BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c80656_g1_i1 len=331 path=[1:0-330]

Length=331
                                                                      Score     E

ref|XP_006345802.1|  PREDICTED: patatin group D-2-like                61.6    1e-08   
ref|XP_004239676.1|  PREDICTED: patatin-like protein 6                61.6    1e-08   
ref|XP_010670011.1|  PREDICTED: patatin-like protein 6                61.6    1e-08   
ref|XP_009605268.1|  PREDICTED: patatin-like protein 6                60.8    2e-08   
ref|XP_010529102.1|  PREDICTED: patatin-like protein 6                60.1    4e-08   
ref|XP_009760715.1|  PREDICTED: patatin-like protein 6 isoform X2     58.9    7e-08   
ref|XP_009630207.1|  PREDICTED: patatin-like protein 6 isoform X3     58.9    7e-08   
ref|XP_009630205.1|  PREDICTED: patatin-like protein 6 isoform X2     58.9    7e-08   
ref|XP_011084360.1|  PREDICTED: patatin-like protein 6                58.9    9e-08   
ref|XP_009630204.1|  PREDICTED: patatin-like protein 6 isoform X1     58.9    9e-08   
ref|XP_009760706.1|  PREDICTED: patatin-like protein 6 isoform X1     58.9    9e-08   
ref|XP_009764486.1|  PREDICTED: patatin-like protein 6                58.9    1e-07   
gb|KHN00838.1|  Patatin-3-Kuras 1                                     57.0    1e-07   
gb|KHN17132.1|  Patatin-3-Kuras 1                                     57.0    1e-07   
ref|XP_007009821.1|  PATATIN-like protein 6, IIB                      58.2    2e-07   
gb|KDO42600.1|  hypothetical protein CISIN_1g012597mg                 57.8    2e-07   
ref|XP_006436295.1|  hypothetical protein CICLE_v10031470mg           57.8    2e-07   
gb|EYU39583.1|  hypothetical protein MIMGU_mgv1a005615mg              57.8    3e-07   
gb|KHG03997.1|  Patatin group A-3                                     57.4    3e-07   
emb|CDY07662.1|  BnaA03g18490D                                        57.0    4e-07   
ref|XP_009133349.1|  PREDICTED: patatin-like protein 6                57.0    4e-07   
ref|XP_002311098.1|  patatin-related family protein                   57.0    4e-07   Populus trichocarpa [western balsam poplar]
ref|XP_011077003.1|  PREDICTED: patatin-like protein 6                57.0    5e-07   
ref|XP_006589431.1|  PREDICTED: patatin-3-Kuras 1-like                57.0    5e-07   
gb|KEH16034.1|  patatin-like phospholipase                            55.8    6e-07   
ref|XP_003591915.1|  Patatin-T5                                       55.8    6e-07   
gb|KFK36815.1|  hypothetical protein AALP_AA4G175000                  56.6    6e-07   
ref|XP_004496284.1|  PREDICTED: patatin-1-Kuras 2-like                56.2    7e-07   
ref|XP_010557098.1|  PREDICTED: LOW QUALITY PROTEIN: patatin-like...  56.2    8e-07   
emb|CBI31469.3|  unnamed protein product                              55.8    9e-07   
ref|XP_002881637.1|  hypothetical protein ARALYDRAFT_903163           55.8    1e-06   
ref|XP_006294077.1|  hypothetical protein CARUB_v10023072mg           55.8    1e-06   
ref|NP_181455.1|  PATATIN-like protein 6                              55.8    1e-06   Arabidopsis thaliana [mouse-ear cress]
gb|KEH43521.1|  patatin-like phospholipase                            55.8    1e-06   
ref|XP_002275108.1|  PREDICTED: patatin-like protein 6                55.8    1e-06   Vitis vinifera
gb|KDP45100.1|  hypothetical protein JCGZ_18542                       55.8    1e-06   
ref|XP_007143699.1|  hypothetical protein PHAVU_007G094300g           55.5    1e-06   
ref|XP_002529576.1|  Patatin T5 precursor, putative                   55.5    1e-06   Ricinus communis
ref|XP_010509059.1|  PREDICTED: patatin-like protein 6                55.5    1e-06   
ref|XP_010517259.1|  PREDICTED: patatin-like protein 6                55.5    1e-06   
ref|XP_011031755.1|  PREDICTED: patatin-like protein 6 isoform X2     55.1    2e-06   
ref|XP_011031752.1|  PREDICTED: patatin-like protein 6 isoform X1     55.1    2e-06   
gb|EYU39817.1|  hypothetical protein MIMGU_mgv1a0057782mg             55.1    2e-06   
emb|CDP04363.1|  unnamed protein product                              55.1    2e-06   
ref|XP_004307392.1|  PREDICTED: patatin group D-2-like                55.1    2e-06   
ref|XP_011040991.1|  PREDICTED: patatin-like protein 6                54.7    2e-06   
ref|XP_002316362.1|  patatin-related family protein                   54.7    2e-06   Populus trichocarpa [western balsam poplar]
emb|CDX74862.1|  BnaA05g06080D                                        54.7    3e-06   
ref|XP_001754698.1|  predicted protein                                54.3    3e-06   
ref|XP_006411148.1|  hypothetical protein EUTSA_v10016579mg           54.7    3e-06   
emb|CDY44633.1|  BnaC04g06290D                                        54.7    3e-06   
ref|XP_009143335.1|  PREDICTED: patatin-like protein 6                54.7    3e-06   
emb|CDY24974.1|  BnaC03g21980D                                        54.3    4e-06   
ref|XP_001763934.1|  predicted protein                                53.9    4e-06   
ref|XP_006606244.1|  PREDICTED: patatin-3-Kuras 1-like isoform X2     54.3    4e-06   
ref|XP_003556231.2|  PREDICTED: patatin-3-Kuras 1-like isoform X1     54.3    4e-06   
ref|XP_009349699.1|  PREDICTED: patatin-like protein 6                53.9    5e-06   
ref|XP_010264697.1|  PREDICTED: patatin-like protein 6 isoform X2     53.5    6e-06   
ref|XP_009344752.1|  PREDICTED: patatin-like protein 6                53.5    6e-06   
ref|XP_010264695.1|  PREDICTED: patatin-like protein 6 isoform X1     53.5    6e-06   
ref|XP_006854500.1|  hypothetical protein AMTR_s00175p00049630        53.1    8e-06   
ref|XP_010099619.1|  Patatin group A-3                                53.1    9e-06   
ref|XP_008368383.1|  PREDICTED: patatin-like protein 6                53.1    1e-05   
emb|CDY07512.1|  BnaC06g15520D                                        52.8    1e-05   
ref|XP_009345376.1|  PREDICTED: patatin-like protein 6                52.4    2e-05   
ref|XP_008377578.1|  PREDICTED: patatin-like protein 6                52.4    2e-05   
ref|XP_009103945.1|  PREDICTED: patatin-like protein 7                52.4    2e-05   
emb|CDX67618.1|  BnaA07g16580D                                        52.4    2e-05   
ref|XP_008446895.1|  PREDICTED: patatin-like protein 6 isoform X3     52.0    2e-05   
ref|XP_008446894.1|  PREDICTED: patatin-like protein 6 isoform X2     52.0    2e-05   
ref|NP_191055.1|  patatin-like protein 6                              52.0    2e-05   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004142417.1|  PREDICTED: patatin group A-3-like isoform 2      52.0    2e-05   
ref|XP_004142416.1|  PREDICTED: patatin group A-3-like isoform 1      52.0    2e-05   
ref|XP_008446892.1|  PREDICTED: patatin-like protein 6 isoform X1     52.0    2e-05   
ref|XP_009116191.1|  PREDICTED: patatin-like protein 7                52.0    2e-05   
ref|XP_006290988.1|  hypothetical protein CARUB_v10017102mg           52.0    3e-05   
ref|XP_010504327.1|  PREDICTED: patatin-like protein 7                51.6    3e-05   
emb|CDX73423.1|  BnaC08g25800D                                        51.6    3e-05   
ref|XP_006403512.1|  hypothetical protein EUTSA_v10010298mg           51.6    3e-05   
emb|CDY56960.1|  BnaA09g55020D                                        51.6    3e-05   
gb|KFK34738.1|  hypothetical protein AALP_AA5G186500                  51.2    3e-05   
ref|XP_010067297.1|  PREDICTED: patatin-like protein 6                51.2    4e-05   
emb|CDX68587.1|  BnaC01g08660D                                        50.8    5e-05   
ref|XP_010534282.1|  PREDICTED: patatin-like protein 8                50.8    5e-05   
ref|XP_010253644.1|  PREDICTED: patatin-like protein 6                50.8    5e-05   
emb|CDY43526.1|  BnaA01g07180D                                        50.8    5e-05   
ref|XP_009128483.1|  PREDICTED: LOW QUALITY PROTEIN: patatin-like...  50.8    6e-05   
ref|XP_008456474.1|  PREDICTED: patatin-like protein 6                50.8    6e-05   
ref|XP_007217968.1|  hypothetical protein PRUPE_ppa005326mg           50.4    6e-05   
ref|XP_008233331.1|  PREDICTED: LOW QUALITY PROTEIN: patatin-like...  50.4    6e-05   
ref|XP_009413712.1|  PREDICTED: patatin-like protein 6                50.4    7e-05   
ref|XP_002878007.1|  hypothetical protein ARALYDRAFT_485912           50.1    8e-05   
ref|XP_010516040.1|  PREDICTED: patatin-like protein 7                50.1    1e-04   
ref|XP_010427227.1|  PREDICTED: patatin-like protein 7                50.1    1e-04   
ref|XP_009401958.1|  PREDICTED: patatin-like protein 6                49.7    1e-04   
ref|XP_009381968.1|  PREDICTED: patatin-like protein 6                49.3    1e-04   
ref|XP_004162843.1|  PREDICTED: patatin group A-3-like                48.9    2e-04   
gb|ABK94145.1|  unknown                                               48.1    2e-04   Populus trichocarpa [western balsam poplar]
ref|XP_004134887.1|  PREDICTED: patatin group A-3-like                48.5    3e-04   
ref|XP_010451115.1|  PREDICTED: patatin-like protein 8                48.5    3e-04   
gb|EPS72086.1|  hypothetical protein M569_02674                       48.1    3e-04   
ref|XP_008439498.1|  PREDICTED: patatin-like protein 3                48.1    4e-04   
ref|XP_002867388.1|  hypothetical protein ARALYDRAFT_491780           48.1    4e-04   
ref|NP_194709.2|  PATATIN-like protein 8                              48.1    4e-04   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001190866.1|  PATATIN-like protein 8                           48.1    4e-04   
ref|XP_010433064.1|  PREDICTED: patatin-like protein 8                48.1    4e-04   
ref|XP_006412806.1|  hypothetical protein EUTSA_v10027483mg           48.1    4e-04   
ref|XP_006293987.1|  hypothetical protein CARUB_v10022979mg           48.1    4e-04   
ref|XP_010438260.1|  PREDICTED: patatin-like protein 8                48.1    4e-04   
gb|KFK29540.1|  hypothetical protein AALP_AA7G147300                  48.1    4e-04   
gb|KFK29539.1|  hypothetical protein AALP_AA7G147300                  48.1    4e-04   
ref|XP_011001376.1|  PREDICTED: patatin-like protein 7                48.1    4e-04   
emb|CBI39004.3|  unnamed protein product                              47.4    6e-04   
gb|EPS63739.1|  hypothetical protein M569_11046                       47.4    6e-04   
ref|XP_002276337.2|  PREDICTED: patatin-like protein 3                47.4    7e-04   Vitis vinifera
ref|XP_010052585.1|  PREDICTED: patatin-like protein 7                47.0    8e-04   
ref|XP_004295464.1|  PREDICTED: uncharacterized protein LOC101292983  47.0    0.001   



>ref|XP_006345802.1| PREDICTED: patatin group D-2-like [Solanum tuberosum]
Length=466

 Score = 61.6 bits (148),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 37/67 (55%), Positives = 39/67 (58%), Gaps = 8/67 (12%)
 Frame = -2

Query  330  RVT*VESGL---VCMSSVNGSTHCVAKDRRLGMRNLTSATITHVLQNKQEFP-----EHQ  175
            R T  E GL   VCM SV+G T CVA D  L M N T+A ITHVL NKQEFP     E  
Sbjct  253  RATSAEPGLFEPVCMKSVDGKTGCVAVDGGLAMSNPTAAAITHVLHNKQEFPFVRGVEDI  312

Query  174  LCAHLGT  154
            L   LGT
Sbjct  313  LVLSLGT  319



>ref|XP_004239676.1| PREDICTED: patatin-like protein 6 [Solanum lycopersicum]
 ref|XP_010321321.1| PREDICTED: patatin-like protein 6 [Solanum lycopersicum]
 ref|XP_010321322.1| PREDICTED: patatin-like protein 6 [Solanum lycopersicum]
Length=466

