BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c80642_g1_i1 len=1349 path=[1354:0-1348]

Length=1349
                                                                      Score     E

ref|XP_009785954.1|  PREDICTED: uncharacterized protein LOC104234...    200   1e-57   
ref|XP_010675098.1|  PREDICTED: uncharacterized protein LOC104891144    194   3e-55   
gb|EYU30527.1|  hypothetical protein MIMGU_mgv1a013800mg                194   4e-55   
ref|XP_003536127.1|  PREDICTED: uncharacterized protein LOC100784530    191   2e-54   
gb|KHN18063.1|  hypothetical protein glysoja_049431                     189   3e-54   
ref|XP_011091947.1|  PREDICTED: uncharacterized protein LOC105172268    191   6e-54   
gb|KCW61586.1|  hypothetical protein EUGRSUZ_H04320                     190   6e-54   
ref|XP_009783975.1|  PREDICTED: uncharacterized protein LOC104232460    190   6e-54   
ref|XP_010027180.1|  PREDICTED: uncharacterized protein LOC104417635    190   1e-53   
ref|XP_007144835.1|  hypothetical protein PHAVU_007G188200g             189   2e-53   
ref|XP_009597354.1|  PREDICTED: uncharacterized protein LOC104093331    189   2e-53   
ref|NP_001238569.1|  uncharacterized protein LOC100305652               187   8e-53   
ref|XP_006347735.1|  PREDICTED: uncharacterized protein LOC102579207    187   1e-52   
gb|KHN14702.1|  hypothetical protein glysoja_038111                     185   1e-52   
ref|XP_002268421.2|  PREDICTED: uncharacterized protein LOC100244447    186   2e-52   Vitis vinifera
emb|CBI35174.3|  unnamed protein product                                186   2e-52   
ref|XP_006487878.1|  PREDICTED: uncharacterized protein LOC102613894    186   2e-52   
ref|XP_006424005.1|  hypothetical protein CICLE_v10030288mg             186   2e-52   
ref|XP_004230086.1|  PREDICTED: uncharacterized protein LOC101258598    185   5e-52   
ref|XP_009785955.1|  PREDICTED: uncharacterized protein LOC104234...    184   5e-52   
gb|KDP23677.1|  hypothetical protein JCGZ_23510                         182   3e-51   
ref|XP_007206285.1|  hypothetical protein PRUPE_ppa016189mg             182   5e-51   
ref|XP_004495610.1|  PREDICTED: uncharacterized protein LOC101496090    180   2e-50   
gb|KEH43007.1|  DUF1685 family protein                                  179   6e-50   
ref|XP_008462705.1|  PREDICTED: uncharacterized protein LOC103501007    178   2e-49   
ref|XP_002531276.1|  conserved hypothetical protein                     178   3e-49   Ricinus communis
ref|XP_008388682.1|  PREDICTED: uncharacterized protein LOC103451035    176   1e-48   
ref|XP_008345715.1|  PREDICTED: uncharacterized protein LOC103408659    176   1e-48   
emb|CDP06830.1|  unnamed protein product                                176   3e-48   
ref|XP_007030541.1|  1-phosphatidylinositol-4,5-bisphosphate phos...    169   6e-46   
ref|XP_002319645.2|  hypothetical protein POPTR_0013s03970g             169   7e-46   Populus trichocarpa [western balsam poplar]
ref|XP_004142530.1|  PREDICTED: uncharacterized protein LOC101212719    167   2e-45   
ref|XP_011038593.1|  PREDICTED: uncharacterized protein LOC105135429    166   5e-45   
gb|EPS70647.1|  hypothetical protein M569_04112                         165   1e-44   
ref|XP_010102281.1|  hypothetical protein L484_024563                   164   4e-44   
ref|XP_006382810.1|  hypothetical protein POPTR_0005s05680g             161   5e-43   
ref|XP_007147182.1|  hypothetical protein PHAVU_006G102600g             160   6e-43   
ref|XP_011032388.1|  PREDICTED: uncharacterized protein LOC105131216    160   1e-42   
ref|XP_010046349.1|  PREDICTED: uncharacterized protein LOC104435263    159   5e-42   
gb|KEH24562.1|  DUF1685 family protein                                  154   2e-40   
ref|XP_010553341.1|  PREDICTED: uncharacterized protein LOC104823462    152   1e-39   
gb|EYU26856.1|  hypothetical protein MIMGU_mgv1a013107mg                152   3e-39   
ref|XP_006577746.1|  PREDICTED: uncharacterized protein LOC102667203    149   4e-39   
ref|XP_008218506.1|  PREDICTED: uncharacterized protein LOC103318851    150   5e-39   
ref|XP_004304752.1|  PREDICTED: uncharacterized protein LOC101311782    157   2e-38   
ref|XP_004494966.1|  PREDICTED: tankyrase-2-like                        154   3e-37   
ref|XP_011088091.1|  PREDICTED: ankyrin repeat domain-containing ...    152   8e-37   
ref|XP_010458142.1|  PREDICTED: uncharacterized protein LOC104739473    143   2e-36   
ref|XP_010475692.1|  PREDICTED: uncharacterized protein LOC104755066    143   2e-36   
gb|KHN31468.1|  hypothetical protein glysoja_035575                     140   4e-36   
gb|KHG02277.1|  hypothetical protein F383_24076                         142   4e-36   
gb|KFK43191.1|  hypothetical protein AALP_AA1G091600                    140   1e-35   
ref|XP_009600334.1|  PREDICTED: uncharacterized protein LOC104095822    141   3e-35   
ref|XP_009134781.1|  PREDICTED: uncharacterized protein LOC103859053    139   5e-35   
ref|XP_006417647.1|  hypothetical protein EUTSA_v10009929mg             138   9e-35   
emb|CDY40670.1|  BnaC03g33860D                                          138   1e-34   
ref|XP_002882370.1|  hypothetical protein ARALYDRAFT_477736             137   2e-34   
ref|XP_010519977.1|  PREDICTED: uncharacterized protein LOC104799259    137   2e-34   
ref|NP_187121.1|  uncharacterized protein                               137   2e-34   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010485853.1|  PREDICTED: uncharacterized protein LOC104764099    137   2e-34   
ref|XP_009124189.1|  PREDICTED: uncharacterized protein LOC103849137    137   2e-34   
emb|CDX95786.1|  BnaC05g35370D                                          137   2e-34   
gb|KFK31933.1|  hypothetical protein AALP_AA6G178000                    137   3e-34   
ref|XP_010417937.1|  PREDICTED: uncharacterized protein LOC104703569    137   3e-34   
ref|XP_002872319.1|  hypothetical protein ARALYDRAFT_351825             137   3e-34   
emb|CDY50748.1|  BnaAnng10550D                                          137   3e-34   
ref|XP_006299371.1|  hypothetical protein CARUB_v10015529mg             137   3e-34   
ref|XP_006408163.1|  hypothetical protein EUTSA_v10021572mg             137   4e-34   
ref|XP_010455193.1|  PREDICTED: uncharacterized protein LOC104736...    136   6e-34   
ref|XP_006289170.1|  hypothetical protein CARUB_v10002608mg             135   1e-33   
ref|XP_006303594.1|  hypothetical protein CARUB_v10011157mg             135   1e-33   
ref|XP_006395028.1|  hypothetical protein EUTSA_v10004951mg             135   2e-33   
ref|XP_010528806.1|  PREDICTED: uncharacterized protein LOC104805823    135   2e-33   
ref|XP_009151262.1|  PREDICTED: uncharacterized protein LOC103874591    135   2e-33   
ref|XP_002889715.1|  predicted protein                                  134   2e-33   
emb|CDY32127.1|  BnaCnng06360D                                          134   4e-33   
ref|XP_010494109.1|  PREDICTED: uncharacterized protein LOC104771...    134   5e-33   
ref|XP_009111215.1|  PREDICTED: uncharacterized protein LOC103836670    133   6e-33   
emb|CDY31128.1|  BnaA08g26780D                                          133   6e-33   
ref|XP_010463956.1|  PREDICTED: uncharacterized protein LOC104744576    133   7e-33   
emb|CDY48661.1|  BnaC07g27480D                                          133   7e-33   
ref|NP_198221.1|  uncharacterized protein                               133   7e-33   Arabidopsis thaliana [mouse-ear cress]
ref|NP_172356.1|  uncharacterized protein                               133   7e-33   Arabidopsis thaliana [mouse-ear cress]
gb|KFK37882.1|  hypothetical protein AALP_AA3G041600                    132   1e-32   
gb|KDO54399.1|  hypothetical protein CISIN_1g045489mg                   131   2e-32   
ref|XP_006836544.1|  hypothetical protein AMTR_s00131p00034410          132   8e-32   
ref|XP_010455192.1|  PREDICTED: uncharacterized protein LOC104736...    129   2e-31   
ref|XP_008355880.1|  PREDICTED: uncharacterized protein LOC103419557    130   3e-31   
ref|XP_010494108.1|  PREDICTED: uncharacterized protein LOC104771...    127   9e-31   
emb|CDX95033.1|  BnaC05g06380D                                          125   3e-30   
emb|CDX93537.1|  BnaA06g05110D                                          125   3e-30   
emb|CDY41891.1|  BnaC05g47130D                                          122   2e-29   
ref|XP_009148230.1|  PREDICTED: uncharacterized protein LOC103871703    123   2e-29   
ref|NP_001189808.1|  carboxylate clamp-tetratricopeptide repeat p...    129   9e-29   
ref|XP_008804527.1|  PREDICTED: uncharacterized protein LOC103717790    120   6e-28   
ref|XP_010917332.1|  PREDICTED: uncharacterized protein LOC105041955    119   2e-27   
ref|XP_009381776.1|  PREDICTED: uncharacterized protein LOC103969862    119   4e-27   
ref|XP_003579539.1|  PREDICTED: uncharacterized protein LOC100835369    117   5e-27   
ref|XP_008799974.1|  PREDICTED: uncharacterized protein LOC103714485    117   1e-26   
ref|XP_009402029.1|  PREDICTED: uncharacterized protein LOC103985897    113   3e-25   
ref|XP_006648617.1|  PREDICTED: uncharacterized protein LOC102700688    112   3e-25   
ref|XP_002447594.1|  hypothetical protein SORBIDRAFT_06g005440          112   7e-25   Sorghum bicolor [broomcorn]
ref|XP_004975096.1|  PREDICTED: uncharacterized protein LOC101758026    112   8e-25   
dbj|BAK03871.1|  predicted protein                                      111   8e-25   
ref|XP_009410247.1|  PREDICTED: uncharacterized protein LOC103992328    110   2e-24   
ref|NP_001052367.1|  Os04g0282200                                       110   3e-24   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001143700.1|  uncharacterized protein LOC100276437               109   4e-24   Zea mays [maize]
ref|XP_009409568.1|  PREDICTED: uncharacterized protein LOC103991751    108   7e-24   
ref|XP_009407592.1|  PREDICTED: uncharacterized protein LOC103990240    108   1e-23   
tpg|DAA38425.1|  TPA: hypothetical protein ZEAMMB73_542900              110   2e-23   
ref|XP_010932317.1|  PREDICTED: uncharacterized protein LOC105053018    105   1e-22   
ref|XP_010468011.1|  PREDICTED: uncharacterized protein LOC104748012    103   2e-22   
gb|KFK35975.1|  hypothetical protein AALP_AA4G062200                    100   6e-22   
ref|XP_006652152.1|  PREDICTED: uncharacterized protein LOC102717057    103   6e-22   
ref|XP_010497904.1|  PREDICTED: uncharacterized protein LOC104775641  98.6    1e-21   
ref|XP_002960564.1|  hypothetical protein SELMODRAFT_437629             102   4e-21   
ref|XP_004954894.1|  PREDICTED: uncharacterized protein LOC101768843    100   1e-20   
ref|NP_001140320.1|  uncharacterized protein LOC100272365             97.4    2e-19   Zea mays [maize]
gb|ADE76026.1|  unknown                                               93.2    3e-19   
ref|XP_002451994.1|  hypothetical protein SORBIDRAFT_04g012950        96.7    4e-19   Sorghum bicolor [broomcorn]
ref|XP_010524140.1|  PREDICTED: uncharacterized protein LOC104802305  94.7    4e-19   
ref|XP_009118570.1|  PREDICTED: uncharacterized protein LOC103843585  93.2    7e-19   
ref|XP_007223513.1|  hypothetical protein PRUPE_ppa011892mg           94.0    8e-19   
emb|CDY10005.1|  BnaC08g44460D                                        92.8    9e-19   
emb|CDY06184.1|  BnaA09g50190D                                        92.4    1e-18   
ref|XP_008222622.1|  PREDICTED: uncharacterized protein LOC103322479  92.8    2e-18   
ref|XP_009776911.1|  PREDICTED: uncharacterized protein LOC104226581  92.8    2e-18   
ref|XP_002972243.1|  hypothetical protein SELMODRAFT_97431            90.9    3e-18   
ref|XP_009591985.1|  PREDICTED: uncharacterized protein LOC104088923  92.4    3e-18   
ref|XP_006410289.1|  hypothetical protein EUTSA_v10017248mg           92.4    4e-18   
gb|ABK23259.1|  unknown                                               92.8    4e-18   Picea sitchensis
ref|XP_009363659.1|  PREDICTED: uncharacterized protein LOC103953622  92.0    4e-18   
ref|XP_004296738.1|  PREDICTED: uncharacterized protein LOC101299372  91.3    4e-18   
ref|XP_008372073.1|  PREDICTED: uncharacterized protein LOC103435452  91.7    5e-18   
gb|EMT02726.1|  hypothetical protein F775_27699                       94.0    5e-18   
emb|CDX83487.1|  BnaA03g20190D                                        90.1    5e-18   
ref|NP_001067693.2|  Os11g0282300                                     90.1    5e-18   Oryza sativa Japonica Group [Japonica rice]
ref|XP_011043545.1|  PREDICTED: uncharacterized protein LOC105138...  91.7    6e-18   
ref|XP_002309816.1|  hypothetical protein POPTR_0007s02150g           91.7    7e-18   Populus trichocarpa [western balsam poplar]
ref|XP_006303187.1|  hypothetical protein CARUB_v10010453mg           90.9    8e-18   
ref|XP_002892311.1|  hypothetical protein ARALYDRAFT_470598           91.3    8e-18   
ref|XP_002310141.1|  hypothetical protein POPTR_0007s11020g           90.9    1e-17   Populus trichocarpa [western balsam poplar]
emb|CDY23360.1|  BnaC04g48880D                                        90.5    1e-17   
ref|XP_007026520.1|  Signal transducer and transcription activato...  90.9    1e-17   
ref|XP_011026386.1|  PREDICTED: uncharacterized protein LOC105127011  90.9    1e-17   
ref|XP_008453998.1|  PREDICTED: uncharacterized protein LOC103494552  90.5    1e-17   
ref|XP_004152108.1|  PREDICTED: uncharacterized protein LOC101213317  90.5    2e-17   
ref|XP_010508442.1|  PREDICTED: uncharacterized protein LOC104785019  90.5    2e-17   
ref|XP_009133597.1|  PREDICTED: uncharacterized protein LOC103858065  90.1    2e-17   
gb|KFK37170.1|  hypothetical protein AALP_AA4G222800                  89.7    2e-17   
ref|XP_006443074.1|  hypothetical protein CICLE_v10022453mg           90.1    2e-17   
ref|XP_002264307.2|  PREDICTED: uncharacterized protein LOC100261066  90.1    2e-17   Vitis vinifera
ref|XP_009142190.1|  PREDICTED: uncharacterized protein LOC103866068  89.7    2e-17   
emb|CDY47701.1|  BnaA10g03900D                                        89.4    2e-17   
ref|XP_002307264.1|  hypothetical protein POPTR_0005s18130g           89.7    3e-17   Populus trichocarpa [western balsam poplar]
ref|XP_010517896.1|  PREDICTED: uncharacterized protein LOC104793266  90.1    3e-17   
ref|XP_004241395.1|  PREDICTED: uncharacterized protein LOC101248208  89.7    3e-17   
gb|EAZ18088.1|  hypothetical protein OsJ_33634                        90.5    3e-17   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010525931.1|  PREDICTED: uncharacterized protein LOC104803633  90.9    3e-17   
ref|XP_009119110.1|  PREDICTED: uncharacterized protein LOC103844090  89.0    3e-17   
ref|XP_008804168.1|  PREDICTED: uncharacterized protein LOC103717519  88.2    4e-17   
ref|XP_006347276.1|  PREDICTED: uncharacterized protein LOC102592452  89.4    4e-17   
gb|AAX92905.1|  expressed protein                                     90.1    4e-17   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010506205.1|  PREDICTED: uncharacterized protein LOC104782850  89.4    4e-17   
gb|KHG09162.1|  Glutamate-1-semialdehyde 2,1-aminomutase 1            89.0    4e-17   
ref|XP_010028255.1|  PREDICTED: uncharacterized protein LOC104418572  89.4    5e-17   
ref|XP_010457696.1|  PREDICTED: uncharacterized protein LOC104739135  89.0    5e-17   
ref|XP_006417977.1|  hypothetical protein EUTSA_v10008864mg           89.0    6e-17   
ref|XP_006397499.1|  hypothetical protein EUTSA_v10001651mg           88.6    7e-17   
emb|CDY44220.1|  BnaC03g24120D                                        88.2    8e-17   
ref|XP_004970915.1|  PREDICTED: uncharacterized protein LOC101772047  87.8    9e-17   
ref|XP_009382924.1|  PREDICTED: uncharacterized protein LOC103970739  88.2    1e-16   
ref|XP_009141154.1|  PREDICTED: uncharacterized protein LOC103865127  88.2    1e-16   
ref|XP_010510186.1|  PREDICTED: uncharacterized protein LOC104786463  88.2    1e-16   
ref|XP_010485468.1|  PREDICTED: uncharacterized protein LOC104763778  88.2    1e-16   
emb|CDY10158.1|  BnaC05g04010D                                        87.4    1e-16   
emb|CDY19080.1|  BnaA04g18200D                                        87.4    1e-16   
ref|XP_002880038.1|  hypothetical protein ARALYDRAFT_483441           87.8    1e-16   
ref|XP_009350717.1|  PREDICTED: uncharacterized protein LOC103942249  87.0    1e-16   
gb|KHG07625.1|  Sphingomyelin phosphodiesterase D                     87.4    1e-16   
ref|XP_009375708.1|  PREDICTED: uncharacterized protein LOC103964496  87.0    1e-16   
ref|XP_010263540.1|  PREDICTED: uncharacterized protein LOC104601776  86.7    2e-16   
ref|XP_010469720.1|  PREDICTED: uncharacterized protein LOC104749735  87.8    2e-16   
ref|XP_008791761.1|  PREDICTED: uncharacterized protein LOC103708560  87.8    2e-16   
ref|XP_006664442.1|  PREDICTED: uncharacterized protein LOC102713151  85.5    2e-16   
ref|XP_010522195.1|  PREDICTED: uncharacterized protein LOC104800902  87.8    2e-16   
gb|KDP42817.1|  hypothetical protein JCGZ_23759                       87.8    2e-16   
ref|XP_011005866.1|  PREDICTED: uncharacterized protein LOC105112024  88.2    2e-16   
ref|XP_010414113.1|  PREDICTED: uncharacterized protein LOC104700310  87.4    2e-16   
ref|XP_009132802.1|  PREDICTED: uncharacterized protein LOC103857387  87.4    2e-16   
emb|CDX84774.1|  BnaA03g14560D                                        87.0    2e-16   
emb|CDY23932.1|  BnaC03g17590D                                        87.0    2e-16   
ref|NP_850394.1|  uncharacterized protein                             87.0    2e-16   Arabidopsis thaliana [mouse-ear cress]
emb|CDX84773.1|  BnaA03g14570D                                        87.0    2e-16   
ref|XP_011043546.1|  PREDICTED: uncharacterized protein LOC105138...  86.7    3e-16   
ref|XP_006295063.1|  hypothetical protein CARUB_v10024131mg           87.0    3e-16   
ref|XP_006339900.1|  PREDICTED: uncharacterized protein LOC102593621  86.3    3e-16   
emb|CDY17931.1|  BnaC04g02880D                                        86.7    3e-16   
ref|XP_004979162.1|  PREDICTED: uncharacterized protein LOC101784137  87.4    3e-16   
emb|CDY15396.1|  BnaC04g42270D                                        86.7    4e-16   
ref|XP_009379920.1|  PREDICTED: uncharacterized protein LOC103968427  86.7    4e-16   
ref|NP_001144165.1|  uncharacterized protein LOC100277020             85.5    5e-16   Zea mays [maize]
gb|EEE52974.1|  hypothetical protein OsJ_35638                        86.3    5e-16   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006663361.1|  PREDICTED: uncharacterized protein LOC102718501  86.3    5e-16   
ref|XP_010671814.1|  PREDICTED: uncharacterized protein LOC104888508  85.9    6e-16   
tpg|DAA56332.1|  TPA: hypothetical protein ZEAMMB73_880748            85.5    6e-16   
ref|XP_010907669.1|  PREDICTED: uncharacterized protein LOC105034285  85.9    6e-16   
ref|XP_008656978.1|  PREDICTED: uncharacterized protein LOC103636401  85.5    6e-16   
ref|XP_004140877.1|  PREDICTED: uncharacterized protein LOC101222799  85.5    6e-16   
ref|XP_006858659.1|  hypothetical protein AMTR_s00066p00064700        85.5    7e-16   
gb|KFK31204.1|  hypothetical protein AALP_AA6G081700                  85.9    7e-16   
ref|XP_006295428.1|  hypothetical protein CARUB_v10024525mg           86.3    7e-16   
ref|XP_002282456.1|  PREDICTED: uncharacterized protein LOC100250717  84.7    8e-16   Vitis vinifera
ref|XP_003578753.1|  PREDICTED: pro-neuregulin-2, membrane-bound ...  86.3    8e-16   
ref|XP_010025913.1|  PREDICTED: uncharacterized protein LOC104416185  85.1    8e-16   
ref|XP_006841745.1|  hypothetical protein AMTR_s00003p00261000        83.6    9e-16   
gb|KHG08432.1|  Membrane insertase YidC                               85.1    1e-15   
ref|XP_009383346.1|  PREDICTED: uncharacterized protein LOC103971...  85.1    1e-15   
ref|XP_006838072.1|  hypothetical protein AMTR_s00091p00173550        85.5    1e-15   
ref|XP_010912118.1|  PREDICTED: uncharacterized protein LOC105038121  85.5    1e-15   
ref|XP_010475308.1|  PREDICTED: uncharacterized protein LOC104754741  85.1    1e-15   
ref|XP_009393523.1|  PREDICTED: uncharacterized protein LOC103979186  83.6    1e-15   
gb|EPS66159.1|  hypothetical protein M569_08616                       84.3    1e-15   
emb|CAN60580.1|  hypothetical protein VITISV_034776                   86.7    1e-15   Vitis vinifera
emb|CDX79829.1|  BnaA05g03270D                                        84.7    1e-15   
ref|XP_009142927.1|  PREDICTED: uncharacterized protein LOC103866709  84.7    1e-15   
ref|NP_850169.1|  uncharacterized protein                             85.1    1e-15   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008790647.1|  PREDICTED: uncharacterized protein LOC103707781  84.7    1e-15   
gb|AAB64331.1|  unknown protein                                       85.9    1e-15   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004232033.1|  PREDICTED: uncharacterized protein LOC101244139  84.3    2e-15   
ref|XP_010912805.1|  PREDICTED: uncharacterized protein LOC105038635  85.1    2e-15   
gb|EEC71962.1|  hypothetical protein OsI_04796                        84.0    2e-15   Oryza sativa Indica Group [Indian rice]
ref|XP_007142628.1|  hypothetical protein PHAVU_007G003800g           83.6    2e-15   
ref|XP_008445710.1|  PREDICTED: uncharacterized protein LOC103488660  84.0    2e-15   
ref|NP_001066444.1|  Os12g0230600                                     84.7    2e-15   Oryza sativa Japonica Group [Japonica rice]
tpg|DAA38424.1|  TPA: hypothetical protein ZEAMMB73_542900            87.0    2e-15   
ref|NP_001237862.1|  uncharacterized protein LOC100527048             84.0    2e-15   
gb|KHG29207.1|  Membrane insertase YidC                               84.0    2e-15   
ref|XP_010269831.1|  PREDICTED: uncharacterized protein LOC104606375  83.2    3e-15   
ref|XP_008241457.1|  PREDICTED: uncharacterized protein LOC103339884  83.6    3e-15   
ref|NP_172078.2|  uncharacterized protein                             84.0    3e-15   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001130176.1|  uncharacterized protein LOC100191270             84.7    3e-15   Zea mays [maize]
ref|XP_006645175.1|  PREDICTED: uncharacterized protein LOC102710928  83.6    3e-15   
dbj|BAK03534.1|  predicted protein                                    84.3    3e-15   
dbj|BAJ89682.1|  predicted protein                                    84.3    3e-15   
ref|XP_007202615.1|  hypothetical protein PRUPE_ppa011847mg           84.0    3e-15   
ref|XP_004497395.1|  PREDICTED: uncharacterized protein LOC101495...  82.4    4e-15   
ref|XP_011037064.1|  PREDICTED: uncharacterized protein LOC105134374  84.0    5e-15   
ref|XP_009621955.1|  PREDICTED: uncharacterized protein LOC104113484  82.4    5e-15   
ref|XP_002879335.1|  hypothetical protein ARALYDRAFT_482083           83.6    5e-15   
ref|XP_009402693.1|  PREDICTED: uncharacterized protein LOC103986406  82.4    5e-15   
ref|XP_009588985.1|  PREDICTED: uncharacterized protein LOC104086446  82.4    5e-15   
ref|XP_009367070.1|  PREDICTED: uncharacterized protein LOC103956762  82.4    6e-15   
ref|XP_010093645.1|  hypothetical protein L484_011069                 82.8    6e-15   
ref|XP_003592837.1|  hypothetical protein MTR_1g116590                81.3    7e-15   
ref|XP_007156805.1|  hypothetical protein PHAVU_002G019000g           82.8    7e-15   
ref|XP_010943071.1|  PREDICTED: uncharacterized protein LOC105060904  82.0    8e-15   
ref|XP_002449418.1|  hypothetical protein SORBIDRAFT_05g010050        83.2    8e-15   Sorghum bicolor [broomcorn]
ref|XP_004141915.1|  PREDICTED: uncharacterized protein LOC101216565  82.0    9e-15   
ref|XP_010930191.1|  PREDICTED: uncharacterized protein LOC105051437  82.8    9e-15   
ref|XP_007047252.1|  Uncharacterized protein TCM_000612               82.4    9e-15   
gb|EMS55256.1|  hypothetical protein TRIUR3_09123                     82.0    1e-14   
ref|XP_002456788.1|  hypothetical protein SORBIDRAFT_03g042740        81.6    1e-14   Sorghum bicolor [broomcorn]
gb|KDP31931.1|  hypothetical protein JCGZ_12392                       82.0    1e-14   
gb|AFK42919.1|  unknown                                               80.9    1e-14   
ref|XP_009387076.1|  PREDICTED: uncharacterized protein LOC103974056  81.6    1e-14   
ref|XP_011069489.1|  PREDICTED: uncharacterized protein LOC105155313  80.5    1e-14   
ref|XP_006372903.1|  hypothetical protein POPTR_0017s06130g           82.4    1e-14   
ref|XP_004511932.1|  PREDICTED: uncharacterized protein LOC101493701  81.6    1e-14   
ref|XP_010070344.1|  PREDICTED: WASH complex subunit CCDC53 homol...  82.0    2e-14   
ref|XP_010070345.1|  PREDICTED: formin-like protein 5 isoform X2      82.0    2e-14   
ref|XP_010530774.1|  PREDICTED: uncharacterized protein LOC104807268  81.3    2e-14   
ref|XP_002862293.1|  hypothetical protein ARALYDRAFT_497529           82.0    2e-14   
ref|XP_010557060.1|  PREDICTED: uncharacterized protein LOC104826190  81.6    2e-14   
ref|XP_010028469.1|  PREDICTED: uncharacterized protein LOC104418733  80.9    2e-14   
ref|XP_011088254.1|  PREDICTED: uncharacterized protein LOC105169539  80.5    3e-14   
ref|XP_003517296.1|  PREDICTED: uncharacterized protein LOC100792...  80.9    3e-14   
gb|ABR16384.1|  unknown                                               83.6    3e-14   Picea sitchensis
ref|XP_010666615.1|  PREDICTED: proline-rich protein 11-like          80.9    3e-14   
gb|EYU37670.1|  hypothetical protein MIMGU_mgv1a026730mg              79.7    4e-14   
ref|XP_009404270.1|  PREDICTED: uncharacterized protein LOC103987640  79.7    5e-14   
gb|EMT25392.1|  hypothetical protein F775_31418                       79.3    5e-14   
ref|XP_009761853.1|  PREDICTED: uncharacterized protein LOC104213971  79.7    5e-14   
emb|CAN61779.1|  hypothetical protein VITISV_028660                   82.0    6e-14   
ref|XP_003564844.1|  PREDICTED: uncharacterized protein LOC100842634  79.7    6e-14   
gb|EMS58971.1|  hypothetical protein TRIUR3_29245                     82.0    6e-14   
ref|XP_009797838.1|  PREDICTED: uncharacterized protein LOC104244175  79.7    6e-14   
ref|XP_008340086.1|  PREDICTED: uncharacterized protein LOC103403047  79.3    7e-14   
gb|AFW84296.1|  hypothetical protein ZEAMMB73_951764                  79.7    9e-14   
ref|XP_009138256.1|  PREDICTED: uncharacterized protein LOC103862313  79.3    9e-14   
ref|XP_010916607.1|  PREDICTED: uncharacterized protein LOC105041361  79.0    1e-13   
ref|XP_002523579.1|  conserved hypothetical protein                   80.9    1e-13   
emb|CDM85321.1|  unnamed protein product                              78.6    1e-13   
ref|XP_006466605.1|  PREDICTED: uncharacterized protein LOC102622403  78.6    1e-13   
ref|XP_006425896.1|  hypothetical protein CICLE_v10026655mg           78.6    1e-13   
gb|KDO79221.1|  hypothetical protein CISIN_1g031189mg                 78.6    1e-13   
ref|XP_004149708.1|  PREDICTED: uncharacterized protein LOC101213...  78.6    2e-13   
emb|CDP02493.1|  unnamed protein product                              78.6    2e-13   
gb|EAZ30059.1|  hypothetical protein OsJ_14119                        79.7    2e-13   
ref|XP_004149707.1|  PREDICTED: uncharacterized protein LOC101213...  78.6    2e-13   
ref|XP_003611749.1|  hypothetical protein MTR_5g017450                78.6    2e-13   
ref|NP_001144607.1|  uncharacterized protein LOC100277623             79.0    2e-13   
ref|XP_009387056.1|  PREDICTED: uncharacterized protein LOC103974046  78.2    3e-13   
gb|AFW56686.1|  hypothetical protein ZEAMMB73_673152                  78.2    3e-13   
ref|XP_002984157.1|  hypothetical protein SELMODRAFT_119859           77.4    4e-13   
emb|CDY49267.1|  BnaA03g50800D                                        77.4    4e-13   
ref|XP_008457792.1|  PREDICTED: uncharacterized protein LOC103497396  77.4    5e-13   
ref|XP_009406417.1|  PREDICTED: uncharacterized protein LOC103989331  77.4    6e-13   
ref|XP_003570567.1|  PREDICTED: uncharacterized protein LOC100833491  77.0    6e-13   
ref|XP_010467308.1|  PREDICTED: uncharacterized protein LOC104747377  76.6    7e-13   
dbj|BAK00756.1|  predicted protein                                    76.3    8e-13   
ref|XP_008805286.1|  PREDICTED: uncharacterized protein LOC103718311  76.3    9e-13   
emb|CDM85320.1|  unnamed protein product                              76.3    9e-13   
ref|XP_002313118.1|  hypothetical protein POPTR_0009s10410g           75.9    1e-12   
ref|XP_009412883.1|  PREDICTED: uncharacterized protein LOC103994279  75.5    1e-12   
ref|XP_010517348.1|  PREDICTED: uncharacterized protein LOC104792814  75.5    1e-12   
ref|XP_002442036.1|  hypothetical protein SORBIDRAFT_08g007690        76.6    1e-12   
ref|XP_010548018.1|  PREDICTED: uncharacterized protein LOC104819576  75.5    2e-12   
ref|XP_006409543.1|  hypothetical protein EUTSA_v10022992mg           75.1    2e-12   
ref|XP_007042437.1|  Uncharacterized protein TCM_007071               75.1    2e-12   
gb|KFK30027.1|  hypothetical protein AALP_AA7G208200                  75.1    2e-12   
gb|ACF83902.1|  unknown                                               75.5    2e-12   
emb|CDM85319.1|  unnamed protein product                              74.7    3e-12   
ref|NP_567947.1|  uncharacterized protein                             74.7    3e-12   
ref|XP_002867140.1|  hypothetical protein ARALYDRAFT_913003           74.7    3e-12   
gb|AAM67048.1|  unknown                                               74.3    3e-12   
gb|AAO24541.1|  At4g33985                                             74.3    4e-12   
ref|XP_010432484.1|  PREDICTED: uncharacterized protein LOC104716752  74.3    4e-12   
ref|XP_010437686.1|  PREDICTED: uncharacterized protein LOC104721411  74.3    4e-12   
ref|XP_006412287.1|  hypothetical protein EUTSA_v10026462mg           74.3    4e-12   
gb|KHG04107.1|  Peter Pan-like protein                                74.7    4e-12   
ref|XP_006284635.1|  hypothetical protein CARUB_v10005883mg           74.3    5e-12   
ref|XP_008797269.1|  PREDICTED: uncharacterized protein LOC103712509  73.9    5e-12   
ref|XP_002968414.1|  hypothetical protein SELMODRAFT_409212           74.7    6e-12   
gb|AFW73611.1|  hypothetical protein ZEAMMB73_713777                  74.3    6e-12   
ref|XP_002970575.1|  hypothetical protein SELMODRAFT_411271           74.3    8e-12   
emb|CDY51861.1|  BnaC03g77130D                                        73.6    8e-12   
emb|CDY51950.1|  BnaA08g11680D                                        73.6    9e-12   
ref|XP_009108762.1|  PREDICTED: uncharacterized protein LOC103834446  73.2    9e-12   
gb|KHG10628.1|  Protein spire                                         73.6    9e-12   
ref|XP_009399708.1|  PREDICTED: uncharacterized protein LOC103984032  72.8    1e-11   
ref|XP_011000538.1|  PREDICTED: uncharacterized protein LOC105108081  72.8    1e-11   
ref|XP_010447166.1|  PREDICTED: uncharacterized protein LOC104729839  73.2    1e-11   
ref|NP_001143667.1|  uncharacterized protein LOC100276390             73.2    1e-11   
ref|NP_001144235.1|  uncharacterized protein LOC100277102             72.8    1e-11   
emb|CDY17769.1|  BnaC08g21770D                                        72.8    2e-11   
ref|XP_002452882.1|  hypothetical protein SORBIDRAFT_04g034180        72.8    2e-11   
ref|XP_004960749.1|  PREDICTED: uncharacterized protein LOC101761324  73.2    2e-11   
ref|XP_008802388.1|  PREDICTED: uncharacterized protein LOC103716243  72.8    3e-11   
ref|XP_009385204.1|  PREDICTED: uncharacterized protein LOC103972576  72.4    3e-11   
ref|XP_009115706.1|  PREDICTED: uncharacterized protein LOC103840945  72.0    3e-11   
ref|XP_006495435.1|  PREDICTED: uncharacterized protein LOC102607232  70.9    5e-11   
ref|XP_004954027.1|  PREDICTED: uncharacterized protein LOC101778045  71.2    6e-11   
ref|XP_004288036.1|  PREDICTED: uncharacterized protein LOC101294593  71.2    6e-11   
ref|XP_006487110.1|  PREDICTED: uncharacterized protein LOC102617610  70.9    6e-11   
gb|AFW64348.1|  hypothetical protein ZEAMMB73_397574                  71.2    6e-11   
ref|XP_010097479.1|  hypothetical protein L484_024684                 70.9    8e-11   
ref|XP_010097481.1|  hypothetical protein L484_024687                 70.5    8e-11   
ref|XP_006423016.1|  hypothetical protein CICLE_v10029483mg           70.1    1e-10   
dbj|BAD19985.1|  hypothetical protein                                 69.3    1e-10   
dbj|BAJ99394.1|  predicted protein                                    70.1    1e-10   
gb|KHN43021.1|  hypothetical protein glysoja_007551                   68.9    1e-10   
ref|XP_002518760.1|  conserved hypothetical protein                   69.7    2e-10   
ref|XP_002529747.1|  conserved hypothetical protein                   70.5    2e-10   
ref|XP_006404038.1|  hypothetical protein EUTSA_v10011124mg           70.1    2e-10   
ref|XP_009123240.1|  PREDICTED: uncharacterized protein LOC103847997  68.9    3e-10   
dbj|BAD44483.1|  hypothetical protein                                 68.9    4e-10   
emb|CDY62316.1|  BnaCnng39940D                                        68.2    5e-10   
ref|NP_001190046.1|  uncharacterized protein                          68.6    5e-10   
ref|XP_010412692.1|  PREDICTED: uncharacterized protein LOC104699037  68.6    6e-10   
ref|XP_011092566.1|  PREDICTED: uncharacterized protein LOC105172717  67.4    8e-10   
gb|EYU42677.1|  hypothetical protein MIMGU_mgv1a015511mg              67.4    1e-09   
emb|CDY37231.1|  BnaA09g08520D                                        67.0    1e-09   
ref|XP_008236587.1|  PREDICTED: uncharacterized protein LOC103335358  66.2    2e-09   
ref|XP_006299625.1|  hypothetical protein CARUB_v10015804mg           66.6    2e-09   
ref|XP_010423920.1|  PREDICTED: uncharacterized protein LOC104708961  66.6    2e-09   
ref|XP_010488970.1|  PREDICTED: uncharacterized protein LOC104766...  66.2    2e-09   
gb|EMS47023.1|  hypothetical protein TRIUR3_21136                     66.6    3e-09   
ref|NP_179161.1|  uncharacterized protein                             65.9    3e-09   
emb|CDO97181.1|  unnamed protein product                              65.9    4e-09   
ref|XP_006649072.1|  PREDICTED: uncharacterized protein LOC102713247  65.5    4e-09   
ref|XP_003555998.1|  PREDICTED: uncharacterized protein LOC100779573  65.5    4e-09   
ref|XP_006292682.1|  hypothetical protein CARUB_v10018927mg           65.5    4e-09   
gb|EPS71661.1|  hypothetical protein M569_03100                       65.1    4e-09   
gb|AFW64349.1|  hypothetical protein ZEAMMB73_397574                  66.6    5e-09   
ref|XP_002883904.1|  hypothetical protein ARALYDRAFT_480419           65.1    5e-09   
ref|XP_010488972.1|  PREDICTED: uncharacterized protein LOC104766729  65.1    6e-09   
ref|XP_007157743.1|  hypothetical protein PHAVU_002G094700g           65.1    6e-09   
ref|XP_002883905.1|  hypothetical protein ARALYDRAFT_343146           64.7    8e-09   
ref|XP_010467306.1|  PREDICTED: uncharacterized protein LOC104747...  64.7    9e-09   
ref|XP_003529413.1|  PREDICTED: uncharacterized protein LOC100786207  64.7    1e-08   
ref|XP_004505227.1|  PREDICTED: uncharacterized protein LOC101503545  64.3    1e-08   
ref|XP_010550774.1|  PREDICTED: uncharacterized protein LOC104821552  64.7    1e-08   
gb|EPS74038.1|  hypothetical protein M569_00718                       63.5    1e-08   
ref|XP_009383345.1|  PREDICTED: uncharacterized protein LOC103971...  64.3    1e-08   
gb|AAD24835.1|  unknown protein                                       63.9    2e-08   
gb|AHA61359.1|  hypothetical protein Lr300_ref                        62.0    3e-08   
ref|NP_849958.1|  uncharacterized protein                             62.8    3e-08   
gb|ACH60614.1|  hypothetical protein                                  62.4    3e-08   
ref|NP_001048224.1|  Os02g0766600                                     63.2    3e-08   
ref|XP_006410290.1|  hypothetical protein EUTSA_v10017248mg           63.2    3e-08   
ref|XP_010488971.1|  PREDICTED: uncharacterized protein LOC104766...  62.0    4e-08   
ref|XP_008373136.1|  PREDICTED: uncharacterized protein LOC103436...  61.6    6e-08   
gb|KHG09163.1|  tyrS                                                  62.8    6e-08   
ref|XP_008466904.1|  PREDICTED: uncharacterized protein LOC103504252  61.2    9e-08   
ref|XP_007201502.1|  hypothetical protein PRUPE_ppa014870mg           60.8    1e-07   
ref|XP_010467307.1|  PREDICTED: uncharacterized protein LOC104747...  60.8    1e-07   
ref|XP_002876025.1|  hypothetical protein ARALYDRAFT_485386           60.8    2e-07   
gb|ACH60635.1|  hypothetical protein                                  60.1    2e-07   
gb|ACH60612.1|  hypothetical protein                                  60.1    2e-07   
ref|XP_002885518.1|  pentatricopeptide repeat-containing protein      63.9    2e-07   
tpg|DAA56333.1|  TPA: hypothetical protein ZEAMMB73_880748            60.1    2e-07   
gb|KDO43501.1|  hypothetical protein CISIN_1g029447mg                 60.8    2e-07   
ref|XP_006346523.1|  PREDICTED: uncharacterized protein LOC102603373  59.7    3e-07   
ref|XP_006299643.1|  hypothetical protein CARUB_v10015830mg           59.3    4e-07   
gb|AEW07549.1|  hypothetical protein 0_4871_01                        59.7    4e-07   
gb|AFG51246.1|  hypothetical protein 0_4871_01                        59.7    4e-07   
ref|NP_190604.1|  uncharacterized protein                             59.7    4e-07   
ref|XP_009346254.1|  PREDICTED: uncharacterized protein LOC103937991  58.9    6e-07   
ref|XP_004966883.1|  PREDICTED: uncharacterized protein LOC101766374  57.8    6e-07   
ref|NP_179163.2|  uncharacterized protein                             58.5    8e-07   
gb|AAD17405.1|  hypothetical protein                                  58.5    1e-06   
dbj|BAB86085.1|  hypothetical protein                                 57.8    1e-06   
ref|XP_009790064.1|  PREDICTED: uncharacterized protein LOC104237587  57.8    2e-06   
ref|XP_008373137.1|  PREDICTED: uncharacterized protein LOC103436...  57.0    2e-06   
ref|XP_004959276.1|  PREDICTED: uncharacterized protein LOC101769433  55.8    3e-06   
ref|NP_001045096.2|  Os01g0898800                                     56.6    4e-06   
gb|EMT10317.1|  hypothetical protein F775_26750                       56.6    5e-06   
ref|XP_004963636.1|  PREDICTED: uncharacterized protein LOC101786035  57.4    5e-06   
ref|XP_004294800.1|  PREDICTED: uncharacterized protein LOC101292492  55.8    5e-06   
ref|XP_004954682.1|  PREDICTED: uncharacterized protein LOC101778048  54.7    7e-06   
gb|EMS47024.1|  hypothetical protein TRIUR3_21137                     55.8    7e-06   
ref|XP_009612789.1|  PREDICTED: uncharacterized protein LOC104106032  55.1    1e-05   
ref|XP_004231399.1|  PREDICTED: uncharacterized protein LOC101259990  56.6    1e-05   
ref|XP_003607962.1|  hypothetical protein MTR_4g085970                54.7    2e-05   
emb|CAA19881.1|  putative protein                                     57.4    2e-05   
ref|NP_188908.2|  protein YELLOW SEEDLINGS 1                          57.4    2e-05   
ref|XP_008778069.1|  PREDICTED: uncharacterized protein LOC103697907  53.1    3e-05   
gb|KDP45014.1|  hypothetical protein JCGZ_01514                       54.3    4e-05   
gb|AFW56685.1|  hypothetical protein ZEAMMB73_673152                  53.5    5e-05   
ref|XP_008661772.1|  PREDICTED: uncharacterized protein LOC100277...  53.5    5e-05   
ref|XP_002992660.1|  hypothetical protein SELMODRAFT_448855           55.8    5e-05   
ref|XP_002979956.1|  hypothetical protein SELMODRAFT_444388           55.5    8e-05   
gb|EEE57860.1|  hypothetical protein OsJ_08503                        51.2    3e-04   



>ref|XP_009785954.1| PREDICTED: uncharacterized protein LOC104234143 isoform X1 [Nicotiana 
sylvestris]
Length=200

 Score =   200 bits (508),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 118/174 (68%), Positives = 137/174 (79%), Gaps = 8/174 (5%)
 Frame = -1

Query  1043  IQRLEHAPPFWRNRKKLSKQLSMCETPRDVAWerrrrqilnqerRKS---DAECLTDDDL  873
             +Q LE APPFWRNRK+LSKQLSMCETPRD+AWE+RRRQ L QERRK    D + LTD+DL
Sbjct  27    LQLLERAPPFWRNRKRLSKQLSMCETPRDIAWEKRRRQFLLQERRKQGIHDPDDLTDEDL  86

Query  872   NELKGCIELGFGFKEEEGQRLCNTLPALDLYFAVNRQFSFSPVSTPGSKGTTLpspsass  693
             NELKGCIELGFGF EEEGQRLC+TLPALDLYFAVNRQ+S SP+S+PGSKG+      +SS
Sbjct  87    NELKGCIELGFGFNEEEGQRLCSTLPALDLYFAVNRQYSTSPISSPGSKGSLPSPAGSSS  146

Query  692   tggrssslss-----pgsdsdSWRICSPGENPEHVKIKLRHWAQAVACSVMQSY  546
             +       SS         +D+WRI SPG++P+ VK KLRHWAQAVACSVMQS+
Sbjct  147   SSTSLGGRSSSFGSPRSDSADAWRIFSPGDDPQQVKTKLRHWAQAVACSVMQSH  200



