BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c8064_g1_i1 len=1028 path=[1080:0-1027]

Length=1028
                                                                      Score     E

ref|XP_004231869.1|  PREDICTED: protein IRX15-LIKE-like                 418   1e-142   
ref|XP_006339865.1|  PREDICTED: protein IRX15-like                      416   8e-142   
ref|XP_009588942.1|  PREDICTED: protein IRX15-LIKE-like                 414   4e-141   
ref|XP_009793224.1|  PREDICTED: protein IRX15-LIKE-like                 412   2e-140   
ref|XP_011097393.1|  PREDICTED: protein IRX15-LIKE                      411   5e-140   
ref|XP_009775230.1|  PREDICTED: protein IRX15-LIKE-like                 409   5e-139   
ref|XP_006360212.1|  PREDICTED: protein IRX15-like                      408   1e-138   
ref|XP_009599933.1|  PREDICTED: protein IRX15-LIKE-like                 407   2e-138   
ref|XP_004233444.1|  PREDICTED: protein IRX15-LIKE-like                 405   1e-137   
gb|EPS63094.1|  hypothetical protein M569_11690                         403   1e-136   
emb|CDP02521.1|  unnamed protein product                                394   4e-133   
ref|XP_002283187.1|  PREDICTED: protein IRX15-LIKE                      363   4e-121   Vitis vinifera
ref|XP_010070598.1|  PREDICTED: protein IRX15-LIKE-like                 357   1e-118   
ref|XP_010672415.1|  PREDICTED: protein IRX15-LIKE-like                 357   2e-118   
ref|XP_003517315.1|  PREDICTED: protein IRREGULAR XYLEM 15-like         356   3e-118   
ref|XP_007156771.1|  hypothetical protein PHAVU_002G016200g             357   9e-118   
ref|XP_010028217.1|  PREDICTED: protein IRX15-LIKE-like                 355   1e-117   
ref|XP_008440308.1|  PREDICTED: protein IRX15-LIKE                      353   4e-117   
ref|NP_001241343.1|  uncharacterized protein LOC100817866               352   2e-116   
ref|XP_010263448.1|  PREDICTED: protein IRX15-LIKE-like                 352   2e-116   
ref|XP_011008784.1|  PREDICTED: protein IRX15-LIKE-like                 351   3e-116   
ref|XP_002306483.1|  hypothetical protein POPTR_0005s18480g             351   4e-116   Populus trichocarpa [western balsam poplar]
ref|XP_003524627.1|  PREDICTED: protein IRX15-like                      351   4e-116   
ref|XP_004288008.1|  PREDICTED: protein IRX15-like                      351   4e-116   
ref|XP_004142003.1|  PREDICTED: uncharacterized protein LOC101217122    349   1e-115   
ref|XP_008238947.1|  PREDICTED: protein IRX15-LIKE                      349   2e-115   
ref|XP_010270730.1|  PREDICTED: protein IRX15-LIKE-like                 348   4e-115   
ref|XP_007155898.1|  hypothetical protein PHAVU_003G241300g             348   4e-115   
ref|XP_006494477.1|  PREDICTED: protein IRX15-like                      348   5e-115   
ref|XP_007205581.1|  hypothetical protein PRUPE_ppa008835mg             348   5e-115   
gb|KHN42103.1|  hypothetical protein glysoja_003843                     348   2e-114   
gb|KDO79100.1|  hypothetical protein CISIN_1g021017mg                   347   2e-114   
ref|XP_011005802.1|  PREDICTED: protein IRX15-LIKE-like                 346   2e-114   
ref|XP_002310711.2|  hypothetical protein POPTR_0007s10710g             346   3e-114   Populus trichocarpa [western balsam poplar]
ref|XP_003550048.1|  PREDICTED: protein IRX15-like                      346   4e-114   
ref|XP_002285113.1|  PREDICTED: protein IRX15-LIKE-like                 345   6e-114   Vitis vinifera
ref|XP_009351143.1|  PREDICTED: protein IRX15-LIKE-like                 346   6e-114   
ref|XP_010093517.1|  hypothetical protein L484_007232                   345   7e-114   
ref|XP_008340351.1|  PREDICTED: protein IRX15-LIKE-like                 345   8e-114   
gb|KDP31981.1|  hypothetical protein JCGZ_12442                         345   8e-114   
ref|XP_008345507.1|  PREDICTED: protein IRX15-LIKE-like                 345   8e-114   
ref|XP_006425964.1|  hypothetical protein CICLE_v10025796mg             348   1e-113   
gb|KEH31471.1|  polysaccharide biosynthesis protein                     344   1e-113   
ref|XP_009367443.1|  PREDICTED: protein IRX15-LIKE-like                 345   1e-113   
ref|XP_009372433.1|  PREDICTED: protein IRX15-LIKE-like                 345   1e-113   
ref|XP_004509113.1|  PREDICTED: protein IRX15-like                      343   3e-113   
emb|CAN74915.1|  hypothetical protein VITISV_041669                     344   4e-113   Vitis vinifera
ref|NP_201522.1|  uncharacterized protein                               342   8e-113   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002866713.1|  nucleic acid binding protein                       341   2e-112   
ref|XP_007047358.1|  Bromodomain-containing protein DDB_G0271118        341   2e-112   
ref|XP_010484528.1|  PREDICTED: protein IRX15-LIKE                      340   8e-112   
ref|XP_010464334.1|  PREDICTED: protein IRX15-LIKE-like                 339   2e-111   
ref|XP_010558800.1|  PREDICTED: protein IRX15-LIKE                      338   3e-111   
gb|ACU21250.1|  unknown                                                 334   4e-111   Glycine max [soybeans]
ref|XP_010444678.1|  PREDICTED: protein IRX15-LIKE-like                 338   5e-111   
ref|XP_010550356.1|  PREDICTED: protein IRX15-LIKE-like                 337   8e-111   
ref|XP_002533263.1|  conserved hypothetical protein                     337   2e-110   Ricinus communis
ref|XP_006393919.1|  hypothetical protein EUTSA_v10004623mg             336   2e-110   
ref|XP_006280826.1|  hypothetical protein CARUB_v10026796mg             335   9e-110   
ref|XP_010503691.1|  PREDICTED: protein IRREGULAR XYLEM 15              333   3e-109   
emb|CDY12819.1|  BnaC07g16140D                                          333   4e-109   
ref|XP_009103444.1|  PREDICTED: protein IRX15-LIKE                      333   4e-109   
gb|AAM64983.1|  unknown                                                 332   1e-108   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010515380.1|  PREDICTED: protein IRREGULAR XYLEM 15-like         332   2e-108   
ref|XP_006292985.1|  hypothetical protein CARUB_v10019263mg             331   3e-108   
ref|NP_190591.1|  protein IRREGULAR XYLEM 15                            331   3e-108   Arabidopsis thaliana [mouse-ear cress]
gb|ABK28594.1|  unknown                                                 331   3e-108   Arabidopsis thaliana [mouse-ear cress]
dbj|BAD94344.1|  hypothetical protein                                   330   4e-108   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010426565.1|  PREDICTED: protein IRREGULAR XYLEM 15              330   4e-108   
ref|XP_002877736.1|  hypothetical protein ARALYDRAFT_906343             330   1e-107   
emb|CDY01429.1|  BnaA07g12020D                                          329   2e-107   
emb|CDX81329.1|  BnaC09g07400D                                          327   1e-106   
ref|XP_006404049.1|  hypothetical protein EUTSA_v10010543mg             327   2e-106   
emb|CDY17753.1|  BnaC08g21610D                                          325   5e-106   
gb|KFK28414.1|  hypothetical protein AALP_AA8G511700                    324   1e-105   
emb|CDY30600.1|  BnaAnng03750D                                          323   4e-105   
ref|XP_009115695.1|  PREDICTED: protein IRREGULAR XYLEM 15              323   4e-105   
gb|ADR31620.1|  DUF579 protein                                          321   8e-105   
gb|ADR31610.1|  DUF579 protein                                          321   8e-105   
gb|ADR31613.1|  DUF579 protein                                          321   8e-105   
ref|XP_006346387.1|  PREDICTED: protein IRX15-like                      322   1e-104   
gb|ADR31612.1|  DUF579 protein                                          320   1e-104   
gb|ADR31629.1|  DUF579 protein                                          315   1e-102   
gb|KDP24994.1|  hypothetical protein JCGZ_23977                         315   4e-102   
ref|XP_004230754.1|  PREDICTED: protein IRX15-LIKE-like                 315   6e-102   
ref|XP_009784046.1|  PREDICTED: protein IRX15-LIKE-like                 313   1e-101   
ref|XP_002518716.1|  conserved hypothetical protein                     308   2e-99    Ricinus communis
ref|XP_009592679.1|  PREDICTED: protein IRX15-LIKE-like                 308   2e-99    
gb|ADR31621.1|  DUF579 protein                                          304   6e-99    
gb|ADR31611.1|  DUF579 protein                                          303   2e-98    
gb|ADR31614.1|  DUF579 protein                                          304   3e-98    
gb|ADR31616.1|  DUF579 protein                                          303   3e-98    
ref|XP_011088226.1|  PREDICTED: protein IRREGULAR XYLEM 15-like         301   1e-96    
ref|XP_002298736.2|  hypothetical protein POPTR_0001s31000g             301   5e-96    Populus trichocarpa [western balsam poplar]
ref|XP_011000138.1|  PREDICTED: protein IRX15-LIKE-like                 299   6e-96    
ref|XP_011000888.1|  PREDICTED: protein IRX15-LIKE-like                 299   1e-95    
gb|EYU37651.1|  hypothetical protein MIMGU_mgv1a010254mg                290   4e-92    
ref|XP_008236563.1|  PREDICTED: protein IRX15-LIKE-like                 289   7e-92    
ref|XP_002313132.2|  hypothetical protein POPTR_0009s10160g             288   8e-92    Populus trichocarpa [western balsam poplar]
emb|CDO97204.1|  unnamed protein product                                286   9e-91    
ref|XP_010107856.1|  hypothetical protein L484_027443                   286   1e-90    
ref|XP_007042486.1|  Uncharacterized protein TCM_007104                 285   2e-90    
ref|XP_008373171.1|  PREDICTED: protein IRX15-LIKE-like                 285   2e-90    
ref|XP_008454974.1|  PREDICTED: protein IRX15-LIKE-like                 283   2e-89    
ref|XP_009345137.1|  PREDICTED: protein IRX15-LIKE-like                 283   2e-89    
ref|XP_004136972.1|  PREDICTED: uncharacterized protein LOC101203456    281   1e-88    
gb|KDO59785.1|  hypothetical protein CISIN_1g019623mg                   280   5e-88    
ref|XP_006487028.1|  PREDICTED: protein IRX15-like                      278   2e-87    
ref|XP_007200416.1|  hypothetical protein PRUPE_ppa008725mg             278   2e-87    
ref|XP_010030639.1|  PREDICTED: protein IRX15-LIKE-like                 276   2e-87    
ref|XP_004305944.1|  PREDICTED: protein IRX15-like                      278   3e-87    
ref|XP_004505254.1|  PREDICTED: protein IRX15-like                      274   3e-86    
ref|XP_007157717.1|  hypothetical protein PHAVU_002G092400g             274   6e-86    
gb|KEH30898.1|  polysaccharide biosynthesis protein                     270   1e-84    
ref|XP_006422963.1|  hypothetical protein CICLE_v10028798mg             268   2e-84    
ref|XP_010691720.1|  PREDICTED: protein IRX15-LIKE-like                 268   1e-83    
gb|KEH30897.1|  polysaccharide biosynthesis protein                     265   1e-83    
gb|KGN43907.1|  hypothetical protein Csa_7G073430                       264   1e-83    
ref|XP_010909183.1|  PREDICTED: protein IRX15-LIKE-like                 268   1e-83    
ref|XP_006855212.1|  hypothetical protein AMTR_s00051p00191940          267   1e-83    
gb|KCW55159.1|  hypothetical protein EUGRSUZ_I01114                     264   2e-83    
ref|XP_003528522.1|  PREDICTED: protein IRX15-like                      265   1e-82    
ref|XP_010932030.1|  PREDICTED: protein IRX15-LIKE-like                 265   1e-82    
ref|XP_008776524.1|  PREDICTED: protein IRX15-LIKE-like                 264   6e-82    
ref|XP_009418802.1|  PREDICTED: protein IRX15-LIKE-like                 263   1e-81    
ref|XP_009412469.1|  PREDICTED: protein IRX15-LIKE-like                 263   2e-81    
ref|XP_009420642.1|  PREDICTED: protein IRX15-LIKE-like                 262   3e-81    
ref|XP_003520070.1|  PREDICTED: protein IRX15-like                      261   5e-81    
gb|EPS67946.1|  hypothetical protein M569_06823                         255   4e-79    
gb|KCW63892.1|  hypothetical protein EUGRSUZ_G01567                     255   1e-78    
ref|XP_008812532.1|  PREDICTED: LOW QUALITY PROTEIN: protein IRX1...    254   1e-78    
ref|XP_010065988.1|  PREDICTED: protein IRX15-LIKE-like                 255   1e-78    
ref|XP_009407075.1|  PREDICTED: protein IRX15-LIKE-like                 253   1e-77    
ref|NP_565374.1|  uncharacterized protein                               251   8e-77    Arabidopsis thaliana [mouse-ear cress]
gb|EYU42690.1|  hypothetical protein MIMGU_mgv1a011105mg                249   1e-76    
ref|XP_003580688.1|  PREDICTED: protein IRX15-LIKE-like                 249   1e-76    
ref|XP_008644968.1|  PREDICTED: protein IRREGULAR XYLEM 15              249   2e-76    
ref|XP_010068514.1|  PREDICTED: protein IRX15-LIKE-like                 242   6e-75    
dbj|BAJ84875.1|  predicted protein                                      244   1e-74    
gb|KHN27079.1|  hypothetical protein glysoja_028358                     242   2e-74    
ref|XP_006409555.1|  hypothetical protein EUTSA_v10022776mg             243   5e-74    
ref|XP_002885962.1|  hypothetical protein ARALYDRAFT_899758             243   6e-74    
ref|XP_009136270.1|  PREDICTED: protein IRX15-LIKE-like                 243   9e-74    
ref|XP_002447223.1|  hypothetical protein SORBIDRAFT_06g030790          242   2e-73    Sorghum bicolor [broomcorn]
emb|CAH68262.1|  H0212B02.6                                             241   2e-73    Oryza sativa [red rice]
ref|NP_001054086.1|  Os04g0649900                                       241   2e-73    Oryza sativa Japonica Group [Japonica rice]
gb|ADR31622.1|  DUF579 protein                                          235   3e-73    
emb|CDY13145.1|  BnaA09g16720D                                          241   4e-73    
ref|XP_002437483.1|  hypothetical protein SORBIDRAFT_10g027930          241   5e-73    Sorghum bicolor [broomcorn]
ref|NP_001058408.1|  Os06g0687600                                       241   7e-73    Oryza sativa Japonica Group [Japonica rice]
gb|EEC81210.1|  hypothetical protein OsI_24242                          239   3e-72    Oryza sativa Indica Group [Indian rice]
gb|ACF86974.1|  unknown                                                 238   8e-72    Zea mays [maize]
ref|NP_001152696.1|  LOC100286337                                       237   2e-71    Zea mays [maize]
ref|XP_010467300.1|  PREDICTED: protein IRX15-LIKE-like                 236   5e-71    
ref|XP_004977048.1|  PREDICTED: protein IRX15-like                      235   5e-71    
ref|XP_008799899.1|  PREDICTED: protein IRX15-LIKE-like                 235   6e-71    
ref|NP_001132394.1|  uncharacterized protein LOC100193840               234   1e-70    Zea mays [maize]
ref|XP_010518178.1|  PREDICTED: protein IRX15-LIKE-like                 234   2e-70    
ref|XP_010488960.1|  PREDICTED: protein IRX15-LIKE-like                 234   3e-70    
ref|XP_004951837.1|  PREDICTED: protein IRREGULAR XYLEM 15-like         230   5e-69    
gb|KFK40017.1|  hypothetical protein AALP_AA3G319200                    230   5e-69    
ref|XP_010530753.1|  PREDICTED: protein IRX15-LIKE-like                 230   6e-69    
gb|EEE66247.1|  hypothetical protein OsJ_22425                          227   5e-68    Oryza sativa Japonica Group [Japonica rice]
ref|XP_002453337.1|  hypothetical protein SORBIDRAFT_04g004070          226   2e-67    Sorghum bicolor [broomcorn]
emb|CDX89660.1|  BnaC03g45740D                                          226   2e-67    
emb|CDY37228.1|  BnaA09g08490D                                          226   3e-67    
dbj|BAJ87047.1|  predicted protein                                      225   4e-67    
ref|XP_010928364.1|  PREDICTED: protein IRX15-LIKE-like                 224   1e-66    
ref|XP_009123237.1|  PREDICTED: protein IRX15-LIKE-like                 224   1e-66    
emb|CDY62313.1|  BnaCnng39920D                                          224   1e-66    
ref|XP_006298050.1|  hypothetical protein CARUB_v10014094mg             224   2e-66    
dbj|BAJ95150.1|  predicted protein                                      223   6e-66    
dbj|BAD28033.1|  unknown protein                                        221   4e-65    Oryza sativa Japonica Group [Japonica rice]
ref|XP_003570954.2|  PREDICTED: protein IRREGULAR XYLEM 15-like         219   6e-65    
gb|EAY84554.1|  hypothetical protein OsI_05925                          219   1e-64    Oryza sativa Indica Group [Indian rice]
ref|XP_003560476.1|  PREDICTED: protein IRX15-LIKE-like                 219   2e-64    
ref|XP_010547998.1|  PREDICTED: protein IRX15-LIKE                      217   7e-64    
ref|XP_002978695.1|  hypothetical protein SELMODRAFT_57632              207   7e-62    
ref|XP_002984622.1|  hypothetical protein SELMODRAFT_47575              206   2e-61    
gb|AFK46333.1|  unknown                                                 206   4e-61    
ref|XP_006648329.1|  PREDICTED: protein IRX15-like                      203   1e-59    
ref|XP_006836793.1|  hypothetical protein AMTR_s00099p00012720          198   8e-57    
gb|EEE56345.1|  hypothetical protein OsJ_05451                          194   2e-56    Oryza sativa Japonica Group [Japonica rice]
gb|AAF43218.1|AC012654_2  EST gb|AI999169 comes from this gene          193   4e-55    Arabidopsis thaliana [mouse-ear cress]
ref|NP_565020.1|  uncharacterized protein                               193   5e-55    Arabidopsis thaliana [mouse-ear cress]
ref|XP_006302624.1|  hypothetical protein CARUB_v10020731mg             193   6e-55    
ref|XP_002990576.1|  hypothetical protein SELMODRAFT_47472              190   8e-55    
ref|XP_006390759.1|  hypothetical protein EUTSA_v10018938mg             192   9e-55    
ref|XP_002983636.1|  hypothetical protein SELMODRAFT_47473              190   1e-54    
gb|EPS67950.1|  hypothetical protein M569_06827                         188   3e-54    
ref|XP_009105824.1|  PREDICTED: glucuronoxylan 4-O-methyltransfer...    189   3e-53    
ref|XP_004310084.1|  PREDICTED: glucuronoxylan 4-O-methyltransfer...    188   3e-53    
emb|CDX96332.1|  BnaA07g29430D                                          188   3e-53    
ref|XP_009417000.1|  PREDICTED: glucuronoxylan 4-O-methyltransfer...    187   5e-53    
ref|XP_011092282.1|  PREDICTED: glucuronoxylan 4-O-methyltransfer...    187   1e-52    
gb|AFK44106.1|  unknown                                                 186   2e-52    
emb|CDX72815.1|  BnaC06g32630D                                          186   2e-52    
ref|XP_006478265.1|  PREDICTED: glucuronoxylan 4-O-methyltransfer...    186   3e-52    
gb|EYU22748.1|  hypothetical protein MIMGU_mgv1a011269mg                186   3e-52    
gb|KEH20602.1|  polysaccharide biosynthesis protein                     186   3e-52    
ref|XP_006417555.1|  hypothetical protein EUTSA_v10009538mg             184   1e-51    
ref|XP_004310083.1|  PREDICTED: glucuronoxylan 4-O-methyltransfer...    184   1e-51    
ref|XP_002887380.1|  hypothetical protein ARALYDRAFT_316133             184   1e-51    
ref|XP_003523475.1|  PREDICTED: glucuronoxylan 4-O-methyltransfer...    183   3e-51    
ref|XP_006441614.1|  hypothetical protein CICLE_v10021249mg             184   3e-51    
ref|XP_002304685.1|  hypothetical protein POPTR_0003s17080g             182   4e-51    Populus trichocarpa [western balsam poplar]
ref|XP_010427991.1|  PREDICTED: glucuronoxylan 4-O-methyltransfer...    182   8e-51    
ref|XP_004502290.1|  PREDICTED: glucuronoxylan 4-O-methyltransfer...    182   8e-51    
ref|XP_008441152.1|  PREDICTED: glucuronoxylan 4-O-methyltransfer...    181   9e-51    
ref|XP_004499575.1|  PREDICTED: glucuronoxylan 4-O-methyltransfer...    182   1e-50    
ref|XP_003598051.1|  hypothetical protein MTR_3g005710                  182   1e-50    
emb|CAN73177.1|  hypothetical protein VITISV_009984                     182   1e-50    Vitis vinifera
ref|XP_011020742.1|  PREDICTED: glucuronoxylan 4-O-methyltransfer...    181   1e-50    
ref|XP_011071227.1|  PREDICTED: glucuronoxylan 4-O-methyltransfer...    181   1e-50    
ref|XP_010471166.1|  PREDICTED: glucuronoxylan 4-O-methyltransfer...    181   2e-50    
ref|XP_008389872.1|  PREDICTED: glucuronoxylan 4-O-methyltransfer...    181   2e-50    
ref|XP_002266046.1|  PREDICTED: glucuronoxylan 4-O-methyltransfer...    181   2e-50    Vitis vinifera
ref|XP_004504411.1|  PREDICTED: glucuronoxylan 4-O-methyltransfer...    181   3e-50    
ref|XP_007019818.1|  UvrABC system protein C isoform 2                  181   3e-50    
ref|XP_007019817.1|  UvrABC system protein C isoform 1                  181   3e-50    
ref|XP_011002126.1|  PREDICTED: glucuronoxylan 4-O-methyltransfer...    180   3e-50    
ref|XP_010646548.1|  PREDICTED: glucuronoxylan 4-O-methyltransfer...    180   4e-50    
ref|XP_008778155.1|  PREDICTED: glucuronoxylan 4-O-methyltransfer...    180   5e-50    
ref|XP_004158529.1|  PREDICTED: uncharacterized LOC101202991            179   5e-50    
ref|XP_004138670.1|  PREDICTED: uncharacterized protein LOC101202991    179   5e-50    
ref|XP_002514909.1|  conserved hypothetical protein                     179   6e-50    Ricinus communis
ref|XP_002279765.1|  PREDICTED: glucuronoxylan 4-O-methyltransfer...    180   6e-50    Vitis vinifera
ref|XP_002274054.1|  PREDICTED: glucuronoxylan 4-O-methyltransfer...    179   7e-50    Vitis vinifera
ref|XP_011095869.1|  PREDICTED: glucuronoxylan 4-O-methyltransfer...    179   7e-50    
ref|XP_010028995.1|  PREDICTED: glucuronoxylan 4-O-methyltransfer...    179   8e-50    
ref|XP_010927860.1|  PREDICTED: glucuronoxylan 4-O-methyltransfer...    179   8e-50    
ref|XP_011036083.1|  PREDICTED: glucuronoxylan 4-O-methyltransfer...    179   8e-50    
ref|XP_009353798.1|  PREDICTED: glucuronoxylan 4-O-methyltransfer...    179   8e-50    
emb|CAN78768.1|  hypothetical protein VITISV_006251                     177   9e-50    Vitis vinifera
ref|XP_010544116.1|  PREDICTED: glucuronoxylan 4-O-methyltransfer...    179   1e-49    
ref|XP_010100099.1|  hypothetical protein L484_014289                   179   1e-49    
ref|XP_008339417.1|  PREDICTED: glucuronoxylan 4-O-methyltransfer...    180   1e-49    
ref|XP_002889761.1|  hypothetical protein ARALYDRAFT_888205             178   2e-49    
ref|XP_008389874.1|  PREDICTED: glucuronoxylan 4-O-methyltransfer...    178   2e-49    
ref|XP_009611193.1|  PREDICTED: glucuronoxylan 4-O-methyltransfer...    178   2e-49    
ref|XP_002526428.1|  conserved hypothetical protein                     178   2e-49    Ricinus communis
gb|KFK45099.1|  hypothetical protein AALP_AA1G343500                    178   2e-49    
ref|XP_006415059.1|  hypothetical protein EUTSA_v10008341mg             178   2e-49    
ref|XP_003531197.1|  PREDICTED: glucuronoxylan 4-O-methyltransfer...    178   2e-49    
ref|NP_564428.1|  glucuronoxylan 4-O-methyltransferase                  178   3e-49    Arabidopsis thaliana [mouse-ear cress]
ref|XP_007163768.1|  hypothetical protein PHAVU_001G262300g             177   3e-49    
ref|XP_006339353.1|  PREDICTED: glucuronoxylan 4-O-methyltransfer...    178   3e-49    
emb|CDP00853.1|  unnamed protein product                                178   3e-49    
ref|XP_010930428.1|  PREDICTED: glucuronoxylan 4-O-methyltransfer...    177   3e-49    
ref|XP_003552780.2|  PREDICTED: glucuronoxylan 4-O-methyltransfer...    178   4e-49    
ref|XP_002297842.1|  hypothetical protein POPTR_0001s13850g             177   4e-49    Populus trichocarpa [western balsam poplar]
ref|XP_010252121.1|  PREDICTED: glucuronoxylan 4-O-methyltransfer...    178   5e-49    
emb|CDP13345.1|  unnamed protein product                                177   5e-49    
ref|XP_001754981.1|  predicted protein                                  175   5e-49    
ref|XP_010499922.1|  PREDICTED: glucuronoxylan 4-O-methyltransfer...    177   5e-49    
ref|XP_010461205.1|  PREDICTED: glucuronoxylan 4-O-methyltransfer...    177   5e-49    
ref|XP_009774625.1|  PREDICTED: glucuronoxylan 4-O-methyltransfer...    177   5e-49    
ref|XP_006303671.1|  hypothetical protein CARUB_v10011736mg             177   5e-49    
ref|XP_008378726.1|  PREDICTED: glucuronoxylan 4-O-methyltransfer...    177   6e-49    
ref|XP_008368121.1|  PREDICTED: glucuronoxylan 4-O-methyltransfer...    177   6e-49    
ref|XP_006305458.1|  hypothetical protein CARUB_v10009876mg             177   7e-49    
ref|XP_008361849.1|  PREDICTED: glucuronoxylan 4-O-methyltransfer...    176   7e-49    
ref|XP_003601776.1|  hypothetical protein MTR_3g085270                  177   7e-49    
ref|XP_009357185.1|  PREDICTED: glucuronoxylan 4-O-methyltransfer...    177   8e-49    
emb|CDY15292.1|  BnaC06g07780D                                          177   8e-49    
ref|XP_009114783.1|  PREDICTED: glucuronoxylan 4-O-methyltransfer...    177   8e-49    
emb|CDY20685.1|  BnaC08g13730D                                          176   8e-49    
ref|XP_007223739.1|  hypothetical protein PRUPE_ppa010492mg             175   8e-49    
gb|EYU33284.1|  hypothetical protein MIMGU_mgv1a010969mg                177   8e-49    
gb|KDP26809.1|  hypothetical protein JCGZ_17967                         176   9e-49    
ref|XP_002891062.1|  predicted protein                                  177   9e-49    
ref|XP_009110815.1|  PREDICTED: glucuronoxylan 4-O-methyltransfer...    176   1e-48    
emb|CAN66688.1|  hypothetical protein VITISV_037863                     176   1e-48    Vitis vinifera
ref|XP_010530547.1|  PREDICTED: glucuronoxylan 4-O-methyltransfer...    176   1e-48    
ref|XP_010912696.1|  PREDICTED: glucuronoxylan 4-O-methyltransfer...    176   1e-48    
ref|NP_172432.1|  uncharacterized protein                               176   1e-48    Arabidopsis thaliana [mouse-ear cress]
ref|XP_009774624.1|  PREDICTED: glucuronoxylan 4-O-methyltransfer...    176   2e-48    
ref|XP_007044007.1|  Cell wall integrity and stress response comp...    176   2e-48    
ref|XP_004230438.1|  PREDICTED: glucuronoxylan 4-O-methyltransfer...    175   2e-48    
ref|XP_006376148.1|  hypothetical protein POPTR_0013s10240g             176   2e-48    
ref|XP_010542789.1|  PREDICTED: glucuronoxylan 4-O-methyltransfer...    176   2e-48    
ref|XP_011047866.1|  PREDICTED: glucuronoxylan 4-O-methyltransfer...    176   2e-48    
ref|XP_008219085.1|  PREDICTED: glucuronoxylan 4-O-methyltransfer...    176   2e-48    
ref|XP_010062382.1|  PREDICTED: glucuronoxylan 4-O-methyltransfer...    176   3e-48    
ref|XP_009773426.1|  PREDICTED: glucuronoxylan 4-O-methyltransfer...    176   3e-48    
ref|XP_010475802.1|  PREDICTED: glucuronoxylan 4-O-methyltransfer...    175   3e-48    
gb|KFK41585.1|  hypothetical protein AALP_AA2G148100                    175   3e-48    
ref|XP_009379025.1|  PREDICTED: glucuronoxylan 4-O-methyltransfer...    175   4e-48    
ref|XP_009372279.1|  PREDICTED: glucuronoxylan 4-O-methyltransfer...    174   4e-48    
emb|CDY31075.1|  BnaA08g26250D                                          174   4e-48    
ref|XP_006349307.1|  PREDICTED: glucuronoxylan 4-O-methyltransfer...    174   5e-48    
ref|XP_008222167.1|  PREDICTED: glucuronoxylan 4-O-methyltransfer...    174   5e-48    
ref|XP_004250648.1|  PREDICTED: glucuronoxylan 4-O-methyltransfer...    174   5e-48    
ref|XP_009415016.1|  PREDICTED: glucuronoxylan 4-O-methyltransfer...    174   5e-48    
ref|XP_009588800.1|  PREDICTED: glucuronoxylan 4-O-methyltransfer...    175   5e-48    
ref|XP_003537534.1|  PREDICTED: glucuronoxylan 4-O-methyltransfer...    174   6e-48    
ref|XP_006848337.1|  hypothetical protein AMTR_s00013p00174150          174   6e-48    
gb|AHK60925.1|  glucuronoxylan methyltransferase 2                      174   6e-48    
gb|AHK60924.1|  glucuronoxylan methyltransferase 1                      174   6e-48    
ref|XP_006484106.1|  PREDICTED: glucuronoxylan 4-O-methyltransfer...    174   6e-48    
ref|XP_009611196.1|  PREDICTED: glucuronoxylan 4-O-methyltransfer...    176   7e-48    
ref|XP_010680469.1|  PREDICTED: uncharacterized protein LOC104895606    180   7e-48    
ref|XP_011005441.1|  PREDICTED: glucuronoxylan 4-O-methyltransfer...    174   7e-48    
dbj|BAK02602.1|  predicted protein                                      174   7e-48    
ref|XP_007158681.1|  hypothetical protein PHAVU_002G173400g             174   8e-48    
ref|XP_010657964.1|  PREDICTED: glucuronoxylan 4-O-methyltransfer...    176   1e-47    
ref|XP_008353046.1|  PREDICTED: glucuronoxylan 4-O-methyltransfer...    176   1e-47    
emb|CDO97633.1|  unnamed protein product                                174   1e-47    
ref|XP_010099365.1|  hypothetical protein L484_000866                   174   1e-47    
ref|XP_010458256.1|  PREDICTED: glucuronoxylan 4-O-methyltransfer...    173   1e-47    
ref|XP_009355344.1|  PREDICTED: glucuronoxylan 4-O-methyltransfer...    173   1e-47    
ref|XP_006447054.1|  hypothetical protein CICLE_v10018349mg             172   2e-47    
ref|XP_006389489.1|  hypothetical protein POPTR_0022s00320g             173   2e-47    
ref|XP_011031554.1|  PREDICTED: glucuronoxylan 4-O-methyltransfer...    173   2e-47    
ref|XP_006438023.1|  hypothetical protein CICLE_v10032331mg             173   2e-47    
emb|CDP16775.1|  unnamed protein product                                173   2e-47    
dbj|BAJ88693.1|  predicted protein                                      173   2e-47    
emb|CDY48797.1|  BnaA05g20730D                                          173   2e-47    
ref|XP_008786409.1|  PREDICTED: glucuronoxylan 4-O-methyltransfer...    172   2e-47    
ref|XP_006470075.1|  PREDICTED: glucuronoxylan 4-O-methyltransfer...    172   3e-47    
ref|XP_006385062.1|  hypothetical protein POPTR_0004s23540g             174   3e-47    
ref|XP_007226453.1|  hypothetical protein PRUPE_ppa024506mg             171   3e-47    
ref|XP_002874599.1|  hypothetical protein ARALYDRAFT_489845             172   3e-47    
ref|XP_002526403.1|  conserved hypothetical protein                     173   3e-47    
ref|XP_006397117.1|  hypothetical protein EUTSA_v10028858mg             172   3e-47    
ref|XP_002325525.2|  hypothetical protein POPTR_0019s10490g             172   3e-47    
ref|XP_007148617.1|  hypothetical protein PHAVU_005G001400g             173   4e-47    
ref|XP_009145172.1|  PREDICTED: glucuronoxylan 4-O-methyltransfer...    172   4e-47    
ref|XP_010030205.1|  PREDICTED: glucuronoxylan 4-O-methyltransfer...    172   4e-47    
ref|XP_007223179.1|  hypothetical protein PRUPE_ppa009168mg             172   4e-47    
ref|XP_004299873.1|  PREDICTED: glucuronoxylan 4-O-methyltransfer...    172   5e-47    
ref|XP_006580120.1|  PREDICTED: glucuronoxylan 4-O-methyltransfer...    171   7e-47    
ref|XP_011028374.1|  PREDICTED: glucuronoxylan 4-O-methyltransfer...    173   9e-47    
ref|XP_003547881.1|  PREDICTED: glucuronoxylan 4-O-methyltransfer...    171   1e-46    
ref|XP_008365324.1|  PREDICTED: glucuronoxylan 4-O-methyltransfer...    171   1e-46    
ref|XP_010261020.1|  PREDICTED: glucuronoxylan 4-O-methyltransfer...    171   1e-46    
gb|KFK44666.1|  hypothetical protein AALP_AA1G288200                    170   2e-46    
ref|XP_004300005.1|  PREDICTED: glucuronoxylan 4-O-methyltransfer...    171   2e-46    
ref|XP_010490173.1|  PREDICTED: glucuronoxylan 4-O-methyltransfer...    170   2e-46    
ref|XP_010667408.1|  PREDICTED: glucuronoxylan 4-O-methyltransfer...    170   2e-46    
ref|XP_010490169.1|  PREDICTED: glucuronoxylan 4-O-methyltransfer...    170   3e-46    
ref|XP_004293059.1|  PREDICTED: glucuronoxylan 4-O-methyltransfer...    170   3e-46    
ref|XP_008801843.1|  PREDICTED: glucuronoxylan 4-O-methyltransfer...    168   3e-46    
ref|XP_007148579.1|  hypothetical protein PHAVU_006G220400g             170   3e-46    
ref|XP_006470960.1|  PREDICTED: glucuronoxylan 4-O-methyltransfer...    170   3e-46    
gb|KDO42443.1|  hypothetical protein CISIN_1g043166mg                   169   4e-46    
ref|XP_008218691.1|  PREDICTED: glucuronoxylan 4-O-methyltransfer...    169   5e-46    
gb|ACU23359.1|  unknown                                                 169   6e-46    
ref|XP_006431520.1|  hypothetical protein CICLE_v10002026mg             169   7e-46    
ref|XP_010549289.1|  PREDICTED: glucuronoxylan 4-O-methyltransfer...    169   7e-46    
gb|EAY89414.1|  hypothetical protein OsI_10920                          169   8e-46    
emb|CDY50891.1|  BnaCnng19830D                                          177   8e-46    
gb|KFK43257.1|  hypothetical protein AALP_AA1G100400                    177   9e-46    
ref|NP_564297.1|  uncharacterized protein                               168   1e-45    
gb|KDP46273.1|  hypothetical protein JCGZ_10113                         168   1e-45    
ref|XP_010099766.1|  hypothetical protein L484_010953                   169   1e-45    
ref|XP_010682760.1|  PREDICTED: glucuronoxylan 4-O-methyltransfer...    168   1e-45    
ref|XP_007041172.1|  S-adenosyl-L-methionine-dependent methyltran...    171   2e-45    
ref|XP_009420161.1|  PREDICTED: glucuronoxylan 4-O-methyltransfer...    167   2e-45    
ref|XP_006288379.1|  hypothetical protein CARUB_v10001630mg             167   2e-45    
ref|XP_010249031.1|  PREDICTED: glucuronoxylan 4-O-methyltransfer...    167   2e-45    
ref|NP_001066378.1|  Os12g0204500                                       167   2e-45    
ref|XP_002893494.1|  hypothetical protein ARALYDRAFT_890326             167   2e-45    
gb|AAC33218.1|  Similar to cdc2 protein kinases                         176   3e-45    
emb|CDY28894.1|  BnaC06g26820D                                          167   3e-45    
ref|NP_176901.1|  uncharacterized protein                               167   3e-45    
gb|AAM61740.1|  unknown                                                 167   3e-45    
ref|XP_008446029.1|  PREDICTED: glucuronoxylan 4-O-methyltransfer...    167   3e-45    
ref|XP_010499283.1|  PREDICTED: glucuronoxylan 4-O-methyltransfer...    167   4e-45    
ref|XP_010460559.1|  PREDICTED: glucuronoxylan 4-O-methyltransfer...    167   4e-45    
ref|XP_010460560.1|  PREDICTED: glucuronoxylan 4-O-methyltransfer...    167   4e-45    
ref|XP_010676715.1|  PREDICTED: glucuronoxylan 4-O-methyltransfer...    166   5e-45    
ref|XP_006304065.1|  hypothetical protein CARUB_v10009914mg             166   6e-45    
ref|XP_009787024.1|  PREDICTED: glucuronoxylan 4-O-methyltransfer...    166   9e-45    
ref|XP_010682758.1|  PREDICTED: glucuronoxylan 4-O-methyltransfer...    166   1e-44    
ref|XP_009105125.1|  PREDICTED: glucuronoxylan 4-O-methyltransfer...    166   1e-44    
ref|XP_009775021.1|  PREDICTED: glucuronoxylan 4-O-methyltransfer...    166   1e-44    
ref|XP_010437731.1|  PREDICTED: glucuronoxylan 4-O-methyltransfer...    166   1e-44    
ref|NP_192737.1|  uncharacterized protein                               165   1e-44    
ref|XP_002443019.1|  hypothetical protein SORBIDRAFT_08g006410          166   1e-44    
ref|XP_010415866.1|  PREDICTED: glucuronoxylan 4-O-methyltransfer...    166   1e-44    
ref|XP_002277620.1|  PREDICTED: glucuronoxylan 4-O-methyltransfer...    165   2e-44    
gb|KGN51667.1|  hypothetical protein Csa_5G589350                       165   2e-44    
ref|XP_009405263.1|  PREDICTED: glucuronoxylan 4-O-methyltransfer...    164   2e-44    
ref|XP_009628062.1|  PREDICTED: glucuronoxylan 4-O-methyltransfer...    163   2e-44    
ref|XP_004152531.1|  PREDICTED: uncharacterized protein LOC101217402    165   2e-44    
emb|CBI27661.3|  unnamed protein product                                166   2e-44    
ref|XP_010539231.1|  PREDICTED: glucuronoxylan 4-O-methyltransfer...    166   2e-44    
ref|XP_002509508.1|  conserved hypothetical protein                     165   2e-44    
ref|XP_006415716.1|  hypothetical protein EUTSA_v10010026mg             165   2e-44    
gb|EPS63199.1|  hypothetical protein M569_11587                         162   2e-44    
ref|XP_006391291.1|  hypothetical protein EUTSA_v10018905mg             164   5e-44    
ref|XP_010421910.1|  PREDICTED: glucuronoxylan 4-O-methyltransfer...    164   6e-44    
gb|EYU22746.1|  hypothetical protein MIMGU_mgv1a023936mg                162   7e-44    
emb|CDP00854.1|  unnamed protein product                                163   8e-44    
ref|XP_008437427.1|  PREDICTED: glucuronoxylan 4-O-methyltransfer...    163   8e-44    
ref|XP_004977142.1|  PREDICTED: glucuronoxylan 4-O-methyltransfer...    164   9e-44    
ref|XP_009113726.1|  PREDICTED: glucuronoxylan 4-O-methyltransfer...    163   9e-44    
gb|EPS67958.1|  hypothetical protein M569_06817                         163   1e-43    
ref|XP_010905171.1|  PREDICTED: glucuronoxylan 4-O-methyltransfer...    162   1e-43    
ref|NP_001045957.2|  Os02g0158500                                       162   1e-43    
ref|XP_002887113.1|  hypothetical protein ARALYDRAFT_475830             162   2e-43    
ref|XP_009394065.1|  PREDICTED: glucuronoxylan 4-O-methyltransfer...    162   2e-43    
gb|ABF72010.1|  hypothetical protein MA4_111B14.64                      162   2e-43    
ref|NP_001147380.1|  plant-specific domain TIGR01627 family protein     162   2e-43    
ref|XP_006301418.1|  hypothetical protein CARUB_v10021834mg             162   2e-43    
ref|XP_011086800.1|  PREDICTED: glucuronoxylan 4-O-methyltransfer...    162   2e-43    
tpg|DAA55455.1|  TPA: plant-specific domain TIGR01627 family protein    162   2e-43    
ref|XP_009102942.1|  PREDICTED: glucuronoxylan 4-O-methyltransfer...    162   2e-43    
gb|KFK41138.1|  hypothetical protein AALP_AA2G090800                    162   2e-43    
ref|XP_009620086.1|  PREDICTED: glucuronoxylan 4-O-methyltransfer...    162   3e-43    
ref|XP_010470638.1|  PREDICTED: glucuronoxylan 4-O-methyltransfer...    162   4e-43    
ref|XP_010415308.1|  PREDICTED: glucuronoxylan 4-O-methyltransfer...    161   4e-43    
ref|XP_006359734.1|  PREDICTED: glucuronoxylan 4-O-methyltransfer...    160   5e-43    
ref|XP_003548518.1|  PREDICTED: glucuronoxylan 4-O-methyltransfer...    161   5e-43    
ref|XP_006397116.1|  hypothetical protein EUTSA_v10028858mg             160   7e-43    
emb|CDY12639.1|  BnaA02g13070D                                          160   8e-43    
ref|XP_010511661.1|  PREDICTED: glucuronoxylan 4-O-methyltransfer...    160   2e-42    
ref|XP_003576967.1|  PREDICTED: glucuronoxylan 4-O-methyltransfer...    160   2e-42    
ref|XP_009127546.1|  PREDICTED: glucuronoxylan 4-O-methyltransfer...    160   2e-42    
ref|XP_009415897.1|  PREDICTED: glucuronoxylan 4-O-methyltransfer...    159   3e-42    
emb|CDY51186.1|  BnaC02g45640D                                          159   3e-42    
ref|XP_004243057.2|  PREDICTED: glucuronoxylan 4-O-methyltransfer...    156   7e-42    
ref|XP_009785261.1|  PREDICTED: glucuronoxylan 4-O-methyltransfer...    157   1e-41    
ref|XP_006352194.1|  PREDICTED: glucuronoxylan 4-O-methyltransfer...    155   2e-41    
gb|EMS63891.1|  hypothetical protein TRIUR3_06059                       154   3e-41    
ref|XP_004513320.1|  PREDICTED: glucuronoxylan 4-O-methyltransfer...    156   4e-41    
gb|EYU42089.1|  hypothetical protein MIMGU_mgv1a011091mg                155   7e-41    
gb|ACE97113.1|  expressed protein                                       152   7e-41    
ref|XP_003553258.1|  PREDICTED: glucuronoxylan 4-O-methyltransfer...    156   9e-41    
ref|XP_006352193.1|  PREDICTED: glucuronoxylan 4-O-methyltransfer...    155   9e-41    
gb|ACE97135.1|  expressed protein                                       151   1e-40    
ref|XP_007161723.1|  hypothetical protein PHAVU_001G093100g             155   2e-40    
gb|ACE97107.1|  expressed protein                                       150   2e-40    
gb|ACE97136.1|  expressed protein                                       150   3e-40    
gb|ACE97121.1|  expressed protein                                       150   3e-40    
tpg|DAA37232.1|  TPA: hypothetical protein ZEAMMB73_285609              150   4e-40    
ref|XP_010421911.1|  PREDICTED: glucuronoxylan 4-O-methyltransfer...    152   8e-40    
gb|ACE97109.1|  expressed protein                                       149   1e-39    
gb|ACE97115.1|  expressed protein                                       149   1e-39    
ref|XP_010480867.1|  PREDICTED: glucuronoxylan 4-O-methyltransfer...    152   1e-39    
gb|ACE97140.1|  expressed protein                                       149   1e-39    
emb|CAN63149.1|  hypothetical protein VITISV_040802                     151   2e-39    
gb|ACE97116.1|  expressed protein                                       148   2e-39    
ref|XP_010682759.1|  PREDICTED: glucuronoxylan 4-O-methyltransfer...    151   4e-39    
ref|XP_008662641.1|  PREDICTED: glucuronoxylan 4-O-methyltransfer...    151   4e-39    
ref|XP_008662640.1|  PREDICTED: glucuronoxylan 4-O-methyltransfer...    151   5e-39    
ref|XP_009629764.1|  PREDICTED: glucuronoxylan 4-O-methyltransfer...    145   4e-37    
gb|KCW57152.1|  hypothetical protein EUGRSUZ_I02785                     144   5e-37    
dbj|BAK07602.1|  predicted protein                                      145   8e-37    
ref|XP_006356560.1|  PREDICTED: glucuronoxylan 4-O-methyltransfer...    147   1e-36    
ref|XP_008245403.1|  PREDICTED: protein IRX15-LIKE-like                 142   1e-36    
ref|XP_010322783.1|  PREDICTED: glucuronoxylan 4-O-methyltransfer...    144   2e-36    
gb|KEH22018.1|  polysaccharide biosynthesis protein                     142   8e-36    
emb|CDP16776.1|  unnamed protein product                                139   1e-35    
gb|AFK42978.1|  unknown                                                 138   1e-35    
gb|KDP45647.1|  hypothetical protein JCGZ_17254                         137   2e-35    
ref|XP_008662639.1|  PREDICTED: glucuronoxylan 4-O-methyltransfer...    141   2e-35    
gb|KFK32037.1|  hypothetical protein AALP_AA6G191900                    137   3e-35    
gb|EMS51769.1|  hypothetical protein TRIUR3_12679                       140   6e-35    
ref|XP_011073068.1|  PREDICTED: glucuronoxylan 4-O-methyltransfer...    140   6e-35    
ref|XP_007209010.1|  hypothetical protein PRUPE_ppa023358mg             140   7e-35    
ref|XP_009368533.1|  PREDICTED: glucuronoxylan 4-O-methyltransfer...    137   1e-33    
ref|XP_010037414.1|  PREDICTED: glucuronoxylan 4-O-methyltransfer...    137   1e-33    
ref|XP_009375208.1|  PREDICTED: glucuronoxylan 4-O-methyltransfer...    136   2e-33    
ref|XP_008239480.1|  PREDICTED: glucuronoxylan 4-O-methyltransfer...    137   2e-33    
ref|XP_002322260.2|  hypothetical protein POPTR_0015s10890g             136   2e-33    
ref|XP_003577659.1|  PREDICTED: glucuronoxylan 4-O-methyltransfer...    136   2e-33    
ref|XP_002511179.1|  conserved hypothetical protein                     136   3e-33    
ref|XP_003525535.1|  PREDICTED: glucuronoxylan 4-O-methyltransfer...    135   3e-33    
ref|XP_008374234.1|  PREDICTED: glucuronoxylan 4-O-methyltransfer...    135   4e-33    
ref|XP_010104047.1|  hypothetical protein L484_005520                   134   2e-32    
gb|KEH31718.1|  polysaccharide biosynthesis protein                     133   2e-32    
ref|XP_007037988.1|  Uncharacterized protein TCM_014647                 133   4e-32    
ref|XP_007155553.1|  hypothetical protein PHAVU_003G211500g             132   8e-32    
ref|XP_010663748.1|  PREDICTED: glucuronoxylan 4-O-methyltransfer...    132   9e-32    
ref|XP_011024394.1|  PREDICTED: glucuronoxylan 4-O-methyltransfer...    131   1e-31    
gb|KHN14112.1|  hypothetical protein glysoja_033339                     130   2e-31    
ref|XP_010555550.1|  PREDICTED: glucuronoxylan 4-O-methyltransfer...    130   5e-31    
ref|XP_008801832.1|  PREDICTED: glucuronoxylan 4-O-methyltransfer...    129   5e-31    
gb|KHN23985.1|  hypothetical protein glysoja_033973                     129   6e-31    
ref|XP_010905172.1|  PREDICTED: glucuronoxylan 4-O-methyltransfer...    128   8e-31    
ref|XP_006579320.1|  PREDICTED: glucuronoxylan 4-O-methyltransfer...    127   9e-31    
ref|XP_006436840.1|  hypothetical protein CICLE_v10033933mg             129   1e-30    
gb|KDO47293.1|  hypothetical protein CISIN_1g021323mg                   129   1e-30    
ref|XP_010917521.1|  PREDICTED: glucuronoxylan 4-O-methyltransfer...    128   1e-30    
ref|XP_008392805.1|  PREDICTED: glucuronoxylan 4-O-methyltransfer...    128   1e-30    
emb|CDY37946.1|  BnaC02g20650D                                          127   1e-30    
ref|XP_008805294.1|  PREDICTED: glucuronoxylan 4-O-methyltransfer...    127   2e-30    
gb|KDP22615.1|  hypothetical protein JCGZ_26446                         127   3e-30    
ref|XP_008446235.1|  PREDICTED: protein IRX15-LIKE                      126   3e-30    
ref|XP_010911544.1|  PREDICTED: glucuronoxylan 4-O-methyltransfer...    124   4e-30    
ref|XP_004515809.1|  PREDICTED: glucuronoxylan 4-O-methyltransfer...    126   6e-30    
gb|KGN64413.1|  hypothetical protein Csa_1G050520                       126   7e-30    
ref|XP_009415898.1|  PREDICTED: glucuronoxylan 4-O-methyltransfer...    125   1e-29    
ref|XP_010695396.1|  PREDICTED: glucuronoxylan 4-O-methyltransfer...    126   1e-29    
gb|EAZ27036.1|  hypothetical protein OsJ_10966                          125   1e-29    
gb|KFK29026.1|  hypothetical protein AALP_AA7G078800                    125   2e-29    
ref|XP_006413372.1|  hypothetical protein EUTSA_v10027469mg             124   4e-29    
emb|CDP16089.1|  unnamed protein product                                124   4e-29    



>ref|XP_004231869.1| PREDICTED: protein IRX15-LIKE-like [Solanum lycopersicum]
Length=308

 Score =   418 bits (1075),  Expect = 1e-142, Method: Compositional matrix adjust.
 Identities = 189/240 (79%), Positives = 214/240 (89%), Gaps = 1/240 (0%)
 Frame = -3

Query  1026  ASGGGGGATPALSKSIVRALVHYASISNNTDRMSYADIKQISDVLRQCGSHPCNFLVFGL  847
             AS     +TP LSK++ RALVHYAS SNNT+ MSY DIK I+DVL++C S PCN LVFGL
Sbjct  59    ASTITSTSTPPLSKAVARALVHYASNSNNTEHMSYTDIKHIADVLQKC-SQPCNLLVFGL  117

Query  846   THETLLWRTLNHHGRTVFIDESRYYAAYVEEKYPEIEVYDVQYSTKLSEMKELISGVKEQ  667
             THETLLW+ LNH+GRTVFIDE+RYYAAY+EEKYPEIE YDVQY+TKLSEMKELI+GVKEQ
Sbjct  118   THETLLWKALNHNGRTVFIDENRYYAAYIEEKYPEIEAYDVQYTTKLSEMKELIAGVKEQ  177

Query  666   ARNECRPVQNLLFSECKLGLNDLPNQLYEVDWDVILVDGPRGYWPEAPGRMSAIFTAGVL  487
              RNEC+PVQNLLFSECKLGLNDLPNQ YEVDWDVIL+DGPRGYWPEAPGRMSAIFTA VL
Sbjct  178   VRNECKPVQNLLFSECKLGLNDLPNQFYEVDWDVILIDGPRGYWPEAPGRMSAIFTASVL  237

Query  486   ARSKKGGNPKTHVLVHDYNQKSDRIASEEFLCRENLVETKGMVGHFVVEVMDANNFNFCR  307
             ARSKKGGNPKTH+ VHD++Q+ DRI S+EFLC+ENLV++  M+GHFV+E MDANNF FCR
Sbjct  238   ARSKKGGNPKTHIFVHDFHQQVDRITSDEFLCKENLVKSMDMLGHFVLERMDANNFQFCR  297



>ref|XP_006339865.1| PREDICTED: protein IRX15-like [Solanum tuberosum]
Length=308

 Score =   416 bits (1069),  Expect = 8e-142, Method: Compositional matrix adjust.
 Identities = 189/240 (79%), Positives = 214/240 (89%), Gaps = 1/240 (0%)
 Frame = -3

Query  1026  ASGGGGGATPALSKSIVRALVHYASISNNTDRMSYADIKQISDVLRQCGSHPCNFLVFGL  847
             AS     +TP LSK++ RALVHYAS SNNT+ MSY DIK I+DVL++C S PCN LVFGL
Sbjct  59    ASTITSTSTPPLSKAVARALVHYASNSNNTEHMSYTDIKHIADVLQKC-SQPCNLLVFGL  117

Query  846   THETLLWRTLNHHGRTVFIDESRYYAAYVEEKYPEIEVYDVQYSTKLSEMKELISGVKEQ  667
             THETLLW+ LNH+GRTVFIDE+RYYAAY+EEKYPEIE YDVQY+TKLSEMKELI+GVKEQ
Sbjct  118   THETLLWKALNHNGRTVFIDENRYYAAYIEEKYPEIEAYDVQYTTKLSEMKELIAGVKEQ  177

Query  666   ARNECRPVQNLLFSECKLGLNDLPNQLYEVDWDVILVDGPRGYWPEAPGRMSAIFTAGVL  487
              RNEC+PVQNLLFSECKLGLNDLPNQ YEVDWDVILVDGPRGYWPEAPGRMSAIFTA VL
Sbjct  178   VRNECKPVQNLLFSECKLGLNDLPNQFYEVDWDVILVDGPRGYWPEAPGRMSAIFTASVL  237

Query  486   ARSKKGGNPKTHVLVHDYNQKSDRIASEEFLCRENLVETKGMVGHFVVEVMDANNFNFCR  307
             ARSKKGGNPKTH+ VHD++Q+ DRI S+EFLC+ENLV++  M+GHFV+E MDAN+F FCR
Sbjct  238   ARSKKGGNPKTHIFVHDFHQQVDRITSDEFLCKENLVKSMDMLGHFVLERMDANSFQFCR  297



>ref|XP_009588942.1| PREDICTED: protein IRX15-LIKE-like [Nicotiana tomentosiformis]
Length=302

 Score =   414 bits (1064),  Expect = 4e-141, Method: Compositional matrix adjust.
 Identities = 189/239 (79%), Positives = 211/239 (88%), Gaps = 1/239 (0%)
 Frame = -3

Query  1023  SGGGGGATPALSKSIVRALVHYASISNNTDRMSYADIKQISDVLRQCGSHPCNFLVFGLT  844
             S   G   P LSK++VRAL HYAS SNNT+ MSY DIKQI+DVLRQC   PCN LVFGLT
Sbjct  62    SAISGSTNPPLSKAVVRALTHYASNSNNTEHMSYTDIKQIADVLRQC-QQPCNLLVFGLT  120

Query  843   HETLLWRTLNHHGRTVFIDESRYYAAYVEEKYPEIEVYDVQYSTKLSEMKELISGVKEQA  664
             HETLLW+ LNH+GRTVFIDE+RYYAAY+EEKYP IE YDVQY+TKLSEMKELI+  KEQA
Sbjct  121   HETLLWKALNHNGRTVFIDENRYYAAYIEEKYPGIEAYDVQYTTKLSEMKELIAAAKEQA  180

Query  663   RNECRPVQNLLFSECKLGLNDLPNQLYEVDWDVILVDGPRGYWPEAPGRMSAIFTAGVLA  484
             RNEC+PVQNLLFSECKLGLNDLPNQ YEV+WDVILVDGPRGYWPEAPGRMSAIFTAGVLA
Sbjct  181   RNECKPVQNLLFSECKLGLNDLPNQFYEVNWDVILVDGPRGYWPEAPGRMSAIFTAGVLA  240

Query  483   RSKKGGNPKTHVLVHDYNQKSDRIASEEFLCRENLVETKGMVGHFVVEVMDANNFNFCR  307
             RSKK GNPKTHV VHD+NQK DRI SEEFLC+ENLV++K M+GHFV+  MD+N+++FCR
Sbjct  241   RSKKSGNPKTHVFVHDFNQKVDRITSEEFLCKENLVKSKHMLGHFVIGRMDSNSYHFCR  299



>ref|XP_009793224.1| PREDICTED: protein IRX15-LIKE-like [Nicotiana sylvestris]
Length=302

 Score =   412 bits (1060),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 189/239 (79%), Positives = 210/239 (88%), Gaps = 1/239 (0%)
 Frame = -3

Query  1023  SGGGGGATPALSKSIVRALVHYASISNNTDRMSYADIKQISDVLRQCGSHPCNFLVFGLT  844
             S   G   P LSK++VRAL HYAS SNNT+ MSY DIKQI+DVLRQC   PCN LVFGLT
Sbjct  62    SAITGSTNPPLSKAVVRALTHYASNSNNTEHMSYTDIKQIADVLRQC-QQPCNLLVFGLT  120

Query  843   HETLLWRTLNHHGRTVFIDESRYYAAYVEEKYPEIEVYDVQYSTKLSEMKELISGVKEQA  664
             HETLLW+ LNH+GRTVFIDE+RYYAAY+EEKYP IE YDVQY+TKLSEMKELI+  KEQA
Sbjct  121   HETLLWKALNHNGRTVFIDENRYYAAYIEEKYPGIEAYDVQYTTKLSEMKELIAAAKEQA  180

Query  663   RNECRPVQNLLFSECKLGLNDLPNQLYEVDWDVILVDGPRGYWPEAPGRMSAIFTAGVLA  484
             RNEC+PVQNLLFSECKLGLNDLPNQ YEV+WDVILVDGPRGYWPEAPGRMSAIFTAGVLA
Sbjct  181   RNECKPVQNLLFSECKLGLNDLPNQFYEVNWDVILVDGPRGYWPEAPGRMSAIFTAGVLA  240

Query  483   RSKKGGNPKTHVLVHDYNQKSDRIASEEFLCRENLVETKGMVGHFVVEVMDANNFNFCR  307
             RSKK GNPKTHV VHD+NQK DRI SEEFLC+ENLV++K M+GHFV+  MD N+++FCR
Sbjct  241   RSKKSGNPKTHVFVHDFNQKVDRITSEEFLCKENLVKSKHMLGHFVIGRMDPNSYHFCR  299



>ref|XP_011097393.1| PREDICTED: protein IRX15-LIKE [Sesamum indicum]
Length=291

 Score =   411 bits (1056),  Expect = 5e-140, Method: Compositional matrix adjust.
 Identities = 190/231 (82%), Positives = 207/231 (90%), Gaps = 1/231 (0%)
 Frame = -3

Query  999  PALSKSIVRALVHYASISNNTDRMSYADIKQISDVLRQCGSHPCNFLVFGLTHETLLWRT  820
            P LS ++ RAL+HYAS SNNTDRMSY DIKQI+D LRQC S PCNFLVFGLTHETLLW+ 
Sbjct  51   PPLSSAVSRALLHYASNSNNTDRMSYTDIKQIADALRQC-SPPCNFLVFGLTHETLLWKA  109

Query  819  LNHHGRTVFIDESRYYAAYVEEKYPEIEVYDVQYSTKLSEMKELISGVKEQARNECRPVQ  640
            LNH+GRTVFIDE+RYYAAY+EEKYPEIE YDVQY TKLSEM ELI+ VKEQ RNECRPVQ
Sbjct  110  LNHNGRTVFIDENRYYAAYIEEKYPEIEAYDVQYGTKLSEMPELIAAVKEQVRNECRPVQ  169

Query  639  NLLFSECKLGLNDLPNQLYEVDWDVILVDGPRGYWPEAPGRMSAIFTAGVLARSKKGGNP  460
            NLLFSECKLGLNDLPNQLYEVDWDVILVDGPRGYWPEAPGRM+AIFTA VLARSKKGGNP
Sbjct  170  NLLFSECKLGLNDLPNQLYEVDWDVILVDGPRGYWPEAPGRMAAIFTAAVLARSKKGGNP  229

Query  459  KTHVLVHDYNQKSDRIASEEFLCRENLVETKGMVGHFVVEVMDANNFNFCR  307
            KTHV VHD+N K DRI S+EFLCRENLV++K M+GHFV+E MD+N   FCR
Sbjct  230  KTHVFVHDFNMKVDRITSDEFLCRENLVKSKDMMGHFVLERMDSNASQFCR  280



>ref|XP_009775230.1| PREDICTED: protein IRX15-LIKE-like [Nicotiana sylvestris]
Length=308

 Score =   409 bits (1051),  Expect = 5e-139, Method: Compositional matrix adjust.
 Identities = 186/231 (81%), Positives = 209/231 (90%), Gaps = 1/231 (0%)
 Frame = -3

Query  999  PALSKSIVRALVHYASISNNTDRMSYADIKQISDVLRQCGSHPCNFLVFGLTHETLLWRT  820
            P LSK++  ALVHYAS SNNT+ MSY D+K I+DVL++C S PCN LVFGLTHET LW+ 
Sbjct  68   PPLSKAVAMALVHYASNSNNTEHMSYTDMKYIADVLQKC-SQPCNLLVFGLTHETRLWKA  126

Query  819  LNHHGRTVFIDESRYYAAYVEEKYPEIEVYDVQYSTKLSEMKELISGVKEQARNECRPVQ  640
            LNH+GRTVFIDE+RYYAAY+EEKYPEIE YDVQY+TKLSEMKELI+GVKEQ RNECRPVQ
Sbjct  127  LNHNGRTVFIDENRYYAAYIEEKYPEIEAYDVQYTTKLSEMKELIAGVKEQVRNECRPVQ  186

Query  639  NLLFSECKLGLNDLPNQLYEVDWDVILVDGPRGYWPEAPGRMSAIFTAGVLARSKKGGNP  460
            NLLFSECKLGLNDLPNQ YEV+WDVILVDGPRGYWPEAPGRMSAIFTA VLARSKKGGNP
Sbjct  187  NLLFSECKLGLNDLPNQFYEVEWDVILVDGPRGYWPEAPGRMSAIFTASVLARSKKGGNP  246

Query  459  KTHVLVHDYNQKSDRIASEEFLCRENLVETKGMVGHFVVEVMDANNFNFCR  307
            KTHV VHD+NQ+ DRI S+EFLC+ENLV++K M+GHFV+E MDAN+F FCR
Sbjct  247  KTHVFVHDFNQQVDRITSDEFLCKENLVKSKDMLGHFVLERMDANSFQFCR  297



>ref|XP_006360212.1| PREDICTED: protein IRX15-like [Solanum tuberosum]
Length=302

 Score =   408 bits (1048),  Expect = 1e-138, Method: Compositional matrix adjust.
 Identities = 189/241 (78%), Positives = 208/241 (86%), Gaps = 2/241 (1%)
 Frame = -3

Query  1026  ASGGGGGATPALSKSIVRALVHYASISNNTDRMSYADIKQISDVLRQCGSHPCNFLVFGL  847
              S       P LSK++VRAL HYAS SNNT+RMSY DIKQI+DVLRQC   PCN LVFGL
Sbjct  59    VSSITASTNPPLSKAVVRALTHYASNSNNTERMSYTDIKQIADVLRQC-QQPCNLLVFGL  117

Query  846   THETLLWRTLNHHGRTVFIDESRYYAAYVEEKYPEIEVYDVQYSTKLSEMKELISGVKEQ  667
             THETLLW+ LNH+GRTVFIDE+RYYAAY+EEKYPEIE YDVQY+TKLSEMKELI  VKEQ
Sbjct  118   THETLLWKALNHNGRTVFIDENRYYAAYIEEKYPEIEAYDVQYTTKLSEMKELIGAVKEQ  177

Query  666   ARNECRPVQNLLFSECKLGLNDLPNQLYEVDWDVILVDGPRGYWPEAPGRMSAIFTAGVL  487
              RNEC+PVQNLLFSECKLG+NDLPNQ YEV+WDVILVDGPRGYWPEAPGRMSAIFTAGVL
Sbjct  178   IRNECKPVQNLLFSECKLGINDLPNQFYEVNWDVILVDGPRGYWPEAPGRMSAIFTAGVL  237

Query  486   ARSKKGGNPKTHVLVHDYNQKSDRIASEEFLCRENLV-ETKGMVGHFVVEVMDANNFNFC  310
             ARSKK GNPKTHV VHD+NQK DRI SEEFLC+ENLV  +K M+GHFV+  MD N++ FC
Sbjct  238   ARSKKFGNPKTHVFVHDFNQKVDRITSEEFLCKENLVNNSKDMLGHFVIGRMDPNSYTFC  297

Query  309   R  307
             R
Sbjct  298   R  298



>ref|XP_009599933.1| PREDICTED: protein IRX15-LIKE-like [Nicotiana tomentosiformis]
Length=308

 Score =   407 bits (1046),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 185/231 (80%), Positives = 208/231 (90%), Gaps = 1/231 (0%)
 Frame = -3

Query  999  PALSKSIVRALVHYASISNNTDRMSYADIKQISDVLRQCGSHPCNFLVFGLTHETLLWRT  820
            P LSK++  ALVHYAS SNNT+ MSY D+K I+DVL++C S PCN LVFGLTHET LW+ 
Sbjct  68   PPLSKAVAMALVHYASNSNNTEHMSYTDMKYIADVLQKC-SQPCNLLVFGLTHETRLWKA  126

Query  819  LNHHGRTVFIDESRYYAAYVEEKYPEIEVYDVQYSTKLSEMKELISGVKEQARNECRPVQ  640
            LNH+GRTVFIDE+RYYAAY+EEKYPEIE YDVQY+TKLSEMKELI+GVKEQ RNECRPVQ
Sbjct  127  LNHNGRTVFIDENRYYAAYIEEKYPEIEAYDVQYTTKLSEMKELIAGVKEQVRNECRPVQ  186