 Score = 61.6 bits (148),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 37/67 (55%), Positives = 39/67 (58%), Gaps = 8/67 (12%)
 Frame = -2

Query  330  RVT*VESGL---VCMSSVNGSTHCVAKDRRLGMRNLTSATITHVLQNKQEFP-----EHQ  175
            R T  E GL   VCM SV+G T CVA D  L M N T+A ITHVL NKQEFP     E  
Sbjct  253  RATSAEPGLFEPVCMKSVDGKTGCVAVDGGLAMSNPTAAAITHVLHNKQEFPFVRGVEDI  312

Query  174  LCAHLGT  154
            L   LGT
Sbjct  313  LVLSLGT  319



>ref|XP_010670011.1| PREDICTED: patatin-like protein 6 [Beta vulgaris subsp. vulgaris]
 ref|XP_010670012.1| PREDICTED: patatin-like protein 6 [Beta vulgaris subsp. vulgaris]
 ref|XP_010670013.1| PREDICTED: patatin-like protein 6 [Beta vulgaris subsp. vulgaris]
Length=470

 Score = 61.6 bits (148),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 36/67 (54%), Positives = 40/67 (60%), Gaps = 8/67 (12%)
 Frame = -2

Query  330  RVT*VESGL---VCMSSVNGSTHCVAKDRRLGMRNLTSATITHVLQNKQEFP-----EHQ  175
            R T  E G+   VCM S++GST CVA D  L M N T+A ITHVL NKQEFP     E  
Sbjct  258  RATSAEPGIFEPVCMRSIDGSTRCVAVDGGLAMGNPTAAAITHVLHNKQEFPFVRGVEDI  317

Query  174  LCAHLGT  154
            L   LGT
Sbjct  318  LLLSLGT  324



>ref|XP_009605268.1| PREDICTED: patatin-like protein 6 [Nicotiana tomentosiformis]
Length=475

 Score = 60.8 bits (146),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 36/67 (54%), Positives = 39/67 (58%), Gaps = 8/67 (12%)
 Frame = -2

Query  330  RVT*VESGL---VCMSSVNGSTHCVAKDRRLGMRNLTSATITHVLQNKQEFP-----EHQ  175
            R T  E G+   VCM SV+G T CVA D  L M N T+A ITHVL NKQEFP     E  
Sbjct  258  RATSAEPGVFEPVCMKSVDGKTKCVAVDGGLAMSNPTAAAITHVLHNKQEFPFVRGVEDI  317

Query  174  LCAHLGT  154
            L   LGT
Sbjct  318  LVLSLGT  324



>ref|XP_010529102.1| PREDICTED: patatin-like protein 6 [Tarenaya hassleriana]
Length=487

 Score = 60.1 bits (144),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 37/71 (52%), Positives = 42/71 (59%), Gaps = 8/71 (11%)
 Frame = -2

Query  330  RVT*VESGL---VCMSSVNGSTHCVAKDRRLGMRNLTSATITHVLQNKQEFP-----EHQ  175
            R T  E G    V M+SV+GST CVA D  L M N T+A ITHVL NKQEFP     E  
Sbjct  262  RATWAEPGAFEAVDMASVDGSTRCVAVDGGLAMSNPTAAAITHVLHNKQEFPFVRGVEDL  321

Query  174  LCAHLGT*KPI  142
            L   LGT +P+
Sbjct  322  LVLSLGTGQPL  332



>ref|XP_009760715.1| PREDICTED: patatin-like protein 6 isoform X2 [Nicotiana sylvestris]
Length=376

 Score = 58.9 bits (141),  Expect = 7e-08, Method: Composition-based stats.
 Identities = 32/55 (58%), Positives = 34/55 (62%), Gaps = 5/55 (9%)
 Frame = -2

Query  303  VCMSSVNGSTHCVAKDRRLGMRNLTSATITHVLQNKQEFP-----EHQLCAHLGT  154
            VCM SV+G T CVA D  L M N T+A ITHVL NKQEFP     E  L   LGT
Sbjct  256  VCMKSVDGKTGCVAVDGGLAMSNPTAAAITHVLHNKQEFPFVRGVEDILVLSLGT  310



>ref|XP_009630207.1| PREDICTED: patatin-like protein 6 isoform X3 [Nicotiana tomentosiformis]
Length=376

 Score = 58.9 bits (141),  Expect = 7e-08, Method: Composition-based stats.
 Identities = 32/55 (58%), Positives = 34/55 (62%), Gaps = 5/55 (9%)
 Frame = -2

Query  303  VCMSSVNGSTHCVAKDRRLGMRNLTSATITHVLQNKQEFP-----EHQLCAHLGT  154
            VCM SV+G T CVA D  L M N T+A ITHVL NKQEFP     E  L   LGT
Sbjct  256  VCMKSVDGKTGCVAVDGGLAMSNPTAAAITHVLHNKQEFPFVRGVEDILVLSLGT  310



>ref|XP_009630205.1| PREDICTED: patatin-like protein 6 isoform X2 [Nicotiana tomentosiformis]
Length=377

 Score = 58.9 bits (141),  Expect = 7e-08, Method: Composition-based stats.
 Identities = 32/55 (58%), Positives = 34/55 (62%), Gaps = 5/55 (9%)
 Frame = -2

Query  303  VCMSSVNGSTHCVAKDRRLGMRNLTSATITHVLQNKQEFP-----EHQLCAHLGT  154
            VCM SV+G T CVA D  L M N T+A ITHVL NKQEFP     E  L   LGT
Sbjct  256  VCMKSVDGKTGCVAVDGGLAMSNPTAAAITHVLHNKQEFPFVRGVEDILVLSLGT  310



>ref|XP_011084360.1| PREDICTED: patatin-like protein 6 [Sesamum indicum]
Length=471

 Score = 58.9 bits (141),  Expect = 9e-08, Method: Composition-based stats.
 Identities = 26/40 (65%), Positives = 29/40 (73%), Gaps = 0/40 (0%)
 Frame = -2

Query  303  VCMSSVNGSTHCVAKDRRLGMRNLTSATITHVLQNKQEFP  184
            +CM SV+GST CV  D  L M N T+A ITHVL NKQEFP
Sbjct  270  ICMKSVDGSTRCVGVDGGLAMNNPTAAAITHVLHNKQEFP  309



>ref|XP_009630204.1| PREDICTED: patatin-like protein 6 isoform X1 [Nicotiana tomentosiformis]
Length=453

 Score = 58.9 bits (141),  Expect = 9e-08, Method: Composition-based stats.
 Identities = 32/55 (58%), Positives = 34/55 (62%), Gaps = 5/55 (9%)
 Frame = -2

Query  303  VCMSSVNGSTHCVAKDRRLGMRNLTSATITHVLQNKQEFP-----EHQLCAHLGT  154
            VCM SV+G T CVA D  L M N T+A ITHVL NKQEFP     E  L   LGT
Sbjct  256  VCMKSVDGKTGCVAVDGGLAMSNPTAAAITHVLHNKQEFPFVRGVEDILVLSLGT  310



>ref|XP_009760706.1| PREDICTED: patatin-like protein 6 isoform X1 [Nicotiana sylvestris]
Length=453

 Score = 58.9 bits (141),  Expect = 9e-08, Method: Composition-based stats.
 Identities = 32/55 (58%), Positives = 34/55 (62%), Gaps = 5/55 (9%)
 Frame = -2

Query  303  VCMSSVNGSTHCVAKDRRLGMRNLTSATITHVLQNKQEFP-----EHQLCAHLGT  154
            VCM SV+G T CVA D  L M N T+A ITHVL NKQEFP     E  L   LGT
Sbjct  256  VCMKSVDGKTGCVAVDGGLAMSNPTAAAITHVLHNKQEFPFVRGVEDILVLSLGT  310



>ref|XP_009764486.1| PREDICTED: patatin-like protein 6 [Nicotiana sylvestris]
Length=475

 Score = 58.9 bits (141),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 35/67 (52%), Positives = 38/67 (57%), Gaps = 8/67 (12%)
 Frame = -2

Query  330  RVT*VESGL---VCMSSVNGSTHCVAKDRRLGMRNLTSATITHVLQNKQEFP-----EHQ  175
            R T  E G+   VCM SV+G T CVA D  L M N  +A ITHVL NKQEFP     E  
Sbjct  258  RATSAEPGVFEPVCMKSVDGKTKCVAVDGGLAMSNPAAAAITHVLHNKQEFPFVRGVEDI  317

Query  174  LCAHLGT  154
            L   LGT
Sbjct  318  LVLSLGT  324



>gb|KHN00838.1| Patatin-3-Kuras 1 [Glycine soja]
Length=251

 Score = 57.0 bits (136),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 36/67 (54%), Positives = 37/67 (55%), Gaps = 8/67 (12%)
 Frame = -2

Query  330  RVT*VESGL---VCMSSVNGSTHCVAKDRRLGMRNLTSATITHVLQNKQEFP-----EHQ  175
            R T  E GL   V M SV+G T CVA D  L M N T A ITHVL NKQEFP     E  
Sbjct  64   RATSAEPGLFEPVQMRSVDGQTKCVAVDGGLAMSNPTGAAITHVLHNKQEFPFVRGVEDL  123

Query  174  LCAHLGT  154
            L   LGT
Sbjct  124  LVLSLGT  130



>gb|KHN17132.1| Patatin-3-Kuras 1 [Glycine soja]
Length=252

 Score = 57.0 bits (136),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 36/67 (54%), Positives = 37/67 (55%), Gaps = 8/67 (12%)
 Frame = -2

Query  330  RVT*VESGL---VCMSSVNGSTHCVAKDRRLGMRNLTSATITHVLQNKQEFP-----EHQ  175
            R T  E GL   V M SV+G T CVA D  L M N T A ITHVL NKQEFP     E  
Sbjct  64   RATSAEPGLFEPVQMRSVDGQTKCVAVDGGLAMSNPTGAAITHVLHNKQEFPFVRGVEDL  123

Query  174  LCAHLGT  154
            L   LGT
Sbjct  124  LVLSLGT  130



>ref|XP_007009821.1| PATATIN-like protein 6, IIB [Theobroma cacao]
 gb|EOY18631.1| PATATIN-like protein 6, IIB [Theobroma cacao]
Length=460

 Score = 58.2 bits (139),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 36/67 (54%), Positives = 38/67 (57%), Gaps = 8/67 (12%)
 Frame = -2

Query  330  RVT*VESGL---VCMSSVNGSTHCVAKDRRLGMRNLTSATITHVLQNKQEFP-----EHQ  175
            R T  E GL   V M SV+G T CVA D  L M N T+A ITHVL NKQEFP     E  
Sbjct  248  RATSAEPGLFDPVLMRSVDGETRCVAVDGGLAMSNPTAAAITHVLHNKQEFPFVRGVEDL  307

Query  174  LCAHLGT  154
            L   LGT
Sbjct  308  LVLSLGT  314



>gb|KDO42600.1| hypothetical protein CISIN_1g012597mg [Citrus sinensis]
 gb|KDO42601.1| hypothetical protein CISIN_1g012597mg [Citrus sinensis]
Length=460

 Score = 57.8 bits (138),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 37/73 (51%), Positives = 42/73 (58%), Gaps = 8/73 (11%)
 Frame = -2

Query  330  RVT*VESGL---VCMSSVNGSTHCVAKDRRLGMRNLTSATITHVLQNKQEFP-----EHQ  175
            R T  E GL   V M SV+G T CVA D  L M N T+A ITHVL NKQEFP     E  
Sbjct  248  RATSSEPGLFDPVLMRSVDGQTRCVAVDGGLAMSNPTAAAITHVLHNKQEFPFVRGVEDL  307

Query  174  LCAHLGT*KPIKA  136
            L   LGT + ++A
Sbjct  308  LVLSLGTGQLLEA  320



>ref|XP_006436295.1| hypothetical protein CICLE_v10031470mg [Citrus clementina]
 ref|XP_006436296.1| hypothetical protein CICLE_v10031470mg [Citrus clementina]
 ref|XP_006485862.1| PREDICTED: patatin-3-Kuras 1-like [Citrus sinensis]
 gb|ESR49535.1| hypothetical protein CICLE_v10031470mg [Citrus clementina]
 gb|ESR49536.1| hypothetical protein CICLE_v10031470mg [Citrus clementina]
Length=460

 Score = 57.8 bits (138),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 37/73 (51%), Positives = 42/73 (58%), Gaps = 8/73 (11%)
 Frame = -2

