BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c80627_g1_i1 len=1900 path=[1:0-1899]

Length=1900
                                                                      Score     E

ref|XP_011099674.1|  PREDICTED: amino acid permease 2-like              790   0.0      
ref|XP_010270272.1|  PREDICTED: amino acid permease 3                   779   0.0      
ref|XP_010652912.1|  PREDICTED: amino acid permease 3 isoform X1        778   0.0      
ref|XP_011022870.1|  PREDICTED: amino acid permease 4-like              776   0.0      
ref|XP_002275881.1|  PREDICTED: amino acid permease 3 isoform X2        774   0.0      Vitis vinifera
ref|XP_006464914.1|  PREDICTED: amino acid permease 2-like              769   0.0      
ref|XP_006432100.1|  hypothetical protein CICLE_v10000986mg             764   0.0      
ref|XP_010674405.1|  PREDICTED: amino acid permease 4                   762   0.0      
ref|XP_002307053.2|  hypothetical protein POPTR_0005s06990g             762   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_007048506.1|  Amino acid permease 2 isoform 1                    761   0.0      
ref|XP_006380397.1|  hypothetical protein POPTR_0007s04710g             761   0.0      
ref|XP_003634405.1|  PREDICTED: amino acid permease 3                   758   0.0      
ref|XP_010025744.1|  PREDICTED: amino acid permease 4-like              758   0.0      
ref|XP_008219592.1|  PREDICTED: amino acid permease 3-like isofor...    758   0.0      
emb|CAN61092.1|  hypothetical protein VITISV_005276                     758   0.0      Vitis vinifera
ref|XP_008227518.1|  PREDICTED: amino acid permease 4 isoform X1        758   0.0      
ref|XP_007213109.1|  hypothetical protein PRUPE_ppa023539mg             757   0.0      
ref|XP_006382883.1|  amino acid permease AAP1 family protein            757   0.0      
ref|XP_011031113.1|  PREDICTED: amino acid permease 4-like isofor...    757   0.0      
ref|XP_008219591.1|  PREDICTED: amino acid permease 3-like isofor...    756   0.0      
ref|XP_008227520.1|  PREDICTED: amino acid permease 4 isoform X3        755   0.0      
ref|XP_007222588.1|  hypothetical protein PRUPE_ppa004920mg             755   0.0      
ref|XP_010269036.1|  PREDICTED: amino acid permease 3-like              755   0.0      
ref|XP_007019168.1|  Amino acid permease isoform 2                      755   0.0      
gb|KHG20963.1|  Amino acid permease 3 -like protein                     754   0.0      
ref|XP_008227519.1|  PREDICTED: amino acid permease 4 isoform X2        754   0.0      
ref|XP_009339426.1|  PREDICTED: amino acid permease 3-like              754   0.0      
emb|CDY21569.1|  BnaC09g47230D                                          753   0.0      
ref|XP_009122500.1|  PREDICTED: amino acid permease 2                   751   0.0      
emb|CDX69918.1|  BnaA10g22670D                                          751   0.0      
ref|XP_007019167.1|  Amino acid permease isoform 1                      751   0.0      
ref|XP_011031114.1|  PREDICTED: amino acid permease 4-like isofor...    750   0.0      
emb|CAF22024.1|  amino acid permease                                    749   0.0      Brassica napus [oilseed rape]
ref|XP_008338673.1|  PREDICTED: amino acid permease 3-like              748   0.0      
ref|XP_006434261.1|  hypothetical protein CICLE_v10000991mg             748   0.0      
ref|XP_006399392.1|  hypothetical protein EUTSA_v10013363mg             747   0.0      
ref|NP_196484.1|  amino acid permease 2                                 747   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_002871360.1|  hypothetical protein ARALYDRAFT_487723             747   0.0      
ref|XP_010452897.1|  PREDICTED: amino acid permease 2                   746   0.0      
ref|XP_006279782.1|  hypothetical protein CARUB_v10027867mg             744   0.0      
emb|CAA54631.1|  amino acid transporter                                 744   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|NP_201190.1|  amino acid permease 4                                 743   0.0      Arabidopsis thaliana [mouse-ear cress]
emb|CDX81121.1|  BnaC03g03750D                                          744   0.0      
gb|AAM61227.1|  amino acid transport protein AAP2                       744   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_002520322.1|  amino acid transporter, putative                   744   0.0      Ricinus communis
ref|XP_004290907.1|  PREDICTED: amino acid permease 3-like              743   0.0      
gb|AAM13223.1|  amino acid transporter AAP4                             742   0.0      Arabidopsis thaliana [mouse-ear cress]
emb|CDX78353.1|  BnaA03g02650D                                          743   0.0      
ref|NP_177862.1|  amino acid permease 3                                 742   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_009106399.1|  PREDICTED: amino acid permease 3                   742   0.0      
emb|CDX88364.1|  BnaC06g38080D                                          741   0.0      
ref|XP_010491540.1|  PREDICTED: amino acid permease 2-like              742   0.0      
ref|XP_010546306.1|  PREDICTED: amino acid permease 4 isoform X1        741   0.0      
ref|XP_010423021.1|  PREDICTED: amino acid permease 2-like              741   0.0      
gb|AAM62803.1|  amino acid carrier, putative                            741   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_006394236.1|  hypothetical protein EUTSA_v10004152mg             740   0.0      
ref|XP_009131105.1|  PREDICTED: amino acid permease 2                   741   0.0      
emb|CDX87522.1|  BnaA07g33510D                                          739   0.0      
ref|XP_010095435.1|  hypothetical protein L484_013392                   739   0.0      
ref|XP_002864872.1|  hypothetical protein ARALYDRAFT_496573             738   0.0      
ref|XP_006390096.1|  hypothetical protein EUTSA_v10018484mg             738   0.0      
gb|AAM61320.1|  amino acid transporter AAP4                             737   0.0      Arabidopsis thaliana [mouse-ear cress]
gb|KFK42132.1|  hypothetical protein AALP_AA2G215300                    737   0.0      
emb|CDX88365.1|  BnaC06g38090D                                          737   0.0      
ref|XP_008466753.1|  PREDICTED: amino acid permease 3-like              737   0.0      
ref|XP_010537371.1|  PREDICTED: amino acid permease 3                   737   0.0      
ref|XP_004142635.1|  PREDICTED: amino acid permease 3-like              737   0.0      
ref|XP_006386354.1|  hypothetical protein POPTR_0002s07960g             737   0.0      
ref|XP_011003418.1|  PREDICTED: amino acid permease 3-like              737   0.0      
ref|XP_010684694.1|  PREDICTED: amino acid permease 3-like              737   0.0      
ref|XP_004149429.1|  PREDICTED: amino acid permease 3-like              736   0.0      
emb|CDY39844.1|  BnaC02g42740D                                          735   0.0      
ref|XP_011027479.1|  PREDICTED: amino acid permease 3-like isofor...    736   0.0      
ref|XP_006287587.1|  hypothetical protein CARUB_v10000805mg             736   0.0      
ref|XP_011002450.1|  PREDICTED: amino acid permease 3-like              735   0.0      
ref|XP_011074825.1|  PREDICTED: amino acid permease 3-like              735   0.0      
ref|XP_002302223.1|  hypothetical protein POPTR_0002s07960g             735   0.0      Populus trichocarpa [western balsam poplar]
emb|CDY31348.1|  BnaA02g33930D                                          734   0.0      
ref|XP_010484145.1|  PREDICTED: amino acid permease 4                   734   0.0      
gb|KGN47695.1|  hypothetical protein Csa_6G381850                       733   0.0      
ref|XP_010461080.1|  PREDICTED: amino acid permease 4-like              733   0.0      
ref|XP_009130275.1|  PREDICTED: amino acid permease 4                   733   0.0      
ref|XP_002889140.1|  hypothetical protein ARALYDRAFT_476902             733   0.0      
ref|XP_010444306.1|  PREDICTED: amino acid permease 4-like              732   0.0      
ref|XP_002520323.1|  amino acid transporter, putative                   733   0.0      Ricinus communis
ref|XP_011027478.1|  PREDICTED: amino acid permease 3-like isofor...    732   0.0      
ref|XP_002306650.2|  hypothetical protein POPTR_0005s20400g             731   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_007222611.1|  hypothetical protein PRUPE_ppa004936mg             731   0.0      
ref|XP_009389175.1|  PREDICTED: amino acid permease 4-like              731   0.0      
ref|XP_008219594.1|  PREDICTED: amino acid permease 3-like              729   0.0      
ref|XP_002302224.2|  hypothetical protein POPTR_0002s08000g             728   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_008444195.1|  PREDICTED: amino acid permease 3-like              728   0.0      
ref|XP_006300985.1|  hypothetical protein CARUB_v10021374mg             727   0.0      
ref|XP_008781630.1|  PREDICTED: amino acid permease 3                   728   0.0      
ref|XP_009377726.1|  PREDICTED: amino acid permease 3-like              727   0.0      
gb|KHG16478.1|  Amino acid permease 2 -like protein                     727   0.0      
ref|XP_010416679.1|  PREDICTED: amino acid permease 3-like              726   0.0      
emb|CDY43761.1|  BnaA06g22970D                                          725   0.0      
ref|XP_006386360.1|  hypothetical protein POPTR_0002s08040g             725   0.0      
ref|XP_008799058.1|  PREDICTED: amino acid permease 3-like              724   0.0      
ref|XP_006473027.1|  PREDICTED: amino acid permease 3-like              723   0.0      
ref|XP_009150448.1|  PREDICTED: amino acid permease 4                   723   0.0      
ref|XP_011027477.1|  PREDICTED: amino acid permease 3-like              722   0.0      
emb|CDX84450.1|  BnaC03g50500D                                          720   0.0      
ref|XP_010912574.1|  PREDICTED: amino acid permease 3-like              721   0.0      
ref|XP_008338672.1|  PREDICTED: amino acid permease 3-like              720   0.0      
ref|XP_010428816.1|  PREDICTED: amino acid permease 3                   719   0.0      
ref|XP_010063420.1|  PREDICTED: amino acid permease 3-like              719   0.0      
gb|EYU23867.1|  hypothetical protein MIMGU_mgv1a005496mg                719   0.0      
ref|XP_006386355.1|  amino acid permease which transports basic a...    719   0.0      
ref|XP_009390075.1|  PREDICTED: amino acid permease 4-like isofor...    719   0.0      
ref|XP_003527948.1|  PREDICTED: amino acid permease 3                   719   0.0      
ref|XP_011102302.1|  PREDICTED: amino acid permease 3 isoform X2        718   0.0      
gb|KDP32820.1|  hypothetical protein JCGZ_12112                         717   0.0      
ref|XP_009390074.1|  PREDICTED: amino acid permease 4-like isofor...    717   0.0      
gb|KDP32819.1|  hypothetical protein JCGZ_12111                         716   0.0      
ref|XP_010471931.1|  PREDICTED: amino acid permease 3-like              716   0.0      
ref|XP_009379863.1|  PREDICTED: amino acid permease 4-like              717   0.0      
emb|CAN65437.1|  hypothetical protein VITISV_038918                     716   0.0      Vitis vinifera
ref|XP_003522571.1|  PREDICTED: amino acid permease 3-like isofor...    716   0.0      
ref|XP_010063933.1|  PREDICTED: amino acid permease 3-like              716   0.0      
ref|XP_004290905.1|  PREDICTED: amino acid permease 2-like              715   0.0      
emb|CDP10973.1|  unnamed protein product                                714   0.0      
ref|XP_011102300.1|  PREDICTED: amino acid permease 3 isoform X1        715   0.0      
ref|XP_010063423.1|  PREDICTED: amino acid permease 3-like              712   0.0      
ref|XP_004498350.1|  PREDICTED: amino acid permease 3-like isofor...    712   0.0      
gb|KHN44307.1|  Amino acid permease 3                                   712   0.0      
gb|KHG27248.1|  Amino acid permease 3 -like protein                     711   0.0      
ref|XP_006383588.1|  hypothetical protein POPTR_0005s20390g             711   0.0      
ref|XP_009609434.1|  PREDICTED: amino acid permease 3-like              711   0.0      
ref|XP_010920126.1|  PREDICTED: amino acid permease 4-like              710   0.0      
ref|XP_009414606.1|  PREDICTED: amino acid permease 3-like              709   0.0      
ref|XP_009801366.1|  PREDICTED: amino acid permease 3-like              708   0.0      
ref|XP_011002449.1|  PREDICTED: amino acid permease 3-like              706   0.0      
gb|EYU32509.1|  hypothetical protein MIMGU_mgv1a005226mg                706   0.0      
ref|XP_010911278.1|  PREDICTED: amino acid permease 3-like isofor...    705   0.0      
ref|XP_010911284.1|  PREDICTED: amino acid permease 3-like isofor...    704   0.0      
ref|XP_006365537.1|  PREDICTED: amino acid permease 3-like              704   0.0      
ref|XP_009767545.1|  PREDICTED: amino acid permease 3-like              704   0.0      
ref|XP_011003419.1|  PREDICTED: amino acid permease 3-like              704   0.0      
gb|AII99817.1|  amino acid transporter                                  703   0.0      
gb|EYU32508.1|  hypothetical protein MIMGU_mgv1a005226mg                703   0.0      
gb|KDP29639.1|  hypothetical protein JCGZ_18801                         704   0.0      
ref|XP_010322323.1|  PREDICTED: amino acid transporter isoform X1       702   0.0      
ref|XP_007137459.1|  hypothetical protein PHAVU_009G128500g             702   0.0      
gb|KEH40510.1|  transmembrane amino acid transporter family protein     702   0.0      
ref|XP_003524313.1|  PREDICTED: amino acid permease 2-like              702   0.0      
ref|XP_009390766.1|  PREDICTED: amino acid permease 4-like              701   0.0      
ref|XP_002278086.1|  PREDICTED: amino acid permease 3                   701   0.0      Vitis vinifera
ref|XP_009596720.1|  PREDICTED: amino acid permease 3-like isofor...    700   0.0      
ref|XP_009596721.1|  PREDICTED: amino acid permease 3-like isofor...    700   0.0      
gb|AIL30502.1|  amino acid transporter                                  699   0.0      
ref|NP_001234606.1|  amino acid transporter                             699   0.0      
ref|XP_008236004.1|  PREDICTED: amino acid permease 3-like              700   0.0      
gb|AIS71894.1|  amino acid transporter                                  699   0.0      
emb|CDO96925.1|  unnamed protein product                                698   0.0      
ref|XP_008810907.1|  PREDICTED: amino acid permease 3-like              696   0.0      
ref|XP_009404321.1|  PREDICTED: amino acid permease 4-like              697   0.0      
ref|XP_010028716.1|  PREDICTED: amino acid permease 4-like              696   0.0      
ref|XP_009388107.1|  PREDICTED: amino acid permease 3-like              694   0.0      
ref|XP_008788441.1|  PREDICTED: amino acid permease 4-like              693   0.0      
ref|XP_007198986.1|  hypothetical protein PRUPE_ppa020916mg             693   0.0      
ref|XP_004289864.1|  PREDICTED: amino acid permease 2-like              692   0.0      
ref|XP_011046334.1|  PREDICTED: amino acid permease 3-like              691   0.0      
ref|XP_009411898.1|  PREDICTED: amino acid permease 3-like isofor...    689   0.0      
ref|XP_008377748.1|  PREDICTED: amino acid permease 3-like              691   0.0      
ref|XP_006847199.1|  hypothetical protein AMTR_s00017p00252280          689   0.0      
ref|XP_009411897.1|  PREDICTED: amino acid permease 3-like isofor...    689   0.0      
emb|CAN77083.1|  hypothetical protein VITISV_003992                     691   0.0      Vitis vinifera
ref|XP_004503904.1|  PREDICTED: amino acid permease 2-like              689   0.0      
ref|XP_003542145.1|  PREDICTED: amino acid permease 3 isoform X1        687   0.0      
emb|CAC51425.1|  amino acid permease AAP4                               687   0.0      Vicia faba var. minor [tick bean]
gb|KHN19623.1|  Amino acid permease 3                                   686   0.0      
gb|KHN25477.1|  Amino acid permease 2                                   687   0.0      
dbj|BAO45885.1|  amino acid permease                                    686   0.0      
ref|XP_006596218.1|  PREDICTED: amino acid permease 3-like isofor...    686   0.0      
ref|XP_010527720.1|  PREDICTED: amino acid permease 5-like isofor...    685   0.0      
gb|AAX56951.1|  amino acid transporter                                  685   0.0      Pisum sativum [garden pea]
ref|XP_006590854.1|  PREDICTED: amino acid permease 2-like              686   0.0      
ref|XP_010653015.1|  PREDICTED: amino acid permease 4-like              685   0.0      
ref|XP_009604405.1|  PREDICTED: amino acid permease 4-like              685   0.0      
ref|XP_004962032.1|  PREDICTED: amino acid permease 3-like isofor...    684   0.0      
ref|XP_006486755.1|  PREDICTED: amino acid permease 3-like              684   0.0      
gb|EYU37943.1|  hypothetical protein MIMGU_mgv1a004721mg                684   0.0      
ref|XP_003540867.1|  PREDICTED: amino acid permease 2                   684   0.0      
ref|XP_006422618.1|  hypothetical protein CICLE_v10028230mg             684   0.0      
gb|AAK33098.1|  amino acid transporter                                  684   0.0      Glycine max [soybeans]
ref|XP_006351135.1|  PREDICTED: amino acid permease 3-like              682   0.0      
ref|XP_010530203.1|  PREDICTED: amino acid permease 5                   682   0.0      
gb|KDO68035.1|  hypothetical protein CISIN_1g010376mg                   682   0.0      
emb|CAA10608.1|  amino acid carrier                                     681   0.0      Ricinus communis
ref|XP_008219720.1|  PREDICTED: amino acid permease 3-like              681   0.0      
ref|XP_004505788.1|  PREDICTED: amino acid permease 2-like              681   0.0      
ref|XP_003630316.1|  Amino acid permease                                680   0.0      
ref|XP_007137460.1|  hypothetical protein PHAVU_009G128600g             680   0.0      
ref|XP_002439825.1|  hypothetical protein SORBIDRAFT_09g020790          678   0.0      Sorghum bicolor [broomcorn]
ref|XP_007224395.1|  hypothetical protein PRUPE_ppa021701mg             678   0.0      
ref|XP_008442173.1|  PREDICTED: amino acid permease 4-like              677   0.0      
ref|XP_008368062.1|  PREDICTED: amino acid permease 3-like              675   0.0      
ref|XP_003568418.2|  PREDICTED: amino acid permease 3-like isofor...    675   0.0      
emb|CAA70778.1|  amino acid transporter                                 676   0.0      Vicia faba [broad bean]
ref|XP_007041865.1|  Amino acid permease 2 isoform 1                    676   0.0      
ref|NP_001233979.1|  amino acid transporter                             674   0.0      
dbj|BAK03497.1|  predicted protein                                      674   0.0      
ref|XP_010232650.1|  PREDICTED: amino acid permease 3-like              674   0.0      
ref|XP_010231354.1|  PREDICTED: amino acid permease 3-like isofor...    673   0.0      
gb|KEH30491.1|  transmembrane amino acid transporter family protein     674   0.0      
gb|KEH30492.1|  transmembrane amino acid transporter family protein     674   0.0      
ref|XP_004156002.1|  PREDICTED: amino acid permease 4-like              672   0.0      
dbj|BAJ95327.1|  predicted protein                                      672   0.0      
emb|CDY36017.1|  BnaA08g04440D                                          672   0.0      
ref|XP_002458869.1|  hypothetical protein SORBIDRAFT_03g041840          672   0.0      Sorghum bicolor [broomcorn]
dbj|BAK03421.1|  predicted protein                                      671   0.0      
ref|XP_008654977.1|  PREDICTED: amino acid carrier isoform X1           671   0.0      
ref|XP_008679681.1|  PREDICTED: amino acid permease 3-like              671   0.0      
gb|KEH35328.1|  transmembrane amino acid transporter family protein     670   0.0      
ref|XP_009764609.1|  PREDICTED: amino acid permease 4-like isofor...    671   0.0      
ref|XP_009145052.1|  PREDICTED: amino acid permease 5                   670   0.0      
ref|NP_001142349.1|  hypothetical protein                               670   0.0      Zea mays [maize]
ref|NP_001149036.1|  amino acid carrier                                 669   0.0      Zea mays [maize]
ref|NP_001055592.1|  Os05g0424000                                       669   0.0      Oryza sativa Japonica Group [Japonica rice]
gb|AFK37021.1|  unknown                                                 670   0.0      
emb|CDM85442.1|  unnamed protein product                                668   0.0      
ref|XP_009339433.1|  PREDICTED: amino acid permease 3-like              668   0.0      
ref|XP_002449174.1|  hypothetical protein SORBIDRAFT_05g006010          667   0.0      Sorghum bicolor [broomcorn]
ref|XP_002534252.1|  amino acid transporter, putative                   667   0.0      Ricinus communis
emb|CDM85443.1|  unnamed protein product                                667   0.0      
ref|XP_004978920.1|  PREDICTED: amino acid permease 3-like              667   0.0      
ref|XP_009107481.1|  PREDICTED: amino acid permease 5-like              667   0.0      
ref|NP_001067425.1|  Os11g0195600                                       666   0.0      Oryza sativa Japonica Group [Japonica rice]
gb|KDO57534.1|  hypothetical protein CISIN_1g015342mg                   663   0.0      
ref|XP_010090330.1|  hypothetical protein L484_024995                   667   0.0      
ref|XP_006654425.1|  PREDICTED: amino acid permease 3-like              666   0.0      
ref|XP_006393747.1|  hypothetical protein EUTSA_v10011449mg             664   0.0      
ref|XP_008442267.1|  PREDICTED: amino acid permease 4-like              662   0.0      
ref|XP_010527719.1|  PREDICTED: amino acid permease 5-like isofor...    664   0.0      
gb|AAD16014.1|  amino acid transporter                                  657   0.0      Nepenthes alata
ref|XP_006307383.1|  hypothetical protein CARUB_v10009009mg             661   0.0      
ref|NP_001045010.1|  Os01g0882800                                       661   0.0      Oryza sativa Japonica Group [Japonica rice]
ref|NP_175076.2|  amino acid permease 5                                 659   0.0      Arabidopsis thaliana [mouse-ear cress]
emb|CAA54632.1|  amino acid permease                                    659   0.0      Arabidopsis thaliana [mouse-ear cress]
gb|KEH35330.1|  transmembrane amino acid transporter family protein     659   0.0      
ref|XP_006645132.1|  PREDICTED: amino acid permease 2-like              658   0.0      
ref|XP_007226332.1|  hypothetical protein PRUPE_ppa022253mg             657   0.0      
ref|XP_010266973.1|  PREDICTED: amino acid permease 3-like              656   0.0      
ref|XP_006662801.1|  PREDICTED: amino acid permease 3-like              656   0.0      
ref|XP_010546307.1|  PREDICTED: amino acid permease 2 isoform X2        653   0.0      
dbj|BAJ86012.1|  predicted protein                                      656   0.0      
gb|AAX56952.1|  amino acid transporter                                  655   0.0      Pisum sativum [garden pea]
ref|XP_004977213.1|  PREDICTED: amino acid permease 3-like              655   0.0      
ref|XP_004977211.1|  PREDICTED: amino acid permease 3-like              654   0.0      
ref|XP_002893978.1|  hypothetical protein ARALYDRAFT_473798             654   0.0      
gb|KCW70650.1|  hypothetical protein EUGRSUZ_F03824                     654   0.0      
ref|XP_006578773.1|  PREDICTED: amino acid permease 3-like isofor...    654   0.0      
ref|XP_004144658.1|  PREDICTED: amino acid permease 4-like              653   0.0      
ref|XP_006578775.1|  PREDICTED: amino acid permease 3-like isofor...    650   0.0      
ref|XP_008377310.1|  PREDICTED: amino acid permease 3-like              651   0.0      
ref|XP_004977210.1|  PREDICTED: amino acid permease 3-like              650   0.0      
ref|XP_010479037.1|  PREDICTED: amino acid permease 5 isoform X1        650   0.0      
gb|ABR18002.1|  unknown                                                 651   0.0      Picea sitchensis
ref|XP_006581782.1|  PREDICTED: amino acid permease 3-like isofor...    650   0.0      
ref|XP_006581783.1|  PREDICTED: amino acid permease 3-like isofor...    649   0.0      
ref|XP_007137763.1|  hypothetical protein PHAVU_009G153700g             649   0.0      
ref|XP_004977212.1|  PREDICTED: amino acid permease 3-like              648   0.0      
ref|XP_002442926.1|  hypothetical protein SORBIDRAFT_08g005000          648   0.0      Sorghum bicolor [broomcorn]
ref|XP_007137761.1|  hypothetical protein PHAVU_009G153700g             649   0.0      
gb|AAG50558.1|AC074228_13  amino acid permease, putative                647   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_003602669.1|  Amino acid permease                                647   0.0      
ref|XP_007137760.1|  hypothetical protein PHAVU_009G153600g             647   0.0      
ref|XP_002442925.1|  hypothetical protein SORBIDRAFT_08g004990          646   0.0      Sorghum bicolor [broomcorn]
gb|AFW56244.1|  hypothetical protein ZEAMMB73_131551                    645   0.0      
ref|XP_006646758.1|  PREDICTED: amino acid permease 3-like              645   0.0      
ref|XP_010500132.1|  PREDICTED: amino acid permease 5-like isofor...    644   0.0      
emb|CAC51423.1|  amino acid permease AAP1                               643   0.0      Vicia faba var. minor [tick bean]
ref|XP_008662536.1|  PREDICTED: amino acid permease 3-like              643   0.0      
ref|XP_006366236.1|  PREDICTED: amino acid permease 3-like              640   0.0      
ref|XP_002442923.1|  hypothetical protein SORBIDRAFT_08g004960          640   0.0      Sorghum bicolor [broomcorn]
ref|XP_003578826.1|  PREDICTED: amino acid permease 3-like              640   0.0      
dbj|BAK02045.1|  predicted protein                                      640   0.0      
gb|EEC68963.1|  hypothetical protein OsI_37697                          640   0.0      
ref|XP_007137762.1|  hypothetical protein PHAVU_009G153700g             639   0.0      
ref|NP_001140430.1|  hypothetical protein                               640   0.0      
emb|CDY47793.1|  BnaC06g00580D                                          639   0.0      
gb|EAY82481.1|  hypothetical protein OsI_37698                          639   0.0      
ref|NP_001066316.1|  Os12g0181500                                       639   0.0      
ref|XP_002441927.1|  hypothetical protein SORBIDRAFT_08g004980          638   0.0      
ref|NP_001045595.1|  Os02g0102200                                       639   0.0      
ref|NP_001066317.1|  Os12g0181600                                       637   0.0      
ref|XP_009123048.1|  PREDICTED: amino acid permease 5                   637   0.0      
ref|XP_003578825.1|  PREDICTED: amino acid permease 4-like              637   0.0      
gb|EAY84081.1|  hypothetical protein OsI_05462                          637   0.0      
ref|XP_004978919.1|  PREDICTED: amino acid permease 3-like              636   0.0      
ref|XP_010051542.1|  PREDICTED: amino acid permease 3-like              633   0.0      
ref|XP_008219593.1|  PREDICTED: amino acid permease 3-like              633   0.0      
ref|XP_003523211.1|  PREDICTED: amino acid permease 2-like              631   0.0      
ref|XP_008668462.1|  PREDICTED: uncharacterized protein LOC100383...    630   0.0      
ref|XP_008674422.1|  PREDICTED: amino acid permease 3-like              628   0.0      
ref|XP_004502977.1|  PREDICTED: amino acid permease 3-like              624   0.0      
ref|XP_004502978.1|  PREDICTED: amino acid permease 2-like isofor...    620   0.0      
ref|XP_002449171.1|  hypothetical protein SORBIDRAFT_05g005980          620   0.0      
ref|XP_003602666.1|  Amino acid permease                                620   0.0      
gb|AFW56242.1|  hypothetical protein ZEAMMB73_107595                    620   0.0      
ref|XP_002312967.2|  hypothetical protein POPTR_0009s13610g             615   0.0      
ref|NP_001170050.1|  uncharacterized protein LOC100383966               613   0.0      
emb|CAA70969.1|  amino acid transporter                                 610   0.0      
ref|XP_009421017.1|  PREDICTED: amino acid permease 3-like              611   0.0      
gb|KHN09641.1|  Amino acid permease 2                                   613   0.0      
ref|XP_002442927.1|  hypothetical protein SORBIDRAFT_08g005010          612   0.0      
ref|XP_010051607.1|  PREDICTED: amino acid permease 3-like              610   0.0      
gb|ABR16450.1|  unknown                                                 610   0.0      
gb|EEE52230.1|  hypothetical protein OsJ_34158                          607   0.0      
ref|XP_008663834.1|  PREDICTED: uncharacterized protein LOC103642302    636   0.0      
ref|XP_004502980.1|  PREDICTED: amino acid permease 2-like isofor...    608   0.0      
gb|EEC81839.1|  hypothetical protein OsI_25597                          605   0.0      
gb|AFW56250.1|  hypothetical protein ZEAMMB73_465553                    633   0.0      
ref|XP_010051605.1|  PREDICTED: amino acid permease 3-like              605   0.0      
gb|KCW82236.1|  hypothetical protein EUGRSUZ_C03655                     601   0.0      
ref|XP_006356925.1|  PREDICTED: amino acid permease 3-like              602   0.0      
ref|XP_003577747.1|  PREDICTED: amino acid permease 3                   601   0.0      
gb|EMT28649.1|  hypothetical protein F775_26310                         598   0.0      
ref|XP_003602671.1|  Amino acid permease                                597   0.0      
ref|XP_003602670.1|  Amino acid permease                                598   0.0      
ref|XP_004290906.1|  PREDICTED: amino acid permease 2-like              595   0.0      
emb|CAC51424.1|  amino acid permease AAP3                               595   0.0      
ref|XP_004301080.1|  PREDICTED: amino acid permease 3-like              594   0.0      
ref|XP_009764610.1|  PREDICTED: amino acid permease 3-like isofor...    592   0.0      
gb|EMT11988.1|  hypothetical protein F775_30582                         591   0.0      
ref|XP_010051603.1|  PREDICTED: amino acid permease 3-like              593   0.0      
ref|XP_003638241.1|  Amino acid permease                                596   0.0      
gb|KCW82488.1|  hypothetical protein EUGRSUZ_C03884                     588   0.0      
gb|ADB92670.1|  amino acid permease 6                                   589   0.0      
gb|KCW82484.1|  hypothetical protein EUGRSUZ_C03879                     588   0.0      
ref|XP_002510013.1|  amino acid transporter, putative                   586   0.0      
ref|XP_008219153.1|  PREDICTED: amino acid permease 6-like              584   0.0      
ref|XP_011017028.1|  PREDICTED: amino acid permease 6-like              584   0.0      
gb|KDP41551.1|  hypothetical protein JCGZ_15958                         582   0.0      
emb|CDY60629.1|  BnaAnng17090D                                          578   0.0      
gb|ADE75660.1|  unknown                                                 582   0.0      
ref|XP_007222665.1|  hypothetical protein PRUPE_ppa004980mg             580   0.0      
ref|XP_004160712.1|  PREDICTED: amino acid permease 3-like              575   0.0      
tpg|DAA38913.1|  TPA: hypothetical protein ZEAMMB73_639977              578   0.0      
emb|CDP00979.1|  unnamed protein product                                579   0.0      
gb|EMT28875.1|  hypothetical protein F775_29828                         578   0.0      
gb|AAD16015.1|  amino acid transporter                                  575   0.0      
ref|XP_004151465.1|  PREDICTED: amino acid permease 4-like              576   0.0      
gb|AFK39617.1|  unknown                                                 575   0.0      
ref|XP_010245602.1|  PREDICTED: amino acid permease 6                   578   0.0      
ref|XP_004136237.1|  PREDICTED: amino acid permease 6-like              578   0.0      
emb|CBI21586.3|  unnamed protein product                                575   0.0      
ref|XP_009335480.1|  PREDICTED: amino acid permease 6-like              578   0.0      
ref|XP_007161468.1|  hypothetical protein PHAVU_001G071500g             573   0.0      
gb|KHN37208.1|  Amino acid permease 6                                   574   0.0      
ref|XP_003526513.1|  PREDICTED: amino acid permease 6-like              574   0.0      
ref|XP_007018375.1|  Amino acid permease 6                              574   0.0      
ref|XP_002977532.1|  hypothetical protein SELMODRAFT_176236             574   0.0      
ref|XP_010063932.1|  PREDICTED: amino acid permease 3-like              573   0.0      
ref|XP_004299846.1|  PREDICTED: amino acid permease 6-like              572   0.0      
ref|XP_009793584.1|  PREDICTED: amino acid permease 6-like              571   0.0      
ref|XP_010250334.1|  PREDICTED: amino acid permease 4-like              573   0.0      
ref|XP_008789212.1|  PREDICTED: amino acid permease 8-like              571   0.0      
ref|XP_002301129.2|  amino acid transport protein AAP2                  571   0.0      
ref|XP_009629042.1|  PREDICTED: amino acid permease 6-like              570   0.0      
gb|EYU34219.1|  hypothetical protein MIMGU_mgv1a005305mg                570   0.0      
ref|XP_010556498.1|  PREDICTED: amino acid permease 6                   569   0.0      
ref|XP_007137276.1|  hypothetical protein PHAVU_009G113800g             569   0.0      
emb|CDP00978.1|  unnamed protein product                                569   0.0      
gb|EAY82539.1|  hypothetical protein OsI_37761                          568   0.0      
gb|KHN08198.1|  Amino acid permease 6                                   568   0.0      
ref|XP_002888218.1|  hypothetical protein ARALYDRAFT_893658             568   0.0      
ref|XP_010667459.1|  PREDICTED: amino acid permease 6-like              568   0.0      
ref|NP_001242816.1|  uncharacterized protein LOC100777963               568   0.0      
ref|NP_001066354.2|  Os12g0195100                                       567   0.0      
ref|XP_010051606.1|  PREDICTED: amino acid permease 3-like              566   0.0      
ref|XP_002975129.1|  hypothetical protein SELMODRAFT_442676             568   0.0      
ref|NP_001057853.1|  Os06g0556000                                       567   0.0      
ref|XP_010440833.1|  PREDICTED: amino acid permease 6-like              566   0.0      
ref|XP_009357221.1|  PREDICTED: amino acid permease 6-like              566   0.0      
ref|XP_010025741.1|  PREDICTED: amino acid permease 4-like              567   0.0      
gb|KCW62470.1|  hypothetical protein EUGRSUZ_H05110                     566   0.0      
ref|XP_011074307.1|  PREDICTED: amino acid permease 6                   565   0.0      
ref|XP_010442428.1|  PREDICTED: amino acid permease 6                   565   0.0      
ref|XP_004498452.1|  PREDICTED: amino acid permease 6-like              565   0.0      
ref|XP_002442913.1|  hypothetical protein SORBIDRAFT_08g004810          565   0.0      
ref|XP_010482241.1|  PREDICTED: amino acid permease 6-like isofor...    565   0.0      
ref|XP_008339056.1|  PREDICTED: amino acid permease 6                   565   0.0      
ref|XP_003563762.1|  PREDICTED: amino acid permease 3-like              565   0.0      
ref|XP_004501076.1|  PREDICTED: amino acid permease 6-like              564   0.0      
ref|NP_176132.1|  amino acid permease 1                                 564   0.0      
ref|XP_001784036.1|  predicted protein                                  563   0.0      
gb|EYU36417.1|  hypothetical protein MIMGU_mgv1a005426mg                563   0.0      
ref|XP_010915382.1|  PREDICTED: amino acid permease 1-like              563   0.0      
gb|EMT28481.1|  hypothetical protein F775_18207                         561   0.0      
dbj|BAJ93107.1|  predicted protein                                      564   0.0      
ref|XP_002285557.1|  PREDICTED: amino acid permease 6                   562   0.0      
gb|KDO68037.1|  hypothetical protein CISIN_1g010376mg                   558   0.0      
ref|XP_010025740.1|  PREDICTED: amino acid permease 4-like              562   0.0      
ref|XP_010051604.1|  PREDICTED: amino acid permease 3-like              560   0.0      
ref|XP_002974163.1|  hypothetical protein SELMODRAFT_100110             560   0.0      
ref|XP_009381189.1|  PREDICTED: amino acid permease 3-like              560   0.0      
ref|XP_002968812.1|  hypothetical protein SELMODRAFT_90661              560   0.0      
ref|XP_006280391.1|  hypothetical protein CARUB_v10026318mg             560   0.0      
gb|AAB87674.1|  neutral amino acid transport system II                  560   0.0      
ref|XP_003603665.1|  Amino acid permease                                560   0.0      
ref|XP_011027691.1|  PREDICTED: amino acid permease 3-like              555   0.0      
gb|AFK42490.1|  unknown                                                 559   0.0      
ref|XP_010269102.1|  PREDICTED: amino acid permease 6-like              558   0.0      
ref|XP_011078457.1|  PREDICTED: amino acid permease 6-like              559   0.0      
ref|XP_006656161.1|  PREDICTED: amino acid permease 1-like              558   0.0      
ref|XP_003588450.1|  Amino acid transporter                             558   0.0      
emb|CAA70968.2|  amino acid transporter                                 557   0.0      
ref|XP_006392303.1|  hypothetical protein EUTSA_v10023431mg             558   0.0      
ref|NP_001168530.1|  uncharacterized protein LOC100382310 precursor     554   0.0      
ref|XP_010553668.1|  PREDICTED: amino acid permease 1-like              557   0.0      
ref|XP_002444093.1|  hypothetical protein SORBIDRAFT_07g007570          557   0.0      
ref|XP_009127448.1|  PREDICTED: amino acid permease 6                   556   0.0      
ref|XP_009102845.1|  PREDICTED: amino acid permease 1                   556   0.0      
ref|XP_006302194.1|  hypothetical protein CARUB_v10020203mg             556   0.0      
emb|CAD92450.1|  amino acid permease 6                                  555   0.0      
ref|XP_010320244.1|  PREDICTED: LOW QUALITY PROTEIN: amino acid p...    555   0.0      
ref|XP_010058357.1|  PREDICTED: amino acid permease 3-like              555   0.0      
emb|CDP08191.1|  unnamed protein product                                555   0.0      
ref|XP_006487060.1|  PREDICTED: amino acid permease 6-like              555   0.0      
dbj|BAJ91439.1|  predicted protein                                      555   0.0      
ref|XP_010269103.1|  PREDICTED: amino acid permease 6-like              554   0.0      
emb|CAD92449.1|  amino acid permease 1                                  555   0.0      
emb|CDY04349.1|  BnaC04g18440D                                          554   0.0      
ref|XP_007161529.1|  hypothetical protein PHAVU_001G077000g             553   0.0      
ref|XP_004973184.1|  PREDICTED: amino acid permease 3-like              554   0.0      
ref|XP_003550117.1|  PREDICTED: amino acid permease 6                   553   0.0      
ref|XP_008678533.1|  PREDICTED: amino acid permease 4-like              553   0.0      
ref|XP_009138576.1|  PREDICTED: amino acid permease 1-like              553   0.0      
ref|XP_006472367.1|  PREDICTED: amino acid permease 6-like              551   0.0      
emb|CBI21597.3|  unnamed protein product                                546   0.0      
ref|NP_172472.1|  amino acid permease 8                                 551   0.0      
gb|EMT26484.1|  hypothetical protein F775_32730                         551   0.0      
gb|KHG24473.1|  Amino acid permease 6 -like protein                     550   0.0      
emb|CDY04448.1|  BnaA03g59400D                                          552   0.0      
ref|XP_006433701.1|  hypothetical protein CICLE_v10000981mg             550   0.0      
ref|XP_010061591.1|  PREDICTED: amino acid permease 6-like              550   0.0      
gb|KFK40897.1|  hypothetical protein AALP_AA2G057600                    550   0.0      
gb|KDO81356.1|  hypothetical protein CISIN_1g011548mg                   550   0.0      
gb|KEH35329.1|  transmembrane amino acid transporter family protein     547   0.0      
ref|XP_010458325.1|  PREDICTED: amino acid permease 8                   549   0.0      
gb|KHN16938.1|  Amino acid permease 2                                   546   0.0      
gb|KCW71228.1|  hypothetical protein EUGRSUZ_F04325                     546   0.0      
ref|XP_002437146.1|  hypothetical protein SORBIDRAFT_10g021980          549   0.0      
ref|XP_010104540.1|  hypothetical protein L484_025514                   548   0.0      
ref|XP_003557617.1|  PREDICTED: amino acid permease 6                   547   0.0      
ref|XP_006417504.1|  hypothetical protein EUTSA_v10007516mg             547   0.0      
ref|XP_010470262.1|  PREDICTED: amino acid permease 1                   547   0.0      
ref|XP_006346279.1|  PREDICTED: amino acid permease 6-like              546   0.0      
gb|KCW62469.1|  hypothetical protein EUGRSUZ_H05109                     547   0.0      
ref|XP_002865746.1|  hypothetical protein ARALYDRAFT_495022             548   0.0      
gb|EAZ19918.1|  hypothetical protein OsJ_35512                          546   0.0      
ref|XP_009148321.1|  PREDICTED: amino acid permease 8                   545   0.0      
ref|XP_008658969.1|  PREDICTED: uncharacterized protein LOC100501...    545   0.0      
ref|XP_010027424.1|  PREDICTED: amino acid permease 4-like              552   0.0      
ref|XP_004965605.1|  PREDICTED: amino acid permease 6-like              545   0.0      
ref|NP_199774.1|  amino acid permease 6                                 544   0.0      
dbj|BAJ85485.1|  predicted protein                                      544   0.0      
ref|XP_010414737.1|  PREDICTED: amino acid permease 1-like              544   0.0      
ref|XP_006306441.1|  hypothetical protein CARUB_v10012383mg             543   0.0      
ref|XP_010490519.1|  PREDICTED: amino acid permease 8-like              543   0.0      
ref|XP_006657428.1|  PREDICTED: amino acid permease 6-like              542   0.0      
emb|CDY44564.1|  BnaA01g21750D                                          542   0.0      
ref|NP_001233983.1|  amino acid transporter                             541   0.0      
ref|NP_001149517.1|  amino acid permease 1                              540   0.0      
ref|XP_004965607.1|  PREDICTED: amino acid permease 3-like              539   0.0      
ref|XP_010240058.1|  PREDICTED: amino acid permease 3-like              540   0.0      
emb|CDY53793.1|  BnaCnng25620D                                          538   0.0      
ref|XP_004955421.1|  PREDICTED: amino acid permease 6-like              538   0.0      
emb|CDY60248.1|  BnaC01g42990D                                          539   0.0      
emb|CDY46779.1|  BnaCnng14480D                                          537   0.0      
gb|KDO80515.1|  hypothetical protein CISIN_1g0115802mg                  531   0.0      
gb|EEC81471.1|  hypothetical protein OsI_24794                          537   0.0      
emb|CDY48843.1|  BnaA09g14700D                                          535   0.0      
ref|XP_010475859.1|  PREDICTED: amino acid permease 8-like              534   0.0      
gb|EMT07264.1|  hypothetical protein F775_06597                         534   0.0      
gb|EMS56484.1|  hypothetical protein TRIUR3_26560                       544   0.0      
gb|EYU20407.1|  hypothetical protein MIMGU_mgv1a018639mg                534   0.0      
ref|XP_002889785.1|  hypothetical protein ARALYDRAFT_471112             534   0.0      
ref|XP_010229892.1|  PREDICTED: amino acid permease 8-like              534   0.0      
ref|XP_002461426.1|  hypothetical protein SORBIDRAFT_02g002440          533   0.0      
ref|XP_010268971.1|  PREDICTED: amino acid permease 6-like              533   1e-180   
ref|XP_003560665.1|  PREDICTED: amino acid permease 1-like              532   2e-180   
ref|XP_009113317.1|  PREDICTED: amino acid permease 1                   533   3e-180   
ref|XP_006307429.1|  hypothetical protein CARUB_v10009053mg             531   3e-180   
gb|KFK43301.1|  hypothetical protein AALP_AA1G106500                    531   3e-180   
emb|CAH67344.1|  OSIGBa0130B08.4                                        532   3e-180   
ref|XP_002889784.1|  hypothetical protein ARALYDRAFT_888258             532   4e-180   
gb|EYU39081.1|  hypothetical protein MIMGU_mgv1a023099mg                531   4e-180   
ref|NP_001058839.1|  Os07g0134000                                       532   4e-180   
gb|EEE66520.1|  hypothetical protein OsJ_22995                          532   4e-180   
emb|CAE01664.2|  OSJNBa0084K20.15                                       532   4e-180   
ref|XP_010927999.1|  PREDICTED: probable amino acid permease 7 is...    530   1e-179   
ref|XP_010490547.1|  PREDICTED: amino acid permease 8-like isofor...    528   4e-179   
gb|EYU39084.1|  hypothetical protein MIMGU_mgv1a018317mg                528   5e-179   
ref|XP_010943299.1|  PREDICTED: amino acid permease 6                   528   5e-179   
ref|XP_010475860.1|  PREDICTED: amino acid permease 8-like              528   1e-178   
dbj|BAK07020.1|  predicted protein                                      527   1e-178   