>ref|XP_010675098.1| PREDICTED: uncharacterized protein LOC104891144 [Beta vulgaris 
subsp. vulgaris]
Length=217

 Score =   194 bits (493),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 115/169 (68%), Positives = 135/169 (80%), Gaps = 10/169 (6%)
 Frame = -1

Query  1043  IQRLEHAPPFWRNRKKLSKQLSMCETPRDVAWerrrrqilnqerRKS---DAECLTDDDL  873
             +QRL HAPPFW+++K+LSKQLSMCET RDVAWE+RRRQIL QER+K+   DAE LTD+DL
Sbjct  56    LQRLVHAPPFWQSKKRLSKQLSMCETHRDVAWEKRRRQILKQERKKNMVLDAEDLTDEDL  115

Query  872   NELKGCIELGFGFKEEEGQRLCNTLPALDLYFAVNRQFSFSPVSTPGSKGTTLpspsass  693
             +ELKG IELGFGF EE GQ+LCNTLPALDLYFAVNRQ S SPVSTP S+G+        S
Sbjct  116   HELKGSIELGFGFNEEAGQKLCNTLPALDLYFAVNRQLSPSPVSTPLSQGSI-------S  168

Query  692   tggrssslsspgsdsdSWRICSPGENPEHVKIKLRHWAQAVACSVMQSY  546
             + G  S+        DSW+IC PG++P+ VKIKLRHWAQAVACSVMQS+
Sbjct  169   SMGPRSASFGSPKSEDSWKICGPGDSPQQVKIKLRHWAQAVACSVMQSF  217



>gb|EYU30527.1| hypothetical protein MIMGU_mgv1a013800mg [Erythranthe guttata]
Length=210

 Score =   194 bits (492),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 117/174 (67%), Positives = 136/174 (78%), Gaps = 10/174 (6%)
 Frame = -1

Query  1043  IQRLEHAPPFWRNR--KKLSKQLSMCETPRDVAWerrrrqilnqerRKS----DAECLTD  882
             +QRLEHAPPFWRN   +KLSKQLSMCE PRD+AWERRR Q L QERRK+    +A+ LTD
Sbjct  35    LQRLEHAPPFWRNPNPRKLSKQLSMCEVPRDMAWERRRLQFLRQERRKNGINHEADDLTD  94

Query  881   DDLNELKGCIELGFGFKEEEGQRLCNTLPALDLYFAVNRQFSFSPVSTPGSKGTTL----  714
             +DLNELKGCIELGFGF  E+GQRLC T+PALDLYFAVNRQF+ SP+S+P S G+T     
Sbjct  95    EDLNELKGCIELGFGFNAEDGQRLCTTIPALDLYFAVNRQFATSPISSPASSGSTAPSLG  154

Query  713   pspsasstggrssslsspgsdsdSWRICSPGENPEHVKIKLRHWAQAVACSVMQ  552
              S + SS        SS  SDSD+W+ICSPGE+P+HVK KLRHWAQAVAC+V Q
Sbjct  155   GSTATSSMSTGIGGRSSSCSDSDAWKICSPGEDPQHVKTKLRHWAQAVACTVRQ  208



>ref|XP_003536127.1| PREDICTED: uncharacterized protein LOC100784530 [Glycine max]
Length=195

 Score =   191 bits (486),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 111/165 (67%), Positives = 131/165 (79%), Gaps = 9/165 (5%)
 Frame = -1

Query  1043  IQRLEHAPPFWRNRKKLSKQLSMCETPRDVAWerrrrqilnqerRKSDAECLTDDDLNEL  864
             +Q +  APP W+N+K+LSKQLSMCE PRD+AWER+R Q   +     D + LTD+DL+EL
Sbjct  39    LQHMLLAPPLWKNKKRLSKQLSMCEMPRDIAWERKRMQEQRRSSTVCDND-LTDEDLHEL  97

Query  863   KGCIELGFGFKEEEGQRLCNTLPALDLYFAVNRQFSFSPVSTPGSKGTTLpspsasstgg  684
             KGCIELGFGF EE+GQRLCNTLPALDLYFAVNR+ S SPVSTP S+ ++L        G 
Sbjct  98    KGCIELGFGFNEEDGQRLCNTLPALDLYFAVNRRLSPSPVSTPQSRASSL--------GC  149

Query  683   rssslsspgsdsdSWRICSPGENPEHVKIKLRHWAQAVACSVMQS  549
             RSSS  SP SD+DSW+ICSPG++PEHVK KLRHWAQAVACSVMQS
Sbjct  150   RSSSFGSPRSDADSWKICSPGDDPEHVKTKLRHWAQAVACSVMQS  194



>gb|KHN18063.1| hypothetical protein glysoja_049431 [Glycine soja]
Length=154

 Score =   189 bits (481),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 110/159 (69%), Positives = 128/159 (81%), Gaps = 9/159 (6%)
 Frame = -1

Query  1025  APPFWRNRKKLSKQLSMCETPRDVAWerrrrqilnqerRKSDAECLTDDDLNELKGCIEL  846
             APP W+N+K+LSKQLSMCE PRD+AWER+R Q   +     D + LTD+DL+ELKGCIEL
Sbjct  4     APPLWKNKKRLSKQLSMCEMPRDIAWERKRMQEQRRSSTVCDND-LTDEDLHELKGCIEL  62

Query  845   GFGFKEEEGQRLCNTLPALDLYFAVNRQFSFSPVSTPGSKGTTLpspsasstggrsssls  666
             GFGF EE+GQRLCNTLPALDLYFAVNR+ S SPVSTP S+ ++L        G RSSS  
Sbjct  63    GFGFNEEDGQRLCNTLPALDLYFAVNRRLSPSPVSTPQSRASSL--------GCRSSSFG  114

Query  665   spgsdsdSWRICSPGENPEHVKIKLRHWAQAVACSVMQS  549
             SP SD+DSW+ICSPG++PEHVK KLRHWAQAVACSVMQS
Sbjct  115   SPRSDADSWKICSPGDDPEHVKTKLRHWAQAVACSVMQS  153



>ref|XP_011091947.1| PREDICTED: uncharacterized protein LOC105172268 [Sesamum indicum]
Length=216

 Score =   191 bits (484),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 116/177 (66%), Positives = 133/177 (75%), Gaps = 12/177 (7%)
 Frame = -1

Query  1043  IQRLEHAPPFWRN--RKKLSKQLSMCETPRDVAWerrrrqilnqerRKS----DAECLTD  882
             +QRLE APPFWRN   K+LSKQLSMCE PRD+AWERRRRQ L QERRK+    +A+ LTD
Sbjct  39    LQRLEQAPPFWRNPNTKRLSKQLSMCEIPRDIAWERRRRQFLRQERRKNGINQEADVLTD  98

Query  881   DDLNELKGCIELGFGFKEEEGQRLCNTLPALDLYFAVNRQFSFSPVSTPGSKGTT-----  717
             +DLNELKGCIELGFGF EE+GQRLC T+PALDLYFAVNRQFS SP+S+P S G+      
Sbjct  99    EDLNELKGCIELGFGFNEEDGQRLCTTIPALDLYFAVNRQFSTSPLSSPASNGSAPSLGG  158

Query  716   -LpspsasstggrssslsspgsdsdSWRICSPGENPEHVKIKLRHWAQAVACSVMQS  549
                S S+ S  G  SS          W+ICSPG++P+HVK KLRHWAQAVACSV QS
Sbjct  159   STTSGSSVSGLGGRSSSFGGPISDSDWKICSPGDDPQHVKTKLRHWAQAVACSVRQS  215



>gb|KCW61586.1| hypothetical protein EUGRSUZ_H04320 [Eucalyptus grandis]
Length=197

 Score =   190 bits (483),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 115/165 (70%), Positives = 136/165 (82%), Gaps = 8/165 (5%)
 Frame = -1

Query  1043  IQRLEHAPPFWRNRKKLSKQLSMCETPRDVAWerrrrqilnqerRKSDAECLTDDDLNEL  864
             +QR+   PP W+NRK+L+KQLSMCETPRD+AWE+RRRQIL     KS    +TD+DLNEL
Sbjct  40    LQRMPLVPPRWKNRKRLTKQLSMCETPRDIAWEKRRRQILR----KSGLGDITDEDLNEL  95

Query  863   KGCIELGFGFKEEEGQRLCNTLPALDLYFAVNRQFSFSPVSTPGSKGTTLpspsasstgg  684
             KG IELGFGFKEE+GQ+LCNTLPALDLYFAVNRQ S SPVSTP S+G +    S +S GG
Sbjct  96    KGSIELGFGFKEEDGQKLCNTLPALDLYFAVNRQLSLSPVSTPQSQGLS----SPTSPGG  151

Query  683   rssslsspgsdsdSWRICSPGENPEHVKIKLRHWAQAVACSVMQS  549
             RSSS  SP SD D+W+IC+PG++P+HVK KLRHWAQAVACS+MQS
Sbjct  152   RSSSFDSPMSDPDAWKICNPGDDPQHVKTKLRHWAQAVACSLMQS  196



>ref|XP_009783975.1| PREDICTED: uncharacterized protein LOC104232460 [Nicotiana sylvestris]
Length=206

 Score =   190 bits (483),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 116/175 (66%), Positives = 140/175 (80%), Gaps = 10/175 (6%)
 Frame = -1

Query  1040  QRLEHAPPFWRN-RKKLSKQLSMCETPRDVAWerrrrqilnqerRKS-----DAECLTDD  879
             QRLE APPFWRN  K+LSKQLSMCE PRD+AWE+RRRQ L+QER+K+     D + +TD+
Sbjct  32    QRLEEAPPFWRNPNKRLSKQLSMCEIPRDIAWEKRRRQFLHQERKKNIIGIQDHDDVTDE  91

Query  878   DLNELKGCIELGFGFKEEEGQRLCNTLPALDLYFAVNRQFSFSPVSTPGSKGTTLpspsa  699
             DLNELKGCIELGFGF EEEGQRLC+TLPALDLYFAVNRQ+S SP+S+PGS   +L SP +
Sbjct  92    DLNELKGCIELGFGFNEEEGQRLCSTLPALDLYFAVNRQYSTSPISSPGSHKGSLSSPGS  151

Query  698   sst----ggrssslsspgsdsdSWRICSPGENPEHVKIKLRHWAQAVACSVMQSY  546
             S++       SS  S+    +D+W+ICSPG++P+ VK KLRHWAQAVACSV QSY
Sbjct  152   SNSLGLGARSSSFGSTRSDPADAWKICSPGDDPQQVKTKLRHWAQAVACSVKQSY  206



>ref|XP_010027180.1| PREDICTED: uncharacterized protein LOC104417635 [Eucalyptus grandis]
Length=215

 Score =   190 bits (482),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 115/165 (70%), Positives = 136/165 (82%), Gaps = 8/165 (5%)
 Frame = -1

Query  1043  IQRLEHAPPFWRNRKKLSKQLSMCETPRDVAWerrrrqilnqerRKSDAECLTDDDLNEL  864
             +QR+   PP W+NRK+L+KQLSMCETPRD+AWE+RRRQIL     KS    +TD+DLNEL
Sbjct  58    LQRMPLVPPRWKNRKRLTKQLSMCETPRDIAWEKRRRQILR----KSGLGDITDEDLNEL  113

Query  863   KGCIELGFGFKEEEGQRLCNTLPALDLYFAVNRQFSFSPVSTPGSKGTTLpspsasstgg  684
             KG IELGFGFKEE+GQ+LCNTLPALDLYFAVNRQ S SPVSTP S+G +    S +S GG
Sbjct  114   KGSIELGFGFKEEDGQKLCNTLPALDLYFAVNRQLSLSPVSTPQSQGLS----SPTSPGG  169

Query  683   rssslsspgsdsdSWRICSPGENPEHVKIKLRHWAQAVACSVMQS  549
             RSSS  SP SD D+W+IC+PG++P+HVK KLRHWAQAVACS+MQS
Sbjct  170   RSSSFDSPMSDPDAWKICNPGDDPQHVKTKLRHWAQAVACSLMQS  214



>ref|XP_007144835.1| hypothetical protein PHAVU_007G188200g [Phaseolus vulgaris]
 gb|ESW16829.1| hypothetical protein PHAVU_007G188200g [Phaseolus vulgaris]
Length=192

 Score =   189 bits (479),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 114/165 (69%), Positives = 129/165 (78%), Gaps = 10/165 (6%)
 Frame = -1

Query  1043  IQRLEHAPPFWRNRKKLSKQLSMCETPRDVAWerrrrqilnqerRKSDAECLTDDDLNEL  864
             +Q +  APP W N KKLSKQLSMCE PRD+AWERRR Q   +     D   LTD+DL+EL
Sbjct  37    LQHMLLAPPLWSNNKKLSKQLSMCEKPRDIAWERRRMQERRRSSTVCDD--LTDEDLHEL  94

Query  863   KGCIELGFGFKEEEGQRLCNTLPALDLYFAVNRQFSFSPVSTPGSKGTTLpspsasstgg  684
             KGCIELGFGF EE+GQRLCNTLPALDLYFAVNR+ S SPVSTP S+ ++L        GG
Sbjct  95    KGCIELGFGFNEEDGQRLCNTLPALDLYFAVNRRLSPSPVSTPQSRASSL--------GG  146

Query  683   rssslsspgsdsdSWRICSPGENPEHVKIKLRHWAQAVACSVMQS  549
             RSSS  SP SD+DSW+ICSPG++PEHVK KLRHWAQAVACSVMQS
Sbjct  147   RSSSFGSPRSDADSWKICSPGDDPEHVKTKLRHWAQAVACSVMQS  191



>ref|XP_009597354.1| PREDICTED: uncharacterized protein LOC104093331 [Nicotiana tomentosiformis]
Length=206

 Score =   189 bits (480),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 116/175 (66%), Positives = 139/175 (79%), Gaps = 10/175 (6%)
 Frame = -1

Query  1040  QRLEHAPPFWRN-RKKLSKQLSMCETPRDVAWerrrrqilnqerRKS-----DAECLTDD  879
             QRLE APPFWRN  K+LSKQLSMCE PRD+AWE+RRRQ L+QER+K+     D + +TD+
Sbjct  32    QRLEEAPPFWRNPNKRLSKQLSMCEIPRDIAWEKRRRQFLHQERKKNIIGIQDHDDVTDE  91

Query  878   DLNELKGCIELGFGFKEEEGQRLCNTLPALDLYFAVNRQFSFSPVSTPGSKGTTLpspsa  699
             DLNELKGCIELGFGF EEEGQRLC+TLPALDLYFAVNRQ+S SP+S+PGS   +L SP +
Sbjct  92    DLNELKGCIELGFGFNEEEGQRLCSTLPALDLYFAVNRQYSTSPISSPGSNKGSLSSPGS  151

Query  698   sstg----grssslsspgsdsdSWRICSPGENPEHVKIKLRHWAQAVACSVMQSY  546
             S++       SS  S     +D+W+ICSPG++P+ VK KLRHWAQAVACSV QSY
Sbjct  152   STSLGPGFRSSSFGSPRSDPADAWKICSPGDDPQQVKTKLRHWAQAVACSVKQSY  206



>ref|NP_001238569.1| uncharacterized protein LOC100305652 [Glycine max]
 gb|ACU13444.1| unknown [Glycine max]
Length=195

 Score =   187 bits (475),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 112/165 (68%), Positives = 129/165 (78%), Gaps = 10/165 (6%)
 Frame = -1

Query  1043  IQRLEHAPPFWRNRKKLSKQLSMCETPRDVAWerrrrqilnqerRKSDAECLTDDDLNEL  864
             +Q +   PP W+N+K+LSKQLSMCE PRD+AWERRR Q   +     D   LTD+DL+EL
Sbjct  40    LQHMLLVPPLWKNKKRLSKQLSMCEKPRDIAWERRRMQERRRSSTVCDD--LTDEDLHEL  97

Query  863   KGCIELGFGFKEEEGQRLCNTLPALDLYFAVNRQFSFSPVSTPGSKGTTLpspsasstgg  684
             KGCIELGFGF EE+GQRLCNTLPALDLYFAVNR+ S SPVSTP S+ ++L        G 
Sbjct  98    KGCIELGFGFNEEDGQRLCNTLPALDLYFAVNRRLSPSPVSTPQSRASSL--------GC  149

Query  683   rssslsspgsdsdSWRICSPGENPEHVKIKLRHWAQAVACSVMQS  549
             RSSS  SP SDSDSW+ICSPG++PEHVK KLRHWAQAVACSVMQS
Sbjct  150   RSSSFGSPRSDSDSWKICSPGDDPEHVKTKLRHWAQAVACSVMQS  194



>ref|XP_006347735.1| PREDICTED: uncharacterized protein LOC102579207 [Solanum tuberosum]
Length=205

 Score =   187 bits (474),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 114/176 (65%), Positives = 134/176 (76%), Gaps = 10/176 (6%)
 Frame = -1

Query  1043  IQRLEHAPPFWRN-RKKLSKQLSMCETPRDVAWerrrrqilnqerRKS------DAEC-L  888
             +QRLE APPFWRN  KKLSKQLSMCE PRD+AWE+RRRQ L+QER+K+      D +  +
Sbjct  30    LQRLEDAPPFWRNPNKKLSKQLSMCEIPRDIAWEKRRRQFLHQERKKNIIGNTQDVDAYI  89

Query  887   TDDDLNELKGCIELGFGFKEEEGQRLCNTLPALDLYFAVNRQFSFSPVSTPGSKGTTLps  708
             TD+DLNELKGCI+LGFGF EEEGQRLCNTLPALDLYFAVNRQ+  SP+S+PGS   ++ S
Sbjct  90    TDEDLNELKGCIDLGFGFNEEEGQRLCNTLPALDLYFAVNRQYLTSPISSPGSNKGSMSS  149

Query  707   --psasstggrssslsspgsdsdSWRICSPGENPEHVKIKLRHWAQAVACSVMQSY  546
                  S  G  SS  S      D+W+I SPG++P+ VK KLRHWAQAVACSV QSY
Sbjct  150   PGSLNSLGGRSSSFGSPRSDHVDAWKIYSPGDDPQQVKTKLRHWAQAVACSVKQSY  205



>gb|KHN14702.1| hypothetical protein glysoja_038111 [Glycine soja]
Length=153

 Score =   185 bits (469),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 111/159 (70%), Positives = 126/159 (79%), Gaps = 10/159 (6%)
 Frame = -1

Query  1025  APPFWRNRKKLSKQLSMCETPRDVAWerrrrqilnqerRKSDAECLTDDDLNELKGCIEL  846
              PP W+N+K+LSKQLSMCE PRD+AWERRR Q   +     D   LTD+DL+ELKGCIEL
Sbjct  4     VPPLWKNKKRLSKQLSMCEKPRDIAWERRRMQERRRSSTVCDD--LTDEDLHELKGCIEL  61

Query  845   GFGFKEEEGQRLCNTLPALDLYFAVNRQFSFSPVSTPGSKGTTLpspsasstggrsssls  666
             GFGF EE+GQRLCNTLPALDLYFAVNR+ S SPVSTP S+ ++L        G RSSS  
Sbjct  62    GFGFNEEDGQRLCNTLPALDLYFAVNRRLSPSPVSTPQSRASSL--------GCRSSSFG  113

Query  665   spgsdsdSWRICSPGENPEHVKIKLRHWAQAVACSVMQS  549
             SP SDSDSW+ICSPG++PEHVK KLRHWAQAVACSVMQS
Sbjct  114   SPRSDSDSWKICSPGDDPEHVKTKLRHWAQAVACSVMQS  152



>ref|XP_002268421.2| PREDICTED: uncharacterized protein LOC100244447 [Vitis vinifera]
 emb|CAN62670.1| hypothetical protein VITISV_005585 [Vitis vinifera]
Length=198

 Score =   186 bits (473),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 114/170 (67%), Positives = 133/170 (78%), Gaps = 7/170 (4%)
 Frame = -1

Query  1043  IQRLEHAPPFWRNRKKLSKQLSMCETPRDVAWerrrrqilnqerRK---SDAECLTDDDL  873
             +Q L  APP W+ +K+LSKQLSMCET RD+AWERRRRQIL QER+K   +D+E LTD+DL
Sbjct  32    LQGLVLAPPPWKTKKRLSKQLSMCETSRDIAWERRRRQILRQERKKDGLNDSEDLTDEDL  91

Query  872   NELKGCIELGFGFKEEEGQRLCNTLPALDLYFAVNRQFSFSPVSTPG-SKGTTLpspsas  696
             +ELKGCIELGFGF EEEGQRLC+TLPALDLYFAVNRQ SFSP+STP  S  ++L      
Sbjct  92    HELKGCIELGFGFNEEEGQRLCSTLPALDLYFAVNRQLSFSPISTPHCSSASSL---PLD  148

Query  695   stggrssslsspgsdsdSWRICSPGENPEHVKIKLRHWAQAVACSVMQSY  546
              + G  SS        DSW+ICSPG+NP+ VK KLRHWAQAVACSVMQS+
Sbjct  149   GSLGGRSSSFGSPRSEDSWKICSPGDNPQQVKTKLRHWAQAVACSVMQSH  198



>emb|CBI35174.3| unnamed protein product [Vitis vinifera]
Length=197

 Score =   186 bits (472),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 113/169 (67%), Positives = 132/169 (78%), Gaps = 5/169 (3%)
 Frame = -1

Query  1043  IQRLEHAPPFWRNRKKLSKQLSMCETPRDVAWerrrrqilnqerRK---SDAECLTDDDL  873
             +Q L  APP W+ +K+LSKQLSMCET RD+AWERRRRQIL QER+K   +D+E LTD+DL
Sbjct  31    LQGLVLAPPPWKTKKRLSKQLSMCETSRDIAWERRRRQILRQERKKDGLNDSEDLTDEDL  90

Query  872   NELKGCIELGFGFKEEEGQRLCNTLPALDLYFAVNRQFSFSPVSTPGSKGTTLpspsass  693
             +ELKGCIELGFGF EEEGQRLC+TLPALDLYFAVNRQ SFSP+STP    ++  S     
Sbjct  91    HELKGCIELGFGFNEEEGQRLCSTLPALDLYFAVNRQLSFSPISTPHC--SSASSLPLDG  148

Query  692   tggrssslsspgsdsdSWRICSPGENPEHVKIKLRHWAQAVACSVMQSY  546
             + G  SS        DSW+ICSPG+NP+ VK KLRHWAQAVACSVMQS+
Sbjct  149   SLGGRSSSFGSPRSEDSWKICSPGDNPQQVKTKLRHWAQAVACSVMQSH  197



>ref|XP_006487878.1| PREDICTED: uncharacterized protein LOC102613894 [Citrus sinensis]
Length=197

 Score =   186 bits (472),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 120/172 (70%), Positives = 141/172 (82%), Gaps = 12/172 (7%)
 Frame = -1

Query  1043  IQRLEHAP-PFWRNRKKLSKQLSMCETPRDVAWerrrrqilnqerRK-----SDAECLTD  882
             ++R+  AP    +N+K+LSKQLSMCETPRD+AWE+RRRQ+L QERRK     SD + LTD
Sbjct  32    LRRMPLAPTSLNKNKKRLSKQLSMCETPRDIAWEKRRRQMLRQERRKNGIHDSDQDLLTD  91

Query  881   DDLNELKGCIELGFGFKEEEGQRLCNTLPALDLYFAVNRQFSFSPVSTPGSKGTTLpsps  702
             +DL+ELKGCIELGFGF EEEGQ+LCNTLPALDLYFAVNRQ S SPVSTP S+ +T     
Sbjct  92    EDLHELKGCIELGFGFNEEEGQQLCNTLPALDLYFAVNRQLSTSPVSTPQSRAST-----  146

Query  701   asstggrssslsspgsdsdSWRICSPGENPEHVKIKLRHWAQAVACSVMQSY  546
              SS GGRSSS  SP SDSD+W+IC+PG+NP+ VK KLRHWAQAVACSVMQS+
Sbjct  147   -SSLGGRSSSFGSPRSDSDAWKICNPGDNPQQVKTKLRHWAQAVACSVMQSF  197



>ref|XP_006424005.1| hypothetical protein CICLE_v10030288mg [Citrus clementina]
 gb|ESR37245.1| hypothetical protein CICLE_v10030288mg [Citrus clementina]
Length=198

 Score =   186 bits (472),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 120/172 (70%), Positives = 141/172 (82%), Gaps = 12/172 (7%)
 Frame = -1

Query  1043  IQRLEHAP-PFWRNRKKLSKQLSMCETPRDVAWerrrrqilnqerRK-----SDAECLTD  882
             ++R+  AP    +N+K+LSKQLSMCETPRD+AWE+RRRQ+L QERRK     SD + LTD
Sbjct  33    LRRMPLAPTSLNKNKKRLSKQLSMCETPRDIAWEKRRRQMLRQERRKNGIHDSDQDLLTD  92

Query  881   DDLNELKGCIELGFGFKEEEGQRLCNTLPALDLYFAVNRQFSFSPVSTPGSKGTTLpsps  702
             +DL+ELKGCIELGFGF EEEGQ+LCNTLPALDLYFAVNRQ S SPVSTP S+ +T     
Sbjct  93    EDLHELKGCIELGFGFNEEEGQQLCNTLPALDLYFAVNRQLSTSPVSTPQSRAST-----  147

Query  701   asstggrssslsspgsdsdSWRICSPGENPEHVKIKLRHWAQAVACSVMQSY  546
              SS GGRSSS  SP SDSD+W+IC+PG+NP+ VK KLRHWAQAVACSVMQS+
Sbjct  148   -SSLGGRSSSFGSPRSDSDAWKICNPGDNPQQVKTKLRHWAQAVACSVMQSF  198



>ref|XP_004230086.1| PREDICTED: uncharacterized protein LOC101258598 [Solanum lycopersicum]
Length=205

 Score =   185 bits (470),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 114/176 (65%), Positives = 134/176 (76%), Gaps = 10/176 (6%)
 Frame = -1

Query  1043  IQRLEHAPPFWRN-RKKLSKQLSMCETPRDVAWerrrrqilnqerRKS------DAEC-L  888
             +QRLE APPFWRN  K+LSKQLSMCE PRD+AWE+RRRQ L+QER+K+      D +  +
Sbjct  30    LQRLEDAPPFWRNPNKRLSKQLSMCEIPRDIAWEKRRRQFLHQERKKNITGSTQDMDAYI  89

Query  887   TDDDLNELKGCIELGFGFKEEEGQRLCNTLPALDLYFAVNRQFSFSPVSTPGSKGTTLps  708
             TD+DLNELKGCI+LGFGF EEEGQRLCNTLPALDLYFAVNRQ+  SPVS+PGS   ++ S
Sbjct  90    TDEDLNELKGCIDLGFGFNEEEGQRLCNTLPALDLYFAVNRQYLTSPVSSPGSNKGSMSS  149

Query  707   --psasstggrssslsspgsdsdSWRICSPGENPEHVKIKLRHWAQAVACSVMQSY  546
                  S  G  SS  S      D+W+I SPG++P+ VK KLRHWAQAVACSV QSY
Sbjct  150   PGSLNSLGGRSSSFGSPRSDHVDAWKIYSPGDDPQQVKTKLRHWAQAVACSVKQSY  205



>ref|XP_009785955.1| PREDICTED: uncharacterized protein LOC104234143 isoform X2 [Nicotiana 
sylvestris]
Length=178

 Score =   184 bits (468),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 110/169 (65%), Positives = 127/169 (75%), Gaps = 20/169 (12%)
 Frame = -1

Query  1043  IQRLEHAPPFWRNRKKLSKQLSMCETPRDVAWerrrrqilnqerRKS---DAECLTDDDL  873
             +Q LE APPFWRNRK+LSKQLSMCETPRD+AWE+RRRQ L QERRK    D + LTD+DL
Sbjct  27    LQLLERAPPFWRNRKRLSKQLSMCETPRDIAWEKRRRQFLLQERRKQGIHDPDDLTDEDL  86

Query  872   NELKGCIELGFGFKEEEGQRLCNTLPALDLYFAVNRQFSFSPVSTPGSKGTTLpspsass  693
             NELKGCIELGFGF EEEGQRLC+TLPALDLYFAVNRQ+S SP+S+PGSKG+      +SS
Sbjct  87    NELKGCIELGFGFNEEEGQRLCSTLPALDLYFAVNRQYSTSPISSPGSKGSLPSPAGSSS  146

Query  692   tggrssslsspgsdsdSWRICSPGENPEHVKIKLRHWAQAVACSVMQSY  546
             +                      G++P+ VK KLRHWAQAVACSVMQS+
Sbjct  147   SSTS-----------------LGGDDPQQVKTKLRHWAQAVACSVMQSH  178



>gb|KDP23677.1| hypothetical protein JCGZ_23510 [Jatropha curcas]
Length=185

 Score =   182 bits (463),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 110/170 (65%), Positives = 131/170 (77%), Gaps = 12/170 (7%)
 Frame = -1

Query  1043  IQRLEHAP-PFWRNRKKLSKQLSMCETPRDVAWerrrrqilnqerRKS---DAECLTDDD  876
             ++R+  AP    +N+K+LSKQLSMCET RD+AWE+RRRQIL QERRK+   D++ LTD+D
Sbjct  24    LKRMPLAPTAMLKNKKRLSKQLSMCETRRDIAWEKRRRQILMQERRKNGIPDSDDLTDED  83

Query  875   LNELKGCIELGFGFKEEEGQRLCNTLPALDLYFAVNRQFSFSPVSTPGSKGTTLpspsas  696
             +NELKGCIELGFGF EEEGQRLCNTLPALDLYFAVNR  S SPVSTP  K T+       
Sbjct  84    MNELKGCIELGFGFNEEEGQRLCNTLPALDLYFAVNRGLSPSPVSTPQRKSTS-------  136

Query  695   stggrssslsspgsdsdSWRICSPGENPEHVKIKLRHWAQAVACSVMQSY  546
              + GR SS     +    W+ICSPG++P+HVK KLRHWAQAVACSV+QSY
Sbjct  137   -SLGRRSSSFGSPTSESDWKICSPGDDPQHVKTKLRHWAQAVACSVLQSY  185



>ref|XP_007206285.1| hypothetical protein PRUPE_ppa016189mg [Prunus persica]
 gb|EMJ07484.1| hypothetical protein PRUPE_ppa016189mg [Prunus persica]
Length=192

 Score =   182 bits (462),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 123/169 (73%), Positives = 135/169 (80%), Gaps = 10/169 (6%)
 Frame = -1

Query  1040  QRLEHAPPFWRNRKKLSKQLSMCETPRDVAWerrrrqilnqerRK-----SDAECLTDDD  876
             Q +  APP   NRK+LSKQLSMCETPRD+AWE+RRRQIL QERR+     SD   LTD+D
Sbjct  28    QHMPLAPPKMLNRKRLSKQLSMCETPRDIAWEKRRRQILRQERRRNGINDSDDMVLTDED  87

Query  875   LNELKGCIELGFGFKEEEGQRLCNTLPALDLYFAVNRQFSFSPVSTPGSKGTTLpspsas  696
             L+ELKGCIELGFGF EEEGQRLC TLPALDLYFAVNRQFS SPVSTP S        S S
Sbjct  88    LHELKGCIELGFGFNEEEGQRLCPTLPALDLYFAVNRQFSPSPVSTPNS-----ARHSTS  142

Query  695   stggrssslsspgsdsdSWRICSPGENPEHVKIKLRHWAQAVACSVMQS  549
             S GGRSSS  SP SD+D+W+ICSPG+NP+ VK KLRHWAQAVACSVMQS
Sbjct  143   SLGGRSSSFGSPRSDTDAWKICSPGDNPQQVKTKLRHWAQAVACSVMQS  191



>ref|XP_004495610.1| PREDICTED: uncharacterized protein LOC101496090 [Cicer arietinum]
Length=186

 Score =   180 bits (457),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 113/167 (68%), Positives = 131/167 (78%), Gaps = 11/167 (7%)
 Frame = -1

Query  1043  IQRLEHAPPFWRNRKKLSKQLSMCETPRDVAWerrrrqilnqerRKSDAEC--LTDDDLN  870
             +Q +  AP  W+NRK+LSKQLSMCE PRD+AWERRRRQ   +    +D  C  +TD+DL+
Sbjct  28    LQHMTLAPVAWKNRKRLSKQLSMCEKPRDIAWERRRRQERRRSIV-NDCVCDDITDEDLH  86

Query  869   ELKGCIELGFGFKEEEGQRLCNTLPALDLYFAVNRQFSFSPVSTPGSKGTTLpspsasst  690
             ELKGCIELGFGF EE+GQRLCNTLPALDLYFAVNR  S SPVSTP S+ ++L        
Sbjct  87    ELKGCIELGFGFNEEDGQRLCNTLPALDLYFAVNRGLSPSPVSTPQSRASSL--------  138

Query  689   ggrssslsspgsdsdSWRICSPGENPEHVKIKLRHWAQAVACSVMQS  549
             GGRSSS  SP SD+DSW+ICSPG++PE VK KLRHWAQAVACSVMQS
Sbjct  139   GGRSSSFGSPRSDADSWKICSPGDDPELVKTKLRHWAQAVACSVMQS  185



>gb|KEH43007.1| DUF1685 family protein [Medicago truncatula]
Length=180

 Score =   179 bits (453),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 112/166 (67%), Positives = 129/166 (78%), Gaps = 11/166 (7%)
 Frame = -1

Query  1040  QRLEHAPPFWRNRKKLSKQLSMCETPRDVAWerrrrqilnqerRKSDAEC--LTDDDLNE  867
             Q +  AP  W NR++LSKQLSMCE PRD+AWERRRRQ + +   + D  C  +TDDDL+E
Sbjct  19    QHMPLAPVAWNNRRRLSKQLSMCEKPRDMAWERRRRQEIRRSIVQ-DCVCDDITDDDLHE  77

Query  866   LKGCIELGFGFKEEEGQRLCNTLPALDLYFAVNRQFSFSPVSTPGSKGTTLpspsasstg  687
             LKGCIELGFGF EE+GQRLCNTLPALDLYFAVNR  S SPVSTP S+ ++L        G
Sbjct  78    LKGCIELGFGFNEEDGQRLCNTLPALDLYFAVNRGLSPSPVSTPQSRASSL--------G  129

Query  686   grssslsspgsdsdSWRICSPGENPEHVKIKLRHWAQAVACSVMQS  549
              RSSS  SP SD+DSW+ICSPG++PE VK KLRHWAQAVACSVMQS
Sbjct  130   ARSSSFGSPRSDADSWKICSPGDDPELVKTKLRHWAQAVACSVMQS  175



>ref|XP_008462705.1| PREDICTED: uncharacterized protein LOC103501007 [Cucumis melo]
Length=191

 Score =   178 bits (451),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 109/165 (66%), Positives = 128/165 (78%), Gaps = 6/165 (4%)
 Frame = -1

Query  1043  IQRLEHAPPFWRNRKKLSKQLSMCETPRDVAWerrrrqilnqerRKSDAECLTDDDLNEL  864
             ++ +  APP  +N+K+LSKQLSMCETPRD+AWE+RRRQ+L      +D + LTD+D NEL
Sbjct  29    LKHMPLAPPRLKNKKRLSKQLSMCETPRDLAWEKRRRQMLRPRNGSTDRDDLTDEDWNEL  88

Query  863   KGCIELGFGFKEEEGQRLCNTLPALDLYFAVNRQFSFSPVSTPGSKGTTLpspsasstgg  684
             KGCIELGF F EE G +LC TLPALDLYFAVNRQ S SPVSTP S  +T      SS GG
Sbjct  89    KGCIELGFAFNEEYGHKLCGTLPALDLYFAVNRQLSPSPVSTPQSSAST------SSLGG  142

Query  683   rssslsspgsdsdSWRICSPGENPEHVKIKLRHWAQAVACSVMQS  549
             RSSS  SP S+ D+WR+CSPGE+P+ VK KLRHWAQAVACSVMQS
Sbjct  143   RSSSFESPRSEFDTWRVCSPGEDPKQVKAKLRHWAQAVACSVMQS  187



>ref|XP_002531276.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF31089.1| conserved hypothetical protein [Ricinus communis]
Length=195

 Score =   178 bits (451),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 111/173 (64%), Positives = 129/173 (75%), Gaps = 18/173 (10%)
 Frame = -1

Query  1040  QRLEHAP-PFWRNRKKLSKQLSMCETPRDVAWerrrrqilnqerRKS-----DAECLTDD  879
             Q +  AP P W+N+K+LSKQLSMCET RD+AWERRRRQILNQERR++     D++ LTD+
Sbjct  33    QHMPLAPLPIWKNKKRLSKQLSMCETRRDIAWERRRRQILNQERRRNSINVVDSDDLTDE  92

Query  878   DLNELKGCIELGFGFKEEEGQRLCNTLPALDLYFAVNRQFSFSPVSTPGSKGTTLpspsa  699
             DL+ELKGCIELGFGF EEEGQ+LC+TLPALDLYFAVNRQ S SPVSTPGS  +       
Sbjct  93    DLHELKGCIELGFGFNEEEGQQLCSTLPALDLYFAVNRQLSPSPVSTPGSTASL------  146

Query  698   sstggrssslsspgsdsdSWRICSP--GENPEHVKIKLRHWAQAVACSVMQSY  546
                 G  SS          W+ICSP  G++P+ VK KLRHWAQAVACSVMQSY
Sbjct  147   ----GARSSSFGSPMSESDWKICSPSTGDDPQQVKTKLRHWAQAVACSVMQSY  195



>ref|XP_008388682.1| PREDICTED: uncharacterized protein LOC103451035 [Malus domestica]
 ref|XP_009364590.1| PREDICTED: uncharacterized protein LOC103954482 [Pyrus x bretschneideri]
Length=194

 Score =   176 bits (446),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 119/170 (70%), Positives = 134/170 (79%), Gaps = 8/170 (5%)
 Frame = -1

Query  1043  IQRLEHAPPFWRNRKKLSKQLSMCETPRDVAWerrrrqilnqerR-----KSDAECLTDD  879
             +Q +  APP   NRK+LSKQLSMCETPRD+AWERRRRQIL+QERR      S+   LTD+
Sbjct  27    LQHMPLAPPKMLNRKRLSKQLSMCETPRDIAWERRRRQILSQERRMHGIRDSEDMHLTDE  86

Query  878   DLNELKGCIELGFGFKEEEGQRLCNTLPALDLYFAVNRQFSFSPVSTPGSKGTTLpspsa  699
             DL+ELKGCIELGFGF EEEGQRL  TLPALDLYFAVNRQ+S SPVSTP S  +     S 
Sbjct  87    DLHELKGCIELGFGFNEEEGQRLSATLPALDLYFAVNRQYSLSPVSTPNSASSR---HST  143

Query  698   sstggrssslsspgsdsdSWRICSPGENPEHVKIKLRHWAQAVACSVMQS  549
             SS GG S S  SP SD+D+W+ICSPG+NPE VK KLRHWAQAVACSV+QS
Sbjct  144   SSMGGHSLSFGSPTSDTDAWKICSPGDNPEQVKTKLRHWAQAVACSVIQS  193



>ref|XP_008345715.1| PREDICTED: uncharacterized protein LOC103408659 [Malus domestica]
Length=184

 Score =   176 bits (445),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 118/169 (70%), Positives = 131/169 (78%), Gaps = 8/169 (5%)
 Frame = -1

Query  1040  QRLEHAPPFWRNRKKLSKQLSMCETPRDVAWerrrrqilnqerR-----KSDAECLTDDD  876
             Q +  APP   +RK+LSKQLSMCETPRD+AWERR+RQIL+QERR      SD   LTD+D
Sbjct  18    QHMPLAPPKTLSRKRLSKQLSMCETPRDIAWERRQRQILSQERRMNGIRDSDDMHLTDED  77

Query  875   LNELKGCIELGFGFKEEEGQRLCNTLPALDLYFAVNRQFSFSPVSTPGSKGTTLpspsas  696
             L+ELKGCIELGFGF EEEGQRL  TLPALDLYFAVNRQFS SP STP S        S S
Sbjct  78    LHELKGCIELGFGFNEEEGQRLSATLPALDLYFAVNRQFSPSPASTPNSASA---RHSTS  134

Query  695   stggrssslsspgsdsdSWRICSPGENPEHVKIKLRHWAQAVACSVMQS  549
             S GG  SS  SP SD+D+W+ICSPG+NPE VK KLRHWAQAVACSV+QS
Sbjct  135   SMGGHYSSFGSPRSDTDAWKICSPGDNPEQVKTKLRHWAQAVACSVIQS  183



>emb|CDP06830.1| unnamed protein product [Coffea canephora]
Length=214

 Score =   176 bits (445),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 115/186 (62%), Positives = 133/186 (72%), Gaps = 20/186 (11%)
 Frame = -1

Query  1043  IQRLEHAPPFWRN--RKKLSKQLSMCETPRDVAWerrrrqilnqerRKS----DAECLTD  882
             +Q +E APPFWRN   KKLSKQLSMCETPRD+AW+RRRRQIL QER+K+    + + LTD
Sbjct  29    LQLIERAPPFWRNPRGKKLSKQLSMCETPRDIAWDRRRRQILQQERKKNGINNENDYLTD  88

Query  881   DDLNELKGCIELGFGFKEEEGQRLCNTLPALDLYFAVNRQFSFSPVSTPGSKGTT-----  717
             +DLNELKG IELGFGF EE+GQ LCNTLPALDLYFAVNRQFS SPV +P +  +      
Sbjct  89    EDLNELKGSIELGFGFNEEQGQGLCNTLPALDLYFAVNRQFSTSPVLSPATPNSNRSSGS  148

Query  716   ---------LpspsasstggrssslsspgsdsdSWRICSPGENPEHVKIKLRHWAQAVAC  564
                      L   S S     SS  S    DSDSW+I +PG++P+ VK KLRHWAQAVAC
Sbjct  149   TTGSSSLSSLGDSSKSLGERSSSFGSPRSGDSDSWKILAPGDDPQQVKTKLRHWAQAVAC  208

Query  563   SVMQSY  546
             SVMQSY
Sbjct  209   SVMQSY  214



>ref|XP_007030541.1| 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase epsilon-1 
[Theobroma cacao]
 gb|EOY11043.1| 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase epsilon-1 
[Theobroma cacao]
Length=197

 Score =   169 bits (428),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 108/169 (64%), Positives = 128/169 (76%), Gaps = 9/169 (5%)
 Frame = -1

Query  1043  IQRLEHAPP-FWRNRKKLSKQLSMCETPRDVAWerrrrqilnqerRKSD---AECLTDDD  876
             +QR+   P    +N++ LSKQLSMCET RD+AWE+RRRQIL QER K+       LTD+D
Sbjct  33    LQRMPLVPSQLMKNKRCLSKQLSMCETSRDIAWEKRRRQILRQERGKNGIIVTNGLTDED  92

Query  875   LNELKGCIELGFGFKEEEGQRLCNTLPALDLYFAVNRQFSFSPVSTPGSKGTTLpspsas  696
             L+ELKGCIELGFGFKEEEGQ+LCNTLPALDLYFAVNRQ S SPVSTP S G++     ++
Sbjct  93    LHELKGCIELGFGFKEEEGQKLCNTLPALDLYFAVNRQLSPSPVSTPQSGGSS-----ST  147

Query  695   stggrssslsspgsdsdSWRICSPGENPEHVKIKLRHWAQAVACSVMQS  549
             S+ G  SS     +    W+ICSPG+NP+ VK KLRHWAQAVACSVMQS
Sbjct  148   SSLGGRSSSFGSPTSESDWKICSPGDNPQQVKTKLRHWAQAVACSVMQS  196



>ref|XP_002319645.2| hypothetical protein POPTR_0013s03970g [Populus trichocarpa]
 gb|EEE95568.2| hypothetical protein POPTR_0013s03970g [Populus trichocarpa]
Length=196

 Score =   169 bits (427),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 111/169 (66%), Positives = 128/169 (76%), Gaps = 8/169 (5%)
 Frame = -1

Query  1043  IQRLEHAPPFWRNRKKLSKQLSMCETPRDVAWerrrrqilnqerRKS---DAECLTDDDL  873
             ++R+  AP  W+N+K+LSKQLSMCET RD AWERRRRQIL QE RK+   D++ LTD+DL
Sbjct  33    LERMPLAPLIWKNKKRLSKQLSMCETQRDRAWERRRRQILMQEGRKNKLLDSDDLTDEDL  92

Query  872   NELKGCIELGFGFKEEEGQRLCNTLPALDLYFAVNRQFSFSPVSTPGSKGTTLpspsass  693
             NELKGCIELGFGFKEEEGQ+L NTLPALDLYFAVNRQ S SPVSTP S  +      +SS
Sbjct  93    NELKGCIELGFGFKEEEGQQLANTLPALDLYFAVNRQLSPSPVSTPHSGESP-----SSS  147

Query  692   tggrssslsspgsdsdSWRICSPGENPEHVKIKLRHWAQAVACSVMQSY  546
               G  SS          W+ICSPG++P+ VK KLRHWAQAVACSV QSY
Sbjct  148   AMGTRSSSFGSPKGDPDWKICSPGDDPKQVKTKLRHWAQAVACSVRQSY  196



>ref|XP_004142530.1| PREDICTED: uncharacterized protein LOC101212719 [Cucumis sativus]
 ref|XP_004170316.1| PREDICTED: uncharacterized LOC101212719 [Cucumis sativus]
 gb|KGN66785.1| hypothetical protein Csa_1G690230 [Cucumis sativus]
Length=192

 Score =   167 bits (424),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 107/165 (65%), Positives = 127/165 (77%), Gaps = 5/165 (3%)
 Frame = -1