Query  639  NLLFSECKLGLNDLPNQLYEVDWDVILVDGPRGYWPEAPGRMSAIFTAGVLARSKKGGNP  460
            NLLFSECKLGLNDLPNQ YEVDWDVILVDGPRGYWPEAPGRMSAIFTA VLARSKKGGN 
Sbjct  187  NLLFSECKLGLNDLPNQFYEVDWDVILVDGPRGYWPEAPGRMSAIFTASVLARSKKGGNS  246

Query  459  KTHVLVHDYNQKSDRIASEEFLCRENLVETKGMVGHFVVEVMDANNFNFCR  307
            KTH+ VHD+NQ+ DRI S+EFLC+ENLV++K M+GHFV+E MDAN+F FCR
Sbjct  247  KTHIFVHDFNQQVDRITSDEFLCKENLVKSKDMLGHFVLERMDANSFQFCR  297



>ref|XP_004233444.1| PREDICTED: protein IRX15-LIKE-like [Solanum lycopersicum]
Length=300

 Score =   405 bits (1041),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 186/240 (78%), Positives = 207/240 (86%), Gaps = 1/240 (0%)
 Frame = -3

Query  1026  ASGGGGGATPALSKSIVRALVHYASISNNTDRMSYADIKQISDVLRQCGSHPCNFLVFGL  847
              S     A P LSK++VRAL HYAS SNNT+RMSY DIKQI+DVLRQC   PCN LVFGL
Sbjct  59    VSSITASANPPLSKAVVRALTHYASNSNNTERMSYTDIKQIADVLRQC-QQPCNLLVFGL  117

Query  846   THETLLWRTLNHHGRTVFIDESRYYAAYVEEKYPEIEVYDVQYSTKLSEMKELISGVKEQ  667
             THETLLW+ LNH+GRTVFIDE+RYYAAY+EEKYPEIE YDVQY+TKLS+ KELI  VKEQ
Sbjct  118   THETLLWKALNHNGRTVFIDENRYYAAYIEEKYPEIEAYDVQYTTKLSDRKELIDAVKEQ  177

Query  666   ARNECRPVQNLLFSECKLGLNDLPNQLYEVDWDVILVDGPRGYWPEAPGRMSAIFTAGVL  487
              RNEC+PVQNLLFSECKLG+NDLPNQ YEV+WDVILVDGPRGYWPEAPGRMSAIFTAGVL
Sbjct  178   IRNECKPVQNLLFSECKLGINDLPNQFYEVNWDVILVDGPRGYWPEAPGRMSAIFTAGVL  237

Query  486   ARSKKGGNPKTHVLVHDYNQKSDRIASEEFLCRENLVETKGMVGHFVVEVMDANNFNFCR  307
             ARSKK GNPKTHV VHD++QK DR+ SEEFLC ENLV +K M+GHFV+  MD N++ FCR
Sbjct  238   ARSKKCGNPKTHVFVHDFDQKVDRVTSEEFLCIENLVNSKDMLGHFVIGRMDPNSYTFCR  297



>gb|EPS63094.1| hypothetical protein M569_11690, partial [Genlisea aurea]
Length=307

 Score =   403 bits (1035),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 184/236 (78%), Positives = 206/236 (87%), Gaps = 1/236 (0%)
 Frame = -3

Query  1014  GGGATPALSKSIVRALVHYASISNNTDRMSYADIKQISDVLRQCGSHPCNFLVFGLTHET  835
                A P LS ++ RAL+HYAS SN+TDRMS  DI+QI+D L+QC S PCNFLVFGLTHET
Sbjct  61    SAAAPPPLSSAVARALIHYASNSNSTDRMSLTDIRQIADALQQC-SRPCNFLVFGLTHET  119

Query  834   LLWRTLNHHGRTVFIDESRYYAAYVEEKYPEIEVYDVQYSTKLSEMKELISGVKEQARNE  655
             LLW+ LNH GRTVFIDE+RYYAAYVEEKYPEIE YDVQYSTKLS+M ELI  VK+Q+ NE
Sbjct  120   LLWKALNHDGRTVFIDENRYYAAYVEEKYPEIEAYDVQYSTKLSDMAELIESVKKQSGNE  179

Query  654   CRPVQNLLFSECKLGLNDLPNQLYEVDWDVILVDGPRGYWPEAPGRMSAIFTAGVLARSK  475
             CRPVQNLLFSECKLGLNDLPNQLYE+DWDVILVDGPRGYWPEAPGRM+AIFTAGVLARSK
Sbjct  180   CRPVQNLLFSECKLGLNDLPNQLYEMDWDVILVDGPRGYWPEAPGRMAAIFTAGVLARSK  239

Query  474   KGGNPKTHVLVHDYNQKSDRIASEEFLCRENLVETKGMVGHFVVEVMDANNFNFCR  307
             KGGNPKTHV VHD+N K DR+ S+EFLCRENLV++K  +GHFV+E MD+N   FCR
Sbjct  240   KGGNPKTHVFVHDFNMKQDRMTSDEFLCRENLVKSKDTMGHFVLERMDSNASEFCR  295



>emb|CDP02521.1| unnamed protein product [Coffea canephora]
Length=316

 Score =   394 bits (1012),  Expect = 4e-133, Method: Compositional matrix adjust.
 Identities = 182/229 (79%), Positives = 203/229 (89%), Gaps = 1/229 (0%)
 Frame = -3

Query  993  LSKSIVRALVHYASISNNTDRMSYADIKQISDVLRQCGSHPCNFLVFGLTHETLLWRTLN  814
            LS S+VRALVHYAS SNNTD MS+ DIKQISDVL++C S PCNFLVFGLT ETLLW+ LN
Sbjct  71   LSSSVVRALVHYASNSNNTDHMSHTDIKQISDVLQKCRS-PCNFLVFGLTPETLLWKALN  129

Query  813  HHGRTVFIDESRYYAAYVEEKYPEIEVYDVQYSTKLSEMKELISGVKEQARNECRPVQNL  634
            H+GRTVFIDE+RYYAAY+EEKYPE+E YDVQY+TK++E  ELI+ VKEQ  NECRPVQNL
Sbjct  130  HNGRTVFIDENRYYAAYIEEKYPEVEAYDVQYTTKITEANELIAAVKEQVMNECRPVQNL  189

Query  633  LFSECKLGLNDLPNQLYEVDWDVILVDGPRGYWPEAPGRMSAIFTAGVLARSKKGGNPKT  454
            LFSECKLGLNDLPNQ YEVDWDVILVDGPRGYWPEAPGRMSAIFTAGVLARSKKGGN KT
Sbjct  190  LFSECKLGLNDLPNQFYEVDWDVILVDGPRGYWPEAPGRMSAIFTAGVLARSKKGGNTKT  249

Query  453  HVLVHDYNQKSDRIASEEFLCRENLVETKGMVGHFVVEVMDANNFNFCR  307
            H+ VHD+NQK DR  S E+LC+ENLV++K M+GHFV+E  DAN F FCR
Sbjct  250  HIFVHDFNQKVDRTTSYEYLCKENLVKSKDMLGHFVLERADANVFQFCR  298



>ref|XP_002283187.1| PREDICTED: protein IRX15-LIKE [Vitis vinifera]
Length=310

 Score =   363 bits (933),  Expect = 4e-121, Method: Compositional matrix adjust.
 Identities = 170/231 (74%), Positives = 199/231 (86%), Gaps = 1/231 (0%)
 Frame = -3

Query  999  PALSKSIVRALVHYASISNNTDRMSYADIKQISDVLRQCGSHPCNFLVFGLTHETLLWRT  820
            P L+K +V ALVHYAS  N +  MS A++K ISDVLR+C S PCNFLVFGLT ETLLW+ 
Sbjct  67   PLLAKPVVDALVHYASNYNTSGHMSNAELKMISDVLRKC-SPPCNFLVFGLTLETLLWKA  125

Query  819  LNHHGRTVFIDESRYYAAYVEEKYPEIEVYDVQYSTKLSEMKELISGVKEQARNECRPVQ  640
            LNH+GRTVFIDE+RYYAAYVEEK+P IE YDVQY+TK+SEM +LI+ VKE  RNECRPVQ
Sbjct  126  LNHNGRTVFIDENRYYAAYVEEKHPGIEAYDVQYTTKISEMNDLIAYVKETIRNECRPVQ  185

Query  639  NLLFSECKLGLNDLPNQLYEVDWDVILVDGPRGYWPEAPGRMSAIFTAGVLARSKKGGNP  460
            NLLFS+CKLGLNDLPN  YE+DWDVIL+DGPR YWPEAPGRMS IFTAGVLARSKKGG+P
Sbjct  186  NLLFSDCKLGLNDLPNHAYELDWDVILIDGPREYWPEAPGRMSPIFTAGVLARSKKGGSP  245

Query  459  KTHVLVHDYNQKSDRIASEEFLCRENLVETKGMVGHFVVEVMDANNFNFCR  307
            KTHV VHD+N+K +R++S+EFLC+ENLVE++  +GHFVVE M+ N F FCR
Sbjct  246  KTHVFVHDFNRKVERVSSKEFLCKENLVESQDWLGHFVVERMEENVFQFCR  296



>ref|XP_010070598.1| PREDICTED: protein IRX15-LIKE-like [Eucalyptus grandis]
 gb|KCW59469.1| hypothetical protein EUGRSUZ_H02217 [Eucalyptus grandis]
Length=313

 Score =   357 bits (917),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 163/228 (71%), Positives = 193/228 (85%), Gaps = 1/228 (0%)
 Frame = -3

Query  993  LSKSIVRALVHYASISNNTDRMSYADIKQISDVLRQCGSHPCNFLVFGLTHETLLWRTLN  814
            L  +++  L+HYAS SN++ RMSY ++K ISDVLR+C S PCNFLVFGLTHET LW+ LN
Sbjct  75   LPSTVINTLLHYASKSNDSFRMSYPELKPISDVLRKCSS-PCNFLVFGLTHETFLWKALN  133

Query  813  HHGRTVFIDESRYYAAYVEEKYPEIEVYDVQYSTKLSEMKELISGVKEQARNECRPVQNL  634
            H+GRTVFIDE+RYYAAYVE+K+PEI+ YDVQY+TK+SEM+EL++  +EQ RNECRPVQNL
Sbjct  134  HNGRTVFIDENRYYAAYVEQKHPEIDAYDVQYTTKMSEMQELMTSTREQVRNECRPVQNL  193

Query  633  LFSECKLGLNDLPNQLYEVDWDVILVDGPRGYWPEAPGRMSAIFTAGVLARSKKGGNPKT  454
            LFSECKL +NDLPN  YEVDWDVILVDGPR  WP  PGRMSAIFTAGVLARSKKGGNPKT
Sbjct  194  LFSECKLAINDLPNHAYEVDWDVILVDGPREEWPNGPGRMSAIFTAGVLARSKKGGNPKT  253

Query  453  HVLVHDYNQKSDRIASEEFLCRENLVETKGMVGHFVVEVMDANNFNFC  310
            HV VHD+  + +R  SEEFLCRENLVE+   +GHFV+E MD ++F FC
Sbjct  254  HVFVHDFCGEVERAYSEEFLCRENLVESTEKLGHFVLERMDPSSFQFC  301



>ref|XP_010672415.1| PREDICTED: protein IRX15-LIKE-like [Beta vulgaris subsp. vulgaris]
Length=325

 Score =   357 bits (916),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 171/243 (70%), Positives = 194/243 (80%), Gaps = 5/243 (2%)
 Frame = -3

Query  1026  ASGGGGGATP--ALSKSIVRALVHYASISNNTDRMSYADIKQISDVLRQCGSHPCNFLVF  853
             A  GGG AT    L K ++  L+HY+S +N T++M  +DIK ISDVLR+C S PCNFLVF
Sbjct  77    AVMGGGHATAQYPLPKHVMNTLIHYSSNANTTEKMELSDIKSISDVLRRCPS-PCNFLVF  135

Query  852   GLTHETLLWRTLNHHGRTVFIDESRYYAAYVEEKYPEIEVYDVQYSTKLSEMKELISGVK  673
             GLTHETLLWR LN HGRT FIDE+RYYAAY+EEK+PEIE YDVQY+TKLS  KELIS VK
Sbjct  136   GLTHETLLWRALNTHGRTFFIDENRYYAAYMEEKHPEIEAYDVQYTTKLSNYKELISSVK  195

Query  672   EQARNECRPVQNLLFSECKLGLNDLPNQLYEVDWDVILVDGPRGYWPEAPGRMSAIFTAG  493
             EQA NEC+PVQNLLFSECKLG+NDLPNQ Y++DWD+ILVDGPRG+W  APGRMS IFTA 
Sbjct  196   EQAHNECKPVQNLLFSECKLGINDLPNQFYDIDWDLILVDGPRGHWDAAPGRMSTIFTAS  255

Query  492   VLARSKKGG--NPKTHVLVHDYNQKSDRIASEEFLCRENLVETKGMVGHFVVEVMDANNF  319
             VLARSKK      KTHV VHDYN    R+ASEEFLC+ENLVE  GM+ HFV+E MD N F
Sbjct  256   VLARSKKTSARTGKTHVFVHDYNLDPQRVASEEFLCKENLVENNGMLAHFVLERMDENCF  315

Query  318   NFC  310
              FC
Sbjct  316   QFC  318



>ref|XP_003517315.1| PREDICTED: protein IRREGULAR XYLEM 15-like [Glycine max]
 gb|KHN36252.1| hypothetical protein glysoja_003375 [Glycine soja]
Length=304

 Score =   356 bits (913),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 162/233 (70%), Positives = 195/233 (84%), Gaps = 1/233 (0%)
 Frame = -3

Query  1005  ATPALSKSIVRALVHYASISNNTDRMSYADIKQISDVLRQCGSHPCNFLVFGLTHETLLW  826
             A   L  +++  L+HYAS SN+T  M ++D+K ISDVLR+C S PCNFL+FGLTHETLLW
Sbjct  66    ANTPLPSTVINTLLHYASKSNDTFHMPHSDLKTISDVLRKCPS-PCNFLIFGLTHETLLW  124

Query  825   RTLNHHGRTVFIDESRYYAAYVEEKYPEIEVYDVQYSTKLSEMKELISGVKEQARNECRP  646
             + LNH+GRTVFIDE+RYYAAY EEK+PEI+ YDVQY+TK SE+KELI+  KEQ  NECRP
Sbjct  125   KALNHNGRTVFIDENRYYAAYFEEKHPEIDAYDVQYTTKRSELKELIASTKEQVGNECRP  184

Query  645   VQNLLFSECKLGLNDLPNQLYEVDWDVILVDGPRGYWPEAPGRMSAIFTAGVLARSKKGG  466
             VQNLLFSECKLGLNDLPN +YEVDWDVILVDGPRG WPEAPGRMS IFTAGVLARSKKGG
Sbjct  185   VQNLLFSECKLGLNDLPNHVYEVDWDVILVDGPRGDWPEAPGRMSPIFTAGVLARSKKGG  244

Query  465   NPKTHVLVHDYNQKSDRIASEEFLCRENLVETKGMVGHFVVEVMDANNFNFCR  307
             NPKTHV VHD++ K ++++  EFLC+ENLVE    +GH+V+E MD ++  +C+
Sbjct  245   NPKTHVFVHDFSGKVEKVSGNEFLCKENLVEATHSLGHYVLEKMDDSSVQYCK  297



>ref|XP_007156771.1| hypothetical protein PHAVU_002G016200g [Phaseolus vulgaris]
 gb|ESW28765.1| hypothetical protein PHAVU_002G016200g [Phaseolus vulgaris]
Length=361

 Score =   357 bits (915),  Expect = 9e-118, Method: Compositional matrix adjust.
 Identities = 166/232 (72%), Positives = 196/232 (84%), Gaps = 2/232 (1%)
 Frame = -3

Query  1002  TPALSKSIVRALVHYASISNNTDRMSYADIKQISDVLRQCGSHPCNFLVFGLTHETLLWR  823
             TP L  S++  L+HYAS SN+T  MS++D+K ISDVLR+C S PCNFLVFGLT ETLLW+
Sbjct  120   TP-LPSSVINTLLHYASKSNDTYHMSHSDLKTISDVLRKCPS-PCNFLVFGLTPETLLWK  177

Query  822   TLNHHGRTVFIDESRYYAAYVEEKYPEIEVYDVQYSTKLSEMKELISGVKEQARNECRPV  643
              LNH+GRTVFIDE+RYYAAY EEK+PEI+ YDVQY+TK SEMKELI+  KEQA NECRPV
Sbjct  178   ALNHNGRTVFIDENRYYAAYFEEKHPEIDAYDVQYTTKRSEMKELIASAKEQAGNECRPV  237

Query  642   QNLLFSECKLGLNDLPNQLYEVDWDVILVDGPRGYWPEAPGRMSAIFTAGVLARSKKGGN  463
             QNLLFSECKLGLNDLPN +YEVDWDVILVDGPRG WP+APGRMS IFTAGVLARSKK GN
Sbjct  238   QNLLFSECKLGLNDLPNHVYEVDWDVILVDGPRGDWPDAPGRMSPIFTAGVLARSKKSGN  297

Query  462   PKTHVLVHDYNQKSDRIASEEFLCRENLVETKGMVGHFVVEVMDANNFNFCR  307
             PKTHV VHD++ K +R+   EFLC+ENLVET   +GH+++E MD ++  +C+
Sbjct  298   PKTHVFVHDFSGKVERVCGNEFLCKENLVETTHSLGHYMLEKMDESSVKYCK  349



>ref|XP_010028217.1| PREDICTED: protein IRX15-LIKE-like [Eucalyptus grandis]
 gb|KCW54913.1| hypothetical protein EUGRSUZ_I00888 [Eucalyptus grandis]
Length=310

 Score =   355 bits (910),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 162/239 (68%), Positives = 196/239 (82%), Gaps = 1/239 (0%)
 Frame = -3

Query  1026  ASGGGGGATPALSKSIVRALVHYASISNNTDRMSYADIKQISDVLRQCGSHPCNFLVFGL  847
             +S         L  +++ AL+HYAS SN++  MS+ DIK ISDVLR+C + PCN LVFGL
Sbjct  66    SSSTTAATNEPLPTTVINALIHYASRSNDSYHMSHKDIKLISDVLRKCAT-PCNLLVFGL  124

Query  846   THETLLWRTLNHHGRTVFIDESRYYAAYVEEKYPEIEVYDVQYSTKLSEMKELISGVKEQ  667
             THETLLW+ LNH GRTVF+DE+RYYAAYVEE++PEI+ YDVQY+TK+SEM ELI+  KEQ
Sbjct  125   THETLLWKALNHGGRTVFVDENRYYAAYVEERHPEIDAYDVQYTTKMSEMMELIASAKEQ  184

Query  666   ARNECRPVQNLLFSECKLGLNDLPNQLYEVDWDVILVDGPRGYWPEAPGRMSAIFTAGVL  487
              R ECRPVQNLLFSEC+LG+NDLPN +YEV WDVILVDGPRG  P+APGRMSAIFTAGVL
Sbjct  185   VRGECRPVQNLLFSECRLGINDLPNHVYEVSWDVILVDGPRGDGPDAPGRMSAIFTAGVL  244

Query  486   ARSKKGGNPKTHVLVHDYNQKSDRIASEEFLCRENLVETKGMVGHFVVEVMDANNFNFC  310
             ARSKKGGNPKTHV++HDY +  ++I  +EFLCR N VE+  M+GHFV+E +DAN+F FC
Sbjct  245   ARSKKGGNPKTHVILHDYYRNVEKICGDEFLCRGNRVESTDMIGHFVLERVDANSFRFC  303



>ref|XP_008440308.1| PREDICTED: protein IRX15-LIKE [Cucumis melo]
Length=313

 Score =   353 bits (906),  Expect = 4e-117, Method: Compositional matrix adjust.
 Identities = 161/232 (69%), Positives = 200/232 (86%), Gaps = 2/232 (1%)
 Frame = -3

Query  1005  ATPALSKSIVRALVHYASISNNTDRMSYADIKQISDVLRQCGSHPCNFLVFGLTHETLLW  826
             ATP L  +++  L++YAS SN++  M+++++K ISDVLR+C S PCNFL+FGLT ETLLW
Sbjct  76    ATP-LPTTVINTLLYYASKSNDSFHMTHSELKPISDVLRKC-STPCNFLIFGLTQETLLW  133

Query  825   RTLNHHGRTVFIDESRYYAAYVEEKYPEIEVYDVQYSTKLSEMKELISGVKEQARNECRP  646
             ++LNH+GRTVFIDE+RYYAA++EEK+PEI+ YDVQY+TK+SE+ ELI+ V+EQ RNECRP
Sbjct  134   KSLNHNGRTVFIDENRYYAAFIEEKHPEIDAYDVQYTTKISELNELITTVREQIRNECRP  193

Query  645   VQNLLFSECKLGLNDLPNQLYEVDWDVILVDGPRGYWPEAPGRMSAIFTAGVLARSKKGG  466
             VQNLLFSEC+LGLNDLPN +Y+VDWDVILVDGPRG WP+APGRMSAI+TAGVLARSKKGG
Sbjct  194   VQNLLFSECRLGLNDLPNHVYDVDWDVILVDGPRGDWPDAPGRMSAIYTAGVLARSKKGG  253

Query  465   NPKTHVLVHDYNQKSDRIASEEFLCRENLVETKGMVGHFVVEVMDANNFNFC  310
             NPKTHV VHDY  + +++ S+EFLC ENLVE    +GH+VVE MD N F FC
Sbjct  254   NPKTHVFVHDYYGEVEKVCSDEFLCSENLVEASHTLGHYVVEKMDENCFQFC  305



>ref|NP_001241343.1| uncharacterized protein LOC100817866 [Glycine max]
 gb|ACU18196.1| unknown [Glycine max]
Length=308

 Score =   352 bits (902),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 160/229 (70%), Positives = 194/229 (85%), Gaps = 1/229 (0%)
 Frame = -3

Query  993  LSKSIVRALVHYASISNNTDRMSYADIKQISDVLRQCGSHPCNFLVFGLTHETLLWRTLN  814
            LS +++  L+HYAS SN+T  M ++D+K ISD+LR+C S PCNFLVFGLTHETLLW+ LN
Sbjct  70   LSSTVINTLLHYASKSNDTFHMPHSDLKTISDMLRKCPS-PCNFLVFGLTHETLLWKALN  128

Query  813  HHGRTVFIDESRYYAAYVEEKYPEIEVYDVQYSTKLSEMKELISGVKEQARNECRPVQNL  634
            H+GRTVFIDE+RYYAAY EEK+PEI+ YDV Y+TK SE+KELI+  KEQ  NECRPVQNL
Sbjct  129  HNGRTVFIDENRYYAAYFEEKHPEIDAYDVAYTTKRSELKELIASAKEQVGNECRPVQNL  188

Query  633  LFSECKLGLNDLPNQLYEVDWDVILVDGPRGYWPEAPGRMSAIFTAGVLARSKKGGNPKT  454
            LFSECKLGLNDLPN +YEVDWDVILVDGPRG WP+APGRMS IFTAGVLARSKKGGNPKT
Sbjct  189  LFSECKLGLNDLPNHVYEVDWDVILVDGPRGDWPDAPGRMSPIFTAGVLARSKKGGNPKT  248

Query  453  HVLVHDYNQKSDRIASEEFLCRENLVETKGMVGHFVVEVMDANNFNFCR  307
            HV VHD++ K ++++  EFLC+ENLVE    +GH+V+E MD ++  +C+
Sbjct  249  HVFVHDFSGKVEKVSGNEFLCKENLVEATHSLGHYVLEKMDESSVQYCK  297



>ref|XP_010263448.1| PREDICTED: protein IRX15-LIKE-like [Nelumbo nucifera]
Length=312

 Score =   352 bits (902),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 160/229 (70%), Positives = 196/229 (86%), Gaps = 1/229 (0%)
 Frame = -3

Query  993  LSKSIVRALVHYASISNNTDRMSYADIKQISDVLRQCGSHPCNFLVFGLTHETLLWRTLN  814
            L KS+  AL+HYASISN T RMS A++K I+DVL++C S PCNFLVFGLT ETLLW+ LN
Sbjct  73   LPKSVADALLHYASISNVTGRMSDAELKMITDVLQRCPS-PCNFLVFGLTPETLLWKALN  131

Query  813  HHGRTVFIDESRYYAAYVEEKYPEIEVYDVQYSTKLSEMKELISGVKEQARNECRPVQNL  634
            H+GRTVF+DES YY A  EEK+P++E YDVQY+TK+S+MK+LI+  +EQ  NECRPVQNL
Sbjct  132  HYGRTVFLDESEYYIAKFEEKHPDMEAYDVQYTTKVSQMKDLIASAREQLHNECRPVQNL  191

Query  633  LFSECKLGLNDLPNQLYEVDWDVILVDGPRGYWPEAPGRMSAIFTAGVLARSKKGGNPKT  454
            LFS+CKLG+NDLPN LYEV WDVILVDGPRGY+P APGRMSAIFT+GVLARSK+ G+ KT
Sbjct  192  LFSDCKLGINDLPNHLYEVAWDVILVDGPRGYYPSAPGRMSAIFTSGVLARSKRSGDRKT  251

Query  453  HVLVHDYNQKSDRIASEEFLCRENLVETKGMVGHFVVEVMDANNFNFCR  307
            HV VHD+N++ +R+ S+EFLC+ENLVE+K ++GHFV+E MDA  F FCR
Sbjct  252  HVFVHDFNREVERVCSDEFLCKENLVESKDLLGHFVLERMDAKTFQFCR  300



>ref|XP_011008784.1| PREDICTED: protein IRX15-LIKE-like [Populus euphratica]
Length=311

 Score =   351 bits (900),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 161/240 (67%), Positives = 194/240 (81%), Gaps = 1/240 (0%)
 Frame = -3

Query  1026  ASGGGGGATPALSKSIVRALVHYASISNNTDRMSYADIKQISDVLRQCGSHPCNFLVFGL  847
             AS    G    L  +++  L+HYAS SN++  MS+A+IK ISDVLR+C S PCNFLVFGL
Sbjct  65    ASSSTFGNNAPLPTTVINTLLHYASRSNDSFHMSHAEIKPISDVLRKCSS-PCNFLVFGL  123

Query  846   THETLLWRTLNHHGRTVFIDESRYYAAYVEEKYPEIEVYDVQYSTKLSEMKELISGVKEQ  667
             THET LW+ LNH+GRTVFI+E+RYYAAY EE +PEI+V+DVQY+TK+ EM+ELI+  KEQ
Sbjct  124   THETPLWKALNHNGRTVFIEENRYYAAYYEELHPEIDVFDVQYTTKMKEMRELIASTKEQ  183

Query  666   ARNECRPVQNLLFSECKLGLNDLPNQLYEVDWDVILVDGPRGYWPEAPGRMSAIFTAGVL  487
              +NECRPVQNLLFSECKLG+NDLPN +YEVDWDVIL+DGPRG  PE PGRM+ IFT+GVL
Sbjct  184   IKNECRPVQNLLFSECKLGINDLPNHVYEVDWDVILIDGPRGDGPEGPGRMTPIFTSGVL  243

Query  486   ARSKKGGNPKTHVLVHDYNQKSDRIASEEFLCRENLVETKGMVGHFVVEVMDANNFNFCR  307
             ARSKK  N KTH+ VHDY +  +RI  +EFLCRENLVE+  M+ HFVVE MD N+F FCR
Sbjct  244   ARSKKASNAKTHIFVHDYYRNVERIYGDEFLCRENLVESNDMLAHFVVEKMDENSFQFCR  303



>ref|XP_002306483.1| hypothetical protein POPTR_0005s18480g [Populus trichocarpa]
 gb|EEE93479.1| hypothetical protein POPTR_0005s18480g [Populus trichocarpa]
Length=311

 Score =   351 bits (900),  Expect = 4e-116, Method: Compositional matrix adjust.
 Identities = 161/240 (67%), Positives = 194/240 (81%), Gaps = 1/240 (0%)
 Frame = -3

Query  1026  ASGGGGGATPALSKSIVRALVHYASISNNTDRMSYADIKQISDVLRQCGSHPCNFLVFGL  847
             AS    G    L  +++  L+HYAS SN++  MS+A+IK ISDVLR+C S PCNFLVFGL
Sbjct  65    ASSSTFGNNAPLPTTVINTLLHYASRSNDSFHMSHAEIKPISDVLRKCSS-PCNFLVFGL  123

Query  846   THETLLWRTLNHHGRTVFIDESRYYAAYVEEKYPEIEVYDVQYSTKLSEMKELISGVKEQ  667
             THET LW+ LNH+GRTVFI+E+RYYAAY EE +PEI+V+DVQY+TK+ EM+ELI+  KEQ
Sbjct  124   THETPLWKALNHNGRTVFIEENRYYAAYYEELHPEIDVFDVQYTTKMKEMRELIASTKEQ  183

Query  666   ARNECRPVQNLLFSECKLGLNDLPNQLYEVDWDVILVDGPRGYWPEAPGRMSAIFTAGVL  487
              +NECRPVQNLLFSECKLG+NDLPN +YEVDWDVIL+DGPRG  PE PGRM+ IFT+GVL
Sbjct  184   IKNECRPVQNLLFSECKLGINDLPNHVYEVDWDVILIDGPRGDGPEGPGRMTPIFTSGVL  243

Query  486   ARSKKGGNPKTHVLVHDYNQKSDRIASEEFLCRENLVETKGMVGHFVVEVMDANNFNFCR  307
             ARSKK  N KTH+ VHDY +  +RI  +EFLCRENLVE+  M+ HFVVE MD N+F FCR
Sbjct  244   ARSKKASNAKTHIFVHDYYRNVERIYGDEFLCRENLVESNDMLAHFVVEKMDENSFQFCR  303



>ref|XP_003524627.1| PREDICTED: protein IRX15-like [Glycine max]
 gb|KHN04163.1| hypothetical protein glysoja_050051 [Glycine soja]
Length=316

 Score =   351 bits (900),  Expect = 4e-116, Method: Compositional matrix adjust.
 Identities = 161/239 (67%), Positives = 195/239 (82%), Gaps = 4/239 (2%)
 Frame = -3

Query  1023  SGGGGGATPALSKSIVRALVHYASISNNTDRMSYADIKQISDVLRQCGSHPCNFLVFGLT  844
             SG G    PA   +++  L+HYAS SN+T  M ++D+K ISDVLR+C S PCNFL+FGLT
Sbjct  69    SGFGSAPLPA---TVINTLLHYASKSNDTFHMPHSDLKPISDVLRKCSS-PCNFLIFGLT  124

Query  843   HETLLWRTLNHHGRTVFIDESRYYAAYVEEKYPEIEVYDVQYSTKLSEMKELISGVKEQA  664
              ETLLW+ LNH+GRTVFIDE+RYYAAY EE +PEI+ YDVQY+TK SEMKELI+  KEQ 
Sbjct  125   PETLLWKALNHNGRTVFIDENRYYAAYYEELHPEIDAYDVQYTTKRSEMKELIASAKEQV  184

Query  663   RNECRPVQNLLFSECKLGLNDLPNQLYEVDWDVILVDGPRGYWPEAPGRMSAIFTAGVLA  484
              NEC+PVQNLLFSECKLGLNDLPN +YEVDWDVILVDGPRG WP+APGRMSAIFT GVLA
Sbjct  185   ANECKPVQNLLFSECKLGLNDLPNHVYEVDWDVILVDGPRGDWPDAPGRMSAIFTVGVLA  244

Query  483   RSKKGGNPKTHVLVHDYNQKSDRIASEEFLCRENLVETKGMVGHFVVEVMDANNFNFCR  307
             RSKKGGNPKTHV +HD++ + +++   EFLC ENL+E  G +GH+V+E MD N+  +C+
Sbjct  245   RSKKGGNPKTHVFLHDFSGEVEKVCGSEFLCNENLLEANGNLGHYVLERMDENSVQYCK  303



>ref|XP_004288008.1| PREDICTED: protein IRX15-like [Fragaria vesca subsp. vesca]
Length=327

 Score =   351 bits (901),  Expect = 4e-116, Method: Compositional matrix adjust.
 Identities = 158/229 (69%), Positives = 193/229 (84%), Gaps = 1/229 (0%)
 Frame = -3

Query  993  LSKSIVRALVHYASISNNTDRMSYADIKQISDVLRQCGSHPCNFLVFGLTHETLLWRTLN  814
            +  +++  L+HYAS SN+T +MSY++IK ISDVLR+C S PCNFL+FGLTHETLLW+ LN
Sbjct  74   MPTTVINTLLHYASKSNDTFKMSYSEIKPISDVLRKCSS-PCNFLIFGLTHETLLWKALN  132

Query  813  HHGRTVFIDESRYYAAYVEEKYPEIEVYDVQYSTKLSEMKELISGVKEQARNECRPVQNL  634
            H+GRTVFIDE+RYYAAY+EEK+PEI+ YDVQY+TK  EM ELI   KEQ RNECRPVQNL
Sbjct  133  HNGRTVFIDENRYYAAYIEEKHPEIDAYDVQYTTKTKEMTELIKVAKEQIRNECRPVQNL  192

Query  633  LFSECKLGLNDLPNQLYEVDWDVILVDGPRGYWPEAPGRMSAIFTAGVLARSKKGGNPKT  454
            LFSECKLG+NDLPN +YEVDWDVIL+DGPRG WP++PGR+S IFT+GVLARSKKGG+ KT
Sbjct  193  LFSECKLGINDLPNHVYEVDWDVILIDGPRGDWPDSPGRISPIFTSGVLARSKKGGSGKT  252

Query  453  HVLVHDYNQKSDRIASEEFLCRENLVETKGMVGHFVVEVMDANNFNFCR  307
            HV VHD+ +  +R+  +EFLCRENLVE    +GH+VVE M+  +F FCR
Sbjct  253  HVFVHDFRRNVERVCGDEFLCRENLVEESETLGHYVVERMEETSFQFCR  301



>ref|XP_004142003.1| PREDICTED: uncharacterized protein LOC101217122 [Cucumis sativus]
 ref|XP_004169903.1| PREDICTED: uncharacterized LOC101217122 [Cucumis sativus]
 gb|KGN48544.1| hypothetical protein Csa_6G491070 [Cucumis sativus]
Length=310

 Score =   349 bits (896),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 155/225 (69%), Positives = 196/225 (87%), Gaps = 1/225 (0%)
 Frame = -3

Query  984  SIVRALVHYASISNNTDRMSYADIKQISDVLRQCGSHPCNFLVFGLTHETLLWRTLNHHG  805
            +++  L++YAS SN++  M+++++K ISDVLR+C + PCNFL+FGLT ETLLW++LNH+G
Sbjct  79   TVINTLLYYASKSNDSFHMTHSELKPISDVLRKCST-PCNFLIFGLTQETLLWKSLNHNG  137

Query  804  RTVFIDESRYYAAYVEEKYPEIEVYDVQYSTKLSEMKELISGVKEQARNECRPVQNLLFS  625
            RTVFIDE+RYYAA++EEK+PEI+ YDVQY+TK+SE+ ELI+ V+EQ RNECRPVQNLLFS
Sbjct  138  RTVFIDENRYYAAFIEEKHPEIDAYDVQYTTKISELNELITTVREQIRNECRPVQNLLFS  197

Query  624  ECKLGLNDLPNQLYEVDWDVILVDGPRGYWPEAPGRMSAIFTAGVLARSKKGGNPKTHVL  445
            EC+LGLNDLPN +Y+VDWDVILVDGPRG WP+APGRMSAI+TAGVLARSKKGGNPKTH+ 
Sbjct  198  ECRLGLNDLPNHVYDVDWDVILVDGPRGDWPDAPGRMSAIYTAGVLARSKKGGNPKTHIF  257

Query  444  VHDYNQKSDRIASEEFLCRENLVETKGMVGHFVVEVMDANNFNFC  310
            VHDY  + +++ S+EFLC ENLVE    +GH+VVE MD N F FC
Sbjct  258  VHDYYGEVEKVCSDEFLCSENLVEASHTLGHYVVEKMDENCFQFC  302



>ref|XP_008238947.1| PREDICTED: protein IRX15-LIKE [Prunus mume]
Length=317

 Score =   349 bits (896),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 159/231 (69%), Positives = 194/231 (84%), Gaps = 1/231 (0%)
 Frame = -3

Query  999  PALSKSIVRALVHYASISNNTDRMSYADIKQISDVLRQCGSHPCNFLVFGLTHETLLWRT  820
            P L  +++  L++YA+ SN+T +MSYADIK ISD LR+C S PCNFL+FGLTHETLLW+ 
Sbjct  75   PQLPTTVINTLLYYAAKSNDTFKMSYADIKPISDALRKC-STPCNFLIFGLTHETLLWKA  133

Query  819  LNHHGRTVFIDESRYYAAYVEEKYPEIEVYDVQYSTKLSEMKELISGVKEQARNECRPVQ  640
            LN++GRTVFIDE+RY+AAY+EEK+PEI+ YDVQY+TK  E+KEL++  KEQ RNECRPVQ
Sbjct  134  LNNNGRTVFIDENRYFAAYMEEKHPEIDAYDVQYTTKSKELKELVAVAKEQIRNECRPVQ  193

Query  639  NLLFSECKLGLNDLPNQLYEVDWDVILVDGPRGYWPEAPGRMSAIFTAGVLARSKKGGNP  460
            NLLFSECKLG+NDLPN +YEVDWDVILVDGPRG WP+APGR+  IFT+GVLARSKKGGN 
Sbjct  194  NLLFSECKLGINDLPNHVYEVDWDVILVDGPRGDWPDAPGRVMPIFTSGVLARSKKGGNG  253

Query  459  KTHVLVHDYNQKSDRIASEEFLCRENLVETKGMVGHFVVEVMDANNFNFCR  307
            KTHV VHD+  +  R+  EEFLCRENLVE    +GH+VVE M+ ++F FCR
Sbjct  254  KTHVFVHDFGGEVQRVCGEEFLCRENLVEASETLGHYVVERMEESSFQFCR  304



>ref|XP_010270730.1| PREDICTED: protein IRX15-LIKE-like [Nelumbo nucifera]
Length=322

 Score =   348 bits (894),  Expect = 4e-115, Method: Compositional matrix adjust.
 Identities = 158/230 (69%), Positives = 193/230 (84%), Gaps = 1/230 (0%)
 Frame = -3

Query  999  PALSKSIVRALVHYASISNNTDRMSYADIKQISDVLRQCGSHPCNFLVFGLTHETLLWRT  820
            P L KS+  AL+HY S SN T RMS A++K I+DVL++C + PCNFLVFGLTHETLLW+ 
Sbjct  70   PQLPKSVADALLHYTSNSNATGRMSDAELKSIADVLQRCPT-PCNFLVFGLTHETLLWKA  128

Query  819  LNHHGRTVFIDESRYYAAYVEEKYPEIEVYDVQYSTKLSEMKELISGVKEQARNECRPVQ  640
            LNH+GRTVF+DES YY    EEK+P++E YD+QY+TK+S+MKELI+  +EQ  NECRPVQ
Sbjct  129  LNHNGRTVFLDESEYYIVKFEEKHPDMEAYDIQYTTKVSQMKELIASAREQLHNECRPVQ  188

Query  639  NLLFSECKLGLNDLPNQLYEVDWDVILVDGPRGYWPEAPGRMSAIFTAGVLARSKKGGNP  460
            NLLFS+CKLG+NDLPN LYEV+WDVILVDGPRGY P APGRMSAIFTAGVLARSK+ G+P
Sbjct  189  NLLFSDCKLGINDLPNHLYEVNWDVILVDGPRGYHPSAPGRMSAIFTAGVLARSKRSGDP  248

Query  459  KTHVLVHDYNQKSDRIASEEFLCRENLVETKGMVGHFVVEVMDANNFNFC  310
            KTHV VHD+N++ +R+ S EFLC+ENLVE+K ++GHFV+E MD   F FC
Sbjct  249  KTHVYVHDFNREVERVCSNEFLCKENLVESKDLLGHFVLERMDPKTFRFC  298



>ref|XP_007155898.1| hypothetical protein PHAVU_003G241300g [Phaseolus vulgaris]
 gb|ESW27892.1| hypothetical protein PHAVU_003G241300g [Phaseolus vulgaris]
Length=315

 Score =   348 bits (894),  Expect = 4e-115, Method: Compositional matrix adjust.
 Identities = 160/240 (67%), Positives = 196/240 (82%), Gaps = 2/240 (1%)
 Frame = -3

Query  1026  ASGGGGGATPALSKSIVRALVHYASISNNTDRMSYADIKQISDVLRQCGSHPCNFLVFGL  847
             A   G G  P L  +++  L+HYAS SN+T+ M ++D+K ISDVLR+C S PCN L+FGL
Sbjct  65    APVSGLGIAP-LPPTVINTLLHYASKSNDTNHMPHSDLKPISDVLRKCSS-PCNLLIFGL  122

Query  846   THETLLWRTLNHHGRTVFIDESRYYAAYVEEKYPEIEVYDVQYSTKLSEMKELISGVKEQ  667
             T ETLLW+ LNH+GRTVFIDE+RYYAAY EE +PEI+ YDVQY+TK SEMKELI+ VKE+
Sbjct  123   TSETLLWKALNHYGRTVFIDENRYYAAYYEELHPEIDAYDVQYTTKRSEMKELITSVKER  182

Query  666   ARNECRPVQNLLFSECKLGLNDLPNQLYEVDWDVILVDGPRGYWPEAPGRMSAIFTAGVL  487
               NEC+PVQNLLFS+CKLGLNDLPN +Y+VDWDVILVDGPRG WP+APGRMSAIFTAGVL
Sbjct  183   VANECKPVQNLLFSDCKLGLNDLPNHVYDVDWDVILVDGPRGDWPDAPGRMSAIFTAGVL  242

Query  486   ARSKKGGNPKTHVLVHDYNQKSDRIASEEFLCRENLVETKGMVGHFVVEVMDANNFNFCR  307
             ARSKKGGNPKTHV VHD++ + +++   EFLC ENLVE    +GH+VVE MD ++  +C+
Sbjct  243   ARSKKGGNPKTHVFVHDFSGEVEKVCGSEFLCSENLVEASESLGHYVVERMDESSVQYCK  302



>ref|XP_006494477.1| PREDICTED: protein IRX15-like [Citrus sinensis]
Length=318

 Score =   348 bits (893),  Expect = 5e-115, Method: Compositional matrix adjust.
 Identities = 157/239 (66%), Positives = 196/239 (82%), Gaps = 1/239 (0%)
 Frame = -3

Query  1026  ASGGGGGATPALSKSIVRALVHYASISNNTDRMSYADIKQISDVLRQCGSHPCNFLVFGL  847
             +S   G   P L  +++  L+ YAS SN++  M+++++K+ISDV+R+C S PCNFLVFGL
Sbjct  68    SSVSAGFGNPPLPTTVINTLLLYASRSNDSYHMTHSELKRISDVIRKCSS-PCNFLVFGL  126

Query  846   THETLLWRTLNHHGRTVFIDESRYYAAYVEEKYPEIEVYDVQYSTKLSEMKELISGVKEQ  667
             T ETLLW+ LNH+GRTVFIDE+RYYAAY EE +PEI+V+DVQY+TK+ E KELI+  KEQ
Sbjct  127   TQETLLWKALNHNGRTVFIDENRYYAAYFEELHPEIDVFDVQYTTKIRETKELIASAKEQ  186

Query  666   ARNECRPVQNLLFSECKLGLNDLPNQLYEVDWDVILVDGPRGYWPEAPGRMSAIFTAGVL  487
              RNEC+PVQNLLFSECKLG+NDLPN +YEVDWDVIL+DGPRG  P+ PGRMS IFTAGVL
Sbjct  187   IRNECKPVQNLLFSECKLGINDLPNHVYEVDWDVILIDGPRGDGPDGPGRMSPIFTAGVL  246

Query  486   ARSKKGGNPKTHVLVHDYNQKSDRIASEEFLCRENLVETKGMVGHFVVEVMDANNFNFC  310
             ARSKKGGNPKTH+ VHDY ++ +R+  +EFLC+ENLVE   M+ HFV+E MD N+F FC
Sbjct  247   ARSKKGGNPKTHIFVHDYYRRVERMCGDEFLCKENLVEFNDMLAHFVLEKMDENSFEFC  305



>ref|XP_007205581.1| hypothetical protein PRUPE_ppa008835mg [Prunus persica]
 gb|EMJ06780.1| hypothetical protein PRUPE_ppa008835mg [Prunus persica]
Length=317

 Score =   348 bits (893),  Expect = 5e-115, Method: Compositional matrix adjust.
 Identities = 158/231 (68%), Positives = 194/231 (84%), Gaps = 1/231 (0%)
 Frame = -3

Query  999  PALSKSIVRALVHYASISNNTDRMSYADIKQISDVLRQCGSHPCNFLVFGLTHETLLWRT  820
            P L  +++  L++Y++ SN+T +MSYADIK ISD LR+C S PCNFL+FGLTHETLLW+ 
Sbjct  75   PQLPTTVINTLLYYSAKSNDTFKMSYADIKPISDALRKC-STPCNFLIFGLTHETLLWKA  133

Query  819  LNHHGRTVFIDESRYYAAYVEEKYPEIEVYDVQYSTKLSEMKELISGVKEQARNECRPVQ  640
            LN++GRTVFIDE+RY+AAY+EEK+PEI+ YDVQY+TK  E+KEL++  KEQ RNECRPVQ
Sbjct  134  LNNNGRTVFIDENRYFAAYMEEKHPEIDAYDVQYTTKSKELKELVAVAKEQIRNECRPVQ  193

Query  639  NLLFSECKLGLNDLPNQLYEVDWDVILVDGPRGYWPEAPGRMSAIFTAGVLARSKKGGNP  460
            NLLFSECKLG+NDLPN +YEVDWDVILVDGPRG WP+APGR+  IFT+GVLARSKKGGN 
Sbjct  194  NLLFSECKLGINDLPNHVYEVDWDVILVDGPRGDWPDAPGRVMPIFTSGVLARSKKGGNG  253

Query  459  KTHVLVHDYNQKSDRIASEEFLCRENLVETKGMVGHFVVEVMDANNFNFCR  307
            KTHV VHD+  +  R+  EEFLCRENLVE    +GH+VVE M+ ++F FCR
Sbjct  254  KTHVFVHDFGGEVQRVCGEEFLCRENLVEASETLGHYVVERMEESSFQFCR  304



>gb|KHN42103.1| hypothetical protein glysoja_003843 [Glycine soja]
Length=345

 Score =   348 bits (892),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 159/227 (70%), Positives = 192/227 (85%), Gaps = 1/227 (0%)
 Frame = -3

Query  993  LSKSIVRALVHYASISNNTDRMSYADIKQISDVLRQCGSHPCNFLVFGLTHETLLWRTLN  814
            LS +++  L+HYAS SN+T  M ++D+K ISD+LR+C S PCNFLVFGLTHETLLW+ LN
Sbjct  70   LSSTVINTLLHYASKSNDTFHMPHSDLKTISDMLRKCPS-PCNFLVFGLTHETLLWKALN  128

Query  813  HHGRTVFIDESRYYAAYVEEKYPEIEVYDVQYSTKLSEMKELISGVKEQARNECRPVQNL  634
            H+GRTVFIDE+RYYAAY EEK+PEI+ YDV Y+TK SE+KELI+  KEQ  NECRPVQNL
Sbjct  129  HNGRTVFIDENRYYAAYFEEKHPEIDAYDVAYTTKRSELKELIASAKEQVGNECRPVQNL  188

Query  633  LFSECKLGLNDLPNQLYEVDWDVILVDGPRGYWPEAPGRMSAIFTAGVLARSKKGGNPKT  454
            LFSECKLGLNDLPN +YEVDWDVILVDGPRG WP+APGRMS IFTAGVLARSKKGGNPKT
Sbjct  189  LFSECKLGLNDLPNHVYEVDWDVILVDGPRGDWPDAPGRMSPIFTAGVLARSKKGGNPKT  248

Query  453  HVLVHDYNQKSDRIASEEFLCRENLVETKGMVGHFVVEVMDANNFNF  313
            HV VHD++ K ++++  EFLC+ENLVE    +GH+V+E MD ++  +
Sbjct  249  HVFVHDFSGKVEKVSGNEFLCKENLVEATHSLGHYVLEKMDESSVQY  295



>gb|KDO79100.1| hypothetical protein CISIN_1g021017mg [Citrus sinensis]
Length=318

 Score =   347 bits (889),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 157/239 (66%), Positives = 195/239 (82%), Gaps = 1/239 (0%)
 Frame = -3

Query  1026  ASGGGGGATPALSKSIVRALVHYASISNNTDRMSYADIKQISDVLRQCGSHPCNFLVFGL  847
             +S   G   P L  +++  L+ YAS SN++  M+++++K+ISDV+R+C S PCNFLVFGL
Sbjct  68    SSVSAGFGNPPLPTTVINTLLLYASRSNDSYHMTHSELKRISDVIRKCSS-PCNFLVFGL  126

Query  846   THETLLWRTLNHHGRTVFIDESRYYAAYVEEKYPEIEVYDVQYSTKLSEMKELISGVKEQ  667
             T ETLLW+ LNH+GRTVFIDE+RYYAAY EE +PEI+V+DVQY+TK+ E KELI+  KEQ
Sbjct  127   TQETLLWKALNHNGRTVFIDENRYYAAYFEELHPEIDVFDVQYTTKIRETKELIASAKEQ  186

Query  666   ARNECRPVQNLLFSECKLGLNDLPNQLYEVDWDVILVDGPRGYWPEAPGRMSAIFTAGVL  487
              RNEC+PVQNLLFSECKLG+NDLPN +YEVDWDVIL+DGPRG  P+ PGRMS IFTAGVL
Sbjct  187   IRNECKPVQNLLFSECKLGINDLPNHVYEVDWDVILIDGPRGDGPDGPGRMSPIFTAGVL  246

Query  486   ARSKKGGNPKTHVLVHDYNQKSDRIASEEFLCRENLVETKGMVGHFVVEVMDANNFNFC  310
             ARSKKGGNPKTH+ VHDY +  +R+  +EFLC+ENLVE   M+ HFV+E MD N+F FC
Sbjct  247   ARSKKGGNPKTHIFVHDYYRHVERMCGDEFLCKENLVEFNDMLAHFVLEKMDENSFEFC  305



>ref|XP_011005802.1| PREDICTED: protein IRX15-LIKE-like [Populus euphratica]
Length=315

 Score =   346 bits (888),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 159/240 (66%), Positives = 195/240 (81%), Gaps = 1/240 (0%)
 Frame = -3

Query  1026  ASGGGGGATPALSKSIVRALVHYASISNNTDRMSYADIKQISDVLRQCGSHPCNFLVFGL  847
             +S   G     L  S++  L+HYAS SN++  MS+A+IK ISDVLR+C S PCNFLVFGL
Sbjct  69    SSSTFGNINVPLPTSVINTLLHYASRSNDSFHMSHAEIKPISDVLRKCSS-PCNFLVFGL  127

Query  846   THETLLWRTLNHHGRTVFIDESRYYAAYVEEKYPEIEVYDVQYSTKLSEMKELISGVKEQ  667
             THETLLW+ LNH+GRTVFI+E+RYYAAY EE +PEI+V+DVQY+TK+ EM+ELI+  K+Q
Sbjct  128   THETLLWKALNHNGRTVFIEENRYYAAYYEELHPEIDVFDVQYTTKMKEMRELIASTKKQ  187

Query  666   ARNECRPVQNLLFSECKLGLNDLPNQLYEVDWDVILVDGPRGYWPEAPGRMSAIFTAGVL  487
              +NECRPVQNLLFSECKLG+NDLPN +YEVDWDVILVDGPRG  P+ PGRM+ IFTAGVL
Sbjct  188   IKNECRPVQNLLFSECKLGINDLPNHVYEVDWDVILVDGPRGDGPDGPGRMTPIFTAGVL  247

Query  486   ARSKKGGNPKTHVLVHDYNQKSDRIASEEFLCRENLVETKGMVGHFVVEVMDANNFNFCR  307
             ARS+K  N KTH+ VHDY +  +RI  +EFLC ENLVE+  M+ HF+VE MD N+F+FCR
Sbjct  248   ARSRKASNAKTHIFVHDYYRNVERIYGDEFLCGENLVESNDMLAHFIVEKMDENSFHFCR  307



>ref|XP_002310711.2| hypothetical protein POPTR_0007s10710g [Populus trichocarpa]
 gb|EEE91161.2| hypothetical protein POPTR_0007s10710g [Populus trichocarpa]
Length=318

 Score =   346 bits (888),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 157/240 (65%), Positives = 195/240 (81%), Gaps = 1/240 (0%)
 Frame = -3

Query  1026  ASGGGGGATPALSKSIVRALVHYASISNNTDRMSYADIKQISDVLRQCGSHPCNFLVFGL  847
             +S   G     L  S++  L+HYAS SN++  MS+A+IK ISDVLR+C S PCNFLVFGL
Sbjct  72    SSSTFGNINAPLPTSVINTLLHYASRSNDSFHMSHAEIKPISDVLRKCSS-PCNFLVFGL  130

Query  846   THETLLWRTLNHHGRTVFIDESRYYAAYVEEKYPEIEVYDVQYSTKLSEMKELISGVKEQ  667
             THETLLW+ LNH+GRTVFI+E+RYYAAY EE +PEI+V+DVQY+TK+ EM+ELI+   +Q
Sbjct  131   THETLLWKALNHNGRTVFIEENRYYAAYYEELHPEIDVFDVQYTTKMKEMRELIASTNKQ  190

Query  666   ARNECRPVQNLLFSECKLGLNDLPNQLYEVDWDVILVDGPRGYWPEAPGRMSAIFTAGVL  487
              +NECRPVQNLLFSECKLG+NDLPN +YEVDWD+ILVDGPRG  P+ PGRM+ IFTAGVL
Sbjct  191   IKNECRPVQNLLFSECKLGINDLPNHVYEVDWDLILVDGPRGDGPDGPGRMTPIFTAGVL  250

Query  486   ARSKKGGNPKTHVLVHDYNQKSDRIASEEFLCRENLVETKGMVGHFVVEVMDANNFNFCR  307
             ARS+K  N KTH+ VHDY +  ++I  +EFLCRENLVE+  M+ HF+VE MD N+F+FCR
Sbjct  251   ARSRKASNAKTHIFVHDYYRNVEKIYGDEFLCRENLVESNDMLAHFIVEKMDENSFHFCR  310



>ref|XP_003550048.1| PREDICTED: protein IRX15-like [Glycine max]
Length=315

 Score =   346 bits (887),  Expect = 4e-114, Method: Compositional matrix adjust.
 Identities = 157/238 (66%), Positives = 193/238 (81%), Gaps = 4/238 (2%)
 Frame = -3

Query  1023  SGGGGGATPALSKSIVRALVHYASISNNTDRMSYADIKQISDVLRQCGSHPCNFLVFGLT  844
             SG G    PA   +++  L+HYAS SN+T  M ++D+K ISDVLR+C S PCNFL+FGLT
Sbjct  69    SGFGSAPLPA---TVINTLLHYASKSNDTFHMPHSDLKPISDVLRKCSS-PCNFLIFGLT  124

Query  843   HETLLWRTLNHHGRTVFIDESRYYAAYVEEKYPEIEVYDVQYSTKLSEMKELISGVKEQA  664
              ETLLW+ LNH+GRTVFIDE+RYYAAY EE +P I+ YDVQY+TK SEMKELI+  KEQ 
Sbjct  125   PETLLWKALNHNGRTVFIDENRYYAAYYEELHPNIDAYDVQYTTKRSEMKELIASAKEQV  184

Query  663   RNECRPVQNLLFSECKLGLNDLPNQLYEVDWDVILVDGPRGYWPEAPGRMSAIFTAGVLA  484
              NEC+PVQNLLFS+CKLGLNDLPN +YE+DWDVILVDGPRG WP+APGRMS IFTAG+LA
Sbjct  185   ANECKPVQNLLFSDCKLGLNDLPNHVYEIDWDVILVDGPRGDWPDAPGRMSTIFTAGILA  244

Query  483   RSKKGGNPKTHVLVHDYNQKSDRIASEEFLCRENLVETKGMVGHFVVEVMDANNFNFC  310
             RSKKGGNPKTHV +HD++ + +++   EFLC ENL+E  G +GH+V+E MD N+  +C
Sbjct  245   RSKKGGNPKTHVFLHDFSGEVEKVCGSEFLCNENLLEANGNLGHYVLERMDENSVQYC  302



>ref|XP_002285113.1| PREDICTED: protein IRX15-LIKE-like [Vitis vinifera]
Length=304

 Score =   345 bits (884),  Expect = 6e-114, Method: Compositional matrix adjust.
 Identities = 159/229 (69%), Positives = 188/229 (82%), Gaps = 1/229 (0%)
 Frame = -3

Query  993  LSKSIVRALVHYASISNNTDRMSYADIKQISDVLRQCGSHPCNFLVFGLTHETLLWRTLN  814
            L  S + AL+HYA+ SN T  M+ A++  I+ VLR+C S PCNFL+FGLTHETLLW+ LN
Sbjct  64   LPHSAMEALLHYAAASNITGHMTAAEMASIAGVLRRCSS-PCNFLIFGLTHETLLWKALN  122

Query  813  HHGRTVFIDESRYYAAYVEEKYPEIEVYDVQYSTKLSEMKELISGVKEQARNECRPVQNL  634
             +GRT+F+DES +Y A  EEK+P+IE YDVQY+TK+SEM ELI   KEQ RNECRPVQNL
Sbjct  123  SNGRTIFLDESEFYIAKFEEKHPDIEAYDVQYTTKVSEMSELIRSAKEQLRNECRPVQNL  182

Query  633  LFSECKLGLNDLPNQLYEVDWDVILVDGPRGYWPEAPGRMSAIFTAGVLARSKKGGNPKT  454
            LFS+CKLG+NDLPN LY+VDWDVILVDGPRGY+P APGRMSAIFTAGVLARSKKGG+ KT
Sbjct  183  LFSDCKLGINDLPNHLYQVDWDVILVDGPRGYFPAAPGRMSAIFTAGVLARSKKGGSAKT  242

Query  453  HVLVHDYNQKSDRIASEEFLCRENLVETKGMVGHFVVEVMDANNFNFCR  307
            HV VHD N+  +RI S EFLC+ENLVET  ++GHFVVE M  N+F FCR
Sbjct  243  HVFVHDMNRDVERICSNEFLCKENLVETTDLLGHFVVETMKPNSFRFCR  291



>ref|XP_009351143.1| PREDICTED: protein IRX15-LIKE-like [Pyrus x bretschneideri]
Length=330

 Score =   346 bits (887),  Expect = 6e-114, Method: Compositional matrix adjust.
 Identities = 159/230 (69%), Positives = 190/230 (83%), Gaps = 1/230 (0%)
 Frame = -3

Query  999  PALSKSIVRALVHYASISNNTDRMSYADIKQISDVLRQCGSHPCNFLVFGLTHETLLWRT  820
            P L  +++  L+HYAS SN+T +MSYADIK ISD LR+C S PCN L+FGLTHETLLW+ 
Sbjct  79   PQLPTTVINTLLHYASKSNDTFKMSYADIKPISDALRKC-STPCNLLIFGLTHETLLWKA  137

Query  819  LNHHGRTVFIDESRYYAAYVEEKYPEIEVYDVQYSTKLSEMKELISGVKEQARNECRPVQ  640
            LN++GRTV+IDE+RYYAAY+EEK+PEI+ YDVQY+TK+ E KELI+  KEQ RNECRPVQ
Sbjct  138  LNNNGRTVYIDENRYYAAYMEEKHPEIDAYDVQYTTKVKETKELIAVAKEQIRNECRPVQ  197

Query  639  NLLFSECKLGLNDLPNQLYEVDWDVILVDGPRGYWPEAPGRMSAIFTAGVLARSKKGGNP  460
            NLLFSECKLG+NDLPN +YEV+WDVILVDGPRG WP+APGR+  IFT+GVLARSKKGGN 
Sbjct  198  NLLFSECKLGINDLPNHVYEVEWDVILVDGPRGGWPDAPGRVMPIFTSGVLARSKKGGNG  257

Query  459  KTHVLVHDYNQKSDRIASEEFLCRENLVETKGMVGHFVVEVMDANNFNFC  310
            KTHV VHD      R+A  EFLCRENLVE    +GH+V+E MD ++F FC
Sbjct  258  KTHVFVHDIGGTEVRVAGNEFLCRENLVEATETMGHYVLEKMDESSFQFC  307



>ref|XP_010093517.1| hypothetical protein L484_007232 [Morus notabilis]
 gb|EXB54183.1| hypothetical protein L484_007232 [Morus notabilis]
Length=309

 Score =   345 bits (884),  Expect = 7e-114, Method: Compositional matrix adjust.
 Identities = 156/226 (69%), Positives = 191/226 (85%), Gaps = 1/226 (0%)
 Frame = -3

Query  984  SIVRALVHYASISNNTDRMSYADIKQISDVLRQCGSHPCNFLVFGLTHETLLWRTLNHHG  805
            +++  L+HYAS SN+T +MSY ++K I+DVLR+C S PCN LVFGLTHETLLW+ LNH+G
Sbjct  77   TVINTLLHYASRSNDTFKMSYGELKPIADVLRKC-SPPCNLLVFGLTHETLLWKALNHNG  135

Query  804  RTVFIDESRYYAAYVEEKYPEIEVYDVQYSTKLSEMKELISGVKEQARNECRPVQNLLFS  625
            RTVFIDE+RYYAAY E+++PEI+ YDVQY+TK SEM+ELI   + Q +NECRPVQNLLFS
Sbjct  136  RTVFIDENRYYAAYYEQQHPEIDAYDVQYTTKTSEMRELIMAARVQVKNECRPVQNLLFS  195

Query  624  ECKLGLNDLPNQLYEVDWDVILVDGPRGYWPEAPGRMSAIFTAGVLARSKKGGNPKTHVL  445
            ECKLGLNDLPN +YEVDWDVILVDGPRG W +APGR+  IFTAGVLARSKKGGN KTHV 
Sbjct  196  ECKLGLNDLPNHVYEVDWDVILVDGPRGDWADAPGRIQPIFTAGVLARSKKGGNAKTHVF  255

Query  444  VHDYNQKSDRIASEEFLCRENLVETKGMVGHFVVEVMDANNFNFCR  307
            VHD+ +  +R+  +EFLC+ENLVE   ++GH+VVE MD N+F+FCR
Sbjct  256  VHDFRRGLERVCGDEFLCKENLVEASDLLGHYVVERMDENSFHFCR  301



>ref|XP_008340351.1| PREDICTED: protein IRX15-LIKE-like [Malus domestica]
Length=326

 Score =   345 bits (886),  Expect = 8e-114, Method: Compositional matrix adjust.
 Identities = 159/230 (69%), Positives = 190/230 (83%), Gaps = 1/230 (0%)
 Frame = -3

Query  999  PALSKSIVRALVHYASISNNTDRMSYADIKQISDVLRQCGSHPCNFLVFGLTHETLLWRT  820
            P L  +++  L+HYAS SN+T +M YADIK ISD LR+C S PCNFL+FGLTHETLLW+ 
Sbjct  75   PQLPTTVINTLLHYASKSNDTFKMPYADIKPISDALRKC-STPCNFLIFGLTHETLLWKA  133

Query  819  LNHHGRTVFIDESRYYAAYVEEKYPEIEVYDVQYSTKLSEMKELISGVKEQARNECRPVQ  640
            LN++GRTV+IDE+RYYAAY+EEK+PEI+ YDVQY+TK+ E KELI+  KEQ RNECRPVQ
Sbjct  134  LNNNGRTVYIDENRYYAAYMEEKHPEIDAYDVQYTTKVKETKELIAVAKEQIRNECRPVQ  193

Query  639  NLLFSECKLGLNDLPNQLYEVDWDVILVDGPRGYWPEAPGRMSAIFTAGVLARSKKGGNP  460
            NLLFSECKLG+NDLPN +YEV+WDVILVDGPRG WP+APGR+  IFT+GVLARSKKGGN 
Sbjct  194  NLLFSECKLGINDLPNHVYEVEWDVILVDGPRGGWPDAPGRVMPIFTSGVLARSKKGGNG  253

Query  459  KTHVLVHDYNQKSDRIASEEFLCRENLVETKGMVGHFVVEVMDANNFNFC  310
            KTHV VHD      R+A  EFLCRENLVE    +GH+V+E MD ++F FC
Sbjct  254  KTHVFVHDIGGTEVRVAGNEFLCRENLVEATETMGHYVLERMDESSFQFC  303



>gb|KDP31981.1| hypothetical protein JCGZ_12442 [Jatropha curcas]
Length=315

 Score =   345 bits (885),  Expect = 8e-114, Method: Compositional matrix adjust.
 Identities = 157/228 (69%), Positives = 189/228 (83%), Gaps = 1/228 (0%)
 Frame = -3

Query  993  LSKSIVRALVHYASISNNTDRMSYADIKQISDVLRQCGSHPCNFLVFGLTHETLLWRTLN  814
            L  +++  L+HYAS SN++  MSY++IK ISDVLR+C S PCNFLVFGLTHETLLW+ LN
Sbjct  78   LPTTVINTLLHYASRSNDSFHMSYSEIKPISDVLRKCSS-PCNFLVFGLTHETLLWKALN  136

Query  813  HHGRTVFIDESRYYAAYVEEKYPEIEVYDVQYSTKLSEMKELISGVKEQARNECRPVQNL  634
            H+GRTVFIDE+RYYAAY EE +PE++V+DVQY+TK+ E KELI+  K+Q RNECRPVQNL
Sbjct  137  HNGRTVFIDENRYYAAYFEELHPEVDVFDVQYTTKMGEFKELIASAKDQIRNECRPVQNL  196

Query  633  LFSECKLGLNDLPNQLYEVDWDVILVDGPRGYWPEAPGRMSAIFTAGVLARSKKGGNPKT  454
            LFSECKLG+NDLPN +YEVDWDVIL+DGPRG  PE PGRM+ IFTAGVLARS+K GN KT
Sbjct  197  LFSECKLGINDLPNHVYEVDWDVILIDGPRGDGPEGPGRMTPIFTAGVLARSRKAGNGKT  256

Query  453  HVLVHDYNQKSDRIASEEFLCRENLVETKGMVGHFVVEVMDANNFNFC  310
            H+ VHDY +  +++   EFLCRENLVE   M+ HFVVE MD N+F FC
Sbjct  257  HIFVHDYYRDVEKVYGNEFLCRENLVEANDMLAHFVVEKMDENSFQFC  304



>ref|XP_008345507.1| PREDICTED: protein IRX15-LIKE-like [Malus domestica]
 ref|XP_008355706.1| PREDICTED: protein IRX15-LIKE-like [Malus domestica]
Length=326

 Score =   345 bits (886),  Expect = 8e-114, Method: Compositional matrix adjust.
 Identities = 159/233 (68%), Positives = 191/233 (82%), Gaps = 1/233 (0%)
 Frame = -3

Query  1005  ATPALSKSIVRALVHYASISNNTDRMSYADIKQISDVLRQCGSHPCNFLVFGLTHETLLW  826
             A P L  +++  L+HYAS SN+T +MSYADIK ISD LR+C S PCNFL+FGLTHETLLW
Sbjct  73    AAPQLPTTVINTLLHYASKSNDTFKMSYADIKPISDALRKC-STPCNFLIFGLTHETLLW  131

