP_008800183.1| PREDICTED: subtilisin-like protease SBT5.3 [Phoenix dactylifera]
Length=779

 Score = 83.6 bits (205),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 40/54 (74%), Positives = 48/54 (89%), Gaps = 0/54 (0%)
 Frame = -2

Query  162  YISSTKNPLATILPTVTVTESKPAPAVAFFSSRGPSLASVNLLKPDICAPGVDI  1
            YI+STKNP+ATILPT+TVT+ KPAP VA+FSSRGPS  + N+LKPDI APGV+I
Sbjct  480  YINSTKNPVATILPTITVTKYKPAPMVAYFSSRGPSPQTSNILKPDIAAPGVNI  533



>ref|XP_008809445.1| PREDICTED: subtilisin-like protease SBT5.3 [Phoenix dactylifera]
Length=796

 Score = 83.6 bits (205),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 40/54 (74%), Positives = 48/54 (89%), Gaps = 0/54 (0%)
 Frame = -2

Query  162  YISSTKNPLATILPTVTVTESKPAPAVAFFSSRGPSLASVNLLKPDICAPGVDI  1
            YI+STKNP+ATILPT+TVT+ KPAP VA+FSSRGPS  + N+LKPDI APGV+I
Sbjct  497  YINSTKNPVATILPTITVTKYKPAPMVAYFSSRGPSPQTSNILKPDIAAPGVNI  550



>emb|CDP07365.1| unnamed protein product [Coffea canephora]
Length=762

 Score = 82.0 bits (201),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 38/54 (70%), Positives = 47/54 (87%), Gaps = 0/54 (0%)
 Frame = -2

Query  162  YISSTKNPLATILPTVTVTESKPAPAVAFFSSRGPSLASVNLLKPDICAPGVDI  1
            YI+ST+NP ATILPTVTVT+  PAP++A+FS+RGP+  + NLLKPDI APGVDI
Sbjct  464  YINSTRNPTATILPTVTVTKYTPAPSIAYFSARGPAFNTRNLLKPDIAAPGVDI  517



>ref|XP_008221224.1| PREDICTED: subtilisin-like protease [Prunus mume]
Length=776

 Score = 82.0 bits (201),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 47/54 (87%), Gaps = 0/54 (0%)
 Frame = -2

Query  162  YISSTKNPLATILPTVTVTESKPAPAVAFFSSRGPSLASVNLLKPDICAPGVDI  1
            YI+ST+NP+ATIL TVTVT+ KPAP VA+FSSRGPS  + N+LKPDI APGV+I
Sbjct  477  YINSTRNPVATILATVTVTKYKPAPIVAYFSSRGPSHGTRNILKPDIAAPGVNI  530



>ref|XP_010095549.1| Subtilisin-like protease [Morus notabilis]
 gb|EXB60669.1| Subtilisin-like protease [Morus notabilis]
Length=669

 Score = 81.6 bits (200),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 47/54 (87%), Gaps = 0/54 (0%)
 Frame = -2

Query  162  YISSTKNPLATILPTVTVTESKPAPAVAFFSSRGPSLASVNLLKPDICAPGVDI  1
            Y++ST NP+ATILPT T+T+ KPAPAVA+FSSRGPS  S N+LKPDI APGV+I
Sbjct  369  YMNSTSNPVATILPTATMTDYKPAPAVAYFSSRGPSYVSPNILKPDIAAPGVNI  422



>dbj|BAJ53097.1| JHL20J20.3 [Jatropha curcas]
Length=756

 Score = 81.3 bits (199),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 45/54 (83%), Gaps = 0/54 (0%)
 Frame = -2

Query  162  YISSTKNPLATILPTVTVTESKPAPAVAFFSSRGPSLASVNLLKPDICAPGVDI  1
            YI+ST+NP+ATILPT TV   KPAP VA+FSSRGPS  S N+LKPDI APGV+I
Sbjct  456  YINSTRNPVATILPTTTVINYKPAPTVAYFSSRGPSAISRNILKPDIAAPGVEI  509



>ref|XP_011034984.1| PREDICTED: CO(2)-response secreted protease [Populus euphratica]
Length=762

 Score = 80.1 bits (196),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 37/54 (69%), Positives = 46/54 (85%), Gaps = 0/54 (0%)
 Frame = -2

Query  162  YISSTKNPLATILPTVTVTESKPAPAVAFFSSRGPSLASVNLLKPDICAPGVDI  1
            Y++STKNP+ATILP+  V++ KPAP +A+FSSRGPS  S N+LKPDI APGVDI
Sbjct  462  YLNSTKNPVATILPSTVVSQYKPAPTIAYFSSRGPSSLSRNILKPDIAAPGVDI  515



>ref|XP_003603807.1| Subtilisin-type protease [Medicago truncatula]
 gb|AES74058.1| subtilisin-like serine protease [Medicago truncatula]
Length=767

 Score = 80.1 bits (196),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 38/54 (70%), Positives = 46/54 (85%), Gaps = 0/54 (0%)
 Frame = -2

Query  162  YISSTKNPLATILPTVTVTESKPAPAVAFFSSRGPSLASVNLLKPDICAPGVDI  1
            Y +ST+NP+ATILPTVTV +SKPAP  AFFSS+GPS  + N+LKPDI APGV+I
Sbjct  468  YANSTRNPVATILPTVTVIDSKPAPMAAFFSSKGPSYLTKNILKPDIAAPGVNI  521



>ref|XP_004500923.1| PREDICTED: subtilisin-like protease-like [Cicer arietinum]
Length=768

 Score = 79.7 bits (195),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 40/54 (74%), Positives = 44/54 (81%), Gaps = 0/54 (0%)
 Frame = -2

Query  162  YISSTKNPLATILPTVTVTESKPAPAVAFFSSRGPSLASVNLLKPDICAPGVDI  1
            YI+ST NP+ATILPTVTV + KPAP VA FSSRGPS  S N+LKPDI APGV I
Sbjct  470  YINSTSNPVATILPTVTVLDYKPAPMVAMFSSRGPSYLSKNILKPDIAAPGVGI  523



>ref|XP_002510578.1| Cucumisin precursor, putative [Ricinus communis]
 gb|EEF52765.1| Cucumisin precursor, putative [Ricinus communis]
Length=578

 Score = 79.0 bits (193),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 38/54 (70%), Positives = 46/54 (85%), Gaps = 0/54 (0%)
 Frame = -2

Query  162  YISSTKNPLATILPTVTVTESKPAPAVAFFSSRGPSLASVNLLKPDICAPGVDI  1
            YI+STK+P+ATILPT TVT  KPAP VA+FS+RGPS  + N+LKPDI APGV+I
Sbjct  275  YINSTKDPVATILPTTTVTNYKPAPMVAYFSARGPSSIARNILKPDIAAPGVNI  328



>ref|XP_006846917.1| hypothetical protein AMTR_s00152p00071630 [Amborella trichopoda]
 gb|ERN08498.1| hypothetical protein AMTR_s00152p00071630 [Amborella trichopoda]
Length=784

 Score = 79.3 bits (194),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 37/54 (69%), Positives = 47/54 (87%), Gaps = 0/54 (0%)
 Frame = -2

Query  162  YISSTKNPLATILPTVTVTESKPAPAVAFFSSRGPSLASVNLLKPDICAPGVDI  1
            +I+ST+NP+ATILPTV VT+ KPAP VA+FSSRGPS  + N+LKPD+ APGV+I
Sbjct  485  HINSTRNPVATILPTVAVTKFKPAPTVAYFSSRGPSTDTKNILKPDVAAPGVNI  538



>gb|KDO84931.1| hypothetical protein CISIN_1g004113mg [Citrus sinensis]
Length=606

 Score = 79.0 bits (193),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 37/54 (69%), Positives = 48/54 (89%), Gaps = 0/54 (0%)
 Frame = -2

Query  162  YISSTKNPLATILPTVTVTESKPAPAVAFFSSRGPSLASVNLLKPDICAPGVDI  1
            YI+S +NP+ATILPTV+VT+ KPAPA+A+FS+RGPS  + N+LKPDI APGV+I
Sbjct  301  YINSKRNPVATILPTVSVTKYKPAPAIAYFSARGPSPLTRNILKPDITAPGVNI  354



>ref|XP_011003069.1| PREDICTED: CO(2)-response secreted protease-like [Populus euphratica]
Length=760

 Score = 79.3 bits (194),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 37/54 (69%), Positives = 46/54 (85%), Gaps = 0/54 (0%)
 Frame = -2

Query  162  YISSTKNPLATILPTVTVTESKPAPAVAFFSSRGPSLASVNLLKPDICAPGVDI  1
            Y++STKNP+ATILPT  V++ KPAPA+A+FSSRGPS  S N+LKPDI APG +I
Sbjct  464  YLNSTKNPVATILPTTVVSQYKPAPAIAYFSSRGPSSISRNILKPDIAAPGSNI  517



>dbj|BAJ93850.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ86508.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=784

 Score = 79.0 bits (193),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 37/54 (69%), Positives = 45/54 (83%), Gaps = 0/54 (0%)
 Frame = -2

Query  162  YISSTKNPLATILPTVTVTESKPAPAVAFFSSRGPSLASVNLLKPDICAPGVDI  1
            YI+ST  P+ATI PT+TVTE KPAP VA+FSSRGPS  + N+LKPD+ APGV+I
Sbjct  487  YIASTSEPVATITPTITVTEYKPAPVVAYFSSRGPSAQTGNILKPDVAAPGVNI  540



>ref|XP_010266013.1| PREDICTED: CO(2)-response secreted protease-like [Nelumbo nucifera]
Length=780

 Score = 79.0 bits (193),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 36/54 (67%), Positives = 47/54 (87%), Gaps = 0/54 (0%)
 Frame = -2

Query  162  YISSTKNPLATILPTVTVTESKPAPAVAFFSSRGPSLASVNLLKPDICAPGVDI  1
            YI+ST NP+AT+ PTV+VT+ KPAPAVA+FSSRGP+  + N+LKPD+ APGV+I
Sbjct  478  YINSTGNPVATVQPTVSVTKYKPAPAVAYFSSRGPNQQTENILKPDVVAPGVNI  531



>ref|XP_006435228.1| hypothetical protein CICLE_v10000339mg [Citrus clementina]
 gb|ESR48468.1| hypothetical protein CICLE_v10000339mg [Citrus clementina]
Length=787

 Score = 79.0 bits (193),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 37/54 (69%), Positives = 48/54 (89%), Gaps = 0/54 (0%)
 Frame = -2

Query  162  YISSTKNPLATILPTVTVTESKPAPAVAFFSSRGPSLASVNLLKPDICAPGVDI  1
            YI+S +NP+ATILPTV+VT+ KPAPA+A+FS+RGPS  + N+LKPDI APGV+I
Sbjct  482  YINSKRNPVATILPTVSVTKYKPAPAIAYFSARGPSPLTRNILKPDITAPGVNI  535



>gb|KDO84930.1| hypothetical protein CISIN_1g004113mg [Citrus sinensis]
Length=773

 Score = 79.0 bits (193),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 37/54 (69%), Positives = 48/54 (89%), Gaps = 0/54 (0%)
 Frame = -2

Query  162  YISSTKNPLATILPTVTVTESKPAPAVAFFSSRGPSLASVNLLKPDICAPGVDI  1
            YI+S +NP+ATILPTV+VT+ KPAPA+A+FS+RGPS  + N+LKPDI APGV+I
Sbjct  468  YINSKRNPVATILPTVSVTKYKPAPAIAYFSARGPSPLTRNILKPDITAPGVNI  521



>gb|EMT05539.1| Subtilisin-like protease [Aegilops tauschii]
Length=604

 Score = 78.2 bits (191),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 37/54 (69%), Positives = 45/54 (83%), Gaps = 0/54 (0%)
 Frame = -2

Query  162  YISSTKNPLATILPTVTVTESKPAPAVAFFSSRGPSLASVNLLKPDICAPGVDI  1
            YI+ST  P+ATI PT+TVTE KPAP VA+FSSRGPS  + N+LKPD+ APGV+I
Sbjct  306  YIASTSEPVATITPTITVTEYKPAPVVAYFSSRGPSSQTGNILKPDVAAPGVNI  359



>ref|XP_008375386.1| PREDICTED: subtilisin-like protease [Malus domestica]
Length=776

 Score = 78.6 bits (192),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 45/54 (83%), Gaps = 0/54 (0%)
 Frame = -2

Query  162  YISSTKNPLATILPTVTVTESKPAPAVAFFSSRGPSLASVNLLKPDICAPGVDI  1
            YI+STKNP ATILPTV V + +PAPAVAFFSSRGP+  + N+LKPDI APGV I
Sbjct  479  YINSTKNPTATILPTVVVPQYRPAPAVAFFSSRGPAELTENILKPDIMAPGVAI  532



>ref|XP_009780984.1| PREDICTED: subtilisin-like protease SBT5.3 [Nicotiana sylvestris]
Length=768

 Score = 78.6 bits (192),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 37/54 (69%), Positives = 47/54 (87%), Gaps = 0/54 (0%)
 Frame = -2

Query  162  YISSTKNPLATILPTVTVTESKPAPAVAFFSSRGPSLASVNLLKPDICAPGVDI  1
            YI+ST+NP+A+ILPTV++T+ KPAP VA+FSSRGP+  + NLLKPDI APGV I
Sbjct  470  YINSTRNPIASILPTVSITKYKPAPVVAYFSSRGPAYNTPNLLKPDITAPGVAI  523



>ref|XP_003603196.1| Subtilisin-type protease [Medicago truncatula]
 gb|AES73447.1| subtilisin-like serine protease [Medicago truncatula]
Length=763

 Score = 78.6 bits (192),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 44/54 (81%), Gaps = 0/54 (0%)
 Frame = -2

Query  162  YISSTKNPLATILPTVTVTESKPAPAVAFFSSRGPSLASVNLLKPDICAPGVDI  1
            Y++ST NP+ATILPTVTV + KPAP VA FSSRGPS  S N+LKPDI APGV I
Sbjct  464  YVNSTSNPVATILPTVTVIDYKPAPMVAIFSSRGPSALSKNILKPDIAAPGVTI  517



>ref|XP_006348565.1| PREDICTED: subtilisin-like protease-like [Solanum tuberosum]
Length=796

 Score = 78.6 bits (192),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 38/54 (70%), Positives = 44/54 (81%), Gaps = 0/54 (0%)
 Frame = -2

Query  162  YISSTKNPLATILPTVTVTESKPAPAVAFFSSRGPSLASVNLLKPDICAPGVDI  1
            YI+ST+NP+ATILPTV+V   KPAP VAFFSSRGP+  + NLLKPDI APG  I
Sbjct  464  YINSTRNPVATILPTVSVDNFKPAPVVAFFSSRGPNYNTRNLLKPDIAAPGTAI  517



>gb|KEH34337.1| subtilisin-like serine protease [Medicago truncatula]
Length=733

 Score = 78.2 bits (191),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 38/54 (70%), Positives = 44/54 (81%), Gaps = 0/54 (0%)
 Frame = -2

Query  162  YISSTKNPLATILPTVTVTESKPAPAVAFFSSRGPSLASVNLLKPDICAPGVDI  1
            YI+ST NP+ TILPTVT+ + KPAP VA FSSRGPS  S N+LKPDI APGV+I
Sbjct  446  YINSTSNPMGTILPTVTIIKYKPAPMVAIFSSRGPSSLSKNILKPDIAAPGVNI  499



>ref|XP_009614808.1| PREDICTED: cucumisin-like [Nicotiana tomentosiformis]
Length=768

 Score = 78.2 bits (191),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 38/54 (70%), Positives = 44/54 (81%), Gaps = 0/54 (0%)
 Frame = -2

Query  162  YISSTKNPLATILPTVTVTESKPAPAVAFFSSRGPSLASVNLLKPDICAPGVDI  1
            Y++STKNP+ATILPTV+V   KPAP VAFFSSRGP+  + NLLKPDI APG  I
Sbjct  468  YLNSTKNPVATILPTVSVDNFKPAPVVAFFSSRGPAYNTRNLLKPDIAAPGTAI  521



>gb|EAZ09528.1| hypothetical protein OsI_31804 [Oryza sativa Indica Group]
Length=810

 Score = 78.2 bits (191),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 38/54 (70%), Positives = 45/54 (83%), Gaps = 0/54 (0%)
 Frame = -2

Query  162  YISSTKNPLATILPTVTVTESKPAPAVAFFSSRGPSLASVNLLKPDICAPGVDI  1
            YISST  P+ATI PT+TVTE KPAP VA+FSSRGPS  + N+LKPD+ APGV+I
Sbjct  505  YISSTSEPVATITPTITVTEYKPAPVVAYFSSRGPSPQTPNILKPDVAAPGVNI  558



>gb|KDO48662.1| hypothetical protein CISIN_1g0368301mg, partial [Citrus sinensis]
Length=351

 Score = 76.3 bits (186),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 35/54 (65%), Positives = 43/54 (80%), Gaps = 0/54 (0%)
 Frame = -2

Query  162  YISSTKNPLATILPTVTVTESKPAPAVAFFSSRGPSLASVNLLKPDICAPGVDI  1
            YI+S KNP ATILPTVT+   +PAP VA+FSSRGP L + N+LKPD+ APGV +
Sbjct  53   YINSNKNPTATILPTVTIPRHRPAPVVAYFSSRGPGLPTENILKPDVAAPGVAV  106



>ref|XP_009614807.1| PREDICTED: subtilisin-like protease SBT5.3 [Nicotiana tomentosiformis]
Length=768

 Score = 77.8 bits (190),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 36/54 (67%), Positives = 47/54 (87%), Gaps = 0/54 (0%)
 Frame = -2

Query  162  YISSTKNPLATILPTVTVTESKPAPAVAFFSSRGPSLASVNLLKPDICAPGVDI  1
            YI+ST+NP+A+ILPT+++T+ KPAP VA+FSSRGP+  + NLLKPDI APGV I
Sbjct  470  YINSTRNPVASILPTISITKYKPAPVVAYFSSRGPAYNTPNLLKPDITAPGVAI  523



>ref|XP_004500924.1| PREDICTED: subtilisin-like protease-like [Cicer arietinum]
Length=776

 Score = 77.4 bits (189),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 43/54 (80%), Gaps = 0/54 (0%)
 Frame = -2

Query  162  YISSTKNPLATILPTVTVTESKPAPAVAFFSSRGPSLASVNLLKPDICAPGVDI  1
            Y++STKNP+ATILPTVT    KPAP V  FSSRGPS  S N+LKPDI APGVDI
Sbjct  477  YVNSTKNPVATILPTVTGINYKPAPVVVAFSSRGPSALSKNILKPDIAAPGVDI  530



>ref|XP_009757105.1| PREDICTED: subtilisin-like protease SBT5.3 [Nicotiana sylvestris]
Length=769

 Score = 77.4 bits (189),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 37/54 (69%), Positives = 46/54 (85%), Gaps = 0/54 (0%)
 Frame = -2

Query  162  YISSTKNPLATILPTVTVTESKPAPAVAFFSSRGPSLASVNLLKPDICAPGVDI  1
            YI+ST+NP+A+ILPTV+ T+ KPAP VA+FSSRGP+  + NLLKPDI APGV I
Sbjct  470  YINSTRNPVASILPTVSKTKYKPAPVVAYFSSRGPAYNTHNLLKPDITAPGVAI  523



>gb|KDO48660.1| hypothetical protein CISIN_1g040558mg, partial [Citrus sinensis]
Length=367

 Score = 75.9 bits (185),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 37/54 (69%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  162  YISSTKNPLATILPTVTVTESKPAPAVAFFSSRGPSLASVNLLKPDICAPGVDI  1
            YI+STKNP ATILPTV V   KPAP VA+FSSRGP   + N+LKPD+ APGV I
Sbjct  69   YINSTKNPTATILPTVDVQRYKPAPVVAYFSSRGPGELTENILKPDVTAPGVAI  122



>ref|XP_010229422.1| PREDICTED: CO(2)-response secreted protease-like [Brachypodium 
distachyon]
Length=521

 Score = 76.6 bits (187),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 36/54 (67%), Positives = 45/54 (83%), Gaps = 0/54 (0%)
 Frame = -2

Query  162  YISSTKNPLATILPTVTVTESKPAPAVAFFSSRGPSLASVNLLKPDICAPGVDI  1
            YI+ST  P+ATI P++TVTE KPAP VA+FSSRGPS  + N+LKPD+ APGV+I
Sbjct  222  YIASTSEPVATITPSITVTEFKPAPVVAYFSSRGPSSQTGNILKPDVAAPGVNI  275



>ref|XP_003523395.1| PREDICTED: subtilisin-like protease-like [Glycine max]
 gb|KHN45942.1| Subtilisin-like protease [Glycine soja]
Length=769