Query  1043  IQRLEHAPPFWRNRKKLSKQLSMCETPRDVAWerrrrqilnqerRKSDAECLTDDDLNEL  864
             ++ +  APP  +N+K+LSKQLSMCETPRD+AWE+RRRQ+L      +D + LTD+D NEL
Sbjct  29    LKHMPLAPPQLKNKKRLSKQLSMCETPRDLAWEKRRRQMLRPRNGSTDRDDLTDEDWNEL  88

Query  863   KGCIELGFGFKEEEGQRLCNTLPALDLYFAVNRQFSFSPVSTPGSKGTTLpspsasstgg  684
             KG IELGF F EE G +LC TLPALDLYFAVNRQ S SPVSTP S  +      +SS GG
Sbjct  89    KGFIELGFAFNEEYGHKLCGTLPALDLYFAVNRQLSPSPVSTPQSSASA-----SSSLGG  143

Query  683   rssslsspgsdsdSWRICSPGENPEHVKIKLRHWAQAVACSVMQS  549
             RSSS  SP S+ D+WR+CSPGE+P+ VK KLRHWAQAVACSVMQS
Sbjct  144   RSSSFESPRSELDTWRVCSPGEDPKQVKAKLRHWAQAVACSVMQS  188



>ref|XP_011038593.1| PREDICTED: uncharacterized protein LOC105135429 [Populus euphratica]
 ref|XP_011015814.1| PREDICTED: uncharacterized protein LOC105119381 [Populus euphratica]
Length=196

 Score =   166 bits (421),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 110/169 (65%), Positives = 126/169 (75%), Gaps = 8/169 (5%)
 Frame = -1

Query  1043  IQRLEHAPPFWRNRKKLSKQLSMCETPRDVAWerrrrqilnqerRKS---DAECLTDDDL  873
             ++R+  AP  W+N+K+LSKQLSMCET RD AWERRRRQIL QE RK+   D + LTD+DL
Sbjct  33    LERMPLAPLIWKNKKRLSKQLSMCETRRDRAWERRRRQILMQEGRKNKLLDPDDLTDEDL  92

Query  872   NELKGCIELGFGFKEEEGQRLCNTLPALDLYFAVNRQFSFSPVSTPGSKGTTLpspsass  693
             NELKGCIELGFGFKEEEGQ+L NT+PALDLYFAVNRQ S SPVSTP S         +SS
Sbjct  93    NELKGCIELGFGFKEEEGQQLTNTIPALDLYFAVNRQLSPSPVSTPHS-----GESPSSS  147

Query  692   tggrssslsspgsdsdSWRICSPGENPEHVKIKLRHWAQAVACSVMQSY  546
               G  SS          W+ICSPG++P+ VK KLRHWAQAVACSV QSY
Sbjct  148   AMGTRSSSFGSPKGDPDWKICSPGDDPKQVKTKLRHWAQAVACSVRQSY  196



>gb|EPS70647.1| hypothetical protein M569_04112, partial [Genlisea aurea]
Length=185

 Score =   165 bits (417),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 111/172 (65%), Positives = 133/172 (77%), Gaps = 11/172 (6%)
 Frame = -1

Query  1043  IQRLEHAPPFWRNR---KKLSKQLSMCETPRDVAWerrrrqilnqerRKS----DAECLT  885
             +QRLE APPFWRNR   ++LSKQLSMCE PR++AWERRRRQ L QERR++    +++ LT
Sbjct  17    LQRLERAPPFWRNRNPRRRLSKQLSMCEIPRNLAWERRRRQFLRQERRRNGINKESDLLT  76

Query  884   DDDLNELKGCIELGFGFKEEEGQRLCNTLPALDLYFAVNRQFSFSPVSTPGSKGTTLpsp  705
             D+DLNELKGCIELGFGF EE GQ LC+T+PALDLYFAVNRQF+ SPVS+P S  +     
Sbjct  77    DEDLNELKGCIELGFGFDEENGQSLCSTIPALDLYFAVNRQFASSPVSSPNSNTSA----  132

Query  704   sasstggrssslsspgsdsdSWRICSPGENPEHVKIKLRHWAQAVACSVMQS  549
             SAS     SS  S    DSD+W+I  PGE+P+H+K KLRHWAQAVACS+ QS
Sbjct  133   SASLGARSSSVGSPGTGDSDAWKIFHPGEDPQHIKTKLRHWAQAVACSLRQS  184



>ref|XP_010102281.1| hypothetical protein L484_024563 [Morus notabilis]
 gb|EXB93224.1| hypothetical protein L484_024563 [Morus notabilis]
Length=209

 Score =   164 bits (416),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 111/162 (69%), Positives = 128/162 (79%), Gaps = 14/162 (9%)
 Frame = -1

Query  1004  RKKLSKQLSMCETPRDVAWerrrrqilnqerRK------SDAEC---LTDDDLNELKGCI  852
             RK+LSKQLSMCET RDVAWE+RRRQ L  + R+      S+ E    LTD+DL+ELKGCI
Sbjct  52    RKRLSKQLSMCETSRDVAWEKRRRQFLLLQERRRNGIMMSNGEGENELTDEDLSELKGCI  111

Query  851   ELGFGFKEEEGQRLCNTLPALDLYFAVNRQFSFSPVSTPGSKGTTLpspsasstggrsss  672
             ELGFGF EE+GQ+LC TLPALDLYFAVNRQ S SPVSTP S+ +T     +SS+ GRSS 
Sbjct  112   ELGFGFNEEDGQKLCGTLPALDLYFAVNRQISLSPVSTPKSRLST-----SSSSAGRSSP  166

Query  671   lsspgsdsdSWRICSPGENPEHVKIKLRHWAQAVACSVMQSY  546
               SP SDSD+W+ICSPG++PE VK KLRHWAQAVACSVMQSY
Sbjct  167   FGSPRSDSDTWKICSPGDDPEQVKTKLRHWAQAVACSVMQSY  208



>ref|XP_006382810.1| hypothetical protein POPTR_0005s05680g [Populus trichocarpa]
 gb|ERP60607.1| hypothetical protein POPTR_0005s05680g [Populus trichocarpa]
Length=198

 Score =   161 bits (407),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 110/169 (65%), Positives = 129/169 (76%), Gaps = 6/169 (4%)
 Frame = -1

Query  1043  IQRLEHAPPFWRNRKKLSKQLSMCETPRDVAWerrrrqilnqerRKS---DAECLTDDDL  873
             ++R+  AP   +N+K+LSKQLSMCET RD AWERRRRQIL QERR+S   +++ LTD+DL
Sbjct  33    LERMPLAPLILKNKKRLSKQLSMCETRRDRAWERRRRQILMQERRRSGLLESDDLTDEDL  92

Query  872   NELKGCIELGFGFKEEEGQRLCNTLPALDLYFAVNRQFSFSPVSTPGSKGTTLpspsass  693
             +ELKGCIELGFGFKEEEG +L NTLPALDLYFAVNRQ S SPVSTP S   +    S+SS
Sbjct  93    HELKGCIELGFGFKEEEGHQLTNTLPALDLYFAVNRQLSPSPVSTPQSGDLS---SSSSS  149

Query  692   tggrssslsspgsdsdSWRICSPGENPEHVKIKLRHWAQAVACSVMQSY  546
               G  SS          W+ICSPG++P+ VK KLRHWAQAVACSVMQSY
Sbjct  150   AMGTRSSSFGSPMSDPDWKICSPGDDPKQVKTKLRHWAQAVACSVMQSY  198



>ref|XP_007147182.1| hypothetical protein PHAVU_006G102600g [Phaseolus vulgaris]
 gb|ESW19176.1| hypothetical protein PHAVU_006G102600g [Phaseolus vulgaris]
Length=177

 Score =   160 bits (405),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 97/169 (57%), Positives = 119/169 (70%), Gaps = 14/169 (8%)
 Frame = -1

Query  1040  QRLEHAPPFWRNRKK-LSKQLSMCETPRDVAWerrrrqilnqerRKSD---AECLTDDDL  873
             Q +  A    + RK+ LSKQLSM E PR++AWER+R+Q      R++     + +TDDDL
Sbjct  19    QHVAFAGEALKKRKRFLSKQLSMVEMPREIAWERKRKQEGRTRTRRNSFHHCDDVTDDDL  78

Query  872   NELKGCIELGFGFKEEEGQRLCNTLPALDLYFAVNRQFSFSPVSTPGSKGTTLpspsass  693
             +ELKGCIELGFGFKEE+GQ LC+TLPALDLYFAVNRQ   SPVSTP S+  +        
Sbjct  79    HELKGCIELGFGFKEEDGQTLCDTLPALDLYFAVNRQ--LSPVSTPHSRAAS--------  128

Query  692   tggrssslsspgsdsdSWRICSPGENPEHVKIKLRHWAQAVACSVMQSY  546
             + G   +     S  DSW+ICSPG++PEHVK KLRHWAQAVACSVMQS+
Sbjct  129   SFGSLINAPPQPSLDDSWKICSPGDDPEHVKTKLRHWAQAVACSVMQSH  177



>ref|XP_011032388.1| PREDICTED: uncharacterized protein LOC105131216 [Populus euphratica]
Length=198

 Score =   160 bits (405),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 111/169 (66%), Positives = 128/169 (76%), Gaps = 6/169 (4%)
 Frame = -1

Query  1043  IQRLEHAPPFWRNRKKLSKQLSMCETPRDVAWerrrrqilnqerRKS---DAECLTDDDL  873
             ++R+  AP   +N+K LSKQLSMCET RD AWERRRRQIL QERRKS   +++ LTD+DL
Sbjct  33    LERMPLAPLVLKNKKLLSKQLSMCETRRDRAWERRRRQILVQERRKSGLLESDDLTDEDL  92

Query  872   NELKGCIELGFGFKEEEGQRLCNTLPALDLYFAVNRQFSFSPVSTPGSKGTTLpspsass  693
             +ELKGCIELGFGFKEEEG +L NTLPALDLYFAVNRQ S SPVSTP S   +    S+SS
Sbjct  93    HELKGCIELGFGFKEEEGNQLTNTLPALDLYFAVNRQLSPSPVSTPQSGDLS---SSSSS  149

Query  692   tggrssslsspgsdsdSWRICSPGENPEHVKIKLRHWAQAVACSVMQSY  546
               G  SS          W+ICSPG++P+ VK KLRHWAQAVACSVMQSY
Sbjct  150   AMGTRSSSFGSPMSDPDWKICSPGDDPKQVKTKLRHWAQAVACSVMQSY  198



>ref|XP_010046349.1| PREDICTED: uncharacterized protein LOC104435263 [Eucalyptus grandis]
 gb|KCW85279.1| hypothetical protein EUGRSUZ_B02125 [Eucalyptus grandis]
Length=207

 Score =   159 bits (401),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 108/167 (65%), Positives = 132/167 (79%), Gaps = 5/167 (3%)
 Frame = -1

Query  1043  IQRLEHAPPFWRNRKKLSKQLSMCETPRDVAWerrrrqilnqerRKS---DAECLTDDDL  873
             +Q +   P    +R+ LSKQLSMCETPRD+AWE+RRRQIL+QER+K+   D++ +TD+DL
Sbjct  33    LQPMPFGPAKKNSRRCLSKQLSMCETPRDIAWEKRRRQILHQERKKNGINDSDDITDEDL  92

Query  872   NELKGCIELGFGFKEEEG-QRLCNTLPALDLYFAVNRQFSFSPVSTPGSKGTTLpspsas  696
             NELKGCI+LGFGFKEEEG Q LCNTLPALD+YFAVNRQ S SPVSTP S G++L    +S
Sbjct  93    NELKGCIDLGFGFKEEEGVQELCNTLPALDIYFAVNRQLSPSPVSTPQSNGSSLSFSMSS  152

Query  695   stggrssslssp-gsdsdSWRICSPGENPEHVKIKLRHWAQAVACSV  558
             S+ G  SS      SDSD+W+IC PG++P+ VK KLRHWAQAVACSV
Sbjct  153   SSLGGGSSSYGSPRSDSDTWKICCPGDSPQQVKTKLRHWAQAVACSV  199



>gb|KEH24562.1| DUF1685 family protein [Medicago truncatula]
Length=187

 Score =   154 bits (389),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 94/156 (60%), Positives = 114/156 (73%), Gaps = 8/156 (5%)
 Frame = -1

Query  1013  WRNRKKLSKQLSMCETPRDVAWerrrrqilnqerRKSDAECLTDDDLNELKGCIELGFGF  834
             ++ RK+L+KQLSMC TP D+AWERRRRQ   +     D     D+DLNEL+GCIELGFGF
Sbjct  39    FKKRKRLTKQLSMCGTPGDMAWERRRRQTQRRRNSMHDC---NDEDLNELRGCIELGFGF  95

Query  833   KEEEGQRLCNTLPALDLYFAVNRQFSFSPVSTPGSKGTTLpspsasstggrssslsspgs  654
              EE+GQ+LCNTLPALDLYFAVNR  S SPVSTP +  TT      S +    +S +    
Sbjct  96    NEEDGQKLCNTLPALDLYFAVNRNLSPSPVSTPTTHRTT-----HSRSSSSIASPTGSIV  150

Query  653   dsdSWRICSPGENPEHVKIKLRHWAQAVACSVMQSY  546
             DSDSW+IC+PG++P  +K KLRHWAQAVACSVMQS+
Sbjct  151   DSDSWKICNPGDDPALIKTKLRHWAQAVACSVMQSH  186



>ref|XP_010553341.1| PREDICTED: uncharacterized protein LOC104823462 [Tarenaya hassleriana]
Length=191

 Score =   152 bits (383),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 107/166 (64%), Positives = 125/166 (75%), Gaps = 14/166 (8%)
 Frame = -1

Query  1022  PPFWRNRKKLSKQLSMCETPRDVAWerrrrqilnqerRK-------SDAECLTDDDLNEL  864
             PP  + +K+LSKQLSMCET RD+AWERRRRQ++    R+       +D   LTD+DL EL
Sbjct  33    PPRLQAKKRLSKQLSMCETRRDIAWERRRRQMMLVPERRRSGSGGDADHGDLTDEDLREL  92

Query  863   KGCIELGFGFKEEEGQRLCNTLPALDLYFAVNRQFSFSPVSTPGSKGTTLpspsasstgg  684
             KG IELGFGF EEEGQRL +TLPALDLYFAVNRQ   SPVSTPGS G++     +S+ G 
Sbjct  93    KGSIELGFGFNEEEGQRLTSTLPALDLYFAVNRQ--ISPVSTPGSGGSS-----SSTLGD  145

Query  683   rssslsspgsdsdSWRICSPGENPEHVKIKLRHWAQAVACSVMQSY  546
             RSSS  SP SDSD  RI SPG+NP+ VK +LRHWAQAVACSVMQS+
Sbjct  146   RSSSFDSPRSDSDPLRILSPGDNPQQVKTRLRHWAQAVACSVMQSF  191



>gb|EYU26856.1| hypothetical protein MIMGU_mgv1a013107mg [Erythranthe guttata]
Length=230

 Score =   152 bits (383),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 112/176 (64%), Positives = 131/176 (74%), Gaps = 11/176 (6%)
 Frame = -1

Query  1043  IQRLEHAPPFWR----NRKK-LSKQLSMCETPRDVAWerrrrqilnqerRKSD-AECLTD  882
             +Q LEHAPPFWR    N+KK LSKQLSMCE PR++AWERRRRQ L QERR+++    LTD
Sbjct  40    LQCLEHAPPFWRSLQSNKKKILSKQLSMCEVPRNIAWERRRRQFLQQERRRNNPGGDLTD  99

Query  881   DDLNELKGCIELGFGFKEEEGQRLCNTLPALDLYFAVNRQFSFSPVSTPGSKGTTLpsps  702
             +DLNELKGCIELGFGF EE GQRLC T+PALDLYFAVNRQ S SP+S+P S G    + S
Sbjct  100   EDLNELKGCIELGFGFNEENGQRLCPTIPALDLYFAVNRQLSISPISSPASSGGGGSARS  159

Query  701   asstggrssslsspg-----sdsdSWRICSPGENPEHVKIKLRHWAQAVACSVMQS  549
               ++   S    S       SDSDSW+I S G++P+ VK KLRHWAQAVACSV+QS
Sbjct  160   IGTSTTLSLGGRSNSFGSPMSDSDSWKIFSRGDDPQQVKTKLRHWAQAVACSVLQS  215



>ref|XP_006577746.1| PREDICTED: uncharacterized protein LOC102667203 [Glycine max]
Length=172

 Score =   149 bits (377),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 98/161 (61%), Positives = 115/161 (71%), Gaps = 17/161 (11%)
 Frame = -1

Query  1010  RNRKK-LSKQLSMCETPRDVAWerrrrqilnqerR-----KSDAECLTDDDLNELKGCIE  849
             + RK+ LSKQ SM E PRD+AWER+RRQ      R      S  + +TDDDL+ELKGCIE
Sbjct  23    KKRKRCLSKQQSMFEAPRDIAWERKRRQEGKTRTRTRTRRNSFHDNVTDDDLHELKGCIE  82

Query  848   LGFGFKEEEGQRLCNTLPALDLYFAVNRQFSFSPVSTPGSKGTTLpspsasstggrsssl  669
             LGFGF EE GQ+LCNTLPALDLYFAVNRQ   S VSTP S+ ++            S   
Sbjct  83    LGFGFNEENGQKLCNTLPALDLYFAVNRQ--LSSVSTPHSRPSS---------SFGSPVS  131

Query  668   sspgsdsdSWRICSPGENPEHVKIKLRHWAQAVACSVMQSY  546
             S+P  DSDSW+ICSPG++PEHVK KLRHWAQAVACS+MQS+
Sbjct  132   SAPPPDSDSWKICSPGDDPEHVKTKLRHWAQAVACSLMQSH  172



>ref|XP_008218506.1| PREDICTED: uncharacterized protein LOC103318851 [Prunus mume]
Length=182

 Score =   150 bits (378),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 111/162 (69%), Positives = 124/162 (77%), Gaps = 10/162 (6%)
 Frame = -1

Query  1019  PFWRNRKKLSKQLSMCETPRDVAWerrrrqilnqerRK-----SDAECLTDDDLNELKGC  855
             PF ++  +L   LSMCETPRD+AWE+RRRQIL QERR+     SD   LTD+DL+ELKGC
Sbjct  25    PFSQHLVELVGLLSMCETPRDIAWEKRRRQILRQERRRNGINDSDDMVLTDEDLHELKGC  84

Query  854   IELGFGFKEEEGQRLCNTLPALDLYFAVNRQFSFSPVSTPGSKGTTLpspsasstggrss  675
             IELGFGF EEEGQRLC TLPALDLYFAVNRQFS SPV             S SS GGRSS
Sbjct  85    IELGFGFNEEEGQRLCPTLPALDLYFAVNRQFSPSPVPP-----PNSARHSTSSLGGRSS  139

Query  674   slsspgsdsdSWRICSPGENPEHVKIKLRHWAQAVACSVMQS  549
             S  SP SD+D+W+ICSPG+NP+ VK KLRHWAQAVACSVMQS
Sbjct  140   SFGSPRSDTDAWKICSPGDNPQQVKTKLRHWAQAVACSVMQS  181



>ref|XP_004304752.1| PREDICTED: uncharacterized protein LOC101311782 [Fragaria vesca 
subsp. vesca]
Length=709

 Score =   157 bits (398),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 111/187 (59%), Positives = 127/187 (68%), Gaps = 27/187 (14%)
 Frame = -1

Query  1043  IQRLEHAPPFWRNRKKLSKQLSMCETPRDVAWerrrrqilnqerRKS-------------  903
             +Q +  APP   +RK+L KQLSMCETPRD+AWE+RRRQIL QER+++             
Sbjct  34    LQHMPLAPPKMMSRKRLCKQLSMCETPRDIAWEKRRRQILKQERKRNGNGDSPGAVAEEQ  93

Query  902   --DAECLTDDDLNELKGCIELGFGFKEEEGQRLCNTLPALDLYFAVNRQFSFSPV-----  744
               D   LTD+DL+ELKGCIELGFGF EEEGQRLC TLPALDLYFAVNRQFS SP+     
Sbjct  94    EGDDMNLTDEDLHELKGCIELGFGFNEEEGQRLCPTLPALDLYFAVNRQFSPSPLSSPNS  153

Query  743   ---STPGSKGTTLpspsasstggrssslsspgsdsdSWRICSPGENPEHVKIKLRHWAQA  573
                ST    G T    S+      S    SP SDSD W+ICSPG+NP+ VK KLRHWAQA
Sbjct  154   GRHSTSSMGGPT----SSFGGLSSSFGSPSPRSDSDGWKICSPGDNPQQVKTKLRHWAQA  209

Query  572   VACSVMQ  552
             VACSVMQ
Sbjct  210   VACSVMQ  216



>ref|XP_004494966.1| PREDICTED: tankyrase-2-like [Cicer arietinum]
Length=686

 Score =   154 bits (388),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 91/155 (59%), Positives = 111/155 (72%), Gaps = 6/155 (4%)
 Frame = -1

Query  1013  WRNRKKLSKQLSMCETPRDVAWerrrrqilnqerRKSDAECLTDDDLNELKGCIELGFGF  834
             ++ RK++  QLSMC T  D+AWERRRRQ   +     D +   D+DLNEL+GCIELGFGF
Sbjct  33    YKKRKRVCVQLSMCGTSGDMAWERRRRQTQRRRNSIHDCD---DEDLNELRGCIELGFGF  89

Query  833   KEEEGQRLCNTLPALDLYFAVNRQFSFSPVSTPGSKGTTLpspsasstggrssslsspgs  654
              EE+GQ+LCNTLPALDLYFAVNRQ S SPVSTP +      +    ++     S ++   
Sbjct  90    NEEDGQKLCNTLPALDLYFAVNRQLSSSPVSTPTAP---RHATHRRASSSFVCSTNTINV  146

Query  653   dsdSWRICSPGENPEHVKIKLRHWAQAVACSVMQS  549
             DSDS +ICSPG++P HVK KLRHWAQAVACSVMQS
Sbjct  147   DSDSLQICSPGDDPAHVKAKLRHWAQAVACSVMQS  181



>ref|XP_011088091.1| PREDICTED: ankyrin repeat domain-containing protein 6 [Sesamum 
indicum]
Length=678

 Score =   152 bits (385),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 104/168 (62%), Positives = 122/168 (73%), Gaps = 14/168 (8%)
 Frame = -1

Query  1010  RNRKKLSKQLSMCETPRDVAWerrrrqilnqerRKS-----------DAECLTDDDLNEL  864
             + ++KLSKQLS+ E PR++AWERRRRQIL QERRK+           D   LTD+DL EL
Sbjct  34    KTKRKLSKQLSINEVPRNIAWERRRRQILQQERRKNSIAIQQEAADDDHLTLTDEDLKEL  93

Query  863   KGCIELGFGFKEEEGQRLCNTLPALDLYFAVNRQFSFSPVSTPGSKG---TTLpspsass  693
             KGCIELGFGF EEEG+RLC TLPALDLYFAVNRQF  SP+++P S G   +   S + S 
Sbjct  94    KGCIELGFGFNEEEGRRLCPTLPALDLYFAVNRQFLTSPIASPASTGPARSPAASSAFSP  153

Query  692   tggrssslsspgsdsdSWRICSPGENPEHVKIKLRHWAQAVACSVMQS  549
              G  SS   SP SD DSW+I SPG++P+H K KLRHWAQAVACSV QS
Sbjct  154   GGRYSSGSPSPTSDPDSWKIVSPGDDPQHAKKKLRHWAQAVACSVRQS  201



>ref|XP_010458142.1| PREDICTED: uncharacterized protein LOC104739473 [Camelina sativa]
Length=190

 Score =   143 bits (361),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 103/165 (62%), Positives = 127/165 (77%), Gaps = 2/165 (1%)
 Frame = -1

Query  1043  IQRLEHAPPFWRNRKKLSKQLSMCETPRDVAWerrrrqilnqerRKSDAECLTDDDLNEL  864
             +Q++   PP  + +K+LSKQLSM ET RDVAWERRRRQ+L+ E+     E LTD+DL+EL
Sbjct  26    LQKMPLEPPRVKAKKRLSKQLSMLETKRDVAWERRRRQMLHLEKHNEGGEDLTDEDLSEL  85

Query  863   KGCIELGFGFKEEEGQRLCNTLPALDLYFAVNRQFSFSPVSTPGSKGTTLpspsasstgg  684
             KG IELGFGF EE+GQ+L  TLPALDLYFAV RQ   SPVSTPGS G +  S   ++ G 
Sbjct  86    KGSIELGFGFNEEQGQQLTTTLPALDLYFAVTRQ--ISPVSTPGSTGGSSSSSRPTTLGD  143

Query  683   rssslsspgsdsdSWRICSPGENPEHVKIKLRHWAQAVACSVMQS  549
             RSSS  SP SDSDS ++ SPG++P+ VK++LRHWAQAVACSV+QS
Sbjct  144   RSSSFGSPKSDSDSLKVMSPGDSPQLVKMRLRHWAQAVACSVIQS  188



>ref|XP_010475692.1| PREDICTED: uncharacterized protein LOC104755066 [Camelina sativa]
Length=190

 Score =   143 bits (360),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 103/165 (62%), Positives = 127/165 (77%), Gaps = 2/165 (1%)
 Frame = -1

Query  1043  IQRLEHAPPFWRNRKKLSKQLSMCETPRDVAWerrrrqilnqerRKSDAECLTDDDLNEL  864
             +Q++   PP  + +K+LSKQLSM ET RDVAWERRRRQ+L+ E+     E LTD+DL+EL
Sbjct  26    LQKMPLEPPRVKAKKRLSKQLSMLETKRDVAWERRRRQMLHLEKHHEGGEDLTDEDLSEL  85

Query  863   KGCIELGFGFKEEEGQRLCNTLPALDLYFAVNRQFSFSPVSTPGSKGTTLpspsasstgg  684
             KG IELGFGF EE+GQ+L  TLPALDLYFAV RQ   SPVSTPGS G +  S   ++ G 
Sbjct  86    KGSIELGFGFNEEQGQQLTTTLPALDLYFAVTRQ--ISPVSTPGSTGGSSSSSRPTTLGD  143

Query  683   rssslsspgsdsdSWRICSPGENPEHVKIKLRHWAQAVACSVMQS  549
             RSSS  SP SDSDS ++ SPG++P+ VK++LRHWAQAVACSV+QS
Sbjct  144   RSSSFGSPKSDSDSLKVMSPGDSPQLVKMRLRHWAQAVACSVIQS  188



>gb|KHN31468.1| hypothetical protein glysoja_035575 [Glycine soja]
Length=138

 Score =   140 bits (354),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 91/149 (61%), Positives = 106/149 (71%), Gaps = 16/149 (11%)
 Frame = -1

Query  977  MCETPRDVAWerrrrqilnqerR-----KSDAECLTDDDLNELKGCIELGFGFKEEEGQR  813
            M E PRD+AWER+RRQ      R      S  + +TDDDL+ELKGCIELGFGF EE GQ+
Sbjct  1    MFEAPRDIAWERKRRQEGKTRTRTRTRRNSFHDNVTDDDLHELKGCIELGFGFNEENGQK  60

Query  812  LCNTLPALDLYFAVNRQFSFSPVSTPGSKGTTLpspsasstggrssslsspgsdsdSWRI  633
            LCNTLPALDLYFAVNRQ   S VSTP S+ ++            S   S+P  DSDSW+I
Sbjct  61   LCNTLPALDLYFAVNRQ--LSSVSTPHSRPSS---------SFGSPVSSAPPPDSDSWKI  109

Query  632  CSPGENPEHVKIKLRHWAQAVACSVMQSY  546
            CSPG++PEHVK KLRHWAQAVACS+MQS+
Sbjct  110  CSPGDDPEHVKTKLRHWAQAVACSLMQSH  138



>gb|KHG02277.1| hypothetical protein F383_24076 [Gossypium arboreum]
Length=188

 Score =   142 bits (358),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 89/156 (57%), Positives = 111/156 (71%), Gaps = 15/156 (10%)
 Frame = -1

Query  995  LSKQLSMCETPRDVAWerrrrqilnqerRK------SDAECLTDDDLNELKGCIELGFGF  834
            LS+QLSMCE  RD+AWERRR+Q+L Q++R+      +D + LTD+DL+ELKG IELGFGF
Sbjct  42   LSRQLSMCEASRDIAWERRRQQMLKQKQRERKGIDVTDGKKLTDEDLHELKGSIELGFGF  101

Query  833  KEEEGQRLCNTLPALDLYFAVNRQFSFSPVSTPGSKGTTLpspsasstggrssslsspgs  654
            +EE+GQ+LC TLPALDLYFAVNRQ S SPVS+P   G             +S +      
Sbjct  102  EEEQGQKLCQTLPALDLYFAVNRQVSSSPVSSPHGGGPAF---------TQSCNEFESPR  152

Query  653  dsdSWRICSPGENPEHVKIKLRHWAQAVACSVMQSY  546
                W+IC+PG+NP+ VK  LRHWAQAVAC+VMQSY
Sbjct  153  SVLDWKICNPGDNPQQVKTNLRHWAQAVACAVMQSY  188



>gb|KFK43191.1| hypothetical protein AALP_AA1G091600 [Arabis alpina]
Length=183

 Score =   140 bits (354),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 99/159 (62%), Positives = 119/159 (75%), Gaps = 6/159 (4%)
 Frame = -1

Query  1022  PPFWRNRKKLSKQLSMCETPRDVAWerrrrqilnqerRKSDAECLTDDDLNELKGCIELG  843
             PP  +++K+LSKQLS  ET RD+AWER+RR +L+Q     D   LTD+DL+ELKG IELG
Sbjct  30    PPRIKSKKRLSKQLSNLETRRDIAWERKRRHMLHQINEGGDD--LTDEDLSELKGSIELG  87

Query  842   FGFKEEEGQRLCNTLPALDLYFAVNRQFSFSPVSTPGSKGTTLpspsasstggrssslss  663
             FGF EE+GQ+L  TLPALDLYFAVNRQ   SPVST     +   S   +S G RSSS  S
Sbjct  88    FGFNEEQGQQLTTTLPALDLYFAVNRQ--ISPVST--PGSSGSSSSRPTSLGDRSSSFGS  143

Query  662   pgsdsdSWRICSPGENPEHVKIKLRHWAQAVACSVMQSY  546
             P SDSDS R+ SPG+NP+ VK++LRHWAQAVACSVMQ+Y
Sbjct  144   PMSDSDSLRLMSPGDNPQQVKMRLRHWAQAVACSVMQTY  182



>ref|XP_009600334.1| PREDICTED: uncharacterized protein LOC104095822 [Nicotiana tomentosiformis]
Length=230

 Score =   141 bits (355),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 79/98 (81%), Positives = 87/98 (89%), Gaps = 3/98 (3%)
 Frame = -1

Query  1043  IQRLEHAPPFWRNRKKLSKQLSMCETPRDVAWerrrrqilnqerRKS---DAECLTDDDL  873
             +Q LEHAPPFWRNRK+LSKQLSMCETPRD+AWE+ RRQIL QERRK    D   LTD++L
Sbjct  27    LQLLEHAPPFWRNRKRLSKQLSMCETPRDIAWEKHRRQILLQERRKQGIHDPGDLTDENL  86

Query  872   NELKGCIELGFGFKEEEGQRLCNTLPALDLYFAVNRQF  759
             NELKGCIELGFGF EEEGQRLC+TLPALDLYFAVNRQ+
Sbjct  87    NELKGCIELGFGFNEEEGQRLCSTLPALDLYFAVNRQY  124



>ref|XP_009134781.1| PREDICTED: uncharacterized protein LOC103859053 [Brassica rapa]
 emb|CDX74173.1| BnaA03g28740D [Brassica napus]
Length=192

 Score =   139 bits (350),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 94/163 (58%), Positives = 116/163 (71%), Gaps = 14/163 (9%)
 Frame = -1

Query  1004  RKKLSKQLSMCETPRDVAWerrrrqilnqerRK----------SDAECLTDDDLNELKGC  855
             +K+LSKQLSM ETPRD+AWERRRRQ++  + +K          S+   LTD+DLNELKG 
Sbjct  34    KKRLSKQLSMLETPRDIAWERRRRQMIMIQEKKMLHKGVSDNLSEQTKLTDEDLNELKGS  93

Query  854   IELGFGFKEEEGQRLCNTLPALDLYFAVNRQFSFSPVSTPGSKGTTLpspsasstggrss  675
             IELGFGF EE GQ+LCNTLPALDLYFAVNRQ S  P  +  S+ ++    ++SS    S 
Sbjct  94    IELGFGFNEEAGQKLCNTLPALDLYFAVNRQLSPLPSPSSSSRTSS----ASSSAFSMSI  149

Query  674   slsspgsdsdSWRICSPGENPEHVKIKLRHWAQAVACSVMQSY  546
               S   +DSDS +I  PG+NP+ VK +LRHWAQAVACSVMQ+Y
Sbjct  150   PGSPKKTDSDSLKIVCPGDNPQQVKQRLRHWAQAVACSVMQTY  192



>ref|XP_006417647.1| hypothetical protein EUTSA_v10009929mg [Eutrema salsugineum]
 gb|ESQ36000.1| hypothetical protein EUTSA_v10009929mg [Eutrema salsugineum]
Length=192

 Score =   138 bits (348),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 98/169 (58%), Positives = 118/169 (70%), Gaps = 6/169 (4%)
 Frame = -1

Query  1043  IQRLEHAPPFWRNRKKLSKQLSMCETPRDVAWerrrrqilnqerRKSDAEC---LTDDDL  873
             +Q++   PP  + +K+LSKQLSM ET RD+AWERRRRQ+L+   RK   E    LTD+DL
Sbjct  26    LQKMPLEPPRIKAKKRLSKQLSMLETRRDIAWERRRRQMLHHLERKQINEGGDDLTDEDL  85

Query  872   NELKGCIELGFGFKEEEGQRLCNTLPALDLYFAVNRQFSFSPVSTPGSKGTTLpspsass  693
             +ELKG IELGFGF EE+GQ+L  TLPALDLYFAVNRQ   SPVSTP   G +  S S S 
Sbjct  86    SELKGSIELGFGFNEEQGQQLTTTLPALDLYFAVNRQ--ISPVSTP-GSGGSSSSRSTSF  142

Query  692   tggrssslsspgsdsdSWRICSPGENPEHVKIKLRHWAQAVACSVMQSY  546
                 SS  S     SD  +  SPG++P+ VK +LRHWAQAVACSV+QSY
Sbjct  143   GDRSSSFGSHISDSSDGLKFMSPGDDPQQVKTRLRHWAQAVACSVIQSY  191



>emb|CDY40670.1| BnaC03g33860D [Brassica napus]
Length=192

 Score =   138 bits (348),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 94/163 (58%), Positives = 115/163 (71%), Gaps = 14/163 (9%)
 Frame = -1

Query  1004  RKKLSKQLSMCETPRDVAWerrrrqilnqerRK----------SDAECLTDDDLNELKGC  855
             +K+LSKQLSM ETPRD+AWERRRRQ++  + +K          S+   LTD+DLNELKG 
Sbjct  34    KKRLSKQLSMLETPRDIAWERRRRQMIMIQEKKMLHKGVSDNLSEQTKLTDEDLNELKGS  93

Query  854   IELGFGFKEEEGQRLCNTLPALDLYFAVNRQFSFSPVSTPGSKGTTLpspsasstggrss  675
             IELGFGF EE GQ+LCNTLPALDLYFAVNRQ S  P     S+ ++    ++SS    S 
Sbjct  94    IELGFGFNEEAGQKLCNTLPALDLYFAVNRQLSPLPSPNSSSRTSS----ASSSAFSMSI  149

Query  674   slsspgsdsdSWRICSPGENPEHVKIKLRHWAQAVACSVMQSY  546
               S   +DSDS +I  PG+NP+ VK +LRHWAQAVACSVMQ+Y
Sbjct  150   PGSPKKTDSDSLKIVCPGDNPQQVKQRLRHWAQAVACSVMQTY  192



>ref|XP_002882370.1| hypothetical protein ARALYDRAFT_477736 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH58629.1| hypothetical protein ARALYDRAFT_477736 [Arabidopsis lyrata subsp. 
lyrata]
Length=191

 Score =   137 bits (346),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 94/163 (58%), Positives = 113/163 (69%), Gaps = 15/163 (9%)
 Frame = -1

Query  1004  RKKLSKQLSMCETPRDVAWerrrrqilnqerRK------SDAEC----LTDDDLNELKGC  855
             + +LSKQLSMCETPRDVAWERRRRQ++  + +K      SD  C    LTD+DLNELKG 
Sbjct  34    KHRLSKQLSMCETPRDVAWERRRRQMIMIQEKKLLHKGASDNLCVQANLTDEDLNELKGS  93

Query  854   IELGFGFKEEEGQRLCNTLPALDLYFAVNRQFSFSPVSTPGSKGTTLpspsasstggrss  675
             IELGFGF EE GQ+LCNTLPALDLYFAVNRQ S  P  +     +      ++S    S 
Sbjct  94    IELGFGFNEEAGQKLCNTLPALDLYFAVNRQLSPLPSPSSSRSSSA-----SASAFSYSI  148

Query  674   slsspgsdsdSWRICSPGENPEHVKIKLRHWAQAVACSVMQSY  546
               S   +DSDS +I  PG++P+ +K +LRHWAQAVACSVMQSY
Sbjct  149   PCSPKKTDSDSLKILCPGDDPQQMKQRLRHWAQAVACSVMQSY  191



>ref|XP_010519977.1| PREDICTED: uncharacterized protein LOC104799259 [Tarenaya hassleriana]
Length=189

 Score =   137 bits (346),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 86/159 (54%), Positives = 105/159 (66%), Gaps = 14/159 (9%)
 Frame = -1

Query  998  KLSKQLSMCETPRDVAWerrrrqilnqerRK--------SDAECLTDDDLNELKGCIELG  843
            +LSKQLS CETPRDVAWE+RRRQ++  + +K        S+   LTD+DL ELKG IELG
Sbjct  37   RLSKQLSTCETPRDVAWEKRRRQVIMIQDKKHKHVSENVSNLPDLTDEDLRELKGSIELG  96

Query  842  FGFKEEEGQRLCNTLPALDLYFAVNRQFSFSPVSTPGSKGTTLpspsasstggrssslss  663
            FGF E+ GQ+LCNTLPALDLYFAVNRQ S  P  +   + + L   S+S         S 
Sbjct  97   FGFNEDAGQKLCNTLPALDLYFAVNRQLSPIPSPSSSGRHSVLSPWSSSVPPSSPKPDSD  156

Query  662  pgsdsdSWRICSPGENPEHVKIKLRHWAQAVACSVMQSY  546
                    +I  PG++P+ VK +LRHWAQAVACSVMQSY
Sbjct  157  T------LKILCPGDDPQQVKTRLRHWAQAVACSVMQSY  189



>ref|NP_187121.1| uncharacterized protein [Arabidopsis thaliana]
 gb|AAF04898.1|AC011437_13 hypothetical protein [Arabidopsis thaliana]
 gb|ABE77403.1| At3g04700 [Arabidopsis thaliana]
 gb|AEE74121.1| uncharacterized protein AT3G04700 [Arabidopsis thaliana]
Length=191

 Score =   137 bits (345),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 90/163 (55%), Positives = 107/163 (66%), Gaps = 15/163 (9%)
 Frame = -1

Query  1004  RKKLSKQLSMCETPRDVAWerrrrqilnqerRK------SDAEC----LTDDDLNELKGC  855
             + +LSKQLSMCETPRDVAWERRRRQ++  + +K      SD  C    LTD+DLNELKG 
Sbjct  34    KHRLSKQLSMCETPRDVAWERRRRQMIMIQEKKLLHKGASDNLCIQANLTDEDLNELKGS  93

Query  854   IELGFGFKEEEGQRLCNTLPALDLYFAVNRQFSFSPVSTPGSKGTTLpspsasstggrss  675
             IELGFGF EE GQ+LCNTLPALDLYFAVNRQ S  P  +     +   S  + S      
Sbjct  94    IELGFGFNEEAGQKLCNTLPALDLYFAVNRQLSPLPSPSSSRSSSASASTFSYSIPCSPK  153

Query  674   slsspgsdsdSWRICSPGENPEHVKIKLRHWAQAVACSVMQSY  546
                S        +I  PG++P+ +K +LRHWAQAVACSVMQSY
Sbjct  154   KTDSDSV-----KILCPGDDPQQMKQRLRHWAQAVACSVMQSY  191



>ref|XP_010485853.1| PREDICTED: uncharacterized protein LOC104764099 [Camelina sativa]
Length=191

 Score =   137 bits (345),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 95/163 (58%), Positives = 115/163 (71%), Gaps = 15/163 (9%)
 Frame = -1

Query  1004  RKKLSKQLSMCETPRDVAWerrrrqilnqerRK----------SDAECLTDDDLNELKGC  855
             +++LSKQLSMCETPRDVAWERRRRQ++  + +K          S    LTD+DLNELKG 
Sbjct  34    KQRLSKQLSMCETPRDVAWERRRRQMIMVQEKKLLHKGISDDISVQMKLTDEDLNELKGS  93

Query  854   IELGFGFKEEEGQRLCNTLPALDLYFAVNRQFSFSPVSTPGSKGTTLpspsasstggrss  675
             IELGFGF EE GQ+LCNTLPALDLYFAVNRQ     VS   S  ++  S  ++ST   S 
Sbjct  94    IELGFGFNEEAGQKLCNTLPALDLYFAVNRQ-----VSPLPSPSSSRSSSVSASTFSNSI  148

Query  674   slsspgsdsdSWRICSPGENPEHVKIKLRHWAQAVACSVMQSY  546
               S   +DSDS +I  PG++P+ +K +LRHWAQAVACSVMQSY
Sbjct  149   PCSPKKTDSDSLKILCPGDDPQQMKQRLRHWAQAVACSVMQSY  191



>ref|XP_009124189.1| PREDICTED: uncharacterized protein LOC103849137 [Brassica rapa]
Length=188

 Score =   137 bits (345),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 86/160 (54%), Positives = 112/160 (70%), Gaps = 12/160 (8%)
 Frame = -1

Query  1004  RKKLSKQLSMCETPRDVAWerrrrqilnqerRK-------SDAECLTDDDLNELKGCIEL  846
             +++L+KQLSMCE+PRD+AWERR+RQ++  + +K       S+ + LTD+DLNELKG IEL
Sbjct  34    KQRLTKQLSMCESPRDIAWERRKRQMIMIQEKKMRVSDNLSEQKKLTDEDLNELKGSIEL  93

Query  845   GFGFKEEEGQRLCNTLPALDLYFAVNRQFSFSPVSTPGSKGTTLpspsasstggrsssls  666
             GFGF EE GQ+LCNTLPALDLYFAVNR  S     +     +      ++S    +   S
Sbjct  94    GFGFNEEAGQKLCNTLPALDLYFAVNRHLSPLASPSSSRSSSA-----SASAFSMNIPCS  148

Query  665   spgsdsdSWRICSPGENPEHVKIKLRHWAQAVACSVMQSY  546
                +DSDS +I  PG+NP+ VK +LRHWAQAVACSVMQ+Y
Sbjct  149   PKKTDSDSLKIVCPGDNPQQVKQRLRHWAQAVACSVMQTY  188



>emb|CDX95786.1| BnaC05g35370D [Brassica napus]
Length=191

 Score =   137 bits (345),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 85/163 (52%), Positives = 109/163 (67%), Gaps = 15/163 (9%)
 Frame = -1

Query  1004  RKKLSKQLSMCETPRDVAWerrrrqilnqerRK----------SDAECLTDDDLNELKGC  855
             +++L+KQLSMCE+PRD+AWERR+RQ++  + +K          S+ + LTD+DLNELKG 
Sbjct  34    KQRLTKQLSMCESPRDIAWERRKRQMIMIQEKKMLHKGVSDHLSEQKKLTDEDLNELKGS  93

Query  854   IELGFGFKEEEGQRLCNTLPALDLYFAVNRQFSFSPVSTPGSKGTTLpspsasstggrss  675
             IELGFGF EE GQ+LC+TLPALDLYFAVNRQ S  P  +   + +   S  + S      
Sbjct  94    IELGFGFNEEAGQKLCSTLPALDLYFAVNRQLSPLPSPSSSRRSSACASAFSMSIPCSPK  153

Query  674   slsspgsdsdSWRICSPGENPEHVKIKLRHWAQAVACSVMQSY  546
                S        +I  PG+NP+ VK +LRHWAQAVACSVMQSY
Sbjct  154   KTDSDS-----LKIVCPGDNPQQVKQRLRHWAQAVACSVMQSY  191



>gb|KFK31933.1| hypothetical protein AALP_AA6G178000 [Arabis alpina]
Length=198

 Score =   137 bits (346),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 93/161 (58%), Positives = 113/161 (70%), Gaps = 8/161 (5%)
 Frame = -1

Query  1004  RKKLSKQLSMCETPRDVAWerrrrqilnqerRK--------SDAECLTDDDLNELKGCIE  849
             +++LSKQLSM ETPRDVAWE+RRRQ+L  + +K        +D   LTD+DL ELKG IE
Sbjct  38    KQRLSKQLSMRETPRDVAWEKRRRQMLKIQEKKQKGVSENDNDPPDLTDEDLRELKGSIE  97

Query  848   LGFGFKEEEGQRLCNTLPALDLYFAVNRQFSFSPVSTPGSKGTTLpspsasstggrsssl  669
             LGFGF EE GQ+LCNTLPALDLYFAVNRQ S  P  +            +S++   SS  
Sbjct  98    LGFGFNEEAGQKLCNTLPALDLYFAVNRQLSPLPSPSSSRSSNGGDGSLSSTSASSSSIP  157

Query  668   sspgsdsdSWRICSPGENPEHVKIKLRHWAQAVACSVMQSY  546
              SP +DSDS +I  PG+NP+ VK +LRHWAQAVACSVMQS+
Sbjct  158   CSPKTDSDSLKILYPGDNPQQVKQRLRHWAQAVACSVMQSH  198