Query  825   RTLNHHGRTVFIDESRYYAAYVEEKYPEIEVYDVQYSTKLSEMKELISGVKEQARNECRP  646
             + LN++GRTV+IDE+RYYAAY+EEK+PEI+ YDVQY+TKL E +ELI+  KEQ RNECRP
Sbjct  132   KALNNNGRTVYIDENRYYAAYMEEKHPEIDAYDVQYTTKLKETEELIAVAKEQIRNECRP  191

Query  645   VQNLLFSECKLGLNDLPNQLYEVDWDVILVDGPRGYWPEAPGRMSAIFTAGVLARSKKGG  466
             VQNLLFSECKLG+NDLPN +YEV+WDVILVDGP   WP+APGR+ +IFT+GVLARSKKGG
Sbjct  192   VQNLLFSECKLGINDLPNHVYEVEWDVILVDGPSSGWPDAPGRVMSIFTSGVLARSKKGG  251

Query  465   NPKTHVLVHDYNQKSDRIASEEFLCRENLVETKGMVGHFVVEVMDANNFNFCR  307
             N KT V VHD+      +A  EFLCRENLVE    +GH+VVE MD ++F FCR
Sbjct  252   NGKTQVFVHDFGGTEVMVAGNEFLCRENLVEATETMGHYVVERMDESSFQFCR  304



>ref|XP_006425964.1| hypothetical protein CICLE_v10025796mg [Citrus clementina]
 gb|ESR39204.1| hypothetical protein CICLE_v10025796mg [Citrus clementina]
Length=395

 Score =   348 bits (892),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 157/239 (66%), Positives = 195/239 (82%), Gaps = 1/239 (0%)
 Frame = -3

Query  1026  ASGGGGGATPALSKSIVRALVHYASISNNTDRMSYADIKQISDVLRQCGSHPCNFLVFGL  847
             +S   G   P L  +++  L+ YAS SN++  M+++++K+ISDV+R+C S PCNFLVFGL
Sbjct  145   SSVSAGFGNPPLPTTVINTLLLYASRSNDSYHMTHSELKRISDVIRKCSS-PCNFLVFGL  203

Query  846   THETLLWRTLNHHGRTVFIDESRYYAAYVEEKYPEIEVYDVQYSTKLSEMKELISGVKEQ  667
             T ETLLW+ LNH+GRTVFIDE+RYYAAY EE +PEI+V+DVQY+TK+ E KELI+  KEQ
Sbjct  204   TQETLLWKALNHNGRTVFIDENRYYAAYFEELHPEIDVFDVQYTTKIRETKELIASAKEQ  263

Query  666   ARNECRPVQNLLFSECKLGLNDLPNQLYEVDWDVILVDGPRGYWPEAPGRMSAIFTAGVL  487
              RNEC+PVQNLLFSECKLG+NDLPN +YEVDWDVIL+DGPRG  P+ PGRMS IFTAGVL
Sbjct  264   IRNECKPVQNLLFSECKLGINDLPNHVYEVDWDVILIDGPRGDGPDGPGRMSPIFTAGVL  323

Query  486   ARSKKGGNPKTHVLVHDYNQKSDRIASEEFLCRENLVETKGMVGHFVVEVMDANNFNFC  310
             ARSKKGGNPKTH+ VHDY +  +R+  +EFLC+ENLVE   M+ HFV+E MD N+F FC
Sbjct  324   ARSKKGGNPKTHIFVHDYYRHVERMCGDEFLCKENLVEFNDMLAHFVLEKMDENSFEFC  382



>gb|KEH31471.1| polysaccharide biosynthesis protein [Medicago truncatula]
Length=303

 Score =   344 bits (883),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 153/229 (67%), Positives = 193/229 (84%), Gaps = 1/229 (0%)
 Frame = -3

Query  993  LSKSIVRALVHYASISNNTDRMSYADIKQISDVLRQCGSHPCNFLVFGLTHETLLWRTLN  814
            L  +++  L+HYAS SN++  M+Y+D+K ISDVLR+C S PCN LVFGLT ETLLW+ LN
Sbjct  70   LPATVINTLLHYASKSNDSYHMTYSDLKPISDVLRKCSS-PCNLLVFGLTPETLLWKALN  128

Query  813  HHGRTVFIDESRYYAAYVEEKYPEIEVYDVQYSTKLSEMKELISGVKEQARNECRPVQNL  634
            H+G+TVFIDE+RYYAAY+EEK+PEI+ YDVQY+TK SEMKELI+  KE   NEC+PVQNL
Sbjct  129  HNGKTVFIDENRYYAAYIEEKHPEIDAYDVQYTTKRSEMKELIASAKEHVANECKPVQNL  188

Query  633  LFSECKLGLNDLPNQLYEVDWDVILVDGPRGYWPEAPGRMSAIFTAGVLARSKKGGNPKT  454
            LFS+CKLG+NDLPN +YEVDWDVILVDGPRG WPEAPGRMSAIFTAGVLARSKKGGNPKT
Sbjct  189  LFSDCKLGINDLPNHVYEVDWDVILVDGPRGDWPEAPGRMSAIFTAGVLARSKKGGNPKT  248

Query  453  HVLVHDYNQKSDRIASEEFLCRENLVETKGMVGHFVVEVMDANNFNFCR  307
            HV +HD++ + +++   EFLC+ENL+E    +GH+V+E M+ ++  +C+
Sbjct  249  HVFLHDFSGEVEQVCGNEFLCKENLLEASESMGHYVLERMNESSVQYCK  297



>ref|XP_009367443.1| PREDICTED: protein IRX15-LIKE-like [Pyrus x bretschneideri]
Length=326

 Score =   345 bits (885),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 159/230 (69%), Positives = 190/230 (83%), Gaps = 1/230 (0%)
 Frame = -3

Query  999  PALSKSIVRALVHYASISNNTDRMSYADIKQISDVLRQCGSHPCNFLVFGLTHETLLWRT  820
            P L  +++  L+HYAS SN+T +MSYADIK ISD LR+C S PCN L+FGLTHETLLW+ 
Sbjct  75   PQLPTTVINTLLHYASKSNDTFKMSYADIKPISDALRKC-STPCNLLIFGLTHETLLWKA  133

Query  819  LNHHGRTVFIDESRYYAAYVEEKYPEIEVYDVQYSTKLSEMKELISGVKEQARNECRPVQ  640
            LN++GRTV+IDE+RYYAAY+EEK+PEI+ YDVQY+TK+ E KELI+  KEQ RNECRPVQ
Sbjct  134  LNNNGRTVYIDENRYYAAYMEEKHPEIDAYDVQYTTKVKETKELIAVAKEQIRNECRPVQ  193

Query  639  NLLFSECKLGLNDLPNQLYEVDWDVILVDGPRGYWPEAPGRMSAIFTAGVLARSKKGGNP  460
            NLLFSECKLG+NDLPN +YEV+WDVILVDGPRG WP+APGR+  IFT+GVLARSKKGGN 
Sbjct  194  NLLFSECKLGINDLPNHVYEVEWDVILVDGPRGGWPDAPGRVMPIFTSGVLARSKKGGNG  253

Query  459  KTHVLVHDYNQKSDRIASEEFLCRENLVETKGMVGHFVVEVMDANNFNFC  310
            KTHV VHD      R+A  EFLCRENLVE    +GH+V+E MD ++F FC
Sbjct  254  KTHVFVHDIGGTEVRVAGNEFLCRENLVEATETMGHYVLERMDESSFQFC  303



>ref|XP_009372433.1| PREDICTED: protein IRX15-LIKE-like [Pyrus x bretschneideri]
Length=326

 Score =   345 bits (884),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 159/233 (68%), Positives = 191/233 (82%), Gaps = 1/233 (0%)
 Frame = -3

Query  1005  ATPALSKSIVRALVHYASISNNTDRMSYADIKQISDVLRQCGSHPCNFLVFGLTHETLLW  826
             A P L  +++  L+HYAS SN+T +MSYADIK ISD LR+C S PCNFL+FGLTHETLLW
Sbjct  73    AAPQLPTTVINTLLHYASKSNDTFKMSYADIKPISDALRKC-STPCNFLIFGLTHETLLW  131

Query  825   RTLNHHGRTVFIDESRYYAAYVEEKYPEIEVYDVQYSTKLSEMKELISGVKEQARNECRP  646
             + LN++GRTV+IDE+RYYAAY+EEK+PEI+ YDVQY+TKL E +ELI+  KEQ RNECRP
Sbjct  132   KALNNNGRTVYIDENRYYAAYMEEKHPEIDAYDVQYTTKLKETEELIAVAKEQIRNECRP  191

Query  645   VQNLLFSECKLGLNDLPNQLYEVDWDVILVDGPRGYWPEAPGRMSAIFTAGVLARSKKGG  466
             VQNLLFSECKLG+NDLPN +YEV+WDVILVDGP   WP+APGR+ +IFT+ VLARSKKGG
Sbjct  192   VQNLLFSECKLGINDLPNHVYEVEWDVILVDGPSSGWPDAPGRVMSIFTSLVLARSKKGG  251

Query  465   NPKTHVLVHDYNQKSDRIASEEFLCRENLVETKGMVGHFVVEVMDANNFNFCR  307
             N KTHV VHD+      +A  EFLCRENLVE    +GH+VVE MD ++F FCR
Sbjct  252   NGKTHVFVHDFGGTEVMVAGNEFLCRENLVEATETMGHYVVERMDESSFQFCR  304



>ref|XP_004509113.1| PREDICTED: protein IRX15-like [Cicer arietinum]
Length=306

 Score =   343 bits (880),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 153/233 (66%), Positives = 192/233 (82%), Gaps = 1/233 (0%)
 Frame = -3

Query  1005  ATPALSKSIVRALVHYASISNNTDRMSYADIKQISDVLRQCGSHPCNFLVFGLTHETLLW  826
             ++  L  +++  L+HYAS SN+T  M+Y+D+K ISDVLR+C S PCN L+FGLT ETLLW
Sbjct  68    SSSPLPSTVINTLLHYASKSNDTYHMTYSDLKPISDVLRKCSS-PCNLLIFGLTPETLLW  126

Query  825   RTLNHHGRTVFIDESRYYAAYVEEKYPEIEVYDVQYSTKLSEMKELISGVKEQARNECRP  646
             + LNH+G+TVFIDE+RYYAAY+EEK+PEI+ YDV Y+TK SEMKELI+  KE   NEC+P
Sbjct  127   KALNHNGKTVFIDENRYYAAYIEEKHPEIDAYDVTYTTKRSEMKELIASAKEHVANECKP  186

Query  645   VQNLLFSECKLGLNDLPNQLYEVDWDVILVDGPRGYWPEAPGRMSAIFTAGVLARSKKGG  466
             VQNLLFS+CKLG+NDLPN +YEVDWDVILVDGPRG WPEAPGRMSAIFTAGVLARSKKGG
Sbjct  187   VQNLLFSDCKLGINDLPNHVYEVDWDVILVDGPRGDWPEAPGRMSAIFTAGVLARSKKGG  246

Query  465   NPKTHVLVHDYNQKSDRIASEEFLCRENLVETKGMVGHFVVEVMDANNFNFCR  307
             NPKTHV +HD+  +  ++   EFLC+ENL+E    +GH+V+E M+ N+  +C+
Sbjct  247   NPKTHVFLHDFYGEVQQVCGNEFLCKENLLEESESLGHYVLERMNENSVQYCK  299



>emb|CAN74915.1| hypothetical protein VITISV_041669 [Vitis vinifera]
Length=342

 Score =   344 bits (882),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 159/229 (69%), Positives = 188/229 (82%), Gaps = 1/229 (0%)
 Frame = -3

Query  993  LSKSIVRALVHYASISNNTDRMSYADIKQISDVLRQCGSHPCNFLVFGLTHETLLWRTLN  814
            L  S + AL+HYA+ SN T  M+ A++  I+ VLR+C S PCNFL+FGLTHETLLW+ LN
Sbjct  64   LPHSAMEALLHYAAASNITGHMTAAEMASIAGVLRRCSS-PCNFLIFGLTHETLLWKALN  122

Query  813  HHGRTVFIDESRYYAAYVEEKYPEIEVYDVQYSTKLSEMKELISGVKEQARNECRPVQNL  634
             +GRT+F+DES +Y A  EEK+P+IE YDVQY+TK+SEM ELI   KEQ RNECRPVQNL
Sbjct  123  SNGRTIFLDESEFYIAKFEEKHPDIEAYDVQYTTKVSEMSELIRSAKEQLRNECRPVQNL  182

Query  633  LFSECKLGLNDLPNQLYEVDWDVILVDGPRGYWPEAPGRMSAIFTAGVLARSKKGGNPKT  454
            LFS+CKLG+NDLPN LY+VDWDVILVDGPRGY+P APGRMSAIFTAGVLARSKKGG+ KT
Sbjct  183  LFSDCKLGINDLPNHLYQVDWDVILVDGPRGYFPAAPGRMSAIFTAGVLARSKKGGSAKT  242

Query  453  HVLVHDYNQKSDRIASEEFLCRENLVETKGMVGHFVVEVMDANNFNFCR  307
            HV VHD N+  +RI S EFLC+ENLVET  ++GHFVVE M  N+F FCR
Sbjct  243  HVFVHDMNRDVERICSNEFLCKENLVETTDLLGHFVVETMKPNSFRFCR  291



>ref|NP_201522.1| uncharacterized protein [Arabidopsis thaliana]
 sp|Q9FH92.1|IX15L_ARATH RecName: Full=Protein IRX15-LIKE [Arabidopsis thaliana]
 dbj|BAB10955.1| unnamed protein product [Arabidopsis thaliana]
 gb|AAO23644.1| At5g67210 [Arabidopsis thaliana]
 dbj|BAE99589.1| hypothetical protein [Arabidopsis thaliana]
 gb|AED98314.1| uncharacterized protein AT5G67210 [Arabidopsis thaliana]
Length=317

 Score =   342 bits (878),  Expect = 8e-113, Method: Compositional matrix adjust.
 Identities = 157/229 (69%), Positives = 191/229 (83%), Gaps = 1/229 (0%)
 Frame = -3

Query  993  LSKSIVRALVHYASISNNTDRMSYADIKQISDVLRQCGSHPCNFLVFGLTHETLLWRTLN  814
            L  + + A++HYAS SN++  MSY ++K ISDVLR+C S PCN LVFGLTHETLLW++LN
Sbjct  77   LPTTAINAMLHYASRSNDSYHMSYGEMKSISDVLRRC-SPPCNLLVFGLTHETLLWKSLN  135

Query  813  HHGRTVFIDESRYYAAYVEEKYPEIEVYDVQYSTKLSEMKELISGVKEQARNECRPVQNL  634
            H+GRTVFI+E+RYYAAY EE +PEIEV+DVQY+TK  E +EL+S VKE ARNECRPVQNL
Sbjct  136  HNGRTVFIEENRYYAAYFEEIHPEIEVFDVQYTTKAREARELVSAVKEAARNECRPVQNL  195

Query  633  LFSECKLGLNDLPNQLYEVDWDVILVDGPRGYWPEAPGRMSAIFTAGVLARSKKGGNPKT  454
            LFS+CKLGLNDLPN +Y+VDWDVILVDGPRG   + PGRMS+IFTA VLARSKKGGNPKT
Sbjct  196  LFSDCKLGLNDLPNHVYDVDWDVILVDGPRGDGGDVPGRMSSIFTAAVLARSKKGGNPKT  255

Query  453  HVLVHDYNQKSDRIASEEFLCRENLVETKGMVGHFVVEVMDANNFNFCR  307
            HV VHDY +  +R+  +EFLCRENLVE+  ++ H+V+E MD N+  FCR
Sbjct  256  HVFVHDYYRDVERLCGDEFLCRENLVESNDLLAHYVLEKMDKNSTQFCR  304



>ref|XP_002866713.1| nucleic acid binding protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH42972.1| nucleic acid binding protein [Arabidopsis lyrata subsp. lyrata]
Length=316

 Score =   341 bits (875),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 157/229 (69%), Positives = 191/229 (83%), Gaps = 1/229 (0%)
 Frame = -3

Query  993  LSKSIVRALVHYASISNNTDRMSYADIKQISDVLRQCGSHPCNFLVFGLTHETLLWRTLN  814
            L  + + A++HYAS SN++  MSY ++K ISDVLR+C S PCN LVFGLTHETLLW++LN
Sbjct  77   LPTAAINAMLHYASRSNDSFHMSYGEMKSISDVLRRC-SPPCNLLVFGLTHETLLWKSLN  135

Query  813  HHGRTVFIDESRYYAAYVEEKYPEIEVYDVQYSTKLSEMKELISGVKEQARNECRPVQNL  634
            H+GRTVFI+E+RYYAAY EE +PEIEV+DVQY+TK  E +EL+S VKE ARNECRPVQNL
Sbjct  136  HNGRTVFIEENRYYAAYFEEIHPEIEVFDVQYTTKAREARELVSAVKEAARNECRPVQNL  195

Query  633  LFSECKLGLNDLPNQLYEVDWDVILVDGPRGYWPEAPGRMSAIFTAGVLARSKKGGNPKT  454
            LFS+CKLGLNDLPN +Y+VDWDVILVDGPRG   + PGRMS+IFTA VLARSKKGGNPKT
Sbjct  196  LFSDCKLGLNDLPNHVYDVDWDVILVDGPRGDGGDVPGRMSSIFTAAVLARSKKGGNPKT  255

Query  453  HVLVHDYNQKSDRIASEEFLCRENLVETKGMVGHFVVEVMDANNFNFCR  307
            HV VHDY +  +R+  +EFLCRENLVE+  M+ H+V++ MD N+  FCR
Sbjct  256  HVFVHDYYRDVERLCGDEFLCRENLVESNDMLAHYVLDRMDKNSTQFCR  304



>ref|XP_007047358.1| Bromodomain-containing protein DDB_G0271118 [Theobroma cacao]
 gb|EOX91515.1| Bromodomain-containing protein DDB_G0271118 [Theobroma cacao]
Length=315

 Score =   341 bits (875),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 155/234 (66%), Positives = 193/234 (82%), Gaps = 2/234 (1%)
 Frame = -3

Query  1008  GATPALSKSIVRALVHYASISNNTDRMSYADIKQISDVLRQCGSHPCNFLVFGLTHETLL  829
             G+ P L  +++  L+HYAS SN++  M+Y+++K ISDVLR+C S PCNFLVFGLT ETLL
Sbjct  72    GSAP-LPTNVINTLLHYASKSNDSFHMTYSELKPISDVLRKCSS-PCNFLVFGLTQETLL  129

Query  828   WRTLNHHGRTVFIDESRYYAAYVEEKYPEIEVYDVQYSTKLSEMKELISGVKEQARNECR  649
             W+ LNH+GRTVFIDE+RYYAAY EE +PEI+ +DVQY+TK+SE +ELI+  KEQ RNECR
Sbjct  130   WKALNHNGRTVFIDENRYYAAYFEEIHPEIDAFDVQYTTKISETRELIASAKEQIRNECR  189

Query  648   PVQNLLFSECKLGLNDLPNQLYEVDWDVILVDGPRGYWPEAPGRMSAIFTAGVLARSKKG  469
             PVQNLLFSECKLG+NDLPN +YEVDWDVIL+DGPRG  PE PGRM  IFT+GVLARSKKG
Sbjct  190   PVQNLLFSECKLGINDLPNHVYEVDWDVILIDGPRGDGPEGPGRMQPIFTSGVLARSKKG  249

Query  468   GNPKTHVLVHDYNQKSDRIASEEFLCRENLVETKGMVGHFVVEVMDANNFNFCR  307
             GN KTH+ VHDY +  ++++ +EFLC+ENLVE    + HFVVE M+ N+F +CR
Sbjct  250   GNTKTHIFVHDYYRDVEQMSGDEFLCKENLVEHNDTLAHFVVERMEENSFQYCR  303



>ref|XP_010484528.1| PREDICTED: protein IRX15-LIKE [Camelina sativa]
Length=317

 Score =   340 bits (872),  Expect = 8e-112, Method: Compositional matrix adjust.
 Identities = 156/229 (68%), Positives = 191/229 (83%), Gaps = 1/229 (0%)
 Frame = -3

Query  993  LSKSIVRALVHYASISNNTDRMSYADIKQISDVLRQCGSHPCNFLVFGLTHETLLWRTLN  814
            L  + + A++HYAS SN++  MSY ++K ISDVLR+C S PCN LVFGLTHETLLW++LN
Sbjct  78   LPTTAINAMLHYASRSNDSFHMSYGEMKSISDVLRRC-SPPCNLLVFGLTHETLLWKSLN  136

Query  813  HHGRTVFIDESRYYAAYVEEKYPEIEVYDVQYSTKLSEMKELISGVKEQARNECRPVQNL  634
            H+GRTVFI+E+RYYAAY EE +PEI+V+DVQY+TK  E +EL+S VKE ARNECRPVQNL
Sbjct  137  HNGRTVFIEENRYYAAYFEEIHPEIDVFDVQYTTKAREARELVSAVKEAARNECRPVQNL  196

Query  633  LFSECKLGLNDLPNQLYEVDWDVILVDGPRGYWPEAPGRMSAIFTAGVLARSKKGGNPKT  454
            LFS+CKLGLNDLPN +Y+VDWDVILVDGPRG   + PGRMS+IFTA VLARSKKGGNPKT
Sbjct  197  LFSDCKLGLNDLPNHVYDVDWDVILVDGPRGDGGDVPGRMSSIFTAAVLARSKKGGNPKT  256

Query  453  HVLVHDYNQKSDRIASEEFLCRENLVETKGMVGHFVVEVMDANNFNFCR  307
            HV VHD+ +  +R+  +EFLCRENLVE+  M+ H+V+E MD N+  FCR
Sbjct  257  HVFVHDFYRDVERLCGDEFLCRENLVESNDMLAHYVLERMDKNSTRFCR  305



>ref|XP_010464334.1| PREDICTED: protein IRX15-LIKE-like [Camelina sativa]
Length=319

 Score =   339 bits (870),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 156/229 (68%), Positives = 191/229 (83%), Gaps = 1/229 (0%)
 Frame = -3

Query  993  LSKSIVRALVHYASISNNTDRMSYADIKQISDVLRQCGSHPCNFLVFGLTHETLLWRTLN  814
            L  + + A++HYAS SN++  MSY ++K ISDVLR+C S PCN LVFGLTHETLLW++LN
Sbjct  80   LPTTAINAMLHYASRSNDSFHMSYGEMKSISDVLRRC-SPPCNLLVFGLTHETLLWKSLN  138

Query  813  HHGRTVFIDESRYYAAYVEEKYPEIEVYDVQYSTKLSEMKELISGVKEQARNECRPVQNL  634
            H+GRTVFI+E+RYYAAY EE +PEI+V+DVQY+TK  E +EL+S VKE ARNECRPVQNL
Sbjct  139  HNGRTVFIEENRYYAAYFEEIHPEIDVFDVQYTTKAREARELVSAVKEAARNECRPVQNL  198

Query  633  LFSECKLGLNDLPNQLYEVDWDVILVDGPRGYWPEAPGRMSAIFTAGVLARSKKGGNPKT  454
            LFS+CKLGLNDLPN +Y+VDWDVILVDGPRG   + PGRMS+IFTA VLARSKKGGNPKT
Sbjct  199  LFSDCKLGLNDLPNHVYDVDWDVILVDGPRGDGGDVPGRMSSIFTAAVLARSKKGGNPKT  258

Query  453  HVLVHDYNQKSDRIASEEFLCRENLVETKGMVGHFVVEVMDANNFNFCR  307
            HV VHD+ +  +R+  +EFLCRENLVE+  M+ H+V+E MD N+  FCR
Sbjct  259  HVFVHDFYRDVERLCGDEFLCRENLVESNDMLAHYVLERMDKNSTRFCR  307



>ref|XP_010558800.1| PREDICTED: protein IRX15-LIKE [Tarenaya hassleriana]
Length=317

 Score =   338 bits (868),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 154/231 (67%), Positives = 190/231 (82%), Gaps = 1/231 (0%)
 Frame = -3

Query  999  PALSKSIVRALVHYASISNNTDRMSYADIKQISDVLRQCGSHPCNFLVFGLTHETLLWRT  820
            P L  S++ AL+HYAS SN++  MSY ++K ISDVLR+C   PCN LVFGLTHETLLW++
Sbjct  76   PQLPTSVINALLHYASRSNDSFHMSYGEMKSISDVLRRCAP-PCNLLVFGLTHETLLWKS  134

Query  819  LNHHGRTVFIDESRYYAAYVEEKYPEIEVYDVQYSTKLSEMKELISGVKEQARNECRPVQ  640
            LNH+GRTVF++E+RYYAAY EE +PEI+V+DVQY+TK +E +EL+S  KE ARNECRPVQ
Sbjct  135  LNHNGRTVFVEENRYYAAYFEELHPEIDVFDVQYTTKATEARELVSAAKEAARNECRPVQ  194

Query  639  NLLFSECKLGLNDLPNQLYEVDWDVILVDGPRGYWPEAPGRMSAIFTAGVLARSKKGGNP  460
            NLLFS+CKLGLNDLPN +Y+VDWDVI VDGPRG   + PGRMS+IFTA VL+RSKKGGNP
Sbjct  195  NLLFSDCKLGLNDLPNHVYDVDWDVIFVDGPRGNGHDGPGRMSSIFTAAVLSRSKKGGNP  254

Query  459  KTHVLVHDYNQKSDRIASEEFLCRENLVETKGMVGHFVVEVMDANNFNFCR  307
            KTHV VHDY +  +R+   EFLCRENLVE+  M+ H+V++ MD N+  FCR
Sbjct  255  KTHVFVHDYYRDVERLCGVEFLCRENLVESNDMLAHYVLDRMDKNSTQFCR  305



>gb|ACU21250.1| unknown [Glycine max]
Length=214

 Score =   334 bits (857),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 152/208 (73%), Positives = 180/208 (87%), Gaps = 1/208 (0%)
 Frame = -3

Query  930  MSYADIKQISDVLRQCGSHPCNFLVFGLTHETLLWRTLNHHGRTVFIDESRYYAAYVEEK  751
            M ++D+K ISDVLR+C S PCNFL+FGLTHETLLW+ LNH+GRTVFIDE+RYYAAY EEK
Sbjct  1    MPHSDLKTISDVLRKCPS-PCNFLIFGLTHETLLWKALNHNGRTVFIDENRYYAAYFEEK  59

Query  750  YPEIEVYDVQYSTKLSEMKELISGVKEQARNECRPVQNLLFSECKLGLNDLPNQLYEVDW  571
            +PEI+ YDVQY+TK SE+KELI+  KEQ  NECRPVQNLLFSECKLGLNDLPN +YEVDW
Sbjct  60   HPEIDAYDVQYTTKRSELKELIASTKEQVGNECRPVQNLLFSECKLGLNDLPNHVYEVDW  119

Query  570  DVILVDGPRGYWPEAPGRMSAIFTAGVLARSKKGGNPKTHVLVHDYNQKSDRIASEEFLC  391
            DVILVDGPRG WPEAPGRMS IFTAGVLARSKKGGNPKTHV VHD++ K ++++  EFLC
Sbjct  120  DVILVDGPRGDWPEAPGRMSPIFTAGVLARSKKGGNPKTHVFVHDFSGKVEKVSGNEFLC  179

Query  390  RENLVETKGMVGHFVVEVMDANNFNFCR  307
            +ENLVE    +GH+V+E MD ++  +C+
Sbjct  180  KENLVEATHSLGHYVLEKMDDSSVQYCK  207



>ref|XP_010444678.1| PREDICTED: protein IRX15-LIKE-like [Camelina sativa]
Length=313

 Score =   338 bits (866),  Expect = 5e-111, Method: Compositional matrix adjust.
 Identities = 155/229 (68%), Positives = 190/229 (83%), Gaps = 1/229 (0%)
 Frame = -3

Query  993  LSKSIVRALVHYASISNNTDRMSYADIKQISDVLRQCGSHPCNFLVFGLTHETLLWRTLN  814
            L  + + A++HYAS SN++  MSY ++K ISDVLR+C S PCN LVFGLTHETLLW++LN
Sbjct  74   LPTTAINAMLHYASRSNDSFHMSYGEMKSISDVLRRC-SPPCNLLVFGLTHETLLWKSLN  132

Query  813  HHGRTVFIDESRYYAAYVEEKYPEIEVYDVQYSTKLSEMKELISGVKEQARNECRPVQNL  634
            H+GRTVFI+E+RYYAAY EE +PEI+V+DVQY+TK  E +EL+S VKE  RNECRPVQNL
Sbjct  133  HNGRTVFIEENRYYAAYFEEIHPEIDVFDVQYTTKAREARELVSAVKEAVRNECRPVQNL  192

Query  633  LFSECKLGLNDLPNQLYEVDWDVILVDGPRGYWPEAPGRMSAIFTAGVLARSKKGGNPKT  454
            LFS+CKLGLNDLPN +Y+VDWDVILVDGPRG   + PGRMS+IFTA VLARSKKGGNPKT
Sbjct  193  LFSDCKLGLNDLPNHVYDVDWDVILVDGPRGDGGDVPGRMSSIFTAAVLARSKKGGNPKT  252

Query  453  HVLVHDYNQKSDRIASEEFLCRENLVETKGMVGHFVVEVMDANNFNFCR  307
            HV VHD+ +  +R+  +EFLCRENLVE+  M+ H+V+E MD N+  FCR
Sbjct  253  HVFVHDFYRDVERLCGDEFLCRENLVESNDMLAHYVLERMDKNSTRFCR  301



>ref|XP_010550356.1| PREDICTED: protein IRX15-LIKE-like [Tarenaya hassleriana]
Length=317

 Score =   337 bits (865),  Expect = 8e-111, Method: Compositional matrix adjust.
 Identities = 153/240 (64%), Positives = 194/240 (81%), Gaps = 1/240 (0%)
 Frame = -3

Query  1026  ASGGGGGATPALSKSIVRALVHYASISNNTDRMSYADIKQISDVLRQCGSHPCNFLVFGL  847
             ++G    A P L  S++ AL+HYAS SN++  MS+ ++K ISDVLR+C   PCN LVFGL
Sbjct  63    SAGVTAAANPQLPTSVINALLHYASRSNDSFHMSHGEMKSISDVLRRCAP-PCNLLVFGL  121

Query  846   THETLLWRTLNHHGRTVFIDESRYYAAYVEEKYPEIEVYDVQYSTKLSEMKELISGVKEQ  667
             T+ETLLW++LNH+GRTVF++E+RYYAAY EE +PEI+V+DVQY+TK +E +E+++  KE 
Sbjct  122   TYETLLWKSLNHNGRTVFVEENRYYAAYFEEIHPEIDVFDVQYTTKATEAREIVAAAKEA  181

Query  666   ARNECRPVQNLLFSECKLGLNDLPNQLYEVDWDVILVDGPRGYWPEAPGRMSAIFTAGVL  487
             A NECRPVQNLLFS+CKLGLNDLPN +Y+VDWDVI VDGPRG   + PGRMS+IFTA VL
Sbjct  182   ALNECRPVQNLLFSDCKLGLNDLPNHVYDVDWDVIFVDGPRGDGHDGPGRMSSIFTAAVL  241

Query  486   ARSKKGGNPKTHVLVHDYNQKSDRIASEEFLCRENLVETKGMVGHFVVEVMDANNFNFCR  307
             ARSKKGGNPKTHV VHDY +  +R+  +EFLCRENLVE+  M+ H+V+E MD N+  FCR
Sbjct  242   ARSKKGGNPKTHVFVHDYYRDIERLCGDEFLCRENLVESNDMLAHYVLERMDKNSTQFCR  301



>ref|XP_002533263.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF29125.1| conserved hypothetical protein [Ricinus communis]
Length=328

 Score =   337 bits (864),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 154/228 (68%), Positives = 188/228 (82%), Gaps = 1/228 (0%)
 Frame = -3

Query  993  LSKSIVRALVHYASISNNTDRMSYADIKQISDVLRQCGSHPCNFLVFGLTHETLLWRTLN  814
            L  +++  L+HYAS SN++  MSY++IK ISDVLR+C S PCN LVFGLTHETLLW+ LN
Sbjct  78   LPTAVINTLLHYASRSNDSFHMSYSEIKPISDVLRKCSS-PCNLLVFGLTHETLLWKALN  136

Query  813  HHGRTVFIDESRYYAAYVEEKYPEIEVYDVQYSTKLSEMKELISGVKEQARNECRPVQNL  634
            H+GRTVFI+E+RYYAAY EE +PE++V+DVQY+TK+ E +ELI+  K+Q RNECRPVQNL
Sbjct  137  HNGRTVFIEENRYYAAYYEELHPEVDVFDVQYTTKMGEFRELITSTKDQIRNECRPVQNL  196

Query  633  LFSECKLGLNDLPNQLYEVDWDVILVDGPRGYWPEAPGRMSAIFTAGVLARSKKGGNPKT  454
            LFSECKLG+NDLPN +YEVDWDVIL+DGPRG   E PGRM+ IFTAGVLARS+K GN KT
Sbjct  197  LFSECKLGINDLPNHVYEVDWDVILIDGPRGDGAEGPGRMAPIFTAGVLARSRKAGNGKT  256

Query  453  HVLVHDYNQKSDRIASEEFLCRENLVETKGMVGHFVVEVMDANNFNFC  310
            HV VHDY ++ +++  +EFLCRENLVE   M+ HFVVE MD N F FC
Sbjct  257  HVFVHDYYREVEKVYGDEFLCRENLVEANDMLAHFVVEKMDENCFQFC  304



>ref|XP_006393919.1| hypothetical protein EUTSA_v10004623mg [Eutrema salsugineum]
 gb|ESQ31205.1| hypothetical protein EUTSA_v10004623mg [Eutrema salsugineum]
Length=316

 Score =   336 bits (862),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 158/230 (69%), Positives = 190/230 (83%), Gaps = 2/230 (1%)
 Frame = -3

Query  993  LSKSIVRALVHYASISNNTDRMSYADIKQISDVLRQCGSHPCNFLVFGLTHETLLWRTLN  814
            L  S + AL+HYAS SN++  MSY ++K ISDVLR+C   PCN LVFGLTHETLLW++LN
Sbjct  77   LPTSAINALLHYASRSNDSFHMSYGEMKSISDVLRRCAP-PCNLLVFGLTHETLLWKSLN  135

Query  813  HHGRTVFIDESRYYAAYVEEKYPEIEVYDVQYSTKLSEMKELISGVKEQARNECRPVQNL  634
            H+GRTVFI+E+RYYAAY EE +PEIEV+DVQY+TK  E +EL+S VKE ARNECRPVQNL
Sbjct  136  HNGRTVFIEENRYYAAYFEEIHPEIEVFDVQYTTKAREARELVSSVKEAARNECRPVQNL  195

Query  633  LFSECKLGLNDLPNQLYEVDWDVILVDGPRGYWPEAPGRMSAIFTAGVLARSKK-GGNPK  457
            LFS+CKLGLNDLPN +Y+VDWDVILVDGPRG   + PGRMS+IFTA VL+RSKK GGNPK
Sbjct  196  LFSDCKLGLNDLPNHVYDVDWDVILVDGPRGDGGDVPGRMSSIFTAAVLSRSKKGGGNPK  255

Query  456  THVLVHDYNQKSDRIASEEFLCRENLVETKGMVGHFVVEVMDANNFNFCR  307
            THV VHDY +  +R+  +EFLCRENLVE+  M+ H+V+E MD N+  FCR
Sbjct  256  THVFVHDYYRDVERLCGDEFLCRENLVESNDMLAHYVLERMDKNSTRFCR  305



>ref|XP_006280826.1| hypothetical protein CARUB_v10026796mg [Capsella rubella]
 gb|EOA13724.1| hypothetical protein CARUB_v10026796mg [Capsella rubella]
Length=318

 Score =   335 bits (858),  Expect = 9e-110, Method: Compositional matrix adjust.
 Identities = 155/229 (68%), Positives = 189/229 (83%), Gaps = 1/229 (0%)
 Frame = -3

Query  993  LSKSIVRALVHYASISNNTDRMSYADIKQISDVLRQCGSHPCNFLVFGLTHETLLWRTLN  814
            L  + + A++HYAS SN++  MSY ++K ISDVLR+C S PCN LVFGLTHETLLW++LN
Sbjct  79   LPTTAINAMLHYASRSNDSFHMSYGEMKSISDVLRRC-SPPCNLLVFGLTHETLLWKSLN  137

Query  813  HHGRTVFIDESRYYAAYVEEKYPEIEVYDVQYSTKLSEMKELISGVKEQARNECRPVQNL  634
            H+GRTVFI+E+RYYAAY EE +PEI+V+DVQY+TK  E +EL+S VKE A NECRPVQNL
Sbjct  138  HNGRTVFIEENRYYAAYFEEIHPEIDVFDVQYTTKAREARELVSAVKEAAGNECRPVQNL  197

Query  633  LFSECKLGLNDLPNQLYEVDWDVILVDGPRGYWPEAPGRMSAIFTAGVLARSKKGGNPKT  454
            LFS+CKLGLNDLPN +Y+VDWDVILVDGPRG   + PGRMS+IFTA VLARSKKGGNPKT
Sbjct  198  LFSDCKLGLNDLPNHVYDVDWDVILVDGPRGDGGDVPGRMSSIFTAAVLARSKKGGNPKT  257

Query  453  HVLVHDYNQKSDRIASEEFLCRENLVETKGMVGHFVVEVMDANNFNFCR  307
            HV VHD  +  +R+  +EFLCRENLVE+  M+ H+V+E MD N+  FCR
Sbjct  258  HVFVHDNYRDVERLCGDEFLCRENLVESNDMLAHYVLERMDKNSTRFCR  306



>ref|XP_010503691.1| PREDICTED: protein IRREGULAR XYLEM 15 [Camelina sativa]
Length=319

 Score =   333 bits (855),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 155/240 (65%), Positives = 190/240 (79%), Gaps = 5/240 (2%)
 Frame = -3

Query  1017  GGGGATPA----LSKSIVRALVHYASISNNTDRMSYADIKQISDVLRQCGSHPCNFLVFG  850
             GG  +TP     L  S + AL+HYAS SN++  MSY ++K ISDVLR+C   PCN LVFG
Sbjct  69    GGSSSTPISNTNLPTSAINALLHYASRSNDSFHMSYGEMKSISDVLRRCAL-PCNLLVFG  127

Query  849   LTHETLLWRTLNHHGRTVFIDESRYYAAYVEEKYPEIEVYDVQYSTKLSEMKELISGVKE  670
             LTHETLLW++LNH+GRT+F++E+RYYAAY EE +PEI+V+DVQY+TK  E  EL+S  KE
Sbjct  128   LTHETLLWKSLNHNGRTIFVEENRYYAAYFEEIHPEIDVFDVQYTTKAHEAGELVSAAKE  187

Query  669   QARNECRPVQNLLFSECKLGLNDLPNQLYEVDWDVILVDGPRGYWPEAPGRMSAIFTAGV  490
              A NECRPVQNLLFS+CKLGLNDLPN +Y+VDWDVI VDGPRG   E PGRMS+IFTA V
Sbjct  188   AAGNECRPVQNLLFSDCKLGLNDLPNHVYDVDWDVIFVDGPRGDAHEGPGRMSSIFTAAV  247

Query  489   LARSKKGGNPKTHVLVHDYNQKSDRIASEEFLCRENLVETKGMVGHFVVEVMDANNFNFC  310
             LARSKKGGNPKTHV VHDY +  +R+  +EFLCRENLVE+  ++ H+V++ MD N+  FC
Sbjct  248   LARSKKGGNPKTHVFVHDYYRDVERLCGDEFLCRENLVESNDLLAHYVLDKMDKNSTQFC  307



>emb|CDY12819.1| BnaC07g16140D [Brassica napus]
Length=315

 Score =   333 bits (854),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 157/233 (67%), Positives = 192/233 (82%), Gaps = 2/233 (1%)
 Frame = -3

Query  1002  TPALSKSIVRALVHYASISNNTDRMSYADIKQISDVLRQCGSHPCNFLVFGLTHETLLWR  823
             T  L  S + AL+HYAS SN++  MSY ++K ISDVLR+C   PCN LVFGLTHETLLW+
Sbjct  73    TSQLPTSAINALLHYASRSNDSFHMSYGEMKSISDVLRRCAP-PCNLLVFGLTHETLLWK  131

Query  822   TLNHHGRTVFIDESRYYAAYVEEKYPEIEVYDVQYSTKLSEMKELISGVKEQARNECRPV  643
             +LNH+GRTV+I+E+RYYAAY EE +PEIEV+DVQY+TK  E +EL+S VKE ARNECRPV
Sbjct  132   SLNHNGRTVYIEENRYYAAYFEEIHPEIEVFDVQYTTKAREARELVSAVKEAARNECRPV  191

Query  642   QNLLFSECKLGLNDLPNQLYEVDWDVILVDGPRGYWPEAPGRMSAIFTAGVLARSKK-GG  466
             QNLLFS+CKLGLNDLPN +Y++DWDVILVDGPRG   + PGRMS+IFTA VLARSKK GG
Sbjct  192   QNLLFSDCKLGLNDLPNHVYDLDWDVILVDGPRGDGGDVPGRMSSIFTAAVLARSKKSGG  251

Query  465   NPKTHVLVHDYNQKSDRIASEEFLCRENLVETKGMVGHFVVEVMDANNFNFCR  307
             N KTHV VHDY ++ +R+  +EFLCRENLVE+  M+ H+V+E MD N+ +FCR
Sbjct  252   NHKTHVFVHDYYREIERLCGDEFLCRENLVESNDMLAHYVLERMDKNSTHFCR  304



>ref|XP_009103444.1| PREDICTED: protein IRX15-LIKE [Brassica rapa]
Length=315

 Score =   333 bits (853),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 157/233 (67%), Positives = 191/233 (82%), Gaps = 2/233 (1%)
 Frame = -3

Query  1002  TPALSKSIVRALVHYASISNNTDRMSYADIKQISDVLRQCGSHPCNFLVFGLTHETLLWR  823
             T  L  S + AL+HYAS SN++  MSY ++K ISDVLR+C   PCN LVFGLTHETLLW+
Sbjct  73    TSQLPTSAINALLHYASRSNDSFHMSYGEMKSISDVLRRCAP-PCNLLVFGLTHETLLWK  131

Query  822   TLNHHGRTVFIDESRYYAAYVEEKYPEIEVYDVQYSTKLSEMKELISGVKEQARNECRPV  643
             +LNH+GRTV+I+E+RYYAAY EE +PEIEV+DVQY+TK  E +EL+S VKE ARNECRPV
Sbjct  132   SLNHNGRTVYIEENRYYAAYFEEIHPEIEVFDVQYTTKAREARELVSAVKEAARNECRPV  191

Query  642   QNLLFSECKLGLNDLPNQLYEVDWDVILVDGPRGYWPEAPGRMSAIFTAGVLARSKK-GG  466
             QNLLFS+CKLGLNDLPN +Y++DWDVILVDGPRG   + PGRMS+IFTA VLARSKK GG
Sbjct  192   QNLLFSDCKLGLNDLPNHVYDLDWDVILVDGPRGDGEDVPGRMSSIFTAAVLARSKKSGG  251

Query  465   NPKTHVLVHDYNQKSDRIASEEFLCRENLVETKGMVGHFVVEVMDANNFNFCR  307
             N KTHV VHDY ++ +R+  +EFLCRENLVE+  M+ H+V+E MD N+  FCR
Sbjct  252   NHKTHVFVHDYYREIERLCGDEFLCRENLVESNDMLAHYVLERMDKNSTQFCR  304



>gb|AAM64983.1| unknown [Arabidopsis thaliana]
Length=322

 Score =   332 bits (851),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 155/243 (64%), Positives = 191/243 (79%), Gaps = 10/243 (4%)
 Frame = -3

Query  1011  GGATPALSKSI---------VRALVHYASISNNTDRMSYADIKQISDVLRQCGSHPCNFL  859
             GG+TP+ S  I         + AL+HYAS SN++  MSY ++K ISDVLR+C   PCN L
Sbjct  69    GGSTPSASSPISNSNLPTSAINALLHYASRSNDSFHMSYGEMKSISDVLRRCAP-PCNLL  127

Query  858   VFGLTHETLLWRTLNHHGRTVFIDESRYYAAYVEEKYPEIEVYDVQYSTKLSEMKELISG  679
             VFGLTHETLLW++LNH+GRT+FI+E+RYYAAY EE +PEI+V+DVQY+TK  E  EL++ 
Sbjct  128   VFGLTHETLLWKSLNHNGRTLFIEENRYYAAYFEEIHPEIDVFDVQYTTKAHEAGELVTA  187

Query  678   VKEQARNECRPVQNLLFSECKLGLNDLPNQLYEVDWDVILVDGPRGYWPEAPGRMSAIFT  499
              KE A NECRPVQNLLFS+CKLGLNDLPN +Y+VDWDVI VDGPRG   E PGRMS+IFT
Sbjct  188   AKEAAGNECRPVQNLLFSDCKLGLNDLPNHVYDVDWDVIFVDGPRGDAHEGPGRMSSIFT  247

Query  498   AGVLARSKKGGNPKTHVLVHDYNQKSDRIASEEFLCRENLVETKGMVGHFVVEVMDANNF  319
             A VLARSKKGGNPKTHV VHDY +  +R+  +EFLCRENLVE+  ++ H+V++ MD N+ 
Sbjct  248   AAVLARSKKGGNPKTHVFVHDYYRDVERLCGDEFLCRENLVESNDLLAHYVLDKMDKNST  307

Query  318   NFC  310
              FC
Sbjct  308   KFC  310



>ref|XP_010515380.1| PREDICTED: protein IRREGULAR XYLEM 15-like [Camelina sativa]
Length=319

 Score =   332 bits (850),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 154/239 (64%), Positives = 189/239 (79%), Gaps = 5/239 (2%)
 Frame = -3

Query  1014  GGGATPA----LSKSIVRALVHYASISNNTDRMSYADIKQISDVLRQCGSHPCNFLVFGL  847
             G  +TP     L  S + AL+HYAS SN++  MSY ++K ISDVLR+C   PCN LVFGL
Sbjct  70    GSSSTPISNTNLPTSAINALLHYASRSNDSFHMSYGEMKSISDVLRRCAP-PCNLLVFGL  128

Query  846   THETLLWRTLNHHGRTVFIDESRYYAAYVEEKYPEIEVYDVQYSTKLSEMKELISGVKEQ  667
             THETLLW++LNH+GRT+F++E+RYYAAY EE +PEI+V+DVQY+TK  E  EL+S  KE 
Sbjct  129   THETLLWKSLNHNGRTIFVEENRYYAAYFEEIHPEIDVFDVQYTTKAHEAGELVSAAKEA  188

Query  666   ARNECRPVQNLLFSECKLGLNDLPNQLYEVDWDVILVDGPRGYWPEAPGRMSAIFTAGVL  487
             A NECRPVQNLLFS+CKLGLNDLPN +Y+VDWDVI VDGPRG   E PGRMS+IFTA VL
Sbjct  189   AGNECRPVQNLLFSDCKLGLNDLPNHVYDVDWDVIFVDGPRGDAHEGPGRMSSIFTAAVL  248

Query  486   ARSKKGGNPKTHVLVHDYNQKSDRIASEEFLCRENLVETKGMVGHFVVEVMDANNFNFC  310
             ARSKKGGNPKTHV VHDY +  +R+  +EFLCRENLVE+  ++ H+V++ MD N+  FC
Sbjct  249   ARSKKGGNPKTHVFVHDYYRDVERLCGDEFLCRENLVESNDLLAHYVLDKMDKNSTQFC  307



>ref|XP_006292985.1| hypothetical protein CARUB_v10019263mg [Capsella rubella]
 gb|EOA25883.1| hypothetical protein CARUB_v10019263mg [Capsella rubella]
Length=323

 Score =   331 bits (849),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 152/228 (67%), Positives = 186/228 (82%), Gaps = 1/228 (0%)
 Frame = -3

Query  993  LSKSIVRALVHYASISNNTDRMSYADIKQISDVLRQCGSHPCNFLVFGLTHETLLWRTLN  814
            L  S + AL+HYAS SN++  MSY ++K ISDVLR+C S PCN LVFGLTHETLLW++LN
Sbjct  85   LPTSAINALLHYASRSNDSFHMSYGEMKSISDVLRRCAS-PCNLLVFGLTHETLLWKSLN  143

Query  813  HHGRTVFIDESRYYAAYVEEKYPEIEVYDVQYSTKLSEMKELISGVKEQARNECRPVQNL  634
            H+GRTVF++E+RYYAAY EE +PEI+V+DVQY+TK  E  EL++  KE A NECRPVQNL
Sbjct  144  HNGRTVFVEENRYYAAYFEEIHPEIDVFDVQYTTKAHEAGELVAAAKEAAGNECRPVQNL  203

Query  633  LFSECKLGLNDLPNQLYEVDWDVILVDGPRGYWPEAPGRMSAIFTAGVLARSKKGGNPKT  454
            LFS+CKLGLNDLPN +Y+VDWDVI VDGPRG   E PGRMS+IFTA VLARSKKGGNPKT
Sbjct  204  LFSDCKLGLNDLPNHVYDVDWDVIFVDGPRGDAHEGPGRMSSIFTAAVLARSKKGGNPKT  263

Query  453  HVLVHDYNQKSDRIASEEFLCRENLVETKGMVGHFVVEVMDANNFNFC  310
            HV VHDY +  +R+  +EFLCRENLVE+  ++ H+V++ MD N+  FC
Sbjct  264  HVFVHDYYRDVERLCGDEFLCRENLVESNDLLAHYVLDKMDKNSTQFC  311



>ref|NP_190591.1| protein IRREGULAR XYLEM 15 [Arabidopsis thaliana]
 sp|Q9SNE5.1|IRX15_ARATH RecName: Full=Protein IRREGULAR XYLEM 15; Short=AtIRX15 [Arabidopsis 
thaliana]
 emb|CAB62301.1| putative protein [Arabidopsis thaliana]
 gb|ABE66005.1| unknown [Arabidopsis thaliana]
 gb|AEE78642.1| uncharacterized protein AT3G50220 [Arabidopsis thaliana]
Length=322

 Score =   331 bits (848),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 155/243 (64%), Positives = 190/243 (78%), Gaps = 10/243 (4%)
 Frame = -3

Query  1011  GGATPALSKSI---------VRALVHYASISNNTDRMSYADIKQISDVLRQCGSHPCNFL  859
             GG+TP+ S  I         + AL+HYAS SN++  MSY ++K ISDVLR+C   PCN L
Sbjct  69    GGSTPSASSPISNSNLPTSAINALLHYASRSNDSFHMSYGEMKSISDVLRRCAP-PCNLL  127

Query  858   VFGLTHETLLWRTLNHHGRTVFIDESRYYAAYVEEKYPEIEVYDVQYSTKLSEMKELISG  679
             VFGLTHETLLW++LNH+GRTVFI+E+RYYAAY EE +PEI+V+DVQY+TK  E  EL++ 
Sbjct  128   VFGLTHETLLWKSLNHNGRTVFIEENRYYAAYFEEIHPEIDVFDVQYTTKAHEAGELVTA  187

Query  678   VKEQARNECRPVQNLLFSECKLGLNDLPNQLYEVDWDVILVDGPRGYWPEAPGRMSAIFT  499
              KE A NECRPVQNLLFS+CKLGLNDLPN +Y+VDWDVI VDGPRG   E PGRMS+IFT
Sbjct  188   AKEAAGNECRPVQNLLFSDCKLGLNDLPNHVYDVDWDVIFVDGPRGDAHEGPGRMSSIFT  247

Query  498   AGVLARSKKGGNPKTHVLVHDYNQKSDRIASEEFLCRENLVETKGMVGHFVVEVMDANNF  319
             A VLARSKKGG PKTHV VHDY +  +R+  +EFLCRENLVE+  ++ H+V++ MD N+ 
Sbjct  248   AAVLARSKKGGTPKTHVFVHDYYRDVERLCGDEFLCRENLVESNDLLAHYVLDKMDKNST  307

Query  318   NFC  310
              FC
Sbjct  308   KFC  310



>gb|ABK28594.1| unknown [Arabidopsis thaliana]
Length=323

 Score =   331 bits (848),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 155/243 (64%), Positives = 190/243 (78%), Gaps = 10/243 (4%)
 Frame = -3

Query  1011  GGATPALSKSI---------VRALVHYASISNNTDRMSYADIKQISDVLRQCGSHPCNFL  859
             GG+TP+ S  I         + AL+HYAS SN++  MSY ++K ISDVLR+C   PCN L
Sbjct  69    GGSTPSASSPISNSNLPTSAINALLHYASRSNDSFHMSYGEMKSISDVLRRCAP-PCNLL  127

Query  858   VFGLTHETLLWRTLNHHGRTVFIDESRYYAAYVEEKYPEIEVYDVQYSTKLSEMKELISG  679
             VFGLTHETLLW++LNH+GRTVFI+E+RYYAAY EE +PEI+V+DVQY+TK  E  EL++ 
Sbjct  128   VFGLTHETLLWKSLNHNGRTVFIEENRYYAAYFEEIHPEIDVFDVQYTTKAHEAGELVTA  187

Query  678   VKEQARNECRPVQNLLFSECKLGLNDLPNQLYEVDWDVILVDGPRGYWPEAPGRMSAIFT  499
              KE A NECRPVQNLLFS+CKLGLNDLPN +Y+VDWDVI VDGPRG   E PGRMS+IFT
Sbjct  188   AKEAAGNECRPVQNLLFSDCKLGLNDLPNHVYDVDWDVIFVDGPRGDAHEGPGRMSSIFT  247

Query  498   AGVLARSKKGGNPKTHVLVHDYNQKSDRIASEEFLCRENLVETKGMVGHFVVEVMDANNF  319
             A VLARSKKGG PKTHV VHDY +  +R+  +EFLCRENLVE+  ++ H+V++ MD N+ 
Sbjct  248   AAVLARSKKGGTPKTHVFVHDYYRDVERLCGDEFLCRENLVESNDLLAHYVLDKMDKNST  307

Query  318   NFC  310
              FC
Sbjct  308   KFC  310



>dbj|BAD94344.1| hypothetical protein [Arabidopsis thaliana]
Length=322

 Score =   330 bits (847),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 155/243 (64%), Positives = 190/243 (78%), Gaps = 10/243 (4%)
 Frame = -3

Query  1011  GGATPALSKSI---------VRALVHYASISNNTDRMSYADIKQISDVLRQCGSHPCNFL  859
             GG+TP+ S  I         + AL+HYAS SN++  MSY ++K ISDVLR+C   PCN L
Sbjct  69    GGSTPSASSPISNSNLPTSAINALLHYASRSNDSFHMSYGEMKSISDVLRRCAP-PCNLL  127

Query  858   VFGLTHETLLWRTLNHHGRTVFIDESRYYAAYVEEKYPEIEVYDVQYSTKLSEMKELISG  679
             VFGLTHETLLW++LNH+GRTVFI+E+RYYAAY EE +PEI+V+DVQY+TK  E  EL++ 
Sbjct  128   VFGLTHETLLWKSLNHNGRTVFIEENRYYAAYFEEIHPEIDVFDVQYTTKAHEAGELVTA  187

Query  678   VKEQARNECRPVQNLLFSECKLGLNDLPNQLYEVDWDVILVDGPRGYWPEAPGRMSAIFT  499
              KE A NECRPVQNLLFS+CKLGLNDLPN +Y+VDWDVI VDGPRG   E PGRMS+IFT
Sbjct  188   AKEAAGNECRPVQNLLFSDCKLGLNDLPNHVYDVDWDVIFVDGPRGDAHEGPGRMSSIFT  247

Query  498   AGVLARSKKGGNPKTHVLVHDYNQKSDRIASEEFLCRENLVETKGMVGHFVVEVMDANNF  319
             A VLARSKKGG PKTHV VHDY +  +R+  +EFLCRENLVE+  ++ H+V++ MD N+ 
Sbjct  248   AAVLARSKKGGTPKTHVFVHDYYRDVERLCGDEFLCRENLVESNDLLAHYVLDEMDKNST  307

Query  318   NFC  310
              FC
Sbjct  308   KFC  310



>ref|XP_010426565.1| PREDICTED: protein IRREGULAR XYLEM 15 [Camelina sativa]
Length=320

 Score =   330 bits (847),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 154/242 (64%), Positives = 189/242 (78%), Gaps = 5/242 (2%)
 Frame = -3

Query  1023  SGGGGGATPA----LSKSIVRALVHYASISNNTDRMSYADIKQISDVLRQCGSHPCNFLV  856
             +GG   +TP     L  S +  L+HYAS SN++  MSY ++K ISDVLR+C   PCN LV
Sbjct  68    TGGSSSSTPISNTNLPTSAINTLLHYASRSNDSFHMSYGEMKSISDVLRRCAP-PCNLLV  126

Query  855   FGLTHETLLWRTLNHHGRTVFIDESRYYAAYVEEKYPEIEVYDVQYSTKLSEMKELISGV  676
             FGLTHETLLW++LNH+GRTVF++E+RYYAAY EE +PEI+V+DVQY+TK  E  EL+S  
Sbjct  127   FGLTHETLLWKSLNHNGRTVFVEENRYYAAYFEEIHPEIDVFDVQYTTKAHEAGELVSAA  186

Query  675   KEQARNECRPVQNLLFSECKLGLNDLPNQLYEVDWDVILVDGPRGYWPEAPGRMSAIFTA  496
             KE A NECRPVQNLLFS+CKLGLNDLPN +Y+VDWDVI VDGPRG   E PGRMS+IFTA
Sbjct  187   KEAAGNECRPVQNLLFSDCKLGLNDLPNHVYDVDWDVIFVDGPRGDAHEGPGRMSSIFTA  246

Query  495   GVLARSKKGGNPKTHVLVHDYNQKSDRIASEEFLCRENLVETKGMVGHFVVEVMDANNFN  316
              VLARSKKGGNPKTHV VHD  +  +R+  +EFLCRENLVE+  ++ H+V++ MD N+  
Sbjct  247   AVLARSKKGGNPKTHVFVHDNYRDVERLCGDEFLCRENLVESNDLLAHYVLDKMDKNSTQ  306

Query  315   FC  310
             FC
Sbjct  307   FC  308



>ref|XP_002877736.1| hypothetical protein ARALYDRAFT_906343 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH53995.1| hypothetical protein ARALYDRAFT_906343 [Arabidopsis lyrata subsp. 
lyrata]
Length=322

 Score =   330 bits (845),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 152/228 (67%), Positives = 185/228 (81%), Gaps = 1/228 (0%)
 Frame = -3

Query  993  LSKSIVRALVHYASISNNTDRMSYADIKQISDVLRQCGSHPCNFLVFGLTHETLLWRTLN  814
            L  S + AL+HYAS SN++  MSY ++K ISDVLR+C   PCN LVFGLTHETLLW++LN
Sbjct  84   LPTSAINALLHYASRSNDSFHMSYGEMKSISDVLRRCAP-PCNLLVFGLTHETLLWKSLN  142

Query  813  HHGRTVFIDESRYYAAYVEEKYPEIEVYDVQYSTKLSEMKELISGVKEQARNECRPVQNL  634
            H+GRTVFI+E+RYYAAY EE +PEI+V+DVQY+TK  E  EL++  KE A NECRPVQNL
Sbjct  143  HNGRTVFIEENRYYAAYFEEIHPEIDVFDVQYTTKAHEAGELVTAAKEAAGNECRPVQNL  202

Query  633  LFSECKLGLNDLPNQLYEVDWDVILVDGPRGYWPEAPGRMSAIFTAGVLARSKKGGNPKT  454
            LFS+CKLGLNDLPN +Y+VDWDVI VDGPRG   E PGRMS+IFTA VLARSKKGGNPKT
Sbjct  203  LFSDCKLGLNDLPNHVYDVDWDVIFVDGPRGDAHEGPGRMSSIFTAAVLARSKKGGNPKT  262

Query  453  HVLVHDYNQKSDRIASEEFLCRENLVETKGMVGHFVVEVMDANNFNFC  310
            HV VHDY +  +R+  +EFLCRENLVE+  ++ H+V++ MD N+  FC
Sbjct  263  HVFVHDYYRDVERLCGDEFLCRENLVESNDLLAHYVLDKMDKNSTTFC  310



>emb|CDY01429.1| BnaA07g12020D [Brassica napus]
Length=315

 Score =   329 bits (843),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 156/233 (67%), Positives = 190/233 (82%), Gaps = 2/233 (1%)
 Frame = -3

Query  1002  TPALSKSIVRALVHYASISNNTDRMSYADIKQISDVLRQCGSHPCNFLVFGLTHETLLWR  823
             T  L  S + AL+HYAS SN++  MSY ++K ISDVLR+C   PCN LVFGLTHETLLW+
Sbjct  73    TSQLPTSAINALLHYASRSNDSFHMSYGEMKSISDVLRRCAP-PCNLLVFGLTHETLLWK  131

Query  822   TLNHHGRTVFIDESRYYAAYVEEKYPEIEVYDVQYSTKLSEMKELISGVKEQARNECRPV  643
             +LNH+GRTV+I+E+RYYAAY EE +PEIEV+DVQY+TK  E +EL+S VKE ARNECRPV
Sbjct  132   SLNHNGRTVYIEENRYYAAYFEEIHPEIEVFDVQYTTKAREARELVSAVKEAARNECRPV  191

Query  642   QNLLFSECKLGLNDLPNQLYEVDWDVILVDGPRGYWPEAPGRMSAIFTAGVLARSKK-GG  466
             QNLLFS+CKLGLNDLPN +Y++DWDVILVDGPRG   + P RMS+IFTA VLARSKK GG
Sbjct  192   QNLLFSDCKLGLNDLPNHVYDLDWDVILVDGPRGDGGDVPVRMSSIFTAAVLARSKKSGG  251

Query  465   NPKTHVLVHDYNQKSDRIASEEFLCRENLVETKGMVGHFVVEVMDANNFNFCR  307
             N KTHV VHDY ++ +R+  +EFLCRENLVE+  M+ H+V+E MD N+  FCR
Sbjct  252   NHKTHVFVHDYYREIERLCGDEFLCRENLVESNDMLAHYVLERMDKNSTQFCR  304



>emb|CDX81329.1| BnaC09g07400D [Brassica napus]
Length=308

 Score =   327 bits (837),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 153/229 (67%), Positives = 188/229 (82%), Gaps = 2/229 (1%)
 Frame = -3

Query  993  LSKSIVRALVHYASISNNTDRMSYADIKQISDVLRQCGSHPCNFLVFGLTHETLLWRTLN  814
            L  + + AL+HYAS SN++  MS+ ++K ISDVLR+C   PCN LVFGLTHETLLW++LN
Sbjct  69   LPTTAINALLHYASRSNDSYHMSHGEMKSISDVLRRCPP-PCNLLVFGLTHETLLWKSLN  127

Query  813  HHGRTVFIDESRYYAAYVEEKYPEIEVYDVQYSTKLSEMKELISGVKEQARNECRPVQNL  634
            H+GRTV+I+E+RYYAAY EE +PEIEV+DVQY+TK  E +EL+S VKE ARNECRPVQNL
Sbjct  128  HNGRTVYIEENRYYAAYFEEIHPEIEVFDVQYTTKAREARELVSAVKEAARNECRPVQNL  187

Query  633  LFSECKLGLNDLPNQLYEVDWDVILVDGPRGYWPEAPGRMSAIFTAGVLARSKK-GGNPK  457
            LFS+CKLGLNDLPN +Y+VDWDVILVDGPRG   + PGRMS+IFTA VLARSKK GGN +
Sbjct  188  LFSDCKLGLNDLPNHVYDVDWDVILVDGPRGDGGDVPGRMSSIFTAAVLARSKKSGGNLR  247

Query  456  THVLVHDYNQKSDRIASEEFLCRENLVETKGMVGHFVVEVMDANNFNFC  310
            THV VHDY +  +R+  +EFLCRENLVE+  M+ H+V+E MD N+  FC
Sbjct  248  THVFVHDYYRDVERLCGDEFLCRENLVESNDMLAHYVLERMDKNSTQFC  296



>ref|XP_006404049.1| hypothetical protein EUTSA_v10010543mg [Eutrema salsugineum]
 gb|ESQ45502.1| hypothetical protein EUTSA_v10010543mg [Eutrema salsugineum]
Length=325

 Score =   327 bits (837),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 149/228 (65%), Positives = 184/228 (81%), Gaps = 1/228 (0%)
 Frame = -3

Query  993  LSKSIVRALVHYASISNNTDRMSYADIKQISDVLRQCGSHPCNFLVFGLTHETLLWRTLN  814
            L  + + AL+HYAS SN++  MSY ++K ISDVLR+C   PCN LVFGLTHETLLW++LN
Sbjct  86   LPTTAINALLHYASRSNDSFHMSYGEMKSISDVLRRCAP-PCNLLVFGLTHETLLWKSLN  144

Query  813  HHGRTVFIDESRYYAAYVEEKYPEIEVYDVQYSTKLSEMKELISGVKEQARNECRPVQNL  634
            H+GRTVF++E+RYYAAY EE +PEI+V+DVQY+TK  E  EL++  KE   NECRPVQNL
Sbjct  145  HNGRTVFVEENRYYAAYFEEIHPEIDVFDVQYTTKAHEAGELVAAAKEAVGNECRPVQNL  204

Query  633  LFSECKLGLNDLPNQLYEVDWDVILVDGPRGYWPEAPGRMSAIFTAGVLARSKKGGNPKT  454
            LFS+CKLGLNDLPN +Y+VDWDVI VDGPRG   E PGRMS+IFTA VLARSKKGGNPKT
Sbjct  205  LFSDCKLGLNDLPNHVYDVDWDVIFVDGPRGDAHEGPGRMSSIFTAAVLARSKKGGNPKT  264

Query  453  HVLVHDYNQKSDRIASEEFLCRENLVETKGMVGHFVVEVMDANNFNFC  310
            HV VHDY +  +R+  +EFLCRENLVE+  ++ H+V++ MD N+  FC
Sbjct  265  HVFVHDYYRDVERLCGDEFLCRENLVESNDLLAHYVLDKMDKNSTRFC  312



>emb|CDY17753.1| BnaC08g21610D [Brassica napus]
Length=324

 Score =   325 bits (834),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 149/228 (65%), Positives = 184/228 (81%), Gaps = 1/228 (0%)
 Frame = -3

Query  993  LSKSIVRALVHYASISNNTDRMSYADIKQISDVLRQCGSHPCNFLVFGLTHETLLWRTLN  814
            L  + + AL+HYAS SN++  MSY ++K ISDVLR+C   PCN LVFGLTHETLLW+ LN
Sbjct  86   LPTTTINALLHYASRSNDSFHMSYGEMKSISDVLRRCAP-PCNLLVFGLTHETLLWKALN  144

Query  813  HHGRTVFIDESRYYAAYVEEKYPEIEVYDVQYSTKLSEMKELISGVKEQARNECRPVQNL  634
            H+GRTVF++E+RYYAAY EE +PEI+V+DVQY+TK  E  EL++  KE A NECRPVQNL
Sbjct  145  HNGRTVFVEENRYYAAYFEEIHPEIDVFDVQYTTKAHEAGELVAAAKEAAGNECRPVQNL  204