>ref|XP_011099674.1| PREDICTED: amino acid permease 2-like [Sesamum indicum]
 ref|XP_011099676.1| PREDICTED: amino acid permease 2-like [Sesamum indicum]
Length=491

 Score =   790 bits (2039),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 400/491 (81%), Positives = 439/491 (89%), Gaps = 6/491 (1%)
 Frame = -3

Query  1730  MGESAAATKNH------RHHLGVSIDAPPLYGFKGLDDDGRPQRTGTVWTASAHIITAVI  1569
             MGES A T +H           VS++ PP +  K +DDDGRPQRTGTVWTASAHIITAVI
Sbjct  1     MGESTATTNHHHHHHHGSQVFDVSVNVPPHFCSKVVDDDGRPQRTGTVWTASAHIITAVI  60

Query  1568  GSGVLSLAWAIGQLGWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRNYTYMDAVR  1389
             GSGVLSLAWAI QLGW+AGP+VM +FS V+YYTSTLLADCYR+GD +FGKRNYTYMDAVR
Sbjct  61    GSGVLSLAWAIAQLGWIAGPTVMFMFSFVIYYTSTLLADCYRSGDSLFGKRNYTYMDAVR  120

Query  1388  SNLGGYQVKICGLIQYFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYM  1209
             SNLGG +VKICG+IQY NLFG+AIGYTIAASISMMAIKRSNCFH SG K+PCHMSSNPYM
Sbjct  121   SNLGGSKVKICGIIQYLNLFGVAIGYTIAASISMMAIKRSNCFHASGEKDPCHMSSNPYM  180

Query  1208  IAFGIIEIILSQIPDFDQIWWLSIVAAVMSFTYSGIGLGLGIAQVVANGAFKGSLTGISI  1029
             IAFGI +I+ SQIPDFDQIWWLSIVAAVMSFTYS IGLGLGIA+V A G FKGSLTGISI
Sbjct  181   IAFGITQILFSQIPDFDQIWWLSIVAAVMSFTYSSIGLGLGIAKVAATGTFKGSLTGISI  240

Query  1028  GTVTETQKIWRSFQALGDIAFAYSYSIILIEIQDTVKSPPSESKTMRKASLFSTIVTTTF  849
             GTVTETQKIWRSFQALGDIAFAYS+SIILIEIQDT+KSPPSE+KTM+KA++ STIVTT F
Sbjct  241   GTVTETQKIWRSFQALGDIAFAYSFSIILIEIQDTIKSPPSEAKTMKKATMISTIVTTAF  300

Query  848   YMLCGCMGYAAFGDDAPGNLLTGFGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAFIE  669
             YMLCGCMGYAAFGD APGNLLTGFGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAF+E
Sbjct  301   YMLCGCMGYAAFGDLAPGNLLTGFGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAFVE  360

Query  668   KWVGAKWPDSEIITKEINLKIPGFGYPYKLNTFRLLWRTAFVLLTTVISMLLPFFNDVVG  489
             K   A+WPDS  ITKEI+++IP    PY LN FRL+WR+ FV+LTTVISMLLPFFND+VG
Sbjct  361   KHAAARWPDSGFITKEISIRIPCLQQPYNLNMFRLVWRSVFVVLTTVISMLLPFFNDIVG  420

Query  488   ILGAFGFWPLTVYFPVRMYISQKKIPKWSTRWICLQMlsgaclavslaaaagsfagvVLD  309
             ILGAFGFWPLTVYFPV MYI+QK+I +WSTRWICLQMLS ACLA+S+AAAAGS AGVVLD
Sbjct  421   ILGAFGFWPLTVYFPVEMYIAQKRIARWSTRWICLQMLSFACLAISIAAAAGSVAGVVLD  480

Query  308   LKLYRPFKTSY  276
             LK+YRPFKTSY
Sbjct  481   LKVYRPFKTSY  491



>ref|XP_010270272.1| PREDICTED: amino acid permease 3 [Nelumbo nucifera]
Length=483

 Score =   779 bits (2011),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 398/487 (82%), Positives = 431/487 (89%), Gaps = 4/487 (1%)
 Frame = -3

Query  1736  MQMGESAAATKNHRHHLGVSIDAPPLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSGV  1557
             M MGE A  T+N+  HL  SID  P  G K  DDDGR +RTGTVWTASAHIITAVIGSGV
Sbjct  1     MTMGEDAV-TRNNNQHL--SIDMLPQGGSKCFDDDGRLKRTGTVWTASAHIITAVIGSGV  57

Query  1556  LSLAWAIGQLGWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRNYTYMDAVRSNLG  1377
             LSLAWAI QLGW+AGP+VM LFS V+YYTS+LL DCYR+GDPV GKRNYTY DAVRSNLG
Sbjct  58    LSLAWAIAQLGWIAGPAVMFLFSFVIYYTSSLLTDCYRSGDPVSGKRNYTYTDAVRSNLG  117

Query  1376  GYQVKICGLIQYFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFG  1197
             G +VKICG+IQY NLFG+AIGYTIAASISMMAIKRSNCFHESGG NPCH+SSNPYMI FG
Sbjct  118   GVKVKICGIIQYLNLFGVAIGYTIAASISMMAIKRSNCFHESGGDNPCHISSNPYMIIFG  177

Query  1196  IIEIILSQIPDFDQIWWLSIVAAVMSFTYSGIGLGLGIAQVVANGAFKGSLTGISIGTVT  1017
             + EI+ SQIPDFDQIWWLSIVAAVMSFTYS IGLGLGIA+V   G+FKGSLTGISIG VT
Sbjct  178   VTEILFSQIPDFDQIWWLSIVAAVMSFTYSSIGLGLGIAKVAETGSFKGSLTGISIGAVT  237

Query  1016  ETQKIWRSFQALGDIAFAYSYSIILIEIQDTVKSPPSESKTMRKASLFSTIVTTTFYMLC  837
             ETQKIWRSFQALGDIAFAYSYSIILIEIQDT+KSPPSE+KTM+KA+L S  VTT FYMLC
Sbjct  238   ETQKIWRSFQALGDIAFAYSYSIILIEIQDTIKSPPSEAKTMKKATLLSVAVTTLFYMLC  297

Query  836   GCMGYAAFGDDAPGNLLTGFGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEKWVG  657
             GCMGYAAFGD APGNLLTGFGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEK   
Sbjct  298   GCMGYAAFGDLAPGNLLTGFGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEKSAS  357

Query  656   AKWPDSEIITKEINLKIPGFGYPYKLNTFRLLWRTAFVLLTTVISMLLPFFNDVVGILGA  477
              +W +S+ ITKEI + IPGF  PYKLN FRL+WR+ FV+ TTVISMLLPFFNDVVGILGA
Sbjct  358   ERWSESKFITKEIKVPIPGF-RPYKLNLFRLVWRSVFVVATTVISMLLPFFNDVVGILGA  416

Query  476   FGFWPLTVYFPVRMYISQKKIPKWSTRWICLQMlsgaclavslaaaagsfagvVLDLKLY  297
             FGFWPLTVYFPV MYI+QKKIPKWSTRW+CLQ+LS ACL VS+AAAAGS AGV LDLK+Y
Sbjct  417   FGFWPLTVYFPVEMYIAQKKIPKWSTRWLCLQILSFACLVVSIAAAAGSIAGVALDLKVY  476

Query  296   RPFKTSY  276
             +PFKTSY
Sbjct  477   KPFKTSY  483



>ref|XP_010652912.1| PREDICTED: amino acid permease 3 isoform X1 [Vitis vinifera]
Length=489

 Score =   778 bits (2010),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 400/491 (81%), Positives = 432/491 (88%), Gaps = 6/491 (1%)
 Frame = -3

Query  1736  MQMGESAAATKNHRHH---LGVSIDAPPLYGF-KGLDDDGRPQRTGTVWTASAHIITAVI  1569
             MQMGE+AA TKNH HH     +SID  P     K  DDDGR +RTGTVWTASAHIITAVI
Sbjct  1     MQMGENAA-TKNHHHHHQVFDISIDVLPHQNTSKCFDDDGRLKRTGTVWTASAHIITAVI  59

Query  1568  GSGVLSLAWAIGQLGWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRNYTYMDAVR  1389
             GSGVLSLAWAI QLGW+AGP+VM LFS V+YYTS+LLADCYR+GD V GKRNYTYMDAVR
Sbjct  60    GSGVLSLAWAIAQLGWIAGPAVMFLFSFVIYYTSSLLADCYRSGDRVSGKRNYTYMDAVR  119

Query  1388  SNLGGYQVKICGLIQYFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYM  1209
             SNLGG +VK+CGLIQY N+FG+AIGYTIAASISMMA+KRSNCFHESG KNPCH+SS PYM
Sbjct  120   SNLGGVKVKVCGLIQYLNIFGVAIGYTIAASISMMAVKRSNCFHESGRKNPCHISSYPYM  179

Query  1208  IAFGIIEIILSQIPDFDQIWWLSIVAAVMSFTYSGIGLGLGIAQVVANGAFKGSLTGISI  1029
             I FGI EI  SQIPDFDQIWWLSIVAAVMSFTYS IGL LG+A+VVA G FKGSLTGISI
Sbjct  180   IMFGIAEIAFSQIPDFDQIWWLSIVAAVMSFTYSSIGLALGVAKVVAAGGFKGSLTGISI  239

Query  1028  GTVTETQKIWRSFQALGDIAFAYSYSIILIEIQDTVKSPPSESKTMRKASLFSTIVTTTF  849
             GTVT+TQKIWRSFQALGDIAFAYSYSIILIEIQDT+KSPPSESKTM+KA+L S  VTT F
Sbjct  240   GTVTQTQKIWRSFQALGDIAFAYSYSIILIEIQDTLKSPPSESKTMKKATLVSIAVTTAF  299

Query  848   YMLCGCMGYAAFGDDAPGNLLTGFGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAFIE  669
             YMLCGCMGYAAFGD APGNLLTGFGFYNP+WLLDIAN AIV+HLVGAYQVYCQPLFAF E
Sbjct  300   YMLCGCMGYAAFGDLAPGNLLTGFGFYNPYWLLDIANVAIVVHLVGAYQVYCQPLFAFTE  359

Query  668   KWVGAKWPDSEIITKEINLKIPGFGYPYKLNTFRLLWRTAFVLLTTVISMLLPFFNDVVG  489
             KW   KWP S+ ITKEI + IPG   P+ LN FRL+WR+AFV++TTVISMLLPFFNDVVG
Sbjct  360   KWAAQKWPHSDFITKEIKIPIPGCS-PFSLNLFRLVWRSAFVVVTTVISMLLPFFNDVVG  418

Query  488   ILGAFGFWPLTVYFPVRMYISQKKIPKWSTRWICLQMlsgaclavslaaaagsfagvVLD  309
             ILGAFGFWPLTVYFPV MYI QKKIPKWSTRWICLQMLS ACL +S+AAAAGS AGVVLD
Sbjct  419   ILGAFGFWPLTVYFPVEMYIVQKKIPKWSTRWICLQMLSVACLIISIAAAAGSIAGVVLD  478

Query  308   LKLYRPFKTSY  276
             LK+Y PFKTSY
Sbjct  479   LKVYHPFKTSY  489



>ref|XP_011022870.1| PREDICTED: amino acid permease 4-like [Populus euphratica]
Length=493

 Score =   776 bits (2004),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 393/494 (80%), Positives = 428/494 (87%), Gaps = 8/494 (2%)
 Frame = -3

Query  1736  MQMGESAAATKNHRHHL-------GVSIDAPPLYGFKGLDDDGRPQRTGTVWTASAHIIT  1578
             MQMGE+AA+   H +HL        +SID  P  G K  D+DGR +RTGT+WTASAHIIT
Sbjct  1     MQMGENAASKNCHNNHLHSHHQVFDISIDVLPQNGSKCFDEDGRLKRTGTLWTASAHIIT  60

Query  1577  AVIGSGVLSLAWAIGQLGWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRNYTYMD  1398
             AVIGSGVLSLAWA+ QLGWVAGP+VM LFS V YYTS+LL DCYR GDP  GKRNYTYMD
Sbjct  61    AVIGSGVLSLAWAVAQLGWVAGPAVMFLFSLVTYYTSSLLTDCYRTGDPDTGKRNYTYMD  120

Query  1397  AVRSNLGGYQVKICGLIQYFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSN  1218
             AVRS LGG +VK+CG IQY  LFGIAIGYTIA+SISMMAIKRSNCFH+SGG+NPCH+SSN
Sbjct  121   AVRSILGGVKVKLCGFIQYLGLFGIAIGYTIASSISMMAIKRSNCFHQSGGQNPCHLSSN  180

Query  1217  PYMIAFGIIEIILSQIPDFDQIWWLSIVAAVMSFTYSGIGLGLGIAQVVANGAFKGSLTG  1038
             PYMI FGI EI+LSQIPDFDQ+WWLSIVAAVMSFTYS IGLGLGI +V  NG FKGSLTG
Sbjct  181   PYMIMFGITEILLSQIPDFDQLWWLSIVAAVMSFTYSSIGLGLGIGKVAVNGTFKGSLTG  240

Query  1037  ISIGTVTETQKIWRSFQALGDIAFAYSYSIILIEIQDTVKSPPSESKTMRKASLFSTIVT  858
             ISIGTVTET+KIWRSFQALG IAFAYSYS+ILIEIQDTVKSPP+ESKTM+KA+  S +VT
Sbjct  241   ISIGTVTETEKIWRSFQALGAIAFAYSYSVILIEIQDTVKSPPAESKTMKKAARISIVVT  300

Query  857   TTFYMLCGCMGYAAFGDDAPGNLLTGFGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFA  678
             TTFYMLCGCMGYAAFGD APGNLLTGFGFYNP+WL+DIANAAIVIHLVGAYQV+CQPLFA
Sbjct  301   TTFYMLCGCMGYAAFGDLAPGNLLTGFGFYNPYWLIDIANAAIVIHLVGAYQVFCQPLFA  360

Query  677   FIEKWVGAKWPDSEIITKEINLKIPGFGYPYKLNTFRLLWRTAFVLLTTVISMLLPFFND  498
             FIEKW   KWP S  ITKE N+ +PG+G  YKLN FRL+WRT FV+LTTVISMLLPFFND
Sbjct  361   FIEKWANQKWPGSYFITKEFNIAVPGYGL-YKLNLFRLVWRTIFVILTTVISMLLPFFND  419

Query  497   VVGILGAFGFWPLTVYFPVRMYISQKKIPKWSTRWICLQMlsgaclavslaaaagsfagv  318
             VVGILGA GFWPLTVYFPV MYI QKKIPKWSTRWICLQMLS ACL +SL A AGS AGV
Sbjct  420   VVGILGALGFWPLTVYFPVEMYIVQKKIPKWSTRWICLQMLSMACLVISLVAVAGSVAGV  479

Query  317   VLDLKLYRPFKTSY  276
             VLDLK Y+PFKTSY
Sbjct  480   VLDLKAYKPFKTSY  493



>ref|XP_002275881.1| PREDICTED: amino acid permease 3 isoform X2 [Vitis vinifera]
 ref|XP_010652913.1| PREDICTED: amino acid permease 3 isoform X2 [Vitis vinifera]
Length=487

 Score =   774 bits (1998),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 398/489 (81%), Positives = 430/489 (88%), Gaps = 6/489 (1%)
 Frame = -3

Query  1730  MGESAAATKNHRHH---LGVSIDAPPLYGF-KGLDDDGRPQRTGTVWTASAHIITAVIGS  1563
             MGE+AA TKNH HH     +SID  P     K  DDDGR +RTGTVWTASAHIITAVIGS
Sbjct  1     MGENAA-TKNHHHHHQVFDISIDVLPHQNTSKCFDDDGRLKRTGTVWTASAHIITAVIGS  59

Query  1562  GVLSLAWAIGQLGWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRNYTYMDAVRSN  1383
             GVLSLAWAI QLGW+AGP+VM LFS V+YYTS+LLADCYR+GD V GKRNYTYMDAVRSN
Sbjct  60    GVLSLAWAIAQLGWIAGPAVMFLFSFVIYYTSSLLADCYRSGDRVSGKRNYTYMDAVRSN  119

Query  1382  LGGYQVKICGLIQYFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIA  1203
             LGG +VK+CGLIQY N+FG+AIGYTIAASISMMA+KRSNCFHESG KNPCH+SS PYMI 
Sbjct  120   LGGVKVKVCGLIQYLNIFGVAIGYTIAASISMMAVKRSNCFHESGRKNPCHISSYPYMIM  179

Query  1202  FGIIEIILSQIPDFDQIWWLSIVAAVMSFTYSGIGLGLGIAQVVANGAFKGSLTGISIGT  1023
             FGI EI  SQIPDFDQIWWLSIVAAVMSFTYS IGL LG+A+VVA G FKGSLTGISIGT
Sbjct  180   FGIAEIAFSQIPDFDQIWWLSIVAAVMSFTYSSIGLALGVAKVVAAGGFKGSLTGISIGT  239

Query  1022  VTETQKIWRSFQALGDIAFAYSYSIILIEIQDTVKSPPSESKTMRKASLFSTIVTTTFYM  843
             VT+TQKIWRSFQALGDIAFAYSYSIILIEIQDT+KSPPSESKTM+KA+L S  VTT FYM
Sbjct  240   VTQTQKIWRSFQALGDIAFAYSYSIILIEIQDTLKSPPSESKTMKKATLVSIAVTTAFYM  299

Query  842   LCGCMGYAAFGDDAPGNLLTGFGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEKW  663
             LCGCMGYAAFGD APGNLLTGFGFYNP+WLLDIAN AIV+HLVGAYQVYCQPLFAF EKW
Sbjct  300   LCGCMGYAAFGDLAPGNLLTGFGFYNPYWLLDIANVAIVVHLVGAYQVYCQPLFAFTEKW  359

Query  662   VGAKWPDSEIITKEINLKIPGFGYPYKLNTFRLLWRTAFVLLTTVISMLLPFFNDVVGIL  483
                KWP S+ ITKEI + IPG   P+ LN FRL+WR+AFV++TTVISMLLPFFNDVVGIL
Sbjct  360   AAQKWPHSDFITKEIKIPIPGCS-PFSLNLFRLVWRSAFVVVTTVISMLLPFFNDVVGIL  418

Query  482   GAFGFWPLTVYFPVRMYISQKKIPKWSTRWICLQMlsgaclavslaaaagsfagvVLDLK  303
             GAFGFWPLTVYFPV MYI QKKIPKWSTRWICLQMLS ACL +S+AAAAGS AGVVLDLK
Sbjct  419   GAFGFWPLTVYFPVEMYIVQKKIPKWSTRWICLQMLSVACLIISIAAAAGSIAGVVLDLK  478

Query  302   LYRPFKTSY  276
             +Y PFKTSY
Sbjct  479   VYHPFKTSY  487



>ref|XP_006464914.1| PREDICTED: amino acid permease 2-like [Citrus sinensis]
Length=485

 Score =   769 bits (1986),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 388/487 (80%), Positives = 420/487 (86%), Gaps = 2/487 (0%)
 Frame = -3

Query  1736  MQMGESAAATKNHRHHLGVSIDAPPLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSGV  1557
             MQMG++ AAT NH     VSID P   G K  DDDGR  RTGTVWTASAHIITAVIGSGV
Sbjct  1     MQMGDNIAAT-NHHQVFDVSIDVPSQNGSKCFDDDGRLNRTGTVWTASAHIITAVIGSGV  59

Query  1556  LSLAWAIGQLGWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRNYTYMDAVRSNLG  1377
             LSLAWAI QLGWVAGP+VM LFS + YYTS+LL DCYR  DPV GKRNYTYMDAVRS LG
Sbjct  60    LSLAWAIAQLGWVAGPAVMFLFSFLTYYTSSLLTDCYRTADPVSGKRNYTYMDAVRSILG  119

Query  1376  GYQVKICGLIQYFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFG  1197
             G +VK CGLIQY NLFGIAIGYTIAASISMMAIKRSNCFHESGG NPCHMSSNPYMI FG
Sbjct  120   GAKVKACGLIQYLNLFGIAIGYTIAASISMMAIKRSNCFHESGGNNPCHMSSNPYMILFG  179

Query  1196  IIEIILSQIPDFDQIWWLSIVAAVMSFTYSGIGLGLGIAQVVANGAFKGSLTGISIGTVT  1017
             ++EI LSQIPDFDQIWWLSIVAAVMSFTYS IGL LGI QV ANGAFKGSLTGISIGTVT
Sbjct  180   VMEIFLSQIPDFDQIWWLSIVAAVMSFTYSAIGLALGIVQVAANGAFKGSLTGISIGTVT  239

Query  1016  ETQKIWRSFQALGDIAFAYSYSIILIEIQDTVKSPPSESKTMRKASLFSTIVTTTFYMLC  837
             +TQKIWRSFQALGDIAFAYSYS+ILIEIQDT+KSPP+ESKTM+KA+  S  VTT FYMLC
Sbjct  240   QTQKIWRSFQALGDIAFAYSYSVILIEIQDTLKSPPAESKTMKKAAKLSIAVTTAFYMLC  299

Query  836   GCMGYAAFGDDAPGNLLTGFGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEKWVG  657
             GCMGYAAFGD APGNLLTGFGFYNPFWLLDIAN+AIV+HLVGAYQV+CQP+FAF+EK V 
Sbjct  300   GCMGYAAFGDFAPGNLLTGFGFYNPFWLLDIANSAIVVHLVGAYQVFCQPIFAFVEKQVA  359

Query  656   AKWPDSEIITKEINLKIPGFGYPYKLNTFRLLWRTAFVLLTTVISMLLPFFNDVVGILGA  477
               WPDS  ++KE  + +PG   PYKLN FRL+WR+ FV+LTTVISMLLPFFNDVVGILGA
Sbjct  360   ESWPDSYFLSKEFKIPVPGL-LPYKLNLFRLVWRSCFVILTTVISMLLPFFNDVVGILGA  418

Query  476   FGFWPLTVYFPVRMYISQKKIPKWSTRWICLQMlsgaclavslaaaagsfagvVLDLKLY  297
              GFWPLTVYFPV MYI+QKKI KWSTRW+CLQMLS ACL +S+ A AGS  GVV D+K Y
Sbjct  419   LGFWPLTVYFPVEMYIAQKKITKWSTRWMCLQMLSMACLVLSIIAGAGSIVGVVNDVKAY  478

Query  296   RPFKTSY  276
              PFKT+Y
Sbjct  479   TPFKTTY  485



>ref|XP_006432100.1| hypothetical protein CICLE_v10000986mg [Citrus clementina]
 gb|ESR45340.1| hypothetical protein CICLE_v10000986mg [Citrus clementina]
Length=483

 Score =   764 bits (1972),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 386/485 (80%), Positives = 418/485 (86%), Gaps = 2/485 (0%)
 Frame = -3

Query  1730  MGESAAATKNHRHHLGVSIDAPPLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSGVLS  1551
             MG++ AAT NH     VSID P   G K  DDDGR  RTGTVWTASAHIITAVIGSGVLS
Sbjct  1     MGDNIAAT-NHHQVFDVSIDVPSQNGSKCFDDDGRLNRTGTVWTASAHIITAVIGSGVLS  59

Query  1550  LAWAIGQLGWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRNYTYMDAVRSNLGGY  1371
             LAWAI QLGWVAGP+VM LFS + YYTS+LL DCYR  DPV GKRNYTYMDAVRS LGG 
Sbjct  60    LAWAIAQLGWVAGPAVMFLFSFLTYYTSSLLTDCYRTADPVSGKRNYTYMDAVRSILGGA  119

Query  1370  QVKICGLIQYFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFGII  1191
             +VK CGLIQY NLFGIAIGYTIAASISMMAIKRSNCFHESGG NPCHMSSNPYMI FG++
Sbjct  120   KVKACGLIQYLNLFGIAIGYTIAASISMMAIKRSNCFHESGGNNPCHMSSNPYMILFGVM  179

Query  1190  EIILSQIPDFDQIWWLSIVAAVMSFTYSGIGLGLGIAQVVANGAFKGSLTGISIGTVTET  1011
             EI LSQIPDFDQIWWLSIVAAVMSFTYS IGL LGI QV ANGAFKGSLTGISIGTVT+T
Sbjct  180   EIFLSQIPDFDQIWWLSIVAAVMSFTYSAIGLALGIVQVAANGAFKGSLTGISIGTVTQT  239

Query  1010  QKIWRSFQALGDIAFAYSYSIILIEIQDTVKSPPSESKTMRKASLFSTIVTTTFYMLCGC  831
             QKIWRSFQALGDIAFAYSYS+ILIEIQDT+KSPP+ESKTM+KA+  S  VTT FYMLCGC
Sbjct  240   QKIWRSFQALGDIAFAYSYSVILIEIQDTLKSPPAESKTMKKAAKLSIAVTTAFYMLCGC  299

Query  830   MGYAAFGDDAPGNLLTGFGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEKWVGAK  651
             MGYAAFGD APGNLLTGFGFYNPFWLLDIAN+AIV+HLVGAYQV+CQP+FAF+EK V   
Sbjct  300   MGYAAFGDFAPGNLLTGFGFYNPFWLLDIANSAIVVHLVGAYQVFCQPIFAFVEKQVAES  359

Query  650   WPDSEIITKEINLKIPGFGYPYKLNTFRLLWRTAFVLLTTVISMLLPFFNDVVGILGAFG  471
             WPDS  ++KE  + +PG   PYKLN FRL+WR+ FV+LTTVISMLLPFFNDVVGILGA G
Sbjct  360   WPDSYFLSKEFKIPVPGL-LPYKLNLFRLVWRSCFVILTTVISMLLPFFNDVVGILGALG  418

Query  470   FWPLTVYFPVRMYISQKKIPKWSTRWICLQMlsgaclavslaaaagsfagvVLDLKLYRP  291
             FWPLTVYFPV MYI+QKKI KWSTRW+CLQMLS ACL +S+ A AGS  GVV D+K Y P
Sbjct  419   FWPLTVYFPVEMYIAQKKITKWSTRWMCLQMLSMACLVLSIIAGAGSIVGVVNDVKAYTP  478

Query  290   FKTSY  276
             FKT+Y
Sbjct  479   FKTTY  483



>ref|XP_010674405.1| PREDICTED: amino acid permease 4 [Beta vulgaris subsp. vulgaris]
Length=485

 Score =   762 bits (1968),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 390/487 (80%), Positives = 427/487 (88%), Gaps = 2/487 (0%)
 Frame = -3

Query  1736  MQMGESAAATKNHRHHLGVSIDAPPLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSGV  1557
             M MG+ AA   NH H   VS D       K  DDDGR +RTGTVWTASAHIITAVIGSGV
Sbjct  1     MTMGDGAAKINNH-HVFDVSFDVLGQNPSKCFDDDGRLKRTGTVWTASAHIITAVIGSGV  59

Query  1556  LSLAWAIGQLGWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRNYTYMDAVRSNLG  1377
             LSLAWAI QLGW+AGP+VM LFS V+YYTSTLLADCYR+GDP  GKRNYTYMDAVRSNLG
Sbjct  60    LSLAWAIAQLGWIAGPAVMFLFSFVIYYTSTLLADCYRSGDPDSGKRNYTYMDAVRSNLG  119

Query  1376  GYQVKICGLIQYFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFG  1197
             G +VK CG+IQY NLFG+AIGYTIAASISMMAIKRSNCFH+SGGKNPCHMSSNPYMIAFG
Sbjct  120   GGKVKFCGMIQYLNLFGVAIGYTIAASISMMAIKRSNCFHDSGGKNPCHMSSNPYMIAFG  179

Query  1196  IIEIILSQIPDFDQIWWLSIVAAVMSFTYSGIGLGLGIAQVVANGAFKGSLTGISIGTVT  1017
             I EI+ SQIPDFDQIWWLSIVAAVMSFTYS IGL LGI QV AN  FKGS TGISIG+VT
Sbjct  180   IAEILFSQIPDFDQIWWLSIVAAVMSFTYSAIGLALGIVQVAANKTFKGSFTGISIGSVT  239

Query  1016  ETQKIWRSFQALGDIAFAYSYSIILIEIQDTVKSPPSESKTMRKASLFSTIVTTTFYMLC  837
             ETQKIWRSFQALGDIAFAYS+SIILIEIQDTV+SPP+ESKTM+KAS  S  VTT FYMLC
Sbjct  240   ETQKIWRSFQALGDIAFAYSFSIILIEIQDTVRSPPAESKTMKKASFISIAVTTVFYMLC  299

Query  836   GCMGYAAFGDDAPGNLLTGFGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEKWVG  657
             GCMGYAAFGD APGNLLTGFGFYNP+WLLDIAN AIVIHLVGAYQVYCQPLFAF+EKW  
Sbjct  300   GCMGYAAFGDLAPGNLLTGFGFYNPYWLLDIANVAIVIHLVGAYQVYCQPLFAFVEKWAA  359

Query  656   AKWPDSEIITKEINLKIPGFGYPYKLNTFRLLWRTAFVLLTTVISMLLPFFNDVVGILGA  477
              KWPDS+ IT+E+ ++IPG G PY LN+FRL+WRT FV+ TT+ISMLLPFFND+VG+LGA
Sbjct  360   QKWPDSDFITREMKIRIPGIG-PYNLNSFRLVWRTTFVITTTIISMLLPFFNDIVGLLGA  418

Query  476   FGFWPLTVYFPVRMYISQKKIPKWSTRWICLQMlsgaclavslaaaagsfagvVLDLKLY  297
              GFWPLTVYFP+ MYI+QKK+PKWST+W+CLQMLS ACL +S+AAAAGS AGV LDLK+Y
Sbjct  419   LGFWPLTVYFPIEMYIAQKKVPKWSTKWLCLQMLSMACLVISIAAAAGSIAGVALDLKVY  478

Query  296   RPFKTSY  276
             RPFKTSY
Sbjct  479   RPFKTSY  485



>ref|XP_002307053.2| hypothetical protein POPTR_0005s06990g [Populus trichocarpa]
 gb|EEE94049.2| hypothetical protein POPTR_0005s06990g [Populus trichocarpa]
Length=494

 Score =   762 bits (1968),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 386/495 (78%), Positives = 426/495 (86%), Gaps = 9/495 (2%)
 Frame = -3

Query  1736  MQMGESAAATKNHR--------HHLGVSIDAPPLYGFKGLDDDGRPQRTGTVWTASAHII  1581
             MQMGE+AA+   H             VS+D  P  G K  DDDGR +RTGT+WTAS+HII
Sbjct  1     MQMGENAASKNYHNNHHLHNHHQVFDVSVDVLPQNGSKCFDDDGRLKRTGTLWTASSHII  60

Query  1580  TAVIGSGVLSLAWAIGQLGWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRNYTYM  1401
             TAVIGSGVLSLAWAI QLGW+AGP+VM LFS V YYTS+LL DCYR GDP  GKRNYTYM
Sbjct  61    TAVIGSGVLSLAWAIAQLGWIAGPAVMFLFSLVTYYTSSLLTDCYRTGDPDTGKRNYTYM  120

Query  1400  DAVRSNLGGYQVKICGLIQYFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSS  1221
             DAV+S LGG +V +CGL+QY  LFGIAIGYTIA+SISMMAIKRSNCFH+SGG+NPCH+SS
Sbjct  121   DAVQSILGGVKVNLCGLVQYIGLFGIAIGYTIASSISMMAIKRSNCFHQSGGQNPCHISS  180

Query  1220  NPYMIAFGIIEIILSQIPDFDQIWWLSIVAAVMSFTYSGIGLGLGIAQVVANGAFKGSLT  1041
             NPYMI FGI EI+LSQIPDFDQ+WWLSIVAAVMSFTYS IGLGLGI +V ANG FKGSLT
Sbjct  181   NPYMIIFGITEILLSQIPDFDQLWWLSIVAAVMSFTYSTIGLGLGIGKVAANGTFKGSLT  240

Query  1040  GISIGTVTETQKIWRSFQALGDIAFAYSYSIILIEIQDTVKSPPSESKTMRKASLFSTIV  861
             GISIGTVTET+KIWRSFQALG IAFAYSYS+ILIEIQDT+KSPP+ESKTM+KA+  S +V
Sbjct  241   GISIGTVTETEKIWRSFQALGAIAFAYSYSVILIEIQDTIKSPPAESKTMKKAAKISIVV  300

Query  860   TTTFYMLCGCMGYAAFGDDAPGNLLTGFGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLF  681
             TTTFYMLCGCMGYAAFGD APGNLLTGFGFYNP+WL+DIAN AIVIHL+GAYQV+CQPLF
Sbjct  301   TTTFYMLCGCMGYAAFGDQAPGNLLTGFGFYNPYWLIDIANVAIVIHLIGAYQVFCQPLF  360

Query  680   AFIEKWVGAKWPDSEIITKEINLKIPGFGYPYKLNTFRLLWRTAFVLLTTVISMLLPFFN  501
             AFIEKW   KWP++  ITKE  + +PGF  PYKLN FR++WRT FVLLTTVISMLLPFFN
Sbjct  361   AFIEKWANQKWPENYFITKEFKIPVPGF-RPYKLNLFRMVWRTIFVLLTTVISMLLPFFN  419

Query  500   DVVGILGAFGFWPLTVYFPVRMYISQKKIPKWSTRWICLQMlsgaclavslaaaagsfag  321
             DVVGILGA GFWPLTVYFPV MYI QKKIPKWSTRWICLQMLS ACL +SL A AGS AG
Sbjct  420   DVVGILGALGFWPLTVYFPVEMYIVQKKIPKWSTRWICLQMLSMACLVISLVAVAGSIAG  479

Query  320   vVLDLKLYRPFKTSY  276
             VVLDLK+Y+PFKTSY
Sbjct  480   VVLDLKVYKPFKTSY  494



>ref|XP_007048506.1| Amino acid permease 2 isoform 1 [Theobroma cacao]
 ref|XP_007048507.1| Amino acid permease 2 isoform 1 [Theobroma cacao]
 gb|EOX92663.1| Amino acid permease 2 isoform 1 [Theobroma cacao]
 gb|EOX92664.1| Amino acid permease 2 isoform 1 [Theobroma cacao]
Length=485

 Score =   761 bits (1966),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 380/487 (78%), Positives = 427/487 (88%), Gaps = 4/487 (1%)
 Frame = -3

Query  1730  MGESAAATKNHRHH--LGVSIDAPPLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSGV  1557
             MGE+AA TKNH +H    VS+  P   G +  DDDGR +RTGT+WTASAHIITAVIGSGV
Sbjct  1     MGENAA-TKNHDNHQVFDVSLGIPSKGGSECFDDDGRIKRTGTLWTASAHIITAVIGSGV  59

Query  1556  LSLAWAIGQLGWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRNYTYMDAVRSNLG  1377
             LSLAWAI QLGW+AGP+VM LFS V  YTS+LL DCYR GDPV GKRNYTYMDAVRS LG
Sbjct  60    LSLAWAIAQLGWIAGPAVMFLFSLVTCYTSSLLTDCYRTGDPVSGKRNYTYMDAVRSILG  119

Query  1376  GYQVKICGLIQYFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFG  1197
             GY+VK CGLIQY NL GI++GYTIAAS+SMMAIKRSNCFHESGGKNPCHMSS PYMI FG
Sbjct  120   GYKVKACGLIQYLNLCGISVGYTIAASVSMMAIKRSNCFHESGGKNPCHMSSTPYMIMFG  179

Query  1196  IIEIILSQIPDFDQIWWLSIVAAVMSFTYSGIGLGLGIAQVVANGAFKGSLTGISIGTVT  1017
             + EI+LSQIPDFDQIWWLSIVAAVMSFTYSGIGLGLGIA+V A G FKGSLTGIS+GT T
Sbjct  180   VTEILLSQIPDFDQIWWLSIVAAVMSFTYSGIGLGLGIAKVAATGTFKGSLTGISVGTET  239

Query  1016  ETQKIWRSFQALGDIAFAYSYSIILIEIQDTVKSPPSESKTMRKASLFSTIVTTTFYMLC  837
             + QKIWRSFQALGDIAFAYSYSI+LIEIQDTVKSPP+E+KTM+KA+  S  +TT FYMLC
Sbjct  240   QAQKIWRSFQALGDIAFAYSYSIVLIEIQDTVKSPPAEAKTMKKATKLSIAITTAFYMLC  299

Query  836   GCMGYAAFGDDAPGNLLTGFGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEKWVG  657
             GCMGYA+FGD APGNLLTGFGFYNPFWLLD+ANAAIVIHLVGAYQV+CQP+FAFIEKW  
Sbjct  300   GCMGYASFGDFAPGNLLTGFGFYNPFWLLDVANAAIVIHLVGAYQVFCQPIFAFIEKWAT  359

Query  656   AKWPDSEIITKEINLKIPGFGYPYKLNTFRLLWRTAFVLLTTVISMLLPFFNDVVGILGA  477
              +W +S  ITKE  + IPG+ +PYKLN FRL+WRTAFV+LTTVISML+PFFNDV+GI+GA
Sbjct  360   QRWAESNFITKEFKIPIPGY-HPYKLNLFRLVWRTAFVILTTVISMLIPFFNDVMGIMGA  418

Query  476   FGFWPLTVYFPVRMYISQKKIPKWSTRWICLQMlsgaclavslaaaagsfagvVLDLKLY  297
             FGFWPLTVYFP+ MYI QKKI KWSTRWICL+MLS ACL +++ A AGS AGV+LDLK+Y
Sbjct  419   FGFWPLTVYFPLEMYIQQKKILKWSTRWICLKMLSMACLLITIVAGAGSIAGVMLDLKVY  478

Query  296   RPFKTSY  276
             +PFKT+Y
Sbjct  479   KPFKTTY  485



>ref|XP_006380397.1| hypothetical protein POPTR_0007s04710g [Populus trichocarpa]
 gb|ERP58194.1| hypothetical protein POPTR_0007s04710g [Populus trichocarpa]
Length=492

 Score =   761 bits (1964),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 388/493 (79%), Positives = 422/493 (86%), Gaps = 9/493 (2%)
 Frame = -3

Query  1730  MGESAAATKNHR--------HHLGVSIDAPPLYGFKGLDDDGRPQRTGTVWTASAHIITA  1575
             MGE+AA+   H             +SID  P  G K  DDDGR +RTGT+WTASAHIITA
Sbjct  1     MGENAASKNCHNNHHLHNHHQVFDISIDVLPQNGSKCFDDDGRLKRTGTLWTASAHIITA  60

Query  1574  VIGSGVLSLAWAIGQLGWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRNYTYMDA  1395
             VIGSGVLSLAWA+ QLGWVAGP+VM LFS V YYTS+LL DCYR GDP  GKRNYTYMDA
Sbjct  61    VIGSGVLSLAWAVAQLGWVAGPAVMFLFSLVTYYTSSLLTDCYRTGDPDTGKRNYTYMDA  120

Query  1394  VRSNLGGYQVKICGLIQYFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNP  1215
             V S LGG +VK+CG IQY  LFGIAIGYTIA+SISMMAIKRSNCFH+SGG+NPCH+SSNP
Sbjct  121   VESILGGVKVKLCGFIQYLGLFGIAIGYTIASSISMMAIKRSNCFHQSGGQNPCHLSSNP  180

Query  1214  YMIAFGIIEIILSQIPDFDQIWWLSIVAAVMSFTYSGIGLGLGIAQVVANGAFKGSLTGI  1035
             YMI FGI EI+LSQIPDFDQ+WWLSIVAAVMSFTYS IGLGLGI +V  NG FKGSLTGI
Sbjct  181   YMIMFGITEILLSQIPDFDQLWWLSIVAAVMSFTYSSIGLGLGIGKVAVNGTFKGSLTGI  240

Query  1034  SIGTVTETQKIWRSFQALGDIAFAYSYSIILIEIQDTVKSPPSESKTMRKASLFSTIVTT  855
             SIGTVTET+KIWRSFQALG IAFAYSYS+ILIEIQDTVKSPP+ESKTM+KA+  S +VTT
Sbjct  241   SIGTVTETEKIWRSFQALGAIAFAYSYSVILIEIQDTVKSPPAESKTMKKAARISIVVTT  300

Query  854   TFYMLCGCMGYAAFGDDAPGNLLTGFGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAF  675
             TFYMLCGCMGYAAFGD APGNLLTGFGFYNP+WL+DIANAAIVIHLVGAYQV+CQPLFAF
Sbjct  301   TFYMLCGCMGYAAFGDLAPGNLLTGFGFYNPYWLIDIANAAIVIHLVGAYQVFCQPLFAF  360

Query  674   IEKWVGAKWPDSEIITKEINLKIPGFGYPYKLNTFRLLWRTAFVLLTTVISMLLPFFNDV  495
             IEKW   KWP+S  ITKE N+ +PG G  YKLN FRL+WRT FV+LTTVISMLLPFFNDV
Sbjct  361   IEKWANQKWPESYFITKEFNIAVPGLGL-YKLNLFRLVWRTIFVILTTVISMLLPFFNDV  419

Query  494   VGILGAFGFWPLTVYFPVRMYISQKKIPKWSTRWICLQMlsgaclavslaaaagsfagvV  315
             VGILGA GFWPLTVYFPV MYI Q+KIPKWSTRWICLQMLS ACL +SL A AGS AGVV
Sbjct  420   VGILGALGFWPLTVYFPVEMYIVQRKIPKWSTRWICLQMLSMACLVISLVAVAGSLAGVV  479

Query  314   LDLKLYRPFKTSY  276
             LDLK Y+PFKTSY
Sbjct  480   LDLKAYKPFKTSY  492



>ref|XP_003634405.1| PREDICTED: amino acid permease 3 [Vitis vinifera]
Length=483

 Score =   758 bits (1958),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 384/483 (80%), Positives = 424/483 (88%), Gaps = 1/483 (0%)
 Frame = -3

Query  1724  ESAAATKNHRHHLGVSIDAPPLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSGVLSLA  1545
             + ++A K+ + H    ID  P    K  DDDGR +RTGT WTASAHIITAVIGSGVLSLA
Sbjct  2     KMSSAPKDLQPHQVFDIDGVPQGASKCFDDDGRLKRTGTFWTASAHIITAVIGSGVLSLA  61

Query  1544  WAIGQLGWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRNYTYMDAVRSNLGGYQV  1365
             WA  QLGW+AGP+V+ LFS V YYTS LL+ CYR GD V GKRNYTYMDAVRSNLGG ++
Sbjct  62    WATAQLGWIAGPAVLFLFSFVTYYTSVLLSSCYRTGDSVTGKRNYTYMDAVRSNLGGAKM  121

Query  1364  KICGLIQYFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFGIIEI  1185
             KICGLIQY NLFG+AIGYTIAASISMMAIKRSNCFHES  KNPCH+SSNPYMI FGI EI
Sbjct  122   KICGLIQYLNLFGVAIGYTIAASISMMAIKRSNCFHESHDKNPCHISSNPYMIMFGIFEI  181

Query  1184  ILSQIPDFDQIWWLSIVAAVMSFTYSGIGLGLGIAQVVANGAFKGSLTGISIGTVTETQK  1005
             ILSQIPDFDQIWWLSIVAA+MSF YS IGLGLG+A+V  +G F+GSLTGISIGTVT+TQK
Sbjct  182   ILSQIPDFDQIWWLSIVAAIMSFAYSTIGLGLGVAKVAESGKFRGSLTGISIGTVTQTQK  241

Query  1004  IWRSFQALGDIAFAYSYSIILIEIQDTVKSPPSESKTMRKASLFSTIVTTTFYMLCGCMG  825
             IWRSFQALG+IAFAYSYSIILIEIQDT+KSPPSE KTM+KA+L S IVTT FYMLCGCMG
Sbjct  242   IWRSFQALGNIAFAYSYSIILIEIQDTIKSPPSEKKTMKKATLLSVIVTTLFYMLCGCMG  301