Query  330  RVT*VESGL---VCMSSVNGSTHCVAKDRRLGMRNLTSATITHVLQNKQEFP-----EHQ  175
            R T  E GL   V M SV+G T CVA D  L M N T+A ITHVL NKQEFP     E  
Sbjct  248  RATSSEPGLFDPVLMRSVDGQTRCVAVDGGLAMSNPTAAAITHVLHNKQEFPFVRGVEDL  307

Query  174  LCAHLGT*KPIKA  136
            L   LGT + ++A
Sbjct  308  LVLSLGTGQLLEA  320



>gb|EYU39583.1| hypothetical protein MIMGU_mgv1a005615mg [Erythranthe guttata]
Length=477

 Score = 57.8 bits (138),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 26/40 (65%), Positives = 29/40 (73%), Gaps = 0/40 (0%)
 Frame = -2

Query  303  VCMSSVNGSTHCVAKDRRLGMRNLTSATITHVLQNKQEFP  184
            VCM S++GST CV  D  L M N T+A ITHVL NKQEFP
Sbjct  275  VCMKSIDGSTRCVGVDGGLVMNNPTAAAITHVLHNKQEFP  314



>gb|KHG03997.1| Patatin group A-3 [Gossypium arboreum]
Length=461

 Score = 57.4 bits (137),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 36/67 (54%), Positives = 38/67 (57%), Gaps = 8/67 (12%)
 Frame = -2

Query  330  RVT*VESGL---VCMSSVNGSTHCVAKDRRLGMRNLTSATITHVLQNKQEFP-----EHQ  175
            R T  E GL   V M SV+G T CVA D  L M N T+A ITHVL NKQEFP     E  
Sbjct  246  RATSAEPGLFEPVKMQSVDGQTSCVAVDGGLAMSNPTAAAITHVLHNKQEFPFVRGVEDI  305

Query  174  LCAHLGT  154
            L   LGT
Sbjct  306  LVLSLGT  312



>emb|CDY07662.1| BnaA03g18490D [Brassica napus]
Length=476

 Score = 57.0 bits (136),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 36/67 (54%), Positives = 38/67 (57%), Gaps = 8/67 (12%)
 Frame = -2

Query  330  RVT*VESGL---VCMSSVNGSTHCVAKDRRLGMRNLTSATITHVLQNKQEFP-----EHQ  175
            R T  E G+   V M SV+G T CVA D  L M N TSA ITHVL NKQEFP     E  
Sbjct  251  RATWAEPGVFEPVEMRSVDGKTRCVAVDGGLAMSNPTSAAITHVLHNKQEFPFVRGVEDL  310

Query  174  LCAHLGT  154
            L   LGT
Sbjct  311  LVLSLGT  317



>ref|XP_009133349.1| PREDICTED: patatin-like protein 6 [Brassica rapa]
Length=483

 Score = 57.0 bits (136),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 36/67 (54%), Positives = 38/67 (57%), Gaps = 8/67 (12%)
 Frame = -2

Query  330  RVT*VESGL---VCMSSVNGSTHCVAKDRRLGMRNLTSATITHVLQNKQEFP-----EHQ  175
            R T  E G+   V M SV+G T CVA D  L M N TSA ITHVL NKQEFP     E  
Sbjct  258  RATWAEPGVFEPVEMRSVDGKTRCVAVDGGLAMSNPTSAAITHVLHNKQEFPFVRGVEDL  317

Query  174  LCAHLGT  154
            L   LGT
Sbjct  318  LVLSLGT  324



>ref|XP_002311098.1| patatin-related family protein [Populus trichocarpa]
 gb|EEE88465.1| patatin-related family protein [Populus trichocarpa]
Length=458

 Score = 57.0 bits (136),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 35/67 (52%), Positives = 38/67 (57%), Gaps = 8/67 (12%)
 Frame = -2

Query  330  RVT*VESGL---VCMSSVNGSTHCVAKDRRLGMRNLTSATITHVLQNKQEFP-----EHQ  175
            R T  E GL   V M SV+G T C+A D  L M N T+A ITHVL NKQEFP     E  
Sbjct  246  RATSAEPGLFDPVLMRSVDGQTRCLAVDGGLAMSNPTAAAITHVLHNKQEFPFVRGVEDL  305

Query  174  LCAHLGT  154
            L   LGT
Sbjct  306  LVLSLGT  312



>ref|XP_011077003.1| PREDICTED: patatin-like protein 6 [Sesamum indicum]
Length=474

 Score = 57.0 bits (136),  Expect = 5e-07, Method: Composition-based stats.
 Identities = 26/40 (65%), Positives = 28/40 (70%), Gaps = 0/40 (0%)
 Frame = -2

Query  303  VCMSSVNGSTHCVAKDRRLGMRNLTSATITHVLQNKQEFP  184
            VCM SV+G T CV  D  L M N T+A ITHVL NKQEFP
Sbjct  273  VCMKSVDGLTRCVGVDGGLAMNNPTAAAITHVLHNKQEFP  312



>ref|XP_006589431.1| PREDICTED: patatin-3-Kuras 1-like [Glycine max]
Length=463

 Score = 57.0 bits (136),  Expect = 5e-07, Method: Composition-based stats.
 Identities = 36/67 (54%), Positives = 37/67 (55%), Gaps = 8/67 (12%)
 Frame = -2

Query  330  RVT*VESGL---VCMSSVNGSTHCVAKDRRLGMRNLTSATITHVLQNKQEFP-----EHQ  175
            R T  E GL   V M SV+G T CVA D  L M N T A ITHVL NKQEFP     E  
Sbjct  251  RATSAEPGLFEPVQMRSVDGQTKCVAVDGGLAMSNPTGAAITHVLHNKQEFPFVRGVEDL  310

Query  174  LCAHLGT  154
            L   LGT
Sbjct  311  LVLSLGT  317



>gb|KEH16034.1| patatin-like phospholipase, partial [Medicago truncatula]
Length=299

 Score = 55.8 bits (133),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 35/67 (52%), Positives = 37/67 (55%), Gaps = 8/67 (12%)
 Frame = -2

Query  330  RVT*VESGL---VCMSSVNGSTHCVAKDRRLGMRNLTSATITHVLQNKQEFP-----EHQ  175
            R T  E GL   V M S++G T CVA D  L M N T A ITHVL NKQEFP     E  
Sbjct  87   RATSAEPGLLEPVQMRSIDGVTKCVAVDGGLAMNNPTGAAITHVLHNKQEFPFVRGVEDL  146

Query  174  LCAHLGT  154
            L   LGT
Sbjct  147  LVLSLGT  153



>ref|XP_003591915.1| Patatin-T5, partial [Medicago truncatula]
Length=300

 Score = 55.8 bits (133),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 35/67 (52%), Positives = 37/67 (55%), Gaps = 8/67 (12%)
 Frame = -2

Query  330  RVT*VESGL---VCMSSVNGSTHCVAKDRRLGMRNLTSATITHVLQNKQEFP-----EHQ  175
            R T  E GL   V M S++G T CVA D  L M N T A ITHVL NKQEFP     E  
Sbjct  88   RATSAEPGLLEPVQMRSIDGVTKCVAVDGGLAMNNPTGAAITHVLHNKQEFPFVRGVEDL  147

Query  174  LCAHLGT  154
            L   LGT
Sbjct  148  LVLSLGT  154



>gb|KFK36815.1| hypothetical protein AALP_AA4G175000 [Arabis alpina]
Length=484

 Score = 56.6 bits (135),  Expect = 6e-07, Method: Composition-based stats.
 Identities = 35/67 (52%), Positives = 38/67 (57%), Gaps = 8/67 (12%)
 Frame = -2

Query  330  RVT*VESGL---VCMSSVNGSTHCVAKDRRLGMRNLTSATITHVLQNKQEFP-----EHQ  175
            R T  E G+   V M S+NG T CVA D  L M N T+A ITHVL NKQEFP     E  
Sbjct  259  RATWAEPGVFEPVEMRSLNGKTRCVAVDGGLAMSNPTAAAITHVLHNKQEFPFVRGVEDL  318

Query  174  LCAHLGT  154
            L   LGT
Sbjct  319  LVLSLGT  325



>ref|XP_004496284.1| PREDICTED: patatin-1-Kuras 2-like [Cicer arietinum]
Length=467

 Score = 56.2 bits (134),  Expect = 7e-07, Method: Composition-based stats.
 Identities = 35/67 (52%), Positives = 37/67 (55%), Gaps = 8/67 (12%)
 Frame = -2

Query  330  RVT*VESGL---VCMSSVNGSTHCVAKDRRLGMRNLTSATITHVLQNKQEFP-----EHQ  175
            R T  E GL   V M S++G T CVA D  L M N T A ITHVL NKQEFP     E  
Sbjct  255  RATSAEPGLLEPVQMRSIDGQTKCVAVDGGLAMSNPTGAAITHVLHNKQEFPFVRGVEDL  314

Query  174  LCAHLGT  154
            L   LGT
Sbjct  315  LVLSLGT  321



>ref|XP_010557098.1| PREDICTED: LOW QUALITY PROTEIN: patatin-like protein 6 [Tarenaya 
hassleriana]
Length=509

 Score = 56.2 bits (134),  Expect = 8e-07, Method: Composition-based stats.
 Identities = 35/67 (52%), Positives = 39/67 (58%), Gaps = 8/67 (12%)
 Frame = -2

Query  330  RVT*VESGL---VCMSSVNGSTHCVAKDRRLGMRNLTSATITHVLQNKQEFP-----EHQ  175
            R T  E G    V M+SV+GST C+A D  L M N T+A ITHVL NKQEFP     E  
Sbjct  282  RATWAEPGAFEAVEMASVDGSTRCLAVDGGLAMSNPTAAAITHVLHNKQEFPFVRGVEDL  341

Query  174  LCAHLGT  154
            L   LGT
Sbjct  342  LVLSLGT  348



>emb|CBI31469.3| unnamed protein product [Vitis vinifera]
Length=359

 Score = 55.8 bits (133),  Expect = 9e-07, Method: Composition-based stats.
 Identities = 31/55 (56%), Positives = 33/55 (60%), Gaps = 5/55 (9%)
 Frame = -2

Query  303  VCMSSVNGSTHCVAKDRRLGMRNLTSATITHVLQNKQEFP-----EHQLCAHLGT  154
            V M SV+G T CVA D  L M N T+A ITHVL NKQEFP     E  L   LGT
Sbjct  159  VSMRSVDGQTRCVAIDGGLAMSNPTAAAITHVLHNKQEFPFVRGVEDLLVLSLGT  213



>ref|XP_002881637.1| hypothetical protein ARALYDRAFT_903163 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH57896.1| hypothetical protein ARALYDRAFT_903163 [Arabidopsis lyrata subsp. 
lyrata]
Length=495

 Score = 55.8 bits (133),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 35/67 (52%), Positives = 38/67 (57%), Gaps = 8/67 (12%)
 Frame = -2

Query  330  RVT*VESGL---VCMSSVNGSTHCVAKDRRLGMRNLTSATITHVLQNKQEFP-----EHQ  175
            R T  E G+   V M SV+G T CVA D  L M N T+A ITHVL NKQEFP     E  
Sbjct  270  RATWAEPGVFEPVEMRSVDGKTRCVAVDGGLAMSNPTAAAITHVLHNKQEFPFVRGVEDL  329

Query  174  LCAHLGT  154
            L   LGT
Sbjct  330  LVLSLGT  336



>ref|XP_006294077.1| hypothetical protein CARUB_v10023072mg [Capsella rubella]
 ref|XP_006294078.1| hypothetical protein CARUB_v10023072mg [Capsella rubella]
 gb|EOA26975.1| hypothetical protein CARUB_v10023072mg [Capsella rubella]
 gb|EOA26976.1| hypothetical protein CARUB_v10023072mg [Capsella rubella]
Length=497

 Score = 55.8 bits (133),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 35/67 (52%), Positives = 38/67 (57%), Gaps = 8/67 (12%)
 Frame = -2

Query  330  RVT*VESGL---VCMSSVNGSTHCVAKDRRLGMRNLTSATITHVLQNKQEFP-----EHQ  175
            R T  E G+   V M SV+G T CVA D  L M N T+A ITHVL NKQEFP     E  
Sbjct  272  RATWAEPGVFEPVEMRSVDGKTRCVAVDGGLAMSNPTAAAITHVLHNKQEFPFVRGVEDL  331