>ref|XP_010417937.1| PREDICTED: uncharacterized protein LOC104703569 [Camelina sativa]
Length=194

 Score =   137 bits (345),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 95/163 (58%), Positives = 115/163 (71%), Gaps = 15/163 (9%)
 Frame = -1

Query  1004  RKKLSKQLSMCETPRDVAWerrrrqilnqerRK----------SDAECLTDDDLNELKGC  855
             +++LSKQLSMCETPRDVAWERRRRQ++  + +K          S    LTD+DLNELKG 
Sbjct  37    KQRLSKQLSMCETPRDVAWERRRRQMIMIQEKKLLHKGISDNLSVQMKLTDEDLNELKGS  96

Query  854   IELGFGFKEEEGQRLCNTLPALDLYFAVNRQFSFSPVSTPGSKGTTLpspsasstggrss  675
             IELGFGF EE GQ+LCNTLPALDLYFAVNRQ     VS   S  ++  S  ++ST   S 
Sbjct  97    IELGFGFNEEAGQKLCNTLPALDLYFAVNRQ-----VSPLPSPSSSRSSSVSASTFSNSI  151

Query  674   slsspgsdsdSWRICSPGENPEHVKIKLRHWAQAVACSVMQSY  546
               S   +DSDS +I  PG++P+ +K +LRHWAQAVACSVMQSY
Sbjct  152   PCSPKKTDSDSLKILCPGDDPQQMKQRLRHWAQAVACSVMQSY  194



>ref|XP_002872319.1| hypothetical protein ARALYDRAFT_351825 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH48578.1| hypothetical protein ARALYDRAFT_351825 [Arabidopsis lyrata subsp. 
lyrata]
Length=195

 Score =   137 bits (345),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 93/161 (58%), Positives = 113/161 (70%), Gaps = 8/161 (5%)
 Frame = -1

Query  1004  RKKLSKQLSMCETPRDVAWerrrrqilnqerRK--------SDAECLTDDDLNELKGCIE  849
             +++LSKQLSM ETPRDVAWE+RRRQ+L  + +K        SD   LTD+DL ELKG IE
Sbjct  35    KQRLSKQLSMRETPRDVAWEKRRRQMLKIQEKKQKGVSENDSDPPDLTDEDLRELKGSIE  94

Query  848   LGFGFKEEEGQRLCNTLPALDLYFAVNRQFSFSPVSTPGSKGTTLpspsasstggrsssl  669
             LGFGF EE GQ+LCNTLPALDLYFAVNRQ S  P  +            +S++   SS  
Sbjct  95    LGFGFSEEAGQKLCNTLPALDLYFAVNRQLSPLPSPSSSRSSNGGDGSLSSTSVSSSSIP  154

Query  668   sspgsdsdSWRICSPGENPEHVKIKLRHWAQAVACSVMQSY  546
              SP +DSDS +I  PG+NP+ VK +LRHWAQAVACS+MQS+
Sbjct  155   CSPKTDSDSLKILCPGDNPQQVKQRLRHWAQAVACSLMQSH  195



>emb|CDY50748.1| BnaAnng10550D [Brassica napus]
Length=188

 Score =   137 bits (344),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 86/160 (54%), Positives = 112/160 (70%), Gaps = 12/160 (8%)
 Frame = -1

Query  1004  RKKLSKQLSMCETPRDVAWerrrrqilnqerRK-------SDAECLTDDDLNELKGCIEL  846
             +++L+KQLSMCE+PRD+AWERR+RQ++  + +K       S+ + LTD+DLNELKG IEL
Sbjct  34    KQRLTKQLSMCESPRDIAWERRKRQMIMIQEKKMRVSDNLSEQKKLTDEDLNELKGSIEL  93

Query  845   GFGFKEEEGQRLCNTLPALDLYFAVNRQFSFSPVSTPGSKGTTLpspsasstggrsssls  666
             GFGF EE GQ+LCNTLPALDLYFAVNR  S     +     +      ++S    +   S
Sbjct  94    GFGFNEEAGQKLCNTLPALDLYFAVNRHLSPLASPSSSRSSSA-----SASAFLMNIPCS  148

Query  665   spgsdsdSWRICSPGENPEHVKIKLRHWAQAVACSVMQSY  546
                +DSDS +I  PG+NP+ VK +LRHWAQAVACSVMQ+Y
Sbjct  149   PKKTDSDSLKIVCPGDNPQQVKQRLRHWAQAVACSVMQTY  188



>ref|XP_006299371.1| hypothetical protein CARUB_v10015529mg [Capsella rubella]
 gb|EOA32269.1| hypothetical protein CARUB_v10015529mg [Capsella rubella]
Length=192

 Score =   137 bits (344),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 96/163 (59%), Positives = 116/163 (71%), Gaps = 15/163 (9%)
 Frame = -1

Query  1004  RKKLSKQLSMCETPRDVAWerrrrqilnqerRK----------SDAECLTDDDLNELKGC  855
             +++LSKQLSMCETPRDVAWERRRRQ++  + +K          S    LTD+DLNELKG 
Sbjct  35    KQRLSKQLSMCETPRDVAWERRRRQMIIIQEKKLLHKGVSDNLSVQMKLTDEDLNELKGS  94

Query  854   IELGFGFKEEEGQRLCNTLPALDLYFAVNRQFSFSPVSTPGSKGTTLpspsasstggrss  675
             IELGFGF EE GQ+LCNTLPALDLYFAVNRQ     VS   S  ++  S +++ST   S 
Sbjct  95    IELGFGFNEEAGQKLCNTLPALDLYFAVNRQ-----VSPLPSPSSSRSSSASASTFSNSI  149

Query  674   slsspgsdsdSWRICSPGENPEHVKIKLRHWAQAVACSVMQSY  546
               S   SDSDS +I  PG++P+ +K +LRHWAQAVACSVMQSY
Sbjct  150   PCSPKKSDSDSIKILRPGDDPQQMKQRLRHWAQAVACSVMQSY  192



>ref|XP_006408163.1| hypothetical protein EUTSA_v10021572mg [Eutrema salsugineum]
 gb|ESQ49616.1| hypothetical protein EUTSA_v10021572mg [Eutrema salsugineum]
Length=191

 Score =   137 bits (344),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 91/163 (56%), Positives = 114/163 (70%), Gaps = 15/163 (9%)
 Frame = -1

Query  1004  RKKLSKQLSMCETPRDVAWerrrrqilnqerRK----------SDAECLTDDDLNELKGC  855
             +++LSKQLSMCETPRD+AWERRRRQ++  + +K           +   LTD+DLNELKG 
Sbjct  34    KQRLSKQLSMCETPRDIAWERRRRQMIMIQEKKLLHKGVSDNLIEQSKLTDEDLNELKGS  93

Query  854   IELGFGFKEEEGQRLCNTLPALDLYFAVNRQFSFSPVSTPGSKGTTLpspsasstggrss  675
             IELGFGF EE GQ+LCNTLPALDLYFAVNRQ S        S  ++  S +++S    S 
Sbjct  94    IELGFGFNEEAGQKLCNTLPALDLYFAVNRQLSPL-----PSPSSSRSSSASASVFSNSM  148

Query  674   slsspgsdsdSWRICSPGENPEHVKIKLRHWAQAVACSVMQSY  546
               S   +DSDS +I  PG++P+ VK +LRHWAQAVACSVMQ+Y
Sbjct  149   PGSPKKTDSDSLKILCPGDDPQQVKQRLRHWAQAVACSVMQTY  191



>ref|XP_010455193.1| PREDICTED: uncharacterized protein LOC104736831 isoform X2 [Camelina 
sativa]
 ref|XP_010455194.1| PREDICTED: uncharacterized protein LOC104736831 isoform X3 [Camelina 
sativa]
Length=193

 Score =   136 bits (343),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 92/161 (57%), Positives = 113/161 (70%), Gaps = 8/161 (5%)
 Frame = -1

Query  1004  RKKLSKQLSMCETPRDVAWerrrrqilnqerRK--------SDAECLTDDDLNELKGCIE  849
             +++LSKQLSM ETPRDVAWE+RRRQ+L  + +K        +D   LTD+DL ELKG IE
Sbjct  33    KQRLSKQLSMRETPRDVAWEKRRRQMLKIQEKKQKGVSENDNDPSDLTDEDLRELKGSIE  92

Query  848   LGFGFKEEEGQRLCNTLPALDLYFAVNRQFSFSPVSTPGSKGTTLpspsasstggrsssl  669
             LGFGF EE GQ+LCNTLPALDLYFAVNRQ S  P  +            +S++   SS  
Sbjct  93    LGFGFNEEAGQKLCNTLPALDLYFAVNRQLSPLPSPSSSRSSNGGDGSLSSTSASSSSIP  152

Query  668   sspgsdsdSWRICSPGENPEHVKIKLRHWAQAVACSVMQSY  546
              SP +DSDS +I  PG+NP+ VK +LRHWAQAVACS+MQS+
Sbjct  153   CSPKTDSDSLKILCPGDNPQQVKQRLRHWAQAVACSLMQSH  193



>ref|XP_006289170.1| hypothetical protein CARUB_v10002608mg [Capsella rubella]
 gb|EOA22068.1| hypothetical protein CARUB_v10002608mg [Capsella rubella]
Length=195

 Score =   135 bits (340),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 92/161 (57%), Positives = 114/161 (71%), Gaps = 8/161 (5%)
 Frame = -1

Query  1004  RKKLSKQLSMCETPRDVAWerrrrqilnqerRK--------SDAECLTDDDLNELKGCIE  849
             +++LSKQLSM ETPRDVAWE+RRRQ+L  + +K        +D   LTD+DL ELKG IE
Sbjct  35    KQRLSKQLSMRETPRDVAWEKRRRQMLKIQEKKQKGVSENDNDPPDLTDEDLRELKGSIE  94

Query  848   LGFGFKEEEGQRLCNTLPALDLYFAVNRQFSFSPVSTPGSKGTTLpspsasstggrsssl  669
             LGFGF EE GQ+LCNTLPALDLYFAVNRQ S  P  +     +      +S++   SS  
Sbjct  95    LGFGFSEEAGQKLCNTLPALDLYFAVNRQISPLPSPSSSRSSSGGDGSLSSTSVSSSSIP  154

Query  668   sspgsdsdSWRICSPGENPEHVKIKLRHWAQAVACSVMQSY  546
              SP +DSDS +I  PG+NP+ VK +LRHWAQAVACS+MQS+
Sbjct  155   CSPKTDSDSLKILCPGDNPQQVKQRLRHWAQAVACSLMQSH  195



>ref|XP_006303594.1| hypothetical protein CARUB_v10011157mg [Capsella rubella]
 gb|EOA36492.1| hypothetical protein CARUB_v10011157mg [Capsella rubella]
Length=190

 Score =   135 bits (340),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 99/166 (60%), Positives = 124/166 (75%), Gaps = 4/166 (2%)
 Frame = -1

Query  1043  IQRLEHAPPFWRNRKKLSKQLSMCETPRDVAWerrrrqilnqerRKSDA-ECLTDDDLNE  867
             +Q++   PP  + +K+LSKQLSM ET RD+AWERRRRQ+L    + ++  E LTD+DL+E
Sbjct  26    LQKMPLEPPRVKAKKRLSKQLSMLETQRDIAWERRRRQMLQHLEKHNEGGENLTDEDLSE  85

Query  866   LKGCIELGFGFKEEEGQRLCNTLPALDLYFAVNRQFSFSPVSTPGSKGTTLpspsasstg  687
             LKG IELGFGF EE+GQ+L  TLPALDLYFAV RQ   SPVSTP     +  S   +S G
Sbjct  86    LKGSIELGFGFNEEQGQQLTTTLPALDLYFAVTRQ--VSPVSTP-GSSGSSSSSRPTSLG  142

Query  686   grssslsspgsdsdSWRICSPGENPEHVKIKLRHWAQAVACSVMQS  549
              RSSS  SP SDSDS ++ SPG++P+ VK++LRHWAQAVACSV+QS
Sbjct  143   DRSSSFGSPKSDSDSLKVMSPGDSPQLVKMRLRHWAQAVACSVIQS  188



>ref|XP_006395028.1| hypothetical protein EUTSA_v10004951mg [Eutrema salsugineum]
 gb|ESQ32314.1| hypothetical protein EUTSA_v10004951mg [Eutrema salsugineum]
Length=198

 Score =   135 bits (340),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 93/161 (58%), Positives = 112/161 (70%), Gaps = 8/161 (5%)
 Frame = -1

Query  1004  RKKLSKQLSMCETPRDVAWerrrrqilnqerRKS--------DAECLTDDDLNELKGCIE  849
             +++LSKQLSM ETPRDVAWE+RRRQ+L  + +K         D   LTD+DL ELKG IE
Sbjct  38    KQRLSKQLSMRETPRDVAWEKRRRQMLKIQEKKHKGVSENEYDPTDLTDEDLRELKGSIE  97

Query  848   LGFGFKEEEGQRLCNTLPALDLYFAVNRQFSFSPVSTPGSKGTTLpspsasstggrsssl  669
             LGFGFKEE G +LCNTLPALDLYFAVNRQ S  P  +            +S++   SS  
Sbjct  98    LGFGFKEEAGLKLCNTLPALDLYFAVNRQLSPLPSPSSSRSSNGGDGSLSSTSASSSSIP  157

Query  668   sspgsdsdSWRICSPGENPEHVKIKLRHWAQAVACSVMQSY  546
              SP +DSDS +I  PG+NP+ VK +LRHWAQAVACSVMQS+
Sbjct  158   CSPKTDSDSLKILCPGDNPQQVKQRLRHWAQAVACSVMQSH  198



>ref|XP_010528806.1| PREDICTED: uncharacterized protein LOC104805823 [Tarenaya hassleriana]
Length=195

 Score =   135 bits (340),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 103/166 (62%), Positives = 120/166 (72%), Gaps = 10/166 (6%)
 Frame = -1

Query  1022  PPFWRNRKKLSKQLSMCETPRDVAWerrrrqil------nqerRKSDAEC-LTDDDLNEL  864
             PP    +K+LSKQLSMCET RD+AWERRRRQ+L         R ++D  C LTD+DL EL
Sbjct  33    PPRLPTKKRLSKQLSMCETRRDIAWERRRRQMLFPGRKRGGGRGETDQNCGLTDEDLREL  92

Query  863   KGCIELGFGFKEEEGQRLCNTLPALDLYFAVNRQFSFSPVSTPGSKGTTLpspsasstgg  684
             KG IELGFGF EEEGQ+L +TLPALDLYFAV RQ   SPVST    G +  S S+S  G 
Sbjct  93    KGSIELGFGFNEEEGQQLTSTLPALDLYFAVTRQ--ISPVST-PGSGGSTSSSSSSILGD  149

Query  683   rssslsspgsdsdSWRICSPGENPEHVKIKLRHWAQAVACSVMQSY  546
             RS S  SP  DSDS +I SPG++P+ VK +LRHWAQAVACSVMQS+
Sbjct  150   RSLSFGSPRGDSDSLKILSPGDDPQQVKTRLRHWAQAVACSVMQSH  195



>ref|XP_009151262.1| PREDICTED: uncharacterized protein LOC103874591 [Brassica rapa]
 emb|CDX86207.1| BnaA06g29240D [Brassica napus]
Length=193

 Score =   135 bits (339),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 93/161 (58%), Positives = 115/161 (71%), Gaps = 8/161 (5%)
 Frame = -1

Query  1004  RKKLSKQLSMCETPRDVAWerrrrqilnqerRK----SDAEC----LTDDDLNELKGCIE  849
             +++LSKQLSM ETPRDVAWE+RRRQ+L  + +K    SD++C    LTD+DL ELKG IE
Sbjct  33    KQRLSKQLSMRETPRDVAWEKRRRQMLKIQEKKQKGLSDSDCDPTDLTDEDLRELKGSIE  92

Query  848   LGFGFKEEEGQRLCNTLPALDLYFAVNRQFSFSPVSTPGSKGTTLpspsasstggrsssl  669
             LGFGFKEE G +LCNTLPALDLYFAV+RQ S  P  +             S++   SS  
Sbjct  93    LGFGFKEEAGLKLCNTLPALDLYFAVHRQLSPLPSPSSSRSSNGGDGSLPSTSASSSSIP  152

Query  668   sspgsdsdSWRICSPGENPEHVKIKLRHWAQAVACSVMQSY  546
              SP +DSDS +I  PG++P+ VK +LRHWAQAVACSVMQS+
Sbjct  153   CSPRTDSDSLKILCPGDSPQQVKQRLRHWAQAVACSVMQSH  193



>ref|XP_002889715.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH65974.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=190

 Score =   134 bits (338),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 99/166 (60%), Positives = 124/166 (75%), Gaps = 4/166 (2%)
 Frame = -1

Query  1043  IQRLEHAPPFWRNRKKLSKQLSMCETPRDVAWerrrrqilnqerRKSDA-ECLTDDDLNE  867
             +Q++   PP  + +K+LSKQLSM ET RD+AWERRRRQ+L+   + ++  + LTD+DL+E
Sbjct  26    LQKMPLEPPRVKTKKRLSKQLSMLETRRDIAWERRRRQMLHHLEKHNEGGDDLTDEDLSE  85

Query  866   LKGCIELGFGFKEEEGQRLCNTLPALDLYFAVNRQFSFSPVSTPGSKGTTLpspsasstg  687
             LKG IELGFGF EE+GQ L  TLPALDLYFAV RQ   SPVSTP   G +  S   +S G
Sbjct  86    LKGSIELGFGFNEEQGQHLTTTLPALDLYFAVTRQ--ISPVSTP-GSGGSSSSSRPTSLG  142

Query  686   grssslsspgsdsdSWRICSPGENPEHVKIKLRHWAQAVACSVMQS  549
              RSSS  SP SDSDS ++ SPG+NP+ VK +LRHWAQAVACS++QS
Sbjct  143   DRSSSFGSPISDSDSLKVMSPGDNPQQVKTRLRHWAQAVACSMIQS  188



>emb|CDY32127.1| BnaCnng06360D [Brassica napus]
Length=191

 Score =   134 bits (337),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 98/168 (58%), Positives = 118/168 (70%), Gaps = 8/168 (5%)
 Frame = -1

Query  1043  IQRLEHAPPFWRNRKKLSKQLSMCETPRDVAWerrrrqilnqerRKSDAEC----LTDDD  876
             +Q++   PP  + +K+LSKQLSM ET RD+AWERRRRQ+L+    K   E     LTD+D
Sbjct  26    LQKMSLEPPRAKPKKRLSKQLSMLETKRDMAWERRRRQMLHHLEMKQINEGGDTDLTDED  85

Query  875   LNELKGCIELGFGFKEEEGQRLCNTLPALDLYFAVNRQFSFSPVSTPGSKGTTLpspsas  696
             L+ELKG IELGFGFKEE+GQ+L +TLPALDLYFAVNRQ S  PVST         S   +
Sbjct  86    LSELKGSIELGFGFKEEQGQQLTSTLPALDLYFAVNRQIS--PVST--PSSGGSSSSRLT  141

Query  695   stggrssslsspgsdsdSWRICSPGENPEHVKIKLRHWAQAVACSVMQ  552
             S G  SSS  SP SDSD  +   PG+NP+ VK +LRHWAQAVACSV+Q
Sbjct  142   SLGEGSSSFGSPMSDSDGLKFMFPGDNPQQVKTRLRHWAQAVACSVIQ  189



>ref|XP_010494109.1| PREDICTED: uncharacterized protein LOC104771301 isoform X2 [Camelina 
sativa]
Length=191

 Score =   134 bits (336),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 93/161 (58%), Positives = 115/161 (71%), Gaps = 10/161 (6%)
 Frame = -1

Query  1004  RKKLSKQLSMCETPRDVAWerrrrqilnqerRK--------SDAECLTDDDLNELKGCIE  849
             +++LSKQLSM ETPRDVAWE+RRRQ+L  + +K        +D   LTD+DL ELKG IE
Sbjct  33    KQRLSKQLSMRETPRDVAWEKRRRQMLKIQEKKQKGVSENDNDPSDLTDEDLRELKGSIE  92

Query  848   LGFGFKEEEGQRLCNTLPALDLYFAVNRQFSFSPVSTPGSKGTTLpspsasstggrsssl  669
             LGFGF EE GQ+LCNTLPALDLYFAVNRQ S  P  +  S  ++     + S+   SS  
Sbjct  93    LGFGFNEEAGQKLCNTLPALDLYFAVNRQLSPLPSPS--SSRSSNGGDGSLSSASSSSIP  150

Query  668   sspgsdsdSWRICSPGENPEHVKIKLRHWAQAVACSVMQSY  546
              SP +DSDS +I  PG+NP+ VK +LRHWAQAVACS+MQS+
Sbjct  151   CSPKTDSDSLKILCPGDNPQQVKQRLRHWAQAVACSLMQSH  191



>ref|XP_009111215.1| PREDICTED: uncharacterized protein LOC103836670 [Brassica rapa]
Length=191

 Score =   133 bits (335),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 97/168 (58%), Positives = 116/168 (69%), Gaps = 8/168 (5%)
 Frame = -1

Query  1043  IQRLEHAPPFWRNRKKLSKQLSMCETPRDVAWerrrrqilnqerRKSDAEC----LTDDD  876
             +Q++   PP  + +K+LSKQLSM ET RD AWERRRRQ+L+    K   E     LTD+D
Sbjct  26    LQKMSLEPPRAKPKKRLSKQLSMLETKRDKAWERRRRQMLHHLEMKQINEGGDIDLTDED  85

Query  875   LNELKGCIELGFGFKEEEGQRLCNTLPALDLYFAVNRQFSFSPVSTPGSKGTTLpspsas  696
             L+ELKG IELGFGF EE+GQ+L  TLPALDLYFAVNRQ   SPVST         S   +
Sbjct  86    LSELKGSIELGFGFNEEQGQQLTTTLPALDLYFAVNRQ--ISPVST--PSSGGSSSSRLT  141

Query  695   stggrssslsspgsdsdSWRICSPGENPEHVKIKLRHWAQAVACSVMQ  552
             S G  SSS  SP SDS+  +  SPG+NP+ VK +LRHWAQAVACSV+Q
Sbjct  142   SLGEGSSSFGSPMSDSEGLKFMSPGDNPQQVKTRLRHWAQAVACSVIQ  189



>emb|CDY31128.1| BnaA08g26780D [Brassica napus]
Length=191

 Score =   133 bits (335),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 97/168 (58%), Positives = 116/168 (69%), Gaps = 8/168 (5%)
 Frame = -1

Query  1043  IQRLEHAPPFWRNRKKLSKQLSMCETPRDVAWerrrrqilnqerRKSDAEC----LTDDD  876
             +Q++   PP  + +K+LSKQLSM ET RD AWERRRRQ+L+    K   E     LTD+D
Sbjct  26    LQKMSLEPPRAKPKKRLSKQLSMLETKRDKAWERRRRQMLHHLEMKQINEGGDIDLTDED  85

Query  875   LNELKGCIELGFGFKEEEGQRLCNTLPALDLYFAVNRQFSFSPVSTPGSKGTTLpspsas  696
             L+ELKG IELGFGF EE+GQ+L  TLPALDLYFAVNRQ   SPVST         S   +
Sbjct  86    LSELKGSIELGFGFNEEQGQQLTTTLPALDLYFAVNRQ--ISPVST--PSSGGSSSSRLT  141

Query  695   stggrssslsspgsdsdSWRICSPGENPEHVKIKLRHWAQAVACSVMQ  552
             S G  SSS  SP SDS+  +  SPG+NP+ VK +LRHWAQAVACSV+Q
Sbjct  142   SLGEGSSSFGSPMSDSEGLKFMSPGDNPQQVKTRLRHWAQAVACSVIQ  189



>ref|XP_010463956.1| PREDICTED: uncharacterized protein LOC104744576 [Camelina sativa]
Length=191

 Score =   133 bits (335),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 94/163 (58%), Positives = 114/163 (70%), Gaps = 15/163 (9%)
 Frame = -1

Query  1004  RKKLSKQLSMCETPRDVAWerrrrqilnqerRK----------SDAECLTDDDLNELKGC  855
             +++LSKQLSM ETPRDVAWERRRRQ++  + +K          S    LTD+DLNELKG 
Sbjct  34    KQRLSKQLSMRETPRDVAWERRRRQMIMIQEKKLLHKGISDDISVQMKLTDEDLNELKGS  93

Query  854   IELGFGFKEEEGQRLCNTLPALDLYFAVNRQFSFSPVSTPGSKGTTLpspsasstggrss  675
             IELGFGF EE GQ+LCNTLPALDLYFAVNRQ     VS   S  ++  S  ++ST   S 
Sbjct  94    IELGFGFNEEAGQKLCNTLPALDLYFAVNRQ-----VSPLPSPSSSRSSSVSASTFSNSI  148

Query  674   slsspgsdsdSWRICSPGENPEHVKIKLRHWAQAVACSVMQSY  546
               S   +DSDS +I  PG++P+ +K +LRHWAQAVACSVMQSY
Sbjct  149   PCSPKKTDSDSLKILCPGDDPQQMKQRLRHWAQAVACSVMQSY  191



>emb|CDY48661.1| BnaC07g27480D [Brassica napus]
Length=193

 Score =   133 bits (335),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 92/161 (57%), Positives = 111/161 (69%), Gaps = 8/161 (5%)
 Frame = -1

Query  1004  RKKLSKQLSMCETPRDVAWerrrrqilnqerRKS--------DAECLTDDDLNELKGCIE  849
             +++LSKQLSM ETPRDVAWE+RRRQ+L  + +K         D   LTD+DL ELKG IE
Sbjct  33    KQRLSKQLSMRETPRDVAWEKRRRQMLKIQEKKQKGLSDSDYDPTDLTDEDLRELKGSIE  92

Query  848   LGFGFKEEEGQRLCNTLPALDLYFAVNRQFSFSPVSTPGSKGTTLpspsasstggrsssl  669
             LGFGFKEE G +LCNTLPALDLYFAVNRQ S  P  +             S++   SS  
Sbjct  93    LGFGFKEEAGLKLCNTLPALDLYFAVNRQLSPLPSPSSSRSSNGGDGSLPSTSASSSSIP  152

Query  668   sspgsdsdSWRICSPGENPEHVKIKLRHWAQAVACSVMQSY  546
              SP +DSDS +I  PG++P+ VK +LRHWAQAVACSVMQS+
Sbjct  153   CSPRTDSDSLKILCPGDSPQQVKQRLRHWAQAVACSVMQSH  193



>ref|NP_198221.1| uncharacterized protein [Arabidopsis thaliana]
 gb|AAQ65144.1| At5g28690 [Arabidopsis thaliana]
 dbj|BAD43525.1| unknown protein [Arabidopsis thaliana]
 dbj|BAD43790.1| unknown protein [Arabidopsis thaliana]
 gb|AED93827.1| uncharacterized protein AT5G28690 [Arabidopsis thaliana]
Length=192

 Score =   133 bits (335),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 93/161 (58%), Positives = 116/161 (72%), Gaps = 11/161 (7%)
 Frame = -1

Query  1004  RKKLSKQLSMCETPRDVAWerrrrqilnqerRK--------SDAECLTDDDLNELKGCIE  849
             +++LSKQLSM ETPRDVAWE+RRRQ+L  + +K        +D+  LTD+DL ELKG IE
Sbjct  35    KQRLSKQLSMRETPRDVAWEKRRRQMLKIQEKKQKSVSENDNDSPDLTDEDLRELKGSIE  94

Query  848   LGFGFKEEEGQRLCNTLPALDLYFAVNRQFSFSPVSTPGSKGTTLpspsasstggrsssl  669
             LGFGF EE GQ+LCNTLPALDLYFAVNRQ S  P  +  + G       +S++   SS  
Sbjct  95    LGFGFSEEAGQKLCNTLPALDLYFAVNRQLSPLPSPSSSNGGD---GSLSSTSVSSSSIP  151

Query  668   sspgsdsdSWRICSPGENPEHVKIKLRHWAQAVACSVMQSY  546
              SP +DSDS +I  PG+NP+ VK +LRHWAQAVACS+MQS+
Sbjct  152   CSPKTDSDSLKILCPGDNPQQVKQRLRHWAQAVACSLMQSH  192



>ref|NP_172356.1| uncharacterized protein [Arabidopsis thaliana]
 gb|AAF99768.1|AC003981_18 F22O13.28 [Arabidopsis thaliana]
 gb|AAV68806.1| hypothetical protein AT1G08790 [Arabidopsis thaliana]
 gb|AAX23735.1| hypothetical protein At1g08790 [Arabidopsis thaliana]
 gb|AEE28347.1| uncharacterized protein AT1G08790 [Arabidopsis thaliana]
Length=190

 Score =   133 bits (334),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 99/166 (60%), Positives = 124/166 (75%), Gaps = 4/166 (2%)
 Frame = -1

Query  1043  IQRLEHAPPFWRNRKKLSKQLSMCETPRDVAWerrrrqilnqerRKSDA-ECLTDDDLNE  867
             +Q++   PP  + +K+LSKQLSM ET RD+AWERRRRQ+L+   + ++  + LTD+DL+E
Sbjct  26    LQKMPLEPPKAKAKKRLSKQLSMLETRRDIAWERRRRQMLHHLEKHNEGGDDLTDEDLSE  85

Query  866   LKGCIELGFGFKEEEGQRLCNTLPALDLYFAVNRQFSFSPVSTPGSKGTTLpspsasstg  687
             LKG IELGFGF EE+GQ L  TLPALDLYFAV RQ   SPVSTP   G +  S   +S G
Sbjct  86    LKGSIELGFGFNEEQGQHLTTTLPALDLYFAVTRQ--ISPVSTP-GSGGSSSSSRPTSLG  142

Query  686   grssslsspgsdsdSWRICSPGENPEHVKIKLRHWAQAVACSVMQS  549
              RSSS  SP SDSDS ++ SPG++P+ VK +LRHWAQAVACSV+QS
Sbjct  143   DRSSSFGSPISDSDSLKVMSPGDDPQQVKTRLRHWAQAVACSVIQS  188



>gb|KFK37882.1| hypothetical protein AALP_AA3G041600 [Arabis alpina]
Length=192

 Score =   132 bits (333),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 93/163 (57%), Positives = 115/163 (71%), Gaps = 15/163 (9%)
 Frame = -1

Query  1004  RKKLSKQLSMCETPRDVAWerrrrqilnqerRK----------SDAECLTDDDLNELKGC  855
             +++LSKQLSM ETPRDVAWERRRRQ++  + +K          S+   LTD+DLNELKG 
Sbjct  35    KQRLSKQLSMRETPRDVAWERRRRQMIVIQEKKLLHKGVSDNLSEHTKLTDEDLNELKGS  94

Query  854   IELGFGFKEEEGQRLCNTLPALDLYFAVNRQFSFSPVSTPGSKGTTLpspsasstggrss  675
             IELGFGF EE GQ+LCNTLPALDLYFAV+RQ S        S  ++  S +++ST   S 
Sbjct  95    IELGFGFNEEAGQKLCNTLPALDLYFAVHRQMSPL-----PSPSSSRSSSASASTFSYSI  149

Query  674   slsspgsdsdSWRICSPGENPEHVKIKLRHWAQAVACSVMQSY  546
               S   +DSDS +I  PG++P+ VK +LRHWAQAVACSVMQSY
Sbjct  150   PCSPKKTDSDSLKILCPGDDPQQVKQRLRHWAQAVACSVMQSY  192



>gb|KDO54399.1| hypothetical protein CISIN_1g045489mg [Citrus sinensis]
Length=174

 Score =   131 bits (330),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 100/172 (58%), Positives = 120/172 (70%), Gaps = 35/172 (20%)
 Frame = -1

Query  1043  IQRLEHAP-PFWRNRKKLSKQLSMCETPRDVAWerrrrqilnqerRK-----SDAECLTD  882
             ++R+  AP    +N+K+LSKQLSMCETPRD+AWE+RRRQ+L QERRK     SD + LTD
Sbjct  32    LRRMPLAPTSLNKNKKRLSKQLSMCETPRDIAWEKRRRQMLRQERRKNGIHDSDQDLLTD  91

Query  881   DDLNELKGCIELGFGFKEEEGQRLCNTLPALDLYFAVNRQFSFSPVSTPGSKGTTLpsps  702
             +DL+ELKGCIELGFGF EEEG                       PVSTP S+ +T     
Sbjct  92    EDLHELKGCIELGFGFNEEEG-----------------------PVSTPQSRAST-----  123

Query  701   asstggrssslsspgsdsdSWRICSPGENPEHVKIKLRHWAQAVACSVMQSY  546
              SS GGRSSS  SP SDSD+W+IC+PG+NP+ VK KLRHWAQAVACSVMQS+
Sbjct  124   -SSLGGRSSSFGSPRSDSDAWKICNPGDNPQQVKTKLRHWAQAVACSVMQSF  174



>ref|XP_006836544.1| hypothetical protein AMTR_s00131p00034410 [Amborella trichopoda]
 gb|ERM99397.1| hypothetical protein AMTR_s00131p00034410 [Amborella trichopoda]
Length=255

 Score =   132 bits (332),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 86/157 (55%), Positives = 108/157 (69%), Gaps = 6/157 (4%)
 Frame = -1

Query  1004  RKKLSKQLSMCETPRDVAWerrrrqilnqerRKSD-----AECLTDDDLNELKGCIELGF  840
             +K+L+KQLSM ET R+ AWERRR Q L QE R S         LTD+DL+ELKGCIELGF
Sbjct  97    KKRLTKQLSMFETSREAAWERRRHQFLKQEERSSSFNGFVGRSLTDEDLDELKGCIELGF  156

Query  839   GF-KEEEGQRLCNTLPALDLYFAVNRQFSFSPVSTPGSKGTTLpspsasstggrssslss  663
             GF  + E + LCNTLPALDLY+AVNRQ S S ++T  +      +PS+S     S     
Sbjct  157   GFDHDHEDRTLCNTLPALDLYYAVNRQLSDSKMTTTTASTQEESTPSSSGGQSSSFGSPR  216

Query  662   pgsdsdSWRICSPGENPEHVKIKLRHWAQAVACSVMQ  552
               + S++W+I +PG+NP+HVK +LRHWAQAVACSV Q
Sbjct  217   SPNSSEAWKIFTPGDNPQHVKRRLRHWAQAVACSVRQ  253



>ref|XP_010455192.1| PREDICTED: uncharacterized protein LOC104736831 isoform X1 [Camelina 
sativa]
Length=199

 Score =   129 bits (324),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 92/167 (55%), Positives = 113/167 (68%), Gaps = 14/167 (8%)
 Frame = -1

Query  1004  RKKLSKQLSMCETPRDVAWerrrrqilnqerRK--------SDAECLTDDDLNELKGCIE  849
             +++LSKQLSM ETPRDVAWE+RRRQ+L  + +K        +D   LTD+DL ELKG IE
Sbjct  33    KQRLSKQLSMRETPRDVAWEKRRRQMLKIQEKKQKGVSENDNDPSDLTDEDLRELKGSIE  92

Query  848   LGFGFKEEEGQRLCNTLPALDLYFAVNRQFSFSPVSTPGSKGTTLpspsasstggrsssl  669
             LGFGF EE GQ+LCNTLPALDLYFAVNRQ S  P  +            +S++   SS  
Sbjct  93    LGFGFNEEAGQKLCNTLPALDLYFAVNRQLSPLPSPSSSRSSNGGDGSLSSTSASSSSIP  152

Query  668   sspgsdsdSWRICSP------GENPEHVKIKLRHWAQAVACSVMQSY  546
              SP +DSDS +I  P      G+NP+ VK +LRHWAQAVACS+MQS+
Sbjct  153   CSPKTDSDSLKILCPGKQKFQGDNPQQVKQRLRHWAQAVACSLMQSH  199



>ref|XP_008355880.1| PREDICTED: uncharacterized protein LOC103419557 [Malus domestica]
Length=241

 Score =   130 bits (327),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 97/144 (67%), Positives = 108/144 (75%), Gaps = 8/144 (6%)
 Frame = -1

Query  1040  QRLEHAPPFWRNRKKLSKQLSMCETPRDVAWerrrrqilnqerR-----KSDAECLTDDD  876
             Q +  APP   +RK+LSKQLSMCETPRD+AWERR+RQIL+QERR      SD   LTD+D
Sbjct  28    QHMPLAPPKTLSRKRLSKQLSMCETPRDIAWERRQRQILSQERRMNGIRDSDDMHLTDED  87

Query  875   LNELKGCIELGFGFKEEEGQRLCNTLPALDLYFAVNRQFSFSPVSTPGSKGTTLpspsas  696
             L+ELKGCIELGFGF EEEGQRL  TLPALDLYFAVNRQFS SP STP S        S S
Sbjct  88    LHELKGCIELGFGFNEEEGQRLSATLPALDLYFAVNRQFSPSPASTPNSASA---RHSTS  144

Query  695   stggrssslsspgsdsdSWRICSP  624
             S GG  SS  SP SD+D+W+ICSP
Sbjct  145   SMGGHYSSFGSPRSDTDAWKICSP  168



>ref|XP_010494108.1| PREDICTED: uncharacterized protein LOC104771301 isoform X1 [Camelina 
sativa]
Length=197

 Score =   127 bits (320),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 93/167 (56%), Positives = 115/167 (69%), Gaps = 16/167 (10%)
 Frame = -1

Query  1004  RKKLSKQLSMCETPRDVAWerrrrqilnqerRK--------SDAECLTDDDLNELKGCIE  849
             +++LSKQLSM ETPRDVAWE+RRRQ+L  + +K        +D   LTD+DL ELKG IE
Sbjct  33    KQRLSKQLSMRETPRDVAWEKRRRQMLKIQEKKQKGVSENDNDPSDLTDEDLRELKGSIE  92

Query  848   LGFGFKEEEGQRLCNTLPALDLYFAVNRQFSFSPVSTPGSKGTTLpspsasstggrsssl  669
             LGFGF EE GQ+LCNTLPALDLYFAVNRQ S  P  +  S  ++     + S+   SS  
Sbjct  93    LGFGFNEEAGQKLCNTLPALDLYFAVNRQLSPLPSPS--SSRSSNGGDGSLSSASSSSIP  150

Query  668   sspgsdsdSWRICSP------GENPEHVKIKLRHWAQAVACSVMQSY  546
              SP +DSDS +I  P      G+NP+ VK +LRHWAQAVACS+MQS+
Sbjct  151   CSPKTDSDSLKILCPGKQKFQGDNPQQVKQRLRHWAQAVACSLMQSH  197



>emb|CDX95033.1| BnaC05g06380D [Brassica napus]
Length=191

 Score =   125 bits (315),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 93/153 (61%), Positives = 110/153 (72%), Gaps = 7/153 (5%)
 Frame = -1

Query  998  KLSKQLSMCETPRDVAWerrrrqilnqerRKSDAEC----LTDDDLNELKGCIELGFGFK  831
            +LSKQLSM ET RD+AWERRRRQ+L+  +RK   E     LTD+DL+ELKG IELGFGF 
Sbjct  40   RLSKQLSMLETKRDIAWERRRRQMLHHLQRKQINEGEDIDLTDEDLSELKGSIELGFGFN  99

Query  830  EEEGQRLCNTLPALDLYFAVNRQFSFSPVSTPGSKGTTLpspsasstggrssslsspgsd  651
            EE+GQ+L  TLPALDLYFAV RQ   SPVSTPGS G++  S   S     SS  S     
Sbjct  100  EEQGQQLTTTLPALDLYFAVTRQ--ISPVSTPGSSGSS-SSRLTSLGDHSSSFGSPISDS  156

Query  650  sdSWRICSPGENPEHVKIKLRHWAQAVACSVMQ  552
            SD  ++ SPG+NP+ VK +LRHWAQAVACSV+Q
Sbjct  157  SDGLKLLSPGDNPQQVKTRLRHWAQAVACSVIQ  189



>emb|CDX93537.1| BnaA06g05110D [Brassica napus]
Length=191

 Score =   125 bits (315),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 90/153 (59%), Positives = 106/153 (69%), Gaps = 7/153 (5%)
 Frame = -1

Query  998  KLSKQLSMCETPRDVAWerrrrqilnqerRKSDAEC----LTDDDLNELKGCIELGFGFK  831
            +LSKQLSM ET RD+AWERRRRQ+L+  +RK   E     LTD+DL+ELKG IELGFGF 
Sbjct  40   RLSKQLSMLETKRDIAWERRRRQVLHHLQRKQINEGGDIDLTDEDLSELKGSIELGFGFN  99

Query  830  EEEGQRLCNTLPALDLYFAVNRQFSFSPVSTPGSKGTTLpspsasstggrssslsspgsd  651
            EE+GQ+L  TLPALDLYFAV RQ   SPVSTP     +  S   S     SS  S     
Sbjct  100  EEQGQQLTTTLPALDLYFAVTRQ--ISPVSTP-GSSGSSSSRLTSLGDHSSSFGSPISDS  156

Query  650  sdSWRICSPGENPEHVKIKLRHWAQAVACSVMQ  552
            SD  ++ SPG+NP+ VK +LRHWAQAVACSV+Q
Sbjct  157  SDGLKLLSPGDNPQQVKTRLRHWAQAVACSVIQ  189



>emb|CDY41891.1| BnaC05g47130D [Brassica napus]
Length=146

 Score =   122 bits (306),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 81/151 (54%), Positives = 102/151 (68%), Gaps = 12/151 (8%)
 Frame = -1

Query  977  MCETPRDVAWerrrrqilnqerRK-------SDAECLTDDDLNELKGCIELGFGFKEEEG  819
            MCE+PRD+AWERR+RQ++  + +K       S+ + LTD+DLNELKG IELGFGF EE G
Sbjct  1    MCESPRDIAWERRKRQMIMIQEKKMRVSDNLSEQKKLTDEDLNELKGSIELGFGFNEEAG  60

Query  818  QRLCNTLPALDLYFAVNRQFSFSPVSTPGSKGTTLpspsasstggrssslsspgsdsdSW  639
            Q+LCNTLPALDLYFAVNR  S     +     +      ++S    S   S   +DSDS 
Sbjct  61   QKLCNTLPALDLYFAVNRHLSPLASPSSSRSSSA-----SASVFSMSIPCSPKKTDSDSL  115

Query  638  RICSPGENPEHVKIKLRHWAQAVACSVMQSY  546
            +IC  G+NP+ VK +LRHWAQAVAC VMQ+Y
Sbjct  116  KICCFGDNPQQVKQRLRHWAQAVACYVMQTY  146



>ref|XP_009148230.1| PREDICTED: uncharacterized protein LOC103871703 [Brassica rapa]
Length=192

 Score =   123 bits (309),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 89/154 (58%), Positives = 106/154 (69%), Gaps = 8/154 (5%)
 Frame = -1

Query  998  KLSKQLSMCETPRDVAWerrrrqilnqerRKSDAE-----CLTDDDLNELKGCIELGFGF  834
            +LSKQLSM ET RD+AWER RRQ+L    ++          LTD+DL+ELKG IELGFGF
Sbjct  40   RLSKQLSMLETKRDIAWERHRRQMLQYHLQRKQINERGDIDLTDEDLSELKGSIELGFGF  99

Query  833  KEEEGQRLCNTLPALDLYFAVNRQFSFSPVSTPGSKGTTLpspsasstggrssslsspgs  654
             EE+GQ+L  TLPALDLYFAV RQ   SPVSTPGS G++  S   S     SS  S    
Sbjct  100  NEEQGQQLTTTLPALDLYFAVTRQ--ISPVSTPGSSGSS-SSRLTSLGDHSSSFGSPISD  156

Query  653  dsdSWRICSPGENPEHVKIKLRHWAQAVACSVMQ  552
             SD  ++ SPG+NP+ VK +LRHWAQAVACSV+Q
Sbjct  157  SSDGLKLLSPGDNPQQVKTRLRHWAQAVACSVIQ  190



>ref|NP_001189808.1| carboxylate clamp-tetratricopeptide repeat protein [Arabidopsis 
thaliana]
 gb|AEE74124.1| carboxylate clamp-tetratricopeptide repeat protein [Arabidopsis 
thaliana]
Length=680

 Score =   129 bits (324),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 91/159 (57%), Positives = 113/159 (71%), Gaps = 15/159 (9%)
 Frame = -1

Query  1004  RKKLSKQLSMCETPRDVAWerrrrqilnqerRK------SDAEC----LTDDDLNELKGC  855
             + +LSKQLSMCETPRDVAWERRRRQ++  + +K      SD  C    LTD+DLNELKG 
Sbjct  34    KHRLSKQLSMCETPRDVAWERRRRQMIMIQEKKLLHKGASDNLCIQANLTDEDLNELKGS  93

Query  854   IELGFGFKEEEGQRLCNTLPALDLYFAVNRQFSFSPVSTPGSKGTTLpspsasstggrss  675
             IELGFGF EE GQ+LCNTLPALDLYFAVNRQ S  P  +     ++  S +++ST   S 
Sbjct  94    IELGFGFNEEAGQKLCNTLPALDLYFAVNRQLSPLPSPS-----SSRSSSASASTFSYSI  148

Query  674   slsspgsdsdSWRICSPGENPEHVKIKLRHWAQAVACSV  558
               S   +DSDS +I  PG++P+ +K +LRHWAQAVACS+
Sbjct  149   PCSPKKTDSDSVKILCPGDDPQQMKQRLRHWAQAVACSI  187



>ref|XP_008804527.1| PREDICTED: uncharacterized protein LOC103717790 [Phoenix dactylifera]
Length=234

 Score =   120 bits (302),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 92/196 (47%), Positives = 114/196 (58%), Gaps = 38/196 (19%)
 Frame = -1

Query  1022  PPFWR---------NRKKL-SKQLSMCETPRDVAWerrrrqilnqerR------------  909
             PP W           RK+L +KQLSM ET R+  WE+RRRQIL++ +             
Sbjct  37    PPTWEKARGVAGVGGRKRLLTKQLSMRETTREAKWEKRRRQILHRRQMVDGESSPINCGG  96