 Score = 77.0 bits (188),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 38/54 (70%), Positives = 43/54 (80%), Gaps = 0/54 (0%)
 Frame = -2

Query  162  YISSTKNPLATILPTVTVTESKPAPAVAFFSSRGPSLASVNLLKPDICAPGVDI  1
            YI+ST NP+ TIL TVTV + KPAP V FFSSRGPS  S N+LKPDI APGV+I
Sbjct  472  YINSTSNPVGTILATVTVPDYKPAPVVGFFSSRGPSTLSSNILKPDIAAPGVNI  525



>gb|AES74057.2| subtilisin-like serine protease [Medicago truncatula]
Length=581

 Score = 76.6 bits (187),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 38/54 (70%), Positives = 43/54 (80%), Gaps = 0/54 (0%)
 Frame = -2

Query  162  YISSTKNPLATILPTVTVTESKPAPAVAFFSSRGPSLASVNLLKPDICAPGVDI  1
            Y++ST NP+ATIL T+TV   KPAP VAFFSSRGPS  S N+LKPDI APGV I
Sbjct  467  YVNSTSNPVATILATITVVGYKPAPMVAFFSSRGPSTLSKNILKPDIAAPGVAI  520



>ref|XP_009605223.1| PREDICTED: subtilisin-like protease [Nicotiana tomentosiformis]
Length=783

 Score = 76.6 bits (187),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 36/54 (67%), Positives = 46/54 (85%), Gaps = 0/54 (0%)
 Frame = -2

Query  162  YISSTKNPLATILPTVTVTESKPAPAVAFFSSRGPSLASVNLLKPDICAPGVDI  1
            YI+ST+NP+A+ILPTV+ T+ KPAP VA+FSSRGP+  ++NLLKPD  APGV I
Sbjct  470  YINSTRNPVASILPTVSKTKYKPAPVVAYFSSRGPAYNTLNLLKPDTTAPGVAI  523



>ref|XP_006658495.1| PREDICTED: subtilisin-like protease-like [Oryza brachyantha]
Length=806

 Score = 76.6 bits (187),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 36/54 (67%), Positives = 44/54 (81%), Gaps = 0/54 (0%)
 Frame = -2

Query  162  YISSTKNPLATILPTVTVTESKPAPAVAFFSSRGPSLASVNLLKPDICAPGVDI  1
            YI+ST  P+ATI PT+T TE KPAP VA+FSSRGPS  + N+LKPD+ APGV+I
Sbjct  504  YIASTSEPVATITPTITFTEYKPAPVVAYFSSRGPSAQTPNILKPDVAAPGVNI  557



>ref|XP_009397604.1| PREDICTED: subtilisin-like protease [Musa acuminata subsp. malaccensis]
Length=776

 Score = 76.6 bits (187),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 35/54 (65%), Positives = 45/54 (83%), Gaps = 0/54 (0%)
 Frame = -2

Query  162  YISSTKNPLATILPTVTVTESKPAPAVAFFSSRGPSLASVNLLKPDICAPGVDI  1
            Y++STKNP+ TIL TVTVT+ +PAP VA+FSSRGPS  +  +LKPD+ APGV+I
Sbjct  476  YMNSTKNPVGTILATVTVTKYRPAPVVAYFSSRGPSTEASGILKPDVAAPGVNI  529



>ref|XP_007220237.1| hypothetical protein PRUPE_ppa001918mg [Prunus persica]
 gb|EMJ21436.1| hypothetical protein PRUPE_ppa001918mg [Prunus persica]
Length=741

 Score = 76.3 bits (186),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 38/54 (70%), Positives = 44/54 (81%), Gaps = 0/54 (0%)
 Frame = -2

Query  162  YISSTKNPLATILPTVTVTESKPAPAVAFFSSRGPSLASVNLLKPDICAPGVDI  1
            YI+STKNP ATILPTV V   +PAPAVA+FSSRGP+  + N+LKPDI APGV I
Sbjct  444  YINSTKNPTATILPTVDVPRYRPAPAVAYFSSRGPAELTENILKPDIMAPGVAI  497



>ref|XP_008231725.1| PREDICTED: subtilisin-like protease [Prunus mume]
Length=775

 Score = 76.3 bits (186),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 38/54 (70%), Positives = 44/54 (81%), Gaps = 0/54 (0%)
 Frame = -2

Query  162  YISSTKNPLATILPTVTVTESKPAPAVAFFSSRGPSLASVNLLKPDICAPGVDI  1
            YI+STKNP ATILPTV V   +PAPAVA+FSSRGP+  + N+LKPDI APGV I
Sbjct  478  YINSTKNPTATILPTVDVPRYRPAPAVAYFSSRGPAELTENILKPDIMAPGVAI  531



>ref|XP_004956009.1| PREDICTED: subtilisin-like protease-like [Setaria italica]
Length=783

 Score = 76.3 bits (186),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 36/54 (67%), Positives = 43/54 (80%), Gaps = 0/54 (0%)
 Frame = -2

Query  162  YISSTKNPLATILPTVTVTESKPAPAVAFFSSRGPSLASVNLLKPDICAPGVDI  1
            YI+S   P+ATI PT TVTE KPAP VA+FSSRGPS  + N+LKPD+ APGV+I
Sbjct  480  YIASASQPVATITPTATVTEYKPAPVVAYFSSRGPSAQTGNVLKPDVAAPGVNI  533



>ref|XP_006432517.1| hypothetical protein CICLE_v10003851mg [Citrus clementina]
 gb|ESR45757.1| hypothetical protein CICLE_v10003851mg [Citrus clementina]
Length=714

 Score = 75.9 bits (185),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 35/54 (65%), Positives = 43/54 (80%), Gaps = 0/54 (0%)
 Frame = -2

Query  162  YISSTKNPLATILPTVTVTESKPAPAVAFFSSRGPSLASVNLLKPDICAPGVDI  1
            YI+S KNP ATILPTVT+   +PAP VA+FSSRGP L + N+LKPD+ APGV +
Sbjct  416  YINSNKNPTATILPTVTIPRHRPAPVVAYFSSRGPGLPTENILKPDVAAPGVAV  469



>ref|XP_006471314.1| PREDICTED: subtilisin-like protease-like [Citrus sinensis]
Length=775

 Score = 75.9 bits (185),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 35/54 (65%), Positives = 43/54 (80%), Gaps = 0/54 (0%)
 Frame = -2

Query  162  YISSTKNPLATILPTVTVTESKPAPAVAFFSSRGPSLASVNLLKPDICAPGVDI  1
            YI+S KNP ATILPTVT+   +PAP VA+FSSRGP L + N+LKPD+ APGV +
Sbjct  477  YINSNKNPTATILPTVTIPRHRPAPVVAYFSSRGPGLPTENILKPDVAAPGVAV  530



>ref|XP_004308189.1| PREDICTED: subtilisin-like protease-like [Fragaria vesca subsp. 
vesca]
Length=770

 Score = 75.9 bits (185),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 37/54 (69%), Positives = 43/54 (80%), Gaps = 0/54 (0%)
 Frame = -2

Query  162  YISSTKNPLATILPTVTVTESKPAPAVAFFSSRGPSLASVNLLKPDICAPGVDI  1
            YI+STKNP ATILPTV V   +PAP VA+FSSRGP+  + N+LKPDI APGV I
Sbjct  473  YINSTKNPRATILPTVDVHRYRPAPTVAYFSSRGPAQLTENILKPDIMAPGVAI  526



>ref|XP_004238378.1| PREDICTED: CO(2)-response secreted protease [Solanum lycopersicum]
Length=783

 Score = 75.9 bits (185),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 36/54 (67%), Positives = 44/54 (81%), Gaps = 0/54 (0%)
 Frame = -2

Query  162  YISSTKNPLATILPTVTVTESKPAPAVAFFSSRGPSLASVNLLKPDICAPGVDI  1
            YI+STK P+A++LPTVT+   KPAP VA+FSSRGP+  + NLLKPDI APGV I
Sbjct  471  YINSTKKPVASVLPTVTIANYKPAPLVAYFSSRGPTYNTHNLLKPDITAPGVAI  524



>ref|XP_004228919.2| PREDICTED: CO(2)-response secreted protease-like [Solanum lycopersicum]
Length=764

 Score = 75.9 bits (185),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 38/54 (70%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  162  YISSTKNPLATILPTVTVTESKPAPAVAFFSSRGPSLASVNLLKPDICAPGVDI  1
            YI+ST NP+ATILPTV V   KPAP VAFFSSRGP+  + NLLKPDI APG  I
Sbjct  464  YINSTMNPVATILPTVGVDNFKPAPVVAFFSSRGPNYNTRNLLKPDIAAPGTAI  517



>ref|XP_010543788.1| PREDICTED: CO(2)-response secreted protease isoform X1 [Tarenaya 
hassleriana]
Length=766

 Score = 75.9 bits (185),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 35/54 (65%), Positives = 43/54 (80%), Gaps = 0/54 (0%)
 Frame = -2

Query  162  YISSTKNPLATILPTVTVTESKPAPAVAFFSSRGPSLASVNLLKPDICAPGVDI  1
            Y+S TKNP ATILPTV +  +KPAP VA+FSSRGP + + N+LKPD+ APGV I
Sbjct  475  YMSQTKNPKATILPTVEIQRAKPAPVVAYFSSRGPGVLTDNILKPDVMAPGVAI  528



>emb|CDY70447.1| BnaAnng33720D, partial [Brassica napus]
Length=318

 Score = 73.6 bits (179),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 36/54 (67%), Positives = 46/54 (85%), Gaps = 0/54 (0%)
 Frame = -2

Query  162  YISSTKNPLATILPTVTVTESKPAPAVAFFSSRGPSLASVNLLKPDICAPGVDI  1
            Y++STK+P+ATILPTVTV +  PAP+VA+FSSRGPS  + ++LKPDI APGV I
Sbjct  13   YVNSTKDPVATILPTVTVEKFTPAPSVAYFSSRGPSSITRSILKPDITAPGVAI  66



>ref|XP_006342240.1| PREDICTED: subtilisin-like protease-like [Solanum tuberosum]
Length=773

 Score = 75.9 bits (185),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 36/54 (67%), Positives = 44/54 (81%), Gaps = 0/54 (0%)
 Frame = -2

Query  162  YISSTKNPLATILPTVTVTESKPAPAVAFFSSRGPSLASVNLLKPDICAPGVDI  1
            YI+STK P+A++LPTVT+   KPAP VA+FSSRGP+  + NLLKPDI APGV I
Sbjct  471  YINSTKKPVASVLPTVTIANYKPAPLVAYFSSRGPTYNTHNLLKPDITAPGVAI  524



>ref|XP_010091320.1| Subtilisin-like protease [Morus notabilis]
 gb|EXB44294.1| Subtilisin-like protease [Morus notabilis]
Length=764

 Score = 75.9 bits (185),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 36/54 (67%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  162  YISSTKNPLATILPTVTVTESKPAPAVAFFSSRGPSLASVNLLKPDICAPGVDI  1
            YI STK P ATILPTV ++  KPAP VA+FSSRGP   + N+LKPDI APGV+I
Sbjct  469  YIKSTKKPTATILPTVEISRHKPAPIVAYFSSRGPGELTENILKPDIMAPGVNI  522



>gb|KHN06934.1| Subtilisin-like protease, partial [Glycine soja]
Length=311

 Score = 73.2 bits (178),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 34/54 (63%), Positives = 43/54 (80%), Gaps = 0/54 (0%)
 Frame = -2

Query  162  YISSTKNPLATILPTVTVTESKPAPAVAFFSSRGPSLASVNLLKPDICAPGVDI  1
            Y+ ST NP+A ILP  TV E+KPAP++A FSSRGP++   N+LKPDI +PGVDI
Sbjct  73   YVHSTLNPMAQILPGTTVLEAKPAPSMASFSSRGPNIVDPNILKPDITSPGVDI  126



>ref|XP_010536423.1| PREDICTED: CO(2)-response secreted protease-like [Tarenaya hassleriana]
Length=766

 Score = 75.1 bits (183),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 36/54 (67%), Positives = 45/54 (83%), Gaps = 0/54 (0%)
 Frame = -2

Query  162  YISSTKNPLATILPTVTVTESKPAPAVAFFSSRGPSLASVNLLKPDICAPGVDI  1
            Y++ST+ P+ATI PTVT+ + KPAPAVA+FSSRGPS  + N+LKPDI APGV I
Sbjct  459  YLNSTREPIATIHPTVTIEKFKPAPAVAYFSSRGPSGLTRNILKPDISAPGVAI  512



>ref|XP_007017870.1| Subtilisin-like serine endopeptidase family protein isoform 1 
[Theobroma cacao]
 gb|EOY15095.1| Subtilisin-like serine endopeptidase family protein isoform 1 
[Theobroma cacao]
Length=735

 Score = 75.1 bits (183),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 37/54 (69%), Positives = 43/54 (80%), Gaps = 0/54 (0%)
 Frame = -2

Query  162  YISSTKNPLATILPTVTVTESKPAPAVAFFSSRGPSLASVNLLKPDICAPGVDI  1
            YI+STKNP ATILPT + T  KPAP +A+FSSRGPS    N+LKPDI APGV+I
Sbjct  433  YINSTKNPAATILPTTSPTNYKPAPTIAYFSSRGPSTIPKNILKPDIAAPGVNI  486



>ref|XP_007017871.1| Subtilisin-like serine endopeptidase family protein isoform 2 
[Theobroma cacao]
 gb|EOY15096.1| Subtilisin-like serine endopeptidase family protein isoform 2 
[Theobroma cacao]
Length=761

 Score = 74.7 bits (182),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 37/54 (69%), Positives = 43/54 (80%), Gaps = 0/54 (0%)
 Frame = -2

Query  162  YISSTKNPLATILPTVTVTESKPAPAVAFFSSRGPSLASVNLLKPDICAPGVDI  1
            YI+STKNP ATILPT + T  KPAP +A+FSSRGPS    N+LKPDI APGV+I
Sbjct  459  YINSTKNPAATILPTTSPTNYKPAPTIAYFSSRGPSTIPKNILKPDIAAPGVNI  512



>ref|XP_002300693.2| putative subtilisin precursor family protein [Populus trichocarpa]
 gb|EEE79966.2| putative subtilisin precursor family protein [Populus trichocarpa]
Length=767

 Score = 74.7 bits (182),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 37/57 (65%), Positives = 46/57 (81%), Gaps = 3/57 (5%)
 Frame = -2

Query  162  YISSTKNPLATILPTVTVTESKPAPAVAFFSSRGPSLASVNLLK---PDICAPGVDI  1
            Y++STKNP+ATILP+  V++ KPAP +A+FSSRGPS  S N+LK   PDI APGVDI
Sbjct  464  YLNSTKNPVATILPSTVVSQYKPAPTIAYFSSRGPSSLSRNILKAKPPDIAAPGVDI  520



>ref|XP_009768389.1| PREDICTED: cucumisin-like [Nicotiana sylvestris]
Length=765

 Score = 74.7 bits (182),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 36/54 (67%), Positives = 43/54 (80%), Gaps = 0/54 (0%)
 Frame = -2

Query  162  YISSTKNPLATILPTVTVTESKPAPAVAFFSSRGPSLASVNLLKPDICAPGVDI  1
            Y++ T+NP+ATILPTV+V   KPAP VAFFSSRGP+  + NLLKPDI APG  I
Sbjct  465  YLNLTRNPVATILPTVSVDNFKPAPVVAFFSSRGPAYNTRNLLKPDIAAPGTAI  518



>ref|XP_008346279.1| PREDICTED: subtilisin-like protease [Malus domestica]
Length=781

 Score = 74.7 bits (182),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 37/54 (69%), Positives = 43/54 (80%), Gaps = 0/54 (0%)
 Frame = -2

Query  162  YISSTKNPLATILPTVTVTESKPAPAVAFFSSRGPSLASVNLLKPDICAPGVDI  1
            YI+STK P ATILPTV V + +PAP VAFFSSRGP+  + N+LKPDI APGV I
Sbjct  484  YINSTKKPTATILPTVVVPQYRPAPXVAFFSSRGPAQLTENILKPDIMAPGVAI  537



>ref|XP_002461867.1| hypothetical protein SORBIDRAFT_02g009600 [Sorghum bicolor]
 gb|EER98388.1| hypothetical protein SORBIDRAFT_02g009600 [Sorghum bicolor]
Length=826

 Score = 74.3 bits (181),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 36/54 (67%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  162  YISSTKNPLATILPTVTVTESKPAPAVAFFSSRGPSLASVNLLKPDICAPGVDI  1
            YI+S   P+ATI P  TVTE KPAP VA+FSSRGPS  + N+LKPDI APGV+I
Sbjct  510  YIASASQPVATITPATTVTEYKPAPVVAYFSSRGPSGQTGNILKPDIAAPGVNI  563



>ref|XP_009355089.1| PREDICTED: subtilisin-like protease SBT5.3 [Pyrus x bretschneideri]
Length=781

 Score = 74.3 bits (181),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 36/52 (69%), Positives = 43/52 (83%), Gaps = 0/52 (0%)
 Frame = -2

Query  162  YISSTKNPLATILPTVTVTESKPAPAVAFFSSRGPSLASVNLLKPDICAPGV  7
            YI+ST+ P ATILPTV V + +PAPAVAFFSSRGP+  + N+LKPDI APGV
Sbjct  484  YINSTQKPTATILPTVVVPQYRPAPAVAFFSSRGPAQLTENILKPDIMAPGV  535



>ref|XP_003541678.1| PREDICTED: subtilisin-like protease-like isoform X1 [Glycine 
max]
Length=789

 Score = 74.3 bits (181),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 35/54 (65%), Positives = 43/54 (80%), Gaps = 0/54 (0%)
 Frame = -2

Query  162  YISSTKNPLATILPTVTVTESKPAPAVAFFSSRGPSLASVNLLKPDICAPGVDI  1
            Y+ ST NP+A ILP  TV E+KPAP++A FSSRGP++   N+LKPDI APGVDI
Sbjct  494  YVHSTPNPMAQILPGTTVLETKPAPSMASFSSRGPNIVDPNILKPDITAPGVDI  547



>ref|XP_008445401.1| PREDICTED: subtilisin-like protease [Cucumis melo]
Length=745

 Score = 74.3 bits (181),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 38/54 (70%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  162  YISSTKNPLATILPTVTVTESKPAPAVAFFSSRGPSLASVNLLKPDICAPGVDI  1
            YI+STKNP ATIL TV V   KPAP VA+FSSRGPS  + N+LKPDI APGV I
Sbjct  448  YINSTKNPTATILKTVEVRRLKPAPTVAYFSSRGPSPLTENILKPDITAPGVSI  501



>ref|XP_006594524.1| PREDICTED: subtilisin-like protease-like isoform X2 [Glycine 
max]
Length=785

 Score = 74.3 bits (181),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 35/54 (65%), Positives = 43/54 (80%), Gaps = 0/54 (0%)
 Frame = -2

Query  162  YISSTKNPLATILPTVTVTESKPAPAVAFFSSRGPSLASVNLLKPDICAPGVDI  1
            Y+ ST NP+A ILP  TV E+KPAP++A FSSRGP++   N+LKPDI APGVDI
Sbjct  490  YVHSTPNPMAQILPGTTVLETKPAPSMASFSSRGPNIVDPNILKPDITAPGVDI  543



>gb|KGN47766.1| hypothetical protein Csa_6G401370 [Cucumis sativus]
Length=789

 Score = 74.3 bits (181),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 38/54 (70%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  162  YISSTKNPLATILPTVTVTESKPAPAVAFFSSRGPSLASVNLLKPDICAPGVDI  1
            YI+STKNP ATIL TV V   KPAP VA+FSSRGPS  + N+LKPDI APGV I
Sbjct  492  YINSTKNPTATILKTVEVRRLKPAPTVAYFSSRGPSPLTENILKPDITAPGVSI  545



>ref|XP_004165291.1| PREDICTED: subtilisin-like protease-like [Cucumis sativus]
Length=738

 Score = 73.9 bits (180),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 38/54 (70%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  162  YISSTKNPLATILPTVTVTESKPAPAVAFFSSRGPSLASVNLLKPDICAPGVDI  1
            YI+STKNP ATIL TV V   KPAP VA+FSSRGPS  + N+LKPDI APGV I
Sbjct  441  YINSTKNPTATILKTVEVRRLKPAPTVAYFSSRGPSPLTENILKPDITAPGVSI  494



>ref|XP_004146802.1| PREDICTED: subtilisin-like protease-like [Cucumis sativus]
Length=733