Query  824   YAAFGDDAPGNLLTGFGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEKWVGAKWP  645
             YAAFGD APGNLLTGFGFYNP+WLLDIANAAIVIHLVGAYQVYCQPLFAFIEKW   K+P
Sbjct  302   YAAFGDLAPGNLLTGFGFYNPYWLLDIANAAIVIHLVGAYQVYCQPLFAFIEKWAAEKFP  361

Query  644   DSEIITKEINLKIPGFGYPYKLNTFRLLWRTAFVLLTTVISMLLPFFNDVVGILGAFGFW  465
             DS+ ITKEI + IPGF  PY LN FRL+WRT FV++TTVISML+PFFNDVVGILGAFGFW
Sbjct  362   DSQFITKEIKIPIPGFK-PYNLNLFRLVWRTIFVIITTVISMLMPFFNDVVGILGAFGFW  420

Query  464   PLTVYFPVRMYISQKKIPKWSTRWICLQMlsgaclavslaaaagsfagvVLDLKLYRPFK  285
             PLTVYFPV MYI+QKKIPKWSTRW+CLQ+LS ACL +S+AAAAGS AGV+LDLK+Y+PFK
Sbjct  421   PLTVYFPVEMYIAQKKIPKWSTRWLCLQILSFACLIISIAAAAGSVAGVILDLKVYKPFK  480

Query  284   TSY  276
             TSY
Sbjct  481   TSY  483



>ref|XP_010025744.1| PREDICTED: amino acid permease 4-like [Eucalyptus grandis]
 ref|XP_010025745.1| PREDICTED: amino acid permease 4-like [Eucalyptus grandis]
 gb|KCW62473.1| hypothetical protein EUGRSUZ_H05115 [Eucalyptus grandis]
 gb|KCW62474.1| hypothetical protein EUGRSUZ_H05115 [Eucalyptus grandis]
Length=494

 Score =   758 bits (1958),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 389/495 (79%), Positives = 424/495 (86%), Gaps = 11/495 (2%)
 Frame = -3

Query  1730  MGESAAATKNHRHHL-------GVSIDAPPLYG---FKGLDDDGRPQRTGTVWTASAHII  1581
             MGESAA   N  HH         +SI+  P      F   DDDGR +RTGT+WTASAHII
Sbjct  1     MGESAATKNNQNHHHHHHHQVRDMSIEMLPQSASNCFDSFDDDGRLKRTGTLWTASAHII  60

Query  1580  TAVIGSGVLSLAWAIGQLGWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRNYTYM  1401
             TAVIGSGVLSLAWAI QLGW+AGP+VM LFS V YYTS LL+DCYRAGDPV GKRNYTYM
Sbjct  61    TAVIGSGVLSLAWAIAQLGWIAGPAVMFLFSFVSYYTSCLLSDCYRAGDPVSGKRNYTYM  120

Query  1400  DAVRSNLGGYQVKICGLIQYFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSS  1221
             D+VRS LGG +VK CG IQYFNLFGIAIGYTIAASISMMAIKRSNCFHES G+NPCHMSS
Sbjct  121   DSVRSILGGAKVKACGFIQYFNLFGIAIGYTIAASISMMAIKRSNCFHESNGENPCHMSS  180

Query  1220  NPYMIAFGIIEIILSQIPDFDQIWWLSIVAAVMSFTYSGIGLGLGIAQVVANGAFKGSLT  1041
              PYMI FGI EI+LSQIPDFDQIWWLSIVAAVMSFTYS IGL LGIAQV ANG+FKGSLT
Sbjct  181   TPYMIMFGITEILLSQIPDFDQIWWLSIVAAVMSFTYSSIGLALGIAQVAANGSFKGSLT  240

Query  1040  GISIGTVTETQKIWRSFQALGDIAFAYSYSIILIEIQDTVKSPPSESKTMRKASLFSTIV  861
             GIS+G VTETQKIWRSFQALGDIAFAYS+S+ILIEIQDTV+SPPSE+KTM+KA+  ST V
Sbjct  241   GISVGAVTETQKIWRSFQALGDIAFAYSFSVILIEIQDTVRSPPSEAKTMKKATFLSTAV  300

Query  860   TTTFYMLCGCMGYAAFGDDAPGNLLTGFGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLF  681
             TTTFYMLCGCMGYAAFGD APGNLLTGFGFYNPFWLLDIANAAIVIHLVGAYQVYCQP+F
Sbjct  301   TTTFYMLCGCMGYAAFGDAAPGNLLTGFGFYNPFWLLDIANAAIVIHLVGAYQVYCQPIF  360

Query  680   AFIEKWVGAKWPDSEIITKEINLKIPGFGYPYKLNTFRLLWRTAFVLLTTVISMLLPFFN  501
             AF+EK    +WPDSE I +EI + +PG G  Y +N FRL+WRT FV LTTVISMLLPFFN
Sbjct  361   AFVEKQAAQRWPDSEFIAREIKIPVPGLG-QYNMNLFRLVWRTIFVTLTTVISMLLPFFN  419

Query  500   DVVGILGAFGFWPLTVYFPVRMYISQKKIPKWSTRWICLQMlsgaclavslaaaagsfag  321
             DVVGILGA GFWPLTVYFPV MYI QK+IP+WSTRW+CLQ+LS ACL +S+ AAAGS AG
Sbjct  420   DVVGILGALGFWPLTVYFPVEMYIKQKQIPRWSTRWLCLQVLSMACLVISIMAAAGSIAG  479

Query  320   vVLDLKLYRPFKTSY  276
             V+LDLK Y+PFKTSY
Sbjct  480   VMLDLKSYQPFKTSY  494



>ref|XP_008219592.1| PREDICTED: amino acid permease 3-like isoform X2 [Prunus mume]
Length=487

 Score =   758 bits (1957),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 381/488 (78%), Positives = 429/488 (88%), Gaps = 2/488 (0%)
 Frame = -3

Query  1736  MQMGESAAATKNHRHHL-GVSIDAPPLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSG  1560
             M MG++    + H H +  VS+D PP  G K  DDDGR +RTGTVWT+SAHIITAVIGSG
Sbjct  1     MTMGDNTKNQQLHHHQIFDVSVDVPPQGGSKCFDDDGRLKRTGTVWTSSAHIITAVIGSG  60

Query  1559  VLSLAWAIGQLGWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRNYTYMDAVRSNL  1380
             VLSLAWA  QLGWVAGPSVMLLFS V YYTSTLL+ CYR+GD V GKRNYTYMDAVRSNL
Sbjct  61    VLSLAWATAQLGWVAGPSVMLLFSFVTYYTSTLLSACYRSGDSVTGKRNYTYMDAVRSNL  120

Query  1379  GGYQVKICGLIQYFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAF  1200
             GG +VKICG +QY NLFG++IGYTIA+SISMMAIKRSNCFH+SGGKNPCH++SNPYMIAF
Sbjct  121   GGAKVKICGYVQYLNLFGVSIGYTIASSISMMAIKRSNCFHKSGGKNPCHINSNPYMIAF  180

Query  1199  GIIEIILSQIPDFDQIWWLSIVAAVMSFTYSGIGLGLGIAQVVANGAFKGSLTGISIGTV  1020
             GI EII SQIP+FDQ+WWLSIVAAVMSFTYS IGLGLGIAQV ANG   GS+TGISIGTV
Sbjct  181   GITEIIFSQIPNFDQLWWLSIVAAVMSFTYSTIGLGLGIAQVAANGNIMGSMTGISIGTV  240

Query  1019  TETQKIWRSFQALGDIAFAYSYSIILIEIQDTVKSPPSESKTMRKASLFSTIVTTTFYML  840
             T  QK+WRSFQALGDIAFAYSYS+ILIEIQDT++SPPSESKTM++A+  S  VTT FYML
Sbjct  241   TPMQKMWRSFQALGDIAFAYSYSLILIEIQDTIRSPPSESKTMKRATQISVAVTTLFYML  300

Query  839   CGCMGYAAFGDDAPGNLLTGFGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEKWV  660
             CGCMGYAAFGD +PGNLLTGFGFYNP+WLLDIANAAIV+HLVGAYQVY QPLFAF+EK  
Sbjct  301   CGCMGYAAFGDLSPGNLLTGFGFYNPYWLLDIANAAIVVHLVGAYQVYAQPLFAFVEKTA  360

Query  659   GAKWPDSEIITKEINLKIPGFGYPYKLNTFRLLWRTAFVLLTTVISMLLPFFNDVVGILG  480
               K+PDS+ ITK+I L+IPG G PY LN FR++WRTAFV++TTVISM+LPFFNDVVG+LG
Sbjct  361   AQKFPDSDFITKDIRLQIPGIG-PYNLNLFRMIWRTAFVIITTVISMILPFFNDVVGLLG  419

Query  479   AFGFWPLTVYFPVRMYISQKKIPKWSTRWICLQMlsgaclavslaaaagsfagvVLDLKL  300
             AFGFWPLTVYFPV MYI QKKIPKWSTRW+CLQ+LS ACL +++AAAAGS AGVV DLK+
Sbjct  420   AFGFWPLTVYFPVEMYIVQKKIPKWSTRWLCLQILSVACLIITIAAAAGSIAGVVSDLKV  479

Query  299   YRPFKTSY  276
             Y+PFKTSY
Sbjct  480   YKPFKTSY  487



>emb|CAN61092.1| hypothetical protein VITISV_005276 [Vitis vinifera]
 emb|CBI18979.3| unnamed protein product [Vitis vinifera]
Length=481

 Score =   758 bits (1956),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 384/481 (80%), Positives = 423/481 (88%), Gaps = 1/481 (0%)
 Frame = -3

Query  1718  AAATKNHRHHLGVSIDAPPLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSGVLSLAWA  1539
             ++A K+ + H    ID  P    K  DDDGR +RTGT WTASAHIITAVIGSGVLSLAWA
Sbjct  2     SSAPKDLQPHQVFDIDGVPQGASKCFDDDGRLKRTGTFWTASAHIITAVIGSGVLSLAWA  61

Query  1538  IGQLGWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRNYTYMDAVRSNLGGYQVKI  1359
               QLGW+AGP+V+ LFS V YYTS LL+ CYR GD V GKRNYTYMDAVRSNLGG ++KI
Sbjct  62    TAQLGWIAGPAVLFLFSFVTYYTSVLLSSCYRTGDSVTGKRNYTYMDAVRSNLGGAKMKI  121

Query  1358  CGLIQYFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFGIIEIIL  1179
             CGLIQY NLFG+AIGYTIAASISMMAIKRSNCFHES  KNPCH+SSNPYMI FGI EIIL
Sbjct  122   CGLIQYLNLFGVAIGYTIAASISMMAIKRSNCFHESHDKNPCHISSNPYMIMFGIFEIIL  181

Query  1178  SQIPDFDQIWWLSIVAAVMSFTYSGIGLGLGIAQVVANGAFKGSLTGISIGTVTETQKIW  999
             SQIPDFDQIWWLSIVAA+MSF YS IGLGLG+A+V  +G F+GSLTGISIGTVT+TQKIW
Sbjct  182   SQIPDFDQIWWLSIVAAIMSFAYSTIGLGLGVAKVAESGKFRGSLTGISIGTVTQTQKIW  241

Query  998   RSFQALGDIAFAYSYSIILIEIQDTVKSPPSESKTMRKASLFSTIVTTTFYMLCGCMGYA  819
             RSFQALG+IAFAYSYSIILIEIQDT+KSPPSE KTM+KA+L S IVTT FYMLCGCMGYA
Sbjct  242   RSFQALGNIAFAYSYSIILIEIQDTIKSPPSEKKTMKKATLLSVIVTTLFYMLCGCMGYA  301

Query  818   AFGDDAPGNLLTGFGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEKWVGAKWPDS  639
             AFGD APGNLLTGFGFYNP+WLLDIANAAIVIHLVGAYQVYCQPLFAFIEKW   K+PDS
Sbjct  302   AFGDLAPGNLLTGFGFYNPYWLLDIANAAIVIHLVGAYQVYCQPLFAFIEKWAAEKFPDS  361

Query  638   EIITKEINLKIPGFGYPYKLNTFRLLWRTAFVLLTTVISMLLPFFNDVVGILGAFGFWPL  459
             + ITKEI + IPGF  PY LN FRL+WRT FV++TTVISML+PFFNDVVGILGAFGFWPL
Sbjct  362   QFITKEIKIPIPGFK-PYNLNLFRLVWRTIFVIITTVISMLMPFFNDVVGILGAFGFWPL  420

Query  458   TVYFPVRMYISQKKIPKWSTRWICLQMlsgaclavslaaaagsfagvVLDLKLYRPFKTS  279
             TVYFPV MYI+QKKIPKWSTRW+CLQ+LS ACL +S+AAAAGS AGV+LDLK+Y+PFKTS
Sbjct  421   TVYFPVEMYIAQKKIPKWSTRWLCLQILSFACLIISIAAAAGSVAGVILDLKVYKPFKTS  480

Query  278   Y  276
             Y
Sbjct  481   Y  481



>ref|XP_008227518.1| PREDICTED: amino acid permease 4 isoform X1 [Prunus mume]
Length=480

 Score =   758 bits (1956),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 377/480 (79%), Positives = 423/480 (88%), Gaps = 2/480 (0%)
 Frame = -3

Query  1712  ATKNHRHHLGVSIDA-PPLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSGVLSLAWAI  1536
             +  N++    +SID  P   G K  DDDGR +RTG+VWTASAHIITAVIGSGVLSLAWAI
Sbjct  2     SENNNQQVFDISIDVVPKNNGSKCFDDDGRLKRTGSVWTASAHIITAVIGSGVLSLAWAI  61

Query  1535  GQLGWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRNYTYMDAVRSNLGGYQVKIC  1356
              QLGW+AGPSVM LFS V YYTS LL+DCYR+GDP+ GKRNYTY+DAVRS LGG +VK C
Sbjct  62    AQLGWIAGPSVMFLFSFVSYYTSCLLSDCYRSGDPLTGKRNYTYIDAVRSILGGARVKAC  121

Query  1355  GLIQYFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFGIIEIILS  1176
             GLIQY NLFGIAIGYTIAAS+SMMAIKRSNCFHESGGK PCHMSSNPYMI FG+ E++LS
Sbjct  122   GLIQYLNLFGIAIGYTIAASVSMMAIKRSNCFHESGGKKPCHMSSNPYMILFGVTEVLLS  181

Query  1175  QIPDFDQIWWLSIVAAVMSFTYSGIGLGLGIAQVVANGAFKGSLTGISIGTVTETQKIWR  996
             QIPDFDQIWWLSIVAAVMSFTYS IGL LGI +V   G F+GSLTGISIGTVTETQK+WR
Sbjct  182   QIPDFDQIWWLSIVAAVMSFTYSSIGLALGIVKVATTGTFRGSLTGISIGTVTETQKMWR  241

Query  995   SFQALGDIAFAYSYSIILIEIQDTVKSPPSESKTMRKASLFSTIVTTTFYMLCGCMGYAA  816
             SFQALGDIAFAYSYS+ILIEIQDT+K+PPSE+KTM+KA++ S  VTTTFYMLCGCMGYAA
Sbjct  242   SFQALGDIAFAYSYSVILIEIQDTIKAPPSEAKTMKKATVLSIAVTTTFYMLCGCMGYAA  301

Query  815   FGDDAPGNLLTGFGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEKWVGAKWPDSE  636
             FGD APGNLLTGFGFYNPFWLLDIANAAIV+HLVGAYQV+CQP+FAF+EKW   +WP+S+
Sbjct  302   FGDFAPGNLLTGFGFYNPFWLLDIANAAIVVHLVGAYQVFCQPIFAFVEKWAAQRWPESK  361

Query  635   IITKEINLKIPGFGYPYKLNTFRLLWRTAFVLLTTVISMLLPFFNDVVGILGAFGFWPLT  456
             +ITKE  + +PG    +KLN FRL+WRT FV+LTT+ISMLLPFFNDVVG+LGA GFWPLT
Sbjct  362   LITKEFQVPVPGLP-SFKLNLFRLVWRTKFVMLTTIISMLLPFFNDVVGLLGALGFWPLT  420

Query  455   VYFPVRMYISQKKIPKWSTRWICLQMlsgaclavslaaaagsfagvVLDLKLYRPFKTSY  276
             VYFPV MYI+QK+IPKWSTRWICLQMLS ACL +SL AAAGS AGV+LDLK+YRPFKTSY
Sbjct  421   VYFPVEMYIAQKQIPKWSTRWICLQMLSIACLVISLVAAAGSIAGVMLDLKVYRPFKTSY  480



>ref|XP_007213109.1| hypothetical protein PRUPE_ppa023539mg [Prunus persica]
 gb|EMJ14308.1| hypothetical protein PRUPE_ppa023539mg [Prunus persica]
Length=480

 Score =   757 bits (1955),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 376/480 (78%), Positives = 424/480 (88%), Gaps = 2/480 (0%)
 Frame = -3

Query  1712  ATKNHRHHLGVSIDA-PPLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSGVLSLAWAI  1536
             +  N++    +SID  P + G K  DDDGR +RTG+VWTASAHIITAVIGSGVLSLAWAI
Sbjct  2     SENNNQQVFDISIDVVPKINGSKCFDDDGRLKRTGSVWTASAHIITAVIGSGVLSLAWAI  61

Query  1535  GQLGWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRNYTYMDAVRSNLGGYQVKIC  1356
              QLGW+AGPSVM LFS V YYTS LL+DCYR+GDP+ GKRNYTY+DAVRS LGG +VK C
Sbjct  62    AQLGWIAGPSVMFLFSFVSYYTSCLLSDCYRSGDPLTGKRNYTYIDAVRSILGGARVKAC  121

Query  1355  GLIQYFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFGIIEIILS  1176
             GLIQY NLFGIAIGYTIAAS+SMMAIKRSNCFHESGGK PCHMSSNPYMI FG+ E++LS
Sbjct  122   GLIQYLNLFGIAIGYTIAASVSMMAIKRSNCFHESGGKKPCHMSSNPYMILFGVTEVLLS  181

Query  1175  QIPDFDQIWWLSIVAAVMSFTYSGIGLGLGIAQVVANGAFKGSLTGISIGTVTETQKIWR  996
             QIPDFDQIWWLSIVAAVMSFTYS IGL LGI +V   G F+GSLTGISIGTVTETQK+WR
Sbjct  182   QIPDFDQIWWLSIVAAVMSFTYSSIGLALGIVKVATAGTFRGSLTGISIGTVTETQKMWR  241

Query  995   SFQALGDIAFAYSYSIILIEIQDTVKSPPSESKTMRKASLFSTIVTTTFYMLCGCMGYAA  816
             SFQALG+IAFAYSYS+ILIEIQDT+K+PPSE+KTM+KA++ S  VTTTFYMLCGCMGYAA
Sbjct  242   SFQALGNIAFAYSYSVILIEIQDTIKAPPSEAKTMKKATVLSIAVTTTFYMLCGCMGYAA  301

Query  815   FGDDAPGNLLTGFGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEKWVGAKWPDSE  636
             FGD APGNLLTGFGFYNPFWLLDIANAAIV+HLVGAYQV+CQP+FAF+EKW   +WP+S+
Sbjct  302   FGDFAPGNLLTGFGFYNPFWLLDIANAAIVVHLVGAYQVFCQPIFAFVEKWAAQRWPESK  361

Query  635   IITKEINLKIPGFGYPYKLNTFRLLWRTAFVLLTTVISMLLPFFNDVVGILGAFGFWPLT  456
             +ITKE  + +PG    +KLN FRL+WRT FV+LTT+ISMLLPFFNDVVG+LGA GFWPLT
Sbjct  362   LITKEFQVPVPGLP-SFKLNLFRLVWRTKFVMLTTIISMLLPFFNDVVGLLGALGFWPLT  420

Query  455   VYFPVRMYISQKKIPKWSTRWICLQMlsgaclavslaaaagsfagvVLDLKLYRPFKTSY  276
             VYFPV MYI+QK+IPKWSTRWICLQMLS ACL +SL AAAGS AGV+LDLK+YRPFKTSY
Sbjct  421   VYFPVEMYIAQKQIPKWSTRWICLQMLSIACLVISLVAAAGSIAGVMLDLKVYRPFKTSY  480



>ref|XP_006382883.1| amino acid permease AAP1 family protein [Populus trichocarpa]
 gb|ERP60680.1| amino acid permease AAP1 family protein [Populus trichocarpa]
Length=492

 Score =   757 bits (1955),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 384/493 (78%), Positives = 424/493 (86%), Gaps = 9/493 (2%)
 Frame = -3

Query  1730  MGESAAATKNHR--------HHLGVSIDAPPLYGFKGLDDDGRPQRTGTVWTASAHIITA  1575
             MGE+AA+   H             VS+D  P  G K  DDDGR +RTGT+WTAS+HIITA
Sbjct  1     MGENAASKNYHNNHHLHNHHQVFDVSVDVLPQNGSKCFDDDGRLKRTGTLWTASSHIITA  60

Query  1574  VIGSGVLSLAWAIGQLGWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRNYTYMDA  1395
             VIGSGVLSLAWAI QLGW+AGP+VM LFS V YYTS+LL DCYR GDP  GKRNYTYMDA
Sbjct  61    VIGSGVLSLAWAIAQLGWIAGPAVMFLFSLVTYYTSSLLTDCYRTGDPDTGKRNYTYMDA  120

Query  1394  VRSNLGGYQVKICGLIQYFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNP  1215
             V+S LGG +V +CGL+QY  LFGIAIGYTIA+SISMMAIKRSNCFH+SGG+NPCH+SSNP
Sbjct  121   VQSILGGVKVNLCGLVQYIGLFGIAIGYTIASSISMMAIKRSNCFHQSGGQNPCHISSNP  180

Query  1214  YMIAFGIIEIILSQIPDFDQIWWLSIVAAVMSFTYSGIGLGLGIAQVVANGAFKGSLTGI  1035
             YMI FGI EI+LSQIPDFDQ+WWLSIVAAVMSFTYS IGLGLGI +V ANG FKGSLTGI
Sbjct  181   YMIIFGITEILLSQIPDFDQLWWLSIVAAVMSFTYSTIGLGLGIGKVAANGTFKGSLTGI  240

Query  1034  SIGTVTETQKIWRSFQALGDIAFAYSYSIILIEIQDTVKSPPSESKTMRKASLFSTIVTT  855
             SIGTVTET+KIWRSFQALG IAFAYSYS+ILIEIQDT+KSPP+ESKTM+KA+  S +VTT
Sbjct  241   SIGTVTETEKIWRSFQALGAIAFAYSYSVILIEIQDTIKSPPAESKTMKKAAKISIVVTT  300

Query  854   TFYMLCGCMGYAAFGDDAPGNLLTGFGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAF  675
             TFYMLCGCMGYAAFGD APGNLLTGFGFYNP+WL+DIAN AIVIHL+GAYQV+CQPLFAF
Sbjct  301   TFYMLCGCMGYAAFGDQAPGNLLTGFGFYNPYWLIDIANVAIVIHLIGAYQVFCQPLFAF  360

Query  674   IEKWVGAKWPDSEIITKEINLKIPGFGYPYKLNTFRLLWRTAFVLLTTVISMLLPFFNDV  495
             IEKW   KWP++  ITKE  + +PGF  PYKLN FR++WRT FVLLTTVISMLLPFFNDV
Sbjct  361   IEKWANQKWPENYFITKEFKIPVPGF-RPYKLNLFRMVWRTIFVLLTTVISMLLPFFNDV  419

Query  494   VGILGAFGFWPLTVYFPVRMYISQKKIPKWSTRWICLQMlsgaclavslaaaagsfagvV  315
             VGILGA GFWPLTVYFPV MYI QKKIPKWSTRWICLQMLS ACL +SL A AGS AGVV
Sbjct  420   VGILGALGFWPLTVYFPVEMYIVQKKIPKWSTRWICLQMLSMACLVISLVAVAGSIAGVV  479

Query  314   LDLKLYRPFKTSY  276
             LDLK+Y+PFKTSY
Sbjct  480   LDLKVYKPFKTSY  492



>ref|XP_011031113.1| PREDICTED: amino acid permease 4-like isoform X1 [Populus euphratica]
Length=494

 Score =   757 bits (1954),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 383/495 (77%), Positives = 423/495 (85%), Gaps = 9/495 (2%)
 Frame = -3

Query  1736  MQMGESAAATKNHR--------HHLGVSIDAPPLYGFKGLDDDGRPQRTGTVWTASAHII  1581
             MQMGE+AA+   H             VS+D  P  G K  DDDGR +RTGT+WTAS+HII
Sbjct  1     MQMGENAASKNYHNNHHLHNHHQVFDVSVDVLPQNGSKCYDDDGRLKRTGTLWTASSHII  60

Query  1580  TAVIGSGVLSLAWAIGQLGWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRNYTYM  1401
             TAVIGSGVLSLAWAI QLGW+AGP+VM LFS V YYTS+LL DCYR GDP  G+RNYTYM
Sbjct  61    TAVIGSGVLSLAWAIAQLGWIAGPAVMFLFSLVTYYTSSLLTDCYRTGDPYTGERNYTYM  120

Query  1400  DAVRSNLGGYQVKICGLIQYFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSS  1221
             DAV+S LGG +V +CGL+QY  LFGIAIGYTIA+SISMMAIKRSNCFH+SGG+NPCH+SS
Sbjct  121   DAVQSILGGVKVNLCGLVQYIGLFGIAIGYTIASSISMMAIKRSNCFHQSGGQNPCHISS  180

Query  1220  NPYMIAFGIIEIILSQIPDFDQIWWLSIVAAVMSFTYSGIGLGLGIAQVVANGAFKGSLT  1041
             NPYMI FGI EI+LSQIPDFDQ+WWLSIVAAVMSFTYS IGLGLGI +V  NG FKGSLT
Sbjct  181   NPYMIMFGITEILLSQIPDFDQLWWLSIVAAVMSFTYSSIGLGLGIGKVAVNGTFKGSLT  240

Query  1040  GISIGTVTETQKIWRSFQALGDIAFAYSYSIILIEIQDTVKSPPSESKTMRKASLFSTIV  861
             GISIGTVTET+KIWRSFQALG IAFAYSYS+ILIEIQDT+KSPP+ESKTM+KA+  S +V
Sbjct  241   GISIGTVTETEKIWRSFQALGAIAFAYSYSVILIEIQDTIKSPPAESKTMKKAAKISIVV  300

Query  860   TTTFYMLCGCMGYAAFGDDAPGNLLTGFGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLF  681
             TTTFYMLCGCMGYAAFG+ APGNLLTGFGFYNP+WL+DIAN AIVIHL+GAYQV+CQPLF
Sbjct  301   TTTFYMLCGCMGYAAFGEQAPGNLLTGFGFYNPYWLIDIANVAIVIHLIGAYQVFCQPLF  360

Query  680   AFIEKWVGAKWPDSEIITKEINLKIPGFGYPYKLNTFRLLWRTAFVLLTTVISMLLPFFN  501
             AFIEKW   KWP++  ITKE  + +PGF  PY LN FRL+WRT FVLLTTVISMLLPFFN
Sbjct  361   AFIEKWANQKWPENYFITKEFRIPVPGF-RPYNLNLFRLVWRTIFVLLTTVISMLLPFFN  419

Query  500   DVVGILGAFGFWPLTVYFPVRMYISQKKIPKWSTRWICLQMlsgaclavslaaaagsfag  321
             DVVGILGA GFWPLTVYFPV MYI QKKIPKWSTRWICLQMLS ACL +SL A AGS AG
Sbjct  420   DVVGILGALGFWPLTVYFPVEMYIVQKKIPKWSTRWICLQMLSMACLVISLVAVAGSIAG  479

Query  320   vVLDLKLYRPFKTSY  276
             VVLDLK Y+PFKTSY
Sbjct  480   VVLDLKAYKPFKTSY  494



>ref|XP_008219591.1| PREDICTED: amino acid permease 3-like isoform X1 [Prunus mume]
Length=488

 Score =   756 bits (1952),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 380/489 (78%), Positives = 430/489 (88%), Gaps = 2/489 (0%)
 Frame = -3

Query  1739  IMQMGESAAATKNHRHHL-GVSIDAPPLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGS  1563
             + +MG++    + H H +  VS+D PP  G K  DDDGR +RTGTVWT+SAHIITAVIGS
Sbjct  1     MTKMGDNTKNQQLHHHQIFDVSVDVPPQGGSKCFDDDGRLKRTGTVWTSSAHIITAVIGS  60

Query  1562  GVLSLAWAIGQLGWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRNYTYMDAVRSN  1383
             GVLSLAWA  QLGWVAGPSVMLLFS V YYTSTLL+ CYR+GD V GKRNYTYMDAVRSN
Sbjct  61    GVLSLAWATAQLGWVAGPSVMLLFSFVTYYTSTLLSACYRSGDSVTGKRNYTYMDAVRSN  120

Query  1382  LGGYQVKICGLIQYFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIA  1203
             LGG +VKICG +QY NLFG++IGYTIA+SISMMAIKRSNCFH+SGGKNPCH++SNPYMIA
Sbjct  121   LGGAKVKICGYVQYLNLFGVSIGYTIASSISMMAIKRSNCFHKSGGKNPCHINSNPYMIA  180

Query  1202  FGIIEIILSQIPDFDQIWWLSIVAAVMSFTYSGIGLGLGIAQVVANGAFKGSLTGISIGT  1023
             FGI EII SQIP+FDQ+WWLSIVAAVMSFTYS IGLGLGIAQV ANG   GS+TGISIGT
Sbjct  181   FGITEIIFSQIPNFDQLWWLSIVAAVMSFTYSTIGLGLGIAQVAANGNIMGSMTGISIGT  240

Query  1022  VTETQKIWRSFQALGDIAFAYSYSIILIEIQDTVKSPPSESKTMRKASLFSTIVTTTFYM  843
             VT  QK+WRSFQALGDIAFAYSYS+ILIEIQDT++SPPSESKTM++A+  S  VTT FYM
Sbjct  241   VTPMQKMWRSFQALGDIAFAYSYSLILIEIQDTIRSPPSESKTMKRATQISVAVTTLFYM  300

Query  842   LCGCMGYAAFGDDAPGNLLTGFGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEKW  663
             LCGCMGYAAFGD +PGNLLTGFGFYNP+WLLDIANAAIV+HLVGAYQVY QPLFAF+EK 
Sbjct  301   LCGCMGYAAFGDLSPGNLLTGFGFYNPYWLLDIANAAIVVHLVGAYQVYAQPLFAFVEKT  360

Query  662   VGAKWPDSEIITKEINLKIPGFGYPYKLNTFRLLWRTAFVLLTTVISMLLPFFNDVVGIL  483
                K+PDS+ ITK+I L+IPG G PY LN FR++WRTAFV++TTVISM+LPFFNDVVG+L
Sbjct  361   AAQKFPDSDFITKDIRLQIPGIG-PYNLNLFRMIWRTAFVIITTVISMILPFFNDVVGLL  419

Query  482   GAFGFWPLTVYFPVRMYISQKKIPKWSTRWICLQMlsgaclavslaaaagsfagvVLDLK  303
             GAFGFWPLTVYFPV MYI QKKIPKWSTRW+CLQ+LS ACL +++AAAAGS AGVV DLK
Sbjct  420   GAFGFWPLTVYFPVEMYIVQKKIPKWSTRWLCLQILSVACLIITIAAAAGSIAGVVSDLK  479

Query  302   LYRPFKTSY  276
             +Y+PFKTSY
Sbjct  480   VYKPFKTSY  488



>ref|XP_008227520.1| PREDICTED: amino acid permease 4 isoform X3 [Prunus mume]
Length=481

 Score =   755 bits (1950),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 378/481 (79%), Positives = 424/481 (88%), Gaps = 3/481 (1%)
 Frame = -3

Query  1712  ATKNHRHHLGVSIDA-PPLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSGVLSLAWAI  1536
             +  N++    +SID  P   G K  DDDGR +RTG+VWTASAHIITAVIGSGVLSLAWAI
Sbjct  2     SENNNQQVFDISIDVVPKNNGSKCFDDDGRLKRTGSVWTASAHIITAVIGSGVLSLAWAI  61

Query  1535  GQLGWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRNYTYMDAVRSNLGGYQVKIC  1356
              QLGW+AGPSVM LFS V YYTS LL+DCYR+GDP+ GKRNYTY+DAVRS LGG +VK C
Sbjct  62    AQLGWIAGPSVMFLFSFVSYYTSCLLSDCYRSGDPLTGKRNYTYIDAVRSILGGARVKAC  121

Query  1355  GLIQYFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFGIIEIILS  1176
             GLIQY NLFGIAIGYTIAAS+SMMAIKRSNCFHESGGK PCHMSSNPYMI FG+ E++LS
Sbjct  122   GLIQYLNLFGIAIGYTIAASVSMMAIKRSNCFHESGGKKPCHMSSNPYMILFGVTEVLLS  181

Query  1175  QIPDFDQIWWLSIVAAVMSFTYSGIGLGLGIAQV-VANGAFKGSLTGISIGTVTETQKIW  999
             QIPDFDQIWWLSIVAAVMSFTYS IGL LGI +V  A G F+GSLTGISIGTVTETQK+W
Sbjct  182   QIPDFDQIWWLSIVAAVMSFTYSSIGLALGIVKVATATGTFRGSLTGISIGTVTETQKMW  241

Query  998   RSFQALGDIAFAYSYSIILIEIQDTVKSPPSESKTMRKASLFSTIVTTTFYMLCGCMGYA  819
             RSFQALGDIAFAYSYS+ILIEIQDT+K+PPSE+KTM+KA++ S  VTTTFYMLCGCMGYA
Sbjct  242   RSFQALGDIAFAYSYSVILIEIQDTIKAPPSEAKTMKKATVLSIAVTTTFYMLCGCMGYA  301

Query  818   AFGDDAPGNLLTGFGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEKWVGAKWPDS  639
             AFGD APGNLLTGFGFYNPFWLLDIANAAIV+HLVGAYQV+CQP+FAF+EKW   +WP+S
Sbjct  302   AFGDFAPGNLLTGFGFYNPFWLLDIANAAIVVHLVGAYQVFCQPIFAFVEKWAAQRWPES  361

Query  638   EIITKEINLKIPGFGYPYKLNTFRLLWRTAFVLLTTVISMLLPFFNDVVGILGAFGFWPL  459
             ++ITKE  + +PG    +KLN FRL+WRT FV+LTT+ISMLLPFFNDVVG+LGA GFWPL
Sbjct  362   KLITKEFQVPVPGLP-SFKLNLFRLVWRTKFVMLTTIISMLLPFFNDVVGLLGALGFWPL  420

Query  458   TVYFPVRMYISQKKIPKWSTRWICLQMlsgaclavslaaaagsfagvVLDLKLYRPFKTS  279
             TVYFPV MYI+QK+IPKWSTRWICLQMLS ACL +SL AAAGS AGV+LDLK+YRPFKTS
Sbjct  421   TVYFPVEMYIAQKQIPKWSTRWICLQMLSIACLVISLVAAAGSIAGVMLDLKVYRPFKTS  480

Query  278   Y  276
             Y
Sbjct  481   Y  481



>ref|XP_007222588.1| hypothetical protein PRUPE_ppa004920mg [Prunus persica]
 gb|EMJ23787.1| hypothetical protein PRUPE_ppa004920mg [Prunus persica]
Length=485

 Score =   755 bits (1950),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 380/486 (78%), Positives = 428/486 (88%), Gaps = 2/486 (0%)
 Frame = -3

Query  1730  MGESAAATKNHRHHL-GVSIDAPPLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSGVL  1554
             MG++    + H H +  VS+D PP  G K  DDDGR +RTGTVWT+SAHIITAVIGSGVL
Sbjct  1     MGDNTKNQQLHHHQIFDVSVDVPPQGGSKCFDDDGRLKRTGTVWTSSAHIITAVIGSGVL  60

Query  1553  SLAWAIGQLGWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRNYTYMDAVRSNLGG  1374
             SLAWA  QLGWVAGPSVMLLFS V YYTSTLL+ CYR+GD V GKRNYTYMDAVRSNLGG
Sbjct  61    SLAWATAQLGWVAGPSVMLLFSFVTYYTSTLLSACYRSGDSVTGKRNYTYMDAVRSNLGG  120

Query  1373  YQVKICGLIQYFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFGI  1194
              +VKICG +QY NLFG++IGYTIA+SISMMAIKRSNCFH+SGGKNPCH++SNPYMIAFGI
Sbjct  121   AKVKICGYVQYLNLFGVSIGYTIASSISMMAIKRSNCFHKSGGKNPCHINSNPYMIAFGI  180

Query  1193  IEIILSQIPDFDQIWWLSIVAAVMSFTYSGIGLGLGIAQVVANGAFKGSLTGISIGTVTE  1014
              EII SQIP+FDQ+WWLSIVAAVMSFTYS IGLGLGIAQV ANG   GS+TGISIGTVT 
Sbjct  181   TEIIFSQIPNFDQLWWLSIVAAVMSFTYSTIGLGLGIAQVAANGNIMGSMTGISIGTVTP  240

Query  1013  TQKIWRSFQALGDIAFAYSYSIILIEIQDTVKSPPSESKTMRKASLFSTIVTTTFYMLCG  834
              QK+WRSFQALGDIAFAYSYS+ILIEIQDT++SPPSESKTM++A+  S  VTT FYMLCG
Sbjct  241   MQKMWRSFQALGDIAFAYSYSLILIEIQDTIRSPPSESKTMKRATQISVAVTTLFYMLCG  300

Query  833   CMGYAAFGDDAPGNLLTGFGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEKWVGA  654
             CMGYAAFGD +PGNLLTGFGFYNP+WLLDIANAAIV+HLVGAYQVY QPLFAF+EK    
Sbjct  301   CMGYAAFGDLSPGNLLTGFGFYNPYWLLDIANAAIVVHLVGAYQVYAQPLFAFVEKTAAQ  360

Query  653   KWPDSEIITKEINLKIPGFGYPYKLNTFRLLWRTAFVLLTTVISMLLPFFNDVVGILGAF  474
             K+PDS+ ITK+I L+IPG G PY LN FR++WRTAFV++TTVISM+LPFFNDVVG+LGAF
Sbjct  361   KFPDSDFITKDIRLQIPGIG-PYNLNLFRMIWRTAFVIITTVISMILPFFNDVVGLLGAF  419

Query  473   GFWPLTVYFPVRMYISQKKIPKWSTRWICLQMlsgaclavslaaaagsfagvVLDLKLYR  294
             GFWPLTVYFPV MYI QKKIPKWSTRW+CLQ+LS ACL +++AAAAGS AGVV DLK+Y+
Sbjct  420   GFWPLTVYFPVEMYIVQKKIPKWSTRWLCLQILSVACLIITIAAAAGSIAGVVSDLKVYK  479

Query  293   PFKTSY  276
             PFKTSY
Sbjct  480   PFKTSY  485



>ref|XP_010269036.1| PREDICTED: amino acid permease 3-like [Nelumbo nucifera]
Length=476

 Score =   755 bits (1949),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 373/475 (79%), Positives = 426/475 (90%), Gaps = 1/475 (0%)
 Frame = -3

Query  1700  HRHHLGVSIDAPPLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSGVLSLAWAIGQLGW  1521
              +    +SID  P  G +  DDDGR +RTGT WTASAHI+TAVIGSGVLSLAWAI QLGW
Sbjct  3     EKQVFDLSIDVSPQGGSECFDDDGRLKRTGTFWTASAHIVTAVIGSGVLSLAWAIAQLGW  62

Query  1520  VAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRNYTYMDAVRSNLGGYQVKICGLIQY  1341
             +AGP++M+LFS V+YYTS+LLADCYR+GDPV GKRNYTYMDAVRSNLGG +VKICG+IQY
Sbjct  63    IAGPAMMILFSFVIYYTSSLLADCYRSGDPVSGKRNYTYMDAVRSNLGGVKVKICGVIQY  122

Query  1340  FNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFGIIEIILSQIPDF  1161
              NLFG++IGYTIAASISMMAI+RSNCFHESGGKN CH+SSNPYMI FG+ EI+LSQIPDF
Sbjct  123   LNLFGVSIGYTIAASISMMAIRRSNCFHESGGKNSCHVSSNPYMIIFGVTEILLSQIPDF  182

Query  1160  DQIWWLSIVAAVMSFTYSGIGLGLGIAQVVANGAFKGSLTGISIGTVTETQKIWRSFQAL  981
             DQIWWLSIVAA+MS TYS IGLGLGI++V   G+F+GSLTGI+IG VTETQKIWRSFQAL
Sbjct  183   DQIWWLSIVAAIMSLTYSVIGLGLGISKVAETGSFRGSLTGITIGAVTETQKIWRSFQAL  242

Query  980   GDIAFAYSYSIILIEIQDTVKSPPSESKTMRKASLFSTIVTTTFYMLCGCMGYAAFGDDA  801
             GDIAFAYSYSIIL EIQ+T+KSPPSE+KTM+KA+LFS  VTT FYMLCGCMGYAAFGD A
Sbjct  243   GDIAFAYSYSIILXEIQNTLKSPPSEAKTMKKATLFSVFVTTLFYMLCGCMGYAAFGDLA  302

Query  800   PGNLLTGFGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEKWVGAKWPDSEIITKE  621
             PGNLLTGFGFYNPFW++DIANAA+VIHLVGAYQV+CQPLFAFIEKW   +WPDS+ IT E
Sbjct  303   PGNLLTGFGFYNPFWVIDIANAAVVIHLVGAYQVFCQPLFAFIEKWASQRWPDSKFITNE  362

Query  620   INLKIPGFGYPYKLNTFRLLWRTAFVLLTTVISMLLPFFNDVVGILGAFGFWPLTVYFPV  441
             I + IPGF  PYKLN FRL+WR+AFV+ TT+ISMLLPFFNDVVGILGAF FWPLTV+FPV
Sbjct  363   IKVPIPGFC-PYKLNLFRLVWRSAFVVATTIISMLLPFFNDVVGILGAFSFWPLTVFFPV  421

Query  440   RMYISQKKIPKWSTRWICLQMlsgaclavslaaaagsfagvVLDLKLYRPFKTSY  276
             +MYI+QKKIP+WSTRW+ LQ+LS ACL +S+AAAAGS AGV+LDLK+Y+PFKTSY
Sbjct  422   QMYIAQKKIPRWSTRWLSLQILSFACLVISVAAAAGSIAGVILDLKVYKPFKTSY  476



>ref|XP_007019168.1| Amino acid permease isoform 2 [Theobroma cacao]
 gb|EOY16393.1| Amino acid permease isoform 2 [Theobroma cacao]
Length=488

 Score =   755 bits (1949),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 385/490 (79%), Positives = 426/490 (87%), Gaps = 5/490 (1%)
 Frame = -3

Query  1736  MQMGESAAATKNHRHH---LGVSIDAPPLYGFKGLDDDGRPQRTGTVWTASAHIITAVIG  1566
             M+M E+ A  KNH  H     +SID  P  G K  D+DGR +RTGTVWTASAHIITAVIG
Sbjct  1     MKMAENGAG-KNHLQHNQVFDLSIDVLPQGGSKCFDEDGRLKRTGTVWTASAHIITAVIG  59

Query  1565  SGVLSLAWAIGQLGWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRNYTYMDAVRS  1386
             SGVLSLAWA  QLGWVAGP+VM LFS V YYTSTLLA CYR+GDP+ GKRNYTYMDAVRS
Sbjct  60    SGVLSLAWATAQLGWVAGPAVMFLFSFVTYYTSTLLAACYRSGDPINGKRNYTYMDAVRS  119

Query  1385  NLGGYQVKICGLIQYFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMI  1206
             NLGG++VKICG +QY NLFG+AIGYTIA+SISMMAIKRSNCFH SGGKNPCH++SNPYMI
Sbjct  120   NLGGFKVKICGWVQYLNLFGVAIGYTIASSISMMAIKRSNCFHASGGKNPCHLNSNPYMI  179

Query  1205  AFGIIEIILSQIPDFDQIWWLSIVAAVMSFTYSGIGLGLGIAQVVANGAFKGSLTGISIG  1026
             AFGI+EII SQIP FDQ+WWLSIVAAVMSFTYS IGLGLGIA+V   G  +GSLTGIS+G
Sbjct  180   AFGIVEIIFSQIPGFDQLWWLSIVAAVMSFTYSTIGLGLGIAKVAETGKVRGSLTGISVG  239