Query  908   ------KSDAECLTDDDLNELKGCIELGFGFKEEEG-QRLCNTLPALDLYFAVNRQFSF-  753
                    S    LTD+D +EL G IELGFGF EE+G   LC+TLPALDLYFAVNRQ S  
Sbjct  97    GRLSRLGSRVRSLTDEDWDELMGSIELGFGFNEEDGGHDLCDTLPALDLYFAVNRQLSDP  156

Query  752   ------SPVSTPGSKGTTLpsp--sasstggrssslsspgsdsdSWRICSPGENPEHVKI  597
                   SP STP +  ++  +   S S +        S  S S+SW+IC+PG+NP+HVK 
Sbjct  157   RLRSSPSPASTPTAATSSASTVCGSLSPSSPLEPHQHSHSSPSESWKICNPGDNPQHVKT  216

Query  596   KLRHWAQAVACSVMQS  549
             +LRHWAQAVACSV QS
Sbjct  217   RLRHWAQAVACSVRQS  232



>ref|XP_010917332.1| PREDICTED: uncharacterized protein LOC105041955 [Elaeis guineensis]
Length=227

 Score =   119 bits (297),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 87/194 (45%), Positives = 110/194 (57%), Gaps = 37/194 (19%)
 Frame = -1

Query  1022  PPFWRN----------RKKLSKQLSMCETPRDVAWerrrrqilnqerRKSD---------  900
             PP W            ++ L+KQLSM ET R+  WE+RR QIL++ +   D         
Sbjct  32    PPTWETARGVAGVGGRKRLLTKQLSMRETTREAKWEKRRWQILHRRQMTGDESSPINGGG  91

Query  899   ---------AECLTDDDLNELKGCIELGFGFKEEEG-QRLCNTLPALDLYFAVNRQFSF-  753
                         LTD+D +EL G IELGFGF EE+G   LC+TLPALDLYFAVNRQ S  
Sbjct  92    GRMSRLGSRVRSLTDEDWDELMGSIELGFGFNEEDGGHDLCDTLPALDLYFAVNRQLSDP  151

Query  752   ------SPVSTP-GSKGTTLpspsasstggrssslsspgsdsdSWRICSPGENPEHVKIK  594
                   SP STP  +   +  S S S +        S  S S++W+IC+PG++P+HVK +
Sbjct  152   KLRSSPSPASTPTATSSASTVSGSPSPSSPHEPHQHSHSSPSEAWKICNPGDSPQHVKTR  211

Query  593   LRHWAQAVACSVMQ  552
             LRHWAQAVACSV Q
Sbjct  212   LRHWAQAVACSVRQ  225



>ref|XP_009381776.1| PREDICTED: uncharacterized protein LOC103969862 [Musa acuminata 
subsp. malaccensis]
Length=256

 Score =   119 bits (297),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 88/187 (47%), Positives = 111/187 (59%), Gaps = 37/187 (20%)
 Frame = -1

Query  1007  NRKKL-SKQLSMCETPRDVAWerrrrqilnqerRKSD-----------------------  900
             N+K+L SKQLSM ET R+V WE+RRRQIL      ++                       
Sbjct  72    NKKRLLSKQLSMKETKREVKWEKRRRQILQSRHMMTERGGKEEEEEDEDEAGDGGERRAT  131

Query  899   --AECLTDDDLNELKGCIELGFGFKEEEG-QRLCNTLPALDLYFAVNRQ-------FSFS  750
                  LTD+DL+EL+G IELGFGF EEEG   L +TLPALDLYFAVNRQ       FS S
Sbjct  132   KRVRNLTDEDLDELRGSIELGFGFNEEEGGHDLLDTLPALDLYFAVNRQLSDIKIPFSPS  191

Query  749   PVSTPGSKGTTLpspsasstggrssslsspgsdsdSWRICSPGENPEHVKIKLRHWAQAV  570
             P+++P +  T     +   +    S     G  S+SW+IC+PG++P+HVK +LRHWAQAV
Sbjct  192   PMTSPTTASTP---STLCGSPSPRSPDEHSGGPSESWKICNPGDDPQHVKTRLRHWAQAV  248

Query  569   ACSVMQS  549
             ACSV QS
Sbjct  249   ACSVRQS  255



>ref|XP_003579539.1| PREDICTED: uncharacterized protein LOC100835369 [Brachypodium 
distachyon]
Length=221

 Score =   117 bits (294),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 88/171 (51%), Positives = 108/171 (63%), Gaps = 19/171 (11%)
 Frame = -1

Query  1004  RKKLSKQLSMCETPRDVAWerrrrqilnqerRKSDA-----------ECLTDDDLNELKG  858
             ++ LSKQLSM ET R+V WE+RRRQI  Q    SDA           + +TD+DL+ELKG
Sbjct  50    KRTLSKQLSMKETTREVKWEKRRRQIQRQRSNMSDAADHVCTVHANAKGVTDEDLDELKG  109

Query  857   CIELGFGFKEEEG-QRLCNTLPALDLYFAVNRQFS-------FSPVSTPGSKGTTLpsps  702
              +ELGFGF EE G Q LC+TLPALDLYFAVNRQFS        S  S P     T  + +
Sbjct  110   SMELGFGFNEENGGQNLCDTLPALDLYFAVNRQFSNPKMWASSSNKSLPSLSLPTRSTST  169

Query  701   asstggrssslsspgsdsdSWRICSPGENPEHVKIKLRHWAQAVACSVMQS  549
              S+T   + S ++  S  DS +ICSPGENP+ +K +LR WAQ VACSV  S
Sbjct  170   FSATSSPAGSPTAQPSLLDSLQICSPGENPKLMKTRLRQWAQVVACSVKHS  220



>ref|XP_008799974.1| PREDICTED: uncharacterized protein LOC103714485 [Phoenix dactylifera]
Length=230

 Score =   117 bits (292),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 78/179 (44%), Positives = 98/179 (55%), Gaps = 28/179 (16%)
 Frame = -1

Query  1004  RKKLSKQLSMCETPRDVAWer-------------------rrrqilnqerRKSDAECLTD  882
             ++ L+KQLSM ET R+  WE+                         +  R  +    LTD
Sbjct  50    KRLLTKQLSMRETRREAKWEKRRRQILRRRRMMGGEGDEESSPIDRDGRRLSARVRSLTD  109

Query  881   DDLNELKGCIELGFGFKEEEG-QRLCNTLPALDLYFAVNRQFSF-------SPVSTP-GS  729
             +D +EL G IELGFGF EE+G   LC+TLPALDLYFAVNRQ S        SP STP  +
Sbjct  110   EDWDELMGSIELGFGFNEEDGGHHLCDTLPALDLYFAVNRQLSDPKLRSSPSPASTPTAT  169

Query  728   KGTTLpspsasstggrssslsspgsdsdSWRICSPGENPEHVKIKLRHWAQAVACSVMQ  552
                +    S            S  S ++SW+IC+PG+NP+HVK +LRHWAQAVACSV Q
Sbjct  170   SSASTLCSSPGPASPLEPHQHSHSSPNESWKICNPGDNPQHVKTRLRHWAQAVACSVRQ  228



>ref|XP_009402029.1| PREDICTED: uncharacterized protein LOC103985897 [Musa acuminata 
subsp. malaccensis]
Length=234

 Score =   113 bits (282),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 69/115 (60%), Positives = 86/115 (75%), Gaps = 1/115 (1%)
 Frame = -1

Query  890  LTDDDLNELKGCIELGFGFKEEEG-QRLCNTLPALDLYFAVNRQFSFSPVSTPGSKGTTL  714
            LTD+DL+EL+G I+LGFGF EEEG Q LC+TLPAL+LYFAVNRQ S   +    S  +T 
Sbjct  119  LTDEDLDELRGSIDLGFGFNEEEGGQDLCDTLPALNLYFAVNRQLSDPKIQLSPSPASTP  178

Query  713  pspsasstggrssslsspgsdsdSWRICSPGENPEHVKIKLRHWAQAVACSVMQS  549
             + S+SST     S  SP   SDSW+IC+PG++P+HVK +LRHWAQAVACS+ QS
Sbjct  179  TATSSSSTLCGLPSPRSPNEQSDSWKICNPGDSPQHVKTRLRHWAQAVACSLRQS  233



>ref|XP_006648617.1| PREDICTED: uncharacterized protein LOC102700688 [Oryza brachyantha]
Length=229

 Score =   112 bits (281),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 81/175 (46%), Positives = 107/175 (61%), Gaps = 24/175 (14%)
 Frame = -1

Query  1010  RNRKKLSKQLSMCETPRDVAWerrrrqilnqerRKSDAE---------------CLTDDD  876
             + R+ LSKQLSM ET R+  WE+RRRQIL +    +  E               CLTD+D
Sbjct  51    KQRRLLSKQLSMKETTREAKWEKRRRQILRRSSMVAVNEAGGLGRSPVDERAQRCLTDED  110

Query  875   LNELKGCIELGFGFKEEEG-QRLCNTLPALDLYFAVNRQFS--------FSPVSTPGSKG  723
             L+EL+G  ELGFGF EE+G   LC+TLPALDLYFAVNRQ S         S   +P +  
Sbjct  111   LDELRGSFELGFGFDEEKGGTDLCDTLPALDLYFAVNRQLSDPKLRSASTSAAVSPTAAL  170

Query  722   TTLpspsasstggrssslsspgsdsdSWRICSPGENPEHVKIKLRHWAQAVACSV  558
             ++  +  + ++  RS   SS  + +D+W I SPG+NP+ +K +LRHWAQ VACSV
Sbjct  171   SSSSTLVSDTSIPRSPDGSSSPAPADAWTIFSPGDNPQLMKTRLRHWAQVVACSV  225



>ref|XP_002447594.1| hypothetical protein SORBIDRAFT_06g005440 [Sorghum bicolor]
 gb|EES11922.1| hypothetical protein SORBIDRAFT_06g005440 [Sorghum bicolor]
Length=239

 Score =   112 bits (279),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 80/186 (43%), Positives = 106/186 (57%), Gaps = 34/186 (18%)
 Frame = -1

Query  1007  NRKKLSKQLSMCETPRDVAWerrrr---------------------------qilnqerR  909
             N+K+LSKQ+SM ET R+V WE+RRR                              +    
Sbjct  54    NKKRLSKQVSMKETTREVKWEKRRRQIQRQRSSMRLNEADDRAGSRTVCHVDSEASSSAE  113

Query  908   KSDAECLTDDDLNELKGCIELGFGFKEEEG-QRLCNTLPALDLYFAVNRQFS-----FSP  747
             +  ++ +TD+DL+EL+G ++LGF F E +G Q LC+TLPALD+YFAVNRQ S     FS 
Sbjct  114   RVSSKRITDEDLDELRGSMDLGFRFDEHKGGQDLCDTLPALDIYFAVNRQLSEPKMRFST  173

Query  746   VSTPGSKGTTLpspsasstggrssslsspgsdsdSWRICSPGENPEHVKIKLRHWAQAVA  567
              S P S   T  SP+   T    S  +   +  +SW+ICSPG+NP+ VK +LRHWAQ VA
Sbjct  174   SSAP-SLLATKSSPNLCGTPSPGSPSTHSNNPLESWKICSPGDNPQLVKTRLRHWAQVVA  232

Query  566   CSVMQS  549
             CSV  S
Sbjct  233   CSVKHS  238



>ref|XP_004975096.1| PREDICTED: uncharacterized protein LOC101758026 [Setaria italica]
Length=239

 Score =   112 bits (279),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 82/185 (44%), Positives = 106/185 (57%), Gaps = 32/185 (17%)
 Frame = -1

Query  1007  NRKKLSKQLSMCETPRDVAWerrrrqi----------------------------lnqer  912
             N+KKL+KQLSM ET R+V WE+RRRQI                                 
Sbjct  54    NKKKLTKQLSMKETTREVKWEKRRRQIQRQRSSMGLHEADDNTAAGGGGACPGDGEASSS  113

Query  911   RKSDAECLTDDDLNELKGCIELGFGFKEEEG-QRLCNTLPALDLYFAVNRQFSFSPVSTP  735
              +  A+ LTD+DL+ELKG ++LGF F E++G Q LC+TLPALDLYFAVNRQ S   +   
Sbjct  114   TERVAKRLTDEDLDELKGSMDLGFRFDEQKGGQDLCDTLPALDLYFAVNRQLSEPKMRWS  173

Query  734   GSKGTTLpspsasstggrs---sslsspgsdsdSWRICSPGENPEHVKIKLRHWAQAVAC  564
              S   +L +  +S     +    S  +  +  DSW+ICSPG+NP+ VK +LRHWAQ VAC
Sbjct  174   TSSAPSLSATKSSPNLCGTPCPGSPCAHSNPMDSWKICSPGDNPQLVKTRLRHWAQVVAC  233

Query  563   SVMQS  549
             SV  S
Sbjct  234   SVKHS  238



>dbj|BAK03871.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=214

 Score =   111 bits (277),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 85/170 (50%), Positives = 103/170 (61%), Gaps = 18/170 (11%)
 Frame = -1

Query  1004  RKKLSKQLSMCETPRDVAWerrrrqilnqerR-----------KSDAECLTDDDLNELKG  858
             ++ LSKQLSM ET R+V WE+RRRQI  Q               ++A  +TD+DL+ELKG
Sbjct  44    KRMLSKQLSMKETTREVKWEKRRRQIQRQRSSMGLYDADRVNMHTNANGVTDEDLDELKG  103

Query  857   CIELGFGFKEEEG-QRLCNTLPALDLYFAVNRQFS-----FSPVSTPGSKGTTLpspsas  696
              +ELGFGF EE G Q LC+TLPALDLYFAVNRQ S         S P     T  S   S
Sbjct  104   SMELGFGFNEESGGQNLCDTLPALDLYFAVNRQLSEPKMRVCSRSLPSLCVATSSSSMHS  163

Query  695   stggrssslsspgsdsdSWRICSP-GENPEHVKIKLRHWAQAVACSVMQS  549
              T   + S ++  S  DS +ICSP GENP+ +K +LR WAQ VACSV  S
Sbjct  164   GTPSPAGSPTAQPSLLDSLKICSPAGENPQLIKTRLRQWAQVVACSVKHS  213



>ref|XP_009410247.1| PREDICTED: uncharacterized protein LOC103992328 [Musa acuminata 
subsp. malaccensis]
Length=228

 Score =   110 bits (275),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 66/122 (54%), Positives = 84/122 (69%), Gaps = 8/122 (7%)
 Frame = -1

Query  890  LTDDDLNELKGCIELGFGFKEEEG-QRLCNTLPALDLYFAVNRQFS----FSPVSTPGSK  726
            LTD+DL+EL+G I+LGFGF EEEG   LC+TLPAL+LYFAVNR+FS      P+ +P   
Sbjct  106  LTDEDLDELRGSIDLGFGFNEEEGGHDLCDTLPALNLYFAVNREFSDPPKLQPLPSPPDS  165

Query  725  ---GTTLpspsasstggrssslsspgsdsdSWRICSPGENPEHVKIKLRHWAQAVACSVM  555
                T+  S   S  G  S +  S    +DSW+IC PG++P+HVK +LRHWAQAVACS+ 
Sbjct  166  TPVATSSWSTLCSIPGPPSPNEPSQPGSTDSWKICHPGDSPQHVKTRLRHWAQAVACSLR  225

Query  554  QS  549
            QS
Sbjct  226  QS  227



>ref|NP_001052367.1| Os04g0282200 [Oryza sativa Japonica Group]
 emb|CAD39790.2| OSJNBa0071G03.3 [Oryza sativa Japonica Group]
 dbj|BAF14281.1| Os04g0282200 [Oryza sativa Japonica Group]
 emb|CAH66050.1| OSIGBa0131F24.4 [Oryza sativa Indica Group]
 gb|EAY93399.1| hypothetical protein OsI_15196 [Oryza sativa Indica Group]
 dbj|BAG97271.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|AFI71849.1| hypothetical protein [Oryza sativa]
Length=237

 Score =   110 bits (275),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 85/184 (46%), Positives = 106/184 (58%), Gaps = 32/184 (17%)
 Frame = -1

Query  1004  RKKLSKQLSMCETPRDVAWerrrr-----------------qilnqerRKSDAEC-----  891
             ++ LSKQLSM ET R+V WE+RRR                    N     +D+E      
Sbjct  53    KRILSKQLSMKETTREVKWEKRRRQIHRQRSSMALQDVEEEASANMFAATTDSEMGSSTE  112

Query  890   -----LTDDDLNELKGCIELGFGFKEEEG-QRLCNTLPALDLYFAVNRQFSFSPVSTPGS  729
                  LTD DL+EL+G +ELGFGF EE G Q LC+TLPALDLYFAVNRQ S   +    S
Sbjct  113   RVPKRLTDGDLDELRGSMELGFGFDEENGGQNLCDTLPALDLYFAVNRQLSEPKMRLSTS  172

Query  728   KGTTLpspsasstggrsssl----sspgsdsdSWRICSPGENPEHVKIKLRHWAQAVACS  561
                +  S ++SS+    +S      +P S  DSW+ICSPG+NP+ VK +LRHWAQ VACS
Sbjct  173   SLPSPTSATSSSSTLGGTSNPGSPVAPSSFMDSWKICSPGDNPQLVKTRLRHWAQVVACS  232

Query  560   VMQS  549
             V  S
Sbjct  233   VKHS  236



>ref|NP_001143700.1| uncharacterized protein LOC100276437 [Zea mays]
 gb|ACG34348.1| hypothetical protein [Zea mays]
Length=242

 Score =   109 bits (273),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 83/187 (44%), Positives = 107/187 (57%), Gaps = 34/187 (18%)
 Frame = -1

Query  1007  NRKKLSKQLSMCETPRDVAWerrrrqilnqerR-----------------------KSDA  897
             N+K+LSKQLSM ET R+V WE+R+RQI  Q                           S A
Sbjct  55    NKKRLSKQLSMKETTREVKWEKRKRQIQRQRSSMRLSEADDRAGGSIAVCPVDGEASSSA  114

Query  896   E----CLTDDDLNELKGCIELGFGFKEEEG-QRLCNTLPALDLYFAVNRQFSFSPVSTPG  732
             E     +TD DL+EL+G ++LGF F E++G Q LC+TLPALD YFAVNRQ S   +S P 
Sbjct  115   ERVATGITDGDLDELRGSMDLGFRFDEQKGGQDLCDTLPALDFYFAVNRQVSEPRMSFPT  174

Query  731   S--KGTTLpspsas----stggrssslsspgsdsdSWRICSPGENPEHVKIKLRHWAQAV  570
             S   G +L +  +S     T    S  +   +  +SW+IC+PG+NP  VK +LRHWAQ V
Sbjct  175   STSSGPSLSATKSSPNLCGTPSPGSPGAHSSNALESWKICNPGDNPLLVKTRLRHWAQVV  234

Query  569   ACSVMQS  549
             ACSV  S
Sbjct  235   ACSVKHS  241



>ref|XP_009409568.1| PREDICTED: uncharacterized protein LOC103991751 [Musa acuminata 
subsp. malaccensis]
Length=230

 Score =   108 bits (271),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 85/182 (47%), Positives = 110/182 (60%), Gaps = 30/182 (16%)
 Frame = -1

Query  1004  RKKLSKQLSMCETPRDVAWerrrrqilnqerRKSDA------------------------  897
             ++ LSKQLSM ET R+  WE+RRRQ L++     +A                        
Sbjct  48    KRLLSKQLSMRETTREAKWEKRRRQTLHRRHMMMEAGNDEEKAVEKEPGDDGERRLSGRV  107

Query  896   ECLTDDDLNELKGCIELGFGFKEEEG-QRLCNTLPALDLYFAVNRQFSFSPVSTPGSKGT  720
             + LTD+DL+EL+GCIELGFGF EEEG   L +TLPALDLYFAVNRQ S   + +  S  +
Sbjct  108   KSLTDEDLDELRGCIELGFGFSEEEGGHDLRHTLPALDLYFAVNRQVSDPKLWSSPSPAS  167

Query  719   TLpspsasst-----ggrssslsspgsdsdSWRICSPGENPEHVKIKLRHWAQAVACSVM  555
             T  S S+ ST       RS    +    S++W+I +PG+NP+HVK +LRHWAQAVACS+ 
Sbjct  168   TPTSTSSPSTLCGPLSPRSPDEQTRSGSSEAWKIFNPGDNPQHVKARLRHWAQAVACSLK  227

Query  554   QS  549
             QS
Sbjct  228   QS  229



>ref|XP_009407592.1| PREDICTED: uncharacterized protein LOC103990240 [Musa acuminata 
subsp. malaccensis]
Length=239

 Score =   108 bits (270),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 86/183 (47%), Positives = 109/183 (60%), Gaps = 30/183 (16%)
 Frame = -1

Query  1004  RKKLSKQLSMCETPRDVAWerrrrqilnqerR------------------------KSDA  897
             R+ LSKQLSM ET  +  WE+RRRQIL   R                             
Sbjct  57    RRLLSKQLSMRETRMEAKWEKRRRQILQTRRLMEGGGRGEGGGGDEEATEGSERRLDGRT  116

Query  896   ECLTDDDLNELKGCIELGFGFKEEEG-QRLCNTLPALDLYFAVNRQFSFSPVSTPGSKGT  720
               LTD+DL+EL+G I+LGFGF EEEG Q LC+TLPAL+LYFAVNRQ S   + +  S  +
Sbjct  117   RSLTDEDLDELRGSIDLGFGFNEEEGGQGLCDTLPALNLYFAVNRQLSDPKLQSSPSPAS  176

Query  719   TLpspsasstgg-----rssslsspgsdsdSWRICSPGENPEHVKIKLRHWAQAVACSVM  555
             T  + S+SS        RS +  S    SD W+IC+PG++P+HVK +LRHWAQAVACS+ 
Sbjct  177   TPTATSSSSALDGLPSPRSPNEQSQSGASDCWKICNPGDSPQHVKTRLRHWAQAVACSLR  236

Query  554   QSY  546
             QS+
Sbjct  237   QSW  239



>tpg|DAA38425.1| TPA: hypothetical protein ZEAMMB73_542900 [Zea mays]
Length=332

 Score =   110 bits (274),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 83/187 (44%), Positives = 107/187 (57%), Gaps = 34/187 (18%)
 Frame = -1

Query  1007  NRKKLSKQLSMCETPRDVAWerrrrqilnqerR-----------KSDAEC----------  891
             N+K+LSKQLSM ET R+V WE+R+RQI  Q               S A C          
Sbjct  145   NKKRLSKQLSMKETTREVKWEKRKRQIQRQRSSMRLSEADDRAGGSTAVCPVDGEASSSA  204

Query  890   ------LTDDDLNELKGCIELGFGFKEEEG-QRLCNTLPALDLYFAVNRQFSFSPVSTPG  732
                   +TD DL+EL+G ++LGF F E++G Q LC+TLPALD YFAVNRQ S   +S P 
Sbjct  205   ERVATGITDGDLDELRGSMDLGFRFDEQKGGQDLCDTLPALDFYFAVNRQVSEPRMSFPT  264

Query  731   S--KGTTLpspsas----stggrssslsspgsdsdSWRICSPGENPEHVKIKLRHWAQAV  570
             S   G +L +  +S     T    S  +   +  +SW+IC+PG+NP  VK +LRHWAQ V
Sbjct  265   STSSGPSLSATKSSPNLCGTPSPGSPGAHSSNALESWKICNPGDNPLLVKTRLRHWAQVV  324

Query  569   ACSVMQS  549
             ACSV  S
Sbjct  325   ACSVKHS  331



>ref|XP_010932317.1| PREDICTED: uncharacterized protein LOC105053018 [Elaeis guineensis]
Length=231

 Score =   105 bits (262),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 79/179 (44%), Positives = 97/179 (54%), Gaps = 28/179 (16%)
 Frame = -1

Query  1004  RKKLSKQLSMCETPRDVAWerrrrqil-------------------nqerRKSDAECLTD  882
             ++ L+KQLSM ET R+  WE+RRRQIL                              LTD
Sbjct  51    KRLLTKQLSMRETRREAKWEKRRRQILRRRMMEGEGEEEESPINSCGGGTLSGRVRSLTD  110

Query  881   DDLNELKGCIELGFGFKEEEG-QRLCNTLPALDLYFAVNRQFS--------FSPVSTPGS  729
             +D +EL G IELGFGF EE+G   LC+TLPALDLYFAVNRQ S            +   +
Sbjct  111   EDWDELMGSIELGFGFNEEDGGHHLCDTLPALDLYFAVNRQLSDPKLRFSPSPASTPTTT  170

Query  728   KGTTLpspsasstggrssslsspgsdsdSWRICSPGENPEHVKIKLRHWAQAVACSVMQ  552
                +    S            S  S S+SW+IC+PG+NP+HVK +LRHWAQAVACSV Q
Sbjct  171   SSESTLCSSPGPASPVEPHQHSHSSPSESWKICNPGDNPQHVKTRLRHWAQAVACSVRQ  229



>ref|XP_010468011.1| PREDICTED: uncharacterized protein LOC104748012, partial [Camelina 
sativa]
Length=166

 Score =   103 bits (256),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 61/92 (66%), Positives = 70/92 (76%), Gaps = 10/92 (11%)
 Frame = -1

Query  1004  RKKLSKQLSMCETPRDVAWerrrrqilnqerRK----------SDAECLTDDDLNELKGC  855
             +++LSKQLSM ETPRDVAWERRRRQ++  + +K          S    LTD+DLNELKG 
Sbjct  34    KQRLSKQLSMRETPRDVAWERRRRQMIMIQEKKLLHKGISDDISVQMKLTDEDLNELKGS  93

Query  854   IELGFGFKEEEGQRLCNTLPALDLYFAVNRQF  759
             IELGFGF EE GQ+LCNTLPALDLYFAVNRQ 
Sbjct  94    IELGFGFNEEAGQKLCNTLPALDLYFAVNRQV  125



>gb|KFK35975.1| hypothetical protein AALP_AA4G062200 [Arabis alpina]
Length=121

 Score =   100 bits (250),  Expect = 6e-22, Method: Composition-based stats.
 Identities = 69/106 (65%), Positives = 82/106 (77%), Gaps = 4/106 (4%)
 Frame = -1

Query  890  LTDDDLNELKGCIELGFGFKEEEGQRLCNTLPALDLYFAVNRQFSFSPVSTPGSKGTTLp  711
            LTD+DL+ELKG IELGFGF EE+GQ+L  TLPALDLYFAVNRQ   SPVST     +   
Sbjct  12   LTDEDLSELKGSIELGFGFNEEQGQQLTTTLPALDLYFAVNRQ--ISPVST--PGSSGSS  67

Query  710  spsasstggrssslsspgsdsdSWRICSPGENPEHVKIKLRHWAQA  573
            S  ++S G RSSS  SP SDS+S R+ SPG+NP+HVK++LRHWAQA
Sbjct  68   SSRSTSLGDRSSSFGSPMSDSNSLRLMSPGDNPQHVKMRLRHWAQA  113



>ref|XP_006652152.1| PREDICTED: uncharacterized protein LOC102717057 [Oryza brachyantha]
Length=239

 Score =   103 bits (258),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 65/119 (55%), Positives = 79/119 (66%), Gaps = 3/119 (3%)
 Frame = -1

Query  896  ECLTDDDLNELKGCIELGFGFKEEEG-QRLCNTLPALDLYFAVNRQFSFSPVSTPGSKGT  720
            + LTD+DL+ELKG +ELGFGF E  G Q LC+TLPALDLYFAVNRQ S   +    S   
Sbjct  120  KSLTDEDLDELKGSMELGFGFDEGSGGQNLCDTLPALDLYFAVNRQLSEPRMRLSTSSLP  179

Query  719  TLpspsas--stggrssslsspgsdsdSWRICSPGENPEHVKIKLRHWAQAVACSVMQS  549
            +  S S++         S  +P S  DSW+ICSPG+NP+ VK +LRHWAQ VACSV  S
Sbjct  180  SPTSSSSTLCGGASNPGSPVAPSSFVDSWKICSPGDNPQLVKTRLRHWAQVVACSVKHS  238



>ref|XP_010497904.1| PREDICTED: uncharacterized protein LOC104775641, partial [Camelina 
sativa]
Length=81

 Score = 98.6 bits (244),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 59/83 (71%), Positives = 66/83 (80%), Gaps = 2/83 (2%)
 Frame = -1

Query  983  LSMCETPRDVAWerrrrqilnqerRKSDAECLTDDDLNELKGCIELGFGFKEEEGQRLCN  804
            LSM ET RDVAWERRRRQ+L+ E+     E LTD+DL+ELKG IELGFGF EE+GQ+L  
Sbjct  1    LSMLETKRDVAWERRRRQMLHLEKHNEGGEDLTDEDLSELKGSIELGFGFNEEQGQQLTT  60

Query  803  TLPALDLYFAVNRQFSFSPVSTP  735
            TLPALDLYFAV RQ   SPVSTP
Sbjct  61   TLPALDLYFAVTRQ--ISPVSTP  81



>ref|XP_002960564.1| hypothetical protein SELMODRAFT_437629 [Selaginella moellendorffii]
 ref|XP_002969205.1| hypothetical protein SELMODRAFT_440689 [Selaginella moellendorffii]
 gb|EFJ29293.1| hypothetical protein SELMODRAFT_440689 [Selaginella moellendorffii]
 gb|EFJ38103.1| hypothetical protein SELMODRAFT_437629 [Selaginella moellendorffii]
Length=287

 Score =   102 bits (254),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 55/120 (46%), Positives = 76/120 (63%), Gaps = 15/120 (13%)
 Frame = -1

Query  899  AECLTDDDLNELKGCIELGFGFKEEEGQRLCNTLPALDLYFAVNRQFS--FSPVSTPGSK  726
            A  LTD+DL+EL+G I+LGFGF  +   RL NTLPAL+L +A+N+Q+    SPVST    
Sbjct  176  ARSLTDEDLDELRGSIDLGFGFSNQADPRLWNTLPALELCYAINQQYQNKGSPVSTVDDD  235

Query  725  GTTLpspsasstggrssslsspgsdsdSWRICSPGENPEHVKIKLRHWAQAVACSVMQSY  546
            GT              S  +    +S SW + SPG++P+ VK ++RHWAQAVAC++ Q+Y
Sbjct  236  GT-------------GSDGTGSPMNSPSWTVSSPGDHPQQVKTRIRHWAQAVACTIRQNY  282



>ref|XP_004954894.1| PREDICTED: uncharacterized protein LOC101768843 [Setaria italica]
Length=258

 Score =   100 bits (250),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 78/203 (38%), Positives = 106/203 (52%), Gaps = 43/203 (21%)
 Frame = -1

Query  1037  RLEHAPP------FWRNRKKL-SKQLSMCETPRDVAWerrrrqilnqe------------  915
             + +H PP      F  NR++L SKQLSM ET R+  W++R+RQIL +             
Sbjct  52    QFDHPPPAGAGAGFGNNRRRLLSKQLSMKETTREAKWKKRQRQILRRSGLVSVVREQQER  111

Query  914   -------------------rRKSDAE----CLTDDDLNELKGCIELGFGFKEEEGQ-RLC  807
                                  +S +E    CLTD+DL+EL+G  ELGFGF EE G   L 
Sbjct  112   NDDGGGGGNKSAILDEGHHVVRSSSERAMRCLTDEDLDELRGSFELGFGFDEETGAAHLR  171

Query  806   NTLPALDLYFAVNRQFSFSPVSTPGSKGTTLpspsasstggrssslsspgsdsdSWRICS  627
             +TLPALD YFAVNRQ S   + +  +   T    S++     S    +     D W++ S
Sbjct  172   DTLPALDFYFAVNRQLSDPKMRSLSAASPTSTLSSSTLPDTPSPRSPNDAPGGDPWKLFS  231

Query  626   PGENPEHVKIKLRHWAQAVACSV  558
             PG+NP+ VK +LRHWAQ VAC++
Sbjct  232   PGDNPQLVKTRLRHWAQVVACNI  254



>ref|NP_001140320.1| uncharacterized protein LOC100272365 [Zea mays]
 gb|ACF83568.1| unknown [Zea mays]
 gb|AFW65711.1| hypothetical protein ZEAMMB73_484686 [Zea mays]
Length=277

 Score = 97.4 bits (241),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 81/199 (41%), Positives = 105/199 (53%), Gaps = 50/199 (25%)
 Frame = -1

Query  1004  RKKLSKQLSMCETPRDVAWerrrrqilnqer----------------RKSDAE-------  894
             R+ LSKQLSM ET R++ WE+RRRQIL +                   KS AE       
Sbjct  76    RRLLSKQLSMKETTREIKWEKRRRQILRRSSLVVSLNDDGGGGCCGSMKSAAEEPERHCH  135

Query  893   -------------CLTDDDLNELKGCIELGFGFKEEEG-QRLCNTLPALDLYFAVNRQFS  756
                          CLTD+DL+EL+G  ELGFGF EE G   L +TLPALD YFAVNRQ S
Sbjct  136   HHVTRSSSERVMRCLTDEDLDELRGSFELGFGFDEESGGAHLRDTLPALDFYFAVNRQLS  195

Query  755   ----FSPVSTPGS---------KGTTLpspsasstggrssslsspgsdsdSWRICSPGEN  615
                    +S+  S           +TLP         +  + ++ G  +D+W+I +PG+N
Sbjct  196   DPAKLRTLSSAASLTSTPSAVSSSSTLPDVPNDPRSPKVGATAASGGGADAWKIFTPGDN  255

Query  614   PEHVKIKLRHWAQAVACSV  558
             P+ VK +LRHWAQ VACS+
Sbjct  256   PQLVKTRLRHWAQVVACSI  274



>gb|ADE76026.1| unknown [Picea sitchensis]
Length=121

 Score = 93.2 bits (230),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 54/116 (47%), Positives = 75/116 (65%), Gaps = 1/116 (1%)
 Frame = -1

Query  905  SDAECLTDDDLNELKGCIELGFGFKEEEGQRLCNTLPALDLYFAVNRQFSFSPVSTPGSK  726
            S  + LTD+DL+ELKGC++LGFGF  EE   LCNTLPAL+L ++++++F      TP S 
Sbjct  3    SRTKSLTDEDLDELKGCLDLGFGFNYEEIPELCNTLPALELCYSISQRFQDEQQRTPSST  62

Query  725  GTTLpspsasstggrssslsspgsdsdSWRICSPGENPEHVKIKLRHWAQAVACSV  558
              T    S+      +S+ S   S   +W+I SPG+ PE VK +L+ WAQAVAC+V
Sbjct  63   TDT-GISSSPVDACSNSASSCSQSHIANWKISSPGDCPEQVKARLKFWAQAVACTV  117



>ref|XP_002451994.1| hypothetical protein SORBIDRAFT_04g012950 [Sorghum bicolor]
 gb|EES04970.1| hypothetical protein SORBIDRAFT_04g012950 [Sorghum bicolor]
Length=262

 Score = 96.7 bits (239),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 79/197 (40%), Positives = 107/197 (54%), Gaps = 39/197 (20%)
 Frame = -1

Query  1031  EHAPPFWRNRKKL-SKQLSMCETPRDVAWerrrrqilnqerR------------------  909
             E A     NR++L SKQLSM ET R+  WE+RRRQIL +                     
Sbjct  63    EAAGGIGNNRRRLLSKQLSMKETTREAKWEKRRRQILRRSSMVSLNDGGSGSSKSIIDER  122

Query  908   -------KSDAEC----LTDDDLNELKGCIELGFGFKEEEG-QRLCNTLPALDLYFAVNR  765
                    +S +EC    LTD+DL+EL+G  ELGFGF E+ G   L +TLPAL+ YFAVNR
Sbjct  123   HYCHHVMRSSSECVMRRLTDEDLDELRGSFELGFGFDEDTGGTHLRDTLPALEFYFAVNR  182

Query  764   QFSFSPVSTPGSKGTTLpspsasstg--------grssslsspgsdsdSWRICSPGENPE  609
             Q S   + T  +   T    + SS+            ++ ++    +DSW+I +PG+NP+
Sbjct  183   QLSDRKLRTLAAASPTSTLSAVSSSSTLPDIPSPRSPNAGATANGGADSWKIFTPGDNPQ  242

Query  608   HVKIKLRHWAQAVACSV  558
              VK +LRHWAQ VACS+
Sbjct  243   LVKTRLRHWAQVVACSI  259



>ref|XP_010524140.1| PREDICTED: uncharacterized protein LOC104802305 [Tarenaya hassleriana]
Length=183

 Score = 94.7 bits (234),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 53/115 (46%), Positives = 72/115 (63%), Gaps = 18/115 (16%)
 Frame = -1

Query  890  LTDDDLNELKGCIELGFGFKEEEGQRLCNTLPALDLYFAVNRQF----SFSPVSTPGSKG  723
            LTDDDL ELKGC++LGFGF  EE   LCNTLPAL+L ++++++F      +P ST   K 
Sbjct  79   LTDDDLEELKGCVDLGFGFSYEEIPELCNTLPALELCYSMSQKFLDHDQHTPSSTSPEKK  138

Query  722  TTLpspsasstggrssslsspgsdsdSWRICSPGENPEHVKIKLRHWAQAVACSV  558
            T +                S  S   +W+I SPG+NP+ VK +L++WAQAVAC+V
Sbjct  139  TPV--------------PESHVSPIANWKISSPGDNPDDVKARLKYWAQAVACTV  179



>ref|XP_009118570.1| PREDICTED: uncharacterized protein LOC103843585 [Brassica rapa]
Length=143

 Score = 93.2 bits (230),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 48/114 (42%), Positives = 72/114 (63%), Gaps = 15/114 (13%)
 Frame = -1

Query  899  AECLTDDDLNELKGCIELGFGFKEEEGQRLCNTLPALDLYFAVNRQFSFSPVSTPGSKGT  720
            A+ LTDDDL +LKGC++LGFGF  +E   LCNTLPAL+L +++ R+FS    +    + +
Sbjct  41   AKSLTDDDLEDLKGCLDLGFGFSYDEIPELCNTLPALELCYSMRRRFSDDKNNNKSPESS  100

Query  719  TLpspsasstggrssslsspgsdsdSWRICSPGENPEHVKIKLRHWAQAVACSV  558
            ++                +P     +W+I SPG+NP+ VK +L++WAQAVAC+V
Sbjct  101  SV---------------DAPSPPIANWKISSPGDNPDDVKARLKYWAQAVACTV  139



>ref|XP_007223513.1| hypothetical protein PRUPE_ppa011892mg [Prunus persica]
 ref|XP_007223514.1| hypothetical protein PRUPE_ppa011892mg [Prunus persica]
 gb|EMJ24712.1| hypothetical protein PRUPE_ppa011892mg [Prunus persica]
 gb|EMJ24713.1| hypothetical protein PRUPE_ppa011892mg [Prunus persica]
Length=192

 Score = 94.0 bits (232),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 52/116 (45%), Positives = 75/116 (65%), Gaps = 12/116 (10%)
 Frame = -1

Query  905  SDAECLTDDDLNELKGCIELGFGFKEEEGQRLCNTLPALDLYFAVNRQFSFSPVSTPGSK  726
            S  + LTD+DL+ELKGC++LGFGF  EE   LCNTLPAL+L ++++++F      +P + 
Sbjct  85   SRTKSLTDEDLDELKGCLDLGFGFSYEEIPELCNTLPALELCYSMSQKFMDENQKSPENS  144

Query  725  GTTLpspsasstggrssslsspgsdsdSWRICSPGENPEHVKIKLRHWAQAVACSV  558
             TT+             S  S  S   +W+I SPG++PE VK +L++WAQAVAC+V
Sbjct  145  PTTV------------DSCPSVSSPIANWKISSPGDHPEDVKARLKYWAQAVACTV  188



>emb|CDY10005.1| BnaC08g44460D [Brassica napus]
Length=144

 Score = 92.8 bits (229),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 49/114 (43%), Positives = 72/114 (63%), Gaps = 13/114 (11%)
 Frame = -1

Query  899  AECLTDDDLNELKGCIELGFGFKEEEGQRLCNTLPALDLYFAVNRQFSFSPVSTPGSKGT  720
            A+ LTDDDL +LKGC++LGFGF  +E   LCNTLPAL+L +++ R+FS    +    + +
Sbjct  40   AKSLTDDDLEDLKGCLDLGFGFSYDEIPELCNTLPALELCYSMRRRFSDDKNNNKSPESS  99

Query  719  TLpspsasstggrssslsspgsdsdSWRICSPGENPEHVKIKLRHWAQAVACSV  558
            ++               S P     +W+I SPG+NP+ VK +L++WAQAVAC+V
Sbjct  100  SV-------------DASPPSPPIANWKISSPGDNPDDVKARLKYWAQAVACTV  140



>emb|CDY06184.1| BnaA09g50190D [Brassica napus]
Length=145

 Score = 92.4 bits (228),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 49/114 (43%), Positives = 72/114 (63%), Gaps = 13/114 (11%)
 Frame = -1

Query  899  AECLTDDDLNELKGCIELGFGFKEEEGQRLCNTLPALDLYFAVNRQFSFSPVSTPGSKGT  720
            A+ LTDDDL +LKGC++LGFGF  +E   LCNTLPAL+L +++ R+FS    +    + +
Sbjct  41   AKSLTDDDLEDLKGCLDLGFGFSYDEIPELCNTLPALELCYSMRRRFSDDKNNNKTPESS  100

Query  719  TLpspsasstggrssslsspgsdsdSWRICSPGENPEHVKIKLRHWAQAVACSV  558
            ++               S P     +W+I SPG+NP+ VK +L++WAQAVAC+V
Sbjct  101  SV-------------DASPPSPPIANWKISSPGDNPDDVKARLKYWAQAVACTV  141



>ref|XP_008222622.1| PREDICTED: uncharacterized protein LOC103322479 [Prunus mume]
Length=182

 Score = 92.8 bits (229),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 51/111 (46%), Positives = 72/111 (65%), Gaps = 12/111 (11%)
 Frame = -1

Query  890  LTDDDLNELKGCIELGFGFKEEEGQRLCNTLPALDLYFAVNRQFSFSPVSTPGSKGTTLp  711
            LTD+DL+ELKGC++LGFGF  EE   LCNTLPAL+L ++++++F       P +  TT+ 
Sbjct  80   LTDEDLDELKGCLDLGFGFSYEEIPELCNTLPALELCYSMSQKFMDENQKLPENSPTTV-  138

Query  710  spsasstggrssslsspgsdsdSWRICSPGENPEHVKIKLRHWAQAVACSV  558
                        S  S  S   +W+I SPG++PE VK +L++WAQAVAC+V
Sbjct  139  -----------DSCPSVSSPIANWKISSPGDHPEDVKARLKYWAQAVACTV  178



>ref|XP_009776911.1| PREDICTED: uncharacterized protein LOC104226581 [Nicotiana sylvestris]
Length=199

 Score = 92.8 bits (229),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 50/111 (45%), Positives = 68/111 (61%), Gaps = 15/111 (14%)
 Frame = -1

Query  890  LTDDDLNELKGCIELGFGFKEEEGQRLCNTLPALDLYFAVNRQFSFSPVSTPGSKGTTLp  711
            LTDDDL ELKGC++LGFGF  EE   LCNTLPAL+L +++++++       P S   T  
Sbjct  100  LTDDDLEELKGCLDLGFGFSYEEIPELCNTLPALELCYSMSQKYIDEHQKCPDSMSDT--  157

Query  710  spsasstggrssslsspgsdsdSWRICSPGENPEHVKIKLRHWAQAVACSV  558
                          SS      +W+I SPG++PE VK +L++WAQAVAC+V
Sbjct  158  -------------ASSGSGHVANWKISSPGDDPEDVKARLKYWAQAVACTV  195



>ref|XP_002972243.1| hypothetical protein SELMODRAFT_97431 [Selaginella moellendorffii]
 gb|EFJ26329.1| hypothetical protein SELMODRAFT_97431 [Selaginella moellendorffii]
Length=126

 Score = 90.9 bits (224),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 51/114 (45%), Positives = 66/114 (58%), Gaps = 3/114 (3%)
 Frame = -1

Query  890  LTDDDLNELKGCIELGFGFKEEEGQRLCNTLPALDLYFAVNRQFSFSPVSTPGSKGTTLp  711
            LTD DL+EL+GCI+LGFGFK E    L  TLPAL+L +A+ +Q       +P S    L 
Sbjct  15   LTDADLDELRGCIDLGFGFKNEADPELWKTLPALELCYAITQQLKEVQRPSPVSP---LA  71

Query  710  spsasstggrssslsspgsdsdSWRICSPGENPEHVKIKLRHWAQAVACSVMQS  549
                 S+               SW+I SPG+ P+ VK +LRHWA+AVAC+V QS
Sbjct  72   DAGDFSSESGGDDSLESSPTFSSWQIASPGDRPQEVKTRLRHWARAVACTVRQS  125



>ref|XP_009591985.1| PREDICTED: uncharacterized protein LOC104088923 [Nicotiana tomentosiformis]
Length=199

 Score = 92.4 bits (228),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 50/111 (45%), Positives = 68/111 (61%), Gaps = 15/111 (14%)
 Frame = -1

Query  890  LTDDDLNELKGCIELGFGFKEEEGQRLCNTLPALDLYFAVNRQFSFSPVSTPGSKGTTLp  711
            LTDDDL ELKGC++LGFGF  EE   LCNTLPAL+L +++++++       P S   T  
Sbjct  100  LTDDDLEELKGCLDLGFGFSYEEIPELCNTLPALELCYSMSQKYIDEHQKCPDSMSDT--  157

Query  710  spsasstggrssslsspgsdsdSWRICSPGENPEHVKIKLRHWAQAVACSV  558
                          SS      +W+I SPG++PE VK +L++WAQAVAC+V
Sbjct  158  -------------ASSGSGHVANWKISSPGDDPEDVKARLKYWAQAVACTV  195