 Score = 73.9 bits (180),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 38/54 (70%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  162  YISSTKNPLATILPTVTVTESKPAPAVAFFSSRGPSLASVNLLKPDICAPGVDI  1
            YI+STKNP ATIL TV V   KPAP VA+FSSRGPS  + N+LKPDI APGV I
Sbjct  436  YINSTKNPTATILKTVEVRRLKPAPTVAYFSSRGPSPLTENILKPDITAPGVSI  489



>ref|XP_007028364.1| Subtilisin-like serine endopeptidase family protein [Theobroma 
cacao]
 gb|EOY08866.1| Subtilisin-like serine endopeptidase family protein [Theobroma 
cacao]
Length=762

 Score = 73.9 bits (180),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 36/54 (67%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  162  YISSTKNPLATILPTVTVTESKPAPAVAFFSSRGPSLASVNLLKPDICAPGVDI  1
            YI+S KNP ATILPT  V   +PAP VA+FSSRGPS+ + N+LKPDI APGV I
Sbjct  470  YINSNKNPTATILPTADVPRHRPAPVVAYFSSRGPSVLAENILKPDIMAPGVAI  523



>gb|KDP40600.1| hypothetical protein JCGZ_24599 [Jatropha curcas]
Length=775

 Score = 73.9 bits (180),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 37/54 (69%), Positives = 41/54 (76%), Gaps = 0/54 (0%)
 Frame = -2

Query  162  YISSTKNPLATILPTVTVTESKPAPAVAFFSSRGPSLASVNLLKPDICAPGVDI  1
            YI+STKNP ATILP V V   KPAP VA+FSSRGP   + N+LKPDI APGV I
Sbjct  477  YINSTKNPTATILPAVDVPRYKPAPVVAYFSSRGPGQLTENILKPDIMAPGVAI  530



>ref|NP_001238252.1| subtilisin-type protease precursor [Glycine max]
 gb|AAG38994.1|AF160513_1 subtilisin-type protease precursor [Glycine max]
 emb|CAB87246.1| putative pre-pro-subtilisin [Glycine max]
 emb|CAB87247.1| putative subtilisin precursor [Glycine max]
Length=770

 Score = 73.9 bits (180),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 35/54 (65%), Positives = 44/54 (81%), Gaps = 0/54 (0%)
 Frame = -2

Query  162  YISSTKNPLATILPTVTVTESKPAPAVAFFSSRGPSLASVNLLKPDICAPGVDI  1
            YI+ST +P+ TIL TVT+ + KPAP V +FSSRGPSL + N+LKPDI APGV+I
Sbjct  473  YINSTSHPVGTILATVTIPDYKPAPRVGYFSSRGPSLITSNVLKPDIAAPGVNI  526



>ref|XP_003541562.1| PREDICTED: subtilisin-like protease-like [Glycine max]
Length=778

 Score = 73.9 bits (180),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 37/54 (69%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  162  YISSTKNPLATILPTVTVTESKPAPAVAFFSSRGPSLASVNLLKPDICAPGVDI  1
            YI+STKNP ATILPT  V  SKP+P VA FSSRGPS  + N+LKPD+ APGV I
Sbjct  480  YINSTKNPTATILPTTEVARSKPSPIVASFSSRGPSSLTENILKPDVMAPGVGI  533



>gb|KHN10324.1| Subtilisin-like protease [Glycine soja]
Length=778

 Score = 73.9 bits (180),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 37/54 (69%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  162  YISSTKNPLATILPTVTVTESKPAPAVAFFSSRGPSLASVNLLKPDICAPGVDI  1
            YI+STKNP ATILPT  V  SKP+P VA FSSRGPS  + N+LKPD+ APGV I
Sbjct  480  YINSTKNPTATILPTTEVARSKPSPIVASFSSRGPSSLTENILKPDVMAPGVGI  533



>ref|XP_002307740.1| putative subtilisin precursor family protein [Populus trichocarpa]
 gb|EEE94736.1| putative subtilisin precursor family protein [Populus trichocarpa]
Length=769

 Score = 73.9 bits (180),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 37/57 (65%), Positives = 46/57 (81%), Gaps = 3/57 (5%)
 Frame = -2

Query  162  YISSTKNPLATILPTVTVTESKPAPAVAFFSSRGPSLASVNLLK---PDICAPGVDI  1
            Y++STKNP+ATILPT  V++ KPAPA+A+FSSRGPS  S N+LK   PDI APG +I
Sbjct  466  YLNSTKNPVATILPTTVVSQYKPAPAIAYFSSRGPSSISRNILKAKPPDIAAPGSNI  522



>ref|XP_006432515.1| hypothetical protein CICLE_v10000349mg [Citrus clementina]
 gb|ESR45755.1| hypothetical protein CICLE_v10000349mg [Citrus clementina]
Length=779

 Score = 73.6 bits (179),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 37/54 (69%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  162  YISSTKNPLATILPTVTVTESKPAPAVAFFSSRGPSLASVNLLKPDICAPGVDI  1
            YI+STKNP ATILPTV V   KPAP VA+FSSRGP   + N+LKPD+ APGV I
Sbjct  481  YINSTKNPTATILPTVDVPGYKPAPVVAYFSSRGPGELTENILKPDVTAPGVAI  534



>ref|XP_006432516.1| hypothetical protein CICLE_v10000349mg [Citrus clementina]
 gb|ESR45756.1| hypothetical protein CICLE_v10000349mg [Citrus clementina]
Length=780

 Score = 73.6 bits (179),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 37/54 (69%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  162  YISSTKNPLATILPTVTVTESKPAPAVAFFSSRGPSLASVNLLKPDICAPGVDI  1
            YI+STKNP ATILPTV V   KPAP VA+FSSRGP   + N+LKPD+ APGV I
Sbjct  482  YINSTKNPTATILPTVDVPGYKPAPVVAYFSSRGPGELTENILKPDVTAPGVAI  535



>ref|XP_006471277.1| PREDICTED: subtilisin-like protease-like [Citrus sinensis]
Length=806

 Score = 73.6 bits (179),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 37/54 (69%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  162  YISSTKNPLATILPTVTVTESKPAPAVAFFSSRGPSLASVNLLKPDICAPGVDI  1
            YI+STKNP ATILPTV V   KPAP VA+FSSRGP   + N+LKPD+ APGV I
Sbjct  508  YINSTKNPTATILPTVDVPGYKPAPVVAYFSSRGPGELTENILKPDVTAPGVAI  561



>ref|XP_009149504.1| PREDICTED: subtilisin-like protease [Brassica rapa]
Length=772

 Score = 73.6 bits (179),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 36/54 (67%), Positives = 46/54 (85%), Gaps = 0/54 (0%)
 Frame = -2

Query  162  YISSTKNPLATILPTVTVTESKPAPAVAFFSSRGPSLASVNLLKPDICAPGVDI  1
            Y++STK+P+ATILPTVTV +  PAP+VA+FSSRGPS  + ++LKPDI APGV I
Sbjct  467  YVNSTKDPVATILPTVTVEKFTPAPSVAYFSSRGPSSITRSILKPDITAPGVAI  520



>emb|CDY44210.1| BnaC05g15670D [Brassica napus]
Length=772

 Score = 73.6 bits (179),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 36/54 (67%), Positives = 46/54 (85%), Gaps = 0/54 (0%)
 Frame = -2

Query  162  YISSTKNPLATILPTVTVTESKPAPAVAFFSSRGPSLASVNLLKPDICAPGVDI  1
            Y++STK+P+ATILPTVTV +  PAP+VA+FSSRGPS  + ++LKPDI APGV I
Sbjct  467  YVNSTKDPVATILPTVTVEKFTPAPSVAYFSSRGPSSITRSILKPDITAPGVAI  520



>ref|XP_009769238.1| PREDICTED: subtilisin-like protease SBT5.3 isoform X2 [Nicotiana 
sylvestris]
Length=761

 Score = 73.6 bits (179),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 36/54 (67%), Positives = 44/54 (81%), Gaps = 0/54 (0%)
 Frame = -2

Query  162  YISSTKNPLATILPTVTVTESKPAPAVAFFSSRGPSLASVNLLKPDICAPGVDI  1
            YI ST+NP+A+ILPTV+ T+ KPAP V +FSSRGP+  + NLLKPDI APGV I
Sbjct  471  YIKSTRNPVASILPTVSTTKYKPAPVVPYFSSRGPAGNTPNLLKPDITAPGVTI  524



>ref|NP_001031070.1| serine-type endopeptidase SBT5.2 [Arabidopsis thaliana]
 gb|AEE29946.1| Subtilisin-like serine endopeptidase family protein [Arabidopsis 
thaliana]
Length=730

 Score = 73.2 bits (178),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 36/54 (67%), Positives = 45/54 (83%), Gaps = 0/54 (0%)
 Frame = -2

Query  162  YISSTKNPLATILPTVTVTESKPAPAVAFFSSRGPSLASVNLLKPDICAPGVDI  1
            Y++STK+P+ATILPT TV +  PAPAVA+FSSRGPS  + ++LKPDI APGV I
Sbjct  426  YLNSTKDPVATILPTATVEKFTPAPAVAYFSSRGPSSLTRSILKPDITAPGVSI  479



>gb|AAM65424.1| subtilisin-like serine protease [Arabidopsis thaliana]
Length=769

 Score = 73.2 bits (178),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 36/54 (67%), Positives = 45/54 (83%), Gaps = 0/54 (0%)
 Frame = -2

Query  162  YISSTKNPLATILPTVTVTESKPAPAVAFFSSRGPSLASVNLLKPDICAPGVDI  1
            Y++STK+P+ATILPT TV +  PAPAVA+FSSRGPS  + ++LKPDI APGV I
Sbjct  465  YLNSTKDPVATILPTATVEKFTPAPAVAYFSSRGPSSLTRSILKPDITAPGVSI  518



>ref|NP_564107.1| serine-type endopeptidase SBT5.2 [Arabidopsis thaliana]
 sp|Q9LNU1.1|CRSP_ARATH RecName: Full=CO(2)-response secreted protease; AltName: Full=Subtilisin-like 
serine protease; Short=AtSBT5.2; AltName: Full=Tripeptidyl-peptidase 
II; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AAF79897.1|AC022472_6 Contains similarity to p69c gene from Lycopersicon esculentum 
gb|Y17277 and is a member of subtilase family PF|00082. ESTs 
gb|T22485, gb|R65370, gb|AA651071 come from this gene [Arabidopsis 
thaliana]
 dbj|BAF00765.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE29945.1| Subtilisin-like serine endopeptidase family protein [Arabidopsis 
thaliana]
Length=769

 Score = 73.2 bits (178),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 36/54 (67%), Positives = 45/54 (83%), Gaps = 0/54 (0%)
 Frame = -2

Query  162  YISSTKNPLATILPTVTVTESKPAPAVAFFSSRGPSLASVNLLKPDICAPGVDI  1
            Y++STK+P+ATILPT TV +  PAPAVA+FSSRGPS  + ++LKPDI APGV I
Sbjct  465  YLNSTKDPVATILPTATVEKFTPAPAVAYFSSRGPSSLTRSILKPDITAPGVSI  518



>ref|XP_006416425.1| hypothetical protein EUTSA_v10006877mg [Eutrema salsugineum]
 gb|ESQ34778.1| hypothetical protein EUTSA_v10006877mg [Eutrema salsugineum]
Length=766

 Score = 73.2 bits (178),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 36/54 (67%), Positives = 46/54 (85%), Gaps = 0/54 (0%)
 Frame = -2

Query  162  YISSTKNPLATILPTVTVTESKPAPAVAFFSSRGPSLASVNLLKPDICAPGVDI  1
            Y++STK+P+ATILPTVTV +  PAP+VA+FSSRGPS  + ++LKPDI APGV I
Sbjct  462  YLNSTKDPVATILPTVTVEKFTPAPSVAYFSSRGPSSLTRSILKPDITAPGVAI  515



>ref|XP_011083454.1| PREDICTED: CO(2)-response secreted protease-like [Sesamum indicum]
Length=729

 Score = 72.8 bits (177),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 35/54 (65%), Positives = 39/54 (72%), Gaps = 0/54 (0%)
 Frame = -2

Query  162  YISSTKNPLATILPTVTVTESKPAPAVAFFSSRGPSLASVNLLKPDICAPGVDI  1
            YI S  NP+ATILPTV +   KPAP V +FSSRGP+    NLLKPDI APGV I
Sbjct  432  YIKSNSNPMATILPTVMIPNYKPAPVVGYFSSRGPTFGIKNLLKPDIAAPGVAI  485



>ref|XP_002893091.1| subtilase [Arabidopsis lyrata subsp. lyrata]
 gb|EFH69350.1| subtilase [Arabidopsis lyrata subsp. lyrata]
Length=730

 Score = 72.8 bits (177),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 36/54 (67%), Positives = 45/54 (83%), Gaps = 0/54 (0%)
 Frame = -2

Query  162  YISSTKNPLATILPTVTVTESKPAPAVAFFSSRGPSLASVNLLKPDICAPGVDI  1
            Y++STK+P+ATILPT TV +  PAPAVA+FSSRGPS  + ++LKPDI APGV I
Sbjct  426  YLNSTKDPVATILPTATVEKFTPAPAVAYFSSRGPSSLTRSILKPDITAPGVAI  479



>ref|XP_010498448.1| PREDICTED: CO(2)-response secreted protease-like [Camelina sativa]
Length=769

 Score = 72.8 bits (177),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 36/54 (67%), Positives = 45/54 (83%), Gaps = 0/54 (0%)
 Frame = -2

Query  162  YISSTKNPLATILPTVTVTESKPAPAVAFFSSRGPSLASVNLLKPDICAPGVDI  1
            Y++STK+P+ATILPTVTV +  PAP VA+FSSRGPS  + ++LKPDI APGV I
Sbjct  465  YLNSTKDPVATILPTVTVEKFTPAPTVAYFSSRGPSSLTRSILKPDITAPGVAI  518



>ref|XP_006306824.1| hypothetical protein CARUB_v10008367mg [Capsella rubella]
 gb|EOA39722.1| hypothetical protein CARUB_v10008367mg [Capsella rubella]
Length=770

 Score = 72.4 bits (176),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 36/54 (67%), Positives = 45/54 (83%), Gaps = 0/54 (0%)
 Frame = -2

Query  162  YISSTKNPLATILPTVTVTESKPAPAVAFFSSRGPSLASVNLLKPDICAPGVDI  1
            Y++STK+P+ATILPT TV +  PAPAVA+FSSRGPS  + ++LKPDI APGV I
Sbjct  466  YLNSTKDPVATILPTATVEKFTPAPAVAYFSSRGPSSLTRSILKPDITAPGVAI  519



>gb|KFK44143.1| hypothetical protein AALP_AA1G220600 [Arabis alpina]
Length=773

 Score = 72.4 bits (176),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 35/54 (65%), Positives = 46/54 (85%), Gaps = 0/54 (0%)
 Frame = -2

Query  162  YISSTKNPLATILPTVTVTESKPAPAVAFFSSRGPSLASVNLLKPDICAPGVDI  1
            Y++STK+P+ATILPTVTV +  PAP++A+FSSRGPS  + ++LKPDI APGV I
Sbjct  469  YLNSTKDPVATILPTVTVEKFTPAPSIAYFSSRGPSSITRSILKPDITAPGVAI  522



>ref|XP_002273703.1| PREDICTED: CO(2)-response secreted protease [Vitis vinifera]
 emb|CBI29159.3| unnamed protein product [Vitis vinifera]
Length=777

 Score = 72.4 bits (176),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 37/54 (69%), Positives = 41/54 (76%), Gaps = 0/54 (0%)
 Frame = -2

Query  162  YISSTKNPLATILPTVTVTESKPAPAVAFFSSRGPSLASVNLLKPDICAPGVDI  1
            YI+STKNP ATILPT  V   +PAP VAFFSSRGP   + N+LKPDI APGV I
Sbjct  480  YINSTKNPTATILPTKEVPRIRPAPVVAFFSSRGPGGLTENILKPDIMAPGVAI  533



>ref|XP_009619450.1| PREDICTED: subtilisin-like protease isoform X2 [Nicotiana tomentosiformis]
Length=760

 Score = 72.4 bits (176),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 36/54 (67%), Positives = 43/54 (80%), Gaps = 0/54 (0%)
 Frame = -2

Query  162  YISSTKNPLATILPTVTVTESKPAPAVAFFSSRGPSLASVNLLKPDICAPGVDI  1
            YI ST+NP+A+ILPTV+ T+ KPAP V +FSSRGP   + NLLKPDI APGV I
Sbjct  470  YIKSTRNPVASILPTVSTTKYKPAPVVPYFSSRGPVENTPNLLKPDITAPGVTI  523



>ref|XP_004514295.1| PREDICTED: subtilisin-like protease-like [Cicer arietinum]
Length=769

 Score = 72.0 bits (175),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 36/54 (67%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  162  YISSTKNPLATILPTVTVTESKPAPAVAFFSSRGPSLASVNLLKPDICAPGVDI  1
            YI+STKNP ATILPT+ V   +PAP VA FSSRGPS  + N+LKPD+ APGV I
Sbjct  472  YINSTKNPTATILPTIEVPRYRPAPIVASFSSRGPSSLTENILKPDVMAPGVSI  525



>ref|XP_007133571.1| hypothetical protein PHAVU_011G190300g, partial [Phaseolus vulgaris]
 gb|ESW05565.1| hypothetical protein PHAVU_011G190300g, partial [Phaseolus vulgaris]
Length=678

 Score = 71.6 bits (174),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 36/54 (67%), Positives = 41/54 (76%), Gaps = 0/54 (0%)
 Frame = -2

Query  162  YISSTKNPLATILPTVTVTESKPAPAVAFFSSRGPSLASVNLLKPDICAPGVDI  1
            YI+STKNP ATILPT  V   KP+P VA FSSRGPS  + N+LKPDI APG+ I
Sbjct  380  YINSTKNPTATILPTAEVARYKPSPIVASFSSRGPSSLTENILKPDIMAPGIGI  433



>gb|AES74035.2| subtilisin-like serine protease [Medicago truncatula]
Length=423

 Score = 70.9 bits (172),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 36/53 (68%), Positives = 40/53 (75%), Gaps = 0/53 (0%)
 Frame = -2

Query  159  ISSTKNPLATILPTVTVTESKPAPAVAFFSSRGPSLASVNLLKPDICAPGVDI  1
            I    NP+ATILPTVT+ + KPAP VA FSSRGPS  S N+LKPDI APGV I
Sbjct  169  IQQGNNPVATILPTVTIIDYKPAPMVATFSSRGPSALSRNILKPDIAAPGVAI  221



>gb|KHN10158.1| Subtilisin-like protease [Glycine soja]
Length=721

 Score = 71.6 bits (174),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 36/54 (67%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  162  YISSTKNPLATILPTVTVTESKPAPAVAFFSSRGPSLASVNLLKPDICAPGVDI  1
            YI+STKNP ATILPT  V+  KP+P VA FSSRGPS  + N+LKPD+ APGV I
Sbjct  423  YINSTKNPTATILPTTEVSRLKPSPIVASFSSRGPSSLTENVLKPDVMAPGVGI  476



>ref|XP_003603784.1| Subtilisin-like serine protease [Medicago truncatula]
Length=569

 Score = 71.2 bits (173),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 36/53 (68%), Positives = 40/53 (75%), Gaps = 0/53 (0%)
 Frame = -2

Query  159  ISSTKNPLATILPTVTVTESKPAPAVAFFSSRGPSLASVNLLKPDICAPGVDI  1
            I    NP+ATILPTVT+ + KPAP VA FSSRGPS  S N+LKPDI APGV I
Sbjct  315  IQQGNNPVATILPTVTIIDYKPAPMVATFSSRGPSALSRNILKPDIAAPGVAI  367



>ref|XP_004164801.1| PREDICTED: cucumisin-like [Cucumis sativus]
Length=777

 Score = 71.6 bits (174),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 31/54 (57%), Positives = 45/54 (83%), Gaps = 0/54 (0%)
 Frame = -2

Query  162  YISSTKNPLATILPTVTVTESKPAPAVAFFSSRGPSLASVNLLKPDICAPGVDI  1
            Y++S++ P+AT+LPT T+   KPAPA+ +FSSRGP+ A +N++KPDI APGV+I
Sbjct  474  YVNSSRKPVATVLPTETIINYKPAPAITYFSSRGPNPAVLNIIKPDISAPGVNI  527



>ref|XP_007136108.1| hypothetical protein PHAVU_009G018500g [Phaseolus vulgaris]
 gb|ESW08102.1| hypothetical protein PHAVU_009G018500g [Phaseolus vulgaris]
Length=768

 Score = 71.2 bits (173),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 36/54 (67%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  162  YISSTKNPLATILPTVTVTESKPAPAVAFFSSRGPSLASVNLLKPDICAPGVDI  1
            YI+ST NP+AT+  TVTV + KPAP V  FSSRGPS  S N+LKPDI APGV+I
Sbjct  472  YINSTSNPMATVQKTVTVFDIKPAPMVVDFSSRGPSRLSSNILKPDIAAPGVNI  525