Query  1025  TVTETQKIWRSFQALGDIAFAYSYSIILIEIQDTVKSPPSESKTMRKASLFSTIVTTTFY  846
             TVT+TQKIWRSFQALGDIAFAYSYS+ILIEIQDT+K+PPSESKTM+KASL S  VTT FY
Sbjct  240   TVTQTQKIWRSFQALGDIAFAYSYSLILIEIQDTLKAPPSESKTMKKASLISVAVTTLFY  299

Query  845   MLCGCMGYAAFGDDAPGNLLTGFGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEK  666
             MLCGCMGYAAFGD +PGNLLTGFGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEK
Sbjct  300   MLCGCMGYAAFGDLSPGNLLTGFGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEK  359

Query  665   WVGAKWPDSEIITKEINLKIPGFGYPYKLNTFRLLWRTAFVLLTTVISMLLPFFNDVVGI  486
                 K+PDSE ITK+I + IPGF   Y LN FRL+WRT FV+ TT+ISMLLPFFND+VG+
Sbjct  360   KAAEKFPDSEFITKDIKISIPGF-RAYNLNLFRLVWRTLFVISTTLISMLLPFFNDIVGL  418

Query  485   LGAFGFWPLTVYFPVRMYISQKKIPKWSTRWICLQMlsgaclavslaaaagsfagvVLDL  306
             LGA GFWPLTVYFPV MYIS+KKIPKWSTRW+CLQ+LS ACL +++AAAAGS AGVVLDL
Sbjct  419   LGALGFWPLTVYFPVEMYISKKKIPKWSTRWLCLQILSIACLIITIAAAAGSIAGVVLDL  478

Query  305   KLYRPFKTSY  276
             K Y+PF T Y
Sbjct  479   KSYKPFSTDY  488



>gb|KHG20963.1| Amino acid permease 3 -like protein [Gossypium arboreum]
Length=486

 Score =   754 bits (1948),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 385/488 (79%), Positives = 429/488 (88%), Gaps = 5/488 (1%)
 Frame = -3

Query  1730  MGESAAATKNHRHH---LGVSIDAPPLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSG  1560
             MG+  AA +NH H+     +SID  P  G K  DDDGR +R+GTVWTASAHIITAVIGSG
Sbjct  1     MGDDGAA-RNHLHNNQVFDLSIDVLPQGGTKCYDDDGRLKRSGTVWTASAHIITAVIGSG  59

Query  1559  VLSLAWAIGQLGWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRNYTYMDAVRSNL  1380
             VLSLAWA  QLGW+AGP VM+LFS V YYTSTLLA CYR+GDPV GKRNYTYMDAVRSNL
Sbjct  60    VLSLAWATAQLGWIAGPIVMILFSFVTYYTSTLLAACYRSGDPVNGKRNYTYMDAVRSNL  119

Query  1379  GGYQVKICGLIQYFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAF  1200
             GG++VKICG +QY NLFG+AIGYTIA+SISMMAIKRSNCFH SGGKNPCHM+SNPYMIAF
Sbjct  120   GGFKVKICGWVQYLNLFGVAIGYTIASSISMMAIKRSNCFHASGGKNPCHMNSNPYMIAF  179

Query  1199  GIIEIILSQIPDFDQIWWLSIVAAVMSFTYSGIGLGLGIAQVVANGAFKGSLTGISIGTV  1020
             GI+EII SQIPDFDQ+WWLSIVAAVMSFTYS IGLGLGIA+V   G  +GSLTGIS+GTV
Sbjct  180   GIVEIIFSQIPDFDQLWWLSIVAAVMSFTYSTIGLGLGIAKVAETGKIRGSLTGISVGTV  239

Query  1019  TETQKIWRSFQALGDIAFAYSYSIILIEIQDTVKSPPSESKTMRKASLFSTIVTTTFYML  840
             T+TQKIWRSFQALGDIAFAYSYS+ILIEIQDT+K+PPSESKTM+KA+L S  VTT FYML
Sbjct  240   TQTQKIWRSFQALGDIAFAYSYSLILIEIQDTLKAPPSESKTMKKATLISVGVTTLFYML  299

Query  839   CGCMGYAAFGDDAPGNLLTGFGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEKWV  660
             CGCMGYAAFGD +PGNLLTGFGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEK  
Sbjct  300   CGCMGYAAFGDLSPGNLLTGFGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEKSA  359

Query  659   GAKWPDSEIITKEINLKIPGFGYPYKLNTFRLLWRTAFVLLTTVISMLLPFFNDVVGILG  480
               ++PDSE ITK+I + IPGF  PY LN FRL+WRT FV++TT+ISMLLPFFND+VG+LG
Sbjct  360   TERFPDSEFITKDIKIPIPGF-RPYNLNLFRLVWRTIFVIITTLISMLLPFFNDIVGLLG  418

Query  479   AFGFWPLTVYFPVRMYISQKKIPKWSTRWICLQMlsgaclavslaaaagsfagvVLDLKL  300
             A GFWPLTVYFPV MYISQKKIPKWSTRW+CLQ+LS ACL +++AAAAGS AGVVLDLK 
Sbjct  419   ALGFWPLTVYFPVEMYISQKKIPKWSTRWVCLQILSIACLFITIAAAAGSIAGVVLDLKS  478

Query  299   YRPFKTSY  276
             ++PF T Y
Sbjct  479   FKPFATVY  486



>ref|XP_008227519.1| PREDICTED: amino acid permease 4 isoform X2 [Prunus mume]
Length=482

 Score =   754 bits (1946),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 377/482 (78%), Positives = 424/482 (88%), Gaps = 4/482 (1%)
 Frame = -3

Query  1712  ATKNHRHHLGVSIDA-PPLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSGVLSLAWAI  1536
             +  N++    +SID  P   G K  DDDGR +RTG+VWTASAHIITAVIGSGVLSLAWAI
Sbjct  2     SENNNQQVFDISIDVVPKNNGSKCFDDDGRLKRTGSVWTASAHIITAVIGSGVLSLAWAI  61

Query  1535  GQLGWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRNYTYMDAVRSNLGGYQVKIC  1356
              QLGW+AGPSVM LFS V YYTS LL+DCYR+GDP+ GKRNYTY+DAVRS LGG +VK C
Sbjct  62    AQLGWIAGPSVMFLFSFVSYYTSCLLSDCYRSGDPLTGKRNYTYIDAVRSILGGARVKAC  121

Query  1355  GLIQYFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFGIIEIILS  1176
             GLIQY NLFGIAIGYTIAAS+SMMAIKRSNCFHESGGK PCHMSSNPYMI FG+ E++LS
Sbjct  122   GLIQYLNLFGIAIGYTIAASVSMMAIKRSNCFHESGGKKPCHMSSNPYMILFGVTEVLLS  181

Query  1175  QIPDFDQIWWLSIVAAVMSFTYSGIGLGLGIAQVVAN--GAFKGSLTGISIGTVTETQKI  1002
             QIPDFDQIWWLSIVAAVMSFTYS IGL LGI +V +   G F+GSLTGISIGTVTETQK+
Sbjct  182   QIPDFDQIWWLSIVAAVMSFTYSSIGLALGIVKVASQSTGTFRGSLTGISIGTVTETQKM  241

Query  1001  WRSFQALGDIAFAYSYSIILIEIQDTVKSPPSESKTMRKASLFSTIVTTTFYMLCGCMGY  822
             WRSFQALGDIAFAYSYS+ILIEIQDT+K+PPSE+KTM+KA++ S  VTTTFYMLCGCMGY
Sbjct  242   WRSFQALGDIAFAYSYSVILIEIQDTIKAPPSEAKTMKKATVLSIAVTTTFYMLCGCMGY  301

Query  821   AAFGDDAPGNLLTGFGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEKWVGAKWPD  642
             AAFGD APGNLLTGFGFYNPFWLLDIANAAIV+HLVGAYQV+CQP+FAF+EKW   +WP+
Sbjct  302   AAFGDFAPGNLLTGFGFYNPFWLLDIANAAIVVHLVGAYQVFCQPIFAFVEKWAAQRWPE  361

Query  641   SEIITKEINLKIPGFGYPYKLNTFRLLWRTAFVLLTTVISMLLPFFNDVVGILGAFGFWP  462
             S++ITKE  + +PG    +KLN FRL+WRT FV+LTT+ISMLLPFFNDVVG+LGA GFWP
Sbjct  362   SKLITKEFQVPVPGLP-SFKLNLFRLVWRTKFVMLTTIISMLLPFFNDVVGLLGALGFWP  420

Query  461   LTVYFPVRMYISQKKIPKWSTRWICLQMlsgaclavslaaaagsfagvVLDLKLYRPFKT  282
             LTVYFPV MYI+QK+IPKWSTRWICLQMLS ACL +SL AAAGS AGV+LDLK+YRPFKT
Sbjct  421   LTVYFPVEMYIAQKQIPKWSTRWICLQMLSIACLVISLVAAAGSIAGVMLDLKVYRPFKT  480

Query  281   SY  276
             SY
Sbjct  481   SY  482



>ref|XP_009339426.1| PREDICTED: amino acid permease 3-like [Pyrus x bretschneideri]
 ref|XP_009339427.1| PREDICTED: amino acid permease 3-like [Pyrus x bretschneideri]
 ref|XP_009342935.1| PREDICTED: amino acid permease 3-like [Pyrus x bretschneideri]
Length=489

 Score =   754 bits (1947),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 379/490 (77%), Positives = 423/490 (86%), Gaps = 4/490 (1%)
 Frame = -3

Query  1736  MQMGESAAATKNHRHHLGV---SIDAPPLYGFKGLDDDGRPQRTGTVWTASAHIITAVIG  1566
             M MG++ A      HH  V   S+D PP  G K  DDDGR +RTGTVWT+SAHIITAVIG
Sbjct  1     MTMGDNTATKNQQLHHDQVFDFSVDMPPQGGSKCFDDDGRLKRTGTVWTSSAHIITAVIG  60

Query  1565  SGVLSLAWAIGQLGWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRNYTYMDAVRS  1386
             SGVLSLAWA  QLGWVAGPSVMLLFS V YYTSTLL+ CYR+GD + GKRNYTYMDAVRS
Sbjct  61    SGVLSLAWATAQLGWVAGPSVMLLFSFVTYYTSTLLSACYRSGDSITGKRNYTYMDAVRS  120

Query  1385  NLGGYQVKICGLIQYFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMI  1206
             NLGG +VKICG +QY NLFG++IGYTIA+SISMMAIKRSNCFH+SGGKNPC ++SNPYMI
Sbjct  121   NLGGAKVKICGYVQYLNLFGVSIGYTIASSISMMAIKRSNCFHKSGGKNPCRINSNPYMI  180

Query  1205  AFGIIEIILSQIPDFDQIWWLSIVAAVMSFTYSGIGLGLGIAQVVANGAFKGSLTGISIG  1026
             AFG+ EII SQIPDFDQ+WWLSIVAAVMSFTYS IGLGLGIAQV  NG   GS+TGISIG
Sbjct  181   AFGVTEIIFSQIPDFDQLWWLSIVAAVMSFTYSTIGLGLGIAQVAENGKIMGSMTGISIG  240

Query  1025  TVTETQKIWRSFQALGDIAFAYSYSIILIEIQDTVKSPPSESKTMRKASLFSTIVTTTFY  846
             TVT TQK+WRSFQALGDIAFAYSYS+ILIEIQDT++SPPSESKTM+KA+  S  VTT FY
Sbjct  241   TVTATQKMWRSFQALGDIAFAYSYSLILIEIQDTIRSPPSESKTMKKATQISVAVTTLFY  300

Query  845   MLCGCMGYAAFGDDAPGNLLTGFGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEK  666
             MLCGCMGYAAFGD +PGNLLTGFGFYNP+WLLDIANAAIVIHLVGAYQVY QPLFAF+EK
Sbjct  301   MLCGCMGYAAFGDLSPGNLLTGFGFYNPYWLLDIANAAIVIHLVGAYQVYAQPLFAFVEK  360

Query  665   WVGAKWPDSEIITKEINLKIPGFGYPYKLNTFRLLWRTAFVLLTTVISMLLPFFNDVVGI  486
                 K+PDSE ITK+I L+IPG G PY LN FR++WRTAFV++TTVISM+LPFFNDVVG+
Sbjct  361   TAAQKFPDSEFITKDIKLRIPGIG-PYNLNLFRMIWRTAFVVITTVISMILPFFNDVVGL  419

Query  485   LGAFGFWPLTVYFPVRMYISQKKIPKWSTRWICLQMlsgaclavslaaaagsfagvVLDL  306
             LGAFGFWPLTVYFPV MYI QK+IPKWSTRW+CLQ LS  CL +++AAAAGS AGVV DL
Sbjct  420   LGAFGFWPLTVYFPVEMYIVQKRIPKWSTRWLCLQTLSVGCLMITIAAAAGSIAGVVSDL  479

Query  305   KLYRPFKTSY  276
             K+Y+PF  SY
Sbjct  480   KVYKPFTASY  489



>emb|CDY21569.1| BnaC09g47230D [Brassica napus]
Length=485

 Score =   753 bits (1945),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 366/485 (75%), Positives = 419/485 (86%), Gaps = 0/485 (0%)
 Frame = -3

Query  1730  MGESAAATKNHRHHLGVSIDAPPLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSGVLS  1551
             MG +AAA  +H+HH    +  P    FK  DDDGR +RTGTVWTASAHIITAVIGSGVLS
Sbjct  1     MGATAAANNHHQHHQVFDMAVPQQPAFKCFDDDGRLKRTGTVWTASAHIITAVIGSGVLS  60

Query  1550  LAWAIGQLGWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRNYTYMDAVRSNLGGY  1371
             LAWAI QLGWVAGP+VMLLFS V  Y+STLL+DCYR GD V GKRNYTYMDAVRS LGG+
Sbjct  61    LAWAIAQLGWVAGPAVMLLFSLVTLYSSTLLSDCYRTGDAVSGKRNYTYMDAVRSILGGF  120

Query  1370  QVKICGLIQYFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFGII  1191
             + KICGLIQY NLFG+AIGYTIAASISMMAIKRSNCFH+SGGK+PCHMSSNPYMI FG+ 
Sbjct  121   KFKICGLIQYLNLFGVAIGYTIAASISMMAIKRSNCFHKSGGKDPCHMSSNPYMIIFGVT  180

Query  1190  EIILSQIPDFDQIWWLSIVAAVMSFTYSGIGLGLGIAQVVANGAFKGSLTGISIGTVTET  1011
             EI+LSQ+PDFDQIWW+SIVAAVMSFTYS IGL LGI QV ANG FKGSLTGISIG VT+T
Sbjct  181   EILLSQVPDFDQIWWISIVAAVMSFTYSAIGLSLGIVQVAANGVFKGSLTGISIGAVTQT  240

Query  1010  QKIWRSFQALGDIAFAYSYSIILIEIQDTVKSPPSESKTMRKASLFSTIVTTTFYMLCGC  831
             QKIWR+FQALGDIAFAYSYS++LIEIQDTV+SPPSESKTM+KA+  S  +TT FYMLCG 
Sbjct  241   QKIWRTFQALGDIAFAYSYSVVLIEIQDTVRSPPSESKTMKKATKLSIAITTIFYMLCGS  300

Query  830   MGYAAFGDDAPGNLLTGFGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEKWVGAK  651
             MGYAAFGD APGNLLTGFGFYNPFWLLDIANAAIV+HL+GAYQV+ QP+FAF EK    +
Sbjct  301   MGYAAFGDAAPGNLLTGFGFYNPFWLLDIANAAIVVHLIGAYQVFSQPIFAFAEKSASER  360

Query  650   WPDSEIITKEINLKIPGFGYPYKLNTFRLLWRTAFVLLTTVISMLLPFFNDVVGILGAFG  471
             +PD++++TKE+  KIPG   PYK N FR+++R +FV+LTTVISML+PFFNDVVGILGA G
Sbjct  361   FPDNDLLTKELEFKIPGLRSPYKTNVFRVVFRCSFVVLTTVISMLMPFFNDVVGILGALG  420

Query  470   FWPLTVYFPVRMYISQKKIPKWSTRWICLQMlsgaclavslaaaagsfagvVLDLKLYRP  291
             FWPLTVYFPV MYI Q+K+ KWS RW+CLQMLS +CL +S+ A  GS AGV+LDLK+Y+P
Sbjct  421   FWPLTVYFPVEMYIKQRKVEKWSLRWVCLQMLSVSCLVISVFAGVGSIAGVMLDLKVYKP  480

Query  290   FKTSY  276
             F+T+Y
Sbjct  481   FQTTY  485



>ref|XP_009122500.1| PREDICTED: amino acid permease 2 [Brassica rapa]
Length=485

 Score =   751 bits (1940),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 366/485 (75%), Positives = 418/485 (86%), Gaps = 0/485 (0%)
 Frame = -3

Query  1730  MGESAAATKNHRHHLGVSIDAPPLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSGVLS  1551
             MG +AA   +H  H    +  P    FK  DDDGR +RTGTVWTASAHIITAVIGSGVLS
Sbjct  1     MGATAAVNNHHHGHQVFDMAVPQQPAFKCFDDDGRLKRTGTVWTASAHIITAVIGSGVLS  60

Query  1550  LAWAIGQLGWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRNYTYMDAVRSNLGGY  1371
             LAWAI QLGWVAGP+VMLLFS V  Y+STLL+DCYR GD + GKRNYTYMDAVRS LGG+
Sbjct  61    LAWAIAQLGWVAGPAVMLLFSLVTLYSSTLLSDCYRTGDAISGKRNYTYMDAVRSILGGF  120

Query  1370  QVKICGLIQYFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFGII  1191
             + KICGLIQY NLFG+AIGYTIAASISMMAIKRSNCFH+SGGK+PCHMSSNPYMI FG+ 
Sbjct  121   KFKICGLIQYLNLFGVAIGYTIAASISMMAIKRSNCFHKSGGKDPCHMSSNPYMIIFGVT  180

Query  1190  EIILSQIPDFDQIWWLSIVAAVMSFTYSGIGLGLGIAQVVANGAFKGSLTGISIGTVTET  1011
             EI+LSQ+PDFDQIWW+SIVAAVMSFTYS IGL LGI QV ANG FKGSLTGISIG VT+T
Sbjct  181   EILLSQVPDFDQIWWISIVAAVMSFTYSAIGLSLGIVQVAANGVFKGSLTGISIGAVTQT  240

Query  1010  QKIWRSFQALGDIAFAYSYSIILIEIQDTVKSPPSESKTMRKASLFSTIVTTTFYMLCGC  831
             QKIWR+FQALGDIAFAYSYS++LIEIQDTV+SPPSESKTM+KA+  S  +TT FYMLCG 
Sbjct  241   QKIWRTFQALGDIAFAYSYSVVLIEIQDTVRSPPSESKTMKKATKLSIAITTIFYMLCGS  300

Query  830   MGYAAFGDDAPGNLLTGFGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEKWVGAK  651
             MGYAAFGD APGNLLTGFGFYNPFWLLDIANAAIV+HL+GAYQV+ QP+FAF EK V  +
Sbjct  301   MGYAAFGDAAPGNLLTGFGFYNPFWLLDIANAAIVVHLIGAYQVFSQPIFAFAEKSVSER  360

Query  650   WPDSEIITKEINLKIPGFGYPYKLNTFRLLWRTAFVLLTTVISMLLPFFNDVVGILGAFG  471
             +PD++++TKE+  KIPGF  PYK N FR+++R  FV+LTTVISML+PFFNDVVGILGA G
Sbjct  361   FPDNDLLTKELEFKIPGFRSPYKTNVFRVVFRCCFVVLTTVISMLMPFFNDVVGILGALG  420

Query  470   FWPLTVYFPVRMYISQKKIPKWSTRWICLQMlsgaclavslaaaagsfagvVLDLKLYRP  291
             FWPLTVYFPV MYI Q+K+ KWSTRW+CLQMLS +CL +S+ A  GS AGV+LDLK+Y+P
Sbjct  421   FWPLTVYFPVEMYIKQRKVEKWSTRWVCLQMLSVSCLVISVVAGVGSIAGVMLDLKVYKP  480

Query  290   FKTSY  276
             F+T+Y
Sbjct  481   FQTTY  485



>emb|CDX69918.1| BnaA10g22670D [Brassica napus]
Length=485

 Score =   751 bits (1940),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 367/485 (76%), Positives = 418/485 (86%), Gaps = 0/485 (0%)
 Frame = -3

Query  1730  MGESAAATKNHRHHLGVSIDAPPLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSGVLS  1551
             MG +AAA  +H  H    +  P    FK  DDDGR +RTGTVWTASAHIITAVIGSGVLS
Sbjct  1     MGATAAANNHHHGHQVFDMAVPQQPAFKCFDDDGRLKRTGTVWTASAHIITAVIGSGVLS  60

Query  1550  LAWAIGQLGWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRNYTYMDAVRSNLGGY  1371
             LAWAI QLGWVAGP+VMLLFS V  Y+STLL+DCYR GD V GKRNYTYMDAVRS LGG+
Sbjct  61    LAWAIAQLGWVAGPAVMLLFSLVTLYSSTLLSDCYRTGDAVSGKRNYTYMDAVRSILGGF  120

Query  1370  QVKICGLIQYFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFGII  1191
             + KICGLIQY NLFG+AIGYTIAASISMMAIKRSNCFH+SGGK+PCHMSSNPYMI FG+ 
Sbjct  121   KFKICGLIQYLNLFGVAIGYTIAASISMMAIKRSNCFHKSGGKDPCHMSSNPYMIIFGVT  180

Query  1190  EIILSQIPDFDQIWWLSIVAAVMSFTYSGIGLGLGIAQVVANGAFKGSLTGISIGTVTET  1011
             EI+LSQ+PDFDQIWW+SIVAAVMSFTYS IGL LGI QV ANG FKGSLTGISIG VT+T
Sbjct  181   EILLSQVPDFDQIWWISIVAAVMSFTYSAIGLSLGIVQVAANGVFKGSLTGISIGAVTQT  240

Query  1010  QKIWRSFQALGDIAFAYSYSIILIEIQDTVKSPPSESKTMRKASLFSTIVTTTFYMLCGC  831
             QKIWR+FQALGDIAFAYSYS++LIEIQDTV+SPPSESKTM+KA+  S  +TT FYMLCG 
Sbjct  241   QKIWRTFQALGDIAFAYSYSVVLIEIQDTVRSPPSESKTMKKATKLSIAITTIFYMLCGS  300

Query  830   MGYAAFGDDAPGNLLTGFGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEKWVGAK  651
             MGYAAFGD APGNLLTGFGFYNPFWLLDIANAAIV+HL+GAYQV+ QP+FAF EK    +
Sbjct  301   MGYAAFGDAAPGNLLTGFGFYNPFWLLDIANAAIVVHLIGAYQVFSQPIFAFAEKSASER  360

Query  650   WPDSEIITKEINLKIPGFGYPYKLNTFRLLWRTAFVLLTTVISMLLPFFNDVVGILGAFG  471
             +PD++++TKE+  KIPGF  PYK N FR+++R  FV+LTTVISML+PFFNDVVGILGA G
Sbjct  361   FPDNDLLTKELVFKIPGFRSPYKTNVFRVVFRCCFVVLTTVISMLMPFFNDVVGILGALG  420

Query  470   FWPLTVYFPVRMYISQKKIPKWSTRWICLQMlsgaclavslaaaagsfagvVLDLKLYRP  291
             FWPLTVYFPV MYI Q+K+ KWSTRW+CLQMLS +CL +S+ A  GS AGV+LDLK+Y+P
Sbjct  421   FWPLTVYFPVEMYIKQRKVEKWSTRWVCLQMLSVSCLVISVVAGVGSIAGVMLDLKVYKP  480

Query  290   FKTSY  276
             F+T+Y
Sbjct  481   FQTTY  485



>ref|XP_007019167.1| Amino acid permease isoform 1 [Theobroma cacao]
 gb|EOY16392.1| Amino acid permease isoform 1 [Theobroma cacao]
Length=486

 Score =   751 bits (1938),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 384/488 (79%), Positives = 424/488 (87%), Gaps = 5/488 (1%)
 Frame = -3

Query  1730  MGESAAATKNHRHH---LGVSIDAPPLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSG  1560
             M E+ A  KNH  H     +SID  P  G K  D+DGR +RTGTVWTASAHIITAVIGSG
Sbjct  1     MAENGAG-KNHLQHNQVFDLSIDVLPQGGSKCFDEDGRLKRTGTVWTASAHIITAVIGSG  59

Query  1559  VLSLAWAIGQLGWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRNYTYMDAVRSNL  1380
             VLSLAWA  QLGWVAGP+VM LFS V YYTSTLLA CYR+GDP+ GKRNYTYMDAVRSNL
Sbjct  60    VLSLAWATAQLGWVAGPAVMFLFSFVTYYTSTLLAACYRSGDPINGKRNYTYMDAVRSNL  119

Query  1379  GGYQVKICGLIQYFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAF  1200
             GG++VKICG +QY NLFG+AIGYTIA+SISMMAIKRSNCFH SGGKNPCH++SNPYMIAF
Sbjct  120   GGFKVKICGWVQYLNLFGVAIGYTIASSISMMAIKRSNCFHASGGKNPCHLNSNPYMIAF  179

Query  1199  GIIEIILSQIPDFDQIWWLSIVAAVMSFTYSGIGLGLGIAQVVANGAFKGSLTGISIGTV  1020
             GI+EII SQIP FDQ+WWLSIVAAVMSFTYS IGLGLGIA+V   G  +GSLTGIS+GTV
Sbjct  180   GIVEIIFSQIPGFDQLWWLSIVAAVMSFTYSTIGLGLGIAKVAETGKVRGSLTGISVGTV  239

Query  1019  TETQKIWRSFQALGDIAFAYSYSIILIEIQDTVKSPPSESKTMRKASLFSTIVTTTFYML  840
             T+TQKIWRSFQALGDIAFAYSYS+ILIEIQDT+K+PPSESKTM+KASL S  VTT FYML
Sbjct  240   TQTQKIWRSFQALGDIAFAYSYSLILIEIQDTLKAPPSESKTMKKASLISVAVTTLFYML  299

Query  839   CGCMGYAAFGDDAPGNLLTGFGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEKWV  660
             CGCMGYAAFGD +PGNLLTGFGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEK  
Sbjct  300   CGCMGYAAFGDLSPGNLLTGFGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEKKA  359

Query  659   GAKWPDSEIITKEINLKIPGFGYPYKLNTFRLLWRTAFVLLTTVISMLLPFFNDVVGILG  480
               K+PDSE ITK+I + IPGF   Y LN FRL+WRT FV+ TT+ISMLLPFFND+VG+LG
Sbjct  360   AEKFPDSEFITKDIKISIPGF-RAYNLNLFRLVWRTLFVISTTLISMLLPFFNDIVGLLG  418

Query  479   AFGFWPLTVYFPVRMYISQKKIPKWSTRWICLQMlsgaclavslaaaagsfagvVLDLKL  300
             A GFWPLTVYFPV MYIS+KKIPKWSTRW+CLQ+LS ACL +++AAAAGS AGVVLDLK 
Sbjct  419   ALGFWPLTVYFPVEMYISKKKIPKWSTRWLCLQILSIACLIITIAAAAGSIAGVVLDLKS  478

Query  299   YRPFKTSY  276
             Y+PF T Y
Sbjct  479   YKPFSTDY  486



>ref|XP_011031114.1| PREDICTED: amino acid permease 4-like isoform X2 [Populus euphratica]
Length=493

 Score =   750 bits (1936),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 382/495 (77%), Positives = 422/495 (85%), Gaps = 10/495 (2%)
 Frame = -3

Query  1736  MQMGESAAATKNHR--------HHLGVSIDAPPLYGFKGLDDDGRPQRTGTVWTASAHII  1581
             MQMGE+AA+   H             VS+D  P  G K  DDDGR +RTGT+WTAS+HII
Sbjct  1     MQMGENAASKNYHNNHHLHNHHQVFDVSVDVLPQNGSKCYDDDGRLKRTGTLWTASSHII  60

Query  1580  TAVIGSGVLSLAWAIGQLGWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRNYTYM  1401
             TAVIGSGVLSLAWAI QLGW+AGP+VM LFS V YYTS+LL DCYR GDP  G+RNYTYM
Sbjct  61    TAVIGSGVLSLAWAIAQLGWIAGPAVMFLFSLVTYYTSSLLTDCYRTGDPYTGERNYTYM  120

Query  1400  DAVRSNLGGYQVKICGLIQYFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSS  1221
             DAV+S LG  +V +CGL+QY  LFGIAIGYTIA+SISMMAIKRSNCFH+SGG+NPCH+SS
Sbjct  121   DAVQSILG-VKVNLCGLVQYIGLFGIAIGYTIASSISMMAIKRSNCFHQSGGQNPCHISS  179

Query  1220  NPYMIAFGIIEIILSQIPDFDQIWWLSIVAAVMSFTYSGIGLGLGIAQVVANGAFKGSLT  1041
             NPYMI FGI EI+LSQIPDFDQ+WWLSIVAAVMSFTYS IGLGLGI +V  NG FKGSLT
Sbjct  180   NPYMIMFGITEILLSQIPDFDQLWWLSIVAAVMSFTYSSIGLGLGIGKVAVNGTFKGSLT  239

Query  1040  GISIGTVTETQKIWRSFQALGDIAFAYSYSIILIEIQDTVKSPPSESKTMRKASLFSTIV  861
             GISIGTVTET+KIWRSFQALG IAFAYSYS+ILIEIQDT+KSPP+ESKTM+KA+  S +V
Sbjct  240   GISIGTVTETEKIWRSFQALGAIAFAYSYSVILIEIQDTIKSPPAESKTMKKAAKISIVV  299

Query  860   TTTFYMLCGCMGYAAFGDDAPGNLLTGFGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLF  681
             TTTFYMLCGCMGYAAFG+ APGNLLTGFGFYNP+WL+DIAN AIVIHL+GAYQV+CQPLF
Sbjct  300   TTTFYMLCGCMGYAAFGEQAPGNLLTGFGFYNPYWLIDIANVAIVIHLIGAYQVFCQPLF  359

Query  680   AFIEKWVGAKWPDSEIITKEINLKIPGFGYPYKLNTFRLLWRTAFVLLTTVISMLLPFFN  501
             AFIEKW   KWP++  ITKE  + +PGF  PY LN FRL+WRT FVLLTTVISMLLPFFN
Sbjct  360   AFIEKWANQKWPENYFITKEFRIPVPGF-RPYNLNLFRLVWRTIFVLLTTVISMLLPFFN  418

Query  500   DVVGILGAFGFWPLTVYFPVRMYISQKKIPKWSTRWICLQMlsgaclavslaaaagsfag  321
             DVVGILGA GFWPLTVYFPV MYI QKKIPKWSTRWICLQMLS ACL +SL A AGS AG
Sbjct  419   DVVGILGALGFWPLTVYFPVEMYIVQKKIPKWSTRWICLQMLSMACLVISLVAVAGSIAG  478

Query  320   vVLDLKLYRPFKTSY  276
             VVLDLK Y+PFKTSY
Sbjct  479   VVLDLKAYKPFKTSY  493



>emb|CAF22024.1| amino acid permease [Brassica napus]
Length=487

 Score =   749 bits (1933),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 373/487 (77%), Positives = 424/487 (87%), Gaps = 2/487 (0%)
 Frame = -3

Query  1730  MGESAAATKNHRHHLGVSIDA--PPLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSGV  1557
             MGE+AAA  +H HH     DA  PP   FK  DDDGR +RTGTVWTASAHIITAVIGSGV
Sbjct  1     MGETAAANHHHHHHGHQVFDAYVPPQPAFKCFDDDGRLKRTGTVWTASAHIITAVIGSGV  60

Query  1556  LSLAWAIGQLGWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRNYTYMDAVRSNLG  1377
             LSLAWAI QLGWVAGP+VML+FS V  Y+STLL+DCYR GD V GKRNYTYMDAVRS LG
Sbjct  61    LSLAWAIAQLGWVAGPAVMLVFSLVTLYSSTLLSDCYRTGDAVSGKRNYTYMDAVRSILG  120

Query  1376  GYQVKICGLIQYFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFG  1197
             G++ KICGLIQY NLFGIAIGYTIAASISMMAIKRSNCFH+SGGK+PCHMSSNPYMI FG
Sbjct  121   GFKFKICGLIQYLNLFGIAIGYTIAASISMMAIKRSNCFHKSGGKDPCHMSSNPYMIIFG  180

Query  1196  IIEIILSQIPDFDQIWWLSIVAAVMSFTYSGIGLGLGIAQVVANGAFKGSLTGISIGTVT  1017
             + EI+LSQ+PDFDQIWW+SIVAAVMSFTYS IGL LGI QV ANG FKGSLTGISIGTVT
Sbjct  181   VTEILLSQVPDFDQIWWISIVAAVMSFTYSAIGLALGIVQVAANGVFKGSLTGISIGTVT  240

Query  1016  ETQKIWRSFQALGDIAFAYSYSIILIEIQDTVKSPPSESKTMRKASLFSTIVTTTFYMLC  837
             +TQKIWR+FQALGDIAFAYSYS++LIEIQDTV+SPPSESKTM+KA+  S  +TT FYMLC
Sbjct  241   QTQKIWRTFQALGDIAFAYSYSVVLIEIQDTVRSPPSESKTMKKATKLSIAITTIFYMLC  300

Query  836   GCMGYAAFGDDAPGNLLTGFGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEKWVG  657
             G MGYAAFGD APGNLLTGFGFYNPFWLLDIANAAIV+HL+GAYQV+ QP+FAF EK   
Sbjct  301   GSMGYAAFGDAAPGNLLTGFGFYNPFWLLDIANAAIVVHLIGAYQVFSQPIFAFAEKSAS  360

Query  656   AKWPDSEIITKEINLKIPGFGYPYKLNTFRLLWRTAFVLLTTVISMLLPFFNDVVGILGA  477
              ++PD++++TKE+  KIPGF  PYK N FR+++R +FV+LTTVISML+PFFNDVVGILGA
Sbjct  361   ERFPDNDLLTKELEFKIPGFRSPYKTNVFRVVFRCSFVVLTTVISMLMPFFNDVVGILGA  420

Query  476   FGFWPLTVYFPVRMYISQKKIPKWSTRWICLQMlsgaclavslaaaagsfagvVLDLKLY  297
              GFWPLTVYFPV MYI Q+K+ KWSTRW+CLQMLS ACL +S+ A  GS AGV+LDLK+Y
Sbjct  421   LGFWPLTVYFPVEMYIKQRKVEKWSTRWVCLQMLSVACLVISVVAGVGSIAGVMLDLKVY  480

Query  296   RPFKTSY  276
             +PF+++Y
Sbjct  481   KPFQSTY  487



>ref|XP_008338673.1| PREDICTED: amino acid permease 3-like [Malus domestica]
Length=489

 Score =   748 bits (1932),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 376/490 (77%), Positives = 421/490 (86%), Gaps = 4/490 (1%)
 Frame = -3

Query  1736  MQMGESAAATKNHRHHLGV---SIDAPPLYGFKGLDDDGRPQRTGTVWTASAHIITAVIG  1566
             M MG++ A      HH  V   S+D PP  G K  DDDGR +RTGTVWT+SAHIITAVIG
Sbjct  1     MTMGDNTATKNQQLHHHQVFDFSVDMPPQGGSKXFDDDGRLKRTGTVWTSSAHIITAVIG  60

Query  1565  SGVLSLAWAIGQLGWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRNYTYMDAVRS  1386
             SGVLSLAWA  QLGWVAGPSVMLLFS V YYTSTLL+ CYR+GD V GKRNYTYMDAVRS
Sbjct  61    SGVLSLAWATAQLGWVAGPSVMLLFSFVTYYTSTLLSACYRSGDSVXGKRNYTYMDAVRS  120

Query  1385  NLGGYQVKICGLIQYFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMI  1206
             NLGG +VKICG +QY NLFG++IGYTIA+SISMMAIKRSNCFH+SGGKNPC ++SNPYMI
Sbjct  121   NLGGAKVKICGYVQYLNLFGVSIGYTIASSISMMAIKRSNCFHKSGGKNPCRINSNPYMI  180

Query  1205  AFGIIEIILSQIPDFDQIWWLSIVAAVMSFTYSGIGLGLGIAQVVANGAFKGSLTGISIG  1026
             AFG+ EII SQIPDFDQ+WWLSIVAAVMSFTYS IGLGLGIAQV  NG   GS+TGI+IG
Sbjct  181   AFGVTEIIFSQIPDFDQLWWLSIVAAVMSFTYSTIGLGLGIAQVAENGKIMGSMTGINIG  240

Query  1025  TVTETQKIWRSFQALGDIAFAYSYSIILIEIQDTVKSPPSESKTMRKASLFSTIVTTTFY  846
             TVT TQK WRSFQALGDIAFAYSYS+ILIEIQDT++SPPSESKTM+KA+  S  VTT FY
Sbjct  241   TVTATQKXWRSFQALGDIAFAYSYSLILIEIQDTIRSPPSESKTMKKATQISVAVTTLFY  300

Query  845   MLCGCMGYAAFGDDAPGNLLTGFGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEK  666
             MLCGCMGYAAFGD +PGNLLTGFGFYNP+WLLDIANAAIVIHLVGAYQVY QPLF+F+EK
Sbjct  301   MLCGCMGYAAFGDLSPGNLLTGFGFYNPYWLLDIANAAIVIHLVGAYQVYAQPLFSFVEK  360

Query  665   WVGAKWPDSEIITKEINLKIPGFGYPYKLNTFRLLWRTAFVLLTTVISMLLPFFNDVVGI  486
                 ++PDSE ITK+I L+IPG G PY LN FR++WRTAFV++TTVISM+LPFFNDVVG+
Sbjct  361   TAAQRFPDSEFITKDIKLRIPGIG-PYNLNLFRMIWRTAFVVITTVISMILPFFNDVVGL  419

Query  485   LGAFGFWPLTVYFPVRMYISQKKIPKWSTRWICLQMlsgaclavslaaaagsfagvVLDL  306
             LGAFGFWPLTVYFPV MYI Q +IPKWSTRW+CLQ LS  CL +++AAAAGS AGVV DL
Sbjct  420   LGAFGFWPLTVYFPVEMYIVQXRIPKWSTRWLCLQTLSVGCLIITIAAAAGSIAGVVSDL  479

Query  305   KLYRPFKTSY  276
             K+Y+PF  SY
Sbjct  480   KVYKPFTASY  489



>ref|XP_006434261.1| hypothetical protein CICLE_v10000991mg [Citrus clementina]
 gb|ESR47501.1| hypothetical protein CICLE_v10000991mg [Citrus clementina]
Length=480

 Score =   748 bits (1931),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 383/479 (80%), Positives = 420/479 (88%), Gaps = 4/479 (1%)
 Frame = -3

Query  1712  ATKNHRHHLGVSIDAPPLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSGVLSLAWAIG  1533
             A KN      VS+   P  G K  DDDGR +RTGT+WTASAHIITAVIGSGVLSLAWA  
Sbjct  6     AAKNQHQVFDVSL---PESGPKCFDDDGRLKRTGTLWTASAHIITAVIGSGVLSLAWATA  62

Query  1532  QLGWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRNYTYMDAVRSNLGGYQVKICG  1353
             QLGW+AGPSVM LFS V YYTSTLLA CYR+GDPV GKRNYTY+DAVRSNLGG+QVKICG
Sbjct  63    QLGWIAGPSVMFLFSFVTYYTSTLLAACYRSGDPVTGKRNYTYVDAVRSNLGGFQVKICG  122

Query  1352  LIQYFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFGIIEIILSQ  1173
             L+QY NLFG+AIGYTIA+SISMMAI+RSNCFH  G KNPCHM+SNPYMIAFGI+EI+LSQ
Sbjct  123   LVQYLNLFGVAIGYTIASSISMMAIERSNCFHSKGDKNPCHMNSNPYMIAFGIVEIVLSQ  182

Query  1172  IPDFDQIWWLSIVAAVMSFTYSGIGLGLGIAQVVANGAFKGSLTGISIGTVTETQKIWRS  993
             IPDFDQ+WWLSIVAAVMSFTYS IGLGLGIA+V   G F+GSLTGISIGTV+ETQKIWRS
Sbjct  183   IPDFDQLWWLSIVAAVMSFTYSTIGLGLGIAKVAETGKFRGSLTGISIGTVSETQKIWRS  242

Query  992   FQALGDIAFAYSYSIILIEIQDTVKSPPSESKTMRKASLFSTIVTTTFYMLCGCMGYAAF  813
             FQALGDIAFAYSYSIILIEIQDTVKSPPSESKTM+KASL S  VTT FYMLCGC GYAAF
Sbjct  243   FQALGDIAFAYSYSIILIEIQDTVKSPPSESKTMKKASLISVGVTTLFYMLCGCFGYAAF  302

Query  812   GDDAPGNLLTGFGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEKWVGAKWPDSEI  633
             GD +PGNLLTGFGFYNP+WLLDIANAAIVIHLVGAYQV+CQPLFAFIEK    ++PDSE 
Sbjct  303   GDLSPGNLLTGFGFYNPYWLLDIANAAIVIHLVGAYQVFCQPLFAFIEKQAHQRFPDSEF  362

Query  632   ITKEINLKIPGFGYPYKLNTFRLLWRTAFVLLTTVISMLLPFFNDVVGILGAFGFWPLTV  453
             ITK+I + IPGF   Y LN FRL+WRT FV+LTTVISMLLPFFNDVVG+LGA GFWPLTV
Sbjct  363   ITKDIKVPIPGFKC-YNLNLFRLVWRTIFVILTTVISMLLPFFNDVVGLLGALGFWPLTV  421

Query  452   YFPVRMYISQKKIPKWSTRWICLQMlsgaclavslaaaagsfagvVLDLKLYRPFKTSY  276
             YFPV MYI+QKKIPKWST+W+CLQ+LS ACL +++AAAAGS AGVV DLK Y+PF TSY
Sbjct  422   YFPVEMYIAQKKIPKWSTKWLCLQILSVACLIITIAAAAGSIAGVVTDLKSYKPFSTSY  480



>ref|XP_006399392.1| hypothetical protein EUTSA_v10013363mg [Eutrema salsugineum]
 gb|ESQ40845.1| hypothetical protein EUTSA_v10013363mg [Eutrema salsugineum]
Length=492

 Score =   747 bits (1928),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 372/492 (76%), Positives = 427/492 (87%), Gaps = 7/492 (1%)
 Frame = -3

Query  1730  MGESAAATKNHRHHLGVSI-DA------PPLYGFKGLDDDGRPQRTGTVWTASAHIITAV  1572
             MGE+AAA  +H HH G  + DA      PP   FK  DDDGR +RTGTVWTASAHI+TAV
Sbjct  1     MGETAAAKNHHHHHHGHQVFDAAIHDVVPPQPAFKCFDDDGRLKRTGTVWTASAHIVTAV  60

Query  1571  IGSGVLSLAWAIGQLGWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRNYTYMDAV  1392
             IGSGVLSLAWAI QLGW+AGP+VMLLFS V  Y+STLL+DCYR GD V GKRNYTYMDAV
Sbjct  61    IGSGVLSLAWAIAQLGWIAGPAVMLLFSLVTLYSSTLLSDCYRTGDAVSGKRNYTYMDAV  120

Query  1391  RSNLGGYQVKICGLIQYFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPY  1212
             RS LGG++ KICGLIQY NLFGIAIGYTIAASISMMAIKRSNCFH+SGGK+PCHMSSNPY
Sbjct  121   RSILGGFKFKICGLIQYLNLFGIAIGYTIAASISMMAIKRSNCFHKSGGKDPCHMSSNPY  180

Query  1211  MIAFGIIEIILSQIPDFDQIWWLSIVAAVMSFTYSGIGLGLGIAQVVANGAFKGSLTGIS  1032
             MI FG+ EI+LSQIPDFDQIWW+SIVAAVMSFTYS IGL LGI QV ANG FKGSLTGIS
Sbjct  181   MIIFGVTEILLSQIPDFDQIWWISIVAAVMSFTYSAIGLALGIVQVAANGVFKGSLTGIS  240

Query  1031  IGTVTETQKIWRSFQALGDIAFAYSYSIILIEIQDTVKSPPSESKTMRKASLFSTIVTTT  852
             IGTVT+TQKIWR+FQALGDIAFAYSYS++LIEIQDTV+SPP+ESKTM+KA+  S  VTT 
Sbjct  241   IGTVTQTQKIWRTFQALGDIAFAYSYSVVLIEIQDTVRSPPAESKTMKKATKISIAVTTV  300