Query  174  LCAHLGT  154
            L   LGT
Sbjct  332  LVLSLGT  338



>ref|NP_181455.1| PATATIN-like protein 6 [Arabidopsis thaliana]
 sp|O80959.1|PLP6_ARATH RecName: Full=Patatin-like protein 6; Short=AtPLP6; AltName: 
Full=Patatin-related phospholipase A IIIalpha; Short=pPLAIIIa; 
AltName: Full=Phospholipase A IIB; Short=AtPLAIIB [Arabidopsis 
thaliana]
 gb|AAC28986.1| similar to latex allergen from Hevea brasiliensis [Arabidopsis 
thaliana]
 gb|AAL32726.1| putative patatin protein [Arabidopsis thaliana]
 gb|AAN31902.1| unknown protein [Arabidopsis thaliana]
 gb|AAP68308.1| At2g39220 [Arabidopsis thaliana]
 gb|AEC09647.1| PATATIN-like protein 6 [Arabidopsis thaliana]
Length=499

 Score = 55.8 bits (133),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 35/67 (52%), Positives = 38/67 (57%), Gaps = 8/67 (12%)
 Frame = -2

Query  330  RVT*VESGL---VCMSSVNGSTHCVAKDRRLGMRNLTSATITHVLQNKQEFP-----EHQ  175
            R T  E G+   V M SV+G T CVA D  L M N T+A ITHVL NKQEFP     E  
Sbjct  274  RATWAEPGVFEPVEMRSVDGKTRCVAVDGGLAMSNPTAAAITHVLHNKQEFPFVRGVEDL  333

Query  174  LCAHLGT  154
            L   LGT
Sbjct  334  LVLSLGT  340



>gb|KEH43521.1| patatin-like phospholipase [Medicago truncatula]
Length=463

 Score = 55.8 bits (133),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 35/67 (52%), Positives = 37/67 (55%), Gaps = 8/67 (12%)
 Frame = -2

Query  330  RVT*VESGL---VCMSSVNGSTHCVAKDRRLGMRNLTSATITHVLQNKQEFP-----EHQ  175
            R T  E GL   V M S++G T CVA D  L M N T A ITHVL NKQEFP     E  
Sbjct  251  RATSAEPGLLEPVQMRSIDGVTKCVAVDGGLAMNNPTGAAITHVLHNKQEFPFVRGVEDL  310

Query  174  LCAHLGT  154
            L   LGT
Sbjct  311  LVLSLGT  317



>ref|XP_002275108.1| PREDICTED: patatin-like protein 6 [Vitis vinifera]
 ref|XP_010658410.1| PREDICTED: patatin-like protein 6 [Vitis vinifera]
Length=458

 Score = 55.8 bits (133),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 31/55 (56%), Positives = 33/55 (60%), Gaps = 5/55 (9%)
 Frame = -2

Query  303  VCMSSVNGSTHCVAKDRRLGMRNLTSATITHVLQNKQEFP-----EHQLCAHLGT  154
            V M SV+G T CVA D  L M N T+A ITHVL NKQEFP     E  L   LGT
Sbjct  258  VSMRSVDGQTRCVAIDGGLAMSNPTAAAITHVLHNKQEFPFVRGVEDLLVLSLGT  312



>gb|KDP45100.1| hypothetical protein JCGZ_18542 [Jatropha curcas]
Length=470

 Score = 55.8 bits (133),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 34/67 (51%), Positives = 38/67 (57%), Gaps = 8/67 (12%)
 Frame = -2

Query  330  RVT*VESGL---VCMSSVNGSTHCVAKDRRLGMRNLTSATITHVLQNKQEFP-----EHQ  175
            R T  E GL   V M S++G T C+A D  L M N T+A ITHVL NKQEFP     E  
Sbjct  258  RATSAEPGLFEPVQMRSIDGQTKCLAVDGGLAMSNPTAAAITHVLHNKQEFPFVRGVEDL  317

Query  174  LCAHLGT  154
            L   LGT
Sbjct  318  LVLSLGT  324



>ref|XP_007143699.1| hypothetical protein PHAVU_007G094300g [Phaseolus vulgaris]
 gb|ESW15693.1| hypothetical protein PHAVU_007G094300g [Phaseolus vulgaris]
Length=458

 Score = 55.5 bits (132),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 35/67 (52%), Positives = 37/67 (55%), Gaps = 8/67 (12%)
 Frame = -2

Query  330  RVT*VESGL---VCMSSVNGSTHCVAKDRRLGMRNLTSATITHVLQNKQEFP-----EHQ  175
            R T  E GL   V M SV+G T C+A D  L M N T A ITHVL NKQEFP     E  
Sbjct  246  RATSAEPGLFEPVQMRSVDGQTKCLAVDGGLAMSNPTGAAITHVLHNKQEFPFVRGVEDL  305

Query  174  LCAHLGT  154
            L   LGT
Sbjct  306  LVLSLGT  312



>ref|XP_002529576.1| Patatin T5 precursor, putative [Ricinus communis]
 gb|EEF32810.1| Patatin T5 precursor, putative [Ricinus communis]
Length=467

 Score = 55.5 bits (132),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 30/52 (58%), Positives = 33/52 (63%), Gaps = 3/52 (6%)
 Frame = -2

Query  330  RVT*VESGL---VCMSSVNGSTHCVAKDRRLGMRNLTSATITHVLQNKQEFP  184
            R T  E GL   V M SV+G T C+A D  L M N T+A ITHVL NKQEFP
Sbjct  254  RATSAEPGLFEPVQMRSVDGQTKCLAVDGGLAMSNPTAAAITHVLHNKQEFP  305



>ref|XP_010509059.1| PREDICTED: patatin-like protein 6 [Camelina sativa]
Length=495

 Score = 55.5 bits (132),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 34/67 (51%), Positives = 39/67 (58%), Gaps = 8/67 (12%)
 Frame = -2

Query  330  RVT*VESGL---VCMSSVNGSTHCVAKDRRLGMRNLTSATITHVLQNKQEFP-----EHQ  175
            + T  E+G+   V M SV+G T CVA D  L M N T+A ITHVL NKQEFP     E  
Sbjct  270  KATWAETGVFEPVEMRSVDGKTRCVAVDGGLAMSNPTAAAITHVLHNKQEFPFVRGVEDL  329

Query  174  LCAHLGT  154
            L   LGT
Sbjct  330  LVLSLGT  336



>ref|XP_010517259.1| PREDICTED: patatin-like protein 6 [Camelina sativa]
Length=500

 Score = 55.5 bits (132),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 34/67 (51%), Positives = 39/67 (58%), Gaps = 8/67 (12%)
 Frame = -2

Query  330  RVT*VESGL---VCMSSVNGSTHCVAKDRRLGMRNLTSATITHVLQNKQEFP-----EHQ  175
            + T  E+G+   V M SV+G T CVA D  L M N T+A ITHVL NKQEFP     E  
Sbjct  275  KATWAETGVFEPVEMRSVDGKTRCVAVDGGLAMSNPTAAAITHVLHNKQEFPFVRGVEDL  334

Query  174  LCAHLGT  154
            L   LGT
Sbjct  335  LVLSLGT  341



>ref|XP_011031755.1| PREDICTED: patatin-like protein 6 isoform X2 [Populus euphratica]
Length=470

 Score = 55.1 bits (131),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 34/67 (51%), Positives = 38/67 (57%), Gaps = 8/67 (12%)
 Frame = -2

Query  330  RVT*VESGL---VCMSSVNGSTHCVAKDRRLGMRNLTSATITHVLQNKQEFP-----EHQ  175
            + T  E GL   V M SV+G T C+A D  L M N T+A ITHVL NKQEFP     E  
Sbjct  254  QATSAEPGLFDPVLMRSVDGQTRCLAVDGGLAMSNPTAAAITHVLHNKQEFPFVRGVEDL  313

Query  174  LCAHLGT  154
            L   LGT
Sbjct  314  LVLSLGT  320



>ref|XP_011031752.1| PREDICTED: patatin-like protein 6 isoform X1 [Populus euphratica]
 ref|XP_011031754.1| PREDICTED: patatin-like protein 6 isoform X1 [Populus euphratica]
Length=479

 Score = 55.1 bits (131),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 34/67 (51%), Positives = 38/67 (57%), Gaps = 8/67 (12%)
 Frame = -2

Query  330  RVT*VESGL---VCMSSVNGSTHCVAKDRRLGMRNLTSATITHVLQNKQEFP-----EHQ  175
            + T  E GL   V M SV+G T C+A D  L M N T+A ITHVL NKQEFP     E  
Sbjct  254  QATSAEPGLFDPVLMRSVDGQTRCLAVDGGLAMSNPTAAAITHVLHNKQEFPFVRGVEDL  313

Query  174  LCAHLGT  154
            L   LGT
Sbjct  314  LVLSLGT  320



>gb|EYU39817.1| hypothetical protein MIMGU_mgv1a0057782mg [Erythranthe guttata]
Length=471

 Score = 55.1 bits (131),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 25/40 (63%), Positives = 28/40 (70%), Gaps = 0/40 (0%)
 Frame = -2

Query  303  VCMSSVNGSTHCVAKDRRLGMRNLTSATITHVLQNKQEFP  184
            + M SV+GST CV  D  L M N T+A ITHVL NKQEFP
Sbjct  273  ISMKSVDGSTRCVGVDGGLAMNNPTAAAITHVLHNKQEFP  312



>emb|CDP04363.1| unnamed protein product [Coffea canephora]
Length=457

 Score = 55.1 bits (131),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 24/40 (60%), Positives = 28/40 (70%), Gaps = 0/40 (0%)
 Frame = -2

Query  303  VCMSSVNGSTHCVAKDRRLGMRNLTSATITHVLQNKQEFP  184
            VC+ SV+G + CV  D  L M N T+A ITHVL NKQEFP
Sbjct  252  VCLKSVDGQSRCVGVDGGLAMSNPTAAAITHVLHNKQEFP  291



>ref|XP_004307392.1| PREDICTED: patatin group D-2-like [Fragaria vesca subsp. vesca]
Length=457

 Score = 55.1 bits (131),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 30/52 (58%), Positives = 32/52 (62%), Gaps = 3/52 (6%)
 Frame = -2

Query  330  RVT*VESGL---VCMSSVNGSTHCVAKDRRLGMRNLTSATITHVLQNKQEFP  184
            R T  E GL   V M SVN  T C+A D  L M N T+A ITHVL NKQEFP
Sbjct  245  RATSAEPGLFEPVQMRSVNNQTRCLAVDGGLAMSNPTAAAITHVLHNKQEFP  296



>ref|XP_011040991.1| PREDICTED: patatin-like protein 6 [Populus euphratica]
Length=464

 Score = 54.7 bits (130),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 33/67 (49%), Positives = 37/67 (55%), Gaps = 8/67 (12%)
 Frame = -2

Query  330  RVT*VESGL---VCMSSVNGSTHCVAKDRRLGMRNLTSATITHVLQNKQEFP-----EHQ  175
            R T  E GL   V M S++G T C+A D  L M N  +A ITHVL NKQEFP     E  
Sbjct  252  RATSAEPGLFDPVLMGSIDGQTRCLAVDGGLAMSNPAAAAITHVLHNKQEFPFVRGVEDL  311

Query  174  LCAHLGT  154
            L   LGT
Sbjct  312  LVLSLGT  318



>ref|XP_002316362.1| patatin-related family protein [Populus trichocarpa]
 gb|EEF02533.1| patatin-related family protein [Populus trichocarpa]
Length=464

 Score = 54.7 bits (130),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 33/67 (49%), Positives = 37/67 (55%), Gaps = 8/67 (12%)
 Frame = -2

Query  330  RVT*VESGL---VCMSSVNGSTHCVAKDRRLGMRNLTSATITHVLQNKQEFP-----EHQ  175
            R T  E GL   V M S++G T C+A D  L M N  +A ITHVL NKQEFP     E  
Sbjct  252  RATSAEPGLFDPVLMGSIDGQTRCLAVDGGLAMSNPAAAAITHVLHNKQEFPFVRGVEDL  311

Query  174  LCAHLGT  154
            L   LGT
Sbjct  312  LVLSLGT  318



>emb|CDX74862.1| BnaA05g06080D [Brassica napus]
Length=449

 Score = 54.7 bits (130),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 35/73 (48%), Positives = 41/73 (56%), Gaps = 8/73 (11%)
 Frame = -2

Query  330  RVT*VESGL---VCMSSVNGSTHCVAKDRRLGMRNLTSATITHVLQNKQEFP-----EHQ  175
            R T  E G+   V M SV+G T CVA D  L M N T+A ITHVL NK+EFP     E  
Sbjct  236  RATWAEPGVFEPVEMRSVDGKTRCVAVDGGLAMSNPTAAAITHVLHNKEEFPFVRGVEDL  295

Query  174  LCAHLGT*KPIKA  136
            L   LGT + + A
Sbjct  296  LVLSLGTGQLVDA  308



>ref|XP_001754698.1| predicted protein [Physcomitrella patens]
 gb|EDQ80668.1| predicted protein [Physcomitrella patens]
Length=383