>ref|XP_003545787.1| PREDICTED: subtilisin-like protease-like [Glycine max]
Length=777

 Score = 71.2 bits (173),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 36/54 (67%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  162  YISSTKNPLATILPTVTVTESKPAPAVAFFSSRGPSLASVNLLKPDICAPGVDI  1
            YI+STKNP ATILPT  V+  KP+P VA FSSRGPS  + N+LKPD+ APGV I
Sbjct  479  YINSTKNPTATILPTTEVSRLKPSPIVASFSSRGPSSLTENVLKPDVMAPGVGI  532



>gb|KEH36679.1| subtilisin-like serine protease [Medicago truncatula]
Length=785

 Score = 71.2 bits (173),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 33/54 (61%), Positives = 43/54 (80%), Gaps = 0/54 (0%)
 Frame = -2

Query  162  YISSTKNPLATILPTVTVTESKPAPAVAFFSSRGPSLASVNLLKPDICAPGVDI  1
            YI S+ NP+A +LP  TV ++KPAP++A FSSRGP++   N+LKPDI APGVDI
Sbjct  490  YIHSSPNPMAQLLPGRTVLDTKPAPSMAMFSSRGPNIIDPNILKPDITAPGVDI  543



>gb|AIC80766.1| subtilase [Cicer arietinum]
Length=773

 Score = 71.2 bits (173),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 33/54 (61%), Positives = 43/54 (80%), Gaps = 0/54 (0%)
 Frame = -2

Query  162  YISSTKNPLATILPTVTVTESKPAPAVAFFSSRGPSLASVNLLKPDICAPGVDI  1
            YI S+ NP+A +LP  TV +SKPAP++A F+SRGP++   N+LKPDI APGVDI
Sbjct  478  YIHSSPNPMAQLLPGTTVLDSKPAPSMAVFTSRGPNIIDPNILKPDITAPGVDI  531



>ref|XP_004136374.1| PREDICTED: subtilisin-like protease-like [Cucumis sativus]
 gb|KGN60051.1| hypothetical protein Csa_3G873800 [Cucumis sativus]
Length=772

 Score = 71.2 bits (173),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 31/54 (57%), Positives = 45/54 (83%), Gaps = 0/54 (0%)
 Frame = -2

Query  162  YISSTKNPLATILPTVTVTESKPAPAVAFFSSRGPSLASVNLLKPDICAPGVDI  1
            Y++S++ P+AT+LPT T+   KPAPA+ +FSSRGP+ A +N++KPDI APGV+I
Sbjct  469  YVNSSRKPVATVLPTETIINYKPAPAITYFSSRGPNPAVLNIIKPDISAPGVNI  522



>ref|XP_004486283.1| PREDICTED: subtilisin-like protease-like [Cicer arietinum]
Length=786

 Score = 71.2 bits (173),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 33/54 (61%), Positives = 43/54 (80%), Gaps = 0/54 (0%)
 Frame = -2

Query  162  YISSTKNPLATILPTVTVTESKPAPAVAFFSSRGPSLASVNLLKPDICAPGVDI  1
            YI S+ NP+A +LP  TV +SKPAP++A F+SRGP++   N+LKPDI APGVDI
Sbjct  491  YIHSSPNPMAQLLPGTTVLDSKPAPSMAVFTSRGPNIIDPNILKPDITAPGVDI  544



>ref|XP_010477246.1| PREDICTED: CO(2)-response secreted protease isoform X1 [Camelina 
sativa]
Length=807

 Score = 70.9 bits (172),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 35/54 (65%), Positives = 44/54 (81%), Gaps = 0/54 (0%)
 Frame = -2

Query  162  YISSTKNPLATILPTVTVTESKPAPAVAFFSSRGPSLASVNLLKPDICAPGVDI  1
            Y++STK+P+ATILPT TV +  PAP VA+FSSRGPS  + ++LKPDI APGV I
Sbjct  503  YLNSTKDPVATILPTATVEKFTPAPTVAYFSSRGPSSLTRSILKPDITAPGVAI  556



>ref|XP_010477247.1| PREDICTED: CO(2)-response secreted protease isoform X2 [Camelina 
sativa]
Length=784

 Score = 70.9 bits (172),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 35/54 (65%), Positives = 44/54 (81%), Gaps = 0/54 (0%)
 Frame = -2

Query  162  YISSTKNPLATILPTVTVTESKPAPAVAFFSSRGPSLASVNLLKPDICAPGVDI  1
            Y++STK+P+ATILPT TV +  PAP VA+FSSRGPS  + ++LKPDI APGV I
Sbjct  480  YLNSTKDPVATILPTATVEKFTPAPTVAYFSSRGPSSLTRSILKPDITAPGVAI  533



>gb|KEH36678.1| subtilisin-like serine protease [Medicago truncatula]
Length=786

 Score = 70.9 bits (172),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 33/54 (61%), Positives = 43/54 (80%), Gaps = 0/54 (0%)
 Frame = -2

Query  162  YISSTKNPLATILPTVTVTESKPAPAVAFFSSRGPSLASVNLLKPDICAPGVDI  1
            YI S+ NP+A +LP  TV ++KPAP++A FSSRGP++   N+LKPDI APGVDI
Sbjct  491  YIHSSPNPMAQLLPGRTVLDTKPAPSMAIFSSRGPNIIDPNILKPDITAPGVDI  544



>ref|XP_002525580.1| Xylem serine proteinase 1 precursor, putative [Ricinus communis]
 gb|EEF36839.1| Xylem serine proteinase 1 precursor, putative [Ricinus communis]
Length=777

 Score = 70.5 bits (171),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 35/54 (65%), Positives = 41/54 (76%), Gaps = 0/54 (0%)
 Frame = -2

Query  162  YISSTKNPLATILPTVTVTESKPAPAVAFFSSRGPSLASVNLLKPDICAPGVDI  1
            YI+STK P ATILP V V   +PAP VA+FSSRGP+  + N+LKPDI APGV I
Sbjct  480  YINSTKKPTATILPAVDVPRYRPAPVVAYFSSRGPAQLTENILKPDIMAPGVAI  533



>gb|KHG24601.1| Cucumisin [Gossypium arboreum]
Length=768

 Score = 70.5 bits (171),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 35/54 (65%), Positives = 43/54 (80%), Gaps = 0/54 (0%)
 Frame = -2

Query  162  YISSTKNPLATILPTVTVTESKPAPAVAFFSSRGPSLASVNLLKPDICAPGVDI  1
            YI+STKNP+ATIL T + T+  PAP +A+FSSRGPS    N+LKPDI APGV+I
Sbjct  466  YINSTKNPVATILRTTSPTKYTPAPIIAYFSSRGPSTIPENILKPDIAAPGVNI  519



>ref|XP_007213640.1| hypothetical protein PRUPE_ppa001689mg [Prunus persica]
 gb|EMJ14839.1| hypothetical protein PRUPE_ppa001689mg [Prunus persica]
Length=779

 Score = 70.5 bits (171),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 33/54 (61%), Positives = 44/54 (81%), Gaps = 0/54 (0%)
 Frame = -2

Query  162  YISSTKNPLATILPTVTVTESKPAPAVAFFSSRGPSLASVNLLKPDICAPGVDI  1
            YI+STK+P+ATI+P  TV  +KPAP +A FSSRGP++   N+LKPDI APG++I
Sbjct  485  YINSTKHPIATIIPARTVLHTKPAPFMASFSSRGPNVIDSNILKPDITAPGLNI  538



>gb|KEH19202.1| subtilisin-like serine protease [Medicago truncatula]
Length=760

 Score = 69.7 bits (169),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 35/54 (65%), Positives = 40/54 (74%), Gaps = 0/54 (0%)
 Frame = -2

Query  162  YISSTKNPLATILPTVTVTESKPAPAVAFFSSRGPSLASVNLLKPDICAPGVDI  1
            YI STK P ATILPT  V+  +PAP VA FSSRGPS  + N+LKPD+ APGV I
Sbjct  466  YIKSTKKPTATILPTTVVSRYRPAPIVASFSSRGPSSLTENILKPDVMAPGVSI  519



>ref|XP_003603806.1| Subtilisin-like serine protease [Medicago truncatula]
Length=641

 Score = 69.7 bits (169),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 35/51 (69%), Positives = 40/51 (78%), Gaps = 0/51 (0%)
 Frame = -2

Query  153  STKNPLATILPTVTVTESKPAPAVAFFSSRGPSLASVNLLKPDICAPGVDI  1
            ++ NP+ATIL T+TV   KPAP VAFFSSRGPS  S N+LKPDI APGV I
Sbjct  530  ASDNPVATILATITVVGYKPAPMVAFFSSRGPSTLSKNILKPDIAAPGVAI  580



>gb|KEH19203.1| subtilisin-like serine protease [Medicago truncatula]
Length=636

 Score = 69.7 bits (169),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 35/54 (65%), Positives = 40/54 (74%), Gaps = 0/54 (0%)
 Frame = -2

Query  162  YISSTKNPLATILPTVTVTESKPAPAVAFFSSRGPSLASVNLLKPDICAPGVDI  1
            YI STK P ATILPT  V+  +PAP VA FSSRGPS  + N+LKPD+ APGV I
Sbjct  342  YIKSTKKPTATILPTTVVSRYRPAPIVASFSSRGPSSLTENILKPDVMAPGVSI  395



>ref|XP_010251788.1| PREDICTED: CO(2)-response secreted protease-like [Nelumbo nucifera]
Length=776

 Score = 69.7 bits (169),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 34/54 (63%), Positives = 41/54 (76%), Gaps = 0/54 (0%)
 Frame = -2

Query  162  YISSTKNPLATILPTVTVTESKPAPAVAFFSSRGPSLASVNLLKPDICAPGVDI  1
            YI+STKNP ATILPTV V   +PAP VA+FSSRGP   +  +LKPD+ APG+ I
Sbjct  479  YINSTKNPTATILPTVHVPGVRPAPVVAYFSSRGPGGITETILKPDVTAPGIGI  532



>ref|XP_011074702.1| PREDICTED: CO(2)-response secreted protease-like isoform X2 [Sesamum 
indicum]
Length=733

 Score = 69.7 bits (169),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 34/54 (63%), Positives = 40/54 (74%), Gaps = 0/54 (0%)
 Frame = -2

Query  162  YISSTKNPLATILPTVTVTESKPAPAVAFFSSRGPSLASVNLLKPDICAPGVDI  1
            YI+S+ NP+ATILPTV +   KPAP VA FSSRGP     NL+KPDI APG +I
Sbjct  430  YINSSSNPVATILPTVVIPNYKPAPVVALFSSRGPVFGVGNLIKPDITAPGQNI  483



>ref|XP_006652630.1| PREDICTED: subtilisin-like protease-like [Oryza brachyantha]
Length=746

 Score = 69.7 bits (169),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 33/54 (61%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  162  YISSTKNPLATILPTVTVTESKPAPAVAFFSSRGPSLASVNLLKPDICAPGVDI  1
            YI+ST NP+A ILP  T+  + PAPA+AFFSSRGPS+ S  +LKPDI  PGV++
Sbjct  447  YINSTANPVAQILPRGTILGTTPAPAMAFFSSRGPSVQSPGILKPDITGPGVNV  500



>ref|XP_011074701.1| PREDICTED: CO(2)-response secreted protease-like isoform X1 [Sesamum 
indicum]
Length=762

 Score = 69.7 bits (169),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 34/54 (63%), Positives = 40/54 (74%), Gaps = 0/54 (0%)
 Frame = -2

Query  162  YISSTKNPLATILPTVTVTESKPAPAVAFFSSRGPSLASVNLLKPDICAPGVDI  1
            YI+S+ NP+ATILPTV +   KPAP VA FSSRGP     NL+KPDI APG +I
Sbjct  459  YINSSSNPVATILPTVVIPNYKPAPVVALFSSRGPVFGVGNLIKPDITAPGQNI  512



>gb|EAY95140.1| hypothetical protein OsI_16958 [Oryza sativa Indica Group]
Length=760

 Score = 68.9 bits (167),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 33/54 (61%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  162  YISSTKNPLATILPTVTVTESKPAPAVAFFSSRGPSLASVNLLKPDICAPGVDI  1
            YI+ST NP+A ILP  TV  + PAPA+AFFSSRGPS+ +  +LKPDI  PGV++
Sbjct  463  YINSTANPVAQILPRGTVLGTTPAPAMAFFSSRGPSVQNPGILKPDITGPGVNV  516



>emb|CAH68048.1| B0103C08-B0602B01.5 [Oryza sativa Indica Group]
Length=760

 Score = 68.9 bits (167),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 33/54 (61%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  162  YISSTKNPLATILPTVTVTESKPAPAVAFFSSRGPSLASVNLLKPDICAPGVDI  1
            YI+ST NP+A ILP  TV  + PAPA+AFFSSRGPS+ +  +LKPDI  PGV++
Sbjct  463  YINSTANPVAQILPRGTVLGTTPAPAMAFFSSRGPSVQNPGILKPDITGPGVNV  516



>ref|NP_001053537.1| Os04g0559000 [Oryza sativa Japonica Group]
 emb|CAE03488.2| OSJNBa0065O17.13 [Oryza sativa Japonica Group]
 dbj|BAF15451.1| Os04g0559000 [Oryza sativa Japonica Group]
 gb|EAZ31611.1| hypothetical protein OsJ_15755 [Oryza sativa Japonica Group]
Length=760

 Score = 68.9 bits (167),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 33/54 (61%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  162  YISSTKNPLATILPTVTVTESKPAPAVAFFSSRGPSLASVNLLKPDICAPGVDI  1
            YI+ST NP+A ILP  TV  + PAPA+AFFSSRGPS+ +  +LKPDI  PGV++
Sbjct  463  YINSTANPVAQILPRGTVLGTTPAPAMAFFSSRGPSVQNPGILKPDITGPGVNV  516



>ref|XP_008225402.1| PREDICTED: subtilisin-like protease [Prunus mume]
Length=780

 Score = 68.9 bits (167),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 33/54 (61%), Positives = 43/54 (80%), Gaps = 0/54 (0%)
 Frame = -2

Query  162  YISSTKNPLATILPTVTVTESKPAPAVAFFSSRGPSLASVNLLKPDICAPGVDI  1
            YI STK+P+ATI+P  TV  +KPAP +A FSSRGP++   N+LKPDI APG++I
Sbjct  486  YIKSTKHPIATIIPARTVLHTKPAPFMASFSSRGPNVIDPNILKPDITAPGLNI  539



>ref|XP_002303965.2| hypothetical protein POPTR_0003s18830g [Populus trichocarpa]
 gb|EEE78944.2| hypothetical protein POPTR_0003s18830g [Populus trichocarpa]
Length=646

 Score = 68.6 bits (166),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 34/54 (63%), Positives = 39/54 (72%), Gaps = 0/54 (0%)
 Frame = -2

Query  162  YISSTKNPLATILPTVTVTESKPAPAVAFFSSRGPSLASVNLLKPDICAPGVDI  1
            YI+ TK P ATILPT  V   +PAP VA+FSSRGP   + N+LKPDI APGV I
Sbjct  349  YINGTKKPTATILPTRDVPRYRPAPTVAYFSSRGPGQYTENILKPDIMAPGVAI  402



>ref|XP_004134922.1| PREDICTED: subtilisin-like protease-like [Cucumis sativus]
 ref|XP_004169531.1| PREDICTED: subtilisin-like protease-like [Cucumis sativus]
 gb|KGN49345.1| hypothetical protein Csa_6G520430 [Cucumis sativus]
Length=791

 Score = 68.9 bits (167),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 35/54 (65%), Positives = 41/54 (76%), Gaps = 0/54 (0%)
 Frame = -2

Query  162  YISSTKNPLATILPTVTVTESKPAPAVAFFSSRGPSLASVNLLKPDICAPGVDI  1
            YI S KNP ATI+P VT+  S+PAPA+A FSSRGP+    + LKPDI APGVDI
Sbjct  491  YIKSRKNPTATIVPPVTIYGSRPAPAMANFSSRGPNPIDPHFLKPDITAPGVDI  544



>ref|XP_007136109.1| hypothetical protein PHAVU_009G018600g [Phaseolus vulgaris]
 gb|ESW08103.1| hypothetical protein PHAVU_009G018600g [Phaseolus vulgaris]
Length=768

 Score = 68.6 bits (166),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 37/54 (69%), Positives = 43/54 (80%), Gaps = 1/54 (2%)
 Frame = -2

Query  162  YISSTKNPLATILPTVTVTESKPAPAVAFFSSRGPSLASVNLLKPDICAPGVDI  1
            YI+S+ NP+ATILPT TV + KPAP V  FSSRGPS  S N+LKPDI APGV+I
Sbjct  470  YINSS-NPVATILPTTTVVDYKPAPLVPDFSSRGPSTLSSNILKPDIAAPGVNI  522



>ref|XP_010273518.1| PREDICTED: subtilisin-like protease SBT5.4 [Nelumbo nucifera]
Length=779

 Score = 68.6 bits (166),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 32/54 (59%), Positives = 43/54 (80%), Gaps = 0/54 (0%)
 Frame = -2

Query  162  YISSTKNPLATILPTVTVTESKPAPAVAFFSSRGPSLASVNLLKPDICAPGVDI  1
            YI+STKNP A ++P +TV   KPAP++A FSSRGP++   N+LKPDI APG++I
Sbjct  484  YINSTKNPTAKVVPGMTVINVKPAPSMASFSSRGPNVIEPNILKPDITAPGINI  537



>ref|XP_010692513.1| PREDICTED: CO(2)-response secreted protease [Beta vulgaris subsp. 
vulgaris]
Length=760

 Score = 68.6 bits (166),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 31/54 (57%), Positives = 44/54 (81%), Gaps = 0/54 (0%)
 Frame = -2

Query  162  YISSTKNPLATILPTVTVTESKPAPAVAFFSSRGPSLASVNLLKPDICAPGVDI  1
            Y+++T+N +ATIL T T+ + +PAP VA+FS+RGPS ++ N+LKPDI APGV I
Sbjct  459  YVNATENSVATILATKTIQKFQPAPTVAYFSARGPSTSTKNILKPDISAPGVSI  512



>gb|KEH19205.1| subtilisin-like serine protease [Medicago truncatula]
Length=766

 Score = 68.6 bits (166),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 34/54 (63%), Positives = 41/54 (76%), Gaps = 0/54 (0%)
 Frame = -2

Query  162  YISSTKNPLATILPTVTVTESKPAPAVAFFSSRGPSLASVNLLKPDICAPGVDI  1
            YI+STK P ATILPT+ +   +PAP VA FSSRGPS  + N+LKPD+ APGV I
Sbjct  469  YINSTKKPTATILPTIEIPRYRPAPIVASFSSRGPSSLTENILKPDVMAPGVAI  522



>ref|XP_010091321.1| Subtilisin-like protease [Morus notabilis]
 gb|EXB44295.1| Subtilisin-like protease [Morus notabilis]
Length=919

 Score = 68.6 bits (166),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 33/54 (61%), Positives = 40/54 (74%), Gaps = 0/54 (0%)
 Frame = -2

Query  162  YISSTKNPLATILPTVTVTESKPAPAVAFFSSRGPSLASVNLLKPDICAPGVDI  1
            Y++STK P A ILP V V   +PAP VA+FSSRGP+  + N+LKPDI APGV I
Sbjct  445  YLNSTKKPTAAILPAVEVLRYRPAPVVAYFSSRGPAQLTENILKPDIMAPGVAI  498



>gb|KEH19206.1| subtilisin-like serine protease [Medicago truncatula]
Length=671

 Score = 68.2 bits (165),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 34/54 (63%), Positives = 41/54 (76%), Gaps = 0/54 (0%)
 Frame = -2

Query  162  YISSTKNPLATILPTVTVTESKPAPAVAFFSSRGPSLASVNLLKPDICAPGVDI  1
            YI+STK P ATILPT+ +   +PAP VA FSSRGPS  + N+LKPD+ APGV I
Sbjct  469  YINSTKKPTATILPTIEIPRYRPAPIVASFSSRGPSSLTENILKPDVMAPGVAI  522



>ref|XP_004309900.1| PREDICTED: subtilisin-like protease-like [Fragaria vesca subsp. 
vesca]
Length=778

 Score = 68.2 bits (165),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 33/54 (61%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  162  YISSTKNPLATILPTVTVTESKPAPAVAFFSSRGPSLASVNLLKPDICAPGVDI  1
            YI+STKNP ATI+P  TV  +KPAP +  F+SRGPS+   N+LKPDI APG++I
Sbjct  486  YINSTKNPEATIIPARTVLHTKPAPYMTAFTSRGPSVIDPNILKPDITAPGLNI  539