Query  633  LFSECKLGLNDLPNQLYEVDWDVILVDGPRGYWPEAPGRMSAIFTAGVLARSKKGGNPKT  454
            LFS+CKLGLNDLPN +Y+VDWDVI VDGPRG   E PGRMS+IFTA VLARSKKGG+PKT
Sbjct  205  LFSDCKLGLNDLPNHVYDVDWDVIFVDGPRGDANEGPGRMSSIFTAAVLARSKKGGSPKT  264

Query  453  HVLVHDYNQKSDRIASEEFLCRENLVETKGMVGHFVVEVMDANNFNFC  310
            HV VHDY +  +R+  +EFLCRENLVE+  ++ H+V++ MD N+  FC
Sbjct  265  HVFVHDYYRDVERLCGDEFLCRENLVESNELLAHYVLDKMDKNSTRFC  312



>gb|KFK28414.1| hypothetical protein AALP_AA8G511700 [Arabis alpina]
Length=319

 Score =   324 bits (831),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 152/225 (68%), Positives = 185/225 (82%), Gaps = 2/225 (1%)
 Frame = -3

Query  978  VRALVHYASISNNTDRMSYADIKQISDVLRQCGSHPCNFLVFGLTHETLLWRTLNHHGRT  799
            + AL+HYAS SN++  MSY ++K ISDVLR+C S PCN LVFGLTHETLLW++LNH+GRT
Sbjct  84   INALLHYASRSNDSFHMSYKEMKSISDVLRRC-SPPCNLLVFGLTHETLLWKSLNHNGRT  142

Query  798  VFIDESRYYAAYVEEKYPEIEVYDVQYSTKLSEMKELISGVKEQARNECRPVQNLLFSEC  619
            VFI+E+RYYAAY EE +PEIEV+DVQY+TK  E +EL+  VKE  +NECRPVQNLLFS+C
Sbjct  143  VFIEENRYYAAYFEEIHPEIEVFDVQYTTKAREARELVRSVKESVKNECRPVQNLLFSDC  202

Query  618  KLGLNDLPNQLYEVDWDVILVDGPRGYWPEAPGRMSAIFTAGVLARSKKGG-NPKTHVLV  442
            KLGLNDLPN +Y++DWDVILVDGPRG     PGRMS+IFTA VLARSKK G N KTHV V
Sbjct  203  KLGLNDLPNHVYDLDWDVILVDGPRGDGGNVPGRMSSIFTAAVLARSKKSGKNLKTHVFV  262

Query  441  HDYNQKSDRIASEEFLCRENLVETKGMVGHFVVEVMDANNFNFCR  307
            HDY ++ +R+  +EFLCRENLVE+  M+ H+V+E MD N+  FCR
Sbjct  263  HDYYREVERLCGDEFLCRENLVESSDMLAHYVLEKMDKNSTEFCR  307



>emb|CDY30600.1| BnaAnng03750D [Brassica napus]
Length=324

 Score =   323 bits (828),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 148/223 (66%), Positives = 182/223 (82%), Gaps = 1/223 (0%)
 Frame = -3

Query  978  VRALVHYASISNNTDRMSYADIKQISDVLRQCGSHPCNFLVFGLTHETLLWRTLNHHGRT  799
            + AL+HYAS SN++  MSY ++K ISDVLR+C   PCN LVFGLTHETLLW+ LNH+GRT
Sbjct  91   INALLHYASRSNDSFHMSYGEMKSISDVLRRCAP-PCNLLVFGLTHETLLWKALNHNGRT  149

Query  798  VFIDESRYYAAYVEEKYPEIEVYDVQYSTKLSEMKELISGVKEQARNECRPVQNLLFSEC  619
            VF++E+RYYAAY EE +PEI+V+DVQY+TK  E  EL++  KE A NECRPVQNLLFS+C
Sbjct  150  VFVEENRYYAAYFEEIHPEIDVFDVQYTTKAHEAGELVAAAKEAAGNECRPVQNLLFSDC  209

Query  618  KLGLNDLPNQLYEVDWDVILVDGPRGYWPEAPGRMSAIFTAGVLARSKKGGNPKTHVLVH  439
            KLGLNDLPN +Y+VDWDVI VDGPRG   E PGRMS+IFTA VLARSKKGG+PKTHV VH
Sbjct  210  KLGLNDLPNHVYDVDWDVIFVDGPRGDANEGPGRMSSIFTAAVLARSKKGGSPKTHVFVH  269

Query  438  DYNQKSDRIASEEFLCRENLVETKGMVGHFVVEVMDANNFNFC  310
            DY +  +R+  +EFLCRENLVE+  ++ H+V++ MD N+  FC
Sbjct  270  DYYRDVERLCGDEFLCRENLVESNELLAHYVLDKMDKNSTRFC  312



>ref|XP_009115695.1| PREDICTED: protein IRREGULAR XYLEM 15 [Brassica rapa]
Length=324

 Score =   323 bits (828),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 148/223 (66%), Positives = 182/223 (82%), Gaps = 1/223 (0%)
 Frame = -3

Query  978  VRALVHYASISNNTDRMSYADIKQISDVLRQCGSHPCNFLVFGLTHETLLWRTLNHHGRT  799
            + AL+HYAS SN++  MSY ++K ISDVLR+C   PCN LVFGLTHETLLW+ LNH+GRT
Sbjct  91   INALLHYASRSNDSFHMSYGEMKSISDVLRRCAP-PCNLLVFGLTHETLLWKALNHNGRT  149

Query  798  VFIDESRYYAAYVEEKYPEIEVYDVQYSTKLSEMKELISGVKEQARNECRPVQNLLFSEC  619
            VF++E+RYYAAY EE +PEI+V+DVQY+TK  E  EL++  KE A NECRPVQNLLFS+C
Sbjct  150  VFVEENRYYAAYFEEIHPEIDVFDVQYTTKAHEAGELVAAAKEAAGNECRPVQNLLFSDC  209

Query  618  KLGLNDLPNQLYEVDWDVILVDGPRGYWPEAPGRMSAIFTAGVLARSKKGGNPKTHVLVH  439
            KLGLNDLPN +Y+VDWDVI VDGPRG   E PGRMS+IFTA VLARSKKGG+PKTHV VH
Sbjct  210  KLGLNDLPNHVYDVDWDVIFVDGPRGDANEGPGRMSSIFTAAVLARSKKGGSPKTHVFVH  269

Query  438  DYNQKSDRIASEEFLCRENLVETKGMVGHFVVEVMDANNFNFC  310
            DY +  +R+  +EFLCRENLVE+  ++ H+V++ MD N+  FC
Sbjct  270  DYYRDVERLCGDEFLCRENLVESNELLAHYVLDKMDKNSTRFC  312



>gb|ADR31620.1| DUF579 protein [Populus trichocarpa]
Length=283

 Score =   321 bits (822),  Expect = 8e-105, Method: Compositional matrix adjust.
 Identities = 148/219 (68%), Positives = 179/219 (82%), Gaps = 1/219 (0%)
 Frame = -3

Query  1026  ASGGGGGATPALSKSIVRALVHYASISNNTDRMSYADIKQISDVLRQCGSHPCNFLVFGL  847
             AS    G    L  +++  L+HYAS SN++  MS+A+IK ISDVLR+C S PCNFLVFGL
Sbjct  64    ASSSTFGNNAPLPTTVINTLLHYASRSNDSFHMSHAEIKPISDVLRKCSS-PCNFLVFGL  122

Query  846   THETLLWRTLNHHGRTVFIDESRYYAAYVEEKYPEIEVYDVQYSTKLSEMKELISGVKEQ  667
             THET LW+ LNH+GRTVFI+E+RYYAAY EE +PEI+V+DVQY+TK+ EM+ELI+  KEQ
Sbjct  123   THETPLWKALNHNGRTVFIEENRYYAAYYEELHPEIDVFDVQYTTKMKEMRELIASTKEQ  182

Query  666   ARNECRPVQNLLFSECKLGLNDLPNQLYEVDWDVILVDGPRGYWPEAPGRMSAIFTAGVL  487
              +NECRPVQNLLFSECKLG+NDLPN +YEVDWDVIL+DGPRG  PE PGRM+ IFT+GVL
Sbjct  183   IKNECRPVQNLLFSECKLGINDLPNHVYEVDWDVILIDGPRGDGPEGPGRMTPIFTSGVL  242

Query  486   ARSKKGGNPKTHVLVHDYNQKSDRIASEEFLCRENLVET  370
             ARSKK  N KTH+ VHDY +  +RI  +EFLCRENLVE+
Sbjct  243   ARSKKASNAKTHIFVHDYYRNVERIYGDEFLCRENLVES  281



>gb|ADR31610.1| DUF579 protein [Populus trichocarpa]
Length=281

 Score =   321 bits (822),  Expect = 8e-105, Method: Compositional matrix adjust.
 Identities = 148/219 (68%), Positives = 179/219 (82%), Gaps = 1/219 (0%)
 Frame = -3

Query  1026  ASGGGGGATPALSKSIVRALVHYASISNNTDRMSYADIKQISDVLRQCGSHPCNFLVFGL  847
             AS    G    L  +++  L+HYAS SN++  MS+A+IK ISDVLR+C S PCNFLVFGL
Sbjct  64    ASSSTFGNNAPLPTTVINTLLHYASRSNDSFHMSHAEIKPISDVLRKCSS-PCNFLVFGL  122

Query  846   THETLLWRTLNHHGRTVFIDESRYYAAYVEEKYPEIEVYDVQYSTKLSEMKELISGVKEQ  667
             THET LW+ LNH+GRTVFI+E+RYYAAY EE +PEI+V+DVQY+TK+ EM+ELI+  KEQ
Sbjct  123   THETPLWKALNHNGRTVFIEENRYYAAYYEELHPEIDVFDVQYTTKMKEMRELIASTKEQ  182

Query  666   ARNECRPVQNLLFSECKLGLNDLPNQLYEVDWDVILVDGPRGYWPEAPGRMSAIFTAGVL  487
              +NECRPVQNLLFSECKLG+NDLPN +YEVDWDVIL+DGPRG  PE PGRM+ IFT+GVL
Sbjct  183   IKNECRPVQNLLFSECKLGINDLPNHVYEVDWDVILIDGPRGDGPEGPGRMTPIFTSGVL  242

Query  486   ARSKKGGNPKTHVLVHDYNQKSDRIASEEFLCRENLVET  370
             ARSKK  N KTH+ VHDY +  +RI  +EFLCRENLVE+
Sbjct  243   ARSKKASNAKTHIFVHDYYRNVERIYGDEFLCRENLVES  281



>gb|ADR31613.1| DUF579 protein [Populus trichocarpa]
 gb|ADR31617.1| DUF579 protein [Populus trichocarpa]
 gb|ADR31625.1| DUF579 protein [Populus trichocarpa]
 gb|ADR31626.1| DUF579 protein [Populus trichocarpa]
Length=282

 Score =   321 bits (822),  Expect = 8e-105, Method: Compositional matrix adjust.
 Identities = 148/219 (68%), Positives = 179/219 (82%), Gaps = 1/219 (0%)
 Frame = -3

Query  1026  ASGGGGGATPALSKSIVRALVHYASISNNTDRMSYADIKQISDVLRQCGSHPCNFLVFGL  847
             AS    G    L  +++  L+HYAS SN++  MS+A+IK ISDVLR+C S PCNFLVFGL
Sbjct  64    ASSSTFGNNAPLPTTVINTLLHYASRSNDSFHMSHAEIKPISDVLRKCSS-PCNFLVFGL  122

Query  846   THETLLWRTLNHHGRTVFIDESRYYAAYVEEKYPEIEVYDVQYSTKLSEMKELISGVKEQ  667
             THET LW+ LNH+GRTVFI+E+RYYAAY EE +PEI+V+DVQY+TK+ EM+ELI+  KEQ
Sbjct  123   THETPLWKALNHNGRTVFIEENRYYAAYYEELHPEIDVFDVQYTTKMKEMRELIASTKEQ  182

Query  666   ARNECRPVQNLLFSECKLGLNDLPNQLYEVDWDVILVDGPRGYWPEAPGRMSAIFTAGVL  487
              +NECRPVQNLLFSECKLG+NDLPN +YEVDWDVIL+DGPRG  PE PGRM+ IFT+GVL
Sbjct  183   IKNECRPVQNLLFSECKLGINDLPNHVYEVDWDVILIDGPRGDGPEGPGRMTPIFTSGVL  242

Query  486   ARSKKGGNPKTHVLVHDYNQKSDRIASEEFLCRENLVET  370
             ARSKK  N KTH+ VHDY +  +RI  +EFLCRENLVE+
Sbjct  243   ARSKKASNAKTHIFVHDYYRNVERIYGDEFLCRENLVES  281



>ref|XP_006346387.1| PREDICTED: protein IRX15-like [Solanum tuberosum]
Length=314

 Score =   322 bits (824),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 148/237 (62%), Positives = 191/237 (81%), Gaps = 4/237 (2%)
 Frame = -3

Query  1014  GGGATPALSKSIVRALVHYASISNNT--DRMSYADIKQISDVLRQCGSHPCNFLVFGLTH  841
               G++P L  ++  AL+HYAS++++T   RMS  ++K I++VLR+C + PCNFLVFGLTH
Sbjct  63    AAGSSP-LPATVFNALLHYASLNSSTVSSRMSAVELKTIANVLRRCKA-PCNFLVFGLTH  120

Query  840   ETLLWRTLNHHGRTVFIDESRYYAAYVEEKYPEIEVYDVQYSTKLSEMKELISGVKEQAR  661
             ETLLW +LNH GRTVF+DES Y  + +EEK+PEIE YDVQ++TK+SE+ +L+   KEQ R
Sbjct  121   ETLLWHSLNHKGRTVFVDESAYLVSKLEEKHPEIEAYDVQFTTKVSELHDLLDYTKEQLR  180

Query  660   NECRPVQNLLFSECKLGLNDLPNQLYEVDWDVILVDGPRGYWPEAPGRMSAIFTAGVLAR  481
              ECRPVQNLLFS+CKLG+NDLPN +Y+V WDVIL+DGPRG+   APGRM+AIFTAGV AR
Sbjct  181   GECRPVQNLLFSDCKLGINDLPNHIYDVPWDVILIDGPRGFSSAAPGRMTAIFTAGVFAR  240

Query  480   SKKGGNPKTHVLVHDYNQKSDRIASEEFLCRENLVETKGMVGHFVVEVMDANNFNFC  310
             SK+G + KTHV VH+ ++  ++I SEEFLC ENLVETK ++GHFVVE M+AN F FC
Sbjct  241   SKRGNSDKTHVFVHEIDRNVEKICSEEFLCSENLVETKELLGHFVVEKMEANRFEFC  297



>gb|ADR31612.1| DUF579 protein [Populus trichocarpa]
 gb|ADR31618.1| DUF579 protein [Populus trichocarpa]
 gb|ADR31627.1| DUF579 protein [Populus trichocarpa]
Length=283

 Score =   320 bits (821),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 148/219 (68%), Positives = 179/219 (82%), Gaps = 1/219 (0%)
 Frame = -3

Query  1026  ASGGGGGATPALSKSIVRALVHYASISNNTDRMSYADIKQISDVLRQCGSHPCNFLVFGL  847
             AS    G    L  +++  L+HYAS SN++  MS+A+IK ISDVLR+C S PCNFLVFGL
Sbjct  64    ASSSTFGNNAPLPTTVINTLLHYASRSNDSFHMSHAEIKPISDVLRKCSS-PCNFLVFGL  122

Query  846   THETLLWRTLNHHGRTVFIDESRYYAAYVEEKYPEIEVYDVQYSTKLSEMKELISGVKEQ  667
             THET LW+ LNH+GRTVFI+E+RYYAAY EE +PEI+V+DVQY+TK+ EM+ELI+  KEQ
Sbjct  123   THETPLWKALNHNGRTVFIEENRYYAAYYEELHPEIDVFDVQYTTKMKEMRELIASTKEQ  182

Query  666   ARNECRPVQNLLFSECKLGLNDLPNQLYEVDWDVILVDGPRGYWPEAPGRMSAIFTAGVL  487
              +NECRPVQNLLFSECKLG+NDLPN +YEVDWDVIL+DGPRG  PE PGRM+ IFT+GVL
Sbjct  183   IKNECRPVQNLLFSECKLGINDLPNHVYEVDWDVILIDGPRGDGPEGPGRMTPIFTSGVL  242

Query  486   ARSKKGGNPKTHVLVHDYNQKSDRIASEEFLCRENLVET  370
             ARSKK  N KTH+ VHDY +  +RI  +EFLCRENLVE+
Sbjct  243   ARSKKASNAKTHIFVHDYYRNVERIYGDEFLCRENLVES  281



>gb|ADR31629.1| DUF579 protein [Populus trichocarpa]
Length=277

 Score =   315 bits (806),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 145/215 (67%), Positives = 175/215 (81%), Gaps = 1/215 (0%)
 Frame = -3

Query  1026  ASGGGGGATPALSKSIVRALVHYASISNNTDRMSYADIKQISDVLRQCGSHPCNFLVFGL  847
             AS    G    L  +++  L+HYAS SN++  MS+A+IK ISDVLR+C S PCNFLVFGL
Sbjct  64    ASSSTFGNNAPLPTTVINTLLHYASRSNDSFHMSHAEIKPISDVLRKCSS-PCNFLVFGL  122

Query  846   THETLLWRTLNHHGRTVFIDESRYYAAYVEEKYPEIEVYDVQYSTKLSEMKELISGVKEQ  667
             THET LW+ LNH+GRTVFI+E+RYYAAY EE +PEI+V+DVQY+TK+ EM+ELI+  KEQ
Sbjct  123   THETPLWKALNHNGRTVFIEENRYYAAYYEELHPEIDVFDVQYTTKMKEMRELIASTKEQ  182

Query  666   ARNECRPVQNLLFSECKLGLNDLPNQLYEVDWDVILVDGPRGYWPEAPGRMSAIFTAGVL  487
              +NECRPVQNLLFSECKLG+NDLPN +YEVDWDVIL+DGPRG  PE PGRM+ IFT+GVL
Sbjct  183   IKNECRPVQNLLFSECKLGINDLPNHVYEVDWDVILIDGPRGDGPEGPGRMTPIFTSGVL  242

Query  486   ARSKKGGNPKTHVLVHDYNQKSDRIASEEFLCREN  382
             ARSKK  N KTH+ VHDY +  +RI  +EFLCREN
Sbjct  243   ARSKKASNAKTHIFVHDYYRNVERIYGDEFLCREN  277



>gb|KDP24994.1| hypothetical protein JCGZ_23977 [Jatropha curcas]
Length=318

 Score =   315 bits (807),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 144/232 (62%), Positives = 185/232 (80%), Gaps = 5/232 (2%)
 Frame = -3

Query  993  LSKSIVRALVHYASISNNTD-RMSYADIKQISDVLRQCGSHPCNFLVFGLTHETLLWRTL  817
            L  S+  AL+HY S SN+T+  +++A++  I+  L++C   PCNFLVFGLTHETLLW++L
Sbjct  66   LPLSVTTALLHYTSTSNSTNPHLTFAELSAIAAALQRCS--PCNFLVFGLTHETLLWKSL  123

Query  816  NHHGRTVFIDESRYYAAYVEEKYPEIEVYDVQYSTKLSEMKELISGVKEQARNECRPVQN  637
            N HGRT+F+DES YY +  E+ +PEIE YD+QY+TK+SEM EL+S  K Q ++EC+PVQN
Sbjct  124  NFHGRTIFLDESEYYVSNFEKNHPEIEAYDIQYTTKVSEMAELLSVTKSQVKDECKPVQN  183

Query  636  LLFSECKLGLNDLPNQLYEVDWDVILVDGPRGYWPEAPGRMSAIFTAGVLARSKKGGNPK  457
            LLFS+CKLG+ND+PN +YEV WDVILVDGPRGY+  APGRMS IFTA VLARSKKGG+ K
Sbjct  184  LLFSDCKLGINDMPNHIYEVSWDVILVDGPRGYFAAAPGRMSPIFTASVLARSKKGGDTK  243

Query  456  THVLVHDYNQKSDRIASEEFLCRENLVETKGMVGHFVVEVMDANN--FNFCR  307
            THV VH+ N++ +R+ S+EFLC ENLVET   +GHFVVE M+AN+  F FC 
Sbjct  244  THVFVHEINREVERVFSDEFLCEENLVETVDSLGHFVVERMEANDNSFEFCE  295



>ref|XP_004230754.1| PREDICTED: protein IRX15-LIKE-like [Solanum lycopersicum]
Length=314

 Score =   315 bits (806),  Expect = 6e-102, Method: Compositional matrix adjust.
 Identities = 145/237 (61%), Positives = 189/237 (80%), Gaps = 4/237 (2%)
 Frame = -3

Query  1014  GGGATPALSKSIVRALVHYASISNNT--DRMSYADIKQISDVLRQCGSHPCNFLVFGLTH  841
               G++P L  ++   L++YAS++++T   RMS  ++K I+ VLR+C + PCNFLVFGLTH
Sbjct  63    AAGSSP-LPAAVFNTLLYYASLNSSTVSSRMSAVELKSIATVLRRCKA-PCNFLVFGLTH  120

Query  840   ETLLWRTLNHHGRTVFIDESRYYAAYVEEKYPEIEVYDVQYSTKLSEMKELISGVKEQAR  661
             ETLLW +LNH GRTVF+DES Y  + +EEK+PEIE YDVQ++TK+SE+ +L+   KEQ +
Sbjct  121   ETLLWHSLNHKGRTVFVDESAYLVSKLEEKHPEIEAYDVQFTTKVSELHDLLDYTKEQLK  180

Query  660   NECRPVQNLLFSECKLGLNDLPNQLYEVDWDVILVDGPRGYWPEAPGRMSAIFTAGVLAR  481
              ECRPVQNLLFS+CKLG+NDLPN +Y+V WDVIL+DGPRG+   APGRMSAI+TAGV AR
Sbjct  181   GECRPVQNLLFSDCKLGINDLPNHIYDVPWDVILIDGPRGFSSAAPGRMSAIYTAGVFAR  240

Query  480   SKKGGNPKTHVLVHDYNQKSDRIASEEFLCRENLVETKGMVGHFVVEVMDANNFNFC  310
             SK+G + KTHV VH+ ++  ++I SEEFLC ENLVETK ++GHFVVE M+AN F FC
Sbjct  241   SKRGNSGKTHVFVHEIDRNVEKICSEEFLCSENLVETKELLGHFVVEKMEANRFEFC  297



>ref|XP_009784046.1| PREDICTED: protein IRX15-LIKE-like [Nicotiana sylvestris]
Length=311

 Score =   313 bits (803),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 144/230 (63%), Positives = 183/230 (80%), Gaps = 3/230 (1%)
 Frame = -3

Query  993  LSKSIVRALVHYASISNNT--DRMSYADIKQISDVLRQCGSHPCNFLVFGLTHETLLWRT  820
            L  ++  AL+HYAS++++T   RMS  ++  I+ VLR C   PCNFLVFGLTHETLLW +
Sbjct  70   LPATVFDALIHYASVNSSTVSSRMSAVELNTIAAVLRGC-KKPCNFLVFGLTHETLLWHS  128

Query  819  LNHHGRTVFIDESRYYAAYVEEKYPEIEVYDVQYSTKLSEMKELISGVKEQARNECRPVQ  640
            LNH+GRTVF+DES Y  + +EEK+P IE YDVQ++TK+SE+ +L+   KEQ + ECRPVQ
Sbjct  129  LNHNGRTVFVDESAYLVSKLEEKHPGIEAYDVQFTTKVSELHDLLDYTKEQLKGECRPVQ  188

Query  639  NLLFSECKLGLNDLPNQLYEVDWDVILVDGPRGYWPEAPGRMSAIFTAGVLARSKKGGNP  460
            NLLFS+CKLG+NDLPN +Y+V WDVIL+DGPRG+   APGRM+AIFTAGV ARSKKG   
Sbjct  189  NLLFSDCKLGINDLPNHIYDVAWDVILIDGPRGFSSSAPGRMTAIFTAGVFARSKKGSAT  248

Query  459  KTHVLVHDYNQKSDRIASEEFLCRENLVETKGMVGHFVVEVMDANNFNFC  310
            KTHV VH+ +++ +RI SEEFLC ENLVETK ++GHFVV+ M+AN F FC
Sbjct  249  KTHVFVHEIDREVERICSEEFLCGENLVETKELLGHFVVDKMEANRFEFC  298



>ref|XP_002518716.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF43641.1| conserved hypothetical protein [Ricinus communis]
Length=322

 Score =   308 bits (790),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 139/226 (62%), Positives = 178/226 (79%), Gaps = 2/226 (1%)
 Frame = -3

Query  981  IVRALVHYASISNNTD-RMSYADIKQISDVLRQCGSHPCNFLVFGLTHETLLWRTLNHHG  805
            +  AL+HYAS SN T   MS A++  I+  L  C S PCNFLVFGLTHETLLW++LN HG
Sbjct  71   VTTALLHYASTSNTTTPHMSSAELSTIASTLHHC-SPPCNFLVFGLTHETLLWKSLNFHG  129

Query  804  RTVFIDESRYYAAYVEEKYPEIEVYDVQYSTKLSEMKELISGVKEQARNECRPVQNLLFS  625
            RT+F+DES YY +  E+ +PEIE YD+QY+TK+SEM +L+S  + Q ++EC+PVQNLLFS
Sbjct  130  RTIFLDESEYYVSNFEKIHPEIEAYDIQYTTKVSEMNDLLSVAQAQVKDECKPVQNLLFS  189

Query  624  ECKLGLNDLPNQLYEVDWDVILVDGPRGYWPEAPGRMSAIFTAGVLARSKKGGNPKTHVL  445
            +CKLG+ND+PN +YEV WDVIL+DGPRGY+  APGRMS IFTA V+ARSK+GG+  THV 
Sbjct  190  DCKLGINDMPNHIYEVAWDVILIDGPRGYFAAAPGRMSPIFTASVMARSKRGGDKTTHVF  249

Query  444  VHDYNQKSDRIASEEFLCRENLVETKGMVGHFVVEVMDANNFNFCR  307
            VH+Y+++ +R  S+EFLC ENLVET   +GHFVVE M+ N+F FC 
Sbjct  250  VHEYDREVERTFSDEFLCDENLVETVDSLGHFVVEKMEGNSFEFCE  295



>ref|XP_009592679.1| PREDICTED: protein IRX15-LIKE-like [Nicotiana tomentosiformis]
Length=316

 Score =   308 bits (789),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 141/230 (61%), Positives = 185/230 (80%), Gaps = 3/230 (1%)
 Frame = -3

Query  993  LSKSIVRALVHYASISNNT--DRMSYADIKQISDVLRQCGSHPCNFLVFGLTHETLLWRT  820
            L  ++  AL++YAS++++T   RMS  ++  I+DVLR+C   PCNFLVFGLTHETLLW +
Sbjct  70   LPAAVFDALLYYASVNSSTVSSRMSPVELNTIADVLRRC-KKPCNFLVFGLTHETLLWHS  128

Query  819  LNHHGRTVFIDESRYYAAYVEEKYPEIEVYDVQYSTKLSEMKELISGVKEQARNECRPVQ  640
            LNH+GRTVF+DES Y  + +EEK+P IE YDVQ++TK+SE+ +L+   K+Q + ECRPVQ
Sbjct  129  LNHNGRTVFVDESAYLVSKLEEKHPGIEAYDVQFTTKVSELHDLLDYTKDQLKGECRPVQ  188

Query  639  NLLFSECKLGLNDLPNQLYEVDWDVILVDGPRGYWPEAPGRMSAIFTAGVLARSKKGGNP  460
            NLLFS+CKLG+NDLPN +Y+V WDVIL+DGPRG+   APGRM+AI+T GVLARSKKG   
Sbjct  189  NLLFSDCKLGINDLPNHIYDVAWDVILIDGPRGFSSSAPGRMTAIYTTGVLARSKKGSVS  248

Query  459  KTHVLVHDYNQKSDRIASEEFLCRENLVETKGMVGHFVVEVMDANNFNFC  310
            KTHV VH+ +++ +RI SEEFLC ENLVETK ++GHF+V+ M+AN F FC
Sbjct  249  KTHVFVHEIDREVERICSEEFLCGENLVETKELLGHFIVDKMEANRFEFC  298



>gb|ADR31621.1| DUF579 protein [Populus trichocarpa]
Length=242

 Score =   304 bits (779),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 140/210 (67%), Positives = 170/210 (81%), Gaps = 1/210 (0%)
 Frame = -3

Query  1026  ASGGGGGATPALSKSIVRALVHYASISNNTDRMSYADIKQISDVLRQCGSHPCNFLVFGL  847
             AS    G    L  +++  L+HYAS SN++  MS+A+IK ISDVLR+C S PCNFLVFGL
Sbjct  34    ASSSTFGNNAPLPTTVINTLLHYASRSNDSFHMSHAEIKPISDVLRKCSS-PCNFLVFGL  92

Query  846   THETLLWRTLNHHGRTVFIDESRYYAAYVEEKYPEIEVYDVQYSTKLSEMKELISGVKEQ  667
             THET LW+ LNH+GRTVFI+E+RYYAAY EE +PEI+V+DVQY+TK+ EM+ELI+  KEQ
Sbjct  93    THETPLWKALNHNGRTVFIEENRYYAAYYEELHPEIDVFDVQYTTKMKEMRELIASTKEQ  152

Query  666   ARNECRPVQNLLFSECKLGLNDLPNQLYEVDWDVILVDGPRGYWPEAPGRMSAIFTAGVL  487
              +NECRPVQNLLFSECKLG+NDLPN +YEVDWDVIL+DGPRG  PE PGRM+ IFT+GVL
Sbjct  153   IKNECRPVQNLLFSECKLGINDLPNHVYEVDWDVILIDGPRGDGPEGPGRMTPIFTSGVL  212

Query  486   ARSKKGGNPKTHVLVHDYNQKSDRIASEEF  397
             ARSKK  N KTH+ VHDY +  +RI  +EF
Sbjct  213   ARSKKASNAKTHIFVHDYYRNVERIYGDEF  242



>gb|ADR31611.1| DUF579 protein [Populus trichocarpa]
Length=263

 Score =   303 bits (777),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 140/210 (67%), Positives = 170/210 (81%), Gaps = 1/210 (0%)
 Frame = -3

Query  1026  ASGGGGGATPALSKSIVRALVHYASISNNTDRMSYADIKQISDVLRQCGSHPCNFLVFGL  847
             AS    G    L  +++  L+HYAS SN++  MS+A+IK ISDVLR+C S PCNFLVFGL
Sbjct  55    ASSSTFGNNAPLPTTVINTLLHYASRSNDSFHMSHAEIKPISDVLRKCSS-PCNFLVFGL  113

Query  846   THETLLWRTLNHHGRTVFIDESRYYAAYVEEKYPEIEVYDVQYSTKLSEMKELISGVKEQ  667
             THET LW+ LNH+GRTVFI+E+RYYAAY EE +PEI+V+DVQY+TK+ EM+ELI+  KEQ
Sbjct  114   THETPLWKALNHNGRTVFIEENRYYAAYYEELHPEIDVFDVQYTTKMKEMRELIASTKEQ  173

Query  666   ARNECRPVQNLLFSECKLGLNDLPNQLYEVDWDVILVDGPRGYWPEAPGRMSAIFTAGVL  487
              +NECRPVQNLLFSECKLG+NDLPN +YEVDWDVIL+DGPRG  PE PGRM+ IFT+GVL
Sbjct  174   IKNECRPVQNLLFSECKLGINDLPNHVYEVDWDVILIDGPRGDGPEGPGRMTPIFTSGVL  233

Query  486   ARSKKGGNPKTHVLVHDYNQKSDRIASEEF  397
             ARSKK  N KTH+ VHDY +  +RI  +EF
Sbjct  234   ARSKKASNAKTHIFVHDYYRNVERIYGDEF  263



>gb|ADR31614.1| DUF579 protein [Populus trichocarpa]
 gb|ADR31615.1| DUF579 protein [Populus trichocarpa]
 gb|ADR31619.1| DUF579 protein [Populus trichocarpa]
 gb|ADR31623.1| DUF579 protein [Populus trichocarpa]
 gb|ADR31624.1| DUF579 protein [Populus trichocarpa]
 gb|ADR31628.1| DUF579 protein [Populus trichocarpa]
Length=272

 Score =   304 bits (778),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 140/210 (67%), Positives = 170/210 (81%), Gaps = 1/210 (0%)
 Frame = -3

Query  1026  ASGGGGGATPALSKSIVRALVHYASISNNTDRMSYADIKQISDVLRQCGSHPCNFLVFGL  847
             AS    G    L  +++  L+HYAS SN++  MS+A+IK ISDVLR+C S PCNFLVFGL
Sbjct  64    ASSSTFGNNAPLPTTVINTLLHYASRSNDSFHMSHAEIKPISDVLRKCSS-PCNFLVFGL  122

Query  846   THETLLWRTLNHHGRTVFIDESRYYAAYVEEKYPEIEVYDVQYSTKLSEMKELISGVKEQ  667
             THET LW+ LNH+GRTVFI+E+RYYAAY EE +PEI+V+DVQY+TK+ EM+ELI+  KEQ
Sbjct  123   THETPLWKALNHNGRTVFIEENRYYAAYYEELHPEIDVFDVQYTTKMKEMRELIASTKEQ  182

Query  666   ARNECRPVQNLLFSECKLGLNDLPNQLYEVDWDVILVDGPRGYWPEAPGRMSAIFTAGVL  487
              +NECRPVQNLLFSECKLG+NDLPN +YEVDWDVIL+DGPRG  PE PGRM+ IFT+GVL
Sbjct  183   IKNECRPVQNLLFSECKLGINDLPNHVYEVDWDVILIDGPRGDGPEGPGRMTPIFTSGVL  242

Query  486   ARSKKGGNPKTHVLVHDYNQKSDRIASEEF  397
             ARSKK  N KTH+ VHDY +  +RI  +EF
Sbjct  243   ARSKKASNAKTHIFVHDYYRNVERIYGDEF  272



>gb|ADR31616.1| DUF579 protein [Populus trichocarpa]
Length=263

 Score =   303 bits (777),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 140/210 (67%), Positives = 170/210 (81%), Gaps = 1/210 (0%)
 Frame = -3

Query  1026  ASGGGGGATPALSKSIVRALVHYASISNNTDRMSYADIKQISDVLRQCGSHPCNFLVFGL  847
             AS    G    L  +++  L+HYAS SN++  MS+A+IK ISDVLR+C S PCNFLVFGL
Sbjct  55    ASSSTFGNNAPLPTTVINTLLHYASRSNDSFHMSHAEIKPISDVLRKCSS-PCNFLVFGL  113

Query  846   THETLLWRTLNHHGRTVFIDESRYYAAYVEEKYPEIEVYDVQYSTKLSEMKELISGVKEQ  667
             THET LW+ LNH+GRTVFI+E+RYYAAY EE +PEI+V+DVQY+TK+ EM+ELI+  KEQ
Sbjct  114   THETPLWKALNHNGRTVFIEENRYYAAYYEELHPEIDVFDVQYTTKMKEMRELIASTKEQ  173

Query  666   ARNECRPVQNLLFSECKLGLNDLPNQLYEVDWDVILVDGPRGYWPEAPGRMSAIFTAGVL  487
              +NECRPVQNLLFSECKLG+NDLPN +YEVDWDVIL+DGPRG  PE PGRM+ IFT+GVL
Sbjct  174   IKNECRPVQNLLFSECKLGINDLPNHVYEVDWDVILIDGPRGDGPEGPGRMTPIFTSGVL  233

Query  486   ARSKKGGNPKTHVLVHDYNQKSDRIASEEF  397
             ARSKK  N KTH+ VHDY +  +RI  +EF
Sbjct  234   ARSKKASNAKTHIFVHDYYRNVERIYGDEF  263



>ref|XP_011088226.1| PREDICTED: protein IRREGULAR XYLEM 15-like [Sesamum indicum]
Length=315

 Score =   301 bits (771),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 141/236 (60%), Positives = 181/236 (77%), Gaps = 5/236 (2%)
 Frame = -3

Query  1005  ATPALSKSIVRALVHYAS--ISNNTDRMSYADIKQISDVLRQCGSHPCNFLVFGLTHETL  832
             A   L + +  AL+HYAS  I+++  RMS+A++K ++  LR+C + PCNFLVFGLTHETL
Sbjct  69    AKSQLPRPVFDALLHYASENITSSAGRMSFAEVKSVAASLRRCAT-PCNFLVFGLTHETL  127

Query  831   LWRTLNHHGRTVFIDESRYYAAYVEEKYPEIEVYDVQYSTKLSEMKELISGVKEQARNEC  652
             LW +LNH+GRTVF+DES Y  + +EEKYP +E YDVQ++TK++E+ +LI   K Q  NEC
Sbjct  128   LWNSLNHNGRTVFVDESSYLISKLEEKYPPLEAYDVQFTTKVNELYDLIEHYKSQVTNEC  187

Query  651   RPVQNLLFSECKLGLNDLPNQLYEVDWDVILVDGPRGYWPEAPGRMSAIFTAGVLARSKK  472
             RPVQNLLFS+CKL +NDLPN +Y+V WDVIL+DGPRGY    PGRM AIFTAGVLARSK+
Sbjct  188   RPVQNLLFSDCKLAINDLPNHIYDVAWDVILIDGPRGYSSTTPGRMGAIFTAGVLARSKR  247

Query  471   GGNPKTHVLVHDYNQKSDRIASEEFLCRENLVETKGMVGHFVVEVMDA--NNFNFC  310
             GG  +THV VH+  ++ +R+ S+EFLC ENLVETK  +GHFVV  M+   N F FC
Sbjct  248   GGAAETHVFVHEIEREVERVCSDEFLCGENLVETKESLGHFVVGKMEGNRNRFGFC  303



>ref|XP_002298736.2| hypothetical protein POPTR_0001s31000g [Populus trichocarpa]
 gb|EEE83541.2| hypothetical protein POPTR_0001s31000g [Populus trichocarpa]
Length=372

 Score =   301 bits (772),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 134/226 (59%), Positives = 178/226 (79%), Gaps = 2/226 (1%)
 Frame = -3

Query  981  IVRALVHYASISN-NTDRMSYADIKQISDVLRQCGSHPCNFLVFGLTHETLLWRTLNHHG  805
            I  AL+HYA+ +N  T  MS A++  I+  L+ C  H CNFL+FGLTHETLLW++LN HG
Sbjct  120  ITAALLHYATTTNITTPHMSSAELSTIAITLQHCSPH-CNFLIFGLTHETLLWKSLNFHG  178

Query  804  RTVFIDESRYYAAYVEEKYPEIEVYDVQYSTKLSEMKELISGVKEQARNECRPVQNLLFS  625
            RTVF+DES Y  +  E+ +P+IE YD+Q++TK+S+M +L+   K +   ECRPVQNLLFS
Sbjct  179  RTVFLDESEYLVSNFEKNHPDIEAYDIQFTTKVSQMSDLLLVTKGKVNGECRPVQNLLFS  238

Query  624  ECKLGLNDLPNQLYEVDWDVILVDGPRGYWPEAPGRMSAIFTAGVLARSKKGGNPKTHVL  445
            +CKLG+ND+PN +YE+ WDVIL+DGPRGY+  APGRMS IFTA VLARS +GGN KTHV 
Sbjct  239  DCKLGINDMPNHIYEITWDVILIDGPRGYFAAAPGRMSPIFTASVLARSSRGGNKKTHVF  298

Query  444  VHDYNQKSDRIASEEFLCRENLVETKGMVGHFVVEVMDANNFNFCR  307
            VH++N++ +R+ SEEFLC+E+LVET   +GHFV+E M+AN+F FC+
Sbjct  299  VHEFNREVERVYSEEFLCKESLVETVDSLGHFVLERMEANSFEFCK  344



>ref|XP_011000138.1| PREDICTED: protein IRX15-LIKE-like [Populus euphratica]
Length=321

 Score =   299 bits (766),  Expect = 6e-96, Method: Compositional matrix adjust.
 Identities = 136/227 (60%), Positives = 179/227 (79%), Gaps = 2/227 (1%)
 Frame = -3

Query  984  SIVRALVHYASISN-NTDRMSYADIKQISDVLRQCGSHPCNFLVFGLTHETLLWRTLNHH  808
            SI  AL+HYAS +N  T  MS A++  I+  L+ C  H CNFL+FGLTHETLLW++LN +
Sbjct  68   SITAALLHYASTTNITTPHMSSAELSTIAITLQHCSPH-CNFLIFGLTHETLLWKSLNFN  126

Query  807  GRTVFIDESRYYAAYVEEKYPEIEVYDVQYSTKLSEMKELISGVKEQARNECRPVQNLLF  628
            GRTVF+DES Y  +  E+ +P+IE YD+Q++TK+SEM +L+   K +   ECRPVQNLLF
Sbjct  127  GRTVFLDESEYLVSNFEKNHPDIEAYDIQFTTKVSEMCDLLLVTKGKVNGECRPVQNLLF  186

Query  627  SECKLGLNDLPNQLYEVDWDVILVDGPRGYWPEAPGRMSAIFTAGVLARSKKGGNPKTHV  448
            S+CKLG+ND+PN +YE+ WDVIL+DGPRGY+  APGRMS IFTA VLARS +GGN KTHV
Sbjct  187  SDCKLGINDMPNHIYEITWDVILIDGPRGYFAAAPGRMSPIFTASVLARSSRGGNKKTHV  246

Query  447  LVHDYNQKSDRIASEEFLCRENLVETKGMVGHFVVEVMDANNFNFCR  307
             VH++N++ +R+ SEEFLC+E+LVET   +GHFV+E M+A++F FCR
Sbjct  247  FVHEFNREVERVYSEEFLCKESLVETVDSLGHFVLERMEADSFEFCR  293



>ref|XP_011000888.1| PREDICTED: protein IRX15-LIKE-like [Populus euphratica]
Length=321

 Score =   299 bits (765),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 135/226 (60%), Positives = 176/226 (78%), Gaps = 2/226 (1%)
 Frame = -3

Query  981  IVRALVHYASISNNTD-RMSYADIKQISDVLRQCGSHPCNFLVFGLTHETLLWRTLNHHG  805
            I  AL+HYAS +N+T   MS A++  I+  L+ C  H CNFLVFGLTHETLLW++LN HG
Sbjct  69   ITAALLHYASTANSTTPHMSSAELSTIATTLQNCSPH-CNFLVFGLTHETLLWKSLNFHG  127

Query  804  RTVFIDESRYYAAYVEEKYPEIEVYDVQYSTKLSEMKELISGVKEQARNECRPVQNLLFS  625
            RT+F+DES Y+ +  E+ +P+IE YD+Q+++K+SEM +L+   K Q   +CRPVQNLLFS
Sbjct  128  RTIFLDESEYFVSNFEKNHPDIEAYDIQFTSKVSEMSDLLLVTKGQVNGDCRPVQNLLFS  187

Query  624  ECKLGLNDLPNQLYEVDWDVILVDGPRGYWPEAPGRMSAIFTAGVLARSKKGGNPKTHVL  445
            +CKLG+ND+PN +YE+ WDVIL+DGPRGY+  APGRMS IFTA VLARSK+GGN KTHV 
Sbjct  188  DCKLGINDMPNHIYEISWDVILIDGPRGYFAAAPGRMSPIFTAAVLARSKRGGNKKTHVF  247

Query  444  VHDYNQKSDRIASEEFLCRENLVETKGMVGHFVVEVMDANNFNFCR  307
            VH+ +++ + I SEEFLC ENLVET   +GHFV+E  +AN F FC+
Sbjct  248  VHEIDREVEGIYSEEFLCEENLVETIDSLGHFVLERKEANCFEFCK  293



>gb|EYU37651.1| hypothetical protein MIMGU_mgv1a010254mg [Erythranthe guttata]
Length=318

 Score =   290 bits (741),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 135/231 (58%), Positives = 175/231 (76%), Gaps = 4/231 (2%)
 Frame = -3

Query  993  LSKSIVRALVHYASI-SNNTDRMSYADIKQISDVLRQCGSHPCNFLVFGLTHETLLWRTL  817
            L   +  AL+HYA+  + ++ RMS  ++  I+ VLR C + PCN LVFGLTHETLLW++L
Sbjct  75   LPDPVFDALLHYAAANATSSGRMSSVEMSHIASVLRGCAA-PCNLLVFGLTHETLLWKSL  133

Query  816  NHHGRTVFIDESRYYAAYVEEKYPEIEVYDVQYSTKLSEMKELISGVKEQARNECRPVQN  637
            NH GRTVF+DES Y  + +EEK+P IE YDVQ++TK+SE+ +LI   K +   ECRPVQN
Sbjct  134  NHKGRTVFVDESAYLISKLEEKHPSIEAYDVQFTTKVSELYDLIEHYKGEVTKECRPVQN  193

Query  636  LLFSECKLGLNDLPNQLYEVDWDVILVDGPRGYWPEAPGRMSAIFTAGVLARSKKGGNPK  457
            LLFS+CKL +NDLPN +Y+V WD ILVDGPRGY   APGRM A+FTAGVLARSK+GG  +
Sbjct  194  LLFSDCKLAINDLPNHIYDVAWDAILVDGPRGYSGAAPGRMMAVFTAGVLARSKRGGARE  253

Query  456  THVLVHDYNQKSDRIASEEFLCRENLVETKGMVGHFVVEVMDAN--NFNFC  310
            THV VH++ ++ +R+ S+EFLCRENLVE K  +GHFV+  M+A+   F FC
Sbjct  254  THVFVHEFEREVERVCSDEFLCRENLVEVKDSLGHFVIGKMEADRRRFGFC  304



>ref|XP_008236563.1| PREDICTED: protein IRX15-LIKE-like [Prunus mume]
Length=322

 Score =   289 bits (740),  Expect = 7e-92, Method: Compositional matrix adjust.
 Identities = 138/238 (58%), Positives = 175/238 (74%), Gaps = 5/238 (2%)
 Frame = -3

Query  1005  ATPALSKSIVRALVHYASISN--NTDRMSYADIKQISDVLRQCGSHPCNFLVFGLTHETL  832
             +T  L   I+ AL+HYA++SN  +T  MS  +I  IS  L    +  CNFL+FGLTHE+L
Sbjct  71    STIPLQPPILDALLHYATLSNTSSTPHMSAPEITTISSTLTSLCAPTCNFLIFGLTHESL  130

Query  831   LWRTLNHHGRTVFIDESRYYAAYVEEKYPE--IEVYDVQYSTKLSEMKELISGVKEQARN  658
             L+  LN +GRTVF+DES +  +  E+ +P    E YDV Y+T++ E K+L+S  + Q +N
Sbjct  131   LYLALNLNGRTVFLDESEFLVSRFEQSHPHHTPEAYDVSYTTQVKEHKQLLSTTRSQVKN  190

Query  657   ECRPVQNLLFSECKLGLNDLPNQLYEVDWDVILVDGPRGYWPEAPGRMSAIFTAGVLARS  478
             ECRPVQNLLFS+CK+G+NDLPN +Y+V WDVILVDGPRGY P APGRMSAIFTAGV ARS
Sbjct  191   ECRPVQNLLFSDCKIGINDLPNHIYQVPWDVILVDGPRGYSPAAPGRMSAIFTAGVFARS  250

Query  477   KKGGNPKTHVLVHDYNQKSDRIASEEFLCRENLVETKGMVGHFVVEVM-DANNFNFCR  307
             K+GG   THV VHD N++ +R+ S+EFLCRENLVE    +GHFVVE M D N+F FCR
Sbjct  251   KRGGRATTHVFVHDLNREVERVFSDEFLCRENLVEAVDSLGHFVVEKMEDHNSFKFCR  308



>ref|XP_002313132.2| hypothetical protein POPTR_0009s10160g [Populus trichocarpa]
 gb|EEE87087.2| hypothetical protein POPTR_0009s10160g [Populus trichocarpa]
Length=289

 Score =   288 bits (736),  Expect = 8e-92, Method: Compositional matrix adjust.
 Identities = 130/220 (59%), Positives = 171/220 (78%), Gaps = 2/220 (1%)
 Frame = -3

Query  981  IVRALVHYASISNNTD-RMSYADIKQISDVLRQCGSHPCNFLVFGLTHETLLWRTLNHHG  805
            I  AL+HYAS +N+T   MS A++  I   L+ C  H CNFLVFGLTHETLLW++LN HG
Sbjct  69   ITAALLHYASTANSTTPHMSSAELSTIVTTLQNCSPH-CNFLVFGLTHETLLWKSLNFHG  127

Query  804  RTVFIDESRYYAAYVEEKYPEIEVYDVQYSTKLSEMKELISGVKEQARNECRPVQNLLFS  625
            RT+F+DES Y+ +  E+ +P+IE YD+Q+++K+SEM +L+   K Q   +CRPVQNLLFS
Sbjct  128  RTIFLDESEYFVSNFEKDHPDIEAYDIQFTSKVSEMSDLLLVTKGQVNGDCRPVQNLLFS  187

Query  624  ECKLGLNDLPNQLYEVDWDVILVDGPRGYWPEAPGRMSAIFTAGVLARSKKGGNPKTHVL  445
            +CKLG+ND+PN +YE+ WDVIL+DGPRGY+  APGRMS IFTA V+ARSK+GGN KTHV 
Sbjct  188  DCKLGINDMPNHIYEISWDVILIDGPRGYFAAAPGRMSPIFTAAVMARSKRGGNKKTHVF  247

Query  444  VHDYNQKSDRIASEEFLCRENLVETKGMVGHFVVEVMDAN  325
            VH+ +++ + + SEEFLC ENLVET   +GHFV+E  +AN
Sbjct  248  VHEIDREVEGVYSEEFLCEENLVETIDSLGHFVLERKEAN  287



>emb|CDO97204.1| unnamed protein product [Coffea canephora]
Length=325

 Score =   286 bits (732),  Expect = 9e-91, Method: Compositional matrix adjust.
 Identities = 135/233 (58%), Positives = 177/233 (76%), Gaps = 5/233 (2%)
 Frame = -3

Query  993  LSKSIVRALVHYASISNNT--DRMSYADIKQISDVLRQCGSH--PCNFLVFGLTHETLLW  826
            L + +  AL+HYAS++ +    R S +++  ++ VLR+C S+  PCN LVFGLTHETLLW
Sbjct  71   LPRPVFDALLHYASVNYSAVGSRFSASELAAVAAVLRRCNSNAAPCNLLVFGLTHETLLW  130

Query  825  RTLNHHGRTVFIDESRYYAAYVEEKYPEIEVYDVQYSTKLSEMKELISGVKEQARNECRP  646
             +LN+ GRTV + ++ Y+   +E+++PEIE YDVQ++TK+SE+ EL+   KEQ +NECRP
Sbjct  131  NSLNYKGRTVIVGDNDYFVTRLEQRHPEIEAYDVQFTTKVSELYELLEYSKEQLKNECRP  190

Query  645  VQNLLFSECKLGLNDLPNQLYEVDWDVILVDGPRGYWPEAPGRMSAIFTAGVLARSKKGG  466
            VQNLLFS+CKL +NDLPNQ+Y+V WDVIL+DGP G+ P APGRMSAIFTAGVLARSKK  
Sbjct  191  VQNLLFSDCKLAINDLPNQIYDVAWDVILIDGPFGFLPTAPGRMSAIFTAGVLARSKKAS  250

Query  465  NPKTHVLVHDYNQKSDRIASEEFLCRENLVETKGMVGHFVVEVMDANN-FNFC  310
              KT V VH+ N++ +R+ SEEFLCRENLVET   +GHF V   +AN  F FC
Sbjct  251  AGKTDVFVHECNREVERVCSEEFLCRENLVETIDALGHFQVGETEANKRFQFC  303



>ref|XP_010107856.1| hypothetical protein L484_027443 [Morus notabilis]
 gb|EXC17256.1| hypothetical protein L484_027443 [Morus notabilis]
Length=335

 Score =   286 bits (733),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 138/236 (58%), Positives = 179/236 (76%), Gaps = 9/236 (4%)
 Frame = -3

Query  993  LSKSIVRALVHYASISNNTD-------RMSYADIKQISDVLRQCGSHPCNFLVFGLTHET  835
            L  S+  AL+HYAS++N++         MS A+++ I+  LR C S  CNFL+FGLTHE+
Sbjct  76   LPPSVADALLHYASLANSSAAGAASGGHMSSAEVESIAAALRHC-SPACNFLIFGLTHES  134

Query  834  LLWRTLNHHGRTVFIDESRYYAAYVEEKYPEIEVYDVQYSTKLSEMKELISGVKEQARNE  655
            LLW+ LNH+G +VF+DES +  +  E+ +P IE YDVQY+TK+ +  EL+S  K Q ++E
Sbjct  135  LLWQALNHNGCSVFLDESEFLVSRFEQSHPGIEAYDVQYTTKVKDFPELLSAAKSQVKDE  194

Query  654  CRPVQNLLFSECKLGLNDLPNQLYEVDWDVILVDGPRGYWPEAPGRMSAIFTAGVLARSK  475
            CRPVQNLLFS+CKLG+NDLPN +Y+V WDVILVDGPRGY+P APGRMSAIFTAGVL+RSK
Sbjct  195  CRPVQNLLFSDCKLGINDLPNHIYQVPWDVILVDGPRGYFPAAPGRMSAIFTAGVLSRSK  254

Query  474  KGGN-PKTHVLVHDYNQKSDRIASEEFLCRENLVETKGMVGHFVVEVMDANNFNFC  310
            KGG   KTHV VHD+ ++ +RI S+EFLC ENLVET   +GHF++E M+   F FC
Sbjct  255  KGGGVSKTHVFVHDFGREVERIFSDEFLCPENLVETVDSLGHFLLETMEIQRFQFC  310



>ref|XP_007042486.1| Uncharacterized protein TCM_007104 [Theobroma cacao]
 gb|EOX98317.1| Uncharacterized protein TCM_007104 [Theobroma cacao]
Length=316

 Score =   285 bits (729),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 134/231 (58%), Positives = 168/231 (73%), Gaps = 6/231 (3%)
 Frame = -3

Query  984  SIVRALVHYAS---ISNNTDRMSYADIKQISDVLRQCGSHPCNFLVFGLTHETLLWRTLN  814
            S+  AL+HYAS   ++  T  MS +++  I+  L  C S PC FLVFG+THE+LLW +LN
Sbjct  68   SVTTALLHYASTATVNTTTHHMSSSELSLIASTLHNCPSSPCRFLVFGITHESLLWHSLN  127

Query  813  HHGRTVFIDESRYYAAYVEEKYPEIEVYDVQYSTKLSEMKELISGVKEQARNECRPVQNL  634
             HG TVF+DES Y  +  E  +PEIE YDVQY+TK+S+M +L+S  K    NEC+PVQNL
Sbjct  128  IHGHTVFLDESEYLVSSFERNHPEIEAYDVQYTTKVSQMSDLLSLAKSHIENECKPVQNL  187

Query  633  LFSECKLGLNDLPNQLYEVDWDVILVDGPRGYWPEAPGRMSAIFTAGVLARSKKGGNPKT  454
            LFS+CKL +ND+PN +Y + WDVIL+DGPRGY+P+APGRM+ IFTAGVLARSKK G  KT
Sbjct  188  LFSDCKLAINDMPNHIYYLSWDVILIDGPRGYFPDAPGRMAPIFTAGVLARSKKKGR-KT  246

Query  453  HVLVHDYNQKSDRIASEEFLCRENLVETKGMVGHFVVE--VMDANNFNFCR  307
            HV VHD+ +  + I SEEFLC ENLVET   +GHFVVE  V D     FC+
Sbjct  247  HVFVHDFERDVESILSEEFLCEENLVETVDSLGHFVVEKGVSDGMMSGFCK  297



>ref|XP_008373171.1| PREDICTED: protein IRX15-LIKE-like [Malus domestica]
Length=321

 Score =   285 bits (729),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 134/235 (57%), Positives = 175/235 (74%), Gaps = 5/235 (2%)
 Frame = -3

Query  996  ALSKSIVRALVHYASISNNTD---RMSYADIKQISDVLRQCGSHPCNFLVFGLTHETLLW  826
            +L  +++ AL+HYA  S+NT     MS  ++  IS  L +  +  CNFLVFGLTHE+L +
Sbjct  75   SLPPAVLDALLHYAISSSNTSSAPHMSPPELTSISSALTRLCAPNCNFLVFGLTHESLFY  134

Query  825  RTLNHHGRTVFIDESRYYAAYVEEKYP--EIEVYDVQYSTKLSEMKELISGVKEQARNEC  652
             TLN +GRT F+DES +  +  E+ +    +E YDV Y T++ + K+L+S  K Q +NEC
Sbjct  135  HTLNLNGRTAFVDESEFLVSRFEQAHSHHSLEAYDVSYVTQVKDHKQLLSTTKSQVKNEC  194

Query  651  RPVQNLLFSECKLGLNDLPNQLYEVDWDVILVDGPRGYWPEAPGRMSAIFTAGVLARSKK  472
            RPVQNLLFS+CK+G+NDLPN +Y+V WDVILVDGPRGY P +PGRMSAIFTAGVLARSK+
Sbjct  195  RPVQNLLFSDCKIGINDLPNHIYQVPWDVILVDGPRGYSPSSPGRMSAIFTAGVLARSKR  254

Query  471  GGNPKTHVLVHDYNQKSDRIASEEFLCRENLVETKGMVGHFVVEVMDANNFNFCR  307
            GG  KTHV VHD++++ +RI S+EFLCRENLVE  G  GHFVVE M+ ++F FCR
Sbjct  255  GGGDKTHVFVHDFSREVERIFSDEFLCRENLVEAVGSXGHFVVEKMEDHSFEFCR  309



>ref|XP_008454974.1| PREDICTED: protein IRX15-LIKE-like [Cucumis melo]
Length=320

 Score =   283 bits (723),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 141/242 (58%), Positives = 173/242 (71%), Gaps = 5/242 (2%)
 Frame = -3

Query  1020  GGGGGATPALSKSIVRALVHYASISNNTDR--MSYADIKQISDVLRQCGSHPCNFLVFGL  847
             G    A+ AL  SI  AL+HYA+   N+ +  MS A++  I+  L  C    CNFL+FGL
Sbjct  73    GPNVAASTALPHSISSALLHYAAADTNSTKPHMSTAELSSIAAALSPCAP-ACNFLIFGL  131

Query  846   THETLLWRTLNHHGRTVFIDESRYYAAYVEEKYPEIEVYDVQYSTKLSEMKELISGVKEQ  667
             THE+LLWR LNH G TVF+DE+ +  +  E+  P  E YDVQY+TK+SEMKEL+   K Q
Sbjct  132   THESLLWRALNHGGATVFLDENEFQVSKFEQSNPGTEAYDVQYTTKVSEMKELLFQAKSQ  191

Query  666   ARNECRPVQNLLFSECKLGLNDLPNQLYEVDWDVILVDGPRGYWPEAPGRMSAIFTAGVL  487
               NEC+PVQNLLFSECKLG+NDLPN +Y+V WDVILVDGPRGY   +PGRMSAIFTAGVL
Sbjct  192   VDNECKPVQNLLFSECKLGINDLPNHIYQVPWDVILVDGPRGYNAGSPGRMSAIFTAGVL  251

Query  486   ARSKKGG-NPKTHVLVHDYNQKSDRIASEEFLCRENLVETKGMVGHFVVE-VMDANNFNF  313
             ARSK G  N KTHV VH+  ++ +RI SEEFLCRENL E+   +GHFVVE V++     F
Sbjct  252   ARSKCGKRNSKTHVFVHEMGREVERIYSEEFLCRENLAESVDSLGHFVVEKVIERAGGRF  311

Query  312   CR  307
             C+
Sbjct  312   CK  313



>ref|XP_009345137.1| PREDICTED: protein IRX15-LIKE-like [Pyrus x bretschneideri]
Length=322

 Score =   283 bits (723),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 133/234 (57%), Positives = 174/234 (74%), Gaps = 5/234 (2%)
 Frame = -3

Query  993  LSKSIVRALVHYASISNNTD---RMSYADIKQISDVLRQCGSHPCNFLVFGLTHETLLWR  823
            L  ++  AL+HYA  S+NT     MS  ++  I+  L +  +  CNFLVFGLTHE+L + 
Sbjct  77   LPPAVHDALLHYAISSSNTSSAPHMSPPELTSIASALTRLCAPNCNFLVFGLTHESLFYH  136

Query  822  TLNHHGRTVFIDESRYYAAYVEEKYPE--IEVYDVQYSTKLSEMKELISGVKEQARNECR  649
            TLN +GRT F+DES +  +  E+ +    +E YDV Y T++ + K+L+S  K Q +NECR
Sbjct  137  TLNLNGRTAFVDESEFLVSRFEQAHSHHSLEAYDVSYVTQVKDHKQLLSTTKSQVKNECR  196

Query  648  PVQNLLFSECKLGLNDLPNQLYEVDWDVILVDGPRGYWPEAPGRMSAIFTAGVLARSKKG  469
            PVQNLLFS+CK+G+NDLPN +Y+V WDVILVDGPRGY P +PGRMSAIFTAGVLARSK+G
Sbjct  197  PVQNLLFSDCKIGINDLPNHIYQVPWDVILVDGPRGYSPSSPGRMSAIFTAGVLARSKRG  256

Query  468  GNPKTHVLVHDYNQKSDRIASEEFLCRENLVETKGMVGHFVVEVMDANNFNFCR  307
            G  KTHV VHD++++ +RI S+EFLCRENLVE  G +GHFVVE M+ ++F FCR
Sbjct  257  GRDKTHVFVHDFSREVERIFSDEFLCRENLVEAVGSLGHFVVEKMEDHSFEFCR  310



>ref|XP_004136972.1| PREDICTED: uncharacterized protein LOC101203456 [Cucumis sativus]
 ref|XP_004170986.1| PREDICTED: uncharacterized protein LOC101227615 [Cucumis sativus]
Length=320

 Score =   281 bits (718),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 140/238 (59%), Positives = 171/238 (72%), Gaps = 5/238 (2%)
 Frame = -3

Query  1008  GATPALSKSIVRALVHYASISNNTDR--MSYADIKQISDVLRQCGSHPCNFLVFGLTHET  835
              +T  L   I  AL+HYA+   N+ +  MS A++  I+  L  C    CNFL+FGLTHE+
Sbjct  77    ASTAPLPHPISSALLHYAAADTNSTKPHMSTAELSSIAVALSPCAPA-CNFLIFGLTHES  135

Query  834   LLWRTLNHHGRTVFIDESRYYAAYVEEKYPEIEVYDVQYSTKLSEMKELISGVKEQARNE  655
             LLWR LNH G TVF+DE+ +  +  E+  P  E YDVQY+TK+SEMKEL+   K QA NE
Sbjct  136   LLWRALNHAGVTVFLDENEFQVSKFEQSNPGTEAYDVQYTTKVSEMKELLFLAKSQADNE  195

Query  654   CRPVQNLLFSECKLGLNDLPNQLYEVDWDVILVDGPRGYWPEAPGRMSAIFTAGVLARSK  475
             C+PVQNLLFSECKLG+NDLPN +Y+V WDVILVDGPRGY   +PGRMSAIFTAGVLARSK
Sbjct  196   CKPVQNLLFSECKLGINDLPNHIYQVPWDVILVDGPRGYNAGSPGRMSAIFTAGVLARSK  255

Query  474   KG-GNPKTHVLVHDYNQKSDRIASEEFLCRENLVETKGMVGHFVVE-VMDANNFNFCR  307
              G GN KTHV VH+  ++ +RI SEEFLCRENL E+   +GHFVVE V +     FC+
Sbjct  256   CGKGNSKTHVFVHEMGREVERIYSEEFLCRENLAESVDSLGHFVVEKVRERKGGRFCK  313



>gb|KDO59785.1| hypothetical protein CISIN_1g019623mg [Citrus sinensis]
Length=338

 Score =   280 bits (715),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 126/231 (55%), Positives = 170/231 (74%), Gaps = 9/231 (4%)
 Frame = -3

Query  981  IVRALVHYASISNNTDRMSYADIKQISDVLRQCGSHPCNFLVFGLTHETLLWRTLNHHGR  802
            I  AL+HY   SN+T  M+ A++  ++D L +C S  CNFLVFGLTHETLLW++LN  G 
Sbjct  78   ITAALLHYTLTSNST--MTSAELTAVADALSRC-SPSCNFLVFGLTHETLLWKSLNFQGH  134

Query  801  TVFIDESRYYAAYVEEKYPEIEVYDVQYSTKLSEMKELISGVKEQARNECRPVQNLLFSE  622
            T+F+DES +     E+ +P+ E+YDVQY+TK+ EM   +  V++Q +++CRP+QNLLFS+
Sbjct  135  TIFVDESEFLVQSFEKNHPDFEIYDVQYTTKVEEMNPTLHAVRKQFKDDCRPMQNLLFSD  194

Query  621  CKLGLNDLPNQLYEVDWDVILVDGPRGYWPEAPGRMSAIFTAGVLARSKKGGNPKTHVLV  442
            CKL +ND+PN +Y++DWDV+LVDGP GY+P APGRM+ IFTA VLARSKK G  KTHV V
Sbjct  195  CKLAINDMPNHVYDMDWDVVLVDGPSGYFPRAPGRMAPIFTASVLARSKKAGRKKTHVFV  254

Query  441  HDYNQKSDRIASEEFLCRENLVETKGMVGHFVVEVM------DANNFNFCR  307
            HD+N++ +R+ SEEFLC ENLVE    + HFVVE M      +  +F FC+
Sbjct  255  HDFNREVERVCSEEFLCEENLVEVVDKLAHFVVEPMAPIEGNEEQSFKFCK  305



>ref|XP_006487028.1| PREDICTED: protein IRX15-like [Citrus sinensis]
Length=339

 Score =   278 bits (712),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 128/231 (55%), Positives = 169/231 (73%), Gaps = 9/231 (4%)
 Frame = -3

Query  981  IVRALVHYASISNNTDRMSYADIKQISDVLRQCGSHPCNFLVFGLTHETLLWRTLNHHGR  802
            I  AL+HY   SN+T  M+ A++  ++D L +C S  CNFLVFGLTHETLLW++LN  G 
Sbjct  80   ITAALLHYTLTSNST--MTSAELTAVADALSRC-SPSCNFLVFGLTHETLLWKSLNFQGH  136

Query  801  TVFIDESRYYAAYVEEKYPEIEVYDVQYSTKLSEMKELISGVKEQARNECRPVQNLLFSE  622
            T+F+DES +     E+ +P  E+YDVQY+TK+ EM   +  V++Q +++CRPVQNLLFS+
Sbjct  137  TIFVDESEFLVQSFEKNHPGFEIYDVQYTTKVEEMNPTLHAVRKQFKDDCRPVQNLLFSD  196

Query  621  CKLGLNDLPNQLYEVDWDVILVDGPRGYWPEAPGRMSAIFTAGVLARSKKGGNPKTHVLV  442
            CKL +ND+PN +Y++DWDVILVDGP GY+P APGRM+ IFTA VLARSKK G  KTHV V
Sbjct  197  CKLAINDMPNHVYDMDWDVILVDGPSGYFPGAPGRMAPIFTASVLARSKKTGRKKTHVFV  256