>ref|XP_006410289.1| hypothetical protein EUTSA_v10017248mg [Eutrema salsugineum]
 gb|ESQ51742.1| hypothetical protein EUTSA_v10017248mg [Eutrema salsugineum]
Length=203

 Score = 92.4 bits (228),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 50/123 (41%), Positives = 72/123 (59%), Gaps = 31/123 (25%)
 Frame = -1

Query  899  AECLTDDDLNELKGCIELGFGFKEEEGQRLCNTLPALDLYFAVNRQF---------SFSP  747
            A+ LTDDDL ELKGC++LGFGF  +E   LCNTLPAL+L ++++++F           SP
Sbjct  99   AKSLTDDDLEELKGCLDLGFGFSYDEIPELCNTLPALELCYSMSQKFLDDNNKLSHHKSP  158

Query  746  VSTPGSKGTTLpspsasstggrssslsspgsdsdSWRICSPGENPEHVKIKLRHWAQAVA  567
            V  P +  + + +                      W+I SPG+NP+ VK +L++WAQAVA
Sbjct  159  VEEPPTTTSPIAN----------------------WKISSPGDNPDEVKARLKYWAQAVA  196

Query  566  CSV  558
            C+V
Sbjct  197  CTV  199



>gb|ABK23259.1| unknown [Picea sitchensis]
 gb|ABK25926.1| unknown [Picea sitchensis]
 gb|ABR17098.1| unknown [Picea sitchensis]
Length=217

 Score = 92.8 bits (229),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 68/162 (42%), Positives = 90/162 (56%), Gaps = 17/162 (10%)
 Frame = -1

Query  1025  APPFWRNRKKLSKQLSMCETPRDVAWerrrrqilnqerRKSDAECLTDDDLNELKGCIEL  846
             APP  R  K+ S     C   R+ AW R++ +     + KS    LTD+D++EL+GCI+L
Sbjct  67    APPPTRLLKQQSWSTESC---REEAWIRKKDRQSKLRKSKS----LTDEDVDELRGCIDL  119

Query  845   GFGF---KEEEG-QRLCNTLPALDLYFAVNRQFSFSPVSTPGSKGTTLpspsasstggrs  678
             GFGF    EEEG  +LC+TLPAL  Y+AVN+ ++ S   +  S      S S+       
Sbjct  120   GFGFGFDSEEEGDHKLCDTLPALYFYYAVNKHYNDSKFKSSPSPSPPSSSSSSCDENPPQ  179

Query  677   sslsspgsdsdSWRICSPGENPEHVKIKLRHWAQAVACSVMQ  552
                  P      W I SPG+NP+ VK +LRHWAQ VACSV Q
Sbjct  180   GQDLDP------WIISSPGDNPQLVKTRLRHWAQVVACSVRQ  215



>ref|XP_009363659.1| PREDICTED: uncharacterized protein LOC103953622 [Pyrus x bretschneideri]
 ref|XP_009337471.1| PREDICTED: uncharacterized protein LOC103929931 [Pyrus x bretschneideri]
Length=180

 Score = 92.0 bits (227),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 49/115 (43%), Positives = 72/115 (63%), Gaps = 23/115 (20%)
 Frame = -1

Query  890  LTDDDLNELKGCIELGFGFKEEEGQRLCNTLPALDLYFAVNRQF----SFSPVSTPGSKG  723
            LTD+DL+ELKGC++LGFGF  EE   LCNTLPAL+L ++++++F      SP ++P +  
Sbjct  81   LTDEDLDELKGCLDLGFGFSYEEIPELCNTLPALELCYSMSQKFMDEHQKSPENSPAAVD  140

Query  722  TTLpspsasstggrssslsspgsdsdSWRICSPGENPEHVKIKLRHWAQAVACSV  558
            +                     S   +W+I SPG++PE VK +L++WAQAVAC+V
Sbjct  141  SV-------------------SSQIANWKISSPGDHPEDVKERLKYWAQAVACTV  176



>ref|XP_004296738.1| PREDICTED: uncharacterized protein LOC101299372 [Fragaria vesca 
subsp. vesca]
Length=148

 Score = 91.3 bits (225),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 46/116 (40%), Positives = 68/116 (59%), Gaps = 28/116 (24%)
 Frame = -1

Query  905  SDAECLTDDDLNELKGCIELGFGFKEEEGQRLCNTLPALDLYFAVNRQFSFSPVSTPGSK  726
            S  + LTD+DL+ELKGC++LGFGF  +E   LCNTLPAL+L ++++ +F     S+P + 
Sbjct  57   SRTKSLTDEDLDELKGCLDLGFGFSYQEIPELCNTLPALELCYSMSHKFMLHSCSSPIAN  116

Query  725  GTTLpspsasstggrssslsspgsdsdSWRICSPGENPEHVKIKLRHWAQAVACSV  558
                                        W+I SPG++PE VK +L++WAQAVAC++
Sbjct  117  ----------------------------WKISSPGDHPEDVKARLKYWAQAVACTL  144



>ref|XP_008372073.1| PREDICTED: uncharacterized protein LOC103435452 [Malus domestica]
Length=180

 Score = 91.7 bits (226),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 48/115 (42%), Positives = 72/115 (63%), Gaps = 23/115 (20%)
 Frame = -1

Query  890  LTDDDLNELKGCIELGFGFKEEEGQRLCNTLPALDLYFAVNRQF----SFSPVSTPGSKG  723
            LTD+DL+ELKGC++LGFGF  EE   LCNTLPAL+L ++++++F      SP ++P +  
Sbjct  81   LTDEDLDELKGCLDLGFGFSYEEIPELCNTLPALELCYSMSQKFMDEHQKSPENSPAAVD  140

Query  722  TTLpspsasstggrssslsspgsdsdSWRICSPGENPEHVKIKLRHWAQAVACSV  558
            +                     +   +W+I SPG++PE VK +L++WAQAVAC+V
Sbjct  141  SV-------------------STQIANWKISSPGDHPEDVKERLKYWAQAVACTV  176



>gb|EMT02726.1| hypothetical protein F775_27699 [Aegilops tauschii]
Length=301

 Score = 94.0 bits (232),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 78/166 (47%), Positives = 98/166 (59%), Gaps = 21/166 (13%)
 Frame = -1

Query  1004  RKKLSKQLSMCETPRDVAWerrrrqilnq--------------erRKSDAECLTDDDLNE  867
             ++ LSKQLSM ET R+V WE+RRRQI  Q                  + +  +TD+DL+E
Sbjct  44    KRMLSKQLSMKETTREVKWEKRRRQIQRQRSSMGLYDADRVGCANTHATSNGVTDEDLDE  103

Query  866   LKGCIELGFGFKEEEG-QRLCNTLPALDLYFAVNRQFSFSPV-----STPGSKGTTLpsp  705
             LKG +ELGFGF EE G Q LC+TLPALDLYFAVNRQ S   +     S P     T  S 
Sbjct  104   LKGSMELGFGFNEENGGQNLCDTLPALDLYFAVNRQLSEPKMRACSRSLPSLSVVTSSSS  163

Query  704   sasstggrssslsspgsdsdSWRICSP-GENPEHVKIKLRHWAQAV  570
               S T   + S ++  S  DS +I SP GENP+ +K +LR WAQA+
Sbjct  164   MHSGTPSPAGSPTAQPSLLDSLKISSPAGENPQLIKTRLRQWAQAI  209



>emb|CDX83487.1| BnaA03g20190D [Brassica napus]
Length=121

 Score = 90.1 bits (222),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 51/114 (45%), Positives = 68/114 (60%), Gaps = 22/114 (19%)
 Frame = -1

Query  890  LTDDDLNELKGCIELGFGFKEEEGQRLCNTLPALDLYFAVNRQF---SFSPVSTPGSKGT  720
            LTDDDL ELKGC++LGFGF  EE   LCNTLPAL+L ++++++F        S+P    +
Sbjct  23   LTDDDLEELKGCVDLGFGFNYEEIPELCNTLPALELCYSMSQKFMDQDHHHTSSPEKIES  82

Query  719  TLpspsasstggrssslsspgsdsdSWRICSPGENPEHVKIKLRHWAQAVACSV  558
             +                   S   SW+I SPG+NP+ VK +LR WAQAVAC+V
Sbjct  83   PV-------------------SSLASWKISSPGDNPDDVKARLRFWAQAVACTV  117



>ref|NP_001067693.2| Os11g0282300 [Oryza sativa Japonica Group]
 dbj|BAF28056.2| Os11g0282300, partial [Oryza sativa Japonica Group]
Length=126

 Score = 90.1 bits (222),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 50/118 (42%), Positives = 71/118 (60%), Gaps = 21/118 (18%)
 Frame = -1

Query  899  AECLTDDDLNELKGCIELGFGFKEEEGQRLCNTLPALDLYFAVNRQF----SFSPVSTPG  732
            A  LTDDDL ELKGC++LGFGF  +E   LC TLPAL+L ++++++F      SPV+ P 
Sbjct  22   ARSLTDDDLEELKGCVDLGFGFSYDEIPELCGTLPALELCYSMSQRFLDEHYHSPVAEPA  81

Query  731  SKGTTLpspsasstggrssslsspgsdsdSWRICSPGENPEHVKIKLRHWAQAVACSV  558
                +                 SP     +W+I SPG++P+ VK +L++WAQAVAC+V
Sbjct  82   PVAPS-----------------SPAQPIANWKISSPGDSPDEVKARLKYWAQAVACTV  122



>ref|XP_011043545.1| PREDICTED: uncharacterized protein LOC105138974 isoform X1 [Populus 
euphratica]
Length=183

 Score = 91.7 bits (226),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 65/173 (38%), Positives = 88/173 (51%), Gaps = 23/173 (13%)
 Frame = -1

Query  1040  QRLEHAPPFWRNRKK--------LSKQLSMC-ETPRDVAWerrrrqilnqerRKSDAECL  888
             +++E+ PP  + ++         L KQ S   +  RD AW RR+         +   + +
Sbjct  19    EQMEYRPPIRKQQQNHRLLGPSPLYKQHSWSPDIDRDEAWLRRKGNYK-----QKKCKSV  73

Query  887   TDDDLNELKGCIELGFGFKEEE-GQRLCNTLPALDLYFAVNRQFSFSPVSTPGSKGTTLp  711
             TD+DL+ELKGCIELGFGF   E  QRL +T PAL+LY+AVN+ +     S P    T   
Sbjct  74    TDEDLDELKGCIELGFGFDSPEMDQRLSDTFPALELYYAVNKNYYDHSASKPVVTATPSS  133

Query  710   spsasstggrssslsspgsdsdSWRICSPGENPEHVKIKLRHWAQAVACSVMQ  552
             S ++                     I  PGENP+ VK +LR WAQ VACSV Q
Sbjct  134   STASDCDSTSPLGSPHT--------IFGPGENPQTVKTRLRQWAQVVACSVRQ  178



>ref|XP_002309816.1| hypothetical protein POPTR_0007s02150g [Populus trichocarpa]
 ref|XP_006380296.1| hypothetical protein POPTR_0007s02150g [Populus trichocarpa]
 ref|XP_006380297.1| hypothetical protein POPTR_0007s02150g [Populus trichocarpa]
 ref|XP_006380298.1| hypothetical protein POPTR_0007s02150g [Populus trichocarpa]
 gb|EEE90266.1| hypothetical protein POPTR_0007s02150g [Populus trichocarpa]
 gb|ERP58093.1| hypothetical protein POPTR_0007s02150g [Populus trichocarpa]
 gb|ERP58094.1| hypothetical protein POPTR_0007s02150g [Populus trichocarpa]
 gb|ERP58095.1| hypothetical protein POPTR_0007s02150g [Populus trichocarpa]
Length=198

 Score = 91.7 bits (226),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 47/111 (42%), Positives = 71/111 (64%), Gaps = 13/111 (12%)
 Frame = -1

Query  890  LTDDDLNELKGCIELGFGFKEEEGQRLCNTLPALDLYFAVNRQFSFSPVSTPGSKGTTLp  711
            LTDDDL+ELKGC++LGFGF  +E   LCNTLPAL+L ++++++F      +P      + 
Sbjct  97   LTDDDLDELKGCLDLGFGFSYDEIPELCNTLPALELCYSMSQKFLDEHQKSPEGSSPAV-  155

Query  710  spsasstggrssslsspgsdsdSWRICSPGENPEHVKIKLRHWAQAVACSV  558
                        + ++  S   +W+I SPG++PE VK +L++WAQAVAC+V
Sbjct  156  ------------AEAANSSPIANWKISSPGDHPEDVKARLKYWAQAVACTV  194



>ref|XP_006303187.1| hypothetical protein CARUB_v10010453mg [Capsella rubella]
 gb|EOA36085.1| hypothetical protein CARUB_v10010453mg [Capsella rubella]
Length=174

 Score = 90.9 bits (224),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 45/114 (39%), Positives = 70/114 (61%), Gaps = 19/114 (17%)
 Frame = -1

Query  899  AECLTDDDLNELKGCIELGFGFKEEEGQRLCNTLPALDLYFAVNRQFSFSPVSTPGSKGT  720
            ++ LTDDDL +LKGC++LGFGF  +E   LCNTLPAL+L ++++++F    + +P    +
Sbjct  76   SKSLTDDDLEDLKGCLDLGFGFSYDEIPELCNTLPALELCYSMSQKFLDDKLRSPEDSPS  135

Query  719  TLpspsasstggrssslsspgsdsdSWRICSPGENPEHVKIKLRHWAQAVACSV  558
                                 +   +W+I SPG+NP+ VK +L++WAQAVAC+V
Sbjct  136  A-------------------AAPIANWKISSPGDNPDDVKARLKYWAQAVACTV  170



>ref|XP_002892311.1| hypothetical protein ARALYDRAFT_470598 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH68570.1| hypothetical protein ARALYDRAFT_470598 [Arabidopsis lyrata subsp. 
lyrata]
Length=187

 Score = 91.3 bits (225),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 47/114 (41%), Positives = 70/114 (61%), Gaps = 10/114 (9%)
 Frame = -1

Query  899  AECLTDDDLNELKGCIELGFGFKEEEGQRLCNTLPALDLYFAVNRQFSFSPVSTPGSKGT  720
            ++ LTDDDL +LKGC++LGFGF  +E   LCNTLPAL+L ++++++F      +P S   
Sbjct  80   SKSLTDDDLEDLKGCLDLGFGFSYDEIPELCNTLPALELCYSMSQKFLDDKHKSPESSSV  139

Query  719  TLpspsasstggrssslsspgsdsdSWRICSPGENPEHVKIKLRHWAQAVACSV  558
                          S      +   +W+I SPG+NP+ VK +L++WAQAVAC+V
Sbjct  140  ----------EDSPSPSPVTSTPIANWKISSPGDNPDDVKARLKYWAQAVACTV  183



>ref|XP_002310141.1| hypothetical protein POPTR_0007s11020g [Populus trichocarpa]
 gb|EEE90591.1| hypothetical protein POPTR_0007s11020g [Populus trichocarpa]
Length=183

 Score = 90.9 bits (224),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 52/114 (46%), Positives = 64/114 (56%), Gaps = 9/114 (8%)
 Frame = -1

Query  890  LTDDDLNELKGCIELGFGFKEEE-GQRLCNTLPALDLYFAVNRQFSFSPVSTPGSKGTTL  714
            +TD+DL+ELKGCIELGFGF   E  QRL +T PAL+LY+AVN+ +     S P    T  
Sbjct  73   VTDEDLDELKGCIELGFGFDSPEMDQRLSDTFPALELYYAVNKNYYDHSASKPVVTATPS  132

Query  713  pspsasstggrssslsspgsdsdSWRICSPGENPEHVKIKLRHWAQAVACSVMQ  552
             S ++                     I  PGENP+ VK +LR WAQ VACSV Q
Sbjct  133  SSTASDCDSPSPLGSPHT--------IFGPGENPQTVKTRLRQWAQVVACSVRQ  178



>emb|CDY23360.1| BnaC04g48880D [Brassica napus]
Length=173

 Score = 90.5 bits (223),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 53/111 (48%), Positives = 70/111 (63%), Gaps = 15/111 (14%)
 Frame = -1

Query  890  LTDDDLNELKGCIELGFGFKEEEGQRLCNTLPALDLYFAVNRQFSFSPVSTPGSKGTTLp  711
            LTDDDL ELKGC++LGFGF  EE   LCNTLPAL+L ++++++F    +S P  K   + 
Sbjct  74   LTDDDLEELKGCVDLGFGFNYEEIPELCNTLPALELCYSMSQKFMDQDLS-PEKKPPMM-  131

Query  710  spsasstggrssslsspgsdsdSWRICSPGENPEHVKIKLRHWAQAVACSV  558
                         L S  S   SW+I SPG+NP+ VK +L+ WAQAVAC+V
Sbjct  132  -------------LESHVSPIASWKISSPGDNPDDVKARLKFWAQAVACTV  169



>ref|XP_007026520.1| Signal transducer and transcription activator isoform 1 [Theobroma 
cacao]
 ref|XP_007026521.1| Signal transducer and transcription activator isoform 1 [Theobroma 
cacao]
 gb|EOY07022.1| Signal transducer and transcription activator isoform 1 [Theobroma 
cacao]
 gb|EOY07023.1| Signal transducer and transcription activator isoform 1 [Theobroma 
cacao]
Length=191

 Score = 90.9 bits (224),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 49/115 (43%), Positives = 71/115 (62%), Gaps = 22/115 (19%)
 Frame = -1

Query  890  LTDDDLNELKGCIELGFGFKEEEGQRLCNTLPALDLYFAVNRQF----SFSPVSTPGSKG  723
            LTD+DL+ELKGC++LGFGF  EE   LCNTLPAL+L +++++++      SP  +P +  
Sbjct  91   LTDEDLDELKGCLDLGFGFSYEEIPELCNTLPALELCYSMSQKYLDEHQKSPDPSPDTTA  150

Query  722  TTLpspsasstggrssslsspgsdsdSWRICSPGENPEHVKIKLRHWAQAVACSV  558
             T+                   S   +W+I SPG++PE VK +L+ WAQAVAC+V
Sbjct  151  ETV------------------SSPIANWKISSPGDHPEDVKARLKFWAQAVACTV  187



>ref|XP_011026386.1| PREDICTED: uncharacterized protein LOC105127011 [Populus euphratica]
Length=197

 Score = 90.9 bits (224),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 47/111 (42%), Positives = 71/111 (64%), Gaps = 13/111 (12%)
 Frame = -1

Query  890  LTDDDLNELKGCIELGFGFKEEEGQRLCNTLPALDLYFAVNRQFSFSPVSTPGSKGTTLp  711
            LTDDDL+ELKGC++LGFGF  +E   LCNTLPAL+L ++++++F      +P      + 
Sbjct  96   LTDDDLDELKGCLDLGFGFSYDEIPELCNTLPALELCYSMSQKFLDEHQKSPERSSPAV-  154

Query  710  spsasstggrssslsspgsdsdSWRICSPGENPEHVKIKLRHWAQAVACSV  558
                        + ++  S   +W+I SPG++PE VK +L++WAQAVAC+V
Sbjct  155  ------------AEAANSSPIANWKISSPGDHPEDVKARLKYWAQAVACTV  193



>ref|XP_008453998.1| PREDICTED: uncharacterized protein LOC103494552 [Cucumis melo]
Length=184

 Score = 90.5 bits (223),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 52/115 (45%), Positives = 74/115 (64%), Gaps = 17/115 (15%)
 Frame = -1

Query  890  LTDDDLNELKGCIELGFGFKEEEGQRLCNTLPALDLYFAVNRQF----SFSPVSTPGSKG  723
            LTD+DL+ELKGC++LGFGF  +E   LCNTLPAL+L +++++++      SP S+P S  
Sbjct  79   LTDEDLDELKGCVDLGFGFSYDEIPELCNTLPALELCYSMSQKYMDDHQKSPESSPAS--  136

Query  722  TTLpspsasstggrssslsspgsdsdSWRICSPGENPEHVKIKLRHWAQAVACSV  558
                          + S SS  S   +W+I SPG++PE VK +L+ WAQAVAC+V
Sbjct  137  -----------AVPADSCSSVSSPIANWKISSPGDHPEDVKARLKFWAQAVACTV  180



>ref|XP_004152108.1| PREDICTED: uncharacterized protein LOC101213317 [Cucumis sativus]
 ref|XP_004156937.1| PREDICTED: uncharacterized LOC101213317 [Cucumis sativus]
 gb|KGN53057.1| hypothetical protein Csa_4G012530 [Cucumis sativus]
Length=183

 Score = 90.5 bits (223),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 52/115 (45%), Positives = 74/115 (64%), Gaps = 17/115 (15%)
 Frame = -1

Query  890  LTDDDLNELKGCIELGFGFKEEEGQRLCNTLPALDLYFAVNRQF----SFSPVSTPGSKG  723
            LTD+DL+ELKGC++LGFGF  +E   LCNTLPAL+L +++++++      SP S+P S  
Sbjct  78   LTDEDLDELKGCVDLGFGFSYDEIPELCNTLPALELCYSMSQKYMDDHQKSPESSPAS--  135

Query  722  TTLpspsasstggrssslsspgsdsdSWRICSPGENPEHVKIKLRHWAQAVACSV  558
                          + S SS  S   +W+I SPG++PE VK +L+ WAQAVAC+V
Sbjct  136  -----------AVPADSCSSVSSPIANWKISSPGDHPEDVKARLKFWAQAVACTV  179



>ref|XP_010508442.1| PREDICTED: uncharacterized protein LOC104785019 [Camelina sativa]
Length=193

 Score = 90.5 bits (223),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 55/117 (47%), Positives = 72/117 (62%), Gaps = 21/117 (18%)
 Frame = -1

Query  890  LTDDDLNELKGCIELGFGFKEEEGQRLCNTLPALDLYFAVNRQF------SFSPVSTPGS  729
            LTDDDL ELKGC++LGFGF  EE   LCNTLPAL+L ++++++F        S  S+P  
Sbjct  88   LTDDDLEELKGCVDLGFGFNYEEIPELCNTLPALELCYSMSQKFIDQDHHHHSSSSSPEK  147

Query  728  KGTTLpspsasstggrssslsspgsdsdSWRICSPGENPEHVKIKLRHWAQAVACSV  558
            K + L                SP S   SW+I SPG+NP+ VK +L+ WAQAVAC+V
Sbjct  148  KSSVL---------------DSPVSPIASWKISSPGDNPDDVKARLKFWAQAVACTV  189



>ref|XP_009133597.1| PREDICTED: uncharacterized protein LOC103858065 [Brassica rapa]
Length=180

 Score = 90.1 bits (222),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 51/114 (45%), Positives = 68/114 (60%), Gaps = 22/114 (19%)
 Frame = -1

Query  890  LTDDDLNELKGCIELGFGFKEEEGQRLCNTLPALDLYFAVNRQF---SFSPVSTPGSKGT  720
            LTDDDL ELKGC++LGFGF  EE   LCNTLPAL+L ++++++F        S+P    +
Sbjct  82   LTDDDLEELKGCVDLGFGFNYEEIPELCNTLPALELCYSMSQKFMDQDHHHTSSPEKIES  141

Query  719  TLpspsasstggrssslsspgsdsdSWRICSPGENPEHVKIKLRHWAQAVACSV  558
             +                   S   SW+I SPG+NP+ VK +LR WAQAVAC+V
Sbjct  142  PV-------------------SSLASWKISSPGDNPDDVKARLRFWAQAVACTV  176



>gb|KFK37170.1| hypothetical protein AALP_AA4G222800 [Arabis alpina]
Length=160

 Score = 89.7 bits (221),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 49/115 (43%), Positives = 65/115 (57%), Gaps = 32/115 (28%)
 Frame = -1

Query  890  LTDDDLNELKGCIELGFGFKEEEGQRLCNTLPALDLYFAVNRQF----SFSPVSTPGSKG  723
            LTDDDL ELKGC++LGFGF  EE   LCNTLPAL+L ++++++F        V +P S  
Sbjct  70   LTDDDLEELKGCVDLGFGFNYEEIPELCNTLPALELCYSMSQKFMDHQDHQVVESPLSS-  128

Query  722  TTLpspsasstggrssslsspgsdsdSWRICSPGENPEHVKIKLRHWAQAVACSV  558
                                       W+I SPG+NP+ VK +L+ WAQAVAC+V
Sbjct  129  ---------------------------WKISSPGDNPDDVKARLKFWAQAVACTV  156



>ref|XP_006443074.1| hypothetical protein CICLE_v10022453mg [Citrus clementina]
 ref|XP_006443075.1| hypothetical protein CICLE_v10022453mg [Citrus clementina]
 ref|XP_006443076.1| hypothetical protein CICLE_v10022453mg [Citrus clementina]
 ref|XP_006443077.1| hypothetical protein CICLE_v10022453mg [Citrus clementina]
 ref|XP_006443078.1| hypothetical protein CICLE_v10022453mg [Citrus clementina]
 ref|XP_006443079.1| hypothetical protein CICLE_v10022453mg [Citrus clementina]
 ref|XP_006494181.1| PREDICTED: uncharacterized protein LOC102619684 isoform X1 [Citrus 
sinensis]
 gb|ESR56314.1| hypothetical protein CICLE_v10022453mg [Citrus clementina]
 gb|ESR56315.1| hypothetical protein CICLE_v10022453mg [Citrus clementina]
 gb|ESR56316.1| hypothetical protein CICLE_v10022453mg [Citrus clementina]
 gb|ESR56317.1| hypothetical protein CICLE_v10022453mg [Citrus clementina]
 gb|ESR56318.1| hypothetical protein CICLE_v10022453mg [Citrus clementina]
 gb|ESR56319.1| hypothetical protein CICLE_v10022453mg [Citrus clementina]
 gb|KDO43493.1| hypothetical protein CISIN_1g029447mg [Citrus sinensis]
 gb|KDO43494.1| hypothetical protein CISIN_1g029447mg [Citrus sinensis]
 gb|KDO43495.1| hypothetical protein CISIN_1g029447mg [Citrus sinensis]
 gb|KDO43496.1| hypothetical protein CISIN_1g029447mg [Citrus sinensis]
 gb|KDO43497.1| hypothetical protein CISIN_1g029447mg [Citrus sinensis]
 gb|KDO43498.1| hypothetical protein CISIN_1g029447mg [Citrus sinensis]
 gb|KDO43499.1| hypothetical protein CISIN_1g029447mg [Citrus sinensis]
 gb|KDO43500.1| hypothetical protein CISIN_1g029447mg [Citrus sinensis]
Length=185

 Score = 90.1 bits (222),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 49/113 (43%), Positives = 71/113 (63%), Gaps = 14/113 (12%)
 Frame = -1

Query  890  LTDDDLNELKGCIELGFGFKEEEGQRLCNTLPALDLYFAVNRQF--SFSPVSTPGSKGTT  717
            LTD+DL+ELKGC++LGFGF  +E   LCNTLPAL+L ++++++F        +P S G +
Sbjct  81   LTDEDLDELKGCLDLGFGFSYDEIPELCNTLPALELCYSMSQKFMDEHQSQKSPESHGNS  140

Query  716  LpspsasstggrssslsspgsdsdSWRICSPGENPEHVKIKLRHWAQAVACSV  558
                          S     S   +W+I SPG++PE VK +L++WAQAVAC+V
Sbjct  141  ------------PVSTDPVSSPIANWKISSPGDHPEDVKARLKYWAQAVACTV  181



>ref|XP_002264307.2| PREDICTED: uncharacterized protein LOC100261066 [Vitis vinifera]
Length=185

 Score = 90.1 bits (222),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 48/115 (42%), Positives = 70/115 (61%), Gaps = 24/115 (21%)
 Frame = -1

Query  890  LTDDDLNELKGCIELGFGFKEEEGQRLCNTLPALDLYFAVNRQF----SFSPVSTPGSKG  723
            LTD+DL+ELKGC++LGFGF  EE   LCNTLPAL+L ++++++F      +P S+P +  
Sbjct  87   LTDEDLDELKGCLDLGFGFSYEEIPELCNTLPALELCYSMSQKFMDDQQKAPESSPAASE  146

Query  722  TTLpspsasstggrssslsspgsdsdSWRICSPGENPEHVKIKLRHWAQAVACSV  558
            +                         +W+I SPG++PE VK +L+ WAQAVAC+V
Sbjct  147  S--------------------PGPIANWKISSPGDHPEEVKARLKFWAQAVACTV  181



>ref|XP_009142190.1| PREDICTED: uncharacterized protein LOC103866068 [Brassica rapa]
 emb|CDY30403.1| BnaA04g25040D [Brassica napus]
Length=173

 Score = 89.7 bits (221),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 52/111 (47%), Positives = 69/111 (62%), Gaps = 15/111 (14%)
 Frame = -1

Query  890  LTDDDLNELKGCIELGFGFKEEEGQRLCNTLPALDLYFAVNRQFSFSPVSTPGSKGTTLp  711
            LTDDDL ELKGC++LGFGF  EE   LCNTLPAL+L ++++++F      +P  K   + 
Sbjct  74   LTDDDLEELKGCVDLGFGFNYEEIPELCNTLPALELCYSMSQKF-MDQDHSPEKKTPMM-  131

Query  710  spsasstggrssslsspgsdsdSWRICSPGENPEHVKIKLRHWAQAVACSV  558
                         L S  S   SW+I SPG+NP+ VK +L+ WAQAVAC+V
Sbjct  132  -------------LESHVSPIASWKISSPGDNPDDVKARLKFWAQAVACTV  169



>emb|CDY47701.1| BnaA10g03900D [Brassica napus]
Length=163

 Score = 89.4 bits (220),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 48/119 (40%), Positives = 73/119 (61%), Gaps = 24/119 (20%)
 Frame = -1

Query  899  AECLTDDDLNELKGCIELGFGFKEEEGQRLCNTLPALDLYFAVNRQFS-----FSPVSTP  735
            ++ LTDDDL +LKGC++LGFGF  +E   LC+TLPAL+L ++++++FS      SP ++P
Sbjct  60   SKSLTDDDLEDLKGCLDLGFGFSYDEIPELCSTLPALELCYSMSQRFSDDNNKSSPENSP  119

Query  734  GSKGTTLpspsasstggrssslsspgsdsdSWRICSPGENPEHVKIKLRHWAQAVACSV  558
                +                   P     +W+I SPG+NP+ VK +L++WAQAVAC+V
Sbjct  120  VDDSS-------------------PAPPIANWKISSPGDNPDDVKARLKYWAQAVACTV  159



>ref|XP_002307264.1| hypothetical protein POPTR_0005s18130g [Populus trichocarpa]
 gb|EEE94260.1| hypothetical protein POPTR_0005s18130g [Populus trichocarpa]
Length=177

 Score = 89.7 bits (221),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 65/172 (38%), Positives = 91/172 (53%), Gaps = 23/172 (13%)
 Frame = -1

Query  1040  QRLEHAPPFWRNRKK-------LSKQLSMC-ETPRDVAWerrrrqilnqerRKSDAECLT  885
             +++E+ PP  +  ++       L KQ S   +  RD AW RR+         K   + +T
Sbjct  15    EQIEYQPPIRKQHQQQLLGPSPLYKQHSWSPDIYRDEAWLRRKGNYK-----KKKCKSVT  69

Query  884   DDDLNELKGCIELGFGFKE-EEGQRLCNTLPALDLYFAVNRQFSFSPVSTPGSKGTTLps  708
             D+DL+ELKGCIELGFGF   E  QRL +T PAL+LY+AVN+ +    VS P +  ++   
Sbjct  70    DEDLDELKGCIELGFGFDSPEMDQRLSDTFPALELYYAVNKNYHDHSVSKPFTDTSS---  126

Query  707   psasstggrssslsspgsdsdSWRICSPGENPEHVKIKLRHWAQAVACSVMQ  552
                      +S   S         I  PG+NP+ VK +L+ WAQ VACSV Q
Sbjct  127   ------SSMASDCDSLSPLGSPHNIFGPGDNPQTVKTRLKQWAQVVACSVRQ  172



>ref|XP_010517896.1| PREDICTED: uncharacterized protein LOC104793266 [Camelina sativa]
Length=198

 Score = 90.1 bits (222),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 56/111 (50%), Positives = 74/111 (67%), Gaps = 4/111 (4%)
 Frame = -1

Query  890  LTDDDLNELKGCIELGFGFKEEEGQRLCNTLPALDLYFAVNRQFSFSPVSTPGSKGTTLp  711
            LTDDDL ELKGC++LGFGF  EE   LCNTLPAL+L ++++++F    +           
Sbjct  88   LTDDDLEELKGCVDLGFGFNYEEIPELCNTLPALELCYSMSQKF----IDQDHHHHHHHS  143

Query  710  spsasstggrssslsspgsdsdSWRICSPGENPEHVKIKLRHWAQAVACSV  558
            S S+SS   +S  L SP S   SW+I SPG+NP+ VK +L+ WAQAVAC+V
Sbjct  144  SSSSSSPEKKSPVLDSPVSPIASWKISSPGDNPDDVKARLKFWAQAVACTV  194



>ref|XP_004241395.1| PREDICTED: uncharacterized protein LOC101248208 [Solanum lycopersicum]
Length=191

 Score = 89.7 bits (221),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 48/117 (41%), Positives = 69/117 (59%), Gaps = 27/117 (23%)
 Frame = -1

Query  890  LTDDDLNELKGCIELGFGFKEEEGQRLCNTLPALDLYFAVNRQF------SFSPVSTPGS  729
            LTDDDL ELKGC++LGFGF  +E   LCNTLPAL+L +++++++          +S  GS
Sbjct  92   LTDDDLEELKGCLDLGFGFSYDEIPELCNTLPALELCYSMSQKYLDEQQKCSDAMSDTGS  151

Query  728  KGTTLpspsasstggrssslsspgsdsdSWRICSPGENPEHVKIKLRHWAQAVACSV  558
             G+                         +W+I SPG++PE VK +L++WAQAVAC+V
Sbjct  152  SGS---------------------GHVANWKISSPGDDPEDVKARLKYWAQAVACTV  187



>gb|EAZ18088.1| hypothetical protein OsJ_33634 [Oryza sativa Japonica Group]
Length=232

 Score = 90.5 bits (223),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 50/118 (42%), Positives = 71/118 (60%), Gaps = 21/118 (18%)
 Frame = -1

Query  899  AECLTDDDLNELKGCIELGFGFKEEEGQRLCNTLPALDLYFAVNRQF----SFSPVSTPG  732
            A  LTDDDL ELKGC++LGFGF  +E   LC TLPAL+L ++++++F      SPV+ P 
Sbjct  128  ARSLTDDDLEELKGCVDLGFGFSYDEIPELCGTLPALELCYSMSQRFLDEHYHSPVAEPA  187

Query  731  SKGTTLpspsasstggrssslsspgsdsdSWRICSPGENPEHVKIKLRHWAQAVACSV  558
                +                 SP     +W+I SPG++P+ VK +L++WAQAVAC+V
Sbjct  188  PVAPS-----------------SPAQPIANWKISSPGDSPDEVKARLKYWAQAVACTV  228



>ref|XP_010525931.1| PREDICTED: uncharacterized protein LOC104803633 [Tarenaya hassleriana]
Length=247

 Score = 90.9 bits (224),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 52/114 (46%), Positives = 71/114 (62%), Gaps = 17/114 (15%)
 Frame = -1

Query  890  LTDDDLNELKGCIELGFGFKEEEGQRLCNTLPALDLYFAVNRQF---SFSPVSTPGSKGT  720
            LTDDDL ELKGC++LGFGF  EE   LCNTLPAL+L ++++++F     +  +T   K T
Sbjct  144  LTDDDLEELKGCVDLGFGFSYEEIPELCNTLPALELCYSMSQKFLDHDQNTTTTSPEKKT  203

Query  719  TLpspsasstggrssslsspgsdsdSWRICSPGENPEHVKIKLRHWAQAVACSV  558
             +                S  S   SW+I SPG+NP+ VK +L++WAQAVAC+V
Sbjct  204  PV--------------PESSVSPIASWKISSPGDNPDDVKARLKYWAQAVACTV  243



>ref|XP_009119110.1| PREDICTED: uncharacterized protein LOC103844090 [Brassica rapa]
Length=165

 Score = 89.0 bits (219),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 48/120 (40%), Positives = 73/120 (61%), Gaps = 25/120 (21%)
 Frame = -1

Query  899  AECLTDDDLNELKGCIELGFGFKEEEGQRLCNTLPALDLYFAVNRQFS------FSPVST  738
            ++ LTDDDL +LKGC++LGFGF  +E   LC+TLPAL+L ++++++FS       SP ++
Sbjct  61   SKSLTDDDLEDLKGCLDLGFGFSYDEIPELCSTLPALELCYSMSQRFSDDNNNKSSPENS  120

Query  737  PGSKGTTLpspsasstggrssslsspgsdsdSWRICSPGENPEHVKIKLRHWAQAVACSV  558
            P    +                   P     +W+I SPG+NP+ VK +L++WAQAVAC+V
Sbjct  121  PVDDSS-------------------PAPPIANWKISSPGDNPDDVKARLKYWAQAVACTV  161



>ref|XP_008804168.1| PREDICTED: uncharacterized protein LOC103717519 [Phoenix dactylifera]
Length=138

 Score = 88.2 bits (217),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 47/111 (42%), Positives = 71/111 (64%), Gaps = 5/111 (5%)
 Frame = -1

Query  890  LTDDDLNELKGCIELGFGFKEEEGQRLCNTLPALDLYFAVNRQFSFSPVSTPGSKGTTLp  711
            LTD+DL ELKGC++LGFGF  EE   LCNTLPAL+L ++++++F          + T  P
Sbjct  29   LTDEDLEELKGCLDLGFGFSYEEIPELCNTLPALELCYSMSQRF-----LDEQQQQTRSP  83

Query  710  spsasstggrssslsspgsdsdSWRICSPGENPEHVKIKLRHWAQAVACSV  558
              +  +      + ++      +W+I SPG++PE VK +L++WAQAVAC+V
Sbjct  84   EAARDAATAEPCASAASPVPVANWKISSPGDHPEEVKARLKYWAQAVACTV  134



>ref|XP_006347276.1| PREDICTED: uncharacterized protein LOC102592452 [Solanum tuberosum]
Length=193

 Score = 89.4 bits (220),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 48/117 (41%), Positives = 69/117 (59%), Gaps = 27/117 (23%)
 Frame = -1

Query  890  LTDDDLNELKGCIELGFGFKEEEGQRLCNTLPALDLYFAVNRQF------SFSPVSTPGS  729
            LTDDDL ELKGC++LGFGF  +E   LCNTLPAL+L +++++++          +S  GS
Sbjct  94   LTDDDLEELKGCLDLGFGFSYDEIPELCNTLPALELCYSMSQKYLDEQQKCSDAMSDTGS  153

Query  728  KGTTLpspsasstggrssslsspgsdsdSWRICSPGENPEHVKIKLRHWAQAVACSV  558
             G+                         +W+I SPG++PE VK +L++WAQAVAC+V
Sbjct  154  SGS---------------------GHVANWKISSPGDDPEDVKARLKYWAQAVACTV  189



>gb|AAX92905.1| expressed protein [Oryza sativa Japonica Group]
 gb|ABA92697.1| expressed protein [Oryza sativa Japonica Group]
Length=232

 Score = 90.1 bits (222),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 50/118 (42%), Positives = 71/118 (60%), Gaps = 21/118 (18%)
 Frame = -1

Query  899  AECLTDDDLNELKGCIELGFGFKEEEGQRLCNTLPALDLYFAVNRQF----SFSPVSTPG  732
            A  LTDDDL ELKGC++LGFGF  +E   LC TLPAL+L ++++++F      SPV+ P 
Sbjct  128  ARSLTDDDLEELKGCVDLGFGFSYDEIPELCGTLPALELCYSMSQRFLDEHYHSPVAEPA  187

Query  731  SKGTTLpspsasstggrssslsspgsdsdSWRICSPGENPEHVKIKLRHWAQAVACSV  558
                +                 SP     +W+I SPG++P+ VK +L++WAQAVAC+V
Sbjct  188  PVAPS-----------------SPAQPIANWKISSPGDSPDEVKARLKYWAQAVACTV  228



>ref|XP_010506205.1| PREDICTED: uncharacterized protein LOC104782850 [Camelina sativa]
Length=196

 Score = 89.4 bits (220),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 53/120 (44%), Positives = 70/120 (58%), Gaps = 24/120 (20%)
 Frame = -1

Query  890  LTDDDLNELKGCIELGFGFKEEEGQRLCNTLPALDLYFAVNRQF---------SFSPVST  738
            LTDDDL ELKGC++LGFGF  EE   LCNTLPAL+L ++++++F           S  S 
Sbjct  88   LTDDDLEELKGCVDLGFGFNYEEIPELCNTLPALELCYSMSQKFIDQDHHHHYHSSSSSY  147

Query  737  PGSKGTTLpspsasstggrssslsspgsdsdSWRICSPGENPEHVKIKLRHWAQAVACSV  558
            P  K + L SP +                   W+I SPG+NP+ VK +L+ WAQAVAC+V
Sbjct  148  PEKKSSVLDSPVSPIAS---------------WKISSPGDNPDDVKARLKFWAQAVACTV  192



>gb|KHG09162.1| Glutamate-1-semialdehyde 2,1-aminomutase 1 [Gossypium arboreum]
Length=184

 Score = 89.0 bits (219),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 47/113 (42%), Positives = 68/113 (60%), Gaps = 22/113 (19%)
 Frame = -1

Query  890  LTDDDLNELKGCIELGFGFKEEEGQRLCNTLPALDLYFAVNRQF--SFSPVSTPGSKGTT  717
            LTDDDL+ELKGC++LGFGF  EE   LCNTLPAL+L +++++++       ++P +  T 
Sbjct  88   LTDDDLDELKGCLDLGFGFSYEEIPELCNTLPALELCYSMSQKYLDDHQHHASPDTTATP  147

Query  716  LpspsasstggrssslsspgsdsdSWRICSPGENPEHVKIKLRHWAQAVACSV  558
                                    +W+I SPG++PE VK +L+ WAQAVAC+V
Sbjct  148  --------------------EPVANWKISSPGDHPEDVKARLKFWAQAVACTV  180



>ref|XP_010028255.1| PREDICTED: uncharacterized protein LOC104418572 [Eucalyptus grandis]
 gb|KCW54957.1| hypothetical protein EUGRSUZ_I00927 [Eucalyptus grandis]
Length=193

 Score = 89.4 bits (220),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 65/168 (39%), Positives = 88/168 (52%), Gaps = 20/168 (12%)
 Frame = -1

Query  1043  IQRLEHAPPFWRNRKKLSKQLSMC-ETPRDVAWerrrrqilnqerRKSDAECLTDDDLNE  867
             ++ L   P   RNR  L KQ S   +  R+ AW RR+            ++ +T++DL+E
Sbjct  41    LRSLASTPSLLRNRSSLCKQKSWSPDMFREEAWLRRKGNFR-----NRQSKSVTEEDLDE  95

Query  866   LKGCIELGFGFKEEE--GQRLCNTLPALDLYFAVNRQFSFSPVSTPGSKGTTLpspsass  693
             LKGCIELGFGF   E    RL +TLPAL  Y+AV RQ   S + +  +  +T     ++S
Sbjct  96    LKGCIELGFGFDSPEVVDGRLSDTLPALGFYYAVTRQCGGSVLRSAETSTSTASDCDSAS  155

Query  692   tggrssslsspgsdsdSWRICSPGENPEHVKIKLRHWAQAVACSVMQS  549
               G   +            IC P +NP+ VK +LR WAQ VACSV QS
Sbjct  156   PIGSPHA------------ICGPSDNPDVVKTRLRQWAQIVACSVRQS  191



>ref|XP_010457696.1| PREDICTED: uncharacterized protein LOC104739135 [Camelina sativa]
Length=190

 Score = 89.0 bits (219),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 46/114 (40%), Positives = 70/114 (61%), Gaps = 13/114 (11%)
 Frame = -1

Query  899  AECLTDDDLNELKGCIELGFGFKEEEGQRLCNTLPALDLYFAVNRQFSFSPVSTPGSKGT  720
            ++ LTDDDL +LKGC++LGFGF  +E   LCNTLPAL+L ++++++F      +P     
Sbjct  86   SKSLTDDDLEDLKGCLDLGFGFSYDEIPELCNTLPALELCYSMSQKFLDDKHRSPDHSSA  145

Query  719  TLpspsasstggrssslsspgsdsdSWRICSPGENPEHVKIKLRHWAQAVACSV  558
                           S  +  +   +W+I SPG+NP+ VK +L++WAQAVAC+V
Sbjct  146  D-------------DSPVTSPAPIANWKISSPGDNPDDVKARLKYWAQAVACTV  186



>ref|XP_006417977.1| hypothetical protein EUTSA_v10008864mg [Eutrema salsugineum]
 gb|ESQ36330.1| hypothetical protein EUTSA_v10008864mg [Eutrema salsugineum]
Length=188

 Score = 89.0 bits (219),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 47/116 (41%), Positives = 73/116 (63%), Gaps = 16/116 (14%)
 Frame = -1

Query  899  AECLTDDDLNELKGCIELGFGFKEEEGQRLCNTLPALDLYFAVNRQF--SFSPVSTPGSK  726
            ++ LTDDDL +LKGC++LGFGF  +E   LCNTLPAL+L ++++++F  + SP S+    
Sbjct  83   SKSLTDDDLEDLKGCLDLGFGFSYDEIPELCNTLPALELCYSMSQKFLDNRSPESSSVDD  142

Query  725  GTTLpspsasstggrssslsspgsdsdSWRICSPGENPEHVKIKLRHWAQAVACSV  558
              +                 +  +   +W+I SPG+NP+ VK +L++WAQAVAC+V
Sbjct  143  SPS--------------HSPATPTPIANWKISSPGDNPDDVKARLKYWAQAVACTV  184



>ref|XP_006397499.1| hypothetical protein EUTSA_v10001651mg [Eutrema salsugineum]
 gb|ESQ38952.1| hypothetical protein EUTSA_v10001651mg [Eutrema salsugineum]
Length=188