>ref|XP_009771512.1| PREDICTED: subtilisin-like protease, partial [Nicotiana sylvestris]
Length=453

 Score = 67.4 bits (163),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 33/54 (61%), Positives = 40/54 (74%), Gaps = 0/54 (0%)
 Frame = -2

Query  162  YISSTKNPLATILPTVTVTESKPAPAVAFFSSRGPSLASVNLLKPDICAPGVDI  1
            YI+S++NPLATI P   +   KPAP VA FSSRGP+  + N+LKPDI APGV I
Sbjct  145  YINSSQNPLATIFPANEIRSFKPAPVVADFSSRGPATLTENILKPDISAPGVGI  198



>ref|XP_009607188.1| PREDICTED: subtilisin-like protease SBT5.3 [Nicotiana tomentosiformis]
Length=792

 Score = 67.8 bits (164),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 33/54 (61%), Positives = 40/54 (74%), Gaps = 0/54 (0%)
 Frame = -2

Query  162  YISSTKNPLATILPTVTVTESKPAPAVAFFSSRGPSLASVNLLKPDICAPGVDI  1
            YI+S++NPLATI P   +   KPAP VA FSSRGP+  + N+LKPDI APGV I
Sbjct  485  YINSSQNPLATIFPANEIRRFKPAPVVADFSSRGPATLTENILKPDISAPGVGI  538



>gb|KDP40601.1| hypothetical protein JCGZ_24600 [Jatropha curcas]
Length=765

 Score = 67.4 bits (163),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 33/54 (61%), Positives = 40/54 (74%), Gaps = 0/54 (0%)
 Frame = -2

Query  162  YISSTKNPLATILPTVTVTESKPAPAVAFFSSRGPSLASVNLLKPDICAPGVDI  1
            YI STK P ATILP+V V   +P+P VA+FSSRGP   + N+LKPDI APG +I
Sbjct  458  YIKSTKKPKATILPSVDVLGVRPSPVVAYFSSRGPGNLTENILKPDIMAPGQEI  511



>ref|XP_009408716.1| PREDICTED: subtilisin-like protease SBT5.3 [Musa acuminata subsp. 
malaccensis]
Length=767

 Score = 67.4 bits (163),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 35/54 (65%), Positives = 41/54 (76%), Gaps = 0/54 (0%)
 Frame = -2

Query  162  YISSTKNPLATILPTVTVTESKPAPAVAFFSSRGPSLASVNLLKPDICAPGVDI  1
            Y+ STK+P ATI P  TV   KPAPA+A FSSRGP+L +  +LKPDI APGVDI
Sbjct  473  YLKSTKSPTATISPVTTVLGVKPAPAMASFSSRGPNLINPEILKPDITAPGVDI  526



>ref|XP_007147961.1| hypothetical protein PHAVU_006G168800g [Phaseolus vulgaris]
 gb|ESW19955.1| hypothetical protein PHAVU_006G168800g [Phaseolus vulgaris]
Length=787

 Score = 67.4 bits (163),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 32/54 (59%), Positives = 40/54 (74%), Gaps = 0/54 (0%)
 Frame = -2

Query  162  YISSTKNPLATILPTVTVTESKPAPAVAFFSSRGPSLASVNLLKPDICAPGVDI  1
            YI ST NP+   LP  TV +++PAP +A FSSRGP++   N+LKPDI APGVDI
Sbjct  492  YIHSTPNPMVRFLPGKTVLKTRPAPFMASFSSRGPNIIDHNILKPDITAPGVDI  545



>gb|KHN45945.1| Subtilisin-like protease [Glycine soja]
Length=510

 Score = 67.0 bits (162),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 32/54 (59%), Positives = 44/54 (81%), Gaps = 0/54 (0%)
 Frame = -2

Query  162  YISSTKNPLATILPTVTVTESKPAPAVAFFSSRGPSLASVNLLKPDICAPGVDI  1
            Y++ST NP+ATILPTV+V + KPAP +  F+++GPS  S N+LKP+I APGV+I
Sbjct  268  YVNSTSNPVATILPTVSVIDFKPAPMMPSFAAKGPSAISKNILKPEITAPGVNI  321



>ref|XP_003567246.1| PREDICTED: CO(2)-response secreted protease-like [Brachypodium 
distachyon]
Length=779

 Score = 67.4 bits (163),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 34/54 (63%), Positives = 40/54 (74%), Gaps = 0/54 (0%)
 Frame = -2

Query  162  YISSTKNPLATILPTVTVTESKPAPAVAFFSSRGPSLASVNLLKPDICAPGVDI  1
            YI+STKNP A ILPT  V E KPAP VA FS+RGP   + ++LKPD+ APGV I
Sbjct  479  YINSTKNPTAVILPTEDVNEFKPAPTVASFSARGPGGLTESILKPDLMAPGVSI  532



>ref|XP_011085840.1| PREDICTED: CO(2)-response secreted protease-like [Sesamum indicum]
Length=767

 Score = 67.4 bits (163),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 34/54 (63%), Positives = 40/54 (74%), Gaps = 0/54 (0%)
 Frame = -2

Query  162  YISSTKNPLATILPTVTVTESKPAPAVAFFSSRGPSLASVNLLKPDICAPGVDI  1
            YI+ST NP+ATILP+  +   KPAP VA FSSRGP   + N+LKPDI APGV I
Sbjct  470  YINSTWNPVATILPSSEIRNFKPAPVVASFSSRGPGALTENILKPDIMAPGVAI  523



>ref|XP_007025242.1| Subtilase family protein, putative isoform 1 [Theobroma cacao]
 gb|EOY27864.1| Subtilase family protein, putative isoform 1 [Theobroma cacao]
Length=780

 Score = 67.0 bits (162),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 31/54 (57%), Positives = 41/54 (76%), Gaps = 0/54 (0%)
 Frame = -2

Query  162  YISSTKNPLATILPTVTVTESKPAPAVAFFSSRGPSLASVNLLKPDICAPGVDI  1
            YI ST+NP+ATI P  TV   KPAP +A F+S+GP++  +N+LKPDI APG+ I
Sbjct  489  YIRSTENPMATISPAQTVMHYKPAPFMAGFTSQGPNVIDLNILKPDITAPGIQI  542



>ref|XP_004295413.1| PREDICTED: subtilisin-like protease-like [Fragaria vesca subsp. 
vesca]
Length=780

 Score = 67.0 bits (162),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 32/54 (59%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  162  YISSTKNPLATILPTVTVTESKPAPAVAFFSSRGPSLASVNLLKPDICAPGVDI  1
            YI+ST+NP ATI+P  TV  +KPAP +  F+SRGPS+   N+LKPDI APG++I
Sbjct  487  YINSTENPEATIIPARTVLHTKPAPYMTAFTSRGPSVIDPNILKPDITAPGLNI  540



>ref|XP_011020517.1| PREDICTED: CO(2)-response secreted protease-like [Populus euphratica]
Length=788

 Score = 67.0 bits (162),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 33/54 (61%), Positives = 38/54 (70%), Gaps = 0/54 (0%)
 Frame = -2

Query  162  YISSTKNPLATILPTVTVTESKPAPAVAFFSSRGPSLASVNLLKPDICAPGVDI  1
            YI+ TK P ATILP   V   +PAP VA+FSSRGP   + N+LKPDI APGV I
Sbjct  491  YINGTKKPTATILPARDVPRYRPAPTVAYFSSRGPGQYTENILKPDIMAPGVAI  544



>gb|KFK32412.1| hypothetical protein AALP_AA6G238800 [Arabis alpina]
Length=706

 Score = 66.6 bits (161),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 35/54 (65%), Positives = 38/54 (70%), Gaps = 0/54 (0%)
 Frame = -2

Query  162  YISSTKNPLATILPTVTVTESKPAPAVAFFSSRGPSLASVNLLKPDICAPGVDI  1
            YI  TKNP  TI PTV V  SKPAP VA FSSRGP+  + N+LKPDI APG  I
Sbjct  410  YILHTKNPTVTIAPTVEVKRSKPAPVVAIFSSRGPASLTPNILKPDIMAPGALI  463



>ref|XP_002974964.1| hypothetical protein SELMODRAFT_415194 [Selaginella moellendorffii]
 gb|EFJ23749.1| hypothetical protein SELMODRAFT_415194 [Selaginella moellendorffii]
Length=761

 Score = 66.6 bits (161),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 34/54 (63%), Positives = 41/54 (76%), Gaps = 0/54 (0%)
 Frame = -2

Query  162  YISSTKNPLATILPTVTVTESKPAPAVAFFSSRGPSLASVNLLKPDICAPGVDI  1
            Y++ T +P+ATILPT TV   KPAPAVA FSSRGP+  +  +LKPDI APGV I
Sbjct  470  YLNQTSSPVATILPTKTVRNFKPAPAVAVFSSRGPNSVTPEILKPDITAPGVSI  523



>ref|XP_002977384.1| hypothetical protein SELMODRAFT_417382 [Selaginella moellendorffii]
 gb|EFJ21388.1| hypothetical protein SELMODRAFT_417382 [Selaginella moellendorffii]
Length=761

 Score = 66.6 bits (161),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 34/54 (63%), Positives = 41/54 (76%), Gaps = 0/54 (0%)
 Frame = -2

Query  162  YISSTKNPLATILPTVTVTESKPAPAVAFFSSRGPSLASVNLLKPDICAPGVDI  1
            Y++ T +P+ATILPT TV   KPAPAVA FSSRGP+  +  +LKPDI APGV I
Sbjct  470  YLNQTSSPVATILPTKTVRNFKPAPAVAVFSSRGPNSVTPEILKPDITAPGVSI  523



>ref|XP_010061088.1| PREDICTED: subtilisin-like protease SBT5.3 [Eucalyptus grandis]
 gb|KCW67983.1| hypothetical protein EUGRSUZ_F01673 [Eucalyptus grandis]
Length=767

 Score = 66.6 bits (161),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 30/54 (56%), Positives = 43/54 (80%), Gaps = 0/54 (0%)
 Frame = -2

Query  162  YISSTKNPLATILPTVTVTESKPAPAVAFFSSRGPSLASVNLLKPDICAPGVDI  1
            Y++S+ NP+A++L TV V   KPAP++A+FSSRGPS  + ++LKPD+ APGV I
Sbjct  465  YMNSSSNPVASVLATVAVANYKPAPSIAYFSSRGPSSITKDILKPDVTAPGVAI  518



>ref|XP_007025243.1| Subtilase family protein isoform 2 [Theobroma cacao]
 gb|EOY27865.1| Subtilase family protein isoform 2 [Theobroma cacao]
Length=754

 Score = 66.6 bits (161),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 31/54 (57%), Positives = 41/54 (76%), Gaps = 0/54 (0%)
 Frame = -2

Query  162  YISSTKNPLATILPTVTVTESKPAPAVAFFSSRGPSLASVNLLKPDICAPGVDI  1
            YI ST+NP+ATI P  TV   KPAP +A F+S+GP++  +N+LKPDI APG+ I
Sbjct  463  YIRSTENPMATISPAQTVMHYKPAPFMAGFTSQGPNVIDLNILKPDITAPGIQI  516



>ref|XP_004985590.1| PREDICTED: subtilisin-like protease-like [Setaria italica]
Length=748

 Score = 66.6 bits (161),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 31/54 (57%), Positives = 40/54 (74%), Gaps = 0/54 (0%)
 Frame = -2

Query  162  YISSTKNPLATILPTVTVTESKPAPAVAFFSSRGPSLASVNLLKPDICAPGVDI  1
            Y+SST NP A IL   T+  + PAP++AFFSSRGPSL +  +LKPDI  PGV++
Sbjct  450  YVSSTANPTAQILAGGTILGTSPAPSIAFFSSRGPSLQNPGILKPDITGPGVNV  503



>ref|XP_006857977.1| hypothetical protein AMTR_s00069p00178740 [Amborella trichopoda]
 gb|ERN19444.1| hypothetical protein AMTR_s00069p00178740 [Amborella trichopoda]
Length=773

 Score = 66.6 bits (161),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 35/54 (65%), Positives = 38/54 (70%), Gaps = 0/54 (0%)
 Frame = -2

Query  162  YISSTKNPLATILPTVTVTESKPAPAVAFFSSRGPSLASVNLLKPDICAPGVDI  1
            YI+STKNP ATIL   TV     AP VA FSSRGPS+ S  +LKPDI  PGVDI
Sbjct  469  YINSTKNPTATILFKGTVFGDTAAPEVAGFSSRGPSIQSFGILKPDIIGPGVDI  522



>ref|XP_010909887.1| PREDICTED: subtilisin-like protease SDD1 [Elaeis guineensis]
Length=771

 Score = 66.6 bits (161),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 31/54 (57%), Positives = 41/54 (76%), Gaps = 0/54 (0%)
 Frame = -2

Query  162  YISSTKNPLATILPTVTVTESKPAPAVAFFSSRGPSLASVNLLKPDICAPGVDI  1
            YI+S  NP+A+I    TV  + PAPAVA+FSSRGP++A  N+LKPDI  PGV++
Sbjct  478  YINSASNPMASITFKGTVIGTSPAPAVAYFSSRGPNVADRNILKPDIVGPGVNV  531



>ref|XP_009140769.1| PREDICTED: subtilisin-like protease SBT5.4 [Brassica rapa]
Length=760

 Score = 66.6 bits (161),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 33/54 (61%), Positives = 41/54 (76%), Gaps = 0/54 (0%)
 Frame = -2

Query  162  YISSTKNPLATILPTVTVTESKPAPAVAFFSSRGPSLASVNLLKPDICAPGVDI  1
            Y+  TK+P  TI+PTV V  +KPAP VAFFSSRGP+  + N+LKPD+ APGV I
Sbjct  465  YMLHTKSPTVTIVPTVEVKPTKPAPVVAFFSSRGPASLTENILKPDVMAPGVLI  518



>emb|CDY57477.1| BnaAnng14590D [Brassica napus]
Length=781

 Score = 66.2 bits (160),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 33/54 (61%), Positives = 41/54 (76%), Gaps = 0/54 (0%)
 Frame = -2

Query  162  YISSTKNPLATILPTVTVTESKPAPAVAFFSSRGPSLASVNLLKPDICAPGVDI  1
            Y+  TK+P  TI+PTV V  +KPAP VAFFSSRGP+  + N+LKPD+ APGV I
Sbjct  486  YMLHTKSPTVTIVPTVEVKPTKPAPVVAFFSSRGPASLTENILKPDVMAPGVLI  539



>ref|XP_008439697.1| PREDICTED: LOW QUALITY PROTEIN: subtilisin-like protease [Cucumis 
melo]
Length=793

 Score = 66.2 bits (160),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 34/54 (63%), Positives = 40/54 (74%), Gaps = 0/54 (0%)
 Frame = -2

Query  162  YISSTKNPLATILPTVTVTESKPAPAVAFFSSRGPSLASVNLLKPDICAPGVDI  1
            YI S  NP ATI+P VT+  S+PAPA+A FSSRGP+    + LKPDI APGVDI
Sbjct  492  YIKSRTNPTATIVPPVTIYGSRPAPAMANFSSRGPNPIDPHFLKPDITAPGVDI  545



>emb|CDP18817.1| unnamed protein product [Coffea canephora]
Length=771

 Score = 65.9 bits (159),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 34/54 (63%), Positives = 40/54 (74%), Gaps = 0/54 (0%)
 Frame = -2

Query  162  YISSTKNPLATILPTVTVTESKPAPAVAFFSSRGPSLASVNLLKPDICAPGVDI  1
            Y++STKNP ATILPT  V   KPAP +A FSSRGP   + ++LKPDI APGV I
Sbjct  474  YLNSTKNPTATILPTFEVPNFKPAPIIADFSSRGPGSLTEDILKPDIVAPGVAI  527



>ref|XP_010095116.1| Subtilisin-like protease [Morus notabilis]
 gb|EXB58282.1| Subtilisin-like protease [Morus notabilis]
Length=784

 Score = 65.9 bits (159),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 32/54 (59%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  162  YISSTKNPLATILPTVTVTESKPAPAVAFFSSRGPSLASVNLLKPDICAPGVDI  1
            YI+STK P A ILP +TV  +KPAP +A F+SRGP++   N+LKPDI APG++I
Sbjct  488  YINSTKWPRANILPGMTVLHTKPAPFMAAFTSRGPNVIEPNILKPDITAPGLNI  541



>ref|XP_009769237.1| PREDICTED: subtilisin-like protease isoform X1 [Nicotiana sylvestris]
Length=787

 Score = 65.9 bits (159),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 32/49 (65%), Positives = 40/49 (82%), Gaps = 0/49 (0%)
 Frame = -2

Query  147  KNPLATILPTVTVTESKPAPAVAFFSSRGPSLASVNLLKPDICAPGVDI  1
            +NP+A+ILPTV+ T+ KPAP V +FSSRGP+  + NLLKPDI APGV I
Sbjct  502  RNPVASILPTVSTTKYKPAPVVPYFSSRGPAGNTPNLLKPDITAPGVTI  550



>gb|KFK31539.1| hypothetical protein AALP_AA6G125500 [Arabis alpina]
Length=942

 Score = 65.9 bits (159),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 34/54 (63%), Positives = 40/54 (74%), Gaps = 0/54 (0%)
 Frame = -2

Query  162  YISSTKNPLATILPTVTVTESKPAPAVAFFSSRGPSLASVNLLKPDICAPGVDI  1
            Y+ + K P+A I P  TV +SKPAP VA FSSRGPSL   N+LKPDI APGV+I
Sbjct  137  YLKTDKKPIAFIKPGKTVYKSKPAPFVADFSSRGPSLLDPNILKPDITAPGVNI  190



>ref|XP_006398246.1| hypothetical protein EUTSA_v10000784mg [Eutrema salsugineum]
 gb|ESQ39699.1| hypothetical protein EUTSA_v10000784mg [Eutrema salsugineum]
Length=792

 Score = 65.9 bits (159),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 31/54 (57%), Positives = 40/54 (74%), Gaps = 0/54 (0%)
 Frame = -2

Query  162  YISSTKNPLATILPTVTVTESKPAPAVAFFSSRGPSLASVNLLKPDICAPGVDI  1
            YI + KNP+A I P  TV +++PAP +  FSSRGPSL   N+LKPDI APG++I
Sbjct  497  YIKTDKNPIAFIKPGTTVYKNQPAPLMTGFSSRGPSLIDANILKPDITAPGLNI  550



>ref|XP_004232973.1| PREDICTED: subtilisin-like protease SBT5.3 [Solanum lycopersicum]
Length=775

 Score = 65.5 bits (158),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 32/54 (59%), Positives = 43/54 (80%), Gaps = 0/54 (0%)
 Frame = -2

Query  162  YISSTKNPLATILPTVTVTESKPAPAVAFFSSRGPSLASVNLLKPDICAPGVDI  1
            YISSTK+P+A I+P  TV  +KPAP +A F+SRGPS  + ++LKPDI APG++I
Sbjct  483  YISSTKSPVAYIIPAKTVLHAKPAPYMASFTSRGPSAVAPDILKPDITAPGLNI  536



>ref|XP_006347851.1| PREDICTED: subtilisin-like protease-like [Solanum tuberosum]
Length=774

 Score = 65.5 bits (158),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 32/54 (59%), Positives = 39/54 (72%), Gaps = 0/54 (0%)
 Frame = -2

Query  162  YISSTKNPLATILPTVTVTESKPAPAVAFFSSRGPSLASVNLLKPDICAPGVDI  1
            YI+S++NP ATI P   +   KPAP VA FSSRGP+  + N+LKPDI APGV I
Sbjct  478  YINSSQNPHATIFPANEIRRFKPAPVVADFSSRGPATLTENILKPDITAPGVGI  531



>gb|KHG30296.1| Subtilisin-like protease [Gossypium arboreum]
Length=778

 Score = 65.5 bits (158),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 31/54 (57%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  162  YISSTKNPLATILPTVTVTESKPAPAVAFFSSRGPSLASVNLLKPDICAPGVDI  1
            YI+STKNP+A + P  TV + KPAP +A F+SRGP++   N+LKPDI APG++I
Sbjct  485  YINSTKNPMAVVSPGRTVLKYKPAPFMAGFTSRGPNVVDPNILKPDITAPGLNI  538



>ref|XP_009803454.1| PREDICTED: subtilisin-like protease SBT5.3 [Nicotiana sylvestris]
Length=776

 Score = 65.5 bits (158),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 32/54 (59%), Positives = 43/54 (80%), Gaps = 0/54 (0%)
 Frame = -2