Query  441  HDYNQKSDRIASEEFLCRENLVETKGMVGHFVVEVM------DANNFNFCR  307
            HD+N++ +R+ SEEFLC ENLVE    + HFVVE M      +  +F FC+
Sbjct  257  HDFNREVERVCSEEFLCEENLVEVVDKLAHFVVEPMAPIEGNEEQSFKFCK  307



>ref|XP_007200416.1| hypothetical protein PRUPE_ppa008725mg [Prunus persica]
 gb|EMJ01615.1| hypothetical protein PRUPE_ppa008725mg [Prunus persica]
Length=321

 Score =   278 bits (710),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 135/238 (57%), Positives = 175/238 (74%), Gaps = 5/238 (2%)
 Frame = -3

Query  1005  ATPALSKSIVRALVHYASISNNTD--RMSYADIKQISDVLRQCGSHPCNFLVFGLTHETL  832
             +T  L   I+ AL+HYA+ SN +    MS  ++  IS  L +  +  CNFL+FGLTHE+L
Sbjct  70    STIPLQPPILDALLHYATSSNTSSTTHMSAPEVTTISSTLTRLCAPTCNFLIFGLTHESL  129

Query  831   LWRTLNHHGRTVFIDESRYYAAYVEEKYPE--IEVYDVQYSTKLSEMKELISGVKEQARN  658
             L+  LN +GRTVF+DES +  +  E+ +P    E YDV Y+T++ + K+L+S  + Q +N
Sbjct  130   LYLALNLNGRTVFLDESEFLVSRFEQSHPHHTPEAYDVSYTTQVKDHKQLLSTTRSQVKN  189

Query  657   ECRPVQNLLFSECKLGLNDLPNQLYEVDWDVILVDGPRGYWPEAPGRMSAIFTAGVLARS  478
             ECRPVQNLLFS+CK+G+NDLPN +Y+V WDVILVDGPRGY P APGRM+AIFTAGVLARS
Sbjct  190   ECRPVQNLLFSDCKIGINDLPNHIYQVPWDVILVDGPRGYSPAAPGRMAAIFTAGVLARS  249

Query  477   KKGGNPKTHVLVHDYNQKSDRIASEEFLCRENLVETKGMVGHFVVEVM-DANNFNFCR  307
             K+GG   THV VHD N++ +R+ S+EFLCRENLVE    +GHFVVE M D N+F FCR
Sbjct  250   KRGGRATTHVFVHDLNREVERVFSDEFLCRENLVEAVDSLGHFVVEKMEDHNSFKFCR  307



>ref|XP_010030639.1| PREDICTED: protein IRX15-LIKE-like [Eucalyptus grandis]
Length=284

 Score =   276 bits (706),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 135/225 (60%), Positives = 171/225 (76%), Gaps = 6/225 (3%)
 Frame = -3

Query  972  ALVHYASISNNTDRMSYADIKQISDVLRQCGSHPCNFLVFGLTHETLLWRTLNHHGRTVF  793
            AL+HYA+ +N T  M+ A+I  I+ VLR+  S   NFLVFGLTHETLL+R LN  GRTVF
Sbjct  47   ALLHYATTTNAT-HMTQAEIASIAAVLRRSPS--ANFLVFGLTHETLLFRALNFDGRTVF  103

Query  792  IDESRYYAAYVEEKYPEIEVYDVQYSTKLSEMKELISGVKEQARNECRPVQNLLFSECKL  613
            +DE  +  + +E+++P IE YDVQ++T+LS+   LI   ++Q + +CRPVQNLLFSECKL
Sbjct  104  LDEREFLISQLEQQHPGIEAYDVQFTTRLSQASGLIKSARDQIKTDCRPVQNLLFSECKL  163

Query  612  GLNDLPNQLYEVDWDVILVDGPRGYWPEAPGRMSAIFTAGVLARS---KKGGNPKTHVLV  442
             LNDLPN +YEVDWDVIL+DGPRGY P APGRMS+IFTA VL RS     GG+ KTHV V
Sbjct  164  ALNDLPNYIYEVDWDVILIDGPRGYLPSAPGRMSSIFTAAVLGRSKKGGGGGDGKTHVFV  223

Query  441  HDYNQKSDRIASEEFLCRENLVETKGMVGHFVVEVMDANNFNFCR  307
            HD +++ +RI SEEFLC ENLVET  ++GHF VE M+ ++F FCR
Sbjct  224  HDIDREVERICSEEFLCEENLVETVDLLGHFAVERMERDSFEFCR  268



>ref|XP_004305944.1| PREDICTED: protein IRX15-like [Fragaria vesca subsp. vesca]
Length=332

 Score =   278 bits (710),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 136/238 (57%), Positives = 177/238 (74%), Gaps = 6/238 (3%)
 Frame = -3

Query  1005  ATPALSKSIVRALVHYA---SISNNTDRMSYADIKQISDVLRQCGSHPCNFLVFGLTHET  835
             +T  L  SI  AL+HYA   + S+++  MS  +I  IS+VL  C SH CNFLVFGLTHE+
Sbjct  71    STIPLPPSISDALLHYAISSNASSSSSHMSLTEITAISNVLSTC-SHTCNFLVFGLTHES  129

Query  834   LLWRTLNHHGRTVFIDESRYYAAYVEEKYPE--IEVYDVQYSTKLSEMKELISGVKEQAR  661
             LLW  LN +GRTVF+D++ +  +  E+ +P   IE YDV ++T++ + K L+S  K Q +
Sbjct  130   LLWHALNLNGRTVFLDDNEFLISKFEQSHPYHGIEAYDVSFATRVKDFKSLLSAAKSQLQ  189

Query  660   NECRPVQNLLFSECKLGLNDLPNQLYEVDWDVILVDGPRGYWPEAPGRMSAIFTAGVLAR  481
             ++CRPVQNLLFS+CKLG+ND+PN +Y+V WDVILVDGP GY P +PGRM+ IFTAGVLAR
Sbjct  190   HDCRPVQNLLFSDCKLGINDMPNHIYQVPWDVILVDGPSGYSPASPGRMAPIFTAGVLAR  249

Query  480   SKKGGNPKTHVLVHDYNQKSDRIASEEFLCRENLVETKGMVGHFVVEVMDANNFNFCR  307
             SKKGG  KTHV VHD  +  +R++S+EFLCRENLVE   ++GHFVVE M+ N F FCR
Sbjct  250   SKKGGGDKTHVFVHDIFRNVERVSSDEFLCRENLVEAVDLLGHFVVEKMEDNRFEFCR  307



>ref|XP_004505254.1| PREDICTED: protein IRX15-like [Cicer arietinum]
Length=310

 Score =   274 bits (701),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 133/227 (59%), Positives = 172/227 (76%), Gaps = 7/227 (3%)
 Frame = -3

Query  978  VRALVHYASISNNTDR-MSYADIKQISDVLRQCGSHPCNFLVFGLTHETLLWRTLNHHGR  802
             +AL+HYAS SN+T + MS+++I  I+  L     HP NFL+FGLTHE+LLW  LNH+GR
Sbjct  73   TKALLHYASSSNSTTKTMSFSEINAIATTLL-LKPHP-NFLIFGLTHESLLWSALNHNGR  130

Query  801  TVFIDESRYYAAYVEEKYPEIEVYDVQYSTKLSEMKELISGVKEQARNECRPVQNLLFSE  622
            TVFIDE+ Y  +  E+  P IE YDVQ++TK+SE  +L+S  K +++ +C+PVQNLLFSE
Sbjct  131  TVFIDENEYTISKFEQTNPGIEAYDVQFTTKVSEHLKLLSQTKAESKRDCKPVQNLLFSE  190

Query  621  CKLGLNDLPNQLYEVDWDVILVDGPRGYWPEAPGRMSAIFTAGVLARSKKGGNPKTHVLV  442
            CKLG+ND+PN +Y++ WDVILVDGPRGY+P APGRMSAIFTA VLARSKK G  KTHV V
Sbjct  191  CKLGINDMPNHVYQISWDVILVDGPRGYFPAAPGRMSAIFTAAVLARSKKVG--KTHVFV  248

Query  441  HDYNQKSDRIASEEFLCRENLVETKGMVGHFVVEVM--DANNFNFCR  307
            HD+ ++ ++I S+EFLC ENLV     +GHFVVE +  +A    FCR
Sbjct  249  HDFGREVEKIFSDEFLCEENLVHNVDQLGHFVVESVADNAETSQFCR  295



>ref|XP_007157717.1| hypothetical protein PHAVU_002G092400g [Phaseolus vulgaris]
 gb|ESW29711.1| hypothetical protein PHAVU_002G092400g [Phaseolus vulgaris]
Length=321

 Score =   274 bits (700),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 134/229 (59%), Positives = 170/229 (74%), Gaps = 7/229 (3%)
 Frame = -3

Query  984  SIVRALVHYASISNNTDR-MSYADIKQISDVLRQCGSHPCNFLVFGLTHETLLWRTLNHH  808
            S+ +AL+HYA+ SN T + MS A+I  +S  L      P NFLVFGLTHE+LLW  LNH 
Sbjct  77   SVSKALLHYAAASNTTAKPMSSAEITALSKALL-LTPRP-NFLVFGLTHESLLWAALNHQ  134

Query  807  GRTVFIDESRYYAAYVEEKYPEIEVYDVQYSTKLSEMKELISGVKEQARNECRPVQNLLF  628
            GRTVF+DE+ Y  +  E+  P IE YDVQ++TK+S+  +L+S  + Q + +CRPVQNLLF
Sbjct  135  GRTVFLDENEYAISKFEQSNPGIEAYDVQFTTKVSDFSKLLSQARSQTQADCRPVQNLLF  194

Query  627  SECKLGLNDLPNQLYEVDWDVILVDGPRGYWPEAPGRMSAIFTAGVLARSKKGGNPKTHV  448
            SECKL +NDLPN +Y+V WDVILVDGPRGY+P APGRMSAIFTA VLARS K G  KTHV
Sbjct  195  SECKLAINDLPNHIYQVAWDVILVDGPRGYFPAAPGRMSAIFTAAVLARSTKAG--KTHV  252

Query  447  LVHDYNQKSDRIASEEFLCRENLVETKGMVGHFVV--EVMDANNFNFCR  307
             VHD+ ++ +R+ S+EFLC+ENLV+    +GHF+V  EV DA +  FCR
Sbjct  253  FVHDFGREVERVFSDEFLCQENLVQLVDSLGHFLVASEVHDAESTVFCR  301



>gb|KEH30898.1| polysaccharide biosynthesis protein [Medicago truncatula]
Length=310

 Score =   270 bits (691),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 133/232 (57%), Positives = 169/232 (73%), Gaps = 7/232 (3%)
 Frame = -3

Query  993  LSKSIVRALVHYASISNNTDR-MSYADIKQISDVLRQCGSHPCNFLVFGLTHETLLWRTL  817
            L  S+ +AL+HYAS  N T + MS+ +I  I+  L     HP NFL+FGLTHE+LLW  L
Sbjct  67   LPPSVTKALLHYASSLNTTTKSMSFEEINAITTTL-HLTPHP-NFLIFGLTHESLLWSAL  124

Query  816  NHHGRTVFIDESRYYAAYVEEKYPEIEVYDVQYSTKLSEMKELISGVKEQARNECRPVQN  637
            N +GRTVFIDE+ Y  +  E+  P IE YDVQ++TK+SE  +L+S  K +++++C+PVQN
Sbjct  125  NQNGRTVFIDENEYMISKFEQSNPGIEAYDVQFTTKVSEYPKLLSHAKAKSKHDCKPVQN  184

Query  636  LLFSECKLGLNDLPNQLYEVDWDVILVDGPRGYWPEAPGRMSAIFTAGVLARSKKGGNPK  457
            LLFSECKLG+NDLPN +Y+V WDVILVDGPRGY+P APGRMSAIFTA VLARSKK G  K
Sbjct  185  LLFSECKLGINDLPNHIYQVSWDVILVDGPRGYFPAAPGRMSAIFTAAVLARSKKMG--K  242

Query  456  THVLVHDYNQKSDRIASEEFLCRENLVETKGMVGHFVV--EVMDANNFNFCR  307
            TH+ VHD+ ++ ++I S EFLC ENLV     +GHFVV  E     +  FCR
Sbjct  243  THIFVHDFGREVEKIFSYEFLCEENLVNNVDQLGHFVVKSETDSGESSEFCR  294



>ref|XP_006422963.1| hypothetical protein CICLE_v10028798mg [Citrus clementina]
 gb|ESR36203.1| hypothetical protein CICLE_v10028798mg [Citrus clementina]
Length=246

 Score =   268 bits (684),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 118/214 (55%), Positives = 160/214 (75%), Gaps = 7/214 (3%)
 Frame = -3

Query  930  MSYADIKQISDVLRQCGSHPCNFLVFGLTHETLLWRTLNHHGRTVFIDESRYYAAYVEEK  751
            M+ A++  ++D L +C S  CNFLVFGLTHETLLW++LN  G T+F+DES +     E+ 
Sbjct  1    MTSAELTAVADALSRC-SPSCNFLVFGLTHETLLWKSLNFQGHTIFVDESEFLVQSFEKN  59

Query  750  YPEIEVYDVQYSTKLSEMKELISGVKEQARNECRPVQNLLFSECKLGLNDLPNQLYEVDW  571
            +P+ E+YDVQY+TK+ EM   +  V++Q +++CRP+QNLLFS+CKL +ND+PN +Y++DW
Sbjct  60   HPDFEIYDVQYTTKVEEMNPTLRAVRKQFKDDCRPMQNLLFSDCKLAINDMPNHVYDMDW  119

Query  570  DVILVDGPRGYWPEAPGRMSAIFTAGVLARSKKGGNPKTHVLVHDYNQKSDRIASEEFLC  391
            DV+LVDGP GY+P APGRM+ IFTA VLARSKK G  KTHV VHD+N++ +R+ SEEFLC
Sbjct  120  DVVLVDGPSGYFPRAPGRMAPIFTASVLARSKKAGRKKTHVFVHDFNREVERVCSEEFLC  179

Query  390  RENLVETKGMVGHFVVEVM------DANNFNFCR  307
             ENLVE    + HFVVE M      +  +F FC+
Sbjct  180  EENLVEVVDKLAHFVVEPMAPIEGNEEQSFKFCK  213



>ref|XP_010691720.1| PREDICTED: protein IRX15-LIKE-like [Beta vulgaris subsp. vulgaris]
Length=304

 Score =   268 bits (684),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 129/228 (57%), Positives = 163/228 (71%), Gaps = 10/228 (4%)
 Frame = -3

Query  972  ALVHYASISNNTDRMSYADIKQISDVLRQCGSHPCNFLVFGLTHETLLWRTLNHHGRTVF  793
            AL+HYASISN TD M++ ++  I+  LR+C   PCNFLVFGLT ETLLWR LNH  RTVF
Sbjct  67   ALLHYASISNTTDHMTHVELSTIASSLRRC-PQPCNFLVFGLTQETLLWRALNH--RTVF  123

Query  792  IDESRYYAAYVEEKYPEIEVYDVQYSTKLSEMKELISGVKEQARNECRPVQNLLFSECKL  613
            +DE+ Y  +  E+ + + E YDVQY+TK+S  K L+   +    +ECRPVQNLLFSECKL
Sbjct  124  LDENEYMISNYEKNFTDFEGYDVQYTTKVSNSKHLVEYARIHRTDECRPVQNLLFSECKL  183

Query  612  GLNDLPNQLYEVDWDVILVDGPRGYWPEAPGRMSAIFTAGVLARSKK-------GGNPKT  454
             +NDLPN LYE++WDVIL+DGPRGY  + PGRM+AIFTA V+ARSK        G    T
Sbjct  184  AINDLPNHLYEIEWDVILIDGPRGYSEKMPGRMAAIFTAAVMARSKGRRGERKVGKTGVT  243

Query  453  HVLVHDYNQKSDRIASEEFLCRENLVETKGMVGHFVVEVMDANNFNFC  310
             V VHDY ++ +RI SEEFLC+ENL+E K  + HFVV+ +   +F FC
Sbjct  244  EVFVHDYGREVERIFSEEFLCQENLIEVKDSLAHFVVKEIHGESFQFC  291



>gb|KEH30897.1| polysaccharide biosynthesis protein [Medicago truncatula]
Length=252

 Score =   265 bits (678),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 130/228 (57%), Positives = 171/228 (75%), Gaps = 7/228 (3%)
 Frame = -3

Query  981  IVRALVHYASISNNTDR-MSYADIKQISDVLRQCGSHPCNFLVFGLTHETLLWRTLNHHG  805
            I +ALVHYAS SN+T + MS+++I  I+  L     +P NFL+FGLT E+LLW  LN++G
Sbjct  21   ITKALVHYASSSNSTTKSMSFSEINAITTTL-HLTPNP-NFLIFGLTQESLLWSALNNNG  78

Query  804  RTVFIDESRYYAAYVEEKYPEIEVYDVQYSTKLSEMKELISGVKEQARNECRPVQNLLFS  625
            RTVFIDE+ Y  +  E+  P IE YDVQ+++K+SE  +L+S  KE+++ +C+PVQNLLFS
Sbjct  79   RTVFIDENEYIISKFEQSNPGIEAYDVQFTSKVSEYPKLLSHAKEESKRDCKPVQNLLFS  138

Query  624  ECKLGLNDLPNQLYEVDWDVILVDGPRGYWPEAPGRMSAIFTAGVLARSKKGGNPKTHVL  445
            ECKLG+ND+PN +Y+V WDVILVDGPRGY+P APGRMSAIFTA VLARSKK G  KTHV 
Sbjct  139  ECKLGINDMPNHIYQVSWDVILVDGPRGYFPAAPGRMSAIFTAAVLARSKKVG--KTHVF  196

Query  444  VHDYNQKSDRIASEEFLCRENLVETKGMVGHFVV--EVMDANNFNFCR  307
            VHD+ ++ ++I S EFLC ENLV     + HFV+  E  +  +F FC+
Sbjct  197  VHDFWREVEKIFSYEFLCEENLVNNVDQLRHFVIKSETENGESFEFCK  244



>gb|KGN43907.1| hypothetical protein Csa_7G073430 [Cucumis sativus]
Length=218

 Score =   264 bits (675),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 128/198 (65%), Positives = 152/198 (77%), Gaps = 2/198 (1%)
 Frame = -3

Query  930  MSYADIKQISDVLRQCGSHPCNFLVFGLTHETLLWRTLNHHGRTVFIDESRYYAAYVEEK  751
            MS A++  I+  L  C    CNFL+FGLTHE+LLWR LNH G TVF+DE+ +  +  E+ 
Sbjct  1    MSTAELSSIAVALSPCAP-ACNFLIFGLTHESLLWRALNHAGVTVFLDENEFQVSKFEQS  59

Query  750  YPEIEVYDVQYSTKLSEMKELISGVKEQARNECRPVQNLLFSECKLGLNDLPNQLYEVDW  571
             P  E YDVQY+TK+SEMKEL+   K QA NEC+PVQNLLFSECKLG+NDLPN +Y+V W
Sbjct  60   NPGTEAYDVQYTTKVSEMKELLFLAKSQADNECKPVQNLLFSECKLGINDLPNHIYQVPW  119

Query  570  DVILVDGPRGYWPEAPGRMSAIFTAGVLARSKKG-GNPKTHVLVHDYNQKSDRIASEEFL  394
            DVILVDGPRGY   +PGRMSAIFTAGVLARSK G GN KTHV VH+  ++ +RI SEEFL
Sbjct  120  DVILVDGPRGYNAGSPGRMSAIFTAGVLARSKCGKGNSKTHVFVHEMGREVERIYSEEFL  179

Query  393  CRENLVETKGMVGHFVVE  340
            CRENL E+   +GHFVVE
Sbjct  180  CRENLAESVDSLGHFVVE  197



>ref|XP_010909183.1| PREDICTED: protein IRX15-LIKE-like [Elaeis guineensis]
Length=325

 Score =   268 bits (684),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 124/217 (57%), Positives = 160/217 (74%), Gaps = 4/217 (2%)
 Frame = -3

Query  993  LSKSIVRALVHYASISNNTDRMSYADIKQISDVLRQCGSHPCNFLVFGLTHETLLWRTLN  814
            L   +  ALV+YA+ SN++ +M  AD++ I+ VLR+    PCNFLVFGL HET LWR LN
Sbjct  91   LPDPVFDALVNYAAASNSSGKMGDADLRTIAAVLRR--RAPCNFLVFGLGHETPLWRALN  148

Query  813  HHGRTVFIDESRYYAAYVEEKYPEIEVYDVQYSTKLSEMKELISGVKEQARNECRPVQNL  634
            H GRTVF+DE+ YY A++E + P +E YD+ Y+TK+ EM +LI+  +   R +CRPVQNL
Sbjct  149  HGGRTVFLDENEYYIAHLEGRLPGLEAYDIAYTTKVQEMPDLIAAARRGHRGDCRPVQNL  208

Query  633  LFSECKLGLNDLPNQLYEVDWDVILVDGPRGYWPEAPGRMSAIFTAGVLARSKKGGNPKT  454
            LFS+C+L LNDLPN LY++ WDVILVDGPRGY P +PGRMSAIFTA V+ARS   G   T
Sbjct  209  LFSDCRLALNDLPNALYDIPWDVILVDGPRGYAPTSPGRMSAIFTAAVMARSAGPG--PT  266

Query  453  HVLVHDYNQKSDRIASEEFLCRENLVETKGMVGHFVV  343
             VLVHDY ++ +R+ SEEFLC ENLV     + HF++
Sbjct  267  DVLVHDYEREVERVCSEEFLCNENLVANTTQLAHFLI  303



>ref|XP_006855212.1| hypothetical protein AMTR_s00051p00191940 [Amborella trichopoda]
 gb|ERN16679.1| hypothetical protein AMTR_s00051p00191940 [Amborella trichopoda]
Length=311

 Score =   267 bits (683),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 133/235 (57%), Positives = 170/235 (72%), Gaps = 10/235 (4%)
 Frame = -3

Query  993  LSKSIVRALVHYASISNNTDRMSYADIKQISDVL-RQCGSHPCNFLVFGLTHETLLWRTL  817
            + + IV AL+HY S SN T  M+  +++ I+DVL R+C   PCN LVFGL HE+L+WR L
Sbjct  71   IPQDIVHALLHY-STSNLTGGMTVREMRAIADVLVRRC---PCNLLVFGLGHESLVWRAL  126

Query  816  NHHGRTVFIDESRYYAAYVEEKYPEIEVYDVQYSTKLSEMKELISGVKEQARNECRPVQN  637
            NH GRTVF+DES Y+ A++E+++P IE YDVQY+TK+++ ++L+   KEQ   +CRPVQN
Sbjct  127  NHGGRTVFLDESEYWIAHIEKRHPGIEAYDVQYTTKVAQKEDLMRAAKEQVGGDCRPVQN  186

Query  636  LLFSECKLGLNDLPNQLYEVDWDVILVDGPRGYWPEAPGRMSAIFTAGVLARS-KKGGNP  460
            LLFSEC L +NDLPN+LY+V WDV+LVDGPRGY P APGRMSAIFTA VLARS KKG + 
Sbjct  187  LLFSECPLAINDLPNELYQVPWDVVLVDGPRGYSPLAPGRMSAIFTAAVLARSTKKGSHM  246

Query  459  KTHVLVHDYNQKSDRIASEEFLCRENLVETKG---MVGHFVVE-VMDANNFNFCR  307
             THV VHD+N+  +R  S  FLC EN+V       M+ HF +    DA    FCR
Sbjct  247  PTHVFVHDFNRDVERAYSNHFLCPENMVVLPAGAEMLAHFTIHGTGDAAVSGFCR  301



>gb|KCW55159.1| hypothetical protein EUGRSUZ_I01114 [Eucalyptus grandis]
Length=225

 Score =   264 bits (675),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 128/211 (61%), Positives = 161/211 (76%), Gaps = 5/211 (2%)
 Frame = -3

Query  930  MSYADIKQISDVLRQCGSHPCNFLVFGLTHETLLWRTLNHHGRTVFIDESRYYAAYVEEK  751
            M+ A+I  I+ VLR+  S   NFLVFGLTHETLL+R LN  GRTVF+DE  +  + +E++
Sbjct  1    MTQAEIASIAAVLRRSPS--ANFLVFGLTHETLLFRALNFDGRTVFLDEREFLISQLEQQ  58

Query  750  YPEIEVYDVQYSTKLSEMKELISGVKEQARNECRPVQNLLFSECKLGLNDLPNQLYEVDW  571
            +P IE YDVQ++T+LS+   LI   ++Q + +CRPVQNLLFSECKL LNDLPN +YEVDW
Sbjct  59   HPGIEAYDVQFTTRLSQASGLIKSARDQIKTDCRPVQNLLFSECKLALNDLPNYIYEVDW  118

Query  570  DVILVDGPRGYWPEAPGRMSAIFTAGVLARS---KKGGNPKTHVLVHDYNQKSDRIASEE  400
            DVIL+DGPRGY P APGRMS+IFTA VL RS     GG+ KTHV VHD +++ +RI SEE
Sbjct  119  DVILIDGPRGYLPSAPGRMSSIFTAAVLGRSKKGGGGGDGKTHVFVHDIDREVERICSEE  178

Query  399  FLCRENLVETKGMVGHFVVEVMDANNFNFCR  307
            FLC ENLVET  ++GHF VE M+ ++F FCR
Sbjct  179  FLCEENLVETVDLLGHFAVERMERDSFEFCR  209



>ref|XP_003528522.1| PREDICTED: protein IRX15-like [Glycine max]
Length=311

 Score =   265 bits (677),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 129/233 (55%), Positives = 170/233 (73%), Gaps = 6/233 (3%)
 Frame = -3

Query  993  LSKSIVRALVHYASISNNTDR-MSYADIKQISDVLRQCGSHPCNFLVFGLTHETLLWRTL  817
            L  S+ +AL+HYA+ +N++ + MS A+I  +S  L +    P N LVFGLTHE+LLW  L
Sbjct  69   LPPSVTKALLHYAAAANSSTKPMSPAEISAVSTSLLRLPPRP-NLLVFGLTHESLLWAAL  127

Query  816  NHHG-RTVFIDESRYYAAYVEEKYPEIEVYDVQYSTKLSEMKELISGVKEQARNECRPVQ  640
            NH G RTVF+DE+ Y  +  E   P +E YD+Q++TK+SE  +L+S  + QA+N+CRPVQ
Sbjct  128  NHRGGRTVFLDENEYAISKFESSNPGVEAYDIQFTTKVSEYPKLLSQAQSQAQNDCRPVQ  187

Query  639  NLLFSECKLGLNDLPNQLYEVDWDVILVDGPRGYWPEAPGRMSAIFTAGVLARSKKGGNP  460
            NLLFSECKL +NDLPN +Y+V WDVILVDGP+GY+P APGRM+ IFTA VLARSK  G  
Sbjct  188  NLLFSECKLAINDLPNHIYQVAWDVILVDGPKGYFPAAPGRMAPIFTAAVLARSKISGG-  246

Query  459  KTHVLVHDYNQKSDRIASEEFLCRENLVETKGMVGHFVV--EVMDANNFNFCR  307
            +THV VHD+ ++ +R+ SEEFLC+ENLVE    +GHFVV  E  D  +  FC+
Sbjct  247  ETHVFVHDFGREVERVFSEEFLCKENLVELVDSLGHFVVKSEAHDGESAVFCK  299



>ref|XP_010932030.1| PREDICTED: protein IRX15-LIKE-like [Elaeis guineensis]
Length=326

 Score =   265 bits (678),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 127/229 (55%), Positives = 164/229 (72%), Gaps = 5/229 (2%)
 Frame = -3

Query  993  LSKSIVRALVHYASISNNTDRMSYADIKQISDVLRQCGSHPCNFLVFGLTHETLLWRTLN  814
            L   +  +LV+YA+ SN+  +M   D++ I+ VL +    PCNFLVFGL HET LWR LN
Sbjct  91   LPDPVFESLVNYAAASNSNSKMGDTDLRTIAAVLHR--RAPCNFLVFGLGHETPLWRALN  148

Query  813  HHGRTVFIDESRYYAAYVEEKYPEIEVYDVQYSTKLSEMKELISGVKEQARNECRPVQNL  634
            H GRTVF+DE+ Y+ A++E + P +E YDV Y+TK+ EM +L++  +   R +CRPVQNL
Sbjct  149  HGGRTVFLDENEYHIAHLEGRLPGLEAYDVAYTTKVQEMPDLLATARRGRRGDCRPVQNL  208

Query  633  LFSECKLGLNDLPNQLYEVDWDVILVDGPRGYWPEAPGRMSAIFTAGVLARSKKGGNPKT  454
            LFS+C+L LNDLPN LY+V WDVILVDGPRGY P APGRMSAIFTA V+ARS   G   T
Sbjct  209  LFSDCRLALNDLPNALYDVPWDVILVDGPRGYAPTAPGRMSAIFTAAVMARSAGPG--PT  266

Query  453  HVLVHDYNQKSDRIASEEFLCRENLVETKGMVGHFVVEVMD-ANNFNFC  310
             VLVHDY ++ +R+ SEEFLC+ENLV   G + HF++   D A   +FC
Sbjct  267  DVLVHDYEREVERVCSEEFLCKENLVANTGQLAHFLIPGGDVARRDDFC  315



>ref|XP_008776524.1| PREDICTED: protein IRX15-LIKE-like [Phoenix dactylifera]
Length=325

 Score =   264 bits (674),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 126/229 (55%), Positives = 163/229 (71%), Gaps = 5/229 (2%)
 Frame = -3

Query  993  LSKSIVRALVHYASISNNTDRMSYADIKQISDVLRQCGSHPCNFLVFGLTHETLLWRTLN  814
            L   +  ALV+YA+ SN++ +M  AD++ I+ VLR+    PC FLVFGL HET LWR LN
Sbjct  91   LPDPVFDALVNYAAASNSSGKMGDADLRTIAAVLRR--RAPCKFLVFGLGHETPLWRALN  148

Query  813  HHGRTVFIDESRYYAAYVEEKYPEIEVYDVQYSTKLSEMKELISGVKEQARNECRPVQNL  634
            H GRTVF+DE+ YY A++E + P +E YD+ Y+TK  EM +LI+  +   R +CRPVQNL
Sbjct  149  HGGRTVFLDENEYYIAHLEGRLPGLEAYDIAYTTKAREMPDLIAAARRGRRGDCRPVQNL  208

Query  633  LFSECKLGLNDLPNQLYEVDWDVILVDGPRGYWPEAPGRMSAIFTAGVLARSKKGGNPKT  454
            LFS+C+L LNDLPN LY++ WDVILVDGPRGY   +PGRMSAIFTA V+ARS   G   T
Sbjct  209  LFSDCRLALNDLPNALYDIPWDVILVDGPRGYASTSPGRMSAIFTAAVMARSAGPG--PT  266

Query  453  HVLVHDYNQKSDRIASEEFLCRENLVETKGMVGHFVVEVMD-ANNFNFC  310
             VLVHDY ++ +R+ SEEFLC ENLV   G + HF++   + A   +FC
Sbjct  267  DVLVHDYEREVERVCSEEFLCNENLVANTGQLAHFLIPGGNGATRDDFC  315



>ref|XP_009418802.1| PREDICTED: protein IRX15-LIKE-like [Musa acuminata subsp. malaccensis]
Length=328

 Score =   263 bits (672),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 124/230 (54%), Positives = 164/230 (71%), Gaps = 4/230 (2%)
 Frame = -3

Query  1008  GATPALSKSIVRALVHYASISNNTDRMSYADIKQISDVLRQCGSHPCNFLVFGLTHETLL  829
             G    L   +  ALV+YA  SN+T +M   D++ ++ VLR+    PCN LVFG+ HET L
Sbjct  88    GKPSPLPAPVFDALVNYAVSSNSTGKMREEDLRAVAGVLRR--RAPCNLLVFGIGHETPL  145

Query  828   WRTLNHHGRTVFIDESRYYAAYVEEKYPEIEVYDVQYSTKLSEMKELISGVKEQARNECR  649
             WR LNH GRTVF+DE+ YY A VE + P +E YDV Y+TK+ EM +L++  + Q R ECR
Sbjct  146   WRALNHGGRTVFLDENEYYVARVEGRNPGLEAYDVAYTTKVREMPDLLAAARRQRRGECR  205

Query  648   PVQNLLFSECKLGLNDLPNQLYEVDWDVILVDGPRGYWPEAPGRMSAIFTAGVLARSKKG  469
             PVQNLLFS+C+L +NDLPNQLY+V WDVILVDGP+G+ P  PGRMSAIFTA V+ARS+  
Sbjct  206   PVQNLLFSDCRLAINDLPNQLYDVAWDVILVDGPKGHTPATPGRMSAIFTAAVMARSRGR  265

Query  468   GNPKTHVLVHDYNQKSDRIASEEFLCRENLVETKGMVGHFVVEVMDANNF  319
             G+  T VLVHD++++++R+ S EFLC ENLV     + HF++    A+ F
Sbjct  266   GH--TDVLVHDHDREAERVCSAEFLCPENLVAATPHLAHFLIRAGPADEF  313



>ref|XP_009412469.1| PREDICTED: protein IRX15-LIKE-like [Musa acuminata subsp. malaccensis]
 ref|XP_009412470.1| PREDICTED: protein IRX15-LIKE-like [Musa acuminata subsp. malaccensis]
Length=328

 Score =   263 bits (671),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 125/227 (55%), Positives = 160/227 (70%), Gaps = 4/227 (2%)
 Frame = -3

Query  999  PALSKSIVRALVHYASISNNTDRMSYADIKQISDVLRQCGSHPCNFLVFGLTHETLLWRT  820
            P L   +  +LV+YA  SN+T +M   D+++++ VLR  G  PCN LVFGL HET LWR 
Sbjct  85   PLLPAPVFDSLVNYAVFSNSTGKMEEGDLRKVAGVLRLRG--PCNLLVFGLGHETPLWRA  142

Query  819  LNHHGRTVFIDESRYYAAYVEEKYPEIEVYDVQYSTKLSEMKELISGVKEQARNECRPVQ  640
            LNH GRTVF+DE+ YY A+VE + P +E YDV Y+TK+ EM ELI+  +   R +CRPVQ
Sbjct  143  LNHGGRTVFVDENEYYVAHVEGRNPGVEAYDVAYTTKVREMPELIAAARRHRRGDCRPVQ  202

Query  639  NLLFSECKLGLNDLPNQLYEVDWDVILVDGPRGYWPEAPGRMSAIFTAGVLARSKKGGNP  460
            NLLFS+C+L +NDLPNQLY+V WDVILVDGP+GY    PGRMSAIFTA V+ARS  GG  
Sbjct  203  NLLFSDCRLAINDLPNQLYDVPWDVILVDGPKGYSATEPGRMSAIFTAAVMARS--GGPG  260

Query  459  KTHVLVHDYNQKSDRIASEEFLCRENLVETKGMVGHFVVEVMDANNF  319
               VLVH+Y++K +++ S EFLC ENLV     + HF +    A+ F
Sbjct  261  HVDVLVHEYDRKVEKLCSAEFLCPENLVAATRSLAHFRIRGGPADEF  307



>ref|XP_009420642.1| PREDICTED: protein IRX15-LIKE-like [Musa acuminata subsp. malaccensis]
Length=327

 Score =   262 bits (669),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 127/230 (55%), Positives = 162/230 (70%), Gaps = 5/230 (2%)
 Frame = -3

Query  1008  GATPALSKSIVRALVHYASISNNTDRMSYADIKQISDVLRQCGSHPCNFLVFGLTHETLL  829
             G +P L   +  ALV+YA  SN+T +M+  D++ I+ VLRQ G  PCN LVFG+ HET L
Sbjct  88    GPSP-LPAPVYDALVNYAVSSNSTGKMTEGDLRAIAAVLRQRG--PCNLLVFGIGHETPL  144

Query  828   WRTLNHHGRTVFIDESRYYAAYVEEKYPEIEVYDVQYSTKLSEMKELISGVKEQARNECR  649
             WR LNH GRTVF+DE+ YY A+VE + P +E YDV Y+TK+ EM ELI+  ++  R ECR
Sbjct  145   WRALNHGGRTVFVDENEYYVAHVEGRNPGLEAYDVSYTTKVREMPELIAAARQHLRGECR  204

Query  648   PVQNLLFSECKLGLNDLPNQLYEVDWDVILVDGPRGYWPEAPGRMSAIFTAGVLARSKKG  469
             PVQNLLFS+C L +NDLPNQLY+V WDVILVDGP+G+    PGRMSAIFTA V+ARS   
Sbjct  205   PVQNLLFSDCPLAINDLPNQLYDVAWDVILVDGPKGFSAAEPGRMSAIFTAAVMARSS--  262

Query  468   GNPKTHVLVHDYNQKSDRIASEEFLCRENLVETKGMVGHFVVEVMDANNF  319
                   VLVHDY +K +++ S EFLC +NLV     +GHF++    A+ F
Sbjct  263   ARAPVDVLVHDYTRKVEKLCSAEFLCPDNLVAATRSLGHFLIGGGPADVF  312



>ref|XP_003520070.1| PREDICTED: protein IRX15-like [Glycine max]
Length=323

 Score =   261 bits (667),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 129/233 (55%), Positives = 167/233 (72%), Gaps = 7/233 (3%)
 Frame = -3

Query  993  LSKSIVRALVHYASISNNTDR-MSYADIKQISDVLRQCGSHPCNFLVFGLTHETLLWRTL  817
            LS S+ +AL+HYA+ +N++ + MS A+I  +S  L +    P N L+ GLTHE+LLW  L
Sbjct  78   LSPSVTKALLHYAAAANSSAKPMSPAEISAVSSTLLRLPPRP-NLLILGLTHESLLWAAL  136

Query  816  NHHG-RTVFIDESRYYAAYVEEKYPEIEVYDVQYSTKLSEMKELISGVKEQARNECRPVQ  640
            NH G RTVF+DE+ Y  +  E   P +E YD+Q++TK+SE  +L+S  + QA  ECRPVQ
Sbjct  137  NHRGGRTVFLDENEYAISKFESSNPGVEAYDIQFTTKVSEYPKLLSQAQSQAHGECRPVQ  196

Query  639  NLLFSECKLGLNDLPNQLYEVDWDVILVDGPRGYWPEAPGRMSAIFTAGVLARSKKGGNP  460
            NLLFSECKL +NDLPN +Y V WDVILVDGP+GY+  APGRM+ IFTA VLARSKK G  
Sbjct  197  NLLFSECKLAINDLPNHIYTVAWDVILVDGPKGYFQAAPGRMAPIFTAAVLARSKKFG--  254

Query  459  KTHVLVHDYNQKSDRIASEEFLCRENLVETKGMVGHFVV--EVMDANNFNFCR  307
            +THV VHDY ++ +R+ SEEFLC+ENLVE    +GHFVV  E  D  +  FC+
Sbjct  255  QTHVFVHDYGREVERVFSEEFLCKENLVELVDSLGHFVVKSEAHDGESAVFCK  307



>gb|EPS67946.1| hypothetical protein M569_06823, partial [Genlisea aurea]
Length=298

 Score =   255 bits (652),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 121/232 (52%), Positives = 168/232 (72%), Gaps = 6/232 (3%)
 Frame = -3

Query  993  LSKSIVRALVHYAS--ISNNTDRMSYADIKQISDVLRQCGSHPCNFLVFGLTHETLLWRT  820
              K +V AL+HYAS  IS +  RM+  +++ ++ VL +C   PCNFLVFGLT+E  LW +
Sbjct  67   FPKPVVEALIHYASENISYSAGRMTADEVRYVAGVLGRCAV-PCNFLVFGLTYEMHLWNS  125

Query  819  LNHHGRTVFIDESRYYAAYVEEKYPEIEVYDVQYSTKLSEMKELISGVKEQARNECRPVQ  640
            LNH GRT+F+DES Y  + ++E++P  E YDV +STK+ ++ +LI   +++   ECRPVQ
Sbjct  126  LNHGGRTIFVDESAYLVSKIDERFPHFEAYDVHFSTKVGDLSDLIEYQRKEVAGECRPVQ  185

Query  639  NLLFSECKLGLNDLPNQLYEVDWDVILVDGPRGYWPEAPGRMSAIFTAGVLARSKKGGNP  460
            NLLFS+CKL +ND+PN +Y+V WDVILVDGPRGY  ++PGR+++IFTA VLARSK G   
Sbjct  186  NLLFSDCKLAINDMPNHVYDVVWDVILVDGPRGYQADSPGRIASIFTAAVLARSKTGA-A  244

Query  459  KTHVLVHDYNQKSDRIASEEFLCRENLVETKGMVGHFVVEVMDANNFN--FC  310
             THVLVH+  ++ +R+ S+EFLCRENLVE +  + HFVV   +A   +  FC
Sbjct  245  GTHVLVHEIGRELERVCSDEFLCRENLVEIRDSLAHFVVGKSNAGEISAGFC  296



>gb|KCW63892.1| hypothetical protein EUGRSUZ_G01567 [Eucalyptus grandis]
Length=321

 Score =   255 bits (652),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 126/234 (54%), Positives = 165/234 (71%), Gaps = 7/234 (3%)
 Frame = -3

Query  993  LSKSIVRALVHYASISNNTDRMSYADIKQISDVLRQCG---SHPCNFLVFGLTHETLLWR  823
            L  SI  AL+HYA+ S N   M+ +++  I+  +  C    SH CN LVFGLTHE LL++
Sbjct  75   LPLSIYDALLHYAA-STNPTHMTSSELATITTAVAHCAAVASH-CNLLVFGLTHEALLYK  132

Query  822  TLNHHGRTVFIDESRYYAAYVEEKYPEIEVYDVQYSTKLSEMKELISGVKEQARNECRPV  643
             LN  GRTVF++E+    +  E+++P +E YDVQY T++ EMK L+   + + RNECRPV
Sbjct  133  ALNFDGRTVFLEENENLVSRFEQRHPGVEAYDVQYETRVGEMKRLLESARGEFRNECRPV  192

Query  642  QNLLFSECKLGLNDLPNQLYEVDWDVILVDGPRGYWPEAPGRMSAIFTAGVLARSKKGGN  463
            Q+LLFSECKL L  LPN +YE+ WDVIL+ GP GY   APGRMSAIFTA VLARSKKGG+
Sbjct  193  QSLLFSECKLALTSLPNHVYELSWDVILIQGPSGYHEAAPGRMSAIFTAAVLARSKKGGS  252

Query  462  PKTHVLVHDYNQKSDRIASEEFLCRENLVETKGMVGHFVVE-VMDANNFN-FCR  307
             +THV V D++++ +R+ S+EFLCR+NLVE    +GHFVVE V D  +   FCR
Sbjct  253  AETHVFVLDFDREVERVYSDEFLCRDNLVEVVDKLGHFVVERVSDGRSMTEFCR  306



>ref|XP_008812532.1| PREDICTED: LOW QUALITY PROTEIN: protein IRX15-LIKE-like [Phoenix 
dactylifera]
Length=293

 Score =   254 bits (649),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 119/213 (56%), Positives = 154/213 (72%), Gaps = 4/213 (2%)
 Frame = -3

Query  981  IVRALVHYASISNNTDRMSYADIKQISDVLRQCGSHPCNFLVFGLTHETLLWRTLNHHGR  802
            +  ALV+YA+ SN++ +M  AD++ I+ VL  C   PC FLVFGL HET LWR LNH GR
Sbjct  63   VFDALVNYAAASNSSGKMGDADLRTIAAVL--CRRAPCKFLVFGLGHETPLWRALNHGGR  120

Query  801  TVFIDESRYYAAYVEEKYPEIEVYDVQYSTKLSEMKELISGVKEQARNECRPVQNLLFSE  622
            TVF+DE+ YY A++E + P +E YD+ Y+TK  EM +LI+  +   R +CRPV NLLFS+
Sbjct  121  TVFLDENEYYIAHLEGRLPGLEAYDIAYTTKAREMPDLIAAARRGRRGDCRPVXNLLFSD  180

Query  621  CKLGLNDLPNQLYEVDWDVILVDGPRGYWPEAPGRMSAIFTAGVLARSKKGGNPKTHVLV  442
            C+L LNDLPN LY++ WDVILVDGPRG+   +PGRMSAIFTA V+ARS   G   T VLV
Sbjct  181  CRLALNDLPNALYDIPWDVILVDGPRGHASTSPGRMSAIFTAAVMARSVGSG--PTDVLV  238

Query  441  HDYNQKSDRIASEEFLCRENLVETKGMVGHFVV  343
            HDY ++ +R+ SEEFLC ENLV     + HF++
Sbjct  239  HDYEREVERVCSEEFLCNENLVANTDQLAHFLI  271



>ref|XP_010065988.1| PREDICTED: protein IRX15-LIKE-like [Eucalyptus grandis]
Length=321

 Score =   255 bits (651),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 127/242 (52%), Positives = 167/242 (69%), Gaps = 7/242 (3%)
 Frame = -3

Query  1017  GGGGATPALSKSIVRALVHYASISNNTDRMSYADIKQISDVLRQCG---SHPCNFLVFGL  847
             G   ++  L  SI  AL+HYA+ S N   M+ +++  I+  +  C    SH CN LVFGL
Sbjct  67    GSTVSSFQLPLSIYDALLHYAA-STNPTHMTSSELATITTAVAHCAAVASH-CNLLVFGL  124

Query  846   THETLLWRTLNHHGRTVFIDESRYYAAYVEEKYPEIEVYDVQYSTKLSEMKELISGVKEQ  667
             THE LL++ LN  GRTVF++E+    +  E+++P IE YDVQY T++ EMK L+   +  
Sbjct  125   THEALLYKALNFDGRTVFLEENENLVSRFEQRHPGIEAYDVQYETRVGEMKRLLESARGV  184

Query  666   ARNECRPVQNLLFSECKLGLNDLPNQLYEVDWDVILVDGPRGYWPEAPGRMSAIFTAGVL  487
              RNECRPVQ+LLFSECKL L  LPN +YE+ WDVIL+ GP GY   APGRM+AIFTA VL
Sbjct  185   FRNECRPVQSLLFSECKLALTSLPNHVYELSWDVILIQGPSGYHEAAPGRMTAIFTAAVL  244

Query  486   ARSKKGGNPKTHVLVHDYNQKSDRIASEEFLCRENLVETKGMVGHFVVE-VMDANNFN-F  313
             ARSKKGG+ +THVLV D++++ +R+ S+EFLCR NLV+  G +GHFVVE   D  +   F
Sbjct  245   ARSKKGGSAETHVLVRDFDREVERVYSDEFLCRHNLVKVVGKLGHFVVERASDGRSMTEF  304

Query  312   CR  307
             CR
Sbjct  305   CR  306



>ref|XP_009407075.1| PREDICTED: protein IRX15-LIKE-like [Musa acuminata subsp. malaccensis]
Length=326

 Score =   253 bits (645),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 124/230 (54%), Positives = 158/230 (69%), Gaps = 7/230 (3%)
 Frame = -3

Query  999  PALSKSIVRALVHYASISNNTDRMSYADIKQISDVLRQCGSHPCNFLVFGLTHETLLWRT  820
            PAL   +  ALVHYA  SN T +M    ++ I+ VLR+ G  PCN LVFG+ HET LWR 
Sbjct  89   PAL---VFDALVHYAVASNYTWKMEEDGLRAIAGVLRRRG--PCNLLVFGIGHETPLWRA  143

Query  819  LNHHGRTVFIDESRYYAAYVEEKYPEIEVYDVQYSTKLSEMKELISGVKEQARNECRPVQ  640
            LN  GRTVF+DE+ YY A++E + P +E YDV Y+TK+ EM EL++  + Q R ECRPVQ
Sbjct  144  LNQGGRTVFVDENEYYVAHMEARNPGLEAYDVAYTTKVREMPELLAESRRQRRGECRPVQ  203

Query  639  NLLFSECKLGLNDLPNQLYEVDWDVILVDGPRGYWPEAPGRMSAIFTAGVLARSKKGGNP  460
            NLLFS+C+L +NDLPNQLY+V WDVIL+DGP+G+   APGRMSAIFTA V+AR +  G  
Sbjct  204  NLLFSDCRLAINDLPNQLYDVAWDVILIDGPKGHEAAAPGRMSAIFTAAVMARYR--GRG  261

Query  459  KTHVLVHDYNQKSDRIASEEFLCRENLVETKGMVGHFVVEVMDANNFNFC  310
               VLVHDY++  +R+ S EFLC ENLV     + HF++         FC
Sbjct  262  PVDVLVHDYDRAVERLCSAEFLCSENLVAASSRLAHFLIRSSVGPTNEFC  311



>ref|NP_565374.1| uncharacterized protein [Arabidopsis thaliana]
 gb|AAD22280.1| expressed protein [Arabidopsis thaliana]
 gb|AAM64752.1| unknown [Arabidopsis thaliana]
 gb|ABI93903.1| At2g15440 [Arabidopsis thaliana]
 gb|AEC06401.1| uncharacterized protein AT2G15440 [Arabidopsis thaliana]
Length=329

 Score =   251 bits (640),  Expect = 8e-77, Method: Compositional matrix adjust.
 Identities = 123/230 (53%), Positives = 164/230 (71%), Gaps = 8/230 (3%)
 Frame = -3

Query  981  IVRALVHYASISNNTDRMSYADIKQISDVLRQCGSHPCNFLVFGLTHETLLWRTLNHHGR  802
            ++ AL+HY S S     MS+ ++  IS+++   G   CN L+FGLTHE+LLWR++N  GR
Sbjct  78   VLAALLHYTSSSPPNTSMSFLELSTISNIIHSHGP-ACNLLIFGLTHESLLWRSINFQGR  136

Query  801  TVFIDESRYYAAYVEEKYPEIEVYDVQYSTKLSEMKELISGVKEQARNECRPVQNLLFSE  622
            TVF+DES Y  +  E+  P +E Y+V YSTK+S+ K+L+   K   R ECRPVQNLLFS+
Sbjct  137  TVFVDESPYSVSKFEQSNPGVEAYEVVYSTKVSQAKKLLGYYK--TRPECRPVQNLLFSD  194

Query  621  CKLGLNDLPNQLYEVDWDVILVDGPRGYWPEAPGRMSAIFTAGVLARSKKGG--NPKTHV  448
            CKLG+NDLPN +YE+DWDVIL+DGPRGY  ++PGRM+ IFT+ VLA+SK  G    KT V
Sbjct  195  CKLGINDLPNFVYEIDWDVILIDGPRGYASDSPGRMAPIFTSAVLAKSKDFGTKTKKTDV  254

Query  447  LVHDYNQKSDRIASEEFLCRENLVETKGMVGHFVV---EVMDANNFNFCR  307
            LVH++ +K +R+ SEEFLC ENL+E  G +GHFVV   E  ++    FCR
Sbjct  255  LVHEFGRKIERVYSEEFLCEENLIEVVGDLGHFVVAAAEERESYGDGFCR  304



>gb|EYU42690.1| hypothetical protein MIMGU_mgv1a011105mg [Erythranthe guttata]
Length=292

 Score =   249 bits (635),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 122/240 (51%), Positives = 166/240 (69%), Gaps = 15/240 (6%)
 Frame = -3

Query  1014  GGGATPALSKSIVRALVHYASI-SNNTDRMSYADIKQISDVLRQCGSH-PCNFLVFGLTH  841
             GG  +  L K +  AL+HYA+  +  + RMS A+ ++++ VLR+C +   CN LVFGLTH
Sbjct  59    GGANSQLLPKPVADALLHYATANATASGRMSTAETEKMASVLRRCAAGGACNLLVFGLTH  118

Query  840   ETLLWRTLNHHGRTVFIDESRYYAAYVEEKYPEIEVYDVQYSTKLSEMKELISGVKEQAR  661
             ETLLW +LNH+GRTVF+DES +  + +E K+P IE YDVQ++T+  E++ LI   + +  
Sbjct  119   ETLLWSSLNHNGRTVFVDESAHSVSEIERKHPSIEAYDVQFTTRSGELQHLIGHYRREKS  178

Query  660   NECRPVQNLLFSECKLGLNDLPNQLYEVDWDVILVDGPRGYWPEAPGRMSAIFTAGVLAR  481
             N+CRP          L +NDLPN +Y+V WDV+LVDGP GY   +PGRM+AIFTAGVLAR
Sbjct  179   NQCRP----------LSINDLPNHIYDVPWDVVLVDGPSGYSAASPGRMAAIFTAGVLAR  228

Query  480   SKK-GGNPKTHVLVHDYNQKSDRIASEEFLCRENLVETKGMVGHFVVEVMD--ANNFNFC  310
             SK  GG   THV VH+  ++++R+ SEEFLCRENLVET   + HFVV  +D  +N  +FC
Sbjct  229   SKSGGGGGATHVFVHEIEREAERVCSEEFLCRENLVETIHSLAHFVVPKIDVHSNKIDFC  288



>ref|XP_003580688.1| PREDICTED: protein IRX15-LIKE-like [Brachypodium distachyon]
Length=316

 Score =   249 bits (637),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 119/230 (52%), Positives = 161/230 (70%), Gaps = 6/230 (3%)
 Frame = -3

Query  993  LSKSIVRALVHYASISNNTDRMSYADIKQISDVLRQCGSHPCNFLVFGLTHETLLWRTLN  814
            L   +  ALVHYAS SN T RM+  DI+ IS +LR  G  PCN LVFGL  E+ LW  LN
Sbjct  74   LPLPVFDALVHYASFSNATHRMTDTDIRAISAILRARG--PCNLLVFGLGAESPLWLALN  131

Query  813  HHGRTVFIDESRYYAAYVEEKYPEIEVYDVQYSTKLSEMKELISGVKEQARNECRPVQNL  634
            H GRTV++DE+ +Y  Y+E ++P +E YDV Y+TK+ + ++L++  ++    ECRPVQNL
Sbjct  132  HGGRTVYLDENEFYVKYLEPRHPGLEAYDVSYTTKVRDFRDLLAAAQKSRAAECRPVQNL  191

Query  633  LFSECKLGLNDLPNQLYEVDWDVILVDGPRGYWPEAPGRMSAIFTAGVLARSKKGGNPKT  454
            LFSEC+L +NDLPN+LY+V WDV+LVDGP G+ P +PGRM +IFT  VLARS   G P T
Sbjct  192  LFSECRLAINDLPNELYDVAWDVVLVDGPSGWNPSSPGRMPSIFTTAVLARSGAKGRP-T  250

Query  453  HVLVHDYNQKSDRIASEEFLCRENLVETKGM--VGHFVVEVMDANNFNFC  310
             VLVHD+N + +++ S+EFLC EN V+  G   +GHF++      + +FC
Sbjct  251  DVLVHDFNFEVEQVLSKEFLCDENRVQGSGTPSLGHFLIRAGGPKD-SFC  299



>ref|XP_008644968.1| PREDICTED: protein IRREGULAR XYLEM 15 [Zea mays]
 gb|AFW69175.1| hypothetical protein ZEAMMB73_790817 [Zea mays]
Length=321

 Score =   249 bits (636),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 123/221 (56%), Positives = 156/221 (71%), Gaps = 5/221 (2%)
 Frame = -3

Query  993  LSKSIVRALVHYASIS-NNTDRMSYADIKQISDVLRQCGSHPCNFLVFGLTHETLLWRTL  817
            L   +  ALV YAS   N+T  M  AD++ I+ VLR+    PC+ LVFGL  ET LWR L
Sbjct  85   LPGHVFDALVQYASAGGNSTASMPGADVRAIAAVLRR--RAPCSLLVFGLGAETPLWRAL  142

Query  816  NHHGRTVFIDESRYYAAYVEEKYPEIEVYDVQYSTKLSEMKELISGVKEQARNECRPVQN  637
            NH GRTVF+DE++YY +++E ++P +E YDV Y+T + E  +L+   +     ECRPVQN
Sbjct  143  NHGGRTVFLDENQYYVSHLEGRHPGLEAYDVAYTTTVREFPDLLDSARAARGAECRPVQN  202

Query  636  LLFSECKLGLNDLPNQLYEVDWDVILVDGPRGYWPEAPGRMSAIFTAGVLARSKKGGNPK  457
            LLFS+C+L +NDLPNQLY+V WDVILVDGPRGY   +PGRMSAIFTAGVLAR++ G   K
Sbjct  203  LLFSDCRLAINDLPNQLYDVSWDVILVDGPRGYTASSPGRMSAIFTAGVLARTRAGEGVK  262

Query  456  THVLVHDYNQKSDRIASEEFLCREN-LVETKGM-VGHFVVE  340
            T VLVHDY ++ +R  S EFLC EN +VET    + HFVV 
Sbjct  263  TDVLVHDYEREVERACSREFLCEENRVVETSTRSLAHFVVR  303



>ref|XP_010068514.1| PREDICTED: protein IRX15-LIKE-like [Eucalyptus grandis]
Length=227

 Score =   242 bits (618),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 116/213 (54%), Positives = 153/213 (72%), Gaps = 6/213 (3%)
 Frame = -3

Query  930  MSYADIKQISDVLRQCG---SHPCNFLVFGLTHETLLWRTLNHHGRTVFIDESRYYAAYV  760
            M+ +++  I+  +  C    SH CN LVFGLTHE LL++ LN  GRTVF++E+    +  
Sbjct  1    MTSSELATITTAVAHCAAVASH-CNLLVFGLTHEALLYKALNFDGRTVFLEENENLVSRF  59

Query  759  EEKYPEIEVYDVQYSTKLSEMKELISGVKEQARNECRPVQNLLFSECKLGLNDLPNQLYE  580
            E+++P +E YDVQY T++ EMK L+   + + RNECRPVQ+LLFSECKL L  LPN +YE
Sbjct  60   EQRHPGVEAYDVQYETRVGEMKRLLESARGEFRNECRPVQSLLFSECKLALTSLPNHVYE  119

Query  579  VDWDVILVDGPRGYWPEAPGRMSAIFTAGVLARSKKGGNPKTHVLVHDYNQKSDRIASEE  400
            + WDVIL+ GP GY   APGRMSAIFTA VLARSKKGG+ +THV V D++++ +R+ S+E
Sbjct  120  LSWDVILIQGPSGYHEAAPGRMSAIFTAAVLARSKKGGSAETHVFVLDFDREVERVYSDE  179

Query  399  FLCRENLVETKGMVGHFVVE-VMDANNFN-FCR  307
            FLCR+NLVE    +GHFVVE V D  +   FCR
Sbjct  180  FLCRDNLVEVVDKLGHFVVERVSDGRSMTEFCR  212



>dbj|BAJ84875.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=314

 Score =   244 bits (624),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 117/225 (52%), Positives = 154/225 (68%), Gaps = 5/225 (2%)
 Frame = -3

Query  1008  GATPALSKSIVRALVHYASISNNTDRMSYADIKQISDVLRQCGSHPCNFLVFGLTHETLL  829
             GA  AL   +  ALVHYAS SN T RM+  DI+ IS +LR  G  PCN LVFGL  E+ L
Sbjct  66    GAAAALPLPVFDALVHYASFSNATHRMTDTDIRAISAILRARG--PCNLLVFGLGAESPL  123

Query  828   WRTLNHHGRTVFIDESRYYAAYVEEKYPEIEVYDVQYSTKLSEMKELISGVKEQARNECR  649
             W  LNH GRTV++DE+ +Y  Y+E ++P +E YDV Y+TK+ + ++L+   +     ECR
Sbjct  124   WLALNHGGRTVYLDENEFYVKYLEPRHPGLEAYDVSYTTKVRDFRDLLEAARGSRAAECR  183

Query  648   PVQNLLFSECKLGLNDLPNQLYEVDWDVILVDGPRGYWPEAPGRMSAIFTAGVLARS-KK  472
             PVQNLLFSEC+L +NDLPN+LY+V WDV+L+DGP G+ P +PGRM +IFT  VLARS   
Sbjct  184   PVQNLLFSECRLAINDLPNELYDVPWDVVLIDGPSGWNPNSPGRMPSIFTTAVLARSGAT  243

Query  471   GGNPKTHVLVHDYNQKSDRIASEEFLCRENLVETKGM--VGHFVV  343
                  T VLVHD+N + +++ S+EFLC EN V   G   + HFV+
Sbjct  244   AAKGPTDVLVHDFNFEVEQVLSKEFLCDENRVAGSGTNSLAHFVI  288



>gb|KHN27079.1| hypothetical protein glysoja_028358 [Glycine soja]
Length=247

 Score =   242 bits (617),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 112/163 (69%), Positives = 133/163 (82%), Gaps = 4/163 (2%)
 Frame = -3

Query  1023  SGGGGGATPALSKSIVRALVHYASISNNTDRMSYADIKQISDVLRQCGSHPCNFLVFGLT  844
             SG G    PA   +++  L+HYAS SN+T  M ++D+K ISDVLR+C S PCNFL+FGLT
Sbjct  69    SGFGSAPLPA---TVINTLLHYASKSNDTFHMPHSDLKPISDVLRKCSS-PCNFLIFGLT  124

Query  843   HETLLWRTLNHHGRTVFIDESRYYAAYVEEKYPEIEVYDVQYSTKLSEMKELISGVKEQA  664
              ETLLW+ LNH+GRTVFIDE+RYYAAY EE +P I+ YDVQY+TK SEMKELI+  KEQ 
Sbjct  125   PETLLWKALNHNGRTVFIDENRYYAAYYEELHPNIDAYDVQYTTKRSEMKELIASAKEQV  184

Query  663   RNECRPVQNLLFSECKLGLNDLPNQLYEVDWDVILVDGPRGYW  535
              NEC+PVQNLLFS+CKLGLNDLPN +YE+DWDVILVDGPRG W
Sbjct  185   ANECKPVQNLLFSDCKLGLNDLPNHVYEIDWDVILVDGPRGDW  227



>ref|XP_006409555.1| hypothetical protein EUTSA_v10022776mg [Eutrema salsugineum]
 gb|ESQ51008.1| hypothetical protein EUTSA_v10022776mg [Eutrema salsugineum]
Length=329

 Score =   243 bits (621),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 121/228 (53%), Positives = 161/228 (71%), Gaps = 7/228 (3%)
 Frame = -3

Query  981  IVRALVHYASISNNTDRMSYADIKQISDVLRQCGSHPCNFLVFGLTHETLLWRTLNHHGR  802
            I+ AL+HY S S     MS++++  IS V+    S  CN LVFGLTHE+L WR++N  GR
Sbjct  82   ILAALLHYTSSSPPNISMSFSELSAISTVINS-KSPTCNLLVFGLTHESLFWRSINLKGR  140

Query  801  TVFIDESRYYAAYVEEKYPEIEVYDVQYSTKLSEMKELISGVKEQARNECRPVQNLLFSE  622
            TVF+DE+ Y  +  E+  P  E YDV +STK+S+  +L+   K   R ECRPVQNLLFS+
Sbjct  141  TVFVDENPYAVSKFEQSNPGAEAYDVVFSTKVSQAGKLLGYYK--TRPECRPVQNLLFSD  198

Query  621  CKLGLNDLPNQLYEVDWDVILVDGPRGYWPEAPGRMSAIFTAGVLARSKKGGNPKTHVLV  442
            CKLG+NDLPN +YE+DWDVILVDGPRGY  ++PGRM+ IFT+ VLA+S+  G  KT + V
Sbjct  199  CKLGINDLPNFVYEIDWDVILVDGPRGYAGDSPGRMAPIFTSAVLAKSRDSGK-KTDIFV  257

Query  441  HDYNQKSDRIASEEFLCRENLVETKGMVGHFVV---EVMDANNFNFCR  307
            H++ ++ +R+ SEEFLC ENL+E  G +GHFVV   E  + +N  FCR
Sbjct  258  HEFGREIERVYSEEFLCEENLIEVVGDLGHFVVAAEERKNQSNSGFCR  305



>ref|XP_002885962.1| hypothetical protein ARALYDRAFT_899758 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH62221.1| hypothetical protein ARALYDRAFT_899758 [Arabidopsis lyrata subsp. 
lyrata]
Length=327

 Score =   243 bits (620),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 122/229 (53%), Positives = 160/229 (70%), Gaps = 7/229 (3%)
 Frame = -3

Query  981  IVRALVHYASISNNTDRMSYADIKQISDVLRQCGSHPCNFLVFGLTHETLLWRTLNHHGR  802
            ++ AL+HY S S     MS+ ++  IS ++   G   CN LVFGLTHE+LLWR++N  GR
Sbjct  77   VLAALLHYTSSSPPNTSMSFLELSTISTIIHSHGP-TCNLLVFGLTHESLLWRSINFQGR  135

Query  801  TVFIDESRYYAAYVEEKYPEIEVYDVQYSTKLSEMKELISGVKEQARNECRPVQNLLFSE  622
             VF+DES Y  +  E+  P +E Y+V YSTK+S+  +L+   K   R ECRPVQNLLFS+
Sbjct  136  MVFVDESPYSVSKFEQSNPGVEAYEVVYSTKVSQAGKLLGYYK--TRPECRPVQNLLFSD  193

Query  621  CKLGLNDLPNQLYEVDWDVILVDGPRGYWPEAPGRMSAIFTAGVLARSKK-GGNPKTHVL  445
            CKLG+NDLPN +YE+DWDVIL+DGPRGY  ++PGRM+ IFT+ VLA+SK  G   KT V 
Sbjct  194  CKLGINDLPNFVYEIDWDVILIDGPRGYASDSPGRMAPIFTSAVLAKSKDFGKKTKTDVF  253

Query  444  VHDYNQKSDRIASEEFLCRENLVETKGMVGHFVVEVMDA-NNFN--FCR  307
            VH++ +K +R+ SEEFLC ENLVE  G +GHFVV   +   +F   FCR
Sbjct  254  VHEFGRKIERVYSEEFLCEENLVEVVGDLGHFVVAAAEERESFGNWFCR  302



>ref|XP_009136270.1| PREDICTED: protein IRX15-LIKE-like [Brassica rapa]
Length=328

 Score =   243 bits (619),  Expect = 9e-74, Method: Compositional matrix adjust.
 Identities = 121/228 (53%), Positives = 159/228 (70%), Gaps = 6/228 (3%)
 Frame = -3

Query  981  IVRALVHYASISNNTDRMSYADIKQISDVLRQCGSHPCNFLVFGLTHETLLWRTLNHHGR  802
            I+ AL+HY S S     MS  ++  +S V+   G   CN LVFGL+HE+LLWR++N  GR
Sbjct  80   ILAALLHYTSSSPPNTSMSLPELSAVSTVINSKGPS-CNLLVFGLSHESLLWRSVNLKGR  138

Query  801  TVFIDESRYYAAYVEEKYPEIEVYDVQYSTKLSEMKELISGVKEQARNECRPVQNLLFSE  622
            TVF+DE+ Y  +  E+  P +E YDV YSTK+S+  +L+   K   R ECRPVQNLLFS+
Sbjct  139  TVFVDENSYAVSKFEQNNPGVEAYDVVYSTKVSQAGKLLGYYK--TRPECRPVQNLLFSD  196

Query  621  CKLGLNDLPNQLYEVDWDVILVDGPRGYWPEAPGRMSAIFTAGVLARSKKGGNPK-THVL  445
            CKLG+NDLPN +YE++WDVIL+DGPRGY  ++PGRM+ IFT+ VLA+SK  G  K T V 
Sbjct  197  CKLGINDLPNFVYEIEWDVILIDGPRGYAGDSPGRMAPIFTSAVLAKSKDSGKKKTTDVF  256