 Score = 88.6 bits (218),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 53/113 (47%), Positives = 71/113 (63%), Gaps = 16/113 (14%)
 Frame = -1

Query  890  LTDDDLNELKGCIELGFGFKEEEGQRLCNTLPALDLYFAVNRQF--SFSPVSTPGSKGTT  717
            LTDDDL ELKGC++LGFGF  EE   LCNTLPAL+L ++++++F       ++P  K   
Sbjct  86   LTDDDLEELKGCVDLGFGFNYEEIPELCNTLPALELCYSMSQKFMDQDHHHTSPEKKSPA  145

Query  716  LpspsasstggrssslsspgsdsdSWRICSPGENPEHVKIKLRHWAQAVACSV  558
            +              L SP S   SW+I SPG+NP+ VK +L+ WAQAVAC+V
Sbjct  146  M--------------LESPVSPIASWKISSPGDNPDDVKARLKFWAQAVACTV  184



>emb|CDY44220.1| BnaC03g24120D [Brassica napus]
Length=180

 Score = 88.2 bits (217),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 50/114 (44%), Positives = 67/114 (59%), Gaps = 22/114 (19%)
 Frame = -1

Query  890  LTDDDLNELKGCIELGFGFKEEEGQRLCNTLPALDLYFAVNRQF---SFSPVSTPGSKGT  720
            LTDDDL ELKGC++LGFGF  EE   LCNTLPAL+L ++++++F        S+P    +
Sbjct  82   LTDDDLEELKGCVDLGFGFNYEEIPELCNTLPALELCYSMSQKFMDQDHHHTSSPEKIES  141

Query  719  TLpspsasstggrssslsspgsdsdSWRICSPGENPEHVKIKLRHWAQAVACSV  558
             +                   S   SW+I  PG+NP+ VK +LR WAQAVAC+V
Sbjct  142  PV-------------------SSLASWKISRPGDNPDDVKARLRFWAQAVACTV  176



>ref|XP_004970915.1| PREDICTED: uncharacterized protein LOC101772047 [Setaria italica]
Length=159

 Score = 87.8 bits (216),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 47/111 (42%), Positives = 64/111 (58%), Gaps = 19/111 (17%)
 Frame = -1

Query  890  LTDDDLNELKGCIELGFGFKEEEGQRLCNTLPALDLYFAVNRQFSFSPVSTPGSKGTTLp  711
            LT+DDL ELKGC++LGFGF   E   LC TLPAL+L +++ R+F       PG +  T  
Sbjct  64   LTEDDLEELKGCLDLGFGFAYSEIPELCGTLPALELCYSMTRRF-LDEQREPGQEQET--  120

Query  710  spsasstggrssslsspgsdsdSWRICSPGENPEHVKIKLRHWAQAVACSV  558
                              +   +WRI  PG++PE VK +L++WAQAVAC+V
Sbjct  121  ----------------SATPLPNWRISGPGDDPEEVKARLKYWAQAVACTV  155



>ref|XP_009382924.1| PREDICTED: uncharacterized protein LOC103970739 [Musa acuminata 
subsp. malaccensis]
Length=190

 Score = 88.2 bits (217),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 50/111 (45%), Positives = 70/111 (63%), Gaps = 6/111 (5%)
 Frame = -1

Query  890  LTDDDLNELKGCIELGFGFKEEEGQRLCNTLPALDLYFAVNRQFSFSPVSTPGSKGTTLp  711
            LTD+DL ELKGC++LGFGF  EE   LCNTLPAL+L ++++++F          +   L 
Sbjct  82   LTDEDLEELKGCLDLGFGFSYEEIPELCNTLPALELCYSMSQRF------LDEQQQQQLS  135

Query  710  spsasstggrssslsspgsdsdSWRICSPGENPEHVKIKLRHWAQAVACSV  558
               +SS        S P     +WRI SPG++P+ VK +LR+WAQAVAC++
Sbjct  136  LDRSSSGESMDLCPSPPSPPIANWRISSPGDDPDEVKARLRYWAQAVACTI  186



>ref|XP_009141154.1| PREDICTED: uncharacterized protein LOC103865127 [Brassica rapa]
Length=195

 Score = 88.2 bits (217),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 48/111 (43%), Positives = 68/111 (61%), Gaps = 10/111 (9%)
 Frame = -1

Query  890  LTDDDLNELKGCIELGFGFKEEEGQRLCNTLPALDLYFAVNRQFSFSPVSTPGSKGTTLp  711
            LTDDDL ELKGC++LGFGF  +E   LCNTLPAL+L ++++++F      +  +  T   
Sbjct  91   LTDDDLEELKGCLDLGFGFSYDEIPELCNTLPALELCYSMSQKFLDDQQKSSDTCQT---  147

Query  710  spsasstggrssslsspgsdsdSWRICSPGENPEHVKIKLRHWAQAVACSV  558
                      S    S      +W+I SPG+NP+ VK +L++WAQAVAC+V
Sbjct  148  -------EEDSPPPPSTTGPVANWKISSPGDNPDDVKARLKYWAQAVACTV  191



>ref|XP_010510186.1| PREDICTED: uncharacterized protein LOC104786463 [Camelina sativa]
Length=206

 Score = 88.2 bits (217),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 47/114 (41%), Positives = 69/114 (61%), Gaps = 11/114 (10%)
 Frame = -1

Query  899  AECLTDDDLNELKGCIELGFGFKEEEGQRLCNTLPALDLYFAVNRQFSFSPVSTPGSKGT  720
            A+ LTDDDL ELKGC++LGFGF  +E   LCNTLPAL+L ++++++F     +   S   
Sbjct  100  AKSLTDDDLEELKGCLDLGFGFSYDEIPELCNTLPALELCYSMSQKFLDDKQNHHSSS--  157

Query  719  TLpspsasstggrssslsspgsdsdSWRICSPGENPEHVKIKLRHWAQAVACSV  558
                         S    +  +   +W+I SPG++PE VK +L++WAQ VAC+V
Sbjct  158  ---------EEEDSPPPPTTTTPIANWKISSPGDDPEDVKARLKYWAQTVACTV  202



>ref|XP_010485468.1| PREDICTED: uncharacterized protein LOC104763778 [Camelina sativa]
Length=194

 Score = 88.2 bits (217),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 47/114 (41%), Positives = 71/114 (62%), Gaps = 9/114 (8%)
 Frame = -1

Query  899  AECLTDDDLNELKGCIELGFGFKEEEGQRLCNTLPALDLYFAVNRQFSFSPVSTPGSKGT  720
            ++ LTDDDL +LKGC++LGFGF  +E   LCNTLPAL+L ++++++F      +P     
Sbjct  86   SKSLTDDDLEDLKGCLDLGFGFSYDEIPELCNTLPALELCYSMSQKFLDDKHRSPDHSSA  145

Query  719  TLpspsasstggrssslsspgsdsdSWRICSPGENPEHVKIKLRHWAQAVACSV  558
                         S S  +  +   +W+I SPG+NP+ VK +L++WAQAVAC+V
Sbjct  146  D---------DSPSPSPVTSPAPIANWKISSPGDNPDDVKARLKYWAQAVACTV  190



>emb|CDY10158.1| BnaC05g04010D [Brassica napus]
Length=162

 Score = 87.4 bits (215),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 48/115 (42%), Positives = 73/115 (63%), Gaps = 17/115 (15%)
 Frame = -1

Query  899  AECLTDDDLNELKGCIELGFGFKEEEGQRLCNTLPALDLYFAVNRQFS-FSPVSTPGSKG  723
            ++ LTDDDL +LKGC++LGFGF  +E   LC+TLPAL+L ++++++FS  +  S+P +  
Sbjct  60   SKSLTDDDLEDLKGCLDLGFGFSYDEIPELCSTLPALELCYSMSQRFSDDNNKSSPENSS  119

Query  722  TTLpspsasstggrssslsspgsdsdSWRICSPGENPEHVKIKLRHWAQAVACSV  558
                               SP     +W+I SPG+NP+ VK +L++WAQAVAC+V
Sbjct  120  V----------------DDSPAPPIANWKISSPGDNPDDVKARLKYWAQAVACTV  158



>emb|CDY19080.1| BnaA04g18200D [Brassica napus]
Length=175

 Score = 87.4 bits (215),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 48/111 (43%), Positives = 67/111 (60%), Gaps = 10/111 (9%)
 Frame = -1

Query  890  LTDDDLNELKGCIELGFGFKEEEGQRLCNTLPALDLYFAVNRQFSFSPVSTPGSKGTTLp  711
            LTDDDL ELKGC++LGFGF  EE   LCNTLPAL+L ++++++F      +  +      
Sbjct  71   LTDDDLEELKGCLDLGFGFSYEEIPELCNTLPALELCYSMSQKFLDDQQKSSDT------  124

Query  710  spsasstggrssslsspgsdsdSWRICSPGENPEHVKIKLRHWAQAVACSV  558
                      S    S      +W+I SPG+NP+ VK +L++WAQAVAC+V
Sbjct  125  ----CPAEEASPPPPSTTGPVANWKISSPGDNPDDVKARLKYWAQAVACTV  171



>ref|XP_002880038.1| hypothetical protein ARALYDRAFT_483441 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH56297.1| hypothetical protein ARALYDRAFT_483441 [Arabidopsis lyrata subsp. 
lyrata]
Length=191

 Score = 87.8 bits (216),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 55/118 (47%), Positives = 72/118 (61%), Gaps = 22/118 (19%)
 Frame = -1

Query  890  LTDDDLNELKGCIELGFGFKEEEGQRLCNTLPALDLYFAVNRQF-------SFSPVSTPG  732
            LTDDDL ELKGC++LGFGF  EE   LCNTLPAL+L ++++++F         S  S+P 
Sbjct  85   LTDDDLEELKGCVDLGFGFNYEEIPELCNTLPALELCYSMSQKFIDHQDHHHSSSSSSPE  144

Query  731  SKGTTLpspsasstggrssslsspgsdsdSWRICSPGENPEHVKIKLRHWAQAVACSV  558
             K + L                SP S   SW+I SPG+NP+ VK +L+ WAQAVAC+V
Sbjct  145  KKLSVL---------------DSPVSPIASWKISSPGDNPDDVKARLKFWAQAVACTV  187



>ref|XP_009350717.1| PREDICTED: uncharacterized protein LOC103942249 [Pyrus x bretschneideri]
Length=155

 Score = 87.0 bits (214),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 62/139 (45%), Positives = 82/139 (59%), Gaps = 9/139 (6%)
 Frame = -1

Query  962  RDVAWerrrrqilnqerRKSDAECLTDDDLNELKGCIELGFGFKE-EEGQRLCNTLPALD  786
            RD AW RR++       ++S  + +TD+DL+ELK CIELGFGF   E  QRL NT PAL 
Sbjct  24   RDEAWHRRKKINGRSNLQRS--KSVTDEDLDELKACIELGFGFDSPESDQRLANTFPALG  81

Query  785  LYFAVNRQFSFSPVSTPGSKGTTLpspsasstggrssslsspgsdsdSWRICSPGENPEH  606
            LY+AVN+ +  S  +      T+L SP+ S      S + SP +      I  PG+ P+ 
Sbjct  82   LYYAVNKSYCDSVSNKSTGTPTSLFSPTPSECDSVPSPVGSPHT------IFGPGDTPQT  135

Query  605  VKIKLRHWAQAVACSVMQS  549
            VK +LR WAQ VAC+V QS
Sbjct  136  VKTRLRQWAQVVACTVRQS  154



>gb|KHG07625.1| Sphingomyelin phosphodiesterase D [Gossypium arboreum]
Length=169

 Score = 87.4 bits (215),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 70/174 (40%), Positives = 91/174 (52%), Gaps = 32/174 (18%)
 Frame = -1

Query  1043  IQRLEHAPPFW----RNRKKLSKQLSMC-ETPRDVAWerrrrqilnqerRKSDAECLTDD  879
             +Q LE  PP           L KQ S+  +  RD AW RR+            ++ +TD+
Sbjct  16    VQVLESPPPMMTMTPSQLPALYKQRSLSPDIFRDEAWLRRKGNSR-----NRGSKSVTDE  70

Query  878   DLNELKGCIELGFGFK---EEEGQRLCNTLPALDLYFAVNRQFS--FSPVSTPGSKGTTL  714
             DL+ELK CIELGFGF+    E  QRL +TLPAL LY+AVN+ ++   S  S+  S   ++
Sbjct  71    DLDELKACIELGFGFEFDSPEVDQRLSDTLPALGLYYAVNKNYNDIVSKSSSVASDCDSI  130

Query  713   pspsasstggrssslsspgsdsdSWRICSPGENPEHVKIKLRHWAQAVACSVMQ  552
             PSP  S                    I  PG+NP+ VKI+LR WAQ VACSV Q
Sbjct  131   PSPIGSPNS-----------------IFGPGDNPQTVKIRLRQWAQVVACSVRQ  167



>ref|XP_009375708.1| PREDICTED: uncharacterized protein LOC103964496 [Pyrus x bretschneideri]
Length=155

 Score = 87.0 bits (214),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 62/139 (45%), Positives = 82/139 (59%), Gaps = 9/139 (6%)
 Frame = -1

Query  962  RDVAWerrrrqilnqerRKSDAECLTDDDLNELKGCIELGFGFKE-EEGQRLCNTLPALD  786
            RD AW RR++       ++S  + +TD+DL+ELK CIELGFGF   E  QRL NT PAL 
Sbjct  24   RDEAWHRRKKINGRSNLQRS--KSVTDEDLDELKACIELGFGFDSPESDQRLANTFPALG  81

Query  785  LYFAVNRQFSFSPVSTPGSKGTTLpspsasstggrssslsspgsdsdSWRICSPGENPEH  606
            LY+AVN+ +  S  +      T+L SP+ S      S + SP +      I  PG+ P+ 
Sbjct  82   LYYAVNKSYCDSVSNKSTGTPTSLFSPTPSECDSVPSPIGSPHT------IFGPGDTPQT  135

Query  605  VKIKLRHWAQAVACSVMQS  549
            VK +LR WAQ VAC+V QS
Sbjct  136  VKTRLRQWAQVVACTVRQS  154



>ref|XP_010263540.1| PREDICTED: uncharacterized protein LOC104601776 [Nelumbo nucifera]
Length=147

 Score = 86.7 bits (213),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 66/152 (43%), Positives = 88/152 (58%), Gaps = 17/152 (11%)
 Frame = -1

Query  995  LSKQLS-MCETPRDVAWerrrrqilnqerRKSDAECLTDDDLNELKGCIELGFGFKEEE-  822
            L KQ S   +T RD AW RR+    N  RR+S  + +TD+DL+ELK CIELGFGF   + 
Sbjct  11   LYKQRSWSSDTYRDEAWLRRKGNSKNNRRRRS--KSVTDEDLDELKACIELGFGFDSPDL  68

Query  821  GQRLCNTLPALDLYFAVNRQFSFSPVSTPGSKGTTLpspsasstggrssslsspgsdsdS  642
              RL +TLPAL L++AVN+Q++ S   +  S        ++S  G   +           
Sbjct  69   DSRLSDTLPALGLFYAVNKQYNDSVSKSSSSSTAASECDASSPLGSPHT-----------  117

Query  641  WRICSPGENPEHVKIKLRHWAQAVACSVMQSY  546
              I +PG+NP+ VK +LR WAQ VACSV QSY
Sbjct  118  --IFTPGDNPQLVKTRLRQWAQVVACSVRQSY  147



>ref|XP_010469720.1| PREDICTED: uncharacterized protein LOC104749735 [Camelina sativa]
Length=207

 Score = 87.8 bits (216),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 46/114 (40%), Positives = 68/114 (60%), Gaps = 9/114 (8%)
 Frame = -1

Query  899  AECLTDDDLNELKGCIELGFGFKEEEGQRLCNTLPALDLYFAVNRQFSFSPVSTPGSKGT  720
            A+ LTDDDL ELKGC++LGFGF  +E   LCNTLPAL+L ++++++F     +   S   
Sbjct  99   AKSLTDDDLEELKGCLDLGFGFSYDEIPELCNTLPALELCYSMSQKFLDDKQNHHSSS--  156

Query  719  TLpspsasstggrssslsspgsdsdSWRICSPGENPEHVKIKLRHWAQAVACSV  558
                              +  +   +W+I SPG++PE VK +L++WAQ VAC+V
Sbjct  157  -------EEEDSPPPPPPTTTTPIANWKISSPGDDPEDVKARLKYWAQTVACTV  203



>ref|XP_008791761.1| PREDICTED: uncharacterized protein LOC103708560 [Phoenix dactylifera]
Length=197

 Score = 87.8 bits (216),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 46/111 (41%), Positives = 71/111 (64%), Gaps = 6/111 (5%)
 Frame = -1

Query  890  LTDDDLNELKGCIELGFGFKEEEGQRLCNTLPALDLYFAVNRQFSFSPVSTPGSKGTTLp  711
            LTD+DL ELKGC++LGFGF  EE   LCNTLPAL+L ++++++F        G +  +  
Sbjct  89   LTDEDLEELKGCLDLGFGFSYEEIPELCNTLPALELCYSMSQRF------LDGQQQQSRA  142

Query  710  spsasstggrssslsspgsdsdSWRICSPGENPEHVKIKLRHWAQAVACSV  558
              +A        + ++  +   +W+I  PG++PE VK +L++WAQAVAC+V
Sbjct  143  PEAAGDAAAELGAAAASSAPVANWKISGPGDHPEEVKARLKYWAQAVACTV  193



>ref|XP_006664442.1| PREDICTED: uncharacterized protein LOC102713151, partial [Oryza 
brachyantha]
Length=114

 Score = 85.5 bits (210),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 48/117 (41%), Positives = 69/117 (59%), Gaps = 20/117 (17%)
 Frame = -1

Query  899  AECLTDDDLNELKGCIELGFGFKEEEGQRLCNTLPALDLYFAVNRQF---SFSPVSTPGS  729
            A  LTDDDL ELKGC++LGFGF  +E   LC TLPAL+L ++++++F      P + P +
Sbjct  11   ARSLTDDDLEELKGCVDLGFGFSYDEIPELCGTLPALELCYSMSQRFLDDRLHPHAPPET  70

Query  728  KGTTLpspsasstggrssslsspgsdsdSWRICSPGENPEHVKIKLRHWAQAVACSV  558
                                 SP     +W+I SPG++P+ VK +L++WAQAVAC+V
Sbjct  71   AAPP-----------------SPSPPIPNWKISSPGDSPDEVKARLKYWAQAVACTV  110



>ref|XP_010522195.1| PREDICTED: uncharacterized protein LOC104800902 [Tarenaya hassleriana]
Length=199

 Score = 87.8 bits (216),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 49/111 (44%), Positives = 70/111 (63%), Gaps = 7/111 (6%)
 Frame = -1

Query  890  LTDDDLNELKGCIELGFGFKEEEGQRLCNTLPALDLYFAVNRQFSFSPVSTPGSKGTTLp  711
            LTDD L ELKGC++LGFGF  +E   LCNTLPAL+L ++++++F        G K +   
Sbjct  92   LTDDHLEELKGCLDLGFGFSYDEIPELCNTLPALELCYSMSQKFL-------GEKQSHQK  144

Query  710  spsasstggrssslsspgsdsdSWRICSPGENPEHVKIKLRHWAQAVACSV  558
            SP  S          +  S   +W+I SPG++P+ VK +L++WAQAVAC+V
Sbjct  145  SPENSPVEESRPPPLAAASPVANWKISSPGDHPDDVKARLKYWAQAVACTV  195



>gb|KDP42817.1| hypothetical protein JCGZ_23759 [Jatropha curcas]
Length=201

 Score = 87.8 bits (216),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 47/111 (42%), Positives = 66/111 (59%), Gaps = 14/111 (13%)
 Frame = -1

Query  890  LTDDDLNELKGCIELGFGFKEEEGQRLCNTLPALDLYFAVNRQFSFSPVSTPGSKGTTLp  711
            LTDDDL+ELKGC++LGFGF  +E   LCNTLPAL+L ++++++F       P      + 
Sbjct  101  LTDDDLDELKGCLDLGFGFSYDEIPELCNTLPALELCYSMSQKFLDEQHKCPERSSPAV-  159

Query  710  spsasstggrssslsspgsdsdSWRICSPGENPEHVKIKLRHWAQAVACSV  558
                              S   +W+I SPG++PE VK +L+ WAQAVAC+V
Sbjct  160  -------------AEPASSPIANWKISSPGDHPEDVKARLKFWAQAVACTV  197



>ref|XP_011005866.1| PREDICTED: uncharacterized protein LOC105112024 [Populus euphratica]
Length=237

 Score = 88.2 bits (217),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 51/115 (44%), Positives = 67/115 (58%), Gaps = 10/115 (9%)
 Frame = -1

Query  893  CLTDDDLNELKGCIELGFGFKEEE-GQRLCNTLPALDLYFAVNRQFSFSPVSTPGSKGTT  717
             +TD+DL+ELKGCIELGFGF   E  QRL +T PAL+LY+AVN+ +    VS P +  ++
Sbjct  127  SVTDEDLDELKGCIELGFGFDSPEMDQRLSDTFPALELYYAVNKNYHDHSVSKPFTDTSS  186

Query  716  LpspsasstggrssslsspgsdsdSWRICSPGENPEHVKIKLRHWAQAVACSVMQ  552
                        +S   S         I  PG+NP+ VK +L+ WAQ VACSV Q
Sbjct  187  ---------SSMASDCDSLSPLGSPHNIFGPGDNPQTVKTRLKLWAQVVACSVRQ  232



>ref|XP_010414113.1| PREDICTED: uncharacterized protein LOC104700310 [Camelina sativa]
Length=198

 Score = 87.4 bits (215),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 47/114 (41%), Positives = 69/114 (61%), Gaps = 11/114 (10%)
 Frame = -1

Query  899  AECLTDDDLNELKGCIELGFGFKEEEGQRLCNTLPALDLYFAVNRQFSFSPVSTPGSKGT  720
            A+ LTDDDL ELKGC++LGFGF  +E   LCNTLPAL+L ++++++F     +   S   
Sbjct  92   AKSLTDDDLEELKGCLDLGFGFSYDEIPELCNTLPALELCYSMSQKFLDDKQNHHNSS--  149

Query  719  TLpspsasstggrssslsspgsdsdSWRICSPGENPEHVKIKLRHWAQAVACSV  558
                         S    +  +   +W+I SPG++PE VK +L++WAQ VAC+V
Sbjct  150  ---------EEEDSPPPPTTTTPIANWKISSPGDDPEDVKARLKYWAQTVACTV  194



>ref|XP_009132802.1| PREDICTED: uncharacterized protein LOC103857387 [Brassica rapa]
Length=188

 Score = 87.4 bits (215),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 46/114 (40%), Positives = 69/114 (61%), Gaps = 15/114 (13%)
 Frame = -1

Query  899  AECLTDDDLNELKGCIELGFGFKEEEGQRLCNTLPALDLYFAVNRQFSFSPVSTPGSKGT  720
            A+ LTDDDL ELKGC++LGFGF  +E   LCNTLPAL+L ++++++F    ++   +   
Sbjct  86   AKSLTDDDLEELKGCLDLGFGFSYDEIPELCNTLPALELCYSMSQKFLDDKLNHQENSPR  145

Query  719  TLpspsasstggrssslsspgsdsdSWRICSPGENPEHVKIKLRHWAQAVACSV  558
                              +  S   +W+I SPG+NP+ VK +L++WAQ VAC+V
Sbjct  146  P---------------PPTTTSPVANWKISSPGDNPDDVKARLKYWAQTVACTV  184



>emb|CDX84774.1| BnaA03g14560D [Brassica napus]
Length=188

 Score = 87.0 bits (214),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 46/114 (40%), Positives = 68/114 (60%), Gaps = 15/114 (13%)
 Frame = -1

Query  899  AECLTDDDLNELKGCIELGFGFKEEEGQRLCNTLPALDLYFAVNRQFSFSPVSTPGSKGT  720
            A+ LTDDDL ELKGC++LGFGF  +E   LCNTLPAL+L ++++++F    ++       
Sbjct  86   AKSLTDDDLEELKGCLDLGFGFSYDEIPELCNTLPALELCYSMSQKFLDDKLN-------  138

Query  719  TLpspsasstggrssslsspgsdsdSWRICSPGENPEHVKIKLRHWAQAVACSV  558
                              +  S   +W+I SPG+NP+ VK +L++WAQ VAC+V
Sbjct  139  --------HQEDSPRPPPTTTSPVANWKISSPGDNPDDVKARLKYWAQTVACTV  184



>emb|CDY23932.1| BnaC03g17590D [Brassica napus]
Length=191

 Score = 87.0 bits (214),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 46/114 (40%), Positives = 68/114 (60%), Gaps = 15/114 (13%)
 Frame = -1

Query  899  AECLTDDDLNELKGCIELGFGFKEEEGQRLCNTLPALDLYFAVNRQFSFSPVSTPGSKGT  720
            A+ LTDDDL ELKGC++LGFGF  +E   LCNTLPAL+L ++++++F    ++       
Sbjct  89   AKSLTDDDLEELKGCLDLGFGFSYDEIPELCNTLPALELCYSMSQKFLDDKLN-------  141

Query  719  TLpspsasstggrssslsspgsdsdSWRICSPGENPEHVKIKLRHWAQAVACSV  558
                              +  S   +W+I SPG+NP+ VK +L++WAQ VAC+V
Sbjct  142  --------HQEDSPRPPPTTTSPVANWKISSPGDNPDDVKARLKYWAQTVACTV  187



>ref|NP_850394.1| uncharacterized protein [Arabidopsis thaliana]
 gb|AAK43923.1|AF370604_1 Unknown protein [Arabidopsis thaliana]
 gb|ABF83640.1| At2g43340 [Arabidopsis thaliana]
 dbj|BAE99801.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEC10253.1| uncharacterized protein AT2G43340 [Arabidopsis thaliana]
Length=189

 Score = 87.0 bits (214),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 54/111 (49%), Positives = 70/111 (63%), Gaps = 10/111 (9%)
 Frame = -1

Query  890  LTDDDLNELKGCIELGFGFKEEEGQRLCNTLPALDLYFAVNRQFSFSPVSTPGSKGTTLp  711
            LTDDDL ELKGC++LGFGF  EE   LCNTLPAL+L ++++++F         S      
Sbjct  85   LTDDDLEELKGCVDLGFGFNYEEIPELCNTLPALELCYSMSQKFIDQDHHHHSSSSPE--  142

Query  710  spsasstggrssslsspgsdsdSWRICSPGENPEHVKIKLRHWAQAVACSV  558
                     +SS L SP S   SW+I SPG+NP+ VK +L+ WAQAVAC+V
Sbjct  143  --------KKSSVLDSPVSPIASWKISSPGDNPDDVKARLKFWAQAVACTV  185



>emb|CDX84773.1| BnaA03g14570D [Brassica napus]
Length=191

 Score = 87.0 bits (214),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 46/114 (40%), Positives = 68/114 (60%), Gaps = 15/114 (13%)
 Frame = -1

Query  899  AECLTDDDLNELKGCIELGFGFKEEEGQRLCNTLPALDLYFAVNRQFSFSPVSTPGSKGT  720
            A+ LTDDDL ELKGC++LGFGF  +E   LCNTLPAL+L ++++++F    ++       
Sbjct  89   AKSLTDDDLEELKGCLDLGFGFSYDEIPELCNTLPALELCYSMSQKFLDDKLN-------  141

Query  719  TLpspsasstggrssslsspgsdsdSWRICSPGENPEHVKIKLRHWAQAVACSV  558
                              +  S   +W+I SPG+NP+ VK +L++WAQ VAC+V
Sbjct  142  --------HQEDSPRPPPTTTSPVANWKISSPGDNPDDVKARLKYWAQTVACTV  187



>ref|XP_011043546.1| PREDICTED: uncharacterized protein LOC105138974 isoform X2 [Populus 
euphratica]
Length=174

 Score = 86.7 bits (213),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 65/174 (37%), Positives = 88/174 (51%), Gaps = 34/174 (20%)
 Frame = -1

Query  1040  QRLEHAPPFWRNRKK--------LSKQLSMC-ETPRDVAWerrrrqilnqerRKSDAECL  888
             +++E+ PP  + ++         L KQ S   +  RD AW RR+         +   + +
Sbjct  19    EQMEYRPPIRKQQQNHRLLGPSPLYKQHSWSPDIDRDEAWLRRKGNYK-----QKKCKSV  73

Query  887   TDDDLNELKGCIELGFGFKE-EEGQRLCNTLPALDLYFAVNRQFSFSPVSTPGSKGTTLp  711
             TD+DL+ELKGCIELGFGF   E  QRL +T PAL+LY+AVN+ +     S P    T   
Sbjct  74    TDEDLDELKGCIELGFGFDSPEMDQRLSDTFPALELYYAVNKNYYDHSASKPVVTATPSS  133

Query  710   spsasstggrssslsspgsdsdSWRICSP-GENPEHVKIKLRHWAQAVACSVMQ  552
             S ++                       SP GENP+ VK +LR WAQ VACSV Q
Sbjct  134   STASDCDS------------------TSPLGENPQTVKTRLRQWAQVVACSVRQ  169



>ref|XP_006295063.1| hypothetical protein CARUB_v10024131mg [Capsella rubella]
 gb|EOA27961.1| hypothetical protein CARUB_v10024131mg [Capsella rubella]
Length=186

 Score = 87.0 bits (214),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 53/111 (48%), Positives = 69/111 (62%), Gaps = 15/111 (14%)
 Frame = -1

Query  890  LTDDDLNELKGCIELGFGFKEEEGQRLCNTLPALDLYFAVNRQFSFSPVSTPGSKGTTLp  711
            LTDDDL ELKGC++LGFGF  EE   LCNTLPAL+L ++++++F                
Sbjct  87   LTDDDLEELKGCVDLGFGFNYEEIPELCNTLPALELCYSMSQKF---------------I  131

Query  710  spsasstggrssslsspgsdsdSWRICSPGENPEHVKIKLRHWAQAVACSV  558
                 S+   S  L SP S   SW+I SPG+NP+ VK +L+ WAQAVAC+V
Sbjct  132  DQDHHSSSSSSLLLESPVSPIASWKISSPGDNPDDVKARLKFWAQAVACTV  182



>ref|XP_006339900.1| PREDICTED: uncharacterized protein LOC102593621 [Solanum tuberosum]
Length=157

 Score = 86.3 bits (212),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 55/142 (39%), Positives = 84/142 (59%), Gaps = 16/142 (11%)
 Frame = -1

Query  971  ETPRDVAWerrrrqilnqerRKSDAECLTDDDLNELKGCIELGFGFKEEE-GQRLCNTLP  795
            +T RD AW+RR+    +  +R+S  + +TD+DL+E+K CIELGFGF   E  QRL +T P
Sbjct  29   DTFRDEAWQRRKGTHGSCLKRRS--KSVTDEDLDEIKACIELGFGFDSPEMDQRLSDTFP  86

Query  794  ALDLYFAVNRQFSFSPVSTPGSKGTTLpspsasstggrssslsspgsdsdSWRICSPGEN  615
            A D+++AVN+Q++ + +S   S  + +    ++       +            I +PG+N
Sbjct  87   AYDMFYAVNKQYTDT-LSKTSSVSSVISDCESTLPPVSPHT------------IVNPGDN  133

Query  614  PEHVKIKLRHWAQAVACSVMQS  549
            P+ VK +LR WAQ VAC V QS
Sbjct  134  PQAVKTRLRQWAQVVACVVRQS  155



>emb|CDY17931.1| BnaC04g02880D [Brassica napus]
Length=182

 Score = 86.7 bits (213),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 49/111 (44%), Positives = 67/111 (60%), Gaps = 12/111 (11%)
 Frame = -1

Query  890  LTDDDLNELKGCIELGFGFKEEEGQRLCNTLPALDLYFAVNRQFSFSPVSTPGSKGTTLp  711
            LTDDDL ELKGC++LGFGF  EE   LCNTLPAL+L ++++ +F            ++  
Sbjct  80   LTDDDLEELKGCVDLGFGFNYEEIPELCNTLPALELCYSMSHKFMDQDHHHHHHTSSS--  137

Query  710  spsasstggrssslsspgsdsdSWRICSPGENPEHVKIKLRHWAQAVACSV  558
                         + SP S   SW+I SPG++P+ VK +L+ WAQAVAC+V
Sbjct  138  ----------PEKIESPLSQIASWKISSPGDSPDDVKARLKFWAQAVACTV  178



>ref|XP_004979162.1| PREDICTED: uncharacterized protein LOC101784137 [Setaria italica]
Length=235

 Score = 87.4 bits (215),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 48/114 (42%), Positives = 69/114 (61%), Gaps = 6/114 (5%)
 Frame = -1

Query  899  AECLTDDDLNELKGCIELGFGFKEEEGQRLCNTLPALDLYFAVNRQFSFSPVSTPGSKGT  720
            A  LTDDDL ELKGC++LGFGF   E   LC TLPAL+L ++++++F       PG    
Sbjct  124  ARSLTDDDLEELKGCVDLGFGFSYHEIPELCGTLPALELCYSMSQRFLDEHQPQPGKH--  181

Query  719  TLpspsasstggrssslsspgsdsdSWRICSPGENPEHVKIKLRHWAQAVACSV  558
                  A +     +  S     + +W+I SPG++P+ VK +L++WAQAVAC+V
Sbjct  182  ----EEAPAATPALAPASPAQPVATNWKISSPGDSPDEVKARLKYWAQAVACTV  231



>emb|CDY15396.1| BnaC04g42270D [Brassica napus]
Length=196

 Score = 86.7 bits (213),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 49/111 (44%), Positives = 68/111 (61%), Gaps = 8/111 (7%)
 Frame = -1

Query  890  LTDDDLNELKGCIELGFGFKEEEGQRLCNTLPALDLYFAVNRQFSFSPVSTPGSKGTTLp  711
            LTDDDL ELKGC++LGFGF  +E   LCNTLPAL+L ++++++F         S    L 
Sbjct  90   LTDDDLEELKGCLDLGFGFSYDEIPELCNTLPALELCYSMSQKF-LDDQQNQKSPEMCL-  147

Query  710  spsasstggrssslsspgsdsdSWRICSPGENPEHVKIKLRHWAQAVACSV  558
                      S    S  +   +W+I SPG+NP+ VK +L++WAQAVAC+V
Sbjct  148  ------AEEASPPPPSTTNPVANWKISSPGDNPDDVKARLKYWAQAVACTV  192



>ref|XP_009379920.1| PREDICTED: uncharacterized protein LOC103968427 [Musa acuminata 
subsp. malaccensis]
Length=198

 Score = 86.7 bits (213),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 48/119 (40%), Positives = 65/119 (55%), Gaps = 35/119 (29%)
 Frame = -1

Query  890  LTDDDLNELKGCIELGFGFKEEEGQRLCNTLPALDLYFAVNRQF--------SFSPVSTP  735
            LTDDDL ELKGC++LGFGF  EE   LC TLPAL+L ++++R          +  P +TP
Sbjct  103  LTDDDLEELKGCLDLGFGFSYEEIPELCGTLPALELCYSMSRSLEAAGEPSVAAEPCATP  162

Query  734  GSKGTTLpspsasstggrssslsspgsdsdSWRICSPGENPEHVKIKLRHWAQAVACSV  558
                                          +W+I SPG++PE VK +L++WAQAVAC+V
Sbjct  163  ---------------------------PVANWKISSPGDHPEEVKARLKYWAQAVACTV  194



>ref|NP_001144165.1| uncharacterized protein LOC100277020 [Zea mays]
 gb|ACG38402.1| hypothetical protein [Zea mays]
Length=162

 Score = 85.5 bits (210),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 47/111 (42%), Positives = 63/111 (57%), Gaps = 17/111 (15%)
 Frame = -1

Query  890  LTDDDLNELKGCIELGFGFKEEEGQRLCNTLPALDLYFAVNRQFSFSPVSTPGSKGTTLp  711
            LT+DDL ELKGC++LGFGF   E   LC TLPAL+L +++ R+F       PG +     
Sbjct  65   LTEDDLEELKGCLDLGFGFAYSEIPELCGTLPALELCYSMTRRF-LDEQKAPGQE-----  118

Query  710  spsasstggrssslsspgsdsdSWRICSPGENPEHVKIKLRHWAQAVACSV  558
                         L        +WRI  PG++PE VK +L++WAQAVAC+V
Sbjct  119  -----------EELEPASPPLPNWRISGPGDDPEEVKARLKYWAQAVACTV  158



>gb|EEE52974.1| hypothetical protein OsJ_35638 [Oryza sativa Japonica Group]
Length=201

 Score = 86.3 bits (212),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 47/114 (41%), Positives = 66/114 (58%), Gaps = 14/114 (12%)
 Frame = -1

Query  899  AECLTDDDLNELKGCIELGFGFKEEEGQRLCNTLPALDLYFAVNRQFSFSPVSTPGSKGT  720
            A  LTDDDL ELKGC++LGFGF  +E   LC TLPAL+L ++++++F             
Sbjct  98   ARSLTDDDLEELKGCVDLGFGFSYDEIPELCGTLPALELCYSMSQRF-------------  144

Query  719  TLpspsasstggrssslsspgsdsdSWRICSPGENPEHVKIKLRHWAQAVACSV  558
             L     S           P     +W+I SPG++P+ VK +L++WAQAVAC+V
Sbjct  145  -LDDHPQSHHSPPPPPPPMPSPSIPNWKISSPGDSPDEVKARLKYWAQAVACTV  197



>ref|XP_006663361.1| PREDICTED: uncharacterized protein LOC102718501 [Oryza brachyantha]
Length=196

 Score = 86.3 bits (212),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 51/118 (43%), Positives = 71/118 (60%), Gaps = 13/118 (11%)
 Frame = -1

Query  899  AECLTDDDLNELKGCIELGFGFKEEEGQRLCNTLPALDLYFAVNRQF----SFSPVSTPG  732
            A  LTDDDL ELKGC++LGFGF  +E   LC TLPAL+L ++++++F      SP  T  
Sbjct  84   ARSLTDDDLEELKGCVDLGFGFSYDEIPELCGTLPALELCYSMSQRFLDEHHHSPPPTSE  143

Query  731  SKGTTLpspsasstggrssslsspgsdsdSWRICSPGENPEHVKIKLRHWAQAVACSV  558
             K                 + +SP     +W+I SPG++PE VK +L++WAQAVAC+V
Sbjct  144  KK---------EKAVPAPVAPASPAQPIANWQISSPGDSPEEVKARLKYWAQAVACTV  192



>ref|XP_010671814.1| PREDICTED: uncharacterized protein LOC104888508 [Beta vulgaris 
subsp. vulgaris]
Length=189

 Score = 85.9 bits (211),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 52/111 (47%), Positives = 73/111 (66%), Gaps = 5/111 (5%)
 Frame = -1

Query  890  LTDDDLNELKGCIELGFGFKEEEGQRLCNTLPALDLYFAVNRQFSFSPVSTPGSKGTTLp  711
            LTDDDL+ELKGC++LGFGF  +E   LCNTLPAL+L ++++++F     +    K  +  
Sbjct  80   LTDDDLDELKGCVDLGFGFSYDEIPELCNTLPALELCYSMSQKFLDDHPNQLNPKSLS--  137

Query  710  spsasstggrssslsspgsdsdSWRICSPGENPEHVKIKLRHWAQAVACSV  558
                +S    SSS S   S   +W+I SPG++PE VK +L+ WAQAVAC+V
Sbjct  138  ---IASDTASSSSGSETSSPMPTWKISSPGDHPEDVKARLKFWAQAVACTV  185



>tpg|DAA56332.1| TPA: hypothetical protein ZEAMMB73_880748 [Zea mays]
Length=162

 Score = 85.5 bits (210),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 47/111 (42%), Positives = 62/111 (56%), Gaps = 17/111 (15%)
 Frame = -1

Query  890  LTDDDLNELKGCIELGFGFKEEEGQRLCNTLPALDLYFAVNRQFSFSPVSTPGSKGTTLp  711
            LT+DDL ELKGC++LGFGF   E   LC TLPAL+L +++ R+F       PG       
Sbjct  65   LTEDDLEELKGCLDLGFGFAYSEIPELCGTLPALELCYSMTRRF-LDEQKAPGQD-----  118

Query  710  spsasstggrssslsspgsdsdSWRICSPGENPEHVKIKLRHWAQAVACSV  558
                         L        +WRI  PG++PE VK +L++WAQAVAC+V
Sbjct  119  -----------EELEPASPPLPNWRISGPGDDPEEVKARLKYWAQAVACTV  158



>ref|XP_010907669.1| PREDICTED: uncharacterized protein LOC105034285 [Elaeis guineensis]
Length=186

 Score = 85.9 bits (211),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 46/111 (41%), Positives = 68/111 (61%), Gaps = 5/111 (5%)
 Frame = -1

Query  890  LTDDDLNELKGCIELGFGFKEEEGQRLCNTLPALDLYFAVNRQFSFSPVSTPGSKGTTLp  711
            LTDDDL +LKGC++LGFGF  EE  +LCNTLPAL+L +++++ F    +     + ++  
Sbjct  77   LTDDDLEDLKGCLDLGFGFSYEEIPQLCNTLPALELCYSMSQLFLDEHLQQHQQQRSS--  134

Query  710  spsasstggrssslsspgsdsdSWRICSPGENPEHVKIKLRHWAQAVACSV  558
                 S        +       +WRI  PG++PE VK +L++WAQAVAC+V
Sbjct  135  ---DGSGEAVEQCAAMSSPPIANWRISCPGDHPEEVKARLKYWAQAVACTV  182



>ref|XP_008656978.1| PREDICTED: uncharacterized protein LOC103636401 [Zea mays]
 gb|AFW84295.1| hypothetical protein ZEAMMB73_951764 [Zea mays]
Length=172

 Score = 85.5 bits (210),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 46/111 (41%), Positives = 62/111 (56%), Gaps = 16/111 (14%)
 Frame = -1

Query  890  LTDDDLNELKGCIELGFGFKEEEGQRLCNTLPALDLYFAVNRQFSFSPVSTPGSKGTTLp  711
            LT+DDL ELKGC++LGFGF   E   LC TLPAL+L +++ R+F       PG       
Sbjct  74   LTEDDLEELKGCVDLGFGFAYSEIPELCGTLPALELCYSMTRRF-LDEQRAPGQDEEE--  130

Query  710  spsasstggrssslsspgsdsdSWRICSPGENPEHVKIKLRHWAQAVACSV  558
                                  +WRI +PG++PE VK +L++WAQAVAC+V
Sbjct  131  -------------EEPASPPLPNWRIFAPGDDPEEVKARLKYWAQAVACTV  168



>ref|XP_004140877.1| PREDICTED: uncharacterized protein LOC101222799 [Cucumis sativus]
 ref|XP_004166414.1| PREDICTED: uncharacterized LOC101222799 [Cucumis sativus]
 gb|KGN45990.1| hypothetical protein Csa_6G041750 [Cucumis sativus]
Length=172

 Score = 85.5 bits (210),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 47/111 (42%), Positives = 67/111 (60%), Gaps = 14/111 (13%)
 Frame = -1

Query  890  LTDDDLNELKGCIELGFGFKEEEGQRLCNTLPALDLYFAVNRQFSFSPVSTPGSKGTTLp  711
            LTDDDL +LKGC++LGF F  +E   LCNTLPAL+L +++N++F       P +      
Sbjct  72   LTDDDLEDLKGCVDLGFAFCYDEIPELCNTLPALELCYSMNQKFMDEHQKVPENP-----  126

Query  710  spsasstggrssslsspgsdsdSWRICSPGENPEHVKIKLRHWAQAVACSV  558
                        S+ S      +W+I SPG++PE VK +L++WAQAVAC+V
Sbjct  127  ---------LPESMDSVSGPIPNWKISSPGDHPEDVKARLKYWAQAVACTV  168



>ref|XP_006858659.1| hypothetical protein AMTR_s00066p00064700 [Amborella trichopoda]
 gb|ERN20126.1| hypothetical protein AMTR_s00066p00064700 [Amborella trichopoda]
Length=177

 Score = 85.5 bits (210),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 46/112 (41%), Positives = 65/112 (58%), Gaps = 25/112 (22%)
 Frame = -1

Query  890  LTDDDLNELKGCIELGFG-FKEEEGQRLCNTLPALDLYFAVNRQFSFSPVSTPGSKGTTL  714
            LTD DL+ELKGC++LGFG F  EE   LCNTLPAL+L ++++++F      +P +     
Sbjct  86   LTDGDLDELKGCVDLGFGGFNYEEIPELCNTLPALELCYSISQRFMEDQNKSPDASSIA-  144

Query  713  pspsasstggrssslsspgsdsdSWRICSPGENPEHVKIKLRHWAQAVACSV  558
                                   +W+I SPG++PE VK +L+ WAQAVAC+V
Sbjct  145  -----------------------NWKISSPGDHPEEVKARLKFWAQAVACTV  173



>gb|KFK31204.1| hypothetical protein AALP_AA6G081700 [Arabis alpina]
Length=184

 Score = 85.9 bits (211),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 49/114 (43%), Positives = 70/114 (61%), Gaps = 7/114 (6%)
 Frame = -1

Query  899  AECLTDDDLNELKGCIELGFGFKEEEGQRLCNTLPALDLYFAVNRQFSFSPVSTPGSKGT  720
            A+ LTDDDL ELKGC++LGFGF   E   LCNTLPAL+L ++++++F          K  
Sbjct  74   AKSLTDDDLEELKGCLDLGFGFSYNEIPELCNTLPALELCYSMSQKF-------LDEKQN  126

Query  719  TLpspsasstggrssslsspgsdsdSWRICSPGENPEHVKIKLRHWAQAVACSV  558
               SP    +        +  S   +W+I SPG++P+ VK +L++WAQAVAC+V
Sbjct  127  HQKSPVEEDSPSSPPPPPTTTSSIANWKISSPGDDPDEVKARLKYWAQAVACTV  180