Query  162  YISSTKNPLATILPTVTVTESKPAPAVAFFSSRGPSLASVNLLKPDICAPGVDI  1
            YI+STK+P+A I+P  TV  SKPAP +A F+SRGPS  + ++LKPDI APG++I
Sbjct  484  YINSTKSPVAYIVPAKTVLHSKPAPYMASFTSRGPSAVAPHILKPDITAPGLNI  537



>ref|XP_006355620.1| PREDICTED: subtilisin-like protease-like [Solanum tuberosum]
Length=775

 Score = 65.5 bits (158),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 32/54 (59%), Positives = 43/54 (80%), Gaps = 0/54 (0%)
 Frame = -2

Query  162  YISSTKNPLATILPTVTVTESKPAPAVAFFSSRGPSLASVNLLKPDICAPGVDI  1
            YISSTK+P+A I+P  TV  +KPAP +A F+SRGPS  + ++LKPDI APG++I
Sbjct  483  YISSTKSPVAYIVPAKTVLHAKPAPYMASFTSRGPSAVAPDILKPDITAPGLNI  536



>emb|CBI30770.3| unnamed protein product [Vitis vinifera]
Length=740

 Score = 65.1 bits (157),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 31/54 (57%), Positives = 40/54 (74%), Gaps = 0/54 (0%)
 Frame = -2

Query  162  YISSTKNPLATILPTVTVTESKPAPAVAFFSSRGPSLASVNLLKPDICAPGVDI  1
            YI STK P+ATI+P  TV  +KPAP +A F+SRGP+    N+LKPDI  PG++I
Sbjct  447  YIKSTKKPMATIIPGRTVLHAKPAPFMASFTSRGPNTIDPNILKPDITGPGLNI  500



>ref|XP_002269375.1| PREDICTED: subtilisin-like protease SBT5.3 [Vitis vinifera]
Length=778

 Score = 65.1 bits (157),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 31/54 (57%), Positives = 40/54 (74%), Gaps = 0/54 (0%)
 Frame = -2

Query  162  YISSTKNPLATILPTVTVTESKPAPAVAFFSSRGPSLASVNLLKPDICAPGVDI  1
            YI STK P+ATI+P  TV  +KPAP +A F+SRGP+    N+LKPDI  PG++I
Sbjct  485  YIKSTKKPMATIIPGRTVLHAKPAPFMASFTSRGPNTIDPNILKPDITGPGLNI  538



>ref|XP_009604273.1| PREDICTED: subtilisin-like protease SBT5.3 [Nicotiana tomentosiformis]
Length=775

 Score = 65.1 bits (157),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 32/54 (59%), Positives = 43/54 (80%), Gaps = 0/54 (0%)
 Frame = -2

Query  162  YISSTKNPLATILPTVTVTESKPAPAVAFFSSRGPSLASVNLLKPDICAPGVDI  1
            YI+STK+P+A I+P  TV  SKPAP +A F+SRGPS  + ++LKPDI APG++I
Sbjct  483  YINSTKSPVAYIVPAKTVLHSKPAPYMASFTSRGPSAVAPDILKPDITAPGLNI  536



>ref|XP_002981864.1| hypothetical protein SELMODRAFT_115574, partial [Selaginella 
moellendorffii]
 gb|EFJ16957.1| hypothetical protein SELMODRAFT_115574, partial [Selaginella 
moellendorffii]
Length=725

 Score = 65.1 bits (157),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 32/54 (59%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  162  YISSTKNPLATILPTVTVTESKPAPAVAFFSSRGPSLASVNLLKPDICAPGVDI  1
            YISSTKNP ATIL + T++   PAP VA FSSRGP+  S +++KPD+ APG++I
Sbjct  419  YISSTKNPTATILKSTTLSNVTPAPVVASFSSRGPNAVSPDIVKPDVTAPGLNI  472



>ref|XP_002991849.1| hypothetical protein SELMODRAFT_236400 [Selaginella moellendorffii]
 gb|EFJ07111.1| hypothetical protein SELMODRAFT_236400 [Selaginella moellendorffii]
Length=753

 Score = 65.1 bits (157),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 32/54 (59%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  162  YISSTKNPLATILPTVTVTESKPAPAVAFFSSRGPSLASVNLLKPDICAPGVDI  1
            YI+STK P+A I PT TV  S+PAP +A FSSRGP+  + ++LKPDI APG++I
Sbjct  447  YINSTKTPVARINPTATVLGSRPAPQIASFSSRGPNSVTPDVLKPDIAAPGLNI  500



>emb|CAN61728.1| hypothetical protein VITISV_036029 [Vitis vinifera]
Length=860

 Score = 65.1 bits (157),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 31/54 (57%), Positives = 39/54 (72%), Gaps = 0/54 (0%)
 Frame = -2

Query  162  YISSTKNPLATILPTVTVTESKPAPAVAFFSSRGPSLASVNLLKPDICAPGVDI  1
            YI STK P+ATI+P  TV  +KPAP +A F SRGP+    N+LKPDI  PG++I
Sbjct  512  YIKSTKKPMATIIPGXTVLHAKPAPFMASFXSRGPNTIDPNILKPDITGPGLNI  565



>ref|XP_002982832.1| hypothetical protein SELMODRAFT_234125 [Selaginella moellendorffii]
 gb|EFJ16077.1| hypothetical protein SELMODRAFT_234125 [Selaginella moellendorffii]
Length=687

 Score = 65.1 bits (157),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 32/54 (59%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  162  YISSTKNPLATILPTVTVTESKPAPAVAFFSSRGPSLASVNLLKPDICAPGVDI  1
            YISSTKNP ATIL + T++   PAP VA FSSRGP+  S +++KPD+ APG++I
Sbjct  381  YISSTKNPTATILKSTTLSNVTPAPVVASFSSRGPNAVSPDIVKPDVTAPGLNI  434



>ref|XP_002993007.1| hypothetical protein SELMODRAFT_236650 [Selaginella moellendorffii]
 gb|EFJ05953.1| hypothetical protein SELMODRAFT_236650 [Selaginella moellendorffii]
Length=755

 Score = 65.1 bits (157),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 32/54 (59%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  162  YISSTKNPLATILPTVTVTESKPAPAVAFFSSRGPSLASVNLLKPDICAPGVDI  1
            YI+STK P+A I PT TV  S+PAP +A FSSRGP+  + ++LKPDI APG++I
Sbjct  449  YINSTKTPVARINPTATVLGSRPAPQIASFSSRGPNSVTPDVLKPDIAAPGLNI  502



>ref|XP_006857959.1| hypothetical protein AMTR_s00069p00172550 [Amborella trichopoda]
 gb|ERN19426.1| hypothetical protein AMTR_s00069p00172550 [Amborella trichopoda]
Length=767

 Score = 65.1 bits (157),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 34/54 (63%), Positives = 38/54 (70%), Gaps = 0/54 (0%)
 Frame = -2

Query  162  YISSTKNPLATILPTVTVTESKPAPAVAFFSSRGPSLASVNLLKPDICAPGVDI  1
            YI+STKNP ATIL   TV     AP VA FSSRGPSL S  +LKPDI  PG++I
Sbjct  470  YINSTKNPTATILFNGTVFRDTAAPVVAVFSSRGPSLQSPGILKPDIIGPGMEI  523



>ref|XP_010683779.1| PREDICTED: xylem serine proteinase 1 [Beta vulgaris subsp. vulgaris]
Length=711

 Score = 64.7 bits (156),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 34/54 (63%), Positives = 42/54 (78%), Gaps = 1/54 (2%)
 Frame = -2

Query  162  YISSTKNPLATILPTVTVTESKPAPAVAFFSSRGPSLASVNLLKPDICAPGVDI  1
            YI++TK+P ATI  TVT+  +K AP VA FSSRGP L + N+LKPDI APG+DI
Sbjct  415  YINTTKSPQATIYKTVTLKTTK-APVVASFSSRGPQLLARNILKPDISAPGMDI  467



>ref|XP_009619449.1| PREDICTED: subtilisin-like protease isoform X1 [Nicotiana tomentosiformis]
Length=786

 Score = 65.1 bits (157),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 32/49 (65%), Positives = 39/49 (80%), Gaps = 0/49 (0%)
 Frame = -2

Query  147  KNPLATILPTVTVTESKPAPAVAFFSSRGPSLASVNLLKPDICAPGVDI  1
            +NP+A+ILPTV+ T+ KPAP V +FSSRGP   + NLLKPDI APGV I
Sbjct  501  RNPVASILPTVSTTKYKPAPVVPYFSSRGPVENTPNLLKPDITAPGVTI  549



>ref|XP_002457657.1| hypothetical protein SORBIDRAFT_03g011300 [Sorghum bicolor]
 gb|EES02777.1| hypothetical protein SORBIDRAFT_03g011300 [Sorghum bicolor]
Length=790

 Score = 64.7 bits (156),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 34/54 (63%), Positives = 40/54 (74%), Gaps = 1/54 (2%)
 Frame = -2

Query  162  YISSTKNPLATILPTVTVTESKPAPAVAFFSSRGPSLASVNLLKPDICAPGVDI  1
            YI+STKNP A ILPT  V + KPAP VA FS+RGP L   ++LKPD+ APGV I
Sbjct  488  YINSTKNPTAVILPTEEVGDFKPAPVVASFSARGPGLTE-SILKPDLMAPGVSI  540



>ref|XP_010103418.1| Subtilisin-like protease [Morus notabilis]
 gb|EXB95737.1| Subtilisin-like protease [Morus notabilis]
Length=799

 Score = 64.7 bits (156),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 31/54 (57%), Positives = 41/54 (76%), Gaps = 0/54 (0%)
 Frame = -2

Query  162  YISSTKNPLATILPTVTVTESKPAPAVAFFSSRGPSLASVNLLKPDICAPGVDI  1
            Y++S++ P AT+    T    KPAP VAFFSSRGP+L S+++LKPD+ APGVDI
Sbjct  490  YLTSSRKPRATMRFRGTQLGVKPAPVVAFFSSRGPNLLSLDVLKPDVIAPGVDI  543



>ref|XP_006851499.1| hypothetical protein AMTR_s00040p00151440 [Amborella trichopoda]
 gb|ERN13080.1| hypothetical protein AMTR_s00040p00151440 [Amborella trichopoda]
Length=738

 Score = 64.3 bits (155),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 31/54 (57%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  162  YISSTKNPLATILPTVTVTESKPAPAVAFFSSRGPSLASVNLLKPDICAPGVDI  1
            Y+S+ KNP+ATI PT T+   KPAP +A FSS GPS+ S +++KPDI APG++I
Sbjct  444  YLSTEKNPVATIYPTSTILNVKPAPKMAVFSSAGPSIISPDVIKPDITAPGLNI  497



>ref|XP_010067650.1| PREDICTED: subtilisin-like protease [Eucalyptus grandis]
 gb|KCW65827.1| hypothetical protein EUGRSUZ_G03177 [Eucalyptus grandis]
Length=774

 Score = 64.3 bits (155),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 32/54 (59%), Positives = 37/54 (69%), Gaps = 0/54 (0%)
 Frame = -2

Query  162  YISSTKNPLATILPTVTVTESKPAPAVAFFSSRGPSLASVNLLKPDICAPGVDI  1
            YISS K P ATIL    V+  +PAP VA FSSRGP   + N+LKPDI APG+ I
Sbjct  477  YISSAKYPTATILKATAVSGQRPAPTVALFSSRGPGELTENILKPDIMAPGIAI  530



>ref|XP_010694663.1| PREDICTED: CO(2)-response secreted protease-like [Beta vulgaris 
subsp. vulgaris]
Length=783

 Score = 64.3 bits (155),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 34/54 (63%), Positives = 39/54 (72%), Gaps = 0/54 (0%)
 Frame = -2

Query  162  YISSTKNPLATILPTVTVTESKPAPAVAFFSSRGPSLASVNLLKPDICAPGVDI  1
            YI+ST+   ATIL TV V + KPAP VA FSSRGP   + N+LKPDI APGV I
Sbjct  486  YINSTRKSTATILSTVPVQKYKPAPVVADFSSRGPGELTENILKPDIMAPGVAI  539



>gb|EYU38296.1| hypothetical protein MIMGU_mgv1a0026491mg, partial [Erythranthe 
guttata]
Length=407

 Score = 63.5 bits (153),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 32/54 (59%), Positives = 39/54 (72%), Gaps = 0/54 (0%)
 Frame = -2

Query  162  YISSTKNPLATILPTVTVTESKPAPAVAFFSSRGPSLASVNLLKPDICAPGVDI  1
            YI+STKNP ATI+  + +   +PAP VA FSSRGP   + N+LKPDI APGV I
Sbjct  104  YINSTKNPSATIVGPIEIRHVEPAPVVASFSSRGPGGLTENILKPDIMAPGVAI  157



>ref|XP_009351978.1| PREDICTED: subtilisin-like protease SBT5.3 [Pyrus x bretschneideri]
Length=781

 Score = 63.9 bits (154),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 32/54 (59%), Positives = 40/54 (74%), Gaps = 0/54 (0%)
 Frame = -2

Query  162  YISSTKNPLATILPTVTVTESKPAPAVAFFSSRGPSLASVNLLKPDICAPGVDI  1
            YI+STK P ATI+P  TV   KPAP +A F+SRGP++   N LKPDI APG++I
Sbjct  487  YINSTKIPTATIIPARTVLNRKPAPFMAAFTSRGPNIIDPNFLKPDITAPGLNI  540



>emb|CBI30775.3| unnamed protein product [Vitis vinifera]
Length=724

 Score = 63.9 bits (154),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 31/54 (57%), Positives = 39/54 (72%), Gaps = 0/54 (0%)
 Frame = -2

Query  162  YISSTKNPLATILPTVTVTESKPAPAVAFFSSRGPSLASVNLLKPDICAPGVDI  1
            YI STK P+ATI+P  TV  +KPAP +A F SRGP+    N+LKPDI  PG++I
Sbjct  432  YIKSTKKPMATIIPGRTVLHAKPAPFMASFISRGPNTIDPNILKPDITGPGLNI  485



>dbj|BAA89562.1| putative subtilisin-like protein [Oryza sativa Japonica Group]
Length=795

 Score = 63.9 bits (154),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 32/54 (59%), Positives = 38/54 (70%), Gaps = 0/54 (0%)
 Frame = -2

Query  162  YISSTKNPLATILPTVTVTESKPAPAVAFFSSRGPSLASVNLLKPDICAPGVDI  1
            YI+STKNP A ILPT    + KPAP VA FS+RGP   +  +LKPD+ APGV I
Sbjct  484  YINSTKNPTAVILPTEDAKDDKPAPVVASFSARGPGGLTEAILKPDLMAPGVSI  537



>ref|XP_008238729.1| PREDICTED: subtilisin-like protease [Prunus mume]
Length=758

 Score = 63.9 bits (154),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 35/54 (65%), Positives = 38/54 (70%), Gaps = 0/54 (0%)
 Frame = -2

Query  162  YISSTKNPLATILPTVTVTESKPAPAVAFFSSRGPSLASVNLLKPDICAPGVDI  1
            YISST +P ATIL   TV     AP VAFFSSRGP+ AS  +LKPDI  PGVDI
Sbjct  462  YISSTSSPTATILFNGTVIGDALAPRVAFFSSRGPNKASPGILKPDIIGPGVDI  515



>gb|EAY73513.1| hypothetical protein OsI_01395 [Oryza sativa Indica Group]
Length=788

 Score = 63.9 bits (154),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 32/54 (59%), Positives = 38/54 (70%), Gaps = 0/54 (0%)
 Frame = -2

Query  162  YISSTKNPLATILPTVTVTESKPAPAVAFFSSRGPSLASVNLLKPDICAPGVDI  1
            YI+STKNP A ILPT    + KPAP VA FS+RGP   +  +LKPD+ APGV I
Sbjct  481  YINSTKNPTAVILPTEDAKDDKPAPVVASFSARGPGGLTEAILKPDLMAPGVSI  534



>ref|XP_009604279.1| PREDICTED: subtilisin-like protease [Nicotiana tomentosiformis]
Length=766

 Score = 63.9 bits (154),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 29/54 (54%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  162  YISSTKNPLATILPTVTVTESKPAPAVAFFSSRGPSLASVNLLKPDICAPGVDI  1
            YI + KNP+AT+LP  T+  +KPAP +A F+S+GP++   N+LKPDI APG++I
Sbjct  479  YIQTEKNPMATLLPGQTLIGTKPAPVMAPFTSKGPNIVDPNILKPDITAPGLNI  532



>ref|XP_009391454.1| PREDICTED: subtilisin-like protease SBT5.3 [Musa acuminata subsp. 
malaccensis]
Length=785

 Score = 63.9 bits (154),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 30/54 (56%), Positives = 41/54 (76%), Gaps = 0/54 (0%)
 Frame = -2

Query  162  YISSTKNPLATILPTVTVTESKPAPAVAFFSSRGPSLASVNLLKPDICAPGVDI  1
            YI S+K+P   +LP+ T     PAP+VA+FSSRGP+ A+ N+LKPDI APGV++
Sbjct  464  YIQSSKDPTVRVLPSRTSIGCSPAPSVAYFSSRGPNSATPNILKPDITAPGVNV  517



>ref|XP_006645770.1| PREDICTED: subtilisin-like protease-like, partial [Oryza brachyantha]
Length=564

 Score = 63.5 bits (153),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 32/54 (59%), Positives = 38/54 (70%), Gaps = 0/54 (0%)
 Frame = -2

Query  162  YISSTKNPLATILPTVTVTESKPAPAVAFFSSRGPSLASVNLLKPDICAPGVDI  1
            YI++TKNP A ILPT    E KPAP VA FS+RGP   +  +LKPD+ APGV I
Sbjct  400  YINATKNPTAVILPTEDAKEVKPAPVVASFSARGPGGLTEAILKPDLMAPGVSI  453



>ref|XP_008371534.1| PREDICTED: subtilisin-like protease [Malus domestica]
Length=780

 Score = 63.9 bits (154),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 32/54 (59%), Positives = 40/54 (74%), Gaps = 0/54 (0%)
 Frame = -2

Query  162  YISSTKNPLATILPTVTVTESKPAPAVAFFSSRGPSLASVNLLKPDICAPGVDI  1
            YI+STK P ATI+P  TV   KPAP +A F+SRGP++   N LKPDI APG++I
Sbjct  486  YINSTKIPTATIIPARTVLNRKPAPFMAAFTSRGPNIIDPNFLKPDITAPGLNI  539



>ref|XP_007210956.1| hypothetical protein PRUPE_ppa023717mg [Prunus persica]
 gb|EMJ12155.1| hypothetical protein PRUPE_ppa023717mg [Prunus persica]
Length=729

 Score = 63.9 bits (154),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 35/54 (65%), Positives = 38/54 (70%), Gaps = 0/54 (0%)
 Frame = -2

Query  162  YISSTKNPLATILPTVTVTESKPAPAVAFFSSRGPSLASVNLLKPDICAPGVDI  1
            YISST +P ATIL   TV     AP VAFFSSRGP+ AS  +LKPDI  PGVDI
Sbjct  433  YISSTSSPTATILFNGTVIGDALAPRVAFFSSRGPNKASPGILKPDIIGPGVDI  486



>gb|KCW76039.1| hypothetical protein EUGRSUZ_D00408 [Eucalyptus grandis]
 gb|KCW76040.1| hypothetical protein EUGRSUZ_D00408 [Eucalyptus grandis]
Length=771

 Score = 63.9 bits (154),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 30/54 (56%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  162  YISSTKNPLATILPTVTVTESKPAPAVAFFSSRGPSLASVNLLKPDICAPGVDI  1
            Y+ STK+P+A I+P  TV  +KPAP +A F+SRGP++   ++LKPDI APGV+I
Sbjct  485  YVRSTKSPMARIVPARTVLYTKPAPVMAAFTSRGPNVIDPDILKPDISAPGVNI  538



>ref|XP_002325705.1| hypothetical protein POPTR_0019s00970g [Populus trichocarpa]
 gb|EEF00087.1| hypothetical protein POPTR_0019s00970g [Populus trichocarpa]
Length=697

 Score = 63.9 bits (154),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 34/54 (63%), Positives = 40/54 (74%), Gaps = 0/54 (0%)
 Frame = -2

Query  162  YISSTKNPLATILPTVTVTESKPAPAVAFFSSRGPSLASVNLLKPDICAPGVDI  1
            YI+ST +P+ATIL   TV     AP +A+FSSRGPSLAS  +LKPDI  PGVDI
Sbjct  407  YINSTSSPMATILFEGTVFGVPYAPQLAYFSSRGPSLASPGILKPDIIGPGVDI  460



>gb|EEE54331.1| hypothetical protein OsJ_01304 [Oryza sativa Japonica Group]
Length=958

 Score = 63.9 bits (154),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 32/54 (59%), Positives = 38/54 (70%), Gaps = 0/54 (0%)
 Frame = -2