Query  444  VHDYNQKSDRIASEEFLCRENLVETKGMVGHFVV--EVMDANNFNFCR  307
            VH++ +K +R+ SEEFLC ENL+E  G +GHFVV  E  +     FCR
Sbjct  257  VHEFGRKLERVYSEEFLCEENLIEVVGELGHFVVAAEKGEKQGNGFCR  304



>ref|XP_002447223.1| hypothetical protein SORBIDRAFT_06g030790 [Sorghum bicolor]
 gb|EES11551.1| hypothetical protein SORBIDRAFT_06g030790 [Sorghum bicolor]
Length=327

 Score =   242 bits (617),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 116/222 (52%), Positives = 153/222 (69%), Gaps = 8/222 (4%)
 Frame = -3

Query  993  LSKSIVRALVHYASISNNTDRMSYADIKQISDVLRQCGSHPCNFLVFGLTHETLLWRTLN  814
            L   +  ALVH+ASISN T RMS  DI+ IS VLR     PCN LVFGL  E+ LW  LN
Sbjct  74   LPLPVFEALVHFASISNATHRMSDTDIRAISAVLR--ARAPCNLLVFGLGAESPLWLALN  131

Query  813  HHGRTVFIDESRYYAAYVEEKYPEIEVYDVQYSTKLSEMKELISGVKEQARNECRPVQNL  634
            H GRTVF++E+ +Y  Y+E ++P +E YDV Y+TK+ + ++L++  +   R ECRP+QNL
Sbjct  132  HGGRTVFLEENEFYVKYLEPRHPGMEAYDVSYTTKVRDFRDLLAAARASRRKECRPIQNL  191

Query  633  LFSECKLGLNDLPNQLYEVDWDVILVDGPRGYWPEAPGRMSAIFTAGVLARS---KKGGN  463
            LFSEC+L +NDLPN LY+V WD++L+DGP G+ P +PGRM +IFT  VLARS      G 
Sbjct  192  LFSECRLAINDLPNDLYDVPWDMVLIDGPSGWNPNSPGRMPSIFTTAVLARSGATAAKGR  251

Query  462  PKTHVLVHDYNQKSDRIASEEFLCRENLVETKGM--VGHFVV  343
            P T VLVHD+  + +++ S EFLC EN V   G   +GHFV+
Sbjct  252  P-TDVLVHDFQFEVEQVLSREFLCDENRVAGSGTPSLGHFVI  292



>emb|CAH68262.1| H0212B02.6 [Oryza sativa Indica Group]
Length=317

 Score =   241 bits (616),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 118/232 (51%), Positives = 155/232 (67%), Gaps = 6/232 (3%)
 Frame = -3

Query  996  ALSKSIVRALVHYASISNNTDRMSYADIKQISDVLRQCGSHPCNFLVFGLTHETLLWRTL  817
            AL   +  ALVH+ASISN T RMS  DI+ IS VLR  G  PCN LVFGL  E+ LW  L
Sbjct  72   ALPLPVFDALVHFASISNATHRMSDTDIRAISAVLRARG--PCNLLVFGLGAESPLWLAL  129

Query  816  NHHGRTVFIDESRYYAAYVEEKYPEIEVYDVQYSTKLSEMKELISGVKEQARNECRPVQN  637
            NH GRTVF++E+ +Y  Y+E ++P +E YDV Y+TK+ + ++L+   +     ECRP+QN
Sbjct  130  NHGGRTVFLEENEFYVKYLEPRHPGLEAYDVSYTTKVRDFRDLLDAARASRAAECRPIQN  189

Query  636  LLFSECKLGLNDLPNQLYEVDWDVILVDGPRGYWPEAPGRMSAIFTAGVLARS-KKGGNP  460
            LLFSEC+L +NDLPN LY+V WD++L+DGP G+ P +PGRM +IFT  VLAR+       
Sbjct  190  LLFSECRLAINDLPNDLYDVAWDIVLIDGPSGWNPTSPGRMPSIFTTAVLARTGATAAKG  249

Query  459  KTHVLVHDYNQKSDRIASEEFLCRENLVETKGM--VGHFVVEVMDANNFNFC  310
             T VLVHD+  + +++ S+EFLC EN V   G   +GHFVV   D     FC
Sbjct  250  PTDVLVHDFQFELEQVLSKEFLCDENRVAGSGTPSLGHFVVRP-DGRRDAFC  300



>ref|NP_001054086.1| Os04g0649900 [Oryza sativa Japonica Group]
 emb|CAE04497.1| OSJNBb0059K02.7 [Oryza sativa Japonica Group]
 dbj|BAF16000.1| Os04g0649900 [Oryza sativa Japonica Group]
 gb|EAY95824.1| hypothetical protein OsI_17693 [Oryza sativa Indica Group]
 gb|EAZ32219.1| hypothetical protein OsJ_16425 [Oryza sativa Japonica Group]
 dbj|BAG87961.1| unnamed protein product [Oryza sativa Japonica Group]
Length=318

 Score =   241 bits (616),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 118/232 (51%), Positives = 155/232 (67%), Gaps = 6/232 (3%)
 Frame = -3

Query  996  ALSKSIVRALVHYASISNNTDRMSYADIKQISDVLRQCGSHPCNFLVFGLTHETLLWRTL  817
            AL   +  ALVH+ASISN T RMS  DI+ IS VLR  G  PCN LVFGL  E+ LW  L
Sbjct  73   ALPLPVFDALVHFASISNATHRMSDTDIRAISAVLRARG--PCNLLVFGLGAESPLWLAL  130

Query  816  NHHGRTVFIDESRYYAAYVEEKYPEIEVYDVQYSTKLSEMKELISGVKEQARNECRPVQN  637
            NH GRTVF++E+ +Y  Y+E ++P +E YDV Y+TK+ + ++L+   +     ECRP+QN
Sbjct  131  NHGGRTVFLEENEFYVKYLEPRHPGLEAYDVSYTTKVRDFRDLLDAARASRAAECRPIQN  190

Query  636  LLFSECKLGLNDLPNQLYEVDWDVILVDGPRGYWPEAPGRMSAIFTAGVLARS-KKGGNP  460
            LLFSEC+L +NDLPN LY+V WD++L+DGP G+ P +PGRM +IFT  VLAR+       
Sbjct  191  LLFSECRLAINDLPNDLYDVAWDIVLIDGPSGWNPTSPGRMPSIFTTAVLARTGATAAKG  250

Query  459  KTHVLVHDYNQKSDRIASEEFLCRENLVETKGM--VGHFVVEVMDANNFNFC  310
             T VLVHD+  + +++ S+EFLC EN V   G   +GHFVV   D     FC
Sbjct  251  PTDVLVHDFQFELEQVLSKEFLCDENRVAGSGTPSLGHFVVR-PDGRRDAFC  301



>gb|ADR31622.1| DUF579 protein [Populus trichocarpa]
Length=145

 Score =   235 bits (599),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 107/146 (73%), Positives = 129/146 (88%), Gaps = 1/146 (1%)
 Frame = -3

Query  978  VRALVHYASISNNTDRMSYADIKQISDVLRQCGSHPCNFLVFGLTHETLLWRTLNHHGRT  799
            +  L+HYAS SN++  MS+A+IK ISDVLR+C S PCNFLVFGLTHET LW+ LNH+GRT
Sbjct  1    INTLLHYASRSNDSFHMSHAEIKPISDVLRKCSS-PCNFLVFGLTHETPLWKALNHNGRT  59

Query  798  VFIDESRYYAAYVEEKYPEIEVYDVQYSTKLSEMKELISGVKEQARNECRPVQNLLFSEC  619
            VFI+E+RYYAAY EE +PEI+V+DVQY+TK+ EM+ELI+  KEQ +NECRPVQNLLFSEC
Sbjct  60   VFIEENRYYAAYYEELHPEIDVFDVQYTTKMKEMRELIASTKEQIKNECRPVQNLLFSEC  119

Query  618  KLGLNDLPNQLYEVDWDVILVDGPRG  541
            KLG+NDLPN +YEVDWDVIL+DGPRG
Sbjct  120  KLGINDLPNHVYEVDWDVILIDGPRG  145



>emb|CDY13145.1| BnaA09g16720D [Brassica napus]
Length=328

 Score =   241 bits (615),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 120/228 (53%), Positives = 159/228 (70%), Gaps = 6/228 (3%)
 Frame = -3

Query  981  IVRALVHYASISNNTDRMSYADIKQISDVLRQCGSHPCNFLVFGLTHETLLWRTLNHHGR  802
            I+ AL+HY S +     MS  ++  +S V+   G   CN LVFGL+HE+LLWR++N  GR
Sbjct  80   ILAALLHYTSSTPLNTSMSLPELSAVSTVINSKGPS-CNLLVFGLSHESLLWRSVNLKGR  138

Query  801  TVFIDESRYYAAYVEEKYPEIEVYDVQYSTKLSEMKELISGVKEQARNECRPVQNLLFSE  622
            TVF+DE+ Y  +  E+  P +E YDV YSTK+S+  +L+   K   R ECRPVQNLLFS+
Sbjct  139  TVFVDENSYAVSKFEQNNPGVEAYDVVYSTKVSQAGKLLGYYK--TRPECRPVQNLLFSD  196

Query  621  CKLGLNDLPNQLYEVDWDVILVDGPRGYWPEAPGRMSAIFTAGVLARSKKGGNPK-THVL  445
            CKLG+NDLPN +YE++WDVIL+DGPRGY  ++PGRM+ IFT+ VLA+SK  G  K T V 
Sbjct  197  CKLGINDLPNFVYEIEWDVILIDGPRGYAGDSPGRMAPIFTSAVLAKSKDSGKKKTTDVF  256

Query  444  VHDYNQKSDRIASEEFLCRENLVETKGMVGHFVV--EVMDANNFNFCR  307
            VH++ +K +R+ SEEFLC ENL+E  G +GHFVV  E  +     FCR
Sbjct  257  VHEFGRKLERVYSEEFLCEENLIEVVGELGHFVVAAEKGEKQGNGFCR  304



>ref|XP_002437483.1| hypothetical protein SORBIDRAFT_10g027930 [Sorghum bicolor]
 gb|EER88850.1| hypothetical protein SORBIDRAFT_10g027930 [Sorghum bicolor]
Length=332

 Score =   241 bits (614),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 120/221 (54%), Positives = 152/221 (69%), Gaps = 5/221 (2%)
 Frame = -3

Query  993  LSKSIVRALVHYASIS-NNTDRMSYADIKQISDVLRQCGSHPCNFLVFGLTHETLLWRTL  817
            L   +  ALV YAS   N+T  M  AD++ I+ VL++    PCN LVFGL  ET LWR L
Sbjct  93   LPGHVFDALVQYASAGGNSTASMPGADVRAIAAVLKR--RAPCNLLVFGLGGETPLWRAL  150

Query  816  NHHGRTVFIDESRYYAAYVEEKYPEIEVYDVQYSTKLSEMKELISGVKEQARNECRPVQN  637
            NH GRTVF+DE++YY +++E ++P +E YDV Y+T + E  +L+   +     ECRPVQN
Sbjct  151  NHGGRTVFLDENQYYVSHLEGRHPGLEAYDVAYTTTVREFPDLLDAARAARAAECRPVQN  210

Query  636  LLFSECKLGLNDLPNQLYEVDWDVILVDGPRGYWPEAPGRMSAIFTAGVLARSKKGGNPK  457
            LLFS+C+L +NDLPNQLY+V WDVILVDGPRGY   +PGRMSAIFTAGVLAR++ G    
Sbjct  211  LLFSDCRLAINDLPNQLYDVSWDVILVDGPRGYTATSPGRMSAIFTAGVLARTRAGEGAT  270

Query  456  THVLVHDYNQKSDRIASEEFLCRENLVETKGM--VGHFVVE  340
            T VLVHDY ++ +R  S EFLC EN V       + HFVV 
Sbjct  271  TDVLVHDYEREVERACSREFLCEENRVAETSTRSLAHFVVR  311



>ref|NP_001058408.1| Os06g0687600 [Oryza sativa Japonica Group]
 dbj|BAD45603.1| cdc2 protein kinases-like [Oryza sativa Japonica Group]
 dbj|BAD46059.1| cdc2 protein kinases-like [Oryza sativa Japonica Group]
 dbj|BAF20322.1| Os06g0687600 [Oryza sativa Japonica Group]
Length=336

 Score =   241 bits (614),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 120/232 (52%), Positives = 156/232 (67%), Gaps = 6/232 (3%)
 Frame = -3

Query  993  LSKSIVRALVHYASIS-NNTDRMSYADIKQISDVLRQCGSHPCNFLVFGLTHETLLWRTL  817
            L   +  ALV YAS   N+T  M   D++ I+ V+++    PCNFLVFGL  ET LWR L
Sbjct  97   LPGYVFDALVQYASAGGNSTASMPGGDVRAIAAVVKR--RAPCNFLVFGLGGETPLWRAL  154

Query  816  NHHGRTVFIDESRYYAAYVEEKYPEIEVYDVQYSTKLSEMKELISGVKEQARNECRPVQN  637
            NH GRTVF+DE++YY +++E ++P +E YDV Y+T + E  +L+   +     ECRPVQN
Sbjct  155  NHGGRTVFLDENQYYVSHLEGRHPGLEAYDVVYTTTVREFPDLLDAARAARSAECRPVQN  214

Query  636  LLFSECKLGLNDLPNQLYEVDWDVILVDGPRGYWPEAPGRMSAIFTAGVLARSKKGGNPK  457
            LL+S+C+L +NDLPNQLY+V WD+ILVDGPRGY   +PGRMSAIFTAGV+ARS+     +
Sbjct  215  LLYSDCRLAINDLPNQLYDVAWDIILVDGPRGYTAASPGRMSAIFTAGVMARSRAEKGAE  274

Query  456  THVLVHDYNQKSDRIASEEFLCRENLVETKGM--VGHFVVE-VMDANNFNFC  310
            T VLVHDY ++ +R  S EFLC EN VE      + HFVV    D     FC
Sbjct  275  TDVLVHDYEREVERACSREFLCEENRVEETSTRSLAHFVVPGGRDLRRETFC  326



>gb|EEC81210.1| hypothetical protein OsI_24242 [Oryza sativa Indica Group]
Length=336

 Score =   239 bits (609),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 119/232 (51%), Positives = 155/232 (67%), Gaps = 6/232 (3%)
 Frame = -3

Query  993  LSKSIVRALVHYASIS-NNTDRMSYADIKQISDVLRQCGSHPCNFLVFGLTHETLLWRTL  817
            L   +  ALV YAS   N+T  M   D++ I+ V+++    PCN LVFGL  ET LWR L
Sbjct  97   LPGYVFDALVQYASAGGNSTASMPGGDVRAIAAVVKR--RAPCNLLVFGLGGETPLWRAL  154

Query  816  NHHGRTVFIDESRYYAAYVEEKYPEIEVYDVQYSTKLSEMKELISGVKEQARNECRPVQN  637
            NH GRTVF+DE++YY +++E ++P +E YDV Y+T + E  +L+   +     ECRPVQN
Sbjct  155  NHGGRTVFLDENQYYVSHLEGRHPGLEAYDVVYTTTVREFPDLLDAARAARSAECRPVQN  214

Query  636  LLFSECKLGLNDLPNQLYEVDWDVILVDGPRGYWPEAPGRMSAIFTAGVLARSKKGGNPK  457
            LL+S+C+L +NDLPNQLY+V WD+ILVDGPRGY   +PGRMSAIFTAGV+ARS+     +
Sbjct  215  LLYSDCRLAINDLPNQLYDVAWDIILVDGPRGYTAASPGRMSAIFTAGVMARSRAEKGAE  274

Query  456  THVLVHDYNQKSDRIASEEFLCRENLVETKGM--VGHFVVE-VMDANNFNFC  310
            T VLVHDY ++ +R  S EFLC EN VE      + HFVV    D     FC
Sbjct  275  TDVLVHDYEREVERACSREFLCEENRVEETSTRSLAHFVVPGGRDLRRETFC  326



>gb|ACF86974.1| unknown [Zea mays]
Length=335

 Score =   238 bits (607),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 115/220 (52%), Positives = 150/220 (68%), Gaps = 5/220 (2%)
 Frame = -3

Query  993  LSKSIVRALVHYASISNNTDRMSYADIKQISDVLRQCGSHPCNFLVFGLTHETLLWRTLN  814
            L   +  ALVH+ASISN T RMS  DI+ IS VLR     PCN LVFGL  E+ LW  LN
Sbjct  87   LPVPVFEALVHFASISNATHRMSDTDIRAISSVLR--ARAPCNLLVFGLGAESPLWLALN  144

Query  813  HHGRTVFIDESRYYAAYVEEKYPEIEVYDVQYSTKLSEMKELISGVKEQARNECRPVQNL  634
            H GRTVF++E+ +Y  Y+E ++P +E YDV Y+TK+ + ++L++  +     ECRPVQNL
Sbjct  145  HGGRTVFLEENEFYVKYLEPRHPGMEAYDVSYTTKVRDFRDLLAAARAARAKECRPVQNL  204

Query  633  LFSECKLGLNDLPNQLYEVDWDVILVDGPRGYWPEAPGRMSAIFTAGVLARS-KKGGNPK  457
            LFSEC+L +NDLPN LY+V WDV+L+DGP G+ P +PGRM +IFT  VLARS        
Sbjct  205  LFSECRLAINDLPNDLYDVAWDVVLIDGPSGWNPNSPGRMPSIFTTAVLARSGATAAKGP  264

Query  456  THVLVHDYNQKSDRIASEEFLCRENLVETKGM--VGHFVV  343
            T VLVHD+  + +++ S EFLC EN V   G   +GHFV+
Sbjct  265  TDVLVHDFQFEVEQVLSREFLCDENRVAGSGTPSLGHFVI  304



>ref|NP_001152696.1| LOC100286337 [Zea mays]
 gb|ACG49018.1| plant-specific domain TIGR01627 family protein [Zea mays]
 gb|ACN26536.1| unknown [Zea mays]
 tpg|DAA35684.1| TPA: Plant-specific domain TIGR01627 family [Zea mays]
Length=335

 Score =   237 bits (604),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 114/220 (52%), Positives = 150/220 (68%), Gaps = 5/220 (2%)
 Frame = -3

Query  993  LSKSIVRALVHYASISNNTDRMSYADIKQISDVLRQCGSHPCNFLVFGLTHETLLWRTLN  814
            L   +  ALVH+ASISN T RMS  DI+ +S VLR     PCN LVFGL  E+ LW  LN
Sbjct  87   LPVPVFEALVHFASISNATHRMSDTDIRAMSSVLR--ARAPCNLLVFGLGAESPLWLALN  144

Query  813  HHGRTVFIDESRYYAAYVEEKYPEIEVYDVQYSTKLSEMKELISGVKEQARNECRPVQNL  634
            H GRTVF++E+ +Y  Y+E ++P +E YDV Y+TK+ + ++L++  +     ECRPVQNL
Sbjct  145  HGGRTVFLEENEFYVKYLEPRHPGMEAYDVSYTTKVRDFRDLLAAARAARAKECRPVQNL  204

Query  633  LFSECKLGLNDLPNQLYEVDWDVILVDGPRGYWPEAPGRMSAIFTAGVLARS-KKGGNPK  457
            LFSEC+L +NDLPN LY+V WDV+L+DGP G+ P +PGRM +IFT  VLARS        
Sbjct  205  LFSECRLAINDLPNDLYDVAWDVVLIDGPSGWNPNSPGRMPSIFTTAVLARSGATAAKGP  264

Query  456  THVLVHDYNQKSDRIASEEFLCRENLVETKGM--VGHFVV  343
            T VLVHD+  + +++ S EFLC EN V   G   +GHFV+
Sbjct  265  TDVLVHDFQFEVEQVLSREFLCDENRVAGSGTPSLGHFVI  304



>ref|XP_010467300.1| PREDICTED: protein IRX15-LIKE-like [Camelina sativa]
Length=332

 Score =   236 bits (601),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 116/219 (53%), Positives = 152/219 (69%), Gaps = 9/219 (4%)
 Frame = -3

Query  981  IVRALVHYASISNNTDRMSYADIKQISDVLRQCGSHPCNFLVFGLTHETLLWRTLNHHGR  802
            +  AL+HY S S     MS+ ++  IS+++   G   CN LVFGLTHE+LLWR++N  GR
Sbjct  78   VTAALLHYTSSSPPNTSMSFLELSTISNIIHSHGP-SCNLLVFGLTHESLLWRSINFQGR  136

Query  801  TVFIDESRYYAAYVEEKYPEIEVYDVQYSTKLSEMKELISGVKEQARNECRPVQNLLFSE  622
            TVF+DES Y  +  E+  P +E YDV YSTK+S+  +L+   +   R ECRPVQNLLFS+
Sbjct  137  TVFVDESPYSVSKFEQSNPGVEAYDVVYSTKVSQASKLLGYYR--TRPECRPVQNLLFSD  194

Query  621  CKLGLNDLPNQLYEVDWDVILVDGPRGYWPEAPGRMSAIFTAGVLARSKKGGNPKTH---  451
            CKLG+NDLPN +YE+DWDVIL+DGPRGY  ++PGRM+ IFT+ VLA+SK  G  K     
Sbjct  195  CKLGINDLPNFVYEIDWDVILIDGPRGYASDSPGRMAPIFTSAVLAKSKDFGKEKKKKTK  254

Query  450  ---VLVHDYNQKSDRIASEEFLCRENLVETKGMVGHFVV  343
               V VH++ +  +R+ SEEFLC ENL E  G +GHFVV
Sbjct  255  KTDVFVHEFGRNIERVYSEEFLCEENLSEVVGDLGHFVV  293



>ref|XP_004977048.1| PREDICTED: protein IRX15-like [Setaria italica]
Length=321

 Score =   235 bits (600),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 116/242 (48%), Positives = 153/242 (63%), Gaps = 5/242 (2%)
 Frame = -3

Query  1026  ASGGGGGATPALSKSIVRALVHYASISNNTDRMSYADIKQISDVLRQCGSHPCNFLVFGL  847
             A+G G G+   L   +  ALVHYASISN T RM   D    +         PCN LVFGL
Sbjct  63    AAGSGSGSDNKLPLPVFDALVHYASISNATHRM--PDTDIRAIAAVVRARAPCNLLVFGL  120

Query  846   THETLLWRTLNHHGRTVFIDESRYYAAYVEEKYPEIEVYDVQYSTKLSEMKELISGVKEQ  667
               E+ LW  LNH GRTVF++E+ +Y  Y+E K+P +E YDV Y+TK+ + ++L+S  +  
Sbjct  121   GAESPLWLALNHGGRTVFLEENEFYVKYLEPKHPGLEAYDVSYTTKVRDFRDLLSAARAS  180

Query  666   ARNECRPVQNLLFSECKLGLNDLPNQLYEVDWDVILVDGPRGYWPEAPGRMSAIFTAGVL  487
                ECRPVQNLLFSEC+L +NDLPN LY+V WD++L+DGP G+ P +PGRM +IFT  VL
Sbjct  181   RAKECRPVQNLLFSECRLAINDLPNDLYDVAWDMVLIDGPSGWNPNSPGRMPSIFTTAVL  240

Query  486   ARS-KKGGNPKTHVLVHDYNQKSDRIASEEFLCRENLVETKGM--VGHFVVEVMDANNFN  316
             ARS        T VLVHD+  + +++ S+EFLC EN V   G   +GHFV+      +  
Sbjct  241   ARSGATAAKGPTDVLVHDFQFEVEQVLSKEFLCDENRVAGSGTPSLGHFVIPGGGGRSDA  300

Query  315   FC  310
             FC
Sbjct  301   FC  302



>ref|XP_008799899.1| PREDICTED: protein IRX15-LIKE-like [Phoenix dactylifera]
Length=317

 Score =   235 bits (599),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 118/238 (50%), Positives = 162/238 (68%), Gaps = 10/238 (4%)
 Frame = -3

Query  999  PALSKSIVRALVHYASISNNTDRMSYADIKQISDVLRQCGSHPCNFLVFGLTHETLLWRT  820
            PAL   I  AL+ YA+ S+   RM+  D++  +DVLR+    PCN LVFGL HE+ LW  
Sbjct  77   PALPGPIFDALLFYATSSSAPGRMADPDLRAAADVLRR--RAPCNLLVFGLGHESPLWLA  134

Query  819  LNHHGRTVFIDESRYYAAYVEEKYPEI---EVYDVQYSTKLSEMKELISGVKEQ---ARN  658
            LNH G TVF+D S  +A+  E+K+P +   EVY   + T++++++ L++ V+ +    R 
Sbjct  135  LNHGGHTVFLDHSDLHASRFEDKHPGLPGLEVYVAAFPTRVADLRPLLAAVRPEEGSPRG  194

Query  657  ECRPVQNLLFSECKLGLNDLPNQLYEVDWDVILVDGPRGYWPEAPGRMSAIFTAGVLARS  478
             CRPVQ+LLFS+C L L+DLPN LY + WDV+LVDGP GY PEAPGR +AIFTA VLARS
Sbjct  195  RCRPVQDLLFSDCPLALSDLPNHLYRLAWDVVLVDGPPGYRPEAPGRAAAIFTAAVLARS  254

Query  477  KKGGNPKTHVLVHDYNQKSDRIASEEFLCRENLVETKGMVGHFVVEV-MDANNFNFCR  307
              GG   T VLVHD++++ +R+ SEEFLC EN+V + G + HFV+   +DA    FC+
Sbjct  255  -VGGEGTTEVLVHDHDRELERVCSEEFLCLENMVGSAGNLVHFVIHRGLDAGGGGFCK  311



>ref|NP_001132394.1| uncharacterized protein LOC100193840 [Zea mays]
 ref|XP_008681198.1| PREDICTED: uncharacterized protein LOC100193840 isoform X1 [Zea 
mays]
 gb|ACF81215.1| unknown [Zea mays]
 gb|AFW70202.1| hypothetical protein ZEAMMB73_405557 [Zea mays]
Length=323

 Score =   234 bits (598),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 122/243 (50%), Positives = 160/243 (66%), Gaps = 10/243 (4%)
 Frame = -3

Query  1023  SGGGGGATPA-LSKSIVRALVHYASISNN-TDRMSYADIKQISDVLRQCGSHPCNFLVFG  850
             +    GAT A L + +  ALV YA+ + N +  M   D++ I+ VLR+    PCN LVFG
Sbjct  73    TASAAGATEAGLPRHVFDALVQYAAAAGNLSSSMPEPDVRAIASVLRR--RAPCNLLVFG  130

Query  849   LTHETLLWRTLNHHGRTVFIDESRYYAAYVEEKYPEIEVYDVQYSTKLSEMKELISGVKE  670
             L  ET LWR LNH GRTVF+DE+ YY A++E K+P +E YDV Y+T + E+ +L+   + 
Sbjct  131   LGAETPLWRALNHGGRTVFLDENPYYVAHLEGKHPGLEAYDVAYATAVRELPDLLDAARA  190

Query  669   QARNECRPVQNLLFSECKLGLNDLPNQLYEVDWDVILVDGPRGYWPEAPGRMSAIFTAGV  490
                 ECRPVQNLLFSEC+L +NDLPNQLY+V WDVILVDGPRG+   +PGRMSAI++A V
Sbjct  191   ARAAECRPVQNLLFSECRLAINDLPNQLYDVAWDVILVDGPRGFMEGSPGRMSAIYSAAV  250

Query  489   LARSKKGGNPKTHVLVHDYNQKSDRIASEEFLCRENLVETKGM--VGHFVVE-VMDANNF  319
             +AR+K     +T V+VHDY ++ +R    EFLC EN V       +GHF+V     AN  
Sbjct  251   MARTKGA---ETEVMVHDYEREVERACGREFLCDENRVTATSTPSLGHFLVRGGAAANRE  307

Query  318   NFC  310
              FC
Sbjct  308   AFC  310



>ref|XP_010518178.1| PREDICTED: protein IRX15-LIKE-like [Camelina sativa]
Length=333

 Score =   234 bits (597),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 115/219 (53%), Positives = 152/219 (69%), Gaps = 9/219 (4%)
 Frame = -3

Query  981  IVRALVHYASISNNTDRMSYADIKQISDVLRQCGSHPCNFLVFGLTHETLLWRTLNHHGR  802
            +  AL+HY S S     MS+ ++  IS+++   G   CN LVFGLTHE+LLWR++N  GR
Sbjct  78   VTAALLHYTSSSPPNTSMSFLELSTISNIIHSHGP-SCNLLVFGLTHESLLWRSINFQGR  136

Query  801  TVFIDESRYYAAYVEEKYPEIEVYDVQYSTKLSEMKELISGVKEQARNECRPVQNLLFSE  622
            TVF+DES Y  +  E+  P +E YDV YSTK+S+  +L+   K   R ECRPVQNLLFS+
Sbjct  137  TVFVDESPYSVSKFEQSNPGVEAYDVVYSTKVSQAGKLLGYYK--TRPECRPVQNLLFSD  194

Query  621  CKLGLNDLPNQLYEVDWDVILVDGPRGYWPEAPGRMSAIFTAGVLARSKKGGNPKTH---  451
            CKLG+N+LPN +YE+DWDVIL+DGPRGY  ++PGRM+ IFT  VLA+SK  G  +     
Sbjct  195  CKLGINNLPNFVYEIDWDVILIDGPRGYASDSPGRMAPIFTTAVLAKSKDFGKKEMKKTK  254

Query  450  ---VLVHDYNQKSDRIASEEFLCRENLVETKGMVGHFVV  343
               V VH++ +K +R+ S+EFLC ENL E  G +GHFVV
Sbjct  255  KTDVFVHEFGRKIERVYSDEFLCEENLSEVVGDLGHFVV  293



>ref|XP_010488960.1| PREDICTED: protein IRX15-LIKE-like [Camelina sativa]
Length=333

 Score =   234 bits (596),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 115/219 (53%), Positives = 152/219 (69%), Gaps = 9/219 (4%)
 Frame = -3

Query  981  IVRALVHYASISNNTDRMSYADIKQISDVLRQCGSHPCNFLVFGLTHETLLWRTLNHHGR  802
            +  AL+HY S S     MS+ ++  IS+++   G   CN LVFGLTHE+LLWR++N  GR
Sbjct  78   VTAALLHYTSSSPPNTSMSFLELSTISNIIHSHGP-SCNLLVFGLTHESLLWRSINFQGR  136

Query  801  TVFIDESRYYAAYVEEKYPEIEVYDVQYSTKLSEMKELISGVKEQARNECRPVQNLLFSE  622
            TVF+DES Y  +  E+  P +E YDV YSTK+S+  +L+   +     ECRPVQNLLFS+
Sbjct  137  TVFVDESPYSVSKFEQSNPGVEAYDVVYSTKVSQASKLLGYYRTLP--ECRPVQNLLFSD  194

Query  621  CKLGLNDLPNQLYEVDWDVILVDGPRGYWPEAPGRMSAIFTAGVLARSKKGGNPKTH---  451
            CKLG+NDLPN +YE+DWDVIL+DGPRGY  ++PGRM+ IFT+ VLA+SK  G  K     
Sbjct  195  CKLGINDLPNFVYEIDWDVILIDGPRGYASDSPGRMAPIFTSAVLAKSKDFGKEKKKKTK  254

Query  450  ---VLVHDYNQKSDRIASEEFLCRENLVETKGMVGHFVV  343
               V VH++ +K +R+ S+EFLC ENL E  G +GHFVV
Sbjct  255  KTDVFVHEFGRKIERVYSDEFLCEENLSEVIGDLGHFVV  293



>ref|XP_004951837.1| PREDICTED: protein IRREGULAR XYLEM 15-like [Setaria italica]
Length=326

 Score =   230 bits (587),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 117/232 (50%), Positives = 152/232 (66%), Gaps = 9/232 (4%)
 Frame = -3

Query  993  LSKSIVRALVHYASISNNTDR-MSYADIKQISDVLRQCGSHPCNFLVFGLTHETLLWRTL  817
            L + +  ALV YA+ + NT   M   D++ I+ VLR+    PCN LVFGL  ET LWR L
Sbjct  92   LPRYVFDALVQYAAAAGNTSGCMPEPDVRAIASVLRR--RAPCNLLVFGLGAETPLWRAL  149

Query  816  NHHGRTVFIDESRYYAAYVEEKYPEIEVYDVQYSTKLSEMKELISGVKEQARNECRPVQN  637
            NH GRTVF+DE+ YY  ++E ++P +E YDV Y+T + E+ +L+   +     ECRPVQN
Sbjct  150  NHGGRTVFLDENPYYVEHLEGRHPGLEAYDVAYATAVRELPDLLDAARTARAAECRPVQN  209

Query  636  LLFSECKLGLNDLPNQLYEVDWDVILVDGPRGYWPEAPGRMSAIFTAGVLARSKKGGNPK  457
            LLFSEC+L +NDLPNQLY+V WDVILVDGPRG+   +PGRMSAI++A V+AR+K     +
Sbjct  210  LLFSECRLAINDLPNQLYDVAWDVILVDGPRGFTEGSPGRMSAIYSAAVMARTKGA---E  266

Query  456  THVLVHDYNQKSDRIASEEFLCRENLVETKGM--VGHFVVE-VMDANNFNFC  310
            T VLVHDY ++ +R    EFLC EN V       + HF V     AN   FC
Sbjct  267  TEVLVHDYEREVERACGREFLCDENRVAATSTPSLAHFRVRGGAAANREAFC  318



>gb|KFK40017.1| hypothetical protein AALP_AA3G319200 [Arabis alpina]
Length=327

 Score =   230 bits (587),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 116/229 (51%), Positives = 151/229 (66%), Gaps = 13/229 (6%)
 Frame = -3

Query  972  ALVHYASISNNTDRMSYADIKQISDVLRQCGSHPCNFLVFGLTHETLLWRTLNHHGRTVF  793
            AL+HY S S     MS+ +I  +   +        N L+FGLTHE+LLWR++N  GRTVF
Sbjct  81   ALLHYTSTSPPNTSMSFLEISTVVSSITPNS----NLLIFGLTHESLLWRSINFQGRTVF  136

Query  792  IDESRYYAAYVEEKYPEIEVYDVQYSTKLSEMKELISGVKEQARNECRPVQNLLFSECKL  613
            IDE+ Y  +  E+  P +E YDV YSTK+S+ K+L+S  K   R EC+PVQNLLFS+CKL
Sbjct  137  IDENPYTVSKFEQNNPGVEAYDVVYSTKVSQAKKLLSYYK--TRPECKPVQNLLFSDCKL  194

Query  612  GLNDLPNQLYEVDWDVILVDGPRGYWPEAPGRMSAIFTAGVLA-------RSKKGGNPKT  454
            G+NDLPN +YE+DWDVIL+DGPRGY  ++PGRM+ IFT+ VLA               KT
Sbjct  195  GINDLPNFVYEIDWDVILIDGPRGYEADSPGRMAPIFTSAVLAKSKSSDKNKNNNNKKKT  254

Query  453  HVLVHDYNQKSDRIASEEFLCRENLVETKGMVGHFVVEVMDANNFNFCR  307
             V VH++ +K +R+ SEEFLC ENL +  G +GHFVV   +   F FCR
Sbjct  255  DVFVHEFGRKLERVYSEEFLCEENLRQVVGGLGHFVVAAEEDKGFGFCR  303



>ref|XP_010530753.1| PREDICTED: protein IRX15-LIKE-like [Tarenaya hassleriana]
Length=328

 Score =   230 bits (587),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 117/232 (50%), Positives = 157/232 (68%), Gaps = 11/232 (5%)
 Frame = -3

Query  981  IVRALVHYASISNNTDRMSYADIKQISDVLRQCGSHPCNFLVFGLTHETLLWRTLNHHGR  802
            +  AL+HYA++S +   MS +++  +S  +R       N LVFGL+HE+LLWR++N  GR
Sbjct  73   VAAALLHYAAVSASNSSMSLSELSAVSAAVRSVSGR--NLLVFGLSHESLLWRSINFAGR  130

Query  801  TVFIDESRYYAAYVEEKYPEIEVYDVQYSTKLSEMKELISGVKEQARNECRPVQNLLFSE  622
            TVF+DE+ Y  +  E+  P +E YDV +ST++S+  EL+   + Q  +ECRPVQNLLFS+
Sbjct  131  TVFVDENSYAVSKFEQANPGVEAYDVVFSTRVSQAGELLRYYRTQ--HECRPVQNLLFSD  188

Query  621  CKLGLNDLPNQLYEVDWDVILVDGPRGYWPEAPGRMSAIFTAGVLARSKKG--GNPKTHV  448
            CKLG+NDLPN +YE DWDVILVDGP G+  E+PGRMSAIFTA VLARSK+      KT V
Sbjct  189  CKLGINDLPNFVYETDWDVILVDGPSGFSGESPGRMSAIFTAAVLARSKRDVKSKKKTDV  248

Query  447  LVHDYNQKSDRIASEEFLCRENLVETKGMVGHFVVEVMDAN-----NFNFCR  307
             VH++ +K +R+ SEEFLC+E LVE  G + HF V   +          FCR
Sbjct  249  FVHEFGRKVERVYSEEFLCKEKLVEVVGELAHFSVAAEEGGAGSPEEVMFCR  300



>gb|EEE66247.1| hypothetical protein OsJ_22425 [Oryza sativa Japonica Group]
Length=309

 Score =   227 bits (579),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 110/202 (54%), Positives = 140/202 (69%), Gaps = 6/202 (3%)
 Frame = -3

Query  906  ISDVLRQCGSHPCNFLVFGLTHETLLWRTLNHHGRTVFIDESRYYAAYVEEKYPEIEVYD  727
            + D LR+    PCNFLVFGL  ET LWR LNH GRTVF+DE++YY +++E ++P +E YD
Sbjct  101  VFDALRRA---PCNFLVFGLGGETPLWRALNHGGRTVFLDENQYYVSHLEGRHPGLEAYD  157

Query  726  VQYSTKLSEMKELISGVKEQARNECRPVQNLLFSECKLGLNDLPNQLYEVDWDVILVDGP  547
            V Y+T + E  +L+   +     ECRPVQNLL+S+C+L +NDLPNQLY+V WD+ILVDGP
Sbjct  158  VVYTTTVREFPDLLDAARAARSAECRPVQNLLYSDCRLAINDLPNQLYDVAWDIILVDGP  217

Query  546  RGYWPEAPGRMSAIFTAGVLARSKKGGNPKTHVLVHDYNQKSDRIASEEFLCRENLVETK  367
            RGY   +PGRMSAIFTAGV+ARS+     +T VLVHDY ++ +R  S EFLC EN VE  
Sbjct  218  RGYTAASPGRMSAIFTAGVMARSRAEKGAETDVLVHDYEREVERACSREFLCEENRVEET  277

Query  366  GM--VGHFVVE-VMDANNFNFC  310
                + HFVV    D     FC
Sbjct  278  STRSLAHFVVPGGRDLRRETFC  299



>ref|XP_002453337.1| hypothetical protein SORBIDRAFT_04g004070 [Sorghum bicolor]
 gb|EES06313.1| hypothetical protein SORBIDRAFT_04g004070 [Sorghum bicolor]
Length=321

 Score =   226 bits (575),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 121/242 (50%), Positives = 159/242 (66%), Gaps = 9/242 (4%)
 Frame = -3

Query  1023  SGGGGGATPALSKSIVRALVHYASISNNTDR-MSYADIKQISDVLRQCGSHPCNFLVFGL  847
             +   G A   L + +  ALVHYA+ + N+   M   D++ I+ VLR+    PCN LVFGL
Sbjct  74    TASAGAAEAGLPRYVFDALVHYAAAAGNSSSSMPEPDVRAIASVLRR--RAPCNLLVFGL  131

Query  846   THETLLWRTLNHHGRTVFIDESRYYAAYVEEKYPEIEVYDVQYSTKLSEMKELISGVKEQ  667
               ET LWR LNH GRTVF+DE+ YY A++E K+P +E YDV Y+T + E+ +L+   +  
Sbjct  132   GAETPLWRALNHGGRTVFLDENPYYVAHLEGKHPGLEAYDVAYATAVRELPDLLDAARAA  191

Query  666   ARNECRPVQNLLFSECKLGLNDLPNQLYEVDWDVILVDGPRGYWPEAPGRMSAIFTAGVL  487
                ECRPVQNLLFSEC+L +NDLPNQLY+V WDVILVDGPRG+   +PGRMSAI++A V+
Sbjct  192   RAAECRPVQNLLFSECRLAINDLPNQLYDVAWDVILVDGPRGFTEGSPGRMSAIYSAAVM  251

Query  486   ARSKKGGNPKTHVLVHDYNQKSDRIASEEFLCRENLVETKGM--VGHFVVEVMDA-NNFN  316
             AR+K     +T V+VHDY ++ +R    EFLC EN V       +GHF+V    A N   
Sbjct  252   ARTK---GTETEVMVHDYEREVERACGREFLCDENGVAATSTPSLGHFLVRGGAAVNREA  308

Query  315   FC  310
             FC
Sbjct  309   FC  310



>emb|CDX89660.1| BnaC03g45740D [Brassica napus]
Length=331

 Score =   226 bits (576),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 118/231 (51%), Positives = 155/231 (67%), Gaps = 9/231 (4%)
 Frame = -3

Query  981  IVRALVHYASISNNTDRMSYADIKQISDVLRQCGSHPCNFLVFGLTHETLLWRTLNHHGR  802
            I+ AL+HY S +     MS  ++  +S V+   G   CN LVFGL+HE+LLWR+ N  GR
Sbjct  80   ILAALLHYTSSTPPNTSMSLPELSAVSTVINSKGP-ACNLLVFGLSHESLLWRSANLKGR  138

Query  801  TVFIDESRYYAAYVEEKYPEIEVYDVQYSTKLSEMKELISGVKEQARNECRPVQNLLFSE  622
            TVF+DE+ Y  +  E+  P +E YDV YSTK+S+  +L+   K   R ECRPVQNLLFS+
Sbjct  139  TVFVDENSYAVSKFEQNNPGVEAYDVVYSTKVSQAGKLLGYYK--TRPECRPVQNLLFSD  196

Query  621  CKLGLNDLPNQLYEVDWDVILVDGPRGYWPEAPGRMSAIFTAGVLA----RSKKGGNPKT  454
            CKLG+NDLPN +YE++WDVIL+DGPRGY  ++PGRM+ IFT+ VLA      KK     T
Sbjct  197  CKLGINDLPNFVYEIEWDVILIDGPRGYAGDSPGRMAPIFTSAVLAKSKDSGKKKKKKTT  256

Query  453  HVLVHDYNQKSDRIASEEFLCRENLVETKGMVGHFVV--EVMDANNFNFCR  307
             V VH++ +K +R+ SEEFLC ENL+E  G +GHFVV  E  +     FCR
Sbjct  257  DVFVHEFGRKLERVYSEEFLCEENLIEVVGELGHFVVAAEKGEKQGNGFCR  307



>emb|CDY37228.1| BnaA09g08490D [Brassica napus]
Length=323

 Score =   226 bits (575),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 112/229 (49%), Positives = 154/229 (67%), Gaps = 7/229 (3%)
 Frame = -3

Query  981  IVRALVHYASISNNTDRMSYADIKQISDVLRQCGSHPCNFLVFGLTHETLLWRTLNHHGR  802
            I+ AL+HY S +     MS++++  IS V+    +  CN LVFGL+HE+LLWR++N  GR
Sbjct  80   ILAALLHYTSSTPPNTSMSFSELSAISTVINS-KAPTCNLLVFGLSHESLLWRSVNLRGR  138

Query  801  TVFIDESRYYAAYVEEKYPEIEVYDVQYSTKLSEMKELISGVKEQARNECRPVQNLLFSE  622
            TVF+DE+ Y  +  E+  P  E YDV + TK+S+  +L+   K   R ECRPVQNLLFS+
Sbjct  139  TVFVDENPYLVSRFEQSNPGAEAYDVVFPTKVSQAGKLLRYYK--TRPECRPVQNLLFSD  196

Query  621  CKLGLNDLPNQLYEVDWDVILVDGPRGYWPEAPGRMSAIFTAGVLARSKKGG--NPKTHV  448
            CKL +NDLPN +YE++WDV+L+DGP GY  ++PGRM+ IFT+ VLA+SK  G     T V
Sbjct  197  CKLAINDLPNFVYEIEWDVVLIDGPSGYAGDSPGRMAPIFTSAVLAKSKGSGRKTKTTDV  256

Query  447  LVHDYNQKSDRIASEEFLCRENLVETKGMVGHFVV--EVMDANNFNFCR  307
             V ++ +K +R+ S+EFLC ENL+E  G +GHFVV  E        FCR
Sbjct  257  FVREFGRKLERVYSDEFLCEENLIEVVGEIGHFVVAAEKGGKQGNGFCR  305



>dbj|BAJ87047.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=327

 Score =   225 bits (574),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 114/233 (49%), Positives = 154/233 (66%), Gaps = 10/233 (4%)
 Frame = -3

Query  993  LSKSIVRALVHYASIS--NNTDRMSYADIKQISDVLRQCGSHPCNFLVFGLTHETLLWRT  820
            L   +  ALV YA+ +  N+T  M   D++ I+ VLR+    PCN LVFGL  ET LWR 
Sbjct  90   LPAYVFDALVRYAAAAGANSTVSMPEGDVRAIAAVLRR--RAPCNLLVFGLGAETPLWRA  147

Query  819  LNHHGRTVFIDESRYYAAYVEEKYPEIEVYDVQYSTKLSEMKELISGVKEQARNECRPVQ  640
            LNH GRTVF+DE+ +Y A++E  +  +E YDV Y+T + E+ +L+   +   R ECRPVQ
Sbjct  148  LNHGGRTVFLDENPFYVAHMEGAHGGLEAYDVAYATAVRELPDLLDAARASRRAECRPVQ  207

Query  639  NLLFSECKLGLNDLPNQLYEVDWDVILVDGPRGYWPEAPGRMSAIFTAGVLARSKKGGNP  460
            NLLFS+C+L + DLPNQLYEV WDVILVDGP GY   +PGRM+AI+++ V+AR+K     
Sbjct  208  NLLFSDCRLAIGDLPNQLYEVAWDVILVDGPHGYAEGSPGRMAAIYSSAVMARTK---GT  264

Query  459  KTHVLVHDYNQKSDRIASEEFLCRENLVE--TKGMVGHFVVE-VMDANNFNFC  310
             T VLVHDY ++ + + + EFLC EN VE  T   +GH+++     AN   FC
Sbjct  265  VTDVLVHDYEREVESVCAREFLCDENRVEGTTTPSLGHYILRGGAAANREAFC  317



>ref|XP_010928364.1| PREDICTED: protein IRX15-LIKE-like [Elaeis guineensis]
Length=321

 Score =   224 bits (571),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 111/238 (47%), Positives = 156/238 (66%), Gaps = 10/238 (4%)
 Frame = -3

Query  999  PALSKSIVRALVHYASISNNTDRMSYADIKQISDVLRQCGSHPCNFLVFGLTHETLLWRT  820
            P+L   I  AL+ YA+ S+   RM+  D++  + VLR     PCN LVFGL HE+ LW  
Sbjct  80   PSLPAPIFDALLFYATSSSTPGRMADTDVRAAAAVLRS--RAPCNLLVFGLGHESPLWLA  137

Query  819  LNHHGRTVFIDESRYYAAYVEEK---YPEIEVYDVQYSTKLSEMKELISGVKEQ---ARN  658
            LNH G TVF+D S   A+  E++    P +EVY   + T++S++  L++ V+ +    R 
Sbjct  138  LNHGGHTVFVDHSDLRASRFEDQRPGLPGLEVYATAFPTRVSDLHPLLAAVRPEEASPRG  197

Query  657  ECRPVQNLLFSECKLGLNDLPNQLYEVDWDVILVDGPRGYWPEAPGRMSAIFTAGVLARS  478
             CRPVQ+LLFS+C L L+DLPN L+ + WDV+ VDGP GY P+APGR +AIFTA VLARS
Sbjct  198  RCRPVQDLLFSDCPLALSDLPNHLFRLAWDVVFVDGPPGYHPDAPGRAAAIFTAAVLARS  257

Query  477  KKGGNPKTHVLVHDYNQKSDRIASEEFLCRENLVETKGMVGHFVVEV-MDANNFNFCR  307
              GG   T V+VHD++++ +++ SEEFLC+EN+V + G + HFV+    DA    FC+
Sbjct  258  -VGGEGTTDVMVHDHDREVEKVCSEEFLCQENMVGSAGNLAHFVIHRGRDAGGGGFCK  314



>ref|XP_009123237.1| PREDICTED: protein IRX15-LIKE-like [Brassica rapa]
Length=325

 Score =   224 bits (571),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 107/213 (50%), Positives = 149/213 (70%), Gaps = 5/213 (2%)
 Frame = -3

Query  981  IVRALVHYASISNNTDRMSYADIKQISDVLRQCGSHPCNFLVFGLTHETLLWRTLNHHGR  802
            I+ AL+HY S +     MS++++  IS V+    +  CN LVFGL+HE+LLWR++N  GR
Sbjct  80   ILAALLHYTSSTPPNTSMSFSELSAISTVINS-KAPTCNLLVFGLSHESLLWRSVNLKGR  138

Query  801  TVFIDESRYYAAYVEEKYPEIEVYDVQYSTKLSEMKELISGVKEQARNECRPVQNLLFSE  622
            TVF+DE+ Y  +  E+ +P  E YDV + TK+S+  +L+   K   R ECRPVQNLLFS+
Sbjct  139  TVFVDENPYAVSRFEQSHPGAEAYDVVFPTKVSQAGKLLRYYK--TRPECRPVQNLLFSD  196

Query  621  CKLGLNDLPNQLYEVDWDVILVDGPRGYWPEAPGRMSAIFTAGVLARSKKGG--NPKTHV  448
            CKL +NDLPN +YE++WDVIL+DGP GY  ++PGRM+ IFT+ VLA+SK  G     T V
Sbjct  197  CKLAINDLPNFVYEIEWDVILIDGPSGYAGDSPGRMAPIFTSAVLAKSKDSGRKTKTTDV  256

Query  447  LVHDYNQKSDRIASEEFLCRENLVETKGMVGHF  349
             V ++ +K +R+ S+EFLC ENL+E  G +GHF
Sbjct  257  FVREFGRKLERVYSDEFLCEENLIEVVGEIGHF  289



>emb|CDY62313.1| BnaCnng39920D [Brassica napus]
Length=320

 Score =   224 bits (570),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 112/229 (49%), Positives = 153/229 (67%), Gaps = 7/229 (3%)
 Frame = -3

Query  981  IVRALVHYASISNNTDRMSYADIKQISDVLRQCGSHPCNFLVFGLTHETLLWRTLNHHGR  802
            I+ AL+HY S +     MS +++  IS V+    +  CN LVFGL+HE+LLWR++N  GR
Sbjct  77   ILAALLHYTSSTPPNTSMSLSELSTISTVINS-KAPTCNLLVFGLSHESLLWRSVNLKGR  135

Query  801  TVFIDESRYYAAYVEEKYPEIEVYDVQYSTKLSEMKELISGVKEQARNECRPVQNLLFSE  622
            TVF+DE+ Y  +  E+  P  E YDV + TK+ +  +L+   K   R+ECRPVQNLLFS+
Sbjct  136  TVFVDENPYAVSRFEQSNPGAEAYDVVFPTKVPQAGKLLRYYK--TRSECRPVQNLLFSD  193

Query  621  CKLGLNDLPNQLYEVDWDVILVDGPRGYWPEAPGRMSAIFTAGVLARSKKGG--NPKTHV  448
            CKL +NDLPN +YE+DWDVIL+DGP GY  ++PGRM+ IFT+ VLA+SK  G     T V
Sbjct  194  CKLAINDLPNFVYEIDWDVILIDGPSGYAGDSPGRMAPIFTSAVLAKSKDSGKKTKTTDV  253

Query  447  LVHDYNQKSDRIASEEFLCRENLVETKGMVGHFVV--EVMDANNFNFCR  307
             V ++ +K +R+ S+EFLC ENL+E  G +GHFV+  E        FCR
Sbjct  254  FVREFGRKLERVYSDEFLCEENLIEVFGEIGHFVLAGEKGGKQGNGFCR  302



>ref|XP_006298050.1| hypothetical protein CARUB_v10014094mg [Capsella rubella]
 gb|EOA30948.1| hypothetical protein CARUB_v10014094mg [Capsella rubella]
Length=346

 Score =   224 bits (571),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 113/222 (51%), Positives = 153/222 (69%), Gaps = 12/222 (5%)
 Frame = -3

Query  981  IVRALVHYASISNNTDRMSYADIKQISDVLRQCGSHPCNFLVFGLTHETLLWRTLNHHGR  802
            +  AL+HY S +     MS+ ++  IS ++   G   CN LVFGLT+E+LLWR++N  GR
Sbjct  85   VTAALLHYTSSTPPNTSMSFLELTTISTIINSHGP-SCNLLVFGLTYESLLWRSINFQGR  143

Query  801  TVFIDESRYYAAYVEEKYPEIEVYDVQYSTKLSEMKELISGVKEQARNECRPVQNLLFSE  622
            TVF+DES Y  +  E+  P +E YDV YSTK+S+  +L+   K   +NECRPVQNLLFS+
Sbjct  144  TVFVDESPYSVSKFEQSNPGVEAYDVVYSTKVSQATKLLGYYK--TKNECRPVQNLLFSD  201

Query  621  CKLGLNDLPNQLYEVDWDVILVDGPRGYWPEAPGRMSAIFTAGVLARSKKGGNPKTH---  451
            CKLG+NDLPN +YE+DWDVIL+DGPRGY  ++PGRM+ IFT  VLA+SK  G  K     
Sbjct  202  CKLGINDLPNFVYEIDWDVILIDGPRGYAFDSPGRMAPIFTTAVLAKSKDLGKKKKMKKT  261

Query  450  ------VLVHDYNQKSDRIASEEFLCRENLVETKGMVGHFVV  343
                  V VH++ ++ +R+ S+EFLC ENL+E  G +GH+VV
Sbjct  262  KKKKTDVFVHEFGREIERVYSDEFLCEENLIEVVGDLGHYVV  303



>dbj|BAJ95150.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=343

 Score =   223 bits (568),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 115/223 (52%), Positives = 152/223 (68%), Gaps = 5/223 (2%)
 Frame = -3

Query  999  PALSKSIVRALVHYASISNNTD-RMSYADIKQISDVLRQCGSHPCNFLVFGLTHETLLWR  823
            P L   +  ALV YA++  NT   M  AD++ I+  L++    PCN LVFGL  ET LWR
Sbjct  101  PGLPGYVFDALVQYAAVGGNTSGSMPAADVRAIAAALKR--RSPCNLLVFGLGGETPLWR  158

Query  822  TLNHHGRTVFIDESRYYAAYVEEKYPEIEVYDVQYSTKLSEMKELISGVKEQARNECRPV  643
             LNH GRTVF+DE+++Y +++E ++P +E YDV Y+T + E  +L+   +     EC+PV
Sbjct  159  ALNHGGRTVFLDENQWYVSHLEGRHPGLEAYDVAYTTTVREFPDLLEAARAARAAECQPV  218

Query  642  QNLLFSECKLGLNDLPNQLYEVDWDVILVDGPRGYWPEAPGRMSAIFTAGVLARSKKGGN  463
            QNLLFS+C+L +NDLPNQLY+V WDVILVDGPRGY   +PGRMSAIFTAGVLAR+++   
Sbjct  219  QNLLFSDCRLAINDLPNQLYDVAWDVILVDGPRGYTASSPGRMSAIFTAGVLARAREEEG  278

Query  462  PKTHVLVHDYNQKSDRIASEEFLCRENLVETKGM--VGHFVVE  340
              T VLVHDY ++ +R  S EFLC EN V       + HFV+ 
Sbjct  279  AATDVLVHDYEREVERACSREFLCEENRVPASSTRSLAHFVIR  321



>dbj|BAD28033.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAD28178.1| unknown protein [Oryza sativa Japonica Group]
Length=347

 Score =   221 bits (563),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 114/233 (49%), Positives = 149/233 (64%), Gaps = 10/233 (4%)
 Frame = -3

Query  993  LSKSIVRALVHYASISNNTDRMSYA--DIKQISDVLRQCGSHPCNFLVFGLTHETLLWRT  820
            L   +  ALV YA+ +      S    D++ I+ VLR+    PC  LVFGL  ET LWR 
Sbjct  108  LPAYVFDALVQYAAAAGANATASMPEEDVRAIASVLRR--RAPCRLLVFGLGAETPLWRA  165

Query  819  LNHHGRTVFIDESRYYAAYVEEKYPEIEVYDVQYSTKLSEMKELISGVKEQARNECRPVQ  640
            LNH GRTVF+DE+ +Y A+VE   P +E YDV Y+T + E  +L+   +     +CRPVQ
Sbjct  166  LNHGGRTVFLDENPFYVAHVEGALPGLEAYDVSYATAVREFPDLLDAARAAQSADCRPVQ  225

Query  639  NLLFSECKLGLNDLPNQLYEVDWDVILVDGPRGYWPEAPGRMSAIFTAGVLARSKKGGNP  460
            NLLFS+C+L +NDLPNQLY+V WDVILVDGP G+   +PGRMSAIF+A V+AR+K     
Sbjct  226  NLLFSDCRLAINDLPNQLYDVSWDVILVDGPSGFTEGSPGRMSAIFSAAVMARTKGS---  282

Query  459  KTHVLVHDYNQKSDRIASEEFLCRENLVETKGM--VGHFVVEVMDANNFN-FC  310
            +T VLVHDY ++ +   + EFLC EN VE      +GHF+V    A N + FC
Sbjct  283  ETEVLVHDYQREVEIACAREFLCPENRVEATATPSLGHFLVRGGAAANRDAFC  335



>ref|XP_003570954.2| PREDICTED: protein IRREGULAR XYLEM 15-like [Brachypodium distachyon]
Length=321

 Score =   219 bits (559),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 113/238 (47%), Positives = 153/238 (64%), Gaps = 14/238 (6%)
 Frame = -3

Query  993  LSKSIVRALVHYASISNN---TDRMSYADIKQISDVLRQCGSHPCNFLVFGLTHETLLWR  823
            L   +  ALV YA+ + N   T  M   D++ I+ VLR+    PC  LVFGL  ET LWR
Sbjct  76   LPAHVFDALVQYAATAGNNSSTSSMPEQDVRAIAAVLRR--RAPCKALVFGLGAETPLWR  133

Query  822  TLNHH--GRTVFIDESRYYAAYVEEKYPEIEVYDVQYSTKLSEMKELISGVKEQARNECR  649
             LNH   GRTVF+DE+ +Y A++E  +P +E YDV YST + + + L+   +     ECR
Sbjct  134  ALNHGAGGRTVFLDENAFYVAHMEATHPGLEAYDVSYSTAVRDFENLLEHARATRAAECR  193

Query  648  PVQNLLFSECKLGLNDLPNQLYEVDWDVILVDGPRGYWPEAPGRMSAIFTAGVLARSKKG  469
            PVQNLLFS+C+L + DLPN LYEV WDVILVDGPRG+ P +PGRM+AIF+A V+AR+K  
Sbjct  194  PVQNLLFSDCRLAIGDLPNALYEVAWDVILVDGPRGFAPGSPGRMAAIFSAAVMARTK--  251

Query  468  GNPKTHVLVHDYNQKSDRIASEEFLCRENLVE---TKGMVGHFVVE-VMDANNFNFCR  307
               +T VLVHD  ++ + + + EFLC EN V+   +   +GH+V+    D +   FCR
Sbjct  252  -GKETDVLVHDLGREVESVCAGEFLCEENRVQGSTSTPSLGHYVIRGGADVDRKAFCR  308



>gb|EAY84554.1| hypothetical protein OsI_05925 [Oryza sativa Indica Group]
Length=347

 Score =   219 bits (559),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 113/233 (48%), Positives = 149/233 (64%), Gaps = 10/233 (4%)
 Frame = -3

Query  993  LSKSIVRALVHYASISNNTDRMSYA--DIKQISDVLRQCGSHPCNFLVFGLTHETLLWRT  820
            L   +  ALV YA+ +      S    D++ I+ VLR+    PC  LVFGL  ET LWR 
Sbjct  108  LPAYVFDALVQYAAAAGANATASMPEEDVRAIASVLRR--RAPCRLLVFGLGAETPLWRA  165

Query  819  LNHHGRTVFIDESRYYAAYVEEKYPEIEVYDVQYSTKLSEMKELISGVKEQARNECRPVQ  640
            LNH GRTVF+DE+ +Y A++E   P +E YDV Y+T + E  +L+   +     +CRPVQ
Sbjct  166  LNHGGRTVFLDENPFYVAHMEGALPGLEAYDVSYATAVREFPDLLDAARAAQSADCRPVQ  225

Query  639  NLLFSECKLGLNDLPNQLYEVDWDVILVDGPRGYWPEAPGRMSAIFTAGVLARSKKGGNP  460
            NLLFS+C+L +NDLPNQLY+V WDVILVDGP G+   +PGRMSAIF+A V+AR+K     
Sbjct  226  NLLFSDCRLAINDLPNQLYDVSWDVILVDGPSGFTEGSPGRMSAIFSAAVMARTKGS---  282

Query  459  KTHVLVHDYNQKSDRIASEEFLCRENLVETKGM--VGHFVVEVMDANNFN-FC  310
            +T VLVHDY ++ +   + EFLC EN VE      +GHF+V    A N + FC
Sbjct  283  ETEVLVHDYQREVEIACAREFLCPENRVEATATPSLGHFLVRGGAAANRDAFC  335



>ref|XP_003560476.1| PREDICTED: protein IRX15-LIKE-like [Brachypodium distachyon]
Length=348

 Score =   219 bits (559),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 107/198 (54%), Positives = 137/198 (69%), Gaps = 4/198 (2%)
 Frame = -3

Query  930  MSYADIKQISDVLRQCGSHPCNFLVFGLTHETLLWRTLNHHGRTVFIDESRYYAAYVEEK  751
            M   D++ I+  L++    PCN LVFGL  ET LWR LNH GRTVF+DE++YY +++E +
Sbjct  131  MPGGDVRAIAAALKR--RAPCNLLVFGLGGETPLWRALNHGGRTVFLDENQYYVSHLEGR  188

Query  750  YPEIEVYDVQYSTKLSEMKELISGVKEQARNECRPVQNLLFSECKLGLNDLPNQLYEVDW  571
            +P +E YDV Y+T + E  +L+   +     ECRPVQNLLFS+C+L +NDLPN LY+V W
Sbjct  189  HPGLEAYDVAYTTTVREFPDLLEAARAARAAECRPVQNLLFSDCRLAINDLPNHLYDVAW  248

Query  570  DVILVDGPRGYWPEAPGRMSAIFTAGVLARSKKGGNPKTHVLVHDYNQKSDRIASEEFLC  391
            DVILVDGPRGY   +PGRM+AIFTAGVLAR +K     T VLVHDY ++ +R  S EFLC
Sbjct  249  DVILVDGPRGYTASSPGRMAAIFTAGVLARGRKEEGATTDVLVHDYEREVERACSREFLC  308

Query  390  RENLVETKGM--VGHFVV  343
             EN V       + HFVV
Sbjct  309  EENRVPETSTRSLAHFVV  326



>ref|XP_010547998.1| PREDICTED: protein IRX15-LIKE [Tarenaya hassleriana]
Length=326

 Score =   217 bits (553),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 101/178 (57%), Positives = 133/178 (75%), Gaps = 3/178 (2%)
 Frame = -3

Query  870  CNFLVFGLTHETLLWRTLNHHGRTVFIDESRYYAAYVEEKYPEIEVYDVQYSTKLSEMKE  691
             N LVFGLTHE+LLWR++N  GRTVF+D+S Y  +  E+  P +E YD+ +S+++S+  E
Sbjct  107  VNLLVFGLTHESLLWRSINFPGRTVFVDDSSYAVSKFEQTNPGVEAYDIVFSSRVSQAGE  166

Query  690  LISGVKEQARNECRPVQNLLFSECKLGLNDLPNQLYEVDWDVILVDGPRGYWPEAPGRMS  511
            L+   +   R++CRPVQNLLFS+C+L +NDLPN  Y+ DWDVILVDGP G+  E+PGRMS
Sbjct  167  LLRYYR--TRHDCRPVQNLLFSDCELAINDLPNFFYDTDWDVILVDGPSGFSGESPGRMS  224

Query  510  AIFTAGVLARSKK-GGNPKTHVLVHDYNQKSDRIASEEFLCRENLVETKGMVGHFVVE  340
            AIFT+ VLARSK+ G N KT V VH++ +  +R+ SEEFLC ENLVE  G + HF VE
Sbjct  225  AIFTSAVLARSKREGKNKKTDVFVHEFGRTVERVYSEEFLCEENLVEVVGELAHFSVE  282



>ref|XP_002978695.1| hypothetical protein SELMODRAFT_57632, partial [Selaginella moellendorffii]
 gb|EFJ20142.1| hypothetical protein SELMODRAFT_57632, partial [Selaginella moellendorffii]
Length=198

 Score =   207 bits (528),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 102/201 (51%), Positives = 141/201 (70%), Gaps = 4/201 (2%)
 Frame = -3

Query  993  LSKSIVRALVHYASISNNTDRMSYADIKQISDVLRQCGSHPCNFLVFGLTHETLLWRTLN  814
            L   ++ ALVHYAS ++ T + +  +I   + VL   G  PCNFLVFGL H++LLW+ LN
Sbjct  2    LPHDLMTALVHYAS-TDTTPQQTREEILMTAKVLASRG--PCNFLVFGLGHDSLLWKMLN  58

Query  813  HHGRTVFIDESRYYAAYVEEKYPEIEVYDVQYSTKLSEMKELISGVKEQARNECRPVQNL  634
            + GRTVF++ES  +   + EK+PE+E + V+YST L+E  +L+   +   + +C  VQNL
Sbjct  59   YAGRTVFLEESEDWIRQISEKHPELETHIVEYSTVLTEADQLLEHARSNRKGKCTAVQNL  118

Query  633  LFSECKLGLNDLPNQLYEVDWDVILVDGPRGYWPEAPGRMSAIFTAGVLARSKKGGNPKT  454
            L SECKL LN L ++L++V+WDVI+VD PRGY+P APGRM+AIF+A V+ARS+K GN  T
Sbjct  119  LLSECKLALNGLADELFQVEWDVIMVDAPRGYFPGAPGRMAAIFSAAVMARSRKTGN-GT  177

Query  453  HVLVHDYNQKSDRIASEEFLC  391
             V VHD  +  +R  SEEFLC
Sbjct  178  DVFVHDVERPVERSYSEEFLC  198



>ref|XP_002984622.1| hypothetical protein SELMODRAFT_47575, partial [Selaginella moellendorffii]
 gb|EFJ14267.1| hypothetical protein SELMODRAFT_47575, partial [Selaginella moellendorffii]
Length=197

 Score =   206 bits (524),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 101/201 (50%), Positives = 140/201 (70%), Gaps = 4/201 (2%)
 Frame = -3

