BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c80661_g1_i1 len=1613 path=[1:0-1612]

Length=1613
                                                                      Score     E

emb|CDO99748.1|  unnamed protein product                                435   6e-146   
dbj|BAC98491.1|  AG-motif binding protein-1                             433   7e-145   Nicotiana tabacum [American tobacco]
ref|XP_009598426.1|  PREDICTED: GATA transcription factor 8-like        432   1e-144   
ref|XP_009760862.1|  PREDICTED: GATA transcription factor 8-like        429   1e-143   
ref|XP_009628969.1|  PREDICTED: LOW QUALITY PROTEIN: GATA transcr...    427   4e-143   
dbj|BAC98495.1|  AG-motif binding protein-5                             422   1e-140   Nicotiana tabacum [American tobacco]
ref|XP_011084325.1|  PREDICTED: GATA transcription factor 8             409   1e-135   
ref|XP_006345791.1|  PREDICTED: GATA transcription factor 8-like ...    405   2e-134   
ref|XP_004239665.1|  PREDICTED: GATA transcription factor 8-like ...    403   2e-133   
ref|XP_004239666.1|  PREDICTED: GATA transcription factor 8-like ...    401   1e-132   
ref|XP_004239667.2|  PREDICTED: GATA transcription factor 8-like ...    404   1e-132   
ref|XP_009605437.1|  PREDICTED: GATA transcription factor 8-like        400   3e-132   
ref|XP_002273502.1|  PREDICTED: GATA transcription factor 8-like        400   4e-132   Vitis vinifera
ref|XP_011076972.1|  PREDICTED: GATA transcription factor 8-like        397   4e-131   
ref|XP_009802378.1|  PREDICTED: GATA transcription factor 8-like        396   1e-130   
ref|XP_006350222.1|  PREDICTED: GATA transcription factor 8-like ...    387   4e-127   
ref|XP_004236632.1|  PREDICTED: GATA transcription factor 8             374   4e-122   
ref|XP_010092608.1|  GATA transcription factor 9                        356   1e-114   
ref|XP_007009854.1|  Plant-specific GATA-type zinc finger transcr...    353   1e-113   
ref|XP_007009853.1|  Plant-specific GATA-type zinc finger transcr...    349   3e-111   
ref|XP_002311088.1|  zinc finger family protein                         345   2e-110   Populus trichocarpa [western balsam poplar]
ref|XP_006436435.1|  hypothetical protein CICLE_v10032018mg             343   7e-110   
gb|KDO44680.1|  hypothetical protein CISIN_1g016706mg                   343   4e-109   
gb|KDP44375.1|  hypothetical protein JCGZ_20055                         339   4e-108   
ref|XP_006378769.1|  hypothetical protein POPTR_0010s23010g             337   2e-107   
ref|XP_011031733.1|  PREDICTED: GATA transcription factor 8-like        337   2e-107   
ref|XP_011041012.1|  PREDICTED: GATA transcription factor 8-like        335   8e-107   
dbj|BAP90356.1|  GATA type zinc finger domain                           334   4e-106   
ref|XP_002534043.1|  GATA transcription factor, putative                332   1e-105   Ricinus communis
ref|XP_007218229.1|  hypothetical protein PRUPE_ppa007936mg             325   7e-103   
ref|XP_008233316.1|  PREDICTED: GATA transcription factor 8             323   4e-102   
ref|XP_003536350.1|  PREDICTED: GATA transcription factor 8-like ...    317   1e-99    
ref|XP_004496271.1|  PREDICTED: GATA transcription factor 8-like ...    317   1e-99    
gb|KHN17141.1|  GATA transcription factor 9                             315   3e-99    
ref|XP_008347480.1|  PREDICTED: GATA transcription factor 8-like        313   3e-98    
ref|XP_007143712.1|  hypothetical protein PHAVU_007G095300g             313   3e-98    
gb|EYU39843.1|  hypothetical protein MIMGU_mgv1a010405mg                311   5e-98    
ref|XP_009345388.1|  PREDICTED: GATA transcription factor 8-like        312   6e-98    
ref|XP_006574762.1|  PREDICTED: GATA transcription factor 8-like ...    311   1e-97    
ref|XP_008446884.1|  PREDICTED: GATA transcription factor 8             311   2e-97    
ref|XP_009344766.1|  PREDICTED: GATA transcription factor 8-like        310   1e-96    
ref|XP_009770305.1|  PREDICTED: GATA transcription factor 8-like        305   3e-96    
ref|XP_003519961.2|  PREDICTED: GATA transcription factor 8-like ...    310   4e-96    
ref|XP_003548072.1|  PREDICTED: GATA transcription factor 8-like ...    305   4e-95    
ref|XP_004142426.1|  PREDICTED: GATA transcription factor 9-like        303   2e-94    
ref|XP_003556234.1|  PREDICTED: GATA transcription factor 8-like ...    302   7e-94    
ref|XP_008367332.1|  PREDICTED: GATA transcription factor 8-like        302   8e-94    
ref|XP_006606248.1|  PREDICTED: GATA transcription factor 8-like ...    302   8e-94    
ref|XP_010683872.1|  PREDICTED: GATA transcription factor 8             300   1e-93    
gb|KHG18876.1|  GATA transcription factor 8 -like protein               298   2e-92    
ref|XP_007151876.1|  hypothetical protein PHAVU_004G083100g             287   3e-88    
ref|XP_010253699.1|  PREDICTED: GATA transcription factor 8-like        284   3e-87    
ref|XP_010067308.1|  PREDICTED: GATA transcription factor 8-like        284   4e-87    
gb|KHG25368.1|  GATA transcription factor 8 -like protein               280   1e-85    
ref|XP_010264666.1|  PREDICTED: GATA transcription factor 8-like        279   2e-85    
ref|XP_004307386.1|  PREDICTED: GATA transcription factor 9-like        279   6e-85    
gb|ACJ02090.1|  AG-motif binding protein                                275   7e-84    Garcinia mangostana [mangosteen]
ref|XP_003591890.1|  GATA transcription factor                          259   1e-77    
ref|XP_003591891.1|  GATA transcription factor                          259   2e-77    
ref|XP_010032183.1|  PREDICTED: GATA transcription factor 8-like ...    245   4e-72    
ref|XP_004149904.1|  PREDICTED: GATA transcription factor 4-like        216   2e-61    
ref|XP_008456488.1|  PREDICTED: LOW QUALITY PROTEIN: GATA transcr...    213   4e-60    
emb|CBI31452.3|  unnamed protein product                                207   9e-60    
ref|XP_010032187.1|  PREDICTED: GATA transcription factor 8-like ...    204   4e-57    
gb|AES62142.2|  GATA type zinc finger transcription factor family...    199   5e-56    
gb|KHN00843.1|  GATA transcription factor 8                             192   3e-53    
gb|EYU39605.1|  hypothetical protein MIMGU_mgv1a011769mg                187   4e-51    
gb|KHN00692.1|  GATA transcription factor 8                             181   5e-50    
emb|CDY07522.1|  BnaC06g15420D                                          183   4e-49    
ref|XP_009382468.1|  PREDICTED: GATA transcription factor 4-like        175   1e-45    
ref|XP_009418333.1|  PREDICTED: GATA transcription factor 8-like ...    169   2e-43    
ref|XP_009418334.1|  PREDICTED: GATA transcription factor 8-like ...    169   2e-43    
ref|XP_011081778.1|  PREDICTED: GATA transcription factor 12-like       163   2e-41    
ref|XP_006424556.1|  hypothetical protein CICLE_v10029015mg             160   3e-41    
ref|XP_008805201.1|  PREDICTED: GATA transcription factor 4-like        160   6e-40    
ref|XP_003592781.1|  GATA transcription factor                          154   2e-39    
gb|EYU20427.1|  hypothetical protein MIMGU_mgv1a008924mg                157   3e-39    
ref|XP_006488078.1|  PREDICTED: GATA transcription factor 11-like       154   7e-39    
ref|XP_011089286.1|  PREDICTED: GATA transcription factor 11-like       154   2e-38    
gb|KDP44040.1|  hypothetical protein JCGZ_05507                         153   3e-38    
ref|XP_004487098.1|  PREDICTED: GATA transcription factor 11-like       152   3e-38    
ref|XP_010924658.1|  PREDICTED: GATA transcription factor 12-like       153   4e-38    
gb|KGN60319.1|  hypothetical protein Csa_3G895650                       153   4e-38    
ref|XP_006359773.1|  PREDICTED: GATA transcription factor 12-like       153   5e-38    
ref|XP_009392221.1|  PREDICTED: GATA transcription factor 8-like        152   6e-38    
ref|XP_010249552.1|  PREDICTED: GATA transcription factor 12            152   6e-38    
ref|XP_011092007.1|  PREDICTED: GATA transcription factor 12            152   1e-37    
ref|XP_010267189.1|  PREDICTED: GATA transcription factor 12-like       152   1e-37    
ref|XP_010935873.1|  PREDICTED: LOW QUALITY PROTEIN: GATA transcr...    153   1e-37    
ref|XP_004245156.2|  PREDICTED: GATA transcription factor 12            152   2e-37    
ref|XP_002284028.1|  PREDICTED: GATA transcription factor 9             150   2e-37    Vitis vinifera
ref|XP_011089920.1|  PREDICTED: GATA transcription factor 11-like...    150   3e-37    
ref|XP_011089919.1|  PREDICTED: GATA transcription factor 11-like...    151   3e-37    
ref|XP_006846789.1|  hypothetical protein AMTR_s00148p00049970          149   4e-37    
ref|XP_003540186.1|  PREDICTED: GATA transcription factor 11-like       150   4e-37    
gb|KHN11215.1|  GATA transcription factor 10                            149   5e-37    
ref|XP_011019597.1|  PREDICTED: GATA transcription factor 12            150   5e-37    
ref|XP_008466068.1|  PREDICTED: GATA transcription factor 9-like        150   7e-37    
emb|CBI36080.3|  unnamed protein product                                148   7e-37    
emb|CDP07101.1|  unnamed protein product                                149   8e-37    
ref|XP_011014869.1|  PREDICTED: GATA transcription factor 12-like       150   9e-37    
ref|XP_010504307.1|  PREDICTED: GATA transcription factor 8             149   1e-36    
ref|XP_010516023.1|  PREDICTED: GATA transcription factor 8-like        149   1e-36    
ref|XP_010427202.1|  PREDICTED: GATA transcription factor 8-like ...    149   1e-36    
gb|KDP34159.1|  hypothetical protein JCGZ_07730                         149   1e-36    
ref|XP_010427201.1|  PREDICTED: GATA transcription factor 8-like ...    148   1e-36    
ref|XP_008807395.1|  PREDICTED: GATA transcription factor 8             150   2e-36    
gb|KHG08445.1|  GATA transcription factor 11 -like protein              149   2e-36    
ref|XP_010555821.1|  PREDICTED: GATA transcription factor 8             148   2e-36    
ref|XP_008804627.1|  PREDICTED: GATA transcription factor 9-like        149   2e-36    
ref|XP_008393856.1|  PREDICTED: GATA transcription factor 12-like       149   3e-36    
ref|XP_002876270.1|  BME3/BME3-ZF                                       147   4e-36    
emb|CDP08170.1|  unnamed protein product                                147   5e-36    
ref|XP_010906504.1|  PREDICTED: GATA transcription factor 8             148   6e-36    
gb|EMT09679.1|  GATA transcription factor 11                            146   7e-36    
dbj|BAH20385.1|  AT3G54810                                              146   8e-36    Arabidopsis thaliana [mouse-ear cress]
ref|NP_191041.1|  GATA transcription factor 8                           146   8e-36    Arabidopsis thaliana [mouse-ear cress]
ref|XP_006340186.1|  PREDICTED: GATA transcription factor 11-like       146   8e-36    
ref|XP_007226931.1|  hypothetical protein PRUPE_ppa015753mg             147   1e-35    
ref|XP_007150193.1|  hypothetical protein PHAVU_005G134400g             145   1e-35    
ref|XP_004162986.1|  PREDICTED: GATA transcription factor 12-like       145   1e-35    
gb|EMS65328.1|  GATA transcription factor 11                            141   2e-35    
ref|XP_004148425.1|  PREDICTED: GATA transcription factor 12-like       145   2e-35    
ref|XP_008220089.1|  PREDICTED: GATA transcription factor 12            146   2e-35    
ref|XP_002283745.1|  PREDICTED: GATA transcription factor 9             145   2e-35    Vitis vinifera
emb|CDX67609.1|  BnaA07g16490D                                          144   2e-35    
ref|XP_009103933.1|  PREDICTED: GATA transcription factor 8-like        144   2e-35    
ref|XP_009628152.1|  PREDICTED: GATA transcription factor 12-like       145   3e-35    
ref|XP_009776828.1|  PREDICTED: GATA transcription factor 12            145   3e-35    
ref|XP_006403533.1|  hypothetical protein EUTSA_v10010544mg             144   3e-35    
ref|XP_003550120.1|  PREDICTED: GATA transcription factor 12-like       145   4e-35    
gb|KGN62802.1|  hypothetical protein Csa_2G373450                       145   4e-35    
gb|EYU18824.1|  hypothetical protein MIMGU_mgv1a008576mg                143   4e-35    
gb|ACL52876.1|  unknown                                                 139   5e-35    Zea mays [maize]
ref|XP_010668515.1|  PREDICTED: GATA transcription factor 12-like       145   5e-35    
emb|CDY67017.1|  BnaCnng53150D                                          144   6e-35    
ref|XP_009631501.1|  PREDICTED: GATA transcription factor 9-like        145   6e-35    
ref|XP_004251141.1|  PREDICTED: GATA transcription factor 11-like       144   7e-35    
gb|ADL36690.1|  GATA domain class transcription factor                  144   7e-35    
emb|CDX78264.1|  BnaA09g34590D                                          143   8e-35    
ref|XP_010031983.1|  PREDICTED: GATA transcription factor 10-like...    143   8e-35    
ref|XP_002308598.1|  zinc finger family protein                         144   8e-35    Populus trichocarpa [western balsam poplar]
ref|XP_010031984.1|  PREDICTED: GATA transcription factor 10-like...    143   8e-35    
emb|CDX73447.1|  BnaC08g25560D                                          143   9e-35    
emb|CDO97987.1|  unnamed protein product                                144   9e-35    
ref|XP_009116158.1|  PREDICTED: GATA transcription factor 8             143   1e-34    
ref|XP_010554544.1|  PREDICTED: GATA transcription factor 8-like        143   1e-34    
ref|XP_010235943.1|  PREDICTED: PHD finger protein rhinoceros-like      145   1e-34    
gb|EYU18823.1|  hypothetical protein MIMGU_mgv1a008576mg                144   1e-34    
ref|XP_007137230.1|  hypothetical protein PHAVU_009G110400g             142   1e-34    
ref|XP_008378072.1|  PREDICTED: GATA transcription factor 12-like       143   2e-34    
ref|XP_007016761.1|  GATA zinc finger protein regulating nitrogen...    142   2e-34    
ref|XP_002529940.1|  GATA transcription factor, putative                142   2e-34    Ricinus communis
gb|ACU24388.1|  unknown                                                 142   2e-34    Glycine max [soybeans]
ref|XP_009410894.1|  PREDICTED: GATA transcription factor 9-like ...    143   3e-34    
ref|XP_010915683.1|  PREDICTED: GATA transcription factor 12            142   3e-34    
ref|XP_009802675.1|  PREDICTED: GATA transcription factor 12            142   3e-34    
ref|XP_003543479.1|  PREDICTED: GATA transcription factor 11-like       141   3e-34    
ref|XP_009394172.1|  PREDICTED: GATA transcription factor 9-like ...    142   4e-34    
ref|XP_007012149.1|  GATA transcription factor 9, putative              142   4e-34    
gb|KHN21512.1|  GATA transcription factor 11                            141   4e-34    
gb|AFK40558.1|  unknown                                                 133   5e-34    
gb|KHG10199.1|  GATA transcription factor 12 -like protein              142   5e-34    
gb|KHG27547.1|  GATA transcription factor 10 -like protein              141   6e-34    
ref|XP_004501147.1|  PREDICTED: GATA transcription factor 12-like       140   6e-34    
emb|CDY02894.1|  BnaC04g25920D                                          140   1e-33    
gb|ACN36994.1|  unknown                                                 139   1e-33    Zea mays [maize]
ref|XP_009795846.1|  PREDICTED: GATA transcription factor 11-like...    139   1e-33    
ref|XP_011088480.1|  PREDICTED: GATA transcription factor 5-like        140   1e-33    
ref|XP_010264324.1|  PREDICTED: GATA transcription factor 4-like        138   1e-33    
ref|XP_009795845.1|  PREDICTED: GATA transcription factor 11-like...    139   1e-33    
gb|KHN05677.1|  GATA transcription factor 11                            137   1e-33    
gb|EPS57111.1|  hypothetical protein M569_17712                         132   1e-33    
ref|XP_009621794.1|  PREDICTED: GATA transcription factor 11-like...    139   1e-33    
ref|XP_009621793.1|  PREDICTED: GATA transcription factor 11-like...    139   1e-33    
gb|AFW64083.1|  putative GATA transcription factor family protein       139   2e-33    
emb|CAC28528.1|  GATA-1 zinc finger protein                             139   2e-33    Nicotiana tabacum [American tobacco]
gb|AAK98698.1|AC069158_10  Putative GATA-1 zinc finger protein          141   2e-33    Oryza sativa [red rice]
ref|XP_002324216.2|  hypothetical protein POPTR_0018s08090g             139   2e-33    Populus trichocarpa [western balsam poplar]
ref|XP_006372032.1|  hypothetical protein POPTR_0018s08090g             137   3e-33    
ref|XP_002453007.1|  hypothetical protein SORBIDRAFT_04g036520          140   4e-33    Sorghum bicolor [broomcorn]
gb|ACL54362.1|  unknown                                                 140   4e-33    Zea mays [maize]
ref|NP_001146600.1|  putative GATA transcription factor family pr...    140   4e-33    Zea mays [maize]
ref|XP_004954283.1|  PREDICTED: GATA transcription factor 8-like ...    140   4e-33    
gb|AFW73937.1|  putative GATA transcription factor family protein...    140   4e-33    
dbj|BAJ84868.1|  predicted protein                                      140   4e-33    
ref|XP_007132266.1|  hypothetical protein PHAVU_011G080200g             137   5e-33    
ref|XP_009406167.1|  PREDICTED: GATA transcription factor 9-like        138   5e-33    
ref|XP_004242094.2|  PREDICTED: GATA transcription factor 11-like       136   6e-33    
ref|XP_003597258.1|  GATA transcription factor                          137   7e-33    
ref|XP_008810653.1|  PREDICTED: GATA transcription factor 12-like       138   8e-33    
ref|XP_004235652.1|  PREDICTED: GATA transcription factor 12-like       138   1e-32    
ref|XP_002313763.2|  hypothetical protein POPTR_0009s12620g             137   1e-32    Populus trichocarpa [western balsam poplar]
ref|XP_009410893.1|  PREDICTED: GATA transcription factor 12-like...    138   1e-32    
ref|XP_009394171.1|  PREDICTED: GATA transcription factor 9-like ...    137   2e-32    
ref|XP_003539767.1|  PREDICTED: GATA transcription factor 11-like       136   2e-32    
gb|KHG09661.1|  GATA transcription factor 11 -like protein              136   2e-32    
ref|XP_010109771.1|  hypothetical protein L484_008447                   136   2e-32    
ref|XP_006365758.1|  PREDICTED: GATA transcription factor 10-like       134   3e-32    
gb|KHG05024.1|  GATA transcription factor 11 -like protein              136   4e-32    
ref|XP_003603626.1|  GATA transcription factor                          135   4e-32    
emb|CDY06293.1|  BnaA09g49100D                                          134   5e-32    
gb|KHN38758.1|  GATA transcription factor 11                            134   6e-32    
ref|XP_003538192.1|  PREDICTED: GATA transcription factor 11-like       134   8e-32    
gb|ACU23703.1|  unknown                                                 134   1e-31    Glycine max [soybeans]
ref|XP_006644696.1|  PREDICTED: GATA transcription factor 12-like       135   1e-31    
ref|XP_007205805.1|  hypothetical protein PRUPE_ppa010692mg             131   2e-31    
ref|XP_009598797.1|  PREDICTED: GATA transcription factor 11-like...    132   2e-31    
ref|XP_010089971.1|  Protein-tyrosine sulfotransferase                  139   2e-31    
ref|XP_009774660.1|  PREDICTED: GATA transcription factor 11-like       132   2e-31    
ref|XP_010542590.1|  PREDICTED: GATA transcription factor 11-like       132   2e-31    
ref|XP_004506013.1|  PREDICTED: GATA transcription factor 11-like       133   3e-31    
ref|XP_003540668.1|  PREDICTED: GATA transcription factor 7-like        132   3e-31    
ref|NP_001044227.1|  Os01g0745700                                       134   3e-31    Oryza sativa Japonica Group [Japonica rice]
ref|XP_009598796.1|  PREDICTED: GATA transcription factor 11-like...    131   3e-31    
gb|EYU37853.1|  hypothetical protein MIMGU_mgv1a009692mg                133   3e-31    
ref|XP_008245237.1|  PREDICTED: GATA transcription factor 11-like...    132   3e-31    
ref|XP_010054482.1|  PREDICTED: GATA transcription factor 2-like        132   3e-31    
gb|EAY75795.1|  hypothetical protein OsI_03711                          134   3e-31    Oryza sativa Indica Group [Indian rice]
ref|XP_009118398.1|  PREDICTED: GATA transcription factor 11-like       131   3e-31    
ref|XP_008245238.1|  PREDICTED: GATA transcription factor 11-like...    132   4e-31    
ref|XP_008359134.1|  PREDICTED: GATA transcription factor 11-like...    132   4e-31    
ref|XP_008385404.1|  PREDICTED: GATA transcription factor 11            131   4e-31    
ref|XP_009367061.1|  PREDICTED: GATA transcription factor 11            132   5e-31    
emb|CDY22706.1|  BnaC08g43400D                                          130   6e-31    
ref|XP_008359133.1|  PREDICTED: GATA transcription factor 11-like...    132   7e-31    
ref|XP_008359306.1|  PREDICTED: GATA transcription factor 11-like       131   7e-31    
ref|XP_006649146.1|  PREDICTED: GATA transcription factor 8-like        131   7e-31    
gb|EYU36178.1|  hypothetical protein MIMGU_mgv1a0095201mg               132   9e-31    
ref|XP_009767386.1|  PREDICTED: GATA transcription factor 1-like        130   9e-31    
dbj|BAC98492.1|  AG-motif binding protein-2                             130   9e-31    Nicotiana tabacum [American tobacco]
ref|XP_009618082.1|  PREDICTED: GATA transcription factor 1-like ...    129   9e-31    
ref|XP_011091388.1|  PREDICTED: GATA transcription factor 1             130   9e-31    
ref|XP_006384910.1|  hypothetical protein POPTR_0004s22140g             129   1e-30    
ref|XP_006304051.1|  hypothetical protein CARUB_v10009871mg             130   1e-30    
ref|XP_009148049.1|  PREDICTED: GATA transcription factor 11-like       130   1e-30    
emb|CDX95103.1|  BnaC05g05680D                                          130   1e-30    
ref|XP_006294768.1|  hypothetical protein CARUB_v10023820mg             130   1e-30    
ref|XP_004291710.1|  PREDICTED: GATA transcription factor 11-like       131   1e-30    
ref|XP_009618081.1|  PREDICTED: GATA transcription factor 1-like ...    130   1e-30    
gb|KEH30032.1|  GATA type zinc finger transcription factor family...    132   1e-30    
ref|XP_011073745.1|  PREDICTED: GATA transcription factor 1-like ...    130   1e-30    
ref|XP_011073746.1|  PREDICTED: GATA transcription factor 1-like ...    130   1e-30    
ref|XP_004507504.1|  PREDICTED: GATA transcription factor 5-like ...    130   2e-30    
emb|CDO96997.1|  unnamed protein product                                130   2e-30    
ref|XP_007156103.1|  hypothetical protein PHAVU_003G258900g             131   2e-30    
ref|XP_010493840.1|  PREDICTED: GATA transcription factor 12-like       130   3e-30    
ref|XP_009110913.1|  PREDICTED: GATA transcription factor 11-like       129   3e-30    
ref|XP_010414544.1|  PREDICTED: putative GATA transcription facto...    129   4e-30    
ref|XP_009802570.1|  PREDICTED: GATA transcription factor 5-like        129   4e-30    
ref|XP_010414543.1|  PREDICTED: putative GATA transcription facto...    127   4e-30    
ref|XP_011040891.1|  PREDICTED: GATA transcription factor 11-like...    129   4e-30    
ref|XP_010414546.1|  PREDICTED: putative GATA transcription facto...    129   5e-30    
ref|XP_006409859.1|  hypothetical protein EUTSA_v10017012mg             129   5e-30    
ref|XP_010414542.1|  PREDICTED: putative GATA transcription facto...    127   5e-30    
emb|CDX71356.1|  BnaC04g15910D                                          128   5e-30    
ref|XP_010470100.1|  PREDICTED: putative GATA transcription facto...    128   5e-30    
ref|XP_010458021.1|  PREDICTED: GATA transcription factor 11-like       129   6e-30    
ref|XP_011040892.1|  PREDICTED: GATA transcription factor 11-like...    129   6e-30    
dbj|BAC98494.1|  AG-motif binding protein-4                             129   6e-30    Nicotiana tabacum [American tobacco]
ref|XP_010475585.1|  PREDICTED: GATA transcription factor 11-like       129   6e-30    
emb|CDO99396.1|  unnamed protein product                                128   6e-30    
ref|XP_011090119.1|  PREDICTED: GATA transcription factor 2-like        127   7e-30    
ref|XP_010488262.1|  PREDICTED: GATA transcription factor 11-like       129   7e-30    
ref|XP_009758423.1|  PREDICTED: GATA transcription factor 1             127   7e-30    
ref|XP_010526169.1|  PREDICTED: GATA transcription factor 9             129   8e-30    
ref|XP_010510639.1|  PREDICTED: putative GATA transcription facto...    125   8e-30    
ref|XP_009606887.1|  PREDICTED: GATA transcription factor 1-like ...    127   8e-30    
ref|XP_010521758.1|  PREDICTED: GATA transcription factor 11-like       128   9e-30    
ref|XP_003624611.1|  GATA transcription factor                          127   9e-30    
ref|XP_009631302.1|  PREDICTED: GATA transcription factor 5-like        129   1e-29    
ref|XP_009606886.1|  PREDICTED: GATA transcription factor 1-like ...    127   1e-29    
ref|XP_009103677.1|  PREDICTED: GATA transcription factor 11 isof...    128   1e-29    
emb|CDY58825.1|  BnaAnng15440D                                          127   1e-29    
emb|CDY04556.1|  BnaA07g13820D                                          128   1e-29    
ref|XP_004230938.1|  PREDICTED: GATA transcription factor 5             128   1e-29    
ref|XP_009103676.1|  PREDICTED: GATA transcription factor 11 isof...    128   1e-29    
gb|EYU43811.1|  hypothetical protein MIMGU_mgv1a011652mg                127   1e-29    
gb|ABR16093.1|  unknown                                                 128   1e-29    Picea sitchensis
ref|NP_172279.1|  GATA transcription factor 11                          127   1e-29    
gb|EYU32614.1|  hypothetical protein MIMGU_mgv1a023497mg                126   1e-29    
ref|XP_008656467.1|  PREDICTED: GATA transcription factor 12-like       129   2e-29    
ref|XP_010454925.1|  PREDICTED: GATA transcription factor 12-like       128   2e-29    
ref|XP_008337889.1|  PREDICTED: GATA transcription factor 5             128   2e-29    
ref|XP_009800952.1|  PREDICTED: GATA transcription factor 5-like        126   2e-29    
gb|EPS67172.1|  hypothetical protein M569_07604                         125   2e-29    
ref|XP_006417739.1|  hypothetical protein EUTSA_v10008338mg             127   2e-29    
ref|XP_011100952.1|  PREDICTED: GATA transcription factor 5-like        128   2e-29    
ref|XP_010046437.1|  PREDICTED: GATA transcription factor 12-like       124   3e-29    
ref|XP_009588688.1|  PREDICTED: GATA transcription factor 5-like        125   3e-29    
ref|XP_010470099.1|  PREDICTED: putative GATA transcription facto...    125   3e-29    
ref|XP_011037193.1|  PREDICTED: GATA transcription factor 5-like        127   3e-29    
ref|XP_004232457.2|  PREDICTED: GATA transcription factor 5-like        128   3e-29    
ref|XP_011010123.1|  PREDICTED: GATA transcription factor 12-like       126   3e-29    
emb|CBI16323.3|  unnamed protein product                                128   3e-29    
ref|XP_006362004.1|  PREDICTED: GATA transcription factor 5-like        127   3e-29    
dbj|BAJ92617.1|  predicted protein                                      128   4e-29    
ref|XP_003619010.1|  GATA transcription factor                          124   4e-29    
emb|CDX93600.1|  BnaA06g04480D                                          126   4e-29    
ref|XP_010426650.1|  PREDICTED: GATA transcription factor 6-like        126   4e-29    
ref|XP_010651174.1|  PREDICTED: GATA transcription factor 8-like        129   4e-29    
ref|XP_006847160.1|  hypothetical protein AMTR_s00017p00242860          124   4e-29    
ref|XP_009338657.1|  PREDICTED: GATA transcription factor 5-like        127   5e-29    
ref|XP_010510638.1|  PREDICTED: putative GATA transcription facto...    125   5e-29    
gb|KHN32754.1|  GATA transcription factor 9                             125   5e-29    
gb|ADL36694.1|  GATA domain class transcription factor                  127   5e-29    
ref|XP_003539005.1|  PREDICTED: GATA transcription factor 5-like        126   5e-29    
ref|XP_009378216.1|  PREDICTED: GATA transcription factor 5-like        126   6e-29    
ref|XP_010326807.1|  PREDICTED: GATA transcription factor 1             125   6e-29    
ref|XP_008357175.1|  PREDICTED: GATA transcription factor 5-like        126   6e-29    
ref|NP_201433.1|  GATA transcription factor 5                           127   6e-29    
gb|EYU42584.1|  hypothetical protein MIMGU_mgv1a010838mg                125   6e-29    
gb|AES75228.2|  GATA type zinc finger transcription factor family...    124   7e-29    
ref|XP_010510637.1|  PREDICTED: putative GATA transcription facto...    125   7e-29    
ref|XP_003548060.1|  PREDICTED: GATA transcription factor 9-like        125   7e-29    
gb|AFK46483.1|  unknown                                                 125   7e-29    
ref|XP_003607047.1|  GATA transcription factor                          125   7e-29    
ref|NP_001159272.1|  uncharacterized protein LOC100304362               124   7e-29    
gb|EYU29287.1|  hypothetical protein MIMGU_mgv1a024688mg                127   7e-29    
gb|AFK35594.1|  unknown                                                 125   7e-29    
ref|XP_003603996.1|  GATA transcription factor                          125   7e-29    
ref|XP_006340696.1|  PREDICTED: GATA transcription factor 5-like        126   7e-29    
ref|XP_004239871.1|  PREDICTED: GATA transcription factor 1-like        124   7e-29    
ref|XP_010033458.1|  PREDICTED: GATA transcription factor 5-like        120   7e-29    
gb|AES74247.2|  GATA type zinc finger transcription factor family...    125   8e-29    
ref|XP_010513267.1|  PREDICTED: GATA transcription factor 1-like ...    124   8e-29    
gb|EPS57889.1|  hypothetical protein M569_16927                         125   8e-29    
ref|XP_006854315.1|  hypothetical protein AMTR_s00039p00112210          124   8e-29    
gb|EPS63160.1|  hypothetical protein M569_11630                         125   8e-29    
gb|KHN08159.1|  GATA transcription factor 9                             125   8e-29    
ref|XP_003554005.1|  PREDICTED: GATA transcription factor 5-like        125   9e-29    
ref|XP_011047468.1|  PREDICTED: GATA transcription factor 5-like        126   9e-29    
ref|XP_010690771.1|  PREDICTED: GATA transcription factor 7-like        125   9e-29    
ref|XP_009395984.1|  PREDICTED: GATA transcription factor 9-like        126   9e-29    
ref|XP_006423461.1|  hypothetical protein CICLE_v10028860mg             125   9e-29    
ref|XP_004969927.1|  PREDICTED: GATA transcription factor 12-like       127   9e-29    
ref|XP_010488503.1|  PREDICTED: GATA transcription factor 1-like ...    123   9e-29    
ref|XP_010066212.1|  PREDICTED: GATA transcription factor 6-like        126   1e-28    
ref|XP_010513260.1|  PREDICTED: GATA transcription factor 1-like ...    124   1e-28    
ref|XP_010466791.1|  PREDICTED: GATA transcription factor 1-like ...    124   1e-28    
ref|NP_001056071.1|  Os05g0520300                                       127   1e-28    
ref|XP_004290341.1|  PREDICTED: GATA transcription factor 5-like        126   1e-28    
ref|XP_002305457.2|  hypothetical protein POPTR_0004s16860g             125   1e-28    
gb|EPS59023.1|  hypothetical protein M569_15789                         125   1e-28    
ref|XP_007217275.1|  hypothetical protein PRUPE_ppa017460mg             125   1e-28    
ref|XP_006487363.1|  PREDICTED: GATA transcription factor 5-like        125   1e-28    
gb|KDO40065.1|  hypothetical protein CISIN_1g021193mg                   125   1e-28    
ref|XP_008228438.1|  PREDICTED: GATA transcription factor 9-like        125   1e-28    
ref|XP_004150343.1|  PREDICTED: GATA transcription factor 1-like        124   1e-28    
gb|KHN39835.1|  GATA transcription factor 7                             125   1e-28    
emb|CDY13505.1|  BnaA03g52230D                                          124   1e-28    
ref|XP_009394834.1|  PREDICTED: GATA transcription factor 9-like ...    125   1e-28    
gb|ABK26808.1|  unknown                                                 120   1e-28    
gb|EYU31150.1|  hypothetical protein MIMGU_mgv1a018773mg                125   1e-28    
ref|XP_010466792.1|  PREDICTED: GATA transcription factor 1-like ...    123   1e-28    
ref|XP_006853640.1|  hypothetical protein AMTR_s00056p00080350          125   1e-28    
ref|XP_010484661.1|  PREDICTED: GATA transcription factor 5-like        125   1e-28    
gb|ADL36693.1|  GATA domain class transcription factor                  125   1e-28    
ref|XP_008460722.1|  PREDICTED: GATA transcription factor 1 isofo...    124   1e-28    
ref|XP_010470098.1|  PREDICTED: putative GATA transcription facto...    124   1e-28    
ref|XP_010557328.1|  PREDICTED: GATA transcription factor 11-like       125   1e-28    
ref|XP_010521511.1|  PREDICTED: GATA transcription factor 9-like        124   1e-28    
ref|XP_002518163.1|  GATA transcription factor, putative                122   1e-28    
emb|CDY32815.1|  BnaC08g02370D                                          124   1e-28    
ref|XP_007034503.1|  GATA transcription factor 1, putative              123   1e-28    
ref|XP_009394835.1|  PREDICTED: GATA transcription factor 9-like ...    125   1e-28    
ref|XP_008392662.1|  PREDICTED: GATA transcription factor 9-like        125   1e-28    
ref|XP_006465677.1|  PREDICTED: GATA transcription factor 12-like       125   1e-28    
gb|KHG12527.1|  GATA transcription factor 9 -like protein               124   1e-28    
ref|XP_002892428.1|  zinc finger family protein                         125   1e-28    
ref|XP_009149294.1|  PREDICTED: GATA transcription factor 6             124   2e-28    
ref|XP_010488502.1|  PREDICTED: GATA transcription factor 1-like ...    124   2e-28    
gb|KDP39718.1|  hypothetical protein JCGZ_02738                         124   2e-28    
ref|XP_004141657.1|  PREDICTED: GATA transcription factor 9-like        125   2e-28    
gb|KCW53097.1|  hypothetical protein EUGRSUZ_J02392                     120   2e-28    
gb|KHG24532.1|  GATA transcription factor 1 -like protein               123   2e-28    
ref|XP_006426898.1|  hypothetical protein CICLE_v10027138mg             126   2e-28    
ref|XP_003527843.1|  PREDICTED: GATA transcription factor 12-like       125   2e-28    
ref|XP_006294728.1|  hypothetical protein CARUB_v10023774mg             124   2e-28    
gb|KDO51760.1|  hypothetical protein CISIN_1g019919mg                   125   2e-28    
emb|CDY33298.1|  BnaA01g19650D                                          124   2e-28    
gb|EAZ13513.1|  hypothetical protein OsJ_03429                          126   2e-28    
ref|XP_008460721.1|  PREDICTED: GATA transcription factor 1 isofo...    124   2e-28    
ref|XP_007024273.1|  GATA transcription factor 9, putative              125   2e-28    
emb|CBI20840.3|  unnamed protein product                                122   2e-28    
ref|XP_008462442.1|  PREDICTED: GATA transcription factor 9-like        125   2e-28    
emb|CDX72377.1|  BnaC07g43990D                                          125   2e-28    
ref|XP_010264014.1|  PREDICTED: GATA transcription factor 1             124   2e-28    
ref|XP_006412416.1|  hypothetical protein EUTSA_v10025757mg             125   2e-28    
ref|XP_009138148.1|  PREDICTED: GATA transcription factor 9-like        124   2e-28    
ref|XP_010679831.1|  PREDICTED: GATA transcription factor 7             124   2e-28    
ref|XP_006394835.1|  hypothetical protein EUTSA_v10004553mg             125   2e-28    
ref|XP_006403956.1|  hypothetical protein EUTSA_v10010566mg             124   2e-28    
gb|KDP40876.1|  hypothetical protein JCGZ_24875                         125   2e-28    
ref|XP_007161927.1|  hypothetical protein PHAVU_001G109500g             124   2e-28    
ref|NP_001280850.1|  GATA transcription factor 5-like                   124   2e-28    
ref|XP_010098128.1|  GATA transcription factor 9                        125   2e-28    
gb|AFK34183.1|  unknown                                                 118   2e-28    
emb|CDX80542.1|  BnaC07g29020D                                          125   2e-28    
gb|ADD09603.1|  zinc finger (GATA type) family protein                  124   2e-28    
gb|KDO46288.1|  hypothetical protein CISIN_1g024771mg                   122   2e-28    
ref|XP_010245657.1|  PREDICTED: GATA transcription factor 1-like        124   2e-28    
emb|CDX68902.1|  BnaC01g05510D                                          124   2e-28    
emb|CDX94847.1|  BnaC03g43410D                                          122   2e-28    
emb|CDX68908.1|  BnaC01g05450D                                          124   2e-28    
ref|XP_010437836.1|  PREDICTED: GATA transcription factor 9-like        124   3e-28    
ref|XP_006572850.1|  PREDICTED: uncharacterized protein LOC100783...    124   3e-28    
ref|XP_009135870.1|  PREDICTED: GATA transcription factor 1             123   3e-28    
ref|XP_006355741.1|  PREDICTED: GATA transcription factor 1-like        123   3e-28    
ref|XP_010447323.1|  PREDICTED: GATA transcription factor 9-like        124   3e-28    
ref|XP_009378427.1|  PREDICTED: GATA transcription factor 5-like        124   3e-28    
ref|XP_011046757.1|  PREDICTED: GATA transcription factor 9-like        124   3e-28    
ref|NP_197955.1|  GATA transcription factor 12                          124   3e-28    
ref|XP_010047283.1|  PREDICTED: GATA transcription factor 12-like       125   3e-28    
ref|NP_190677.1|  GATA transcription factor 6                           124   3e-28    
ref|XP_002885621.1|  hypothetical protein ARALYDRAFT_479930             123   3e-28    
ref|XP_003523746.1|  PREDICTED: GATA transcription factor 12-like       124   3e-28    
gb|KDP28810.1|  hypothetical protein JCGZ_14581                         123   3e-28    
ref|XP_003548758.1|  PREDICTED: GATA transcription factor 9-like        123   3e-28    
ref|XP_006340920.1|  PREDICTED: GATA transcription factor 1-like        123   3e-28    
ref|XP_003567108.1|  PREDICTED: GATA transcription factor 12            125   3e-28    
ref|XP_009151105.1|  PREDICTED: GATA transcription factor 12            124   3e-28    
ref|XP_002869237.1|  zinc finger family protein                         124   3e-28    
ref|XP_002303808.2|  hypothetical protein POPTR_0003s17340g             122   3e-28    
emb|CDY26535.1|  BnaC01g23640D                                          123   3e-28    
ref|XP_009605872.1|  PREDICTED: GATA transcription factor 5             125   3e-28    
emb|CDX87075.1|  BnaC09g03900D                                          124   3e-28    
ref|XP_009591827.1|  PREDICTED: GATA transcription factor 4-like        123   3e-28    
ref|XP_006420528.1|  hypothetical protein CICLE_v10005658mg             122   3e-28    
ref|XP_010432642.1|  PREDICTED: GATA transcription factor 9-like        124   3e-28    
ref|XP_006492137.1|  PREDICTED: GATA transcription factor 1-like        122   3e-28    
ref|NP_195015.1|  GATA transcription factor 9                           124   4e-28    
ref|XP_007042041.1|  GATA transcription factor 5, putative              124   4e-28    
ref|XP_008655150.1|  PREDICTED: uncharacterized protein LOC100304...    125   4e-28    
gb|KDO46287.1|  hypothetical protein CISIN_1g024771mg                   122   4e-28    
ref|XP_007204696.1|  hypothetical protein PRUPE_ppa008278mg             124   4e-28    
gb|KEH41211.1|  GATA type zinc finger transcription factor family...    122   4e-28    
gb|KHG06288.1|  GATA transcription factor 9 -like protein               124   4e-28    
ref|XP_006846028.1|  hypothetical protein AMTR_s00155p00085360          126   4e-28    
ref|XP_009138942.1|  PREDICTED: GATA transcription factor 5-like        124   4e-28    
ref|XP_004302868.1|  PREDICTED: GATA transcription factor 9-like        124   4e-28    
emb|CDX89441.1|  BnaA01g14520D                                          124   4e-28    
ref|XP_003566028.1|  PREDICTED: GATA transcription factor 12-like       125   4e-28    
gb|ACU17869.1|  unknown                                                 123   4e-28    
dbj|BAE99493.1|  GATA transcription factor 1                            119   4e-28    
ref|XP_002960543.1|  hypothetical protein SELMODRAFT_69566              117   4e-28    
ref|NP_189047.1|  GATA transcription factor 1                           123   4e-28    
ref|XP_008440788.1|  PREDICTED: GATA transcription factor 7-like        123   4e-28    
ref|XP_010519882.1|  PREDICTED: GATA transcription factor 12            124   4e-28    
ref|NP_001146093.1|  uncharacterized protein LOC100279625               125   4e-28    
ref|XP_006393827.1|  hypothetical protein EUTSA_v10004566mg             124   4e-28    
gb|KHG27335.1|  GATA transcription factor 5 -like protein               124   4e-28    
dbj|BAK07945.1|  predicted protein                                      125   4e-28    
ref|XP_007131760.1|  hypothetical protein PHAVU_011G039600g             123   4e-28    
ref|XP_009125288.1|  PREDICTED: GATA transcription factor 9             124   4e-28    
ref|XP_006298300.1|  hypothetical protein CARUB_v10014365mg             121   4e-28    
gb|AAM65139.1|  GATA transcription factor 1 (AtGATA-1)                  122   5e-28    
ref|XP_009111680.1|  PREDICTED: GATA transcription factor 12-like       124   5e-28    
emb|CDX75297.1|  BnaA01g04050D                                          123   5e-28    
ref|XP_010918855.1|  PREDICTED: GATA transcription factor 1-like        122   5e-28    
ref|XP_004291171.1|  PREDICTED: GATA transcription factor 12-like       125   5e-28    
gb|KHG08475.1|  GATA transcription factor 12 -like protein              123   5e-28    
ref|NP_001150502.1|  GATA zinc finger family protein                    125   5e-28    
gb|AFW72550.1|  putative GATA transcription factor family protein       125   5e-28    
ref|XP_007030701.1|  GATA transcription factor 9, putative              123   5e-28    
gb|KFK29899.1|  hypothetical protein AALP_AA7G192900                    124   5e-28    
ref|XP_002325826.2|  hypothetical protein POPTR_0019s04860g             123   5e-28    
ref|XP_010421443.1|  PREDICTED: GATA transcription factor 12            124   5e-28    
ref|XP_008445001.1|  PREDICTED: GATA transcription factor 12-like       124   5e-28    
emb|CDY19792.1|  BnaA09g04450D                                          123   5e-28    
ref|XP_006298301.1|  hypothetical protein CARUB_v10014365mg             122   5e-28    
ref|XP_002458475.1|  hypothetical protein SORBIDRAFT_03g034360          125   6e-28    
ref|XP_002319169.2|  hypothetical protein POPTR_0013s05610g             123   6e-28    
emb|CDP19135.1|  unnamed protein product                                117   6e-28    
emb|CDX81398.1|  BnaC09g08090D                                          124   6e-28    
ref|NP_001053437.2|  Os04g0539500                                       120   6e-28    
gb|AFK36201.1|  unknown                                                 119   6e-28    
ref|XP_004493146.1|  PREDICTED: GATA transcription factor 9-like        122   6e-28    
ref|XP_007046767.1|  GATA transcription factor 5, putative              124   6e-28    
ref|XP_011020707.1|  PREDICTED: GATA transcription factor 1             122   6e-28    
ref|XP_009136583.1|  PREDICTED: GATA transcription factor 6-like        123   6e-28    
ref|XP_011034353.1|  PREDICTED: GATA transcription factor 5-like        123   7e-28    
ref|XP_010270320.1|  PREDICTED: GATA transcription factor 9-like        121   7e-28    
ref|XP_006288129.1|  hypothetical protein CARUB_v10001360mg             124   7e-28    
ref|NP_172278.1|  GATA transcription factor 10                          123   7e-28    
gb|KFK27827.1|  hypothetical protein AALP_AA8G434900                    123   7e-28    
ref|XP_010444812.1|  PREDICTED: GATA transcription factor 5-like        123   7e-28    
ref|XP_008380945.1|  PREDICTED: GATA transcription factor 12-like       123   7e-28    
ref|XP_004172012.1|  PREDICTED: GATA transcription factor 9-like        123   7e-28    
emb|CDP01939.1|  unnamed protein product                                124   7e-28    
ref|XP_008447537.1|  PREDICTED: GATA transcription factor 4-like        123   7e-28    
ref|XP_010691426.1|  PREDICTED: GATA transcription factor 12-like       123   7e-28    
ref|XP_004309759.1|  PREDICTED: GATA transcription factor 1-like ...    120   7e-28    
ref|XP_009346302.1|  PREDICTED: GATA transcription factor 5-like        123   8e-28    
gb|KHG09448.1|  GATA transcription factor 9 -like protein               123   8e-28    
ref|XP_002880933.1|  hypothetical protein ARALYDRAFT_901675             123   8e-28    
ref|XP_008812058.1|  PREDICTED: GATA transcription factor 2-like        121   8e-28    
gb|EPS68410.1|  hypothetical protein M569_06360                         119   8e-28    
ref|XP_009761911.1|  PREDICTED: GATA transcription factor 5             124   8e-28    
gb|KHN00670.1|  GATA transcription factor 9                             122   8e-28    



>emb|CDO99748.1| unnamed protein product [Coffea canephora]
Length=341

 Score =   435 bits (1119),  Expect = 6e-146, Method: Compositional matrix adjust.
 Identities = 243/316 (77%), Positives = 273/316 (86%), Gaps = 3/316 (1%)
 Frame = +1

Query  169   MGSNFMDELDCGSFFDHIDDLIEFPPENECVGG-VGSGEFKNFPSIWNDPLPDSEPLFSG  345
             MG NF+DE+DCGSFFDHIDDLIEFPPENEC  G VGSG+ KNFPS+W++ LPD++ LF+G
Sbjct  1     MGPNFVDEIDCGSFFDHIDDLIEFPPENECGNGLVGSGDCKNFPSLWDEALPDTDTLFTG  60

Query  346   SHNNSAADLSAELSVPYEDIIQLEWLSTFVEDSFSGGGMTLGKENTPVNVEPPHNKFQTs  525
             + +NSA+DLSAELSVPYEDI+QLEWLSTFVEDSFSGGGMTL K+N+ VN + P N+FQTS
Sbjct  61    NTSNSASDLSAELSVPYEDIVQLEWLSTFVEDSFSGGGMTLSKDNSSVNKDNPCNQFQTS  120

Query  526   spvsvlesssssssssscsGGKTTIPLSPSRCGVQRARSKRPRPATFNPRPAIQLISPTS  705
             SPVSVLESSSSSSSSS   GGKT IPLSP+  G QRARSKRPRPATFNPRPAIQLISP +
Sbjct  121   SPVSVLESSSSSSSSSCS-GGKT-IPLSPNHRGPQRARSKRPRPATFNPRPAIQLISPPA  178

Query  706   SFTEAPQPFVAPAVSSESENFAESPMKKLTTRPEAPEQkkkkkikFTIPIAPVDTNQNQP  885
             SF+EAP  F+AP VSSESENFAES   +   +P   E KKKKKIK T+P+ P++ NQN  
Sbjct  179   SFSEAPHLFLAPGVSSESENFAESEFVRKFPKPAGGEHKKKKKIKLTVPLGPMEINQNSA  238

Query  886   PQAIRKCLHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFTPSLHSN  1065
             PQA+RKC+HCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTF PSLHSN
Sbjct  239   PQAVRKCMHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFVPSLHSN  298

Query  1066  SHKKVIEMRSKVGVEN  1113
             SHKKV+EMR KV  EN
Sbjct  299   SHKKVLEMRGKVVEEN  314



>dbj|BAC98491.1| AG-motif binding protein-1 [Nicotiana tabacum]
Length=343

 Score =   433 bits (1113),  Expect = 7e-145, Method: Compositional matrix adjust.
 Identities = 246/335 (73%), Positives = 272/335 (81%), Gaps = 9/335 (3%)
 Frame = +1

Query  169   MGSNFMDELDCGSFFDHIDDLIEFPPENECVGGVGSGEFKNFPSIWNDPLPDSEPLFSGS  348
             MGSN +DE+DCGSFFDHIDDLIEFP ENE   G+ S + K+FP+IWNDPLPDS+ LFSGS
Sbjct  1     MGSNLVDEIDCGSFFDHIDDLIEFPLENEG-AGLSSTDCKDFPTIWNDPLPDSDSLFSGS  59

Query  349   HNNSAADLSAELSVPYEDIIQLEWLSTFVEDSFSGGGMTLGKENTPVNVEPPHNKFQTss  528
             H NSA+D SAELSVPYEDI+QLEWLS FVEDSFSGGG+TLGK+N P+N E    KFQTSS
Sbjct  60    HRNSASDFSAELSVPYEDIVQLEWLSAFVEDSFSGGGLTLGKDNFPLNKETSEAKFQTSS  119

Query  529   pvsvlesssssssssscsGGKTTIPLS-PSRCGVQRARSKRPRPATFNPRPAIQLISPTS  705
             PVSVLESSSSSSSSS     + T+PLS P   G QRARSKRPRPATFNP PAIQLISPTS
Sbjct  120   PVSVLESSSSSSSSSCSV--EKTVPLSSPCHRGPQRARSKRPRPATFNPAPAIQLISPTS  177

Query  706   SFTEAPQPFVAPAVSSESENFAESPMKKLTTRPEAPEQkkkkkikFTIPIAPVDTNQNQP  885
             SFTE PQPFVAP ++SESENFAESPMKK+  +P   EQK KKK+K + P + V TNQN  
Sbjct  178   SFTEIPQPFVAPKITSESENFAESPMKKIL-KPAVAEQKTKKKLKLSFPSSLVKTNQNPV  236

Query  886   PQAIRKCLHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFTPSLHSN  1065
              Q IRKC HCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTF P++HSN
Sbjct  237   AQTIRKCQHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFVPAIHSN  296

Query  1066  SHKKVIEMRSKVGVENTAITEAPSTP----QPAFN  1158
             SHKKVIEMR+KV  +N A     + P    QP FN
Sbjct  297   SHKKVIEMRTKVVPDNNATIARTAPPATVTQPEFN  331



>ref|XP_009598426.1| PREDICTED: GATA transcription factor 8-like [Nicotiana tomentosiformis]
 ref|XP_009598427.1| PREDICTED: GATA transcription factor 8-like [Nicotiana tomentosiformis]
Length=343

 Score =   432 bits (1112),  Expect = 1e-144, Method: Compositional matrix adjust.
 Identities = 245/335 (73%), Positives = 271/335 (81%), Gaps = 9/335 (3%)
 Frame = +1

Query  169   MGSNFMDELDCGSFFDHIDDLIEFPPENECVGGVGSGEFKNFPSIWNDPLPDSEPLFSGS  348
             MGSN +DE+DCGSFFDHIDDLIEFP ENE   G+ S + K+FP+IWNDPLPDS+ LFSGS
Sbjct  1     MGSNLVDEIDCGSFFDHIDDLIEFPLENEG-AGLSSTDCKDFPTIWNDPLPDSDSLFSGS  59

Query  349   HNNSAADLSAELSVPYEDIIQLEWLSTFVEDSFSGGGMTLGKENTPVNVEPPHNKFQTss  528
             H NSA+D SAELSVPYEDI+QLEWLS FVEDSFSGGG+TLGK+N P+N E    KFQTSS
Sbjct  60    HRNSASDFSAELSVPYEDIVQLEWLSAFVEDSFSGGGLTLGKDNFPLNKETSEAKFQTSS  119

Query  529   pvsvlesssssssssscsGGKTTIPLS-PSRCGVQRARSKRPRPATFNPRPAIQLISPTS  705
             PVSVLESSSS SSSS     + T+PLS P   G QRARSKRPRPATFNP PAIQLISPTS
Sbjct  120   PVSVLESSSSCSSSSCSV--EKTVPLSSPCHRGPQRARSKRPRPATFNPAPAIQLISPTS  177

Query  706   SFTEAPQPFVAPAVSSESENFAESPMKKLTTRPEAPEQkkkkkikFTIPIAPVDTNQNQP  885
             SFTE PQPFVAP ++SESENFAESPMKK+  +P   EQK KKK+K + P + V TNQN  
Sbjct  178   SFTEIPQPFVAPKITSESENFAESPMKKIL-KPAVAEQKTKKKLKLSFPSSLVKTNQNPV  236

Query  886   PQAIRKCLHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFTPSLHSN  1065
              Q IRKC HCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTF P++HSN
Sbjct  237   AQTIRKCQHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFVPAIHSN  296

Query  1066  SHKKVIEMRSKVGVENTAITEAPSTP----QPAFN  1158
             SHKKVIEMR+KV  +N A     + P    QP FN
Sbjct  297   SHKKVIEMRTKVVPDNNATIARTAPPATVTQPEFN  331



>ref|XP_009760862.1| PREDICTED: GATA transcription factor 8-like [Nicotiana sylvestris]
 ref|XP_009760863.1| PREDICTED: GATA transcription factor 8-like [Nicotiana sylvestris]
Length=332

 Score =   429 bits (1104),  Expect = 1e-143, Method: Compositional matrix adjust.
 Identities = 250/338 (74%), Positives = 278/338 (82%), Gaps = 10/338 (3%)
 Frame = +1

Query  169   MGSNFMDELDCGSFFDHIDDLIEFPPENECVGGVGSGEFKNFPSIWNDPLPDSEPLFSGS  348
             MGSN +DE+DCGSFFD IDDLIEFP ENEC GG  S + K FPSIW+ P   S+PLFSGS
Sbjct  1     MGSNMVDEIDCGSFFDQIDDLIEFPSENEC-GGFSSTDCKEFPSIWDQP---SDPLFSGS  56

Query  349   HNNSAADLSAELSVPYEDIIQLEWLSTFVEDSFSGGGMTLGKENTPVNVEPPHNKFQTss  528
             +NNS +DLSAELSVPYEDI+QLEWLSTFVEDSFS GG+TLGKEN P+N E  H+KFQ+SS
Sbjct  57    YNNSPSDLSAELSVPYEDIVQLEWLSTFVEDSFSAGGLTLGKENAPINKETSHSKFQSSS  116

Query  529   pvsvlesssssssssscsGGKTTIPLSPSRCGVQRARSKRPRPATFNPRPAIQLISPTSS  708
             PVSVLESS SSSSSS       TIPLSP   G QRARSKRPRPATFNPRPAIQLISPTS 
Sbjct  117   PVSVLESSGSSSSSSCSG--GKTIPLSPCHRGPQRARSKRPRPATFNPRPAIQLISPTSV  174

Query  709   FTEAPQPFVAPAVSSESENFAESPMKKLTTRPEAPEQkkkkkikFTIPIAPVDTNQNQPP  888
             F E P+PFVAP  SSES NFA+SPMKK+  RP A EQK KKKIKFTIP+AP++TNQN   
Sbjct  175   FIENPRPFVAPVTSSESGNFAQSPMKKIP-RPAAAEQKTKKKIKFTIPLAPIETNQNSTA  233

Query  889   QAIRKCLHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFTPSLHSNS  1068
              A+R+C+HCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTF PS+HSNS
Sbjct  234   HAVRRCMHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFVPSMHSNS  293

Query  1069  HKKVIEMRSKVGVEN--TAITEAPST-PQPAFNNPSVE  1173
             HKKV+EMR+K   EN  TA T+ P+T  +  F+  SVE
Sbjct  294   HKKVLEMRTKDIPENNATARTQIPATITEHEFSKSSVE  331



>ref|XP_009628969.1| PREDICTED: LOW QUALITY PROTEIN: GATA transcription factor 8-like 
[Nicotiana tomentosiformis]
Length=320

 Score =   427 bits (1099),  Expect = 4e-143, Method: Compositional matrix adjust.
 Identities = 239/330 (72%), Positives = 265/330 (80%), Gaps = 19/330 (6%)
 Frame = +1

Query  169   MGSNFMDELDCGSFFDHIDDLIEFPPENECVGGVGSGEFKNFPSIWNDPLPDSEPLFSGS  348
             MGSNF+DE+DCGSFFD IDDLIEFP ENEC GG+ S + K FPSIW+ PLPDS+PLFSGS
Sbjct  1     MGSNFVDEIDCGSFFDQIDDLIEFPSENEC-GGLSSTDCKEFPSIWDQPLPDSDPLFSGS  59

Query  349   HNNSAADLSAELSVPYEDIIQLEWLSTFVEDSFSGGGMTLGKENTPVNVEPPHNKFQTss  528
             +NNS +DLSAELSVPYEDI+QLEWLSTFVEDSFSG G+TLGKEN P+N E  H+KFQ+SS
Sbjct  60    YNNSPSDLSAELSVPYEDIVQLEWLSTFVEDSFSGRGLTLGKENAPINKETSHSKFQSSS  119

Query  529   pvsvlesssssssssscsGGKTTIPLSPSRCGVQRARSKRPRPATFNPRPAIQLISPTSS  708
             PVSVLESSSSSSSSS   GGKT  PLSP   G QRARSKRPRP TFNPRPAIQLISPT  
Sbjct  120   PVSVLESSSSSSSSSCS-GGKT-FPLSPCHRGPQRARSKRPRPPTFNPRPAIQLISPTLV  177

Query  709   FTEAPQPFVAPAVSSESENFAESPMKKLTTRPEAPEQkkkkkikFTIPIAPVDTNQNQPP  888
             F E P+PF AP  SS+SEN AESPMKK+               KFTIP+AP++T  N   
Sbjct  178   FIENPRPFAAPVTSSQSENLAESPMKKI---------------KFTIPLAPIETIHNSTA  222

Query  889   QAIRKCLHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFTPSLHSNS  1068
              A+R+C+HCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTF PS+HSNS
Sbjct  223   HAVRRCMHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFVPSMHSNS  282

Query  1069  HKKVIEMRSKVGVENTAITEAPSTPQPAFN  1158
             HKKV+EMR+K   EN A   A +T Q  FN
Sbjct  283   HKKVLEMRTKDIPENNATXPA-TTIQQEFN  311



>dbj|BAC98495.1| AG-motif binding protein-5 [Nicotiana tabacum]
Length=342

 Score =   422 bits (1084),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 245/335 (73%), Positives = 268/335 (80%), Gaps = 10/335 (3%)
 Frame = +1