Query  162  YISSTKNPLATILPTVTVTESKPAPAVAFFSSRGPSLASVNLLKPDICAPGVDI  1
            YI+STKNP A ILPT    + KPAP VA FS+RGP   +  +LKPD+ APGV I
Sbjct  452  YINSTKNPTAVILPTEDAKDDKPAPVVASFSARGPGGLTEAILKPDLMAPGVSI  505



>ref|XP_010052139.1| PREDICTED: subtilisin-like protease SBT5.3 [Eucalyptus grandis]
Length=776

 Score = 63.9 bits (154),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 30/54 (56%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  162  YISSTKNPLATILPTVTVTESKPAPAVAFFSSRGPSLASVNLLKPDICAPGVDI  1
            Y+ STK+P+A I+P  TV  +KPAP +A F+SRGP++   ++LKPDI APGV+I
Sbjct  485  YVRSTKSPMARIVPARTVLYTKPAPVMAAFTSRGPNVIDPDILKPDISAPGVNI  538



>ref|XP_002269555.2| PREDICTED: subtilisin-like protease SBT5.3 [Vitis vinifera]
Length=777

 Score = 63.9 bits (154),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 31/54 (57%), Positives = 39/54 (72%), Gaps = 0/54 (0%)
 Frame = -2

Query  162  YISSTKNPLATILPTVTVTESKPAPAVAFFSSRGPSLASVNLLKPDICAPGVDI  1
            YI STK P+ATI+P  TV  +KPAP +A F SRGP+    N+LKPDI  PG++I
Sbjct  485  YIKSTKKPMATIIPGRTVLHAKPAPFMASFISRGPNTIDPNILKPDITGPGLNI  538



>gb|EMT03593.1| Subtilisin-like protease [Aegilops tauschii]
Length=332

 Score = 62.4 bits (150),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 33/54 (61%), Positives = 39/54 (72%), Gaps = 0/54 (0%)
 Frame = -2

Query  162  YISSTKNPLATILPTVTVTESKPAPAVAFFSSRGPSLASVNLLKPDICAPGVDI  1
            YI+ST NP A+I    TV  + PAPAV FFSSRGPS AS  +LKPDI  PG++I
Sbjct  36   YINSTANPTASIAFKGTVMGALPAPAVTFFSSRGPSKASPGILKPDITGPGMNI  89



>ref|XP_010529231.1| PREDICTED: subtilisin-like protease [Tarenaya hassleriana]
Length=783

 Score = 63.5 bits (153),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 32/54 (59%), Positives = 39/54 (72%), Gaps = 0/54 (0%)
 Frame = -2

Query  162  YISSTKNPLATILPTVTVTESKPAPAVAFFSSRGPSLASVNLLKPDICAPGVDI  1
            YI + KNP+A I P  TV  SKPAP V  FSSRGP++   N+LKPDI APG++I
Sbjct  488  YIKTDKNPVAFIKPGKTVYRSKPAPFVTGFSSRGPNVIDPNILKPDISAPGLNI  541



>ref|XP_008464322.1| PREDICTED: subtilisin-like protease [Cucumis melo]
Length=776

 Score = 63.5 bits (153),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 29/54 (54%), Positives = 41/54 (76%), Gaps = 0/54 (0%)
 Frame = -2

Query  162  YISSTKNPLATILPTVTVTESKPAPAVAFFSSRGPSLASVNLLKPDICAPGVDI  1
            YI STKNP+ +++P      +KPAP++A FSSRGP+L S  ++KPD+ APGV+I
Sbjct  481  YIKSTKNPMGSLIPPSAKVNTKPAPSMAAFSSRGPNLISPEIIKPDVTAPGVNI  534



>ref|XP_008809520.1| PREDICTED: subtilisin-like protease [Phoenix dactylifera]
Length=777

 Score = 63.5 bits (153),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 32/54 (59%), Positives = 39/54 (72%), Gaps = 0/54 (0%)
 Frame = -2

Query  162  YISSTKNPLATILPTVTVTESKPAPAVAFFSSRGPSLASVNLLKPDICAPGVDI  1
            Y S+ KNP ATI+   T+  ++ APAVA FSSRGPSL +  +LKPDI  PGVDI
Sbjct  472  YFSTEKNPTATIIFKGTLYGARRAPAVASFSSRGPSLVNGGILKPDIIGPGVDI  525



>ref|XP_002965691.1| hypothetical protein SELMODRAFT_407291 [Selaginella moellendorffii]
 gb|EFJ33111.1| hypothetical protein SELMODRAFT_407291 [Selaginella moellendorffii]
Length=729

 Score = 63.5 bits (153),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 31/54 (57%), Positives = 41/54 (76%), Gaps = 0/54 (0%)
 Frame = -2

Query  162  YISSTKNPLATILPTVTVTESKPAPAVAFFSSRGPSLASVNLLKPDICAPGVDI  1
            Y SS+ +  ATI PT TV + +PAP VA FSSRGP + ++++LKPDI APGV+I
Sbjct  435  YTSSSNSTAATIFPTKTVLDVEPAPTVAGFSSRGPHIENLDILKPDITAPGVNI  488



>gb|KDP25558.1| hypothetical protein JCGZ_20714 [Jatropha curcas]
Length=733

 Score = 63.5 bits (153),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 35/54 (65%), Positives = 39/54 (72%), Gaps = 0/54 (0%)
 Frame = -2

Query  162  YISSTKNPLATILPTVTVTESKPAPAVAFFSSRGPSLASVNLLKPDICAPGVDI  1
            YI+ST +P ATIL   TVT  K AP VA FSSRGPS+AS  +LKPDI  PGV I
Sbjct  446  YINSTSSPTATILFKGTVTGLKDAPQVADFSSRGPSMASPGILKPDIIGPGVKI  499



>gb|EMT32761.1| Subtilisin-like protease [Aegilops tauschii]
Length=779

 Score = 63.5 bits (153),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 33/54 (61%), Positives = 39/54 (72%), Gaps = 0/54 (0%)
 Frame = -2

Query  162  YISSTKNPLATILPTVTVTESKPAPAVAFFSSRGPSLASVNLLKPDICAPGVDI  1
            YI+STKNP A ILPT  V   KPAP VA FS+RGP+  +  +LKPD+ APGV I
Sbjct  481  YINSTKNPTAAILPTKDVKLFKPAPVVASFSARGPAALTEAILKPDLMAPGVSI  534



>ref|XP_002971639.1| hypothetical protein SELMODRAFT_412127 [Selaginella moellendorffii]
 gb|EFJ27388.1| hypothetical protein SELMODRAFT_412127 [Selaginella moellendorffii]
Length=729

 Score = 63.5 bits (153),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 31/54 (57%), Positives = 41/54 (76%), Gaps = 0/54 (0%)
 Frame = -2

Query  162  YISSTKNPLATILPTVTVTESKPAPAVAFFSSRGPSLASVNLLKPDICAPGVDI  1
            Y SS+ +  ATI PT TV + +PAP VA FSSRGP + ++++LKPDI APGV+I
Sbjct  435  YTSSSNSTAATIFPTKTVLDVEPAPTVAGFSSRGPHIENLDILKPDITAPGVNI  488



>ref|XP_009360803.1| PREDICTED: subtilisin-like protease SBT5.3 [Pyrus x bretschneideri]
Length=778

 Score = 63.2 bits (152),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 32/54 (59%), Positives = 39/54 (72%), Gaps = 0/54 (0%)
 Frame = -2

Query  162  YISSTKNPLATILPTVTVTESKPAPAVAFFSSRGPSLASVNLLKPDICAPGVDI  1
            YI+STK P A I+P  TV   KPAP +A F+SRGP+L   N LKPDI APG++I
Sbjct  485  YINSTKIPTAAIIPARTVLNRKPAPFMAAFTSRGPNLIDPNFLKPDITAPGLNI  538



>emb|CDM82985.1| unnamed protein product [Triticum aestivum]
Length=787

 Score = 63.2 bits (152),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 33/54 (61%), Positives = 39/54 (72%), Gaps = 0/54 (0%)
 Frame = -2

Query  162  YISSTKNPLATILPTVTVTESKPAPAVAFFSSRGPSLASVNLLKPDICAPGVDI  1
            YI+STKNP A ILPT  V   KPAP VA FS+RGP   + ++LKPD+ APGV I
Sbjct  488  YINSTKNPTAVILPTEDVKLFKPAPMVASFSARGPGGLTESILKPDLMAPGVSI  541



>ref|XP_002972044.1| hypothetical protein SELMODRAFT_96495 [Selaginella moellendorffii]
 gb|EFJ26961.1| hypothetical protein SELMODRAFT_96495 [Selaginella moellendorffii]
Length=681

 Score = 63.2 bits (152),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 30/54 (56%), Positives = 39/54 (72%), Gaps = 0/54 (0%)
 Frame = -2

Query  162  YISSTKNPLATILPTVTVTESKPAPAVAFFSSRGPSLASVNLLKPDICAPGVDI  1
            Y +ST+NP+A  LPT+  T  +    VA FSSRGP+L + ++LKPDI APGVDI
Sbjct  388  YTNSTRNPIARFLPTIVRTGEEIKATVALFSSRGPNLITPDILKPDIVAPGVDI  441



>ref|XP_008383532.1| PREDICTED: subtilisin-like protease [Malus domestica]
Length=778

 Score = 63.2 bits (152),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 32/54 (59%), Positives = 39/54 (72%), Gaps = 0/54 (0%)
 Frame = -2

Query  162  YISSTKNPLATILPTVTVTESKPAPAVAFFSSRGPSLASVNLLKPDICAPGVDI  1
            YI+STK P ATI+P  TV   KPAP +  F+SRGP+L   N LKPDI APG++I
Sbjct  485  YINSTKIPTATIIPARTVFNRKPAPFMXAFTSRGPNLIDPNFLKPDITAPGLNI  538



>ref|XP_002522297.1| Xylem serine proteinase 1 precursor, putative [Ricinus communis]
 gb|EEF40155.1| Xylem serine proteinase 1 precursor, putative [Ricinus communis]
Length=776

 Score = 63.2 bits (152),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 32/54 (59%), Positives = 39/54 (72%), Gaps = 0/54 (0%)
 Frame = -2

Query  162  YISSTKNPLATILPTVTVTESKPAPAVAFFSSRGPSLASVNLLKPDICAPGVDI  1
            YI ST+NP ATI    TV    PAP++A FSSRGP++   N+LKPDI APGV+I
Sbjct  484  YIKSTENPTATIGKAKTVLHYSPAPSMAAFSSRGPNVIDPNILKPDISAPGVNI  537



>dbj|BAA13135.1| subtilisin-like protein [Picea abies]
Length=779

 Score = 63.2 bits (152),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 32/54 (59%), Positives = 38/54 (70%), Gaps = 0/54 (0%)
 Frame = -2

Query  162  YISSTKNPLATILPTVTVTESKPAPAVAFFSSRGPSLASVNLLKPDICAPGVDI  1
            YI S +NP+ATI  T  VT   PAP +A FSSRGP   + N+LKPDI APGV+I
Sbjct  477  YIKSNRNPVATITLTEVVTNYIPAPVIASFSSRGPGGLTQNILKPDISAPGVNI  530



>gb|ACN36528.1| unknown [Zea mays]
Length=342

 Score = 62.0 bits (149),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 33/54 (61%), Positives = 38/54 (70%), Gaps = 0/54 (0%)
 Frame = -2

Query  162  YISSTKNPLATILPTVTVTESKPAPAVAFFSSRGPSLASVNLLKPDICAPGVDI  1
            YI ST  P ATI    TV  S PAP+VAFFSSRGP+ AS  +LKPDI  PG++I
Sbjct  45   YIKSTPRPTATITFRGTVMGSSPAPSVAFFSSRGPNKASPGILKPDITGPGMNI  98



>gb|EMS62609.1| Subtilisin-like protease [Triticum urartu]
Length=509

 Score = 62.8 bits (151),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 33/54 (61%), Positives = 39/54 (72%), Gaps = 0/54 (0%)
 Frame = -2

Query  162  YISSTKNPLATILPTVTVTESKPAPAVAFFSSRGPSLASVNLLKPDICAPGVDI  1
            YI+ST NP A+I    TV  + PAPAV FFSSRGPS AS  +LKPDI  PG++I
Sbjct  213  YINSTANPTASIAFKGTVMGALPAPAVTFFSSRGPSKASPGILKPDITGPGMNI  266



>ref|XP_010925147.1| PREDICTED: subtilisin-like protease [Elaeis guineensis]
Length=781

 Score = 63.2 bits (152),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 32/54 (59%), Positives = 39/54 (72%), Gaps = 0/54 (0%)
 Frame = -2

Query  162  YISSTKNPLATILPTVTVTESKPAPAVAFFSSRGPSLASVNLLKPDICAPGVDI  1
            Y S+ KNP ATI+   T+  ++ APAVA FSSRGPSL +  +LKPDI  PGVDI
Sbjct  471  YFSTEKNPTATIVFKGTLYGARRAPAVASFSSRGPSLVNGGILKPDIIGPGVDI  524



>gb|EPS68445.1| hypothetical protein M569_06321, partial [Genlisea aurea]
Length=639

 Score = 62.8 bits (151),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 30/54 (56%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  162  YISSTKNPLATILPTVTVTESKPAPAVAFFSSRGPSLASVNLLKPDICAPGVDI  1
            YI ST++P A I+P  TV  +KPAP++A F+SRGP+  S ++LKPD+ APGV+I
Sbjct  339  YIDSTEDPRAYIIPAKTVVGTKPAPSMAVFTSRGPNTISPDVLKPDVTAPGVNI  392



>gb|EYU28144.1| hypothetical protein MIMGU_mgv1a001682mg [Erythranthe guttata]
Length=773

 Score = 63.2 bits (152),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 32/54 (59%), Positives = 41/54 (76%), Gaps = 0/54 (0%)
 Frame = -2

Query  162  YISSTKNPLATILPTVTVTESKPAPAVAFFSSRGPSLASVNLLKPDICAPGVDI  1
            YI+ST+ P A I P  TV ++KPAP +A FSSRGPS  S ++LKPDI APG++I
Sbjct  484  YINSTRAPKAYIEPAKTVLDTKPAPFMAAFSSRGPSTVSPDILKPDITAPGINI  537



>gb|AES88343.2| subtilisin-like serine protease [Medicago truncatula]
Length=734

 Score = 63.2 bits (152),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 29/54 (54%), Positives = 40/54 (74%), Gaps = 0/54 (0%)
 Frame = -2

Query  162  YISSTKNPLATILPTVTVTESKPAPAVAFFSSRGPSLASVNLLKPDICAPGVDI  1
            YI + KNP+A I PT+TV  +KPAP  A FSS GP++ + +++KPDI  PGV+I
Sbjct  440  YIKTEKNPIAKIYPTITVVGTKPAPEAAAFSSMGPNIITPDIIKPDITGPGVNI  493



>ref|NP_001065109.1| Os10g0524600 [Oryza sativa Japonica Group]
 gb|AAM12497.1|AC074232_24 putative serine protease [Oryza sativa Japonica Group]
 gb|AAO00703.1| putative serine protease [Oryza sativa Japonica Group]
 gb|AAP54706.1| Subtilisin N-terminal Region family protein, expressed [Oryza 
sativa Japonica Group]
 dbj|BAF27023.1| Os10g0524600 [Oryza sativa Japonica Group]
 gb|EAZ16740.1| hypothetical protein OsJ_32216 [Oryza sativa Japonica Group]
 dbj|BAG91330.1| unnamed protein product [Oryza sativa Japonica Group]
Length=759

 Score = 63.2 bits (152),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 32/54 (59%), Positives = 39/54 (72%), Gaps = 0/54 (0%)
 Frame = -2

Query  162  YISSTKNPLATILPTVTVTESKPAPAVAFFSSRGPSLASVNLLKPDICAPGVDI  1
            Y++ST NP A+I    TV  S P+PAV FFSSRGPS AS  +LKPDI  PG++I
Sbjct  464  YVNSTDNPTASIAFKGTVIGSSPSPAVTFFSSRGPSKASPGILKPDITGPGMNI  517



>gb|KEH29866.1| subtilisin-like serine protease [Medicago truncatula]
Length=657

 Score = 62.8 bits (151),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 29/54 (54%), Positives = 40/54 (74%), Gaps = 0/54 (0%)
 Frame = -2

Query  162  YISSTKNPLATILPTVTVTESKPAPAVAFFSSRGPSLASVNLLKPDICAPGVDI  1
            YI + KNP+A I PT+TV  +KPAP  A FSS GP++ + +++KPDI  PGV+I
Sbjct  363  YIKTEKNPIAKIYPTITVVGTKPAPEAAAFSSMGPNIITPDIIKPDITGPGVNI  416



>gb|EAY79268.1| hypothetical protein OsI_34383 [Oryza sativa Indica Group]
Length=759

 Score = 63.2 bits (152),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 32/54 (59%), Positives = 39/54 (72%), Gaps = 0/54 (0%)
 Frame = -2

Query  162  YISSTKNPLATILPTVTVTESKPAPAVAFFSSRGPSLASVNLLKPDICAPGVDI  1
            Y++ST NP A+I    TV  S P+PAV FFSSRGPS AS  +LKPDI  PG++I
Sbjct  464  YVNSTDNPTASIAFKGTVIGSSPSPAVTFFSSRGPSKASPGILKPDITGPGMNI  517



>emb|CAA07250.1| serine protease [Solanum lycopersicum]
Length=747

 Score = 62.8 bits (151),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 32/54 (59%), Positives = 39/54 (72%), Gaps = 0/54 (0%)
 Frame = -2

Query  162  YISSTKNPLATILPTVTVTESKPAPAVAFFSSRGPSLASVNLLKPDICAPGVDI  1
            Y++ST NP+ATI    T+   K AP VA FSSRGPS AS+ +LKPDI  PGV+I
Sbjct  454  YMNSTSNPVATITFQGTIIGDKNAPIVAAFSSRGPSGASIGILKPDIIGPGVNI  507



>ref|XP_004159123.1| PREDICTED: LOW QUALITY PROTEIN: subtilisin-like protease-like 
[Cucumis sativus]
Length=751

 Score = 62.8 bits (151),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 29/54 (54%), Positives = 39/54 (72%), Gaps = 0/54 (0%)
 Frame = -2

Query  162  YISSTKNPLATILPTVTVTESKPAPAVAFFSSRGPSLASVNLLKPDICAPGVDI  1
            YI STKNP+  ++P      +KPAP +A FSSRGP+L S  ++KPD+ APGV+I
Sbjct  456  YIKSTKNPMGYLIPPTAKVNTKPAPTMAAFSSRGPNLISPEIIKPDVTAPGVNI  509



>ref|XP_002972591.1| hypothetical protein SELMODRAFT_97292 [Selaginella moellendorffii]
 gb|EFJ26677.1| hypothetical protein SELMODRAFT_97292 [Selaginella moellendorffii]
Length=686

 Score = 62.8 bits (151),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 30/54 (56%), Positives = 39/54 (72%), Gaps = 0/54 (0%)
 Frame = -2

Query  162  YISSTKNPLATILPTVTVTESKPAPAVAFFSSRGPSLASVNLLKPDICAPGVDI  1
            Y +ST+NP+A  LPT+  T  +    VA FSSRGP+L + ++LKPDI APGVDI
Sbjct  393  YANSTRNPIARFLPTIVRTGEEIKATVALFSSRGPNLITPDILKPDIVAPGVDI  446



>ref|XP_010918054.1| PREDICTED: subtilisin-like protease, partial [Elaeis guineensis]
Length=628

 Score = 62.8 bits (151),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 30/54 (56%), Positives = 39/54 (72%), Gaps = 0/54 (0%)
 Frame = -2

Query  162  YISSTKNPLATILPTVTVTESKPAPAVAFFSSRGPSLASVNLLKPDICAPGVDI  1
            YI S   P A+I    T+ ++KPAPA+AFFSSRGP+ A  N+LKPDI  PG++I
Sbjct  331  YIKSASTPTASITFKGTLMKTKPAPALAFFSSRGPNQADRNILKPDIVGPGMNI  384



>ref|XP_011044970.1| PREDICTED: subtilisin-like protease SBT5.3 [Populus euphratica]
Length=727

 Score = 62.8 bits (151),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 29/54 (54%), Positives = 41/54 (76%), Gaps = 0/54 (0%)
 Frame = -2

Query  162  YISSTKNPLATILPTVTVTESKPAPAVAFFSSRGPSLASVNLLKPDICAPGVDI  1
            Y+ + KNP A I PTVTV  +KPAP V  FSS+GP++ + +++KPDI APG++I
Sbjct  434  YMQAQKNPTARIAPTVTVLNTKPAPKVTVFSSQGPNIITPDIIKPDITAPGLNI  487