Query  851   FYMLCGCMGYAAFGDDAPGNLLTGFGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAFI  672
             FYMLCG MGYAAFGD APGNLLTGFGFYNPFWLLD+ANAAIV+HL+GAYQV+ QP+FAF+
Sbjct  301   FYMLCGSMGYAAFGDAAPGNLLTGFGFYNPFWLLDVANAAIVVHLIGAYQVFSQPIFAFV  360

Query  671   EKWVGAKWPDSEIITKEINLKIPGFGYPYKLNTFRLLWRTAFVLLTTVISMLLPFFNDVV  492
             EK V  ++PD++++TKE  +K+PGF  PY+ N FR+++R  FV+LTTVISML+PFFNDVV
Sbjct  361   EKSVSERFPDNDLVTKEFKIKVPGFKSPYRANVFRVVFRCCFVVLTTVISMLMPFFNDVV  420

Query  491   GILGAFGFWPLTVYFPVRMYISQKKIPKWSTRWICLQMlsgaclavslaaaagsfagvVL  312
             GILGA GFWPLTVYFPV MYI Q+K+ KWSTRW+CLQMLS ACL +S+ A  GS AGV+L
Sbjct  421   GILGALGFWPLTVYFPVEMYIKQRKVEKWSTRWVCLQMLSVACLVISVVAGVGSIAGVML  480

Query  311   DLKLYRPFKTSY  276
             DLK+Y+PF+++Y
Sbjct  481   DLKVYKPFQSTY  492



>ref|NP_196484.1| amino acid permease 2 [Arabidopsis thaliana]
 sp|Q38967.1|AAP2_ARATH RecName: Full=Amino acid permease 2; AltName: Full=Amino acid 
transporter AAP2 [Arabidopsis thaliana]
 emb|CAA50672.1| amine acid permease [Arabidopsis thaliana]
 emb|CAC05448.1| amino acid transport protein AAP2 [Arabidopsis thaliana]
 gb|AAL91247.1| AT5g09220/T5E8_20 [Arabidopsis thaliana]
 gb|AED91352.1| amino acid permease 2 [Arabidopsis thaliana]
Length=493

 Score =   747 bits (1928),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 369/493 (75%), Positives = 421/493 (85%), Gaps = 8/493 (2%)
 Frame = -3

Query  1730  MGESAAATKN--------HRHHLGVSIDAPPLYGFKGLDDDGRPQRTGTVWTASAHIITA  1575
             MGE+AAA  +            +      PP   FK  DDDGR +RTGTVWTASAHIITA
Sbjct  1     MGETAAANNHRHHHHHGHQVFDVASHDFVPPQPAFKCFDDDGRLKRTGTVWTASAHIITA  60

Query  1574  VIGSGVLSLAWAIGQLGWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRNYTYMDA  1395
             VIGSGVLSLAWAI QLGW+AGP+VMLLFS V  Y+STLL+DCYR GD V GKRNYTYMDA
Sbjct  61    VIGSGVLSLAWAIAQLGWIAGPAVMLLFSLVTLYSSTLLSDCYRTGDAVSGKRNYTYMDA  120

Query  1394  VRSNLGGYQVKICGLIQYFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNP  1215
             VRS LGG++ KICGLIQY NLFGIAIGYTIAASISMMAIKRSNCFH+SGGK+PCHMSSNP
Sbjct  121   VRSILGGFKFKICGLIQYLNLFGIAIGYTIAASISMMAIKRSNCFHKSGGKDPCHMSSNP  180

Query  1214  YMIAFGIIEIILSQIPDFDQIWWLSIVAAVMSFTYSGIGLGLGIAQVVANGAFKGSLTGI  1035
             YMI FG+ EI+LSQ+PDFDQIWW+SIVAAVMSFTYS IGL LGI QV ANG FKGSLTGI
Sbjct  181   YMIVFGVAEILLSQVPDFDQIWWISIVAAVMSFTYSAIGLALGIVQVAANGVFKGSLTGI  240

Query  1034  SIGTVTETQKIWRSFQALGDIAFAYSYSIILIEIQDTVKSPPSESKTMRKASLFSTIVTT  855
             SIGTVT+TQKIWR+FQALGDIAFAYSYS++LIEIQDTV+SPP+ESKTM+KA+  S  VTT
Sbjct  241   SIGTVTQTQKIWRTFQALGDIAFAYSYSVVLIEIQDTVRSPPAESKTMKKATKISIAVTT  300

Query  854   TFYMLCGCMGYAAFGDDAPGNLLTGFGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAF  675
              FYMLCG MGYAAFGD APGNLLTGFGFYNPFWLLDIANAAIV+HLVGAYQV+ QP+FAF
Sbjct  301   IFYMLCGSMGYAAFGDAAPGNLLTGFGFYNPFWLLDIANAAIVVHLVGAYQVFAQPIFAF  360

Query  674   IEKWVGAKWPDSEIITKEINLKIPGFGYPYKLNTFRLLWRTAFVLLTTVISMLLPFFNDV  495
             IEK V  ++PD++ ++KE  ++IPGF  PYK+N FR+++R+ FV+ TTVISML+PFFNDV
Sbjct  361   IEKSVAERYPDNDFLSKEFEIRIPGFKSPYKVNVFRMVYRSGFVVTTTVISMLMPFFNDV  420

Query  494   VGILGAFGFWPLTVYFPVRMYISQKKIPKWSTRWICLQMlsgaclavslaaaagsfagvV  315
             VGILGA GFWPLTVYFPV MYI Q+K+ KWSTRW+CLQMLS ACL +S+ A  GS AGV+
Sbjct  421   VGILGALGFWPLTVYFPVEMYIKQRKVEKWSTRWVCLQMLSVACLVISVVAGVGSIAGVM  480

Query  314   LDLKLYRPFKTSY  276
             LDLK+Y+PFK++Y
Sbjct  481   LDLKVYKPFKSTY  493



>ref|XP_002871360.1| hypothetical protein ARALYDRAFT_487723 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH47619.1| hypothetical protein ARALYDRAFT_487723 [Arabidopsis lyrata subsp. 
lyrata]
Length=493

 Score =   747 bits (1928),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 370/493 (75%), Positives = 421/493 (85%), Gaps = 8/493 (2%)
 Frame = -3

Query  1730  MGESAAATKN--------HRHHLGVSIDAPPLYGFKGLDDDGRPQRTGTVWTASAHIITA  1575
             MGE+AAA  +            +      PP   FK  DDDGR +RTGTVWTASAHIITA
Sbjct  1     MGETAAANNHRHHHHHGHQVFDVASHDVVPPQPAFKCFDDDGRLKRTGTVWTASAHIITA  60

Query  1574  VIGSGVLSLAWAIGQLGWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRNYTYMDA  1395
             VIGSGVLSLAWAI QLGW+AGP+VMLLFS V  Y+STLL+DCYR GD V GKRNYTYMDA
Sbjct  61    VIGSGVLSLAWAIAQLGWIAGPAVMLLFSFVTLYSSTLLSDCYRTGDAVSGKRNYTYMDA  120

Query  1394  VRSNLGGYQVKICGLIQYFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNP  1215
             VRS LGG++ KICGLIQY NLFGIAIGYTIAASISMMAIKRSNCFH+SGGK+PCHMSSNP
Sbjct  121   VRSILGGFKFKICGLIQYLNLFGIAIGYTIAASISMMAIKRSNCFHKSGGKDPCHMSSNP  180

Query  1214  YMIAFGIIEIILSQIPDFDQIWWLSIVAAVMSFTYSGIGLGLGIAQVVANGAFKGSLTGI  1035
             YMIAFG+ EI+LSQ+PDFDQIWW+SIVAAVMSFTYS IGL LGI QV ANG FKGSLTGI
Sbjct  181   YMIAFGVAEILLSQVPDFDQIWWISIVAAVMSFTYSAIGLALGIVQVAANGVFKGSLTGI  240

Query  1034  SIGTVTETQKIWRSFQALGDIAFAYSYSIILIEIQDTVKSPPSESKTMRKASLFSTIVTT  855
             SIGTVT+TQKIWR+FQALGDIAFAYSYS++LIEIQDTV+SPP+ESKTM+KA+  S  VTT
Sbjct  241   SIGTVTQTQKIWRTFQALGDIAFAYSYSVVLIEIQDTVRSPPAESKTMKKATKISIAVTT  300

Query  854   TFYMLCGCMGYAAFGDDAPGNLLTGFGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAF  675
              FYMLCG MGYAAFGD APGNLLTGFGFYNPFWLLDIANAAIV+HL+GAYQV+ QP+FAF
Sbjct  301   IFYMLCGSMGYAAFGDAAPGNLLTGFGFYNPFWLLDIANAAIVVHLIGAYQVFAQPIFAF  360

Query  674   IEKWVGAKWPDSEIITKEINLKIPGFGYPYKLNTFRLLWRTAFVLLTTVISMLLPFFNDV  495
             IEK V  ++PD++ ++KE  +KIPGF  PYK N FR+++R+ FV+ TTVISML+PFFNDV
Sbjct  361   IEKSVAERYPDNDFLSKEFEIKIPGFKSPYKANVFRVVYRSGFVVTTTVISMLMPFFNDV  420

Query  494   VGILGAFGFWPLTVYFPVRMYISQKKIPKWSTRWICLQMlsgaclavslaaaagsfagvV  315
             VGILGA GFWPLTVYFPV MYI Q+K+ KWSTRW+CLQMLS ACL +S+ A  GS AGV+
Sbjct  421   VGILGALGFWPLTVYFPVEMYIKQRKVEKWSTRWVCLQMLSVACLVISVVAGVGSIAGVM  480

Query  314   LDLKLYRPFKTSY  276
             LDLK+Y+PFK++Y
Sbjct  481   LDLKVYKPFKSTY  493



>ref|XP_010452897.1| PREDICTED: amino acid permease 2 [Camelina sativa]
Length=493

 Score =   746 bits (1925),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 371/493 (75%), Positives = 419/493 (85%), Gaps = 8/493 (2%)
 Frame = -3

Query  1730  MGESAAATKN--------HRHHLGVSIDAPPLYGFKGLDDDGRPQRTGTVWTASAHIITA  1575
             MGE+AAA ++            +  S   PP   FK  DDDGR +RTGTVWTASAHIITA
Sbjct  1     MGETAAANRHHHNHHHGHQVFDVASSDVVPPQPAFKCFDDDGRLKRTGTVWTASAHIITA  60

Query  1574  VIGSGVLSLAWAIGQLGWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRNYTYMDA  1395
             VIGSGVLSLAWAI QLGW+AGP+VMLLFS V  Y+STLL+DCYR GD V GKRNYTYMDA
Sbjct  61    VIGSGVLSLAWAIAQLGWIAGPAVMLLFSFVTLYSSTLLSDCYRTGDAVSGKRNYTYMDA  120

Query  1394  VRSNLGGYQVKICGLIQYFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNP  1215
             VRS LGG++ KICGLIQY NLFGIAIGYTIAASISMMAIKRSNCFH+SGGK+PCHMSSNP
Sbjct  121   VRSILGGFKFKICGLIQYLNLFGIAIGYTIAASISMMAIKRSNCFHKSGGKDPCHMSSNP  180

Query  1214  YMIAFGIIEIILSQIPDFDQIWWLSIVAAVMSFTYSGIGLGLGIAQVVANGAFKGSLTGI  1035
             YMI FG+ EI+LSQIPDFDQIWW+SIVAAVMSFTYS IGL LGI QV ANG FKGSLTGI
Sbjct  181   YMIIFGVTEILLSQIPDFDQIWWISIVAAVMSFTYSAIGLALGIVQVAANGVFKGSLTGI  240

Query  1034  SIGTVTETQKIWRSFQALGDIAFAYSYSIILIEIQDTVKSPPSESKTMRKASLFSTIVTT  855
             SIGTVT+TQKIWR+FQALGDIAFAYSYS++LIEIQDTV+SPP+ESKTM+KA+  S  VTT
Sbjct  241   SIGTVTQTQKIWRTFQALGDIAFAYSYSVVLIEIQDTVRSPPAESKTMKKATKISIAVTT  300

Query  854   TFYMLCGCMGYAAFGDDAPGNLLTGFGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAF  675
              FYMLCG MGYAAFGD APGNLLTGFGFYNPFWLLDIANAAIV+HLVGAYQV+ QP+FAF
Sbjct  301   MFYMLCGSMGYAAFGDAAPGNLLTGFGFYNPFWLLDIANAAIVVHLVGAYQVFAQPIFAF  360

Query  674   IEKWVGAKWPDSEIITKEINLKIPGFGYPYKLNTFRLLWRTAFVLLTTVISMLLPFFNDV  495
             IEK V  ++PD++  TKE  +KIPG   PYK N FR+++R  FV+ TTVISML+PFFNDV
Sbjct  361   IEKSVAERYPDNDFFTKEFEIKIPGLRSPYKANVFRIVYRCGFVVSTTVISMLMPFFNDV  420

Query  494   VGILGAFGFWPLTVYFPVRMYISQKKIPKWSTRWICLQMlsgaclavslaaaagsfagvV  315
             VGILGA GFWPLTVYFPV MYI Q+K+ KWSTRW+CLQMLS ACL +++ A  GS AGV+
Sbjct  421   VGILGALGFWPLTVYFPVEMYIKQRKVEKWSTRWVCLQMLSVACLVITVVAGVGSIAGVM  480

Query  314   LDLKLYRPFKTSY  276
             LDLK+Y+PFK++Y
Sbjct  481   LDLKVYKPFKSTY  493



>ref|XP_006279782.1| hypothetical protein CARUB_v10027867mg [Capsella rubella]
 gb|EOA12680.1| hypothetical protein CARUB_v10027867mg [Capsella rubella]
Length=466

 Score =   744 bits (1920),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 364/463 (79%), Positives = 410/463 (89%), Gaps = 0/463 (0%)
 Frame = -3

Query  1664  PLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSGVLSLAWAIGQLGWVAGPSVMLLFSC  1485
             P   FK  DDDGR +R+GTVWTASAHIITAVIGSGVLSLAWAIGQLGW+AGP+VM LFS 
Sbjct  4     PQPAFKCFDDDGRLKRSGTVWTASAHIITAVIGSGVLSLAWAIGQLGWIAGPAVMFLFSF  63

Query  1484  VVYYTSTLLADCYRAGDPVFGKRNYTYMDAVRSNLGGYQVKICGLIQYFNLFGIAIGYTI  1305
             V YY+STLL+DCYR GDPV GKRNYTYMDAVRS LGG++ KICGLIQY NLFGI IGYTI
Sbjct  64    VTYYSSTLLSDCYRTGDPVSGKRNYTYMDAVRSILGGFRFKICGLIQYLNLFGITIGYTI  123

Query  1304  AASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFGIIEIILSQIPDFDQIWWLSIVAAV  1125
             AASISMMAIKRSNCFHESGGKNPCHMSSNPYMI FG+ EI+LSQI DFDQIWWLSIVAAV
Sbjct  124   AASISMMAIKRSNCFHESGGKNPCHMSSNPYMILFGVTEILLSQIKDFDQIWWLSIVAAV  183

Query  1124  MSFTYSGIGLGLGIAQVVANGAFKGSLTGISIGTVTETQKIWRSFQALGDIAFAYSYSII  945
             MSFTYS IGL LGI QV ANGA KGSLTGISIG VT+TQKIWR+FQALGDIAFAYSYS++
Sbjct  184   MSFTYSAIGLALGIIQVAANGAVKGSLTGISIGAVTQTQKIWRTFQALGDIAFAYSYSVV  243

Query  944   LIEIQDTVKSPPSESKTMRKASLFSTIVTTTFYMLCGCMGYAAFGDDAPGNLLTGFGFYN  765
             LIEIQDTV+SPP+ESKTM+ A+  S  VTTTFY+LCGCMGYAAFGD APGNLLTGFGFYN
Sbjct  244   LIEIQDTVRSPPAESKTMKNATRISIAVTTTFYLLCGCMGYAAFGDAAPGNLLTGFGFYN  303

Query  764   PFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEKWVGAKWPDSEIITKEINLKIPGFGYPY  585
             PFWLLD+ANAAIV+HLVGAYQV+ QP+FAFIEK   A++PDS+++TKE  ++IPGF  PY
Sbjct  304   PFWLLDVANAAIVVHLVGAYQVFAQPIFAFIEKQAAARFPDSDLVTKEYEIRIPGFRSPY  363

Query  584   KLNTFRLLWRTAFVLLTTVISMLLPFFNDVVGILGAFGFWPLTVYFPVRMYISQKKIPKW  405
             K+N FR ++R+ FV+LTTVISMLLPFFNDVVGILGA GFWPLTVYFPV MYI Q+K+ +W
Sbjct  364   KVNVFRTVYRSGFVVLTTVISMLLPFFNDVVGILGALGFWPLTVYFPVEMYIKQRKVERW  423

Query  404   STRWICLQMlsgaclavslaaaagsfagvVLDLKLYRPFKTSY  276
             S +W+CLQMLS  CL ++L A  GS AGV+LDLK+Y+PFKT+Y
Sbjct  424   SMKWVCLQMLSCGCLMITLVAGVGSIAGVMLDLKVYKPFKTTY  466



>emb|CAA54631.1| amino acid transporter [Arabidopsis thaliana]
Length=466

 Score =   744 bits (1920),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 363/463 (78%), Positives = 411/463 (89%), Gaps = 0/463 (0%)
 Frame = -3

Query  1664  PLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSGVLSLAWAIGQLGWVAGPSVMLLFSC  1485
             P   FK  DDDGR +R+GTVWTASAHIITAVIGSGVLSLAWAIGQLGW+AGP+VMLLFS 
Sbjct  4     PRPAFKCFDDDGRLKRSGTVWTASAHIITAVIGSGVLSLAWAIGQLGWIAGPTVMLLFSF  63

Query  1484  VVYYTSTLLADCYRAGDPVFGKRNYTYMDAVRSNLGGYQVKICGLIQYFNLFGIAIGYTI  1305
             V YY+STLL+DCYR GDPV GKRNYTYMDAVRS LGG++ KICGLIQY NLFGI +GYTI
Sbjct  64    VTYYSSTLLSDCYRTGDPVSGKRNYTYMDAVRSILGGFRFKICGLIQYLNLFGITVGYTI  123

Query  1304  AASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFGIIEIILSQIPDFDQIWWLSIVAAV  1125
             AASISMMAIKRSNCFHESGGKNPCHMSSNPYMI FG+ EI+LSQI DFDQIWWLSIVAA+
Sbjct  124   AASISMMAIKRSNCFHESGGKNPCHMSSNPYMIMFGVTEILLSQIKDFDQIWWLSIVAAI  183

Query  1124  MSFTYSGIGLGLGIAQVVANGAFKGSLTGISIGTVTETQKIWRSFQALGDIAFAYSYSII  945
             MSFTYS IGL LGI QV ANG  KGSLTGISIG VT+TQKIWR+FQALGDIAFAYSYS++
Sbjct  184   MSFTYSAIGLALGIIQVAANGVVKGSLTGISIGAVTQTQKIWRTFQALGDIAFAYSYSVV  243

Query  944   LIEIQDTVKSPPSESKTMRKASLFSTIVTTTFYMLCGCMGYAAFGDDAPGNLLTGFGFYN  765
             LIEIQDTV+SPP+ESKTM+ A+  S  VTTTFYMLCGCMGYAAFGD APGNLLTGFGFYN
Sbjct  244   LIEIQDTVRSPPAESKTMKIATRISIAVTTTFYMLCGCMGYAAFGDKAPGNLLTGFGFYN  303

Query  764   PFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEKWVGAKWPDSEIITKEINLKIPGFGYPY  585
             PFWLLD+ANAAIVIHLVGAYQV+ QP+FAFIEK + A++PDS+++TKE  ++IPGF  PY
Sbjct  304   PFWLLDVANAAIVIHLVGAYQVFAQPIFAFIEKQLAARFPDSDLVTKEYEIRIPGFRSPY  363

Query  584   KLNTFRLLWRTAFVLLTTVISMLLPFFNDVVGILGAFGFWPLTVYFPVRMYISQKKIPKW  405
             K+N FR ++R+ FV+LTTVISML+PFFNDVVGILGA GFWPLTVYFPV MYI Q+K+ +W
Sbjct  364   KVNVFRAVYRSGFVVLTTVISMLMPFFNDVVGILGALGFWPLTVYFPVEMYIRQRKVERW  423

Query  404   STRWICLQMlsgaclavslaaaagsfagvVLDLKLYRPFKTSY  276
             S +W+CLQMLS  CL ++L A  GS AGV+LDLK+Y+PFKT+Y
Sbjct  424   SMKWVCLQMLSCGCLMITLVAGVGSIAGVMLDLKVYKPFKTTY  466



>ref|NP_201190.1| amino acid permease 4 [Arabidopsis thaliana]
 sp|Q9FN04.1|AAP4_ARATH RecName: Full=Amino acid permease 4; AltName: Full=Amino acid 
transporter AAP4 [Arabidopsis thaliana]
 dbj|BAB11033.1| amino acid transporter AAP4 [Arabidopsis thaliana]
 gb|AED97804.1| amino acid permease 4 [Arabidopsis thaliana]
Length=466

 Score =   743 bits (1919),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 363/463 (78%), Positives = 410/463 (89%), Gaps = 0/463 (0%)
 Frame = -3

Query  1664  PLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSGVLSLAWAIGQLGWVAGPSVMLLFSC  1485
             P   FK  DDDGR +R+GTVWTASAHIITAVIGSGVLSLAWAIGQLGW+AGP+VMLLFS 
Sbjct  4     PRPAFKCFDDDGRLKRSGTVWTASAHIITAVIGSGVLSLAWAIGQLGWIAGPTVMLLFSF  63

Query  1484  VVYYTSTLLADCYRAGDPVFGKRNYTYMDAVRSNLGGYQVKICGLIQYFNLFGIAIGYTI  1305
             V YY+STLL+DCYR GDPV GKRNYTYMDAVRS LGG++ KICGLIQY NLFGI +GYTI
Sbjct  64    VTYYSSTLLSDCYRTGDPVSGKRNYTYMDAVRSILGGFRFKICGLIQYLNLFGITVGYTI  123

Query  1304  AASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFGIIEIILSQIPDFDQIWWLSIVAAV  1125
             AASISMMAIKRSNCFHESGGKNPCHMSSNPYMI FG+ EI+LSQI DFDQIWWLSIVAA+
Sbjct  124   AASISMMAIKRSNCFHESGGKNPCHMSSNPYMIMFGVTEILLSQIKDFDQIWWLSIVAAI  183

Query  1124  MSFTYSGIGLGLGIAQVVANGAFKGSLTGISIGTVTETQKIWRSFQALGDIAFAYSYSII  945
             MSFTYS IGL LGI QV ANG  KGSLTGISIG VT+TQKIWR+FQALGDIAFAYSYS++
Sbjct  184   MSFTYSAIGLALGIIQVAANGVVKGSLTGISIGAVTQTQKIWRTFQALGDIAFAYSYSVV  243

Query  944   LIEIQDTVKSPPSESKTMRKASLFSTIVTTTFYMLCGCMGYAAFGDDAPGNLLTGFGFYN  765
             LIEIQDTV+SPP+ESKTM+ A+  S  VTTTFYMLCGCMGYAAFGD APGNLLTGFGFYN
Sbjct  244   LIEIQDTVRSPPAESKTMKIATRISIAVTTTFYMLCGCMGYAAFGDKAPGNLLTGFGFYN  303

Query  764   PFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEKWVGAKWPDSEIITKEINLKIPGFGYPY  585
             PFWLLD+ANAAIVIHLVGAYQV+ QP+FAFIEK   A++PDS+++TKE  ++IPGF  PY
Sbjct  304   PFWLLDVANAAIVIHLVGAYQVFAQPIFAFIEKQAAARFPDSDLVTKEYEIRIPGFRSPY  363

Query  584   KLNTFRLLWRTAFVLLTTVISMLLPFFNDVVGILGAFGFWPLTVYFPVRMYISQKKIPKW  405
             K+N FR ++R+ FV+LTTVISML+PFFNDVVGILGA GFWPLTVYFPV MYI Q+K+ +W
Sbjct  364   KVNVFRAVYRSGFVVLTTVISMLMPFFNDVVGILGALGFWPLTVYFPVEMYIRQRKVERW  423

Query  404   STRWICLQMlsgaclavslaaaagsfagvVLDLKLYRPFKTSY  276
             S +W+CLQMLS  CL ++L A  GS AGV+LDLK+Y+PFKT+Y
Sbjct  424   SMKWVCLQMLSCGCLMITLVAGVGSIAGVMLDLKVYKPFKTTY  466



>emb|CDX81121.1| BnaC03g03750D [Brassica napus]
Length=487

 Score =   744 bits (1920),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 371/487 (76%), Positives = 422/487 (87%), Gaps = 2/487 (0%)
 Frame = -3

Query  1730  MGESAAATKNHRHHLGVSIDA--PPLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSGV  1557
             MGE+AAA  +H HH     DA  P    FK  DDDGR +RTGTVWTASAHIITAVIGSGV
Sbjct  1     MGETAAANHHHHHHGHQVFDASVPQQPAFKCFDDDGRLKRTGTVWTASAHIITAVIGSGV  60

Query  1556  LSLAWAIGQLGWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRNYTYMDAVRSNLG  1377
             LSLAWAI QLGW+AGP+VMLLFS V  Y+STLL+DCYR GD V GKRNYTYMDAVRS LG
Sbjct  61    LSLAWAIAQLGWIAGPAVMLLFSFVTLYSSTLLSDCYRTGDAVSGKRNYTYMDAVRSILG  120

Query  1376  GYQVKICGLIQYFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFG  1197
             G++ KICGLIQY NLFGIA+GYTIAASISMMAIKRSNCFH+SGGK+PCHMSSNPYMI FG
Sbjct  121   GFKFKICGLIQYLNLFGIAVGYTIAASISMMAIKRSNCFHKSGGKDPCHMSSNPYMIIFG  180

Query  1196  IIEIILSQIPDFDQIWWLSIVAAVMSFTYSGIGLGLGIAQVVANGAFKGSLTGISIGTVT  1017
             + EI+LSQ+PDFDQIWW+SIVAAVMSFTYS IGL LGI QV ANG FKGSLTGISIGTVT
Sbjct  181   VTEILLSQVPDFDQIWWISIVAAVMSFTYSAIGLALGIVQVAANGVFKGSLTGISIGTVT  240

Query  1016  ETQKIWRSFQALGDIAFAYSYSIILIEIQDTVKSPPSESKTMRKASLFSTIVTTTFYMLC  837
             +TQKIWR+FQALGDIAFAYSYS++LIEIQDTV+SPPSES TM+KA+  S  VTT FYMLC
Sbjct  241   QTQKIWRTFQALGDIAFAYSYSVVLIEIQDTVRSPPSESTTMKKATKISIAVTTIFYMLC  300

Query  836   GCMGYAAFGDDAPGNLLTGFGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEKWVG  657
             G MGYAAFGD APGNLLTGFGFYNPFWLLDIANAAIV+HL+GAYQV+ QP+FAF+EK V 
Sbjct  301   GSMGYAAFGDAAPGNLLTGFGFYNPFWLLDIANAAIVVHLIGAYQVFSQPIFAFVEKSVS  360

Query  656   AKWPDSEIITKEINLKIPGFGYPYKLNTFRLLWRTAFVLLTTVISMLLPFFNDVVGILGA  477
              ++PD++++TKE+  KIPG   PYK N FR+++R  FV+LTTVISML+PFFNDVVGILGA
Sbjct  361   ERFPDNDLLTKELQFKIPGIRSPYKTNVFRVVFRCCFVVLTTVISMLMPFFNDVVGILGA  420

Query  476   FGFWPLTVYFPVRMYISQKKIPKWSTRWICLQMlsgaclavslaaaagsfagvVLDLKLY  297
              GFWPLTVYFPV MYI Q+K+ KWSTRW+CLQMLS ACL +S+ A  GS AGV+LDLK+Y
Sbjct  421   LGFWPLTVYFPVEMYIKQRKVEKWSTRWVCLQMLSVACLVISVVAGVGSIAGVMLDLKVY  480

Query  296   RPFKTSY  276
             +PF+++Y
Sbjct  481   KPFQSTY  487



>gb|AAM61227.1| amino acid transport protein AAP2 [Arabidopsis thaliana]
Length=493

 Score =   744 bits (1921),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 367/493 (74%), Positives = 420/493 (85%), Gaps = 8/493 (2%)
 Frame = -3

Query  1730  MGESAAATKN--------HRHHLGVSIDAPPLYGFKGLDDDGRPQRTGTVWTASAHIITA  1575
             MGE+AAA  +            +      PP   FK  DDDGR +RTGTVWTASAHIITA
Sbjct  1     MGETAAANNHRHHHHHGHQVFDVASHDFVPPQPAFKCFDDDGRLKRTGTVWTASAHIITA  60

Query  1574  VIGSGVLSLAWAIGQLGWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRNYTYMDA  1395
             VIGSGVLSLAWAI QLGW+AGP+VMLLFS V  Y+STLL+DCYR GD V GKRNYTYMDA
Sbjct  61    VIGSGVLSLAWAIAQLGWIAGPAVMLLFSLVTLYSSTLLSDCYRTGDAVSGKRNYTYMDA  120

Query  1394  VRSNLGGYQVKICGLIQYFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNP  1215
             VRS LGG++ KICGLIQY NLF IAIGYTIAASISMMAIKRSNCFH+SGGK+PCHMSSNP
Sbjct  121   VRSILGGFKFKICGLIQYLNLFVIAIGYTIAASISMMAIKRSNCFHKSGGKDPCHMSSNP  180

Query  1214  YMIAFGIIEIILSQIPDFDQIWWLSIVAAVMSFTYSGIGLGLGIAQVVANGAFKGSLTGI  1035
             YMI FG+ EI+LSQ+PDFDQIWW+SIVAAVMSFTYS IGL LGI QV ANG FKGSLTGI
Sbjct  181   YMIVFGVAEILLSQVPDFDQIWWISIVAAVMSFTYSAIGLALGIVQVAANGVFKGSLTGI  240

Query  1034  SIGTVTETQKIWRSFQALGDIAFAYSYSIILIEIQDTVKSPPSESKTMRKASLFSTIVTT  855
             SIGTVT+TQKIWR+FQALGDIAFAYSYS++LIEIQDTV+SPP+ESKTM+KA+  S  VTT
Sbjct  241   SIGTVTQTQKIWRTFQALGDIAFAYSYSVVLIEIQDTVRSPPAESKTMKKATKISIAVTT  300

Query  854   TFYMLCGCMGYAAFGDDAPGNLLTGFGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAF  675
              FYMLCG MGYAAFGD APGNLLTGFGFYNPFWLLDIANAAIV+HLVGAYQV+ QP+FAF
Sbjct  301   IFYMLCGSMGYAAFGDAAPGNLLTGFGFYNPFWLLDIANAAIVVHLVGAYQVFAQPIFAF  360

Query  674   IEKWVGAKWPDSEIITKEINLKIPGFGYPYKLNTFRLLWRTAFVLLTTVISMLLPFFNDV  495
             IEK V  ++PD++ ++KE  ++IPGF  PYK+N FR+++R+ FV+ TTVISML+PFFNDV
Sbjct  361   IEKSVAERYPDNDFLSKEFEIRIPGFKSPYKVNVFRMVYRSGFVVTTTVISMLMPFFNDV  420

Query  494   VGILGAFGFWPLTVYFPVRMYISQKKIPKWSTRWICLQMlsgaclavslaaaagsfagvV  315
             VGILGA GFWPLTVYFPV MYI Q+K+ KWSTRW+CLQML+ ACL +S+ A  GS AGV+
Sbjct  421   VGILGALGFWPLTVYFPVEMYIKQRKVEKWSTRWVCLQMLTVACLVISVVAGVGSIAGVM  480

Query  314   LDLKLYRPFKTSY  276
             LDLK+Y+PFK++Y
Sbjct  481   LDLKVYKPFKSTY  493



>ref|XP_002520322.1| amino acid transporter, putative [Ricinus communis]
 gb|EEF42108.1| amino acid transporter, putative [Ricinus communis]
Length=485

 Score =   744 bits (1920),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 373/487 (77%), Positives = 424/487 (87%), Gaps = 4/487 (1%)
 Frame = -3

Query  1730  MGESAAATKNH--RHHLGVSIDAPPLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSGV  1557
             MGE+ A TKNH       V++D PP  G K  DDDG+ +RTGTVWTASAHIITAVIGSGV
Sbjct  1     MGENTA-TKNHFPPQVFSVNVDMPPQAGSKWYDDDGKLKRTGTVWTASAHIITAVIGSGV  59

Query  1556  LSLAWAIGQLGWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRNYTYMDAVRSNLG  1377
             LSLAWA+ QLGWVAGP+VM LFS V YYTSTLL+ CYR GDPV GKRNYTYMDAVRSNLG
Sbjct  60    LSLAWAVAQLGWVAGPAVMFLFSLVTYYTSTLLSACYRTGDPVNGKRNYTYMDAVRSNLG  119

Query  1376  GYQVKICGLIQYFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFG  1197
             G + KICG +QY NL G+AIGYTIA+SISMMA+KRSNCFH+SGGKNPCHM++NPYMIAFG
Sbjct  120   GAKFKICGYVQYVNLIGVAIGYTIASSISMMAVKRSNCFHKSGGKNPCHMNANPYMIAFG  179

Query  1196  IIEIILSQIPDFDQIWWLSIVAAVMSFTYSGIGLGLGIAQVVANGAFKGSLTGISIGTVT  1017
             ++EII SQIPDFDQ+WWLSIVAA+MSFTYS IGLGLGIA+V  NG   GS+TGISIGTVT
Sbjct  180   VVEIIFSQIPDFDQLWWLSIVAAIMSFTYSTIGLGLGIAEVTKNGKAMGSMTGISIGTVT  239

Query  1016  ETQKIWRSFQALGDIAFAYSYSIILIEIQDTVKSPPSESKTMRKASLFSTIVTTTFYMLC  837
             ETQKIWRSFQALGDIAFAYSYS+ILIEIQDT++SPP+ESKTMRKA+L S  VTT FYMLC
Sbjct  240   ETQKIWRSFQALGDIAFAYSYSLILIEIQDTIRSPPAESKTMRKATLISVSVTTLFYMLC  299

Query  836   GCMGYAAFGDDAPGNLLTGFGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEKWVG  657
             GC GYAAFGD +PGNLLTGFGFYNP+WLLDIAN AIV+HLVGAYQVYCQPLFAF+EK   
Sbjct  300   GCFGYAAFGDMSPGNLLTGFGFYNPYWLLDIANVAIVVHLVGAYQVYCQPLFAFVEKAAV  359

Query  656   AKWPDSEIITKEINLKIPGFGYPYKLNTFRLLWRTAFVLLTTVISMLLPFFNDVVGILGA  477
              ++PDSE ITK+I + IPG   PY LN FR++WRT FV+ TTVISMLLPFFND+VG+LGA
Sbjct  360   QRFPDSEFITKDIKIPIPGCK-PYNLNLFRMVWRTVFVIFTTVISMLLPFFNDIVGLLGA  418

Query  476   FGFWPLTVYFPVRMYISQKKIPKWSTRWICLQMlsgaclavslaaaagsfagvVLDLKLY  297
              GFWPLTVYFPV MYI+QKKIPKWSTRW+CLQ+LS ACL +++AAAAGS AGV++DLK  
Sbjct  419   LGFWPLTVYFPVEMYIAQKKIPKWSTRWLCLQILSAACLIITIAAAAGSIAGVIVDLKTV  478

Query  296   RPFKTSY  276
             +PF+T+Y
Sbjct  479   KPFQTTY  485



>ref|XP_004290907.1| PREDICTED: amino acid permease 3-like [Fragaria vesca subsp. 
vesca]
Length=484

 Score =   743 bits (1919),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 370/485 (76%), Positives = 422/485 (87%), Gaps = 1/485 (0%)
 Frame = -3

Query  1730  MGESAAATKNHRHHLGVSIDAPPLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSGVLS  1551
             MG++      H     VS++ PP  G K  DDDGR +RTGTVWTASAHIITAVIGSGVLS
Sbjct  1     MGDNKNQMLQHNQVFDVSVNMPPQGGSKCFDDDGRLKRTGTVWTASAHIITAVIGSGVLS  60

Query  1550  LAWAIGQLGWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRNYTYMDAVRSNLGGY  1371
             LAWAI QLGWVAGP+VM LFS V YYTSTLL+ CYR+GD   GKRNYTYMDAV+SNLGG 
Sbjct  61    LAWAIAQLGWVAGPAVMFLFSLVTYYTSTLLSACYRSGDSDTGKRNYTYMDAVQSNLGGV  120

Query  1370  QVKICGLIQYFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFGII  1191
             +VKICG +QY NLFG+AIGYTIA++ISMMAIKRSNCFH+SGGK+PCH++SNPYMIAFGI+
Sbjct  121   KVKICGYVQYLNLFGVAIGYTIASAISMMAIKRSNCFHKSGGKDPCHINSNPYMIAFGIV  180

Query  1190  EIILSQIPDFDQIWWLSIVAAVMSFTYSGIGLGLGIAQVVANGAFKGSLTGISIGTVTET  1011
             EII SQIPDFDQ+WWLSIVAAVMSFTYS IGLGLGIA+V   G   GS+TGISIGTV+ET
Sbjct  181   EIIFSQIPDFDQLWWLSIVAAVMSFTYSTIGLGLGIAKVAETGTIMGSMTGISIGTVSET  240

Query  1010  QKIWRSFQALGDIAFAYSYSIILIEIQDTVKSPPSESKTMRKASLFSTIVTTTFYMLCGC  831
             +K+WRSFQALGDIAFAYSYS+ILIEIQDTV+SPPSE+KTM+KA+  S  VTT FYMLCGC
Sbjct  241   EKMWRSFQALGDIAFAYSYSLILIEIQDTVRSPPSEAKTMKKATTISVAVTTLFYMLCGC  300

Query  830   MGYAAFGDDAPGNLLTGFGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEKWVGAK  651
             MGYAAFGD APGNLLTGFGFYNP+WLLDIAN AIV+HLVGAYQVYCQPLFAF+EK    K
Sbjct  301   MGYAAFGDLAPGNLLTGFGFYNPYWLLDIANVAIVVHLVGAYQVYCQPLFAFVEKAAAKK  360

Query  650   WPDSEIITKEINLKIPGFGYPYKLNTFRLLWRTAFVLLTTVISMLLPFFNDVVGILGAFG  471
             +PDSE I++EI + +PG G+   LN FRL+WRTAFV++TTVISMLLPFFNDVVG+LGA G
Sbjct  361   YPDSEFISREIKIPVPGLGH-CNLNLFRLVWRTAFVIVTTVISMLLPFFNDVVGLLGAVG  419

Query  470   FWPLTVYFPVRMYISQKKIPKWSTRWICLQMlsgaclavslaaaagsfagvVLDLKLYRP  291
             FWPLTVYFPV MYI+QK+IPKWSTRW+CLQ+LS ACL +++AAAAGS AGV+ DLK Y+P
Sbjct  420   FWPLTVYFPVEMYIAQKRIPKWSTRWLCLQILSVACLIITIAAAAGSIAGVISDLKTYKP  479

Query  290   FKTSY  276
             FKTSY
Sbjct  480   FKTSY  484



>gb|AAM13223.1| amino acid transporter AAP4 [Arabidopsis thaliana]
 gb|AAO30058.1| amino acid transporter AAP4 [Arabidopsis thaliana]
Length=466

 Score =   742 bits (1916),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 363/463 (78%), Positives = 409/463 (88%), Gaps = 0/463 (0%)
 Frame = -3

Query  1664  PLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSGVLSLAWAIGQLGWVAGPSVMLLFSC  1485
             P   FK  DDDGR +R+GTVWTASAHIITAVIGSGVLSLAWAIGQLGW+AGP+VMLLFS 
Sbjct  4     PRPAFKCFDDDGRLKRSGTVWTASAHIITAVIGSGVLSLAWAIGQLGWIAGPTVMLLFSF  63

Query  1484  VVYYTSTLLADCYRAGDPVFGKRNYTYMDAVRSNLGGYQVKICGLIQYFNLFGIAIGYTI  1305
             V YY+STLL+DCYR GDPV GKRNYTYMDAVRS LGG++ KICGLIQY NLFGI +GYTI
Sbjct  64    VTYYSSTLLSDCYRTGDPVSGKRNYTYMDAVRSILGGFRFKICGLIQYLNLFGITVGYTI  123

Query  1304  AASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFGIIEIILSQIPDFDQIWWLSIVAAV  1125
             AASISMMAIKRSNCFHESGGKNPCHMSSNPYMI FG+ EI+LSQI DFDQIWWLSIVAA+
Sbjct  124   AASISMMAIKRSNCFHESGGKNPCHMSSNPYMIMFGVTEILLSQIKDFDQIWWLSIVAAI  183

Query  1124  MSFTYSGIGLGLGIAQVVANGAFKGSLTGISIGTVTETQKIWRSFQALGDIAFAYSYSII  945
             MSFTYS IGL LGI QV ANG  KGSLTGISIG VT+TQKIWR+FQALGDIAFAYSYS++
Sbjct  184   MSFTYSAIGLALGIIQVAANGVVKGSLTGISIGAVTQTQKIWRTFQALGDIAFAYSYSVV  243

Query  944   LIEIQDTVKSPPSESKTMRKASLFSTIVTTTFYMLCGCMGYAAFGDDAPGNLLTGFGFYN  765
             LIEIQDTV+SPP+ESKTM+ A+  S  VTTTFYMLCGCMGYAAFGD APGNLLTGFGFYN
Sbjct  244   LIEIQDTVRSPPAESKTMKIATRISIAVTTTFYMLCGCMGYAAFGDKAPGNLLTGFGFYN  303

Query  764   PFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEKWVGAKWPDSEIITKEINLKIPGFGYPY  585
             PFWLLD+ANAAIVIHLVGAYQV+ QP+FAFIEK   A +PDS+++TKE  ++IPGF  PY
Sbjct  304   PFWLLDVANAAIVIHLVGAYQVFAQPIFAFIEKQAAASFPDSDLVTKEYEIRIPGFRSPY  363

Query  584   KLNTFRLLWRTAFVLLTTVISMLLPFFNDVVGILGAFGFWPLTVYFPVRMYISQKKIPKW  405
             K+N FR ++R+ FV+LTTVISML+PFFNDVVGILGA GFWPLTVYFPV MYI Q+K+ +W
Sbjct  364   KVNVFRAVYRSGFVVLTTVISMLMPFFNDVVGILGALGFWPLTVYFPVEMYIRQRKVERW  423

Query  404   STRWICLQMlsgaclavslaaaagsfagvVLDLKLYRPFKTSY  276
             S +W+CLQMLS  CL ++L A  GS AGV+LDLK+Y+PFKT+Y
Sbjct  424   SMKWVCLQMLSCGCLMITLVAGVGSIAGVMLDLKVYKPFKTTY  466



>emb|CDX78353.1| BnaA03g02650D [Brassica napus]
Length=487

 Score =   743 bits (1917),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 373/487 (77%), Positives = 424/487 (87%), Gaps = 2/487 (0%)
 Frame = -3

Query  1730  MGESAAATKNHRHHLGVSIDA--PPLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSGV  1557
             MGE+AAA  +H HH     DA  P    FK  DDDGR +RTGTVWTASAHIITAVIGSGV
Sbjct  1     MGETAAANNHHHHHGHQVFDASVPQQPAFKCFDDDGRLKRTGTVWTASAHIITAVIGSGV  60

Query  1556  LSLAWAIGQLGWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRNYTYMDAVRSNLG  1377
             LSLAWAI QLGW+AGP+VMLLFS V  Y+STLL+DCYR GD V GKRNYTYMDAVRS LG
Sbjct  61    LSLAWAIAQLGWIAGPAVMLLFSFVTLYSSTLLSDCYRTGDAVSGKRNYTYMDAVRSILG  120

Query  1376  GYQVKICGLIQYFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFG  1197
             G++ KICGLIQY NLFGIA+GYTIAASISMMAIKRSNCFH+SGGK+PCHMSSNPYMI FG
Sbjct  121   GFKFKICGLIQYLNLFGIAVGYTIAASISMMAIKRSNCFHKSGGKDPCHMSSNPYMIIFG  180