Query  169   MGSNFMDELDCGSFFDHIDDLIEFPPENECVGGVGSGEFKNFPSIWNDPLPDSEPLFSGS  348
             MGSN +DE+DCGSFFDHIDDLI+FP ENE   G+ S + K+FPSIWNDPLPDS+ LFSGS
Sbjct  1     MGSNLVDEIDCGSFFDHIDDLIDFPLENES-AGLSSTDCKDFPSIWNDPLPDSDSLFSGS  59

Query  349   HNNSAADLSAELSVPYEDIIQLEWLSTFVEDSFSGGGMTLGKENTPVNVEPPHNKFQTss  528
             H NSA+D SAELSVPYEDI+QLEWLSTFVEDSFSGGG+TLGKEN P+  E    KFQTSS
Sbjct  60    HRNSASDFSAELSVPYEDIVQLEWLSTFVEDSFSGGGLTLGKENFPLYKETSEAKFQTSS  119

Query  529   pvsvlesssssssssscsGGKTTIPLS-PSRCGVQRARSKRPRPATFNPRPAIQLISPTS  705
             PVSVLESSSSSSSSS     + T+PLS P   G QRARSKRPRPATFNP P IQLISPTS
Sbjct  120   PVSVLESSSSSSSSSCSV--EKTVPLSSPCHRGPQRARSKRPRPATFNPAPVIQLISPTS  177

Query  706   SFTEAPQPFVAPAVSSESENFAESPMKKLTTRPEAPEQkkkkkikFTIPIAPVDTNQNQP  885
             SFTE PQPFVA  ++SESENFAESPMKK+  +P   EQKKKK    + P A V+ NQN  
Sbjct  178   SFTEIPQPFVARGIASESENFAESPMKKIL-KPAVAEQKKKKLK-LSFPSARVEANQNPV  235

Query  886   PQAIRKCLHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFTPSLHSN  1065
              Q IRKC HCE+TKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTF PS+HSN
Sbjct  236   AQTIRKCQHCEMTKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFVPSIHSN  295

Query  1066  SHKKVIEMRSKV---GVENTAITEAPST-PQPAFN  1158
             SHKKVIEMR+K       N A T  P+T  QP FN
Sbjct  296   SHKKVIEMRTKFVPDNNANIARTAPPATVTQPEFN  330



>ref|XP_011084325.1| PREDICTED: GATA transcription factor 8 [Sesamum indicum]
Length=333

 Score =   409 bits (1050),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 234/315 (74%), Positives = 258/315 (82%), Gaps = 6/315 (2%)
 Frame = +1

Query  169   MGSNFMDELDCGSFFDHIDDLIEFPPENECVGG----VGSGEFKNFPSIWNDPLPDSEPL  336
             MG NFMDE+DCG+FFD IDDLIEFPPENE  GG    V S + K F S+WND LP+S+P 
Sbjct  1     MGPNFMDEIDCGNFFDQIDDLIEFPPENESGGGGGNLVSSVDSKAFSSMWNDALPESDPF  60

Query  337   FSGSHNNSAADLSAELSVPYEDIIQLEWLSTFVEDSFSGGGMTLGKENTPVNVEPPHNKF  516
             FSGSH NS++DLSAELSVPYEDI+QLEWLSTF+EDSFSG GMT+GKEN    +EP  N+F
Sbjct  61    FSGSHGNSSSDLSAELSVPYEDIVQLEWLSTFMEDSFSGQGMTVGKENLCPEMEPSDNQF  120

Query  517   QTsspvsvlesssssssssscsGGKTTIPLSPSRCGVQRARSKRPRPATFNPRPAIQLIS  696
             QTSSP+SVLESSSSSS+SSS       +PLSPS  G QRARSKRPRPATFNPR AIQLIS
Sbjct  121   QTSSPISVLESSSSSSTSSSSEA--KAMPLSPSHRGPQRARSKRPRPATFNPRAAIQLIS  178

Query  697   PTSSFTEAPQPFVAPAVSSESENFAESPMKKLTTRPEAPEQkkkkkikFTIPIAPVDTNQ  876
             PTSSF E PQPFVAP +SSESENFAES   K + +P   E KKKKKIK   P+   D +Q
Sbjct  179   PTSSFIETPQPFVAPGLSSESENFAESTTMKKSPKPAGLEPKKKKKIKIASPVDAEDAHQ  238

Query  877   NQPPQAIRKCLHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFTPSL  1056
             N P QA+RKC+HCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTF PSL
Sbjct  239   NPPAQAVRKCMHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFVPSL  298

Query  1057  HSNSHKKVIEMRSKV  1101
             HSNSHKKV+EMR KV
Sbjct  299   HSNSHKKVLEMRGKV  313



>ref|XP_006345791.1| PREDICTED: GATA transcription factor 8-like isoform X1 [Solanum 
tuberosum]
 ref|XP_006345792.1| PREDICTED: GATA transcription factor 8-like isoform X2 [Solanum 
tuberosum]
 ref|XP_006345793.1| PREDICTED: GATA transcription factor 8-like isoform X3 [Solanum 
tuberosum]
 ref|XP_006345794.1| PREDICTED: GATA transcription factor 8-like isoform X4 [Solanum 
tuberosum]
Length=328

 Score =   405 bits (1042),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 245/343 (71%), Positives = 269/343 (78%), Gaps = 27/343 (8%)
 Frame = +1

Query  169   MGSNFMDELDCGSFFDHIDDLIEFPPENECVGGVGSGEFKNFPSIWNDPLPDSEPLFSGS  348
             MGSN +DE+DCGSFFDHIDDLI+FP ENE VG + S + K+FPSIWNDPLPDS+ LFSGS
Sbjct  1     MGSNVVDEIDCGSFFDHIDDLIDFPLENENVG-LSSTDCKDFPSIWNDPLPDSDSLFSGS  59

Query  349   HNNSAADLSAELSVPYEDIIQLEWLSTFVEDSFSGGGMTLGKENTPVNVEP-PHNKFQTs  525
             H NSA+DLSAELSVPYEDI+QLEWLSTFVEDSFSGGG+TLGKEN PV  EP    KFQTS
Sbjct  60    HRNSASDLSAELSVPYEDIVQLEWLSTFVEDSFSGGGLTLGKENIPVEKEPLSQGKFQTS  119

Query  526   spvsvlesssssssssscsGGKTTIPLSPSRCGVQRARSKRPRPATFNPRPAIQLISPTS  705
             SPVSVLESSSSSSSS S SG KT +PLSP   G QRAR+KRPRP TFNP P         
Sbjct  120   SPVSVLESSSSSSSSFSSSGEKT-LPLSPCHRGPQRARTKRPRPTTFNPFPV--------  170

Query  706   SFTEAPQPFVAPAVSSESENFAESPMKKLTTRPEAPEQkkkkkikFTIPIAPVDTNQN-Q  882
                     FVAP V +ESENFAESPMKK   +P APEQKKKKKIKF++P+APV+TNQN  
Sbjct  171   --------FVAPGVPTESENFAESPMKK-NLKPAAPEQKKKKKIKFSVPLAPVETNQNPV  221

Query  883   PPQAIRKCLHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFTPSLHS  1062
               QA+RKC HCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTF P+LHS
Sbjct  222   AQQAVRKCQHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFVPALHS  281

Query  1063  NSHKKVIEMRSKVGVENTAITEAPS---TPQPAF---NNPSVE  1173
             NSHKKV+EMR+ +  +N  I    S     QP F   NN SVE
Sbjct  282   NSHKKVLEMRTTIVPDNDTIARTSSPAIATQPEFNPSNNVSVE  324



>ref|XP_004239665.1| PREDICTED: GATA transcription factor 8-like isoform X2 [Solanum 
lycopersicum]
Length=341

 Score =   403 bits (1036),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 244/345 (71%), Positives = 270/345 (78%), Gaps = 26/345 (8%)
 Frame = +1

Query  160   QGSMGSNFMDELDCGSFFDHIDDLIEFPPENECVGGVGSGEFKNFPSIWNDPLPDSEPLF  339
             Q +MGSN +DE+DCGSFFDHIDDLI+FP E+E VG + S + K+FPSIWNDPLPDS+ LF
Sbjct  12    QETMGSNVVDEIDCGSFFDHIDDLIDFPLESENVG-LSSTDCKDFPSIWNDPLPDSDSLF  70

Query  340   SGSHNNSAADLSAELSVPYEDIIQLEWLSTFVEDSFSGGGMTLGKENTPVNVEPP-HNKF  516
             SGSH NSA+DLSAELSVPYEDI+QLEWLSTFVEDSFSGGG+TLGKEN PV  EP    KF
Sbjct  71    SGSHRNSASDLSAELSVPYEDIVQLEWLSTFVEDSFSGGGLTLGKENIPVEKEPSSQGKF  130

Query  517   QTsspvsvlesssssssssscsGGKTTIPLSPSRCGVQRARSKRPRPATFNPRPAIQLIS  696
             QTSSPVSVLESSSSSSSS S SG KT +PLSP   G QRAR+KRPRP TFNP P      
Sbjct  131   QTSSPVSVLESSSSSSSSFSSSGEKT-LPLSPCHRGPQRARTKRPRPTTFNPFPV-----  184

Query  697   PTSSFTEAPQPFVAPAVSSESENFAESPMKKLTTRPEAPEQkkkkkikFTIPIAPVDTNQ  876
                        FVAP V +ESENFAESPMKK+  +P  PEQKKKKKIKF+IP+APV+TNQ
Sbjct  185   -----------FVAPVVPTESENFAESPMKKIL-KPAEPEQKKKKKIKFSIPLAPVETNQ  232

Query  877   N-QPPQAIRKCLHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFTPS  1053
             N    QA+RKC HCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTF P+
Sbjct  233   NPVAQQAVRKCQHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFVPA  292

Query  1054  LHSNSHKKVIEMRSKVGVENTAITEAPS---TPQPAFN--NPSVE  1173
             LHSNSHKKV+EMR+ +  +N  I    S     Q  FN  N SVE
Sbjct  293   LHSNSHKKVLEMRTTIVPDNDIIARTSSPAIATQLEFNPSNVSVE  337



>ref|XP_004239666.1| PREDICTED: GATA transcription factor 8-like isoform X3 [Solanum 
lycopersicum]
 ref|XP_010321318.1| PREDICTED: GATA transcription factor 8-like isoform X3 [Solanum 
lycopersicum]
 ref|XP_010321319.1| PREDICTED: GATA transcription factor 8-like isoform X3 [Solanum 
lycopersicum]
Length=327

 Score =   401 bits (1030),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 243/342 (71%), Positives = 268/342 (78%), Gaps = 26/342 (8%)
 Frame = +1

Query  169   MGSNFMDELDCGSFFDHIDDLIEFPPENECVGGVGSGEFKNFPSIWNDPLPDSEPLFSGS  348
             MGSN +DE+DCGSFFDHIDDLI+FP E+E VG + S + K+FPSIWNDPLPDS+ LFSGS
Sbjct  1     MGSNVVDEIDCGSFFDHIDDLIDFPLESENVG-LSSTDCKDFPSIWNDPLPDSDSLFSGS  59

Query  349   HNNSAADLSAELSVPYEDIIQLEWLSTFVEDSFSGGGMTLGKENTPVNVEPP-HNKFQTs  525
             H NSA+DLSAELSVPYEDI+QLEWLSTFVEDSFSGGG+TLGKEN PV  EP    KFQTS
Sbjct  60    HRNSASDLSAELSVPYEDIVQLEWLSTFVEDSFSGGGLTLGKENIPVEKEPSSQGKFQTS  119

Query  526   spvsvlesssssssssscsGGKTTIPLSPSRCGVQRARSKRPRPATFNPRPAIQLISPTS  705
             SPVSVLESSSSSSSS S SG KT +PLSP   G QRAR+KRPRP TFNP P         
Sbjct  120   SPVSVLESSSSSSSSFSSSGEKT-LPLSPCHRGPQRARTKRPRPTTFNPFPV--------  170

Query  706   SFTEAPQPFVAPAVSSESENFAESPMKKLTTRPEAPEQkkkkkikFTIPIAPVDTNQN-Q  882
                     FVAP V +ESENFAESPMKK+  +P  PEQKKKKKIKF+IP+APV+TNQN  
Sbjct  171   --------FVAPVVPTESENFAESPMKKIL-KPAEPEQKKKKKIKFSIPLAPVETNQNPV  221

Query  883   PPQAIRKCLHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFTPSLHS  1062
               QA+RKC HCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTF P+LHS
Sbjct  222   AQQAVRKCQHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFVPALHS  281

Query  1063  NSHKKVIEMRSKVGVENTAITEAPS---TPQPAFN--NPSVE  1173
             NSHKKV+EMR+ +  +N  I    S     Q  FN  N SVE
Sbjct  282   NSHKKVLEMRTTIVPDNDIIARTSSPAIATQLEFNPSNVSVE  323



>ref|XP_004239667.2| PREDICTED: GATA transcription factor 8-like isoform X1 [Solanum 
lycopersicum]
Length=410

 Score =   404 bits (1038),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 244/345 (71%), Positives = 270/345 (78%), Gaps = 26/345 (8%)
 Frame = +1

Query  160   QGSMGSNFMDELDCGSFFDHIDDLIEFPPENECVGGVGSGEFKNFPSIWNDPLPDSEPLF  339
             Q +MGSN +DE+DCGSFFDHIDDLI+FP E+E VG + S + K+FPSIWNDPLPDS+ LF
Sbjct  81    QETMGSNVVDEIDCGSFFDHIDDLIDFPLESENVG-LSSTDCKDFPSIWNDPLPDSDSLF  139

Query  340   SGSHNNSAADLSAELSVPYEDIIQLEWLSTFVEDSFSGGGMTLGKENTPVNVEPP-HNKF  516
             SGSH NSA+DLSAELSVPYEDI+QLEWLSTFVEDSFSGGG+TLGKEN PV  EP    KF
Sbjct  140   SGSHRNSASDLSAELSVPYEDIVQLEWLSTFVEDSFSGGGLTLGKENIPVEKEPSSQGKF  199

Query  517   QTsspvsvlesssssssssscsGGKTTIPLSPSRCGVQRARSKRPRPATFNPRPAIQLIS  696
             QTSSPVSVLESSSSSSSS S SG KT +PLSP   G QRAR+KRPRP TFNP P      
Sbjct  200   QTSSPVSVLESSSSSSSSFSSSGEKT-LPLSPCHRGPQRARTKRPRPTTFNPFPV-----  253

Query  697   PTSSFTEAPQPFVAPAVSSESENFAESPMKKLTTRPEAPEQkkkkkikFTIPIAPVDTNQ  876
                        FVAP V +ESENFAESPMKK+  +P  PEQKKKKKIKF+IP+APV+TNQ
Sbjct  254   -----------FVAPVVPTESENFAESPMKKIL-KPAEPEQKKKKKIKFSIPLAPVETNQ  301

Query  877   N-QPPQAIRKCLHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFTPS  1053
             N    QA+RKC HCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTF P+
Sbjct  302   NPVAQQAVRKCQHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFVPA  361

Query  1054  LHSNSHKKVIEMRSKVGVENTAITEAPS---TPQPAFN--NPSVE  1173
             LHSNSHKKV+EMR+ +  +N  I    S     Q  FN  N SVE
Sbjct  362   LHSNSHKKVLEMRTTIVPDNDIIARTSSPAIATQLEFNPSNVSVE  406



>ref|XP_009605437.1| PREDICTED: GATA transcription factor 8-like [Nicotiana tomentosiformis]
Length=339

 Score =   400 bits (1028),  Expect = 3e-132, Method: Compositional matrix adjust.
 Identities = 223/323 (69%), Positives = 248/323 (77%), Gaps = 17/323 (5%)
 Frame = +1

Query  169   MGSNFMDELDCGSFFDHIDDLIEFPPENECVGGVGSGEFKNFPSIWNDPLPDSEPLFSGS  348
             M SN +DE+DC SFFDHIDDL+EF PENEC G + S + KNFPSI NDPLPDS PLF  S
Sbjct  1     MASNLVDEIDCASFFDHIDDLVEFSPENEC-GDLDSTDCKNFPSICNDPLPDSGPLFFSS  59

Query  349   HNNSAADLSAELSVPYEDIIQLEWLSTFVEDSFSGGGMTLGKENTPVNVEPPHNKFQTss  528
             H NS +D SAEL VPYEDI+QLEWLSTFVEDSFS GG+T+GKE+ PVN EP H+KF   S
Sbjct  60    HRNSPSDFSAELLVPYEDIVQLEWLSTFVEDSFSCGGLTMGKEHFPVNKEPSHSKF--LS  117

Query  529   pvsvlesssssssssscsGGKTTIPLSPSRCGVQRARSKRPRPATFNPRPAIQLISPTSS  708
                V    SSSSSSSS   GKTT PLSP   G QRARSKRPRPATFNP P  QL+SPTSS
Sbjct  118   SSPVSVLESSSSSSSSSGAGKTTPPLSPCHRGTQRARSKRPRPATFNPWPVSQLMSPTSS  177

Query  709   FTEAPQPFVAPAVSSESENFAESPMKKLTTRPEAPEQkkkkkikFTIPIAPVDTNQN--Q  882
             FTE  Q FVAP  + ES+NF ES MKK            KK+IKF+IP+APVDTNQN  +
Sbjct  178   FTEIHQQFVAPEDTLESDNFGESHMKK------------KKRIKFSIPLAPVDTNQNCQR  225

Query  883   PPQAIRKCLHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFTPSLHS  1062
               Q +RKC+HCEITKTPQWRAGPMGPKTLCNACGVRYK GRLFPEYRPAA+PTF PSLHS
Sbjct  226   ALQTVRKCMHCEITKTPQWRAGPMGPKTLCNACGVRYKKGRLFPEYRPAAAPTFVPSLHS  285

Query  1063  NSHKKVIEMRSKVGVENTAITEA  1131
             NSHKKV+EMRS +  E+T   +A
Sbjct  286   NSHKKVLEMRSNLIPEDTHDKQA  308



>ref|XP_002273502.1| PREDICTED: GATA transcription factor 8-like [Vitis vinifera]
Length=340

 Score =   400 bits (1028),  Expect = 4e-132, Method: Compositional matrix adjust.
 Identities = 227/328 (69%), Positives = 265/328 (81%), Gaps = 12/328 (4%)
 Frame = +1

Query  169   MGSNFMDELDCGSFFDHIDDLIEFPPENECVGGVGSGEFKNFPSIW---NDPLPDSEPLF  339
             +G NFMDE+DCGSFFDHIDDL+EFPPE +  GG+  G+  +FPSIW   +DPLP  + +F
Sbjct  2     IGPNFMDEIDCGSFFDHIDDLLEFPPE-DVSGGLMGGDCNSFPSIWTNASDPLPGPDSVF  60

Query  340   SGSHNNSAADLSAELSVPYEDIIQLEWLSTFVEDSFSGGGMTLGKENTPVNVEPPHNKFQ  519
             SG ++NS +DLSAELSVPYEDI+QLEWLS FVEDSFSGG + L KE+  +  + PH++FQ
Sbjct  61    SGPNSNSNSDLSAELSVPYEDIVQLEWLSNFVEDSFSGGSIGLNKEDGSIVKDSPHHQFQ  120

Query  520   TsspvsvlesssssssssscsGGKTTIPLSPSRCGVQRARSKRPRPATFNPRPAIQLISP  699
             TSSPVSVLESSSS S          TIPLSP+  G QRARSKRPRPATFNPRPAIQLISP
Sbjct  121   TSSPVSVLESSSSCSGGG-----GKTIPLSPNHRGAQRARSKRPRPATFNPRPAIQLISP  175

Query  700   TSSFTEAPQPFVAPAVSSESENFAES-PMKKLTTRPEAPEQkkkkkikFTIPIAPVDTNQ  876
             TSS TE+PQP + P  SS+SEN+AES P+KK+     A E KKKKK+K ++P+ PV+ NQ
Sbjct  176   TSSVTESPQPVLVPKASSDSENYAESSPLKKMPKPAAA-EHKKKKKMKLSLPLGPVEMNQ  234

Query  877   NQPPQAIRKCLHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFTPSL  1056
             N P QA+RKC+HCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTF P+L
Sbjct  235   NPPAQAVRKCMHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFVPAL  294

Query  1057  HSNSHKKVIEMRSKVGVENTAITEAPST  1140
             HSNSHKKVIEMR+K   ENTA+T +P T
Sbjct  295   HSNSHKKVIEMRNK-ACENTAMTASPPT  321



>ref|XP_011076972.1| PREDICTED: GATA transcription factor 8-like [Sesamum indicum]
 ref|XP_011076974.1| PREDICTED: GATA transcription factor 8-like [Sesamum indicum]
Length=328

 Score =   397 bits (1020),  Expect = 4e-131, Method: Compositional matrix adjust.
 Identities = 231/317 (73%), Positives = 260/317 (82%), Gaps = 9/317 (3%)
 Frame = +1

Query  169   MGSNFMDELDCGSFFDHIDDLIEFPPENECVGG--VGSGEFKNFPSIWNDPLPDSEPLFS  342
             M SNF+DE+DCGSFFD +DDLIEFPP+N+C  G  + SG+ ++F ++WND LPD++P FS
Sbjct  1     MESNFVDEIDCGSFFDQMDDLIEFPPDNDCGDGNLISSGDCEDFTNMWNDALPDADPFFS  60

Query  343   GSHNNSAADLSAELSVPYEDIIQLEWLSTFVEDSFSGGGMTLGKENTPVNVEPPHNKFQT  522
             GSH + A+DLSAELSVPYEDI+QLEWLSTFVEDSFSGGG+T+GKEN  ++VE   N F+T
Sbjct  61    GSHVDCASDLSAELSVPYEDIVQLEWLSTFVEDSFSGGGLTIGKENLSIDVESSRNPFRT  120

Query  523   sspvsvlesssssssssscsGGKTTIPLSPSRCGVQRARSKRPRPATFNPRPAIQLISPT  702
             SSPVSVLESSSSSSS S   GGKT +PLSPS  G QRARSKRPRP TFNPR AIQLISP+
Sbjct  121   SSPVSVLESSSSSSSCS---GGKT-MPLSPSHRGTQRARSKRPRPPTFNPRTAIQLISPS  176

Query  703   SSF--TEAPQPFVAPAVSSESENFAESPMKKLTTRPEAPEQkkkkkikFTIPIAPVDTNQ  876
             SS   TE PQP  A   SSES+NFA+SP KK   +P   EQKK KKIK T+P  P  T  
Sbjct  177   SSSIETETPQPVFALGFSSESDNFADSPPKKKVPKPAETEQKKHKKIKITLPADPTATRN  236

Query  877   NQPPQA-IRKCLHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFTPS  1053
             + P QA +RKCLHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTF PS
Sbjct  237   DPPAQAAVRKCLHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFVPS  296

Query  1054  LHSNSHKKVIEMRSKVG  1104
             LHSNSHKKVIEMRSKVG
Sbjct  297   LHSNSHKKVIEMRSKVG  313



>ref|XP_009802378.1| PREDICTED: GATA transcription factor 8-like [Nicotiana sylvestris]
 ref|XP_009802379.1| PREDICTED: GATA transcription factor 8-like [Nicotiana sylvestris]
Length=338

 Score =   396 bits (1017),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 222/323 (69%), Positives = 250/323 (77%), Gaps = 18/323 (6%)
 Frame = +1

Query  169   MGSNFMDELDCGSFFDHIDDLIEFPPENECVGGVGSGEFKNFPSIWNDPLPDSEPLFSGS  348
             MGS+ +DE+DC SFFDH+DDLIEF PENEC G + S + KNFPSI N+PLPDS+PLF  S
Sbjct  1     MGSSLVDEIDCASFFDHMDDLIEFSPENEC-GDLDSTDCKNFPSICNEPLPDSDPLFFSS  59

Query  349   HNNSAADLSAELSVPYEDIIQLEWLSTFVEDSFSGGGMTLGKENTPVNVEPPHNKFQTss  528
             H NS +D S+EL VPYEDI+QLEWLSTFVEDSFS GG+T+GKE+ PVN EP HNKF   S
Sbjct  60    HRNSPSDFSSELLVPYEDIVQLEWLSTFVEDSFSCGGLTMGKEHFPVNKEPSHNKF--LS  117

Query  529   pvsvlesssssssssscsGGKTTIPLSPSRCGVQRARSKRPRPATFNPRPAIQLISPTSS  708
                V    SSSSSSSS    KTT PLSP   G QRARSKRPRPATFNPR   QL+SPTSS
Sbjct  118   SSPVSVLESSSSSSSSSGAVKTTPPLSPCHRGTQRARSKRPRPATFNPRLVSQLMSPTSS  177

Query  709   FTEAPQPFVAPAVSSESENFAESPMKKLTTRPEAPEQkkkkkikFTIPIAPVDTNQN--Q  882
             FTE  Q FVAP  + ES+ F ESPMKK            KK+IKF+IP+APVDTN+N  +
Sbjct  178   FTEIHQQFVAPEDTLESD-FGESPMKK------------KKRIKFSIPLAPVDTNRNYQR  224

Query  883   PPQAIRKCLHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFTPSLHS  1062
              PQ +RKC+HCEITKTPQWRAGPMGPKTLCNACGVRYK GRLFPEYRPAA+PTF PSLHS
Sbjct  225   APQTVRKCVHCEITKTPQWRAGPMGPKTLCNACGVRYKKGRLFPEYRPAAAPTFVPSLHS  284

Query  1063  NSHKKVIEMRSKVGVENTAITEA  1131
             NSHKKV+EMRS V  E+T   +A
Sbjct  285   NSHKKVLEMRSNVFPEDTHDKQA  307



>ref|XP_006350222.1| PREDICTED: GATA transcription factor 8-like isoform X1 [Solanum 
tuberosum]
 ref|XP_006350223.1| PREDICTED: GATA transcription factor 8-like isoform X2 [Solanum 
tuberosum]
Length=344

 Score =   387 bits (995),  Expect = 4e-127, Method: Compositional matrix adjust.
 Identities = 226/317 (71%), Positives = 255/317 (80%), Gaps = 22/317 (7%)
 Frame = +1

Query  169   MGSNFMDELDCGSFFDHIDDLIEFPPENECVGGVGSGEFKNFPSIWNDPLPDSEPLFSGS  348
             MGS+F+DE+DC SFFDH++DLIEF PENEC GG+ + + K+FPSIWNDPLPDS+PLFSGS
Sbjct  1     MGSDFVDEIDCSSFFDHMEDLIEFSPENEC-GGLDAVDCKDFPSIWNDPLPDSDPLFSGS  59

Query  349   HNNSAADLSAELSVPYEDIIQLEWLSTFVEDSFSGGGMTLGKENTPVNVEPPHNKFQTss  528
             ++NSA+D SAELSVPYEDI+QLEWLSTFVEDSFS GG+TLGKE+  V  E   +KF TSS
Sbjct  60    YSNSASDFSAELSVPYEDIVQLEWLSTFVEDSFSCGGLTLGKEHCSVKKESSDSKFLTSS  119

Query  529   pvsvlesssssssssscsGG--KTTIPLSPSRCGVQRARSKRPRPATFNPRPAIQLISPT  702
             PVSVLESSSSSSSSS+ S G  KT  PLSP   G QRAR+KRPRP TFNPRP   L+ PT
Sbjct  120   PVSVLESSSSSSSSSTSSSGPGKTLPPLSPCTRGPQRARTKRPRPTTFNPRPVNHLMFPT  179

Query  703   SSFTEAPQPFVAPAVSS-ESENFAESPMKKLTTRPEAPEQkkkkkikFTIPIAPVDTNQN  879
             S     PQ FVAP V+S ESENFAESPMKK                K +IP+AP++TNQ+
Sbjct  180   SVI---PQQFVAPGVNSLESENFAESPMKKKKKI------------KLSIPLAPIETNQD  224

Query  880   --QP-PQAIRKCLHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFTP  1050
               QP PQA+RKCLHCEITKTPQWRAGPMGPKTLCNACGVRYK GRL+PEYRPAASPTF P
Sbjct  225   NYQPAPQAVRKCLHCEITKTPQWRAGPMGPKTLCNACGVRYKKGRLYPEYRPAASPTFVP  284

Query  1051  SLHSNSHKKVIEMRSKV  1101
             SLHSNSHKKV+EMRS V
Sbjct  285   SLHSNSHKKVLEMRSNV  301



>ref|XP_004236632.1| PREDICTED: GATA transcription factor 8 [Solanum lycopersicum]
 ref|XP_010319208.1| PREDICTED: GATA transcription factor 8 [Solanum lycopersicum]
Length=337

 Score =   374 bits (961),  Expect = 4e-122, Method: Compositional matrix adjust.
 Identities = 221/317 (70%), Positives = 251/317 (79%), Gaps = 22/317 (7%)
 Frame = +1

Query  169   MGSNFMDELDCGSFFDHIDDLIEFPPENECVGGVGSGEFKNFPSIWNDPLPDSEPLFSGS  348
             MGS+F+DE+DC SFFDH++DLIEF PEN C GGV + +  +FPSIWNDPLPDS+P FSGS
Sbjct  1     MGSDFVDEIDCSSFFDHMEDLIEFSPENVC-GGVDAVDCNDFPSIWNDPLPDSDPFFSGS  59

Query  349   HNNSAADLSAELSVPYEDIIQLEWLSTFVEDSFSGGGMTLGKENTPVNVEPPHNKFQTss  528
             ++NSA+D SAELSVP EDI+QLEWLSTFVEDSFS GG+TLGKE+  V  E   +KF TSS
Sbjct  60    YSNSASDFSAELSVPLEDIVQLEWLSTFVEDSFSCGGLTLGKEHCSVKKESSDSKFLTSS  119

Query  529   pvsvlesssssssssscsGG--KTTIPLSPSRCGVQRARSKRPRPATFNPRPAIQLISPT  702
             PVSVLESSSSSSSSS+ S G  KT  PLSP   G QRAR+KRPRP TFNPR    L+ PT
Sbjct  120   PVSVLESSSSSSSSSTSSSGPGKTLPPLSPCPRGPQRARTKRPRPTTFNPRSVNHLMFPT  179

Query  703   SSFTEAPQPFVAPAVSS-ESENFAESPMKKLTTRPEAPEQkkkkkikFTIPIAPVDTNQN  879
             S    +PQ FVAP V+S +SENFAESPMKK                K +IP+AP++TNQ+
Sbjct  180   SV---SPQQFVAPGVNSLDSENFAESPMKKKKKI------------KLSIPLAPIETNQD  224

Query  880   --QP-PQAIRKCLHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFTP  1050
               QP PQA+RKCLHCEITKTPQWRAGPMGPKTLCNACGVRYK GRL+PEYRPAASPTF P
Sbjct  225   NYQPAPQAVRKCLHCEITKTPQWRAGPMGPKTLCNACGVRYKKGRLYPEYRPAASPTFVP  284

Query  1051  SLHSNSHKKVIEMRSKV  1101
             SLHSNSHKKV+EMRS V
Sbjct  285   SLHSNSHKKVLEMRSNV  301



>ref|XP_010092608.1| GATA transcription factor 9 [Morus notabilis]
 gb|EXB51749.1| GATA transcription factor 9 [Morus notabilis]
Length=351

 Score =   356 bits (913),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 218/326 (67%), Positives = 251/326 (77%), Gaps = 26/326 (8%)
 Frame = +1

Query  169   MGSNFMDELDCGSFFDHIDDL-IEFPPENECVGGVGSGEFKNFPSIWN----DPLPDSEP  333
             +G NFMDE+DCGSFFDHIDDL ++F  ++   G     E   F SIW+    + LP S+ 
Sbjct  2     IGPNFMDEIDCGSFFDHIDDLLVDFSGDDVDTGLGPKPEANPFTSIWSTTQSESLPSSDS  61

Query  334   LFSGSHNNSAADLSAELSVPYEDIIQLEWLSTFVEDSFSGGGMTLGKE--NTPVNVEPPH  507
             +FSG    SA+DLSAELSVPYEDI+QLEWLS FVEDSFSGG + + KE  ++ +N E  H
Sbjct  62    VFSG---KSASDLSAELSVPYEDIVQLEWLSNFVEDSFSGGSLAINKEQDSSSLNKESSH  118

Query  508   NKFQTsspvsvlesssssssssscsGGKTTIPLSP-----SRCGVQRARSKRPRPATFNP  672
             ++FQTSSPVSVLESSSS S      GG+   P SP      R G  RARSKRPRPATFNP
Sbjct  119   HQFQTSSPVSVLESSSSCS------GGEKNAPCSPETVNPGRRG--RARSKRPRPATFNP  170

Query  673   RPAIQLISPTSSFTEAPQPFVA-PAVSSESENFAES-PMKKLTTRPEAPEQkkkkkikFT  846
             RPAIQLISP+SS  EAPQPFVA P  SS+SENFAES P+ K+  + +  EQKKKKKIK +
Sbjct  171   RPAIQLISPSSSVIEAPQPFVAAPKSSSDSENFAESRPVIKIPKQ-DPVEQKKKKKIKLS  229

Query  847   IPIAPVDTNQNQPPQAIRKCLHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRP  1026
              P+APV+TNQNQ  QA+RKC+HCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRP
Sbjct  230   FPLAPVETNQNQSSQAVRKCMHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRP  289

Query  1027  AASPTFTPSLHSNSHKKVIEMRSKVG  1104
             AASPTF PSLHSNSHKKV+EMR+K G
Sbjct  290   AASPTFVPSLHSNSHKKVLEMRTKGG  315



>ref|XP_007009854.1| Plant-specific GATA-type zinc finger transcription factor family 
protein isoform 2 [Theobroma cacao]
 gb|EOY18664.1| Plant-specific GATA-type zinc finger transcription factor family 
protein isoform 2 [Theobroma cacao]
Length=341

 Score =   353 bits (905),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 213/346 (62%), Positives = 250/346 (72%), Gaps = 22/346 (6%)
 Frame = +1

Query  175   SNFMDELDCGSFFDHIDDLIEFPPENECVGGVGSGEFKN---FPSIW---NDPLPDSEPL  336
             +NF+DE+DCGSFFDHIDDL++FP E+   G   S    N   FPSIW   ++ LP S+ +
Sbjct  5     TNFIDEIDCGSFFDHIDDLLDFPNEDVEAGLSASDSAVNASAFPSIWTTHSESLPGSDSV  64

Query  337   FSGSHNNSAADLSAELSVPYEDIIQLEWLSTFVEDSFSGGGMTLGKE-NTPVNVEPPHNK  513
             FS   NNSA+DLSAELSVPYEDI+QLEWLS FV+DS  G  +T+ KE ++ +  +   ++
Sbjct  65    FS---NNSASDLSAELSVPYEDIVQLEWLSNFVDDSQCGASLTIKKEESSSITKDSSQHQ  121

Query  514   FQTsspvsvlesssssssssscsGGKTTIPLSPSRCG---VQRARSKRPRPATFNPRPAI  684
             FQTSSPVSVLESSSS S       G+ T+P SP         RARSKRPRP TFNPRPAI
Sbjct  122   FQTSSPVSVLESSSSCS-------GEKTLPRSPETAAPGRRGRARSKRPRPTTFNPRPAI  174

Query  685   QLISPTSSFTE--APQPFVAPAVSSESENFAESPMKKLTTRPEAPEQkkkkkikFTIPIA  858
             QLISPTSS  E   PQPFV P V S+SEN+AES +     R   PE KKKKKIK ++P A
Sbjct  175   QLISPTSSVNENDIPQPFVVPKVPSDSENYAESRLLIKIPRQVNPEHKKKKKIKLSLPTA  234

Query  859   PVDTNQNQPPQAIRKCLHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASP  1038
             P D NQN   QA+RKC+HCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASP
Sbjct  235   PADNNQNSSGQAVRKCMHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASP  294

Query  1039  TFTPSLHSNSHKKVIEMRSKVGVENTAITEAPSTPQPAFNNPSVEF  1176
             TF PSLHSNSHKKVIEMR+K G   T +  +     P  +NP+++F
Sbjct  295   TFVPSLHSNSHKKVIEMRNKGGAAPTTMVTSSPELIPNKSNPALDF  340



>ref|XP_007009853.1| Plant-specific GATA-type zinc finger transcription factor family 
protein isoform 1 [Theobroma cacao]
 gb|EOY18663.1| Plant-specific GATA-type zinc finger transcription factor family 
protein isoform 1 [Theobroma cacao]
Length=414

 Score =   349 bits (895),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 212/346 (61%), Positives = 249/346 (72%), Gaps = 22/346 (6%)
 Frame = +1

Query  175   SNFMDELDCGSFFDHIDDLIEFPPENECVGGVGSGEFKN---FPSIW---NDPLPDSEPL  336
             +NF+DE+DCGSFFDHIDDL++FP E+   G   S    N   FPSIW   ++ LP S+ +
Sbjct  78    TNFIDEIDCGSFFDHIDDLLDFPNEDVEAGLSASDSAVNASAFPSIWTTHSESLPGSDSV  137

Query  337   FSGSHNNSAADLSAELSVPYEDIIQLEWLSTFVEDSFSGGGMTLGKE-NTPVNVEPPHNK  513
             FS   NNSA+DLSAELSVPYEDI+QLEWLS FV+DS  G  +T+ KE ++ +  +   ++
Sbjct  138   FS---NNSASDLSAELSVPYEDIVQLEWLSNFVDDSQCGASLTIKKEESSSITKDSSQHQ  194

Query  514   FQTsspvsvlesssssssssscsGGKTTIPLSPSRCG---VQRARSKRPRPATFNPRPAI  684
             FQTSSPVSVLESSSS         G+ T+P SP         RARSKRPRP TFNPRPAI
Sbjct  195   FQTSSPVSVLESSSSC-------SGEKTLPRSPETAAPGRRGRARSKRPRPTTFNPRPAI  247

Query  685   QLISPTSSFTE--APQPFVAPAVSSESENFAESPMKKLTTRPEAPEQkkkkkikFTIPIA  858
             QLISPTSS  E   PQPFV P V S+SEN+AES +     R   PE KKKKKIK ++P A
Sbjct  248   QLISPTSSVNENDIPQPFVVPKVPSDSENYAESRLLIKIPRQVNPEHKKKKKIKLSLPTA  307

Query  859   PVDTNQNQPPQAIRKCLHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASP  1038
             P D NQN   QA+RKC+HCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASP
Sbjct  308   PADNNQNSSGQAVRKCMHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASP  367

Query  1039  TFTPSLHSNSHKKVIEMRSKVGVENTAITEAPSTPQPAFNNPSVEF  1176
             TF PSLHSNSHKKVIEMR+K G   T +  +     P  +NP+++F
Sbjct  368   TFVPSLHSNSHKKVIEMRNKGGAAPTTMVTSSPELIPNKSNPALDF  413



>ref|XP_002311088.1| zinc finger family protein [Populus trichocarpa]
 gb|EEE88455.1| zinc finger family protein [Populus trichocarpa]
Length=354

 Score =   345 bits (885),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 208/367 (57%), Positives = 246/367 (67%), Gaps = 45/367 (12%)
 Frame = +1

Query  160   QGSMGSNFMDELDCGSFFDHIDDLIEFPPE------------NECVGGVGSGEFKNFPSI  303
             Q +  SNFMDE+DCGSFF+HIDDL+EFP +            N       + +  +FP I
Sbjct  4     QTNTTSNFMDEIDCGSFFEHIDDLLEFPSDDVDATLPDCTTTNNHTSCFMNNDDNSFPGI  63

Query  304   WN---DPLPDSEPLFSGSHNNSAADLSAELSVPYEDIIQLEWLSTFVEDSFSGGGMTLGK  474
             W+   D LP            SA+DLSAELSVPYEDI+QLEWLS FVEDSFSGG +T+ K
Sbjct  64    WSTQSDSLP-----------GSASDLSAELSVPYEDIVQLEWLSNFVEDSFSGGSLTMKK  112

Query  475   ENTPV--NVE-PPHNKFQTsspvsvlesssssssssscsGGKTTIPLSPSRCGVQ----R  633
             E + +  N E PPH+++Q         S  S   SSS   G+ T P SP   G      R
Sbjct  113   EESTIVNNKESPPHHQYQ-----FQTSSPVSVLESSSSCSGEKTAPRSP-EVGASGKRGR  166

Query  634   ARSKRPRPATFNPRPAIQLISPTSSFTEAPQPFVAPAVSSESENFAESPMKKLTTRPEAP  813
             ARSKRPRPATF PRPA+QLISPTSS TE PQPFV P ++ +SENFAES +         P
Sbjct  167   ARSKRPRPATFTPRPAMQLISPTSSITEVPQPFVPPKIALDSENFAESRLVIKIPNHVDP  226

Query  814   EQkkkkkikFTIPIAPVDTNQNQPPQ-AIRKCLHCEITKTPQWRAGPMGPKTLCNACGVR  990
             E KKKKKIKFT+P+ PV+ NQN  PQ A+RKC+HCEITKTPQWRAGPMGPKTLCNACGVR
Sbjct  227   EHKKKKKIKFTVPLGPVEMNQNSSPQQAVRKCMHCEITKTPQWRAGPMGPKTLCNACGVR  286

Query  991   YKSGRLFPEYRPAASPTFTPSLHSNSHKKVIEMRSKVGVENT-----AITEAPSTPQPAF  1155
             YKSGRLFPEYRPAASPTF PSLHSNSHKKV+EMR+K G + T     A+   P    P  
Sbjct  287   YKSGRLFPEYRPAASPTFVPSLHSNSHKKVVEMRAKSGEKITVSRPAAMVANPPELIPNK  346

Query  1156  NNPSVEF  1176
             +NP++++
Sbjct  347   SNPAMDY  353



>ref|XP_006436435.1| hypothetical protein CICLE_v10032018mg [Citrus clementina]
 ref|XP_006436436.1| hypothetical protein CICLE_v10032018mg [Citrus clementina]
 ref|XP_006436437.1| hypothetical protein CICLE_v10032018mg [Citrus clementina]
 ref|XP_006485699.1| PREDICTED: GATA transcription factor 8-like [Citrus sinensis]
 gb|ESR49675.1| hypothetical protein CICLE_v10032018mg [Citrus clementina]
 gb|ESR49676.1| hypothetical protein CICLE_v10032018mg [Citrus clementina]
 gb|ESR49677.1| hypothetical protein CICLE_v10032018mg [Citrus clementina]
Length=341

 Score =   343 bits (880),  Expect = 7e-110, Method: Compositional matrix adjust.
 Identities = 207/336 (62%), Positives = 248/336 (74%), Gaps = 24/336 (7%)
 Frame = +1

Query  169   MGSNFMDELDCGSFFDHIDDLIEFPPENECVGGVGSGEFKNFPSIW---NDPLPDSEPLF  339
             +G+NFMDE+DCGSFFDHIDDL++FP E +   G+ + +  +FPSIW   +D LP S+ +F
Sbjct  2     IGTNFMDEIDCGSFFDHIDDLLDFPNE-DVEAGLPNADSNSFPSIWPTQSDSLPGSDSVF  60

Query  340   SGSHNNSAADLSAELSVPYEDIIQLEWLSTFVEDSFSGGGMTLGKE--NTPVNVEPPHNK  513
             S    NS+ DLS +LSVPYEDI+QLEWLS FVEDSFSGG +T+ K+  +T    +  HN+
Sbjct  61    S----NSSTDLSTQLSVPYEDIVQLEWLSNFVEDSFSGGSLTMSKQESSTITKDDSSHNQ  116

Query  514   FQTsspvsvlesssssssssscsGGKTTIPLSPSRCGVQRARSKRPRPATFNPRPAIQLI  693
             FQTSSPVSVLESSSS S   +  G   T   +P R G  RARSKRPRPATFNPRP +QL+
Sbjct  117   FQTSSPVSVLESSSSCSGEKTVLGSPETT--APGRRG--RARSKRPRPATFNPRPPVQLV  172

Query  694   SPTSSFTEAPQP---FVAPAVSSESENFAESPMKKLTTRPEAPEQkkkkkikFTIPIAPV  864
             SPTSS TE  QP    +AP  SS+SENFAES +     +   PE KKKKKIK ++P    
Sbjct  173   SPTSSVTET-QPQHRLIAPKASSDSENFAESRLVIKIPKQFNPEHKKKKKIKLSVPKVSD  231

Query  865   DTNQNQPPQAIRKCLHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTF  1044
             +T++  P QA+RKC+HCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTF
Sbjct  232   ETSEVGPTQAVRKCMHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTF  291

Query  1045  TPSLHSNSHKKVIEMRSK------VGVENTAITEAP  1134
              PSLHSNSHKKV+EMR+K      V    T +T+AP
Sbjct  292   VPSLHSNSHKKVVEMRNKNCQKPIVAGTETMMTDAP  327



>gb|KDO44680.1| hypothetical protein CISIN_1g016706mg [Citrus sinensis]
 gb|KDO44681.1| hypothetical protein CISIN_1g016706mg [Citrus sinensis]
Length=384

 Score =   343 bits (879),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 219/393 (56%), Positives = 271/393 (69%), Gaps = 34/393 (9%)
 Frame = +1

Query  169   MGSNFMDELDCGSFFDHIDDLIEFPPENECVGGVGSGEFKNFPSIW---NDPLPDSEPLF  339
             +G+NFMDE+DCGSFFDHIDDL++FP E +   G+ + +  +FPSIW   +D LP S+ +F
Sbjct  2     IGTNFMDEIDCGSFFDHIDDLLDFPNE-DVEAGLPNADSNSFPSIWPTQSDSLPGSDSVF  60

Query  340   SGSHNNSAADLSAELSVPYEDIIQLEWLSTFVEDSFSGGGMTLGKE--NTPVNVEPPHNK  513
             S    NS+ DLS +LSVPYEDI+QLEWLS FVEDSFSGG +T+ K+  +T    +  HN+
Sbjct  61    S----NSSTDLSTQLSVPYEDIVQLEWLSNFVEDSFSGGSLTMSKQESSTITKDDSSHNQ  116

Query  514   FQTsspvsvlesssssssssscsGGKTTIPLSPSRCGVQRARSKRPRPATFNPRPAIQLI  693
             FQTSSPVSVLESSSS S   +  G   T   +P R G  RARSKRPRPATFNPRP +QL+
Sbjct  117   FQTSSPVSVLESSSSCSGEKTVLGSPETT--APGRRG--RARSKRPRPATFNPRPPVQLV  172

Query  694   SPTSSFTEAPQP---FVAPAVSSESENFAESPMKKLTTRPEAPEQkkkkkikFTIPIAPV  864
             SPTSS TE  QP    +AP  SS+SENFAES +     +   PE KKKKKIK ++P    
Sbjct  173   SPTSSVTET-QPQHRLIAPKASSDSENFAESRLVIKIPKQFNPEHKKKKKIKLSVPKVSD  231

Query  865   DTNQNQPPQAIRKCLHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTF  1044
             +T++  P QA+RKC+HCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTF
Sbjct  232   ETSEVGPTQAVRKCMHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTF  291

Query  1045  TPSLHSNSHKKVIEMRSK------VGVENTAITEAPSTPQPAFNNPSVEF*QEYT*KTER  1206
              PSLHSNSHKKV+EMR+K      V    T +T+A   P+   NN ++ +       + R
Sbjct  292   VPSLHSNSHKKVVEMRNKNCQKPIVAGTETMMTDA---PELIPNNNTLHW--STFEGSRR  346

Query  1207  CREWFS*SKALSLHSSIIPQFQQS*CYLVKVFF  1305
              RE  S    +SL  S++  +    CY + +F 
Sbjct  347   LREQHS-LTGISLFRSLLFAY----CYFISLFI  374



>gb|KDP44375.1| hypothetical protein JCGZ_20055 [Jatropha curcas]
Length=357

 Score =   339 bits (869),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 209/352 (59%), Positives = 245/352 (70%), Gaps = 31/352 (9%)
 Frame = +1

Query  175   SNFMDELDCGSFFDHIDDLIEFPPEN--ECVGGVGSGEFKN-------FPSIWN---DPL  318
             +NFMDE+DCGSFFDHIDDL++FP ++  +C+ G       N       FPSIW+   D L
Sbjct  5     ANFMDEIDCGSFFDHIDDLLDFPTDDIDDCLPGSDCATINNNGIAGNSFPSIWSTQSDSL  64

Query  319   PDSEPLFSGSHNNSAADLSAELSVPYEDIIQLEWLSTFVEDSFSGGGMTLGKENTPVNVE  498
             P S+ +FS   NNSA+DLSAELSVPYEDI+QLEWLS FVEDSFSGG +T+   N+  N E
Sbjct  65    PGSDSVFS---NNSASDLSAELSVPYEDIVQLEWLSNFVEDSFSGGSLTIN--NSSKNKE  119

Query  499   PPHNKFQTsspvsvlesssssssssscsGGKTTIPLSP-----SRCGVQRARSKRPRPAT  663
                +  + SS      S  S   SSS   G+ T P SP      R G  RARSKRPRPA+
Sbjct  120   GSTSINKDSSRQFQTSSPVSVLESSSSCSGEKTAPRSPEIIASGRRG--RARSKRPRPAS  177

Query  664   FNPRPAIQLISPTSSFTEAPQPFVAPAVSSESENFAESPMKKLTTRPEAPEQkkkkkikF  843
             F PRPA+QLISP+SS +E   PF  P VSS+SEN+AES +     +  APEQKKKKKIKF
Sbjct  178   FTPRPAMQLISPSSSVSETHHPFAVPKVSSDSENYAESRLLIKLPKQVAPEQKKKKKIKF  237

Query  844   TIPIAPVDTNQNQPPQ---AIRKCLHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFP  1014
             T+PI P +T+QN PPQ   A+RKC+HCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFP
Sbjct  238   TVPIVPSETSQNSPPQQQQAVRKCMHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFP  297

Query  1015  EYRPAASPTFTPSLHSNSHKKVIEMRSKVGVENTAITEAPSTPQPAFNNPSV  1170
             EYRPAASPTF PSLHSNSHKKV+EMR+K     T  T  P       N+P +
Sbjct  298   EYRPAASPTFVPSLHSNSHKKVLEMRTKT----TTKTNVPGNATMMTNSPEL  345



>ref|XP_006378769.1| hypothetical protein POPTR_0010s23010g [Populus trichocarpa]
 ref|XP_002316371.2| zinc finger family protein [Populus trichocarpa]
 gb|ERP56566.1| hypothetical protein POPTR_0010s23010g [Populus trichocarpa]
 gb|EEF02542.2| zinc finger family protein [Populus trichocarpa]
Length=352

 Score =   337 bits (865),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 204/340 (60%), Positives = 235/340 (69%), Gaps = 46/340 (14%)
 Frame = +1

Query  160   QGSMGSNFMDELDCGSFFDHIDDLIEFPPE------------NECVGGVGSGEFKNFPSI  303
             Q +  S FMDE+DCGSFFDHIDDL++FP +            N         +  +FP I
Sbjct  4     QTNTSSGFMDEIDCGSFFDHIDDLLDFPSDDVDASLPDCTTTNNHASCFIDNDDNSFPGI  63

Query  304   WN---DPLPDSEPLFSGSHNNSAADLSAELSVPYEDIIQLEWLSTFVEDSFSGGGMTLGK  474
             W+   D LP            SA+DLSAELSVPYEDI+QLEWLS FVEDSFSGG +T+ K
Sbjct  64    WSTQSDSLP-----------GSASDLSAELSVPYEDIVQLEWLSNFVEDSFSGGSLTMKK  112

Query  475   ENTPVNVEP----PHNKFQTsspvsvlesssssssssscsGGKTTIPLSP-----SRCGV  627
             E +  +V+     PH++FQTSSPVSVLESSS          G+   P SP      +CG 
Sbjct  113   EES-ASVDKKDSTPHHQFQTSSPVSVLESSSDC-------SGEKNAPRSPEIVASGKCG-  163

Query  628   QRARSKRPRPATFNPRPAIQLISPTSSFTEAPQPFVAPAVSSESENFAESPMKKLTTRPE  807
              RARSKRPRPA F PRPA+QL+SPTSS TE PQ FV+P V S+SE+FAES +        
Sbjct  164   -RARSKRPRPAAFTPRPAMQLVSPTSSITEVPQQFVSPRVPSDSESFAESRLVIKIPEHV  222

Query  808   APEQkkkkkikFTIPIAPVDTNQN-QPPQAIRKCLHCEITKTPQWRAGPMGPKTLCNACG  984
              PE KKKKKIKF +P   V+ NQN QP QA+RKC+HCEITKTPQWRAGPMGPKTLCNACG
Sbjct  223   DPEHKKKKKIKFIVPSGTVEMNQNSQPQQAVRKCMHCEITKTPQWRAGPMGPKTLCNACG  282

Query  985   VRYKSGRLFPEYRPAASPTFTPSLHSNSHKKVIEMRSKVG  1104
             VRYKSGRLFPEYRPAASPTF PSLHSNSHKKV+EMR+K G
Sbjct  283   VRYKSGRLFPEYRPAASPTFVPSLHSNSHKKVVEMRAKAG  322



>ref|XP_011031733.1| PREDICTED: GATA transcription factor 8-like [Populus euphratica]
Length=358

 Score =   337 bits (864),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 199/334 (60%), Positives = 230/334 (69%), Gaps = 32/334 (10%)
 Frame = +1

Query  160   QGSMGSNFMDELDCGSFFDHIDDLIEFPPE------------NECVGGVGSGEFKNFPSI  303
             Q +  SNFMDE+DCGSFF+HIDDL+EFP +            N       + +  +FP I
Sbjct  4     QTNTTSNFMDEIDCGSFFEHIDDLLEFPSDDVDATLPDCTTTNNHTSCFVNNDDNSFPGI  63

Query  304   WNDPLPDSEPLFSGSHNNSAADLSAELSVPYEDIIQLEWLSTFVEDSFSGGGMTLGKE-N  480
             W        P  S S   SA+DLSAELSVPYEDI+QLEWLS FVEDSFSGG +T+ KE +
Sbjct  64    W--------PTQSDSLPGSASDLSAELSVPYEDIVQLEWLSNFVEDSFSGGSLTMKKEES  115

Query  481   TPVNVE--PPHNKFQTsspvsvlesssssssssscsGGKTTIPLSP---SRCGVQRARSK  645
             T VN +  PPH+++Q         S  S   SSS   G+ T P SP   +     R RSK
Sbjct  116   TIVNNKDSPPHHQYQ-----FQTSSPVSVLESSSSCSGEKTAPRSPEVGASGKRGRPRSK  170

Query  646   RPRPATFNPRPAIQLISPTSSFTEAPQPFVAPAVSSESENFAESPMKKLTTRPEAPEQkk  825
             RPRPATF PRPA+QLISPTSS TE PQPF    ++ +SENFAES +         PE KK
Sbjct  171   RPRPATFTPRPAMQLISPTSSITEVPQPFDPSKIALDSENFAESRLVIKIPNHVDPEHKK  230

Query  826   kkkikFTIPIAPVDTNQN-QPPQAIRKCLHCEITKTPQWRAGPMGPKTLCNACGVRYKSG  1002
             KKKIKFT+P+ PV+ NQN  P QA+RKC+HCEITKTPQWRAGPMGPKTLCNACGVRYKSG
Sbjct  231   KKKIKFTVPLGPVEMNQNPSPQQAVRKCMHCEITKTPQWRAGPMGPKTLCNACGVRYKSG  290

Query  1003  RLFPEYRPAASPTFTPSLHSNSHKKVIEMRSKVG  1104
             RLFPEYRPAASPTF PSLHSNSHKKV+EMR+K G
Sbjct  291   RLFPEYRPAASPTFVPSLHSNSHKKVVEMRAKAG  324



>ref|XP_011041012.1| PREDICTED: GATA transcription factor 8-like [Populus euphratica]
 ref|XP_011041013.1| PREDICTED: GATA transcription factor 8-like [Populus euphratica]
Length=355

 Score =   335 bits (860),  Expect = 8e-107, Method: Compositional matrix adjust.
 Identities = 204/340 (60%), Positives = 233/340 (69%), Gaps = 43/340 (13%)
 Frame = +1

Query  160   QGSMGSNFMDELDCGSFFDHIDDLIEFPPENECVGGVGSGEFKN-------------FPS  300
             Q +  S FMDE+DCGSFFDHIDDL++FP  ++   G+  G   N             FP 
Sbjct  4     QTNTSSGFMDEIDCGSFFDHIDDLLDFP-SDDVDAGLPDGTTTNNHASCFIGNDDNSFPG  62

Query  301   IWNDPLPDSEPLFSGSHNNSAADLSAELSVPYEDIIQLEWLSTFVEDSFSGGGMTLGKEN  480
             IW+          S S   SA+DLSAELSVPYEDI+QLEWLS FVEDSFSGG +T+ KE 
Sbjct  63    IWSTQ--------SESLPGSASDLSAELSVPYEDIVQLEWLSNFVEDSFSGGSLTMKKEE  114

Query  481   TPV------NVEPPHNKFQTsspvsvlesssssssssscsGGKTTIPLSP-----SRCGV  627
             +            PH +FQTSSPVSVLESSS          G+   P SP      +CG 
Sbjct  115   SAFVDKKDKKDSAPHPQFQTSSPVSVLESSSYC-------SGEKNAPRSPEVVASGKCG-  166

Query  628   QRARSKRPRPATFNPRPAIQLISPTSSFTEAPQPFVAPAVSSESENFAESPMKKLTTRPE  807
              RARSKRPRPA F PRPA+QL+SPTSS TE PQ FV+P V S+SE+FAES +     +  
Sbjct  167   -RARSKRPRPAAFTPRPAMQLVSPTSSITEVPQQFVSPRVPSDSESFAESRLVIKIPKHV  225

Query  808   APEQkkkkkikFTIPIAPVDTNQN-QPPQAIRKCLHCEITKTPQWRAGPMGPKTLCNACG  984
              PE KKKKKIKF +P   V+ NQN QP QA+RKC+HCEITKTPQWRAGPMGPKTLCNACG
Sbjct  226   DPEHKKKKKIKFIVPSGTVEMNQNSQPQQAVRKCMHCEITKTPQWRAGPMGPKTLCNACG  285

Query  985   VRYKSGRLFPEYRPAASPTFTPSLHSNSHKKVIEMRSKVG  1104
             VRYKSGRLFPEYRPAASPTF PSLHSNSHKKV+EMR+K G
Sbjct  286   VRYKSGRLFPEYRPAASPTFVPSLHSNSHKKVVEMRAKAG  325



>dbj|BAP90356.1| GATA type zinc finger domain [Populus nigra]
Length=352

 Score =   334 bits (856),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 203/340 (60%), Positives = 234/340 (69%), Gaps = 46/340 (14%)
 Frame = +1

Query  160   QGSMGSNFMDELDCGSFFDHIDDLIEFPPE------------NECVGGVGSGEFKNFPSI  303
             Q +  S FMDE+ CGSFFDHIDDL++FP +            N         +  +FP I
Sbjct  4     QTNTSSGFMDEIGCGSFFDHIDDLLDFPSDDVDASLPDCTTTNNHASCFIDNDDNSFPGI  63

Query  304   WN---DPLPDSEPLFSGSHNNSAADLSAELSVPYEDIIQLEWLSTFVEDSFSGGGMTLGK  474
             W+   D LP            SA+DLSAELSVPYEDI+QLEWLS FVEDSFSGG +T+ K
Sbjct  64    WSTQSDSLP-----------GSASDLSAELSVPYEDIVQLEWLSNFVEDSFSGGSLTMKK  112

Query  475   ENTPVNVEP----PHNKFQTsspvsvlesssssssssscsGGKTTIPLSP-----SRCGV  627
             E +  +V+     PH++FQTSSPVSVLESSS          G+   P SP      +CG 
Sbjct  113   EES-ASVDKKDSTPHHQFQTSSPVSVLESSSDC-------SGEKNAPRSPEVVASGKCG-  163

Query  628   QRARSKRPRPATFNPRPAIQLISPTSSFTEAPQPFVAPAVSSESENFAESPMKKLTTRPE  807
              RARSKRPRPA F PRPA+QL+SPTSS TE PQ FV+P V S+SE+FAES +        
Sbjct  164   -RARSKRPRPAAFTPRPAMQLVSPTSSITEVPQQFVSPRVPSDSESFAESRLVIKIPEHV  222