 Score = 54.3 bits (129),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 28/54 (52%), Positives = 35/54 (65%), Gaps = 5/54 (9%)
 Frame = -2

Query  300  CMSSVNGSTHCVAKDRRLGMRNLTSATITHVLQNKQEFP-----EHQLCAHLGT  154
            C++SV+G+T C A D R+ M N T+A ITHVL NK+EFP     E  L   LGT
Sbjct  207  CVTSVDGNTSCTAIDGRVVMHNPTAAAITHVLHNKREFPFVRGVEDLLVLSLGT  260



>ref|XP_006411148.1| hypothetical protein EUTSA_v10016579mg [Eutrema salsugineum]
 gb|ESQ52601.1| hypothetical protein EUTSA_v10016579mg [Eutrema salsugineum]
Length=487

 Score = 54.7 bits (130),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 31/55 (56%), Positives = 33/55 (60%), Gaps = 5/55 (9%)
 Frame = -2

Query  303  VCMSSVNGSTHCVAKDRRLGMRNLTSATITHVLQNKQEFP-----EHQLCAHLGT  154
            V M SV+G T CVA D  L M N T+A ITHVL NKQEFP     E  L   LGT
Sbjct  274  VEMRSVDGKTRCVAVDGGLAMSNPTAAAITHVLHNKQEFPFVRGVEDLLVLSLGT  328



>emb|CDY44633.1| BnaC04g06290D [Brassica napus]
Length=486

 Score = 54.7 bits (130),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 34/67 (51%), Positives = 38/67 (57%), Gaps = 8/67 (12%)
 Frame = -2

Query  330  RVT*VESGL---VCMSSVNGSTHCVAKDRRLGMRNLTSATITHVLQNKQEFP-----EHQ  175
            R T  E G+   V M SV+G T CVA D  L M N T+A ITHVL NK+EFP     E  
Sbjct  262  RATWAEPGVFEPVEMRSVDGKTRCVAVDGGLAMSNPTAAAITHVLHNKEEFPFVRGVEDL  321

Query  174  LCAHLGT  154
            L   LGT
Sbjct  322  LVLSLGT  328



>ref|XP_009143335.1| PREDICTED: patatin-like protein 6 [Brassica rapa]
Length=487

 Score = 54.7 bits (130),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 34/67 (51%), Positives = 38/67 (57%), Gaps = 8/67 (12%)
 Frame = -2

Query  330  RVT*VESGL---VCMSSVNGSTHCVAKDRRLGMRNLTSATITHVLQNKQEFP-----EHQ  175
            R T  E G+   V M SV+G T CVA D  L M N T+A ITHVL NK+EFP     E  
Sbjct  262  RATWAEPGVFEPVEMRSVDGKTRCVAVDGGLAMSNPTAAAITHVLHNKEEFPFVRGVEDL  321

Query  174  LCAHLGT  154
            L   LGT
Sbjct  322  LVLSLGT  328



>emb|CDY24974.1| BnaC03g21980D [Brassica napus]
Length=476

 Score = 54.3 bits (129),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 34/67 (51%), Positives = 37/67 (55%), Gaps = 8/67 (12%)
 Frame = -2

Query  330  RVT*VESGL---VCMSSVNGSTHCVAKDRRLGMRNLTSATITHVLQNKQEFP-----EHQ  175
            R T  E G+   V M SV+G T C A D  L M N T+A ITHVL NKQEFP     E  
Sbjct  251  RATWAEPGVFEPVEMRSVDGKTRCAAVDGGLAMSNPTAAAITHVLHNKQEFPFVRGVEDL  310

Query  174  LCAHLGT  154
            L   LGT
Sbjct  311  LVLSLGT  317



>ref|XP_001763934.1| predicted protein [Physcomitrella patens]
 gb|EDQ71338.1| predicted protein [Physcomitrella patens]
Length=407

 Score = 53.9 bits (128),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 28/54 (52%), Positives = 34/54 (63%), Gaps = 5/54 (9%)
 Frame = -2

Query  300  CMSSVNGSTHCVAKDRRLGMRNLTSATITHVLQNKQEFP-----EHQLCAHLGT  154
            C++SV+G T C A D R+ M N T+A ITHVL NK+EFP     E  L   LGT
Sbjct  234  CVTSVDGKTSCTAIDGRVVMHNPTAAAITHVLHNKREFPSVRGVEDLLVLSLGT  287



>ref|XP_006606244.1| PREDICTED: patatin-3-Kuras 1-like isoform X2 [Glycine max]
Length=462

 Score = 54.3 bits (129),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 31/55 (56%), Positives = 32/55 (58%), Gaps = 5/55 (9%)
 Frame = -2

Query  303  VCMSSVNGSTHCVAKDRRLGMRNLTSATITHVLQNKQEFP-----EHQLCAHLGT  154
            V M SV+G T CVA D  L M N T A ITHVL NKQEFP     E  L   LGT
Sbjct  262  VQMRSVDGQTKCVAVDGGLAMSNPTGAAITHVLHNKQEFPFVRGVEDLLVLSLGT  316



>ref|XP_003556231.2| PREDICTED: patatin-3-Kuras 1-like isoform X1 [Glycine max]
Length=544

 Score = 54.3 bits (129),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 31/55 (56%), Positives = 32/55 (58%), Gaps = 5/55 (9%)
 Frame = -2

Query  303  VCMSSVNGSTHCVAKDRRLGMRNLTSATITHVLQNKQEFP-----EHQLCAHLGT  154
            V M SV+G T CVA D  L M N T A ITHVL NKQEFP     E  L   LGT
Sbjct  344  VQMRSVDGQTKCVAVDGGLAMSNPTGAAITHVLHNKQEFPFVRGVEDLLVLSLGT  398



>ref|XP_009349699.1| PREDICTED: patatin-like protein 6 [Pyrus x bretschneideri]
 ref|XP_009349700.1| PREDICTED: patatin-like protein 6 [Pyrus x bretschneideri]
Length=478

 Score = 53.9 bits (128),  Expect = 5e-06, Method: Composition-based stats.
 Identities = 29/52 (56%), Positives = 32/52 (62%), Gaps = 3/52 (6%)
 Frame = -2

Query  330  RVT*VESGL---VCMSSVNGSTHCVAKDRRLGMRNLTSATITHVLQNKQEFP  184
            R T  E G+   V M SVN  T C+A D  L M N T+A ITHVL NKQEFP
Sbjct  265  RATSAEPGVFEPVQMQSVNNQTKCLAVDGGLAMSNPTAAAITHVLHNKQEFP  316



>ref|XP_010264697.1| PREDICTED: patatin-like protein 6 isoform X2 [Nelumbo nucifera]
Length=456

 Score = 53.5 bits (127),  Expect = 6e-06, Method: Composition-based stats.
 Identities = 25/40 (63%), Positives = 27/40 (68%), Gaps = 0/40 (0%)
 Frame = -2

Query  303  VCMSSVNGSTHCVAKDRRLGMRNLTSATITHVLQNKQEFP  184
            V M SV+G T CVA D  L M N T+A ITHVL NK EFP
Sbjct  256  VAMRSVDGQTQCVAVDGGLAMSNPTAAAITHVLHNKHEFP  295



>ref|XP_009344752.1| PREDICTED: patatin-like protein 6 [Pyrus x bretschneideri]
 ref|XP_009344753.1| PREDICTED: patatin-like protein 6 [Pyrus x bretschneideri]
Length=478

 Score = 53.5 bits (127),  Expect = 6e-06, Method: Composition-based stats.
 Identities = 29/52 (56%), Positives = 32/52 (62%), Gaps = 3/52 (6%)
 Frame = -2

Query  330  RVT*VESGL---VCMSSVNGSTHCVAKDRRLGMRNLTSATITHVLQNKQEFP  184
            R T  E G+   V M SVN  T C+A D  L M N T+A ITHVL NKQEFP
Sbjct  265  RATSAEPGVFEPVQMQSVNNQTKCLAVDGGLAMSNPTAAAITHVLHNKQEFP  316



>ref|XP_010264695.1| PREDICTED: patatin-like protein 6 isoform X1 [Nelumbo nucifera]
 ref|XP_010264696.1| PREDICTED: patatin-like protein 6 isoform X1 [Nelumbo nucifera]
Length=465

 Score = 53.5 bits (127),  Expect = 6e-06, Method: Composition-based stats.
 Identities = 25/40 (63%), Positives = 27/40 (68%), Gaps = 0/40 (0%)
 Frame = -2

Query  303  VCMSSVNGSTHCVAKDRRLGMRNLTSATITHVLQNKQEFP  184
            V M SV+G T CVA D  L M N T+A ITHVL NK EFP
Sbjct  265  VAMRSVDGQTQCVAVDGGLAMSNPTAAAITHVLHNKHEFP  304



>ref|XP_006854500.1| hypothetical protein AMTR_s00175p00049630 [Amborella trichopoda]
 gb|ERN15967.1| hypothetical protein AMTR_s00175p00049630 [Amborella trichopoda]
Length=446

 Score = 53.1 bits (126),  Expect = 8e-06, Method: Composition-based stats.
 Identities = 24/40 (60%), Positives = 28/40 (70%), Gaps = 0/40 (0%)
 Frame = -2

Query  303  VCMSSVNGSTHCVAKDRRLGMRNLTSATITHVLQNKQEFP  184
            + M SV+G T C+A D  L M N T+A ITHVL NKQEFP
Sbjct  239  IMMRSVDGQTRCLAVDGGLAMNNPTAAAITHVLHNKQEFP  278



>ref|XP_010099619.1| Patatin group A-3 [Morus notabilis]
 gb|EXB80085.1| Patatin group A-3 [Morus notabilis]
Length=467

 Score = 53.1 bits (126),  Expect = 9e-06, Method: Composition-based stats.
 Identities = 25/40 (63%), Positives = 28/40 (70%), Gaps = 0/40 (0%)
 Frame = -2

Query  303  VCMSSVNGSTHCVAKDRRLGMRNLTSATITHVLQNKQEFP  184
            V M SV+G T C+A D  L M N T+A ITHVL NKQEFP
Sbjct  267  VQMRSVDGQTRCLAVDGGLAMSNPTAAAITHVLHNKQEFP  306



>ref|XP_008368383.1| PREDICTED: patatin-like protein 6 [Malus domestica]
Length=478

 Score = 53.1 bits (126),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 29/52 (56%), Positives = 32/52 (62%), Gaps = 3/52 (6%)
 Frame = -2

Query  330  RVT*VESGL---VCMSSVNGSTHCVAKDRRLGMRNLTSATITHVLQNKQEFP  184
            R T  E G+   V M SVN  T C+A D  L M N T+A ITHVL NKQEFP
Sbjct  265  RATSAEPGVFEPVQMQSVNKHTKCLAVDGGLAMSNPTAAAITHVLHNKQEFP  316



>emb|CDY07512.1| BnaC06g15520D [Brassica napus]
Length=475

 Score = 52.8 bits (125),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 29/52 (56%), Positives = 34/52 (65%), Gaps = 3/52 (6%)
 Frame = -2

Query  330  RVT*VESGL---VCMSSVNGSTHCVAKDRRLGMRNLTSATITHVLQNKQEFP  184
            R T  E+G+   V M SV+G+T CVA    L M N T+A ITHVL NKQEFP
Sbjct  258  RATWAETGVFEPVEMKSVDGTTKCVAIGGGLAMSNPTAAAITHVLHNKQEFP  309



>ref|XP_009345376.1| PREDICTED: patatin-like protein 6 [Pyrus x bretschneideri]
Length=477

 Score = 52.4 bits (124),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 25/40 (63%), Positives = 27/40 (68%), Gaps = 0/40 (0%)
 Frame = -2

Query  303  VCMSSVNGSTHCVAKDRRLGMRNLTSATITHVLQNKQEFP  184
            V M SVN  T C+A D  L M N T+A ITHVL NKQEFP
Sbjct  276  VQMQSVNNQTKCLAVDGGLAMSNPTAAAITHVLHNKQEFP  315



>ref|XP_008377578.1| PREDICTED: patatin-like protein 6 [Malus domestica]
Length=477

 Score = 52.4 bits (124),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 25/40 (63%), Positives = 27/40 (68%), Gaps = 0/40 (0%)
 Frame = -2

Query  303  VCMSSVNGSTHCVAKDRRLGMRNLTSATITHVLQNKQEFP  184
            V M SVN  T C+A D  L M N T+A ITHVL NKQEFP
Sbjct  276  VQMQSVNNQTKCLAVDGGLAMSNPTAAAITHVLHNKQEFP  315



>ref|XP_009103945.1| PREDICTED: patatin-like protein 7 [Brassica rapa]
Length=476

 Score = 52.4 bits (124),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 29/52 (56%), Positives = 33/52 (63%), Gaps = 3/52 (6%)
 Frame = -2