Query  1196  IIEIILSQIPDFDQIWWLSIVAAVMSFTYSGIGLGLGIAQVVANGAFKGSLTGISIGTVT  1017
             + EI+LSQ+PDFDQIWW+SIVAAVMSFTYS IGL LGI QV ANG FKGSLTGISIGTVT
Sbjct  181   VTEILLSQVPDFDQIWWISIVAAVMSFTYSAIGLALGIVQVAANGVFKGSLTGISIGTVT  240

Query  1016  ETQKIWRSFQALGDIAFAYSYSIILIEIQDTVKSPPSESKTMRKASLFSTIVTTTFYMLC  837
             +TQKIWR+FQALGDIAFAYSYS++LIEIQDTV+SPPSES TM+KA+  S  VTT FYMLC
Sbjct  241   QTQKIWRTFQALGDIAFAYSYSVVLIEIQDTVRSPPSESTTMKKATKISIAVTTIFYMLC  300

Query  836   GCMGYAAFGDDAPGNLLTGFGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEKWVG  657
             G MGYAAFGD APGNLLTGFGFYNPFWLLDIANAAIV+HL+GAYQV+ QP+FAF+EK V 
Sbjct  301   GSMGYAAFGDAAPGNLLTGFGFYNPFWLLDIANAAIVVHLIGAYQVFSQPIFAFVEKSVS  360

Query  656   AKWPDSEIITKEINLKIPGFGYPYKLNTFRLLWRTAFVLLTTVISMLLPFFNDVVGILGA  477
              ++PDS+++TKE+ +KIPGF  PYK N FR+++R  FV+LTTVISML+PFFNDVVGILGA
Sbjct  361   ERFPDSDLLTKELQIKIPGFRSPYKTNVFRVVFRCCFVVLTTVISMLMPFFNDVVGILGA  420

Query  476   FGFWPLTVYFPVRMYISQKKIPKWSTRWICLQMlsgaclavslaaaagsfagvVLDLKLY  297
              GFWPLTVYFPV MYI Q+K+ KWSTRW+CLQMLS ACL +S+ A  GS AGV+LDLK+Y
Sbjct  421   LGFWPLTVYFPVEMYIKQRKVEKWSTRWVCLQMLSVACLVISVVAGVGSIAGVMLDLKVY  480

Query  296   RPFKTSY  276
             +PF+++Y
Sbjct  481   KPFQSTY  487



>ref|NP_177862.1| amino acid permease 3 [Arabidopsis thaliana]
 sp|Q39134.2|AAP3_ARATH RecName: Full=Amino acid permease 3; AltName: Full=Amino acid 
transporter AAP3 [Arabidopsis thaliana]
 gb|AAG29203.1|AC078898_13 amino acid carrier, putative [Arabidopsis thaliana]
 emb|CAA54630.1| amino acid permease [Arabidopsis thaliana]
 gb|AAM20639.1| putative amino acid carrier [Arabidopsis thaliana]
 gb|AAM91305.1| putative amino acid carrier [Arabidopsis thaliana]
 gb|AEE35971.1| amino acid permease 3 [Arabidopsis thaliana]
Length=476

 Score =   742 bits (1915),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 365/475 (77%), Positives = 417/475 (88%), Gaps = 1/475 (0%)
 Frame = -3

Query  1700  HRHHLGVSIDAPPLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSGVLSLAWAIGQLGW  1521
               H   +++D P   G K LDDDG+ +RTG+VWTASAHIITAVIGSGVLSLAWA  QLGW
Sbjct  3     QNHQTVLAVDMPQTGGSKYLDDDGKNKRTGSVWTASAHIITAVIGSGVLSLAWATAQLGW  62

Query  1520  VAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRNYTYMDAVRSNLGGYQVKICGLIQY  1341
             +AGP VMLLFS V Y+TS+LLA CYR+GDP+ GKRNYTYMDAVRSNLGG +V +CG++QY
Sbjct  63    LAGPVVMLLFSAVTYFTSSLLAACYRSGDPISGKRNYTYMDAVRSNLGGVKVTLCGIVQY  122

Query  1340  FNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFGIIEIILSQIPDF  1161
              N+FG+AIGYTIA++ISMMAIKRSNCFH+SGGK+PCHM+SNPYMIAFG+++I+ SQIPDF
Sbjct  123   LNIFGVAIGYTIASAISMMAIKRSNCFHKSGGKDPCHMNSNPYMIAFGLVQILFSQIPDF  182

Query  1160  DQIWWLSIVAAVMSFTYSGIGLGLGIAQVVANGAFKGSLTGISIGTVTETQKIWRSFQAL  981
             DQ+WWLSI+AAVMSFTYS  GL LGIAQVV NG  KGSLTGISIG VTETQKIWR+FQAL
Sbjct  183   DQLWWLSILAAVMSFTYSSAGLALGIAQVVVNGKVKGSLTGISIGAVTETQKIWRTFQAL  242

Query  980   GDIAFAYSYSIILIEIQDTVKSPPSESKTMRKASLFSTIVTTTFYMLCGCMGYAAFGDDA  801
             GDIAFAYSYSIILIEIQDTVKSPPSE KTM+KA+L S  VTT FYMLCGCMGYAAFGD +
Sbjct  243   GDIAFAYSYSIILIEIQDTVKSPPSEEKTMKKATLVSVSVTTMFYMLCGCMGYAAFGDLS  302

Query  800   PGNLLTGFGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEKWVGAKWPDSEIITKE  621
             PGNLLTGFGFYNP+WLLDIANAAIVIHL+GAYQVYCQPLFAFIEK    ++PDSE I K+
Sbjct  303   PGNLLTGFGFYNPYWLLDIANAAIVIHLIGAYQVYCQPLFAFIEKQASIQFPDSEFIAKD  362

Query  620   INLKIPGFGYPYKLNTFRLLWRTAFVLLTTVISMLLPFFNDVVGILGAFGFWPLTVYFPV  441
             I + IPGF  P +LN FRL+WRT FV++TTVISMLLPFFNDVVG+LGA GFWPLTVYFPV
Sbjct  363   IKIPIPGFK-PLRLNVFRLIWRTVFVIITTVISMLLPFFNDVVGLLGALGFWPLTVYFPV  421

Query  440   RMYISQKKIPKWSTRWICLQMlsgaclavslaaaagsfagvVLDLKLYRPFKTSY  276
              MYI+QKKIP+WSTRW+CLQ+ S  CL VS+AAAAGS AGV+LDLK Y+PF++ Y
Sbjct  422   EMYIAQKKIPRWSTRWVCLQVFSLGCLVVSIAAAAGSIAGVLLDLKSYKPFRSEY  476



>ref|XP_009106399.1| PREDICTED: amino acid permease 3 [Brassica rapa]
Length=476

 Score =   742 bits (1915),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 368/475 (77%), Positives = 418/475 (88%), Gaps = 1/475 (0%)
 Frame = -3

Query  1700  HRHHLGVSIDAPPLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSGVLSLAWAIGQLGW  1521
                    ++D P   G K  DDDGR +RTG+VWTASAHIITAVIGSGVLSLAWA  QLGW
Sbjct  3     QNQQEAFAVDMPQTGGSKCFDDDGRIKRTGSVWTASAHIITAVIGSGVLSLAWATAQLGW  62

Query  1520  VAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRNYTYMDAVRSNLGGYQVKICGLIQY  1341
             +AGP VMLLFS V Y+TSTLLA CYR+GDP+ GKRNYTYMDAVRSNLGG +VK+CG++QY
Sbjct  63    LAGPVVMLLFSIVTYFTSTLLAACYRSGDPISGKRNYTYMDAVRSNLGGVKVKLCGIVQY  122

Query  1340  FNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFGIIEIILSQIPDF  1161
              NLFG+AIGYTIA++ISMMAIKRSNCFH+SGGK+PCHM+SNPYMIAFG+++II SQIPDF
Sbjct  123   LNLFGVAIGYTIASAISMMAIKRSNCFHKSGGKDPCHMNSNPYMIAFGLVQIIFSQIPDF  182

Query  1160  DQIWWLSIVAAVMSFTYSGIGLGLGIAQVVANGAFKGSLTGISIGTVTETQKIWRSFQAL  981
             DQ+WWLSI+AAVMSFTYS  GL LGIAQVVANG  KGSLTGISIG VTETQKIWRSFQAL
Sbjct  183   DQLWWLSILAAVMSFTYSSAGLALGIAQVVANGKVKGSLTGISIGAVTETQKIWRSFQAL  242

Query  980   GDIAFAYSYSIILIEIQDTVKSPPSESKTMRKASLFSTIVTTTFYMLCGCMGYAAFGDDA  801
             GDIAFAYSYSIILIEIQDTVKSPPSE KTM+KA+L S  VTT FYMLCGCMGYAAFGD +
Sbjct  243   GDIAFAYSYSIILIEIQDTVKSPPSEEKTMKKATLVSVGVTTMFYMLCGCMGYAAFGDMS  302

Query  800   PGNLLTGFGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEKWVGAKWPDSEIITKE  621
             PGNLLTGFGFYNP+WLLDIANAAIV+HLVGAYQVYCQPLFAFIE+    ++PDS+ I KE
Sbjct  303   PGNLLTGFGFYNPYWLLDIANAAIVVHLVGAYQVYCQPLFAFIERQASTRFPDSDFIAKE  362

Query  620   INLKIPGFGYPYKLNTFRLLWRTAFVLLTTVISMLLPFFNDVVGILGAFGFWPLTVYFPV  441
             I + +PGF  P++LN FRL+WRT FV++TT+ISMLLPFFNDVVG+LGA GFWPLTVYFPV
Sbjct  363   IKIPVPGFK-PFRLNFFRLIWRTVFVIITTLISMLLPFFNDVVGLLGALGFWPLTVYFPV  421

Query  440   RMYISQKKIPKWSTRWICLQMlsgaclavslaaaagsfagvVLDLKLYRPFKTSY  276
              MYI QKKIP+WST+W+CLQ+ S ACL VS+AAAAGS AGVVLDLK Y+PF+++Y
Sbjct  422   EMYIEQKKIPRWSTQWVCLQVFSSACLVVSIAAAAGSIAGVVLDLKSYKPFQSNY  476



>emb|CDX88364.1| BnaC06g38080D [Brassica napus]
Length=476

 Score =   741 bits (1914),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 369/475 (78%), Positives = 418/475 (88%), Gaps = 1/475 (0%)
 Frame = -3

Query  1700  HRHHLGVSIDAPPLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSGVLSLAWAIGQLGW  1521
                    S+D P   G K  DDDGR +RTG+VWTASAHIITAVIGSGVLSLAWA  QLGW
Sbjct  3     QNQQEAFSVDMPRTGGSKCFDDDGRIKRTGSVWTASAHIITAVIGSGVLSLAWATAQLGW  62

Query  1520  VAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRNYTYMDAVRSNLGGYQVKICGLIQY  1341
             +AGP VMLLFS V Y+TSTLLA CYR+GDP+ GKRNYTYMDAVRSNLGG +VK+CG++QY
Sbjct  63    LAGPVVMLLFSIVTYFTSTLLAACYRSGDPISGKRNYTYMDAVRSNLGGVKVKLCGIVQY  122

Query  1340  FNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFGIIEIILSQIPDF  1161
              NLFG+AIGYTIA++ISMMAIKRSNCFH+SGGK+PCHM+SNPYMIAFG+++II SQIPDF
Sbjct  123   LNLFGVAIGYTIASAISMMAIKRSNCFHKSGGKDPCHMNSNPYMIAFGLVQIIFSQIPDF  182

Query  1160  DQIWWLSIVAAVMSFTYSGIGLGLGIAQVVANGAFKGSLTGISIGTVTETQKIWRSFQAL  981
             DQ+WWLSI+AAVMSFTYS  GL LGIAQVVANG  KGSLTGISIG VTETQKIWRSFQAL
Sbjct  183   DQLWWLSILAAVMSFTYSSAGLALGIAQVVANGKVKGSLTGISIGAVTETQKIWRSFQAL  242

Query  980   GDIAFAYSYSIILIEIQDTVKSPPSESKTMRKASLFSTIVTTTFYMLCGCMGYAAFGDDA  801
             GDIAFAYSYSIILIEIQDTVKSPPSE KTM+KA+L S  VTT FYMLCGCMGYAAFGD +
Sbjct  243   GDIAFAYSYSIILIEIQDTVKSPPSEEKTMKKATLVSVGVTTMFYMLCGCMGYAAFGDMS  302

Query  800   PGNLLTGFGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEKWVGAKWPDSEIITKE  621
             PGNLLTGFGFYNP+WLLDIANAAIV+HLVGAYQVYCQPLFAFIE+    ++PDS+ I K+
Sbjct  303   PGNLLTGFGFYNPYWLLDIANAAIVVHLVGAYQVYCQPLFAFIERQASTRFPDSDFIAKD  362

Query  620   INLKIPGFGYPYKLNTFRLLWRTAFVLLTTVISMLLPFFNDVVGILGAFGFWPLTVYFPV  441
             I + IPGF  P++LN FRL+WRT FV++TT+ISMLLPFFNDVVG+LGA GFWPLTVYFPV
Sbjct  363   IKIPIPGFK-PFRLNFFRLIWRTVFVIITTLISMLLPFFNDVVGLLGALGFWPLTVYFPV  421

Query  440   RMYISQKKIPKWSTRWICLQMlsgaclavslaaaagsfagvVLDLKLYRPFKTSY  276
              MYI QKKIP+WST+W+CLQ+ S ACL VS+AAAAGS AGVVLDLK Y+PF+++Y
Sbjct  422   EMYIEQKKIPRWSTQWVCLQVFSSACLVVSIAAAAGSIAGVVLDLKSYKPFQSNY  476



>ref|XP_010491540.1| PREDICTED: amino acid permease 2-like [Camelina sativa]
Length=493

 Score =   742 bits (1915),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 368/493 (75%), Positives = 418/493 (85%), Gaps = 8/493 (2%)
 Frame = -3

Query  1730  MGESAAATKN--------HRHHLGVSIDAPPLYGFKGLDDDGRPQRTGTVWTASAHIITA  1575
             MGE+AAAT++            +  +   PP   FK  DDDGR +RTGTVWTASAHIITA
Sbjct  1     MGETAAATRHHHNHHHGHQVFDVASNEVVPPQPAFKCFDDDGRLKRTGTVWTASAHIITA  60

Query  1574  VIGSGVLSLAWAIGQLGWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRNYTYMDA  1395
             VIGSGVLSLAWAI QLGW+AGP+VM+LFS V  Y+STLL+DCYR GD V GKRNYTYMDA
Sbjct  61    VIGSGVLSLAWAIAQLGWIAGPAVMILFSLVTLYSSTLLSDCYRTGDAVSGKRNYTYMDA  120

Query  1394  VRSNLGGYQVKICGLIQYFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNP  1215
             VRS LGG++ KICGLIQY NLFGIAIGYTIAASISMMAIKRSNCFH+SGGK+PCHMSSNP
Sbjct  121   VRSILGGFKFKICGLIQYLNLFGIAIGYTIAASISMMAIKRSNCFHKSGGKDPCHMSSNP  180

Query  1214  YMIAFGIIEIILSQIPDFDQIWWLSIVAAVMSFTYSGIGLGLGIAQVVANGAFKGSLTGI  1035
             YMI FG+ EI LSQ+PDFDQIWW+SIVAAVMSFTYS IGL LGI QV ANG FKGSLTGI
Sbjct  181   YMIIFGVTEIFLSQVPDFDQIWWISIVAAVMSFTYSAIGLALGIVQVAANGVFKGSLTGI  240

Query  1034  SIGTVTETQKIWRSFQALGDIAFAYSYSIILIEIQDTVKSPPSESKTMRKASLFSTIVTT  855
             SIGTVT+TQKIWR+FQALGDIAFAYSYS +LIEIQDTV+SPP+ESKTM+KA+  S  VTT
Sbjct  241   SIGTVTQTQKIWRTFQALGDIAFAYSYSAVLIEIQDTVRSPPAESKTMKKATKISIAVTT  300

Query  854   TFYMLCGCMGYAAFGDDAPGNLLTGFGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAF  675
              FYMLCG MGYAAFGD APGNLLTGFGFYNPFWLLDIANAAIV+HLVGAYQV+ QP+FAF
Sbjct  301   MFYMLCGSMGYAAFGDAAPGNLLTGFGFYNPFWLLDIANAAIVVHLVGAYQVFAQPIFAF  360

Query  674   IEKWVGAKWPDSEIITKEINLKIPGFGYPYKLNTFRLLWRTAFVLLTTVISMLLPFFNDV  495
             IEK V  ++PD++  TKE  ++IPG   PY+ N FR+++R  FV+ TTVISML+PFFNDV
Sbjct  361   IEKSVAERYPDNDFFTKEFEIRIPGLRSPYRANVFRIVYRCIFVVTTTVISMLMPFFNDV  420

Query  494   VGILGAFGFWPLTVYFPVRMYISQKKIPKWSTRWICLQMlsgaclavslaaaagsfagvV  315
             VGILGA GFWPLTVYFPV MYI Q+K+ KWSTRW+CLQMLS ACL +S+ A  GS AGV+
Sbjct  421   VGILGALGFWPLTVYFPVEMYIKQRKVEKWSTRWVCLQMLSVACLVISVVAGVGSIAGVM  480

Query  314   LDLKLYRPFKTSY  276
             LDLK+Y+PFK++Y
Sbjct  481   LDLKVYKPFKSTY  493



>ref|XP_010546306.1| PREDICTED: amino acid permease 4 isoform X1 [Tarenaya hassleriana]
Length=472

 Score =   741 bits (1912),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 366/485 (75%), Positives = 416/485 (86%), Gaps = 13/485 (3%)
 Frame = -3

Query  1730  MGESAAATKNHRHHLGVSIDAPPLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSGVLS  1551
             MGES A             +  P   FK  DDDGR +RTGTVWTASAHIITAVIGSGVLS
Sbjct  1     MGESGA-------------NVLPQPAFKCFDDDGRLKRTGTVWTASAHIITAVIGSGVLS  47

Query  1550  LAWAIGQLGWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRNYTYMDAVRSNLGGY  1371
             LAWAI QLGW+AGP+VMLLFS V YY+STLL+DCYR GDPV GKRNYTYMDAVRS LGG+
Sbjct  48    LAWAIAQLGWIAGPAVMLLFSFVTYYSSTLLSDCYRTGDPVSGKRNYTYMDAVRSILGGF  107

Query  1370  QVKICGLIQYFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFGII  1191
             + KICGLIQY NLFGIA+GYTIAASISMMAIKRSNCFH+SGGKNPCHMSSNPYMI FG+ 
Sbjct  108   KFKICGLIQYLNLFGIAVGYTIAASISMMAIKRSNCFHKSGGKNPCHMSSNPYMIMFGLT  167

Query  1190  EIILSQIPDFDQIWWLSIVAAVMSFTYSGIGLGLGIAQVVANGAFKGSLTGISIGTVTET  1011
             EI+LSQIPDFDQIWWLSIVAAVMSFTYS IGL LGI QV ANG FKGSLTGISIGTVTET
Sbjct  168   EILLSQIPDFDQIWWLSIVAAVMSFTYSAIGLSLGILQVTANGFFKGSLTGISIGTVTET  227

Query  1010  QKIWRSFQALGDIAFAYSYSIILIEIQDTVKSPPSESKTMRKASLFSTIVTTTFYMLCGC  831
             QKIWRSFQALGDIAFAYSYS++LIEIQDTV+SPP+ESKTM+KA+  S  VTT FYMLCGC
Sbjct  228   QKIWRSFQALGDIAFAYSYSVVLIEIQDTVRSPPAESKTMKKATRISIAVTTMFYMLCGC  287

Query  830   MGYAAFGDDAPGNLLTGFGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEKWVGAK  651
             MGYAAFGD APGNLLTGFG+Y PFWLLD+ANAAIVIHLVGAYQV+CQP+FAF+EKWV  +
Sbjct  288   MGYAAFGDFAPGNLLTGFGYYEPFWLLDVANAAIVIHLVGAYQVFCQPIFAFVEKWVSER  347

Query  650   WPDSEIITKEINLKIPGFGYPYKLNTFRLLWRTAFVLLTTVISMLLPFFNDVVGILGAFG  471
             +P + ++ KE  +++PGF  PY+ N FR ++R+ FV+ TTVISML+PFFNDVVGILGA G
Sbjct  348   FPGNGLLGKEFEIRVPGFRAPYRANVFRAVFRSGFVVSTTVISMLMPFFNDVVGILGALG  407

Query  470   FWPLTVYFPVRMYISQKKIPKWSTRWICLQMlsgaclavslaaaagsfagvVLDLKLYRP  291
             FWPLTVYFPV MY+ Q+K+ +WS RW+CLQMLS +CL +S+ A  GS AGV+LDLK+Y+P
Sbjct  408   FWPLTVYFPVEMYVRQRKVERWSVRWVCLQMLSVSCLVISVVAGVGSIAGVMLDLKVYKP  467

Query  290   FKTSY  276
             FK++Y
Sbjct  468   FKSTY  472



>ref|XP_010423021.1| PREDICTED: amino acid permease 2-like [Camelina sativa]
Length=493

 Score =   741 bits (1914),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 375/493 (76%), Positives = 420/493 (85%), Gaps = 8/493 (2%)
 Frame = -3

Query  1730  MGESAAATKNHRHHLG-------VSIDA-PPLYGFKGLDDDGRPQRTGTVWTASAHIITA  1575
             MGE+AAA ++H  H          S DA PP   FK  DDDGR +RTGTVWTASAHIITA
Sbjct  1     MGETAAANRHHHTHHHGHQVFDVASNDAVPPQPAFKCFDDDGRLKRTGTVWTASAHIITA  60

Query  1574  VIGSGVLSLAWAIGQLGWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRNYTYMDA  1395
             VIGSGVLSLAWAI QLGW+AGP+VMLLFS V  Y+STLL+DCYR GD V GKRNYTYMDA
Sbjct  61    VIGSGVLSLAWAIAQLGWIAGPAVMLLFSFVTLYSSTLLSDCYRTGDAVSGKRNYTYMDA  120

Query  1394  VRSNLGGYQVKICGLIQYFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNP  1215
             VRS LGG++ KICGLIQY NLFGIAIGYTIAASISMMAIKRSNCFH+SGGK+PCHMSSNP
Sbjct  121   VRSILGGFKFKICGLIQYLNLFGIAIGYTIAASISMMAIKRSNCFHKSGGKDPCHMSSNP  180

Query  1214  YMIAFGIIEIILSQIPDFDQIWWLSIVAAVMSFTYSGIGLGLGIAQVVANGAFKGSLTGI  1035
             YMI FG+ EI+ SQIPDFDQIWW+SIVAAVMSFTYS IGL LGI QV ANG FKGSLTGI
Sbjct  181   YMIIFGVTEILFSQIPDFDQIWWISIVAAVMSFTYSAIGLALGIVQVAANGVFKGSLTGI  240

Query  1034  SIGTVTETQKIWRSFQALGDIAFAYSYSIILIEIQDTVKSPPSESKTMRKASLFSTIVTT  855
             SIGTVT+TQKIWR+FQALGDIAFAYSYS +LIEIQDTV+SPP+ESKTM+KA+  S  VTT
Sbjct  241   SIGTVTQTQKIWRTFQALGDIAFAYSYSAVLIEIQDTVRSPPAESKTMKKATKISIAVTT  300

Query  854   TFYMLCGCMGYAAFGDDAPGNLLTGFGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAF  675
              FYMLCG MGYAAFGD APGNLLTGFGFYNPFWLLDIANAAIVIHL+GAYQV+ QP+FAF
Sbjct  301   MFYMLCGSMGYAAFGDAAPGNLLTGFGFYNPFWLLDIANAAIVIHLIGAYQVFAQPIFAF  360

Query  674   IEKWVGAKWPDSEIITKEINLKIPGFGYPYKLNTFRLLWRTAFVLLTTVISMLLPFFNDV  495
             IEK V  ++PD++  TKE  +KIPG   PYK N FR+++R  FV+ TTVISML+PFFNDV
Sbjct  361   IEKSVAERYPDNDFFTKEFEIKIPGLKSPYKANVFRIVYRCGFVVSTTVISMLMPFFNDV  420

Query  494   VGILGAFGFWPLTVYFPVRMYISQKKIPKWSTRWICLQMlsgaclavslaaaagsfagvV  315
             VGILGA GFWPLTVYFPV MYI Q+K+ KWSTRW+CLQMLS ACL +S+ A  GS AGV+
Sbjct  421   VGILGALGFWPLTVYFPVEMYIKQRKVEKWSTRWVCLQMLSVACLLISVVAGVGSIAGVM  480

Query  314   LDLKLYRPFKTSY  276
             LDLK+Y+PFK++Y
Sbjct  481   LDLKVYKPFKSTY  493



>gb|AAM62803.1| amino acid carrier, putative [Arabidopsis thaliana]
Length=476

 Score =   741 bits (1912),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 365/475 (77%), Positives = 417/475 (88%), Gaps = 1/475 (0%)
 Frame = -3

Query  1700  HRHHLGVSIDAPPLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSGVLSLAWAIGQLGW  1521
               H   +++D P   G K LDDDG+ +RTG+VWTASAHIITAVIGSGVLSLAWA  QLGW
Sbjct  3     QNHQTVLAVDMPQTGGSKYLDDDGKNKRTGSVWTASAHIITAVIGSGVLSLAWATAQLGW  62

Query  1520  VAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRNYTYMDAVRSNLGGYQVKICGLIQY  1341
             +AGP VMLLFS V Y+TS+LLA CYR+GDP+ GKRNYTYMDAVRSNLGG +V +CG++QY
Sbjct  63    LAGPVVMLLFSVVTYFTSSLLAACYRSGDPISGKRNYTYMDAVRSNLGGVKVTLCGIVQY  122

Query  1340  FNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFGIIEIILSQIPDF  1161
              N+FG+AIGYTIA++ISMMAIKRSNCFH+SGGK+PCHM+SNPYMIAFG+++I+ SQIPDF
Sbjct  123   LNIFGVAIGYTIASAISMMAIKRSNCFHKSGGKDPCHMNSNPYMIAFGLVQILFSQIPDF  182

Query  1160  DQIWWLSIVAAVMSFTYSGIGLGLGIAQVVANGAFKGSLTGISIGTVTETQKIWRSFQAL  981
             DQ+WWLSI+AAVMSFTYS  GL LGIAQVV NG  KGSLTGISIG VTETQKIWR+FQAL
Sbjct  183   DQLWWLSILAAVMSFTYSSAGLALGIAQVVVNGKVKGSLTGISIGAVTETQKIWRTFQAL  242

Query  980   GDIAFAYSYSIILIEIQDTVKSPPSESKTMRKASLFSTIVTTTFYMLCGCMGYAAFGDDA  801
             GDIAFAYSYSIILIEIQDTVKSPPSE KTM+KA+L S  VTT FYMLCGCMGYAAFGD +
Sbjct  243   GDIAFAYSYSIILIEIQDTVKSPPSEEKTMKKATLVSVSVTTMFYMLCGCMGYAAFGDLS  302

Query  800   PGNLLTGFGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEKWVGAKWPDSEIITKE  621
             PGNLLTGFGFYNP+WLLDIANAAIVIHL+GAYQVYCQPLFAFIEK    ++PDSE I K+
Sbjct  303   PGNLLTGFGFYNPYWLLDIANAAIVIHLIGAYQVYCQPLFAFIEKQASIQFPDSEFIAKD  362

Query  620   INLKIPGFGYPYKLNTFRLLWRTAFVLLTTVISMLLPFFNDVVGILGAFGFWPLTVYFPV  441
             I + IPGF  P +LN FRL+WRT FV++TTVISMLLPFFNDVVG+LGA GFWPLTVYFPV
Sbjct  363   IKIPIPGFK-PLRLNVFRLIWRTVFVIITTVISMLLPFFNDVVGLLGALGFWPLTVYFPV  421

Query  440   RMYISQKKIPKWSTRWICLQMlsgaclavslaaaagsfagvVLDLKLYRPFKTSY  276
              MYI+QKKIP+WSTRW+CLQ+ S  CL VS+AAAAGS AGV+LDLK Y+PF++ Y
Sbjct  422   EMYIAQKKIPRWSTRWVCLQVFSLGCLVVSIAAAAGSIAGVLLDLKSYKPFRSEY  476



>ref|XP_006394236.1| hypothetical protein EUTSA_v10004152mg [Eutrema salsugineum]
 ref|XP_006394237.1| hypothetical protein EUTSA_v10004152mg [Eutrema salsugineum]
 gb|ESQ31522.1| hypothetical protein EUTSA_v10004152mg [Eutrema salsugineum]
 gb|ESQ31523.1| hypothetical protein EUTSA_v10004152mg [Eutrema salsugineum]
Length=466

 Score =   740 bits (1911),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 358/463 (77%), Positives = 410/463 (89%), Gaps = 0/463 (0%)
 Frame = -3

Query  1664  PLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSGVLSLAWAIGQLGWVAGPSVMLLFSC  1485
             P   FK  DDDGR +R+GTVWTASAHIITAVIGSGVLSLAWAIGQLGW+AGP+VM LFS 
Sbjct  4     PRPAFKCFDDDGRLKRSGTVWTASAHIITAVIGSGVLSLAWAIGQLGWIAGPAVMFLFSF  63

Query  1484  VVYYTSTLLADCYRAGDPVFGKRNYTYMDAVRSNLGGYQVKICGLIQYFNLFGIAIGYTI  1305
             V YY+STLL+DCYR GD V GKRNYTYMDAVRS LGG++ KICGLIQY NLFGI +GYTI
Sbjct  64    VTYYSSTLLSDCYRTGDHVSGKRNYTYMDAVRSILGGFRFKICGLIQYLNLFGITVGYTI  123

Query  1304  AASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFGIIEIILSQIPDFDQIWWLSIVAAV  1125
             AA+ISMMAIKRSNCFHESGGKNPCHMSSNPYMI FG+ EI+LSQI DFDQIWWLSIVAA+
Sbjct  124   AAAISMMAIKRSNCFHESGGKNPCHMSSNPYMIMFGVTEILLSQIKDFDQIWWLSIVAAI  183

Query  1124  MSFTYSGIGLGLGIAQVVANGAFKGSLTGISIGTVTETQKIWRSFQALGDIAFAYSYSII  945
             MSFTYS IGL LGI QV ANG FKGSLTGISIGTVT+TQKIWR+FQALGDIAFAYSYS++
Sbjct  184   MSFTYSAIGLALGIIQVAANGVFKGSLTGISIGTVTQTQKIWRTFQALGDIAFAYSYSVV  243

Query  944   LIEIQDTVKSPPSESKTMRKASLFSTIVTTTFYMLCGCMGYAAFGDDAPGNLLTGFGFYN  765
             LIEIQDTV+SPP+ESKTM+KA+  S  VTTTFYMLCGCMGYAAFGD APGNLLTGFGFYN
Sbjct  244   LIEIQDTVRSPPAESKTMKKATRISIAVTTTFYMLCGCMGYAAFGDAAPGNLLTGFGFYN  303

Query  764   PFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEKWVGAKWPDSEIITKEINLKIPGFGYPY  585
             PFWLLD+ANAAIV+HLVGAYQV+ QP+FAF+EK   A++PD++++TKE  ++IPG   PY
Sbjct  304   PFWLLDVANAAIVVHLVGAYQVFAQPIFAFVEKQAAARFPDNDLVTKEFEIRIPGIRSPY  363

Query  584   KLNTFRLLWRTAFVLLTTVISMLLPFFNDVVGILGAFGFWPLTVYFPVRMYISQKKIPKW  405
             K+N FR ++R+ FV+LTTVISML+PFFNDVVGILGA GFWPLTVYFPV MYI Q+K+ +W
Sbjct  364   KVNVFRAVFRSCFVVLTTVISMLMPFFNDVVGILGALGFWPLTVYFPVEMYIKQRKVERW  423

Query  404   STRWICLQMlsgaclavslaaaagsfagvVLDLKLYRPFKTSY  276
             S +W+CLQMLS  CL +++ A  GS AGV+LDLK+Y+PFKT+Y
Sbjct  424   SLKWVCLQMLSCGCLVITVVAGVGSLAGVMLDLKVYKPFKTTY  466



>ref|XP_009131105.1| PREDICTED: amino acid permease 2 [Brassica rapa]
Length=487

 Score =   741 bits (1913),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 372/487 (76%), Positives = 423/487 (87%), Gaps = 2/487 (0%)
 Frame = -3

Query  1730  MGESAAATKNHRHHLGVSIDA--PPLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSGV  1557
             MGE+AAA  +H HH     DA  P    FK  DDDGR +RTGTVWTASAHIITAVIGSGV
Sbjct  1     MGETAAANNHHHHHGHQVFDASVPQQPAFKCFDDDGRLKRTGTVWTASAHIITAVIGSGV  60

Query  1556  LSLAWAIGQLGWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRNYTYMDAVRSNLG  1377
             LSLAWAI QLGW+AGP+VMLLFS V  Y+STLL+DCYR GD V GKRNYTYMDAVRS LG
Sbjct  61    LSLAWAIAQLGWIAGPAVMLLFSFVTLYSSTLLSDCYRTGDAVSGKRNYTYMDAVRSILG  120

Query  1376  GYQVKICGLIQYFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFG  1197
             G++ KICGLIQY NLFGIA+GYTIAASISMMAIKRSNCFH+SGGK+PCHMSSNPYMI FG
Sbjct  121   GFKFKICGLIQYLNLFGIAVGYTIAASISMMAIKRSNCFHKSGGKDPCHMSSNPYMIIFG  180

Query  1196  IIEIILSQIPDFDQIWWLSIVAAVMSFTYSGIGLGLGIAQVVANGAFKGSLTGISIGTVT  1017
             + EI+LSQ+PDFDQIWW+SIVAAVMSFTYS IGL LGI QV ANG FKGSLTGISIGTVT
Sbjct  181   VTEILLSQVPDFDQIWWISIVAAVMSFTYSAIGLALGIVQVAANGVFKGSLTGISIGTVT  240

Query  1016  ETQKIWRSFQALGDIAFAYSYSIILIEIQDTVKSPPSESKTMRKASLFSTIVTTTFYMLC  837
             +TQKIWR+FQALGDIAFAYSYS++LIEIQDTV+SPPSES TM+KA+  S  VTT FYMLC
Sbjct  241   QTQKIWRTFQALGDIAFAYSYSVVLIEIQDTVRSPPSESTTMKKATKISIAVTTIFYMLC  300

Query  836   GCMGYAAFGDDAPGNLLTGFGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEKWVG  657
             G MGYAAFGD APGNLLTGFGFYNPFWLLDIANAAIV+HL+GAYQV+ QP+FAF+EK V 
Sbjct  301   GSMGYAAFGDAAPGNLLTGFGFYNPFWLLDIANAAIVVHLIGAYQVFSQPIFAFVEKSVS  360

Query  656   AKWPDSEIITKEINLKIPGFGYPYKLNTFRLLWRTAFVLLTTVISMLLPFFNDVVGILGA  477
              ++PDS+++TKE+ +KIPGF  PYK N FR+++R  FV+LTTVISML+PFFNDVVGILG 
Sbjct  361   ERFPDSDLLTKELQIKIPGFRSPYKTNVFRVVFRCCFVVLTTVISMLMPFFNDVVGILGV  420

Query  476   FGFWPLTVYFPVRMYISQKKIPKWSTRWICLQMlsgaclavslaaaagsfagvVLDLKLY  297
              GFWPLTVYFPV MYI Q+K+ KWSTRW+CLQMLS ACL +S+ A  GS AGV+LDLK+Y
Sbjct  421   LGFWPLTVYFPVEMYIKQRKVEKWSTRWVCLQMLSVACLVISVVAGVGSIAGVMLDLKVY  480

Query  296   RPFKTSY  276
             +PF+++Y
Sbjct  481   KPFQSTY  487



>emb|CDX87522.1| BnaA07g33510D [Brassica napus]
Length=476

 Score =   739 bits (1907),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 367/475 (77%), Positives = 417/475 (88%), Gaps = 1/475 (0%)
 Frame = -3

Query  1700  HRHHLGVSIDAPPLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSGVLSLAWAIGQLGW  1521
                    ++D P   G K  DDDGR +RTG+VWTASAHIITAVIGSGVLSLAWA  QLGW
Sbjct  3     QNQQEAFAVDMPQSGGSKCFDDDGRIKRTGSVWTASAHIITAVIGSGVLSLAWATAQLGW  62

Query  1520  VAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRNYTYMDAVRSNLGGYQVKICGLIQY  1341
             +AGP VMLLFS V Y+TSTLLA CYR+GDP+ GKRNYTYMDAVRSNLGG +VK+CG++QY
Sbjct  63    LAGPVVMLLFSIVTYFTSTLLAACYRSGDPISGKRNYTYMDAVRSNLGGVKVKLCGIVQY  122

Query  1340  FNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFGIIEIILSQIPDF  1161
              NLFG+AIGYTIA++ISMMAIKRSNCFH+SGGK+PCHM+SNPYMIAFG+++II SQIPDF
Sbjct  123   LNLFGVAIGYTIASAISMMAIKRSNCFHKSGGKDPCHMNSNPYMIAFGLVQIIFSQIPDF  182

Query  1160  DQIWWLSIVAAVMSFTYSGIGLGLGIAQVVANGAFKGSLTGISIGTVTETQKIWRSFQAL  981
             DQ+WWLS++AAVMSFTYS  GL LGIAQVVANG  KGSLTGISIG VTETQKIWRSFQAL
Sbjct  183   DQLWWLSVLAAVMSFTYSSAGLALGIAQVVANGKVKGSLTGISIGAVTETQKIWRSFQAL  242

Query  980   GDIAFAYSYSIILIEIQDTVKSPPSESKTMRKASLFSTIVTTTFYMLCGCMGYAAFGDDA  801
             GDIAFAYSYSIILIEIQDTVKSPPSE KTM+KA+L S  VTT FYMLCGCMGYAAFGD +
Sbjct  243   GDIAFAYSYSIILIEIQDTVKSPPSEEKTMKKATLVSVGVTTMFYMLCGCMGYAAFGDMS  302

Query  800   PGNLLTGFGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEKWVGAKWPDSEIITKE  621
             PGNLLTGFGFYNP+WLLDIANAAIV+HLVGAYQVYCQPLFAFIE+    ++PDS+ I K+
Sbjct  303   PGNLLTGFGFYNPYWLLDIANAAIVVHLVGAYQVYCQPLFAFIERQASTRFPDSDFIAKD  362

Query  620   INLKIPGFGYPYKLNTFRLLWRTAFVLLTTVISMLLPFFNDVVGILGAFGFWPLTVYFPV  441
             I + IPGF  P +LN FRL+WRT FV++TT+ISMLLPFFNDVVG+LGA GFWPLTVYFPV
Sbjct  363   IKIPIPGFK-PLRLNFFRLIWRTVFVIITTLISMLLPFFNDVVGLLGALGFWPLTVYFPV  421

Query  440   RMYISQKKIPKWSTRWICLQMlsgaclavslaaaagsfagvVLDLKLYRPFKTSY  276
              MYI QKKIP+WST+W+CLQ+ S ACL VS+AAAAGS AGVVLDLK Y+PF+++Y
Sbjct  422   EMYIEQKKIPRWSTQWVCLQVFSSACLVVSIAAAAGSIAGVVLDLKSYKPFQSNY  476



>ref|XP_010095435.1| hypothetical protein L484_013392 [Morus notabilis]
 gb|EXB60127.1| hypothetical protein L484_013392 [Morus notabilis]
Length=482

 Score =   739 bits (1907),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 373/486 (77%), Positives = 421/486 (87%), Gaps = 5/486 (1%)
 Frame = -3

Query  1730  MGESAAATKNHRHHLGVSIDAPPLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSGVLS  1551
             MGE       HR    VS+D P   G K  DDDGR +RTGTVWTASAHIITAVIGSGVLS
Sbjct  1     MGEQQL---QHRQVFDVSLDVPQQPGSKCFDDDGRLKRTGTVWTASAHIITAVIGSGVLS  57

Query  1550  LAWAIGQLGWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRNYTYMDAVRSNLGGY  1371
             LAWA  QLGW+AGP+VM LFS V YYTSTLL+ CYR GDPV GKRNYTYMDAVRSNLGG 
Sbjct  58    LAWATAQLGWIAGPAVMFLFSFVTYYTSTLLSACYRTGDPVTGKRNYTYMDAVRSNLGGL  117

Query  1370  QVKICGLIQYFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFGII  1191
             +V+ICGL QY NLFG+AIGYTIA++ISMMAIKRSNCFH+SG K+PCHMSSNPYMIAFG+ 
Sbjct  118   RVRICGLFQYLNLFGVAIGYTIASAISMMAIKRSNCFHKSGRKDPCHMSSNPYMIAFGVT  177

Query  1190  EIILSQIPDFDQIWWLSIVAAVMSFTYSGIGLGLGIAQVVANGAFKGSLTGISIGTVTET  1011
             EII SQIP+FDQ+WWLS+VAAVMSFTYS IGLGLGIAQV ANG   GSLTGISIGTVT+T
Sbjct  178   EIIFSQIPNFDQLWWLSLVAAVMSFTYSTIGLGLGIAQVAANGKVAGSLTGISIGTVTQT  237

Query  1010  QKIWRSFQALGDIAFAYSYSIILIEIQDTVKS-PPSESKTMRKASLFSTIVTTTFYMLCG  834
             +KIWRSFQALGDIAFAYSYSIILIEIQDT+K  PPSE+KTM+KA+L S  VTT FYMLCG
Sbjct  238   EKIWRSFQALGDIAFAYSYSIILIEIQDTIKCPPPSEAKTMKKATLISVSVTTLFYMLCG  297

Query  833   CMGYAAFGDDAPGNLLTGFGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEKWVGA  654
             CMGYAAFGD +PGNLLTGFGFYNP+WLLDIANAAIVIHLVGAYQVYCQPLFAF+EK    
Sbjct  298   CMGYAAFGDMSPGNLLTGFGFYNPYWLLDIANAAIVIHLVGAYQVYCQPLFAFVEKQAAQ  357

Query  653   KWPDSEIITKEINLKIPGFGYPYKLNTFRLLWRTAFVLLTTVISMLLPFFNDVVGILGAF  474
             ++PDSE IT++I + +PG  + Y LN FRL+WRT FV+LTT+ISMLLPFFND+VG+LGA 
Sbjct  358   RFPDSEFITRDIRIPLPGSRF-YNLNLFRLVWRTIFVILTTLISMLLPFFNDIVGLLGAL  416

Query  473   GFWPLTVYFPVRMYISQKKIPKWSTRWICLQMlsgaclavslaaaagsfagvVLDLKLYR  294
             GFWPLTVY+PV MYI+QK+IPKWST+W+CLQ+LS ACL +++AAAAGS AGV+LDLK Y+
Sbjct  417   GFWPLTVYYPVEMYIAQKRIPKWSTKWLCLQILSFACLIITVAAAAGSIAGVILDLKSYK  476

Query  293   PFKTSY  276
             PFKT Y
Sbjct  477   PFKTDY  482



>ref|XP_002864872.1| hypothetical protein ARALYDRAFT_496573 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH41131.1| hypothetical protein ARALYDRAFT_496573 [Arabidopsis lyrata subsp. 
lyrata]
Length=466

 Score =   738 bits (1905),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 359/463 (78%), Positives = 408/463 (88%), Gaps = 0/463 (0%)
 Frame = -3

Query  1664  PLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSGVLSLAWAIGQLGWVAGPSVMLLFSC  1485
             P   FK  DDDGR +R+GT+WTASAHIITAVIGSGVLSLAWAIGQLGW+AGP+VM LFS 
Sbjct  4     PRPAFKCFDDDGRLKRSGTIWTASAHIITAVIGSGVLSLAWAIGQLGWIAGPAVMFLFSF  63

Query  1484  VVYYTSTLLADCYRAGDPVFGKRNYTYMDAVRSNLGGYQVKICGLIQYFNLFGIAIGYTI  1305
             V YY+STLL+DCYR GDPV GKRNYTYMDAVRS LGG++ KICGLIQY NLFGI +GYTI
Sbjct  64    VTYYSSTLLSDCYRTGDPVSGKRNYTYMDAVRSILGGFRFKICGLIQYLNLFGITVGYTI  123