Query  808   APEQkkkkkikFTIPIAPVDTNQN-QPPQAIRKCLHCEITKTPQWRAGPMGPKTLCNACG  984
              PE KKKKKIKF +P   V+ NQN QP QA+RKC+HCEITKTPQWRAGPMGPKTLCNACG
Sbjct  223   DPEHKKKKKIKFIVPSGTVEMNQNSQPQQAVRKCMHCEITKTPQWRAGPMGPKTLCNACG  282

Query  985   VRYKSGRLFPEYRPAASPTFTPSLHSNSHKKVIEMRSKVG  1104
             VRYKSGRLFPEYRPAASPTF PSLHSNSHKKV+EMR+K G
Sbjct  283   VRYKSGRLFPEYRPAASPTFVPSLHSNSHKKVVEMRAKAG  322



>ref|XP_002534043.1| GATA transcription factor, putative [Ricinus communis]
 gb|EEF28339.1| GATA transcription factor, putative [Ricinus communis]
Length=359

 Score =   332 bits (852),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 212/334 (63%), Positives = 251/334 (75%), Gaps = 33/334 (10%)
 Frame = +1

Query  175   SNFMDELDCGSFFDHIDDLIEFPPEN------ECVGGVGSGEFK-NFPSIWN---DPLPD  324
             +NF+DE+DCGSFFDHIDDL++FP ++      +C   V       +FPSIW+   D LP 
Sbjct  5     TNFIDEIDCGSFFDHIDDLLDFPTDDIDSCLPDCTNAVNVNGNVNSFPSIWSTQSDSLPG  64

Query  325   SEPLFSGSHNNSAA-DLSAELSVPYEDIIQLEWLSTFVEDSFSGGGMTLGKE-NTPVNVE  498
             S  +FS + NN++A DLSAELSVPYEDI+QLEWLS FVEDSFSGG +T+ KE +T +N +
Sbjct  65    SHSVFSSNTNNNSASDLSAELSVPYEDIVQLEWLSNFVEDSFSGGSLTMNKEESTSINKD  124

Query  499   PPHN-KFQTsspvsvlesssssssssscsGGKTTIPLSP-----SRCGVQRARSKRPRPA  660
               H+ +FQTSSPVSVLESSSS S       G+ T+P SP      R G  RARSKRPRPA
Sbjct  125   SSHHHQFQTSSPVSVLESSSSCS-------GEKTVPRSPEIIASGRRG--RARSKRPRPA  175

Query  661   TFNPRPAIQLISPTSSFTEAP-QPFVAPAVSSESENFAESPMK-KLTTRPEAPEQkkkkk  834
             TF PRPA+QLISP+SS TE P QPFV P   S+SEN+AES +  KL  +   PE KKKKK
Sbjct  176   TFTPRPAMQLISPSSSATETPHQPFVVPKAPSDSENYAESRLLIKLPNKQVVPEHKKKKK  235

Query  835   ikFTIPIAPVDTNQNQPP----QAIRKCLHCEITKTPQWRAGPMGPKTLCNACGVRYKSG  1002
             IKFT+P+   +T+ +  P    QA+RKC+HCEITKTPQWRAGPMGPKTLCNACGVRYKSG
Sbjct  236   IKFTVPLGSAETSHDSSPPPQQQAVRKCMHCEITKTPQWRAGPMGPKTLCNACGVRYKSG  295

Query  1003  RLFPEYRPAASPTFTPSLHSNSHKKVIEMRSKVG  1104
             RLFPEYRPAASPTF PSLHSNSHKKV+EMR+KVG
Sbjct  296   RLFPEYRPAASPTFVPSLHSNSHKKVLEMRNKVG  329



>ref|XP_007218229.1| hypothetical protein PRUPE_ppa007936mg [Prunus persica]
 gb|EMJ19428.1| hypothetical protein PRUPE_ppa007936mg [Prunus persica]
Length=351

 Score =   325 bits (834),  Expect = 7e-103, Method: Compositional matrix adjust.
 Identities = 203/333 (61%), Positives = 242/333 (73%), Gaps = 35/333 (11%)
 Frame = +1

Query  169   MGSNFMDELDCGSFFDHIDDLIEFPPENECVGGVG-----SGEFKNFPSIWND-----PL  318
             +G NF+DE+DCGSFFD IDDL++FP  ++   G+G     +  F N  S+W +     P 
Sbjct  2     IGPNFIDEIDCGSFFDTIDDLLDFP-NDDVESGLGPAPDCNAAFNN--SLWPNQSGSLPA  58

Query  319   PDSEPLFSGSHNNSAADLSAELSVPYEDIIQLEWLSTFVEDSFSGGGMTLGKENTPVNVE  498
             P+     +G   NSA+DLSAELSVP EDI+QLEWLS FVEDSFSGG +T+ K ++ +N +
Sbjct  59    PNDAVFSAG---NSASDLSAELSVPIEDIVQLEWLSNFVEDSFSGGSLTINKPDSFINKD  115

Query  499   PPHNKFQTsspvsvlesssssssssscsGGKTTIPLSPSRCGV----QRARSKRPRPATF  666
               H +FQTSSP+SVL+SSSS S       G   +P SP          RARSKRPRPATF
Sbjct  116   TSHRQFQTSSPISVLDSSSSCS-------GDKNVPQSPGPVAAPGKRGRARSKRPRPATF  168

Query  667   NPRPAIQLISPTSSFTEA--PQ--PFVAPAVSSESENFAES-PMKKLTTRPEAPEQkkkk  831
             NPR AIQLISP SS TEA  PQ  PF+AP + S+SENFAES P+ K+  +    EQKKKK
Sbjct  169   NPRSAIQLISPASSVTEAEGPQAEPFLAPKIPSDSENFAESRPVIKIPKQASG-EQKKKK  227

Query  832   kikFTIPIAPVDTNQNQPP--QAIRKCLHCEITKTPQWRAGPMGPKTLCNACGVRYKSGR  1005
             K+K ++P+AP + NQN  P   A+RKCLHCEITKTPQWRAGPMGPKTLCNACGVRYKSGR
Sbjct  228   KLKVSLPLAPFEGNQNSGPTQAAVRKCLHCEITKTPQWRAGPMGPKTLCNACGVRYKSGR  287

Query  1006  LFPEYRPAASPTFTPSLHSNSHKKVIEMRSKVG  1104
             LFPEYRPAASPTF PSLHSNSHKKV+EMR+K G
Sbjct  288   LFPEYRPAASPTFVPSLHSNSHKKVLEMRTKGG  320



>ref|XP_008233316.1| PREDICTED: GATA transcription factor 8 [Prunus mume]
 ref|XP_008233317.1| PREDICTED: GATA transcription factor 8 [Prunus mume]
Length=351

 Score =   323 bits (829),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 201/333 (60%), Positives = 241/333 (72%), Gaps = 35/333 (11%)
 Frame = +1

Query  169   MGSNFMDELDCGSFFDHIDDLIEFPPENECVGGVG-----SGEFKNFPSIWND-----PL  318
             +G NF+DE+DCGSFFD IDDL++FP  ++   G+G     +  F N  S+W +     P 
Sbjct  2     IGPNFIDEIDCGSFFDTIDDLLDFP-NDDVESGLGPASDCNAAFNN--SLWPNQSGSLPA  58

Query  319   PDSEPLFSGSHNNSAADLSAELSVPYEDIIQLEWLSTFVEDSFSGGGMTLGKENTPVNVE  498
             P+     +G   NSA+DLSAELSVP EDI+QLEWLS FVEDSFSGG +T+ K ++ +N +
Sbjct  59    PNDAVFSAG---NSASDLSAELSVPIEDIVQLEWLSNFVEDSFSGGSLTINKPDSFINKD  115

Query  499   PPHNKFQTsspvsvlesssssssssscsGGKTTIPLSPSRCGV----QRARSKRPRPATF  666
               H++FQTSSP+SVL+SSSS S       G   +P SP          RARSKR  PATF
Sbjct  116   TSHHQFQTSSPISVLDSSSSCS-------GDKNVPQSPGPIAAPGKRGRARSKRLSPATF  168

Query  667   NPRPAIQLISPTSSFTEA----PQPFVAPAVSSESENFAES-PMKKLTTRPEAPEQkkkk  831
             NPR AIQLISP SS TEA     QPF+AP V S+SENFAES P+ K+  +    EQKKKK
Sbjct  169   NPRSAIQLISPASSVTEAEGPQAQPFLAPKVPSDSENFAESRPVIKIPKQASG-EQKKKK  227

Query  832   kikFTIPIAPVDTNQNQPP--QAIRKCLHCEITKTPQWRAGPMGPKTLCNACGVRYKSGR  1005
             K+K ++P+AP++ NQN  P   A+RKCLHCEITKTPQWRAGPMGPKTLCNACGVRYKSGR
Sbjct  228   KLKVSLPLAPLEGNQNSGPTQAAVRKCLHCEITKTPQWRAGPMGPKTLCNACGVRYKSGR  287

Query  1006  LFPEYRPAASPTFTPSLHSNSHKKVIEMRSKVG  1104
             LFPEYRPAASPTF PSLHSNSHKKV+EMR+K G
Sbjct  288   LFPEYRPAASPTFVPSLHSNSHKKVLEMRTKGG  320



>ref|XP_003536350.1| PREDICTED: GATA transcription factor 8-like isoform X1 [Glycine 
max]
 ref|XP_006589425.1| PREDICTED: GATA transcription factor 8-like isoform X2 [Glycine 
max]
 ref|XP_006589426.1| PREDICTED: GATA transcription factor 8-like isoform X3 [Glycine 
max]
Length=347

 Score =   317 bits (812),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 202/328 (62%), Positives = 234/328 (71%), Gaps = 30/328 (9%)
 Frame = +1

Query  169   MGSNFMDELDCGSFFDHIDDLIEFPPENECVGG-----VGSGEFKNFPSIW---NDPLPD  324
             +G NFMDE+DCGSFFDHIDDL++FP E+   G      V +G   +  SIW   +D  P 
Sbjct  2     VGPNFMDEIDCGSFFDHIDDLLDFPVEDVDGGAATLPSVSAGNSNSLASIWPSESDSFPA  61

Query  325   SEPLFSGSHNNSAADLSAELSVPYEDIIQLEWLSTFVEDSFSGGGMTLGKENTP---VNV  495
             S+ +FSG   NSA+DLSAELSVPYEDI+QLEWLS FVEDSF GG +T+ K   P      
Sbjct  62    SDSVFSG---NSASDLSAELSVPYEDIVQLEWLSNFVEDSFCGGSLTMNKVEEPSCTTKE  118

Query  496   EPPHNKFQTsspvsvlesssssssssscsGGKTTIPLSPSR-----CGVQRARSKRPRPA  660
             +  + +F TSSPVSVLESSSS S      GGKT  P SP       CG  RARSKRPRPA
Sbjct  119   DSVNTQFHTSSPVSVLESSSSCS------GGKTLPPRSPEIYIPVPCG--RARSKRPRPA  170

Query  661   TFNPRPAIQLISPTSSFT-EAPQP-FVAPAVSSESENFAESPMKKLTTRPEAPEQkkkkk  834
             TFNPRPA+ LISP SSF  E  QP  ++   SS+SENFAES +     +  + E KKKKK
Sbjct  171   TFNPRPAMNLISPASSFVGENMQPNVISSKASSDSENFAESQLVPKMPKLASGEPKKKKK  230

Query  835   ikFTIPIAPVDTNQNQPPQAIRKCLHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFP  1014
             +K  +P+AP D NQN   Q +RKC+HCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFP
Sbjct  231   VKVPLPVAPADNNQNAS-QPVRKCMHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFP  289

Query  1015  EYRPAASPTFTPSLHSNSHKKVIEMRSK  1098
             EYRPAASPTF PS+HSNSHKKV+EMR +
Sbjct  290   EYRPAASPTFCPSVHSNSHKKVLEMRCR  317



>ref|XP_004496271.1| PREDICTED: GATA transcription factor 8-like isoform X1 [Cicer 
arietinum]
 ref|XP_004496272.1| PREDICTED: GATA transcription factor 8-like isoform X2 [Cicer 
arietinum]
Length=345

 Score =   317 bits (811),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 206/334 (62%), Positives = 237/334 (71%), Gaps = 29/334 (9%)
 Frame = +1

Query  169   MGSNFMDELDCGSFFDHIDDLIEFPPE-----NECVGGVGS-GEFKNFPSIW---NDPLP  321
             +G NFMDELDCGSFFD IDDL++FP +     N  +  V S G   +  SIW   +   P
Sbjct  2     VGPNFMDELDCGSFFDQIDDLLDFPVDDVDTANASLPSVASAGNCNSLASIWPSESHSFP  61

Query  322   DSEPLFSGSHNNSAADLSAELSVPYEDIIQLEWLSTFVEDSFSGGGMTLGK-ENTPVNV-  495
              S+ +FSG   NSA+DLSAELSVPYEDI+QLEWLS FVEDSFS G +T+ K E  P +  
Sbjct  62    ASDSVFSG---NSASDLSAELSVPYEDIVQLEWLSNFVEDSFSEGSLTMKKIEQQPSSCA  118

Query  496   ---EPPHNKFQTsspvsvlesssssssssscsGGKTTIPLSPSRCGVQRARSKRPRPATF  666
                +  HN+FQTSSPVSVLESSSSSS      GGKTT    P  CG  RAR+KRPRPATF
Sbjct  119   TKEDSVHNQFQTSSPVSVLESSSSSS------GGKTTGIYIPVPCG--RARTKRPRPATF  170

Query  667   NPRPAIQLISPTSSFT-EAPQP-FVAPAVSSESENFAESPMKKLTTRPEAPEQkkkkkik  840
             NPR A+QLISPTSSF  E  QP  ++   S E EN  ES +     +  + E KKKKK+K
Sbjct  171   NPRSAMQLISPTSSFVGENMQPNVISTKASLEFENVVESQIVGKKPKLASGESKKKKKMK  230

Query  841   FTIPIAPVDTNQNQPPQAIRKCLHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEY  1020
               +P AP D+NQ+   Q IRKC+HCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEY
Sbjct  231   MPLPAAPADSNQDAS-QPIRKCMHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEY  289

Query  1021  RPAASPTFTPSLHSNSHKKVIEMRSKVGVENTAI  1122
             RPAASPTF PSLHSNSHKKV+EMR K  +EN+  
Sbjct  290   RPAASPTFCPSLHSNSHKKVLEMRCK-DIENSGF  322



>gb|KHN17141.1| GATA transcription factor 9 [Glycine soja]
Length=339

 Score =   315 bits (808),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 200/323 (62%), Positives = 232/323 (72%), Gaps = 28/323 (9%)
 Frame = +1

Query  169   MGSNFMDELDCGSFFDHIDDLIEFPPENECVGGVGSGEFKNFPSIW---NDPLPDSEPLF  339
             +G NFMDE+DCGSFFDHIDDL++FP     +  V +G   +  SIW   +D  P S+ +F
Sbjct  2     VGPNFMDEIDCGSFFDHIDDLLDFP---ATLPSVSAGNSNSLASIWPSESDSFPASDSVF  58

Query  340   SGSHNNSAADLSAELSVPYEDIIQLEWLSTFVEDSFSGGGMTLGKENTP---VNVEPPHN  510
             SG   NSA+DLSAELSVPYEDI+QLEWLS FVEDSF GG +T+ K   P      +  + 
Sbjct  59    SG---NSASDLSAELSVPYEDIVQLEWLSNFVEDSFCGGSLTMNKVEEPSCTTKEDSVNT  115

Query  511   KFQTsspvsvlesssssssssscsGGKTTIPLSPSR-----CGVQRARSKRPRPATFNPR  675
             +F TSSPVSVLESSSS S      GGKT  P SP       CG  RARSKRPRPATFNPR
Sbjct  116   QFHTSSPVSVLESSSSCS------GGKTLPPRSPEIYIPVPCG--RARSKRPRPATFNPR  167

Query  676   PAIQLISPTSSFT-EAPQP-FVAPAVSSESENFAESPMKKLTTRPEAPEQkkkkkikFTI  849
             PA+ LISP SSF  E  QP  ++   SS+SENFAES +     +  + E KKKKK+K  +
Sbjct  168   PAMNLISPASSFVGENMQPNVISSKASSDSENFAESQLVPKMPKLASGEPKKKKKVKVPL  227

Query  850   PIAPVDTNQNQPPQAIRKCLHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPA  1029
             P+AP D NQN   Q +RKC+HCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPA
Sbjct  228   PVAPADNNQNAS-QPVRKCMHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPA  286

Query  1030  ASPTFTPSLHSNSHKKVIEMRSK  1098
             ASPTF PS+HSNSHKKV+EMR +
Sbjct  287   ASPTFCPSVHSNSHKKVLEMRCR  309



>ref|XP_008347480.1| PREDICTED: GATA transcription factor 8-like [Malus domestica]
Length=351

 Score =   313 bits (803),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 198/329 (60%), Positives = 236/329 (72%), Gaps = 27/329 (8%)
 Frame = +1

Query  169   MGSNFMDELDCGSFFDHIDDLIEFPPEN---------ECVGGVGSGEFKNFPSIWNDPLP  321
             +G +F+D++DCGS FD IDDL++FP ++         +C     S     +PS      P
Sbjct  2     IGQSFIDDIDCGSLFDTIDDLLDFPTDDVESALGPAPDCNAAFNSSSL--WPSQSXSLQP  59

Query  322   DSEPLFSGSHNNSAADLSAELSVPYEDIIQLEWLSTFVEDSFSGGGMTLGK-ENTPVNVE  498
              +E +FSG   NSA+DLSAEL VP EDI+QLEWLS F EDSFSGG +T+ K +N+ VN E
Sbjct  60    PNEAVFSG---NSASDLSAELDVPIEDIVQLEWLSNFCEDSFSGGSLTINKPDNSFVNNE  116

Query  499   PPHNKFQTsspvsvlesssssssssscsGGKTTIPLSPSRCGVQRARSKRPRPATFNPRP  678
               H +FQTSSP+SVL+SSSS S        ++  P+ P + G  RARSKRPRPATFNPRP
Sbjct  117   SSHRQFQTSSPISVLDSSSSCSVEKXVP--QSPGPVVPGKRG--RARSKRPRPATFNPRP  172

Query  679   AIQLISPTSSFTEAP----QPFVAPAVSSESENFAES-PMKKLTTRPEAPEQkkkkkikF  843
             AIQLISP SS TEA     QP + P + S+SENFAES P+ K+  +    EQKKKKKIK 
Sbjct  173   AIQLISPASSVTEAEALQHQPLLPPKLHSDSENFAESRPVIKIPXQASG-EQKKKKKIKL  231

Query  844   TIPIAPVDTNQNQPPQ--AIRKCLHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPE  1017
             T+P AP + NQ+      A+RKCLHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPE
Sbjct  232   TLPQAPAEGNQSSGTTQGAVRKCLHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPE  291

Query  1018  YRPAASPTFTPSLHSNSHKKVIEMRSKVG  1104
             YRPAASPTF P+LHSNSHKKVIEMR+K G
Sbjct  292   YRPAASPTFVPALHSNSHKKVIEMRNKGG  320



>ref|XP_007143712.1| hypothetical protein PHAVU_007G095300g [Phaseolus vulgaris]
 gb|ESW15706.1| hypothetical protein PHAVU_007G095300g [Phaseolus vulgaris]
Length=354

 Score =   313 bits (803),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 195/343 (57%), Positives = 232/343 (68%), Gaps = 38/343 (11%)
 Frame = +1

Query  169   MGSNFMDELDCGSFFDHIDDLIEFPPENE--------CVGGVGSGEFKNFPSIW---NDP  315
             +G NFMDE+DCGSFFDHIDDL++FP E+          V    +G   +  SIW   +D 
Sbjct  2     VGPNFMDEIDCGSFFDHIDDLLDFPVEDVDGGAPTLPSVAAAAAGNCNSLASIWPAGSDS  61

Query  316   LPDSEPLFSGSHNNSAADLSAELSVPYEDIIQLEWLSTFVEDSFSGGGMTLGKENTP---  486
              P S+ +FSG   NSA+DLSAELSVPYEDI+QLEWLS FVEDSF GG +T+ K + P   
Sbjct  62    FPGSDSVFSG---NSASDLSAELSVPYEDIVQLEWLSNFVEDSFCGGSLTMKKVDEPSCT  118

Query  487   -VNVEPPHNKFQTsspvsvlesssssssssscsGGKTTIPLSPSR--------CGVQRAR  639
                 +  HN+F TSSPVSVLESSSS S      GGKT +P  P          CG  RAR
Sbjct  119   TTKEDSVHNQFHTSSPVSVLESSSSCS------GGKT-VPAPPRSPEVYIPVPCG--RAR  169

Query  640   SKRPRPATFNPRPAIQLISPTSSFT--EAPQPFVAPAVSSESENFAESPMKKLTTRPEAP  813
             SKRPRPATFNPRPA+ LISP SSF         ++   SS+SENFAES +     +    
Sbjct  170   SKRPRPATFNPRPAMNLISPASSFVGENMQANVISSKASSDSENFAESQLVAKMPKQGCG  229

Query  814   EQkkkkkikFTIPIAPVDTNQNQPPQAIRKCLHCEITKTPQWRAGPMGPKTLCNACGVRY  993
             E KKKKK+K T+   P D+N     Q +RKC+HCEITKTPQWRAGPMGPKTLCNACGVR+
Sbjct  230   EMKKKKKVKVTLGAGPGDSNNQNGLQPVRKCMHCEITKTPQWRAGPMGPKTLCNACGVRF  289

Query  994   KSGRLFPEYRPAASPTFTPSLHSNSHKKVIEMRSKVGVENTAI  1122
             KSGRL+PEYRPAASPTF PS+HSNSHKKV+EMR + G++ +  
Sbjct  290   KSGRLYPEYRPAASPTFCPSVHSNSHKKVLEMRCR-GIDKSGF  331



>gb|EYU39843.1| hypothetical protein MIMGU_mgv1a010405mg [Erythranthe guttata]
Length=313

 Score =   311 bits (798),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 191/324 (59%), Positives = 222/324 (69%), Gaps = 33/324 (10%)
 Frame = +1

Query  169   MGSNFMDELDCGSFFDHIDDLIEFPPENECVGG--VGSGEFKNFPSIWND-PLPDSEPLF  339
             M  NFMDE+DCG+FFD IDDLIEFPP+NE VGG  V S   K+FPS+WND  LP+S+ LF
Sbjct  1     MEPNFMDEIDCGNFFDQIDDLIEFPPDNEDVGGIFVNSDSSKDFPSMWNDDALPESDHLF  60

Query  340   SGSHNNSAADLSAELSVPYEDIIQLEWLSTFVEDSFSGGGMTLG-KENTPVNVEPP--HN  510
             S    N+A+DLSAELSVPYEDI+QLEWLSTFVEDSFSGGGMT+  KEN   +   P  H 
Sbjct  61    SA---NAASDLSAELSVPYEDIVQLEWLSTFVEDSFSGGGMTIAAKENLREHKNEPTSHT  117

Query  511   KFQTsspvsvlesssssssssscsGGKTTIPLSPSRCGVQRARSKRPRPATFNPRPAIQL  690
              +Q  +   V    S+SSSSS+ S G+TT  L P+  G QRARSKRPRP+TFNPRP    
Sbjct  118   TYQFQTSSPVSVLESTSSSSSTTSVGQTTAHLPPTHRGPQRARSKRPRPSTFNPRPTT--  175

Query  691   ISPTSSFTEAPQPFVAPAVSSESENFAESPMKKLTTRPEAPEQkkkkkikFTIPIAPVDT  870
                  SF +       P  SSE+E F E         P A  +  K+K     P +  + 
Sbjct  176   ---IPSFVD-----TTPQFSSETEIFVEE------APPLATNKIPKRKKMKKTPPSNRED  221

Query  871   NQNQ------PPQAIRKCLHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAA  1032
             + N+      PP  +RKC HCEITKTPQWRAGP GPKTLCNACGVRYKSGRLFPEYRPAA
Sbjct  222   DDNEGGAHGDPP--VRKCKHCEITKTPQWRAGPTGPKTLCNACGVRYKSGRLFPEYRPAA  279

Query  1033  SPTFTPSLHSNSHKKVIEMRSKVG  1104
             SPTF P+LHSNSHKKV+EMR+KVG
Sbjct  280   SPTFVPALHSNSHKKVVEMRTKVG  303



>ref|XP_009345388.1| PREDICTED: GATA transcription factor 8-like [Pyrus x bretschneideri]
Length=351

 Score =   312 bits (800),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 204/348 (59%), Positives = 239/348 (69%), Gaps = 39/348 (11%)
 Frame = +1

Query  169   MGSNFMDELDCGSFFDHIDDLIEFPPEN---------ECVGGVGSGEFKNFPSIWNDPLP  321
             MG +F+D++DCGS FD IDDL++FP ++         +C     S     +PS      P
Sbjct  2     MGPSFIDDIDCGSLFDTIDDLLDFPTDDVESALGPTPDCDAAFNSS--SPWPSQSGSLQP  59

Query  322   DSEPLFSGSHNNSAADLSAELSVPYEDIIQLEWLSTFVEDSFSGGGMTLGKENTP-VNVE  498
              +E +FSG   NSA+DLSAEL VP EDI+QLEWLS F EDSFSGG +T+ K + P VN E
Sbjct  60    PNEAVFSG---NSASDLSAELDVPIEDIVQLEWLSNFCEDSFSGGSLTINKPDNPFVNNE  116

Query  499   PPHNKFQTsspvsvlesssssssssscsGGKTTIPLSPSRC---GVQRARSKRPRPATFN  669
               H +FQTSSP+SVL+SSSS S        +  +P SP +       RARSKRPRPATFN
Sbjct  117   SSHQQFQTSSPISVLDSSSSCSV-------EKNVPQSPGQVVPGKRGRARSKRPRPATFN  169

Query  670   PRPAIQLISPTSSFTEAP----QPFVAPAVSSESENFAES-PMKKLTTRPEAPEQkkkkk  834
             PRPAIQLISP SS TEA     QP +   V S+SENFAES P+ K+  +    EQKKKKK
Sbjct  170   PRPAIQLISPASSVTEAEALQHQPLLPLKVHSDSENFAESRPVIKIPKQASG-EQKKKKK  228

Query  835   ikFTIPIAPVDTNQNQPPQ--AIRKCLHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRL  1008
             IK TIP AP + NQ+      A+RKCLHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRL
Sbjct  229   IKLTIPQAPAEGNQSSGTTQGAVRKCLHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRL  288

Query  1009  FPEYRPAASPTFTPSLHSNSHKKVIEMRSK------VGVENTAITEAP  1134
             FPEYRPAASPTF P+LHSNSHKKV+EMR+K       G   TA+TE P
Sbjct  289   FPEYRPAASPTFVPALHSNSHKKVLEMRNKGGELVPFGETTTAMTETP  336



>ref|XP_006574762.1| PREDICTED: GATA transcription factor 8-like isoform X2 [Glycine 
max]
 ref|XP_006574763.1| PREDICTED: GATA transcription factor 8-like isoform X3 [Glycine 
max]
Length=333

 Score =   311 bits (797),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 190/335 (57%), Positives = 227/335 (68%), Gaps = 25/335 (7%)
 Frame = +1

Query  169   MGSNFMDELDCGSFFDHIDDLIEFPPENECVGGVGSGEFKNFPSIWNDPLPDSEPLFSGS  348
             M  NF+D++DCGSFFDHIDDL+EFP +N            NF S  +D LP S  +FS  
Sbjct  1     MIGNFIDDIDCGSFFDHIDDLLEFPDDN----AAPVAPPANFWSAESDSLPASYTVFS--  54

Query  349   HNNSAADLSAELSVPYEDIIQLEWLSTFVEDSFSGGGMTLGKENTP-----VNVEPPHNK  513
              +NS  DLSAELSV Y+DI+QLEWLS FVEDSFSGG +T+ KE  P        +  H +
Sbjct  55    -DNSVTDLSAELSVSYDDIVQLEWLSNFVEDSFSGGSITMKKEEEPQCTTTTKEDIAHAQ  113

Query  514   FQTsspvsvlesssssssssscsGG-KTTIPLSPSRCGVQRARSKRPRPATFNPRPAIQL  690
             FQT+SPVSVLESSS  S   + S G +  IP+    CG  R RSKRPRPATFNP P +QL
Sbjct  114   FQTASPVSVLESSSFCSGEKAASRGPEIYIPVP---CG--RVRSKRPRPATFNPHPVMQL  168

Query  691   ISPTSSFTEAPQ---PFVAPAVSSESENFAESPMKKLTTRPEAPEQkkkkkikFTIPIAP  861
             ISP SS  E  Q      + A SS+SENFAES +K     P+    + K K K  +  + 
Sbjct  169   ISPASSTGENVQHNATTTSKAASSDSENFAESVIKG----PKQASGEHKNKRKIKVTFSS  224

Query  862   VDTNQNQPPQAIRKCLHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPT  1041
                 QN P QA+RKCLHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPT
Sbjct  225   GQEQQNAPSQAVRKCLHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPT  284

Query  1042  FTPSLHSNSHKKVIEMRSKVGVENTAITEAPSTPQ  1146
             F  ++HSNSHKKVIEMR+K G ++   T++ ++P+
Sbjct  285   FCAAVHSNSHKKVIEMRNKTGTKSGFATDSAASPE  319



>ref|XP_008446884.1| PREDICTED: GATA transcription factor 8 [Cucumis melo]
Length=353

 Score =   311 bits (798),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 202/344 (59%), Positives = 238/344 (69%), Gaps = 37/344 (11%)
 Frame = +1

Query  169   MGSNFMDELDCGSFFDHIDDLIEFPPENECVG---GVGSGEFKNFPSIW---NDPLPDSE  330
             +G+NF+DE+DCGSFFD IDDL++FP E+   G     G     +FP+IW   ++ LP S+
Sbjct  2     IGNNFVDEIDCGSFFDQIDDLLDFPVEDVDTGLPPAKGGDSTNSFPTIWPTHSESLPGSD  61

Query  331   PLFSGSHNNSAADLSAELSVPYEDIIQLEWLSTFVEDSFSGGGMTLGKENTPVNVEPPHN  510
              +FS    NS +DLSAELSVPYEDI+QL+WL+ FVEDSF GG +T+ KE  P ++   HN
Sbjct  62    SVFSA---NSNSDLSAELSVPYEDIVQLDWLANFVEDSFCGGSLTMNKEE-PKDLT--HN  115

Query  511   KFQTsspvsvlesssssssssscsGGKTTIPLSP----SRCGVQR--ARSKRPRPATFNP  672
             +FQTSSPVSVLESSSS SS       KT  P SP    +  G QR  ARSKRPRPATFNP
Sbjct  116   QFQTSSPVSVLESSSSCSS------DKTLQPRSPEPTVATPGQQRGRARSKRPRPATFNP  169

Query  673   RPAIQLISPTSSFTEAPQPF----VAPAVSSESENFAES-PMKKLTTRPEAPE-----Qk  822
             RP IQLISP SS TE   P     + P   S++ENFAES P  KL     A       + 
Sbjct  170   RPPIQLISPASSVTETTTPDQTLQLVPKAPSDTENFAESRPSVKLPKHGAAASGTQKIKN  229

Query  823   kkkkikFTI--PIAPVDTNQNQPP-QAIRKCLHCEITKTPQWRAGPMGPKTLCNACGVRY  993
             KK K+ F++  P+     NQN P  Q++RKC+HCEITKTPQWRAGPMGPKTLCNACGVRY
Sbjct  230   KKIKLSFSLAPPLEAGAGNQNLPSSQSVRKCMHCEITKTPQWRAGPMGPKTLCNACGVRY  289

Query  994   KSGRLFPEYRPAASPTFTPSLHSNSHKKVIEMRSKVGVENTAIT  1125
             KSGRLFPEYRPAASPTF PSLHSNSHKKV+EMR+K      AIT
Sbjct  290   KSGRLFPEYRPAASPTFIPSLHSNSHKKVLEMRNKTDENTAAIT  333



>ref|XP_009344766.1| PREDICTED: GATA transcription factor 8-like [Pyrus x bretschneideri]
Length=354

 Score =   310 bits (793),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 199/345 (58%), Positives = 240/345 (70%), Gaps = 33/345 (10%)
 Frame = +1

Query  169   MGSNFMDELDCGSFFDHIDDLIEFPPEN---------ECVGGVGSGEFKNFPSIWNDPLP  321
             +G N++D++DCGS FD IDDL++FP ++         +C   + S     +PS      P
Sbjct  5     IGPNYIDDIDCGSLFDTIDDLLDFPTDDVESVLGPVPDCNAAINSSSL--WPSHSGSLQP  62

Query  322   DSEPLFSGSHNNSAADLSAELSVPYEDIIQLEWLSTFVEDSFSGGGMTLGK-ENTPVNVE  498
              ++ +FS    NSA+DLSAEL VP EDI+QLEWLS F EDSFSGG +T+ K +++ +N E
Sbjct  63    PNDAVFSC---NSASDLSAELDVPIEDIVQLEWLSNFCEDSFSGGSLTINKPDSSFINKE  119

Query  499   PPHNKFQTsspvsvlesssssssssscsGGKTTIPLSPSRCGVQRARSKRPRPATFNPRP  678
               H +FQTSSP+SVL+SSSS S   +      T+   P + G  RARSKRPRPATFNPR 
Sbjct  120   SSHQQFQTSSPISVLDSSSSCSVEKNVPQSPGTV--VPGKRG--RARSKRPRPATFNPRS  175

Query  679   AIQLISPTSSFTEAP----QPFVAPAVSSESENFAES-PMKKLTTRPEAPEQkkkkkikF  843
             AIQLISP SS TEA     QP + P V S+SENFAES P+ K+  +    EQKKKKKIK 
Sbjct  176   AIQLISPASSVTEAEALQHQPLLPPKVHSDSENFAESRPVIKIPKQASG-EQKKKKKIKL  234

Query  844   TIPIAPVDTNQNQPPQ--AIRKCLHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPE  1017
             T+P AP + NQ+      A+RKCLHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPE
Sbjct  235   TLPQAPAEGNQSSGTTQGAVRKCLHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPE  294

Query  1018  YRPAASPTFTPSLHSNSHKKVIEMRSK------VGVENTAITEAP  1134
             YRPAASPTF P+LHSNSHKKVIEMR+K       G   TA+TE P
Sbjct  295   YRPAASPTFVPALHSNSHKKVIEMRNKGGELIPFGETTTAMTETP  339



>ref|XP_009770305.1| PREDICTED: GATA transcription factor 8-like, partial [Nicotiana 
sylvestris]
Length=272

 Score =   305 bits (782),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 190/260 (73%), Positives = 204/260 (78%), Gaps = 9/260 (3%)
 Frame = +1

Query  394   YEDIIQLEWLSTFVEDSFSGGGMTLGKENTPVNVEPPHNKFQTsspvsvlesssssssss  573
             YEDI+QLEWLSTFVEDSFSGGG+TLGKEN P+  E    KFQTSSPVSVLESSSSSSSSS
Sbjct  5     YEDIVQLEWLSTFVEDSFSGGGLTLGKENFPLYKETSEAKFQTSSPVSVLESSSSSSSSS  64

Query  574   scsGGKTTIPLS-PSRCGVQRARSKRPRPATFNPRPAIQLISPTSSFTEAPQPFVAPAVS  750
                  + T+PLS P   G QRARSKRPRPATFNP P IQLISPTSSFTE PQPFVA  ++
Sbjct  65    C--SVEKTVPLSSPCHRGPQRARSKRPRPATFNPAPVIQLISPTSSFTEIPQPFVARGIA  122

Query  751   SESENFAESPMKKLTTRPEAPEQkkkkkikFTIPIAPVDTNQNQPPQAIRKCLHCEITKT  930
             SESENFAESPMKK+  +P   EQKKKK    + P A V+ NQN   Q IRKC HCEITKT
Sbjct  123   SESENFAESPMKKIL-KPAVAEQKKKKLK-LSFPSARVEANQNPVAQTIRKCQHCEITKT  180

Query  931   PQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFTPSLHSNSHKKVIEMRSKV---  1101
             PQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTF PS+HSNSHKKVIEMR+K    
Sbjct  181   PQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFVPSIHSNSHKKVIEMRTKFVPD  240

Query  1102  GVENTAITEAPST-PQPAFN  1158
                N A T  P+T  QP FN
Sbjct  241   NNANIARTAPPATVTQPEFN  260



>ref|XP_003519961.2| PREDICTED: GATA transcription factor 8-like isoform X1 [Glycine 
max]
Length=416

 Score =   310 bits (794),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 190/335 (57%), Positives = 227/335 (68%), Gaps = 25/335 (7%)
 Frame = +1

Query  169   MGSNFMDELDCGSFFDHIDDLIEFPPENECVGGVGSGEFKNFPSIWNDPLPDSEPLFSGS  348
             M  NF+D++DCGSFFDHIDDL+EFP +N            NF S  +D LP S  +FS  
Sbjct  84    MIGNFIDDIDCGSFFDHIDDLLEFPDDN----AAPVAPPANFWSAESDSLPASYTVFS--  137

Query  349   HNNSAADLSAELSVPYEDIIQLEWLSTFVEDSFSGGGMTLGKENTP-----VNVEPPHNK  513
              +NS  DLSAELSV Y+DI+QLEWLS FVEDSFSGG +T+ KE  P        +  H +
Sbjct  138   -DNSVTDLSAELSVSYDDIVQLEWLSNFVEDSFSGGSITMKKEEEPQCTTTTKEDIAHAQ  196

Query  514   FQTsspvsvlesssssssssscsGG-KTTIPLSPSRCGVQRARSKRPRPATFNPRPAIQL  690
             FQT+SPVSVLESSS  S   + S G +  IP+    CG  R RSKRPRPATFNP P +QL
Sbjct  197   FQTASPVSVLESSSFCSGEKAASRGPEIYIPVP---CG--RVRSKRPRPATFNPHPVMQL  251

Query  691   ISPTSSFTEAPQ---PFVAPAVSSESENFAESPMKKLTTRPEAPEQkkkkkikFTIPIAP  861
             ISP SS  E  Q      + A SS+SENFAES +K     P+    + K K K  +  + 
Sbjct  252   ISPASSTGENVQHNATTTSKAASSDSENFAESVIKG----PKQASGEHKNKRKIKVTFSS  307

Query  862   VDTNQNQPPQAIRKCLHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPT  1041
                 QN P QA+RKCLHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPT
Sbjct  308   GQEQQNAPSQAVRKCLHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPT  367

Query  1042  FTPSLHSNSHKKVIEMRSKVGVENTAITEAPSTPQ  1146
             F  ++HSNSHKKVIEMR+K G ++   T++ ++P+
Sbjct  368   FCAAVHSNSHKKVIEMRNKTGTKSGFATDSAASPE  402



>ref|XP_003548072.1| PREDICTED: GATA transcription factor 8-like isoform X1 [Glycine 
max]
 ref|XP_006599443.1| PREDICTED: GATA transcription factor 8-like isoform X2 [Glycine 
max]
Length=333

 Score =   305 bits (780),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 186/338 (55%), Positives = 225/338 (67%), Gaps = 31/338 (9%)
 Frame = +1

Query  169   MGSNFMDELDCGSFFDHIDDLIEFPPENECVGGVGSGEFKNFPSIWN---DPLPDSEPLF  339
             M  NF+D++DCG+FFDHIDDL+EFP +        +       + W+   D LP ++ +F
Sbjct  1     MIGNFIDDIDCGNFFDHIDDLLEFPDDAAAADTSAAAPVPPPANFWSAESDSLPATDTVF  60

Query  340   SGSHNNSAADLSAELSVPYEDIIQLEWLSTFVEDSFSGGGMTLGKE-----NTPVNVEPP  504
             S   +NS  DLSAELSVPYEDI+QLEWLS FVEDSFSGG MT+ KE      T  ++ P 
Sbjct  61    S---DNSVTDLSAELSVPYEDIMQLEWLSNFVEDSFSGGSMTMKKEEPQCTTTKEDIAPA  117

Query  505   HNKFQTsspvsvlesssssssssscsGGKTTIPLSPSRCGVQRARSKRPRPATFNPRPAI  684
               +FQT+SPVSVLESSS  S   + +    ++P     CG  RARSKRPRPATFNP P +
Sbjct  118   --QFQTASPVSVLESSSFCSGEKAGTEINISVP-----CG--RARSKRPRPATFNPNPVM  168

Query  685   QLISPTSSFTEAPQPFVA--PAVSSESENFAESPMKKLTTRPEAPEQkkkkkikFTIPIA  858
             QLISP SS  E  Q   A     SS+SENFAES +K       AP+Q   +  K      
Sbjct  169   QLISPASSTGENTQHNAANTSKASSDSENFAESVIK-------APKQASGEHKKKKKIKV  221

Query  859   --PVDTNQNQPPQAIRKCLHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAA  1032
               P    +N P QAIRKCLHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAA
Sbjct  222   TFPSGQERNAPSQAIRKCLHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAA  281

Query  1033  SPTFTPSLHSNSHKKVIEMRSKVGVENTAITEAPSTPQ  1146
             SPTF  ++HSNSHKKV+EMR+K G ++   T + ++P+
Sbjct  282   SPTFCAAMHSNSHKKVLEMRNKTGTKSGFATVSAASPE  319



>ref|XP_004142426.1| PREDICTED: GATA transcription factor 9-like [Cucumis sativus]
 ref|XP_004166767.1| PREDICTED: GATA transcription factor 9-like [Cucumis sativus]
 gb|KGN52268.1| hypothetical protein Csa_5G622830 [Cucumis sativus]
Length=355

 Score =   303 bits (777),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 200/344 (58%), Positives = 239/344 (69%), Gaps = 35/344 (10%)
 Frame = +1

Query  169   MGSNFMDELDCGSFFDHIDDLIEFPPENECVG---GVGSGEFKNFPSIW---NDPLPDSE  330
             +G+NF+DE+DCGSFFDHIDDL++FP E+   G     G     +FP+IW   ++ LP S+
Sbjct  2     IGNNFVDEIDCGSFFDHIDDLLDFPVEDVDAGLPPAKGGDSANSFPTIWPTHSESLPGSD  61

Query  331   PLFSGSHNNSAADLSAELSVPYEDIIQLEWLSTFVEDSFSGGGMTLGKENTPVNVEPPHN  510
              +FS    NS +DLSAELSVPYEDI+QL+WL+ FVEDSF G G+T+ KE    ++   +N
Sbjct  62    SVFSA---NSNSDLSAELSVPYEDIVQLDWLANFVEDSFCGEGLTMNKEEVK-DLTHNNN  117

Query  511   KFQTsspvsvlesssssssssscsGGKTTIPLSP----SRCGVQR--ARSKRPRPATFNP  672
             +FQTSSPVSVLESSSS SS       KT  P SP    +  G QR  ARSKRPRPATF+P
Sbjct  118   QFQTSSPVSVLESSSSCSS------DKTLQPRSPEPTVATPGQQRGRARSKRPRPATFSP  171

Query  673   R-PAIQLISPTSSFTEAPQPFVA----PAVSSESENFAES-PMKKLTTRP--EAPEQkkk  828
             R P IQ ISP SS TE   P  A    P  +S+++NFAES P+ KL         ++ K 
Sbjct  172   RSPIIQRISPASSVTETTTPDQALQLVPKAASDTDNFAESRPLVKLPKHGAGSGTQKIKN  231

Query  829   kkikFTIPIAP----VDTNQNQPP-QAIRKCLHCEITKTPQWRAGPMGPKTLCNACGVRY  993
             KKIK +  +AP       NQN P  Q++RKC+HCEITKTPQWRAGPMGPKTLCNACGVRY
Sbjct  232   KKIKLSFSLAPPLEGGAGNQNLPSSQSVRKCMHCEITKTPQWRAGPMGPKTLCNACGVRY  291

Query  994   KSGRLFPEYRPAASPTFTPSLHSNSHKKVIEMRSKVGVENTAIT  1125
             KSGRLFPEYRPAASPTF PSLHSNSHKKV+EMR+K      AIT
Sbjct  292   KSGRLFPEYRPAASPTFIPSLHSNSHKKVLEMRNKTDENTAAIT  335



>ref|XP_003556234.1| PREDICTED: GATA transcription factor 8-like isoform X1 [Glycine 
max]
Length=348

 Score =   302 bits (773),  Expect = 7e-94, Method: Compositional matrix adjust.
 Identities = 204/345 (59%), Positives = 240/345 (70%), Gaps = 36/345 (10%)
 Frame = +1

Query  169   MGSNFMDELDCGSFFDHIDDLIEFPPENECVGGV------GSGEFKNFPSIW---NDPLP  321
             +G NFMDE+DCGSFFDHIDDL++FP E+   G         +G   +  SIW   +D  P
Sbjct  2     VGPNFMDEIDCGSFFDHIDDLLDFPVEDVDGGAATLPSVAAAGNCNSLASIWPAESDSFP  61

Query  322   DSEPLFSGSHNNSAADLSAELSVPYEDIIQLEWLSTFVEDSFSGGGMTLGKENTP---VN  492
              S+ +FSG   N+A+DLSAELSVPYEDI+QLEWLS FVEDSF GG +T+ K   P     
Sbjct  62    TSDSVFSG---NTASDLSAELSVPYEDIVQLEWLSNFVEDSFCGGSLTMNKVEEPSCTTK  118

Query  493   VEPPHNKFQTsspvsvlesssssssssscsGGKTTIPLS------PSRCGVQRARSKRPR  654
              +  + +F TSSPVSVLESSSS S      GGKT  PLS      P  CG  R RSKRPR
Sbjct  119   EDSVNTQFHTSSPVSVLESSSSCS------GGKT-FPLSSPEIYIPVPCG--RTRSKRPR  169

Query  655   PATFNPRPAIQLISPTSSFT-EAPQP-FVAPAVSSESENFAESPMKKLTTRPEAPEQkkk  828
             PATFNPRPA+ LISP SSF  E  QP  ++   SS+SENFAES +     +  + E KKK
Sbjct  170   PATFNPRPAMNLISPASSFVGENMQPNVISSKSSSDSENFAESQLVPKMPKQASEEPKKK  229

Query  829   kkikFTIPIAPVDTNQNQPPQAIRKCLHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRL  1008
             KK+K  +P+ P D NQN   Q +RKC+HCEITKTPQWRAGPMGPKTLCNACGVRYKSGRL
Sbjct  230   KKVKLPLPLVPADNNQNAS-QPVRKCMHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRL  288

Query  1009  FPEYRPAASPTFTPSLHSNSHKKVIEMRSKVGVENT--AITEAPS  1137
             FPEYRPAASPTF PS+HSNSHKKV+EMR + G++ +  AI  A S
Sbjct  289   FPEYRPAASPTFCPSVHSNSHKKVLEMRCR-GIDKSGFAINSAAS  332



>ref|XP_008367332.1| PREDICTED: GATA transcription factor 8-like [Malus domestica]
Length=351

 Score =   302 bits (773),  Expect = 8e-94, Method: Compositional matrix adjust.
 Identities = 198/345 (57%), Positives = 233/345 (68%), Gaps = 39/345 (11%)
 Frame = +1

Query  178   NFMDELDCGSFFDHIDDLIEFPPEN---------ECVGGVGSGEFKNFPSIWNDPLPDSE  330
             N++D++DCGS FD IDDL++FP ++          C     S     +P       P ++
Sbjct  5     NYIDDIDCGSLFDTIDDLLDFPTDDVESALGPAPNCDAAFNSSSL--WPGHSGSLQPPND  62

Query  331   PLFSGSHNNSAADLSAELSVPYEDIIQLEWLSTFVEDSFSGGGMTLGKENTP-VNVEPPH  507
              +FS    NSA+DLSAEL VP EDI+QLEWLS F EDSFSGG +T+ K +   +N EP H
Sbjct  63    AVFSC---NSASDLSAELDVPIEDIVQLEWLSNFCEDSFSGGSLTINKPDISFINREPSH  119

Query  508   NKFQTsspvsvlesssssssssscsGGKTTIPLSPSRC---GVQRARSKRPRPATFNPRP  678
              +FQTSSP+SVL+SSSS S        +  +P SP         RARSKRPRPATFNPR 
Sbjct  120   QQFQTSSPISVLDSSSSCSV-------EKNVPQSPGAVVPGKRGRARSKRPRPATFNPRS  172

Query  679   AIQLISPTSSFTEAP----QPFVAPAVSSESENFAES-PMKKLTTRPEAPEQkkkkkikF  843
             AIQLISP SS TEA     Q  + P V S+SENFAES P+ K+  R  + EQKKKKKIK 
Sbjct  173   AIQLISPASSVTEAEALQHQQLLPPKVHSDSENFAESRPVIKIP-RQASGEQKKKKKIKL  231

Query  844   TIPIAPVDTNQNQPPQ--AIRKCLHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPE  1017
             T+P AP + NQ+      A+RKCLHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPE
Sbjct  232   TLPQAPAEGNQSSGTTQGAVRKCLHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPE  291

Query  1018  YRPAASPTFTPSLHSNSHKKVIEMRSK------VGVENTAITEAP  1134
             YRPAASPTF P+LHSNSHKKVIEMR+K       G   TA+TE P
Sbjct  292   YRPAASPTFVPALHSNSHKKVIEMRNKGGEVVPFGETTTAMTETP  336



>ref|XP_006606248.1| PREDICTED: GATA transcription factor 8-like isoform X2 [Glycine 
max]
Length=357

 Score =   302 bits (773),  Expect = 8e-94, Method: Compositional matrix adjust.
 Identities = 204/345 (59%), Positives = 240/345 (70%), Gaps = 36/345 (10%)
 Frame = +1

Query  169   MGSNFMDELDCGSFFDHIDDLIEFPPENECVGGV------GSGEFKNFPSIW---NDPLP  321
             +G NFMDE+DCGSFFDHIDDL++FP E+   G         +G   +  SIW   +D  P
Sbjct  11    VGPNFMDEIDCGSFFDHIDDLLDFPVEDVDGGAATLPSVAAAGNCNSLASIWPAESDSFP  70

Query  322   DSEPLFSGSHNNSAADLSAELSVPYEDIIQLEWLSTFVEDSFSGGGMTLGKENTP---VN  492
              S+ +FSG   N+A+DLSAELSVPYEDI+QLEWLS FVEDSF GG +T+ K   P     
Sbjct  71    TSDSVFSG---NTASDLSAELSVPYEDIVQLEWLSNFVEDSFCGGSLTMNKVEEPSCTTK  127

Query  493   VEPPHNKFQTsspvsvlesssssssssscsGGKTTIPLS------PSRCGVQRARSKRPR  654
              +  + +F TSSPVSVLESSSS S      GGKT  PLS      P  CG  R RSKRPR
Sbjct  128   EDSVNTQFHTSSPVSVLESSSSCS------GGKT-FPLSSPEIYIPVPCG--RTRSKRPR  178

Query  655   PATFNPRPAIQLISPTSSFT-EAPQP-FVAPAVSSESENFAESPMKKLTTRPEAPEQkkk  828
             PATFNPRPA+ LISP SSF  E  QP  ++   SS+SENFAES +     +  + E KKK
Sbjct  179   PATFNPRPAMNLISPASSFVGENMQPNVISSKSSSDSENFAESQLVPKMPKQASEEPKKK  238

Query  829   kkikFTIPIAPVDTNQNQPPQAIRKCLHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRL  1008
             KK+K  +P+ P D NQN   Q +RKC+HCEITKTPQWRAGPMGPKTLCNACGVRYKSGRL
Sbjct  239   KKVKLPLPLVPADNNQNAS-QPVRKCMHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRL  297

Query  1009  FPEYRPAASPTFTPSLHSNSHKKVIEMRSKVGVENT--AITEAPS  1137
             FPEYRPAASPTF PS+HSNSHKKV+EMR + G++ +  AI  A S
Sbjct  298   FPEYRPAASPTFCPSVHSNSHKKVLEMRCR-GIDKSGFAINSAAS  341



>ref|XP_010683872.1| PREDICTED: GATA transcription factor 8 [Beta vulgaris subsp. 
vulgaris]
Length=310

 Score =   300 bits (768),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 183/333 (55%), Positives = 227/333 (68%), Gaps = 40/333 (12%)
 Frame = +1

Query  172   GSNFMDELDCGSFFDHIDDLIEFPPENECVGGVGSG-----EFKNFPSIWNDPLPDSEPL  336
             G+  M+E+DCG+FFD IDDL+EFP ++   G + +G     ++ +FP ++     ++ P+
Sbjct  3     GTKLMEEIDCGNFFDQIDDLLEFPNDDVEKGLIDNGVGVEHQYNDFPPVF---WSENSPV  59

Query  337   FSGSHNNSAADLSAELSVPYEDIIQLEWLSTFVEDSFSGGGMTLGKEN-TPVNVEPPHNK  513
             FS +++NSA+DLSAELSVPYEDI+QLEWLSTFVEDSF+GGG+TL K   T  + + P N+
Sbjct  60    FSAANSNSASDLSAELSVPYEDIVQLEWLSTFVEDSFAGGGLTLEKSQCTSSSKDSPRNQ  119

Query  514   FQTsspvsvlesssssssssscsGGKTTIPLSPSRCGVQRARSKRPRPATFNPRPAIQLI  693
             FQTSSP+SVLESSS+ S       GKT +P S  +    RARSKRPRPATFNPR    LI
Sbjct  120   FQTSSPISVLESSSACSR------GKT-LPASHEK----RARSKRPRPATFNPR--AHLI  166

Query  694   SPTSSFTEAPQPFVA-PAVSSESENFAESPMKKLTTRPEAPEQkkkkkikFTIPIAPVDT  870
             SP SS  + P   +A  A  S S +FAES   K   + +                  +  
Sbjct  167   SPASSILQTPHRLLAFNAPMSGSGSFAESLPLKKKKKIKILPPS-----------GGISQ  215

Query  871   NQNQPP------QAIRKCLHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAA  1032
             NQN+ P      QA+RKC+HCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAA
Sbjct  216   NQNENPNANTTSQALRKCMHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAA  275

Query  1033  SPTFTPSLHSNSHKKVIEMRSKVGVENTAITEA  1131
             SPTF PSLHSNSHKKV+EMR+K+  E   +T A
Sbjct  276   SPTFVPSLHSNSHKKVVEMRTKITEEKPLVTTA  308



>gb|KHG18876.1| GATA transcription factor 8 -like protein [Gossypium arboreum]
Length=337

 Score =   298 bits (762),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 194/331 (59%), Positives = 232/331 (70%), Gaps = 30/331 (9%)
 Frame = +1

Query  175   SNFMDELDCGSFFDHIDDLIEFPPENECVG---GVGSGEFKNFPSIW---NDPLPDSEPL  336
             +NF+DE+DCGSFFDHIDDL++FP E+   G      +     FPSIW   ++  P S+ +
Sbjct  5     TNFIDEIDCGSFFDHIDDLLDFPNEDVEAGFSAADSAINAAAFPSIWTAHSESFPGSDSV  64

Query  337   FSGSHNNSAADLSAELSVPYEDIIQLEWLSTFVEDSFSGGGMTLGKE-------NTPVNV  495
             FS   NNSA+DLSAELSVPYEDI+QLEWLS FVEDS  G  +T+ K+       ++P + 
Sbjct  65    FS---NNSASDLSAELSVPYEDIVQLEWLSNFVEDSNCGASLTIKKQEPNSNNKDSPSHH  121

Query  496   EPPHNKFQTsspvsvlesssssssssscsGGKTTIPLSPSRCGVQRARSKRPRPATFNPR  675
             +  H++FQTSSPVSVLESSSS S       G+  +  +P +CG  RARSKRPRPATFNPR
Sbjct  122   DHDHHQFQTSSPVSVLESSSSYS-------GEKPV-AAPGKCG--RARSKRPRPATFNPR  171

Query  676   PAIQLISPTSSFTE--APQPFVAPAVSSESENFAESPMKKLTTRPEAPEQkkkkkikFTI  849
              AIQLISP+SS  +   PQ    P V S+SEN AES +     R   PE KKKKKIK T+
Sbjct  172   SAIQLISPSSSVNDNDVPQSLFVPKVPSDSENHAESRLLIKLPRQVNPEHKKKKKIKLTL  231

Query  850   PIAPVDTNQNQPPQ--AIRKCLHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYR  1023
             P  P     N      ++RKC+HCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYR
Sbjct  232   PAPPPPPTDNNTTPNPSVRKCMHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYR  291

Query  1024  PAASPTFTPSLHSNSHKKVIEMRSKVGVENT  1116
             PAASPTF PS+HSNSHKKV+EMR+K G  + 
Sbjct  292   PAASPTFIPSVHSNSHKKVLEMRTKCGTADV  322



>ref|XP_007151876.1| hypothetical protein PHAVU_004G083100g [Phaseolus vulgaris]
 gb|ESW23870.1| hypothetical protein PHAVU_004G083100g [Phaseolus vulgaris]
Length=336

 Score =   287 bits (734),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 180/343 (52%), Positives = 217/343 (63%), Gaps = 38/343 (11%)
 Frame = +1

Query  169   MGSNFMDELDCGSFFDHIDDLIEFPPENECVGGVGSGEFK------NFPSIWNDPLPDSE  330
             M  NF+D++DCGSFFD IDDL+EFP E      + +          NF S  +D    + 
Sbjct  1     MIGNFIDDIDCGSFFDQIDDLLEFPAEE--TAAIDTTAVAPLAPPTNFWSAESDSFHAAN  58

Query  331   PLFSGSHNNSAADLSAELSVPYEDIIQLEWLSTFVEDSFSGGGMTLGKEN-TPVNVEP-P  504
              +FSG   N+  DLS ELSVPYEDI+QLEWLS FVEDSFSGG +T+ +E     N E   
Sbjct  59    AVFSG---NTVPDLSTELSVPYEDIVQLEWLSNFVEDSFSGGSLTMQQEQPQCTNKEDIT  115

Query  505   HNKFQTsspvsvlesssssssssscsGGKTTIPLSPSR-----CGVQRARSKRPRPATFN  669
             H +FQT+SPVSVLESSS          G+  +P SP       CG  RARSKR RP  FN
Sbjct  116   HAQFQTASPVSVLESSSFC-------SGEKAVPRSPEIFIPVPCG--RARSKRARPTAFN  166

Query  670   PRPAIQLISPTSSFTEAPQPFVAPA-VSSESENFAESPMKKLTTRPEAPEQkkkkkikFT  846
             P P +QLISP SS  E  Q   +    SS+SENFAESP+K        P+Q   +  K  
Sbjct  167   PHPVMQLISPASSTGENTQHNTSTCKASSDSENFAESPIK-------TPKQAFGEHKKKK  219

Query  847   IPIAPVDTNQNQ---PPQAIRKCLHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPE  1017
                      Q+Q   P QA+RKC+HCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPE
Sbjct  220   KIKVTFSAGQDQNGSPSQAVRKCVHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPE  279

Query  1018  YRPAASPTFTPSLHSNSHKKVIEMRSKVGVENTAITEAPSTPQ  1146
             YRPAASPTF  ++HSNSHKKV+EMR+K   ++    ++ S+P+
Sbjct  280   YRPAASPTFCAAVHSNSHKKVLEMRNKSDTKSGFAADSASSPE  322



>ref|XP_010253699.1| PREDICTED: GATA transcription factor 8-like [Nelumbo nucifera]
Length=334

 Score =   284 bits (727),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 184/327 (56%), Positives = 219/327 (67%), Gaps = 25/327 (8%)
 Frame = +1

Query  187   DELD-CGSFFDHIDDLIEFPPENECVGGVGSGEFKNFPSIWNDPLPDS-----EPLFSGS  348
             D LD CG FFD IDDL++F  E+     + +G  +N+ + W    PD+     + +FSG 
Sbjct  7     DLLDVCGDFFDQIDDLLDFSTED-----IEAGAGENYITSWTTVPPDTMIGAPDSVFSGY  61

Query  349   HNNSAADLSAELSVPYEDIIQLEWLSTFVEDSFSGGG-MTLGKENTPVNVEPPHNKFQTs  525
              + S+++L+ ELSVPYE+I QLEWLS FVEDSFS G  +TL K++   +     ++FQTS
Sbjct  62    SDRSSSELATELSVPYEEIAQLEWLSNFVEDSFSAGSSVTLDKDSFNDHKNNDSHRFQTS  121