Query  330  RVT*VESGL---VCMSSVNGSTHCVAKDRRLGMRNLTSATITHVLQNKQEFP  184
            R T  E G+   V M SV+G+T CVA    L M N T+A ITHVL NKQEFP
Sbjct  249  RATWAEPGVFEPVEMKSVDGTTKCVAIGGGLAMSNPTAAAITHVLHNKQEFP  300



>emb|CDX67618.1| BnaA07g16580D [Brassica napus]
Length=466

 Score = 52.4 bits (124),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 29/52 (56%), Positives = 33/52 (63%), Gaps = 3/52 (6%)
 Frame = -2

Query  330  RVT*VESGL---VCMSSVNGSTHCVAKDRRLGMRNLTSATITHVLQNKQEFP  184
            R T  E G+   V M SV+G+T CVA    L M N T+A ITHVL NKQEFP
Sbjct  249  RATWAEPGVFEPVEMKSVDGTTKCVAIGGGLAMSNPTAAAITHVLHNKQEFP  300



>ref|XP_008446895.1| PREDICTED: patatin-like protein 6 isoform X3 [Cucumis melo]
Length=381

 Score = 52.0 bits (123),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 32/67 (48%), Positives = 37/67 (55%), Gaps = 8/67 (12%)
 Frame = -2

Query  330  RVT*VESGL---VCMSSVNGSTHCVAKDRRLGMRNLTSATITHVLQNKQEFP-----EHQ  175
            R T  E G+   V M S++  T C+A D  L M N T+A ITHVL NKQEFP     E  
Sbjct  254  RATSAEPGVFEPVPMQSIDRQTQCLAVDGGLAMSNPTAAAITHVLHNKQEFPFVRGVEDL  313

Query  174  LCAHLGT  154
            L   LGT
Sbjct  314  LVLSLGT  320



>ref|XP_008446894.1| PREDICTED: patatin-like protein 6 isoform X2 [Cucumis melo]
Length=383

 Score = 52.0 bits (123),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 32/67 (48%), Positives = 37/67 (55%), Gaps = 8/67 (12%)
 Frame = -2

Query  330  RVT*VESGL---VCMSSVNGSTHCVAKDRRLGMRNLTSATITHVLQNKQEFP-----EHQ  175
            R T  E G+   V M S++  T C+A D  L M N T+A ITHVL NKQEFP     E  
Sbjct  254  RATSAEPGVFEPVPMQSIDRQTQCLAVDGGLAMSNPTAAAITHVLHNKQEFPFVRGVEDL  313

Query  174  LCAHLGT  154
            L   LGT
Sbjct  314  LVLSLGT  320



>ref|NP_191055.1| patatin-like protein 6 [Arabidopsis thaliana]
 sp|Q9SV43.1|PLP7_ARATH RecName: Full=Patatin-like protein 7; Short=AtPLP7; AltName: 
Full=Patatin-related phospholipase A IIIbeta; Short=pPLAIIIb; 
AltName: Full=Phospholipase A IIIA; Short=AtPLAIIIA [Arabidopsis 
thaliana]
 emb|CAB41089.1| putative protein [Arabidopsis thaliana]
 dbj|BAF01066.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE79317.1| patatin-like protein 6 [Arabidopsis thaliana]
Length=488

 Score = 52.0 bits (123),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 29/52 (56%), Positives = 32/52 (62%), Gaps = 3/52 (6%)
 Frame = -2

Query  330  RVT*VESGL---VCMSSVNGSTHCVAKDRRLGMRNLTSATITHVLQNKQEFP  184
            R T  E G+   V M SV+G T CVA    L M N T+A ITHVL NKQEFP
Sbjct  261  RATWAEPGVFEPVEMKSVDGQTKCVAVGGGLAMSNPTAAAITHVLHNKQEFP  312



>ref|XP_004142417.1| PREDICTED: patatin group A-3-like isoform 2 [Cucumis sativus]
 ref|XP_004172512.1| PREDICTED: patatin group A-3-like [Cucumis sativus]
Length=417

 Score = 52.0 bits (123),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 32/67 (48%), Positives = 37/67 (55%), Gaps = 8/67 (12%)
 Frame = -2

Query  330  RVT*VESGL---VCMSSVNGSTHCVAKDRRLGMRNLTSATITHVLQNKQEFP-----EHQ  175
            R T  E G+   V M S++  T C+A D  L M N T+A ITHVL NKQEFP     E  
Sbjct  253  RATSAEPGVFDPVPMQSIDRQTQCLAVDGGLAMSNPTAAAITHVLHNKQEFPFVRGVEDL  312

Query  174  LCAHLGT  154
            L   LGT
Sbjct  313  LVLSLGT  319



>ref|XP_004142416.1| PREDICTED: patatin group A-3-like isoform 1 [Cucumis sativus]
 gb|KGN52278.1| hypothetical protein Csa_5G623420 [Cucumis sativus]
Length=465

 Score = 52.0 bits (123),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 32/67 (48%), Positives = 37/67 (55%), Gaps = 8/67 (12%)
 Frame = -2

Query  330  RVT*VESGL---VCMSSVNGSTHCVAKDRRLGMRNLTSATITHVLQNKQEFP-----EHQ  175
            R T  E G+   V M S++  T C+A D  L M N T+A ITHVL NKQEFP     E  
Sbjct  253  RATSAEPGVFDPVPMQSIDRQTQCLAVDGGLAMSNPTAAAITHVLHNKQEFPFVRGVEDL  312

Query  174  LCAHLGT  154
            L   LGT
Sbjct  313  LVLSLGT  319



>ref|XP_008446892.1| PREDICTED: patatin-like protein 6 isoform X1 [Cucumis melo]
 ref|XP_008446893.1| PREDICTED: patatin-like protein 6 isoform X1 [Cucumis melo]
Length=466

 Score = 52.0 bits (123),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 32/67 (48%), Positives = 37/67 (55%), Gaps = 8/67 (12%)
 Frame = -2

Query  330  RVT*VESGL---VCMSSVNGSTHCVAKDRRLGMRNLTSATITHVLQNKQEFP-----EHQ  175
            R T  E G+   V M S++  T C+A D  L M N T+A ITHVL NKQEFP     E  
Sbjct  254  RATSAEPGVFEPVPMQSIDRQTQCLAVDGGLAMSNPTAAAITHVLHNKQEFPFVRGVEDL  313

Query  174  LCAHLGT  154
            L   LGT
Sbjct  314  LVLSLGT  320



>ref|XP_009116191.1| PREDICTED: patatin-like protein 7 [Brassica rapa]
Length=496

 Score = 52.0 bits (123),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 29/52 (56%), Positives = 32/52 (62%), Gaps = 3/52 (6%)
 Frame = -2

Query  330  RVT*VESGL---VCMSSVNGSTHCVAKDRRLGMRNLTSATITHVLQNKQEFP  184
            R T  E G+   V M SV+G T CVA    L M N T+A ITHVL NKQEFP
Sbjct  269  RATWAEPGVFEPVEMKSVDGKTKCVAIGGGLAMSNPTAAAITHVLHNKQEFP  320



>ref|XP_006290988.1| hypothetical protein CARUB_v10017102mg [Capsella rubella]
 gb|EOA23886.1| hypothetical protein CARUB_v10017102mg [Capsella rubella]
Length=489

 Score = 52.0 bits (123),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 29/52 (56%), Positives = 32/52 (62%), Gaps = 3/52 (6%)
 Frame = -2

Query  330  RVT*VESGL---VCMSSVNGSTHCVAKDRRLGMRNLTSATITHVLQNKQEFP  184
            R T  E G+   V M SV+G T CVA    L M N T+A ITHVL NKQEFP
Sbjct  262  RATWAEPGVFQPVEMKSVDGRTKCVAVGGGLAMSNPTAAAITHVLHNKQEFP  313



>ref|XP_010504327.1| PREDICTED: patatin-like protein 7 [Camelina sativa]
Length=484

 Score = 51.6 bits (122),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 28/52 (54%), Positives = 32/52 (62%), Gaps = 3/52 (6%)
 Frame = -2

Query  330  RVT*VESGL---VCMSSVNGSTHCVAKDRRLGMRNLTSATITHVLQNKQEFP  184
            R T  E G+   + M SV+G T CVA    L M N T+A ITHVL NKQEFP
Sbjct  257  RATCAEPGVFDPLVMKSVDGRTECVAVGGGLAMSNPTAAAITHVLHNKQEFP  308



>emb|CDX73423.1| BnaC08g25800D [Brassica napus]
Length=491

 Score = 51.6 bits (122),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 29/52 (56%), Positives = 32/52 (62%), Gaps = 3/52 (6%)
 Frame = -2

Query  330  RVT*VESGL---VCMSSVNGSTHCVAKDRRLGMRNLTSATITHVLQNKQEFP  184
            R T  E G+   V M SV+G T CVA    L M N T+A ITHVL NKQEFP
Sbjct  264  RATWAEPGVFEPVEMKSVDGKTKCVAIGGGLAMSNPTAAAITHVLHNKQEFP  315



>ref|XP_006403512.1| hypothetical protein EUTSA_v10010298mg [Eutrema salsugineum]
 gb|ESQ44965.1| hypothetical protein EUTSA_v10010298mg [Eutrema salsugineum]
Length=514

 Score = 51.6 bits (122),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 29/52 (56%), Positives = 32/52 (62%), Gaps = 3/52 (6%)
 Frame = -2

Query  330  RVT*VESGL---VCMSSVNGSTHCVAKDRRLGMRNLTSATITHVLQNKQEFP  184
            R T  E G+   V M SV+G T CVA    L M N T+A ITHVL NKQEFP
Sbjct  287  RATWAEPGVFEPVEMKSVDGKTKCVAIGGGLAMSNPTAAAITHVLHNKQEFP  338



>emb|CDY56960.1| BnaA09g55020D [Brassica napus]
Length=486

 Score = 51.6 bits (122),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 29/52 (56%), Positives = 32/52 (62%), Gaps = 3/52 (6%)
 Frame = -2

Query  330  RVT*VESGL---VCMSSVNGSTHCVAKDRRLGMRNLTSATITHVLQNKQEFP  184
            R T  E G+   V M SV+G T CVA    L M N T+A ITHVL NKQEFP
Sbjct  269  RATWAEPGVFEPVEMKSVDGKTKCVAIGGGLAMSNPTAAAITHVLHNKQEFP  320



>gb|KFK34738.1| hypothetical protein AALP_AA5G186500 [Arabis alpina]
Length=485

 Score = 51.2 bits (121),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 29/52 (56%), Positives = 32/52 (62%), Gaps = 3/52 (6%)
 Frame = -2

Query  330  RVT*VESGL---VCMSSVNGSTHCVAKDRRLGMRNLTSATITHVLQNKQEFP  184
            R T  E G+   V M SV+G T CVA    L M N T+A ITHVL NKQEFP
Sbjct  258  RATWAEPGVFEPVEMKSVDGRTKCVAVGGGLAMSNPTAAAITHVLHNKQEFP  309



>ref|XP_010067297.1| PREDICTED: patatin-like protein 6 [Eucalyptus grandis]
 gb|KCW65398.1| hypothetical protein EUGRSUZ_G02825 [Eucalyptus grandis]
Length=468

 Score = 51.2 bits (121),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 33/67 (49%), Positives = 36/67 (54%), Gaps = 8/67 (12%)
 Frame = -2

Query  330  RVT*VESGL---VCMSSVNGSTHCVAKDRRLGMRNLTSATITHVLQNKQEFP-----EHQ  175
            R T  E G+   V M SV+G T CVA    L M N  +A ITHVL NKQEFP     E  
Sbjct  255  RATSAEPGVLEPVQMRSVDGRTRCVAVGGGLAMSNPAAAAITHVLHNKQEFPFVRGMEDL  314

Query  174  LCAHLGT  154
            L   LGT
Sbjct  315  LVLSLGT  321



>emb|CDX68587.1| BnaC01g08660D [Brassica napus]
Length=499

 Score = 50.8 bits (120),  Expect = 5e-05, Method: Composition-based stats.
 Identities = 33/67 (49%), Positives = 35/67 (52%), Gaps = 8/67 (12%)
 Frame = -2

Query  330  RVT*VESGL---VCMSSVNGSTHCVAKDRRLGMRNLTSATITHVLQNKQEFP-----EHQ  175
            R T  E G    V  SSV+G T CVA    L M N T+A ITHV  NKQEFP     E  
Sbjct  271  RATWAEPGTFDPVRTSSVDGKTRCVAVGGGLAMSNPTAAAITHVFHNKQEFPAVKGVEDM  330