Query  993  LSKSIVRALVHYASISNNTDRMSYADIKQISDVLRQCGSHPCNFLVFGLTHETLLWRTLN  814
            L   ++ ALVHYAS ++ T + +  +I   + VL   G  PCNFLVFGL H++LLW+ LN
Sbjct  1    LPHDLMTALVHYAS-TDTTPQQTREEILMTAKVLASRG--PCNFLVFGLGHDSLLWKMLN  57

Query  813  HHGRTVFIDESRYYAAYVEEKYPEIEVYDVQYSTKLSEMKELISGVKEQARNECRPVQNL  634
            + GRT F++ES  +   + EK+PE+E + V+YST L+E  +L+   +   + +C  VQNL
Sbjct  58   YAGRTAFLEESEDWIRQISEKHPELETHIVEYSTVLTEADQLLEHARSNRKGKCTAVQNL  117

Query  633  LFSECKLGLNDLPNQLYEVDWDVILVDGPRGYWPEAPGRMSAIFTAGVLARSKKGGNPKT  454
            L SECKL LN L ++L++V+WDVI+VD PRGY+P APGRM+AIF+A V+ARS+K GN  T
Sbjct  118  LLSECKLALNGLADELFQVEWDVIMVDAPRGYFPGAPGRMAAIFSAAVMARSRKTGN-GT  176

Query  453  HVLVHDYNQKSDRIASEEFLC  391
             V VHD  +  +R  SEEFLC
Sbjct  177  DVFVHDVERPVERSYSEEFLC  197



>gb|AFK46333.1| unknown [Lotus japonicus]
Length=208

 Score =   206 bits (524),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 95/144 (66%), Positives = 117/144 (81%), Gaps = 4/144 (3%)
 Frame = -3

Query  1026  ASGGGGGATPALSKSIVRALVHYASISNNTDRMSYADIKQISDVLRQCGSHPCNFLVFGL  847
              SG G    PA   +++  L+HYA+ SN+T  M Y+D+K ISD+LR+C S PCN L+FGL
Sbjct  66    VSGLGSAPLPA---TVINTLLHYAAKSNDTFHMPYSDLKPISDMLRKCSS-PCNLLIFGL  121

Query  846   THETLLWRTLNHHGRTVFIDESRYYAAYVEEKYPEIEVYDVQYSTKLSEMKELISGVKEQ  667
             THETLLW+ LNH+GRTVFI+E+RYYAAY EEK+P I+V+DVQY+TK SEMKELI+  KEQ
Sbjct  122   THETLLWKALNHNGRTVFIEENRYYAAYFEEKHPGIDVFDVQYTTKRSEMKELIASAKEQ  181

Query  666   ARNECRPVQNLLFSECKLGLNDLP  595
               NEC+PVQNLLFS+CKLGLNDLP
Sbjct  182   VANECKPVQNLLFSDCKLGLNDLP  205



>ref|XP_006648329.1| PREDICTED: protein IRX15-like [Oryza brachyantha]
Length=253

 Score =   203 bits (517),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 97/185 (52%), Positives = 129/185 (70%), Gaps = 6/185 (3%)
 Frame = -3

Query  855  FGLTHETLLWRTLNHHGRTVFIDESRYYAAYVEEKYPEIEVYDVQYSTKLSEMKELISGV  676
            FGL  ET LWR LNH GRTVF+DE+ +Y A++E  +P +E YDV Y+T + E  +L+   
Sbjct  60   FGLGAETPLWRALNHGGRTVFLDENPFYVAHLEGAHPGLEAYDVSYATAVREFPDLLDAA  119

Query  675  KEQARNECRPVQNLLFSECKLGLNDLPNQLYEVDWDVILVDGPRGYWPEAPGRMSAIFTA  496
            +     +CRPVQNLLFS+C+L +NDLPNQLY+V WDVILVDGP G+   +PGRM+AIF+A
Sbjct  120  RASRSADCRPVQNLLFSDCRLAINDLPNQLYDVSWDVILVDGPSGFTEGSPGRMAAIFSA  179

Query  495  GVLARSKKGGNPKTHVLVHDYNQKSDRIASEEFLCRENLVETKGM--VGHFVVEVMDANN  322
             V+AR+K     +T VLVHDY ++ +  ++ EFLC EN VET     +GH+VV    A +
Sbjct  180  AVMARTKGA---ETEVLVHDYQREVESASAREFLCPENRVETTTTPSLGHYVVRGAAAAS  236

Query  321  FN-FC  310
             N FC
Sbjct  237  QNTFC  241



>ref|XP_006836793.1| hypothetical protein AMTR_s00099p00012720 [Amborella trichopoda]
 gb|ERM99646.1| hypothetical protein AMTR_s00099p00012720 [Amborella trichopoda]
Length=310

 Score =   198 bits (504),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 98/228 (43%), Positives = 152/228 (67%), Gaps = 7/228 (3%)
 Frame = -3

Query  993  LSKSIVRALVHYASISNNTDRMSYADIKQISDVLRQCGSHPCNFLVFGLTHETLLWRTLN  814
            L ++IV++L+HYA+ SN T + +  +I   S VL Q    PCNFL+FGL H++LLW +LN
Sbjct  89   LPEAIVQSLIHYAT-SNTTPQQTIKEISITSSVLLQ--KSPCNFLIFGLGHDSLLWSSLN  145

Query  813  HHGRTVFIDESRYYAAYVEEKYPEIEVYDVQYSTKLSEMKELISGVKEQARNECRPVQNL  634
            ++GRTVF++E + +   + +K P +E Y +QY+T++SE  EL+   K     ECR VQN 
Sbjct  146  YNGRTVFLEEDKAWIQQITQKIPNLEAYHLQYTTRVSEADELL---KYGETEECRRVQNP  202

Query  633  LFSECKLGLNDLPNQLYEVDWDVILVDGPRGYWPEAPGRMSAIFTAGVLARSKKGGNPKT  454
              S+C+L +  +P++LYEV+WD+I+VD P GY+  APGRM+AI+TAG++ARS++ G  +T
Sbjct  203  RDSDCRLSIKGMPDELYEVNWDLIMVDAPTGYFSGAPGRMTAIYTAGMIARSRRDGG-ET  261

Query  453  HVLVHDYNQKSDRIASEEFLCRENLVETKGMVGHFVVEVMDANNFNFC  310
             V VHD ++  +   S  FLC   +   +G + HF++    +N  +FC
Sbjct  262  DVFVHDCDRPVEDKYSMSFLCEGYMKNAEGRLRHFLIPSQLSNPGSFC  309



>gb|EEE56345.1| hypothetical protein OsJ_05451 [Oryza sativa Japonica Group]
Length=199

 Score =   194 bits (492),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 94/179 (53%), Positives = 122/179 (68%), Gaps = 6/179 (3%)
 Frame = -3

Query  837  TLLWRTLNHHGRTVFIDESRYYAAYVEEKYPEIEVYDVQYSTKLSEMKELISGVKEQARN  658
            T LWR LNH GRTVF+DE+ +Y A+VE   P +E YDV Y+T + E  +L+   +     
Sbjct  12   TPLWRALNHGGRTVFLDENPFYVAHVEGALPGLEAYDVSYATAVREFPDLLDAARAAQSA  71

Query  657  ECRPVQNLLFSECKLGLNDLPNQLYEVDWDVILVDGPRGYWPEAPGRMSAIFTAGVLARS  478
            +CRPVQNLLFS+C+L +NDLPNQLY+V WDVILVDGP G+   +PGRMSAIF+A V+AR+
Sbjct  72   DCRPVQNLLFSDCRLAINDLPNQLYDVSWDVILVDGPSGFTEGSPGRMSAIFSAAVMART  131

Query  477  KKGGNPKTHVLVHDYNQKSDRIASEEFLCRENLVETKGM--VGHFVVEVMDANNFN-FC  310
            K     +T VLVHDY ++ +   + EFLC EN VE      +GHF+V    A N + FC
Sbjct  132  KGS---ETEVLVHDYQREVEIACAREFLCPENRVEATATPSLGHFLVRGGAAANRDAFC  187



>gb|AAF43218.1|AC012654_2 EST gb|AI999169 comes from this gene [Arabidopsis thaliana]
Length=287

 Score =   193 bits (490),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 98/218 (45%), Positives = 140/218 (64%), Gaps = 6/218 (3%)
 Frame = -3

Query  993  LSKSIVRALVHYASISNNTDRMSYADIKQISDVLRQCGSHPCNFLVFGLTHETLLWRTLN  814
            +  S+  ALVHYAS SN T + + ++I      L +    PCNFLVFGL H++L+W TLN
Sbjct  60   IPPSLADALVHYAS-SNVTPQQTLSEISVTKKELEK--KSPCNFLVFGLGHDSLMWATLN  116

Query  813  HHGRTVFIDESRYYAAYVEEKYPEIEVYDVQYSTKLSEMKELISGVKEQARNECRPVQ-N  637
            H GRT+F+DE   +   + EK+P +E Y V+Y TK+ + + L++  K+  R ECR V  +
Sbjct  117  HGGRTIFLDEDESWIHQIAEKFPSLESYHVRYKTKVRDAEALMAATKD--REECRRVSTD  174

Query  636  LLFSECKLGLNDLPNQLYEVDWDVILVDGPRGYWPEAPGRMSAIFTAGVLARSKKGGNPK  457
            L  S C+L L  LP  +YE +WD+I+VD P G+  EAPGRMSAI+TAG++AR +K     
Sbjct  175  LRVSTCELALKGLPEVVYETEWDLIMVDAPTGFHEEAPGRMSAIYTAGMIARRRKDEEET  234

Query  456  THVLVHDYNQKSDRIASEEFLCRENLVETKGMVGHFVV  343
            T V VHD ++K +   S EFLCR+ + + +G + HF V
Sbjct  235  TAVFVHDVDRKVEDEFSMEFLCRDYMTKQEGRLRHFTV  272



>ref|NP_565020.1| uncharacterized protein [Arabidopsis thaliana]
 gb|AAG51814.1|AC016163_3 hypothetical protein; 28267-27009 [Arabidopsis thaliana]
 gb|AAS76228.1| At1g71690 [Arabidopsis thaliana]
 gb|AAS92321.1| At1g71690 [Arabidopsis thaliana]
 dbj|BAF00524.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE35213.1| uncharacterized protein AT1G71690 [Arabidopsis thaliana]
Length=295

 Score =   193 bits (490),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 98/218 (45%), Positives = 140/218 (64%), Gaps = 6/218 (3%)
 Frame = -3

Query  993  LSKSIVRALVHYASISNNTDRMSYADIKQISDVLRQCGSHPCNFLVFGLTHETLLWRTLN  814
            +  S+  ALVHYAS SN T + + ++I      L +    PCNFLVFGL H++L+W TLN
Sbjct  68   IPPSLADALVHYAS-SNVTPQQTLSEISVTKKELEK--KSPCNFLVFGLGHDSLMWATLN  124

Query  813  HHGRTVFIDESRYYAAYVEEKYPEIEVYDVQYSTKLSEMKELISGVKEQARNECRPVQ-N  637
            H GRT+F+DE   +   + EK+P +E Y V+Y TK+ + + L++  K+  R ECR V  +
Sbjct  125  HGGRTIFLDEDESWIHQIAEKFPSLESYHVRYKTKVRDAEALMAATKD--REECRRVSTD  182

Query  636  LLFSECKLGLNDLPNQLYEVDWDVILVDGPRGYWPEAPGRMSAIFTAGVLARSKKGGNPK  457
            L  S C+L L  LP  +YE +WD+I+VD P G+  EAPGRMSAI+TAG++AR +K     
Sbjct  183  LRVSTCELALKGLPEVVYETEWDLIMVDAPTGFHEEAPGRMSAIYTAGMIARRRKDEEET  242

Query  456  THVLVHDYNQKSDRIASEEFLCRENLVETKGMVGHFVV  343
            T V VHD ++K +   S EFLCR+ + + +G + HF V
Sbjct  243  TAVFVHDVDRKVEDEFSMEFLCRDYMTKQEGRLRHFTV  280



>ref|XP_006302624.1| hypothetical protein CARUB_v10020731mg [Capsella rubella]
 gb|EOA35522.1| hypothetical protein CARUB_v10020731mg [Capsella rubella]
Length=295

 Score =   193 bits (490),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 96/215 (45%), Positives = 141/215 (66%), Gaps = 6/215 (3%)
 Frame = -3

Query  984  SIVRALVHYASISNNTDRMSYADIKQISDVLRQCGSHPCNFLVFGLTHETLLWRTLNHHG  805
            S+  AL+HYAS SN T + ++++I     VL +    PCNFLVFGL H++ +W TLN+ G
Sbjct  71   SLADALIHYAS-SNVTPQQTHSEISVTKKVLVK--KSPCNFLVFGLGHDSFMWSTLNYGG  127

Query  804  RTVFIDESRYYAAYVEEKYPEIEVYDVQYSTKLSEMKELISGVKEQARNECRPVQ-NLLF  628
            RT+F++E+  +   + EK+P +E Y VQY+TK+ +   L++  KE  R ECR V  +L  
Sbjct  128  RTIFLEENESWIRQIAEKFPSLESYHVQYNTKVRDAAALMAVAKE--REECRSVSTDLRV  185

Query  627  SECKLGLNDLPNQLYEVDWDVILVDGPRGYWPEAPGRMSAIFTAGVLARSKKGGNPKTHV  448
            S C+L L  LP  +YE +WD+I+VD P G+  EAPGRM+A++TAG++AR +K G   T V
Sbjct  186  SACELALKGLPEVVYETEWDLIMVDAPTGFHEEAPGRMTALYTAGMIARRRKDGGETTDV  245

Query  447  LVHDYNQKSDRIASEEFLCRENLVETKGMVGHFVV  343
             VHD ++K +   S  FLCR+ + E +G + HF V
Sbjct  246  FVHDVDRKVEDEFSMAFLCRDYMTEQEGRLRHFTV  280



>ref|XP_002990576.1| hypothetical protein SELMODRAFT_47472, partial [Selaginella moellendorffii]
 gb|EFJ08453.1| hypothetical protein SELMODRAFT_47472, partial [Selaginella moellendorffii]
Length=218

 Score =   190 bits (482),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 97/200 (49%), Positives = 132/200 (66%), Gaps = 5/200 (3%)
 Frame = -3

Query  972  ALVHYASISNNTDRMSYADIKQISDVLRQCGSHPCNFLVFGLTHETLLWRTLNHHGRTVF  793
            AL  Y S S    + ++ +I     VL   G  PCNFLVFGL  ++++W+TLNH GRTVF
Sbjct  14   ALARYVS-SKVIPQQTFDEIMMTVRVLAARG--PCNFLVFGLGFDSVMWKTLNHGGRTVF  70

Query  792  IDESRYYAAYVEEKYPEIEVYDVQYSTKLSEMKELISGVKEQARNECRPVQNLLFSECKL  613
            ++E+  +   V  K P++E Y V+Y+TKL +   L+   ++    +CRPVQ +  S CK+
Sbjct  71   LEETEDWIKQVTGKNPDLEAYLVRYNTKLMDAGRLMDHARKNRNGKCRPVQAIRNSTCKI  130

Query  612  GLNDLPNQLYEVDWDVILVDGPRGYWPEAPGRMSAIFTAGVLARSKKGGNPKTHVLVHDY  433
             L+ LP +LYEVDWDVI+VD PRGY+ EAPGRM+AIF+A V+ARS+K G   T + VHD 
Sbjct  131  ALSYLPKKLYEVDWDVIMVDAPRGYFAEAPGRMAAIFSASVMARSRKNGT--TDIYVHDV  188

Query  432  NQKSDRIASEEFLCRENLVE  373
             +  +R   EEFLCR NLVE
Sbjct  189  ERPVERQYCEEFLCRANLVE  208



>ref|XP_006390759.1| hypothetical protein EUTSA_v10018938mg [Eutrema salsugineum]
 gb|ESQ28045.1| hypothetical protein EUTSA_v10018938mg [Eutrema salsugineum]
Length=297

 Score =   192 bits (488),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 101/230 (44%), Positives = 141/230 (61%), Gaps = 10/230 (4%)
 Frame = -3

Query  984  SIVRALVHYASISNNTDRMSYADIKQISDVLRQCGSHPCNFLVFGLTHETLLWRTLNHHG  805
            S+  ALVHYA+ SN T + + ++I     VL +    PCNFLVFGL H++L+W +LNH G
Sbjct  72   SLADALVHYAA-SNITPQQTLSEISVTKKVLEK--KSPCNFLVFGLGHDSLMWASLNHGG  128

Query  804  RTVFIDESRYYAAYVEEKYPEIEVYDVQYSTKLSEMKELISGVKEQARNECRP--VQNLL  631
            RT+F+DE   +   + EK+P +E Y V+Y TK+ +   L+S  K   R ECR     +L 
Sbjct  129  RTIFLDEDESWIRRISEKFPSLESYHVKYETKVKDAAALMSSAKN--REECRRGLSTDLR  186

Query  630  FSECKLGLNDLPNQLYEVDWDVILVDGPRGYWPEAPGRMSAIFTAGVLARSKKGGNPKTH  451
             S C+L L  LP  +YE +WD+I+VD P G+  EAPGRM+AI+TAG++ARS+K     T 
Sbjct  187  VSACELTLTRLPEVVYETEWDLIMVDAPTGFHEEAPGRMTAIYTAGMIARSRKNEGETTA  246

Query  450  VLVHDYNQKSDRIASEEFLCRENLVETKGMVGHFVVEVMDANNFN---FC  310
            V VHD ++  +   S  FLCR+ L E +G + HF V      NF+   FC
Sbjct  247  VFVHDVDRTVEDEFSMTFLCRDYLTEQQGRLRHFTVPSHRNKNFSGGRFC  296



>ref|XP_002983636.1| hypothetical protein SELMODRAFT_47473, partial [Selaginella moellendorffii]
 gb|EFJ15132.1| hypothetical protein SELMODRAFT_47473, partial [Selaginella moellendorffii]
Length=233

 Score =   190 bits (483),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 97/200 (49%), Positives = 132/200 (66%), Gaps = 5/200 (3%)
 Frame = -3

Query  972  ALVHYASISNNTDRMSYADIKQISDVLRQCGSHPCNFLVFGLTHETLLWRTLNHHGRTVF  793
            AL  Y S S    + ++ +I     VL   G  PCNFLVFGL  ++++W+TLNH GRTVF
Sbjct  14   ALARYVS-SKVIPQQTFDEIMMTVRVLAARG--PCNFLVFGLGFDSVMWKTLNHGGRTVF  70

Query  792  IDESRYYAAYVEEKYPEIEVYDVQYSTKLSEMKELISGVKEQARNECRPVQNLLFSECKL  613
            ++E+  +   V  K P++E Y V+Y+TKL +   L+   ++    +CRPVQ +  S CK+
Sbjct  71   LEETEDWIKQVTGKNPDLEAYLVRYNTKLMDAGRLMDHARKNRNGKCRPVQAIRNSTCKI  130

Query  612  GLNDLPNQLYEVDWDVILVDGPRGYWPEAPGRMSAIFTAGVLARSKKGGNPKTHVLVHDY  433
             L+ LP +LYEVDWDVI+VD PRGY+ EAPGRM+AIF+A V+ARS+K G   T + VHD 
Sbjct  131  ALSYLPKKLYEVDWDVIMVDAPRGYFAEAPGRMAAIFSASVMARSRKNGT--TDIYVHDV  188

Query  432  NQKSDRIASEEFLCRENLVE  373
             +  +R   EEFLCR NLVE
Sbjct  189  ERPVERQYCEEFLCRANLVE  208



>gb|EPS67950.1| hypothetical protein M569_06827, partial [Genlisea aurea]
Length=209

 Score =   188 bits (477),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 96/210 (46%), Positives = 136/210 (65%), Gaps = 17/210 (8%)
 Frame = -3

Query  930  MSYADIKQISDVLRQCGSHPCNFLVFGLTHETLLWRTLNHHGRTVFIDESRYYAAYVEEK  751
            M+  +I  ++ VL +C    CN LVFGL++ET++WR +NH G T+F+D++ ++  ++E  
Sbjct  1    MTLPEISYVASVLGRC-PVGCNLLVFGLSYETIVWRAINHRGHTIFVDQNYWWVYFLESS  59

Query  750  YPEIEVYDVQYS-----TKLSEMKELISGVKEQARNECRPVQNLLFSECKLGLNDLPNQL  586
            +P IE YDV +         S++ + I      +R ECRPVQ+LL+SEC+L +ND+PN +
Sbjct  60   FPGIEAYDVYFGGDGGGVDRSQLSDAIR--NYTSRVECRPVQDLLWSECELAINDMPNHV  117

Query  585  YEVDWDVILVDGPR--------GYWPEAPGRMSAIFTAGVLARSKKGG-NPKTHVLVHDY  433
            Y+V WDVILVDGPR             A  RMS+IFTA V+ARSK+GG    THVLVHD+
Sbjct  118  YDVAWDVILVDGPRLAGENETAAGPAPAATRMSSIFTAAVMARSKRGGAGGGTHVLVHDF  177

Query  432  NQKSDRIASEEFLCRENLVETKGMVGHFVV  343
             +++ R+  EEFLC ENLV     + HFVV
Sbjct  178  GREAVRVCGEEFLCMENLVGVTDTLAHFVV  207



>ref|XP_009105824.1| PREDICTED: glucuronoxylan 4-O-methyltransferase 3 [Brassica rapa]
Length=296

 Score =   189 bits (479),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 96/219 (44%), Positives = 141/219 (64%), Gaps = 8/219 (4%)
 Frame = -3

Query  993  LSKSIVRALVHYASISNNTDRMSYADIKQISDVLRQCGSHPCNFLVFGLTHETLLWRTLN  814
            +  S+  AL+HYA+ SN T + + ++I     VL +  + PCNFLVFGL H++L+W +LN
Sbjct  69   IPPSLADALIHYAA-SNVTPQQTLSEISVTKKVLDK--TSPCNFLVFGLGHDSLMWASLN  125

Query  813  HHGRTVFIDESRYYAAYVEEKYPEIEVYDVQYSTKLSEMKELISGVKEQARNECR--PVQ  640
            H GRT+F+DE   +   + EK+P +E Y V+Y TK+ +   L+S  ++  R ECR     
Sbjct  126  HGGRTIFLDEDESWIRRIAEKFPSLESYHVRYETKVRDAAALMSAARD--REECRLGASM  183

Query  639  NLLFSECKLGLNDLPNQLYEVDWDVILVDGPRGYWPEAPGRMSAIFTAGVLARSKKGGNP  460
            +L  S+C+L L  LP  +YE +WD+I+VD P G+  +APGRMSAI+TAG+LARS+K G  
Sbjct  184  DLRVSKCELALKGLPEVVYEREWDLIMVDAPTGFHEDAPGRMSAIYTAGMLARSRKNGE-  242

Query  459  KTHVLVHDYNQKSDRIASEEFLCRENLVETKGMVGHFVV  343
             T V VHD ++  +   S  FLCR+ + E +G + HF V
Sbjct  243  NTAVFVHDVDRTVEDEFSMAFLCRDYMTEQEGRLRHFTV  281



>ref|XP_004310084.1| PREDICTED: glucuronoxylan 4-O-methyltransferase 2-like [Fragaria 
vesca subsp. vesca]
Length=275

 Score =   188 bits (477),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 94/226 (42%), Positives = 147/226 (65%), Gaps = 9/226 (4%)
 Frame = -3

Query  978  VRALVHYASISNNTDRMSYADIKQISDVLRQCGSHPCNFLVFGLTHETLLWRTLNHHGRT  799
            ++A++HYA+ S+ T + S A+I    DVL+     PCNFLVFGL +++L+W + N  G T
Sbjct  56   LQAVLHYAT-SSKTPQQSRAEISVSFDVLK--SRAPCNFLVFGLGYDSLMWASFNPRGTT  112

Query  798  VFIDESRYYAAYVEEKYPEIEVYDVQYSTKLSEMKELISGVKEQARNECRPVQNLLF--S  625
            +F++E   +   V +  PE+    V Y T+L +  EL+S  K +A   C P + +L    
Sbjct  113  LFLEEDPKWVQTVLKASPELRAETVNYRTQLKQADELLSSYKSEA--TCAPSEAVLRGNE  170

Query  624  ECKLGLNDLPNQLYEVDWDVILVDGPRGYWPEAPGRMSAIFTAGVLARSKKGGNPKTHVL  445
             CKL L++LP ++YE +WD+I++D PRGY+PEAPGRM+AIF+A V+AR ++G    THV 
Sbjct  171  RCKLALSNLPEEVYEKEWDLIMIDAPRGYFPEAPGRMAAIFSAAVMARRRRGSG-ATHVF  229

Query  444  VHDYNQKSDRIASEEFLCRENLVETKGMVGHF-VVEVMDANNFNFC  310
            +HD ++K ++  +EEFLCR  LV+  G + HF +   ++A + +FC
Sbjct  230  LHDVDRKVEKAFAEEFLCRNFLVKAVGRLWHFEIPSAVNATDVSFC  275



>emb|CDX96332.1| BnaA07g29430D [Brassica napus]
Length=296

 Score =   188 bits (478),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 96/219 (44%), Positives = 141/219 (64%), Gaps = 8/219 (4%)
 Frame = -3

Query  993  LSKSIVRALVHYASISNNTDRMSYADIKQISDVLRQCGSHPCNFLVFGLTHETLLWRTLN  814
            +  S+  AL+HYA+ SN T + + ++I     VL +  + PCNFLVFGL H++L+W +LN
Sbjct  69   IPPSLADALIHYAA-SNVTPQQTLSEISVTKKVLDK--TSPCNFLVFGLGHDSLMWASLN  125

Query  813  HHGRTVFIDESRYYAAYVEEKYPEIEVYDVQYSTKLSEMKELISGVKEQARNECR--PVQ  640
            H GRT+F+DE   +   + EK+P +E Y V+Y TK+ +   L+S  ++  R ECR     
Sbjct  126  HGGRTIFLDEDESWIRRIAEKFPSLESYHVRYETKVRDAAALMSAARD--REECRLGASM  183

Query  639  NLLFSECKLGLNDLPNQLYEVDWDVILVDGPRGYWPEAPGRMSAIFTAGVLARSKKGGNP  460
            +L  S+C+L L  LP  +YE +WD+I+VD P G+  +APGRMSAI+TAG+LARS+K G  
Sbjct  184  DLRVSKCELALKGLPEVVYEREWDLIMVDAPTGFHEDAPGRMSAIYTAGMLARSRKNGE-  242

Query  459  KTHVLVHDYNQKSDRIASEEFLCRENLVETKGMVGHFVV  343
             T V VHD ++  +   S  FLCR+ + E +G + HF V
Sbjct  243  TTAVFVHDVDRTVEDEFSMAFLCRDYMTEQEGRLRHFTV  281



>ref|XP_009417000.1| PREDICTED: glucuronoxylan 4-O-methyltransferase 3-like [Musa 
acuminata subsp. malaccensis]
Length=280

 Score =   187 bits (475),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 98/234 (42%), Positives = 142/234 (61%), Gaps = 11/234 (5%)
 Frame = -3

Query  999  PALSK---SIVRALVHYASISNNTDRMSYADIKQISDVLRQCGSHPCNFLVFGLTHETLL  829
            PA +K   S+   ++HYA+ SN T + +  +I   + VL +    PCNFLVFGL H++L+
Sbjct  52   PACTKIPPSLGETIIHYAT-SNITPQQTLREISVTAKVLER--KSPCNFLVFGLGHDSLM  108

Query  828  WRTLNHHGRTVFIDESRYYAAYVEEKYPEIEVYDVQYSTKLSEMKELISGVKEQARNECR  649
            W  LNH GRTVF++E + +   V +K+P +E Y V Y TK+S+  EL+   K      C 
Sbjct  109  WSALNHGGRTVFLEEDKKWIESVTQKFPTLEAYHVSYDTKVSQADELLESGKSTG---CM  165

Query  648  PVQNLLFSECKLGLNDLPNQLYEVDWDVILVDGPRGYWPEAPGRMSAIFTAGVLARSKKG  469
             +++  FS C L L  LP+  YEVDWD+I+VD P GY+P+APGRM AI+TAG+ AR ++ 
Sbjct  166  VLEDTKFSRCPLALTKLPDVFYEVDWDLIMVDAPTGYFPQAPGRMGAIYTAGMAARGRRR  225

Query  468  GNPKTHVLVHDYNQKSDRIASEEFLCRENLVETKGMVGHFVVEVMDAN-NFNFC  310
                T V VHD ++  +   S+ FLC+  L E +G + HF +    AN   +FC
Sbjct  226  EG-DTDVFVHDVDRAVEDKFSKTFLCQGYLKEEEGRIRHFTIPSHRANPEISFC  278



>ref|XP_011092282.1| PREDICTED: glucuronoxylan 4-O-methyltransferase 1 [Sesamum indicum]
Length=297

 Score =   187 bits (474),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 91/229 (40%), Positives = 147/229 (64%), Gaps = 7/229 (3%)
 Frame = -3

Query  993  LSKSIVRALVHYASISNNTDRMSYADIKQISDVLRQCGSHPCNFLVFGLTHETLLWRTLN  814
            +  S+ +AL+HY S S  T + +  +I   S +L +    PCNFL+FGL H++L+W +LN
Sbjct  68   IPSSLAQALIHY-STSTITPQQTLKEISVTSRILDK--KSPCNFLIFGLGHDSLMWHSLN  124

Query  813  HHGRTVFIDESRYYAAYVEEKYPEIEVYDVQYSTKLSEMKELISGVKEQARNECRPVQNL  634
            H GRT+F++E   +   ++ ++P +E Y V Y +K+++  +L+   K     EC  + + 
Sbjct  125  HGGRTIFLEEDEAWIEQIKRRFPMLESYHVTYDSKVNQASDLMQVGKGP---ECTAISDP  181

Query  633  LFSECKLGLNDLPNQLYEVDWDVILVDGPRGYWPEAPGRMSAIFTAGVLARSKKGGNPKT  454
             +S C+L L  LP+++Y+++WD+I+VD P GY+ EAPGRMSAI+TAG++AR+++ G  KT
Sbjct  182  QYSMCQLALKGLPSEVYDMEWDLIMVDAPTGYYEEAPGRMSAIYTAGMMARNRQEGGGKT  241

Query  453  HVLVHDYNQKSDRIASEEFLCRENLVETKGMVGHFVVEV-MDANNFNFC  310
            HV VHD N++ +   S EFLC   + + +G + HFV+    D  N  FC
Sbjct  242  HVFVHDVNREVEDKFSREFLCEGYMKKQEGRLRHFVIPSHRDDLNKPFC  290



>gb|AFK44106.1| unknown [Medicago truncatula]
Length=297

 Score =   186 bits (473),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 90/220 (41%), Positives = 145/220 (66%), Gaps = 7/220 (3%)
 Frame = -3

Query  978  VRALVHYASISNNTDRMSYADIKQISDVLRQCGSHPCNFLVFGLTHETLLWRTLNHHGRT  799
            +RAL+HYA+ S+   + S+++I    DV++   + P NFLVFGL H++L+W   N  G+T
Sbjct  70   LRALLHYAT-SHVVPQQSFSEITVTLDVIKSL-NRPFNFLVFGLGHDSLMWAGFNPQGKT  127

Query  798  VFIDESRYYAAYVEEKYPEIEVYDVQYSTKLSEMKELISGVKEQARNECRPVQNLLF--S  625
            +F++E   +   V +  PE++ + V Y T+L E  EL+   K +    C P +  L    
Sbjct  128  LFLEEDPKWVQTVLKDAPELQAFTVHYRTQLQEADELLKSYKSEP--SCSPAKATLKGNE  185

Query  624  ECKLGLNDLPNQLYEVDWDVILVDGPRGYWPEAPGRMSAIFTAGVLARSKKGGNPKTHVL  445
            +CKL L++LP+++YE +WD+I++D PRGY+ EAPGRM+AIF+  V+AR++KG    THV 
Sbjct  186  QCKLALHNLPDEIYETEWDLIMIDAPRGYFAEAPGRMAAIFSMAVMARNRKGSG-VTHVF  244

Query  444  VHDYNQKSDRIASEEFLCRENLVETKGMVGHFVVEVMDAN  325
            +HD ++K +++ +EEFLCR+NLV+  G + HF +  +  N
Sbjct  245  LHDVDRKVEKVYAEEFLCRKNLVKGVGRLWHFEIPALGNN  284



>emb|CDX72815.1| BnaC06g32630D [Brassica napus]
Length=301

 Score =   186 bits (473),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 95/219 (43%), Positives = 140/219 (64%), Gaps = 8/219 (4%)
 Frame = -3

Query  993  LSKSIVRALVHYASISNNTDRMSYADIKQISDVLRQCGSHPCNFLVFGLTHETLLWRTLN  814
            +  S+  AL+HYA+ SN T + + ++I     VL +  + PCNFLVFGL H++L+W +LN
Sbjct  69   IPPSLADALIHYAA-SNVTPQQTLSEISVTKKVLDK--TSPCNFLVFGLGHDSLMWASLN  125

Query  813  HHGRTVFIDESRYYAAYVEEKYPEIEVYDVQYSTKLSEMKELISGVKEQARNECR--PVQ  640
            H GRT+F+DE   +   + EK+P +E Y V+Y TKL +   L+S  +   R ECR     
Sbjct  126  HGGRTIFLDEDESWIRQIAEKFPSLESYHVRYETKLRDAAALMSAARN--REECRLGASM  183

Query  639  NLLFSECKLGLNDLPNQLYEVDWDVILVDGPRGYWPEAPGRMSAIFTAGVLARSKKGGNP  460
            +L  S+C+L L  LP  +YE++W++I+VD P G+  EAPGRMSAI+TAG++ARS+  G  
Sbjct  184  DLRVSKCELALKGLPEVVYEMEWNLIMVDAPTGFHEEAPGRMSAIYTAGMIARSRGKGE-  242

Query  459  KTHVLVHDYNQKSDRIASEEFLCRENLVETKGMVGHFVV  343
             T V VHD ++  +   S  FLCR+ + E +G + HF V
Sbjct  243  TTAVFVHDVDRTVEDEFSMAFLCRDYMTEQEGRLRHFTV  281



>ref|XP_006478265.1| PREDICTED: glucuronoxylan 4-O-methyltransferase 3-like [Citrus 
sinensis]
 gb|KDO38549.1| hypothetical protein CISIN_1g021206mg [Citrus sinensis]
Length=316

 Score =   186 bits (473),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 94/215 (44%), Positives = 142/215 (66%), Gaps = 9/215 (4%)
 Frame = -3

Query  984  SIVRALVHYASISNNTDRMSYADIKQISDVLRQCGSH-PCNFLVFGLTHETLLWRTLNHH  808
            S+  ALVHYA+    T+      +K+IS  LR      PCNFLVFGL +++L+W  LNH 
Sbjct  96   SLANALVHYAT----TNITPQQTVKEISVSLRVLAQKSPCNFLVFGLGYDSLMWSALNHG  151

Query  807  GRTVFIDESRYYAAYVEEKYPEIEVYDVQYSTKLSEMKELISGVKEQARNECRPVQNLLF  628
            GRT+F++E + +   ++EK+P +E Y V+Y TK++E  EL++ V   +  ECR V +  F
Sbjct  152  GRTLFLEEDKSWINQIKEKFPTLESYHVEYDTKVNEADELMNAVG--SDEECRVVTDPRF  209

Query  627  SECKLGLNDLPNQLYEVDWDVILVDGPRGYWPEAPGRMSAIFTAGVLARSKKGGNPKTHV  448
            S+C+L L   P+++Y+V+WD+I+VD P GY   APGRM+AI+TAG++AR+++ G  +T V
Sbjct  210  SKCRLALKGFPSEVYDVEWDLIMVDAPTGYHEAAPGRMTAIYTAGLMARNRESG--ETDV  267

Query  447  LVHDYNQKSDRIASEEFLCRENLVETKGMVGHFVV  343
             VHD ++  +   S+ FLC   L E +G + HFVV
Sbjct  268  FVHDVDRVVEDKFSKAFLCEGYLKEQEGRIRHFVV  302



>gb|EYU22748.1| hypothetical protein MIMGU_mgv1a011269mg [Erythranthe guttata]
Length=287

 Score =   186 bits (471),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 91/217 (42%), Positives = 144/217 (66%), Gaps = 8/217 (4%)
 Frame = -3

Query  993  LSKSIVRALVHYASISNNTDRMSYADIKQISDVLRQCGSHPCNFLVFGLTHETLLWRTLN  814
            ++ S+  ALVHYA++ N T + ++ +I     +L +    PCNFLVFGL H++L+W +LN
Sbjct  66   IAPSLAHALVHYATL-NITPQQTFKEISVSLKILEK--KSPCNFLVFGLGHDSLMWTSLN  122

Query  813  HHGRTVFIDESRYYAAYVEEKYPEIEVYDVQYSTKLSEMKELISGVKEQARNECRPVQNL  634
            H GRTVF++E + +   +  + P +E Y V Y TK+++  EL+  + E  R ECR V + 
Sbjct  123  HGGRTVFLEEDKSWIQQINARIPSLESYHVNYDTKVTQADELLE-ISE--REECRTVSDP  179

Query  633  LFSECKLGLNDLPNQLYEVDWDVILVDGPRGYWPEAPGRMSAIFTAGVLARSKKGGNPKT  454
             FS+C+L L  LP+++Y++DWD+I+VD P GY+  APGRMSAI+TAG++AR+++ G  +T
Sbjct  180  RFSKCQLALKGLPSEIYDIDWDLIMVDAPTGYFDGAPGRMSAIYTAGLMARNRENG--ET  237

Query  453  HVLVHDYNQKSDRIASEEFLCRENLVETKGMVGHFVV  343
             V VHD ++  +   S+  LC+  L E +G + HF +
Sbjct  238  DVFVHDVDRVVEDKFSKALLCQGYLREQEGRIRHFTI  274



>gb|KEH20602.1| polysaccharide biosynthesis protein [Medicago truncatula]
Length=297

 Score =   186 bits (471),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 90/220 (41%), Positives = 145/220 (66%), Gaps = 7/220 (3%)
 Frame = -3

Query  978  VRALVHYASISNNTDRMSYADIKQISDVLRQCGSHPCNFLVFGLTHETLLWRTLNHHGRT  799
            +RAL+HYA+ S+   + S+++I    DV++   + P NFLVFGL H++L+W   N  G+T
Sbjct  70   LRALLHYAT-SHVVPQQSFSEITVTLDVIKSL-NRPFNFLVFGLGHDSLMWAGFNPQGKT  127

Query  798  VFIDESRYYAAYVEEKYPEIEVYDVQYSTKLSEMKELISGVKEQARNECRPVQNLLF--S  625
            +F++E   +   V +  PE++ + V Y T+L E  EL+   K +    C P +  L    
Sbjct  128  LFLEEDPKWVQTVLKDAPELQAFTVHYRTQLQEADELLKSYKSEP--SCSPAKATLKGNE  185

Query  624  ECKLGLNDLPNQLYEVDWDVILVDGPRGYWPEAPGRMSAIFTAGVLARSKKGGNPKTHVL  445
            +CKL L++LP+++YE +WD+I++D PRGY+ EAPGRM+AIF+  V+AR++KG    THV 
Sbjct  186  QCKLALHNLPDEIYETEWDLIMIDAPRGYFAEAPGRMAAIFSMTVMARNRKGSG-VTHVF  244

Query  444  VHDYNQKSDRIASEEFLCRENLVETKGMVGHFVVEVMDAN  325
            +HD ++K +++ +EEFLCR+NLV+  G + HF +  +  N
Sbjct  245  LHDVDRKVEKVYAEEFLCRKNLVKGVGRLWHFEIPALGNN  284



>ref|XP_006417555.1| hypothetical protein EUTSA_v10009538mg [Eutrema salsugineum]
 gb|ESQ35908.1| hypothetical protein EUTSA_v10009538mg [Eutrema salsugineum]
Length=283

 Score =   184 bits (467),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 96/227 (42%), Positives = 143/227 (63%), Gaps = 7/227 (3%)
 Frame = -3

Query  1023  SGGGGGATPALSKSIVRALVHYASISNNTDRMSYADIKQISDVLRQCGSHPCNFLVFGLT  844
             SG   GA   L +S+ +AL+HY S S  T + +  +I   S VL      PCNFLVFGL 
Sbjct  47    SGPCAGACNKLPRSLAQALIHY-STSVITPQQTLKEIVVSSRVLD--NKSPCNFLVFGLG  103

Query  843   HETLLWRTLNHHGRTVFIDESRYYAAYVEEKYPEIEVYDVQYSTKLSEMKELISGVKEQA  664
             H++L+W +LN+ GRTVF++E   +   ++ ++P +E Y V Y +K+ +   LI   K   
Sbjct  104   HDSLMWSSLNYGGRTVFLEEDEAWIRQIKRRFPMLESYHVTYDSKVHQADNLIQVGKGP-  162

Query  663   RNECRPVQNLLFSECKLGLNDLPNQLYEVDWDVILVDGPRGYWPEAPGRMSAIFTAGVLA  484
               EC  + +L +S C+L L  LP Q+YE  WD+I+VD P GY+ EAPGRM+AI+TAG++A
Sbjct  163   --ECTAIGDLRYSMCQLALKGLPAQIYETSWDLIMVDAPTGYYDEAPGRMTAIYTAGMMA  220

Query  483   RSKKGGNPKTHVLVHDYNQKSDRIASEEFLCRENLVETKGMVGHFVV  343
             R++K G  +THV VHD N++ +   S  FLC+  + + +G + HFV+
Sbjct  221   RNRKQGG-ETHVFVHDVNREVEDNFSMAFLCQGYMKKQEGRLRHFVI  266



>ref|XP_004310083.1| PREDICTED: glucuronoxylan 4-O-methyltransferase 1-like [Fragaria 
vesca subsp. vesca]
Length=272

 Score =   184 bits (466),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 92/226 (41%), Positives = 145/226 (64%), Gaps = 9/226 (4%)
 Frame = -3

Query  978  VRALVHYASISNNTDRMSYADIKQISDVLRQCGSHPCNFLVFGLTHETLLWRTLNHHGRT  799
            ++A++HYA+ S+ T + S A+I    DVL+     PCNFLVFGL +++L+W + N  G T
Sbjct  53   LQAVLHYAT-SSKTPQQSRAEISVSFDVLK--SRAPCNFLVFGLGYDSLMWASFNPRGTT  109

Query  798  VFIDESRYYAAYVEEKYPEIEVYDVQYSTKLSEMKELISGVKEQARNECRPVQNLLF--S  625
            +F++E   +   V +  PE+    V Y T+L +  EL+S  K +A   C P + +L    
Sbjct  110  LFLEEDPKWVQTVLKDSPELRAETVNYRTQLKQADELLSSYKSEA--ACAPSEAVLRGNE  167

Query  624  ECKLGLNDLPNQLYEVDWDVILVDGPRGYWPEAPGRMSAIFTAGVLARSKKGGNPKTHVL  445
             CKL L++LP ++YE +WD+I++D PRGY+PEAPGRM+ IF+A V+AR ++G    THV 
Sbjct  168  RCKLALSNLPEEVYEKEWDLIMIDAPRGYFPEAPGRMAVIFSAAVMARRRRGSG-ATHVF  226

Query  444  VHDYNQKSDRIASEEFLCRENLVETKGMVGHF-VVEVMDANNFNFC  310
            +HD ++K ++  +EEFLCR+ LV+  G + HF +    + ++  FC
Sbjct  227  LHDVDRKVEKAFAEEFLCRKYLVKAVGRLWHFEIPSATNGSDARFC  272



>ref|XP_002887380.1| hypothetical protein ARALYDRAFT_316133 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH63639.1| hypothetical protein ARALYDRAFT_316133 [Arabidopsis lyrata subsp. 
lyrata]
Length=297

 Score =   184 bits (467),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 92/218 (42%), Positives = 137/218 (63%), Gaps = 6/218 (3%)
 Frame = -3

Query  993  LSKSIVRALVHYASISNNTDRMSYADIKQISDVLRQCGSHPCNFLVFGLTHETLLWRTLN  814
            +  S+  ALVHYA+ SN T + + ++I     VL +    PCNFLVFGL  ++L+W  LN
Sbjct  70   IPPSLADALVHYAA-SNVTPQQTLSEISVTKKVLEK--KSPCNFLVFGLGRDSLMWAALN  126

Query  813  HHGRTVFIDESRYYAAYVEEKYPEIEVYDVQYSTKLSEMKELISGVKEQARNECRPVQ-N  637
            H GRT+F++E   +   + EK+P +E Y V+Y+TK+ +   L++  ++  R ECR V  +
Sbjct  127  HGGRTIFLEEDELWIHKIAEKFPSLESYHVRYNTKVRDATALMAATRD--REECRRVSTD  184

Query  636  LLFSECKLGLNDLPNQLYEVDWDVILVDGPRGYWPEAPGRMSAIFTAGVLARSKKGGNPK  457
            L  S C+L L  LP  +YE +WD+I+VD P G+  E PGRM+AI+T G++AR +K     
Sbjct  185  LRVSACELALKGLPEVVYETEWDLIMVDAPTGFDDETPGRMTAIYTVGMIARRRKDDGET  244

Query  456  THVLVHDYNQKSDRIASEEFLCRENLVETKGMVGHFVV  343
            T V VHD ++K +   S EFLCR+ + E +G + HF V
Sbjct  245  TAVFVHDVDRKVEDEFSMEFLCRDYMTEQEGRLRHFTV  282



>ref|XP_003523475.1| PREDICTED: glucuronoxylan 4-O-methyltransferase 3-like [Glycine 
max]
 gb|KHN47081.1| hypothetical protein glysoja_018448 [Glycine soja]
Length=306

 Score =   183 bits (465),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 92/213 (43%), Positives = 144/213 (68%), Gaps = 10/213 (5%)
 Frame = -3

Query  984  SIVRALVHYASISNNTDRMSYADIKQISDVLRQCGSHPCNFLVFGLTHETLLWRTLNHHG  805
            S+  A++HYA+ +N T + +  +I   + VL +    PCNFLVFGL H++L+W +LN+ G
Sbjct  87   SLANAIIHYAT-ANVTPQQTLHEISVSARVLEK--KSPCNFLVFGLGHDSLMWTSLNYGG  143

Query  804  RTVFIDESRYYAAYVEEKYPEIEVYDVQYSTKLSEMKELI-SGVKEQARNECRPVQNLLF  628
            RTVF++E + +   ++EK P +E Y V Y T++ + +EL+ +G+KE    +C+ V +  F
Sbjct  144  RTVFLEEDKSWIDQIQEKVPSLESYHVMYDTQVHQAEELMKTGMKE----DCQKVTDPRF  199

Query  627  SECKLGLNDLPNQLYEVDWDVILVDGPRGYWPEAPGRMSAIFTAGVLARSKKGGNPKTHV  448
            S C L    LP+++Y++DWDVI+VD P GY+ EAPGRMSAI+TAG++AR+K+ G  +T V
Sbjct  200  SRCPLAHKGLPSEVYDIDWDVIMVDAPTGYFDEAPGRMSAIYTAGLIARNKERG--QTDV  257

Query  447  LVHDYNQKSDRIASEEFLCRENLVETKGMVGHF  349
             VHD ++K + + S+ FLC     E +G + HF
Sbjct  258  FVHDVDRKVEDMFSKAFLCEGYFKEQEGRIRHF  290



>ref|XP_006441614.1| hypothetical protein CICLE_v10021249mg [Citrus clementina]
 gb|ESR54854.1| hypothetical protein CICLE_v10021249mg [Citrus clementina]
Length=314

 Score =   184 bits (466),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 93/214 (43%), Positives = 142/214 (66%), Gaps = 7/214 (3%)
 Frame = -3

Query  984  SIVRALVHYASISNNTDRMSYADIKQISDVLRQCGSHPCNFLVFGLTHETLLWRTLNHHG  805
            S+  ALVHYA+ +N T + +  +I     VL Q    PCNFLVFGL +++L+W  LNH G
Sbjct  94   SLANALVHYAT-TNITPQQTLKEISVSLRVLAQ--KSPCNFLVFGLGYDSLMWSALNHGG  150

Query  804  RTVFIDESRYYAAYVEEKYPEIEVYDVQYSTKLSEMKELISGVKEQARNECRPVQNLLFS  625
            RT+F++E + +   ++EK+P +E Y V+Y TK++E  EL++ V   +  ECR V +  FS
Sbjct  151  RTLFLEEDKSWINQMKEKFPTLESYHVEYDTKVNEADELMNTVA--SDEECRVVTDPRFS  208

Query  624  ECKLGLNDLPNQLYEVDWDVILVDGPRGYWPEAPGRMSAIFTAGVLARSKKGGNPKTHVL  445
            +C+L L   P+++Y+V+WD+I+VD P GY   APGRM+AI+TAG++ R+++ G  +T V 
Sbjct  209  KCRLALKGFPSEVYDVEWDLIMVDAPTGYHEAAPGRMTAIYTAGLMGRNRESG--ETDVF  266

Query  444  VHDYNQKSDRIASEEFLCRENLVETKGMVGHFVV  343
            VHD ++  +   S+ FLC   L E +G + HFVV
Sbjct  267  VHDVDRVVEDKFSKAFLCEGYLKEQEGRIRHFVV  300



>ref|XP_002304685.1| hypothetical protein POPTR_0003s17080g [Populus trichocarpa]
 gb|EEE79664.1| hypothetical protein POPTR_0003s17080g [Populus trichocarpa]
Length=285

 Score =   182 bits (463),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 92/220 (42%), Positives = 143/220 (65%), Gaps = 10/220 (5%)
 Frame = -3

Query  978  VRALVHYASISNNTDRMSYADIKQISDVLRQCGSHPCNFLVFGLTHETLLWRTLNHHGRT  799
            +++++HYA+ S    + S A+I    DVL+     PCNFLVFGL  ++L+W +LN HG T
Sbjct  64   LQSILHYAT-SKIVPQQSLAEISVTFDVLKT--RSPCNFLVFGLGFDSLMWTSLNPHGTT  120

Query  798  VFIDESRYYAAYVEEKYPEIEVYDVQYSTKLSEMKELISGVKEQARNECRPVQNLLFS--  625
            +F++E   +   + +K P +  + VQY T+L E   L+   + +    C P +  L    
Sbjct  121  LFLEEDPKWVQTIVKKAPTLNAHTVQYRTQLQEANSLLKTYRSEPL--CSPSKAYLRGNY  178

Query  624  ECKLGLNDLPNQLYEVDWDVILVDGPRGYWPEAPGRMSAIFTAGVLARSKKGGNPKTHVL  445
            +CKL L  LP+++Y+ +WD+I++D PRGY+PEAPGRM+AIF+A V+AR +KG    THV 
Sbjct  179  KCKLALTGLPDEVYDKEWDLIMIDAPRGYFPEAPGRMAAIFSAVVMARGRKGSG-VTHVF  237

Query  444  VHDYNQKSDRIASEEFLCRENLVETKGMVGHFVVEVMDAN  325
            +HD ++K +++ +EEFLCR+NLV+  G + HF  E+  AN
Sbjct  238  LHDVDRKVEKMFAEEFLCRKNLVKAVGRLWHF--EIPAAN  275



>ref|XP_010427991.1| PREDICTED: glucuronoxylan 4-O-methyltransferase 3-like [Camelina 
sativa]
Length=297

 Score =   182 bits (462),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 90/218 (41%), Positives = 141/218 (65%), Gaps = 6/218 (3%)
 Frame = -3

Query  993  LSKSIVRALVHYASISNNTDRMSYADIKQISDVLRQCGSHPCNFLVFGLTHETLLWRTLN  814
            +  S+  AL+HYA+ SN T + ++++I     VL +    PCNFLVFGL +++L+W TLN
Sbjct  70   IPPSLADALIHYAA-SNVTPQQTHSEISVTKKVLEK--KSPCNFLVFGLGYDSLMWSTLN  126

Query  813  HHGRTVFIDESRYYAAYVEEKYPEIEVYDVQYSTKLSEMKELISGVKEQARNECRPVQ-N  637
            + GRT+F++E+  +   + EK+P +E Y V+Y+TK+S+   L++  ++  + EC  V  +
Sbjct  127  YGGRTIFLEENESWIRQIAEKFPSLESYHVRYNTKVSDADALMAAARD--KEECHSVSMD  184

Query  636  LLFSECKLGLNDLPNQLYEVDWDVILVDGPRGYWPEAPGRMSAIFTAGVLARSKKGGNPK  457
               S C L L  LP+ +YE +WD+I+VD P G+  EAPGRM+AI+TAG++AR +K     
Sbjct  185  PRVSACDLALKGLPDVVYETEWDLIMVDAPTGFHEEAPGRMTAIYTAGLIARRRKDEGET  244

Query  456  THVLVHDYNQKSDRIASEEFLCRENLVETKGMVGHFVV  343
            T V +HD ++K +   S  FLCR+ L E +G + HF V
Sbjct  245  TDVFLHDVDRKVEDEFSMAFLCRDYLTEQEGRLRHFTV  282



>ref|XP_004502290.1| PREDICTED: glucuronoxylan 4-O-methyltransferase 1-like [Cicer 
arietinum]
Length=283

 Score =   182 bits (461),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 91/225 (40%), Positives = 144/225 (64%), Gaps = 10/225 (4%)
 Frame = -3

Query  978  VRALVHYASISNNTDRMSYADIKQISDVLRQCGSHPCNFLVFGLTHETLLWRTLNHHGRT  799
            +RA++HYA+ S+   + S ++IK   DVL+  G  PCNFLVFGL H++L+W + N  G T
Sbjct  63   LRAILHYAT-SHVVPQQSVSEIKISFDVLKSFG-RPCNFLVFGLGHDSLMWASFNPGGTT  120

Query  798  VFIDESRYYAAYVEEKYPEIEVYDVQYSTKLSEMKELISGVKEQARNECRPVQNLLF--S  625
            +F++E   +   V +  P +  + V Y T+L + + LIS  + +    C P +  L    
Sbjct  121  LFLEEDPKWVQTVLKDAPGLRAHTVHYRTQLRQAQTLISSYRSEP--TCSPSKAFLRGNK  178

Query  624  ECKLGLNDLPNQLYEVDWDVILVDGPRGYWPEAPGRMSAIFTAGVLARSKKGGNPKTHVL  445
             CKL L +LP ++Y+ +WD+I++D P+GY+ EAPGRM+A+F+A V+AR++KG    THV 
Sbjct  179  ACKLALENLPEEVYDTEWDLIMIDAPKGYYAEAPGRMAAVFSAAVMARNRKGSG-VTHVF  237

Query  444  VHDYNQKSDRIASEEFLCRENLVETKGMVGHFVV---EVMDANNF  319
            +HD N+K +++ ++EFLC+ NLV+  G + HF +    V DA  F
Sbjct  238  LHDVNRKVEKLYADEFLCKRNLVKGVGRLWHFQIPPSNVTDATRF  282



>ref|XP_008441152.1| PREDICTED: glucuronoxylan 4-O-methyltransferase 3-like [Cucumis 
melo]
Length=287

 Score =   181 bits (460),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 92/215 (43%), Positives = 142/215 (66%), Gaps = 10/215 (5%)
 Frame = -3

Query  984  SIVRALVHYASISNNTDRMSYADIKQISDVLRQCGSHPCNFLVFGLTHETLLWRTLNHHG  805
            S+  AL+HYA+ SN T + +  +I   + +L      PCNFLVFGL H++L+W  LNH G
Sbjct  69   SVANALIHYAT-SNITPQQTLKEISVSARILET--KSPCNFLVFGLGHDSLMWTALNHGG  125

Query  804  RTVFIDESRYYAAYVEEKYPEIEVYDVQYSTKLSEMKELIS-GVKEQARNECRPVQNLLF  628
            RTVF++E + +   ++E+ P +E Y VQY TK+ +  EL+  G+ E    EC+ V +  F
Sbjct  126  RTVFLEEDKAWIDQIQERLPNLEAYHVQYDTKVHQADELMKIGMGE----ECKSVGDPRF  181

Query  627  SECKLGLNDLPNQLYEVDWDVILVDGPRGYWPEAPGRMSAIFTAGVLARSKKGGNPKTHV  448
             +C+L L  LP+++YE++WD+I+VD P GY+ EAPGRMSAI+TAG++AR+++ G  +T V
Sbjct  182  CKCELALKGLPSEIYEMEWDLIMVDAPTGYFNEAPGRMSAIYTAGLMARNRQEG--ETDV  239

Query  447  LVHDYNQKSDRIASEEFLCRENLVETKGMVGHFVV  343
             VHD ++  +   S  FLC+  L + +G + HF +
Sbjct  240  FVHDVDRVVEDNFSMAFLCKGYLRKQEGRIRHFSI  274



>ref|XP_004499575.1| PREDICTED: glucuronoxylan 4-O-methyltransferase 3-like [Cicer 
arietinum]
Length=296

 Score =   182 bits (461),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 91/214 (43%), Positives = 140/214 (65%), Gaps = 7/214 (3%)
 Frame = -3

Query  984  SIVRALVHYASISNNTDRMSYADIKQISDVLRQCGSHPCNFLVFGLTHETLLWRTLNHHG  805
            S+V AL+HYA+ +N T + +  +I   S +L +    PCNFLVFGL H++L+W +LN+ G
Sbjct  77   SLVNALIHYAT-TNITPQQTIQEILVSSKILEK--KSPCNFLVFGLGHDSLMWTSLNYGG  133

Query  804  RTVFIDESRYYAAYVEEKYPEIEVYDVQYSTKLSEMKELISGVKEQARNECRPVQNLLFS  625
            RTVF++E + +   +++K+P +E Y V Y TK+ +  EL+    E    EC+ + +   S
Sbjct  134  RTVFLEEDKSWIEQIQKKFPSLESYHVTYDTKVHQGDELMRIAMEN--EECKKISDPRIS  191

Query  624  ECKLGLNDLPNQLYEVDWDVILVDGPRGYWPEAPGRMSAIFTAGVLARSKKGGNPKTHVL  445
            +C+L     PN++YE++WDVI+VD P GY+  APGRMSAI+TAG++AR+K+ G+  T V 
Sbjct  192  KCELTHKGFPNEVYEIEWDVIMVDAPTGYFDGAPGRMSAIYTAGLIARNKENGD--TDVF  249

Query  444  VHDYNQKSDRIASEEFLCRENLVETKGMVGHFVV  343
            VHD N+K +   S+ FLC     E +G + HF +
Sbjct  250  VHDVNRKVEDEFSKAFLCEGYFREQEGRIRHFNI  283



>ref|XP_003598051.1| hypothetical protein MTR_3g005710 [Medicago truncatula]
 gb|AES68302.1| glucuronoxylan 4-O-methyltransferase [Medicago truncatula]
 gb|AFK39995.1| unknown [Medicago truncatula]
Length=298

 Score =   182 bits (461),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 93/221 (42%), Positives = 144/221 (65%), Gaps = 10/221 (5%)
 Frame = -3

Query  1002  TPALSK---SIVRALVHYASISNNTDRMSYADIKQISDVLRQCGSHPCNFLVFGLTHETL  832
             TP  +K   S+  AL+HYA+ +  T + +  +I   + VL++    PCNFLVFGL H++L
Sbjct  70    TPTCTKNPPSLANALIHYAT-TKITPQQTIQEISVSAKVLQK--KSPCNFLVFGLGHDSL  126

Query  831   LWRTLNHHGRTVFIDESRYYAAYVEEKYPEIEVYDVQYSTKLSEMKELISGVKEQARNEC  652
             +W +LN+ GRTVF++E + +   ++ K+P +E Y V Y TK+ +  EL+    EQ   +C
Sbjct  127   MWTSLNYGGRTVFLEEDKTWIEQIQSKFPTLESYHVVYDTKVHQSDELMKIGMEQ--EDC  184

Query  651   RPVQNLLFSECKLGLNDLPNQLYEVDWDVILVDGPRGYWPEAPGRMSAIFTAGVLARSKK  472
             + V +  FS+C L L   P+++Y+V+WDVI+VD P GY+  APGRMSAI+TAG++AR+++
Sbjct  185   KKVSDPRFSKCGLALKGFPSEIYDVEWDVIMVDAPTGYFDGAPGRMSAIYTAGLIARNRE  244

Query  471   GGNPKTHVLVHDYNQKSDRIASEEFLCRENLVETKGMVGHF  349
              G+  T V VHD ++K +   S+ FLC   L E +G + HF
Sbjct  245   NGD--TDVFVHDVDRKVEDQFSKAFLCEGYLREQEGRIRHF  283



>emb|CAN73177.1| hypothetical protein VITISV_009984 [Vitis vinifera]
Length=299

 Score =   182 bits (461),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 92/215 (43%), Positives = 142/215 (66%), Gaps = 10/215 (5%)
 Frame = -3

Query  984  SIVRALVHYASISNNTDRMSYADIKQISDVLRQCGSHPCNFLVFGLTHETLLWRTLNHHG  805
            S+ +ALVHYA++ N T + ++ +I   S VL++    PCNFLVFGL H++L+W  LNH G
Sbjct  81   SLAQALVHYATL-NVTPQQTFDEISVTSRVLQK--KAPCNFLVFGLGHDSLMWTALNHGG  137

Query  804  RTVFIDESRYYAAYVEEKYPEIEVYDVQYSTKLSEMKELIS-GVKEQARNECRPVQNLLF  628
            RTVF++E + +   +++K+P +E Y V Y TK+ +  EL+  G+ E    +C+ V +  F
Sbjct  138  RTVFLEEDKSWMERIKQKFPSVESYYVVYDTKVHQADELLEVGMGE----DCKVVVDPRF  193

Query  627  SECKLGLNDLPNQLYEVDWDVILVDGPRGYWPEAPGRMSAIFTAGVLARSKKGGNPKTHV  448
            S+CKL L   PN++Y+V+WD+I+VD P GY  EAPGRM AI+TAG++ R+++ G  +T V
Sbjct  194  SKCKLSLKGFPNEVYDVEWDLIMVDAPTGYHDEAPGRMGAIYTAGLMGRNREDG--ETDV  251

Query  447  LVHDYNQKSDRIASEEFLCRENLVETKGMVGHFVV  343
             VH+ N+  +   S+ FLC     E +G +G F +
Sbjct  252  FVHNVNRVVEDKFSKAFLCEGYFREQEGRIGRFTI  286



>ref|XP_011020742.1| PREDICTED: glucuronoxylan 4-O-methyltransferase 1-like [Populus 
euphratica]
Length=284

 Score =   181 bits (459),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 96/229 (42%), Positives = 144/229 (63%), Gaps = 14/229 (6%)
 Frame = -3

Query  1005  ATPALSKSIVRALVHYASISNNTDRMSYADIKQISDVLRQCGSHPCNFLVFGLTHETLLW  826
             ATP   +SI+    HYA+ S    + S A+I    DVL+     PCNFLVFGL  ++L+W
Sbjct  59    ATPTQLQSIL----HYAT-SKIVPQQSLAEISVTFDVLKT--RSPCNFLVFGLGFDSLMW  111

Query  825   RTLNHHGRTVFIDESRYYAAYVEEKYPEIEVYDVQYSTKLSEMKELISGVKEQARNECRP  646
              +LN HG T+F++E   +   + +K P +  + VQY T+L E   L+   + +    C P
Sbjct  112   TSLNPHGTTLFLEEDPKWVQTIVKKAPTLNAHTVQYRTQLQEADSLLKTYRSEPL--CSP  169

Query  645   VQNLLFS--ECKLGLNDLPNQLYEVDWDVILVDGPRGYWPEAPGRMSAIFTAGVLARSKK  472
              +  L     CKL L  LP+++Y+ +WD+I++D PRGY+PEAPGRM+AIF+A V+AR +K
Sbjct  170   SKAYLRGNYRCKLALTGLPDEVYDKEWDLIMIDAPRGYFPEAPGRMAAIFSAVVMARGRK  229

Query  471   GGNPKTHVLVHDYNQKSDRIASEEFLCRENLVETKGMVGHFVVEVMDAN  325
             G    THV +HD +++ +++ +EEFLCR+NLV+  G + HF  E+  AN
Sbjct  230   GSG-VTHVFLHDVDRRVEKMFAEEFLCRKNLVKAVGRLWHF--EIPAAN  275



>ref|XP_011071227.1| PREDICTED: glucuronoxylan 4-O-methyltransferase 1 [Sesamum indicum]
Length=280

 Score =   181 bits (459),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 91/225 (40%), Positives = 142/225 (63%), Gaps = 8/225 (4%)
 Frame = -3

Query  978  VRALVHYASISNNTDRMSYADIKQISDVLRQCGSHPCNFLVFGLTHETLLWRTLNHHGRT  799
            + A+ HYA+ S    + S  ++    DVL+   + PCNFLVFGL H++L+W  LN  GRT
Sbjct  62   MEAIRHYAT-SQVVPQQSLGEVTVSFDVLK--ATAPCNFLVFGLGHDSLMWAALNPRGRT  118

Query  798  VFIDESRYYAAYVEEKYPEIEVYDVQYSTKLSEMKELISGVKEQARNECRPVQNLLF--S  625
            +F++E   +   V +  P +E   V Y T+LSE  EL+   + +    C P  + L   S
Sbjct  119  LFLEEDPKWYQAVLKDAPALEAETVAYRTQLSEADELLQHYRTEPL--CSPTNSFLRGNS  176

Query  624  ECKLGLNDLPNQLYEVDWDVILVDGPRGYWPEAPGRMSAIFTAGVLARSKKGGNPKTHVL  445
            +C+L LN L +++Y+ +WD+I++D PRGY+PEAPGRM+AI++A V+AR++KG    THV 
Sbjct  177  KCRLALNMLSDKVYDTEWDLIMIDAPRGYFPEAPGRMAAIYSAAVMARNRKGSG-VTHVF  235

Query  444  VHDYNQKSDRIASEEFLCRENLVETKGMVGHFVVEVMDANNFNFC  310
            +HD ++K ++  +E FLC+ NLV+ +G + HF +  +   N  FC
Sbjct  236  LHDVDRKVEKTYAEMFLCKRNLVKAEGRLWHFEIPPVTNPNSEFC  280



>ref|XP_010471166.1| PREDICTED: glucuronoxylan 4-O-methyltransferase 3-like [Camelina 
sativa]
Length=297

 Score =   181 bits (459),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 90/218 (41%), Positives = 141/218 (65%), Gaps = 6/218 (3%)
 Frame = -3

Query  993  LSKSIVRALVHYASISNNTDRMSYADIKQISDVLRQCGSHPCNFLVFGLTHETLLWRTLN  814
            +  S+  AL+HYA+ SN T + ++++I     VL +    PCNFLVFGL +++L+W TLN
Sbjct  70   IPPSLADALIHYAA-SNVTPQQTHSEISVTKKVLEK--KSPCNFLVFGLGYDSLMWSTLN  126

Query  813  HHGRTVFIDESRYYAAYVEEKYPEIEVYDVQYSTKLSEMKELISGVKEQARNECRPVQ-N  637
            + GRT+F++E+  +   + EK+P +E Y V+Y+TK+ +   L++ V++  + EC  V  +
Sbjct  127  YGGRTIFLEENESWIRQIAEKFPSLESYHVRYNTKVRDADALMAAVRD--KEECHNVSTD  184