Query  526   spvsvlesssssssssscsGGKTTIPLSPSRCGVQRARSKRPRPATFNPRPAIQLISPTS  705
             SPVSVLESSSS S          T+PLSP      RARSKRPRPATFNPRP I LISPTS
Sbjct  122   SPVSVLESSSSCSGGGR------TMPLSPETVVPGRARSKRPRPATFNPRPVIPLISPTS  175

Query  706   SFTEAPQPFVAPAVSSESENFAESPMKKLTTRPEAPEQkkkkkikFTIPIAPVDTNQN-Q  882
             S  E  QP  A    SE EN+AES   K T +  A E  ++KK K  + +      Q+  
Sbjct  176   SIMEPNQPLSA----SELENYAESRPTKPTKKIRADEAMEQKKKKKKLSLIAGSAEQSVS  231

Query  883   PPQAIRKCLHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFTPSLHS  1062
              P AIRKC+HCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTF  SLHS
Sbjct  232   QPIAIRKCMHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFVSSLHS  291

Query  1063  NSHKKVIEMRSKVGVENTAITEAPSTP  1143
             NSHKKV+EMRSKV   + A   A +TP
Sbjct  292   NSHKKVLEMRSKVS--HNAEMSAAATP  316



>ref|XP_010067308.1| PREDICTED: GATA transcription factor 8-like [Eucalyptus grandis]
 gb|KCW65417.1| hypothetical protein EUGRSUZ_G02840 [Eucalyptus grandis]
Length=333

 Score =   284 bits (726),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 187/325 (58%), Positives = 222/325 (68%), Gaps = 30/325 (9%)
 Frame = +1

Query  172   GSNFMDELDCGSFFDHIDDLIEFPPENECVGGVGSGEFKNFPSIWNDPLPDSEPLFSGSH  351
             G N M+E+DCGSFFD IDDL++FP  ++   G+   +  +FPS W+D  P S P  SGS 
Sbjct  3     GQNIMEEIDCGSFFDQIDDLLDFP-SDDVEAGLPPIDHDSFPSFWSD-QPQSLP-GSGSG  59

Query  352   NNSA------ADLSAELSVPYEDIIQLEWLSTFVEDSFSGGGMTLGKENTPVNVEP-PHN  510
               S       +DLSA LSVPYEDI+Q+EWLS  ++DSFS   +T+  ++ P   +P  H 
Sbjct  60    VGSVFEAHPGSDLSAHLSVPYEDIVQMEWLSNLMDDSFSSDPLTINDQD-PSKAQPVSHA  118

Query  511   KFQTsspvsvlesssssssssscsGGKTTIPLSPSRCGVQRARSKRPRPATFNPRPAIQL  690
             +FQTSSP+SVL+SSSS +   +       I L+  RCG  RARSKRPRP TFNPRP +QL
Sbjct  119   QFQTSSPISVLDSSSSCTDEKAAPRSPEAINLA--RCG--RARSKRPRPRTFNPRPPVQL  174

Query  691   ISPTSSFTEAPQPFVAPAVSSESENFAES-PMKKLTTRPEAPEQkkkkkikFTIPIAPVD  867
             ISPTSS  E PQP        +SE+  ES P+ K+  R   PEQKKKKKIKFT+  A   
Sbjct  175   ISPTSSVGENPQPV-------DSESHVESRPVIKIP-RQVNPEQKKKKKIKFTMSTAAAA  226

Query  868   TNQNQPP------QAIRKCLHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPA  1029
                          QA+RKC+HCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPA
Sbjct  227   AASADTSQSSATAQAVRKCMHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPA  286

Query  1030  ASPTFTPSLHSNSHKKVIEMRSKVG  1104
             ASPTF PSLHSNSHKKV+EMRS VG
Sbjct  287   ASPTFIPSLHSNSHKKVLEMRSNVG  311



>gb|KHG25368.1| GATA transcription factor 8 -like protein [Gossypium arboreum]
Length=339

 Score =   280 bits (717),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 187/346 (54%), Positives = 230/346 (66%), Gaps = 24/346 (7%)
 Frame = +1

Query  175   SNFMDELDCGSFFDHIDDLIEFPPENECVGGVGSGEFKN---FPSIWN---DPLPDSEPL  336
             ++F+DE+DCGSFFD   DLI+FP  N  V    S    N   FPSIW    + LP S+ +
Sbjct  5     TDFIDEIDCGSFFD---DLIDFP--NGDVEAYDSTAVINAAAFPSIWTTQPESLPFSDSV  59

Query  337   FSGSHNNSAADLSAELSVPYEDIIQLEWLSTFVEDSFSGGGMTLGKENTPVNVEPPHNKF  516
             F    NNSA++LS EL VPYEDI+QLEW+S FVED+  G  +T  KE++    E  +N+F
Sbjct  60    F---LNNSASELSTELFVPYEDIVQLEWMSKFVEDTQCGASLTKKKEDSSSISEGSNNQF  116

Query  517   QTsspvsvlesssssssssscsGGKTTIPLSPSRCGVQRARSKRPRPATFNPRPAIQLIS  696
             QT SPVSVLESSSSSS          T   +P + G  R RSKRPR ATFN  P +Q+ S
Sbjct  117   QTCSPVSVLESSSSSSGVKPLPHSPETS--APGKRG--RPRSKRPRLATFNHLPGVQMTS  172

Query  697   PTSSFTE--APQPFVAPAVSSESENFAESPMK-KLTTRPEAPEQkkkkkikFTIPIAPVD  867
             P SS  E   PQPF  P V S+SEN+AES +  KL  +     +KKK K+  +   A  D
Sbjct  173   PASSVNENDIPQPFAVPKVLSDSENYAESRLLIKLPKQVNPEHKKKKIKLSVSAAAAIAD  232

Query  868   TNQNQPPQAIRKCLHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFT  1047
              +QN   QA+RKC+HCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTF 
Sbjct  233   NSQNPTGQAVRKCMHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFV  292

Query  1048  PSLHSNSHKKVIEMRSK-VGVENTAITEAPSTPQ--PAFNNPSVEF  1176
             PS+HSNSHKKV+EMR+K   +  T    A + P+  P  +NP++++
Sbjct  293   PSVHSNSHKKVLEMRTKSCALAPTTTMVANNLPELIPNKSNPALDY  338



>ref|XP_010264666.1| PREDICTED: GATA transcription factor 8-like [Nelumbo nucifera]
Length=333

 Score =   279 bits (714),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 183/315 (58%), Positives = 213/315 (68%), Gaps = 25/315 (8%)
 Frame = +1

Query  187   DELD-CGSFFDHIDDLIEFPPENECVGGVGSGEFKNFPSIWNDPLPDS-----EPLFSGS  348
             D LD CG FFD IDDL++FP   E  G V  G+   F   W  P PD+       +FSG+
Sbjct  7     DLLDICGDFFDQIDDLLDFP-TGEMEGEVIGGDCNAF---WTAPPPDTLMGGPNAVFSGN  62

Query  349   HNNSAADLSAELSVPYEDIIQLEWLSTFVEDSFSGGGMTLGKENTPVNVEPPHNKFQTss  528
             +++S ++L+ ELSVPYEDI QLEWLS FVEDSFS G      +++  N +  + +FQTSS
Sbjct  63    NDSSRSELANELSVPYEDIAQLEWLSNFVEDSFSAGSSITIDKDSSTNDQNSY-QFQTSS  121

Query  529   pvsvlesssssssssscsGGKTTIPLSPSRCGVQRARSKRPRPATFNPRPAIQLISPTSS  708
             PVSVLESSSSSS S        T+PLSP      RARSKRPRPATFNPRP I LISPTSS
Sbjct  122   PVSVLESSSSSSGSG-----GRTMPLSPETIVPGRARSKRPRPATFNPRPVIPLISPTSS  176

Query  709   FTEAPQPFVAPAVSSESENFAES-PMKKLTTRPEAPEQkkkkkikFTIPIAPVDTNQNQP  885
              T+    F A  ++SE EN AES P KK+      P  +   + K  +  AP    Q  P
Sbjct  177   VTDPSPSFSASELASEFENHAESRPWKKV------PRSEMLGQKKKKLSPAPGAKEQYAP  230

Query  886   PQ--AIRKCLHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFTPSLH  1059
              Q  A+RKCLHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTF  SLH
Sbjct  231   AQPVAVRKCLHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFVASLH  290

Query  1060  SNSHKKVIEMRSKVG  1104
             SNSHKKV+EMR++ G
Sbjct  291   SNSHKKVLEMRTQAG  305



>ref|XP_004307386.1| PREDICTED: GATA transcription factor 9-like [Fragaria vesca subsp. 
vesca]
Length=344

 Score =   279 bits (713),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 182/329 (55%), Positives = 223/329 (68%), Gaps = 35/329 (11%)
 Frame = +1

Query  178   NFMDELDCGSFFDHIDDLIEFPPENECVGGVGSGEFKNFPSIWNDPLPDSEP--------  333
             +F+DE+DCGSFFD+IDDL+E   + + V G        F S+W      +          
Sbjct  5     SFVDEIDCGSFFDNIDDLME---DVDSVLGPAPDCNSAF-SLWPAASSAAAAPLPPPDAA  60

Query  334   LFSGSHNNSAADLSAELSVPYEDIIQLEWLSTFVEDS-FSGGGMTLGKEN---TPVNVEP  501
             +FSG   N  +D S+EL VPYE+++ LEWLS FVE+S +SGG +T+ K+    + VN E 
Sbjct  61    VFSG---NGDSDFSSELPVPYEEMVHLEWLSNFVENSEYSGGDLTMNKQQESYSLVNKES  117

Query  502   PHNKFQTsspvsvlesssssssssscsGGKTTIPLSPSRCGVQRARSKRPRPATFNPRPA  681
              H +FQTSSP+SVL+SSSS S   +   G     ++P R G  RARSKRPRPATFNPR A
Sbjct  118   SHQQFQTSSPISVLDSSSSCSGEKNVLEGS----IAPGRRG--RARSKRPRPATFNPRSA  171

Query  682   IQLISPTSSFTEAPQP------FVAPAVSSESENFAESPMKKLTTRPEAPEQkkkkkikF  843
             IQLISP SS +E   P      F AP V SESENFAES  + +   P+    ++KKK + 
Sbjct  172   IQLISPASSVSEIDNPLQQHSLFAAPKVFSESENFAES--RPVVKMPKLASGEQKKKKRI  229

Query  844   TIP-IAPVDTNQNQPPQ-AIRKCLHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPE  1017
              +P   P + ++N P Q AIRKCLHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPE
Sbjct  230   KLPPQVPGELDENSPLQGAIRKCLHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPE  289

Query  1018  YRPAASPTFTPSLHSNSHKKVIEMRSKVG  1104
             YRPAASPTF P+LHSNSHKKV+EMR+K G
Sbjct  290   YRPAASPTFVPALHSNSHKKVLEMRTKGG  318



>gb|ACJ02090.1| AG-motif binding protein [Garcinia mangostana]
Length=335

 Score =   275 bits (704),  Expect = 7e-84, Method: Compositional matrix adjust.
 Identities = 180/327 (55%), Positives = 215/327 (66%), Gaps = 41/327 (13%)
 Frame = +1

Query  172   GSNFMDELDCGSFFDHIDDLIEFPPENECVGGVG------SGEFKNFPSIWNDPLPDSEP  333
              +N M+E DCG+F D    LI+FP ++  +           G  +++  +   P P+   
Sbjct  3     AANLMEETDCGNFLD----LIDFPSDDVLIDNDTFTDNNVVGVDQSYDVVEGFPFPND--  56

Query  334   LFSGSHNNSAA--DLSAELSVPYEDIIQLEWLSTFVEDSFSGGGMTLGKEN-TPVNVEPP  504
             ++S +H  S A  DLSAELSVPYEDI+QLEWLS FVEDSFSGG +T+ KE+ + +N    
Sbjct  57    VWSSAHCQSLANADLSAELSVPYEDIVQLEWLSNFVEDSFSGGSLTMKKEDYSSIN----  112

Query  505   HNKFQTsspvsvlesssssssssscsGGKTTIPLSP--SRCGVQRARSKRPRPATFNPRP  678
              NK  +          S   SSSSCSG KT+ P SP  +RCG  RARSKRPRPATF PRP
Sbjct  113   -NKDSSPRQFHTSSPVSVLESSSSCSGEKTSSPPSPGSARCG--RARSKRPRPATFTPRP  169

Query  679   AIQLISPTSSFTEAPQPFVAPAVSSESENFAESPMKKLTTRPEAPEQkkkkkikFTIPIA  858
              + L+ PTSS            V S+SENFAES +     R    EQKKKKKIK T+  A
Sbjct  170   PMHLVLPTSS------------VPSDSENFAESRLVIKIPRQVGSEQKKKKKIKITLAAA  217

Query  859   ---PVDTNQNQ--PPQAIRKCLHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYR  1023
                PV T+ +   P QA+RKCLHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYR
Sbjct  218   AAPPVQTHHDSSLPQQAVRKCLHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYR  277

Query  1024  PAASPTFTPSLHSNSHKKVIEMRSKVG  1104
             PAASPTF PS+HSNSHKKV+EMR+K G
Sbjct  278   PAASPTFVPSVHSNSHKKVLEMRNKTG  304



>ref|XP_003591890.1| GATA transcription factor [Medicago truncatula]
 gb|AES62141.1| GATA type zinc finger transcription factor family protein [Medicago 
truncatula]
Length=331

 Score =   259 bits (662),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 172/333 (52%), Positives = 218/333 (65%), Gaps = 29/333 (9%)
 Frame = +1

Query  184   MDELDCGSFFDHIDDLIEFPPENECVGGV--GSGEFKNFPSIWNDPLPDSEPLFSGSHNN  357
             M+E+DC + FD+IDD+      +     +   +G + +  SIW +   +S+ +FSG   N
Sbjct  5     MNEIDCFNLFDNIDDIYPVDDVDTAAASLPSSAGNYNSLASIWPN---ESDSVFSG---N  58

Query  358   SAADLSAELSV-PYEDIIQLEWLSTFVEDSFSGGGMTLGKENTPVNV-----EPPHNKFQ  519
             S +DLSAEL V P+ED++ LEW+S  V+DSF    +T+  E  P +      +  H +FQ
Sbjct  59    STSDLSAELPVDPFEDLLSLEWVSNIVDDSFCEESLTMKVEQQPSSSAVSKEDSGHYQFQ  118

Query  520   TsspvsvlesssssssssscsGGKTT---IPLSPSRCGVQRARSKRPRPATFNPRPAIQL  690
             T SP+SVLESSSS S      GGKTT   +P+ P  CG  RAR+KRPRP  FNPR A+QL
Sbjct  119   TPSPISVLESSSSCS------GGKTTGIYVPI-PVPCG--RARTKRPRPTAFNPRSAMQL  169

Query  691   ISPTSSFTE---APQPFVAPAVSSESENFAESPMKKLTTRPEAPEQkkkkkikFTIPIAP  861
             ISPTSS  E    P      A+SS+ ENFAES +     +  + E KKKKKIK  +P AP
Sbjct  170   ISPTSSSVEENMQPNVISTKAMSSDFENFAESRIIVKKPKLSSGETKKKKKIKAPLPTAP  229

Query  862   VDTNQNQPPQAIRKCLHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPT  1041
              D+ +      +RKC+HCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPT
Sbjct  230   ADSGEQIGSLPVRKCMHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPT  289

Query  1042  FTPSLHSNSHKKVIEMRSKVGVENTAITEAPST  1140
             F P++HSNSHKKV+EMR K   E+ +    P+T
Sbjct  290   FCPAVHSNSHKKVLEMRCKDSFESDSAELIPNT  322



>ref|XP_003591891.1| GATA transcription factor [Medicago truncatula]
Length=327

 Score =   259 bits (661),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 172/333 (52%), Positives = 218/333 (65%), Gaps = 29/333 (9%)
 Frame = +1

Query  184   MDELDCGSFFDHIDDLIEFPPENECVGGV--GSGEFKNFPSIWNDPLPDSEPLFSGSHNN  357
             M+E+DC + FD+IDD+      +     +   +G + +  SIW +   +S+ +FSG   N
Sbjct  1     MNEIDCFNLFDNIDDIYPVDDVDTAAASLPSSAGNYNSLASIWPN---ESDSVFSG---N  54

Query  358   SAADLSAELSV-PYEDIIQLEWLSTFVEDSFSGGGMTLGKENTPVNV-----EPPHNKFQ  519
             S +DLSAEL V P+ED++ LEW+S  V+DSF    +T+  E  P +      +  H +FQ
Sbjct  55    STSDLSAELPVDPFEDLLSLEWVSNIVDDSFCEESLTMKVEQQPSSSAVSKEDSGHYQFQ  114

Query  520   TsspvsvlesssssssssscsGGKTT---IPLSPSRCGVQRARSKRPRPATFNPRPAIQL  690
             T SP+SVLESSSS S      GGKTT   +P+ P  CG  RAR+KRPRP  FNPR A+QL
Sbjct  115   TPSPISVLESSSSCS------GGKTTGIYVPI-PVPCG--RARTKRPRPTAFNPRSAMQL  165

Query  691   ISPTSSFTE---APQPFVAPAVSSESENFAESPMKKLTTRPEAPEQkkkkkikFTIPIAP  861
             ISPTSS  E    P      A+SS+ ENFAES +     +  + E KKKKKIK  +P AP
Sbjct  166   ISPTSSSVEENMQPNVISTKAMSSDFENFAESRIIVKKPKLSSGETKKKKKIKAPLPTAP  225

Query  862   VDTNQNQPPQAIRKCLHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPT  1041
              D+ +      +RKC+HCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPT
Sbjct  226   ADSGEQIGSLPVRKCMHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPT  285

Query  1042  FTPSLHSNSHKKVIEMRSKVGVENTAITEAPST  1140
             F P++HSNSHKKV+EMR K   E+ +    P+T
Sbjct  286   FCPAVHSNSHKKVLEMRCKDSFESDSAELIPNT  318



>ref|XP_010032183.1| PREDICTED: GATA transcription factor 8-like isoform X1 [Eucalyptus 
grandis]
 ref|XP_010032184.1| PREDICTED: GATA transcription factor 8-like isoform X1 [Eucalyptus 
grandis]
 ref|XP_010032185.1| PREDICTED: GATA transcription factor 8-like isoform X1 [Eucalyptus 
grandis]
 ref|XP_010032186.1| PREDICTED: GATA transcription factor 8-like isoform X1 [Eucalyptus 
grandis]
 gb|KCW51583.1| hypothetical protein EUGRSUZ_J01083 [Eucalyptus grandis]
 gb|KCW51584.1| hypothetical protein EUGRSUZ_J01083 [Eucalyptus grandis]
 gb|KCW51585.1| hypothetical protein EUGRSUZ_J01083 [Eucalyptus grandis]
Length=350

 Score =   245 bits (626),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 170/327 (52%), Positives = 208/327 (64%), Gaps = 27/327 (8%)
 Frame = +1

Query  172   GSNFMDELDCGSFFDHIDDLIEFPPENECVGGVGSGEFKNFPSIWN---DPLPDSEPLFS  342
             G NF+DE+DCGSFFD   D ++FP E+    G+  G+  + PSIW+   +PLP S+ +FS
Sbjct  3     GPNFIDEIDCGSFFD---DFLDFPSED-IEAGLPVGKPDSLPSIWSAQPEPLPGSDAVFS  58

Query  343   GSHNNSAADLSAELSVPYEDIIQLEWLSTFVEDSFSGGGMTLGKENTPVNVEPPHNKFQT  522
             G+ ++S    SAELSVPYEDI+QLEWLSTFVE+SFSGG +T+ KE               
Sbjct  59    GNSSSSL---SAELSVPYEDIVQLEWLSTFVEESFSGGSLTMSKEQVSNGGGGGGGGGSG  115

Query  523   sspvsvlesssssssssscsGGKTTI--------PLSPSRCGVQRAR-----SKRPRPAT  663
                 +  +SSS    +SS      +         P  PS   +  AR     SKRPRPA 
Sbjct  116   GGSGNNTDSSSQQFQTSSPVSVLDSSSSCSVDNKPRPPSPEAINPARCGRARSKRPRPAN  175

Query  664   FNPRPAIQLISPTSSFTEAPQPFVAPAVSSESENFAESPMKKLTTRPEAPEQkkkkkikF  843
             FNPRPAIQL    SS     +P    +  S      ++P K+ +      E KKKKKIKF
Sbjct  176   FNPRPAIQLAPQQSSDVAENEPGSENSEESNCLPVIKAPKKQASG---GAEPKKKKKIKF  232

Query  844   TIPIA-PVDTNQNQPPQAIRKCLHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEY  1020
             T+P A P + +Q  P QA+RKCLHCEITKTPQWRAGP+GPKTLCNACGVRYKSGRL+PEY
Sbjct  233   TMPPAPPAEADQGLPQQAVRKCLHCEITKTPQWRAGPLGPKTLCNACGVRYKSGRLYPEY  292

Query  1021  RPAASPTFTPSLHSNSHKKVIEMRSKV  1101
             RPAASPTF PSLHSNSHKKV+EMR+K 
Sbjct  293   RPAASPTFIPSLHSNSHKKVLEMRNKT  319



>ref|XP_004149904.1| PREDICTED: GATA transcription factor 4-like [Cucumis sativus]
 ref|XP_004158598.1| PREDICTED: GATA transcription factor 4-like [Cucumis sativus]
 gb|KGN47830.1| hypothetical protein Csa_6G405920 [Cucumis sativus]
Length=327

 Score =   216 bits (550),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 159/322 (49%), Positives = 198/322 (61%), Gaps = 53/322 (16%)
 Frame = +1

Query  169   MGSNFMDELDCGSFFDHIDDLIEFPPENECVGGVGSGEFKNFPSIW---NDPLPDS---E  330
             +G N  +E+DCG+FFD+I+DL+E   +++      S     FP IW   +D LP     +
Sbjct  2     IGENIAEEIDCGNFFDNIEDLLE-DLDHDVDFNTNSAA---FPPIWSEHSDSLPSDPVVD  57

Query  331   PLFSGSHNNSAADLSAELSVPYEDIIQLEWLSTFVEDSFSGG-GMTLGKENTPVNVEPPH  507
             P+    +    + LS +L VPY+D  Q+EWLS FV+DSFSG   +T+       N+ PP 
Sbjct  58    PVLFSVNTAPDSALSPDLCVPYDD--QMEWLSNFVDDSFSGAETLTINAS----NLSPP-  110

Query  508   NKFQTsspvsvlesssssssssscsGGKTTIPLSPSRCGVQRARSKRPRP-ATFNPRPAI  684
             ++F  SSPVSVL+SSSSSSSS          PLS       RARSKRPRP  TF PR   
Sbjct  111   SQFHISSPVSVLDSSSSSSSSDEKK------PLSTKDGRRGRARSKRPRPTTTFIPRTP-  163

Query  685   QLISPTSSFTEAPQPFVAPAVSSESENFAES----PMKKLTTRPEAPEQkkkkkikFTIP  852
             +L SPT+S  +         VSSESEN+AES    P+ K T + +   ++          
Sbjct  164   ELTSPTNSGIK---------VSSESENYAESCPPLPLPKKTKKIKLTFRR----------  204

Query  853   IAPVDTNQNQPPQAIRKCLHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAA  1032
                 D N    PQ +RKCLHCE+TKTPQWRAGP+GPKTLCNACGVRYKSGRL+PEYRPAA
Sbjct  205   ----DQNDTLNPQGVRKCLHCEVTKTPQWRAGPLGPKTLCNACGVRYKSGRLYPEYRPAA  260

Query  1033  SPTFTPSLHSNSHKKVIEMRSK  1098
             SPTF P LHSNSHKKV+EMR K
Sbjct  261   SPTFVPCLHSNSHKKVLEMRIK  282



>ref|XP_008456488.1| PREDICTED: LOW QUALITY PROTEIN: GATA transcription factor 8-like 
[Cucumis melo]
Length=328

 Score =   213 bits (542),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 166/338 (49%), Positives = 210/338 (62%), Gaps = 52/338 (15%)
 Frame = +1

Query  169   MGSNFMDELDCGSFFDHIDDLIEFPPENECVGGVGSGEFKNFPSIWN---DPLPDS---E  330
             + +N ++E+DC +FFD+I+DL+E   +++      S  F   P IW+   D LP     +
Sbjct  2     IAANTVEEIDCANFFDNIEDLLEDLDDHDVDFNTNSAAF---PPIWSQHSDSLPSDAVVD  58

Query  331   P-LFSGSHNNSAADLSAELSVPYEDIIQLEWLSTFVEDSFSGG-GMTLGKENTPVNVEPP  504
             P LF  +  +SA  LS +L VPY+D  Q+EWLS FV+DSFSG   +T+   N+      P
Sbjct  59    PVLFPVNTADSA--LSPDLCVPYDD--QMEWLSNFVDDSFSGAETLTINTSNSS-----P  109

Query  505   HNKFQTsspvsvlesssssssssscsGGKTTIPLSPSRCGVQRARSKRPRPATFNPRPAI  684
              ++F  SSPVSVL+SSSSSSSSS         PL+       RARSKRPRP TF PRP  
Sbjct  110   PSQFHISSPVSVLDSSSSSSSSSFXRKK----PLTTKDGRRGRARSKRPRPTTFIPRPP-  164

Query  685   QLISPTSSFTEAPQPFVAPAVSSESENFAES----PMKKLTTRPEAPEQkkkkkikFTIP  852
             QLISPT+S ++         VSSESEN+AES    P+ K T + +   ++          
Sbjct  165   QLISPTNSGSK---------VSSESENYAESCSPLPLPKKTKKIKLTFRR----------  205

Query  853   IAPVDTNQNQPPQAIRKCLHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAA  1032
                 D N    PQ +RKCLHCE+TKTPQWRAGP+GPKTLCNACGVRYKSGRL+PEYRPAA
Sbjct  206   ----DQNDALNPQGMRKCLHCEVTKTPQWRAGPLGPKTLCNACGVRYKSGRLYPEYRPAA  261

Query  1033  SPTFTPSLHSNSHKKVIEMRSKVGVENTAITEAPSTPQ  1146
             SPTF P LHSNSHKKV+EMR K   +   +T   S P+
Sbjct  262   SPTFVPCLHSNSHKKVLEMRIKQVKKGVELTGEESPPE  299



>emb|CBI31452.3| unnamed protein product [Vitis vinifera]
Length=185

 Score =   207 bits (527),  Expect = 9e-60, Method: Compositional matrix adjust.
 Identities = 123/183 (67%), Positives = 144/183 (79%), Gaps = 9/183 (5%)
 Frame = +1

Query  169  MGSNFMDELDCGSFFDHIDDLIEFPPENECVGGVGSGEFKNFPSIW---NDPLPDSEPLF  339
            +G NFMDE+DCGSFFDHIDDL+EFPPE +  GG+  G+  +FPSIW   +DPLP  + +F
Sbjct  2    IGPNFMDEIDCGSFFDHIDDLLEFPPE-DVSGGLMGGDCNSFPSIWTNASDPLPGPDSVF  60

Query  340  SGSHNNSAADLSAELSVPYEDIIQLEWLSTFVEDSFSGGGMTLGKENTPVNVEPPHNKFQ  519
            SG ++NS +DLSAELSVPYEDI+QLEWLS FVEDSFSGG + L KE+  +  + PH++FQ
Sbjct  61   SGPNSNSNSDLSAELSVPYEDIVQLEWLSNFVEDSFSGGSIGLNKEDGSIVKDSPHHQFQ  120

Query  520  TsspvsvlesssssssssscsGGKTTIPLSPSRCGVQRARSKRPRPATFNPRPAIQLISP  699
            TSSPVSVLESSSS S          TIPLSP+  G QRARSKRPRPATFNPRPAIQLISP
Sbjct  121  TSSPVSVLESSSSCSGGG-----GKTIPLSPNHRGAQRARSKRPRPATFNPRPAIQLISP  175

Query  700  TSS  708
            TSS
Sbjct  176  TSS  178



>ref|XP_010032187.1| PREDICTED: GATA transcription factor 8-like isoform X2 [Eucalyptus 
grandis]
Length=310

 Score =   204 bits (520),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 133/250 (53%), Positives = 156/250 (62%), Gaps = 17/250 (7%)
 Frame = +1

Query  394   YEDIIQLEWLSTFVEDSFSGGGMTLGKENTPVNVEPPHNKFQTsspvsvlesssssssss  573
             YEDI+QLEWLSTFVE+SFSGG +T+ KE                   +  +SSS    +S
Sbjct  33    YEDIVQLEWLSTFVEESFSGGSLTMSKEQVSNGGGGGGGGGSGGGSGNNTDSSSQQFQTS  92

Query  574   scsGGKTTI--------PLSPSRCGVQRAR-----SKRPRPATFNPRPAIQLISPTSSFT  714
             S      +         P  PS   +  AR     SKRPRPA FNPRPAIQL    SS  
Sbjct  93    SPVSVLDSSSSCSVDNKPRPPSPEAINPARCGRARSKRPRPANFNPRPAIQLAPQQSSDV  152

Query  715   EAPQPFVAPAVSSESENFAESPMKKLTTRPEAPEQkkkkkikFTIPIA-PVDTNQNQPPQ  891
                +P    +  S      ++P K+ +      E KKKKKIKFT+P A P + +Q  P Q
Sbjct  153   AENEPGSENSEESNCLPVIKAPKKQASG---GAEPKKKKKIKFTMPPAPPAEADQGLPQQ  209

Query  892   AIRKCLHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFTPSLHSNSH  1071
             A+RKCLHCEITKTPQWRAGP+GPKTLCNACGVRYKSGRL+PEYRPAASPTF PSLHSNSH
Sbjct  210   AVRKCLHCEITKTPQWRAGPLGPKTLCNACGVRYKSGRLYPEYRPAASPTFIPSLHSNSH  269

Query  1072  KKVIEMRSKV  1101
             KKV+EMR+K 
Sbjct  270   KKVLEMRNKT  279



>gb|AES62142.2| GATA type zinc finger transcription factor family protein [Medicago 
truncatula]
Length=236

 Score =   199 bits (506),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 117/192 (61%), Positives = 137/192 (71%), Gaps = 9/192 (5%)
 Frame = +1

Query  583   GGKTT---IPLSPSRCGVQRARSKRPRPATFNPRPAIQLISPTSSFTE---APQPFVAPA  744
             GGKTT   +P+ P  CG  RAR+KRPRP  FNPR A+QLISPTSS  E    P      A
Sbjct  39    GGKTTGIYVPI-PVPCG--RARTKRPRPTAFNPRSAMQLISPTSSSVEENMQPNVISTKA  95

Query  745   VSSESENFAESPMKKLTTRPEAPEQkkkkkikFTIPIAPVDTNQNQPPQAIRKCLHCEIT  924
             +SS+ ENFAES +     +  + E KKKKKIK  +P AP D+ +      +RKC+HCEIT
Sbjct  96    MSSDFENFAESRIIVKKPKLSSGETKKKKKIKAPLPTAPADSGEQIGSLPVRKCMHCEIT  155

Query  925   KTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFTPSLHSNSHKKVIEMRSKVG  1104
             KTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTF P++HSNSHKKV+EMR K  
Sbjct  156   KTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFCPAVHSNSHKKVLEMRCKDS  215

Query  1105  VENTAITEAPST  1140
              E+ +    P+T
Sbjct  216   FESDSAELIPNT  227



>gb|KHN00843.1| GATA transcription factor 8 [Glycine soja]
Length=242

 Score =   192 bits (487),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 125/195 (64%), Positives = 143/195 (73%), Gaps = 15/195 (8%)
 Frame = +1

Query  583   GGKTTIPLS------PSRCGVQRARSKRPRPATFNPRPAIQLISPTSSFT-EAPQP-FVA  738
             GGKT  PLS      P  CG  R RSKRPRPATFNPRPA+ LISP SSF  E  QP  ++
Sbjct  37    GGKT-FPLSSPEIYIPVPCG--RTRSKRPRPATFNPRPAMNLISPASSFVGENMQPNVIS  93

Query  739   PAVSSESENFAESPMKKLTTRPEAPEQkkkkkikFTIPIAPVDTNQNQPPQAIRKCLHCE  918
                SS+SENFAES +     +  + E KKKKK+K  +P+ P D NQN   Q +RKC+HCE
Sbjct  94    SKSSSDSENFAESQLVPKMPKQASGEPKKKKKVKLPLPLVPADNNQNAS-QPVRKCMHCE  152

Query  919   ITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFTPSLHSNSHKKVIEMRSK  1098
             ITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTF PS+HSNSHKKV+EMR +
Sbjct  153   ITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFCPSVHSNSHKKVLEMRCR  212

Query  1099  VGVENT--AITEAPS  1137
              G++ +  AI  A S
Sbjct  213   -GIDKSGFAINSAAS  226



>gb|EYU39605.1| hypothetical protein MIMGU_mgv1a011769mg [Erythranthe guttata]
 gb|EYU39606.1| hypothetical protein MIMGU_mgv1a011769mg [Erythranthe guttata]
 gb|EYU39607.1| hypothetical protein MIMGU_mgv1a011769mg [Erythranthe guttata]
 gb|EYU39608.1| hypothetical protein MIMGU_mgv1a011769mg [Erythranthe guttata]
Length=271

 Score =   187 bits (475),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 138/262 (53%), Positives = 167/262 (64%), Gaps = 40/262 (15%)
 Frame = +1

Query  169  MGSNFMDELDCGSFFDHIDDLIEFPPENECVGG----VGSGEFKNFPSIWNDPLPDSEPL  336
            MG NFMDE+DCG+FFD IDDLIEFPP+NEC       + S   K+FP+ WN+ LPD +PL
Sbjct  1    MGPNFMDEIDCGNFFDQIDDLIEFPPDNECGEDSNLVISSDVRKDFPA-WNNDLPDCDPL  59

Query  337  FSGSHNNSAADLSAELSVPYEDIIQLEWLSTFVEDSFSGGGMTLGKENTPVNVEPPHNKF  516
            FSGSH +SA+DLSAELSVPYEDI+QLEWLS F+EDSFS   MT+GK+N+ V    PHN+F
Sbjct  60   FSGSHVSSASDLSAELSVPYEDIVQLEWLSNFMEDSFSCKDMTIGKQNSSV----PHNQF  115

Query  517  QTsspvsvlesssssssssscsGGKTTIPLSPSRCGVQRARSKRPRPATFNPRPAIQLIS  696
            QTSSPVSVLESSSSS+S+SS               G QRARSKR RPA+FNPR AIQLIS
Sbjct  116  QTSSPVSVLESSSSSNSTSSSLSPTHR--------GPQRARSKRARPASFNPRAAIQLIS  167

Query  697  PTSSFTEAPQPFVAPAVSSESENF-AESPMKKLTTRPEAPEQkkkkkikFTIPIAPVDTN  873
            P+      P+P         + NF  ESP          P++ K+        + P+  N
Sbjct  168  PS------PEP---------NHNFIIESPPVMKKAHKPKPKKIKETPP-----VDPLSAN  207

Query  874  QNQPP--QAIRKCLHCEITKTP  933
                P  QA+RKCLH     +P
Sbjct  208  DEYTPPGQALRKCLHYYFISSP  229



>gb|KHN00692.1| GATA transcription factor 8 [Glycine soja]
Length=168

 Score =   181 bits (458),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 98/165 (59%), Positives = 117/165 (71%), Gaps = 9/165 (5%)
 Frame = +1

Query  682   IQLISPTSSFTEAPQ---PFVAPAVSSESENFAESPMKKLTTRPEAPEQkkkkkikFTIP  852
             +QLISP SS  E  Q      + A SS+SENFAES +K     P+    + K K K  + 
Sbjct  1     MQLISPASSTGENVQHNATTTSKAASSDSENFAESVIKG----PKQASGEHKNKRKIKVT  56

Query  853   IAPVDTNQNQPPQAIRKCLHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAA  1032
              +     QN P QA+RKCLHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAA
Sbjct  57    FSSGQEQQNAPSQAVRKCLHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAA  116

Query  1033  SPTFTPSLHSNSHKKVIEMRSKVGVENTAITEAPSTPQ--PAFNN  1161
             SPTF  ++HSNSHKKVIEMR+K G ++   T++P++P+  P  NN
Sbjct  117   SPTFCAAVHSNSHKKVIEMRNKTGTKSGFATDSPASPELIPNTNN  161



>emb|CDY07522.1| BnaC06g15420D [Brassica napus]
Length=324

 Score =   183 bits (465),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 133/326 (41%), Positives = 184/326 (56%), Gaps = 37/326 (11%)
 Frame = +1

Query  175   SNFMDELDCGSFFDHIDDLIEFPPENECVGGVGSGEFKNFPSIW---NDPLP-DSEPLFS  342
             S F ++LDCG+FFD++DD+++FP  +  VG    GE  +FP+IW   +D  P  S+PLFS
Sbjct  5     SFFPEDLDCGNFFDNMDDILDFPGGDIDVG-FDIGESDSFPNIWTTHHDTWPPASDPLFS  63

Query  343   GSHNNSAADLSAELSVPYEDIIQLEWLSTFVE---DSFSGGGMTLGKENTPVNVEPPHNK  513
              S+ N+ +D S EL VP+EDI+++E   + +E   DSFS             N++   + 
Sbjct  64    -SNTNTNSDSSPELYVPFEDIVKVERPPSLIEKKEDSFS------------TNMDSSSSY  110

Query  514   FQTsspvsvlesssssssssscsGGKTTIPLSPSRCGVQ-RARSKRPRPATFNPRPAIQL  690
                 S   V    SSSSSS + +     +P      G Q R R+KRPRP   + +  ++ 
Sbjct  111   STFRSSSPVSVLESSSSSSQTTNTTSLVLP------GKQGRPRTKRPRPH-LHEKDGVKD  163

Query  691   ISPTSSFTEAPQPFVAPAVSSESENFAESPMKKLTTRPEAPEQkkkkkikFTIPIAPVDT  870
             I  +      P+ FV+      ++   +      ++     + +          +     
Sbjct  164   IVDSCLIVRIPKQFVSDHSKMITKKKKKKGKVTSSSSSSGIDLEVNGNSN----VDSYSL  219

Query  871   NQNQPPQAIRKCLHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFTP  1050
             +QN     +RKC+HCE+TKTPQWR GP GPKTLCNACGVRYKSGRLFPEYRPAASPTFTP
Sbjct  220   DQN----PVRKCMHCEVTKTPQWRLGPNGPKTLCNACGVRYKSGRLFPEYRPAASPTFTP  275

Query  1051  SLHSNSHKKVIEMRSKVGVENTAITE  1128
             +LHSNSHKKV EMRSK   + +  TE
Sbjct  276   ALHSNSHKKVAEMRSKRCKDGSYTTE  301



>ref|XP_009382468.1| PREDICTED: GATA transcription factor 4-like [Musa acuminata subsp. 
malaccensis]
Length=371

 Score =   175 bits (444),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 143/363 (39%), Positives = 184/363 (51%), Gaps = 88/363 (24%)
 Frame = +1

Query  202   GSFFDHIDDLIEFPPE-------------------------NECVGGVGSGEFKNFPSIW  306
             G  F+HIDDL++FP +                         +  +GGVG           
Sbjct  6     GDLFEHIDDLLDFPDDVLGLVEPCNQSAHLFLPAATVPASADGLLGGVGE----------  55

Query  307   NDPLPDSEPLFSGSHNNSAADLSA---ELSVPYE-DIIQLEWLSTFVED--SF-----SG  453
                  DS    SG  N S A  SA   +L    E D++QLEW+S F++D  SF     S 
Sbjct  56    -----DSLDGSSGRSNKSGAPFSAAEDKLGPCDELDVLQLEWMSKFLDDSDSFPLDLPSC  110

Query  454   GGMTLGKENTPVNVEP---PHNKFQTsspvsvlessssssssssc---------------  579
               +T    +   + +P    H+ F+TSSPVSVLE ++  S  S                 
Sbjct  111   NAVTNNGNDENSDAQPKAKAHSFFRTSSPVSVLEDNTRGSGGSDSSSSSSSSSSWTSASY  170

Query  580   -sGGKTTIP-----LSPSRCGV-QRARSKRPRPATFNPRPAIQL--ISPTSSFTEAPQPF  732
                 K  +P      +PS   V  RARSKRPRPA F+ RP + +  + P+S       P 
Sbjct  171   CKDAKVLLPPISPPEAPSVMAVPARARSKRPRPAAFSLRPHVTIPYLPPSSDAVTEVHPL  230

Query  733   VAPAVSSESENFAESPMKKLTTRPEAPEQkkkkkikFTIPIAPVDTNQNQPPQAIRKCLH  912
              A A +S+ E+F ES       + +  ++          P A  D +++  P  +RKC+H
Sbjct  231   SA-AANSDPESFGESCPPPPPPKKKNSQK---------TPAATADGDESGSPPPVRKCMH  280

Query  913   CEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFTPSLHSNSHKKVIEMR  1092
             CEI KTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTF PS+HSNSHKKV+EMR
Sbjct  281   CEIQKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFLPSIHSNSHKKVVEMR  340

Query  1093  SKV  1101
              K 
Sbjct  341   IKA  343



>ref|XP_009418333.1| PREDICTED: GATA transcription factor 8-like isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=374

 Score =   169 bits (428),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 93/173 (54%), Positives = 113/173 (65%), Gaps = 13/173 (8%)
 Frame = +1

Query  631   RARSKRPRPATFNPRPAIQ--LISPTSSFTEAPQPFVAPAVSSESENFAES-PMKKLTTR  801
             RARSKRPRPATF+PR  +    + P+S     P P  A A SS+ E+  ES P+     +
Sbjct  195   RARSKRPRPATFSPRHHVAAPYLPPSSDAVPVPNPLSA-ATSSDPESIGESCPVPPPPKK  253

Query  802   PEAPEQkkkkkikFTIPIAPVDTNQNQPPQAIRKCLHCEITKTPQWRAGPMGPKTLCNAC  981
              ++ ++            A  D  ++ PP  +RKC+HCEI KTPQWRAGPMGPKTLCNAC
Sbjct  254   KKSKKKSPATA-------ATADGEESGPPPPVRKCMHCEIQKTPQWRAGPMGPKTLCNAC  306

Query  982   GVRYKSGRLFPEYRPAASPTFTPSLHSNSHKKVIEMRSKVGVENTAITEAPST  1140
             GVRYKSGRLFPEYRPAASPTF PS+HSNSHKKV+EMR  +       TE  +T
Sbjct  307   GVRYKSGRLFPEYRPAASPTFVPSIHSNSHKKVVEMR--INASQKCATEGAAT  357



>ref|XP_009418334.1| PREDICTED: GATA transcription factor 8-like isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=366

 Score =   169 bits (427),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 93/173 (54%), Positives = 113/173 (65%), Gaps = 13/173 (8%)
 Frame = +1

Query  631   RARSKRPRPATFNPRPAIQ--LISPTSSFTEAPQPFVAPAVSSESENFAES-PMKKLTTR  801
             RARSKRPRPATF+PR  +    + P+S     P P  A A SS+ E+  ES P+     +
Sbjct  187   RARSKRPRPATFSPRHHVAAPYLPPSSDAVPVPNPLSA-ATSSDPESIGESCPVPPPPKK  245

Query  802   PEAPEQkkkkkikFTIPIAPVDTNQNQPPQAIRKCLHCEITKTPQWRAGPMGPKTLCNAC  981
              ++ ++            A  D  ++ PP  +RKC+HCEI KTPQWRAGPMGPKTLCNAC
Sbjct  246   KKSKKKSPATA-------ATADGEESGPPPPVRKCMHCEIQKTPQWRAGPMGPKTLCNAC  298

Query  982   GVRYKSGRLFPEYRPAASPTFTPSLHSNSHKKVIEMRSKVGVENTAITEAPST  1140
             GVRYKSGRLFPEYRPAASPTF PS+HSNSHKKV+EMR  +       TE  +T
Sbjct  299   GVRYKSGRLFPEYRPAASPTFVPSIHSNSHKKVVEMR--INASQKCATEGAAT  349



>ref|XP_011081778.1| PREDICTED: GATA transcription factor 12-like [Sesamum indicum]
Length=359

 Score =   163 bits (412),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 122/321 (38%), Positives = 158/321 (49%), Gaps = 66/321 (21%)
 Frame = +1

Query  214   DH--IDDLIEFPPENECVGGVG------------SGEFKNFPSIWNDPLPDSEPLFSGSH  351
             DH  IDDL++ P +   V   G            S       +  N     +EP F  + 
Sbjct  29    DHFIIDDLLDLPNDETMVAADGCLDAAMAGTSTESSSATPVDTSCNSSFSTAEPHFLAAD  88

Query  352   ---NNSAAD--LSAELSVPYEDIIQLEWLSTFVEDSFSGGGMTLG------KENTPVNVE  498
                + S AD   S+EL VPY+D+ +LEWLS FVE+SFS   M         K  T  + E
Sbjct  89    IVGHRSLADGHFSSELCVPYDDLAELEWLSNFVEESFSSDDMQKMQLIQGVKARTNEDSE  148

Query  499   PPHNKFQTsspvsvlesssssssssscsGGKTTIPLSPSRCGV-QRARSKRPRPATFNPR  675
               H +FQ  +                        P+  S   V  +ARSKR R A  N  
Sbjct  149   SHHYQFQPEASRPG--------------------PILRSEMSVPAKARSKRSRAAPGNWT  188

Query  676   PAIQLISPTSSFTEAPQPFVAPAVSSESENFAESPMKKLTTRPEAPEQkkkkkikFTIPI  855
               + ++SPT +   AP     PA+SS SE+   +   K +T+P   ++K+       +P 
Sbjct  189   SRLLVVSPTPA---APD---VPAMSSSSESDVATTAGKKSTKPAGQKKKE-------VPD  235

Query  856   APVDTNQNQPPQAIRKCLHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAAS  1035
             +             RKCLHC   KTPQWR GPMGPKTLCNACGVRYKSGRL PEYRPAAS
Sbjct  236   SSTGGEG-------RKCLHCATDKTPQWRTGPMGPKTLCNACGVRYKSGRLVPEYRPAAS  288

Query  1036  PTFTPSLHSNSHKKVIEMRSK  1098
             PTF  + HSNSH+KV+E+R +
Sbjct  289   PTFVLTKHSNSHRKVLELRRQ  309



>ref|XP_006424556.1| hypothetical protein CICLE_v10029015mg [Citrus clementina]
 gb|ESR37796.1| hypothetical protein CICLE_v10029015mg [Citrus clementina]
 gb|KDO73316.1| hypothetical protein CISIN_1g023588mg [Citrus sinensis]
Length=280

 Score =   160 bits (405),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 87/168 (52%), Positives = 105/168 (63%), Gaps = 10/168 (6%)
 Frame = +1

Query  598   IPLSPSRC-GVQRARSKRPRPATFNPRPAIQLISPTSSFTEAPQPFVAPAVSSESENFAE  774
             +P++P     V+RARSKR RPAT NP      IS TSS +E   P  A    SE  N  E
Sbjct  119   VPINPKLVFAVKRARSKRRRPATLNPLFIYPFISSTSSTSEDYHPETASESGSEM-NLTE  177

Query  775   SPMKKLTTRPEAPEQkkkkkikFTIPIAPVDTNQNQPPQAIRKCLHCEITKTPQWRAGPM  954
              P++K   R +        +    +     DT         RKC+HCE+ +TPQWR GPM
Sbjct  178   KPVRKKQKRKKNLTVLSGSRENKKLSFQQTDTP--------RKCMHCEVAETPQWREGPM  229

Query  955   GPKTLCNACGVRYKSGRLFPEYRPAASPTFTPSLHSNSHKKVIEMRSK  1098
             GPKTLCNACGVRY+SGRL PEYRPAASPTF PSLHSNSHK+++EMR+K
Sbjct  230   GPKTLCNACGVRYRSGRLVPEYRPAASPTFVPSLHSNSHKRIMEMRNK  277



>ref|XP_008805201.1| PREDICTED: GATA transcription factor 4-like [Phoenix dactylifera]
 ref|XP_008805202.1| PREDICTED: GATA transcription factor 4-like [Phoenix dactylifera]
 ref|XP_008805203.1| PREDICTED: GATA transcription factor 4-like [Phoenix dactylifera]
Length=398

 Score =   160 bits (404),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 96/165 (58%), Positives = 108/165 (65%), Gaps = 27/165 (16%)
 Frame = +1

Query  631   RARSKRPRPATFNPRPAIQLISPTSSFTEAPQPFVAPAV--------SSESENFAESPMK  786
             RARSKRPRPATF+ RP + +            PF+ P+         SS+ E+F ES   
Sbjct  223   RARSKRPRPATFSARPHVTI------------PFLPPSSGGVPVYSSSSDPESFGES---  267

Query  787   KLTTRPEAPEQkkkkkikFTIPIAPVDTNQNQPPQAIRKCLHCEITKTPQWRAGPMGPKT  966
                +   AP  KKKKK  F    A  D    Q P A RKC+HCEI KTPQWRAGPMGPKT
Sbjct  268   ---SPSPAPMMKKKKKKSFAAIAAGGDEAGPQAPPA-RKCMHCEIQKTPQWRAGPMGPKT  323

Query  967   LCNACGVRYKSGRLFPEYRPAASPTFTPSLHSNSHKKVIEMRSKV  1101
             LCNACGVRYKSGRLFPEYRPAASPTF PS+HSNSHKKV+E+R K 
Sbjct  324   LCNACGVRYKSGRLFPEYRPAASPTFVPSVHSNSHKKVVELRIKA  368



>ref|XP_003592781.1| GATA transcription factor [Medicago truncatula]
 gb|AES63032.1| GATA type zinc finger transcription factor family protein [Medicago 
truncatula]
Length=246

 Score =   154 bits (389),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 111/241 (46%), Positives = 133/241 (55%), Gaps = 44/241 (18%)
 Frame = +1

Query  400   DIIQLEWLSTFVEDSFSGGGMTLGK-ENTP---VNVE----PPHNKFQTsspvsvlesss  555
             DI+ LEWLS  V+DS     +T+ K E  P   VN E    P  N   T           
Sbjct  22    DILSLEWLSDIVDDS-RDENITMKKVEQHPSSSVNKEDFVLPKSNSSPTCE---------  71

Query  556   ssssssscsGGKTTIPLSPSRCGVQRARSKRPRPATFNPRPA-IQLISPTSSFT-EAPQP  729
                        KTT         V+R RSKRPR ATF+   + +QLIS TSSF  E  Q 
Sbjct  72    -----------KTT---------VRRTRSKRPRLATFSSHHSTMQLISSTSSFVGENMQD  111

Query  730   FVAPAVSSESENFAESPMKKLTTRPEAPEQkkkkkikFTIPIAPVDTNQNQPPQAIRKCL  909
              V     + +E F +S +     +  + E KK KK K  + +A +D N       +R+C 
Sbjct  112   SVISNKGASTEKFPDSQIAAKKQKLSSGESKKNKKTKAPL-LAALDHN---ALGLVRQCT  167

Query  910   HCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFTPSLHSNSHKKVIEM  1089
             HCE TKTPQWR GP GPKTLCNACGVRYKSGRL PEYRPAAS TF+P LHSNSHKK++EM
Sbjct  168   HCEATKTPQWRTGPEGPKTLCNACGVRYKSGRLCPEYRPAASSTFSPDLHSNSHKKILEM  227

Query  1090  R  1092
             R
Sbjct  228   R  228



>gb|EYU20427.1| hypothetical protein MIMGU_mgv1a008924mg [Erythranthe guttata]
Length=358

 Score =   157 bits (396),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 118/326 (36%), Positives = 158/326 (48%), Gaps = 77/326 (24%)
 Frame = +1

Query  220   IDDLIEFPPEN-------ECVGGVGSGEFKNFPSI--------WNDPLPDSEPLFSGSHN  354
             I+DL++FP ++       +C    G     + P+          N     +EP    + +
Sbjct  32    IEDLLDFPNDDGMVDAGDDCAALTGGTSTGSSPTAAPTTADNSCNSSFSTAEPYLQTTAH  91

Query  355   NSAAD-LSAELSVPYEDIIQLEWLSTFVEDSFSG---------GGMTLGK------ENTP  486
               A D  S EL VPY+D+ +LEWLS FV++SFS           GM   +      E   
Sbjct  92    GFADDHFSNELCVPYDDLAELEWLSNFVDESFSSEDLQKMQLIQGMKAARTTNDSSETHQ  151

Query  487   VNVEPPHNKFQTsspvsvlesssssssssscsGGKTTIPLSPSRCGV-QRARSKRPRPAT  663
                +PP     T                          PL P+   V  +ARSKRPR A 
Sbjct  152   YQFQPPEAAHPT--------------------------PLIPTEMSVPAKARSKRPRAAP  185

Query  664   FNPRPAIQLISPTSSFTEAPQPFV-APAVSSESENFAESPMKKLTTRPEAPEQkkkkkik  840
              N    +  +S     T  P  F+ APA+SS SE  ++  +KK + +P A +QKKK+   
Sbjct  186   GNWTSRLLAVS-----TSPPAAFITAPAMSSSSE--SDVAVKK-SGKPAAAQQKKKE---  234

Query  841   FTIPIAPVDTNQNQPPQAIRKCLHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEY  1020
                       +        R+C+HC   KTPQWR GPMGPKTLCNACGVRYKSGRL PEY
Sbjct  235   -------ASDSSGSGGGEGRRCVHCATDKTPQWRTGPMGPKTLCNACGVRYKSGRLVPEY  287

Query  1021  RPAASPTFTPSLHSNSHKKVIEMRSK  1098
             RPA+SPTF  + HSNSH+KV+E+R +
Sbjct  288   RPASSPTFVMTKHSNSHRKVMELRRQ  313



>ref|XP_006488078.1| PREDICTED: GATA transcription factor 11-like [Citrus sinensis]
Length=277

 Score =   154 bits (388),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 86/168 (51%), Positives = 103/168 (61%), Gaps = 13/168 (8%)
 Frame = +1

Query  598   IPLSPSRC-GVQRARSKRPRPATFNPRPAIQLISPTSSFTEAPQPFVAPAVSSESENFAE  774
             +P++P     V+RARSKR RPAT NP      IS TS   E   P  A    SE  N  E
Sbjct  119   VPINPKLVFAVKRARSKRRRPATLNPLFIYPFISSTS---EDYHPETASESGSEM-NLTE  174

Query  775   SPMKKLTTRPEAPEQkkkkkikFTIPIAPVDTNQNQPPQAIRKCLHCEITKTPQWRAGPM  954
              P++K   R +        +    +     D        A RKC+HCE+ +TPQWR GPM
Sbjct  175   KPVRKKQKRKKNLTVLSGSRENKKLSFQQTD--------APRKCMHCEVAETPQWREGPM  226

Query  955   GPKTLCNACGVRYKSGRLFPEYRPAASPTFTPSLHSNSHKKVIEMRSK  1098
             GPKTLCNACGVRY+SGRL PEYRPAASPTF PSLHSNSHK+++EMR+K
Sbjct  227   GPKTLCNACGVRYRSGRLVPEYRPAASPTFVPSLHSNSHKRIMEMRNK  274



>ref|XP_011089286.1| PREDICTED: GATA transcription factor 11-like [Sesamum indicum]
Length=336

 Score =   154 bits (389),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 87/178 (49%), Positives = 107/178 (60%), Gaps = 11/178 (6%)
 Frame = +1

Query  631   RARSKRPRPATFNPRPAIQLISPTSSFTEAPQPFVAPAVSSESENFAESPMKKLTTRPEA  810
             R RSKR R A  NP     L+SP  + T   +         E+      P   + +  ++
Sbjct  155   RTRSKRVRHAGINP---WLLVSPWFAATSTSKRTSNARKHKEARKKLSQPSVVVKSTRDS  211

Query  811   PEQkkkkkikFTIPIAPVDTNQN---QPPQAIRKCLHCEITKTPQWRAGPMGPKTLCNAC  981
             PE+ +      ++ ++     QN     P   +KC HCE+TKTPQWR GP+GPKTLCNAC
Sbjct  212   PEKVEN-----SLQVSDYGEPQNVSSHRPALAKKCTHCEVTKTPQWREGPLGPKTLCNAC  266

Query  982   GVRYKSGRLFPEYRPAASPTFTPSLHSNSHKKVIEMRSKVGVENTAITEAPSTPQPAF  1155
             GVRY+SGRLFPEYRPAASPTF PSLHSNSHKKVIEMRSK     T + E P +PQP F
Sbjct  267   GVRYRSGRLFPEYRPAASPTFVPSLHSNSHKKVIEMRSKAKQPATKLEEPPISPQPEF  324



>gb|KDP44040.1| hypothetical protein JCGZ_05507 [Jatropha curcas]
Length=324

 Score =   153 bits (387),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 135/345 (39%), Positives = 176/345 (51%), Gaps = 46/345 (13%)
 Frame = +1

Query  172   GSNFMDELDCG---SFFDHIDDLIEFPPENECVGGVGSGEFKNFPSIWNDPLPDSEPL--  336
             GS F DE   G    FFD   +L++FP EN  +  +G      F  +     P S  L  
Sbjct  9     GSWFFDENFNGVPDDFFDDAMELLDFPLENVELNDLGEDWEVKFQQL---VPPPSNVLAG  65

Query  337   FSGSHNNSAADLSAELSVPYEDIIQ-LEWLSTFVEDSFSGGGMTLGKENTPVNVEPPHNK  513
               G + N    +    SV +++  Q  +W ST   ++ SG G+       P+N +    K
Sbjct  66    LCGENGNDILKVKKSSSVLHDESSQPKQWPST--AEASSGRGI-------PLNYDSSEAK  116

Query  514   FQTsspvsvlesssssssssscsGG------KTTIPLSPSRCGVQRARSKRPRPATFNP-  672
             +      S   S   SSSSSS +        K  IP       V+R RSKRPR    +P 
Sbjct  117   YSRLFWTSSPVSVLESSSSSSSAENAVVQHPKFVIP-------VKRPRSKRPRSKRPHPH  169

Query  673   RPAIQLISPTSSFTEAPQPFVAPAVSSESENFAESPMKKLTTRPEAPEQkkkkkikFTIP  852
             R     IS       AP+ +      SE+E+  +  M  +  R    +QKKK+ +     
Sbjct  170   RRTFPFIS------YAPKQYHPLGSESETESCPDEKMLNVAKR----KQKKKRNLMLLSC  219

Query  853   IAPVDTNQNQPPQAIRKCLHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAA  1032
                +  +  Q P  IRKC HCE+TKTPQWR GPMGPKTLCNACGVRY+SGRLFPEYRPAA
Sbjct  220   TVEMKKSSTQQPIEIRKCTHCEVTKTPQWREGPMGPKTLCNACGVRYRSGRLFPEYRPAA  279

Query  1033  SPTFTPSLHSNSHKKVIEMRSKVG--VENTAITEA--PSTPQPAF  1155
             SPTF PSLHSNSH+KV+EMR K    +  TA  +A  P+ P+ +F
Sbjct  280   SPTFVPSLHSNSHRKVVEMRKKTTRPMTTTAAMDASLPTVPEYSF  324



>ref|XP_004487098.1| PREDICTED: GATA transcription factor 11-like [Cicer arietinum]
Length=313

 Score =   152 bits (385),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 82/159 (52%), Positives = 97/159 (61%), Gaps = 19/159 (12%)
 Frame = +1

Query  625   VQRARSKRPRPATFNPRPAIQLISPTSSFTEAPQPFVAPAVSSESENFAESPMKKLTTRP  804
             V+RARSKR RP+  NP  +I  I P S    A Q +     S    N A+ P K+     
Sbjct  161   VKRARSKRRRPSILNPVFSISFIPPNSL---ALQKYHKTPTSESDSNKAKKPRKR-----  212

Query  805   EAPEQkkkkkikFTIPIAPVDTNQNQPPQAIRKCLHCEITKTPQWRAGPMGPKTLCNACG  984
                          ++    V+T+ +Q     RKC HCEITKTPQWR GP GPKTLCNACG
Sbjct  213   -----------DLSVLSGDVETSSSQDSVVTRKCSHCEITKTPQWREGPKGPKTLCNACG  261