Query  174  LCAHLGT  154
            L   LGT
Sbjct  331  LVLSLGT  337



>ref|XP_010534282.1| PREDICTED: patatin-like protein 8 [Tarenaya hassleriana]
Length=533

 Score = 50.8 bits (120),  Expect = 5e-05, Method: Composition-based stats.
 Identities = 33/67 (49%), Positives = 37/67 (55%), Gaps = 8/67 (12%)
 Frame = -2

Query  330  RVT*VESGL---VCMSSVNGSTHCVAKDRRLGMRNLTSATITHVLQNKQEFP-----EHQ  175
            R T  E G    V MSSV+G T CVA +  L M N T+A ITHV+ NK EFP     E  
Sbjct  305  RATWAEPGTFDPVRMSSVDGKTRCVAVEGGLAMSNPTAAAITHVVHNKLEFPYAKNVEDL  364

Query  174  LCAHLGT  154
            L   LGT
Sbjct  365  LVLSLGT  371



>ref|XP_010253644.1| PREDICTED: patatin-like protein 6 [Nelumbo nucifera]
 ref|XP_010253645.1| PREDICTED: patatin-like protein 6 [Nelumbo nucifera]
 ref|XP_010253647.1| PREDICTED: patatin-like protein 6 [Nelumbo nucifera]
Length=463

 Score = 50.8 bits (120),  Expect = 5e-05, Method: Composition-based stats.
 Identities = 23/40 (58%), Positives = 26/40 (65%), Gaps = 0/40 (0%)
 Frame = -2

Query  303  VCMSSVNGSTHCVAKDRRLGMRNLTSATITHVLQNKQEFP  184
            V M S++G T CVA D  L M N  +A ITHVL NK EFP
Sbjct  263  VAMRSIDGQTRCVAVDGGLAMSNPAAAAITHVLHNKHEFP  302



>emb|CDY43526.1| BnaA01g07180D [Brassica napus]
Length=488

 Score = 50.8 bits (120),  Expect = 5e-05, Method: Composition-based stats.
 Identities = 33/67 (49%), Positives = 35/67 (52%), Gaps = 8/67 (12%)
 Frame = -2

Query  330  RVT*VESGL---VCMSSVNGSTHCVAKDRRLGMRNLTSATITHVLQNKQEFP-----EHQ  175
            R T  E G    V  SSV+G T CVA    L M N T+A ITHV  NKQEFP     E  
Sbjct  260  RATWAEPGTFDPVRASSVDGKTRCVAVGGGLAMSNPTAAAITHVFHNKQEFPAVKGVEDM  319

Query  174  LCAHLGT  154
            L   LGT
Sbjct  320  LVLSLGT  326



>ref|XP_009128483.1| PREDICTED: LOW QUALITY PROTEIN: patatin-like protein 8 [Brassica 
rapa]
Length=532

 Score = 50.8 bits (120),  Expect = 6e-05, Method: Composition-based stats.
 Identities = 33/67 (49%), Positives = 35/67 (52%), Gaps = 8/67 (12%)
 Frame = -2

Query  330  RVT*VESGL---VCMSSVNGSTHCVAKDRRLGMRNLTSATITHVLQNKQEFP-----EHQ  175
            R T  E G    V  SSV+G T CVA    L M N T+A ITHV  NKQEFP     E  
Sbjct  304  RATWAEPGTFDPVRASSVDGKTRCVAVGGGLAMSNPTAAAITHVFHNKQEFPAVKGVEDM  363

Query  174  LCAHLGT  154
            L   LGT
Sbjct  364  LVLSLGT  370



>ref|XP_008456474.1| PREDICTED: patatin-like protein 6 [Cucumis melo]
Length=467

 Score = 50.8 bits (120),  Expect = 6e-05, Method: Composition-based stats.
 Identities = 28/64 (44%), Positives = 39/64 (61%), Gaps = 5/64 (8%)
 Frame = -2

Query  303  VCMSSVNGSTHCVAKDRRLGMRNLTSATITHVLQNKQEFP-----EHQLCAHLGT*KPIK  139
            V + S++  T+C+A D  L M N T+A ITHVL NKQEFP     E  L   LGT + ++
Sbjct  262  VTLRSIDSQTNCLAIDGGLAMSNPTAAAITHVLHNKQEFPFVRGVEDLLVLSLGTGQILE  321

Query  138  AIKN  127
            A ++
Sbjct  322  ARRD  325



>ref|XP_007217968.1| hypothetical protein PRUPE_ppa005326mg [Prunus persica]
 gb|EMJ19167.1| hypothetical protein PRUPE_ppa005326mg [Prunus persica]
Length=466

 Score = 50.4 bits (119),  Expect = 6e-05, Method: Composition-based stats.
 Identities = 27/52 (52%), Positives = 31/52 (60%), Gaps = 3/52 (6%)
 Frame = -2

Query  330  RVT*VESGL---VCMSSVNGSTHCVAKDRRLGMRNLTSATITHVLQNKQEFP  184
            R T  E G+   V M SVN  T C+A D  L M N  ++ ITHVL NKQEFP
Sbjct  253  RATSAEPGVFEPVQMRSVNNQTRCLAVDGGLAMSNPAASAITHVLHNKQEFP  304



>ref|XP_008233331.1| PREDICTED: LOW QUALITY PROTEIN: patatin-like protein 6 [Prunus 
mume]
Length=467

 Score = 50.4 bits (119),  Expect = 6e-05, Method: Composition-based stats.
 Identities = 27/52 (52%), Positives = 31/52 (60%), Gaps = 3/52 (6%)
 Frame = -2

Query  330  RVT*VESGL---VCMSSVNGSTHCVAKDRRLGMRNLTSATITHVLQNKQEFP  184
            R T  E G+   V M SVN  T C+A D  L M N  ++ ITHVL NKQEFP
Sbjct  254  RATSAEPGVFEPVQMRSVNNQTRCLAVDGGLAMSNPAASAITHVLHNKQEFP  305



>ref|XP_009413712.1| PREDICTED: patatin-like protein 6 [Musa acuminata subsp. malaccensis]
Length=494

 Score = 50.4 bits (119),  Expect = 7e-05, Method: Composition-based stats.
 Identities = 23/38 (61%), Positives = 27/38 (71%), Gaps = 0/38 (0%)
 Frame = -2

Query  297  MSSVNGSTHCVAKDRRLGMRNLTSATITHVLQNKQEFP  184
            +SSV+G+T CV  D  L M N  +A ITHVL NKQEFP
Sbjct  282  ISSVDGATACVGVDGGLAMSNPAAAAITHVLHNKQEFP  319



>ref|XP_002878007.1| hypothetical protein ARALYDRAFT_485912 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH54266.1| hypothetical protein ARALYDRAFT_485912 [Arabidopsis lyrata subsp. 
lyrata]
Length=504

 Score = 50.1 bits (118),  Expect = 8e-05, Method: Composition-based stats.
 Identities = 25/40 (63%), Positives = 27/40 (68%), Gaps = 0/40 (0%)
 Frame = -2

Query  303  VCMSSVNGSTHCVAKDRRLGMRNLTSATITHVLQNKQEFP  184
            V M SV+G T CVA    L M N T+A ITHVL NKQEFP
Sbjct  289  VEMKSVDGQTKCVAVGGGLAMSNPTAAAITHVLHNKQEFP  328



>ref|XP_010516040.1| PREDICTED: patatin-like protein 7 [Camelina sativa]
Length=476

 Score = 50.1 bits (118),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 28/52 (54%), Positives = 32/52 (62%), Gaps = 3/52 (6%)
 Frame = -2

Query  330  RVT*VESGL---VCMSSVNGSTHCVAKDRRLGMRNLTSATITHVLQNKQEFP  184
            R T  E G+   + M SV+G T CVA    L M N T+A ITHVL NKQEFP
Sbjct  249  RATCAEPGVFDPLEMKSVDGRTECVAIGGGLAMSNPTAAAITHVLHNKQEFP  300



>ref|XP_010427227.1| PREDICTED: patatin-like protein 7 [Camelina sativa]
Length=489

 Score = 50.1 bits (118),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 27/52 (52%), Positives = 31/52 (60%), Gaps = 3/52 (6%)
 Frame = -2

Query  330  RVT*VESGL---VCMSSVNGSTHCVAKDRRLGMRNLTSATITHVLQNKQEFP  184
            R T  E G+   + M SV+G T CVA    L M N T+A ITHVL NK EFP
Sbjct  262  RATCAEPGVFDPLVMKSVDGRTECVAVGGGLAMSNPTAAAITHVLHNKHEFP  313



>ref|XP_009401958.1| PREDICTED: patatin-like protein 6 [Musa acuminata subsp. malaccensis]
 ref|XP_009401959.1| PREDICTED: patatin-like protein 6 [Musa acuminata subsp. malaccensis]
Length=478

 Score = 49.7 bits (117),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 23/38 (61%), Positives = 26/38 (68%), Gaps = 0/38 (0%)
 Frame = -2

Query  297  MSSVNGSTHCVAKDRRLGMRNLTSATITHVLQNKQEFP  184
            +SSV+G+T CVA D  L M N   A ITHV  NKQEFP
Sbjct  274  ISSVDGATSCVAVDGGLAMSNPAVAAITHVFHNKQEFP  311



>ref|XP_009381968.1| PREDICTED: patatin-like protein 6 [Musa acuminata subsp. malaccensis]
Length=482

 Score = 49.3 bits (116),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 22/38 (58%), Positives = 27/38 (71%), Gaps = 0/38 (0%)
 Frame = -2

Query  297  MSSVNGSTHCVAKDRRLGMRNLTSATITHVLQNKQEFP  184
            ++SV+G+T CV  D  L M N  +A ITHVL NKQEFP
Sbjct  274  ITSVDGATACVGVDGGLAMSNPAAAAITHVLHNKQEFP  311



>ref|XP_004162843.1| PREDICTED: patatin group A-3-like [Cucumis sativus]
Length=362

 Score = 48.9 bits (115),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 25/43 (58%), Positives = 28/43 (65%), Gaps = 0/43 (0%)
 Frame = -2

Query  312  SGLVCMSSVNGSTHCVAKDRRLGMRNLTSATITHVLQNKQEFP  184
            SG V MSSV+  T   A D  + M N T+A ITHVL NKQEFP
Sbjct  239  SGAVQMSSVDKRTKIAAVDGGIAMNNPTAAAITHVLNNKQEFP  281



>gb|ABK94145.1| unknown [Populus trichocarpa]
Length=222

 Score = 48.1 bits (113),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 28/56 (50%), Positives = 31/56 (55%), Gaps = 5/56 (9%)
 Frame = -2

Query  309  GLVCMSSVNGSTHCVAKDRRLGMRNLTSATITHVLQNKQEFP-----EHQLCAHLG  157
            G V M SV+  T  VA D  + M N T+A ITHVL NKQEFP     E  L   LG
Sbjct  16   GAVDMRSVDKRTKIVAIDGGIAMNNPTAAAITHVLNNKQEFPLCNGVEDLLVVSLG  71



>ref|XP_004134887.1| PREDICTED: patatin group A-3-like [Cucumis sativus]
 gb|KGN49500.1| hypothetical protein Csa_6G526340 [Cucumis sativus]
Length=447

 Score = 48.5 bits (114),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 25/43 (58%), Positives = 28/43 (65%), Gaps = 0/43 (0%)
 Frame = -2

Query  312  SGLVCMSSVNGSTHCVAKDRRLGMRNLTSATITHVLQNKQEFP  184
            SG V MSSV+  T   A D  + M N T+A ITHVL NKQEFP
Sbjct  239  SGAVQMSSVDKRTKIAAVDGGIAMNNPTAAAITHVLNNKQEFP  281



>ref|XP_010451115.1| PREDICTED: patatin-like protein 8 [Camelina sativa]
Length=534

 Score = 48.5 bits (114),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 33/77 (43%), Positives = 39/77 (51%), Gaps = 8/77 (10%)
 Frame = -2

Query  330  RVT*VESGL---VCMSSVNGSTHCVAKDRRLGMRNLTSATITHVLQNKQEFP-----EHQ  175
            R T  E G    V   SV+G T CVA    L M N T+A ITHV  NKQEFP     E  
Sbjct  274  RATWAEPGTFDPVRTCSVDGKTRCVAVGGGLAMSNPTAAAITHVFHNKQEFPAVKGVEDL  333

Query  174  LCAHLGT*KPIKAIKNL  124
            L   LGT +  + ++ L
Sbjct  334  LVLSLGTGQLFEVLQGL  350



>gb|EPS72086.1| hypothetical protein M569_02674, partial [Genlisea aurea]
Length=412

 Score = 48.1 bits (113),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 21/41 (51%), Positives = 27/41 (66%), Gaps = 0/41 (0%)
 Frame = -2