Query  636  LLFSECKLGLNDLPNQLYEVDWDVILVDGPRGYWPEAPGRMSAIFTAGVLARSKKGGNPK  457
               S C+L L  LP  +YE +WD+I+VD P G+  EAPGRM+AI+TAG++AR +K     
Sbjct  185  PRVSACELALKGLPEVVYETEWDLIMVDAPTGFHEEAPGRMTAIYTAGMMARRRKDEGET  244

Query  456  THVLVHDYNQKSDRIASEEFLCRENLVETKGMVGHFVV  343
            T V VHD ++K +   +  FLCR+ L E +G + HF V
Sbjct  245  TDVFVHDVDRKVEDEFTMAFLCRDYLTEQEGRLRHFTV  282



>ref|XP_008389872.1| PREDICTED: glucuronoxylan 4-O-methyltransferase 2-like [Malus 
domestica]
 ref|XP_008389873.1| PREDICTED: glucuronoxylan 4-O-methyltransferase 2-like [Malus 
domestica]
Length=282

 Score =   181 bits (458),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 93/229 (41%), Positives = 145/229 (63%), Gaps = 12/229 (5%)
 Frame = -3

Query  978  VRALVHYASISNNTDRMSYADIKQISDVLRQCGSHPCNFLVFGLTHETLLWRTLNHHGRT  799
            ++A++HYA+ S+ T + S  +I    +VL+     PCNFLVFGL  ++L+W +LN  G T
Sbjct  60   LQAILHYAT-SSQTPQQSRDEITVSFEVLK--SRSPCNFLVFGLGFDSLMWASLNPRGTT  116

Query  798  VFIDESRYYAAYVEEKYPEIEVYDVQYSTKLSEMKELISGVKEQARNECRPVQNLLF--S  625
            +F++E   +   V +  P++    V+Y T+L E  EL+S  + Q    C P + +L   +
Sbjct  117  LFLEEDPKWVQTVLKDAPQLRAETVRYRTQLKEADELLSSYRSQ--RSCSPSEAVLRGNT  174

Query  624  ECKLGLNDLPNQLYEVDWDVILVDGPRGYWPEAPGRMSAIFTAGVLARSKKGGNPKTHVL  445
            EC+L L++LP+ +Y+ +WD+I+VD PRGY+PEAPGRM AIF+A V+AR ++G    THV 
Sbjct  175  ECRLALDNLPDDVYDKEWDLIMVDAPRGYFPEAPGRMGAIFSAAVMARRRRGSG-VTHVF  233

Query  444  VHDYNQKSDRIASEEFLCRENLVETKGMVGHF----VVEVMDANNFNFC  310
            +HD ++K ++  +EEFLCR+ LV+  G + HF    V  V   +   FC
Sbjct  234  LHDVDRKVEKAFAEEFLCRKFLVKAVGRLWHFEIPSVANVTHGDGERFC  282



>ref|XP_002266046.1| PREDICTED: glucuronoxylan 4-O-methyltransferase 1 [Vitis vinifera]
Length=284

 Score =   181 bits (458),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 89/217 (41%), Positives = 139/217 (64%), Gaps = 8/217 (4%)
 Frame = -3

Query  993  LSKSIVRALVHYASISNNTDRMSYADIKQISDVLRQCGSHPCNFLVFGLTHETLLWRTLN  814
            +  S+ +AL+HY + S  T + +  +IK  S VL++    PCNFLVFGL H++L+W  LN
Sbjct  62   IPPSLAQALIHYTT-STITPQQTLKEIKVTSRVLQK--KSPCNFLVFGLGHDSLMWAALN  118

Query  813  HHGRTVFIDESRYYAAYVEEKYPEIEVYDVQYSTKLSEMKELISGVKEQARNECRPVQNL  634
            H GRT+F+DE   +   +  ++P +E Y V Y +K+++  EL+   K   R EC  + + 
Sbjct  119  HGGRTIFLDEDAVWIERIRRRFPMLESYHVTYDSKVNQADELMEAGK---RPECTAIVDA  175

Query  633  LFSECKLGLNDLPNQLYEVDWDVILVDGPRGYWPEAPGRMSAIFTAGVLARSKKGGNPKT  454
             +S C+LGL  LP ++Y++ WD+I+VD P GY  EAPGRM+AI+TAG++AR++  G  +T
Sbjct  176  RYSMCQLGLKGLPGEVYDIKWDLIMVDAPTGYHDEAPGRMTAIYTAGMMARNRADG--ET  233

Query  453  HVLVHDYNQKSDRIASEEFLCRENLVETKGMVGHFVV  343
             V VHD N+  +   S+EFLC   + + +G + HF +
Sbjct  234  DVFVHDVNRVVEDKFSKEFLCDGYMKKQEGRLRHFTI  270



>ref|XP_004504411.1| PREDICTED: glucuronoxylan 4-O-methyltransferase 1-like [Cicer 
arietinum]
Length=296

 Score =   181 bits (458),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 90/221 (41%), Positives = 142/221 (64%), Gaps = 7/221 (3%)
 Frame = -3

Query  978  VRALVHYASISNNTDRMSYADIKQISDVLRQCGSHPCNFLVFGLTHETLLWRTLNHHGRT  799
            + A++HYA+ S+   + S ++I    DV++   + P NFLVFGL H++L+W   N  G T
Sbjct  69   LHAILHYAT-SHVVPQQSISEISVTLDVIKSL-NRPINFLVFGLGHDSLMWTGFNPSGTT  126

Query  798  VFIDESRYYAAYVEEKYPEIEVYDVQYSTKLSEMKELISGVKEQARNECRPVQNLLF--S  625
            +F++E   +   V +  PE+  + VQY T+L E  EL+   K +    C P +  L    
Sbjct  127  LFLEEDPKWVQTVLKDAPELRAHTVQYRTQLQEADELLKSYKSEP--TCSPAKAFLRGNE  184

Query  624  ECKLGLNDLPNQLYEVDWDVILVDGPRGYWPEAPGRMSAIFTAGVLARSKKGGNPKTHVL  445
            +CKL L++LP+++YE DWD+I++D PRGY+ EAPGRM+AIF+  V+AR++KG    THV 
Sbjct  185  KCKLALHNLPDEVYETDWDLIMIDAPRGYFAEAPGRMAAIFSMTVMARNRKGSG-VTHVF  243

Query  444  VHDYNQKSDRIASEEFLCRENLVETKGMVGHFVVEVMDANN  322
            +HD ++K +++ +EEFLCR+NLV+  G + HF +  +   N
Sbjct  244  LHDVDRKVEKVYAEEFLCRKNLVKGVGRLWHFEIPSLGNQN  284



>ref|XP_007019818.1| UvrABC system protein C isoform 2, partial [Theobroma cacao]
 gb|EOY17043.1| UvrABC system protein C isoform 2, partial [Theobroma cacao]
Length=310

 Score =   181 bits (459),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 93/224 (42%), Positives = 148/224 (66%), Gaps = 13/224 (6%)
 Frame = -3

Query  1002  TPALSK---SIVRALVHYASISNNTDRMSYADIKQISDVLRQCGSHPCNFLVFGLTHETL  832
             TP  SK   S+  ALVHYA+ +N T + ++ +I   + VL +    PCNFLVFGL H++L
Sbjct  77    TPTCSKAPPSLANALVHYAT-TNITPQQTFKEISVSARVLEK--KSPCNFLVFGLGHDSL  133

Query  831   LWRTLNHHGRTVFIDESRYYAAYVEEKYPEIEVYDVQYSTKLSEMKELI-SGVKEQARNE  655
             +W  LN+ GRTVF++E + +   +++K P +E Y V+Y TK+ +  +L+ +G+KE    E
Sbjct  134   MWTALNYGGRTVFLEEDKAWIEQIKQKLPTLESYHVEYDTKVHQADDLMETGMKE----E  189

Query  654   CRPVQNLLFSECKLGLNDLPNQLYEVDWDVILVDGPRGYWPEAPGRMSAIFTAGVLARSK  475
             C+ V +  FS+C+L L   P+ +Y+++WD+I+VD P G+  EAPGRM+AI+TAG++AR++
Sbjct  190   CKVVSDPRFSKCQLALKGFPSDIYDIEWDLIMVDAPTGFHDEAPGRMNAIYTAGLMARNR  249

Query  474   KGGNPKTHVLVHDYNQKSDRIASEEFLCRENLVETKGMVGHFVV  343
             + G  +T V VHD ++  +   S+ FLC   L E +G + HF +
Sbjct  250   EEG--ETDVFVHDVDRVVEDKFSKAFLCEGYLREQQGRLRHFTI  291



>ref|XP_007019817.1| UvrABC system protein C isoform 1 [Theobroma cacao]
 gb|EOY17042.1| UvrABC system protein C isoform 1 [Theobroma cacao]
Length=304

 Score =   181 bits (459),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 93/224 (42%), Positives = 148/224 (66%), Gaps = 13/224 (6%)
 Frame = -3

Query  1002  TPALSK---SIVRALVHYASISNNTDRMSYADIKQISDVLRQCGSHPCNFLVFGLTHETL  832
             TP  SK   S+  ALVHYA+ +N T + ++ +I   + VL +    PCNFLVFGL H++L
Sbjct  77    TPTCSKAPPSLANALVHYAT-TNITPQQTFKEISVSARVLEK--KSPCNFLVFGLGHDSL  133

Query  831   LWRTLNHHGRTVFIDESRYYAAYVEEKYPEIEVYDVQYSTKLSEMKELI-SGVKEQARNE  655
             +W  LN+ GRTVF++E + +   +++K P +E Y V+Y TK+ +  +L+ +G+KE    E
Sbjct  134   MWTALNYGGRTVFLEEDKAWIEQIKQKLPTLESYHVEYDTKVHQADDLMETGMKE----E  189

Query  654   CRPVQNLLFSECKLGLNDLPNQLYEVDWDVILVDGPRGYWPEAPGRMSAIFTAGVLARSK  475
             C+ V +  FS+C+L L   P+ +Y+++WD+I+VD P G+  EAPGRM+AI+TAG++AR++
Sbjct  190   CKVVSDPRFSKCQLALKGFPSDIYDIEWDLIMVDAPTGFHDEAPGRMNAIYTAGLMARNR  249

Query  474   KGGNPKTHVLVHDYNQKSDRIASEEFLCRENLVETKGMVGHFVV  343
             + G  +T V VHD ++  +   S+ FLC   L E +G + HF +
Sbjct  250   EEG--ETDVFVHDVDRVVEDKFSKAFLCEGYLREQQGRLRHFTI  291



>ref|XP_011002126.1| PREDICTED: glucuronoxylan 4-O-methyltransferase 1-like [Populus 
euphratica]
Length=285

 Score =   180 bits (457),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 95/230 (41%), Positives = 145/230 (63%), Gaps = 14/230 (6%)
 Frame = -3

Query  1005  ATPALSKSIVRALVHYASISNNTDRMSYADIKQISDVLRQCGSHPCNFLVFGLTHETLLW  826
             ATP   +SI+    HYA+ S    + S A+I    DVL+     PCNFLVFGL  ++L+W
Sbjct  59    ATPTQLQSIL----HYAT-SKIVPQQSLAEISVTFDVLKT--RSPCNFLVFGLGFDSLMW  111

Query  825   RTLNHHGRTVFIDESRYYAAYVEEKYPEIEVYDVQYSTKLSEMKELISGVKEQARNECRP  646
              +LN HG T+F++E   +   + +K P +  + VQY T+L E   L+   + +    C P
Sbjct  112   TSLNPHGTTLFLEEDPKWVQTIVKKAPTLNAHTVQYRTQLQEADSLLKTYRSEPL--CSP  169

Query  645   VQNLLFS--ECKLGLNDLPNQLYEVDWDVILVDGPRGYWPEAPGRMSAIFTAGVLARSKK  472
              +  L    +C+L L+ LP+++Y+ +WD+I++D PRGY+PEAPGRM+AIF+A V+AR +K
Sbjct  170   SKACLRGNYKCRLALSGLPDEVYDKEWDLIMIDAPRGYFPEAPGRMAAIFSAAVMARGRK  229

Query  471   GGNPKTHVLVHDYNQKSDRIASEEFLCRENLVETKGMVGHFVVEVMDANN  322
             G    THV +HD N++ +++ +EEFLCR+ LV+  G + HF  E+  A N
Sbjct  230   GSG-VTHVFLHDVNRRVEKMFAEEFLCRKYLVKAVGRLWHF--EIPPAAN  276



>ref|XP_010646548.1| PREDICTED: glucuronoxylan 4-O-methyltransferase 2-like [Vitis 
vinifera]
Length=299

 Score =   180 bits (457),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 95/224 (42%), Positives = 145/224 (65%), Gaps = 13/224 (6%)
 Frame = -3

Query  1002  TPALSK---SIVRALVHYASISNNTDRMSYADIKQISDVLRQCGSHPCNFLVFGLTHETL  832
             TP  +K   S+ +ALVHYA++ N T + ++ +I   S VL++    PCNFLVFGL H++L
Sbjct  72    TPTCTKTPPSLAQALVHYATL-NVTPQQTFNEISVTSRVLQK--KAPCNFLVFGLGHDSL  128

Query  831   LWRTLNHHGRTVFIDESRYYAAYVEEKYPEIEVYDVQYSTKLSEMKELIS-GVKEQARNE  655
             +W  LNH GRTVF++E + +   +++K+P +E Y V Y TK+ E  EL+  G+ E    +
Sbjct  129   MWTALNHGGRTVFLEEDKSWMERIKQKFPSVESYYVVYDTKVHEADELLEVGMGE----D  184

Query  654   CRPVQNLLFSECKLGLNDLPNQLYEVDWDVILVDGPRGYWPEAPGRMSAIFTAGVLARSK  475
             C+ V +  FS+ KL L   PN++Y+V+WD+I+VD P GY  EAPGRM AI+TAG++ R++
Sbjct  185   CKVVADPRFSKYKLSLKGFPNEVYDVEWDLIMVDAPTGYHDEAPGRMGAIYTAGLMGRNR  244

Query  474   KGGNPKTHVLVHDYNQKSDRIASEEFLCRENLVETKGMVGHFVV  343
             + G  +T V VH+ N+  +   S+ FLC     E +G +G F +
Sbjct  245   EDG--ETDVFVHNVNRVVEDKFSKAFLCEGYFREQEGRIGRFTI  286



>ref|XP_008778155.1| PREDICTED: glucuronoxylan 4-O-methyltransferase 3 [Phoenix dactylifera]
Length=292

 Score =   180 bits (456),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 90/217 (41%), Positives = 137/217 (63%), Gaps = 8/217 (4%)
 Frame = -3

Query  993  LSKSIVRALVHYASISNNTDRMSYADIKQISDVLRQCGSHPCNFLVFGLTHETLLWRTLN  814
            +  S+   ++HYA+ SN T + +  +I   + VL +    PCNFLVFGL  ++L+W  LN
Sbjct  70   IPPSLANTIIHYAT-SNTTPQQTIKEISITAQVLER--RSPCNFLVFGLGRDSLMWTALN  126

Query  813  HHGRTVFIDESRYYAAYVEEKYPEIEVYDVQYSTKLSEMKELISGVKEQARNECRPVQNL  634
            H GRTVF++E R +   V+++ P +E Y V+Y TK+S+ +EL+   +     EC  V ++
Sbjct  127  HGGRTVFLEEDRQWIETVQQELPTLEAYHVRYDTKVSQAEELL---ELGQLPECTTVGDM  183

Query  633  LFSECKLGLNDLPNQLYEVDWDVILVDGPRGYWPEAPGRMSAIFTAGVLARSKKGGNPKT  454
              S+C+L L  LP   +EV+WD+I+VD P GY+P APGRM AI+TAG+ AR +K G  +T
Sbjct  184  RLSKCRLALKGLPEVFFEVEWDLIMVDAPTGYFPGAPGRMGAIYTAGMAARWRKEG--ET  241

Query  453  HVLVHDYNQKSDRIASEEFLCRENLVETKGMVGHFVV  343
             V VHD N+  +   S++FLC   + + KG + HF +
Sbjct  242  DVFVHDVNRLVEDRFSKKFLCEGYMRQEKGFLRHFTI  278



>ref|XP_004158529.1| PREDICTED: uncharacterized LOC101202991 [Cucumis sativus]
Length=287

 Score =   179 bits (455),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 90/215 (42%), Positives = 141/215 (66%), Gaps = 10/215 (5%)
 Frame = -3

Query  984  SIVRALVHYASISNNTDRMSYADIKQISDVLRQCGSHPCNFLVFGLTHETLLWRTLNHHG  805
            S+  AL+HYA+ +N T + +  +I   + +L      PCNFLVFGL H++L+W  LNH G
Sbjct  69   SVANALIHYAT-TNITPQQTLKEISVSARILET--KSPCNFLVFGLGHDSLMWTALNHGG  125

Query  804  RTVFIDESRYYAAYVEEKYPEIEVYDVQYSTKLSEMKELIS-GVKEQARNECRPVQNLLF  628
            RTVF++E + +   ++E+ P +E Y VQY TK+ +  EL+  G+ E    EC+ V +  F
Sbjct  126  RTVFLEEDKAWIDQIQERLPNLEAYHVQYDTKVHQADELMKIGMGE----ECKIVGDPRF  181

Query  627  SECKLGLNDLPNQLYEVDWDVILVDGPRGYWPEAPGRMSAIFTAGVLARSKKGGNPKTHV  448
             +C+L L   P+++YE++WD+I+VD P GY+ EAPGRMSAI+TAG++AR+++ G  +T V
Sbjct  182  CKCELALKGFPSEIYEMEWDLIMVDAPTGYFNEAPGRMSAIYTAGLMARNRQEG--ETDV  239

Query  447  LVHDYNQKSDRIASEEFLCRENLVETKGMVGHFVV  343
             VHD ++  +   S  FLC+  L + +G + HF +
Sbjct  240  FVHDVDRVVEDNFSMAFLCKGYLTKQEGRIRHFSI  274



>ref|XP_004138670.1| PREDICTED: uncharacterized protein LOC101202991 [Cucumis sativus]
 gb|KGN63058.1| hypothetical protein Csa_2G396200 [Cucumis sativus]
Length=287

 Score =   179 bits (455),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 90/215 (42%), Positives = 141/215 (66%), Gaps = 10/215 (5%)
 Frame = -3

Query  984  SIVRALVHYASISNNTDRMSYADIKQISDVLRQCGSHPCNFLVFGLTHETLLWRTLNHHG  805
            S+  AL+HYA+ +N T + +  +I   + +L      PCNFLVFGL H++L+W  LNH G
Sbjct  69   SVANALIHYAT-TNITPQQTLKEISVSARILET--KSPCNFLVFGLGHDSLMWTALNHGG  125

Query  804  RTVFIDESRYYAAYVEEKYPEIEVYDVQYSTKLSEMKELIS-GVKEQARNECRPVQNLLF  628
            RTVF++E + +   ++E+ P +E Y VQY TK+ +  EL+  G+ E    EC+ V +  F
Sbjct  126  RTVFLEEDKAWIDQIQERLPNLEAYHVQYDTKVHQADELMKIGMGE----ECKIVGDPRF  181

Query  627  SECKLGLNDLPNQLYEVDWDVILVDGPRGYWPEAPGRMSAIFTAGVLARSKKGGNPKTHV  448
             +C+L L   P+++YE++WD+I+VD P GY+ EAPGRMSAI+TAG++AR+++ G  +T V
Sbjct  182  CKCELALKGFPSEIYEMEWDLIMVDAPTGYFNEAPGRMSAIYTAGLMARNRQEG--ETDV  239

Query  447  LVHDYNQKSDRIASEEFLCRENLVETKGMVGHFVV  343
             VHD ++  +   S  FLC+  L + +G + HF +
Sbjct  240  FVHDVDRVVEDNFSMAFLCKGYLTKQEGRIRHFSI  274



>ref|XP_002514909.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF47463.1| conserved hypothetical protein [Ricinus communis]
Length=285

 Score =   179 bits (455),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 92/227 (41%), Positives = 141/227 (62%), Gaps = 8/227 (4%)
 Frame = -3

Query  1023  SGGGGGATPALSKSIVRALVHYASISNNTDRMSYADIKQISDVLRQCGSHPCNFLVFGLT  844
             S G   A  A +   ++A++HYA+ S    + S  +I    +VL+     PCNFLVFGL 
Sbjct  49    SNGRATAEYAATPIQLQAIIHYAT-SRVVPQQSLGEISVTFNVLKSLA--PCNFLVFGLG  105

Query  843   HETLLWRTLNHHGRTVFIDESRYYAAYVEEKYPEIEVYDVQYSTKLSEMKELISGVKEQA  664
             H++L+W +LN HG T+F++E   +   V    P +  + VQY T+L E  +L+S  + + 
Sbjct  106   HDSLMWSSLNPHGTTLFLEEDPKWIQTVLANAPTLHAHAVQYRTQLQEANQLLSSYRSEP  165

Query  663   RNECRPVQNLLFS--ECKLGLNDLPNQLYEVDWDVILVDGPRGYWPEAPGRMSAIFTAGV  490
                C P +  L     CKL L  LP+++Y+ +WD+I++D PRGY+ EAPGRM+AIF+A V
Sbjct  166   Y--CLPSKAYLRGNYRCKLALTGLPDEVYDKEWDLIMIDAPRGYFNEAPGRMAAIFSAAV  223

Query  489   LARSKKGGNPKTHVLVHDYNQKSDRIASEEFLCRENLVETKGMVGHF  349
             +AR++K     THV +HD ++K ++I +EEFLCR+ LV+  G + HF
Sbjct  224   MARARKASG-ATHVFLHDVDRKVEKIYAEEFLCRKYLVKAVGRLWHF  269



>ref|XP_002279765.1| PREDICTED: glucuronoxylan 4-O-methyltransferase 3 [Vitis vinifera]
 emb|CBI40958.3| unnamed protein product [Vitis vinifera]
Length=300

 Score =   180 bits (456),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 94/224 (42%), Positives = 146/224 (65%), Gaps = 13/224 (6%)
 Frame = -3

Query  1002  TPALSK---SIVRALVHYASISNNTDRMSYADIKQISDVLRQCGSHPCNFLVFGLTHETL  832
             TP  +K   S+ +ALVHYA++ N T + ++ +I     VL++    PCNFLVFGL H++L
Sbjct  73    TPTCTKTPPSLAQALVHYATL-NITPQQTFNEISVSLRVLQKKA--PCNFLVFGLGHDSL  129

Query  831   LWRTLNHHGRTVFIDESRYYAAYVEEKYPEIEVYDVQYSTKLSEMKELIS-GVKEQARNE  655
             +W  LNH GRT+F++E + +   +++K P +E Y V Y +K+ +  EL+  G+ E    +
Sbjct  130   MWTALNHGGRTIFLEEDKSWIEQIKQKLPSLESYHVVYDSKVHQADELMEVGMGE----D  185

Query  654   CRPVQNLLFSECKLGLNDLPNQLYEVDWDVILVDGPRGYWPEAPGRMSAIFTAGVLARSK  475
             C+ V +  FS+CKL L   PN++Y+V+WD+I+VD P GY  EAPGRMSAI+TAG++AR++
Sbjct  186   CKVVVDPRFSKCKLSLKGFPNEVYDVEWDLIMVDAPTGYHDEAPGRMSAIYTAGLMARNR  245

Query  474   KGGNPKTHVLVHDYNQKSDRIASEEFLCRENLVETKGMVGHFVV  343
             + G  +T V VHD ++  +   S+ FLC     E +G + HF +
Sbjct  246   EDG--ETDVFVHDVDRVVEDKFSKAFLCEGYFREQEGRIRHFTI  287



>ref|XP_002274054.1| PREDICTED: glucuronoxylan 4-O-methyltransferase 1 [Vitis vinifera]
Length=282

 Score =   179 bits (454),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 90/233 (39%), Positives = 147/233 (63%), Gaps = 10/233 (4%)
 Frame = -3

Query  996  ALSKSIVRALVHYASISNNTDRMSYADIKQISDVLRQCGSHPCNFLVFGLTHETLLWRTL  817
            +++++ + A++HYA+ S    + S A+I+   DVL+     PCNFLV+GL H++++W + 
Sbjct  56   SVAQTQLIAILHYAT-SRVVPQQSLAEIRVSFDVLQSLA--PCNFLVYGLGHDSVMWSSF  112

Query  816  NHHGRTVFIDESRYYAAYVEEKYPEIEVYDVQYSTKLSEMKELISGVKEQARNECRPVQN  637
            N  G T+F++E   +   V ++ P +  + V+Y T LSE  +L+   K +    C P   
Sbjct  113  NPKGTTIFLEEDPKWVQTVLKQAPNLLAHTVRYRTHLSEADQLLRSYKSEP--ACLPPDV  170

Query  636  LLF--SECKLGLNDLPNQLYEVDWDVILVDGPRGYWPEAPGRMSAIFTAGVLARSKKGGN  463
             L   + C+L L  LP ++Y+ +WD+I++D PRGY+PEAPGRM AIFTA V+AR++K   
Sbjct  171  RLRDNTACRLALTGLPEEVYDTEWDLIMIDAPRGYFPEAPGRMGAIFTAAVMARARKRQG  230

Query  462  PKTHVLVHDYNQKSDRIASEEFLCRENLVETKGMVGHFVV--EVMDANNFNFC  310
              THV +HD N++ +++ +EEFLC++NLV+ +G + HF +     D  N  FC
Sbjct  231  -VTHVFLHDVNRRIEKVYAEEFLCKKNLVKAEGRLWHFAIPSAANDTMNSAFC  282



>ref|XP_011095869.1| PREDICTED: glucuronoxylan 4-O-methyltransferase 1-like [Sesamum 
indicum]
Length=296

 Score =   179 bits (455),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 90/217 (41%), Positives = 139/217 (64%), Gaps = 8/217 (4%)
 Frame = -3

Query  993  LSKSIVRALVHYASISNNTDRMSYADIKQISDVLRQCGSHPCNFLVFGLTHETLLWRTLN  814
            +S S+  ALVHYA++ N T + +  +I     VL      PCNFLVFGL H++L+W  LN
Sbjct  75   ISPSLAHALVHYATL-NITPQQTLKEISVSLKVLE--NKSPCNFLVFGLGHDSLMWTALN  131

Query  813  HHGRTVFIDESRYYAAYVEEKYPEIEVYDVQYSTKLSEMKELISGVKEQARNECRPVQNL  634
            H GRTVF++E + +   ++ + P +E Y V Y TK+++  EL+   +   + EC+ V + 
Sbjct  132  HGGRTVFLEEDKSWIQQIQRQIPSLESYHVVYDTKVTQADELL---EISTKEECKTVGDP  188

Query  633  LFSECKLGLNDLPNQLYEVDWDVILVDGPRGYWPEAPGRMSAIFTAGVLARSKKGGNPKT  454
             FS+C L L  LPN++Y+++WD+I+VD P GY+  APGRMSAI+TAG++AR+++ G  +T
Sbjct  189  RFSKCPLALKGLPNEVYDIEWDLIMVDAPTGYFDGAPGRMSAIYTAGLMARNRENG--ET  246

Query  453  HVLVHDYNQKSDRIASEEFLCRENLVETKGMVGHFVV  343
             V VHD ++  +   S+  LC   L E +G + HF +
Sbjct  247  DVFVHDVDRVVEDKFSKALLCEGYLREQEGRIRHFTI  283



>ref|XP_010028995.1| PREDICTED: glucuronoxylan 4-O-methyltransferase 2-like [Eucalyptus 
grandis]
 gb|KCW55827.1| hypothetical protein EUGRSUZ_I01644 [Eucalyptus grandis]
Length=303

 Score =   179 bits (455),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 96/240 (40%), Positives = 145/240 (60%), Gaps = 10/240 (4%)
 Frame = -3

Query  1020  GGGGGATPALSKSIVRALVHYASISNNTDRMSYADIKQISDVLRQCGSHPCNFLVFGLTH  841
             GG   ++   + + ++A++HYA+ S    + S A+I    +VLR+    PCNFLVFGL H
Sbjct  70    GGSVSSSQVTTPTQLQAILHYAT-SRVVPQQSLAEISLCFNVLREAA--PCNFLVFGLGH  126

Query  840   ETLLWRTLNHHGRTVFIDESRYYAAYVEEKYPEIEVYDVQYSTKLSEMKELISGVKEQAR  661
             ++L+W  LN  G TVF++E   +   V  K P +  + V Y T+L+E  EL++  +++  
Sbjct  127   DSLMWAALNPRGTTVFLEEGESWIRSVITKAPSLHAFHVHYPTRLAEANELLATYRDE--  184

Query  660   NECRPVQNLLFSE--CKLGLNDLPNQLYEVDWDVILVDGPRGYWPEAPGRMSAIFTAGVL  487
              +C P    +  E  C+L L  LP ++ E  WDVI++D PRGY+ EAPGRM AIFTA V+
Sbjct  185   RDCMPGHAGMGGESRCRLALPGLPEEVREKQWDVIMIDAPRGYFAEAPGRMGAIFTAAVM  244

Query  486   ARSKKGGNPKTHVLVHDYNQKSDRIASEEFLCRENLVETKGMVGHFVVEVMDANNFNFCR  307
             AR + G    THV +HD N++ +R  ++EFLC +N VE  G + HF  E+  ++N N  R
Sbjct  245   ARGRTGEG-VTHVFLHDVNRRVERAYAKEFLCMKNKVEGVGRLWHF--EIPPSSNVNATR  301



>ref|XP_010927860.1| PREDICTED: glucuronoxylan 4-O-methyltransferase 3-like [Elaeis 
guineensis]
Length=292

 Score =   179 bits (455),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 88/217 (41%), Positives = 137/217 (63%), Gaps = 8/217 (4%)
 Frame = -3

Query  993  LSKSIVRALVHYASISNNTDRMSYADIKQISDVLRQCGSHPCNFLVFGLTHETLLWRTLN  814
            +  S+   ++HYA+ SN T + +  +I   S VL +    PCNFL+FGL  ++L+W  LN
Sbjct  70   IPPSLANTIIHYAA-SNTTPQQTIKEISITSQVLER--RSPCNFLIFGLGRDSLMWTALN  126

Query  813  HHGRTVFIDESRYYAAYVEEKYPEIEVYDVQYSTKLSEMKELISGVKEQARNECRPVQNL  634
            H GRTVF++E R +   ++++ P +E Y V+Y TK+S+ +EL+   +     EC  V ++
Sbjct  127  HGGRTVFLEEDRQWIETIQQELPNLEAYHVEYDTKVSQAEELL---ELGQLPECTTVGDV  183

Query  633  LFSECKLGLNDLPNQLYEVDWDVILVDGPRGYWPEAPGRMSAIFTAGVLARSKKGGNPKT  454
              S+C+L L  LP   +EV+WD+I+VD P GY+P APGRM AI+TAG+ AR +K G  +T
Sbjct  184  RLSKCRLALKGLPEAFFEVEWDLIMVDAPTGYFPGAPGRMGAIYTAGMAARWRKEG--ET  241

Query  453  HVLVHDYNQKSDRIASEEFLCRENLVETKGMVGHFVV  343
             V VHD N+ ++   S +FLC   + + +G + HF +
Sbjct  242  DVFVHDVNRFAEDRFSRKFLCEGYMRQEEGFLRHFTI  278



>ref|XP_011036083.1| PREDICTED: glucuronoxylan 4-O-methyltransferase 1-like [Populus 
euphratica]
Length=285

 Score =   179 bits (454),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 89/221 (40%), Positives = 144/221 (65%), Gaps = 10/221 (5%)
 Frame = -3

Query  978  VRALVHYASISNNTDRMSYADIKQISDVLRQCGSHPCNFLVFGLTHETLLWRTLNHHGRT  799
            +++++HYA+ S    + S+A+I    +VL+     PCNFLVFGL  ++L+W +LN HG T
Sbjct  64   LQSILHYAT-SKIVPQQSFAEITVTFNVLKT--RSPCNFLVFGLGFDSLMWTSLNPHGTT  120

Query  798  VFIDESRYYAAYVEEKYPEIEVYDVQYSTKLSEMKELISGVKEQARNECRPVQNLLFS--  625
            +F++E   +   + +K P +  + VQY T+L E   L+   + +    C P +  L    
Sbjct  121  LFLEEDPKWVQTIVKKAPTLNAHTVQYLTQLKEADSLLKTYRSEPL--CSPSKACLRGNY  178

Query  624  ECKLGLNDLPNQLYEVDWDVILVDGPRGYWPEAPGRMSAIFTAGVLARSKKGGNPKTHVL  445
            +C+L L+ LP+++Y+ +WD+I++D PRGY+PEAPGRM+AIF+A V+AR +KG    THV 
Sbjct  179  KCRLALSGLPDEVYDKEWDLIMIDAPRGYFPEAPGRMAAIFSAAVMARGRKGSG-VTHVF  237

Query  444  VHDYNQKSDRIASEEFLCRENLVETKGMVGHFVVEVMDANN  322
            +HD N++ +++ +EEFLCR+ LV+  G + HF  E+  A N
Sbjct  238  LHDVNRRVEKMFAEEFLCRKYLVKAVGRLWHF--EIPPAAN  276



>ref|XP_009353798.1| PREDICTED: glucuronoxylan 4-O-methyltransferase 1-like [Pyrus 
x bretschneideri]
Length=291

 Score =   179 bits (454),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 93/229 (41%), Positives = 143/229 (62%), Gaps = 9/229 (4%)
 Frame = -3

Query  993  LSKSIVRALVHYASISNNTDRMSYADIKQISDVLRQCGSHPCNFLVFGLTHETLLWRTLN  814
            +  S+ +AL+HY + S  T + +  +I   S VL +    PCNFLVFGL H++L+W +LN
Sbjct  69   IPTSLAKALIHYTT-STITPQQTLKEISVTSKVLDK--KSPCNFLVFGLGHDSLMWTSLN  125

Query  813  HHGRTVFIDESRYYAAYVEEKYPEIEVYDVQYSTKLSEMKELISGVKEQARNECRPVQNL  634
            H GRT+F++E   +   +  ++P +E Y V Y +K++E   L+   K     EC  V + 
Sbjct  126  HGGRTIFLEEDESWIEQIRRRFPTLESYHVTYDSKVNEANSLMDVGKGP---ECTAVVDP  182

Query  633  LFSECKLGLNDLPNQLYEVDWDVILVDGPRGYWPEAPGRMSAIFTAGVLARSKKGGNPKT  454
             +S C+L L  LP+++YE+ WD+I+VD P GY  EAPGRMSAI+TAG++AR+K+GG  +T
Sbjct  183  RYSVCQLALKGLPSEVYEIKWDLIMVDAPTGYHDEAPGRMSAIYTAGMMARNKEGG--ET  240

Query  453  HVLVHDYNQKSDRIASEEFLCRENLVETKGMVGHF-VVEVMDANNFNFC  310
             V VHD N+  +   S+ FLC   + + +G + HF +    D++N  FC
Sbjct  241  DVFVHDVNRDVEDKFSKAFLCEGYMKKQEGRLRHFNIPSHKDSSNRPFC  289



>emb|CAN78768.1| hypothetical protein VITISV_006251 [Vitis vinifera]
Length=237

 Score =   177 bits (450),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 88/217 (41%), Positives = 137/217 (63%), Gaps = 8/217 (4%)
 Frame = -3

Query  993  LSKSIVRALVHYASISNNTDRMSYADIKQISDVLRQCGSHPCNFLVFGLTHETLLWRTLN  814
            +  S+ +AL+HY + S  T + +  +IK  S VL++    PCNFLVFGL H++L+W  LN
Sbjct  15   IPPSLAQALIHYTT-STITPQQTLKEIKVTSRVLQK--KSPCNFLVFGLGHDSLMWAALN  71

Query  813  HHGRTVFIDESRYYAAYVEEKYPEIEVYDVQYSTKLSEMKELISGVKEQARNECRPVQNL  634
            H GRT+F+DE   +   +  ++P +E Y V Y +K+++  EL+   K     EC  + + 
Sbjct  72   HGGRTIFLDEDAVWIEQIRRRFPMLESYHVTYDSKVNQADELMEAGKGP---ECTAIVDA  128

Query  633  LFSECKLGLNDLPNQLYEVDWDVILVDGPRGYWPEAPGRMSAIFTAGVLARSKKGGNPKT  454
             +S C+LGL  LP ++Y++ WD+I+VD P GY  EAPGRM+AI+TAG++AR++  G  +T
Sbjct  129  RYSMCQLGLKGLPGEVYDIKWDLIMVDAPTGYHDEAPGRMTAIYTAGMMARNRADG--ET  186

Query  453  HVLVHDYNQKSDRIASEEFLCRENLVETKGMVGHFVV  343
             V VHD N+  +   S+EFLC   + + +G   HF +
Sbjct  187  DVFVHDVNRVVEDKFSKEFLCDGYMKKQEGRXRHFTI  223



>ref|XP_010544116.1| PREDICTED: glucuronoxylan 4-O-methyltransferase 1 [Tarenaya hassleriana]
Length=288

 Score =   179 bits (453),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 92/235 (39%), Positives = 145/235 (62%), Gaps = 9/235 (4%)
 Frame = -3

Query  1011  GGATPALSKSIVRALVHYASISNNTDRMSYADIKQISDVLRQCGSHPCNFLVFGLTHETL  832
             G AT  + +SI +AL+HY S +  T + +  +I   + VL +    PCNFLVFGL H++L
Sbjct  54    GDATNKIPRSIAQALIHY-STTTITPQQTLKEISVTAKVLEK--KSPCNFLVFGLGHDSL  110

Query  831   LWRTLNHHGRTVFIDESRYYAAYVEEKYPEIEVYDVQYSTKLSEMKELISGVKEQARNEC  652
             +W +LN+ GRTVF++E   +   +++++P +E Y V Y +K+++   L+   K     EC
Sbjct  111   MWSSLNYGGRTVFLEEDEAWIGQIKKRFPMLESYHVTYDSKVNQADNLMEVGKG---TEC  167

Query  651   RPVQNLLFSECKLGLNDLPNQLYEVDWDVILVDGPRGYWPEAPGRMSAIFTAGVLARSKK  472
               V +  +S C+L L  LP ++YE  WD+I+VD P GY+ EAPGRM+AI+TAG++AR+K 
Sbjct  168   TAVDDPRYSMCQLALKGLPKEIYETKWDLIMVDAPTGYYDEAPGRMTAIYTAGMMARNKD  227

Query  471   GGNPKTHVLVHDYNQKSDRIASEEFLCRENLVETKGMVGHFVVEV-MDANNFNFC  310
              G  +T V VHD N++ +   S  FLC   + + +G + HF +    D ++  FC
Sbjct  228   EG--ETDVFVHDVNREVEDKFSMAFLCDRYMKKQEGRLRHFTIPSHKDGSDRPFC  280



>ref|XP_010100099.1| hypothetical protein L484_014289 [Morus notabilis]
 gb|EXB81482.1| hypothetical protein L484_014289 [Morus notabilis]
Length=306

 Score =   179 bits (454),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 88/214 (41%), Positives = 140/214 (65%), Gaps = 8/214 (4%)
 Frame = -3

Query  984  SIVRALVHYASISNNTDRMSYADIKQISDVLRQCGSHPCNFLVFGLTHETLLWRTLNHHG  805
            S+  ALVHYA+ +N T + +  +I     VL +    PCNFLVFGL H++L+W  LNH G
Sbjct  88   SLANALVHYAA-TNITPQQTQKEISVSMSVLEK--KSPCNFLVFGLGHDSLMWTALNHGG  144

Query  804  RTVFIDESRYYAAYVEEKYPEIEVYDVQYSTKLSEMKELISGVKEQARNECRPVQNLLFS  625
            RTVF++E + +   ++ ++P +E Y V Y TK+ + +EL+   K     EC+ V +  FS
Sbjct  145  RTVFLEEDKAWIEQIKRRFPGLESYHVTYDTKVHQAEELL---KLGDSEECKAVGDPRFS  201

Query  624  ECKLGLNDLPNQLYEVDWDVILVDGPRGYWPEAPGRMSAIFTAGVLARSKKGGNPKTHVL  445
            +C+L L + P+++Y+ +WD+I+VD P GY+  APGRMSAI+TAG++AR+++ G  +T V 
Sbjct  202  DCQLALKNFPSEVYDTEWDLIMVDAPTGYFDGAPGRMSAIYTAGIMARNRESG--ETDVF  259

Query  444  VHDYNQKSDRIASEEFLCRENLVETKGMVGHFVV  343
            VHD ++  +   S+ FLC   L + +G + HF++
Sbjct  260  VHDVDRVVEDKFSKTFLCEGYLAQQEGRLRHFIL  293



>ref|XP_008339417.1| PREDICTED: glucuronoxylan 4-O-methyltransferase 1 [Malus domestica]
Length=329

 Score =   180 bits (456),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 93/234 (40%), Positives = 144/234 (62%), Gaps = 9/234 (4%)
 Frame = -3

Query  1008  GATPALSKSIVRALVHYASISNNTDRMSYADIKQISDVLRQCGSHPCNFLVFGLTHETLL  829
             G    +  S+ +AL+HY + S  T + +  +I   S VL +    PCNFLVFGL H++L+
Sbjct  102   GTCNKIPTSLAKALIHYTT-STITPQQTLKEISVTSKVLDK--KSPCNFLVFGLGHDSLM  158

Query  828   WRTLNHHGRTVFIDESRYYAAYVEEKYPEIEVYDVQYSTKLSEMKELISGVKEQARNECR  649
             W +LNH GRT+F++E   +   +  ++P +E Y V Y +K++E   L+   K     EC 
Sbjct  159   WTSLNHGGRTIFLEEDESWIEQIRRRFPTLESYHVTYDSKVNEANSLMDVGKGP---ECT  215

Query  648   PVQNLLFSECKLGLNDLPNQLYEVDWDVILVDGPRGYWPEAPGRMSAIFTAGVLARSKKG  469
              V +  +S C+L L  LP+++YE+ W++I+VD P GY  EAPGRMSAI+TAG++AR+K+G
Sbjct  216   AVGDPRYSVCQLALKGLPSEVYEIKWBLIMVDAPTGYHDEAPGRMSAIYTAGMMARNKEG  275

Query  468   GNPKTHVLVHDYNQKSDRIASEEFLCRENLVETKGMVGHF-VVEVMDANNFNFC  310
             G  +T V VHD N+  +   S+ FLC   + + +G + HF +    D++N  FC
Sbjct  276   G--ETDVFVHDVNRDVEDKFSKAFLCEGYMKKQEGRLRHFNIPSHKDSSNRPFC  327



>ref|XP_002889761.1| hypothetical protein ARALYDRAFT_888205 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH66020.1| hypothetical protein ARALYDRAFT_888205 [Arabidopsis lyrata subsp. 
lyrata]
Length=282

 Score =   178 bits (452),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 91/222 (41%), Positives = 141/222 (64%), Gaps = 7/222 (3%)
 Frame = -3

Query  1008  GATPALSKSIVRALVHYASISNNTDRMSYADIKQISDVLRQCGSHPCNFLVFGLTHETLL  829
             GA   L +S+ +AL+HY S S  T + +  +I   S VL +    PCNFLVFGL H++L+
Sbjct  51    GACNKLPRSLAQALIHY-STSVITPQQTLKEIAVSSTVLGK--KSPCNFLVFGLGHDSLM  107

Query  828   WRTLNHHGRTVFIDESRYYAAYVEEKYPEIEVYDVQYSTKLSEMKELISGVKEQARNECR  649
             W +LN+ GRTVF++E   +   ++ ++P +E Y V Y +K+++   LI   K     EC 
Sbjct  108   WSSLNYGGRTVFLEEDEAWIKQIKRRFPMLESYHVTYDSKVNQADNLIEVGKGP---ECT  164

Query  648   PVQNLLFSECKLGLNDLPNQLYEVDWDVILVDGPRGYWPEAPGRMSAIFTAGVLARSKKG  469
              + +  +S C+L L  LP ++YE  WD+I+VD P GY+ EAPGRM+AI+TAG++AR++K 
Sbjct  165   AIGDPRYSMCQLALKGLPAEIYETSWDLIMVDAPTGYYDEAPGRMTAIYTAGMMARNRKQ  224

Query  468   GNPKTHVLVHDYNQKSDRIASEEFLCRENLVETKGMVGHFVV  343
             G  +T V VHD N++ +   S+ FLC   + + +G + HFV+
Sbjct  225   GG-ETDVFVHDVNREIENKFSKTFLCEGYMTKQEGRLRHFVI  265



>ref|XP_008389874.1| PREDICTED: glucuronoxylan 4-O-methyltransferase 2-like [Malus 
domestica]
Length=282

 Score =   178 bits (452),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 91/224 (41%), Positives = 144/224 (64%), Gaps = 10/224 (4%)
 Frame = -3

Query  978  VRALVHYASISNNTDRMSYADIKQISDVLRQCGSHPCNFLVFGLTHETLLWRTLNHHGRT  799
            ++A++HYA+ S  T + S  +I    +VL+     PCNFLVFGL  ++L+W +LN  G T
Sbjct  60   LQAILHYAT-SRQTPQQSRDEIAVSFEVLK--SRSPCNFLVFGLGFDSLMWASLNPRGTT  116

Query  798  VFIDESRYYAAYVEEKYPEIEVYDVQYSTKLSEMKELISGVKEQARNECRPVQNLLF--S  625
            +F++E   +   V +  P++    V Y T+L E  EL+S  +  +   C P + +L   +
Sbjct  117  LFLEEDPKWVQTVLKDVPQLRAETVHYRTQLKEADELLSSYR--SLRSCSPSEAVLRGNT  174

Query  624  ECKLGLNDLPNQLYEVDWDVILVDGPRGYWPEAPGRMSAIFTAGVLARSKKGGNPKTHVL  445
            EC+L L++LP+++Y+ +WD+I+VD PRGY+PEAPGRM AIF+A V+AR ++G    THV 
Sbjct  175  ECRLALDNLPDEVYDKEWDLIMVDAPRGYFPEAPGRMGAIFSAAVMARRRRGSG-VTHVF  233

Query  444  VHDYNQKSDRIASEEFLCRENLVETKGMVGHFVVEVMDANNFNF  313
            +HD ++K ++  +EEFLCR+ LV+  G + HF  E+  A N  +
Sbjct  234  LHDVDRKVEKAFAEEFLCRKFLVKAVGRLWHF--EIPSAANVTY  275



>ref|XP_009611193.1| PREDICTED: glucuronoxylan 4-O-methyltransferase 1-like [Nicotiana 
tomentosiformis]
Length=287

 Score =   178 bits (451),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 88/229 (38%), Positives = 143/229 (62%), Gaps = 9/229 (4%)
 Frame = -3

Query  993  LSKSIVRALVHYASISNNTDRMSYADIKQISDVLRQCGSHPCNFLVFGLTHETLLWRTLN  814
            +  S+ ++L+HYA+ SN T +    +I   S++L +    PCNFLVFGL H++L+W TLN
Sbjct  66   IPSSVAKSLIHYAT-SNTTPQQKLDEISITSNILDK--KSPCNFLVFGLGHDSLMWHTLN  122

Query  813  HHGRTVFIDESRYYAAYVEEKYPEIEVYDVQYSTKLSEMKELISGVKEQARNECRPVQNL  634
              GRT+F+DE   +   +++K+P +E Y V Y +K+ E   L+   K   + +C  + + 
Sbjct  123  FGGRTIFLDEDVIWIEKIKKKFPMLESYHVTYDSKVKEANVLMEAGK---KPDCTAIADP  179

Query  633  LFSECKLGLNDLPNQLYEVDWDVILVDGPRGYWPEAPGRMSAIFTAGVLARSKKGGNPKT  454
             +S+C+L L  LPN++Y++ WD+I+VD P G+   APGRM+AI+TAG++AR+K+ G  +T
Sbjct  180  RYSKCQLALKGLPNEIYDIKWDLIMVDAPTGFHENAPGRMTAIYTAGMMARNKENG--ET  237

Query  453  HVLVHDYNQKSDRIASEEFLCRENLVETKGMVGHFVVEVMDAN-NFNFC  310
            HV VHD ++  +   S+ FLC   + +  G + HF +     N +  FC
Sbjct  238  HVFVHDVHRNIEDKFSKAFLCDGYMKKQVGKLRHFTIPSHKNNLDMPFC  286



>ref|XP_002526428.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF35923.1| conserved hypothetical protein [Ricinus communis]
Length=291

 Score =   178 bits (452),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 89/229 (39%), Positives = 144/229 (63%), Gaps = 9/229 (4%)
 Frame = -3

Query  993  LSKSIVRALVHYASISNNTDRMSYADIKQISDVLRQCGSHPCNFLVFGLTHETLLWRTLN  814
            + +S+ +AL+HY + S  T + +  +I   + +L +    PCNFLVFGL H++L+W TLN
Sbjct  69   IPRSLAQALIHYTT-STITPQQTLKEISVTARILEK--KSPCNFLVFGLGHDSLMWNTLN  125

Query  813  HHGRTVFIDESRYYAAYVEEKYPEIEVYDVQYSTKLSEMKELISGVKEQARNECRPVQNL  634
            + GRT+F++E   + + +  ++P +E Y V Y +K+++   L+   K     EC  + + 
Sbjct  126  YGGRTIFLEEDESWISQIRRRFPMLESYHVTYDSKVNQADNLMDVGKGP---ECTALSDP  182

Query  633  LFSECKLGLNDLPNQLYEVDWDVILVDGPRGYWPEAPGRMSAIFTAGVLARSKKGGNPKT  454
              S C+L L  LPN++YE+ WD+I+VD P GY+ EAPGRM+AI+TAG++AR++  G  KT
Sbjct  183  KVSMCQLALKGLPNEVYEIKWDLIMVDAPTGYYEEAPGRMTAIYTAGMMARNRPEG--KT  240

Query  453  HVLVHDYNQKSDRIASEEFLCRENLVETKGMVGHFVVEV-MDANNFNFC  310
             V VHD N++ +   S+ FLC   + + +G + HF +   MDA +  FC
Sbjct  241  EVFVHDVNREVEDRFSKAFLCEGYMKKQEGRLRHFTIPSHMDALDRPFC  289



>gb|KFK45099.1| hypothetical protein AALP_AA1G343500 [Arabis alpina]
Length=296

 Score =   178 bits (452),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 93/214 (43%), Positives = 134/214 (63%), Gaps = 8/214 (4%)
 Frame = -3

Query  984  SIVRALVHYASISNNTDRMSYADIKQISDVLRQCGSHPCNFLVFGLTHETLLWRTLNHHG  805
            S+  ALVHY + SN T + ++ ++     VL +    PCNFLVFGL H++L+W +LNH G
Sbjct  71   SLSDALVHYVT-SNVTPQQTFDEVSVSKRVLDK--KSPCNFLVFGLGHDSLMWASLNHGG  127

Query  804  RTVFIDESRYYAAYVEEKYPEIEVYDVQYSTKLSEMKELISGVKEQARNECRPVQNLLFS  625
            RT+FI+E + + A V +K+P +E Y V Y TK+ +  +L+   + +   ECR V +   S
Sbjct  128  RTLFIEEDKAWIAIVTKKFPNLESYHVVYDTKVKDSDKLMELGQSE---ECRSVSDPRNS  184

Query  624  ECKLGLNDLPNQLYEVDWDVILVDGPRGYWPEAPGRMSAIFTAGVLARSKKGGNPKTHVL  445
            +C L L D P   YE  WD+I+VD P GY  EAPGRMSAI+TAG+LAR+++ G  +T V 
Sbjct  185  KCDLALKDFPADFYETKWDLIMVDAPTGYHEEAPGRMSAIYTAGMLARNREDG--ETDVF  242

Query  444  VHDYNQKSDRIASEEFLCRENLVETKGMVGHFVV  343
            VHD N+  +   S  FLC+  + E  G + HF +
Sbjct  243  VHDVNRPVEDEFSATFLCKGYMREQNGRLRHFTI  276



>ref|XP_006415059.1| hypothetical protein EUTSA_v10008341mg [Eutrema salsugineum]
 gb|ESQ33412.1| hypothetical protein EUTSA_v10008341mg [Eutrema salsugineum]
Length=295

 Score =   178 bits (452),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 93/214 (43%), Positives = 134/214 (63%), Gaps = 8/214 (4%)
 Frame = -3

Query  984  SIVRALVHYASISNNTDRMSYADIKQISDVLRQCGSHPCNFLVFGLTHETLLWRTLNHHG  805
            S+  ALVHY + SN T + ++ ++     VL +    PCNFLVFGL H++L+W +LNH G
Sbjct  70   SLSDALVHYVT-SNITPQQTFDEVSVSKRVLDK--KSPCNFLVFGLGHDSLMWASLNHGG  126

Query  804  RTVFIDESRYYAAYVEEKYPEIEVYDVQYSTKLSEMKELISGVKEQARNECRPVQNLLFS  625
            RT+FI+E + + A V +K+P +E Y V Y TK+ +  +L+   + +   ECR V +   S
Sbjct  127  RTLFIEEDKAWIAIVTKKFPNLESYHVVYDTKVKDSDKLMELGRSE---ECRSVSDPRNS  183

Query  624  ECKLGLNDLPNQLYEVDWDVILVDGPRGYWPEAPGRMSAIFTAGVLARSKKGGNPKTHVL  445
            +C L L D P   YE  WD+I+VD P GY  EAPGRMSAI+TAG+LAR+++ G  +T V 
Sbjct  184  KCDLALKDFPADFYETKWDLIMVDAPTGYHEEAPGRMSAIYTAGLLARNREDG--ETDVF  241

Query  444  VHDYNQKSDRIASEEFLCRENLVETKGMVGHFVV  343
            VHD N+  +   S  FLC+  + E  G + HF +
Sbjct  242  VHDVNRPVEDEFSATFLCKGYMREQNGRLRHFTI  275



>ref|XP_003531197.1| PREDICTED: glucuronoxylan 4-O-methyltransferase 3-like [Glycine 
max]
Length=286

 Score =   178 bits (451),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 90/226 (40%), Positives = 144/226 (64%), Gaps = 7/226 (3%)
 Frame = -3

Query  978  VRALVHYASISNNTDRMSYADIKQISDVLRQCGSHPCNFLVFGLTHETLLWRTLNHHGRT  799
            ++A++HYA+ S    + S ++I    DVL Q    P NFLVFGL  ++L+W +LN HG T
Sbjct  64   LKAILHYAT-SQIVPQQSLSEITITFDVL-QSLHRPANFLVFGLGRDSLMWASLNPHGTT  121

Query  798  VFIDESRYYAAYVEEKYPEIEVYDVQYSTKLSEMKELISGVKEQARNECRPVQNLLF--S  625
            +F++E   +   V ++ P +  + V+Y T+L E   L+S  + +    C P    L    
Sbjct  122  LFLEEDPKWFGIVTKEAPYLRAHTVRYRTQLREADSLMSSYRSEP--ACFPATATLRGNE  179

Query  624  ECKLGLNDLPNQLYEVDWDVILVDGPRGYWPEAPGRMSAIFTAGVLARSKKGGNPKTHVL  445
             CKL L++LP+++YE +WD+I++D P+GY+ EAPGRM+AIF+A V+AR +KG    THV 
Sbjct  180  RCKLALHNLPDEVYEKEWDLIMIDAPKGYFAEAPGRMAAIFSAAVMARDRKGSG-VTHVF  238

Query  444  VHDYNQKSDRIASEEFLCRENLVETKGMVGHFVVEVMDANNFNFCR  307
            +HD ++K +++ +EEFLCR++LV+  G + HF +  M  N  ++ R
Sbjct  239  LHDVDRKVEKVYAEEFLCRKHLVKGVGRLWHFEIPPMGNNTRDYAR  284



>ref|NP_564428.1| glucuronoxylan 4-O-methyltransferase [Arabidopsis thaliana]
 sp|Q9LQ32.1|GXM3_ARATH RecName: Full=Glucuronoxylan 4-O-methyltransferase 3 [Arabidopsis 
thaliana]
 gb|AAF97282.1|AC010164_4 Hypothetical protein [Arabidopsis thaliana]
 gb|AAL50109.1| At1g33800/F14M2_23 [Arabidopsis thaliana]
 gb|AAM19911.1| At1g33800/F14M2_23 [Arabidopsis thaliana]
 gb|AAM61226.1| unknown [Arabidopsis thaliana]
 gb|AEE31626.1| glucuronoxylan 4-O-methyltransferase [Arabidopsis thaliana]
 gb|AFU91594.1| glucuronoxylan methyltransferase 3 [Arabidopsis thaliana]
Length=297

 Score =   178 bits (451),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 93/214 (43%), Positives = 134/214 (63%), Gaps = 8/214 (4%)
 Frame = -3

Query  984  SIVRALVHYASISNNTDRMSYADIKQISDVLRQCGSHPCNFLVFGLTHETLLWRTLNHHG  805
            S+  ALVHY + SN T + ++ ++     VL +    PCNFLVFGL H++L+W +LNH G
Sbjct  72   SLSDALVHYVT-SNVTPQQTFDEVSVSKRVLDK--KSPCNFLVFGLGHDSLMWASLNHGG  128

Query  804  RTVFIDESRYYAAYVEEKYPEIEVYDVQYSTKLSEMKELISGVKEQARNECRPVQNLLFS  625
            RT+FI+E + + A V +K+P +E Y V Y TK+ +  +L+   + +   ECR V +   S
Sbjct  129  RTLFIEEDQAWIAIVTKKFPNLESYHVVYDTKVKDSDKLMELGRSE---ECRSVSDPRNS  185

Query  624  ECKLGLNDLPNQLYEVDWDVILVDGPRGYWPEAPGRMSAIFTAGVLARSKKGGNPKTHVL  445
            +C L L D P   YE  WD+I+VD P GY  EAPGRMSAI+TAG+LAR+++ G  +T V 
Sbjct  186  KCDLALKDFPADFYETKWDLIMVDAPTGYHEEAPGRMSAIYTAGLLARNREDG--ETDVF  243

Query  444  VHDYNQKSDRIASEEFLCRENLVETKGMVGHFVV  343
            VHD N+  +   S  FLC+  + E  G + HF +
Sbjct  244  VHDVNRPVEDEFSATFLCKGYMREQNGRLRHFTI  277



>ref|XP_007163768.1| hypothetical protein PHAVU_001G262300g [Phaseolus vulgaris]
 gb|ESW35762.1| hypothetical protein PHAVU_001G262300g [Phaseolus vulgaris]
Length=282

 Score =   177 bits (450),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 90/226 (40%), Positives = 143/226 (63%), Gaps = 8/226 (4%)
 Frame = -3

Query  978  VRALVHYASISNNTDRMSYADIKQISDVLRQCGSHPCNFLVFGLTHETLLWRTLNHHGRT  799
            +RA++HYA+ S    + S A+IK   DV++  G  PCNFLVFGL H++L+W + N  G T
Sbjct  62   MRAILHYAT-SRVVPQQSVAEIKISLDVMKSLG-RPCNFLVFGLGHDSLMWASFNPGGTT  119

Query  798  VFIDESRYYAAYVEEKYPEIEVYDVQYSTKLSEMKELISGVKEQARNECRPVQNLLFSE-  622
            VF++E   +   + +  P ++ + V Y T+L + + L++  + +A   C P    L    
Sbjct  120  VFLEEDPKWVHSILKDAPGLQAHTVHYRTQLRDAQTLLASYRSEA--TCSPAAAYLRGNE  177

Query  621  -CKLGLNDLPNQLYEVDWDVILVDGPRGYWPEAPGRMSAIFTAGVLARSKKGGNPKTHVL  445
             CKL L +LP ++YE +WD+I++D P+GY+ EAPGRM+A+F+A V+AR++K     THV 
Sbjct  178  ACKLALENLPEEVYEREWDMIMIDAPKGYFAEAPGRMAAVFSAAVMARNRKQPG-VTHVF  236

Query  444  VHDYNQKSDRIASEEFLCRENLVETKGMVGHFVVEVM-DANNFNFC  310
            +HD ++K ++  +EEFLCR+NLV   G + HF +    D +  +FC
Sbjct  237  LHDVDRKVEKAYAEEFLCRKNLVNGAGRLWHFQIPSSNDTHASHFC  282



>ref|XP_006339353.1| PREDICTED: glucuronoxylan 4-O-methyltransferase 3-like [Solanum 
tuberosum]
Length=308

 Score =   178 bits (452),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 93/216 (43%), Positives = 139/216 (64%), Gaps = 9/216 (4%)
 Frame = -3

Query  993  LSKSIVRALVHYASISNNTDRMSYADIKQISDVLRQCGSHPCNFLVFGLTHETLLWRTLN  814
            +S S+  ALVHYA+ SN T + +  +I     VL +    PCNFLVFGL H++L+W  LN
Sbjct  86   ISPSLANALVHYAT-SNVTPQQTLKEISVSLRVLEK--KSPCNFLVFGLGHDSLMWTALN  142

Query  813  HHGRTVFIDESRYYAAYVEEKYPEIEVYDVQYSTKLSEMKELIS-GVKEQARNECRPVQN  637
            H GRTVF++E + +   ++ + P +E Y V Y T++++  EL+  G+  +   +C+ V +
Sbjct  143  HGGRTVFLEEDKSWIEQIQSQLPNLESYHVIYDTRITQADELMEIGMSNE---DCKKVTD  199

Query  636  LLFSECKLGLNDLPNQLYEVDWDVILVDGPRGYWPEAPGRMSAIFTAGVLARSKKGGNPK  457
              FS+C+L L  LP Q+ E+DWD+I+VD P G+   APGRMSAI+TAG++AR+K  G  +
Sbjct  200  PRFSKCQLALKGLPQQVLEIDWDLIMVDAPTGWHDGAPGRMSAIYTAGLIARNKLDG--E  257

Query  456  THVLVHDYNQKSDRIASEEFLCRENLVETKGMVGHF  349
            T V VHD ++  +   S+ FLC   LVE +G + HF
Sbjct  258  TDVFVHDVDRIVEDQFSKAFLCESYLVEQEGRIRHF  293



>emb|CDP00853.1| unnamed protein product [Coffea canephora]
Length=310

 Score =   178 bits (452),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 88/218 (40%), Positives = 143/218 (66%), Gaps = 10/218 (5%)
 Frame = -3

Query  993  LSKSIVRALVHYASISNNTDRMSYADIKQISDVLRQCGSHPCNFLVFGLTHETLLWRTLN  814
            +S S+  A+VHYA++ N T + ++ +I     VL +    PCNFLVFGL H++L+W  LN
Sbjct  89   ISPSLANAIVHYATL-NITPQQTFKEISVSLRVLEK--KSPCNFLVFGLGHDSLMWTALN  145

Query  813  HHGRTVFIDESRYYAAYVEEKYPEIEVYDVQYSTKLSEMKELIS-GVKEQARNECRPVQN  637
            H GRTVF++E + +   V+ + P +E Y V Y TK+++  E++  G++E    +C+ V +
Sbjct  146  HGGRTVFLEEDKSWIEQVQRQLPNLESYHVTYDTKVTQADEMMEVGMRE----DCKVVGD  201

Query  636  LLFSECKLGLNDLPNQLYEVDWDVILVDGPRGYWPEAPGRMSAIFTAGVLARSKKGGNPK  457
              FS+C L L   P+++Y+++WD+I+VD P G+  EAPGRM+AI+TAG++AR+++ G  +
Sbjct  202  PRFSKCGLALKGFPSEVYDIEWDLIMVDAPTGWHDEAPGRMTAIYTAGLMARNRESG--E  259

Query  456  THVLVHDYNQKSDRIASEEFLCRENLVETKGMVGHFVV  343
            T V VHD ++  +   S+ FLC   L E +G + HF +
Sbjct  260  TDVFVHDVDRAVEDKFSKTFLCEGYLREQEGRIRHFTI  297



>ref|XP_010930428.1| PREDICTED: glucuronoxylan 4-O-methyltransferase 3-like [Elaeis 
guineensis]
Length=284

 Score =   177 bits (450),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 89/217 (41%), Positives = 137/217 (63%), Gaps = 8/217 (4%)
 Frame = -3

Query  993  LSKSIVRALVHYASISNNTDRMSYADIKQISDVLRQCGSHPCNFLVFGLTHETLLWRTLN  814
            + +S+   ++HYA+ SN T + ++ +I   + VL +    PCNFLVFGL  ++ +W  LN
Sbjct  63   IPQSLANTIIHYAT-SNTTPQQTFKEISVTARVLEK--KAPCNFLVFGLGRDSPMWTALN  119

Query  813  HHGRTVFIDESRYYAAYVEEKYPEIEVYDVQYSTKLSEMKELISGVKEQARNECRPVQNL  634
            H GRTVF++E   +   ++EK+P +E Y V Y TK+++  +L+   +E A   C  V  +
Sbjct  120  HGGRTVFLEEDMSWMETIQEKFPTLESYHVTYDTKVTQANDLLELRREPA---CTAVGEV  176

Query  633  LFSECKLGLNDLPNQLYEVDWDVILVDGPRGYWPEAPGRMSAIFTAGVLARSKKGGNPKT  454
             FS+C+L L  LP+  +EV+WD+I+VD P G+ PEAPGRM AI+TAG+ AR++  G  +T
Sbjct  177  KFSKCQLALKRLPSVFFEVEWDLIMVDAPTGWIPEAPGRMGAIYTAGMAARARTEG--ET  234

Query  453  HVLVHDYNQKSDRIASEEFLCRENLVETKGMVGHFVV  343
             V VHD ++  +   S+ FLC   L E +G + HF V
Sbjct  235  DVFVHDVDRVVEDKFSKIFLCEGYLREQEGRLRHFTV  271



>ref|XP_003552780.2| PREDICTED: glucuronoxylan 4-O-methyltransferase 1-like [Glycine 
max]
Length=320

 Score =   178 bits (452),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 89/226 (39%), Positives = 145/226 (64%), Gaps = 8/226 (4%)
 Frame = -3

Query  978  VRALVHYASISNNTDRMSYADIKQISDVLRQCGSHPCNFLVFGLTHETLLWRTLNHHGRT  799
            +RA++HYA+ S    + S ++IK   DV++  G  P NFLVFGL H++L+W + N  G T
Sbjct  100  LRAILHYAT-SRVVPQQSVSEIKISLDVIKSLG-RPINFLVFGLGHDSLMWASFNPGGTT  157

Query  798  VFIDESRYYAAYVEEKYPEIEVYDVQYSTKLSEMKELISGVKEQARNECRPVQNLLFSE-  622
            VF++E   +   + +  P +  + V+Y T+L + K L++  + +    C P +  L    
Sbjct  158  VFLEEDPKWVHSILKDAPGLRAHTVRYRTQLRDAKGLLTSYRSEP--SCSPTKAYLRGNE  215

Query  621  -CKLGLNDLPNQLYEVDWDVILVDGPRGYWPEAPGRMSAIFTAGVLARSKKGGNPKTHVL  445
             CKL L +LP+++YE +WD+I++D P+GY+ EAPGRM+A+F+A V+AR++KG    THV 
Sbjct  216  ACKLALENLPDEVYETEWDLIMIDAPKGYFAEAPGRMAAVFSAAVMARNRKGSG-VTHVF  274

Query  444  VHDYNQKSDRIASEEFLCRENLVETKGMVGHFVVEVM-DANNFNFC  310
            +HD ++K +++ +EEFLCR+NLV+  G + HF +    D +   FC
Sbjct  275  LHDVDRKVEKVYAEEFLCRKNLVKGVGRLWHFQIPPSNDTHASRFC  320



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2339198799562