Query  985   VRYKSGRLFPEYRPAASPTFTPSLHSNSHKKVIEMRSKV  1101
             VRY+SGRL+PEYRPAASPTF  S+HSN HKKV+EMR KV
Sbjct  262   VRYRSGRLYPEYRPAASPTFVESIHSNCHKKVMEMRCKV  300



>ref|XP_010924658.1| PREDICTED: GATA transcription factor 12-like [Elaeis guineensis]
Length=351

 Score =   153 bits (387),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 113/314 (36%), Positives = 153/314 (49%), Gaps = 60/314 (19%)
 Frame = +1

Query  220   IDDLIEFPPENECVGGVGSGEFKNFPSI---------------WNDPLPDSEPLFSGS--  348
             ++DL++F  E +  G    G+   F +                 ++    S+P FSG   
Sbjct  35    VEDLLDFSNEEDEAGVAAGGDDAGFDATAGNSTDSSTVTAVDSCSNSFSGSDPHFSGDLV  94

Query  349   -HNNSAADLSAELSVPYEDIIQLEWLSTFVEDSFSGGGMTLGKENTPVNVEPPHNKFQTs  525
               + + A LS +L  PY+++ +LEWLS FVE+SFS   +                K Q  
Sbjct  95    CRSFADASLSGDLCEPYDELAELEWLSNFVEESFSSEDL---------------QKLQLI  139

Query  526   spvsvlessssssssss-csGGKTTIP--LSPSRCGVQRARSKRPRPATFNPRPAIQLIS  696
             S +    SSS + +  +   GG    P    P      +ARSKR R A  +    + ++S
Sbjct  140   SGIKSSSSSSENRAEIAPTVGGGAAQPALFRPEAPVPGKARSKRSRAAPCSWSSRLLVLS  199

Query  697   PTSSFTEAPQPFVAPAVSSESENFAESPMKKLTTRPEAPEQkkkkkikFTIPIAPVDTNQ  876
             PT++ +      + PA SS  +  A    K  ++RP                +AP     
Sbjct  200   PTTTASSPESELLVPAGSSCGKK-AAVKKKDQSSRP---------------AVAPAADG-  242

Query  877   NQPPQAIRKCLHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFTPSL  1056
                    RKCLHC   KTPQWR GPMGPKTLCNACGVRYKSGRL PEYRPAASPTF  S 
Sbjct  243   -------RKCLHCATDKTPQWRTGPMGPKTLCNACGVRYKSGRLVPEYRPAASPTFVLSK  295

Query  1057  HSNSHKKVIEMRSK  1098
             HSNSH+KV+E+R +
Sbjct  296   HSNSHRKVLELRRQ  309



>gb|KGN60319.1| hypothetical protein Csa_3G895650 [Cucumis sativus]
Length=351

 Score =   153 bits (387),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 117/314 (37%), Positives = 158/314 (50%), Gaps = 60/314 (19%)
 Frame = +1

Query  214   DH--IDDLIEFPPENECVGGVGSGEFKNFPSIWNDPLP-----DSEPLFSGSHNNSAAD-  369
             DH  ++DL++F  +++ V   G+ + +   S  +  L      +S P    +HN   AD 
Sbjct  39    DHFIVEDLLDFSNDDDVVFTDGTFDNQTPTSTDSSTLTLLDSCNSYPNTGNAHNYHFADA  98

Query  370   -LSAELSVPYEDIIQLEWLSTFVEDSFSGGGM----TLGKENTPVNVEPPH----NKFQT  522
               S +L VPY+D+ +LEWLS FVEDSFS   +     +   N+  +V         +FQT
Sbjct  99    NFSTDLGVPYDDLAELEWLSNFVEDSFSTDDLEKLSLISGMNSRADVHDDDASKAREFQT  158

Query  523   sspvsvlesssssssssscsGGKTTIPLSPSRCGVQRARSKRPR--PATFNPRPAIQLIS  696
                 +               G +  + + P++     ARSKR R  P  +N R  + ++S
Sbjct  159   GFNRNHSP------------GFRHEMSVVPAKA----ARSKRSRAAPCIWNSR--LSVLS  200

Query  697   PTSSFTEAPQPFVAPAVSSESENFAESPMKKLTTRPEAPEQkkkkkikFTIPIAPVDTNQ  876
             PT+S             SSE++         + T    P   KK   K  IP        
Sbjct  201   PTNS-------------SSETD--------VVVTLTPHPNTAKKTTKKKEIPDDTSSAAG  239

Query  877   NQPPQAIRKCLHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFTPSL  1056
             N      RKCLHC   KTPQWR GPMGPKTLCNACGVRYKSGRL PEYRPAASPTF  + 
Sbjct  240   NNGEG--RKCLHCATDKTPQWRTGPMGPKTLCNACGVRYKSGRLVPEYRPAASPTFVLTK  297

Query  1057  HSNSHKKVIEMRSK  1098
             HSNSH+KV+E+R +
Sbjct  298   HSNSHRKVMELRRQ  311



>ref|XP_006359773.1| PREDICTED: GATA transcription factor 12-like [Solanum tuberosum]
Length=362

 Score =   153 bits (387),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 101/249 (41%), Positives = 140/249 (56%), Gaps = 23/249 (9%)
 Frame = +1

Query  370   LSAELSVPYEDIIQLEWLSTFVEDSFSGGGMTLGKENTPVNVEPPHNKFQTsspvsvles  549
             LS E +VPYED+ +LEWLS FVE+SFS   +   +      V+   N+  +     + + 
Sbjct  94    LSTEFAVPYEDMAELEWLSNFVEESFSSNELHKMQM-----VQAMRNRTDSEIHQFIPDP  148

Query  550   ssssssssscsGGKTTIPLSPSRCGVQRARSKRPRPATFNPRPAIQLISPTSSFTEAPQP  729
             + +S++SS+    +  +P         +ARSKR R A  N    + ++SP ++  ++   
Sbjct  149   NRASATSSTIFKPEMPVP--------AKARSKRSRMAPGNWASRLLVVSPNTTTPDSSMD  200

Query  730   FVAP---AVSSESENFAESPMKKLTTRPEAPEQkkkkkikFTIPIAPVDTNQNQPPQAIR  900
              ++    + SSES     S  KK       P++K+         I  V +N N      R
Sbjct  201   TISMQDMSSSSESGMIIPSSGKKTVKSSSTPKKKESN-------IHHVPSNNNGSNSEGR  253

Query  901   KCLHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFTPSLHSNSHKKV  1080
             KCLHC   KTPQWR GP+GPKTLCNACGVRYKSGRL PEYRPAASPTF  + HSNSH+KV
Sbjct  254   KCLHCATDKTPQWRTGPLGPKTLCNACGVRYKSGRLVPEYRPAASPTFMLTKHSNSHRKV  313

Query  1081  IEMRSKVGV  1107
             +E+R +  V
Sbjct  314   LEIRRQKEV  322



>ref|XP_009392221.1| PREDICTED: GATA transcription factor 8-like [Musa acuminata subsp. 
malaccensis]
Length=340

 Score =   152 bits (385),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 89/157 (57%), Positives = 102/157 (65%), Gaps = 11/157 (7%)
 Frame = +1

Query  631   RARSKRPRPATFNPRPAIQLISPTSSFTEAPQPFVAPAVSSESENFAESPMKKLTTRPEA  810
             RARSKR R +T  P+P      P+S    AP P    A  S+ E+F ES        P  
Sbjct  168   RARSKRQRRSTLMPQP------PSSDVVAAPHPLSV-ASDSDPESFGES----CPPPPPP  216

Query  811   PEQkkkkkikFTIPIAPVDTNQNQPPQAIRKCLHCEITKTPQWRAGPMGPKTLCNACGVR  990
              ++KKK K K     A  + ++   P   RKC HCEI KTPQWRAGPMGPKTLCNACGVR
Sbjct  217   KKKKKKSKKKGPGATAAAEGDEPGSPPPGRKCTHCEIQKTPQWRAGPMGPKTLCNACGVR  276

Query  991   YKSGRLFPEYRPAASPTFTPSLHSNSHKKVIEMRSKV  1101
             Y+SGRLFPEYRPA SPTF PSLHSNSHKKV+EMR+K 
Sbjct  277   YRSGRLFPEYRPAGSPTFVPSLHSNSHKKVVEMRNKA  313



>ref|XP_010249552.1| PREDICTED: GATA transcription factor 12 [Nelumbo nucifera]
Length=335

 Score =   152 bits (385),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 110/308 (36%), Positives = 141/308 (46%), Gaps = 57/308 (19%)
 Frame = +1

Query  214   DH--IDDLIEFPPENECV--------GGVGSGEFKNFPSIWNDPLPDSEPLFSGSHNNSA  363
             DH  IDDL++F  E+  +        G              N     S+P FSG     +
Sbjct  32    DHFIIDDLLDFSNEDAVITDGTFDITGNSTDSSTVTVLDSCNSSFSGSDPHFSGDFGCRS  91

Query  364   ---ADLSAELSVPYEDIIQLEWLSTFVEDSFSGGGMTLGKENTPVNVEPPHNKFQTsspv  534
                A  S +L VPY+D+ +LEWLS FVE+SFS   +                K Q  S +
Sbjct  92    FPDAQFSGDLCVPYDDLAELEWLSNFVEESFSSEDL---------------QKLQLISGM  136

Query  535   svlesssssssssscsGGKTTIPLSPSRCGVQRARSKRPRPATFNPRPAIQLISPTSSFT  714
                    S +        +      P      +ARSKR R A  +    + ++SPT+S  
Sbjct  137   KARTDEVSETREFQPENNRNNPMFRPEISVPGKARSKRSRAAPCDWSSRLLVLSPTTS--  194

Query  715   EAPQPFVAPAVSSESENFAESPMKKLTTRPEAPEQkkkkkikFTIPIAPVDTNQNQPPQA  894
                        SSES+  + S  K     P+  E                 ++       
Sbjct  195   -----------SSESDVASNSGKKTTKGAPKKRES----------------SDNASGNGE  227

Query  895   IRKCLHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFTPSLHSNSHK  1074
              RKCLHC   KTPQWR GPMGPKTLCNACGVRYKSGRL PEYRPAASPTF  + HSNSH+
Sbjct  228   GRKCLHCATDKTPQWRTGPMGPKTLCNACGVRYKSGRLVPEYRPAASPTFVLTKHSNSHR  287

Query  1075  KVIEMRSK  1098
             KV+E+R +
Sbjct  288   KVMELRRQ  295



>ref|XP_011092007.1| PREDICTED: GATA transcription factor 12 [Sesamum indicum]
Length=352

 Score =   152 bits (384),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 117/330 (35%), Positives = 153/330 (46%), Gaps = 81/330 (25%)
 Frame = +1

Query  202   GSFFDH--IDDLIEFPPENECVGGVGSGEF------------------KNFPSIWNDPLP  321
             G   DH  I+DL++FP ++  V  V +G                     +F ++      
Sbjct  23    GKNGDHFIIEDLLDFPTDDNLVSAVDTGLMAVSSTDSSTVTAVDTSCNSSFSAVST----  78

Query  322   DSEPLF-----SGSHNNSAADLSAELSVPYEDIIQLEWLSTFVEDSFSGGGMTLGKENTP  486
              +EP F      G   +  A+ S+EL VPY+D+ +LEWLS FV++SFS   +        
Sbjct  79    -AEPHFHPADIGGPRCSVGANFSSELCVPYDDLAELEWLSNFVDESFSSEDL--------  129

Query  487   VNVEPPHNKFQTsspvsvlesssssssssscsGGKTT-IPLSPSRCGV-QRARSKRPRPA  660
                     K Q    +      +S+          T   PL P    V  +ARSKR R A
Sbjct  130   -------QKLQLIQGMKARTDEASADYQYQFQPETTHPGPLLPPETPVPAKARSKRSRTA  182

Query  661   TFNPRPAIQLISPTSSFTEAPQPFVAPAVSSESENFAESPMKK----LTTRPEAPEQkkk  828
               N    + ++SPT            PA+SS SE+   +  K     +  + E PE    
Sbjct  183   PGNWTSRLLVVSPT-----------PPAMSSSSESDVTAVKKAAKPGVQKKREGPETAS-  230

Query  829   kkikFTIPIAPVDTNQNQPPQAIRKCLHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRL  1008
                               P    RKCLHC   KTPQWR GPMGPKTLCNACGVRYKSGRL
Sbjct  231   ------------------PGGEGRKCLHCATDKTPQWRTGPMGPKTLCNACGVRYKSGRL  272

Query  1009  FPEYRPAASPTFTPSLHSNSHKKVIEMRSK  1098
              PEYRPAASPTF  + HSNSH+KV+E+R +
Sbjct  273   VPEYRPAASPTFVLTKHSNSHRKVLELRRQ  302



>ref|XP_010267189.1| PREDICTED: GATA transcription factor 12-like [Nelumbo nucifera]
Length=336

 Score =   152 bits (383),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 100/262 (38%), Positives = 128/262 (49%), Gaps = 54/262 (21%)
 Frame = +1

Query  337   FSGSHNNSAADL----------SAELSVPYEDIIQLEWLSTFVEDSFSGGGMTLGKENTP  486
             FSGS    + DL          S +L VPY+D+ +LEWLS FVE+SFS   +        
Sbjct  77    FSGSDTQISGDLGCRNFPDAQFSGDLCVPYDDLAELEWLSNFVEESFSSEDL--------  128

Query  487   VNVEPPHNKFQTsspvsvlesssssssssscsGGKTTIPLSPSRCGVQRARSKRPRPATF  666
                     K Q  S +       S +        K      P      +ARSKR R A  
Sbjct  129   -------QKLQLISGMKARTDDVSDTREFQPENNKNNSIFRPEMSVPAKARSKRSRAAPG  181

Query  667   NPRPAIQLISPTSSFTEAPQPFVAPAVSSESENFAESPMKKLTTRPEAPEQkkkkkikFT  846
             N    + ++SPT+S +E+       A SS  ++   +P K+ ++   +   +        
Sbjct  182   NWSSRLLVLSPTTSSSESD-----VATSSGKKSTKGTPKKRESSDGASGNGEG-------  229

Query  847   IPIAPVDTNQNQPPQAIRKCLHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRP  1026
                              RKCLHC   KTPQWR GPMGPKTLCNACGVRYKSGRL PEYRP
Sbjct  230   -----------------RKCLHCATDKTPQWRTGPMGPKTLCNACGVRYKSGRLVPEYRP  272

Query  1027  AASPTFTPSLHSNSHKKVIEMR  1092
             AASPTF  + HSNSH+KV+E+R
Sbjct  273   AASPTFVLTKHSNSHRKVLELR  294



>ref|XP_010935873.1| PREDICTED: LOW QUALITY PROTEIN: GATA transcription factor 8-like 
[Elaeis guineensis]
Length=383

 Score =   153 bits (386),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 94/157 (60%), Positives = 106/157 (68%), Gaps = 19/157 (12%)
 Frame = +1

Query  631   RARSKRPRPATFNPRPAIQLISPTSSFTEAPQPFVAPAVSSESENFAES-PMKKLTTRPE  807
             RARSKRPRPA F+ RP + +     S             SS+ E+  ES P+        
Sbjct  214   RARSKRPRPAAFSARPHVTIPLSPPSSGS----------SSDPESLGESNPVP-------  256

Query  808   APEQkkkkkikFTIPIAPVDTNQNQPPQAIRKCLHCEITKTPQWRAGPMGPKTLCNACGV  987
             AP +KKKKK  F    A  D   +QPP  +RKC+HCEI KTPQWRAGPMGPKTLCNACGV
Sbjct  257   APMKKKKKKKSFAAIAAGGDEAGSQPPP-VRKCMHCEIQKTPQWRAGPMGPKTLCNACGV  315

Query  988   RYKSGRLFPEYRPAASPTFTPSLHSNSHKKVIEMRSK  1098
             RYKSGRLFPEYRPAASPTF PSLHSNSHKKV+E+R K
Sbjct  316   RYKSGRLFPEYRPAASPTFVPSLHSNSHKKVVELRIK  352



>ref|XP_004245156.2| PREDICTED: GATA transcription factor 12 [Solanum lycopersicum]
Length=359

 Score =   152 bits (383),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 100/249 (40%), Positives = 140/249 (56%), Gaps = 23/249 (9%)
 Frame = +1

Query  370   LSAELSVPYEDIIQLEWLSTFVEDSFSGGGMTLGKENTPVNVEPPHNKFQTsspvsvles  549
             LS E ++PYED+ +LEWLS FVE+SFS   M   +      V+   N+  +     + + 
Sbjct  91    LSTEFALPYEDMAELEWLSNFVEESFSSNEMHKMQM-----VQAMRNRTDSEIHQFIPDP  145

Query  550   ssssssssscsGGKTTIPLSPSRCGVQRARSKRPRPATFNPRPAIQLISPTSSFTEAPQP  729
             + +S++S++    +  +P         +ARSKR R A  N    + ++SP ++  ++   
Sbjct  146   NRASATSNTIFKPEMPVP--------AKARSKRSRMAPGNWASRLLVVSPNTTNPDSSMD  197

Query  730   FVAP---AVSSESENFAESPMKKLTTRPEAPEQkkkkkikFTIPIAPVDTNQNQPPQAIR  900
              ++    + SSES     S  KK      AP++K+         I  V +N        R
Sbjct  198   TISVQDMSSSSESGMIIPSSGKKTVKCSSAPKKKENN-------IHHVPSNNTGSNSEGR  250

Query  901   KCLHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFTPSLHSNSHKKV  1080
             KCLHC   KTPQWR GP+GPKTLCNACGVRYKSGRL PEYRPAASPTF  + HSNSH+KV
Sbjct  251   KCLHCATDKTPQWRTGPLGPKTLCNACGVRYKSGRLVPEYRPAASPTFMLTKHSNSHRKV  310

Query  1081  IEMRSKVGV  1107
             +E+R +  V
Sbjct  311   LEIRRQKEV  319



>ref|XP_002284028.1| PREDICTED: GATA transcription factor 9 [Vitis vinifera]
Length=329

 Score =   150 bits (380),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 108/320 (34%), Positives = 151/320 (47%), Gaps = 73/320 (23%)
 Frame = +1

Query  214   DH--IDDLIEFPPENECV---------GGVGSGEFKNFPSIWNDPLPDSEPLFSGS---H  351
             DH  ++DL++FP +++ +         G              N  L  +EP FSG     
Sbjct  30    DHFLVEDLLDFPNDDDIMTDGFFDTVTGNSTDSSTVTVVDSCNSSLSGNEPHFSGDVGCR  89

Query  352   NNSAADLSAELSVPYEDIIQLEWLSTFVEDSFSGGGM----TLGKENTPVNV-EPPHNKF  516
             N + A  S EL VP +++ +LEWLS FVE+SFS   +     L     P++  E P  +F
Sbjct  90    NFTDAQFSGELCVPCDELAELEWLSNFVEESFSSEDLHKIQVLSGIKAPLHTTESPEPQF  149

Query  517   QTsspvsvlesssssssssscsGGKTTIPLSPSRCGVQRARSKRPRPATFNPRPAIQLIS  696
             Q  +                    ++   L P      +ARSKRPR    +    + ++S
Sbjct  150   QPET-------------------ARSEPILQPPMNVPGKARSKRPRSVPCDWSTRLLVLS  190

Query  697   PTSSFTEAPQPFVAPAVSSESENFAESPMKKLTTRPEAPEQkkkkkikFTIPIAPVDTNQ  876
             P +S             SSES+ F + P    + + E  +                    
Sbjct  191   PATS-------------SSESDAFKKPPKTTSSKKKENSDSAGDG---------------  222

Query  877   NQPPQAIRKCLHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFTPSL  1056
                    RKCLHC   KTPQWR GPMGPKTLCNACGVR+KSGRL PEYRPA+SPTF  + 
Sbjct  223   -------RKCLHCAAEKTPQWRTGPMGPKTLCNACGVRFKSGRLVPEYRPASSPTFVSAK  275

Query  1057  HSNSHKKVIEMRSKVGVENT  1116
             HSNSH+KV+E+R +  ++ +
Sbjct  276   HSNSHRKVLELRRQKDLQRS  295



>ref|XP_011089920.1| PREDICTED: GATA transcription factor 11-like isoform X2 [Sesamum 
indicum]
Length=335

 Score =   150 bits (380),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 68/92 (74%), Positives = 76/92 (83%), Gaps = 0/92 (0%)
 Frame = +1

Query  880   QPPQAIRKCLHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFTPSLH  1059
             Q P  ++KC HCE+TKTPQWR GP+GPKTLCNACGVRY+SGRLFPEYRPAASPTF PSLH
Sbjct  232   QRPAIVKKCTHCEVTKTPQWREGPLGPKTLCNACGVRYRSGRLFPEYRPAASPTFIPSLH  291

Query  1060  SNSHKKVIEMRSKVGVENTAITEAPSTPQPAF  1155
             SNSHKKVIEMRSK   + + I E P +PQ  F
Sbjct  292   SNSHKKVIEMRSKAKQQVSNIEEHPVSPQMEF  323



>ref|XP_011089919.1| PREDICTED: GATA transcription factor 11-like isoform X1 [Sesamum 
indicum]
Length=353

 Score =   151 bits (381),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 68/92 (74%), Positives = 76/92 (83%), Gaps = 0/92 (0%)
 Frame = +1

Query  880   QPPQAIRKCLHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFTPSLH  1059
             Q P  ++KC HCE+TKTPQWR GP+GPKTLCNACGVRY+SGRLFPEYRPAASPTF PSLH
Sbjct  250   QRPAIVKKCTHCEVTKTPQWREGPLGPKTLCNACGVRYRSGRLFPEYRPAASPTFIPSLH  309

Query  1060  SNSHKKVIEMRSKVGVENTAITEAPSTPQPAF  1155
             SNSHKKVIEMRSK   + + I E P +PQ  F
Sbjct  310   SNSHKKVIEMRSKAKQQVSNIEEHPVSPQMEF  341



>ref|XP_006846789.1| hypothetical protein AMTR_s00148p00049970 [Amborella trichopoda]
 gb|ERN08370.1| hypothetical protein AMTR_s00148p00049970 [Amborella trichopoda]
Length=277

 Score =   149 bits (375),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 118/239 (49%), Positives = 139/239 (58%), Gaps = 28/239 (12%)
 Frame = +1

Query  409   QLEWLSTFVEDSFSGGGMTLGKENTPVNVEP--PHNKFQTsspvsvlesssssssssscs  582
             +LEWLS FVEDSFS          +P N  P  PH+  Q SS  ++  SSSSSSSSSS S
Sbjct  3     ELEWLSIFVEDSFS---------PSPANPLPLVPHHHQQDSSASNLDTSSSSSSSSSSSS  53

Query  583   GGKTTIPLSPSRCGVQ----RARSKRPRPATFNPRPAIQLISPTSSFTEA-PQPFVAPAV  747
                T    + +   +     RAR+KRPRP  F  R  + L+SP+SS T   P P    +V
Sbjct  54    AASTITTAAAAAAILSAVPGRARTKRPRPPPFTAR--LPLLSPSSSVTTVTPSPASPDSV  111

Query  748   SSESENFAESPMKKLTTRPEAPEQkkkkkikFTIPIAPVDTNQNQPPQAIRKCLHCEITK  927
             +   E+ +  P+KK  T                  I P         Q  RKC HCEI K
Sbjct  112   THIVESESR-PLKKKPTTTPTMGPTPNT-------IGPSTAGPTS--QLGRKCTHCEIQK  161

Query  928   TPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFTPSLHSNSHKKVIEMRSKVG  1104
             TPQWR GP+GPKTLCNACGVRYKSGRLFPEYRPAASPTF  SLHSNSHKKV+EMR ++G
Sbjct  162   TPQWRTGPLGPKTLCNACGVRYKSGRLFPEYRPAASPTFVASLHSNSHKKVLEMRVRIG  220



>ref|XP_003540186.1| PREDICTED: GATA transcription factor 11-like [Glycine max]
Length=326

 Score =   150 bits (378),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 79/161 (49%), Positives = 103/161 (64%), Gaps = 14/161 (9%)
 Frame = +1

Query  625   VQRARSKRPRPATFNPRPAIQLISPTSSFTEAPQPFVAPAVSSESENFAESPMKKLTTRP  804
             V+RARSKR RP+ F+P  +I LI         P        ++   +F  +    L+ + 
Sbjct  157   VKRARSKRQRPSNFSPLFSIPLI------VNLPAVRKDQRTAASDSDFGTNVAGNLSNKV  210

Query  805   EAPEQkkkkkikFTIPIAPVDTNQNQPPQAI--RKCLHCEITKTPQWRAGPMGPKTLCNA  978
             +   +K          ++ V+  ++  P++   RKC+HCE+TKTPQWR GPMGPKTLCNA
Sbjct  211   KKQRKKDLSL------LSDVEMTRSSSPESGPPRKCMHCEVTKTPQWREGPMGPKTLCNA  264

Query  979   CGVRYKSGRLFPEYRPAASPTFTPSLHSNSHKKVIEMRSKV  1101
             CGVRY+SGRLFPEYRPAASPTF  SLHSN HKKV+EMRS+V
Sbjct  265   CGVRYRSGRLFPEYRPAASPTFVASLHSNCHKKVVEMRSRV  305



>gb|KHN11215.1| GATA transcription factor 10 [Glycine soja]
Length=319

 Score =   149 bits (377),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 79/161 (49%), Positives = 103/161 (64%), Gaps = 14/161 (9%)
 Frame = +1

Query  625   VQRARSKRPRPATFNPRPAIQLISPTSSFTEAPQPFVAPAVSSESENFAESPMKKLTTRP  804
             V+RARSKR RP+ F+P  +I LI         P        ++   +F  +    L+ + 
Sbjct  150   VKRARSKRQRPSNFSPLFSIPLI------VNLPAVRKDQRTAASDSDFGTNVAGNLSNKV  203

Query  805   EAPEQkkkkkikFTIPIAPVDTNQNQPPQAI--RKCLHCEITKTPQWRAGPMGPKTLCNA  978
             +   +K          ++ V+  ++  P++   RKC+HCE+TKTPQWR GPMGPKTLCNA
Sbjct  204   KKQRKKDLSL------LSDVEMTRSSSPESGPPRKCMHCEVTKTPQWREGPMGPKTLCNA  257

Query  979   CGVRYKSGRLFPEYRPAASPTFTPSLHSNSHKKVIEMRSKV  1101
             CGVRY+SGRLFPEYRPAASPTF  SLHSN HKKV+EMRS+V
Sbjct  258   CGVRYRSGRLFPEYRPAASPTFVASLHSNCHKKVVEMRSRV  298



>ref|XP_011019597.1| PREDICTED: GATA transcription factor 12 [Populus euphratica]
Length=373

 Score =   150 bits (380),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 96/245 (39%), Positives = 126/245 (51%), Gaps = 38/245 (16%)
 Frame = +1

Query  370   LSAELSVPYEDIIQLEWLSTFVEDSFSGGGMTLGKENTPVNVEPPHN----KFQTsspvs  537
             L +EL VPY+D+ +LEWLS FVE+SFS   +   +  + +   P  +    +FQT    +
Sbjct  114   LGSELCVPYDDLAELEWLSNFVEESFSSEDLQRLQLISGMKARPDESSETRQFQTDDNNN  173

Query  538   vlesssssssssscsGGKTTIPLSPSRCGVQRARSKRPRPATFNPRPAIQLISPTSSFTE  717
                S+                  +P      +ARSKR R A  N    + ++SPT+S +E
Sbjct  174   GNVSNIC----------NNNTMFNPEMAVPAKARSKRSRAAPGNWASRLLVLSPTTSSSE  223

Query  718   APQPFVAPAVSSESENFAESPMKKLTTRPEAPEQkkkkkikFTIPIAPVDTNQNQPPQAI  897
                P + P                 T  P + ++  K  +        V+          
Sbjct  224   ---PEIIPGS---------------TQHPNSGKKTIKGAVGLKKRDGDVEGGDG------  259

Query  898   RKCLHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFTPSLHSNSHKK  1077
             RKCLHC   KTPQWR GPMGPKTLCNACGVRYKSGRL PEYRPAASPTF  + HSNSH+K
Sbjct  260   RKCLHCATDKTPQWRTGPMGPKTLCNACGVRYKSGRLVPEYRPAASPTFMLTKHSNSHRK  319

Query  1078  VIEMR  1092
             V+E+R
Sbjct  320   VLELR  324



>ref|XP_008466068.1| PREDICTED: GATA transcription factor 9-like [Cucumis melo]
Length=352

 Score =   150 bits (378),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 114/306 (37%), Positives = 155/306 (51%), Gaps = 43/306 (14%)
 Frame = +1

Query  214   DH--IDDLIEFPPENECVGGVGSGEFKNFPSIWNDPLP-----DSEPLFSGSHNNSAAD-  369
             DH  ++DL++F  +++ V   G+ + +   S  +  L      +S P    +HN   AD 
Sbjct  39    DHFIVEDLLDFSNDDDVVFTDGAFDNQTPTSTDSSSLTLLDSCNSYPNTGNAHNYHFADA  98

Query  370   -LSAELSVPYEDIIQLEWLSTFVEDSFSGGGMTLGKENTPVNVEPPHNKFQTsspvsvle  546
               S +L VPY+D+ +LEWLS FVEDSFS   +      + +N +   +    S       
Sbjct  99    NFSTDLGVPYDDLAELEWLSNFVEDSFSTDDLEKLSLISGMNSQTDVHDDDASKTREFQS  158

Query  547   sssssssssscsGGKTTIPLSPSRCGVQRARSKRPR--PATFNPRPAIQLISPTSSFTEA  720
               +  + S +     + +P        + ARSKR R  P  +N R  + ++SPT+S    
Sbjct  159   GFNPRNHSPAFRHEMSVVP-------AKAARSKRSRAAPCIWNSR--LSVLSPTNS----  205

Query  721   PQPFVAPAVSSESENFAESPMKKLTTRPEAPEQkkkkkikFTIPIAPVDTNQNQPPQAIR  900
                      SSE++         + T    P   KK   K  IP        N      R
Sbjct  206   ---------SSETD--------VVVTLTPHPNTAKKTTKKKEIPDDTSSAAGNNGEG--R  246

Query  901   KCLHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFTPSLHSNSHKKV  1080
             KCLHC   KTPQWR GPMGPKTLCNACGVRYKSGRL PEYRPAASPTF  + HSNSH+KV
Sbjct  247   KCLHCATDKTPQWRTGPMGPKTLCNACGVRYKSGRLVPEYRPAASPTFVLTKHSNSHRKV  306

Query  1081  IEMRSK  1098
             +E+R +
Sbjct  307   MELRRQ  312



>emb|CBI36080.3| unnamed protein product [Vitis vinifera]
Length=283

 Score =   148 bits (373),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 101/278 (36%), Positives = 136/278 (49%), Gaps = 62/278 (22%)
 Frame = +1

Query  307   NDPLPDSEPLFSGS---HNNSAADLSAELSVPYEDIIQLEWLSTFVEDSFSGGGM----T  465
             N  L  +EP FSG     N + A  S EL VP +++ +LEWLS FVE+SFS   +     
Sbjct  26    NSSLSGNEPHFSGDVGCRNFTDAQFSGELCVPCDELAELEWLSNFVEESFSSEDLHKIQV  85

Query  466   LGKENTPVNV-EPPHNKFQTsspvsvlesssssssssscsGGKTTIPLSPSRCGVQRARS  642
             L     P++  E P  +FQ  +                    ++   L P      +ARS
Sbjct  86    LSGIKAPLHTTESPEPQFQPET-------------------ARSEPILQPPMNVPGKARS  126

Query  643   KRPRPATFNPRPAIQLISPTSSFTEAPQPFVAPAVSSESENFAESPMKKLTTRPEAPEQk  822
             KRPR    +    + ++SP +S             SSES+ F + P    + + E  +  
Sbjct  127   KRPRSVPCDWSTRLLVLSPATS-------------SSESDAFKKPPKTTSSKKKENSDSA  173

Query  823   kkkkikFTIPIAPVDTNQNQPPQAIRKCLHCEITKTPQWRAGPMGPKTLCNACGVRYKSG  1002
                                      RKCLHC   KTPQWR GPMGPKTLCNACGVR+KSG
Sbjct  174   GDG----------------------RKCLHCAAEKTPQWRTGPMGPKTLCNACGVRFKSG  211

Query  1003  RLFPEYRPAASPTFTPSLHSNSHKKVIEMRSKVGVENT  1116
             RL PEYRPA+SPTF  + HSNSH+KV+E+R +  ++ +
Sbjct  212   RLVPEYRPASSPTFVSAKHSNSHRKVLELRRQKDLQRS  249



>emb|CDP07101.1| unnamed protein product [Coffea canephora]
Length=316

 Score =   149 bits (375),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 69/95 (73%), Positives = 79/95 (83%), Gaps = 4/95 (4%)
 Frame = +1

Query  880   QPPQAIRKCLHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFTPSLH  1059
             Q P A +KC HCE+TKTPQWR GPMGPKTLCNACGVRY+SGRLFPEYRPAASPTF P+LH
Sbjct  211   QRPVAAKKCTHCEVTKTPQWREGPMGPKTLCNACGVRYRSGRLFPEYRPAASPTFIPTLH  270

Query  1060  SNSHKKVIEMRSKVGVENTAIT---EAPSTPQPAF  1155
             SNSH+KV+EMR K  V+ TAI+   +AP +P P F
Sbjct  271   SNSHRKVVEMRKK-AVQETAISSHDDAPMSPAPEF  304



>ref|XP_011014869.1| PREDICTED: GATA transcription factor 12-like [Populus euphratica]
Length=380

 Score =   150 bits (379),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 96/245 (39%), Positives = 133/245 (54%), Gaps = 29/245 (12%)
 Frame = +1

Query  370   LSAELSVPYEDIIQLEWLSTFVEDSFSGGGMTLGKENTPVNVEPPHNKFQTsspvsvles  549
             L +EL VPY+D+ +LEWLS FVE+SFS   +   +  + +   PP    ++    +  ++
Sbjct  116   LGSELCVPYDDLAELEWLSNFVEESFSSEDLQRLQLISGMKA-PPDESSKSRHFQTHGDT  174

Query  550   ssssssssscsGGKTTIPLSPSRCGVQRARSKRPRPATFNPRPAIQLISPTSSFTEAPQP  729
               +++   S          +P      +ARSKR R A  N    + ++SPT+S       
Sbjct  175   DDNNNGDVSNISNINNTTFNPETAVPAKARSKRSRAAPCNWASRLLVLSPTTS-------  227

Query  730   FVAPAVSSESENFAESPMKKLTTRPEAPEQkkkkkikFTIPIAPVDTNQNQPPQAI--RK  903
                   SS++E  A  P    T  P + ++        TI +      ++   +    RK
Sbjct  228   ------SSDTEIIA-GP----TPHPNSGKK--------TIKVEARQKKRDGGVEGCDGRK  268

Query  904   CLHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFTPSLHSNSHKKVI  1083
             CLHC   KTPQWR GPMGPKTLCNACGVRYKSGRL PEYRPAASPTF  + HSNSH+KV+
Sbjct  269   CLHCATDKTPQWRTGPMGPKTLCNACGVRYKSGRLVPEYRPAASPTFVLTKHSNSHRKVL  328

Query  1084  EMRSK  1098
             E+R +
Sbjct  329   ELRRQ  333



>ref|XP_010504307.1| PREDICTED: GATA transcription factor 8 [Camelina sativa]
 ref|XP_010504308.1| PREDICTED: GATA transcription factor 8 [Camelina sativa]
Length=326

 Score =   149 bits (375),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 67/92 (73%), Positives = 75/92 (82%), Gaps = 0/92 (0%)
 Frame = +1

Query  895   IRKCLHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFTPSLHSNSHK  1074
             +RKC+HCE+TKTPQWR GPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFTP+LHSNSHK
Sbjct  232   VRKCMHCEVTKTPQWRLGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFTPALHSNSHK  291

Query  1075  KVIEMRSKVGVENTAITEAPSTPQPAFNNPSV  1170
             KV EMRSK   + + ITE     +   NN  +
Sbjct  292   KVAEMRSKRCSDGSYITEENDLQELIPNNAYI  323


 Score = 72.8 bits (177),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 43/97 (44%), Positives = 67/97 (69%), Gaps = 6/97 (6%)
 Frame = +1

Query  169  MGSNFMDELDCGSFFDHIDDLIEFPPENECVGGVGSGEFKNFPSIW---NDPLP-DSEPL  336
            +G +F ++LDCG+FFD++DDL++FP  +  V G G G+  +FP+IW    D  P  S+PL
Sbjct  2    IGQSFPEDLDCGNFFDNMDDLMDFPGGDIDV-GFGIGDSDSFPTIWTSHQDTWPAASDPL  60

Query  337  FSGSHNNSAADLSAELSVPYEDIIQLEWLSTFVEDSF  447
            FS S+  + +D S EL VP+EDI++++   +FVE+S 
Sbjct  61   FS-SNTTTNSDSSPELYVPFEDIVKVDRPPSFVEESL  96



>ref|XP_010516023.1| PREDICTED: GATA transcription factor 8-like [Camelina sativa]
Length=324

 Score =   149 bits (375),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 67/92 (73%), Positives = 75/92 (82%), Gaps = 0/92 (0%)
 Frame = +1

Query  895   IRKCLHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFTPSLHSNSHK  1074
             +RKC+HCE+TKTPQWR GPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFTP+LHSNSHK
Sbjct  230   VRKCMHCEVTKTPQWRLGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFTPALHSNSHK  289

Query  1075  KVIEMRSKVGVENTAITEAPSTPQPAFNNPSV  1170
             KV EMRSK   + + ITE     +   NN  +
Sbjct  290   KVAEMRSKRCSDGSYITEENDLQELIPNNAYI  321


 Score = 68.2 bits (165),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 39/87 (45%), Positives = 61/87 (70%), Gaps = 6/87 (7%)
 Frame = +1

Query  169  MGSNFMDELDCGSFFDHIDDLIEFPPENECVGGVGSGEFKNFPSIW---NDPLP-DSEPL  336
            +G +F ++LDCG+FFD++DDL++FP  +  V G G G+  +FP+IW    D  P  S+PL
Sbjct  2    IGQSFPEDLDCGNFFDNMDDLMDFPGGDIDV-GFGIGDSDSFPTIWTSHQDTWPAASDPL  60

Query  337  FSGSHNNSAADLSAELSVPYEDIIQLE  417
            FS S+  + +D S EL VP+EDI++++
Sbjct  61   FS-SNTTTNSDSSPELYVPFEDIVKVD  86



>ref|XP_010427202.1| PREDICTED: GATA transcription factor 8-like isoform X2 [Camelina 
sativa]
Length=326

 Score =   149 bits (375),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 67/92 (73%), Positives = 75/92 (82%), Gaps = 0/92 (0%)
 Frame = +1

Query  895   IRKCLHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFTPSLHSNSHK  1074
             +RKC+HCE+TKTPQWR GPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFTP+LHSNSHK
Sbjct  232   VRKCMHCEVTKTPQWRLGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFTPALHSNSHK  291

Query  1075  KVIEMRSKVGVENTAITEAPSTPQPAFNNPSV  1170
             KV EMRSK   + + ITE     +   NN  +
Sbjct  292   KVAEMRSKRCSDGSYITEENDLQELIPNNAYI  323


 Score = 72.8 bits (177),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 43/97 (44%), Positives = 67/97 (69%), Gaps = 6/97 (6%)
 Frame = +1

Query  169  MGSNFMDELDCGSFFDHIDDLIEFPPENECVGGVGSGEFKNFPSIW---NDPLP-DSEPL  336
            +G +F ++LDCG+FFD++DDL++FP  +  V G G G+  +FP+IW    D  P  S+PL
Sbjct  2    IGQSFPEDLDCGNFFDNMDDLMDFPGGDIDV-GFGIGDSDSFPTIWTSHQDTWPAASDPL  60

Query  337  FSGSHNNSAADLSAELSVPYEDIIQLEWLSTFVEDSF  447
            FS S+  + +D S EL VP+EDI++++   +FVE+S 
Sbjct  61   FS-SNTTTNSDSSPELYVPFEDIVKVDRPPSFVEESL  96



>gb|KDP34159.1| hypothetical protein JCGZ_07730 [Jatropha curcas]
Length=371

 Score =   149 bits (377),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 111/317 (35%), Positives = 156/317 (49%), Gaps = 47/317 (15%)
 Frame = +1

Query  214   DH--IDDLIEFPPENECV--GGVG----------SGEFKNFPSIWNDPLPDSEPLFSG--  345
             DH  ++DL++F  E+  +  GGV           S       S  +      EP F+G  
Sbjct  35    DHFIVEDLLDFSNEDAVITDGGVAFDNVTGNSTDSSSVTVVDSCNSSSFSGCEPCFNGGD  94

Query  346   --SHNNSAADLSAELSVPYEDIIQLEWLSTFVEDSFSGGGMTLGKENTPVNVEPPHN---  510
               S N +    S++L VPY+D+ +LEWLS FVE+SFS   +   +  + +   P  +   
Sbjct  95    IGSRNLADVQFSSDLCVPYDDLAELEWLSNFVEESFSSEDLQKLQLISGIKARPDESSET  154

Query  511   -KFQTsspvsvlesssssssssscsGGKTTIPLSPSRCGVQRARSKRPRPATFNPRPAIQ  687
               FQ     +   ++++++   + +     I   P      +ARSKR R A  N    + 
Sbjct  155   RNFQPDCNGNDNTNNNNNNDVVAINNNNNPI-FHPEMSVPAKARSKRSRAAPCNWASRLL  213

Query  688   LISPTSSFTEAPQPFVAPAVSSESENFAESPMKKLTTRPEAPEQkkkkkikFTIPIAPVD  867
             ++SPT++  E P+  V P     S         K T +   P++                
Sbjct  214   VLSPTTTSPE-PEIIVGPTTQHPSSG-------KKTIKGTGPKR----------------  249

Query  868   TNQNQPPQAIRKCLHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFT  1047
              +        RKCLHC   KTPQWR GPMGPKTLCNACGVRYKSGRL PEYRPAASPTF 
Sbjct  250   RDGGDGNGDGRKCLHCATDKTPQWRTGPMGPKTLCNACGVRYKSGRLVPEYRPAASPTFV  309

Query  1048  PSLHSNSHKKVIEMRSK  1098
              + HSNSH+KV+E+R +
Sbjct  310   LTKHSNSHRKVLELRRQ  326



>ref|XP_010427201.1| PREDICTED: GATA transcription factor 8-like isoform X1 [Camelina 
sativa]
Length=326

 Score =   148 bits (374),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 67/92 (73%), Positives = 75/92 (82%), Gaps = 0/92 (0%)
 Frame = +1

Query  895   IRKCLHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFTPSLHSNSHK  1074
             +RKC+HCE+TKTPQWR GPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFTP+LHSNSHK
Sbjct  232   VRKCMHCEVTKTPQWRLGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFTPALHSNSHK  291

Query  1075  KVIEMRSKVGVENTAITEAPSTPQPAFNNPSV  1170
             KV EMRSK   + + ITE     +   NN  +
Sbjct  292   KVAEMRSKRCSDGSYITEENDLQELIPNNAYI  323


 Score = 73.9 bits (180),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 42/97 (43%), Positives = 66/97 (68%), Gaps = 6/97 (6%)
 Frame = +1

Query  169  MGSNFMDELDCGSFFDHIDDLIEFPPENECVGGVGSGEFKNFPSIWNDPLPD----SEPL  336
            +G +F ++LDCG+FFD++DDL++FP  +  V G G G+  +FP+IW  P       S+PL
Sbjct  2    IGQSFPEDLDCGNFFDNMDDLMDFPGGDIDV-GFGIGDSDSFPTIWTSPQDTWPAASDPL  60

Query  337  FSGSHNNSAADLSAELSVPYEDIIQLEWLSTFVEDSF  447
            FS S+  + +D S EL VP+EDI++++   +FVE+S 
Sbjct  61   FS-SNTTTNSDSSPELYVPFEDIVKVDRPPSFVEESL  96



>ref|XP_008807395.1| PREDICTED: GATA transcription factor 8 [Phoenix dactylifera]
 ref|XP_008807403.1| PREDICTED: GATA transcription factor 8 [Phoenix dactylifera]
Length=407

 Score =   150 bits (379),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 91/156 (58%), Positives = 106/156 (68%), Gaps = 14/156 (9%)
 Frame = +1

Query  631   RARSKRPRPATFNPRPAIQL--ISPTSSFTEAPQPFVAPAVSSESENFAESPMKKLTTRP  804
             RARSKRPRPATF+ RP + +  + P S    AP P V  + +S+SE+F ES         
Sbjct  231   RARSKRPRPATFSSRPHVTVPFLPPLSDNIPAPTP-VDSSSNSKSESFGES---------  280

Query  805   EAPEQkkkkkikFTIPIAPVDTNQNQPPQAIRKCLHCEITKTPQWRAGPMGPKTLCNACG  984
               P     K+ K     A      ++ P  +RKC+HCEI KTPQWRAGPMGPKTLCNACG
Sbjct  281   -NPGPDTMKQKKKKKCSAGTAAGGDEAPP-VRKCMHCEIQKTPQWRAGPMGPKTLCNACG  338

Query  985   VRYKSGRLFPEYRPAASPTFTPSLHSNSHKKVIEMR  1092
             VRYKSGRLFPEYRPAASPTF PSLHSNSH+KV+EMR
Sbjct  339   VRYKSGRLFPEYRPAASPTFVPSLHSNSHRKVVEMR  374



>gb|KHG08445.1| GATA transcription factor 11 -like protein [Gossypium arboreum]
Length=390

 Score =   149 bits (377),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 85/158 (54%), Positives = 104/158 (66%), Gaps = 15/158 (9%)
 Frame = +1

Query  625   VQRARSKRPRPATFNPRPAIQLISPTSSFTEAPQPFVAPAVSSESENFAESPMKKLTTRP  804
             V+R RSKR R +TFN +  +  IS T S            V SESE  +ES +    T  
Sbjct  224   VKRDRSKRRRASTFNLQFTLPFISSTGS---------TSLVGSESE--SESHL----TEK  268

Query  805   EAPEQkkkkkikFTIPIAPVDTNQNQPPQAIRKCLHCEITKTPQWRAGPMGPKTLCNACG  984
              A +++KKK + +    +  D + ++    +RKC HCE+TKTPQWR GP GPKTLCNACG
Sbjct  269   SAKKRQKKKNLTWLSGSSENDRSSSEEAAVVRKCTHCEVTKTPQWREGPKGPKTLCNACG  328

Query  985   VRYKSGRLFPEYRPAASPTFTPSLHSNSHKKVIEMRSK  1098
             VRY+SGRLFPEYRPAASPTF  SLHSNSHKKVIEMR +
Sbjct  329   VRYRSGRLFPEYRPAASPTFVASLHSNSHKKVIEMRKQ  366



>ref|XP_010555821.1| PREDICTED: GATA transcription factor 8 [Tarenaya hassleriana]
Length=331

 Score =   148 bits (373),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 64/70 (91%), Positives = 68/70 (97%), Gaps = 0/70 (0%)
 Frame = +1

Query  889   QAIRKCLHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFTPSLHSNS  1068
             Q +RKC+HCE+TKTPQWR GPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFTP+LHSNS
Sbjct  226   QPVRKCMHCEVTKTPQWRLGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFTPALHSNS  285

Query  1069  HKKVIEMRSK  1098
             HKKVIEMRSK
Sbjct  286   HKKVIEMRSK  295



>ref|XP_008804627.1| PREDICTED: GATA transcription factor 9-like [Phoenix dactylifera]
Length=363

 Score =   149 bits (375),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 94/245 (38%), Positives = 129/245 (53%), Gaps = 29/245 (12%)
 Frame = +1

Query  364   ADLSAELSVPYEDIIQLEWLSTFVEDSFSGGGMTLGKENTPVNVEPPHNKFQTsspvsvl  543
             A LS +L  PYE+I +LEWLS FVE+SFS   +   +  + +    P ++       +  
Sbjct  102   ARLSGDLYEPYEEIAELEWLSNFVEESFSSEDLQKLQLISGIKSSSPASENAAEVSATAG  161

Query  544   esssssssssscsGGKTTIPLSPSRCGVQRARSKRPRPATFNPRPAIQLISPTSSFTEAP  723
             + ++  ++  +    +  +P         +ARSKR R A  +    +  +SPT++ + A 
Sbjct  162   DGAAGCAAQPALVRAEAPVP--------GKARSKRSRAAPSSWSSRLPELSPTTTASSAE  213

Query  724   QPFVAPAVSSESENFAESPMKKLTTRPEAPEQkkkkkikFTIPIAPVDTNQNQPPQAIRK  903
                + PA      NF+E        + + P             +AP            RK
Sbjct  214   SGLIVPA-----GNFSEKKAAAKPAKKKDPSAGPA--------VAPAPDG--------RK  252

Query  904   CLHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFTPSLHSNSHKKVI  1083
             CLHC   KTPQWR GPMGPKTLCNACGVRYKSGRL PEYRPAASPTF  S HSNSH+KV+
Sbjct  253   CLHCATEKTPQWRTGPMGPKTLCNACGVRYKSGRLVPEYRPAASPTFVLSKHSNSHRKVL  312

Query  1084  EMRSK  1098
             E+R +
Sbjct  313   ELRRQ  317



>ref|XP_008393856.1| PREDICTED: GATA transcription factor 12-like [Malus domestica]
Length=374

 Score =   149 bits (375),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 117/329 (36%), Positives = 159/329 (48%), Gaps = 65/329 (20%)
 Frame = +1

Query  202   GSFFDH--IDDLIEFPPENECV----GGVGSGEFKNFPSIWNDP-------------LPD  324
             G   DH  ++DL++F  +++ V    G   +  F+N      D              L  
Sbjct  32    GGGGDHFKVEDLLDFSNDDDDVITDGGCSAAAAFENVAGNSTDSSTLTVMDSCNSSSLSG  91

Query  325   SEPLFSGSHNNSAADLSAELSVPYEDIIQLEWLSTFVEDSFSGGGMTLGKENTPVNVEPP  504
             SEP+F GS N +   LS+EL VPY+D+ +LEWLS FVE+SFS   +   +  + +   P 
Sbjct  92    SEPIF-GSRNLADGPLSSELCVPYDDLAELEWLSNFVEESFSSEDLQKLQLISGMKARPD  150

Query  505   HNKFQTsspvsvlesssssssssscsGGKTTIPLSPSRCGVQRARSKRPR--PATFNPRP  678
                 +T         ++++  S       +    +P      +ARSKR R  P  +  R 
Sbjct  151   EAASETGQLQPDPTRTNNNPYS------NSNPIFNPEVSVPAKARSKRSRASPCNWTSRI  204

Query  679   AIQ---------LISPTSSFTEAPQPFVAPAVSSESENFAESPMKKLTTRPEAPEQkkkk  831
              +          L+S   + T  PQP      S+  ++   +P KK     E+ E     
Sbjct  205   LVLSSTKEQSDVLVSAEEAATLLPQP-----SSTGKKSVKSAPKKK-----ESQEGSGG-  253

Query  832   kikFTIPIAPVDTNQNQPPQAIRKCLHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLF  1011
                      P D          RKCLHC   KTPQWR GPMGPKTLCNACGVRYKSGRL 
Sbjct  254   --------GPCDG---------RKCLHCATDKTPQWRTGPMGPKTLCNACGVRYKSGRLV  296

Query  1012  PEYRPAASPTFTPSLHSNSHKKVIEMRSK  1098
             PEYRPAASPTF  + HSNSH+KV+E+R +
Sbjct  297   PEYRPAASPTFVLTKHSNSHRKVLELRRQ  325



>ref|XP_002876270.1| BME3/BME3-ZF [Arabidopsis lyrata subsp. lyrata]
 gb|EFH52529.1| BME3/BME3-ZF [Arabidopsis lyrata subsp. lyrata]
Length=319

 Score =   147 bits (370),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 65/77 (84%), Positives = 70/77 (91%), Gaps = 0/77 (0%)
 Frame = +1

Query  898   RKCLHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFTPSLHSNSHKK  1077
             RKC+HCE+TKTPQWR GPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFTP+LHSNSHKK
Sbjct  226   RKCMHCEVTKTPQWRLGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFTPALHSNSHKK  285

Query  1078  VIEMRSKVGVENTAITE  1128
             V EMRSK   + + ITE
Sbjct  286   VAEMRSKRCSDGSYITE  302


 Score = 76.6 bits (187),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 45/97 (46%), Positives = 68/97 (70%), Gaps = 8/97 (8%)
 Frame = +1

Query  169  MGSNFMDELDCGSFFDHIDDLIEFPPENECVGGVGSGEFKNFPSIW---NDPLP-DSEPL  336
            +G +F ++LDCG+FFD++DDL++FP  +  V G G G+  +FP+IW   +D  P  S+PL
Sbjct  2    IGQSFPEDLDCGNFFDNMDDLMDFPGGDIDV-GFGIGDSDSFPTIWTTHHDTWPAASDPL  60

Query  337  FSGSHNNSAADLSAELSVPYEDIIQLEWLSTFVEDSF  447
            FS   +N+ +D S EL VP+EDI+++E   TFVE+S 
Sbjct  61   FS---SNTNSDSSPELYVPFEDIVKVERPPTFVEESL  94



>emb|CDP08170.1| unnamed protein product [Coffea canephora]
Length=360

 Score =   147 bits (372),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 116/322 (36%), Positives = 153/322 (48%), Gaps = 60/322 (19%)
 Frame = +1

Query  214   DH--IDDLIEFPPENECVGGVGSGEFKNFPSIWNDPLPDSEPL--------FSGS-----  348
             DH  IDDL+++P ++   G V  G F    +I      DS  +        FSGS     
Sbjct  29    DHFIIDDLLDYPNDD---GMVADGTFDT--TITAGTSTDSSTVVDTSCNSSFSGSTEPHL  83

Query  349   -------HNNSAADLSAELSVPYEDIIQLEWLSTFVEDSFSGGGMTLGKENTPVNVEPPH  507
                     N +    S+EL VPY+D+ +LEWLS FVE+SFS   +               
Sbjct  84    PGGDMGCRNFTDGQFSSELCVPYDDLAELEWLSNFVEESFSSEDL---------------  128

Query  508   NKFQTsspvsvlesssssssssscsGGKTTIP--LSPSRCGVQRARSKRPRPATFNPRPA  681
              K Q  S +    +  S +        + T    L P      +ARSKR R A  N    
Sbjct  129   QKLQIISGMKARTNEVSETHDDQPEPNRETATPMLRPEMSVPAKARSKRSRAAPCNWTSR  188

Query  682   IQLISPTSSFTEAPQPFVAPAVSSESENFAE---SPMKKLTTRPEAPEQkkkkkikFTIP  852
             + +++P+++   A       A +  S + +E   S  KK    P   ++           
Sbjct  189   LLMVTPSTTTLTAATTTTIMAAAMSSSSDSEITPSTGKKAVKAPSKKKEV----------  238

Query  853   IAPVDTNQNQPPQAIRKCLHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAA  1032
                 D N +      RKCLHC   KTPQWR GPMGPKTLCNACGVRYKSGRL PEYRPAA
Sbjct  239   ---YDQNASMANGEGRKCLHCATDKTPQWRTGPMGPKTLCNACGVRYKSGRLVPEYRPAA  295

Query  1033  SPTFTPSLHSNSHKKVIEMRSK  1098
             SPTF  + HSNSH+KV+E+R +
Sbjct  296   SPTFVLTKHSNSHRKVLELRRQ  317



>ref|XP_010906504.1| PREDICTED: GATA transcription factor 8 [Elaeis guineensis]
 ref|XP_010906505.1| PREDICTED: GATA transcription factor 8 [Elaeis guineensis]
Length=381

 Score =   148 bits (373),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 86/157 (55%), Positives = 99/157 (63%), Gaps = 14/157 (9%)
 Frame = +1

Query  631   RARSKRPRPATFNPRPAIQLISPTSSFTEAPQPFVAPAVSSESENFAESPMKKLTTRPEA  810
             RARSKRPRPATF+ RP + +            PF+ P+  S     + S  +        
Sbjct  221   RARSKRPRPATFS-RPHVTI------------PFLPPSSDSIPVASSSSQSESFGESNPG  267

Query  811   PEQkkkkkikFTIPIAPVDTNQNQPPQAIRKCLHCEITKTPQWRAGPMGPKTLCNACGVR  990
             P    +KK K     A      ++ P  +RKC+HCEI KTPQWRAGPMGPKTLCNACGVR
Sbjct  268   PATMTQKKNKTKKSSAGTAAGGDEAP-PVRKCMHCEIQKTPQWRAGPMGPKTLCNACGVR  326

Query  991   YKSGRLFPEYRPAASPTFTPSLHSNSHKKVIEMRSKV  1101
             YKSGRLFPEYRPAASPTF P LHSNSHKKV+EMR K 
Sbjct  327   YKSGRLFPEYRPAASPTFVPDLHSNSHKKVVEMRIKA  363



>gb|EMT09679.1| GATA transcription factor 11 [Aegilops tauschii]
Length=307

 Score =   146 bits (368),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 113/316 (36%), Positives = 145/316 (46%), Gaps = 55/316 (17%)
 Frame = +1

Query  190   ELDCGSFFDHIDDLIEFPPENECVGGVGSGEFKNFPSIWNDPLPDSEPLFSGSHNNSAAD  369
             E  CG  FDHI+DL++FP E+     +          + + P+PDS PL +         
Sbjct  20    EATCGGLFDHIEDLLDFPKEDSAEDVL----------LLDAPVPDS-PLAARVLGGG---  65

Query  370   LSAELSVPYEDIIQLEWLSTFVEDSFSGGGMTLGKENTPVNVEPPHNKFQTsspvsvles  549
                   VP      LE                 G++   + V PP      S+       
Sbjct  66    ------VPPPAPASLE-----------------GQQQASLMVPPPPPAGDHSAAFLGALG  102

Query  550   ssssssssscsGGKTTIPLSPS-----RCGVQRARSKRPRPATF-------NPRPAIQLI  693
              +   +S S SG   ++PLSP           RARSKR R + F        P P   ++
Sbjct  103   DTHIGTSFSGSGRPWSVPLSPRPEPPVLVIPARARSKRSRASAFPAAIRAAVPAPEATIL  162

Query  694   SPTSSFTEAPQPFVAPAVSSESENFAESPMKKLTTRPEAPEQkkkkkikFTIPIAPVDTN  873
              PT  F+         + S E E  AES  +    +                      + 
Sbjct  163   VPTPMFSSTS------SYSEEPECIAESNSQPKKKKKAKRPTPPVTSDAEGDADYEEGSG  216

Query  874   QNQPPQAIRKCLHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFTPS  1053
                 P  +R+C HC+I KTPQWRAGP+GPKTLCNACGVRYKSGRLFPEYRPAASPTF P+
Sbjct  217   TALAPGEVRRCTHCQIDKTPQWRAGPLGPKTLCNACGVRYKSGRLFPEYRPAASPTFVPA  276

Query  1054  LHSNSHKKVIEMRSKV  1101
             +HSNSHKKV+EMR KV
Sbjct  277   IHSNSHKKVVEMRQKV  292



>dbj|BAH20385.1| AT3G54810 [Arabidopsis thaliana]
Length=322

 Score =   146 bits (368),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 64/78 (82%), Positives = 71/78 (91%), Gaps = 0/78 (0%)
 Frame = +1

Query  895   IRKCLHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFTPSLHSNSHK  1074
             +RKC+HCE+TKTPQWR GPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFTP+LHSNSHK
Sbjct  228   LRKCMHCEVTKTPQWRLGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFTPALHSNSHK  287

Query  1075  KVIEMRSKVGVENTAITE  1128
             KV EMR+K   + + ITE
Sbjct  288   KVAEMRNKRCSDGSYITE  305


 Score = 76.3 bits (186),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 44/97 (45%), Positives = 70/97 (72%), Gaps = 8/97 (8%)
 Frame = +1

Query  169  MGSNFMDELDCGSFFDHIDDLIEFPPENECVGGVGSGEFKNFPSIW---NDPLP-DSEPL  336
            +G++F ++LDCG+FFD++DDL++FP  +  V G G G+  +FP+IW   +D  P  S+PL
Sbjct  2    IGTSFPEDLDCGNFFDNMDDLMDFPGGDIDV-GFGIGDSDSFPTIWTTHHDTWPAASDPL  60