Query  1304  AASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFGIIEIILSQIPDFDQIWWLSIVAAV  1125
             AASISMMAIKRSNCFHESGGKNPCHMSSNPYMI FG+ EI+LSQI DFDQIWWLSIVAA+
Sbjct  124   AASISMMAIKRSNCFHESGGKNPCHMSSNPYMIMFGVTEILLSQIKDFDQIWWLSIVAAI  183

Query  1124  MSFTYSGIGLGLGIAQVVANGAFKGSLTGISIGTVTETQKIWRSFQALGDIAFAYSYSII  945
             MSFTYS IGL LGI QV ANG  KGSLTGISIG VT+TQKIWR+FQALGDIAFAYSYS++
Sbjct  184   MSFTYSAIGLALGIIQVAANGVVKGSLTGISIGAVTQTQKIWRTFQALGDIAFAYSYSVV  243

Query  944   LIEIQDTVKSPPSESKTMRKASLFSTIVTTTFYMLCGCMGYAAFGDDAPGNLLTGFGFYN  765
             LIEIQDTVKSPP+ESKTM+ A+  S  VTTTFY+LCGCMGYAAFGD APGNLLTGFGFYN
Sbjct  244   LIEIQDTVKSPPAESKTMKIATRISIAVTTTFYLLCGCMGYAAFGDAAPGNLLTGFGFYN  303

Query  764   PFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEKWVGAKWPDSEIITKEINLKIPGFGYPY  585
             PFWLLD+ANAAIV+HLVGAYQV+ QP+FAFIEK   A++PDS+++TKE  ++IPG   PY
Sbjct  304   PFWLLDVANAAIVVHLVGAYQVFAQPIFAFIEKQAAARFPDSDLVTKEYEIRIPGIRSPY  363

Query  584   KLNTFRLLWRTAFVLLTTVISMLLPFFNDVVGILGAFGFWPLTVYFPVRMYISQKKIPKW  405
             K+N FR ++R+ FV+LTTVISML+PFFNDVVGILGA GFWPLTVYFPV MYI Q+K+ +W
Sbjct  364   KVNVFRAVYRSGFVVLTTVISMLMPFFNDVVGILGALGFWPLTVYFPVEMYIRQRKVERW  423

Query  404   STRWICLQMlsgaclavslaaaagsfagvVLDLKLYRPFKTSY  276
             S +W+CLQMLS  CL ++L A  GS AGV+LDLK+Y+PFKT+Y
Sbjct  424   SMKWVCLQMLSCGCLMITLVAGVGSIAGVMLDLKVYKPFKTTY  466



>ref|XP_006390096.1| hypothetical protein EUTSA_v10018484mg [Eutrema salsugineum]
 gb|ESQ27382.1| hypothetical protein EUTSA_v10018484mg [Eutrema salsugineum]
Length=476

 Score =   738 bits (1904),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 367/476 (77%), Positives = 417/476 (88%), Gaps = 1/476 (0%)
 Frame = -3

Query  1703  NHRHHLGVSIDAPPLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSGVLSLAWAIGQLG  1524
             NH      ++D P   G K  DDDGR +RTG+VWTASAHIITAVIGSGVLSLAWA  QLG
Sbjct  2     NHNQQAAFAVDMPQPGGSKCFDDDGRIKRTGSVWTASAHIITAVIGSGVLSLAWATAQLG  61

Query  1523  WVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRNYTYMDAVRSNLGGYQVKICGLIQ  1344
             W+AGP VMLLFS V Y+TSTLLA CYR+GDP+ GKRNYTYMDAVRSNLGG +VK+CG++Q
Sbjct  62    WLAGPVVMLLFSVVTYFTSTLLAACYRSGDPISGKRNYTYMDAVRSNLGGVKVKLCGIVQ  121

Query  1343  YFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFGIIEIILSQIPD  1164
             Y NLFG+AIGYTIA++ISMMAIKRSNCFH+SGGK+PCHM+SNPYMIAFG+++II SQIPD
Sbjct  122   YLNLFGVAIGYTIASAISMMAIKRSNCFHKSGGKDPCHMNSNPYMIAFGLVQIIFSQIPD  181

Query  1163  FDQIWWLSIVAAVMSFTYSGIGLGLGIAQVVANGAFKGSLTGISIGTVTETQKIWRSFQA  984
             FDQ+WWLSI+AAVMSFTYS  GL LGIAQVVANG  KGSLTGISIG VTETQKIWRSFQA
Sbjct  182   FDQLWWLSILAAVMSFTYSSAGLALGIAQVVANGKVKGSLTGISIGAVTETQKIWRSFQA  241

Query  983   LGDIAFAYSYSIILIEIQDTVKSPPSESKTMRKASLFSTIVTTTFYMLCGCMGYAAFGDD  804
             LGDIAFAYSYSIILIEIQDTVKSPPSE KTM+KA+L S  VTT FYMLCGCMGYAAFGD 
Sbjct  242   LGDIAFAYSYSIILIEIQDTVKSPPSEEKTMKKATLVSVGVTTMFYMLCGCMGYAAFGDM  301

Query  803   APGNLLTGFGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEKWVGAKWPDSEIITK  624
             +PGNLLTGFGFYNP+WLLDIANAAIV+HL+GAYQVYCQPLFAFIEK    ++P ++ I K
Sbjct  302   SPGNLLTGFGFYNPYWLLDIANAAIVVHLIGAYQVYCQPLFAFIEKQASIRFPGNKFIAK  361

Query  623   EINLKIPGFGYPYKLNTFRLLWRTAFVLLTTVISMLLPFFNDVVGILGAFGFWPLTVYFP  444
             +I + IPGF  P++LN FRL+WRT FV++TT+ISMLLPFFNDVVG+LGA GFWPLTVYFP
Sbjct  362   DIKIPIPGFK-PFRLNFFRLIWRTVFVMITTLISMLLPFFNDVVGLLGALGFWPLTVYFP  420

Query  443   VRMYISQKKIPKWSTRWICLQMlsgaclavslaaaagsfagvVLDLKLYRPFKTSY  276
             V MYI QKKI +WST+W+CLQ+ S ACL VS+AAAAGS AGVVLDLK Y+PF++ Y
Sbjct  421   VEMYIEQKKIARWSTQWVCLQVFSSACLVVSIAAAAGSIAGVVLDLKSYKPFRSDY  476



>gb|AAM61320.1| amino acid transporter AAP4 [Arabidopsis thaliana]
Length=466

 Score =   737 bits (1903),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 361/463 (78%), Positives = 407/463 (88%), Gaps = 0/463 (0%)
 Frame = -3

Query  1664  PLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSGVLSLAWAIGQLGWVAGPSVMLLFSC  1485
             P   FK  DDDGR +R+GTVWTASAHIITAVIGSGVLSLAWAIGQLGW+AGP+VM LFS 
Sbjct  4     PRPAFKCFDDDGRLKRSGTVWTASAHIITAVIGSGVLSLAWAIGQLGWIAGPTVMXLFSF  63

Query  1484  VVYYTSTLLADCYRAGDPVFGKRNYTYMDAVRSNLGGYQVKICGLIQYFNLFGIAIGYTI  1305
             V YY+STLL+DCYR GDPV GKRNYTYMDAVRS LGG++ KICGLIQY NLFGI +GYTI
Sbjct  64    VTYYSSTLLSDCYRTGDPVSGKRNYTYMDAVRSILGGFRFKICGLIQYLNLFGITVGYTI  123

Query  1304  AASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFGIIEIILSQIPDFDQIWWLSIVAAV  1125
             AASISMMAIKRSNCFHESGGKNPCHMSSNPYMI FG+ EI+LSQI DFDQIWWLSIVAA+
Sbjct  124   AASISMMAIKRSNCFHESGGKNPCHMSSNPYMIMFGVTEILLSQIKDFDQIWWLSIVAAI  183

Query  1124  MSFTYSGIGLGLGIAQVVANGAFKGSLTGISIGTVTETQKIWRSFQALGDIAFAYSYSII  945
             MSFTYS IGL LGI QV ANG  KGSLTGISIG VT TQKIWR+FQALGDIAFAYSYS++
Sbjct  184   MSFTYSAIGLALGIIQVAANGVVKGSLTGISIGAVTXTQKIWRTFQALGDIAFAYSYSVV  243

Query  944   LIEIQDTVKSPPSESKTMRKASLFSTIVTTTFYMLCGCMGYAAFGDDAPGNLLTGFGFYN  765
             LIEIQDTV+SPP+ESKTM+ A+  S  VTTTFYMLCGCMGYAAFGD APGNLLTGFGFYN
Sbjct  244   LIEIQDTVRSPPAESKTMKIATRISIAVTTTFYMLCGCMGYAAFGDKAPGNLLTGFGFYN  303

Query  764   PFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEKWVGAKWPDSEIITKEINLKIPGFGYPY  585
             PFWLLD+ANAAIVIHLVGAYQV+ QP+FAFIEK   A++PDS+++TKE  ++IPGF  PY
Sbjct  304   PFWLLDVANAAIVIHLVGAYQVFAQPIFAFIEKQAAARFPDSDLVTKEYEIRIPGFRSPY  363

Query  584   KLNTFRLLWRTAFVLLTTVISMLLPFFNDVVGILGAFGFWPLTVYFPVRMYISQKKIPKW  405
             K+N FR ++R+ FV+LTTVISML+PFFNDVVGILGA GFWPLTVYFPV MYI Q+K+ +W
Sbjct  364   KVNVFRAVYRSGFVVLTTVISMLMPFFNDVVGILGALGFWPLTVYFPVEMYIRQRKVERW  423

Query  404   STRWICLQMlsgaclavslaaaagsfagvVLDLKLYRPFKTSY  276
             S +W+CLQMLS  CL ++L A  GS AGV+LDLK+ +PFKT+Y
Sbjct  424   SMKWVCLQMLSCGCLMITLVAGVGSIAGVMLDLKVXKPFKTTY  466



>gb|KFK42132.1| hypothetical protein AALP_AA2G215300 [Arabis alpina]
Length=476

 Score =   737 bits (1903),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 368/475 (77%), Positives = 416/475 (88%), Gaps = 1/475 (0%)
 Frame = -3

Query  1700  HRHHLGVSIDAPPLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSGVLSLAWAIGQLGW  1521
             H      ++D P     K  DDDGR +RTG+VWTASAHIITAVIGSGVLSLAWA  QLGW
Sbjct  3     HNKQTSFAVDLPQTGDSKCYDDDGRTKRTGSVWTASAHIITAVIGSGVLSLAWATAQLGW  62

Query  1520  VAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRNYTYMDAVRSNLGGYQVKICGLIQY  1341
             +AGP VMLLFS V Y+TSTLLA CYR+GDP+ GKRNYTYMDAVRSNLGG +VK+CG++QY
Sbjct  63    LAGPVVMLLFSIVTYFTSTLLAACYRSGDPISGKRNYTYMDAVRSNLGGVKVKLCGIVQY  122

Query  1340  FNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFGIIEIILSQIPDF  1161
              NLFG+AIGYTIA++ISMMAIKRSNCFH+SGGK+PCHM+SNPYMIAFG+++II SQIPDF
Sbjct  123   LNLFGVAIGYTIASAISMMAIKRSNCFHKSGGKDPCHMNSNPYMIAFGLVQIIFSQIPDF  182

Query  1160  DQIWWLSIVAAVMSFTYSGIGLGLGIAQVVANGAFKGSLTGISIGTVTETQKIWRSFQAL  981
             DQ+ WLSIVAAVMSFTYS  GL LGIAQVVANG  KGSLTGISIGTVTETQKIWRSFQAL
Sbjct  183   DQLSWLSIVAAVMSFTYSSAGLALGIAQVVANGKVKGSLTGISIGTVTETQKIWRSFQAL  242

Query  980   GDIAFAYSYSIILIEIQDTVKSPPSESKTMRKASLFSTIVTTTFYMLCGCMGYAAFGDDA  801
             GDIAFAYSYSIILIEIQDTVKSPPSE KTM+KA+L S  VTT FYMLCGCMGYAAFGD +
Sbjct  243   GDIAFAYSYSIILIEIQDTVKSPPSEEKTMKKATLVSVGVTTMFYMLCGCMGYAAFGDLS  302

Query  800   PGNLLTGFGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEKWVGAKWPDSEIITKE  621
             PGNLLTGFGFYNP+WLLDIANAAIV+HL+GAYQVYCQPLFAFIEK    ++PDS+ I K+
Sbjct  303   PGNLLTGFGFYNPYWLLDIANAAIVVHLIGAYQVYCQPLFAFIEKQASLRFPDSDFIAKD  362

Query  620   INLKIPGFGYPYKLNTFRLLWRTAFVLLTTVISMLLPFFNDVVGILGAFGFWPLTVYFPV  441
             I + +PG+  P +LN FRL+WRT FV++TTVISMLLPFFNDVVG+LGA GFWPLTVYFPV
Sbjct  363   IKIPVPGYK-PLRLNFFRLIWRTVFVIITTVISMLLPFFNDVVGLLGALGFWPLTVYFPV  421

Query  440   RMYISQKKIPKWSTRWICLQMlsgaclavslaaaagsfagvVLDLKLYRPFKTSY  276
              MYI QKKI +WSTRW+CLQ+ S ACL VS+AAAAGS AGVVLDLK Y+PF+++Y
Sbjct  422   EMYIEQKKIARWSTRWVCLQVFSLACLVVSIAAAAGSIAGVVLDLKSYKPFRSNY  476



>emb|CDX88365.1| BnaC06g38090D [Brassica napus]
Length=476

 Score =   737 bits (1903),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 367/475 (77%), Positives = 417/475 (88%), Gaps = 1/475 (0%)
 Frame = -3

Query  1700  HRHHLGVSIDAPPLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSGVLSLAWAIGQLGW  1521
                    S+D P   G K  DDDGR +RTG+VWTASAHIITAVIGSGVLSLAWA  QLGW
Sbjct  3     QNQQEAFSVDMPRTGGSKCFDDDGRIKRTGSVWTASAHIITAVIGSGVLSLAWATAQLGW  62

Query  1520  VAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRNYTYMDAVRSNLGGYQVKICGLIQY  1341
             +AGP VMLLFS V Y+TSTLLA CYR+GDP+ GKRNYTYMDAVRSNLGG +VK+CG++QY
Sbjct  63    LAGPVVMLLFSIVTYFTSTLLAACYRSGDPISGKRNYTYMDAVRSNLGGVKVKLCGIVQY  122

Query  1340  FNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFGIIEIILSQIPDF  1161
              NLFG+AIGYTIA++ISMMAIKRSNCFH+SGGK+PCHM+SNPYMIAFG+++II SQIPDF
Sbjct  123   LNLFGVAIGYTIASAISMMAIKRSNCFHKSGGKDPCHMNSNPYMIAFGLVQIIFSQIPDF  182

Query  1160  DQIWWLSIVAAVMSFTYSGIGLGLGIAQVVANGAFKGSLTGISIGTVTETQKIWRSFQAL  981
             DQ+WWLSI+AAVMSFTYS  GL LGIAQVVANG  KGSLTGISIG VTETQKIWRSFQAL
Sbjct  183   DQLWWLSILAAVMSFTYSSAGLALGIAQVVANGKVKGSLTGISIGAVTETQKIWRSFQAL  242

Query  980   GDIAFAYSYSIILIEIQDTVKSPPSESKTMRKASLFSTIVTTTFYMLCGCMGYAAFGDDA  801
             GDIAFAYSYSIILIEIQDTVKSPPSE KTM+KA+L S  VTT FYMLCGCMGYAAFGD +
Sbjct  243   GDIAFAYSYSIILIEIQDTVKSPPSEEKTMKKATLVSVGVTTMFYMLCGCMGYAAFGDMS  302

Query  800   PGNLLTGFGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEKWVGAKWPDSEIITKE  621
             PGNLLTGFGFYNP+WLLDIANAA+V+ LVGAYQVYCQPLFAFIE+    ++PDS+ I K+
Sbjct  303   PGNLLTGFGFYNPYWLLDIANAAVVVLLVGAYQVYCQPLFAFIERQASTRFPDSDFIAKD  362

Query  620   INLKIPGFGYPYKLNTFRLLWRTAFVLLTTVISMLLPFFNDVVGILGAFGFWPLTVYFPV  441
             I + IPGF  P++LN FRL+WRT FV++TT+ISMLLPFFNDVVG+LGA GFWPLTVYFPV
Sbjct  363   IKIPIPGFK-PFRLNFFRLIWRTVFVIITTLISMLLPFFNDVVGLLGALGFWPLTVYFPV  421

Query  440   RMYISQKKIPKWSTRWICLQMlsgaclavslaaaagsfagvVLDLKLYRPFKTSY  276
              MYI QKKIP+WST+W+CLQ+ S ACL VS+AAAAGS AGVVLDLK Y+PF+++Y
Sbjct  422   EMYIEQKKIPRWSTQWVCLQVFSSACLVVSIAAAAGSIAGVVLDLKSYKPFQSNY  476



>ref|XP_008466753.1| PREDICTED: amino acid permease 3-like [Cucumis melo]
Length=478

 Score =   737 bits (1902),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 376/487 (77%), Positives = 422/487 (87%), Gaps = 9/487 (2%)
 Frame = -3

Query  1736  MQMGESAAATKNHRHHLGVSIDAPPLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSGV  1557
             M+MGE+ A         G+S D  P  G K  DDDGR +RTGTVWTASAHIITAVIGSGV
Sbjct  1     MKMGENQA--------FGISNDVVPQGGSKCFDDDGRLKRTGTVWTASAHIITAVIGSGV  52

Query  1556  LSLAWAIGQLGWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRNYTYMDAVRSNLG  1377
             LSLAWA  QLGWVAGP+VM LFS V YYTS LL+ CYR+GDPV GKRNYTYMDAV++NLG
Sbjct  53    LSLAWATAQLGWVAGPAVMFLFSLVTYYTSVLLSACYRSGDPVSGKRNYTYMDAVQANLG  112

Query  1376  GYQVKICGLIQYFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFG  1197
             G+ VK+CG++QY N+ G+AIGYTIA++ISMMAIKRSNCFH SGGK+PC ++SNPYMI FG
Sbjct  113   GWNVKLCGVVQYANIVGVAIGYTIASAISMMAIKRSNCFHASGGKDPCQINSNPYMIGFG  172

Query  1196  IIEIILSQIPDFDQIWWLSIVAAVMSFTYSGIGLGLGIAQVVANGAFKGSLTGISIGTVT  1017
             I+EII SQI DFDQ+WWLSIVA+VMSFTYS IGLGLG+AQ+ ANG   GSLTGISIGTVT
Sbjct  173   IVEIIFSQIKDFDQLWWLSIVASVMSFTYSTIGLGLGVAQIAANGKIGGSLTGISIGTVT  232

Query  1016  ETQKIWRSFQALGDIAFAYSYSIILIEIQDTVKSPPSESKTMRKASLFSTIVTTTFYMLC  837
             +TQK+WRSFQALGDIAFAYSYSIILIEIQDTVKSPPSE+KTM+KA+L S  VTT FYMLC
Sbjct  233   QTQKVWRSFQALGDIAFAYSYSIILIEIQDTVKSPPSEAKTMKKATLVSVSVTTLFYMLC  292

Query  836   GCMGYAAFGDDAPGNLLTGFGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEKWVG  657
             G  GYAAFGD APGNLLTGFGFYNP+WLLDIANAAIVIHLVGAYQVYCQPLFAF+EK+  
Sbjct  293   GAAGYAAFGDMAPGNLLTGFGFYNPYWLLDIANAAIVIHLVGAYQVYCQPLFAFVEKYAA  352

Query  656   AKWPDSEIITKEINLKIPGFGYPYKLNTFRLLWRTAFVLLTTVISMLLPFFNDVVGILGA  477
              K PDSE ITK+I++ IPGF  PYKLN FRL+WRTAFV+ TTVISMLLPFFNDVVG LGA
Sbjct  353   EKSPDSEFITKDIDVPIPGF-RPYKLNLFRLVWRTAFVITTTVISMLLPFFNDVVGFLGA  411

Query  476   FGFWPLTVYFPVRMYISQKKIPKWSTRWICLQMlsgaclavslaaaagsfagvVLDLKLY  297
              GFWPLTVY+PV MYI+QKKIPKWS+RW+CLQ LS ACL +S+AAAAGS AGVVLDLK Y
Sbjct  412   LGFWPLTVYYPVEMYIAQKKIPKWSSRWLCLQTLSFACLMISIAAAAGSVAGVVLDLKSY  471

Query  296   RPFKTSY  276
             +PFKTS+
Sbjct  472   KPFKTSF  478



>ref|XP_010537371.1| PREDICTED: amino acid permease 3 [Tarenaya hassleriana]
Length=480

 Score =   737 bits (1902),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 363/479 (76%), Positives = 418/479 (87%), Gaps = 2/479 (0%)
 Frame = -3

Query  1712  ATKNHRHHLGVSIDAPPLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSGVLSLAWAIG  1533
             + K+H      ++D PP  G +  DDDGR +RTG+VWTASAHIITAVIGSGVLSLAWA  
Sbjct  4     SAKSHDRQ-AFAVDMPPSGGSEIFDDDGRHKRTGSVWTASAHIITAVIGSGVLSLAWATA  62

Query  1532  QLGWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRNYTYMDAVRSNLGGYQVKICG  1353
             QLGWVAGP+ MLLFS V Y+TSTLL+ CYR+GDP+ GKRNYTYMDAVRSNLGG +VK+CG
Sbjct  63    QLGWVAGPAAMLLFSAVTYFTSTLLSSCYRSGDPLSGKRNYTYMDAVRSNLGGVKVKLCG  122

Query  1352  LIQYFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFGIIEIILSQ  1173
             L+QY NLFG+AIGYTIA++ SMMAIKRSNCFH+S GKNPC M+SNPYMIAFG++EII SQ
Sbjct  123   LVQYLNLFGVAIGYTIASATSMMAIKRSNCFHKSRGKNPCRMNSNPYMIAFGVVEIIFSQ  182

Query  1172  IPDFDQIWWLSIVAAVMSFTYSGIGLGLGIAQVVANGAFKGSLTGISIGTVTETQKIWRS  993
             IPDFDQ+WWLSI+AAVMSFTYS +GL LGIA+V  NG ++GSLTGIS+G VTETQK+WRS
Sbjct  183   IPDFDQLWWLSILAAVMSFTYSSVGLALGIAKVAENGKWRGSLTGISVGRVTETQKVWRS  242

Query  992   FQALGDIAFAYSYSIILIEIQDTVKSPPSESKTMRKASLFSTIVTTTFYMLCGCMGYAAF  813
             FQALGDIAFAYSYSIILIEIQDT+KSPP+E KTM+KA+L S  VTT FYMLCGCMGYAAF
Sbjct  243   FQALGDIAFAYSYSIILIEIQDTLKSPPAEEKTMKKATLVSVGVTTLFYMLCGCMGYAAF  302

Query  812   GDDAPGNLLTGFGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEKWVGAKWPDSEI  633
             GD +P NLLTGFG+YNPFWLLD+ANAAIV+HLVGAYQVYCQPLFAF+EK   A++P +E 
Sbjct  303   GDMSPANLLTGFGYYNPFWLLDVANAAIVVHLVGAYQVYCQPLFAFVEKQASARFPGNEF  362

Query  632   ITKEINLKIPGFGYPYKLNTFRLLWRTAFVLLTTVISMLLPFFNDVVGILGAFGFWPLTV  453
             I KEI + +PGF  PY LN FRL+WRTAFV++TTVISMLLPFFNDVVG+LGA GFWPLTV
Sbjct  363   IAKEIKIPVPGFK-PYNLNLFRLIWRTAFVIITTVISMLLPFFNDVVGLLGALGFWPLTV  421

Query  452   YFPVRMYISQKKIPKWSTRWICLQMlsgaclavslaaaagsfagvVLDLKLYRPFKTSY  276
             YFPV MYI QKKIP+WSTRW+CLQ+ S ACL V++AAAAGS AGVVLDLK Y+PF+T Y
Sbjct  422   YFPVEMYIEQKKIPRWSTRWVCLQVFSSACLVVTVAAAAGSVAGVVLDLKSYKPFRTDY  480



>ref|XP_004142635.1| PREDICTED: amino acid permease 3-like [Cucumis sativus]
 ref|XP_004170719.1| PREDICTED: amino acid permease 3-like [Cucumis sativus]
 gb|KGN54544.1| Amino acid permease [Cucumis sativus]
Length=480

 Score =   737 bits (1902),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 368/479 (77%), Positives = 422/479 (88%), Gaps = 4/479 (1%)
 Frame = -3

Query  1703  NHRHHLGVSIDAPPL---YGFKGLDDDGRPQRTGTVWTASAHIITAVIGSGVLSLAWAIG  1533
             N+ HH  ++I APP          DDDGRP+RTGTVWTASAHIITAVIGSGVLSLAWA  
Sbjct  3     NNHHHHSLNISAPPHPASAADTAFDDDGRPKRTGTVWTASAHIITAVIGSGVLSLAWATA  62

Query  1532  QLGWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRNYTYMDAVRSNLGGYQVKICG  1353
             QLGWVAGP VM+LFS V YYTSTLLA CYR+GD V GKRNYTYMDAVR+NLGG++VK+CG
Sbjct  63    QLGWVAGPVVMMLFSFVTYYTSTLLAACYRSGDSVNGKRNYTYMDAVRNNLGGFKVKLCG  122

Query  1352  LIQYFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFGIIEIILSQ  1173
             L+QY NLFG+AIGYTIA+SISMMAIKRSNCFH+SGGKNPCHM+SNPYMI+FGI+EI LSQ
Sbjct  123   LVQYVNLFGVAIGYTIASSISMMAIKRSNCFHKSGGKNPCHMNSNPYMISFGIMEIFLSQ  182

Query  1172  IPDFDQIWWLSIVAAVMSFTYSGIGLGLGIAQVVANGAFKGSLTGISIGTVTETQKIWRS  993
             IPDFDQ+WWLSIVAAVMSFTYS IGL LGI QV  NG FKGSLTG+SIG+VTE+QKIWRS
Sbjct  183   IPDFDQLWWLSIVAAVMSFTYSIIGLVLGIIQVTDNGKFKGSLTGVSIGSVTESQKIWRS  242

Query  992   FQALGDIAFAYSYSIILIEIQDTVKSPPSESKTMRKASLFSTIVTTTFYMLCGCMGYAAF  813
             FQALGD+AFAYS+SIILIEIQDT+K+PPSE+KTM+KA+  S  VTT FYMLCGCMGYAAF
Sbjct  243   FQALGDMAFAYSFSIILIEIQDTIKAPPSEAKTMKKATFLSVAVTTVFYMLCGCMGYAAF  302

Query  812   GDDAPGNLLTGFGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEKWVGAKWPDSEI  633
             GD APGNLLTGFGFYNP+WLLDIAN AIV+HLVGAYQV+CQPLFAFIEK   +++PDS+ 
Sbjct  303   GDLAPGNLLTGFGFYNPYWLLDIANVAIVVHLVGAYQVFCQPLFAFIEKNASSRFPDSKF  362

Query  632   ITKEINLKIPGFGYPYKLNTFRLLWRTAFVLLTTVISMLLPFFNDVVGILGAFGFWPLTV  453
             I ++IN+ IPGF  P+KLN FRL+WRT FV++TT++SMLLPFFND+VG+LGA GFWPLTV
Sbjct  363   INEDINIPIPGF-RPFKLNLFRLVWRTIFVIITTLVSMLLPFFNDIVGLLGALGFWPLTV  421

Query  452   YFPVRMYISQKKIPKWSTRWICLQMlsgaclavslaaaagsfagvVLDLKLYRPFKTSY  276
             YFPV MYI+QKKIPKWSTRWI LQ+LS ACL +S+AAAAGS AGV+ D K  +PF+T+Y
Sbjct  422   YFPVEMYIAQKKIPKWSTRWISLQILSMACLIISIAAAAGSVAGVIQDSKSIKPFQTTY  480



>ref|XP_006386354.1| hypothetical protein POPTR_0002s07960g [Populus trichocarpa]
 gb|ERP64151.1| hypothetical protein POPTR_0002s07960g [Populus trichocarpa]
Length=487

 Score =   737 bits (1903),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 371/488 (76%), Positives = 423/488 (87%), Gaps = 2/488 (0%)
 Frame = -3

Query  1736  MQMGESAAATKNHRHHL-GVSIDAPPLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSG  1560
             M MGE+ +A     H +  VSID  P  G K  DDDGRP+RTG VWTASAHIITAVIGSG
Sbjct  1     MTMGENTSAKNQLPHQVFSVSIDTNPQSGSKWFDDDGRPKRTGNVWTASAHIITAVIGSG  60

Query  1559  VLSLAWAIGQLGWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRNYTYMDAVRSNL  1380
             VLSLAWAIGQLGW+AGP+VMLLFS V YYTS LL+ CYR+GDPV GKRNYTYMDAVR+NL
Sbjct  61    VLSLAWAIGQLGWIAGPAVMLLFSLVTYYTSILLSACYRSGDPVNGKRNYTYMDAVRANL  120

Query  1379  GGYQVKICGLIQYFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAF  1200
             GG +VKICG +QY NLFG+AIGYTIA+SISMMAIKRSNCFH+SGG++PCHM++ PYMIAF
Sbjct  121   GGGKVKICGFVQYVNLFGVAIGYTIASSISMMAIKRSNCFHQSGGQDPCHMNAYPYMIAF  180

Query  1199  GIIEIILSQIPDFDQIWWLSIVAAVMSFTYSGIGLGLGIAQVVANGAFKGSLTGISIGTV  1020
             GI EI+LSQIP FDQ+ WLS+VAAVMSFTYS IGLGLGI +VV N    GSLTGISIGTV
Sbjct  181   GIAEILLSQIPGFDQLHWLSLVAAVMSFTYSSIGLGLGIGKVVENKRVMGSLTGISIGTV  240

Query  1019  TETQKIWRSFQALGDIAFAYSYSIILIEIQDTVKSPPSESKTMRKASLFSTIVTTTFYML  840
             T+TQKIWRSFQALGDIAFAYSYS+ILIEIQDTVK+PP+E+KTM+KA+L S  VTT FYM 
Sbjct  241   TQTQKIWRSFQALGDIAFAYSYSMILIEIQDTVKAPPTEAKTMKKATLISVAVTTLFYMF  300

Query  839   CGCMGYAAFGDDAPGNLLTGFGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEKWV  660
             CGC GYAAFGD +PGNLLTGFGFYNP+WLLDIANAAIVIHLVGAYQVYCQPLFAF+EK  
Sbjct  301   CGCFGYAAFGDLSPGNLLTGFGFYNPYWLLDIANAAIVIHLVGAYQVYCQPLFAFVEKEA  360

Query  659   GAKWPDSEIITKEINLKIPGFGYPYKLNTFRLLWRTAFVLLTTVISMLLPFFNDVVGILG  480
               ++PDS+ +TK+I + IPG G PY LN FR++WRT FV+ TTVISMLLPFFND+VG+LG
Sbjct  361   ARRFPDSDFVTKDIKISIPGLG-PYNLNLFRMIWRTLFVVTTTVISMLLPFFNDIVGLLG  419

Query  479   AFGFWPLTVYFPVRMYISQKKIPKWSTRWICLQMlsgaclavslaaaagsfagvVLDLKL  300
             A GFWPLTVYFPV MYISQKKIPKWSTRW+CLQ+LS ACL +++AAAAGS AGV+ D+K 
Sbjct  420   ALGFWPLTVYFPVEMYISQKKIPKWSTRWLCLQILSVACLIITIAAAAGSIAGVLDDVKT  479

Query  299   YRPFKTSY  276
              +PF+TSY
Sbjct  480   IKPFQTSY  487



>ref|XP_011003418.1| PREDICTED: amino acid permease 3-like [Populus euphratica]
Length=487

 Score =   737 bits (1902),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 370/489 (76%), Positives = 424/489 (87%), Gaps = 4/489 (1%)
 Frame = -3

Query  1736  MQMGESAAATKNH--RHHLGVSIDAPPLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGS  1563
             M+MGE+ A TKNH       VS+D  P    K  DDDGRP+RTG VWTASAH+ITAVIGS
Sbjct  1     MKMGENTA-TKNHLPPQAFSVSVDTDPQSDSKWFDDDGRPKRTGNVWTASAHVITAVIGS  59

Query  1562  GVLSLAWAIGQLGWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRNYTYMDAVRSN  1383
             GVLSLAWAIGQLGW+AGP+VMLLFS V YYTS LL+ CYR+GDPV GKRNYTYMDAVR+N
Sbjct  60    GVLSLAWAIGQLGWIAGPAVMLLFSFVTYYTSILLSACYRSGDPVNGKRNYTYMDAVRAN  119

Query  1382  LGGYQVKICGLIQYFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIA  1203
             LGG +VKICG +QY NLFG+AIGYTIA+SISMMAIKRSNCFH+SGGK+PC M++NPYMI 
Sbjct  120   LGGVKVKICGFVQYVNLFGVAIGYTIASSISMMAIKRSNCFHQSGGKDPCRMNANPYMIG  179

Query  1202  FGIIEIILSQIPDFDQIWWLSIVAAVMSFTYSGIGLGLGIAQVVANGAFKGSLTGISIGT  1023
             FGI EI+LSQIP FDQ+ WLS+VAAVMSFTYS IGLGLGI +V+ N   +GSLTGISIGT
Sbjct  180   FGIAEILLSQIPGFDQLHWLSLVAAVMSFTYSTIGLGLGIGKVIENKRVRGSLTGISIGT  239

Query  1022  VTETQKIWRSFQALGDIAFAYSYSIILIEIQDTVKSPPSESKTMRKASLFSTIVTTTFYM  843
             VT+TQKIWRSFQALGD+AFAYSYSIILIEIQDTVK+PPSE+KTM+KA+L S +VTT FYM
Sbjct  240   VTQTQKIWRSFQALGDVAFAYSYSIILIEIQDTVKAPPSEAKTMKKATLISVVVTTLFYM  299

Query  842   LCGCMGYAAFGDDAPGNLLTGFGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEKW  663
              CGC GYAAFGD +PGNLLTGFGFYNP+WLLDIAN AIVIHLVGAYQVYCQPLFAFIEK 
Sbjct  300   FCGCFGYAAFGDMSPGNLLTGFGFYNPYWLLDIANTAIVIHLVGAYQVYCQPLFAFIEKE  359

Query  662   VGAKWPDSEIITKEINLKIPGFGYPYKLNTFRLLWRTAFVLLTTVISMLLPFFNDVVGIL  483
                ++PDS+ +TK+I + IPG   P+ +N FR +WRT FV++TTVISMLLPFFND+VG+L
Sbjct  360   AARRFPDSDFVTKDIKISIPGL-RPFNINLFRTVWRTTFVVITTVISMLLPFFNDIVGLL  418

Query  482   GAFGFWPLTVYFPVRMYISQKKIPKWSTRWICLQMlsgaclavslaaaagsfagvVLDLK  303
             GAFGFWPLTVYFPV MYISQKKIPKWSTRW+CLQ+LS ACL +++AAAAGS AGV+ D+K
Sbjct  419   GAFGFWPLTVYFPVEMYISQKKIPKWSTRWLCLQILSVACLIITIAAAAGSIAGVIDDVK  478

Query  302   LYRPFKTSY  276
               +PFKTSY
Sbjct  479   TIKPFKTSY  487



>ref|XP_010684694.1| PREDICTED: amino acid permease 3-like [Beta vulgaris subsp. vulgaris]
Length=494

 Score =   737 bits (1902),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 379/492 (77%), Positives = 420/492 (85%), Gaps = 2/492 (0%)
 Frame = -3

Query  1748  GSKIMQMGESAAATKNHRHHLGV-SIDAPPLYGFKGLDDDGRPQRTGTVWTASAHIITAV  1572
             GSK ++  E      N   HL    +D+    G K  DDDGR +R GT+WTASAHIITAV
Sbjct  4     GSKQLK-NEYNFDNGNQSFHLTTFDVDSATGSGSKLFDDDGRLKRRGTMWTASAHIITAV  62

Query  1571  IGSGVLSLAWAIGQLGWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRNYTYMDAV  1392
             IGSGVLSLAWA  QLGWVAGP VMLLFS V YYTS LLADCYR+GDPV GKRNYTYMDAV
Sbjct  63    IGSGVLSLAWATAQLGWVAGPIVMLLFSIVTYYTSVLLADCYRSGDPVSGKRNYTYMDAV  122

Query  1391  RSNLGGYQVKICGLIQYFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPY  1212
             ++NLGG QVKICGLIQY NLFG+AIGYTIAASISM AIKRSNCFHE G K+ C +S+NPY
Sbjct  123   QANLGGLQVKICGLIQYLNLFGVAIGYTIAASISMTAIKRSNCFHEKGEKSKCDISTNPY  182

Query  1211  MIAFGIIEIILSQIPDFDQIWWLSIVAAVMSFTYSGIGLGLGIAQVVANGAFKGSLTGIS  1032
             MIAFG+ EII SQIPDFDQIWWLSIVAAVMSFTYS IGLGLGIA+V  NG  KGSLTGIS
Sbjct  183   MIAFGVAEIIFSQIPDFDQIWWLSIVAAVMSFTYSTIGLGLGIAKVAVNGQVKGSLTGIS  242

Query  1031  IGTVTETQKIWRSFQALGDIAFAYSYSIILIEIQDTVKSPPSESKTMRKASLFSTIVTTT  852
             IG VT+T KIWRSFQALGDIAFAYSYS+ILIEIQDTV+SPPSESKTMRKA+L S +VTT 
Sbjct  243   IGVVTQTDKIWRSFQALGDIAFAYSYSMILIEIQDTVRSPPSESKTMRKATLISVVVTTF  302

Query  851   FYMLCGCMGYAAFGDDAPGNLLTGFGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAFI  672
             FYMLCGC GYAAFGD +PGNLLTGFGFYNPFWL+DIANAAIVIHL+GAYQVYCQPL+AFI
Sbjct  303   FYMLCGCFGYAAFGDLSPGNLLTGFGFYNPFWLVDIANAAIVIHLIGAYQVYCQPLYAFI  362

Query  671   EKWVGAKWPDSEIITKEINLKIPGFGYPYKLNTFRLLWRTAFVLLTTVISMLLPFFNDVV  492
             EK     +P+S+ ITKEI + +PG   PY+LN FRL+WRT FV++TTVISMLLPFFNDVV
Sbjct  363   EKIASENFPNSDFITKEILIPLPGGYKPYRLNMFRLVWRTIFVIVTTVISMLLPFFNDVV  422

Query  491   GILGAFGFWPLTVYFPVRMYISQKKIPKWSTRWICLQMlsgaclavslaaaagsfagvVL  312
             G+LGA GFWPLTVYFPV MYISQKKIPKWST+WICLQMLS ACL +++AAAAGS AGV+L
Sbjct  423   GLLGALGFWPLTVYFPVEMYISQKKIPKWSTKWICLQMLSFACLIITIAAAAGSVAGVIL  482

Query  311   DLKLYRPFKTSY  276
             DLK Y+PFKT+Y
Sbjct  483   DLKSYKPFKTTY  494



>ref|XP_004149429.1| PREDICTED: amino acid permease 3-like [Cucumis sativus]
Length=478

 Score =   736 bits (1900),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 373/487 (77%), Positives = 424/487 (87%), Gaps = 9/487 (2%)
 Frame = -3

Query  1736  MQMGESAAATKNHRHHLGVSIDAPPLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSGV  1557
             M+MGE+ A         G+S D  P  G K  DDDGR +RTGTVWTASAHIITAVIGSGV
Sbjct  1     MKMGENQA--------FGISNDVVPQGGSKCFDDDGRLKRTGTVWTASAHIITAVIGSGV  52

Query  1556  LSLAWAIGQLGWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRNYTYMDAVRSNLG  1377
             LSLAWA  QLGWVAGP+VM LFS V YYTS LL+ CYR+GDPV GKRNYTYMDAV++NLG
Sbjct  53    LSLAWATAQLGWVAGPAVMFLFSMVTYYTSVLLSACYRSGDPVSGKRNYTYMDAVQANLG  112

Query  1376  GYQVKICGLIQYFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFG  1197
             G+ VK+CG++QY N+ G+AIGYTIA++ISMMAIKRSNCFH SGGK+PC ++SNPYMIAFG
Sbjct  113   GWNVKLCGVVQYANIVGVAIGYTIASAISMMAIKRSNCFHASGGKDPCQINSNPYMIAFG  172

Query  1196  IIEIILSQIPDFDQIWWLSIVAAVMSFTYSGIGLGLGIAQVVANGAFKGSLTGISIGTVT  1017
             ++EI+ SQI DFDQ+WWLSIVA+VMSFTYS IGLGLG+AQ+ ANG   GSLTGISIGTVT
Sbjct  173   VVEIVFSQIKDFDQLWWLSIVASVMSFTYSTIGLGLGVAQIAANGKIGGSLTGISIGTVT  232

Query  1016  ETQKIWRSFQALGDIAFAYSYSIILIEIQDTVKSPPSESKTMRKASLFSTIVTTTFYMLC  837
             +TQK+WRSFQALGDIAFAYSYSIILIEIQDT+KSPPSE+KTM+KA+L S  VTT FYMLC
Sbjct  233   QTQKVWRSFQALGDIAFAYSYSIILIEIQDTLKSPPSEAKTMKKATLVSVSVTTLFYMLC  292

Query  836   GCMGYAAFGDDAPGNLLTGFGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEKWVG  657
             G  GYAAFGD APGNLLTGFGFYNP+WLLDIANAAIVIHLVGAYQVYCQPLFAF+EK+  
Sbjct  293   GAAGYAAFGDMAPGNLLTGFGFYNPYWLLDIANAAIVIHLVGAYQVYCQPLFAFVEKYAS  352

Query  656   AKWPDSEIITKEINLKIPGFGYPYKLNTFRLLWRTAFVLLTTVISMLLPFFNDVVGILGA  477
              K PDS+ ITK+I++ IPGF  PYKLN FRL+WRTAFV++TTVISMLLPFFNDVVG LGA
Sbjct  353   EKSPDSDFITKDIDVPIPGF-RPYKLNLFRLVWRTAFVIVTTVISMLLPFFNDVVGFLGA  411

Query  476   FGFWPLTVYFPVRMYISQKKIPKWSTRWICLQMlsgaclavslaaaagsfagvVLDLKLY  297
              GFWPLTVY+PV MYI+QKKIPKWS+RW+CLQ LS ACL +S+AAAAGS AGVVLDLK Y
Sbjct  412   LGFWPLTVYYPVEMYIAQKKIPKWSSRWLCLQTLSFACLMISIAAAAGSIAGVVLDLKSY  471

Query  296   RPFKTSY  276
             +PFKTS+
Sbjct  472   KPFKTSF  478



>emb|CDY39844.1| BnaC02g42740D [Brassica napus]
Length=466

 Score =   735 bits (1898),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 355/460 (77%), Positives = 410/460 (89%), Gaps = 0/460 (0%)
 Frame = -3

Query  1655  GFKGLDDDGRPQRTGTVWTASAHIITAVIGSGVLSLAWAIGQLGWVAGPSVMLLFSCVVY  1476
              FK  DDDGR +R+GTVWTASAHIITAVIGSGVLSLAWAIGQLGW+AGP+VM LFS V Y
Sbjct  7     AFKCFDDDGRLKRSGTVWTASAHIITAVIGSGVLSLAWAIGQLGWIAGPAVMFLFSFVTY  66

Query  1475  YTSTLLADCYRAGDPVFGKRNYTYMDAVRSNLGGYQVKICGLIQYFNLFGIAIGYTIAAS  1296
             ++STLL+DCYR GDPV GKRNYTYMDAV+S LGG++ KICGLIQ+ NLFGI +GYTIAAS
Sbjct  67    FSSTLLSDCYRTGDPVSGKRNYTYMDAVQSILGGFRFKICGLIQFLNLFGITVGYTIAAS  126

Query  1295  ISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFGIIEIILSQIPDFDQIWWLSIVAAVMSF  1116
             ISMMAIKRSNCFHESGGKNPCHMSSNPYMI FG+ EI+LSQI DFDQIWWLSIVAA+MSF
Sbjct  127   ISMMAIKRSNCFHESGGKNPCHMSSNPYMIMFGVTEILLSQIKDFDQIWWLSIVAAIMSF  186

Query  1115  TYSGIGLGLGIAQVVANGAFKGSLTGISIGTVTETQKIWRSFQALGDIAFAYSYSIILIE  936
             TYS IGL LGI QV ANG FKGSLTGISIGTVT+TQKIWR+FQALGDIAFAYSYS++LIE
Sbjct  187   TYSAIGLALGIIQVAANGVFKGSLTGISIGTVTQTQKIWRTFQALGDIAFAYSYSVVLIE  246