>ref|NP_001234257.1| subtilisin-like endoprotease precursor [Solanum lycopersicum]
 emb|CAA64566.1| subtilisin-like endoprotease [Solanum lycopersicum]
 emb|CAA76724.1| P69A protein [Solanum lycopersicum]
Length=745

 Score = 62.8 bits (151),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 32/54 (59%), Positives = 39/54 (72%), Gaps = 0/54 (0%)
 Frame = -2

Query  162  YISSTKNPLATILPTVTVTESKPAPAVAFFSSRGPSLASVNLLKPDICAPGVDI  1
            Y++ST NP+ATI    T+   K AP VA FSSRGPS AS+ +LKPDI  PGV+I
Sbjct  454  YMNSTSNPVATITFQGTIIGDKNAPIVAAFSSRGPSGASIGILKPDIIGPGVNI  507



>ref|XP_010910904.1| PREDICTED: subtilisin-like protease [Elaeis guineensis]
Length=741

 Score = 62.8 bits (151),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 30/54 (56%), Positives = 39/54 (72%), Gaps = 0/54 (0%)
 Frame = -2

Query  162  YISSTKNPLATILPTVTVTESKPAPAVAFFSSRGPSLASVNLLKPDICAPGVDI  1
            YI S   P A+I    T+ ++KPAPA+A+FSSRGPS A  N+LKPDI  PG++I
Sbjct  444  YIKSASTPTASITFKGTLMKTKPAPALAYFSSRGPSQADRNILKPDIVGPGMNI  497



>gb|EPS69827.1| hypothetical protein M569_04935, partial [Genlisea aurea]
Length=721

 Score = 62.8 bits (151),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 31/54 (57%), Positives = 39/54 (72%), Gaps = 0/54 (0%)
 Frame = -2

Query  162  YISSTKNPLATILPTVTVTESKPAPAVAFFSSRGPSLASVNLLKPDICAPGVDI  1
            YI++TKNP A+IL ++     +PAP VA FSSRGP   + N+LKPDI APGV I
Sbjct  424  YINTTKNPTASILSSIEKLNLRPAPMVASFSSRGPGALTENILKPDIMAPGVAI  477



>ref|XP_003625338.1| Subtilisin-like serine protease [Medicago truncatula]
 gb|AES81556.1| subtilisin-like serine protease [Medicago truncatula]
Length=766

 Score = 62.8 bits (151),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 31/54 (57%), Positives = 40/54 (74%), Gaps = 0/54 (0%)
 Frame = -2

Query  162  YISSTKNPLATILPTVTVTESKPAPAVAFFSSRGPSLASVNLLKPDICAPGVDI  1
            YI+STKNPL  I P  T  + KPAP++A FSSRGP+  +  +LKPD+ APGV+I
Sbjct  475  YINSTKNPLGYIHPPTTKLKIKPAPSMAVFSSRGPNTITPEILKPDVTAPGVNI  528



>ref|XP_010911578.1| PREDICTED: subtilisin-like protease, partial [Elaeis guineensis]
Length=444

 Score = 62.0 bits (149),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 30/54 (56%), Positives = 40/54 (74%), Gaps = 0/54 (0%)
 Frame = -2

Query  162  YISSTKNPLATILPTVTVTESKPAPAVAFFSSRGPSLASVNLLKPDICAPGVDI  1
            YI+S   P A+I    T+ ++KPAPA+A+FSSRGPS A  N+LKPDI  PG++I
Sbjct  149  YINSVSAPTASITFKGTLMKTKPAPALAYFSSRGPSKADRNILKPDIVGPGMNI  202



>ref|XP_002509669.1| Cucumisin precursor, putative [Ricinus communis]
 gb|EEF51056.1| Cucumisin precursor, putative [Ricinus communis]
Length=767

 Score = 62.8 bits (151),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 34/54 (63%), Positives = 38/54 (70%), Gaps = 0/54 (0%)
 Frame = -2

Query  162  YISSTKNPLATILPTVTVTESKPAPAVAFFSSRGPSLASVNLLKPDICAPGVDI  1
            YI+STK P+ATIL   TV     +PAV  FSSRGPSLAS  +LKPDI  PGV I
Sbjct  476  YINSTKTPMATILFKGTVIGDSSSPAVTSFSSRGPSLASPGILKPDIIGPGVSI  529



>ref|XP_010052138.1| PREDICTED: subtilisin-like protease SBT5.3 [Eucalyptus grandis]
Length=771

 Score = 62.8 bits (151),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 31/54 (57%), Positives = 41/54 (76%), Gaps = 0/54 (0%)
 Frame = -2

Query  162  YISSTKNPLATILPTVTVTESKPAPAVAFFSSRGPSLASVNLLKPDICAPGVDI  1
            YI STK+P A I+P  TV  +KPAPA+A  +SRGP++   ++LKPDI APGV+I
Sbjct  485  YIRSTKSPTARIVPARTVLYTKPAPAIAALTSRGPNVIDPDILKPDISAPGVNI  538



>ref|XP_006416427.1| hypothetical protein EUTSA_v10006858mg [Eutrema salsugineum]
 gb|ESQ34780.1| hypothetical protein EUTSA_v10006858mg [Eutrema salsugineum]
Length=779

 Score = 62.4 bits (150),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 31/54 (57%), Positives = 41/54 (76%), Gaps = 0/54 (0%)
 Frame = -2

Query  162  YISSTKNPLATILPTVTVTESKPAPAVAFFSSRGPSLASVNLLKPDICAPGVDI  1
            YI+ST+ P+ATI+PT + T    AP++  FSSRGP L + +LLKPDI APGV+I
Sbjct  469  YINSTREPIATIMPTRSRTGHMLAPSIPSFSSRGPYLLTRSLLKPDIAAPGVNI  522



>ref|XP_006601388.1| PREDICTED: subtilisin-like protease-like [Glycine max]
Length=561

 Score = 62.4 bits (150),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 30/54 (56%), Positives = 41/54 (76%), Gaps = 0/54 (0%)
 Frame = -2

Query  162  YISSTKNPLATILPTVTVTESKPAPAVAFFSSRGPSLASVNLLKPDICAPGVDI  1
            Y++STKNPL  I P  T  + KPAP++A FSSRGP++ +  +LKPD+ APGV+I
Sbjct  268  YMNSTKNPLGYIDPPKTKLQIKPAPSMAAFSSRGPNIVTPEILKPDVTAPGVNI  321



>ref|XP_006358147.1| PREDICTED: subtilisin-like protease SDD1-like [Solanum tuberosum]
Length=730

 Score = 62.4 bits (150),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 32/54 (59%), Positives = 39/54 (72%), Gaps = 0/54 (0%)
 Frame = -2

Query  162  YISSTKNPLATILPTVTVTESKPAPAVAFFSSRGPSLASVNLLKPDICAPGVDI  1
            YI+ST  P+A+IL   TV  +K AP+VAFFSSRGPS  S  +LKPDI  PG +I
Sbjct  439  YINSTSTPMASILFKGTVIGNKHAPSVAFFSSRGPSRTSPGILKPDIIGPGFNI  492



>gb|KFK31536.1| hypothetical protein AALP_AA6G125100 [Arabis alpina]
Length=788

 Score = 62.4 bits (150),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 31/54 (57%), Positives = 39/54 (72%), Gaps = 0/54 (0%)
 Frame = -2

Query  162  YISSTKNPLATILPTVTVTESKPAPAVAFFSSRGPSLASVNLLKPDICAPGVDI  1
            YI + K P+A I P  TV ++KPAP V  FSSRGPS+   N+LKPDI APG++I
Sbjct  493  YIKTDKKPIAFIKPGETVYKNKPAPFVTGFSSRGPSMIDPNILKPDITAPGLNI  546



>ref|XP_006859003.1| hypothetical protein AMTR_s00068p00149940 [Amborella trichopoda]
 gb|ERN20470.1| hypothetical protein AMTR_s00068p00149940 [Amborella trichopoda]
Length=766

 Score = 62.4 bits (150),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 30/54 (56%), Positives = 40/54 (74%), Gaps = 0/54 (0%)
 Frame = -2

Query  162  YISSTKNPLATILPTVTVTESKPAPAVAFFSSRGPSLASVNLLKPDICAPGVDI  1
            Y++S+KNP A I+P  TV   KPAP +A FSS GP++   N+LKPDI APG++I
Sbjct  476  YLNSSKNPTAKIIPATTVNGYKPAPVMAAFSSTGPNVLDPNILKPDITAPGLNI  529



>ref|NP_001142096.1| uncharacterized protein LOC100274260 [Zea mays]
 gb|ACF87635.1| unknown [Zea mays]
Length=497

 Score = 62.0 bits (149),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 33/54 (61%), Positives = 38/54 (70%), Gaps = 0/54 (0%)
 Frame = -2

Query  162  YISSTKNPLATILPTVTVTESKPAPAVAFFSSRGPSLASVNLLKPDICAPGVDI  1
            YI ST  P ATI    TV  S PAP+VAFFSSRGP+ AS  +LKPDI  PG++I
Sbjct  200  YIKSTPRPTATITFRGTVMGSSPAPSVAFFSSRGPNKASPGILKPDITGPGMNI  253



>ref|XP_006424267.1| hypothetical protein CICLE_v10030373mg [Citrus clementina]
 gb|ESR37507.1| hypothetical protein CICLE_v10030373mg [Citrus clementina]
Length=561

 Score = 62.0 bits (149),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 27/54 (50%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  162  YISSTKNPLATILPTVTVTESKPAPAVAFFSSRGPSLASVNLLKPDICAPGVDI  1
            Y ++ KNP+A I PT T+ ++KPAP +A FSS GP++ + ++++PDI APGV+I
Sbjct  268  YTTTGKNPIARIYPTQTILKTKPAPEMAAFSSMGPNIITADIIRPDITAPGVNI  321



>ref|XP_006355621.1| PREDICTED: subtilisin-like protease-like [Solanum tuberosum]
Length=758

 Score = 62.4 bits (150),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 28/54 (52%), Positives = 41/54 (76%), Gaps = 0/54 (0%)
 Frame = -2

Query  162  YISSTKNPLATILPTVTVTESKPAPAVAFFSSRGPSLASVNLLKPDICAPGVDI  1
            YI + KNP+AT++P  T+  +KPAP +A F+S+GP++   N+LKPDI APG +I
Sbjct  468  YIRTEKNPMATLVPGNTLIGTKPAPVMASFTSKGPNIVDPNILKPDITAPGFNI  521



>ref|XP_010272679.1| PREDICTED: subtilisin-like protease SBT5.4 [Nelumbo nucifera]
Length=773

 Score = 62.4 bits (150),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 30/54 (56%), Positives = 41/54 (76%), Gaps = 0/54 (0%)
 Frame = -2

Query  162  YISSTKNPLATILPTVTVTESKPAPAVAFFSSRGPSLASVNLLKPDICAPGVDI  1
            YI+STK P+A I+P  +V  +KPAP +A FSS GP++   N++KPDI APGV+I
Sbjct  482  YINSTKKPMAKIVPGKSVLNAKPAPYMAGFSSTGPNVIEPNIIKPDITAPGVNI  535



>tpg|DAA42972.1| TPA: putative subtilase family protein [Zea mays]
Length=748

 Score = 62.4 bits (150),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 33/54 (61%), Positives = 38/54 (70%), Gaps = 0/54 (0%)
 Frame = -2

Query  162  YISSTKNPLATILPTVTVTESKPAPAVAFFSSRGPSLASVNLLKPDICAPGVDI  1
            YI ST  P ATI    TV  S PAP+VAFFSSRGP+ AS  +LKPDI  PG++I
Sbjct  451  YIKSTPRPTATITFRGTVMGSSPAPSVAFFSSRGPNKASPGILKPDITGPGMNI  504



>ref|NP_001145938.1| uncharacterized protein LOC100279461 precursor [Zea mays]
 gb|ACL52885.1| unknown [Zea mays]
Length=803

 Score = 62.4 bits (150),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 33/54 (61%), Positives = 39/54 (72%), Gaps = 1/54 (2%)
 Frame = -2

Query  162  YISSTKNPLATILPTVTVTESKPAPAVAFFSSRGPSLASVNLLKPDICAPGVDI  1
            YI+STKNP A IL T  V + KPAP VA FS+RGP L   ++LKPD+ APGV I
Sbjct  481  YINSTKNPTAVILQTEDVGDFKPAPVVASFSARGPGLTE-SILKPDLMAPGVSI  533



>ref|XP_004967678.1| PREDICTED: subtilisin-like protease-like [Setaria italica]
Length=781

 Score = 62.4 bits (150),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 32/54 (59%), Positives = 40/54 (74%), Gaps = 1/54 (2%)
 Frame = -2

Query  162  YISSTKNPLATILPTVTVTESKPAPAVAFFSSRGPSLASVNLLKPDICAPGVDI  1
            YI+STK+P A ILPT  V + KPAP VA FS+RGP +   ++LKPD+ APGV I
Sbjct  480  YINSTKDPTAVILPTEDVKDFKPAPVVASFSARGPGMTE-SILKPDLMAPGVSI  532



>gb|KFK44142.1| hypothetical protein AALP_AA1G220500 [Arabis alpina]
Length=706

 Score = 62.0 bits (149),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 30/54 (56%), Positives = 41/54 (76%), Gaps = 0/54 (0%)
 Frame = -2

Query  162  YISSTKNPLATILPTVTVTESKPAPAVAFFSSRGPSLASVNLLKPDICAPGVDI  1
            YI+ST+ P+A I+PT + T  K AP++  FS+RGP L + +LLKPDI APGV+I
Sbjct  470  YINSTREPIAMIMPTQSQTGHKLAPSIPSFSARGPYLLTRSLLKPDIVAPGVNI  523



>gb|KHN03560.1| Subtilisin-like protease, partial [Glycine soja]
Length=609

 Score = 62.0 bits (149),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 30/54 (56%), Positives = 41/54 (76%), Gaps = 0/54 (0%)
 Frame = -2

Query  162  YISSTKNPLATILPTVTVTESKPAPAVAFFSSRGPSLASVNLLKPDICAPGVDI  1
            Y++STKNPL  I P  T  + KPAP++A FSSRGP++ +  +LKPD+ APGV+I
Sbjct  321  YMNSTKNPLGYIDPPKTKLQIKPAPSMAAFSSRGPNIVTPEILKPDVTAPGVNI  374



>ref|XP_008672702.1| PREDICTED: uncharacterized protein LOC100279461 isoform X1 [Zea 
mays]
 tpg|DAA54193.1| TPA: putative subtilase family protein [Zea mays]
Length=782

 Score = 62.0 bits (149),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 33/54 (61%), Positives = 39/54 (72%), Gaps = 1/54 (2%)
 Frame = -2

Query  162  YISSTKNPLATILPTVTVTESKPAPAVAFFSSRGPSLASVNLLKPDICAPGVDI  1
            YI+STKNP A IL T  V + KPAP VA FS+RGP L   ++LKPD+ APGV I
Sbjct  481  YINSTKNPTAVILQTEDVGDFKPAPVVASFSARGPGLTE-SILKPDLMAPGVSI  533



>ref|XP_004300737.1| PREDICTED: subtilisin-like protease SDD1-like [Fragaria vesca 
subsp. vesca]
Length=721

 Score = 62.0 bits (149),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 33/54 (61%), Positives = 37/54 (69%), Gaps = 0/54 (0%)
 Frame = -2

Query  162  YISSTKNPLATILPTVTVTESKPAPAVAFFSSRGPSLASVNLLKPDICAPGVDI  1
            YI+ST  P ATIL   TV   + APAV  FSSRGPS+AS  +LKPDI  PGV I
Sbjct  424  YINSTSTPTATILFKGTVIGDQNAPAVTSFSSRGPSIASTGILKPDIIGPGVSI  477



>ref|XP_002523127.1| Xylem serine proteinase 1 precursor, putative [Ricinus communis]
 gb|EEF39312.1| Xylem serine proteinase 1 precursor, putative [Ricinus communis]
Length=704

 Score = 62.0 bits (149),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 31/54 (57%), Positives = 39/54 (72%), Gaps = 0/54 (0%)
 Frame = -2

Query  162  YISSTKNPLATILPTVTVTESKPAPAVAFFSSRGPSLASVNLLKPDICAPGVDI  1
            Y+SST NP A ++   T    KPAP VAFFSSRGP+  S+ ++KPD+ APGVDI
Sbjct  397  YMSSTPNPRAMMVFRGTQVGVKPAPVVAFFSSRGPNTRSMYVMKPDVIAPGVDI  450



>ref|XP_004296128.1| PREDICTED: subtilisin-like protease-like [Fragaria vesca subsp. 
vesca]
Length=718

 Score = 62.0 bits (149),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 33/54 (61%), Positives = 39/54 (72%), Gaps = 0/54 (0%)
 Frame = -2

Query  162  YISSTKNPLATILPTVTVTESKPAPAVAFFSSRGPSLASVNLLKPDICAPGVDI  1
            Y++STK PLA I    TV  +KPAP +A FSSRGPS    ++LKPDI APGVDI
Sbjct  461  YLNSTKTPLARITRVKTVHGTKPAPVMAAFSSRGPSPIEPSILKPDITAPGVDI  514



>ref|XP_007132414.1| hypothetical protein PHAVU_011G092600g [Phaseolus vulgaris]
 gb|ESW04408.1| hypothetical protein PHAVU_011G092600g [Phaseolus vulgaris]
Length=760

 Score = 62.0 bits (149),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 29/54 (54%), Positives = 41/54 (76%), Gaps = 0/54 (0%)
 Frame = -2

Query  162  YISSTKNPLATILPTVTVTESKPAPAVAFFSSRGPSLASVNLLKPDICAPGVDI  1
            Y+ + KNP A I+PTVTV  +KPAP +A FSS GP++ + +++KPDI  PGV+I
Sbjct  466  YVKTDKNPTARIIPTVTVVGTKPAPEMAAFSSIGPNIITPDIIKPDITGPGVNI  519



>ref|XP_008802988.1| PREDICTED: subtilisin-like protease SDD1 [Phoenix dactylifera]
Length=762

 Score = 62.0 bits (149),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 30/54 (56%), Positives = 39/54 (72%), Gaps = 0/54 (0%)
 Frame = -2

Query  162  YISSTKNPLATILPTVTVTESKPAPAVAFFSSRGPSLASVNLLKPDICAPGVDI  1
            YI+S   P A+I    TV  + PAPAVA+FSSRGP++A  N+LKPDI  PGV++
Sbjct  469  YINSASAPTASITFKGTVIGTSPAPAVAYFSSRGPNMADRNILKPDIVGPGVNV  522



>ref|XP_009114399.1| PREDICTED: subtilisin-like protease SBT5.3 [Brassica rapa]
Length=790

 Score = 62.0 bits (149),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 29/54 (54%), Positives = 40/54 (74%), Gaps = 0/54 (0%)
 Frame = -2

Query  162  YISSTKNPLATILPTVTVTESKPAPAVAFFSSRGPSLASVNLLKPDICAPGVDI  1
            YI + KNP+A I P  TV +++PAP +  FSSRGP++   N+LKPDI APG++I
Sbjct  496  YIKTDKNPIAFIKPGTTVYKNQPAPLMTGFSSRGPNVVDPNILKPDITAPGLNI  549



>ref|XP_007132413.1| hypothetical protein PHAVU_011G092600g [Phaseolus vulgaris]
 gb|ESW04407.1| hypothetical protein PHAVU_011G092600g [Phaseolus vulgaris]
Length=681

 Score = 62.0 bits (149),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 29/54 (54%), Positives = 41/54 (76%), Gaps = 0/54 (0%)
 Frame = -2

Query  162  YISSTKNPLATILPTVTVTESKPAPAVAFFSSRGPSLASVNLLKPDICAPGVDI  1
            Y+ + KNP A I+PTVTV  +KPAP +A FSS GP++ + +++KPDI  PGV+I
Sbjct  387  YVKTDKNPTARIIPTVTVVGTKPAPEMAAFSSIGPNIITPDIIKPDITGPGVNI  440



>ref|XP_004959107.1| PREDICTED: cucumisin-like [Setaria italica]
Length=717

 Score = 62.0 bits (149),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 31/54 (57%), Positives = 43/54 (80%), Gaps = 1/54 (2%)
 Frame = -2

Query  162  YISSTKNPLATILPTVTVTESKPAPAVAFFSSRGPSLASVNLLKPDICAPGVDI  1
            Y +ST++P+ATI  +VTV ++  APAVA FSSRGP++ +  +LKPD+ APGVDI
Sbjct  421  YYNSTRHPVATIKKSVTVKDAA-APAVAQFSSRGPNMITYGVLKPDLSAPGVDI  473



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 517806786618