Query  303  VCMSSVNGSTHCVAKDRRLGMRNLTSATITHVLQNKQEFPE  181
            V M S++G T C A    + M N T+A ITHVL NKQ+FP+
Sbjct  231  VGMKSIDGQTQCTAVGGGIAMSNPTAAAITHVLHNKQDFPQ  271



>ref|XP_008439498.1| PREDICTED: patatin-like protein 3 [Cucumis melo]
Length=445

 Score = 48.1 bits (113),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 25/43 (58%), Positives = 28/43 (65%), Gaps = 0/43 (0%)
 Frame = -2

Query  312  SGLVCMSSVNGSTHCVAKDRRLGMRNLTSATITHVLQNKQEFP  184
            SG V MSSV+  T   A D  + M N T+A ITHVL NKQEFP
Sbjct  237  SGAVQMSSVDKRTKIAAVDGGIAMNNPTAAAITHVLNNKQEFP  279



>ref|XP_002867388.1| hypothetical protein ARALYDRAFT_491780 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH43647.1| hypothetical protein ARALYDRAFT_491780 [Arabidopsis lyrata subsp. 
lyrata]
Length=525

 Score = 48.1 bits (113),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 32/67 (48%), Positives = 34/67 (51%), Gaps = 8/67 (12%)
 Frame = -2

Query  330  RVT*VESGL---VCMSSVNGSTHCVAKDRRLGMRNLTSATITHVLQNKQEFP-----EHQ  175
            R T  E G    V   SV+G T CVA    L M N T+A ITHV  NKQEFP     E  
Sbjct  298  RATWAEPGTFDPVRTCSVDGKTRCVAVGGGLAMSNPTAAAITHVFHNKQEFPAVKGVEDL  357

Query  174  LCAHLGT  154
            L   LGT
Sbjct  358  LVLSLGT  364



>ref|NP_194709.2| PATATIN-like protein 8 [Arabidopsis thaliana]
 sp|Q8H133.1|PLP8_ARATH RecName: Full=Patatin-like protein 8; Short=AtPLP8; AltName: 
Full=Patatin-related phospholipase A IIIgamma; Short=pPLAIIIg; 
AltName: Full=Phospholipase A IVD; Short=AtPLAIVD [Arabidopsis 
thaliana]
 gb|AAN41269.1| unknown protein [Arabidopsis thaliana]
 gb|AEE85677.1| PATATIN-like protein 8 [Arabidopsis thaliana]
Length=525

 Score = 48.1 bits (113),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 32/67 (48%), Positives = 34/67 (51%), Gaps = 8/67 (12%)
 Frame = -2

Query  330  RVT*VESGL---VCMSSVNGSTHCVAKDRRLGMRNLTSATITHVLQNKQEFP-----EHQ  175
            R T  E G    V   SV+G T CVA    L M N T+A ITHV  NKQEFP     E  
Sbjct  298  RATWAEPGTFDPVRTCSVDGKTRCVAVGGGLAMSNPTAAAITHVFHNKQEFPAVKGVEDL  357

Query  174  LCAHLGT  154
            L   LGT
Sbjct  358  LVLSLGT  364



>ref|NP_001190866.1| PATATIN-like protein 8 [Arabidopsis thaliana]
 emb|CAB43655.1| putative protein [Arabidopsis thaliana]
 emb|CAB79738.1| putative protein [Arabidopsis thaliana]
 gb|AEE85678.1| PATATIN-like protein 8 [Arabidopsis thaliana]
Length=526

 Score = 48.1 bits (113),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 32/67 (48%), Positives = 34/67 (51%), Gaps = 8/67 (12%)
 Frame = -2

Query  330  RVT*VESGL---VCMSSVNGSTHCVAKDRRLGMRNLTSATITHVLQNKQEFP-----EHQ  175
            R T  E G    V   SV+G T CVA    L M N T+A ITHV  NKQEFP     E  
Sbjct  298  RATWAEPGTFDPVRTCSVDGKTRCVAVGGGLAMSNPTAAAITHVFHNKQEFPAVKGVEDL  357

Query  174  LCAHLGT  154
            L   LGT
Sbjct  358  LVLSLGT  364



>ref|XP_010433064.1| PREDICTED: patatin-like protein 8 [Camelina sativa]
Length=530

 Score = 48.1 bits (113),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 32/67 (48%), Positives = 34/67 (51%), Gaps = 8/67 (12%)
 Frame = -2

Query  330  RVT*VESGL---VCMSSVNGSTHCVAKDRRLGMRNLTSATITHVLQNKQEFP-----EHQ  175
            R T  E G    V   SV+G T CVA    L M N T+A ITHV  NKQEFP     E  
Sbjct  302  RATWAEPGTFDPVRTCSVDGKTRCVAVGGGLAMSNPTAAAITHVFHNKQEFPAVKGVEDL  361

Query  174  LCAHLGT  154
            L   LGT
Sbjct  362  LVLSLGT  368



>ref|XP_006412806.1| hypothetical protein EUTSA_v10027483mg [Eutrema salsugineum]
 gb|ESQ54259.1| hypothetical protein EUTSA_v10027483mg [Eutrema salsugineum]
Length=530

 Score = 48.1 bits (113),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 32/67 (48%), Positives = 34/67 (51%), Gaps = 8/67 (12%)
 Frame = -2

Query  330  RVT*VESGL---VCMSSVNGSTHCVAKDRRLGMRNLTSATITHVLQNKQEFP-----EHQ  175
            R T  E G    V   SV+G T CVA    L M N T+A ITHV  NKQEFP     E  
Sbjct  302  RATWAEPGTFDPVRTCSVDGKTRCVAVGGGLAMSNPTAAAITHVFHNKQEFPAVTGVEDL  361

Query  174  LCAHLGT  154
            L   LGT
Sbjct  362  LVLSLGT  368



>ref|XP_006293987.1| hypothetical protein CARUB_v10022979mg [Capsella rubella]
 gb|EOA26885.1| hypothetical protein CARUB_v10022979mg [Capsella rubella]
Length=530

 Score = 48.1 bits (113),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 32/67 (48%), Positives = 34/67 (51%), Gaps = 8/67 (12%)
 Frame = -2

Query  330  RVT*VESGL---VCMSSVNGSTHCVAKDRRLGMRNLTSATITHVLQNKQEFP-----EHQ  175
            R T  E G    V   SV+G T CVA    L M N T+A ITHV  NKQEFP     E  
Sbjct  302  RATWAEPGTFDPVRTCSVDGKTRCVAVGGGLAMSNPTAAAITHVFHNKQEFPAVKGVEDL  361

Query  174  LCAHLGT  154
            L   LGT
Sbjct  362  LVLSLGT  368



>ref|XP_010438260.1| PREDICTED: patatin-like protein 8 [Camelina sativa]
Length=531

 Score = 48.1 bits (113),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 32/67 (48%), Positives = 34/67 (51%), Gaps = 8/67 (12%)
 Frame = -2

Query  330  RVT*VESGL---VCMSSVNGSTHCVAKDRRLGMRNLTSATITHVLQNKQEFP-----EHQ  175
            R T  E G    V   SV+G T CVA    L M N T+A ITHV  NKQEFP     E  
Sbjct  303  RATWAEPGTFDPVRTCSVDGKTRCVAVGGGLAMSNPTAAAITHVFHNKQEFPAVKGVEDL  362

Query  174  LCAHLGT  154
            L   LGT
Sbjct  363  LVLSLGT  369



>gb|KFK29540.1| hypothetical protein AALP_AA7G147300 [Arabis alpina]
Length=535

 Score = 48.1 bits (113),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 32/67 (48%), Positives = 34/67 (51%), Gaps = 8/67 (12%)
 Frame = -2

Query  330  RVT*VESGL---VCMSSVNGSTHCVAKDRRLGMRNLTSATITHVLQNKQEFP-----EHQ  175
            R T  E G    V   SV+G T CVA    L M N T+A ITHV  NKQEFP     E  
Sbjct  308  RATWAEPGTFDPVRTCSVDGKTRCVAVGGGLAMSNPTAAAITHVFHNKQEFPAVKGVEDL  367

Query  174  LCAHLGT  154
            L   LGT
Sbjct  368  LVLSLGT  374



>gb|KFK29539.1| hypothetical protein AALP_AA7G147300 [Arabis alpina]
Length=536

 Score = 48.1 bits (113),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 32/67 (48%), Positives = 34/67 (51%), Gaps = 8/67 (12%)
 Frame = -2

Query  330  RVT*VESGL---VCMSSVNGSTHCVAKDRRLGMRNLTSATITHVLQNKQEFP-----EHQ  175
            R T  E G    V   SV+G T CVA    L M N T+A ITHV  NKQEFP     E  
Sbjct  308  RATWAEPGTFDPVRTCSVDGKTRCVAVGGGLAMSNPTAAAITHVFHNKQEFPAVKGVEDL  367

Query  174  LCAHLGT  154
            L   LGT
Sbjct  368  LVLSLGT  374



>ref|XP_011001376.1| PREDICTED: patatin-like protein 7 [Populus euphratica]
Length=438

 Score = 48.1 bits (113),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 28/56 (50%), Positives = 31/56 (55%), Gaps = 5/56 (9%)
 Frame = -2

Query  309  GLVCMSSVNGSTHCVAKDRRLGMRNLTSATITHVLQNKQEFP-----EHQLCAHLG  157
            G V M SV+  T  VA D  + M N T+A ITHVL NKQEFP     E  L   LG
Sbjct  232  GAVDMRSVDKRTKIVAIDGGIAMNNPTAAAITHVLNNKQEFPLCNGVEDLLVVSLG  287



>emb|CBI39004.3| unnamed protein product [Vitis vinifera]
Length=417

 Score = 47.4 bits (111),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 23/43 (53%), Positives = 29/43 (67%), Gaps = 0/43 (0%)
 Frame = -2

Query  312  SGLVCMSSVNGSTHCVAKDRRLGMRNLTSATITHVLQNKQEFP  184
            +G V + SV+  T  +A D R+ M N T+A ITHVL NKQEFP
Sbjct  215  AGGVELRSVDRGTRIMAVDGRIAMNNPTAAAITHVLNNKQEFP  257



>gb|EPS63739.1| hypothetical protein M569_11046, partial [Genlisea aurea]
Length=471

 Score = 47.4 bits (111),  Expect = 6e-04, Method: Composition-based stats.
 Identities = 21/40 (53%), Positives = 26/40 (65%), Gaps = 0/40 (0%)
 Frame = -2

Query  303  VCMSSVNGSTHCVAKDRRLGMRNLTSATITHVLQNKQEFP  184
            + M SV+G T CV     + M N T+A ITHV+ NKQEFP
Sbjct  277  ITMESVDGRTRCVGVGGGVAMSNPTAAAITHVVHNKQEFP  316



>ref|XP_002276337.2| PREDICTED: patatin-like protein 3 [Vitis vinifera]
Length=484

 Score = 47.4 bits (111),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 23/43 (53%), Positives = 29/43 (67%), Gaps = 0/43 (0%)
 Frame = -2

Query  312  SGLVCMSSVNGSTHCVAKDRRLGMRNLTSATITHVLQNKQEFP  184
            +G V + SV+  T  +A D R+ M N T+A ITHVL NKQEFP
Sbjct  282  AGGVELRSVDRGTRIMAVDGRIAMNNPTAAAITHVLNNKQEFP  324



>ref|XP_010052585.1| PREDICTED: patatin-like protein 7 [Eucalyptus grandis]
 gb|KCW76666.1| hypothetical protein EUGRSUZ_D01034 [Eucalyptus grandis]
Length=418

 Score = 47.0 bits (110),  Expect = 8e-04, Method: Composition-based stats.
 Identities = 22/38 (58%), Positives = 27/38 (71%), Gaps = 0/38 (0%)
 Frame = -2

Query  297  MSSVNGSTHCVAKDRRLGMRNLTSATITHVLQNKQEFP  184
            + SV+G T  VA + R+ M N T+A ITHVL NKQEFP
Sbjct  223  LRSVDGRTRIVAINGRVAMNNPTAAAITHVLNNKQEFP  260



>ref|XP_004295464.1| PREDICTED: uncharacterized protein LOC101292983 [Fragaria vesca 
subsp. vesca]
Length=537

 Score = 47.0 bits (110),  Expect = 0.001, Method: Composition-based stats.
 Identities = 24/42 (57%), Positives = 28/42 (67%), Gaps = 0/42 (0%)
 Frame = -2

Query  309  GLVCMSSVNGSTHCVAKDRRLGMRNLTSATITHVLQNKQEFP  184
            G V + SV+G T  +A D  + M N TSA ITHVL NKQEFP
Sbjct  331  GAVEVKSVDGRTKIMAVDGGIAMNNPTSAAITHVLNNKQEFP  372



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 519284018688