Query  337  FSGSHNNSAADLSAELSVPYEDIIQLEWLSTFVEDSF  447
            FS   +N+ +D S EL VP+EDI+++E   +FVE++F
Sbjct  61   FS---SNTNSDSSPELYVPFEDIVKVERPPSFVEETF  94



>ref|NP_191041.1| GATA transcription factor 8 [Arabidopsis thaliana]
 ref|NP_850704.1| GATA transcription factor 8 [Arabidopsis thaliana]
 sp|Q9SV30.1|GATA8_ARATH RecName: Full=GATA transcription factor 8 [Arabidopsis thaliana]
 gb|AAL06560.1|AF412107_1 AT3g54810/F28P10_210 [Arabidopsis thaliana]
 emb|CAB41103.1| putative protein [Arabidopsis thaliana]
 gb|AAL77730.1| AT3g54810/F28P10_210 [Arabidopsis thaliana]
 dbj|BAH20168.1| AT3G54810 [Arabidopsis thaliana]
 gb|AEE79293.1| GATA transcription factor 8 [Arabidopsis thaliana]
 gb|AEE79294.1| GATA transcription factor 8 [Arabidopsis thaliana]
Length=322

 Score =   146 bits (368),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 64/78 (82%), Positives = 71/78 (91%), Gaps = 0/78 (0%)
 Frame = +1

Query  895   IRKCLHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFTPSLHSNSHK  1074
             +RKC+HCE+TKTPQWR GPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFTP+LHSNSHK
Sbjct  228   LRKCMHCEVTKTPQWRLGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFTPALHSNSHK  287

Query  1075  KVIEMRSKVGVENTAITE  1128
             KV EMR+K   + + ITE
Sbjct  288   KVAEMRNKRCSDGSYITE  305


 Score = 74.3 bits (181),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 43/97 (44%), Positives = 69/97 (71%), Gaps = 8/97 (8%)
 Frame = +1

Query  169  MGSNFMDELDCGSFFDHIDDLIEFPPENECVGGVGSGEFKNFPSIW---NDPLP-DSEPL  336
            +G++F ++LDCG+FFD++DDL++FP  +  V G G G+  +FP+IW   +D  P  S+PL
Sbjct  2    IGTSFPEDLDCGNFFDNMDDLMDFPGGDIDV-GFGIGDSDSFPTIWTTHHDTWPAASDPL  60

Query  337  FSGSHNNSAADLSAELSVPYEDIIQLEWLSTFVEDSF  447
            FS   +N+ +D S EL VP+EDI+++E   +FVE++ 
Sbjct  61   FS---SNTNSDSSPELYVPFEDIVKVERPPSFVEETL  94



>ref|XP_006340186.1| PREDICTED: GATA transcription factor 11-like [Solanum tuberosum]
Length=337

 Score =   146 bits (369),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 119/335 (36%), Positives = 158/335 (47%), Gaps = 53/335 (16%)
 Frame = +1

Query  172   GSNFMDELDCGSF----FDHIDDLIEFPPENECVGGVGSGEF-----KNFPSIWNDPLPD  324
             G  +MD +  G      FD I + ++ P E+    G+G  E+     K F  I  D L D
Sbjct  7     GGGYMDGVPTGPIVDDDFDDILNFLDMPMESLEEDGLGGVEWDVSESKGFGPIPTDALMD  66

Query  325   SEPLFSGSHNNSAADLSAELSVPYEDIIQLEWLSTFVEDSFSGGGMTLGKENTPVNVEPP  504
               P+  G+  N   +  A+ S P+  I        F E   +G   T     +PV+V   
Sbjct  67    FPPMPQGNIGNRRVNAVAK-SHPHPPI-------KFTEVQGTGTFQT----QSPVSVLEG  114

Query  505   HNKFQTsspvsvlesssssssssscsGGKTTIPLSPSRCGVQRARSKRPRPATFNPRPAI  684
              N                     SCSGGK+ IP+        R RSKR RP+  NP    
Sbjct  115   SN---------------------SCSGGKS-IPIKHDIVIPVRPRSKRARPSAVNP---W  149

Query  685   QLISPTSSFTEAPQPFVAPAVSSESENFAESPMKKLTTRPEAPEQkkkkkikFTIPIAPV  864
              L++P SS   A +       + E        +  L+   E  +   ++     +P++ V
Sbjct  150   VLMAPISSTRVASKKISDARKTKEKRRR----LSLLSGAKEPMKNYVQQINDAALPLSDV  205

Query  865   ---DTNQNQPPQAIRKCLHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAAS  1035
                     Q     +KC HCE+TKTPQWR GP+GPKTLCNACGVRY+SGRLFPEYRPAAS
Sbjct  206   YKKKITSTQQSSFFKKCTHCEVTKTPQWREGPLGPKTLCNACGVRYRSGRLFPEYRPAAS  265

Query  1036  PTFTPSLHSNSHKKVIEMRSKVGVENTAITEAPST  1140
             PTF PS+HSNSH+KV+EMR K       + E P  
Sbjct  266   PTFVPSVHSNSHRKVVEMRKKTLYGTGEVEEPPKV  300



>ref|XP_007226931.1| hypothetical protein PRUPE_ppa015753mg [Prunus persica]
 gb|EMJ28130.1| hypothetical protein PRUPE_ppa015753mg [Prunus persica]
Length=384

 Score =   147 bits (370),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 100/260 (38%), Positives = 136/260 (52%), Gaps = 37/260 (14%)
 Frame = +1

Query  343   GSHNNSAADLSAELSVPYEDIIQLEWLSTFVEDSFSGGGMTLGKENTPVNVEPPHNKFQT  522
             GS N +    S++L VPY+D+ +LEWLS FVE+SFS   M   +  + +   P     +T
Sbjct  99    GSRNITEGPFSSDLCVPYDDLAELEWLSNFVEESFSSEDMQKLQLISGMKARPDEAASET  158

Query  523   sspvsvlesssssssssscsGGKTTIPL-SPSRCGVQRARSKRPRPATFNPRPAIQLIS-  696
                      + ++ +++      T  P+ +P      +ARSKR R A  N    + L+S 
Sbjct  159   RQFQPEPNRNDNAHNTT------TNNPIFNPDVSVPAKARSKRSRGAPCNWTSRLLLLSQ  212

Query  697   PTSS------FTEAPQPFVAPAVSSESENFAESPMKKLTTRPEAPEQkkkkkikFTIPIA  858
             PTSS       + AP+  + P  ++  +     P KK     E+PE              
Sbjct  213   PTSSSEQSDVVSGAPESPLPPPSTTGKKTVKSVPKKK-----ESPEGLGGGP--------  259

Query  859   PVDTNQNQPPQAIRKCLHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASP  1038
                          RKCLHC   KTPQWR GP+GPKTLCNACGVRYKSGRL PEYRPA+SP
Sbjct  260   ----------GDGRKCLHCATDKTPQWRTGPLGPKTLCNACGVRYKSGRLVPEYRPASSP  309

Query  1039  TFTPSLHSNSHKKVIEMRSK  1098
             TF  + HSNSH+KV+E+R +
Sbjct  310   TFVLTKHSNSHRKVLELRRQ  329



>ref|XP_007150193.1| hypothetical protein PHAVU_005G134400g [Phaseolus vulgaris]
 gb|AGV54633.1| GATA transcription factor [Phaseolus vulgaris]
 gb|ESW22187.1| hypothetical protein PHAVU_005G134400g [Phaseolus vulgaris]
Length=323

 Score =   145 bits (367),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 75/159 (47%), Positives = 100/159 (63%), Gaps = 9/159 (6%)
 Frame = +1

Query  625   VQRARSKRPRPATFNPRPAIQLISPTSSFTEAPQPFVAPAVSSESENFAESPMKKLTTRP  804
             V+RARSKR R ++ +P  +I  I    +     +       S+   +F  +    ++ + 
Sbjct  154   VKRARSKRQRRSSLSPLFSIPYILNAQALQNQQR------TSASESDFETNVAGNMSNKV  207

Query  805   EAPEQkkkkkikFTIPIAPVDTNQNQPPQAIRKCLHCEITKTPQWRAGPMGPKTLCNACG  984
             ++  +K    +   + +       + PP   RKC+HCE+TKTPQWR GPMGPKTLCNACG
Sbjct  208   KSHRKKDLSLLSEDVEMMRSSHLVSDPP---RKCMHCEVTKTPQWREGPMGPKTLCNACG  264

Query  985   VRYKSGRLFPEYRPAASPTFTPSLHSNSHKKVIEMRSKV  1101
             VRY+SGRLFPEYRPAASPTF  SLHSN HKKV+EMRS+V
Sbjct  265   VRYRSGRLFPEYRPAASPTFVSSLHSNCHKKVVEMRSRV  303



>ref|XP_004162986.1| PREDICTED: GATA transcription factor 12-like [Cucumis sativus]
Length=338

 Score =   145 bits (367),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 107/266 (40%), Positives = 131/266 (49%), Gaps = 61/266 (23%)
 Frame = +1

Query  337   FSGSHNNSAADLSAELSVPYEDIIQLEWLSTFVEDSFSGGGMTLGKENTPVNV---EPPH  507
              SGS N   A  S+EL VPY+D+ +LEWLS FVE+SFS   M   +  + V V   EPP 
Sbjct  76    ISGS-NLGDAHFSSELCVPYDDLAELEWLSNFVEESFSSEDMQKLELISGVKVKSDEPPT  134

Query  508   NKFQTsspvsvlesssssssssscsGGKTTIPLSPSRCGV-QRARSKRPR--PATFNPRP  678
                Q ++  S                        P    V  +ARSKR R  P+ +N   
Sbjct  135   QSPQPTATRSAAAI------------------FKPEIVSVPAKARSKRSRALPSNWNNSA  176

Query  679   AIQLISPTSSFTEAPQPFVAPAVSSESENFAESPMKKLTTRPEAPEQkkkkkikFTIPIA  858
              + L SPT+  +E   P   P            P+KK                  T+P A
Sbjct  177   LLPLSSPTAE-SETTPPIEQP-----------HPIKK------------------TLPKA  206

Query  859   PVDTNQNQPPQA------IRKCLHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEY  1020
                  +   P         RKC+HC   KTPQWR GPMGPKTLCNACGVRYKSGRL PEY
Sbjct  207   AATAKKKDSPDLGFSSGEGRKCMHCATDKTPQWRTGPMGPKTLCNACGVRYKSGRLVPEY  266

Query  1021  RPAASPTFTPSLHSNSHKKVIEMRSK  1098
             RPAASPTF  + HSNSH+KV+E+R +
Sbjct  267   RPAASPTFVLTKHSNSHRKVLELRRQ  292



>gb|EMS65328.1| GATA transcription factor 11 [Triticum urartu]
Length=183

 Score =   141 bits (355),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 59/72 (82%), Positives = 66/72 (92%), Gaps = 0/72 (0%)
 Frame = +1

Query  886   PQAIRKCLHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFTPSLHSN  1065
             P  +R+C HC+I KTPQWRAGP+GPKTLCNACGVRYKSGRLFPEYRPAASPTF P++HSN
Sbjct  97    PGEVRRCTHCQIDKTPQWRAGPLGPKTLCNACGVRYKSGRLFPEYRPAASPTFVPAIHSN  156

Query  1066  SHKKVIEMRSKV  1101
             SHKKV+EMR KV
Sbjct  157   SHKKVVEMRQKV  168



>ref|XP_004148425.1| PREDICTED: GATA transcription factor 12-like [Cucumis sativus]
Length=336

 Score =   145 bits (366),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 107/266 (40%), Positives = 131/266 (49%), Gaps = 61/266 (23%)
 Frame = +1

Query  337   FSGSHNNSAADLSAELSVPYEDIIQLEWLSTFVEDSFSGGGMTLGKENTPVNV---EPPH  507
              SGS N   A  S+EL VPY+D+ +LEWLS FVE+SFS   M   +  + V V   EPP 
Sbjct  74    ISGS-NLGDAHFSSELCVPYDDLAELEWLSNFVEESFSSEDMQKLELISGVKVKSDEPPT  132

Query  508   NKFQTsspvsvlesssssssssscsGGKTTIPLSPSRCGV-QRARSKRPR--PATFNPRP  678
                Q ++  S                        P    V  +ARSKR R  P+ +N   
Sbjct  133   QSPQPTATRSAAAI------------------FKPEIVSVPAKARSKRSRALPSNWNNSA  174

Query  679   AIQLISPTSSFTEAPQPFVAPAVSSESENFAESPMKKLTTRPEAPEQkkkkkikFTIPIA  858
              + L SPT+  +E   P   P            P+KK                  T+P A
Sbjct  175   LLPLSSPTAE-SETTPPIEQP-----------HPIKK------------------TLPKA  204

Query  859   PVDTNQNQPPQA------IRKCLHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEY  1020
                  +   P         RKC+HC   KTPQWR GPMGPKTLCNACGVRYKSGRL PEY
Sbjct  205   AATAKKKDSPDLGFSSGEGRKCMHCATDKTPQWRTGPMGPKTLCNACGVRYKSGRLVPEY  264

Query  1021  RPAASPTFTPSLHSNSHKKVIEMRSK  1098
             RPAASPTF  + HSNSH+KV+E+R +
Sbjct  265   RPAASPTFVLTKHSNSHRKVLELRRQ  290



>ref|XP_008220089.1| PREDICTED: GATA transcription factor 12 [Prunus mume]
Length=385

 Score =   146 bits (369),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 100/258 (39%), Positives = 136/258 (53%), Gaps = 31/258 (12%)
 Frame = +1

Query  343   GSHNNSAADLSAELSVPYEDIIQLEWLSTFVEDSFSGGGMTL-----GKENTPVNVEPPH  507
             GS N +    S++L VPY+D+ +LEWLS FVE+SFS   +       G +  P       
Sbjct  99    GSRNIAEGPFSSDLCVPYDDLAELEWLSNFVEESFSSEDLQKLQLISGMKARPDEAASET  158

Query  508   NKFQTsspvsvlesssssssssscsGGKTTIPLSPSRCGVQRARSKRPRPATFNPRPAIQ  687
              +FQ     +    ++++++++       ++P         +ARSKR R A  N    + 
Sbjct  159   RQFQPERNRNDNAQNTTTTNNNPIFNPDVSVP--------AKARSKRSRAAPCNWTSRLL  210

Query  688   LIS-PTSSFTEAPQPFVAPAVSSESENFAESPMKKLTTRPEAPEQkkkkkikFTIPIAPV  864
             L+S PTSS   + Q  V  +          +  KK  T   AP++K+             
Sbjct  211   LLSQPTSS---SEQSDVVSSGPGSPLPPPSTTGKK--TVKSAPKKKESP-----------  254

Query  865   DTNQNQPPQAIRKCLHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTF  1044
                    P   RKCLHC   KTPQWR GPMGPKTLCNACGVRYKSGRL PEYRPA+SPTF
Sbjct  255   -EGPGGGPGEGRKCLHCATDKTPQWRTGPMGPKTLCNACGVRYKSGRLVPEYRPASSPTF  313

Query  1045  TPSLHSNSHKKVIEMRSK  1098
               + HSNSH+KV+E+R +
Sbjct  314   VLTKHSNSHRKVLELRRQ  331



>ref|XP_002283745.1| PREDICTED: GATA transcription factor 9 [Vitis vinifera]
 emb|CAN61228.1| hypothetical protein VITISV_004677 [Vitis vinifera]
Length=342

 Score =   145 bits (366),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 106/258 (41%), Positives = 131/258 (51%), Gaps = 47/258 (18%)
 Frame = +1

Query  328   EPLFSG---SHNNSAADLSAELSVPYEDIIQLEWLSTFVEDSFSGGGMTLGKENTPVNVE  498
             EP F+G   S N + A  S++L VPY+D+ +LEWLS  VE+SFS   +            
Sbjct  82    EPQFAGDIGSRNYTDAHFSSDLCVPYDDLAELEWLSNIVEESFSSEDL------------  129

Query  499   PPHNKFQTsspvsvlesssssssssscsGGKTTIPLSPSRCGVQRARSKRPRPATFNPRP  678
                 K Q  S +      +S +        +   PLS  R    +ARSKR R        
Sbjct  130   ---EKLQLISGMKANTEEASETRDFQPENNQNP-PLSL-RDFPAKARSKRARAMPCKWTS  184

Query  679   AIQLISPTSSFTEAPQPFVAPAVSSESENFAESPMKKLTTRPEAPEQkkkkkikFTIPIA  858
              +  +SPTSS +E     + P    +S   A  P KK     E+PE          +   
Sbjct  185   RLLALSPTSSLSETD--IIPPNSGKKSTKSA--PKKK-----ESPE---------VVAGG  226

Query  859   PVDTNQNQPPQAIRKCLHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASP  1038
               D          RKCLHC   KTPQWR GPMGPKTLCNACGVRYKSGRL PEYRPAASP
Sbjct  227   CSDG---------RKCLHCATDKTPQWRTGPMGPKTLCNACGVRYKSGRLVPEYRPAASP  277

Query  1039  TFTPSLHSNSHKKVIEMR  1092
             TF  + HSNSH+KV+E+R
Sbjct  278   TFVLTKHSNSHRKVLELR  295



>emb|CDX67609.1| BnaA07g16490D [Brassica napus]
Length=315

 Score =   144 bits (364),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 64/78 (82%), Positives = 70/78 (90%), Gaps = 0/78 (0%)
 Frame = +1

Query  895   IRKCLHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFTPSLHSNSHK  1074
             +RKC+HCEITKTPQWR GPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFTP+LHSNSHK
Sbjct  225   VRKCMHCEITKTPQWRLGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFTPALHSNSHK  284

Query  1075  KVIEMRSKVGVENTAITE  1128
             KV EMRSK   + +  T+
Sbjct  285   KVAEMRSKRCKDGSYTTQ  302



>ref|XP_009103933.1| PREDICTED: GATA transcription factor 8-like [Brassica rapa]
Length=313

 Score =   144 bits (364),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 64/78 (82%), Positives = 70/78 (90%), Gaps = 0/78 (0%)
 Frame = +1

Query  895   IRKCLHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFTPSLHSNSHK  1074
             +RKC+HCEITKTPQWR GPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFTP+LHSNSHK
Sbjct  223   VRKCMHCEITKTPQWRLGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFTPALHSNSHK  282

Query  1075  KVIEMRSKVGVENTAITE  1128
             KV EMRSK   + +  T+
Sbjct  283   KVAEMRSKRCKDGSYTTQ  300



>ref|XP_009628152.1| PREDICTED: GATA transcription factor 12-like [Nicotiana tomentosiformis]
Length=344

 Score =   145 bits (366),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 98/242 (40%), Positives = 125/242 (52%), Gaps = 42/242 (17%)
 Frame = +1

Query  373   SAELSVPYEDIIQLEWLSTFVEDSFSGGGMTLGKENTPVNVEPPHNKFQTsspvsvless  552
             S+EL VPY+D+ +LEWLS FVE+SFS   +   +     N+    N    SS  +   S+
Sbjct  94    SSELCVPYDDLAELEWLSNFVEESFSSDDVQNLQLIPVTNINSAANNTTDSSSSATTISA  153

Query  553   sssssssscsGGKTTIPLSPSRCGV-QRARSKRPRPATFNPRPAIQLI-SPTSSFTEAPQ  726
                        G  + P  P    V  +ARSKR R A  +    +QL+ SP +S +E+  
Sbjct  154   -----------GTNSPPAFPVDTSVPGKARSKRSRAAPCDWSSRLQLLLSPVTSSSES--  200

Query  727   PFVAPAVSSESENFAESPMKKLTTRPEAPEQkkkkkikFTIPIAPVDTNQNQPPQAIRKC  906
                    +  + N + S   K T  P    +  +                       RKC
Sbjct  201   -------NDAAANNSTSATAKATKAPSKKRESIETPG--------------------RKC  233

Query  907   LHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFTPSLHSNSHKKVIE  1086
             LHC   KTPQWR GPMGPKTLCNACGVRYKSGRL PEYRPAASPTF  + HSNSH+KV+E
Sbjct  234   LHCASEKTPQWRTGPMGPKTLCNACGVRYKSGRLVPEYRPAASPTFVSAKHSNSHRKVLE  293

Query  1087  MR  1092
             +R
Sbjct  294   LR  295



>ref|XP_009776828.1| PREDICTED: GATA transcription factor 12 [Nicotiana sylvestris]
Length=367

 Score =   145 bits (367),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 105/280 (38%), Positives = 130/280 (46%), Gaps = 39/280 (14%)
 Frame = +1

Query  343   GSHNNSAADLSAELSVPYEDIIQLEWLSTFVEDSFSGG---------GMTLGKENTPVNV  495
             G  N      S+E SVPY+D+ +LEWLS FVE+SFS           GM    +N     
Sbjct  89    GCRNFPDGQFSSEFSVPYDDLAELEWLSNFVEESFSSNEMQKIQFIQGMKCRNDNETHQF  148

Query  496   EPPHNKFQTsspvsvlesssssssssscsGGKTTIPLSPSRCGVQRARSKRPRPATFNPR  675
              P  N  +                        T    +P      +ARSKR R A  N  
Sbjct  149   IPDPNNNRA--------------------SAATNPIFNPDMSVPAKARSKRSRMAPGNWA  188

Query  676   PAIQLISPTSSFTEAPQPFVAPAVSS---ESENFAESPMKKLTTRPEAPEQkkkkkikFT  846
               + ++SP S       P    ++      SE+   S   K T +   P+ KK+      
Sbjct  189   SRLLVVSPNSPNNTPNSPMNTTSMQDMSSSSESGIISSSGKKTVKSSTPKIKKENTQH--  246

Query  847   IPIAPVDTNQNQPPQAIRKCLHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRP  1026
                  V  N        RKCLHC   KTPQWR GPMGPKTLCNACGVRYKSGRL PEYRP
Sbjct  247   -----VPNNNMASNSEGRKCLHCATDKTPQWRTGPMGPKTLCNACGVRYKSGRLVPEYRP  301

Query  1027  AASPTFTPSLHSNSHKKVIEMRSKVGVENTAITEAPSTPQ  1146
             AASPTF  + HSNSH+KV+E+R +  +  T   +    PQ
Sbjct  302   AASPTFVLTKHSNSHRKVLEIRRQKEIVRTHQQQQQFLPQ  341



>ref|XP_006403533.1| hypothetical protein EUTSA_v10010544mg [Eutrema salsugineum]
 dbj|BAJ34547.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ44986.1| hypothetical protein EUTSA_v10010544mg [Eutrema salsugineum]
Length=325

 Score =   144 bits (364),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 63/79 (80%), Positives = 70/79 (89%), Gaps = 0/79 (0%)
 Frame = +1

Query  862   VDTNQNQPPQAIRKCLHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPT  1041
             VD + +     +RKC+HCE+TKTPQWR GPMGPKTLCNACGVRYKSGRLFPEYRPAASPT
Sbjct  223   VDISYSSEQNLVRKCMHCEVTKTPQWRLGPMGPKTLCNACGVRYKSGRLFPEYRPAASPT  282

Query  1042  FTPSLHSNSHKKVIEMRSK  1098
             FTP+LHSNSHKKV EMR+K
Sbjct  283   FTPALHSNSHKKVAEMRNK  301


 Score = 65.5 bits (158),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 43/96 (45%), Positives = 66/96 (69%), Gaps = 8/96 (8%)
 Frame = +1

Query  169  MGSNFMDELDCGSFFDHIDDLIEFPPENECVGGVGSGEFKNFPSIW---NDPLPD-SEPL  336
            +G +F ++LDCG+FFD++DDLI+FP  +  V G   G+  +FP+IW   +D  P  S+PL
Sbjct  2    IGQSFPEDLDCGNFFDNMDDLIDFPGGDIDV-GFDIGDSDSFPNIWTTHHDTWPTASDPL  60

Query  337  FSGSHNNSAADLSAELSVPYEDIIQLEWLSTFVEDS  444
            FS +   + +D S EL VP+EDI+++E   +FVE+S
Sbjct  61   FSSN---TNSDSSTELYVPFEDIVKVERPPSFVEES  93



>ref|XP_003550120.1| PREDICTED: GATA transcription factor 12-like [Glycine max]
Length=366

 Score =   145 bits (366),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 101/258 (39%), Positives = 134/258 (52%), Gaps = 32/258 (12%)
 Frame = +1

Query  343   GSHNNSAADLSAELSVPYEDIIQLEWLSTFVEDSFSGGGMTLGKENTPVNVEPPHNKFQT  522
             GS N S    S +L VPY+DI +LEWLS FVE+SFS   +   +  + +N +        
Sbjct  77    GSRNLSDGHFSDDLCVPYDDIAELEWLSNFVEESFSSEDLHKMQLISGMNAQ--------  128

Query  523   sspvsvlesssssssssscsGGKT-----TIPLSPSRCGV-QRARSKRPRPATFNPRPAI  684
              +             +++ SG  T       P+  S   V  +ARSKR R    N    +
Sbjct  129   -NNDVSEAREFHYEPTTTRSGSHTPEPTRNSPIFNSEVSVPAKARSKRSRGPPCNWASRL  187

Query  685   QLISPTSSFTEAPQPFVAPAVSSESENFAESPMKKLTTRPEAPEQkkkkkikFTIPIAPV  864
              ++SPTSS ++      +PA +        +P KK+      P +K              
Sbjct  188   LVLSPTSSSSDNEVVVPSPATAEP----CPTPAKKMAK--VGPRKKDSSS----------  231

Query  865   DTNQNQPPQAIRKCLHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTF  1044
              ++ N      R+CLHC   KTPQWR GPMGPKTLCNACGVRYKSGRL PEYRPAASPTF
Sbjct  232   -SDGNGSGGDGRRCLHCATDKTPQWRTGPMGPKTLCNACGVRYKSGRLVPEYRPAASPTF  290

Query  1045  TPSLHSNSHKKVIEMRSK  1098
               + HSNSH+KV+E+R +
Sbjct  291   VLTKHSNSHRKVLELRRQ  308



>gb|KGN62802.1| hypothetical protein Csa_2G373450 [Cucumis sativus]
Length=374

 Score =   145 bits (366),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 107/266 (40%), Positives = 131/266 (49%), Gaps = 61/266 (23%)
 Frame = +1

Query  337   FSGSHNNSAADLSAELSVPYEDIIQLEWLSTFVEDSFSGGGMTLGKENTPVNV---EPPH  507
              SGS N   A  S+EL VPY+D+ +LEWLS FVE+SFS   M   +  + V V   EPP 
Sbjct  112   ISGS-NLGDAHFSSELCVPYDDLAELEWLSNFVEESFSSEDMQKLELISGVKVKSDEPPT  170

Query  508   NKFQTsspvsvlesssssssssscsGGKTTIPLSPSRCGV-QRARSKRPR--PATFNPRP  678
                Q ++  S                        P    V  +ARSKR R  P+ +N   
Sbjct  171   QSPQPTATRSAAAI------------------FKPEIVSVPAKARSKRSRALPSNWNNSA  212

Query  679   AIQLISPTSSFTEAPQPFVAPAVSSESENFAESPMKKLTTRPEAPEQkkkkkikFTIPIA  858
              + L SPT+  +E   P   P            P+KK                  T+P A
Sbjct  213   LLPLSSPTAE-SETTPPIEQP-----------HPIKK------------------TLPKA  242

Query  859   PVDTNQNQPPQA------IRKCLHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEY  1020
                  +   P         RKC+HC   KTPQWR GPMGPKTLCNACGVRYKSGRL PEY
Sbjct  243   AATAKKKDSPDLGFSSGEGRKCMHCATDKTPQWRTGPMGPKTLCNACGVRYKSGRLVPEY  302

Query  1021  RPAASPTFTPSLHSNSHKKVIEMRSK  1098
             RPAASPTF  + HSNSH+KV+E+R +
Sbjct  303   RPAASPTFVLTKHSNSHRKVLELRRQ  328



>gb|EYU18824.1| hypothetical protein MIMGU_mgv1a008576mg [Erythranthe guttata]
Length=304

 Score =   143 bits (361),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 64/86 (74%), Positives = 71/86 (83%), Gaps = 0/86 (0%)
 Frame = +1

Query  898   RKCLHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFTPSLHSNSHKK  1077
             +KC HCE+TKTPQWR GP+GPKTLCNACGVRY+SGRL+PEYRPAASPTF PSLHSNSHKK
Sbjct  204   KKCTHCEVTKTPQWREGPLGPKTLCNACGVRYRSGRLYPEYRPAASPTFAPSLHSNSHKK  263

Query  1078  VIEMRSKVGVENTAITEAPSTPQPAF  1155
             VIEMR+K         E P +PQP F
Sbjct  264   VIEMRNKGKFPTNIFEEPPISPQPEF  289



>gb|ACL52876.1| unknown [Zea mays]
Length=152

 Score =   139 bits (349),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 59/70 (84%), Positives = 65/70 (93%), Gaps = 0/70 (0%)
 Frame = +1

Query  892   AIRKCLHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFTPSLHSNSH  1071
             A+R+C HC+I KTPQWRAGP+GPKTLCNACGVRYKSGRLFPEYRPAASPTF PS+HSNSH
Sbjct  65    AVRRCTHCQIEKTPQWRAGPLGPKTLCNACGVRYKSGRLFPEYRPAASPTFVPSIHSNSH  124

Query  1072  KKVIEMRSKV  1101
             KKV+EMR K 
Sbjct  125   KKVVEMRQKA  134



>ref|XP_010668515.1| PREDICTED: GATA transcription factor 12-like [Beta vulgaris subsp. 
vulgaris]
Length=376

 Score =   145 bits (366),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 107/276 (39%), Positives = 136/276 (49%), Gaps = 72/276 (26%)
 Frame = +1

Query  337   FSGSHNNSA-----ADL----SAELSVPYEDIIQLEWLSTFVEDSFSGGGMTLGKENTPV  489
             FSG++ N A     AD+    S EL+VPY+D+ +LEWLS FVE+SFS   +         
Sbjct  92    FSGNNTNDAIFPLPADIGSHFSGELAVPYDDLAELEWLSNFVEESFSSEDLH------KF  145

Query  490   NVEPPHNKFQTsspvsvlesssssssssscsGGKT-TIPLSPSRCGVQ------------  630
             ++ P  +  +T                    G +T   P  P+R                
Sbjct  146   HLIPAMSAMKTRPDE----------------GSETRYYPSEPTRTAATPVSPIFNPEIPV  189

Query  631   --RARSKRPRPATFNPRPAIQLISPTSSFTEAPQPFVAPAVSSESENFAESPMKKLTTRP  804
               +ARSKR R A  N    + +++P +S T    P   P  SS ++N      K L +  
Sbjct  190   PGKARSKRSRAAPCNWASRLLVLAPGASDT---GPVTKPTKSSGAKN-----KKGLNSGG  241

Query  805   EAPEQkkkkkikFTIPIAPVDTNQNQPPQAIRKCLHCEITKTPQWRAGPMGPKTLCNACG  984
               P           I  A V          +RKCLHC   KTPQWR GPMGPKTLCNACG
Sbjct  242   IGP-----------IVEANV-------VGEVRKCLHCATDKTPQWRTGPMGPKTLCNACG  283

Query  985   VRYKSGRLFPEYRPAASPTFTPSLHSNSHKKVIEMR  1092
             VRYKSGRL PEYRPAASPTF  + HSNSH+KV+E+R
Sbjct  284   VRYKSGRLVPEYRPAASPTFMLTKHSNSHRKVMELR  319



>emb|CDY67017.1| BnaCnng53150D [Brassica napus]
Length=333

 Score =   144 bits (363),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 64/92 (70%), Positives = 71/92 (77%), Gaps = 0/92 (0%)
 Frame = +1

Query  895   IRKCLHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFTPSLHSNSHK  1074
             +RKC+HCE+TKTPQWR GPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFTP+LHSNSHK
Sbjct  229   VRKCMHCEVTKTPQWRLGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFTPALHSNSHK  288

Query  1075  KVIEMRSKVGVENTAITEAPSTPQPAFNNPSV  1170
             KV EMR+K     +   E         NN  +
Sbjct  289   KVAEMRNKRCSNGSYTNEENDLHDLVLNNAYI  320


 Score = 75.1 bits (183),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 43/97 (44%), Positives = 65/97 (67%), Gaps = 8/97 (8%)
 Frame = +1

Query  169  MGSNFMDELDCGSFFDHIDDLIEFPPENECVGGVGSGEFKNFPSIW---NDPLP-DSEPL  336
             G +F ++LDCG+FFD++DDL++FP  +  V G G G+  +FP+IW    D  P  S+PL
Sbjct  2    FGQSFAEDLDCGNFFDNMDDLLDFPGGDIDV-GFGIGDSDSFPNIWTTHQDTWPAASDPL  60

Query  337  FSGSHNNSAADLSAELSVPYEDIIQLEWLSTFVEDSF  447
            F+   +N+ +D S EL VP+EDI+++E    FVE+S 
Sbjct  61   FA---SNTNSDSSPELYVPFEDIVKVERPKCFVEESL  94



>ref|XP_009631501.1| PREDICTED: GATA transcription factor 9-like [Nicotiana tomentosiformis]
Length=369

 Score =   145 bits (365),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 104/280 (37%), Positives = 128/280 (46%), Gaps = 59/280 (21%)
 Frame = +1

Query  343   GSHNNSAADLSAELSVPYEDIIQLEWLSTFVEDSFSGG---------GMTLGKENTPVNV  495
             G  N      S+E SVPY+D+ +LEWLS FVE+SFS           GM    +N     
Sbjct  89    GCRNFPDGQFSSEFSVPYDDLAELEWLSNFVEESFSSNEMQKIQFIQGMKSRNDNETHQF  148

Query  496   EPPHNKFQTsspvsvlesssssssssscsGGKTTIPLSPSRCGVQRARSKRPRPATFNPR  675
              P  N  +                        T    +P      +ARSKR R A  N  
Sbjct  149   IPDPNNNRA--------------------SAATNPIFNPDMSVPAKARSKRSRMAPGNWA  188

Query  676   PAIQLISPTSSFTEAPQPFVAPAVSSESENFAESPMKKLTTRP-------EAPEQkkkkk  834
               + ++SP S                   N   SPM   T +               KK 
Sbjct  189   SRLLVVSPNSP-----------------NNTPNSPMNTTTMQDMSSSSESGIISCSGKKT  231

Query  835   ikFTIPIAPVDTNQNQPPQAI------RKCLHCEITKTPQWRAGPMGPKTLCNACGVRYK  996
             +K +IP    +  Q+ P   +      RKCLHC   KTPQWR GPMGPKTLCNACGVRYK
Sbjct  232   VKSSIPKIKKENTQHVPNNNMASNSEGRKCLHCATDKTPQWRTGPMGPKTLCNACGVRYK  291

Query  997   SGRLFPEYRPAASPTFTPSLHSNSHKKVIEMRSKVGVENT  1116
             SGRL PEYRPAASPTF  + HSNSH+KV+E+R +  +  T
Sbjct  292   SGRLVPEYRPAASPTFVLTKHSNSHRKVLEIRRQKEIVRT  331



>ref|XP_004251141.1| PREDICTED: GATA transcription factor 11-like [Solanum lycopersicum]
Length=336

 Score =   144 bits (362),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 112/340 (33%), Positives = 149/340 (44%), Gaps = 69/340 (20%)
 Frame = +1

Query  172   GSNFMDELDCGSF----FDHIDDLIEFPPEN---ECVGGV--GSGEFKNFPSIWNDPLPD  324
             G  +MDE+  G      FD I + ++ P E+   + +GGV     E K F  I  + L D
Sbjct  7     GGGYMDEIPTGPIVDDDFDDILNFLDMPMESLEGDVLGGVEWDVSESKGFGPIPTEALMD  66

Query  325   SEPLFSGSHNNSAADLSAELSVPYEDIIQLEWLSTFVEDS----FSGGGMTLGKENTPVN  492
               PL   +  N   +  A    P +   +++   TF   S      G     G ++ P+ 
Sbjct  67    FLPLPQSNIGNRRVNAVANSHPPIK-FTEVQGTGTFQTQSPVSVLEGSNSCSGGKSVPIK  125

Query  493   VEPPHNKFQTsspvsvlesssssssssscsGGKTTIPLSPSRCGVQRARSKRPRPATFNP  672
              +P                                IP+ P        RSKR RP+  NP
Sbjct  126   HDP-------------------------------VIPVRP--------RSKRARPSAVNP  146

Query  673   RPAIQLISPTSSFTEAPQPFVAPAVSSESE------NFAESPMKKLTTRPEAPEQkkkkk  834
                  L++P SS   A +       + E        + A+ PMK          Q+    
Sbjct  147   ---WVLMAPISSTRVASKKISDARKTKERRRRLSLLSGAKEPMKNYV-------QQISDA  196

Query  835   ikFTIPIAPVDTNQNQPPQAIRKCLHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFP  1014
                   ++       Q     +KC HCE+TKTPQWR GP+GPKTLCNACGVRY+SGRLFP
Sbjct  197   APPVSDVSKKKITSTQQSSFFKKCTHCEVTKTPQWREGPLGPKTLCNACGVRYRSGRLFP  256

Query  1015  EYRPAASPTFTPSLHSNSHKKVIEMRSKVGVENTAITEAP  1134
             EYRPAASPTF PS+HSNSH+KV+EMR K         E P
Sbjct  257   EYRPAASPTFVPSVHSNSHRKVVEMRKKTLYGGAGEVEEP  296



>gb|ADL36690.1| GATA domain class transcription factor [Malus domestica]
Length=375

 Score =   144 bits (364),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 111/318 (35%), Positives = 152/318 (48%), Gaps = 54/318 (17%)
 Frame = +1

Query  214   DH--IDDLIEFPPENECVGGVGS--GEFKNFPSIWNDPLP-------------DSEPLFS  342
             DH  ++DL++F  E++ V   G     F N      D  P              SEP F 
Sbjct  37    DHFMVEDLLDFSNEDDAVITDGGCPAAFDNVIGNSTDSSPLNVIDSCNSSSFSGSEPNF-  95

Query  343   GSHNNSAADLSAELSVPYEDIIQLEWLSTFVEDSFSGGGMTLGKENTPVNVEPPHNKFQT  522
             GS N +    S++L VP +D+ +LEWLS FVE+SFS   +   +  + +   P    F+T
Sbjct  96    GSRNLADGPFSSDLCVPCDDLAELEWLSNFVEESFSSEDLQKLQLISGMKPRPDQAAFET  155

Query  523   sspvsvlesssssssssscsGGKTTIPLSPSRCGVQRARSKRPRPATFNPRPAIQLISP-  699
                      ++++ + ++       + +        +ARSKR R A  N    + L+S  
Sbjct  156   RQFQPDPTRTNNNPNGNNNPIFNPEVSVPA------KARSKRSRAAPCNWTSRLLLLSTP  209

Query  700   -----TSSFTEAPQPFVAPAVSSESENFAESPMKKLTTRPEAPEQkkkkkikFTIPIAPV  864
                    S  EA  P   P+ S+  +    +P KK     E+ E                
Sbjct  210   EQSDVVVSAAEAASPLPPPS-STGKKTVKSAPKKK-----ESQEGSGGGP----------  253

Query  865   DTNQNQPPQAIRKCLHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTF  1044
                        RKC+HC   KTPQWR GPMGPKTLCNACGVRYKSGRL PEYRPAASPTF
Sbjct  254   --------GDGRKCMHCATDKTPQWRTGPMGPKTLCNACGVRYKSGRLVPEYRPAASPTF  305

Query  1045  TPSLHSNSHKKVIEMRSK  1098
               + HSNSH+KV+E+R +
Sbjct  306   VLTKHSNSHRKVLELRRQ  323



>emb|CDX78264.1| BnaA09g34590D [Brassica napus]
Length=324

 Score =   143 bits (361),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 61/68 (90%), Positives = 65/68 (96%), Gaps = 0/68 (0%)
 Frame = +1

Query  895   IRKCLHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFTPSLHSNSHK  1074
             +RKC+HCE+TKTPQWR GPMGPKTLCNACGVRYKSGRLFPEYRPA SPTFTP+LHSNSHK
Sbjct  230   VRKCMHCEVTKTPQWRLGPMGPKTLCNACGVRYKSGRLFPEYRPANSPTFTPALHSNSHK  289

Query  1075  KVIEMRSK  1098
             KV EMRSK
Sbjct  290   KVAEMRSK  297


 Score = 69.7 bits (169),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 44/106 (42%), Positives = 68/106 (64%), Gaps = 16/106 (15%)
 Frame = +1

Query  169  MGSNFMDELDCGSFFDHIDDLIEFPPENECVGGVGSGEFKNFPSIW---NDPLP-DSEPL  336
             G +F +++DCG+FFD++DD+++FP  +  V G   G+  +FP+IW    D  P  S+PL
Sbjct  2    FGQSFPEDIDCGNFFDNMDDILDFPGCDMDV-GFNIGDSDSFPNIWTNHQDTWPAASDPL  60

Query  337  FSGSHNNSAADLSAELSVPYEDIIQLEWLSTFV--------EDSFS  450
            FS   +N+ +D S EL VP+EDI+++E  ++FV        EDSFS
Sbjct  61   FS---SNTNSDSSPELYVPFEDIVKVERPASFVSESLVAKKEDSFS  103



>ref|XP_010031983.1| PREDICTED: GATA transcription factor 10-like isoform X1 [Eucalyptus 
grandis]
 gb|KCW51378.1| hypothetical protein EUGRSUZ_J00922 [Eucalyptus grandis]
Length=319

 Score =   143 bits (361),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 84/156 (54%), Positives = 99/156 (63%), Gaps = 10/156 (6%)
 Frame = +1

Query  625   VQRARSKRPRPATFNPRPAIQLISPTSSFTEAPQPFVAPAVSSESENFAESPMKKLTTRP  804
             V+R RSKR RP T   R      S  SS +    P  A   SSE  +          T+ 
Sbjct  145   VKRPRSKRLRPQTPKTRFNFPFASSASSASGIYHPLAASRSSSEGRH----------TKK  194

Query  805   EAPEQkkkkkikFTIPIAPVDTNQNQPPQAIRKCLHCEITKTPQWRAGPMGPKTLCNACG  984
              + ++K K+K    +  A    + +Q P A RKC+HCE+TKTPQWR GPMGPKTLCNACG
Sbjct  195   SSGKRKGKEKNLHLLSGAEEMNSASQNPSATRKCMHCEVTKTPQWREGPMGPKTLCNACG  254

Query  985   VRYKSGRLFPEYRPAASPTFTPSLHSNSHKKVIEMR  1092
             VRY+SGRLFPEYRPAASPTF  SLHSNSH+KVIEMR
Sbjct  255   VRYRSGRLFPEYRPAASPTFISSLHSNSHRKVIEMR  290



>ref|XP_002308598.1| zinc finger family protein [Populus trichocarpa]
 gb|EEE92121.1| zinc finger family protein [Populus trichocarpa]
Length=357

 Score =   144 bits (363),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 93/243 (38%), Positives = 122/243 (50%), Gaps = 38/243 (16%)
 Frame = +1

Query  376   AELSVPYEDIIQLEWLSTFVEDSFSGGGMTLGKENTPVNVEPPHN----KFQTsspvsvl  543
              EL VPY+D+ +LEWLS FVE+SFS   +   +  + +   P  +     FQ+    +  
Sbjct  100   GELCVPYDDLAELEWLSNFVEESFSSEDLQRLQLISGMKARPDESSETRHFQSDDNNNGN  159

Query  544   esssssssssscsGGKTTIPLSPSRCGVQRARSKRPRPATFNPRPAIQLISPTSSFTEAP  723
              S+                  +P      +ARSKR R A  N    + ++S T+S +E  
Sbjct  160   VSNIC----------NNNTMFNPEMAVPAKARSKRSRAAPGNWASRLLVLSRTTSSSE--  207

Query  724   QPFVAPAVSSESENFAESPMKKLTTRPEAPEQkkkkkikFTIPIAPVDTNQNQPPQAIRK  903
              P + P                 T  P + ++  K  +        V+          RK
Sbjct  208   -PEIIPGS---------------TQHPNSGKKTIKGAVGLKKRDGDVEGGDG------RK  245

Query  904   CLHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFTPSLHSNSHKKVI  1083
             CLHC   KTPQWR GPMGPKTLCNACGVRYKSGRL PEYRPAASPTF  + HSNSH+KV+
Sbjct  246   CLHCATDKTPQWRTGPMGPKTLCNACGVRYKSGRLVPEYRPAASPTFMLTKHSNSHRKVL  305

Query  1084  EMR  1092
             E+R
Sbjct  306   ELR  308



>ref|XP_010031984.1| PREDICTED: GATA transcription factor 10-like isoform X2 [Eucalyptus 
grandis]
Length=318

 Score =   143 bits (360),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 84/156 (54%), Positives = 99/156 (63%), Gaps = 10/156 (6%)
 Frame = +1

Query  625   VQRARSKRPRPATFNPRPAIQLISPTSSFTEAPQPFVAPAVSSESENFAESPMKKLTTRP  804
             V+R RSKR RP T   R      S  SS +    P  A   SSE  +          T+ 
Sbjct  144   VKRPRSKRLRPQTPKTRFNFPFASSASSASGIYHPLAASRSSSEGRH----------TKK  193

Query  805   EAPEQkkkkkikFTIPIAPVDTNQNQPPQAIRKCLHCEITKTPQWRAGPMGPKTLCNACG  984
              + ++K K+K    +  A    + +Q P A RKC+HCE+TKTPQWR GPMGPKTLCNACG
Sbjct  194   SSGKRKGKEKNLHLLSGAEEMNSASQNPSATRKCMHCEVTKTPQWREGPMGPKTLCNACG  253

Query  985   VRYKSGRLFPEYRPAASPTFTPSLHSNSHKKVIEMR  1092
             VRY+SGRLFPEYRPAASPTF  SLHSNSH+KVIEMR
Sbjct  254   VRYRSGRLFPEYRPAASPTFISSLHSNSHRKVIEMR  289



>emb|CDX73447.1| BnaC08g25560D [Brassica napus]
Length=323

 Score =   143 bits (360),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 61/68 (90%), Positives = 65/68 (96%), Gaps = 0/68 (0%)
 Frame = +1

Query  895   IRKCLHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFTPSLHSNSHK  1074
             +RKC+HCE+TKTPQWR GPMGPKTLCNACGVRYKSGRLFPEYRPA SPTFTP+LHSNSHK
Sbjct  229   VRKCMHCEVTKTPQWRLGPMGPKTLCNACGVRYKSGRLFPEYRPANSPTFTPALHSNSHK  288

Query  1075  KVIEMRSK  1098
             KV EMRSK
Sbjct  289   KVAEMRSK  296


 Score = 71.2 bits (173),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 41/97 (42%), Positives = 66/97 (68%), Gaps = 8/97 (8%)
 Frame = +1

Query  169  MGSNFMDELDCGSFFDHIDDLIEFPPENECVGGVGSGEFKNFPSIW---NDPLP-DSEPL  336
             G +F +++DCG+FFD++DD+++FP  +  V G   G+  +FP+IW    D  P  S+PL
Sbjct  2    FGQSFPEDIDCGNFFDNMDDILDFPGCDMDV-GFSIGDSDSFPNIWTNHQDTWPAASDPL  60

Query  337  FSGSHNNSAADLSAELSVPYEDIIQLEWLSTFVEDSF  447
            FS   +N+ +D S EL VP+EDI+++E  ++FVE+S 
Sbjct  61   FS---SNTNSDSSPELYVPFEDIVKVERPASFVEESL  94



>emb|CDO97987.1| unnamed protein product [Coffea canephora]
Length=374

 Score =   144 bits (363),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 115/306 (38%), Positives = 161/306 (53%), Gaps = 43/306 (14%)
 Frame = +1

Query  220   IDDLIEFPPENECVGGV-------GSGEFKNFPSI--WNDPLPDSEPLFSGSHN-NSAAD  369
             +DDL++FP E+E +           SGE  +   +   N  +   +  F+G+ +  S  D
Sbjct  41    VDDLLDFPKEDEVMTDAFFDSITGNSGESSSLTVVDSCNSSVSGGDRQFNGNISCRSFTD  100

Query  370   L---SAELSVPYEDIIQLEWLSTFVEDSFSGGGM-TLGKENTPVNVEPPHNKFQTsspvs  537
                  +EL VPY+D+ +LEWLS FVE+SFS   +  L   +   N + P      ++  +
Sbjct  101   TQFSGSELCVPYDDLAELEWLSNFVEESFSSDDLHNLHLISPTTNFKAPSASSAATANAT  160

Query  538   vlesssssssssscsGGKTTIPLSPSRCGV-QRARSKRPRPATFNPRPAIQLI-SPTSSF  711
                SSS+++ S++     ++ P+ PS      +ARSKR R A  N    + L+ SP +S 
Sbjct  161   TDTSSSAATISTNNDNSNSSSPVFPSDVSFPGKARSKRSRAAPCNWASRLLLLASPATS-  219

Query  712   TEAPQPFVAPAVSSESENFAESPMKKLTTRPEAPEQkkkkkikFTIPIAPVDTNQNQPPQ  891
                         SSE  N   +P   ++   +AP+Q            AP    +     
Sbjct  220   ------------SSEPTNDVNTP-NPISVTIKAPKQ------------APSRKRETTETP  254

Query  892   AIRKCLHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFTPSLHSNSH  1071
               R+CLHC   KTPQWR GPMGPKTLCNACGVRYKSGRL PEYRPAASPTF  + HSNSH
Sbjct  255   G-RQCLHCGSEKTPQWRTGPMGPKTLCNACGVRYKSGRLVPEYRPAASPTFVSAKHSNSH  313

Query  1072  KKVIEM  1089
             +KV+E+
Sbjct  314   RKVLEL  319



>ref|XP_009116158.1| PREDICTED: GATA transcription factor 8 [Brassica rapa]
Length=324

 Score =   143 bits (360),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 61/68 (90%), Positives = 65/68 (96%), Gaps = 0/68 (0%)
 Frame = +1

Query  895   IRKCLHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFTPSLHSNSHK  1074
             +RKC+HCE+TKTPQWR GPMGPKTLCNACGVRYKSGRLFPEYRPA SPTFTP+LHSNSHK
Sbjct  230   VRKCMHCEVTKTPQWRLGPMGPKTLCNACGVRYKSGRLFPEYRPANSPTFTPALHSNSHK  289

Query  1075  KVIEMRSK  1098
             KV EMRSK
Sbjct  290   KVAEMRSK  297


 Score = 69.7 bits (169),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 41/97 (42%), Positives = 65/97 (67%), Gaps = 8/97 (8%)
 Frame = +1

Query  169  MGSNFMDELDCGSFFDHIDDLIEFPPENECVGGVGSGEFKNFPSIW---NDPLP-DSEPL  336
             G +F +++DCG+FFD++DD+++FP  +  V G   G+   FP+IW    D  P  S+PL
Sbjct  2    FGQSFPEDIDCGNFFDNMDDILDFPGCDMDV-GFNIGDSDPFPNIWTNHQDTWPAASDPL  60

Query  337  FSGSHNNSAADLSAELSVPYEDIIQLEWLSTFVEDSF  447
            FS   +N+ +D S EL VP+EDI+++E  ++FVE+S 
Sbjct  61   FS---SNTNSDSSPELYVPFEDIVKVERPASFVEESL  94



>ref|XP_010554544.1| PREDICTED: GATA transcription factor 8-like [Tarenaya hassleriana]
Length=317

 Score =   143 bits (360),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 61/67 (91%), Positives = 65/67 (97%), Gaps = 0/67 (0%)
 Frame = +1

Query  895   IRKCLHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFTPSLHSNSHK  1074
             +RKC+HCE+TKTPQWR GPMGPKTLCNACGVRYKSGRLFPEYRPAASPTF PSLHSNSHK
Sbjct  226   VRKCMHCEVTKTPQWRLGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFMPSLHSNSHK  285

Query  1075  KVIEMRS  1095
             KV+EMRS
Sbjct  286   KVVEMRS  292


 Score = 83.6 bits (205),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 51/98 (52%), Positives = 67/98 (68%), Gaps = 9/98 (9%)
 Frame = +1

Query  169  MGSNFMDELDCGSFFDHIDDLIEFPPENECVG-GVGSGEFKNFPSIWN---DPLPDSEPL  336
            +G +F DE+DCG+FFD++DDLI+FP  NE +G G G G+   FPSIW+   +  P S+ L
Sbjct  2    IGQSFADEMDCGNFFDNMDDLIDFP--NEDIGLGFGMGDNDVFPSIWSAQPESWPGSDQL  59

Query  337  FSGSHNNSAADLSAELSVPYEDIIQLEWLSTFVEDSFS  450
            FS S NNS  D   EL VP+ +I+QLE  S FV+DS S
Sbjct  60   FS-SKNNS--DSPTELYVPFANIVQLEQPSGFVDDSCS  94



>ref|XP_010235943.1| PREDICTED: PHD finger protein rhinoceros-like [Brachypodium distachyon]
 ref|XP_010235944.1| PREDICTED: PHD finger protein rhinoceros-like [Brachypodium distachyon]
Length=416

 Score =   145 bits (365),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 61/74 (82%), Positives = 68/74 (92%), Gaps = 0/74 (0%)
 Frame = +1

Query  883   PPQAIRKCLHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFTPSLHS  1062
             PP A+R+C HC+I KTPQWRAGP+GPKTLCNACGVRYKSGRLFPEYRPAASPTF P++HS
Sbjct  329   PPGAVRRCTHCQIEKTPQWRAGPLGPKTLCNACGVRYKSGRLFPEYRPAASPTFVPAIHS  388

Query  1063  NSHKKVIEMRSKVG  1104
             NSHKKV+EMR KV 
Sbjct  389   NSHKKVVEMRQKVA  402



>gb|EYU18823.1| hypothetical protein MIMGU_mgv1a008576mg [Erythranthe guttata]
Length=369

 Score =   144 bits (362),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 64/86 (74%), Positives = 71/86 (83%), Gaps = 0/86 (0%)
 Frame = +1

Query  898   RKCLHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFTPSLHSNSHKK  1077
             +KC HCE+TKTPQWR GP+GPKTLCNACGVRY+SGRL+PEYRPAASPTF PSLHSNSHKK
Sbjct  269   KKCTHCEVTKTPQWREGPLGPKTLCNACGVRYRSGRLYPEYRPAASPTFAPSLHSNSHKK  328

Query  1078  VIEMRSKVGVENTAITEAPSTPQPAF  1155
             VIEMR+K         E P +PQP F
Sbjct  329   VIEMRNKGKFPTNIFEEPPISPQPEF  354



>ref|XP_007137230.1| hypothetical protein PHAVU_009G110400g [Phaseolus vulgaris]
 gb|ESW09224.1| hypothetical protein PHAVU_009G110400g [Phaseolus vulgaris]
Length=319

 Score =   142 bits (359),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 93/251 (37%), Positives = 120/251 (48%), Gaps = 74/251 (29%)
 Frame = +1

Query  370   LSAELSVPYEDIIQLEWLSTFVEDSFSGGGMTLGKENTPVNVEPPHNKFQTsspvsvles  549
              S +LSVPY+D+ +LEWLS F E+SFS   +                K Q          
Sbjct  85    FSGDLSVPYDDLAELEWLSKFAEESFSSEDL---------------QKLQLI--------  121

Query  550   ssssssssscsGGKTTIPLSPSRCGVQR---ARSKRPRPATFNPRPAIQLISPTSSFTEA  720
                                  S  GVQ+   + ++ P PA FNP+ +++     S  T  
Sbjct  122   ---------------------SGAGVQKDATSETRDPNPALFNPQVSVR-GKARSKRTRG  159

Query  721   P-----QPFVAPAVSSESENFAESPMKKLTTRPEAPEQkkkkkikFTIPIAPVDTNQNQP  885
             P        V  + ++ SE+F     KK                     +AP   + ++ 
Sbjct  160   PPCNWTSRLVVLSPNTVSESFHSDGGKK---------------------VAPRRRDVSEG  198

Query  886   PQAIRKCLHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFTPSLHSN  1065
                 RKCLHC   KTPQWR GPMGPKTLCNACGVRYKSGRL PEYRPAASPTF  + HSN
Sbjct  199   SSEGRKCLHCATDKTPQWRTGPMGPKTLCNACGVRYKSGRLVPEYRPAASPTFVLTKHSN  258

Query  1066  SHKKVIEMRSK  1098
             SH+KV+E+R +
Sbjct  259   SHRKVLELRRQ  269



>ref|XP_008378072.1| PREDICTED: GATA transcription factor 12-like [Malus domestica]
Length=374

 Score =   143 bits (361),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 111/318 (35%), Positives = 153/318 (48%), Gaps = 54/318 (17%)
 Frame = +1

Query  214   DH--IDDLIEFPPENECVGGVGS--GEFKNFPSIWNDPLP-------------DSEPLFS  342
             DH  ++DL++F  +++ V   G     F N      D  P              SEP F 
Sbjct  37    DHFMVEDLLDFSNDDDAVITDGGCPAAFDNVIGNSTDSSPLNVIDSCNSSSLSGSEPNF-  95

Query  343   GSHNNSAADLSAELSVPYEDIIQLEWLSTFVEDSFSGGGMTLGKENTPVNVEPPHNKFQT  522
             GS N +    S++L VP +D+ +LEWLS FVE+SFS   +   +  + +   P    F+T
Sbjct  96    GSRNLADGPFSSDLCVPCDDLAELEWLSNFVEESFSSEDLQKLQLISGMKPRPDQAAFET  155

Query  523   sspvsvlesssssssssscsGGKTTIPLSPSRCGVQRARSKRPRPATFNPRPAIQLISP-  699
             S        ++++ + ++       + +        +ARSKR R A  N    + L+S  
Sbjct  156   SQFQPDPTLTNNNPNGNNNPIFNPEVSVPA------KARSKRSRAAPCNWTSRLLLLSTP  209

Query  700   -----TSSFTEAPQPFVAPAVSSESENFAESPMKKLTTRPEAPEQkkkkkikFTIPIAPV  864
                    S  EA  P   P+ S+  +    +P KK     E+ E                
Sbjct  210   EQSDVVVSAAEAASPLPPPS-STGKKTVKSAPKKK-----ESQEGSGGGP----------  253

Query  865   DTNQNQPPQAIRKCLHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTF  1044
                        RKC+HC   KTPQWR GPMGPKTLCNACGVRYKSGRL PEYRPAASPTF
Sbjct  254   --------GDGRKCMHCATDKTPQWRTGPMGPKTLCNACGVRYKSGRLVPEYRPAASPTF  305

Query  1045  TPSLHSNSHKKVIEMRSK  1098
               + HSNSH+KV+E+R +
Sbjct  306   VLTKHSNSHRKVLELRRQ  323



>ref|XP_007016761.1| GATA zinc finger protein regulating nitrogen assimilation, putative 
[Theobroma cacao]
 gb|EOY34380.1| GATA zinc finger protein regulating nitrogen assimilation, putative 
[Theobroma cacao]
Length=342

 Score =   142 bits (359),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 60/76 (79%), Positives = 66/76 (87%), Gaps = 0/76 (0%)
 Frame = +1

Query  880   QPPQAIRKCLHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFTPSLH  1059
             Q P  +RKC+HCE+TKTPQWR GPMGPKTLCNACGVRY+SGRL PEYRPAASPTF  SLH
Sbjct  249   QQPVVVRKCMHCEVTKTPQWREGPMGPKTLCNACGVRYRSGRLLPEYRPAASPTFVSSLH  308

Query  1060  SNSHKKVIEMRSKVGV  1107
             SNSHKKV+EMR K  +
Sbjct  309   SNSHKKVVEMRKKAKL  324



>ref|XP_002529940.1| GATA transcription factor, putative [Ricinus communis]
 gb|EEF32448.1| GATA transcription factor, putative [Ricinus communis]
Length=323

 Score =   142 bits (357),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 66/92 (72%), Positives = 73/92 (79%), Gaps = 1/92 (1%)
 Frame = +1

Query  886   PQAIRKCLHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFTPSLHSN  1065
             P  IRKC HCE+TKTPQWR GPMGPKTLCNACGVRY+SGRLFPEYRPAASPTF P+LHSN
Sbjct  231   PGEIRKCTHCEVTKTPQWREGPMGPKTLCNACGVRYRSGRLFPEYRPAASPTFVPALHSN  290