>ref|XP_006295428.1| hypothetical protein CARUB_v10024525mg [Capsella rubella]
 gb|EOA28326.1| hypothetical protein CARUB_v10024525mg [Capsella rubella]
Length=205

 Score = 86.3 bits (212),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 47/114 (41%), Positives = 67/114 (59%), Gaps = 12/114 (11%)
 Frame = -1

Query  899  AECLTDDDLNELKGCIELGFGFKEEEGQRLCNTLPALDLYFAVNRQFSFSPVSTPGSKGT  720
            A+ LTDDDL ELKGC++LGFGF  +E   LCNTLPAL+L ++++++F             
Sbjct  100  AKSLTDDDLEELKGCLDLGFGFSYDEIPELCNTLPALELCYSMSQKF------------L  147

Query  719  TLpspsasstggrssslsspgsdsdSWRICSPGENPEHVKIKLRHWAQAVACSV  558
                    S     S      +   +W+I SPG+NP+ VK +L++WAQ VAC+V
Sbjct  148  DDKQIHQKSPDEEDSPPPPTSTPIANWKISSPGDNPDDVKARLKYWAQTVACTV  201



>ref|XP_002282456.1| PREDICTED: uncharacterized protein LOC100250717 [Vitis vinifera]
Length=157

 Score = 84.7 bits (208),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 54/117 (46%), Positives = 69/117 (59%), Gaps = 13/117 (11%)
 Frame = -1

Query  896  ECLTDDDLNELKGCIELGFGFKEEE-GQRLCNTLPALDLYFAVNRQFSFSPVSTPGSKGT  720
            + +TD+DL+ELK CIELGFGF   +  QRL +TLPAL LY AVN+Q+ F  V+   S  +
Sbjct  51   KSVTDEDLDELKACIELGFGFDSPDMDQRLSDTLPALGLYKAVNKQY-FDTVAKSLSPSS  109

Query  719  TLpspsasstggrssslsspgsdsdSWRICSPGENPEHVKIKLRHWAQAVACSVMQS  549
            +  S     +   S              I  PG+NP+ VK +LRHWAQ VACSV QS
Sbjct  110  STMSECDPPSPLGSPHT-----------IFGPGDNPQTVKTRLRHWAQVVACSVRQS  155



>ref|XP_003578753.1| PREDICTED: pro-neuregulin-2, membrane-bound isoform [Brachypodium 
distachyon]
Length=220

 Score = 86.3 bits (212),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 47/114 (41%), Positives = 67/114 (59%), Gaps = 16/114 (14%)
 Frame = -1

Query  899  AECLTDDDLNELKGCIELGFGFKEEEGQRLCNTLPALDLYFAVNRQFSFSPVSTPGSKGT  720
            A  LTDDDL ELKGC++LGFGF  +E   LC TLPAL+L +++ ++F+            
Sbjct  119  ARSLTDDDLEELKGCVDLGFGFSYDEIPELCGTLPALELCYSMRQRFNLDD---------  169

Query  719  TLpspsasstggrssslsspgsdsdSWRICSPGENPEHVKIKLRHWAQAVACSV  558
                         + +  SP     +W+I SPG++PE VK +L++WAQAVAC+V
Sbjct  170  -------HHHHQETPAPPSPSPPIANWKISSPGDSPEEVKARLKYWAQAVACTV  216



>ref|XP_010025913.1| PREDICTED: uncharacterized protein LOC104416185, partial [Eucalyptus 
grandis]
 gb|KCW57633.1| hypothetical protein EUGRSUZ_H004031, partial [Eucalyptus grandis]
 gb|KCW57634.1| hypothetical protein EUGRSUZ_H004031, partial [Eucalyptus grandis]
Length=174

 Score = 85.1 bits (209),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 52/117 (44%), Positives = 72/117 (62%), Gaps = 19/117 (16%)
 Frame = -1

Query  890  LTDDDLNELKGCIELGFGFKEEEGQRLCNTLPALDLYFAVNRQFSF-----SP-VSTPGS  729
            LTD+DL+ELKGC++LGFGF  +E   LCNTLPAL+L ++++++F       SP  S P S
Sbjct  67   LTDEDLDELKGCLDLGFGFSYDEIPELCNTLPALELCYSMSQKFQLDDHQKSPERSAPPS  126

Query  728  KGTTLpspsasstggrssslsspgsdsdSWRICSPGENPEHVKIKLRHWAQAVACSV  558
              T              S  ++  S   SW+I SPG++PE VK +L+ WAQ VAC+V
Sbjct  127  SVT-------------ESPPAAAASPIASWKISSPGDHPEDVKARLKFWAQTVACTV  170



>ref|XP_006841745.1| hypothetical protein AMTR_s00003p00261000 [Amborella trichopoda]
 gb|ERN03420.1| hypothetical protein AMTR_s00003p00261000 [Amborella trichopoda]
Length=106

 Score = 83.6 bits (205),  Expect = 9e-16, Method: Composition-based stats.
 Identities = 47/121 (39%), Positives = 64/121 (53%), Gaps = 22/121 (18%)
 Frame = -1

Query  908  KSDAECLTDDDLNELKGCIELGFGFKEEEGQRLCNTLPALDLYFAVNRQFSFSPVSTPGS  729
            + +A   TD+DL ELKGCIELGFGF  +E  +LC  LPAL LY+AV RQ+         S
Sbjct  8    QREAITCTDEDLKELKGCIELGFGFGLDEDHKLCGMLPALTLYYAVKRQYLSCNSHPSSS  67

Query  728  KGTTLpspsasstggrssslsspgsdsdSWRICSPGENPEHVKIKLRHWAQAVACSVMQS  549
               + P  +                      + +  ++ +  K +L+HWAQAVACS+MQS
Sbjct  68   SSNSEPEVA----------------------MVTVSDDSQLTKTRLKHWAQAVACSIMQS  105

Query  548  Y  546
            Y
Sbjct  106  Y  106



>gb|KHG08432.1| Membrane insertase YidC [Gossypium arboreum]
Length=175

 Score = 85.1 bits (209),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 51/121 (42%), Positives = 70/121 (58%), Gaps = 12/121 (10%)
 Frame = -1

Query  908  KSDAECLTDDDLNELKGCIELGFGFKEEE-GQRLCNTLPALDLYFAVNRQFSFSPVSTPG  732
            K  ++ +TD+DL+ELK CIELGFGF   E   RL +T PAL LY+AVN+ ++ + +S P 
Sbjct  65   KRRSKSVTDEDLDELKACIELGFGFDSPEVDPRLSDTFPALGLYYAVNKSYNDA-ISKPS  123

Query  731  SKGTTLpspsasstggrssslsspgsdsdSWRICSPGENPEHVKIKLRHWAQAVACSVMQ  552
            +   ++ S   S      S  +          I  PG+NP  VK +LR WAQ VACSV Q
Sbjct  124  TSPPSVVSDCDSIPSPIGSPHA----------IVGPGDNPRTVKTRLRQWAQVVACSVRQ  173

Query  551  S  549
            +
Sbjct  174  N  174



>ref|XP_009383346.1| PREDICTED: uncharacterized protein LOC103971115 isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=182

 Score = 85.1 bits (209),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 48/111 (43%), Positives = 67/111 (60%), Gaps = 2/111 (2%)
 Frame = -1

Query  890  LTDDDLNELKGCIELGFGFKEEEGQRLCNTLPALDLYFAVNRQFSFSPVSTPGSKGTTLp  711
            LTD+DL ELKGC++LGFGF  EE   LCNTLPAL+L +++ ++F             +  
Sbjct  70   LTDEDLKELKGCLDLGFGFSYEEIPELCNTLPALELCYSMTQRFLDDHHHHHHHHQRSF-  128

Query  710  spsasstggrssslsspgsdsdSWRICSPGENPEHVKIKLRHWAQAVACSV  558
               +SS        S       +WRI SPG++P+ VK +LR+WAQAVAC++
Sbjct  129  -YRSSSGESMDLCASPTSPPIANWRISSPGDHPDEVKARLRYWAQAVACTI  178



>ref|XP_006838072.1| hypothetical protein AMTR_s00091p00173550 [Amborella trichopoda]
 gb|ERN00641.1| hypothetical protein AMTR_s00091p00173550 [Amborella trichopoda]
Length=192

 Score = 85.5 bits (210),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 50/131 (38%), Positives = 66/131 (50%), Gaps = 42/131 (32%)
 Frame = -1

Query  908  KSDAECLTDDDLNELKGCIELGFGFKEEEGQRLCNTLPALDLYFAVNRQFS---------  756
            K   + +TD+DL+EL+GCIELGFGF   +  RL +TLPALDLY+AVNRQ++         
Sbjct  90   KRRTKSVTDEDLDELRGCIELGFGFGASDDHRLTDTLPALDLYYAVNRQYNDSISKSSAS  149

Query  755  ---FSPVSTPGSKGTTLpspsasstggrssslsspgsdsdSWRICSPGENPEHVKIKLRH  585
                SPV  P +                                  PG++P+ +K +LR 
Sbjct  150  DSSGSPVGCPHNS------------------------------FFGPGDSPQLMKTRLRQ  179

Query  584  WAQAVACSVMQ  552
            WAQ VACSV Q
Sbjct  180  WAQVVACSVRQ  190



>ref|XP_010912118.1| PREDICTED: uncharacterized protein LOC105038121 [Elaeis guineensis]
Length=201

 Score = 85.5 bits (210),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 46/111 (41%), Positives = 64/111 (58%), Gaps = 9/111 (8%)
 Frame = -1

Query  890  LTDDDLNELKGCIELGFGFKEEEGQRLCNTLPALDLYFAVNRQFSFSPVSTPGSKGTTLp  711
            LTD+DL ELKGC++LGFGF  EE   LCNTLPAL+L ++++++F                
Sbjct  96   LTDEDLVELKGCLDLGFGFSYEEIPELCNTLPALELCYSMSQRF---------MDEQQQQ  146

Query  710  spsasstggrssslsspgsdsdSWRICSPGENPEHVKIKLRHWAQAVACSV  558
                 S        +       +WRI  PG++PE VK +L++WAQAVAC+V
Sbjct  147  RSPDRSEEAVEQCAAVSSLPIANWRISEPGDHPEEVKARLKYWAQAVACTV  197



>ref|XP_010475308.1| PREDICTED: uncharacterized protein LOC104754741 [Camelina sativa]
Length=190

 Score = 85.1 bits (209),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 45/114 (39%), Positives = 70/114 (61%), Gaps = 13/114 (11%)
 Frame = -1

Query  899  AECLTDDDLNELKGCIELGFGFKEEEGQRLCNTLPALDLYFAVNRQFSFSPVSTPGSKGT  720
            ++ LTDDDL +LKGC++LGFGF  +E   LCNTLPAL+L ++++++F             
Sbjct  86   SKSLTDDDLEDLKGCLDLGFGFSYDEIPELCNTLPALELCYSMSQKF-------------  132

Query  719  TLpspsasstggrssslsspgsdsdSWRICSPGENPEHVKIKLRHWAQAVACSV  558
                  + +    S    +  +   +W+I SPG+NP+ VK +L++WAQAVAC+V
Sbjct  133  LDDKHRSPADDSPSPPPVTSPAPIANWKISSPGDNPDDVKARLKYWAQAVACTV  186



>ref|XP_009393523.1| PREDICTED: uncharacterized protein LOC103979186 [Musa acuminata 
subsp. malaccensis]
Length=120

 Score = 83.6 bits (205),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 44/111 (40%), Positives = 63/111 (57%), Gaps = 20/111 (18%)
 Frame = -1

Query  890  LTDDDLNELKGCIELGFGFKEEEGQRLCNTLPALDLYFAVNRQFSFSPVSTPGSKGTTLp  711
            LTDDDL ELK C++LGFGF  E    LCNTLPAL+L ++++++F         S G +L 
Sbjct  26   LTDDDLEELKACLDLGFGFSYEGIPELCNTLPALELCYSMSQRFHLDDQQEQISHGDSL-  84

Query  710  spsasstggrssslsspgsdsdSWRICSPGENPEHVKIKLRHWAQAVACSV  558
                                  +W I SPG++P+ VK +L++WAQ VAC++
Sbjct  85   -------------------PFANWMISSPGDDPDEVKARLKYWAQTVACTL  116



>gb|EPS66159.1| hypothetical protein M569_08616, partial [Genlisea aurea]
Length=157

 Score = 84.3 bits (207),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 52/131 (40%), Positives = 67/131 (51%), Gaps = 39/131 (30%)
 Frame = -1

Query  899  AECLTDDDLNELKGCIELGFGFKEEE-GQRLCNTLPALDLYFAVNRQFSFS------PVS  741
            +  +TD+DL E K CIELGFGF   E   RL +TLPA  LY+AVN+Q++ +      P+S
Sbjct  50   SRSVTDEDLEEFKACIELGFGFDSPEMDPRLSDTLPAYGLYYAVNKQYNDAVAKPPLPIS  109

Query  740  -------TPGSKGTTLpspsasstggrssslsspgsdsdSWRICSPGENPEHVKIKLRHW  582
                   TP   G+ L                          I SPGENP+ VK +LR W
Sbjct  110  PSASECETPSPLGSPLT-------------------------IFSPGENPQTVKTRLRQW  144

Query  581  AQAVACSVMQS  549
            AQ VAC+V Q+
Sbjct  145  AQVVACTVRQN  155



>emb|CAN60580.1| hypothetical protein VITISV_034776 [Vitis vinifera]
Length=295

 Score = 86.7 bits (213),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 49/122 (40%), Positives = 72/122 (59%), Gaps = 27/122 (22%)
 Frame = -1

Query  890  LTDDDLNELKGCIELGFGFKEEEGQRLCNTLPALDLYFAVNRQF----SFSPVSTPGSKG  723
            LTD+DL+ELKGC++LGFGF  EE   LCNTLPAL+L ++++++F      +P S+P +  
Sbjct  87   LTDEDLDELKGCLDLGFGFSYEEIPELCNTLPALELCYSMSQKFMDDQQKAPESSPAAS-  145

Query  722  TTLpspsasstggrssslsspgsdsdSWRICSPGENPEHVKIKLRHWAQAVACS---VMQ  552
                                      +W+I SPG++PE VK +L+ WAQAVAC+    +Q
Sbjct  146  -------------------ESPGPIANWKISSPGDHPEEVKARLKFWAQAVACTGWEFLQ  186

Query  551  SY  546
            S+
Sbjct  187  SF  188



>emb|CDX79829.1| BnaA05g03270D [Brassica napus]
Length=181

 Score = 84.7 bits (208),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 50/111 (45%), Positives = 68/111 (61%), Gaps = 10/111 (9%)
 Frame = -1

Query  890  LTDDDLNELKGCIELGFGFKEEEGQRLCNTLPALDLYFAVNRQFSFSPVSTPGSKGTTLp  711
            LTDDDL ELKGC++LGFGF  EE   LCNTLPAL+L ++++ +F                
Sbjct  77   LTDDDLEELKGCVDLGFGFNYEEIPELCNTLPALELCYSMSHKF----------MDQDHH  126

Query  710  spsasstggrssslsspgsdsdSWRICSPGENPEHVKIKLRHWAQAVACSV  558
                +S+      + SP S   SW+I SPG++P+ VK +L+ WAQAVAC+V
Sbjct  127  HNHHTSSSSSPEKIESPLSQIASWKISSPGDSPDDVKARLKFWAQAVACTV  177



>ref|XP_009142927.1| PREDICTED: uncharacterized protein LOC103866709 [Brassica rapa]
 ref|XP_009119825.1| PREDICTED: uncharacterized protein LOC103844769 [Brassica rapa]
Length=181

 Score = 84.7 bits (208),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 49/111 (44%), Positives = 67/111 (60%), Gaps = 11/111 (10%)
 Frame = -1

Query  890  LTDDDLNELKGCIELGFGFKEEEGQRLCNTLPALDLYFAVNRQFSFSPVSTPGSKGTTLp  711
            LTDDDL ELKGC++LGFGF  EE   LCNTLPAL+L ++++ +F            ++  
Sbjct  78   LTDDDLEELKGCVDLGFGFNYEEIPELCNTLPALELCYSMSHKFMDQDHHHHHHTSSS--  135

Query  710  spsasstggrssslsspgsdsdSWRICSPGENPEHVKIKLRHWAQAVACSV  558
                         + SP S   SW+I SPG++P+ VK +L+ WAQAVAC+V
Sbjct  136  ---------SPEKIESPLSQIASWKISSPGDSPDDVKARLKFWAQAVACTV  177



>ref|NP_850169.1| uncharacterized protein [Arabidopsis thaliana]
 ref|NP_973575.1| uncharacterized protein [Arabidopsis thaliana]
 gb|AAL38681.1| unknown protein [Arabidopsis thaliana]
 gb|AAT85765.1| At2g31560 [Arabidopsis thaliana]
 dbj|BAH19620.1| AT2G31560 [Arabidopsis thaliana]
 dbj|BAH19665.1| AT2G31560 [Arabidopsis thaliana]
 gb|AEC08560.1| uncharacterized protein AT2G31560 [Arabidopsis thaliana]
 gb|AEC08561.1| uncharacterized protein AT2G31560 [Arabidopsis thaliana]
Length=202

 Score = 85.1 bits (209),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 47/114 (41%), Positives = 70/114 (61%), Gaps = 10/114 (9%)
 Frame = -1

Query  899  AECLTDDDLNELKGCIELGFGFKEEEGQRLCNTLPALDLYFAVNRQFSFSPVSTPGSKGT  720
            A+ LTDDDL ELKGC++LGFGF  +E   LCNTLPAL+L ++++++F             
Sbjct  95   AKSLTDDDLEELKGCLDLGFGFSYDEIPELCNTLPALELCYSMSQKF----------LDD  144

Query  719  TLpspsasstggrssslsspgsdsdSWRICSPGENPEHVKIKLRHWAQAVACSV  558
               +   S     SS   +  +   +W+I SPG++P+ VK +L++WAQ VAC+V
Sbjct  145  KQQNHHKSQEEDDSSPPPTTTAPIANWKISSPGDDPDDVKARLKYWAQTVACTV  198



>ref|XP_008790647.1| PREDICTED: uncharacterized protein LOC103707781 [Phoenix dactylifera]
Length=182

 Score = 84.7 bits (208),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 46/116 (40%), Positives = 65/116 (56%), Gaps = 16/116 (14%)
 Frame = -1

Query  890  LTDDDLNELKGCIELGFGFKEEEGQRLCNTLPALDLYFAVNRQFSFSPV-----STPGSK  726
            LTDDDL +LKGC++LGFGF  EE   LCNTLPAL+L ++++ +F    +      +P   
Sbjct  74   LTDDDLEDLKGCLDLGFGFSYEEIPELCNTLPALELCYSMSHRFLDEHLQQQQHGSPDGS  133

Query  725  GTTLpspsasstggrssslsspgsdsdSWRICSPGENPEHVKIKLRHWAQAVACSV  558
            G  +               +       +WRI  PG+ PE VK +L++WAQ VAC+V
Sbjct  134  GDAV-----------EQCAAMSSPPIANWRISGPGDQPEDVKARLKYWAQTVACTV  178



>gb|AAB64331.1| unknown protein [Arabidopsis thaliana]
Length=241

 Score = 85.9 bits (211),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 53/111 (48%), Positives = 70/111 (63%), Gaps = 10/111 (9%)
 Frame = -1

Query  890  LTDDDLNELKGCIELGFGFKEEEGQRLCNTLPALDLYFAVNRQFSFSPVSTPGSKGTTLp  711
            LTDDDL ELKGC++LGFGF  EE   LCNTLPAL+L ++++++F         S      
Sbjct  85   LTDDDLEELKGCVDLGFGFNYEEIPELCNTLPALELCYSMSQKFIDQDHHHHSSSSPE--  142

Query  710  spsasstggrssslsspgsdsdSWRICSPGENPEHVKIKLRHWAQAVACSV  558
                     +SS L SP S   SW+I SPG+NP+ VK +L+ WAQAVAC++
Sbjct  143  --------KKSSVLDSPVSPIASWKISSPGDNPDDVKARLKFWAQAVACTM  185



>ref|XP_004232033.1| PREDICTED: uncharacterized protein LOC101244139 [Solanum lycopersicum]
Length=162

 Score = 84.3 bits (207),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 55/142 (39%), Positives = 83/142 (58%), Gaps = 16/142 (11%)
 Frame = -1

Query  971  ETPRDVAWerrrrqilnqerRKSDAECLTDDDLNELKGCIELGFGFKEEE-GQRLCNTLP  795
            +T RD AW+RR+    +  +R+S  + +TD+D +E+K CIELGFGF   E  QRL +T P
Sbjct  34   DTFRDEAWQRRKGTHGSCLKRRS--KSVTDEDFDEIKACIELGFGFDSPEMDQRLSDTFP  91

Query  794  ALDLYFAVNRQFSFSPVSTPGSKGTTLpspsasstggrssslsspgsdsdSWRICSPGEN  615
            A DL++AVN+Q++ + +S   S  + + +  ++       +            I  PG+N
Sbjct  92   AYDLFYAVNKQYTDT-LSKTSSVSSVISNCESTLPPVSPHT------------IVFPGDN  138

Query  614  PEHVKIKLRHWAQAVACSVMQS  549
            P+ VK +LR WAQ VAC V QS
Sbjct  139  PQAVKTRLRQWAQVVACVVRQS  160



>ref|XP_010912805.1| PREDICTED: uncharacterized protein LOC105038635 [Elaeis guineensis]
Length=202

 Score = 85.1 bits (209),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 47/111 (42%), Positives = 72/111 (65%), Gaps = 4/111 (4%)
 Frame = -1

Query  890  LTDDDLNELKGCIELGFGFKEEEGQRLCNTLPALDLYFAVNRQFSFSPVSTPGSKGTTLp  711
            LTD+DL ELKGC++LGFGF  EE   LCNTLPAL+L ++++++F    +       +  P
Sbjct  92   LTDEDLEELKGCLDLGFGFSYEEIPELCNTLPALELCYSMSQRF----LDEQQQHQSRSP  147

Query  710  spsasstggrssslsspgsdsdSWRICSPGENPEHVKIKLRHWAQAVACSV  558
              +  +     S  ++  +   +W+I SPG++PE VK +L++WAQAVAC+V
Sbjct  148  ETAGDAAAAEQSPAAASSTPVANWKISSPGDHPEEVKARLKYWAQAVACTV  198



>gb|EEC71962.1| hypothetical protein OsI_04796 [Oryza sativa Indica Group]
 gb|EEE55817.1| hypothetical protein OsJ_04419 [Oryza sativa Japonica Group]
Length=159

 Score = 84.0 bits (206),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 46/114 (40%), Positives = 64/114 (56%), Gaps = 24/114 (21%)
 Frame = -1

Query  890  LTDDDLNELKGCIELGFGFKEEEGQRLCNTLPALDLYFAVNRQF---SFSPVSTPGSKGT  720
            LT++DL ELKGC++LGFGF   E   LC TLPAL+L +++ R+F     +P   P S  T
Sbjct  63   LTEEDLEELKGCLDLGFGFAYHEIPELCGTLPALELCYSMTRRFLDEQRAPGQEPESPAT  122

Query  719  TLpspsasstggrssslsspgsdsdSWRICSPGENPEHVKIKLRHWAQAVACSV  558
                                     +WRI  PG++P+ VK +L++WAQAVAC+V
Sbjct  123  ---------------------PPLPNWRISGPGDDPKEVKARLKYWAQAVACTV  155



>ref|XP_007142628.1| hypothetical protein PHAVU_007G003800g [Phaseolus vulgaris]
 ref|XP_007142629.1| hypothetical protein PHAVU_007G003800g [Phaseolus vulgaris]
 gb|ESW14622.1| hypothetical protein PHAVU_007G003800g [Phaseolus vulgaris]
 gb|ESW14623.1| hypothetical protein PHAVU_007G003800g [Phaseolus vulgaris]
Length=137

 Score = 83.6 bits (205),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 48/111 (43%), Positives = 70/111 (63%), Gaps = 12/111 (11%)
 Frame = -1

Query  890  LTDDDLNELKGCIELGFGFKEEEGQRLCNTLPALDLYFAVNRQFSFSPVSTPGSKGTTLp  711
            L+D+DL ELKGC++LGFGF  EE   LCNTLPAL+L ++++++F  +   +P S  ++  
Sbjct  35   LSDEDLEELKGCLDLGFGFSYEEIPELCNTLPALELCYSMSQKFMDNSPPSPSSSSSS--  92

Query  710  spsasstggrssslsspgsdsdSWRICSPGENPEHVKIKLRHWAQAVACSV  558
                       S  S       +W+I SPG++PE VK +L+ WAQAVAC+V
Sbjct  93   ----------PSPHSLSTPSIANWKISSPGDHPEDVKARLKFWAQAVACTV  133



>ref|XP_008445710.1| PREDICTED: uncharacterized protein LOC103488660 [Cucumis melo]
 ref|XP_008445711.1| PREDICTED: uncharacterized protein LOC103488660 [Cucumis melo]
 ref|XP_008445712.1| PREDICTED: uncharacterized protein LOC103488660 [Cucumis melo]
 ref|XP_008445713.1| PREDICTED: uncharacterized protein LOC103488660 [Cucumis melo]
Length=172

 Score = 84.0 bits (206),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 46/111 (41%), Positives = 66/111 (59%), Gaps = 14/111 (13%)
 Frame = -1

Query  890  LTDDDLNELKGCIELGFGFKEEEGQRLCNTLPALDLYFAVNRQFSFSPVSTPGSKGTTLp  711
            LTDDDL ELKGC++LGF F  +E   LCNTLPAL+L ++++++F              + 
Sbjct  72   LTDDDLEELKGCVDLGFAFCYDEIPELCNTLPALELCYSMSQKF--------------MD  117

Query  710  spsasstggrssslsspgsdsdSWRICSPGENPEHVKIKLRHWAQAVACSV  558
                        S+ S      +W+I SPG++PE VK +L++WAQAVAC+V
Sbjct  118  EHQKEPENPLPESVDSVSGPIPNWKISSPGDHPEDVKARLKYWAQAVACTV  168



>ref|NP_001066444.1| Os12g0230600 [Oryza sativa Japonica Group]
 gb|ABA96312.1| expressed protein [Oryza sativa Japonica Group]
 dbj|BAF29463.1| Os12g0230600 [Oryza sativa Japonica Group]
 dbj|BAG93038.1| unnamed protein product [Oryza sativa Japonica Group]
Length=215

 Score = 84.7 bits (208),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 47/114 (41%), Positives = 66/114 (58%), Gaps = 14/114 (12%)
 Frame = -1

Query  899  AECLTDDDLNELKGCIELGFGFKEEEGQRLCNTLPALDLYFAVNRQFSFSPVSTPGSKGT  720
            A  LTDDDL ELKGC++LGFGF  +E   LC TLPAL+L ++++++F             
Sbjct  112  ARSLTDDDLEELKGCVDLGFGFSYDEIPELCGTLPALELCYSMSQRF-------------  158

Query  719  TLpspsasstggrssslsspgsdsdSWRICSPGENPEHVKIKLRHWAQAVACSV  558
             L     S           P     +W+I SPG++P+ VK +L++WAQAVAC+V
Sbjct  159  -LDDHPQSHHSPPPPPPPMPSPSIPNWKISSPGDSPDEVKARLKYWAQAVACTV  211



>tpg|DAA38424.1| TPA: hypothetical protein ZEAMMB73_542900 [Zea mays]
Length=377

 Score = 87.0 bits (214),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 83/232 (36%), Positives = 107/232 (46%), Gaps = 79/232 (34%)
 Frame = -1

Query  1007  NRKKLSKQLSMCETPRDVAWerrrrqilnqerRK-----------SDAEC----------  891
             N+K+LSKQLSM ET R+V WE+R+RQI  Q               S A C          
Sbjct  145   NKKRLSKQLSMKETTREVKWEKRKRQIQRQRSSMRLSEADDRAGGSTAVCPVDGEASSSA  204

Query  890   ------LTDDDLNELKGCIELGFGFKEEEG-QRLCNTLPALDLYFAVNRQFSFSPVSTP-  735
                   +TD DL+EL+G ++LGF F E++G Q LC+TLPALD YFAVNRQ S   +S P 
Sbjct  205   ERVATGITDGDLDELRGSMDLGFRFDEQKGGQDLCDTLPALDFYFAVNRQVSEPRMSFPT  264

Query  734   -GSKGTTLpspsas----stggrssslsspgsdsdSWRICSP------------------  624
               S G +L +  +S     T    S  +   +  +SW+IC+P                  
Sbjct  265   STSSGPSLSATKSSPNLCGTPSPGSPGAHSSNALESWKICNPGNLSCRIFFHDLVNVLQF  324

Query  623   ---------------------------GENPEHVKIKLRHWAQAVACSVMQS  549
                                        G+NP  VK +LRHWAQ VACSV  S
Sbjct  325   LMLGRTVCFGIEFLSFFSSLLSVLDVIGDNPLLVKTRLRHWAQVVACSVKHS  376



>ref|NP_001237862.1| uncharacterized protein LOC100527048 [Glycine max]
 gb|ACU16087.1| unknown [Glycine max]
Length=167

 Score = 84.0 bits (206),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 69/174 (40%), Positives = 93/174 (53%), Gaps = 30/174 (17%)
 Frame = -1

Query  1028  HAPPFWRNRKKLSKQLSMC--------ETPRDVAWerrrrqilnqerRKSDAECLTDDDL  873
             HAPPF   R  L +  S          +  RD AW RR+    N+      ++ +TD+D+
Sbjct  7     HAPPFLLQRPPLLQSASPLFKQRSWSPDAFRDEAWLRRKGNCKNRR-----SKSVTDEDV  61

Query  872   NELKGCIELGFGF----KEEEGQRLCNTLPALDLYFAVNRQFSFSPV--STPGSKGTTLp  711
             +ELK CIELGFGF    + E  QRL +TLPAL LY+AVN++++ S V  +TP S      
Sbjct  62    DELKACIELGFGFDSSPENELDQRLSDTLPALGLYYAVNKRYNNSLVTKTTPSSSSAASD  121

Query  710   spsasstggrssslsspgsdsdSWRICSPGENPEHVKIKLRHWAQAVACSVMQS  549
               S+ S  G   S            I + G+NP+ VK +LR WAQ VAC+V QS
Sbjct  122   CDSSPSPHGSPHSA-----------IFTTGDNPQTVKTRLRQWAQVVACAVRQS  164



>gb|KHG29207.1| Membrane insertase YidC [Gossypium arboreum]
Length=175

 Score = 84.0 bits (206),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 50/121 (41%), Positives = 70/121 (58%), Gaps = 12/121 (10%)
 Frame = -1

Query  908  KSDAECLTDDDLNELKGCIELGFGFKEEE-GQRLCNTLPALDLYFAVNRQFSFSPVSTPG  732
            K  ++ +TD+DL++LK CIELGFGF   E   RL +T PAL LY+AVN+ ++ + +S P 
Sbjct  65   KRRSKSVTDEDLDDLKACIELGFGFDSPEVDPRLSDTFPALGLYYAVNKSYNDA-ISKPS  123

Query  731  SKGTTLpspsasstggrssslsspgsdsdSWRICSPGENPEHVKIKLRHWAQAVACSVMQ  552
            +   ++ S   S      S  +          I  PG+NP  VK +LR WAQ VACSV Q
Sbjct  124  TSPPSVVSDCDSIPSPIGSPHA----------IVGPGDNPRTVKTRLRQWAQVVACSVRQ  173

Query  551  S  549
            +
Sbjct  174  N  174



>ref|XP_010269831.1| PREDICTED: uncharacterized protein LOC104606375 [Nelumbo nucifera]
Length=149

 Score = 83.2 bits (204),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 62/144 (43%), Positives = 83/144 (58%), Gaps = 20/144 (14%)
 Frame = -1

Query  971  ETPRDVAWerrrrqilnqerRKSDAECLTDDDLNELKGCIELGFGFKEEE---GQRLCNT  801
            +T RD AW +R++   N+ R KS    +TD+DL ELK CIELGFGF  +      RL +T
Sbjct  22   DTYRDEAWLKRKKGNNNRRRSKS----VTDEDLVELKACIELGFGFDSDSPHLDSRLSDT  77

Query  800  LPALDLYFAVNRQFSFSPVSTPGSKGTTLpspsasstggrssslsspgsdsdSWRICSPG  621
            LPAL LY+AVN+Q++ S   +P S        ++S  G   +             I +PG
Sbjct  78   LPALGLYYAVNKQYNDSVSKSPSSSTAASECDASSPLGSPHT-------------IFTPG  124

Query  620  ENPEHVKIKLRHWAQAVACSVMQS  549
            +NP+ VK +LR WAQ VACSV QS
Sbjct  125  DNPQLVKTRLRQWAQVVACSVRQS  148



>ref|XP_008241457.1| PREDICTED: uncharacterized protein LOC103339884 [Prunus mume]
Length=155

 Score = 83.6 bits (205),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 58/139 (42%), Positives = 77/139 (55%), Gaps = 9/139 (6%)
 Frame = -1

Query  962  RDVAWerrrrqilnqerRKSDAECLTDDDLNELKGCIELGFGFKE-EEGQRLCNTLPALD  786
            RD AW RR++     + ++S  + +TD+DL+ELK CIELGFGF   E  QRL +TLPAL 
Sbjct  24   RDEAWHRRKKINGRSKLQRS--KSVTDEDLDELKACIELGFGFNSPESDQRLADTLPALG  81

Query  785  LYFAVNRQFSFSPVSTPGSKGTTLpspsasstggrssslsspgsdsdSWRICSPGENPEH  606
            LY+AVN+ + +  VS   +   T       S      S            I  PG+ P+ 
Sbjct  82   LYYAVNKSY-YDSVSHKSTTTPTSSFSPTPSECDSVPSPVDSPHT-----IFGPGDTPQT  135

Query  605  VKIKLRHWAQAVACSVMQS  549
            VK +LR WAQ VAC+V QS
Sbjct  136  VKARLRQWAQVVACTVRQS  154



>ref|NP_172078.2| uncharacterized protein [Arabidopsis thaliana]
 ref|NP_973766.1| uncharacterized protein [Arabidopsis thaliana]
 ref|NP_001184917.1| uncharacterized protein [Arabidopsis thaliana]
 ref|NP_001184918.1| uncharacterized protein [Arabidopsis thaliana]
 gb|AAF29393.1|AC009999_13 Contains similarity to an unknown protein from Arabidopsis thaliana 
gb|AC002335.2. ESTs gb|AI997584, gb|AA712406 come from 
this gene [Arabidopsis thaliana]
 gb|ABF83638.1| At1g05870 [Arabidopsis thaliana]
 gb|AEE27906.1| uncharacterized protein AT1G05870 [Arabidopsis thaliana]
 gb|AEE27907.1| uncharacterized protein AT1G05870 [Arabidopsis thaliana]
 gb|AEE27908.1| uncharacterized protein AT1G05870 [Arabidopsis thaliana]
 gb|AEE27909.1| uncharacterized protein AT1G05870 [Arabidopsis thaliana]
Length=189

 Score = 84.0 bits (206),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 44/111 (40%), Positives = 67/111 (60%), Gaps = 9/111 (8%)
 Frame = -1

Query  890  LTDDDLNELKGCIELGFGFKEEEGQRLCNTLPALDLYFAVNRQFSFSPVSTPGSKGTTLp  711
            LTDDDL +L+GC++LGFGF  +E   LCNTLPAL+L ++++++F     +      +   
Sbjct  84   LTDDDLEDLRGCLDLGFGFSYDEIPELCNTLPALELCYSMSQKFLDDKQNKSPETSSV--  141

Query  710  spsasstggrssslsspgsdsdSWRICSPGENPEHVKIKLRHWAQAVACSV  558
                       S      +   +W+I SPG+NP+ VK +L++WAQAVAC+V
Sbjct  142  -------EDCPSPPLVTATPIANWKISSPGDNPDDVKARLKYWAQAVACTV  185



>ref|NP_001130176.1| uncharacterized protein LOC100191270 [Zea mays]
 gb|ACF78321.1| unknown [Zea mays]
 gb|AFW60653.1| hypothetical protein ZEAMMB73_931356 [Zea mays]
Length=230

 Score = 84.7 bits (208),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 46/114 (40%), Positives = 68/114 (60%), Gaps = 8/114 (7%)
 Frame = -1

Query  899  AECLTDDDLNELKGCIELGFGFKEEEGQRLCNTLPALDLYFAVNRQFSFSPVSTPGSKGT  720
            A  LTDDDL ELKGC++LGFGF   E   LC TLPALDL ++++++F          K  
Sbjct  121  ARSLTDDDLEELKGCVDLGFGFSYREIPELCGTLPALDLCYSMSQRFLDEHHHQQLGKA-  179

Query  719  TLpspsasstggrssslsspgsdsdSWRICSPGENPEHVKIKLRHWAQAVACSV  558
                         + +  +  + + +W+I SPG++P+ VK +L++WAQAVAC+V
Sbjct  180  -------EEAPPLAPASPAQPAATTNWKISSPGDSPDEVKARLKYWAQAVACTV  226



>ref|XP_006645175.1| PREDICTED: uncharacterized protein LOC102710928 [Oryza brachyantha]
Length=167

 Score = 83.6 bits (205),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 45/111 (41%), Positives = 62/111 (56%), Gaps = 18/111 (16%)
 Frame = -1

Query  890  LTDDDLNELKGCIELGFGFKEEEGQRLCNTLPALDLYFAVNRQFSFSPVSTPGSKGTTLp  711
            LT++DL ELKGC++LGFGF   E   LC TLPAL+L +++ R+F       PG +     
Sbjct  71   LTEEDLEELKGCLDLGFGFAYHEIPELCGTLPALELCYSMTRRF-LDEQRAPGQEPAP--  127

Query  710  spsasstggrssslsspgsdsdSWRICSPGENPEHVKIKLRHWAQAVACSV  558
                                  +WRI  PG++PE VK +L++WAQAVAC+V
Sbjct  128  ---------------PATPPLPNWRISGPGDDPEEVKARLKYWAQAVACTV  163



>dbj|BAK03534.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=217

 Score = 84.3 bits (207),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 49/114 (43%), Positives = 69/114 (61%), Gaps = 8/114 (7%)
 Frame = -1

Query  899  AECLTDDDLNELKGCIELGFGFKEEEGQRLCNTLPALDLYFAVNRQFSFSPVSTPGSKGT  720
            A  LTDDDL ELKGC++LGFGF   E   LC TLPAL+L ++++++F       P SK  
Sbjct  108  ARSLTDDDLEELKGCVDLGFGFSYNEIPELCGTLPALELCYSMSQRFLDE--HQPSSKAE  165

Query  719  TLpspsasstggrssslsspgsdsdSWRICSPGENPEHVKIKLRHWAQAVACSV  558
             L      +    +    SP     +W+I  PG++P+ VK +L++WAQAVAC+V
Sbjct  166  DL------APEPPAVVPPSPVQPIPNWKISCPGDSPDEVKARLKYWAQAVACTV  213



>dbj|BAJ89682.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=217

 Score = 84.3 bits (207),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 49/114 (43%), Positives = 69/114 (61%), Gaps = 8/114 (7%)
 Frame = -1

Query  899  AECLTDDDLNELKGCIELGFGFKEEEGQRLCNTLPALDLYFAVNRQFSFSPVSTPGSKGT  720
            A  LTDDDL ELKGC++LGFGF   E   LC TLPAL+L ++++++F       P SK  
Sbjct  108  ARSLTDDDLEELKGCVDLGFGFSYNEIPELCGTLPALELCYSMSQRFLDE--HQPSSKAE  165

Query  719  TLpspsasstggrssslsspgsdsdSWRICSPGENPEHVKIKLRHWAQAVACSV  558
             L      +    +    SP     +W+I  PG++P+ VK +L++WAQAVAC+V
Sbjct  166  DL------APEPPAVVPPSPVQPIPNWKISCPGDSPDEVKARLKYWAQAVACTV  213



>ref|XP_007202615.1| hypothetical protein PRUPE_ppa011847mg [Prunus persica]
 gb|EMJ03814.1| hypothetical protein PRUPE_ppa011847mg [Prunus persica]
Length=193

 Score = 84.0 bits (206),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 58/139 (42%), Positives = 77/139 (55%), Gaps = 9/139 (6%)
 Frame = -1

Query  962  RDVAWerrrrqilnqerRKSDAECLTDDDLNELKGCIELGFGFKE-EEGQRLCNTLPALD  786
            RD AW RR++     + ++S  + +TD+DL+ELK CIELGFGF   E  QRL +TLPAL 
Sbjct  62   RDEAWHRRKKINGRSKLQRS--KSVTDEDLDELKACIELGFGFNSPESDQRLADTLPALG  119

Query  785  LYFAVNRQFSFSPVSTPGSKGTTLpspsasstggrssslsspgsdsdSWRICSPGENPEH  606
            LY+AVN+ + +  VS   +   T       S      S            I  PG+ P+ 
Sbjct  120  LYYAVNKSY-YDSVSHKSTTTPTSSFSPTPSECDSVPSPVGSPHT-----IFGPGDTPQT  173

Query  605  VKIKLRHWAQAVACSVMQS  549
            VK +LR WAQ VAC+V QS
Sbjct  174  VKARLRQWAQVVACTVRQS  192



>ref|XP_004497395.1| PREDICTED: uncharacterized protein LOC101495445 isoform X1 [Cicer 
arietinum]
 ref|XP_004497396.1| PREDICTED: uncharacterized protein LOC101495445 isoform X2 [Cicer 
arietinum]
 ref|XP_004497397.1| PREDICTED: uncharacterized protein LOC101495445 isoform X3 [Cicer 
arietinum]
Length=128

 Score = 82.4 bits (202),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 48/111 (43%), Positives = 61/111 (55%), Gaps = 31/111 (28%)
 Frame = -1

Query  890  LTDDDLNELKGCIELGFGFKEEEGQRLCNTLPALDLYFAVNRQFSFSPVSTPGSKGTTLp  711
            LTD+DL ELKGC++LGFGF  +E   LCNTLPAL+L       +S SP S   S      
Sbjct  45   LTDEDLEELKGCLDLGFGFSYDEIPELCNTLPALELC------YSMSPNSPQHSSFAN--  96

Query  710  spsasstggrssslsspgsdsdSWRICSPGENPEHVKIKLRHWAQAVACSV  558
                                   W+I SPG++PE VK +L++WAQAVAC+V
Sbjct  97   -----------------------WKISSPGDHPEDVKARLKYWAQAVACTV  124



>ref|XP_011037064.1| PREDICTED: uncharacterized protein LOC105134374 [Populus euphratica]
Length=204

 Score = 84.0 bits (206),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 46/111 (41%), Positives = 69/111 (62%), Gaps = 11/111 (10%)
 Frame = -1

Query  890  LTDDDLNELKGCIELGFGFKEEEGQRLCNTLPALDLYFAVNRQFSFSPVSTPGSKGTTLp  711
            LTDDDL+ELKGC++LGFGF  +E   LCNTLPAL+L ++++++F       P    +   
Sbjct  101  LTDDDLDELKGCLDLGFGFSYDEIPELCNTLPALELCYSMSQKF-LDEHQKPHESSSP--  157

Query  710  spsasstggrssslsspgsdsdSWRICSPGENPEHVKIKLRHWAQAVACSV  558
                      + + ++  S   +W+I SPG++PE VK +L+ WAQ VAC+V
Sbjct  158  --------AEAEAEAASSSPIANWKISSPGDHPEDVKARLKFWAQTVACTV  200



>ref|XP_009621955.1| PREDICTED: uncharacterized protein LOC104113484 [Nicotiana tomentosiformis]
Length=150

 Score = 82.4 bits (202),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 58/139 (42%), Positives = 78/139 (56%), Gaps = 14/139 (10%)
 Frame = -1

Query  962  RDVAWerrrrqilnqerRKSDAECLTDDDLNELKGCIELGFGFKEEE-GQRLCNTLPALD  786
            R+ AW +R+    ++   +  ++ +TDDDL EL+ C +LGFGF   +   +L  T PAL+
Sbjct  22   REEAWLKRKGNYRSKLADRRRSKSVTDDDLEELRACFDLGFGFDSPDLDPKLTETFPALE  81

Query  785  LYFAVNRQFSFSPVSTPGSKGTTLpspsasstggrssslsspgsdsdSWRICSPGENPEH  606
            LY AVN+Q+           G TL   S+SST       +S    S S  I  PGE+PE 
Sbjct  82   LYQAVNKQY-----------GYTLSRSSSSSTVASDFDTASFVGSSSS--IVDPGEDPEM  128

Query  605  VKIKLRHWAQAVACSVMQS  549
            VK +LR WAQ VACSV QS
Sbjct  129  VKTRLRQWAQVVACSVRQS  147



>ref|XP_002879335.1| hypothetical protein ARALYDRAFT_482083 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH55594.1| hypothetical protein ARALYDRAFT_482083 [Arabidopsis lyrata subsp. 
lyrata]
Length=202

 Score = 83.6 bits (205),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 46/114 (40%), Positives = 68/114 (60%), Gaps = 10/114 (9%)
 Frame = -1

Query  899  AECLTDDDLNELKGCIELGFGFKEEEGQRLCNTLPALDLYFAVNRQFSFSPVSTPGSKGT  720
            A+ LTDDDL ELKGC++LGFGF  +E   LCNTLPAL+L ++++++F             
Sbjct  95   AKSLTDDDLEELKGCLDLGFGFSYDEIPELCNTLPALELCYSMSQKFLDDKQQN------  148

Query  719  TLpspsasstggrssslsspgsdsdSWRICSPGENPEHVKIKLRHWAQAVACSV  558
                   S     S    +  +   +W+I SPG++P+ VK +L++WAQ VAC+V
Sbjct  149  ----HHKSPDEDDSPPPPTTTAPIANWKISSPGDDPDDVKARLKYWAQTVACTV  198



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 3601749637304