Query  1066  SHKKVIEMRSK-VGVENTAITEAPSTPQPAFN  1158
             SH+KVIEMR     V N A  +A   P P ++
Sbjct  291   SHRKVIEMRKNPRHVGNMAAMDAARLPVPEYS  322



>gb|ACU24388.1| unknown [Glycine max]
Length=327

 Score =   142 bits (357),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 79/160 (49%), Positives = 102/160 (64%), Gaps = 13/160 (8%)
 Frame = +1

Query  625   VQRARSKRPRPATFNPRPAIQLISPTSSFTEAPQPFVAPAVSSESENFAESPMKKLTTRP  804
             V+RARSKR RP++F+P  +I  I  + +     +  +A A S    N A +   KL  + 
Sbjct  157   VKRARSKRQRPSSFSPLFSIPFILNSPAMQNHQR--IAAADSDFGTNVAGNLSNKLKKQK  214

Query  805   EAPEQkkkkkikFTIPIAPVDTNQNQPPQAI--RKCLHCEITKTPQWRAGPMGPKTLCNA  978
             +                  V+  ++  P++   RKC+HCE+TKTPQWR GP+GPKTLCNA
Sbjct  215   KKDSSLLS---------GDVEMMRSSSPESGSPRKCMHCEVTKTPQWREGPVGPKTLCNA  265

Query  979   CGVRYKSGRLFPEYRPAASPTFTPSLHSNSHKKVIEMRSK  1098
             CGVRY+SGRLFPEYRPAASPTF  SLHSN HKKV+EMRS+
Sbjct  266   CGVRYRSGRLFPEYRPAASPTFVASLHSNCHKKVVEMRSR  305



>ref|XP_009410894.1| PREDICTED: GATA transcription factor 9-like isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=372

 Score =   143 bits (360),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 95/259 (37%), Positives = 138/259 (53%), Gaps = 20/259 (8%)
 Frame = +1

Query  364   ADLSAELSVPYEDIIQLEWLSTFVEDSFSGGGMTLGKENTPVNVEPPHNKFQTsspvsvl  543
             A  S +L  PYE++ +LEWLS FVE+SFS     L K +    V        +++  +  
Sbjct  97    ASRSGDLCEPYEELAELEWLSNFVEESFSS--EDLHKLHPISGVSSTTTGSSSTTTAAAA  154

Query  544   esssssssssscsGGKT--TIPLSPSRCGVQRARSKRPRPATFNPRPAIQLISPTSSFTE  717
               +  S+ +   +GG+     P  P      +ARSKR R A  +    + ++SP+ +   
Sbjct  155   TRAEVSAHTQVAAGGRVNHVAPFRPEAIVPGKARSKRSRAAPCSWSSRLLVLSPSLATAS  214

Query  718   APQP-FVAPAVSSESENFAESPMKKLTTRPEAPEQkkkkkikFTIPIAPVDTNQNQPPQA  894
             +P+   + PA ++ +        K +  +P + ++           +A  D         
Sbjct  215   SPESELIVPASAAAASAGGGGGKKAV--KPASKKKDLTAGTA----VAAGDG--------  260

Query  895   IRKCLHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFTPSLHSNSHK  1074
              RKCLHC+  KTPQWR GP+GPKTLCNACGVRYKSGRL PEYRPAASPTF  S HSNSH+
Sbjct  261   -RKCLHCQTDKTPQWRTGPLGPKTLCNACGVRYKSGRLVPEYRPAASPTFVVSKHSNSHR  319

Query  1075  KVIEMRSKVGVENTAITEA  1131
             KV+E+R +  ++   +  A
Sbjct  320   KVLELRRQKELQQQQLFHA  338



>ref|XP_010915683.1| PREDICTED: GATA transcription factor 12 [Elaeis guineensis]
Length=359

 Score =   142 bits (359),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 95/261 (36%), Positives = 134/261 (51%), Gaps = 32/261 (12%)
 Frame = +1

Query  325   SEPLFSGS---HNNSAADLSAELSVPYEDIIQLEWLSTFVEDSFSGGGMTLGKENTPVNV  495
             S+P F+G     + + A LS +L  PYE++ +LEWLS FVE+SFS   +   +  + V  
Sbjct  86    SDPHFAGDLVCRSFADASLSGDLCEPYEELAELEWLSNFVEESFSSEDIQKLQLISGVKS  145

Query  496   EPPHNKFQTsspvsvlesssssssssscsGGKTTIPLSPSRCGVQRARSKRPRPATFNPR  675
                 ++ +     +    ++  ++  +    +  +P         +ARSKR R A  +  
Sbjct  146   SSTSSENRAEISANAGGGAAGRAAQPALFRAEAPVP--------GKARSKRSRAAPSSWS  197

Query  676   PAIQLISPTSSFTEAPQPFVAPAVSSESENFAESPMKKLTTRPEAPEQkkkkkikFTIPI  855
               +  +SPT++ + A    + PA      NF          + + P             +
Sbjct  198   SRLPELSPTTTASSAESELIVPA-----GNFPGKKAAAKPAKKKEPSAGPA--------V  244

Query  856   APVDTNQNQPPQAIRKCLHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAAS  1035
             AP            RKCLHC   KTPQWR GPMGPKTLCNACGVR+KSGRL PEYRPAAS
Sbjct  245   APAADG--------RKCLHCATEKTPQWRTGPMGPKTLCNACGVRFKSGRLVPEYRPAAS  296

Query  1036  PTFTPSLHSNSHKKVIEMRSK  1098
             PTF  S HSNSH+KV+E+R +
Sbjct  297   PTFVLSKHSNSHRKVLELRRQ  317



>ref|XP_009802675.1| PREDICTED: GATA transcription factor 12 [Nicotiana sylvestris]
Length=342

 Score =   142 bits (358),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 97/243 (40%), Positives = 126/243 (52%), Gaps = 40/243 (16%)
 Frame = +1

Query  373   SAELSVPYEDIIQLEWLSTFVEDSFSGGGMTLGKENTPVNVEPPHNKFQTsspvsvless  552
             S+EL VPY+D+ +LEWLS FVE+SFS   +   +     N+    N    SS  +   S+
Sbjct  92    SSELCVPYDDLAELEWLSNFVEESFSSDDVQNLQLIPVTNINSAANNTTDSSSSATTISA  151

Query  553   sssssssscsGGKTTIPLSPSRCGV-QRARSKRPRPATFNPRPAIQLISPTSSFTEAPQP  729
                        G  + P  P+   V  +ARSKRPR A  +    +QL+   ++ +     
Sbjct  152   -----------GTNSPPAFPADTSVPGKARSKRPRAAPCDWSSRLQLLLSPTTSSSESNN  200

Query  730   FVAPAVSSESENFAESPMKKLTTRPEAPEQkkkkkikFTIPIAPVDTNQNQPPQAIRKCL  909
               A   +S +    ++P KK  +  E P                            RKCL
Sbjct  201   SAANNNTSATAKATKAPSKKRES-IETPG---------------------------RKCL  232

Query  910   HCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFTPSLHSNSHKKVIEM  1089
             HC   KTPQWR GPMGPKTLCNACGVRYKSGRL PEYRPAASPTF  + HSNSH+KV+E+
Sbjct  233   HCASEKTPQWRTGPMGPKTLCNACGVRYKSGRLVPEYRPAASPTFVSAKHSNSHRKVLEL  292

Query  1090  RSK  1098
             R +
Sbjct  293   RRQ  295



>ref|XP_003543479.1| PREDICTED: GATA transcription factor 11-like [Glycine max]
Length=327

 Score =   141 bits (356),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 79/158 (50%), Positives = 102/158 (65%), Gaps = 9/158 (6%)
 Frame = +1

Query  625   VQRARSKRPRPATFNPRPAIQLISPTSSFTEAPQPFVAPAVSSESENFAESPMKKLTTRP  804
             V+RARSKR RP++F+P  +I  I  + +     +  +A A S    N A +   KL  + 
Sbjct  157   VKRARSKRQRPSSFSPLFSIPFILNSPAMQNHQR--IAAADSDFGTNVAGNLSNKLKKQK  214

Query  805   EAPEQkkkkkikFTIPIAPVDTNQNQPPQAIRKCLHCEITKTPQWRAGPMGPKTLCNACG  984
             +         ++     +P    ++  P   RKC+HCE+TKTPQWR GP+GPKTLCNACG
Sbjct  215   KKDSSLLSDDVEMMRSSSP----ESGSP---RKCMHCEVTKTPQWREGPVGPKTLCNACG  267

Query  985   VRYKSGRLFPEYRPAASPTFTPSLHSNSHKKVIEMRSK  1098
             VRY+SGRLFPEYRPAASPTF  SLHSN HKKV+EMRS+
Sbjct  268   VRYRSGRLFPEYRPAASPTFVASLHSNCHKKVVEMRSR  305



>ref|XP_009394172.1| PREDICTED: GATA transcription factor 9-like isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=360

 Score =   142 bits (358),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 96/248 (39%), Positives = 127/248 (51%), Gaps = 30/248 (12%)
 Frame = +1

Query  364   ADLSAELSVPYEDIIQLEWLSTFVEDSFSGGGMTLGKENTPVNVEPPHNKFQTsspvsvl  543
             A LS +L  PY+++ +LEWLS FVE+SFS   +      + VN     ++   ++     
Sbjct  98    ASLSGDLCEPYDELAELEWLSNFVEESFSSEDLHKLHLISGVNSTTTSSRTTAAAATRAE  157

Query  544   esssssssssscsGGKTTIPLSPSRCGVQRARSKRPRPATFNPRPAIQLISPTSSFTEAP  723
              S+  +++  +    +  +P         +ARSKR R A  +    + ++SP  S T AP
Sbjct  158   FSAQEAANQVAPFRAEALVP--------GKARSKRSRAAPCSWSSRLLVLSP--SLTAAP  207

Query  724   QPFVAPAVSSESENFAESPMKKLTTRPEAPEQkkkkkikFTIPIAPVDTNQNQPPQAI--  897
                              SP  +L   P A       K          D +      A   
Sbjct  208   -----------------SPESELIVPPSAAAAGAGGKKAAKPASKKKDMSAGPAVAAAPD  250

Query  898   -RKCLHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFTPSLHSNSHK  1074
              RKCLHC+  KTPQWR GPMGPKTLCNACGVRYKSGRL PEYRPAASPTF  S HSNSH+
Sbjct  251   GRKCLHCQTDKTPQWRTGPMGPKTLCNACGVRYKSGRLVPEYRPAASPTFVVSKHSNSHR  310

Query  1075  KVIEMRSK  1098
             KV+E+R +
Sbjct  311   KVLELRRQ  318



>ref|XP_007012149.1| GATA transcription factor 9, putative [Theobroma cacao]
 gb|EOY29768.1| GATA transcription factor 9, putative [Theobroma cacao]
Length=363

 Score =   142 bits (358),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 103/269 (38%), Positives = 132/269 (49%), Gaps = 33/269 (12%)
 Frame = +1

Query  316   LPDSEPLFSGS---HNNSAADLSAELSVPYEDIIQLEWLSTFVEDSFSGGGMTLGKENTP  486
             L   EP F G       +    + +L VPY+D+ +LEWLS FVE+SFS   +   +  + 
Sbjct  73    LSGCEPNFEGDMGCRGFTDGQFAGDLCVPYDDLAELEWLSNFVEESFSSEDLQKLQLISG  132

Query  487   VNVEPPHNK----FQTsspvsvlesssssssssscsGGKTTIP-LSPSRCGVQRARSKRP  651
             +   P  +     FQ   PV   +      +  +  G     P   P      +ARSKR 
Sbjct  133   MKTRPDESSQSGGFQ---PVITNQMHHVIENGDTEHGNNNNNPSFHPDMSVPAKARSKRS  189

Query  652   RPATFNPRPAIQLISPTSSFTEAPQPFVAPAVSSESENFAESPMKKLTTRPEAPEQkkkk  831
             R A  N    + ++SPT+S             SSE +              + P + KKK
Sbjct  190   RAAPLNWASRLLVLSPTTS-------------SSEPDIVVPVQPPPPNHPGKKPVKTKKK  236

Query  832   kikFTIPIAPVDTNQNQPPQAIRKCLHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLF  1011
                    +A  D          RKCLHC   KTPQWR GPMGPKTLCNACGVRYKSGRL 
Sbjct  237   DGGEGGGLANSDG---------RKCLHCATDKTPQWRTGPMGPKTLCNACGVRYKSGRLV  287

Query  1012  PEYRPAASPTFTPSLHSNSHKKVIEMRSK  1098
             PEYRPAASPTF  + HSNSH+KV+E+R +
Sbjct  288   PEYRPAASPTFVLTKHSNSHRKVLELRRQ  316



>gb|KHN21512.1| GATA transcription factor 11 [Glycine soja]
Length=327

 Score =   141 bits (356),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 79/160 (49%), Positives = 102/160 (64%), Gaps = 13/160 (8%)
 Frame = +1

Query  625   VQRARSKRPRPATFNPRPAIQLISPTSSFTEAPQPFVAPAVSSESENFAESPMKKLTTRP  804
             V+RARSKR RP++F+P  +I  I  + +     +  +A A S    N A +   KL  + 
Sbjct  157   VKRARSKRQRPSSFSPLFSIPFILNSPAMQNHQR--IAAADSDFGTNVAGNLSNKLKKQK  214

Query  805   EAPEQkkkkkikFTIPIAPVDTNQNQPPQAI--RKCLHCEITKTPQWRAGPMGPKTLCNA  978
             +                  V+  ++  P++   RKC+HCE+TKTPQWR GP+GPKTLCNA
Sbjct  215   KKDSSLLSDD---------VEMMRSSSPESGSPRKCMHCEVTKTPQWREGPVGPKTLCNA  265

Query  979   CGVRYKSGRLFPEYRPAASPTFTPSLHSNSHKKVIEMRSK  1098
             CGVRY+SGRLFPEYRPAASPTF  SLHSN HKKV+EMRS+
Sbjct  266   CGVRYRSGRLFPEYRPAASPTFVASLHSNCHKKVVEMRSR  305



>gb|AFK40558.1| unknown [Medicago truncatula]
Length=87

 Score =   133 bits (335),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 60/78 (77%), Positives = 68/78 (87%), Gaps = 0/78 (0%)
 Frame = +1

Query  907   LHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFTPSLHSNSHKKVIE  1086
             +HCEITKTPQWRAGPMGPKTLCNACGVR+KSGRLFPEYRPAASPTF P++HSNSHKKV+E
Sbjct  1     MHCEITKTPQWRAGPMGPKTLCNACGVRHKSGRLFPEYRPAASPTFCPAVHSNSHKKVLE  60

Query  1087  MRSKVGVENTAITEAPST  1140
             MR K   E+ +    P+T
Sbjct  61    MRCKDSFESDSAELIPNT  78



>gb|KHG10199.1| GATA transcription factor 12 -like protein [Gossypium arboreum]
 gb|KHG11345.1| GATA transcription factor 12 -like protein [Gossypium arboreum]
Length=364

 Score =   142 bits (357),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 92/253 (36%), Positives = 127/253 (50%), Gaps = 26/253 (10%)
 Frame = +1

Query  343   GSHNNSAADLSAELSVPYEDIIQLEWLSTFVEDSFSGGGMTLGKENTPVNVEPPHNKFQT  522
             G  + +    + +L VPY+D+ +LEWLS F E+SFS   +   +  + +   P      +
Sbjct  86    GCRSFTDGQFAGDLCVPYDDLAELEWLSNFAEESFSSEDLQKLQLISGMKTLP---NVSS  142

Query  523   sspvsvlesssssssssscsGGKTTIPLSPSRCGVQRARSKRPRPATFNPRPAIQLISPT  702
                    E  +   ++    GG       P      +ARSKR R A  N    + ++SPT
Sbjct  143   EPRGLQPELPNQIENAIDGGGGDNNHVFHPDMTVPAKARSKRSRAAPCNWASRLLVLSPT  202

Query  703   SSFTEAPQP-FVAPAVSSESENFAESPMKKLTTRPEAPEQkkkkkikFTIPIAPVDTNQN  879
              S   +P+P  + P     S    + P+K  ++  +  +  +                  
Sbjct  203   VS---SPEPDIIVPVQPLPSNQPGKKPVKTTSSSSKKKDGGETSSDG-------------  246

Query  880   QPPQAIRKCLHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFTPSLH  1059
                   RKCLHC   KTPQWR GPMGPKTLCNACGVRYKSGRL PEYRPAASPTF  + H
Sbjct  247   ------RKCLHCATDKTPQWRTGPMGPKTLCNACGVRYKSGRLVPEYRPAASPTFVLTKH  300

Query  1060  SNSHKKVIEMRSK  1098
             SNSH+KV+E+R +
Sbjct  301   SNSHRKVLELRRQ  313



>gb|KHG27547.1| GATA transcription factor 10 -like protein [Gossypium arboreum]
Length=343

 Score =   141 bits (356),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 62/87 (71%), Positives = 70/87 (80%), Gaps = 0/87 (0%)
 Frame = +1

Query  886   PQAIRKCLHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFTPSLHSN  1065
             P  +RKCLHCE+TKTPQWR GPMGPKTLCNACGVR++SGRL PEYRPAASPTF P+LHSN
Sbjct  252   PIEVRKCLHCEVTKTPQWREGPMGPKTLCNACGVRFRSGRLLPEYRPAASPTFVPALHSN  311

Query  1066  SHKKVIEMRSKVGVENTAITEAPSTPQ  1146
             SHKKV+EMR +  +  T      S PQ
Sbjct  312   SHKKVVEMRKQANLPTTGTPPMLSIPQ  338



>ref|XP_004501147.1| PREDICTED: GATA transcription factor 12-like [Cicer arietinum]
Length=316

 Score =   140 bits (354),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 94/246 (38%), Positives = 124/246 (50%), Gaps = 56/246 (23%)
 Frame = +1

Query  370   LSAELSVPYEDIIQLEWLSTFVEDSFSGGGMTLGKENTPVNVEPPHNKFQTsspvsvles  549
              S +LSVPY+D+ +LEWLS F E+SFS   +                K Q  S V   ++
Sbjct  84    FSGDLSVPYDDLAELEWLSKFAEESFSNDDL---------------QKLQLISGVKASKN  128

Query  550   ssssssssscsGGKTTIPLSPSRCGVQRARSKRPRPATFNPRPAIQLISPTSSFTEAPQP  729
              +S +        +  I  +P      +ARSKR R    N    + ++SPT++   +   
Sbjct  129   GASKTHE------EPNIIFNPQVSVPAKARSKRSRGPPCNWTSRLLVLSPTTTAESSHYD  182

Query  730   FVAPAVSSESENFAESPMKKLTTRPEAPEQkkkkkikFTIPIAPVDTNQNQPPQAIRKCL  909
              ++P   S       SP K+ TT                      D  +       R+CL
Sbjct  183   TISPPKKS-------SPRKRDTT----------------------DGGEG------RRCL  207

Query  910   HCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFTPSLHSNSHKKVIEM  1089
             HC   KTPQWR GP+GPKTLCNACGVRYKSGRL PEYRPAASPTF  + HSNSH+KV+E+
Sbjct  208   HCATDKTPQWRTGPLGPKTLCNACGVRYKSGRLVPEYRPAASPTFVLTKHSNSHRKVMEL  267

Query  1090  RSKVGV  1107
             R +  V
Sbjct  268   RRQKDV  273



>emb|CDY02894.1| BnaC04g25920D [Brassica napus]
Length=333

 Score =   140 bits (353),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 63/92 (68%), Positives = 70/92 (76%), Gaps = 0/92 (0%)
 Frame = +1

Query  895   IRKCLHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFTPSLHSNSHK  1074
             +RKC+HCE+TKTPQWR GPMGPKTLCNACGVRYKSGRL PEYRPAASPTFTP+LHSNSHK
Sbjct  229   VRKCMHCEVTKTPQWRLGPMGPKTLCNACGVRYKSGRLCPEYRPAASPTFTPALHSNSHK  288

Query  1075  KVIEMRSKVGVENTAITEAPSTPQPAFNNPSV  1170
             KV EMR+K     +   E         NN  +
Sbjct  289   KVAEMRNKRCSSGSYTNEENDLHDLVLNNAYI  320



>gb|ACN36994.1| unknown [Zea mays]
 gb|AFW64082.1| putative GATA transcription factor family protein [Zea mays]
Length=301

 Score =   139 bits (351),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 59/70 (84%), Positives = 65/70 (93%), Gaps = 0/70 (0%)
 Frame = +1

Query  892   AIRKCLHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFTPSLHSNSH  1071
             A+R+C HC+I KTPQWRAGP+GPKTLCNACGVRYKSGRLFPEYRPAASPTF PS+HSNSH
Sbjct  214   AVRRCTHCQIEKTPQWRAGPLGPKTLCNACGVRYKSGRLFPEYRPAASPTFVPSIHSNSH  273

Query  1072  KKVIEMRSKV  1101
             KKV+EMR K 
Sbjct  274   KKVVEMRQKA  283



>ref|XP_009795846.1| PREDICTED: GATA transcription factor 11-like isoform X2 [Nicotiana 
sylvestris]
Length=305

 Score =   139 bits (351),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 82/171 (48%), Positives = 101/171 (59%), Gaps = 27/171 (16%)
 Frame = +1

Query  631   RARSKRPRPATFNPRPAIQLISPTSSFTEAPQPFVAPAVSSESENFAESPMKKLTTRPEA  810
             R RSKRPR +  NP                    + P +SS    FA     K T     
Sbjct  132   RPRSKRPRSSALNPW------------------ILMPPISST--RFAS----KKTCDARK  167

Query  811   PEQkkkkkikFTIP-IAPVDTNQNQPPQ--AIRKCLHCEITKTPQWRAGPMGPKTLCNAC  981
              ++KK+K    ++P IA V   +    Q  + +KC HC++TKTPQWR GP+GPKTLCNAC
Sbjct  168   GKEKKRKMSLLSVPQIADVTKKKTTSAQQFSFKKCTHCQVTKTPQWREGPLGPKTLCNAC  227

Query  982   GVRYKSGRLFPEYRPAASPTFTPSLHSNSHKKVIEMRSKVGVENTAITEAP  1134
             GVRY+SGRLFPEYRPAASPTF P+LHSNSH+KV+EMR K     T+  E P
Sbjct  228   GVRYRSGRLFPEYRPAASPTFVPTLHSNSHRKVVEMRKKAIYGETSALEEP  278



>ref|XP_011088480.1| PREDICTED: GATA transcription factor 5-like [Sesamum indicum]
Length=323

 Score =   140 bits (352),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 101/269 (38%), Positives = 122/269 (45%), Gaps = 87/269 (32%)
 Frame = +1

Query  373   SAELSVPYEDIIQLEWLSTFVEDSFSGG-------------GMTLGKENTPVNVEPPHNK  513
             + EL+VP +D+  LEWLS FV+DS SG              G   GK   PVN  PP N 
Sbjct  95    AGELAVPVDDLENLEWLSQFVDDSTSGLSLLCPAGSFTSNIGTNSGKRVDPVN-RPPQN-  152

Query  514   FQTsspvsvlesssssssssscsGGKTTIPLSPSRCGVQRARSKRPRPATFNPRPAIQLI  693
                                          P  P R    +ARSKR RP   N RP   L 
Sbjct  153   --------------------------IRAPCFPMRVP-SKARSKRSRP---NGRPWT-LA  181

Query  694   SP--------------TSSFTEAPQPFVAPAVSSESENFAESPMKKLTTRPEAPEQkkkk  831
             SP                S + +P  F  P + +E  +  E P  K              
Sbjct  182   SPPLSSADSSSTSSSSLGSSSVSPFIFTNPVLDTEWFSSVEKPPAK--------------  227

Query  832   kikFTIPIAPVDTNQNQPPQAIRKCLHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLF  1011
                           Q + P    +C HC++ KTPQWR GP+GPKTLCNACGVR+KSGRLF
Sbjct  228   -------------KQKRKPXXXXRCTHCQVQKTPQWRTGPLGPKTLCNACGVRFKSGRLF  274

Query  1012  PEYRPAASPTFTPSLHSNSHKKVIEMRSK  1098
             PEYRPA SPTF+  +HSNSH+KV+EMR K
Sbjct  275   PEYRPACSPTFSQEMHSNSHRKVLEMRRK  303



>ref|XP_010264324.1| PREDICTED: GATA transcription factor 4-like [Nelumbo nucifera]
Length=268

 Score =   138 bits (348),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 96/296 (32%), Positives = 141/296 (48%), Gaps = 62/296 (21%)
 Frame = +1

Query  211   FDHIDDLIEFPPENECVGGVGSGEFKNFPSIWNDPLPDSEPLFSGSHNNSAADLSAELSV  390
             F HIDDL++F  ++         +  + P   N+P   + P  +  ++N +     +L V
Sbjct  11    FLHIDDLLDFSNDDL----FSDSDLIHLPPSENNP--GNRPSITTDNSNLSTSFPNDLCV  64

Query  391   PYEDIIQLEWLSTFVEDSFSGGGMTLGKENTPVNVEPPHNKFQTsspvsvlessssssss  570
             P +D+ +LEWLS FV+DS++         + P N    + K++                 
Sbjct  65    PNDDVAELEWLSKFVDDSYT---------DFPTNEPVGNTKYR-----------------  98

Query  571   sscsGGKTTIPLSPSRCGVQRARSKRPRPATFNPRPAIQLISPTSSFTEAPQPFVAPAVS  750
                     ++P         R RSKR R A           S   S+T  P+ ++ P   
Sbjct  99    -----ADASVP--------GRTRSKRSRAA-----------STHISWTSLPESYI-PVTG  133

Query  751   SESENFAESPMKKLTTRPEAPEQkkkkkikFTIPIAPVDTNQNQPPQAIRKCLHCEITKT  930
                   + + +   ++R     +K+       I  A    + +     +RKC HC   KT
Sbjct  134   KSKLGNSNTNINSTSSR-----KKEGSLASSVITAAEPSGSASSSSSGVRKCTHCASEKT  188

Query  931   PQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFTPSLHSNSHKKVIEMRSK  1098
             PQWR GP+GPKTLCNACGVRYKSGRL PEYRPAASPTF  + HSNSH+KV+E+R +
Sbjct  189   PQWRTGPLGPKTLCNACGVRYKSGRLVPEYRPAASPTFVLAQHSNSHRKVMELRRQ  244



>ref|XP_009795845.1| PREDICTED: GATA transcription factor 11-like isoform X1 [Nicotiana 
sylvestris]
Length=306

 Score =   139 bits (351),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 82/171 (48%), Positives = 101/171 (59%), Gaps = 27/171 (16%)
 Frame = +1

Query  631   RARSKRPRPATFNPRPAIQLISPTSSFTEAPQPFVAPAVSSESENFAESPMKKLTTRPEA  810
             R RSKRPR +  NP                    + P +SS    FA     K T     
Sbjct  133   RPRSKRPRSSALNPW------------------ILMPPISST--RFAS----KKTCDARK  168

Query  811   PEQkkkkkikFTIP-IAPVDTNQNQPPQ--AIRKCLHCEITKTPQWRAGPMGPKTLCNAC  981
              ++KK+K    ++P IA V   +    Q  + +KC HC++TKTPQWR GP+GPKTLCNAC
Sbjct  169   GKEKKRKMSLLSVPQIADVTKKKTTSAQQFSFKKCTHCQVTKTPQWREGPLGPKTLCNAC  228

Query  982   GVRYKSGRLFPEYRPAASPTFTPSLHSNSHKKVIEMRSKVGVENTAITEAP  1134
             GVRY+SGRLFPEYRPAASPTF P+LHSNSH+KV+EMR K     T+  E P
Sbjct  229   GVRYRSGRLFPEYRPAASPTFVPTLHSNSHRKVVEMRKKAIYGETSALEEP  279



>gb|KHN05677.1| GATA transcription factor 11 [Glycine soja]
Length=221

 Score =   137 bits (344),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 59/74 (80%), Positives = 67/74 (91%), Gaps = 0/74 (0%)
 Frame = +1

Query  877   NQPPQAIRKCLHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFTPSL  1056
             +Q   A+RKCLHCE+TKTPQWR GPMGPKTLCNACGVRY+SGRLF EYRPAASPTF  SL
Sbjct  141   SQESVALRKCLHCEVTKTPQWREGPMGPKTLCNACGVRYRSGRLFAEYRPAASPTFVSSL  200

Query  1057  HSNSHKKVIEMRSK  1098
             HSNSHKKV+E+R++
Sbjct  201   HSNSHKKVLEIRNR  214



>gb|EPS57111.1| hypothetical protein M569_17712, partial [Genlisea aurea]
Length=64

 Score =   132 bits (331),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 59/64 (92%), Positives = 62/64 (97%), Gaps = 0/64 (0%)
 Frame = +1

Query  901   KCLHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFTPSLHSNSHKKV  1080
             KCLHCEITKTPQWR+GP GPKTLCNACGVR+KSGRLFPEYRPAASPTF P+LHSNSHKKV
Sbjct  1     KCLHCEITKTPQWRSGPSGPKTLCNACGVRFKSGRLFPEYRPAASPTFVPALHSNSHKKV  60

Query  1081  IEMR  1092
             IEMR
Sbjct  61    IEMR  64



>ref|XP_009621794.1| PREDICTED: GATA transcription factor 11-like isoform X2 [Nicotiana 
tomentosiformis]
Length=305

 Score =   139 bits (350),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 82/171 (48%), Positives = 100/171 (58%), Gaps = 27/171 (16%)
 Frame = +1

Query  631   RARSKRPRPATFNPRPAIQLISPTSSFTEAPQPFVAPAVSSESENFAESPMKKLTTRPEA  810
             R RSKRPR +  NP   +  IS T                     FA     K T     
Sbjct  132   RPRSKRPRSSALNPWILMPPISAT--------------------RFAS----KKTCDARK  167

Query  811   PEQkkkkkikFTIP-IAPVDTNQNQPPQ--AIRKCLHCEITKTPQWRAGPMGPKTLCNAC  981
              ++KK+K    ++P IA V   +    Q  + +KC HC++TKTPQWR GP+GPKTLCNAC
Sbjct  168   GKEKKRKMSLLSVPQIADVTKKKTTSTQQSSFKKCTHCQVTKTPQWREGPLGPKTLCNAC  227

Query  982   GVRYKSGRLFPEYRPAASPTFTPSLHSNSHKKVIEMRSKVGVENTAITEAP  1134
             GVRY+SGRLFPEYRPAASPTF P+LHSNSH+KV+EMR K     T+  E P
Sbjct  228   GVRYRSGRLFPEYRPAASPTFVPTLHSNSHRKVVEMRKKALYGETSALEEP  278



>ref|XP_009621793.1| PREDICTED: GATA transcription factor 11-like isoform X1 [Nicotiana 
tomentosiformis]
Length=306

 Score =   139 bits (350),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 82/171 (48%), Positives = 100/171 (58%), Gaps = 27/171 (16%)
 Frame = +1

Query  631   RARSKRPRPATFNPRPAIQLISPTSSFTEAPQPFVAPAVSSESENFAESPMKKLTTRPEA  810
             R RSKRPR +  NP   +  IS T                     FA     K T     
Sbjct  133   RPRSKRPRSSALNPWILMPPISAT--------------------RFAS----KKTCDARK  168

Query  811   PEQkkkkkikFTIP-IAPVDTNQNQPPQ--AIRKCLHCEITKTPQWRAGPMGPKTLCNAC  981
              ++KK+K    ++P IA V   +    Q  + +KC HC++TKTPQWR GP+GPKTLCNAC
Sbjct  169   GKEKKRKMSLLSVPQIADVTKKKTTSTQQSSFKKCTHCQVTKTPQWREGPLGPKTLCNAC  228

Query  982   GVRYKSGRLFPEYRPAASPTFTPSLHSNSHKKVIEMRSKVGVENTAITEAP  1134
             GVRY+SGRLFPEYRPAASPTF P+LHSNSH+KV+EMR K     T+  E P
Sbjct  229   GVRYRSGRLFPEYRPAASPTFVPTLHSNSHRKVVEMRKKALYGETSALEEP  279



>gb|AFW64083.1| putative GATA transcription factor family protein [Zea mays]
Length=311

 Score =   139 bits (350),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 59/70 (84%), Positives = 65/70 (93%), Gaps = 0/70 (0%)
 Frame = +1

Query  892   AIRKCLHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFTPSLHSNSH  1071
             A+R+C HC+I KTPQWRAGP+GPKTLCNACGVRYKSGRLFPEYRPAASPTF PS+HSNSH
Sbjct  224   AVRRCTHCQIEKTPQWRAGPLGPKTLCNACGVRYKSGRLFPEYRPAASPTFVPSIHSNSH  283

Query  1072  KKVIEMRSKV  1101
             KKV+EMR K 
Sbjct  284   KKVVEMRQKA  293



>emb|CAC28528.1| GATA-1 zinc finger protein [Nicotiana tabacum]
Length=305

 Score =   139 bits (350),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 82/171 (48%), Positives = 101/171 (59%), Gaps = 27/171 (16%)
 Frame = +1

Query  631   RARSKRPRPATFNPRPAIQLISPTSSFTEAPQPFVAPAVSSESENFAESPMKKLTTRPEA  810
             R RSKRPR +  NP                    + P +SS    FA     K T     
Sbjct  132   RPRSKRPRSSALNPW------------------ILMPPISST--RFAS----KKTCDARK  167

Query  811   PEQkkkkkikFTIP-IAPVDTNQNQPPQ--AIRKCLHCEITKTPQWRAGPMGPKTLCNAC  981
              ++KK+K    ++P IA V   +    Q  + +KC HC++TKTPQWR GP+GPKTLCNAC
Sbjct  168   GKEKKRKMSLLSVPQIADVTKKKTTSGQQFSFKKCTHCQVTKTPQWREGPLGPKTLCNAC  227

Query  982   GVRYKSGRLFPEYRPAASPTFTPSLHSNSHKKVIEMRSKVGVENTAITEAP  1134
             GVRY+SGRLFPEYRPAASPTF P+LHSNSH+KV+EMR K     T+  E P
Sbjct  228   GVRYRSGRLFPEYRPAASPTFVPTLHSNSHRKVVEMRKKAIYGETSALEEP  278



>gb|AAK98698.1|AC069158_10 Putative GATA-1 zinc finger protein [Oryza sativa Japonica Group]
 gb|EAY87927.1| hypothetical protein OsI_09352 [Oryza sativa Indica Group]
Length=418

 Score =   141 bits (356),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 60/73 (82%), Positives = 66/73 (90%), Gaps = 0/73 (0%)
 Frame = +1

Query  883   PPQAIRKCLHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFTPSLHS  1062
             PP  +R+C HC+I KTPQWRAGP+GPKTLCNACGVRYKSGRLFPEYRPAASPTF PS+HS
Sbjct  328   PPGTVRRCTHCQIEKTPQWRAGPLGPKTLCNACGVRYKSGRLFPEYRPAASPTFMPSIHS  387

Query  1063  NSHKKVIEMRSKV  1101
             NSHKKV+EMR K 
Sbjct  388   NSHKKVVEMRQKA  400



>ref|XP_002324216.2| hypothetical protein POPTR_0018s08090g [Populus trichocarpa]
 gb|EEF02781.2| hypothetical protein POPTR_0018s08090g [Populus trichocarpa]
Length=353

 Score =   139 bits (351),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 93/237 (39%), Positives = 126/237 (53%), Gaps = 29/237 (12%)
 Frame = +1

Query  388   VPYEDIIQLEWLSTFVEDSFSGGGMTLGKENTPVNVEPPHNKFQTsspvsvlesssssss  567
             V Y+D+ +LEWLS FVE+SFS   +   +  + +   P  +              +++  
Sbjct  95    VQYDDLAELEWLSNFVEESFSSEDLQRLQLISGMKARPDESSKSRHFRTHGDTDDNNNGD  154

Query  568   ssscsGGKTTIPLSPSRCGVQRARSKRPRPATFNPRPAIQLISPTSSFTEAPQPFVAPAV  747
              S+ S    T+  +P      +ARSKR R A  N    + ++SPT+S             
Sbjct  155   VSNISNINNTM-FNPETAVPAKARSKRSRAAPGNWASRLLVLSPTTS-------------  200

Query  748   SSESENFAESPMKKLTTRPEAPEQkkkkkikFTIPIAPVDTNQNQPPQAI--RKCLHCEI  921
             SS++E  A  P    T  P + ++        TI +      ++   +    RKCLHC  
Sbjct  201   SSDTEIIA-GP----TPHPNSGKK--------TIKVEARQKKRDGGVEGCDGRKCLHCAT  247

Query  922   TKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFTPSLHSNSHKKVIEMR  1092
              KTPQWR GPMGPKTLCNACGVRYKSGRL PEYRPAASPTF  + HSNSH+KV+E+R
Sbjct  248   DKTPQWRTGPMGPKTLCNACGVRYKSGRLVPEYRPAASPTFMLTKHSNSHRKVLELR  304



>ref|XP_006372032.1| hypothetical protein POPTR_0018s08090g [Populus trichocarpa]
 gb|ERP49829.1| hypothetical protein POPTR_0018s08090g [Populus trichocarpa]
Length=264

 Score =   137 bits (345),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 92/235 (39%), Positives = 125/235 (53%), Gaps = 29/235 (12%)
 Frame = +1

Query  394   YEDIIQLEWLSTFVEDSFSGGGMTLGKENTPVNVEPPHNKFQTsspvsvlesssssssss  573
             Y+D+ +LEWLS FVE+SFS   +   +  + +   P  +              +++   S
Sbjct  8     YDDLAELEWLSNFVEESFSSEDLQRLQLISGMKARPDESSKSRHFRTHGDTDDNNNGDVS  67

Query  574   scsGGKTTIPLSPSRCGVQRARSKRPRPATFNPRPAIQLISPTSSFTEAPQPFVAPAVSS  753
             + S    T+  +P      +ARSKR R A  N    + ++SPT+S             SS
Sbjct  68    NISNINNTM-FNPETAVPAKARSKRSRAAPGNWASRLLVLSPTTS-------------SS  113

Query  754   ESENFAESPMKKLTTRPEAPEQkkkkkikFTIPIAPVDTNQNQPPQAI--RKCLHCEITK  927
             ++E  A  P    T  P + ++        TI +      ++   +    RKCLHC   K
Sbjct  114   DTEIIA-GP----TPHPNSGKK--------TIKVEARQKKRDGGVEGCDGRKCLHCATDK  160

Query  928   TPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFTPSLHSNSHKKVIEMR  1092
             TPQWR GPMGPKTLCNACGVRYKSGRL PEYRPAASPTF  + HSNSH+KV+E+R
Sbjct  161   TPQWRTGPMGPKTLCNACGVRYKSGRLVPEYRPAASPTFMLTKHSNSHRKVLELR  215



>ref|XP_002453007.1| hypothetical protein SORBIDRAFT_04g036520 [Sorghum bicolor]
 gb|EES05983.1| hypothetical protein SORBIDRAFT_04g036520 [Sorghum bicolor]
Length=434

 Score =   140 bits (354),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 59/70 (84%), Positives = 65/70 (93%), Gaps = 0/70 (0%)
 Frame = +1

Query  892   AIRKCLHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFTPSLHSNSH  1071
             A+R+C HC+I KTPQWRAGP+GPKTLCNACGVRYKSGRLFPEYRPAASPTF PS+HSNSH
Sbjct  347   AVRRCTHCQIEKTPQWRAGPLGPKTLCNACGVRYKSGRLFPEYRPAASPTFVPSIHSNSH  406

Query  1072  KKVIEMRSKV  1101
             KKV+EMR K 
Sbjct  407   KKVVEMRQKA  416



>gb|ACL54362.1| unknown [Zea mays]
 gb|AIB05491.1| C2C2-GATA transcription factor, partial [Zea mays]
Length=405

 Score =   140 bits (353),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 59/70 (84%), Positives = 65/70 (93%), Gaps = 0/70 (0%)
 Frame = +1

Query  892   AIRKCLHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFTPSLHSNSH  1071
             A+R+C HC+I KTPQWRAGP+GPKTLCNACGVRYKSGRLFPEYRPAASPTF PS+HSNSH
Sbjct  318   AVRRCTHCQIEKTPQWRAGPLGPKTLCNACGVRYKSGRLFPEYRPAASPTFVPSIHSNSH  377

Query  1072  KKVIEMRSKV  1101
             KKV+EMR K 
Sbjct  378   KKVVEMRQKA  387



>ref|NP_001146600.1| putative GATA transcription factor family protein isoform 1 [Zea 
mays]
 ref|XP_008677139.1| PREDICTED: putative GATA transcription factor family protein 
isoform 1 isoform X1 [Zea mays]
 ref|XP_008677140.1| PREDICTED: putative GATA transcription factor family protein 
isoform 1 isoform X1 [Zea mays]
 gb|ACN33964.1| unknown [Zea mays]
 gb|AFW64084.1| putative GATA transcription factor family protein isoform 1 [Zea 
mays]
 gb|AFW64085.1| putative GATA transcription factor family protein isoform 2 [Zea 
mays]
 gb|AFW64086.1| putative GATA transcription factor family protein isoform 3 [Zea 
mays]
Length=405

 Score =   140 bits (353),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 59/70 (84%), Positives = 65/70 (93%), Gaps = 0/70 (0%)
 Frame = +1

Query  892   AIRKCLHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFTPSLHSNSH  1071
             A+R+C HC+I KTPQWRAGP+GPKTLCNACGVRYKSGRLFPEYRPAASPTF PS+HSNSH
Sbjct  318   AVRRCTHCQIEKTPQWRAGPLGPKTLCNACGVRYKSGRLFPEYRPAASPTFVPSIHSNSH  377

Query  1072  KKVIEMRSKV  1101
             KKV+EMR K 
Sbjct  378   KKVVEMRQKA  387



>ref|XP_004954283.1| PREDICTED: GATA transcription factor 8-like isoform X1 [Setaria 
italica]
 ref|XP_004954284.1| PREDICTED: GATA transcription factor 8-like isoform X2 [Setaria 
italica]
Length=422

 Score =   140 bits (353),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 59/70 (84%), Positives = 65/70 (93%), Gaps = 0/70 (0%)
 Frame = +1

Query  892   AIRKCLHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFTPSLHSNSH  1071
             A+R+C HC+I KTPQWRAGP+GPKTLCNACGVRYKSGRLFPEYRPAASPTF PS+HSNSH
Sbjct  335   AVRRCTHCQIEKTPQWRAGPLGPKTLCNACGVRYKSGRLFPEYRPAASPTFVPSIHSNSH  394

Query  1072  KKVIEMRSKV  1101
             KKV+EMR K 
Sbjct  395   KKVVEMRQKA  404



>gb|AFW73937.1| putative GATA transcription factor family protein isoform 1 [Zea 
mays]
 gb|AFW73938.1| putative GATA transcription factor family protein isoform 2 [Zea 
mays]
 gb|AFW73939.1| putative GATA transcription factor family protein isoform 3 [Zea 
mays]
 gb|AFW73940.1| putative GATA transcription factor family protein isoform 4 [Zea 
mays]
 gb|AIB04338.1| C2C2-GATA transcription factor, partial [Zea mays]
Length=422

 Score =   140 bits (353),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 58/70 (83%), Positives = 65/70 (93%), Gaps = 0/70 (0%)
 Frame = +1

Query  892   AIRKCLHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFTPSLHSNSH  1071
             A+R+C HC+I KTPQWRAGP+GPKTLCNACGVRYKSGRLFPEYRPAASPTF PS+HSNSH
Sbjct  335   AVRRCTHCQIEKTPQWRAGPLGPKTLCNACGVRYKSGRLFPEYRPAASPTFVPSIHSNSH  394

Query  1072  KKVIEMRSKV  1101
             K+V+EMR K 
Sbjct  395   KRVVEMRQKA  404



>dbj|BAJ84868.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ87901.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=405

 Score =   140 bits (352),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 78/164 (48%), Positives = 92/164 (56%), Gaps = 13/164 (8%)
 Frame = +1

Query  631   RARSKRPRPATF-------NPRPAIQLISPTSSFTEAPQPFVAPAVSSESENFAESPMKK  789
             RARSKR R + F        P P   ++ PT  F+         + S E E  AES  + 
Sbjct  233   RARSKRSRASAFPTAIRAAVPAPEATILVPTPMFSSTS------SYSEEPECIAESNSQP  286

Query  790   LTTRPEAPEQkkkkkikFTIPIAPVDTNQNQPPQAIRKCLHCEITKTPQWRAGPMGPKTL  969
                +                           P   +R+C HC+I KTPQWRAGP+GPKTL
Sbjct  287   KKKKKAKRPTPPVTSDAEGDADYEEGGGAALPAGEVRRCTHCQIEKTPQWRAGPLGPKTL  346

Query  970   CNACGVRYKSGRLFPEYRPAASPTFTPSLHSNSHKKVIEMRSKV  1101
             CNACGVRYKSGRLFPEYRPAASPTF P++HSNSHKKV+EMR KV
Sbjct  347   CNACGVRYKSGRLFPEYRPAASPTFVPAIHSNSHKKVVEMRQKV  390



>ref|XP_007132266.1| hypothetical protein PHAVU_011G080200g [Phaseolus vulgaris]
 gb|ESW04260.1| hypothetical protein PHAVU_011G080200g [Phaseolus vulgaris]
Length=295

 Score =   137 bits (346),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 78/170 (46%), Positives = 105/170 (62%), Gaps = 20/170 (12%)
 Frame = +1

Query  598   IPLSPSRCGVQRARSKRPRPATFNPRPAIQLISPTSSFTEAPQPFVAPAVSSESENFAES  777
             +P+ P++    R RSKR   +      +I  I  + +F    Q F   AVS    +    
Sbjct  140   LPVIPTK----RPRSKRRALSNITLLYSIPFICTSPAF----QKFRRTAVSKS--DLETQ  189

Query  778   PMKKLTTRPEAPEQkkkkkikFTIPIAP---VDTNQNQPPQAIRKCLHCEITKTPQWRAG  948
             P+ KL++  +   +K        +P+     +  + ++   A+RKCLHCE+TKTPQWR G
Sbjct  190   PLGKLSSMVKKQRKK-------NVPLLANKEMKRSSSEESVAVRKCLHCEVTKTPQWREG  242

Query  949   PMGPKTLCNACGVRYKSGRLFPEYRPAASPTFTPSLHSNSHKKVIEMRSK  1098
             PMGPKTLCNACGVRY+SGRLF EYRPAASPTF  SLHSNSHKKV+E+R++
Sbjct  243   PMGPKTLCNACGVRYRSGRLFAEYRPAASPTFVGSLHSNSHKKVLEIRNR  292



>ref|XP_009406167.1| PREDICTED: GATA transcription factor 9-like [Musa acuminata subsp. 
malaccensis]
Length=332

 Score =   138 bits (348),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 94/250 (38%), Positives = 125/250 (50%), Gaps = 60/250 (24%)
 Frame = +1

Query  364   ADLSAELSVPYEDIIQLEWLSTFVEDSFSGGGMTLGKENTPVNVEPPHNKFQTsspvsvl  543
             A LS +L  P+E++ +LEWLS FVE+SFSG  +   +  +  N     + +  ++P    
Sbjct  94    ACLSGDLCGPHEELAELEWLSNFVEESFSGEDVHRPQLVSGTNPTTSLSSYPAAAP----  149

Query  544   esssssssssscsGGKTTIPLSPSRCGVQRARSKRPRPATFNPRPAIQLISPTSSFTEAP  723
                                 L P    + +ARSKR RPA  +      + SP+++     
Sbjct  150   ---------------AQPPRLRPEAPVLAKARSKRSRPAPCSWSSRALVFSPSTAT----  190

Query  724   QPFVAPAVSSESENFAESPMKKLTTRPEAPEQkkkkkikFTIPIAPVDTNQNQPPQAI--  897
                            A SP  +L   P A                P +  + Q   A+  
Sbjct  191   ---------------ASSPELELIKPPSA---------------VPGNKAKKQASAAVVG  220

Query  898   -----RKCLHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFTPSLHS  1062
                  ++CLHC+  KTPQWRAGPMGPKTLCNACGVRYKSGRL PEYRPAASPTF PS HS
Sbjct  221   SPREGQRCLHCQAEKTPQWRAGPMGPKTLCNACGVRYKSGRLVPEYRPAASPTFVPSKHS  280

Query  1063  NSHKKVIEMR  1092
             NSH+KV+E++
Sbjct  281   NSHRKVLELQ  290



>ref|XP_004242094.2| PREDICTED: GATA transcription factor 11-like [Solanum lycopersicum]
Length=258

 Score =   136 bits (342),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 76/173 (44%), Positives = 95/173 (55%), Gaps = 41/173 (24%)
 Frame = +1

Query  583   GGKTTIPLSPSRCGVQRARSKRPRPATFNPRPAIQLISPTSSFTEAPQPFVAPAVSSESE  762
             GG++ I  +    G +  RSKR R +T NP   +           AP P    A    S+
Sbjct  101   GGRSAISFN---FGSKGRRSKRARSSTLNPWLKM-----------APMPCTTSAAKKNSD  146

Query  763   N-FAESPMKKLTTRPEAPEQkkkkkikFTIPIAPVDTNQNQPPQAIRKCLHCEITKTPQW  939
             +   +   +KL++   +P                            ++C HCE+TKTPQW
Sbjct  147   SKIGKVNKRKLSSAMASP--------------------------LFKRCTHCEVTKTPQW  180

Query  940   RAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFTPSLHSNSHKKVIEMRSK  1098
             R GP+GPKTLCNACGVRY+SGRL PEYRPAASPTF PSLHSNSHKKV+EMR K
Sbjct  181   REGPLGPKTLCNACGVRYRSGRLLPEYRPAASPTFIPSLHSNSHKKVVEMRRK  233



>ref|XP_003597258.1| GATA transcription factor [Medicago truncatula]
 gb|AES67509.1| GATA type zinc finger transcription factor family protein [Medicago 
truncatula]
Length=312

 Score =   137 bits (346),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 74/161 (46%), Positives = 97/161 (60%), Gaps = 28/161 (17%)
 Frame = +1

Query  625   VQRARSKRPRPATFNPRPAIQLISPTSSFTEAPQPFVAPAVSSESENFAESPMKKLTTRP  804
             V+RARSKR RP++ NP  +I       SF  + Q       +SES+       K++ +  
Sbjct  149   VKRARSKRRRPSSLNPVFSI-------SFIASLQALHKKISASESDLNRVKKQKRMLS--  199

Query  805   EAPEQkkkkkikFTIPIAPVDTNQNQPPQAI--RKCLHCEITKTPQWRAGPMGPKTLCNA  978
                                ++T ++   +++  RKC HCE+T+TPQWR GP GPKTLCNA
Sbjct  200   -----------------GDIETKKSSSQESVVQRKCTHCEVTETPQWREGPNGPKTLCNA  242

Query  979   CGVRYKSGRLFPEYRPAASPTFTPSLHSNSHKKVIEMRSKV  1101
             CGVRY+SGRL+PEYRPA SPTF  S+HSNSHKKV+EMR  V
Sbjct  243   CGVRYRSGRLYPEYRPANSPTFVASVHSNSHKKVLEMRGVV  283



>ref|XP_008810653.1| PREDICTED: GATA transcription factor 12-like [Phoenix dactylifera]
Length=360

 Score =   138 bits (348),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 102/311 (33%), Positives = 149/311 (48%), Gaps = 50/311 (16%)
 Frame = +1

Query  220   IDDLIEFPPENECVGGVGSGEFKNFPS---------------IWNDPLPDSEPLFSGS--  348
             ++DL++F  E +  G    G+   F +                 ++    S+P FSG   
Sbjct  39    VEDLLDFSNEEDEAGLAAGGDDAGFDAPAGNSTDSSTVTAVDSCSNSFSGSDPHFSGDLV  98

Query  349   -HNNSAADLSAELSVPYEDIIQLEWLSTFVEDSFSGGGMTLGKENTPVNVEPPHNKFQTs  525
               + +   LS  L  PY+++ +LEWLS FVE+SFS   +   +  + +      ++ +  
Sbjct  99    CRSFAGTSLSGGLCEPYDELAELEWLSNFVEESFSSEDLQKLQLISGIKSSSSSSENRAE  158

Query  526   spvsvlesssssssssscsGGKTTIPLSPSRCGVQRARSKRPRPATFNPRPAIQLISPTS  705
                 V E ++   +  +    +  +P         +ARSKR R A  +    + ++SPT+
Sbjct  159   ISPPVGEGAAGRDAQPALFRPEAPVP--------GKARSKRSRAAPCSWSSRLLVLSPTT  210

Query  706   SFTEAPQPFVAPAVSSESENFAESPMKKLTTRPEAPEQkkkkkikFTIPIAPVDTNQNQP  885
             + +      +  A SS  +  A       + RP                +AP        
Sbjct  211   TASSPESELLVLAESSYGKKAAAKKKDP-SARP---------------AVAPAADG----  250

Query  886   PQAIRKCLHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFTPSLHSN  1065
                 R+CLHC   KTPQWR GPMGPKTLCNACGVRYKSGRL PEYRPAASPTF  S HSN
Sbjct  251   ----RRCLHCATDKTPQWRTGPMGPKTLCNACGVRYKSGRLVPEYRPAASPTFMLSKHSN  306

Query  1066  SHKKVIEMRSK  1098
             SH+KV+E+R +
Sbjct  307   SHRKVLELRRQ  317



>ref|XP_004235652.1| PREDICTED: GATA transcription factor 12-like [Solanum lycopersicum]
Length=350

 Score =   138 bits (347),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 100/243 (41%), Positives = 134/243 (55%), Gaps = 37/243 (15%)
 Frame = +1

Query  373   SAELSVPYEDIIQLEWLSTFVEDSFSGGGMTLGKENTPVNVEPPHNKFQTsspvsvless  552
             ++EL VP++D+ +LEWLS FVE+SFS   +    +  PV           +   S   ++
Sbjct  97    NSELCVPFDDLAELEWLSNFVEESFSSDDVQ-NLQFIPV----------ANINSSSTVTT  145

Query  553   sssssssscsGGKTTIPLSPSRCGV-QRARSKRPRPATFNPRPAIQLISPTSSFTEAPQP  729
              SSSS+++ S G  + P  P+   V  +ARSKR R A  +    +QL+            
Sbjct  146   DSSSSATTFSTGPNSPPAFPADTSVPGKARSKRSRAAPCDWSSRLQLL------------  193

Query  730   FVAPAVSSESENFAESPMKKLTTRPEAPEQkkkkkikFTIPIAPVDTNQNQPPQAIRKCL  909
              ++PA SS   N    P    TT   A   K   K + ++          + P   RKCL
Sbjct  194   -LSPATSSSESNNISPPSVNNTTFATAKATKAPSKKRESV----------ETPG--RKCL  240

Query  910   HCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFTPSLHSNSHKKVIEM  1089
             HC   KTPQWR GP+GPKTLCNACGVRYKSGRL PEYRPA+SPTF  + HSNSH+KV+E+
Sbjct  241   HCASDKTPQWRTGPLGPKTLCNACGVRYKSGRLVPEYRPASSPTFISARHSNSHRKVLEL  300

Query  1090  RSK  1098
             R +
Sbjct  301   RRQ  303



>ref|XP_002313763.2| hypothetical protein POPTR_0009s12620g [Populus trichocarpa]
 gb|EEE87718.2| hypothetical protein POPTR_0009s12620g [Populus trichocarpa]
Length=329

 Score =   137 bits (345),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 93/258 (36%), Positives = 129/258 (50%), Gaps = 53/258 (21%)
 Frame = +1

Query  370   LSAELSVPYEDIIQLEWLSTFVEDSFSGGGMTL------GKENTPVNVEPPHNKFQTssp  531
             L++EL+VP +DI +LEW+S FV+DS S   + +       K +     EP          
Sbjct  99    LASELAVPTDDIAELEWVSHFVDDSVSDVSLLVPACKGSSKRHAKNRFEP----------  148

Query  532   vsvlesssssssssscsGGKTTIPLSPSRCGVQRARSKRPRPA--TFNPRPAIQLISPTS  705
                          +  +  KT+  L PSR    +AR+KR RP   T++          +S
Sbjct  149   ------------ETKPTFAKTSC-LFPSRVP-SKARTKRSRPTGRTWSAGSNQSETPSSS  194

Query  706   SFTEAPQPFVAPAVSSESEN----FAESPMKKLTTRPEAPEQkkkkkikFTIPIAPVDTN  873
             + + +  P +    + ++ +     +E PMK    RP           +F          
Sbjct  195   TSSTSSMPCLVATNTVQTADSLSWLSEQPMKISKKRPAVHTSGLMASTQFQ---------  245

Query  874   QNQPPQAIRKCLHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFTPS  1053
                     R+C HC++ KTPQWR GP+G KTLCNACGVRYKSGRLFPEYRPA SPTF+  
Sbjct  246   --------RRCSHCQVQKTPQWRTGPLGAKTLCNACGVRYKSGRLFPEYRPACSPTFSSE  297

Query  1054  LHSNSHKKVIEMRSKVGV  1107
             +HSNSH+KV+EMR K  V
Sbjct  298   VHSNSHRKVLEMRRKKEV  315



>ref|XP_009410893.1| PREDICTED: GATA transcription factor 12-like isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=373

 Score =   138 bits (347),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 95/260 (37%), Positives = 138/260 (53%), Gaps = 21/260 (8%)
 Frame = +1

Query  364   ADLSAELSVP-YEDIIQLEWLSTFVEDSFSGGGMTLGKENTPVNVEPPHNKFQTsspvsv  540
             A  S +L  P YE++ +LEWLS FVE+SFS     L K +    V        +++  + 
Sbjct  97    ASRSGDLCEPQYEELAELEWLSNFVEESFSS--EDLHKLHPISGVSSTTTGSSSTTTAAA  154

Query  541   lesssssssssscsGGKT--TIPLSPSRCGVQRARSKRPRPATFNPRPAIQLISPTSSFT  714
                +  S+ +   +GG+     P  P      +ARSKR R A  +    + ++SP+ +  
Sbjct  155   ATRAEVSAHTQVAAGGRVNHVAPFRPEAIVPGKARSKRSRAAPCSWSSRLLVLSPSLATA  214

Query  715   EAPQP-FVAPAVSSESENFAESPMKKLTTRPEAPEQkkkkkikFTIPIAPVDTNQNQPPQ  891
              +P+   + PA ++ +        K +  +P + ++           +A  D        
Sbjct  215   SSPESELIVPASAAAASAGGGGGKKAV--KPASKKKDLTAGTA----VAAGDG-------  261

Query  892   AIRKCLHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFTPSLHSNSH  1071
               RKCLHC+  KTPQWR GP+GPKTLCNACGVRYKSGRL PEYRPAASPTF  S HSNSH
Sbjct  262   --RKCLHCQTDKTPQWRTGPLGPKTLCNACGVRYKSGRLVPEYRPAASPTFVVSKHSNSH  319

Query  1072  KKVIEMRSKVGVENTAITEA  1131
             +KV+E+R +  ++   +  A
Sbjct  320   RKVLELRRQKELQQQQLFHA  339



>ref|XP_009394171.1| PREDICTED: GATA transcription factor 9-like isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=361

 Score =   137 bits (346),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 96/249 (39%), Positives = 127/249 (51%), Gaps = 31/249 (12%)
 Frame = +1

Query  364   ADLSAELSVP-YEDIIQLEWLSTFVEDSFSGGGMTLGKENTPVNVEPPHNKFQTsspvsv  540
             A LS +L  P Y+++ +LEWLS FVE+SFS   +      + VN     ++   ++    
Sbjct  98    ASLSGDLCEPQYDELAELEWLSNFVEESFSSEDLHKLHLISGVNSTTTSSRTTAAAATRA  157

Query  541   lesssssssssscsGGKTTIPLSPSRCGVQRARSKRPRPATFNPRPAIQLISPTSSFTEA  720
               S+  +++  +    +  +P         +ARSKR R A  +    + ++SP  S T A
Sbjct  158   EFSAQEAANQVAPFRAEALVP--------GKARSKRSRAAPCSWSSRLLVLSP--SLTAA  207

Query  721   PQPFVAPAVSSESENFAESPMKKLTTRPEAPEQkkkkkikFTIPIAPVDTNQNQPPQAI-  897
             P                 SP  +L   P A       K          D +      A  
Sbjct  208   P-----------------SPESELIVPPSAAAAGAGGKKAAKPASKKKDMSAGPAVAAAP  250

Query  898   --RKCLHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFTPSLHSNSH  1071
               RKCLHC+  KTPQWR GPMGPKTLCNACGVRYKSGRL PEYRPAASPTF  S HSNSH
Sbjct  251   DGRKCLHCQTDKTPQWRTGPMGPKTLCNACGVRYKSGRLVPEYRPAASPTFVVSKHSNSH  310

Query  1072  KKVIEMRSK  1098
             +KV+E+R +
Sbjct  311   RKVLELRRQ  319



>ref|XP_003539767.1| PREDICTED: GATA transcription factor 11-like [Glycine max]
Length=304

 Score =   136 bits (342),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 58/74 (78%), Positives = 67/74 (91%), Gaps = 0/74 (0%)
 Frame = +1

Query  877   NQPPQAIRKCLHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFTPSL  1056
             +Q   A+RKCLHCE+TKTPQWR GPMGPKTLCNACGVRY+SGRLF EYRPAASPTF  SL
Sbjct  224   SQESVALRKCLHCEVTKTPQWREGPMGPKTLCNACGVRYRSGRLFAEYRPAASPTFVSSL  283

Query  1057  HSNSHKKVIEMRSK  1098
             HS+SHKKV+E+R++
Sbjct  284   HSDSHKKVLEIRNR  297



>gb|KHG09661.1| GATA transcription factor 11 -like protein [Gossypium arboreum]
Length=314

 Score =   136 bits (343),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 58/69 (84%), Positives = 62/69 (90%), Gaps = 0/69 (0%)
 Frame = +1

Query  892   AIRKCLHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFTPSLHSNSH  1071
              IRKC HCE+T+TPQWR GPMGPKTLCNACGVRY+SGRLFPEYRPA SPTF  SLHSNSH
Sbjct  221   VIRKCGHCEVTETPQWRKGPMGPKTLCNACGVRYRSGRLFPEYRPAGSPTFIASLHSNSH  280

Query  1072  KKVIEMRSK  1098
             KKV+EMR K
Sbjct  281   KKVVEMRRK  289



>ref|XP_010109771.1| hypothetical protein L484_008447 [Morus notabilis]
 gb|EXC24676.1| hypothetical protein L484_008447 [Morus notabilis]
Length=310

 Score =   136 bits (342),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 97/255 (38%), Positives = 130/255 (51%), Gaps = 61/255 (24%)
 Frame = +1

Query  355   NSAADLSAELSVPYEDIIQLEWLSTFVEDSFSGGGMT--LGKENTPVNVEPPHNKFQTss  528
             +S + L++ L+VP +DI +LEW+S FV+DS S   +   LGK+ T  N   P  +     
Sbjct  93    DSESPLTSALAVPDDDIAELEWVSHFVDDSVSDFSLLHPLGKQRTEANWYEPEPR-----  147

Query  529   pvsvlesssssssssscsGGKT-----TIPLSPSRCGVQRARSKRPRPATFNPRPAIQLI  693
                                GKT     ++P+ P        R+KR RP T   RP+    
Sbjct  148   -----------------PTGKTPLCFPSVPVRP--------RTKRARPTT---RPSPLSQ  179

Query  694   SPTSSFTEAPQPFVAPAVSSESENFAESPMKKLTTRPEAPEQkkkkkikFTIPIAPVDTN  873
                SS +       +  +   S+   E   KK   +P A +           P +    +
Sbjct  180   LSESSSSSM-----SNLIFVLSKAIREPARKKQKIKPAAVQ-----------PGSGSTGS  223

Query  874   QNQPPQAIRKCLHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFTPS  1053
             Q Q     R+C HC++ KTPQWRAGP+G KTLCNACGVR+KSGRLFPEYRPA SPTF   
Sbjct  224   QFQ-----RRCSHCQVQKTPQWRAGPLGAKTLCNACGVRFKSGRLFPEYRPACSPTFCSD  278

Query  1054  LHSNSHKKVIEMRSK  1098
             +HSNSH+KV+EMR K
Sbjct  279   VHSNSHRKVLEMRKK  293



>ref|XP_006365758.1| PREDICTED: GATA transcription factor 10-like [Solanum tuberosum]
Length=258

 Score =   134 bits (337),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 74/172 (43%), Positives = 97/172 (56%), Gaps = 44/172 (26%)
 Frame = +1

Query  583   GGKTTIPLSPSRCGVQRARSKRPRPATFNPRPAIQLISPTSSFTEAPQPFVAPAVSSESE  762
             GG++ I  +    G +  RSKR R +T NP     +++P             P  +S ++
Sbjct  110   GGRSAISFN---FGSKGRRSKRARSSTLNP---WLMMAPI------------PCTTSAAK  151

Query  763   NFAESPMKKLTTRPEAPEQkkkkkikFTIPIAPVDTNQNQPPQAIRKCLHCEITKTPQWR  942
               ++S   KL++   +P                            ++C HCE+TKTPQWR
Sbjct  152   KNSDSKSGKLSSAKGSP--------------------------LFKRCTHCEVTKTPQWR  185

Query  943   AGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFTPSLHSNSHKKVIEMRSK  1098
              GP+GPKTLCNACGVRY+SGRL PEYRPAASPTF PSLHSNSH+KV+EMR K
Sbjct  186   EGPLGPKTLCNACGVRYRSGRLLPEYRPAASPTFIPSLHSNSHRKVVEMRRK  237



>gb|KHG05024.1| GATA transcription factor 11 -like protein [Gossypium arboreum]
Length=347

 Score =   136 bits (342),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 59/79 (75%), Positives = 67/79 (85%), Gaps = 0/79 (0%)
 Frame = +1

Query  886   PQAIRKCLHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFTPSLHSN  1065
             P  I KC HCE+T+TPQWR GPMGPKTLCNACGVRY+SGRLFPEYRPAASPTF  S+HSN
Sbjct  262   PVVIMKCTHCEVTETPQWREGPMGPKTLCNACGVRYRSGRLFPEYRPAASPTFVASMHSN  321

Query  1066  SHKKVIEMRSKVGVENTAI  1122
             SHKKV+EMR K  +  ++I
Sbjct  322   SHKKVVEMRKKAKLPLSSI  340



>ref|XP_003603626.1| GATA transcription factor [Medicago truncatula]
 gb|AES73877.1| GATA transcription factor, putative [Medicago truncatula]
Length=318

 Score =   135 bits (340),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 97/250 (39%), Positives = 126/250 (50%), Gaps = 51/250 (20%)
 Frame = +1

Query  349   HNNSAADLSAELSVPYEDIIQLEWLSTFVEDSFSGGGMTLGKENTPVNVEPPHNKFQTss  528
              N++    S ELSVPY+D+ +LEW+S F E+SFS     L K      ++ P+N      
Sbjct  75    QNSADGPFSGELSVPYDDLAELEWVSKFAEESFSSED--LHKLQLISGLKAPNN------  126

Query  529   pvsvlesssssssssscsGGKTTIPLSPSRCGVQRARSKRPRPATFNPRPAIQLISPTSS  708
                   +S     S+     + ++P         +ARSKR R    N    + ++SPT++
Sbjct  127   -----VASKPYEESNPTVHSQVSVP--------AKARSKRSRVPPCNWTSRLLVLSPTTT  173

Query  709   FTEAPQPFVAPAVSSESENFAESPMKKLTTRPEAPEQkkkkkikFTIPIAPVDTNQNQPP  888
              T           SS S+  A  P KK + R   P    +                    
Sbjct  174   TT------TTTTTSSHSDTMA--PPKKPSPRKRDPNDGGEG-------------------  206

Query  889   QAIRKCLHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFTPSLHSNS  1068
                RKCLHC   KTPQWR GP+GPKTLCNACGVRYKSGRL PEYRPAASPTF  + HSNS
Sbjct  207   ---RKCLHCATDKTPQWRTGPLGPKTLCNACGVRYKSGRLVPEYRPAASPTFVLTKHSNS  263

Query  1069  HKKVIEMRSK  1098
             H+KV E+R +
Sbjct  264   HRKVQELRRQ  273



>emb|CDY06293.1| BnaA09g49100D [Brassica napus]
Length=256

 Score =   134 bits (336),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 58/79 (73%), Positives = 66/79 (84%), Gaps = 0/79 (0%)
 Frame = +1

Query  895   IRKCLHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFTPSLHSNSHK  1074
             +R+C HCE TKTPQWR GP GPKTLCNACGVR++SGRL PEYRPA+SPTF PSLHSNSH+
Sbjct  178   VRRCTHCETTKTPQWREGPNGPKTLCNACGVRFRSGRLVPEYRPASSPTFIPSLHSNSHR  237

Query  1075  KVIEMRSKVGVENTAITEA  1131
             K+IEMR K G E   +T A
Sbjct  238   KIIEMRRKEGDEFDNLTTA  256



>gb|KHN38758.1| GATA transcription factor 11 [Glycine soja]
Length=305

 Score =   134 bits (338),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 58/74 (78%), Positives = 66/74 (89%), Gaps = 0/74 (0%)
 Frame = +1

Query  877   NQPPQAIRKCLHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFTPSL  1056
             +Q   A RKCLHCE+TKTPQWR GPMGPKTLCNACGVRY+SGRLF EYRPA+SPTF  SL
Sbjct  225   SQESVAPRKCLHCEVTKTPQWREGPMGPKTLCNACGVRYRSGRLFAEYRPASSPTFVASL  284

Query  1057  HSNSHKKVIEMRSK  1098
             HSNSHKKV+E+R++
Sbjct  285   HSNSHKKVLEIRNR  298



>ref|XP_003538192.1| PREDICTED: GATA transcription factor 11-like [Glycine max]
Length=305

 Score =   134 bits (337),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 58/74 (78%), Positives = 66/74 (89%), Gaps = 0/74 (0%)
 Frame = +1

Query  877   NQPPQAIRKCLHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFTPSL  1056
             +Q   A RKCLHCE+TKTPQWR GPMGPKTLCNACGVRY+SGRLF EYRPA+SPTF  SL
Sbjct  225   SQESVAPRKCLHCEVTKTPQWREGPMGPKTLCNACGVRYRSGRLFAEYRPASSPTFVASL  284

Query  1057  HSNSHKKVIEMRSK  1098
             HSNSHKKV+E+R++
Sbjct  285   HSNSHKKVLEIRNR  298



>gb|ACU23703.1| unknown [Glycine max]
Length=305

 Score =   134 bits (336),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 58/74 (78%), Positives = 66/74 (89%), Gaps = 0/74 (0%)
 Frame = +1

Query  877   NQPPQAIRKCLHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFTPSL  1056
             +Q   A RKCLHCE+TKTPQWR GPMGPKTLCNACGVRY+SGRLF EYRPA+SPTF  SL
Sbjct  225   SQESVAPRKCLHCEVTKTPQWREGPMGPKTLCNACGVRYRSGRLFAEYRPASSPTFVASL  284

Query  1057  HSNSHKKVIEMRSK  1098
             HSNSHKKV+E+R++
Sbjct  285   HSNSHKKVLEIRNR  298



>ref|XP_006644696.1| PREDICTED: GATA transcription factor 12-like [Oryza brachyantha]
Length=385

 Score =   135 bits (340),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 98/252 (39%), Positives = 138/252 (55%), Gaps = 24/252 (10%)
 Frame = +1

Query  364   ADLSAELSVPYEDIIQLEWLSTFV---EDSFSGGGMTLGKENTPVNVEPPHNKFQTsspv  534
              D S EL  PY+ + +LEWLS ++   ED+F+    T       +    P   F T+  +
Sbjct  91    GDFSGELCEPYDQLAELEWLSNYMVEGEDTFA----TEDLHKLQLISGIPSGGFSTACAL  146

Query  535   svlesssssssssscsGGKTTIPLSPSRCGVQRARSKRPRPATFNPRPAIQLISPTSSFT  714
             S   + +++S++    G    +P +P      +ARSKR R A  N    + ++ P  +  
Sbjct  147   SAQAAPAAASAAVQPGG---FLPEAPVPA---KARSKRSRAAPGNWSSRLLVLPPPPASP  200

Query  715   EAPQPF-VAPAVSSESEN-FAESPMKKLTTRPEAPEQkkkkkikFTIPIAPVDTNQNQPP  888
              +P    ++PA S  S + F      K   + +AP Q +       +   PV +  + P 
Sbjct  201   PSPASMAISPAESGVSAHAFPVKKPSKPAKKKDAPPQPQ-------LSSVPVHSGGSAPV  253

Query  889   QA--IRKCLHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFTPSLHS  1062
              A   R+C+HC+  KTPQWR GPMGPKTLCNACGVRYKSGRL PEYRPAASPTF  S HS
Sbjct  254   AAGEGRRCVHCDTDKTPQWRTGPMGPKTLCNACGVRYKSGRLVPEYRPAASPTFVVSKHS  313

Query  1063  NSHKKVIEMRSK  1098
             NSH+KV+E+R +
Sbjct  314   NSHRKVMELRRQ  325



>ref|XP_007205805.1| hypothetical protein PRUPE_ppa010692mg [Prunus persica]
 gb|EMJ07004.1| hypothetical protein PRUPE_ppa010692mg [Prunus persica]
Length=240

 Score =   131 bits (330),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 54/67 (81%), Positives = 63/67 (94%), Gaps = 0/67 (0%)
 Frame = +1

Query  898   RKCLHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFTPSLHSNSHKK  1077
             ++C+HC +TKTPQWR GP+GPKTLCNACGVRY+SGRLFPEYRPAASPTF  S+HSNSHKK
Sbjct  160   KRCMHCAVTKTPQWREGPLGPKTLCNACGVRYRSGRLFPEYRPAASPTFVASVHSNSHKK  219

Query  1078  VIEMRSK  1098
             VIE+R+K
Sbjct  220   VIELRNK  226



>ref|XP_009598797.1| PREDICTED: GATA transcription factor 11-like isoform X2 [Nicotiana 
tomentosiformis]
Length=250

 Score =   132 bits (331),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 56/66 (85%), Positives = 60/66 (91%), Gaps = 0/66 (0%)
 Frame = +1

Query  895   IRKCLHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFTPSLHSNSHK  1074
              +KC HCE+TKTPQWR GP+GPKTLCNACGVRY+SGRL PEYRPAASPTF PSLHSNSH 
Sbjct  166   FKKCTHCEVTKTPQWREGPLGPKTLCNACGVRYRSGRLLPEYRPAASPTFVPSLHSNSHM  225

Query  1075  KVIEMR  1092
             KVIEMR
Sbjct  226   KVIEMR  231



>ref|XP_010089971.1| Protein-tyrosine sulfotransferase [Morus notabilis]
 gb|EXB38685.1| Protein-tyrosine sulfotransferase [Morus notabilis]
Length=820

 Score =   139 bits (349),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 81/159 (51%), Positives = 102/159 (64%), Gaps = 12/159 (8%)
 Frame = +1

Query  625   VQRARSK-RPRPATFNPRPAIQLISPTSSFTEAPQPFVAPAVSSESENFAESPMKKLTTR  801
             V+R RSK R RP+ F+    +  I        A    + P+ +SES+  A    K   T 
Sbjct  644   VKRPRSKKRSRPSNFDRLYTLPFI--------AALERLRPSAASESDLGAPQVGKMFKTA  695

Query  802   PEAPEQkkkkkikFTIPIAPVDTNQNQPPQAIRKCLHCEITKTPQWRAGPMGPKTLCNAC  981
              +A ++K+       I +  V + Q+     I+KC HC++T TPQWR GPMGPKTLCNAC
Sbjct  696   KKAMKKKRATPHPIGIEVRNVSSQQSGE---IKKCTHCQMTTTPQWREGPMGPKTLCNAC  752

Query  982   GVRYKSGRLFPEYRPAASPTFTPSLHSNSHKKVIEMRSK  1098
             GVR++SGRLFPEYRPAASPTF PSLHSNSHKKVIEMR+K
Sbjct  753   GVRFRSGRLFPEYRPAASPTFVPSLHSNSHKKVIEMRNK  791



>ref|XP_009774660.1| PREDICTED: GATA transcription factor 11-like [Nicotiana sylvestris]
Length=282

 Score =   132 bits (332),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 55/66 (83%), Positives = 61/66 (92%), Gaps = 0/66 (0%)
 Frame = +1

Query  895   IRKCLHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFTPSLHSNSHK  1074
              +KC HCE+T+TPQWR GP+GPKTLCNACGVRY+SGRL PEYRPAASPTF PSLHSNSH+
Sbjct  186   FKKCTHCEVTRTPQWREGPLGPKTLCNACGVRYRSGRLLPEYRPAASPTFVPSLHSNSHR  245

Query  1075  KVIEMR  1092
             KVIEMR
Sbjct  246   KVIEMR  251



>ref|XP_010542590.1| PREDICTED: GATA transcription factor 11-like [Tarenaya hassleriana]
 ref|XP_010542591.1| PREDICTED: GATA transcription factor 11-like [Tarenaya hassleriana]
Length=288

 Score =   132 bits (332),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 77/163 (47%), Positives = 92/163 (56%), Gaps = 20/163 (12%)
 Frame = +1

Query  625   VQRARSKRPRPATFNPRPAIQLISPTSSFTEAPQPFVAPAVSSESENFAESPMKKLTTRP  804
             V+  RSKR RP        +    PT S    P+     AV   SE   +   KK    P
Sbjct  128   VKGVRSKRKRPTALKLGLLLPPFEPTKSQQLPPEESEYEAVYYPSEKPGKKKSKKNKIHP  187

Query  805   EAPEQkkkkkikFTIPIAPVDTNQNQPPQA---IRKCLHCEITKTPQWRAGPMGPKTLCN  975
                                +D+  ++P  +   +RKC HCE TKTPQWR GP GPKTLCN
Sbjct  188   TH-----------------LDSANSEPKNSEGTVRKCTHCETTKTPQWREGPNGPKTLCN  230

Query  976   ACGVRYKSGRLFPEYRPAASPTFTPSLHSNSHKKVIEMRSKVG  1104
             ACGVR++SGRL PEYRPAASPTF PS+HSNSH+K+IEMRSK G
Sbjct  231   ACGVRFRSGRLVPEYRPAASPTFVPSVHSNSHRKIIEMRSKDG  273



>ref|XP_004506013.1| PREDICTED: GATA transcription factor 11-like [Cicer arietinum]
Length=317

 Score =   133 bits (334),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 59/79 (75%), Positives = 67/79 (85%), Gaps = 0/79 (0%)
 Frame = +1

Query  874   QNQPPQAIRKCLHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFTPS  1053
             ++Q   A RKC+HCE+T+TPQWR GP GPKTLCNACGVRY+SGRLFPEYRPAASPTF  S
Sbjct  220   KSQESVAPRKCMHCEVTETPQWREGPKGPKTLCNACGVRYRSGRLFPEYRPAASPTFEAS  279

Query  1054  LHSNSHKKVIEMRSKVGVE  1110
              HSNSHKKV+EMR+K   E
Sbjct  280   SHSNSHKKVLEMRNKASQE  298



>ref|XP_003540668.1| PREDICTED: GATA transcription factor 7-like [Glycine max]
 gb|KHN25424.1| GATA transcription factor 7 [Glycine soja]
Length=289

 Score =   132 bits (332),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 59/89 (66%), Positives = 71/89 (80%), Gaps = 1/89 (1%)
 Frame = +1

Query  874   QNQPPQAIRKCLHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFTPS  1053
             QN   Q++R+C HC++ KTPQWR GP+GPKTLCNACGVR+KSGRLFPEYRPA SPTF+  
Sbjct  200   QNGGAQSLRRCSHCQVQKTPQWRTGPLGPKTLCNACGVRFKSGRLFPEYRPACSPTFSDD  259

Query  1054  LHSNSHKKVIEMRSKVG-VENTAITEAPS  1137
             +HSNSH+KV+EMR K   VE+  I   PS
Sbjct  260   IHSNSHRKVLEMRRKKEIVESDRIQLIPS  288



>ref|NP_001044227.1| Os01g0745700 [Oryza sativa Japonica Group]
 dbj|BAC05593.1| putative AG-motif binding protein-4 [Oryza sativa Japonica Group]
 dbj|BAF06141.1| Os01g0745700 [Oryza sativa Japonica Group]
Length=387

 Score =   134 bits (338),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 112/318 (35%), Positives = 161/318 (51%), Gaps = 34/318 (11%)
 Frame = +1

Query  199   CGSFFDHIDDLIEFP--------PENECVGGVGSGEFKNFPSIWNDPLPDSEPL-----F  339
             CG  F  +DDL+  P         E E  GG      K   + + +   DS  +      
Sbjct  27    CGDHFA-VDDLLVLPYGEEDETTREGEATGG------KEEAAGFGNASADSSTITALDSC  79

Query  340   SGSHNNSAADLSAELSVPYEDIIQLEWLSTFV---EDSFSGGGMTLGKENTPVNVEPPHN  510
             S S   +  D   EL  PY+ + +LEWLS ++   +D+F+    T   +   +    P  
Sbjct  80    SNSFGLADGDFPGELCEPYDQLAELEWLSNYMNEGDDAFA----TEDLQKLQLISGIPSG  135

Query  511   KFQTsspvsvlesssssssssscsGGKTTIPLSPSRCGVQRARSKRPRPATFNPRPAIQL  690
              F T+S  S    ++S+++S +   G   +P +P      +ARSKR R A  N    + +
Sbjct  136   GFSTASVPSAQAQAASAAASMAVQPGGF-LPEAPVPA---KARSKRSRAAPGNWSSRLLV  191

Query  691   ISPTSSFTEAPQPF-VAPAVSSESEN-FAESPMKKLTTRPEAPEQkkkkkikFTIPIAPV  864
             + P  +   +P    ++PA S  S + F      K   + +AP    + ++  ++P+   
Sbjct  192   LPPPPASPPSPASMAISPAESGVSAHAFPIKKPSKPAKKKDAPAPPAQAQLS-SVPVHSG  250

Query  865   DTNQNQPPQAIRKCLHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTF  1044
              +         R+CLHCE  KTPQWR GPMGPKTLCNACGVRYKSGRL PEYRPAASPTF
Sbjct  251   GSAPAAAAGEGRRCLHCETDKTPQWRTGPMGPKTLCNACGVRYKSGRLVPEYRPAASPTF  310

Query  1045  TPSLHSNSHKKVIEMRSK  1098
               S HSNSH+KV+E+R +
Sbjct  311   MVSKHSNSHRKVLELRRQ  328



>ref|XP_009598796.1| PREDICTED: GATA transcription factor 11-like isoform X1 [Nicotiana 
tomentosiformis]
Length=264

 Score =   131 bits (330),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 56/66 (85%), Positives = 60/66 (91%), Gaps = 0/66 (0%)
 Frame = +1

Query  895   IRKCLHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFTPSLHSNSHK  1074
              +KC HCE+TKTPQWR GP+GPKTLCNACGVRY+SGRL PEYRPAASPTF PSLHSNSH 
Sbjct  180   FKKCTHCEVTKTPQWREGPLGPKTLCNACGVRYRSGRLLPEYRPAASPTFVPSLHSNSHM  239

Query  1075  KVIEMR  1092
             KVIEMR
Sbjct  240   KVIEMR  245



>gb|EYU37853.1| hypothetical protein MIMGU_mgv1a009692mg [Erythranthe guttata]
Length=334

 Score =   133 bits (335),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 97/267 (36%), Positives = 120/267 (45%), Gaps = 76/267 (28%)
 Frame = +1

Query  373   SAELSVPYEDIIQLEWLSTFVEDSFSGGGMTL------------GKENTPVNVEPPHNKF  516
             + EL VP +D+  LEWLS FV+D+ S G   L               N  V V  P  K 
Sbjct  101   AGELPVPSDDLENLEWLSQFVDDTTSSGLSLLCPAGSFTERAEPNFANRVVTVNRPLRKI  160

Query  517   QTsspvsvlesssssssssscsGGKTTIPLSPSRCGVQRARSKRPRPATFNPRP------  678
             Q    +                   T IP+        +ARSKR R    N RP      
Sbjct  161   QAPFLL-------------------TPIPV--------KARSKRSRS---NGRPWSLSSP  190

Query  679   -------AIQLISPTSSFTEAPQPFVAPAVSSESENFAESPMKKLTTRPEAPEQkkkkki  837
                    +    S   S   +P  F  P   +E  +  E P KKL  +P   E       
Sbjct  191   PLSSGDSSSTTSSSYGSSILSPFLFTTPVRETEWFSTGEKPAKKLKRKPAETETGSISG-  249

Query  838   kFTIPIAPVDTNQNQPPQAIRKCLHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPE  1017
                                 R+C HC++ KTPQWR GP+GPKTLCNACGVR+KSGRLFPE
Sbjct  250   --------------------RRCTHCQVQKTPQWRTGPLGPKTLCNACGVRFKSGRLFPE  289

Query  1018  YRPAASPTFTPSLHSNSHKKVIEMRSK  1098
             YRPA SPTF+  +HSNSH+KV+EMR +
Sbjct  290   YRPAFSPTFSHEVHSNSHRKVLEMRRR  316



>ref|XP_008245237.1| PREDICTED: GATA transcription factor 11-like isoform X1 [Prunus 
mume]
Length=309

 Score =   132 bits (333),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 54/67 (81%), Positives = 63/67 (94%), Gaps = 0/67 (0%)
 Frame = +1

Query  898   RKCLHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFTPSLHSNSHKK  1077
             ++C+HC +TKTPQWR GP+GPKTLCNACGVRY+SGRLFPEYRPAASPTF  S+HSNSHKK
Sbjct  229   KRCMHCAVTKTPQWREGPLGPKTLCNACGVRYRSGRLFPEYRPAASPTFVASVHSNSHKK  288

Query  1078  VIEMRSK  1098
             VIE+R+K
Sbjct  289   VIELRNK  295



>ref|XP_010054482.1| PREDICTED: GATA transcription factor 2-like [Eucalyptus grandis]
 gb|KCW89852.1| hypothetical protein EUGRSUZ_A02086 [Eucalyptus grandis]
Length=286

 Score =   132 bits (332),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 104/289 (36%), Positives = 128/289 (44%), Gaps = 58/289 (20%)
 Frame = +1

Query  322   DSEPLFSGSHNNSAADLSAELSVPYEDIIQLEWLSTFVEDSFSGGGMTLGKEN--TPVNV  495
             DS+P   G  +NS  +L +    P  D+  +EWLS FVED  S  G TL  +   TP + 
Sbjct  12    DSQPKLGGFASNSLDELFSN-QKPEADV-SMEWLSVFVEDCLSSSGNTLQVQTLPTPSSA  69

Query  496   EPPHNKFQTsspvsvlesssssssssscsGGKTTIPLSPSRCGVQRARSKRPRPATFNPR  675
               P                    S +      T +P         +ARSKR R A    +
Sbjct  70    SVP--------------------SKTPSKPSSTNLPSLHKIVVTGKARSKRKRIAAAKTK  109

Query  676   PAIQLISPTSSFTEAPQPFVAPAVSSESENFAESPM---KKLTTRPEAP---EQkkkkki  837
                 L+ P       P     P +  +S   A+S +   KK     E P   EQ+  K  
Sbjct  110   NNAFLMMPA-----WPNHSADPLLLHQSHWLADSELIEPKKQEQEQEQPKKQEQELPKTT  164

Query  838   kFTIPIAPVDTN-----------------------QNQPPQAIRKCLHCEITKTPQWRAG  948
                +P +P   +                               R+C HC   +TPQWRAG
Sbjct  165   TTNMPSSPTQCDAEEEEAVESKEDHSEESGGGGGGGAGQQGTGRRCTHCLSQRTPQWRAG  224

Query  949   PMGPKTLCNACGVRYKSGRLFPEYRPAASPTFTPSLHSNSHKKVIEMRS  1095
             PMGPKTLCNACGVRYKSGRL PEYRPA SPTF   LHSNSHKKV+EMRS
Sbjct  225   PMGPKTLCNACGVRYKSGRLLPEYRPAKSPTFVSYLHSNSHKKVMEMRS  273



>gb|EAY75795.1| hypothetical protein OsI_03711 [Oryza sativa Indica Group]
Length=387

 Score =   134 bits (337),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 112/318 (35%), Positives = 161/318 (51%), Gaps = 34/318 (11%)
 Frame = +1

Query  199   CGSFFDHIDDLIEFP--------PENECVGGVGSGEFKNFPSIWNDPLPDSEPL-----F  339
             CG  F  +DDL+  P         E E  GG      K   + + +   DS  +      
Sbjct  27    CGDHFA-VDDLLVLPYDEEDETTREGEATGG------KEEAAGFGNASADSSTITALDSC  79

Query  340   SGSHNNSAADLSAELSVPYEDIIQLEWLSTFV---EDSFSGGGMTLGKENTPVNVEPPHN  510
             S S   +  D   EL  PY+ + +LEWLS ++   +D+F+    T   +   +    P  
Sbjct  80    SNSFGLADGDFPGELCEPYDQLAELEWLSNYMNEGDDAFA----TEDLQKLQLISGIPSG  135

Query  511   KFQTsspvsvlesssssssssscsGGKTTIPLSPSRCGVQRARSKRPRPATFNPRPAIQL  690
              F T+S  S    ++S+++S +   G   +P +P      +ARSKR R A  N    + +
Sbjct  136   GFSTASVPSAQAQAASAAASMAVQPGGF-LPEAPVPA---KARSKRSRAAPGNWSSRLLV  191

Query  691   ISPTSSFTEAPQPF-VAPAVSSESEN-FAESPMKKLTTRPEAPEQkkkkkikFTIPIAPV  864
             + P  +   +P    ++PA S  S + F      K   + +AP    + ++  ++P+   
Sbjct  192   LPPPPASPPSPASMAISPAESGVSAHAFPIKKPSKPAKKKDAPAPPAQAQLS-SVPVHSG  250

Query  865   DTNQNQPPQAIRKCLHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTF  1044
              +         R+CLHCE  KTPQWR GPMGPKTLCNACGVRYKSGRL PEYRPAASPTF
Sbjct  251   GSAPAAAAGEGRRCLHCETDKTPQWRTGPMGPKTLCNACGVRYKSGRLVPEYRPAASPTF  310

Query  1045  TPSLHSNSHKKVIEMRSK  1098
               S HSNSH+KV+E+R +
Sbjct  311   MVSKHSNSHRKVLELRRQ  328



>ref|XP_009118398.1| PREDICTED: GATA transcription factor 11-like [Brassica rapa]
Length=259

 Score =   131 bits (329),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 56/72 (78%), Positives = 63/72 (88%), Gaps = 0/72 (0%)
 Frame = +1

Query  895   IRKCLHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFTPSLHSNSHK  1074
             +R+C HCE TKTPQWR GP GPKTLCNACGVR++SGRL PEYRPA+SPTF PSLHSNSH+
Sbjct  178   VRRCTHCETTKTPQWREGPNGPKTLCNACGVRFRSGRLVPEYRPASSPTFIPSLHSNSHR  237

Query  1075  KVIEMRSKVGVE  1110
             K+IEMR K G E
Sbjct  238   KIIEMRRKEGDE  249



>ref|XP_008245238.1| PREDICTED: GATA transcription factor 11-like isoform X2 [Prunus 
mume]
Length=290

 Score =   132 bits (331),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 54/67 (81%), Positives = 63/67 (94%), Gaps = 0/67 (0%)
 Frame = +1

Query  898   RKCLHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFTPSLHSNSHKK  1077
             ++C+HC +TKTPQWR GP+GPKTLCNACGVRY+SGRLFPEYRPAASPTF  S+HSNSHKK
Sbjct  210   KRCMHCAVTKTPQWREGPLGPKTLCNACGVRYRSGRLFPEYRPAASPTFVASVHSNSHKK  269

Query  1078  VIEMRSK  1098
             VIE+R+K
Sbjct  270   VIELRNK  276



>ref|XP_008359134.1| PREDICTED: GATA transcription factor 11-like isoform X2 [Malus 
domestica]
Length=300

 Score =   132 bits (331),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 54/67 (81%), Positives = 63/67 (94%), Gaps = 0/67 (0%)
 Frame = +1

Query  898   RKCLHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFTPSLHSNSHKK  1077
             ++C HC++TKTPQWR GP+GPKTLCNACGVRY+SGRLFPEYRPAASPTF  ++HSNSHKK
Sbjct  220   KRCTHCQVTKTPQWREGPLGPKTLCNACGVRYRSGRLFPEYRPAASPTFVAAVHSNSHKK  279

Query  1078  VIEMRSK  1098
             VIE+RSK
Sbjct  280   VIELRSK  286



>ref|XP_008385404.1| PREDICTED: GATA transcription factor 11 [Malus domestica]
Length=285

 Score =   131 bits (330),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 54/67 (81%), Positives = 63/67 (94%), Gaps = 0/67 (0%)
 Frame = +1

Query  898   RKCLHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFTPSLHSNSHKK  1077
             ++C HC++TKTPQWR GP+GPKTLCNACGVRY+SGRLFPEYRPAASPTF  ++HSNSHKK
Sbjct  205   KRCTHCQVTKTPQWREGPLGPKTLCNACGVRYRSGRLFPEYRPAASPTFVAAVHSNSHKK  264

Query  1078  VIEMRSK  1098
             VIE+RSK
Sbjct  265   VIELRSK  271



>ref|XP_009367061.1| PREDICTED: GATA transcription factor 11 [Pyrus x bretschneideri]
Length=301

 Score =   132 bits (331),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 55/79 (70%), Positives = 67/79 (85%), Gaps = 0/79 (0%)
 Frame = +1

Query  862   VDTNQNQPPQAIRKCLHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPT  1041
             + T++    +  ++C HC++TKTPQWR GP+GPKTLCNACGVRY+SGRL PEYRPAASPT
Sbjct  209   LSTDEAGESRETKRCAHCQVTKTPQWREGPLGPKTLCNACGVRYRSGRLLPEYRPAASPT  268

Query  1042  FTPSLHSNSHKKVIEMRSK  1098
             F  S+HSNSHKKVIE+RSK
Sbjct  269   FIASVHSNSHKKVIELRSK  287



>emb|CDY22706.1| BnaC08g43400D [Brassica napus]
Length=258

 Score =   130 bits (327),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 56/72 (78%), Positives = 63/72 (88%), Gaps = 0/72 (0%)
 Frame = +1

Query  895   IRKCLHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFTPSLHSNSHK  1074
             +R+C HCE TKTPQWR GP GPKTLCNACGVR++SGRL PEYRPA+SPTF PSLHSNSH+
Sbjct  177   VRRCTHCETTKTPQWREGPNGPKTLCNACGVRFRSGRLVPEYRPASSPTFIPSLHSNSHR  236

Query  1075  KVIEMRSKVGVE  1110
             K+IEMR K G E
Sbjct  237   KIIEMRRKEGDE  248



>ref|XP_008359133.1| PREDICTED: GATA transcription factor 11-like isoform X1 [Malus 
domestica]
Length=316

 Score =   132 bits (331),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 54/67 (81%), Positives = 63/67 (94%), Gaps = 0/67 (0%)
 Frame = +1

Query  898   RKCLHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFTPSLHSNSHKK  1077
             ++C HC++TKTPQWR GP+GPKTLCNACGVRY+SGRLFPEYRPAASPTF  ++HSNSHKK
Sbjct  236   KRCTHCQVTKTPQWREGPLGPKTLCNACGVRYRSGRLFPEYRPAASPTFVAAVHSNSHKK  295

Query  1078  VIEMRSK  1098
             VIE+RSK
Sbjct  296   VIELRSK  302



>ref|XP_008359306.1| PREDICTED: GATA transcription factor 11-like [Malus domestica]
Length=296

 Score =   131 bits (329),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 54/67 (81%), Positives = 62/67 (93%), Gaps = 0/67 (0%)
 Frame = +1

Query  898   RKCLHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFTPSLHSNSHKK  1077
             ++C HC++TKTPQWR GP+GPKTLCNACGVRY+SGRL PEYRPAASPTF  S+HSNSHKK
Sbjct  216   KRCTHCQVTKTPQWREGPLGPKTLCNACGVRYRSGRLLPEYRPAASPTFVASVHSNSHKK  275

Query  1078  VIEMRSK  1098
             VIE+RSK
Sbjct  276   VIELRSK  282



>ref|XP_006649146.1| PREDICTED: GATA transcription factor 8-like [Oryza brachyantha]
Length=292

 Score =   131 bits (329),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 115/317 (36%), Positives = 155/317 (49%), Gaps = 73/317 (23%)
 Frame = +1

Query  190   ELDCGSFFDHIDDLIEFPPENECVG----GVGSGEFKNFPSIWNDPLPDSEPLFSGSHNN  357
             E  CG  FDHI+DL++FP E          +   + +    +++D     EP F G+  N
Sbjct  18    EATCGDLFDHIEDLLDFPKEESAADCDDLDMDMAQLEWLSDLFDDGTIPHEPSFPGA--N  75

Query  358   SAADLSAELSVPYEDIIQLEWLSTFVEDSFSGGGMTLGKENTPVNVEPPHNKFQTs----  525
              AA + A        ++    L   +E++       L + ++P++V   H+ F  +    
Sbjct  76    CAAPIKASALAANAGVV----LPDKMEEA-------LFRSSSPISVLE-HSGFNAAPNGG  123

Query  526   spvsvlesssssssssscsGGKTTIPLSPS-----RCGVQRARSKRPRPATFNPRPAIQL  690
             S  S   S+SSSS S S +G   + P+SP           RARSKR RP+ F   PA++ 
Sbjct  124   SSSSSSSSASSSSESFSGNGHAWSAPVSPRPEPPVLIIPARARSKRSRPSAF---PAVR-  179

Query  691   ISPTSSFTEAPQPFVAPAVSSESENFAESPMKKLTTRPEAPEQkkkkkikFTIPIAPVDT  870
                            +PA  +E+     +PM   T+    PE                  
Sbjct  180   --------------TSPA-ETETTILVPTPMYSSTSSHSDPES----------------I  208

Query  871   NQNQPPQAIRKCLHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFTP  1050
              ++ P           I KTPQWRAGP+GPKTLCNACGVRYKSGRLFPEYRPAASPTF P
Sbjct  209   AESSP-----------IEKTPQWRAGPLGPKTLCNACGVRYKSGRLFPEYRPAASPTFVP  257

Query  1051  SLHSNSHKKVIEMRSKV  1101
             S+HSNSHKKV+EMR K 
Sbjct  258   SIHSNSHKKVVEMRQKA  274



>gb|EYU36178.1| hypothetical protein MIMGU_mgv1a0095201mg [Erythranthe guttata]
 gb|EYU36179.1| hypothetical protein MIMGU_mgv1a0095201mg [Erythranthe guttata]
Length=339

 Score =   132 bits (331),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 54/76 (71%), Positives = 64/76 (84%), Gaps = 0/76 (0%)
 Frame = +1

Query  871   NQNQPPQAIRKCLHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFTP  1050
              Q  P    ++C HC++ KTPQWR GP GPKTLCNACGVRY+SGRLFPEYRPAASPTF P
Sbjct  200   QQRSPTATTKRCTHCQVMKTPQWREGPAGPKTLCNACGVRYRSGRLFPEYRPAASPTFVP  259

Query  1051  SLHSNSHKKVIEMRSK  1098
             ++HSNSH+KV+EMR+K
Sbjct  260   TVHSNSHRKVVEMRTK  275



>ref|XP_009767386.1| PREDICTED: GATA transcription factor 1-like [Nicotiana sylvestris]
Length=289

 Score =   130 bits (328),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 60/95 (63%), Positives = 71/95 (75%), Gaps = 1/95 (1%)
 Frame = +1

Query  850   PIAPVDTNQNQPPQAIRKCLHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPA  1029
             P+  +  N  +     R+C HC   KTPQWRAGP+GPKTLCNACGVRYKSGRL PEYRPA
Sbjct  189   PLLSLPLNSAKSASIGRRCQHCGADKTPQWRAGPLGPKTLCNACGVRYKSGRLLPEYRPA  248

Query  1030  ASPTFTPSLHSNSHKKVIEMR-SKVGVENTAITEA  1131
              SPTF+P++HSNSH+KV+EMR  K+GV    I EA
Sbjct  249   NSPTFSPTVHSNSHRKVLEMRKQKIGVGGMMIHEA  283



>dbj|BAC98492.1| AG-motif binding protein-2 [Nicotiana tabacum]
Length=289

 Score =   130 bits (328),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 60/95 (63%), Positives = 71/95 (75%), Gaps = 1/95 (1%)
 Frame = +1

Query  850   PIAPVDTNQNQPPQAIRKCLHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPA  1029
             P+  +  N  +     R+C HC   KTPQWRAGP+GPKTLCNACGVRYKSGRL PEYRPA
Sbjct  189   PLLSLPLNSAKSASIGRRCQHCGADKTPQWRAGPLGPKTLCNACGVRYKSGRLLPEYRPA  248

Query  1030  ASPTFTPSLHSNSHKKVIEMR-SKVGVENTAITEA  1131
              SPTF+P++HSNSH+KV+EMR  K+GV    I EA
Sbjct  249   NSPTFSPTVHSNSHRKVLEMRKQKIGVGGMMIHEA  283



>ref|XP_009618082.1| PREDICTED: GATA transcription factor 1-like isoform X2 [Nicotiana 
tomentosiformis]
Length=236

 Score =   129 bits (325),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 60/95 (63%), Positives = 71/95 (75%), Gaps = 1/95 (1%)
 Frame = +1

Query  850   PIAPVDTNQNQPPQAIRKCLHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPA  1029
             P+  +  N  +     R+C HC   KTPQWRAGP+GPKTLCNACGVRYKSGRL PEYRPA
Sbjct  136   PLLSLPMNSAKSACIGRRCQHCGADKTPQWRAGPLGPKTLCNACGVRYKSGRLLPEYRPA  195

Query  1030  ASPTFTPSLHSNSHKKVIEMR-SKVGVENTAITEA  1131
              SPTF+P++HSNSH+KV+EMR  K+GV    I EA
Sbjct  196   NSPTFSPTVHSNSHRKVLEMRKQKIGVGGMMIHEA  230



>ref|XP_011091388.1| PREDICTED: GATA transcription factor 1 [Sesamum indicum]
Length=284

 Score =   130 bits (328),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 58/86 (67%), Positives = 68/86 (79%), Gaps = 2/86 (2%)
 Frame = +1

Query  841   FTIPIAPVDTNQNQPPQAIRKCLHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEY  1020
             F +P  P+ T +       R+CLHC+  KTPQWRAGPMGPKTLCNACGVRYKSGRL PEY
Sbjct  181   FLLP--PLSTMRTNGASMGRRCLHCQADKTPQWRAGPMGPKTLCNACGVRYKSGRLLPEY  238

Query  1021  RPAASPTFTPSLHSNSHKKVIEMRSK  1098
             RPA+SPTF+  LHSNSH+KV+EMR +
Sbjct  239   RPASSPTFSSILHSNSHRKVVEMRKQ  264



>ref|XP_006384910.1| hypothetical protein POPTR_0004s22140g [Populus trichocarpa]
 gb|ERP62707.1| hypothetical protein POPTR_0004s22140g [Populus trichocarpa]
Length=232

 Score =   129 bits (324),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 54/71 (76%), Positives = 62/71 (87%), Gaps = 0/71 (0%)
 Frame = +1

Query  886   PQAIRKCLHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFTPSLHSN  1065
             P   R+C HC++TKTPQWR GP+GPKTLCNACGVRY+SGRL PEYRPAASPTF P LHSN
Sbjct  161   PVETRRCTHCQVTKTPQWREGPLGPKTLCNACGVRYRSGRLLPEYRPAASPTFVPFLHSN  220

Query  1066  SHKKVIEMRSK  1098
             SH+KV+EMR +
Sbjct  221   SHRKVLEMRKQ  231



>ref|XP_006304051.1| hypothetical protein CARUB_v10009871mg [Capsella rubella]
 ref|XP_006304052.1| hypothetical protein CARUB_v10009871mg [Capsella rubella]
 gb|EOA36949.1| hypothetical protein CARUB_v10009871mg [Capsella rubella]
 gb|EOA36950.1| hypothetical protein CARUB_v10009871mg [Capsella rubella]
Length=300

 Score =   130 bits (328),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 56/68 (82%), Positives = 61/68 (90%), Gaps = 0/68 (0%)
 Frame = +1

Query  895   IRKCLHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFTPSLHSNSHK  1074
             +RKC HCE TKTPQWR GP GPKTLCNACGVRY+SGRL PEYRPA+SPTF PSLHSNSH+
Sbjct  216   VRKCTHCETTKTPQWREGPSGPKTLCNACGVRYRSGRLVPEYRPASSPTFIPSLHSNSHR  275

Query  1075  KVIEMRSK  1098
             K+IEMR K
Sbjct  276   KIIEMRRK  283



>ref|XP_009148049.1| PREDICTED: GATA transcription factor 11-like [Brassica rapa]
 ref|XP_009148050.1| PREDICTED: GATA transcription factor 11-like [Brassica rapa]
Length=282

 Score =   130 bits (327),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 54/71 (76%), Positives = 63/71 (89%), Gaps = 0/71 (0%)
 Frame = +1

Query  892   AIRKCLHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFTPSLHSNSH  1071
              +R+C HCE TKTPQWR GP GPKTLCNACGVR++SGRL PEYRPA+SPTF PS+HSNSH
Sbjct  204   VVRRCTHCETTKTPQWREGPNGPKTLCNACGVRFRSGRLVPEYRPASSPTFIPSVHSNSH  263

Query  1072  KKVIEMRSKVG  1104
             +K+IEMRS+ G
Sbjct  264   RKIIEMRSREG  274



>emb|CDX95103.1| BnaC05g05680D [Brassica napus]
Length=288

 Score =   130 bits (328),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 54/71 (76%), Positives = 63/71 (89%), Gaps = 0/71 (0%)
 Frame = +1

Query  892   AIRKCLHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFTPSLHSNSH  1071
              +R+C HCE TKTPQWR GP GPKTLCNACGVR++SGRL PEYRPA+SPTF PS+HSNSH
Sbjct  210   VVRRCTHCETTKTPQWREGPNGPKTLCNACGVRFRSGRLVPEYRPASSPTFVPSVHSNSH  269

Query  1072  KKVIEMRSKVG  1104
             +K+IEMRS+ G
Sbjct  270   RKIIEMRSREG  280



>ref|XP_006294768.1| hypothetical protein CARUB_v10023820mg [Capsella rubella]
 gb|EOA27666.1| hypothetical protein CARUB_v10023820mg [Capsella rubella]
Length=277

 Score =   130 bits (327),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 76/172 (44%), Positives = 96/172 (56%), Gaps = 29/172 (17%)
 Frame = +1

Query  604   LSPSRCGVQR-------ARSKRPRPATFNPRPAIQLISPTSSFTEAPQPFVAPAVSSESE  762
             LS S+  +QR        RSKR RP T     ++          E  Q FV     SE+ 
Sbjct  124   LSQSQNRIQRLTFLVKGIRSKRKRPTTLKFFKSLG--------AEMSQHFVPDESKSETH  175

Query  763   NFAESPMKKLTTRPEAPEQkkkkkikFTIPIAPVDTNQNQPPQAIRKCLHCEITKTPQWR  942
               +E+ +KK    P             +I  +P   N +     +RKC HCE T+TPQWR
Sbjct  176   LSSENSVKKKRKSP-----------ALSISYSPELINSDG---TVRKCTHCETTRTPQWR  221

Query  943   AGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFTPSLHSNSHKKVIEMRSK  1098
              GP G KTLCNACGVR++SGRL PEYRPA+SPTF P++HSNSH+K+IEMR K
Sbjct  222   EGPHGRKTLCNACGVRFRSGRLVPEYRPASSPTFIPAVHSNSHRKIIEMRRK  273



>ref|XP_004291710.1| PREDICTED: GATA transcription factor 11-like [Fragaria vesca 
subsp. vesca]
Length=309

 Score =   131 bits (329),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 54/67 (81%), Positives = 63/67 (94%), Gaps = 0/67 (0%)
 Frame = +1

Query  898   RKCLHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFTPSLHSNSHKK  1077
             ++C HC +TKTPQWR GP+GPKTLCNACGVRY+SGRLFPEYRPAASPTF P++HSNSHKK
Sbjct  238   KRCTHCAVTKTPQWREGPLGPKTLCNACGVRYRSGRLFPEYRPAASPTFVPAVHSNSHKK  297

Query  1078  VIEMRSK  1098
             VIE+R+K
Sbjct  298   VIELRNK  304



>ref|XP_009618081.1| PREDICTED: GATA transcription factor 1-like isoform X1 [Nicotiana 
tomentosiformis]
Length=288

 Score =   130 bits (327),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 58/79 (73%), Positives = 66/79 (84%), Gaps = 1/79 (1%)
 Frame = +1

Query  898   RKCLHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFTPSLHSNSHKK  1077
             R+C HC   KTPQWRAGP+GPKTLCNACGVRYKSGRL PEYRPA SPTF+P++HSNSH+K
Sbjct  204   RRCQHCGADKTPQWRAGPLGPKTLCNACGVRYKSGRLLPEYRPANSPTFSPTVHSNSHRK  263

Query  1078  VIEMR-SKVGVENTAITEA  1131
             V+EMR  K+GV    I EA
Sbjct  264   VLEMRKQKIGVGGMMIHEA  282



>gb|KEH30032.1| GATA type zinc finger transcription factor family protein [Medicago 
truncatula]
Length=402

 Score =   132 bits (333),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 59/85 (69%), Positives = 71/85 (84%), Gaps = 2/85 (2%)
 Frame = +1

Query  862   VDTNQNQPPQAI--RKCLHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAAS  1035
             ++T ++   ++I  RKC HCE+T+TPQWR GP GPKTLCNACGVRY+SGRLFPEYRPAAS
Sbjct  300   IETKRSSLHESIAPRKCTHCEVTETPQWREGPKGPKTLCNACGVRYRSGRLFPEYRPAAS  359

Query  1036  PTFTPSLHSNSHKKVIEMRSKVGVE  1110
             PTF  S+HSNSHKKV+E+R KV  E
Sbjct  360   PTFEASVHSNSHKKVLEIRKKVNQE  384



>ref|XP_011073745.1| PREDICTED: GATA transcription factor 1-like isoform X1 [Sesamum 
indicum]
Length=284

 Score =   130 bits (327),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 55/67 (82%), Positives = 62/67 (93%), Gaps = 0/67 (0%)
 Frame = +1

Query  898   RKCLHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFTPSLHSNSHKK  1077
             R+CLHC+  KTPQWRAGPMGPKTLCNACGVRYKSGRL PEYRPA+SPTF+ +LHSNSH+K
Sbjct  198   RRCLHCQADKTPQWRAGPMGPKTLCNACGVRYKSGRLLPEYRPASSPTFSSTLHSNSHRK  257

Query  1078  VIEMRSK  1098
             VIEMR +
Sbjct  258   VIEMRKQ  264



>ref|XP_011073746.1| PREDICTED: GATA transcription factor 1-like isoform X2 [Sesamum 
indicum]
Length=283

 Score =   130 bits (326),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 55/67 (82%), Positives = 62/67 (93%), Gaps = 0/67 (0%)
 Frame = +1

Query  898   RKCLHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFTPSLHSNSHKK  1077
             R+CLHC+  KTPQWRAGPMGPKTLCNACGVRYKSGRL PEYRPA+SPTF+ +LHSNSH+K
Sbjct  197   RRCLHCQADKTPQWRAGPMGPKTLCNACGVRYKSGRLLPEYRPASSPTFSSTLHSNSHRK  256

Query  1078  VIEMRSK  1098
             VIEMR +
Sbjct  257   VIEMRKQ  263



>ref|XP_004507504.1| PREDICTED: GATA transcription factor 5-like isoform X1 [Cicer 
arietinum]
 ref|XP_004507505.1| PREDICTED: GATA transcription factor 5-like isoform X2 [Cicer 
arietinum]
Length=289

 Score =   130 bits (326),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 54/78 (69%), Positives = 66/78 (85%), Gaps = 0/78 (0%)
 Frame = +1

Query  886   PQAIRKCLHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFTPSLHSN  1065
             PQ  R+C HC++ KTPQWR GP+GPKTLCNACGVR+KSGRLFPEYRPA+SPTF+  +HSN
Sbjct  203   PQFQRRCSHCQVQKTPQWRTGPLGPKTLCNACGVRFKSGRLFPEYRPASSPTFSGDIHSN  262

Query  1066  SHKKVIEMRSKVGVENTA  1119
             SH+KV+EMR +   + TA
Sbjct  263   SHRKVLEMRRRKETDETA  280



>emb|CDO96997.1| unnamed protein product [Coffea canephora]
Length=337

 Score =   130 bits (328),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 59/85 (69%), Positives = 67/85 (79%), Gaps = 2/85 (2%)
 Frame = +1

Query  889   QAIRKCLHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFTPSLHSNS  1068
             Q  R+C HC++ KTPQWR GP+GPKTLCNACGVRYKSGRLFPEYRPA SPTF+  +HSNS
Sbjct  250   QTSRRCSHCQVNKTPQWRTGPLGPKTLCNACGVRYKSGRLFPEYRPACSPTFSQEVHSNS  309

Query  1069  HKKVIEMRSKVGVENTAITEAPSTP  1143
             H+KV+EMR K   E T   EA  TP
Sbjct  310   HRKVLEMRRK--KEATGHVEAGLTP  332



>ref|XP_007156103.1| hypothetical protein PHAVU_003G258900g [Phaseolus vulgaris]
 gb|ESW28097.1| hypothetical protein PHAVU_003G258900g [Phaseolus vulgaris]
Length=381

 Score =   131 bits (330),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 87/248 (35%), Positives = 116/248 (47%), Gaps = 55/248 (22%)
 Frame = +1

Query  367   DLSAELSVPYEDIIQLEWLSTFVEDSFSGGGMTLGKENTPVNVEPPHNKFQTsspvsvle  546
             + + EL++P E++  LEW+S F+EDSFS   ++     +    E P              
Sbjct  175   NFNTELTLPAEEVADLEWVSHFIEDSFSKYSLSFPATVSQSLAEKP--------------  220

Query  547   sssssssssscsGGKTTIPLSPSRCGVQRARSKRPRPATFNPRPAIQLISPTSSFTEAPQ  726
                     ++    KT +P  P        RSKR R         +  +   SSFT+   
Sbjct  221   ----PEPGNAGFTFKTLVPAKP--------RSKRTRTGV-----RVWPLRSPSSFTDTSS  263

Query  727   PFVAPAVSSESENFAESPMKKLTTRPEAPEQkkkkkikFTIPIAPVDTNQNQPPQAIRKC  906
             P  +P +   + +    P  K   +  AP+                         A R+C
Sbjct  264   P-SSPLLICAAASKDHHPEDKRAKKRAAPDGG-----------------------AARRC  299

Query  907   LHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFTPSLHSNSHKKVIE  1086
              HC + KTPQWR GP+G KTLCNACGVRYKSGRL PEYRPA SPTF+  LHSN H+KV+E
Sbjct  300   SHCGVQKTPQWRTGPLGAKTLCNACGVRYKSGRLLPEYRPACSPTFSSELHSNHHRKVLE  359

Query  1087  MRSKVGVE  1110
             MR K   E
Sbjct  360   MRQKKEAE  367



>ref|XP_010493840.1| PREDICTED: GATA transcription factor 12-like [Camelina sativa]
Length=333

 Score =   130 bits (327),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 94/257 (37%), Positives = 127/257 (49%), Gaps = 32/257 (12%)
 Frame = +1

Query  331   PLFSGSHNNSAADLSAELSVPYEDII-QLEWLSTFVEDSFSGGGMTLGKENTPVNVEP-P  504
             P FSG   +  +  S +L VP +D+  +L WLS  V++SFS   +   +  +  N  P P
Sbjct  58    PNFSGDVQDGTS-FSGDLCVPCDDLADELAWLSNIVDESFSPEDVQKLQLISGFNTRPGP  116

Query  505   HNKFQTsspvsvlesssssssssscsGGKTTIPLSPSRCGV-QRARSKRPRPATFNPRPA  681
              ++  TS                      +T P+  +   V  +ARSKR R A  N    
Sbjct  117   KSESGTSENP------------------NSTSPIFTTDVSVPAKARSKRSRAAACNWASR  158

Query  682   IQLISPTSSFTEAPQPFVAPAVSSESENFAESPMKKLTTRPEAPEQkkkkkikFTIPIAP  861
               L+      T    PF   ++ S S N +            A +Q      +    ++ 
Sbjct  159   GLLME-----TVYDNPFTGESILS-SHNLSPPTSPPPPMAHLAKKQATDGGYRRKKDVSS  212

Query  862   VDTNQNQPPQAIRKCLHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPT  1041
              ++   +     R+CLHC   KTPQWR GPMGPKTLCNACGVRYKSGRL PEYRPAASPT
Sbjct  213   PESGGTEE----RRCLHCATDKTPQWRTGPMGPKTLCNACGVRYKSGRLVPEYRPAASPT  268

Query  1042  FTPSLHSNSHKKVIEMR  1092
             F  + HSNSH+KV+E+R
Sbjct  269   FVLTKHSNSHRKVMELR  285



>ref|XP_009110913.1| PREDICTED: GATA transcription factor 11-like [Brassica rapa]
Length=283

 Score =   129 bits (324),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 55/72 (76%), Positives = 62/72 (86%), Gaps = 0/72 (0%)
 Frame = +1

Query  889   QAIRKCLHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFTPSLHSNS  1068
             Q  RKC HCE T+TPQWR GP GPKTLCNACGVR++SGRL PEYRPA+SPTF PS+HSNS
Sbjct  197   QVARKCTHCETTETPQWREGPSGPKTLCNACGVRFRSGRLVPEYRPASSPTFVPSVHSNS  256

Query  1069  HKKVIEMRSKVG  1104
             H+K+IEMR K G
Sbjct  257   HRKIIEMRRKEG  268



>ref|XP_010414544.1| PREDICTED: putative GATA transcription factor 13 isoform X1 [Camelina 
sativa]
 ref|XP_010414545.1| PREDICTED: putative GATA transcription factor 13 isoform X2 [Camelina 
sativa]
Length=304

 Score =   129 bits (324),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 75/158 (47%), Positives = 93/158 (59%), Gaps = 25/158 (16%)
 Frame = +1

Query  625   VQRARSKRPRPATFNPRPAIQLISPTSSFTEAPQPFVAPAVSSESENFAESPMKKLTTRP  804
             V+  RSKR RP T     ++          E  Q FV     SESEN A+   KK  + P
Sbjct  157   VKGTRSKRKRPTTLRFFQSLG--------AEMSQMFVPE--ESESENSAKKKRKKYRSPP  206

Query  805   EAPEQkkkkkikFTIPIAPVDTNQNQPPQAIRKCLHCEITKTPQWRAGPMGPKTLCNACG  984
             ++            +  +P   N   P   +RKC HCE T+TPQWR GP G KTLCNACG
Sbjct  207   QS------------VCNSPELFN---PDGTVRKCTHCETTRTPQWREGPCGRKTLCNACG  251

Query  985   VRYKSGRLFPEYRPAASPTFTPSLHSNSHKKVIEMRSK  1098
             VR++SGRL PEYRPA+SPTF P++HSNSH+K+IEMR K
Sbjct  252   VRFRSGRLVPEYRPASSPTFVPTVHSNSHRKIIEMRRK  289



>ref|XP_009802570.1| PREDICTED: GATA transcription factor 5-like [Nicotiana sylvestris]
Length=326

 Score =   129 bits (325),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 53/67 (79%), Positives = 61/67 (91%), Gaps = 0/67 (0%)
 Frame = +1

Query  898   RKCLHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFTPSLHSNSHKK  1077
             R+C HC++ KTPQWRAGP+GPKTLCNACGVRYKSGRLFPEYRPA SPTF+  +HSNSH+K
Sbjct  242   RRCTHCQVQKTPQWRAGPLGPKTLCNACGVRYKSGRLFPEYRPACSPTFSQEVHSNSHRK  301

Query  1078  VIEMRSK  1098
             V+EMR K
Sbjct  302   VLEMRRK  308



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 4531252235272