Query  935   IQDTVKSPPSESKTMRKASLFSTIVTTTFYMLCGCMGYAAFGDDAPGNLLTGFGFYNPFW  756
             IQDTV+SPP+ESKTM++A+  S  VTTTFYMLCGCMGYAAFGD APGNLLTGFGFYNPFW
Sbjct  247   IQDTVRSPPAESKTMKQATRISIAVTTTFYMLCGCMGYAAFGDAAPGNLLTGFGFYNPFW  306

Query  755   LLDIANAAIVIHLVGAYQVYCQPLFAFIEKWVGAKWPDSEIITKEINLKIPGFGYPYKLN  576
             LLD+AN AIVIHLVGAYQV+ QP+FAF++K   A++PDS++++KE  ++IPG   PYK+N
Sbjct  307   LLDVANVAIVIHLVGAYQVFAQPIFAFVDKQAAARFPDSDLVSKEFEIRIPGVRAPYKVN  366

Query  575   TFRLLWRTAFVLLTTVISMLLPFFNDVVGILGAFGFWPLTVYFPVRMYISQKKIPKWSTR  396
              FR ++R+ FV+LTTVISML+PFFNDVVGILGA GFWPLTVYFPV MYI Q+K+ KWS +
Sbjct  367   VFRAVFRSCFVVLTTVISMLMPFFNDVVGILGALGFWPLTVYFPVEMYIKQRKVEKWSMK  426

Query  395   WICLQMlsgaclavslaaaagsfagvVLDLKLYRPFKTSY  276
             W+CL+MLSG CL +++ A  GS AGV+LDLK+Y+PFKT+Y
Sbjct  427   WVCLKMLSGGCLVITVVAGVGSVAGVMLDLKVYKPFKTTY  466



>ref|XP_011027479.1| PREDICTED: amino acid permease 3-like isoform X2 [Populus euphratica]
Length=485

 Score =   736 bits (1900),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 371/486 (76%), Positives = 423/486 (87%), Gaps = 2/486 (0%)
 Frame = -3

Query  1730  MGESAAATKNHRHHL-GVSIDAPPLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSGVL  1554
             MGE+ +A     H +  VSID  P  G +  DDDGRP+RTGTVWTASAHIITAVIGSGVL
Sbjct  1     MGENTSAENQLPHQVFSVSIDTHPRSGSEWFDDDGRPKRTGTVWTASAHIITAVIGSGVL  60

Query  1553  SLAWAIGQLGWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRNYTYMDAVRSNLGG  1374
             SLAWAIGQLGW+AGP+VMLLFS V YYTS LL+ CYR+GDPV GKRNYTYMDAVR+NLGG
Sbjct  61    SLAWAIGQLGWIAGPAVMLLFSLVTYYTSILLSACYRSGDPVNGKRNYTYMDAVRANLGG  120

Query  1373  YQVKICGLIQYFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFGI  1194
              +VKICG +QY NLFG+AIGYTIA+SISMMAIKRSNCFH+SGGK+PCHM++ PYMIAFGI
Sbjct  121   GKVKICGYVQYVNLFGVAIGYTIASSISMMAIKRSNCFHQSGGKDPCHMNAYPYMIAFGI  180

Query  1193  IEIILSQIPDFDQIWWLSIVAAVMSFTYSGIGLGLGIAQVVANGAFKGSLTGISIGTVTE  1014
              EI+LSQIP FDQ+ WLS+VAAVMSFTYS IGLGLGI +VV N    GSLTGISIGTVT+
Sbjct  181   AEILLSQIPGFDQLHWLSLVAAVMSFTYSSIGLGLGIGKVVENRRVMGSLTGISIGTVTQ  240

Query  1013  TQKIWRSFQALGDIAFAYSYSIILIEIQDTVKSPPSESKTMRKASLFSTIVTTTFYMLCG  834
             TQKIWRSFQALGDIAFAYSYS+ILIEIQDTVK+PP+E+KTM+KA+L S  VTT FYM CG
Sbjct  241   TQKIWRSFQALGDIAFAYSYSMILIEIQDTVKAPPTEAKTMKKATLISVAVTTLFYMFCG  300

Query  833   CMGYAAFGDDAPGNLLTGFGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEKWVGA  654
             C GYAAFGD +PGNLLTGFGFYNP+WLLDIANAAIVIHLVGAYQVYCQPLFAF+EK    
Sbjct  301   CFGYAAFGDLSPGNLLTGFGFYNPYWLLDIANAAIVIHLVGAYQVYCQPLFAFVEKAAAR  360

Query  653   KWPDSEIITKEINLKIPGFGYPYKLNTFRLLWRTAFVLLTTVISMLLPFFNDVVGILGAF  474
             ++PDS+ +TK+I + IPG G PY LN FR++WRT FV+ TTVISMLLPFFND+VG+LGA 
Sbjct  361   RFPDSDFVTKDIKISIPGLG-PYNLNLFRMIWRTLFVVTTTVISMLLPFFNDIVGLLGAL  419

Query  473   GFWPLTVYFPVRMYISQKKIPKWSTRWICLQMlsgaclavslaaaagsfagvVLDLKLYR  294
             GFWPLTVYFPV MYISQKKIPKWSTRW+CLQ+LS ACL +++AAAAGS AGV+ D+K  +
Sbjct  420   GFWPLTVYFPVEMYISQKKIPKWSTRWLCLQILSVACLIITIAAAAGSIAGVLDDVKTIK  479

Query  293   PFKTSY  276
             PF+TSY
Sbjct  480   PFQTSY  485



>ref|XP_006287587.1| hypothetical protein CARUB_v10000805mg [Capsella rubella]
 gb|EOA20485.1| hypothetical protein CARUB_v10000805mg [Capsella rubella]
Length=493

 Score =   736 bits (1899),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 368/493 (75%), Positives = 417/493 (85%), Gaps = 8/493 (2%)
 Frame = -3

Query  1730  MGESAAATKNHRHHLG-------VSIDAPPLY-GFKGLDDDGRPQRTGTVWTASAHIITA  1575
             MGE+AAA  +   H          S D  P    FK  DDDGR +RTGTVWTASAHIITA
Sbjct  1     MGETAAANHHRHQHHHGHQVFDVASNDVVPTQPAFKCFDDDGRLKRTGTVWTASAHIITA  60

Query  1574  VIGSGVLSLAWAIGQLGWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRNYTYMDA  1395
             VIGSGVLSLAWAI QLGW+AGP+VMLLFS V  Y+STLL+DCYR GD V GKRNYTYMDA
Sbjct  61    VIGSGVLSLAWAIAQLGWIAGPAVMLLFSFVTLYSSTLLSDCYRTGDAVSGKRNYTYMDA  120

Query  1394  VRSNLGGYQVKICGLIQYFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNP  1215
             VRS LGG++ KICGLIQY NLFGIA+GYTIAASISMMAIKRSNCFH+SGGK+PCHMSSN 
Sbjct  121   VRSILGGFKFKICGLIQYLNLFGIAVGYTIAASISMMAIKRSNCFHKSGGKDPCHMSSNS  180

Query  1214  YMIAFGIIEIILSQIPDFDQIWWLSIVAAVMSFTYSGIGLGLGIAQVVANGAFKGSLTGI  1035
             YMI FG+ EI+LSQ+PDFDQIWW+SIVAAVMSFTYS IGL LGI QV ANG FKGSLTGI
Sbjct  181   YMIVFGVTEILLSQVPDFDQIWWISIVAAVMSFTYSAIGLALGIVQVAANGVFKGSLTGI  240

Query  1034  SIGTVTETQKIWRSFQALGDIAFAYSYSIILIEIQDTVKSPPSESKTMRKASLFSTIVTT  855
             SIGTVT+TQKIWR+FQALGDIAFAYSYS++LIEIQDTV+SPP+ESKTM+KA+  S  VTT
Sbjct  241   SIGTVTQTQKIWRTFQALGDIAFAYSYSVVLIEIQDTVRSPPAESKTMKKATKISIAVTT  300

Query  854   TFYMLCGCMGYAAFGDDAPGNLLTGFGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAF  675
              FYMLCG MGYAAFGD APGNLLTGFGFYNPFWLLDIANAAIV+HLVGAYQV+ QP+FAF
Sbjct  301   MFYMLCGSMGYAAFGDAAPGNLLTGFGFYNPFWLLDIANAAIVVHLVGAYQVFAQPIFAF  360

Query  674   IEKWVGAKWPDSEIITKEINLKIPGFGYPYKLNTFRLLWRTAFVLLTTVISMLLPFFNDV  495
             IEK    ++PD++ +TKE  ++IPG   PYK N FR+++R  FV+ TTVISML+PFFNDV
Sbjct  361   IEKSAAERYPDNDFLTKEFEIRIPGLKSPYKANVFRVVYRCGFVVSTTVISMLMPFFNDV  420

Query  494   VGILGAFGFWPLTVYFPVRMYISQKKIPKWSTRWICLQMlsgaclavslaaaagsfagvV  315
             VGILGA GFWPLTVYFPV MYI Q+K+ KWSTRW+CLQMLS ACL +S+ A  GS AGV+
Sbjct  421   VGILGALGFWPLTVYFPVEMYIKQRKVEKWSTRWVCLQMLSAACLVISVVAGVGSIAGVM  480

Query  314   LDLKLYRPFKTSY  276
             LDLK+Y+PFK++Y
Sbjct  481   LDLKVYKPFKSTY  493



>ref|XP_011002450.1| PREDICTED: amino acid permease 3-like [Populus euphratica]
Length=487

 Score =   735 bits (1898),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 369/489 (75%), Positives = 424/489 (87%), Gaps = 4/489 (1%)
 Frame = -3

Query  1736  MQMGESAAATKNH--RHHLGVSIDAPPLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGS  1563
             M+MGE+ A TKNH       VS+D  P    K  DDDGRP+RTG VWTASAH+ITAVIGS
Sbjct  1     MKMGENTA-TKNHLPPQAFSVSVDTDPQSDSKWFDDDGRPKRTGNVWTASAHVITAVIGS  59

Query  1562  GVLSLAWAIGQLGWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRNYTYMDAVRSN  1383
             GVLSLAWAIGQLGW+AGP+VMLLFS V YYTS LL+ CYR+GDPV GKRNYTYMDAVR+N
Sbjct  60    GVLSLAWAIGQLGWIAGPAVMLLFSFVTYYTSILLSACYRSGDPVNGKRNYTYMDAVRAN  119

Query  1382  LGGYQVKICGLIQYFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIA  1203
             LGG +VKICG +QY NLFG+AIGYTIA+SISMMAIKRSNCFH+SGGK+PC M++NPYMI 
Sbjct  120   LGGVKVKICGFVQYVNLFGVAIGYTIASSISMMAIKRSNCFHQSGGKDPCRMNANPYMIG  179

Query  1202  FGIIEIILSQIPDFDQIWWLSIVAAVMSFTYSGIGLGLGIAQVVANGAFKGSLTGISIGT  1023
             FGI EI+LSQIP FDQ+ WLS+VAAVMSFTYS IGLGLGI +V+ N   +GSLTGISIGT
Sbjct  180   FGIAEILLSQIPGFDQLHWLSLVAAVMSFTYSTIGLGLGIGKVIENKRVRGSLTGISIGT  239

Query  1022  VTETQKIWRSFQALGDIAFAYSYSIILIEIQDTVKSPPSESKTMRKASLFSTIVTTTFYM  843
             VT+TQKIWRSFQALGD+AFAYSYSIILIEIQDTVK+PPSE+KTM+KA+L S +VTT FYM
Sbjct  240   VTQTQKIWRSFQALGDVAFAYSYSIILIEIQDTVKAPPSEAKTMKKATLISVVVTTLFYM  299

Query  842   LCGCMGYAAFGDDAPGNLLTGFGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEKW  663
              CGC GYAAFGD +PGNLLTGFGFYNP+WLLDIAN AIVIHLVGAYQVYCQPLFAFIEK 
Sbjct  300   FCGCFGYAAFGDMSPGNLLTGFGFYNPYWLLDIANTAIVIHLVGAYQVYCQPLFAFIEKE  359

Query  662   VGAKWPDSEIITKEINLKIPGFGYPYKLNTFRLLWRTAFVLLTTVISMLLPFFNDVVGIL  483
                ++PDS+ +TK+I + IPG   P+ +N FR +WRT FV++TTVISMLLPFFND+VG+L
Sbjct  360   AARRFPDSDFVTKDIKISIPGL-RPFNINLFRTVWRTTFVVITTVISMLLPFFNDIVGLL  418

Query  482   GAFGFWPLTVYFPVRMYISQKKIPKWSTRWICLQMlsgaclavslaaaagsfagvVLDLK  303
             GAFGFWPLTVYFPV +YISQKKIPKWSTRW+CLQ+LS ACL +++AAAAGS AGV+ D+K
Sbjct  419   GAFGFWPLTVYFPVEIYISQKKIPKWSTRWLCLQILSVACLIITIAAAAGSIAGVIDDVK  478

Query  302   LYRPFKTSY  276
               +PFKTSY
Sbjct  479   TIKPFKTSY  487



>ref|XP_011074825.1| PREDICTED: amino acid permease 3-like [Sesamum indicum]
Length=484

 Score =   735 bits (1897),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 373/485 (77%), Positives = 417/485 (86%), Gaps = 1/485 (0%)
 Frame = -3

Query  1730  MGESAAATKNHRHHLGVSIDAPPLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSGVLS  1551
             M ESA + + H     +S++ P   G K  DDDGR +R+GT+WTASAHIITAVIGSGVLS
Sbjct  1     MSESAGSRQAHNQVFDISVNVPNQGGSKCFDDDGRLKRSGTLWTASAHIITAVIGSGVLS  60

Query  1550  LAWAIGQLGWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRNYTYMDAVRSNLGGY  1371
             LAWA  QLGWVAGPSVM +FS V YYTSTLLA CYR+GDP  GKRNYTYMDAVR+NLGG+
Sbjct  61    LAWATAQLGWVAGPSVMFMFSIVTYYTSTLLAACYRSGDPDTGKRNYTYMDAVRANLGGF  120

Query  1370  QVKICGLIQYFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFGII  1191
             QVK+CG IQY NLFG+AIGYTIA+SISMMAI+RSNCFH  G  +PC +SSNPYMIAFG++
Sbjct  121   QVKLCGAIQYLNLFGVAIGYTIASSISMMAIERSNCFHSKGDDSPCRVSSNPYMIAFGVV  180

Query  1190  EIILSQIPDFDQIWWLSIVAAVMSFTYSGIGLGLGIAQVVANGAFKGSLTGISIGTVTET  1011
             EIILSQIPDFDQIWWLSIVAAVMSFTYS IGLGLGIA+V  NG   GSLTGISIG VTET
Sbjct  181   EIILSQIPDFDQIWWLSIVAAVMSFTYSTIGLGLGIAKVAENGKIMGSLTGISIGKVTET  240

Query  1010  QKIWRSFQALGDIAFAYSYSIILIEIQDTVKSPPSESKTMRKASLFSTIVTTTFYMLCGC  831
             QKIWRSFQALG IAFAYSYS+ILIEIQDT+KSPPSE KTM+KA+L S  VTT FYM CGC
Sbjct  241   QKIWRSFQALGAIAFAYSYSLILIEIQDTIKSPPSEYKTMKKATLLSVAVTTIFYMSCGC  300

Query  830   MGYAAFGDDAPGNLLTGFGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEKWVGAK  651
              GYAAFGD +PGNLLTGFGFYNP+WLLDIAN AIVIHL+GAYQV+CQPLFAFIEK     
Sbjct  301   FGYAAFGDMSPGNLLTGFGFYNPYWLLDIANVAIVIHLIGAYQVFCQPLFAFIEKTALEW  360

Query  650   WPDSEIITKEINLKIPGFGYPYKLNTFRLLWRTAFVLLTTVISMLLPFFNDVVGILGAFG  471
             +PDS+ ITKEI + IPGF   YKLN FRL+WRT FV++TT+ISML+PFFNDVVGILGAFG
Sbjct  361   FPDSKFITKEIAIPIPGF-RAYKLNLFRLVWRTIFVIVTTIISMLMPFFNDVVGILGAFG  419

Query  470   FWPLTVYFPVRMYISQKKIPKWSTRWICLQMlsgaclavslaaaagsfagvVLDLKLYRP  291
             FWPLTVYFPV MYI QK+IPKWSTRW+ LQ+LS ACL +S+AAAAGSFAGVV DLK+Y+P
Sbjct  420   FWPLTVYFPVEMYIKQKRIPKWSTRWVSLQILSVACLVISVAAAAGSFAGVVSDLKVYKP  479

Query  290   FKTSY  276
             FKTSY
Sbjct  480   FKTSY  484



>ref|XP_002302223.1| hypothetical protein POPTR_0002s07960g [Populus trichocarpa]
 gb|EEE81496.1| hypothetical protein POPTR_0002s07960g [Populus trichocarpa]
Length=485

 Score =   735 bits (1897),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 370/486 (76%), Positives = 422/486 (87%), Gaps = 2/486 (0%)
 Frame = -3

Query  1730  MGESAAATKNHRHHL-GVSIDAPPLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSGVL  1554
             MGE+ +A     H +  VSID  P  G K  DDDGRP+RTG VWTASAHIITAVIGSGVL
Sbjct  1     MGENTSAKNQLPHQVFSVSIDTNPQSGSKWFDDDGRPKRTGNVWTASAHIITAVIGSGVL  60

Query  1553  SLAWAIGQLGWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRNYTYMDAVRSNLGG  1374
             SLAWAIGQLGW+AGP+VMLLFS V YYTS LL+ CYR+GDPV GKRNYTYMDAVR+NLGG
Sbjct  61    SLAWAIGQLGWIAGPAVMLLFSLVTYYTSILLSACYRSGDPVNGKRNYTYMDAVRANLGG  120

Query  1373  YQVKICGLIQYFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFGI  1194
              +VKICG +QY NLFG+AIGYTIA+SISMMAIKRSNCFH+SGG++PCHM++ PYMIAFGI
Sbjct  121   GKVKICGFVQYVNLFGVAIGYTIASSISMMAIKRSNCFHQSGGQDPCHMNAYPYMIAFGI  180

Query  1193  IEIILSQIPDFDQIWWLSIVAAVMSFTYSGIGLGLGIAQVVANGAFKGSLTGISIGTVTE  1014
              EI+LSQIP FDQ+ WLS+VAAVMSFTYS IGLGLGI +VV N    GSLTGISIGTVT+
Sbjct  181   AEILLSQIPGFDQLHWLSLVAAVMSFTYSSIGLGLGIGKVVENKRVMGSLTGISIGTVTQ  240

Query  1013  TQKIWRSFQALGDIAFAYSYSIILIEIQDTVKSPPSESKTMRKASLFSTIVTTTFYMLCG  834
             TQKIWRSFQALGDIAFAYSYS+ILIEIQDTVK+PP+E+KTM+KA+L S  VTT FYM CG
Sbjct  241   TQKIWRSFQALGDIAFAYSYSMILIEIQDTVKAPPTEAKTMKKATLISVAVTTLFYMFCG  300

Query  833   CMGYAAFGDDAPGNLLTGFGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEKWVGA  654
             C GYAAFGD +PGNLLTGFGFYNP+WLLDIANAAIVIHLVGAYQVYCQPLFAF+EK    
Sbjct  301   CFGYAAFGDLSPGNLLTGFGFYNPYWLLDIANAAIVIHLVGAYQVYCQPLFAFVEKEAAR  360

Query  653   KWPDSEIITKEINLKIPGFGYPYKLNTFRLLWRTAFVLLTTVISMLLPFFNDVVGILGAF  474
             ++PDS+ +TK+I + IPG G PY LN FR++WRT FV+ TTVISMLLPFFND+VG+LGA 
Sbjct  361   RFPDSDFVTKDIKISIPGLG-PYNLNLFRMIWRTLFVVTTTVISMLLPFFNDIVGLLGAL  419

Query  473   GFWPLTVYFPVRMYISQKKIPKWSTRWICLQMlsgaclavslaaaagsfagvVLDLKLYR  294
             GFWPLTVYFPV MYISQKKIPKWSTRW+CLQ+LS ACL +++AAAAGS AGV+ D+K  +
Sbjct  420   GFWPLTVYFPVEMYISQKKIPKWSTRWLCLQILSVACLIITIAAAAGSIAGVLDDVKTIK  479

Query  293   PFKTSY  276
             PF+TSY
Sbjct  480   PFQTSY  485



>emb|CDY31348.1| BnaA02g33930D [Brassica napus]
Length=466

 Score =   734 bits (1895),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 355/460 (77%), Positives = 410/460 (89%), Gaps = 0/460 (0%)
 Frame = -3

Query  1655  GFKGLDDDGRPQRTGTVWTASAHIITAVIGSGVLSLAWAIGQLGWVAGPSVMLLFSCVVY  1476
              FK  DDDGR +R+GTVWTASAHIITAVIGSGVLSLAWAIGQLGW+AGP+VM LFS V Y
Sbjct  7     AFKCFDDDGRLKRSGTVWTASAHIITAVIGSGVLSLAWAIGQLGWIAGPAVMFLFSFVTY  66

Query  1475  YTSTLLADCYRAGDPVFGKRNYTYMDAVRSNLGGYQVKICGLIQYFNLFGIAIGYTIAAS  1296
             ++STLL+DCYR GDPV GKRNYTYMDAV+S LGG++ KICGLIQ+ NLFGI +GYTIAAS
Sbjct  67    FSSTLLSDCYRTGDPVSGKRNYTYMDAVQSILGGFRFKICGLIQFLNLFGITVGYTIAAS  126

Query  1295  ISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFGIIEIILSQIPDFDQIWWLSIVAAVMSF  1116
             ISMMAIKRSNCFHESGGKNPCHMSSNPYMI FG+ EI+LSQI DFDQIWWLSIVAA+MSF
Sbjct  127   ISMMAIKRSNCFHESGGKNPCHMSSNPYMIMFGVTEILLSQIKDFDQIWWLSIVAAIMSF  186

Query  1115  TYSGIGLGLGIAQVVANGAFKGSLTGISIGTVTETQKIWRSFQALGDIAFAYSYSIILIE  936
             TYS IGL LGI QV ANG FKGSLTGISIGTVT+TQKIWR+FQALGDIAFAYSYS++LIE
Sbjct  187   TYSAIGLALGIIQVAANGVFKGSLTGISIGTVTQTQKIWRTFQALGDIAFAYSYSVVLIE  246

Query  935   IQDTVKSPPSESKTMRKASLFSTIVTTTFYMLCGCMGYAAFGDDAPGNLLTGFGFYNPFW  756
             IQDTV+SPP+ESKTM++A+  S  VTTTFYMLCGCMGYAAFGD APGNLLTGFGFYNPFW
Sbjct  247   IQDTVRSPPAESKTMKQATRISIAVTTTFYMLCGCMGYAAFGDAAPGNLLTGFGFYNPFW  306

Query  755   LLDIANAAIVIHLVGAYQVYCQPLFAFIEKWVGAKWPDSEIITKEINLKIPGFGYPYKLN  576
             LLD+AN AIVIHLVGAYQV+ QP+FAF++K   A++PDS++++KE  ++IPG   PYK+N
Sbjct  307   LLDVANVAIVIHLVGAYQVFAQPIFAFVDKQAAARFPDSDLVSKEFEIRIPGVRAPYKVN  366

Query  575   TFRLLWRTAFVLLTTVISMLLPFFNDVVGILGAFGFWPLTVYFPVRMYISQKKIPKWSTR  396
              FR ++R+ FV+LTTVISML+PFFNDVVGILGA GFWPLTVYFPV MYI Q+K+ +WS +
Sbjct  367   VFRAVFRSCFVVLTTVISMLMPFFNDVVGILGALGFWPLTVYFPVEMYIKQRKVERWSMK  426

Query  395   WICLQMlsgaclavslaaaagsfagvVLDLKLYRPFKTSY  276
             W+CL+MLSG CL +S+ A  GS AGV+LDLK+Y+PFKT+Y
Sbjct  427   WVCLKMLSGGCLVISVVAGVGSVAGVMLDLKVYKPFKTTY  466



>ref|XP_010484145.1| PREDICTED: amino acid permease 4 [Camelina sativa]
Length=466

 Score =   734 bits (1895),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 358/463 (77%), Positives = 405/463 (87%), Gaps = 0/463 (0%)
 Frame = -3

Query  1664  PLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSGVLSLAWAIGQLGWVAGPSVMLLFSC  1485
             P   FK  DDDGR +R+GTVWTASAHIITAVIGSGVLSLAWAIGQLGW+AGP+VM LFS 
Sbjct  4     PRPAFKCFDDDGRLKRSGTVWTASAHIITAVIGSGVLSLAWAIGQLGWIAGPAVMFLFSF  63

Query  1484  VVYYTSTLLADCYRAGDPVFGKRNYTYMDAVRSNLGGYQVKICGLIQYFNLFGIAIGYTI  1305
             V YY+STLL+DCYR GDPV GKRNYTYMDAVRS LGG++ KICGLIQY NLFGI IGYTI
Sbjct  64    VTYYSSTLLSDCYRTGDPVSGKRNYTYMDAVRSILGGFRFKICGLIQYLNLFGITIGYTI  123

Query  1304  AASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFGIIEIILSQIPDFDQIWWLSIVAAV  1125
             AASISMMAIKRSNCFHESGGKNPCHMSSNPYMI FG+ EI+LSQI DFDQIWWLSIVA +
Sbjct  124   AASISMMAIKRSNCFHESGGKNPCHMSSNPYMIMFGVTEILLSQIKDFDQIWWLSIVATI  183

Query  1124  MSFTYSGIGLGLGIAQVVANGAFKGSLTGISIGTVTETQKIWRSFQALGDIAFAYSYSII  945
             MSFTYS IGL LGI QV ANG  KGSLTGISIG VT+TQKIWR+FQALGDIAFAYSYS +
Sbjct  184   MSFTYSAIGLALGIIQVAANGVVKGSLTGISIGAVTQTQKIWRTFQALGDIAFAYSYSAV  243

Query  944   LIEIQDTVKSPPSESKTMRKASLFSTIVTTTFYMLCGCMGYAAFGDDAPGNLLTGFGFYN  765
             LIEIQDTV+SPP+ESKTM+ A+  S  VTTTFY+LCGCMGYAAFGD APGNLLTGFGFYN
Sbjct  244   LIEIQDTVRSPPAESKTMKNATRISITVTTTFYLLCGCMGYAAFGDAAPGNLLTGFGFYN  303

Query  764   PFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEKWVGAKWPDSEIITKEINLKIPGFGYPY  585
             PFWLLD+AN AIV+HLVGAYQV+ QP+FAFIEK   A++PDS+++TKE  ++IPG   PY
Sbjct  304   PFWLLDVANVAIVVHLVGAYQVFAQPIFAFIEKQAAARFPDSDLVTKEHEIRIPGLKSPY  363

Query  584   KLNTFRLLWRTAFVLLTTVISMLLPFFNDVVGILGAFGFWPLTVYFPVRMYISQKKIPKW  405
             K+N FR ++R+ FV+LTTVISML+PFFNDVVGILGA GFWPLTVYFPV MYI Q+K+ +W
Sbjct  364   KVNVFRTVYRSGFVVLTTVISMLMPFFNDVVGILGALGFWPLTVYFPVEMYIKQRKVERW  423

Query  404   STRWICLQMlsgaclavslaaaagsfagvVLDLKLYRPFKTSY  276
             S +W+CLQMLS  CL V+L A  GS AGV+LDLK+Y+PFK++Y
Sbjct  424   SMKWVCLQMLSAGCLMVTLVAGVGSIAGVMLDLKVYKPFKSTY  466



>gb|KGN47695.1| hypothetical protein Csa_6G381850 [Cucumis sativus]
Length=476

 Score =   733 bits (1893),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 368/475 (77%), Positives = 417/475 (88%), Gaps = 1/475 (0%)
 Frame = -3

Query  1700  HRHHLGVSIDAPPLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSGVLSLAWAIGQLGW  1521
                  G+S D  P  G K  DDDGR +RTGTVWTASAHIITAVIGSGVLSLAWA  QLGW
Sbjct  3     ENQAFGISNDVVPQGGSKCFDDDGRLKRTGTVWTASAHIITAVIGSGVLSLAWATAQLGW  62

Query  1520  VAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRNYTYMDAVRSNLGGYQVKICGLIQY  1341
             VAGP+VM LFS V YYTS LL+ CYR+GDPV GKRNYTYMDAV++NLGG+ VK+CG++QY
Sbjct  63    VAGPAVMFLFSMVTYYTSVLLSACYRSGDPVSGKRNYTYMDAVQANLGGWNVKLCGVVQY  122

Query  1340  FNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFGIIEIILSQIPDF  1161
              N+ G+AIGYTIA++ISMMAIKRSNCFH SGGK+PC ++SNPYMIAFG++EI+ SQI DF
Sbjct  123   ANIVGVAIGYTIASAISMMAIKRSNCFHASGGKDPCQINSNPYMIAFGVVEIVFSQIKDF  182

Query  1160  DQIWWLSIVAAVMSFTYSGIGLGLGIAQVVANGAFKGSLTGISIGTVTETQKIWRSFQAL  981
             DQ+WWLSIVA+VMSFTYS IGLGLG+AQ+ ANG   GSLTGISIGTVT+TQK+WRSFQAL
Sbjct  183   DQLWWLSIVASVMSFTYSTIGLGLGVAQIAANGKIGGSLTGISIGTVTQTQKVWRSFQAL  242

Query  980   GDIAFAYSYSIILIEIQDTVKSPPSESKTMRKASLFSTIVTTTFYMLCGCMGYAAFGDDA  801
             GDIAFAYSYSIILIEIQDT+KSPPSE+KTM+KA+L S  VTT FYMLCG  GYAAFGD A
Sbjct  243   GDIAFAYSYSIILIEIQDTLKSPPSEAKTMKKATLVSVSVTTLFYMLCGAAGYAAFGDMA  302

Query  800   PGNLLTGFGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEKWVGAKWPDSEIITKE  621
             PGNLLTGFGFYNP+WLLDIANAAIVIHLVGAYQVYCQPLFAF+EK+   K PDS+ ITK+
Sbjct  303   PGNLLTGFGFYNPYWLLDIANAAIVIHLVGAYQVYCQPLFAFVEKYASEKSPDSDFITKD  362

Query  620   INLKIPGFGYPYKLNTFRLLWRTAFVLLTTVISMLLPFFNDVVGILGAFGFWPLTVYFPV  441
             I++ IPGF  PYKLN FRL+WRTAFV++TTVISMLLPFFNDVVG LGA GFWPLTVY+PV
Sbjct  363   IDVPIPGF-RPYKLNLFRLVWRTAFVIVTTVISMLLPFFNDVVGFLGALGFWPLTVYYPV  421

Query  440   RMYISQKKIPKWSTRWICLQMlsgaclavslaaaagsfagvVLDLKLYRPFKTSY  276
              MYI+QKKIPKWS+RW+CLQ LS ACL +S+AAAAGS AGVVLDLK Y+PFKTS+
Sbjct  422   EMYIAQKKIPKWSSRWLCLQTLSFACLMISIAAAAGSIAGVVLDLKSYKPFKTSF  476



>ref|XP_010461080.1| PREDICTED: amino acid permease 4-like [Camelina sativa]
Length=466

 Score =   733 bits (1892),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 358/463 (77%), Positives = 405/463 (87%), Gaps = 0/463 (0%)
 Frame = -3

Query  1664  PLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSGVLSLAWAIGQLGWVAGPSVMLLFSC  1485
             P   FK  DDDG+ +R+GTVWTASAHIITAVIGSGVLSLAWAIGQLGW+AGP VM LFS 
Sbjct  4     PRPAFKCFDDDGKLKRSGTVWTASAHIITAVIGSGVLSLAWAIGQLGWIAGPVVMFLFSF  63

Query  1484  VVYYTSTLLADCYRAGDPVFGKRNYTYMDAVRSNLGGYQVKICGLIQYFNLFGIAIGYTI  1305
             V YY STLL+DCYR GDPV GKRNYTYMDAVRS LGG++ KICGLIQY NLFGI IGYTI
Sbjct  64    VTYYCSTLLSDCYRTGDPVSGKRNYTYMDAVRSILGGFRFKICGLIQYLNLFGITIGYTI  123

Query  1304  AASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFGIIEIILSQIPDFDQIWWLSIVAAV  1125
             AASISMMAIKRSNCFHESGGKNPCHMSSNPYMI FG+ EI+LSQI DFDQIWWLSIVAA+
Sbjct  124   AASISMMAIKRSNCFHESGGKNPCHMSSNPYMIMFGVTEILLSQIKDFDQIWWLSIVAAI  183

Query  1124  MSFTYSGIGLGLGIAQVVANGAFKGSLTGISIGTVTETQKIWRSFQALGDIAFAYSYSII  945
             MSFTYS IGL LGI QV ANG  KGSLTGISIG VT+TQKIWR+FQALGDIAFAYSYS +
Sbjct  184   MSFTYSAIGLALGIIQVAANGVVKGSLTGISIGAVTQTQKIWRTFQALGDIAFAYSYSAV  243

Query  944   LIEIQDTVKSPPSESKTMRKASLFSTIVTTTFYMLCGCMGYAAFGDDAPGNLLTGFGFYN  765
             LIEIQDTV+SPP+ESKTM+ A+  S  VTTTFY+LCGCMGYAAFGD APGNLLTGFGFYN
Sbjct  244   LIEIQDTVRSPPAESKTMKNATRISITVTTTFYLLCGCMGYAAFGDAAPGNLLTGFGFYN  303

Query  764   PFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEKWVGAKWPDSEIITKEINLKIPGFGYPY  585
             PFWLLD+ANAAIV+HLVGAYQV+ QP+FAFIEK   A++PDS+++TKE  ++IPG   PY
Sbjct  304   PFWLLDVANAAIVVHLVGAYQVFAQPIFAFIEKQAAARFPDSDLVTKEHEIRIPGLKSPY  363

Query  584   KLNTFRLLWRTAFVLLTTVISMLLPFFNDVVGILGAFGFWPLTVYFPVRMYISQKKIPKW  405
             K+N FR ++R+ FV+LTTVISML+PFFNDVVGILGA GFWPLTVYFPV MYI Q+K+ +W
Sbjct  364   KVNVFRTVYRSGFVVLTTVISMLMPFFNDVVGILGALGFWPLTVYFPVEMYIKQRKVERW  423

Query  404   STRWICLQMlsgaclavslaaaagsfagvVLDLKLYRPFKTSY  276
             S +W+CLQ+LS  CL V+L A  GS AGV+LDLK+Y+PFK++Y
Sbjct  424   SMKWVCLQLLSAGCLMVTLVAGVGSIAGVMLDLKVYKPFKSTY  466



>ref|XP_009130275.1| PREDICTED: amino acid permease 4 [Brassica rapa]
 ref|XP_009130276.1| PREDICTED: amino acid permease 4 [Brassica rapa]
Length=466

 Score =   733 bits (1891),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 353/460 (77%), Positives = 409/460 (89%), Gaps = 0/460 (0%)
 Frame = -3

Query  1655  GFKGLDDDGRPQRTGTVWTASAHIITAVIGSGVLSLAWAIGQLGWVAGPSVMLLFSCVVY  1476
              FK  DDDGR +R+GTVWTASAHIITAVIGSGVLSLAWAIGQLGW+AGP+VM LFS V Y
Sbjct  7     AFKCFDDDGRLKRSGTVWTASAHIITAVIGSGVLSLAWAIGQLGWIAGPAVMFLFSFVTY  66

Query  1475  YTSTLLADCYRAGDPVFGKRNYTYMDAVRSNLGGYQVKICGLIQYFNLFGIAIGYTIAAS  1296
             ++STLL+DCYR GDPV GKRNYTYMDAV+S LGG++ KICGLIQ+ NLFGI +GYTIAAS
Sbjct  67    FSSTLLSDCYRTGDPVSGKRNYTYMDAVQSILGGFRFKICGLIQFLNLFGITVGYTIAAS  126

Query  1295  ISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFGIIEIILSQIPDFDQIWWLSIVAAVMSF  1116
             ISMMAIKRSNCFHESGGKNPCHMSSNPYMI FG+ EI+LSQI DFDQIWWLSIVAA+MSF
Sbjct  127   ISMMAIKRSNCFHESGGKNPCHMSSNPYMIMFGVTEILLSQIKDFDQIWWLSIVAAIMSF  186

Query  1115  TYSGIGLGLGIAQVVANGAFKGSLTGISIGTVTETQKIWRSFQALGDIAFAYSYSIILIE  936
             TYS IGL LGI QV ANG  KGSLTGISIGTVT+TQKIWR+FQALGDIAFAYSYS++LIE
Sbjct  187   TYSAIGLALGIIQVAANGVLKGSLTGISIGTVTQTQKIWRTFQALGDIAFAYSYSVVLIE  246

Query  935   IQDTVKSPPSESKTMRKASLFSTIVTTTFYMLCGCMGYAAFGDDAPGNLLTGFGFYNPFW  756
             IQDTV+SPP+ESKTM++A+  S  VTTTFYMLCGCMGYAAFGD APGNLLTGFGFYNPFW
Sbjct  247   IQDTVRSPPAESKTMKQATRISIAVTTTFYMLCGCMGYAAFGDAAPGNLLTGFGFYNPFW  306

Query  755   LLDIANAAIVIHLVGAYQVYCQPLFAFIEKWVGAKWPDSEIITKEINLKIPGFGYPYKLN  576
             LLD+AN AIVIHLVGAYQV+ QP+FAF++K   A++PDS++++KE  ++IPG   PYK+N
Sbjct  307   LLDVANVAIVIHLVGAYQVFAQPIFAFVDKQAAARFPDSDLVSKEFEIRIPGVRSPYKVN  366

Query  575   TFRLLWRTAFVLLTTVISMLLPFFNDVVGILGAFGFWPLTVYFPVRMYISQKKIPKWSTR  396
              FR ++R+ FV+LTTVISML+PFFNDVVGILGA GFWPLTVYFPV MYI Q+K+ +WS +
Sbjct  367   VFRAVFRSCFVVLTTVISMLMPFFNDVVGILGALGFWPLTVYFPVEMYIKQRKVERWSMK  426

Query  395   WICLQMlsgaclavslaaaagsfagvVLDLKLYRPFKTSY  276
             W+CL+MLSG CL +++ A  GS AGV+LDLK+Y+PFKT+Y
Sbjct  427   WVCLKMLSGGCLVITVVAGVGSVAGVMLDLKVYKPFKTTY  466



>ref|XP_002889140.1| hypothetical protein ARALYDRAFT_476902 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH65399.1| hypothetical protein ARALYDRAFT_476902 [Arabidopsis lyrata subsp. 
lyrata]
Length=476

 Score =   733 bits (1892),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 360/473 (76%), Positives = 416/473 (88%), Gaps = 1/473 (0%)
 Frame = -3

Query  1694  HHLGVSIDAPPLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSGVLSLAWAIGQLGWVA  1515
             H   +++D P   G K LDDDG+ +RTG+VWTASAHIITAVIGSGVLSLAWA  QLGW+A
Sbjct  5     HQTVLAVDMPQTGGSKYLDDDGKVKRTGSVWTASAHIITAVIGSGVLSLAWATAQLGWLA  64

Query  1514  GPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRNYTYMDAVRSNLGGYQVKICGLIQYFN  1335
             GP VMLLFS V Y+TS+LLA CYR+G+P+ GKRNYTYMDAVRSNLGG +V +CG++QY N
Sbjct  65    GPVVMLLFSAVTYFTSSLLAACYRSGNPISGKRNYTYMDAVRSNLGGVKVTLCGIVQYLN  124

Query  1334  LFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFGIIEIILSQIPDFDQ  1155
             +FG+AIGYTIA++ISMMAIKRSNCFH+SGGK+PCHM+SNPYMIAFG+++I+ SQIPDFDQ
Sbjct  125   IFGVAIGYTIASAISMMAIKRSNCFHKSGGKDPCHMNSNPYMIAFGLVQILFSQIPDFDQ  184

Query  1154  IWWLSIVAAVMSFTYSGIGLGLGIAQVVANGAFKGSLTGISIGTVTETQKIWRSFQALGD  975
             +WWLSI+AAVMSFTYS  GL LGIAQVV NG  KGSLTGISIG VTETQKIWR+FQALGD
Sbjct  185   LWWLSILAAVMSFTYSSAGLALGIAQVVVNGKVKGSLTGISIGAVTETQKIWRTFQALGD  244

Query  974   IAFAYSYSIILIEIQDTVKSPPSESKTMRKASLFSTIVTTTFYMLCGCMGYAAFGDDAPG  795
             IAFAYSYSIILIEIQDTVKSPPSE KTM+K +L S  VTT FYMLCGCMGYAAFGD +PG
Sbjct  245   IAFAYSYSIILIEIQDTVKSPPSEEKTMKKPTLVSVSVTTMFYMLCGCMGYAAFGDLSPG  304

Query  794   NLLTGFGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEKWVGAKWPDSEIITKEIN  615
             NLLTGFGFYNP+WLLDIANAAIVIHL+GAYQVYCQPLFAFIEK    ++PDSE I ++I 
Sbjct  305   NLLTGFGFYNPYWLLDIANAAIVIHLIGAYQVYCQPLFAFIEKQASIRFPDSEFIARDIK  364

Query  614   LKIPGFGYPYKLNTFRLLWRTAFVLLTTVISMLLPFFNDVVGILGAFGFWPLTVYFPVRM  435
             + IPGF + + LN FRL+WRT FV++TTVISMLLPFFNDVVG+LGA GFWPLTVYFPV M
Sbjct  365   IPIPGFKHLH-LNVFRLIWRTVFVIITTVISMLLPFFNDVVGLLGALGFWPLTVYFPVEM  423

Query  434   YISQKKIPKWSTRWICLQMlsgaclavslaaaagsfagvVLDLKLYRPFKTSY  276
             YI+QKKIP+WSTRW+CLQ+ S  CL +S+AAAAGS AGV+LDLK Y+PF++ Y
Sbjct  424   YIAQKKIPRWSTRWVCLQVFSSGCLVISIAAAAGSIAGVLLDLKSYKPFRSEY  476



>ref|XP_010444306.1| PREDICTED: amino acid permease 4-like [Camelina sativa]
Length=466

 Score =   732 bits (1890),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 355/463 (77%), Positives = 406/463 (88%), Gaps = 0/463 (0%)
 Frame = -3

Query  1664  PLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSGVLSLAWAIGQLGWVAGPSVMLLFSC  1485
             P   FK  DDDGR +R+GTVWTASAHIITAVIGSGVLSLAWAIGQLGW+AGP+VM LFS 
Sbjct  4     PRPAFKCFDDDGRLKRSGTVWTASAHIITAVIGSGVLSLAWAIGQLGWIAGPAVMFLFSF  63

Query  1484  VVYYTSTLLADCYRAGDPVFGKRNYTYMDAVRSNLGGYQVKICGLIQYFNLFGIAIGYTI  1305
             V YY+STLL+DCYR GDPV GKRNYTYMDAVRS LGG++ KICGLIQY NLFG+ IGYTI
Sbjct  64    VTYYSSTLLSDCYRTGDPVSGKRNYTYMDAVRSILGGFRFKICGLIQYLNLFGVTIGYTI  123

Query  1304  AASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFGIIEIILSQIPDFDQIWWLSIVAAV  1125
             AASISMMAIKRSNCFHESGGKNPCHMSSNPYMI FG+ EI+LSQI DFDQIWWLSIVAA+
Sbjct  124   AASISMMAIKRSNCFHESGGKNPCHMSSNPYMIMFGVTEILLSQIKDFDQIWWLSIVAAI  183

Query  1124  MSFTYSGIGLGLGIAQVVANGAFKGSLTGISIGTVTETQKIWRSFQALGDIAFAYSYSII  945
             MSFTYS IGL LGI QV ANG  KGSLTGISIG VT+TQKIWR+FQALGDIAFAYSYS++
Sbjct  184   MSFTYSAIGLALGIIQVAANGVVKGSLTGISIGAVTQTQKIWRTFQALGDIAFAYSYSVV  243

Query  944   LIEIQDTVKSPPSESKTMRKASLFSTIVTTTFYMLCGCMGYAAFGDDAPGNLLTGFGFYN  765
             LIEIQDT++SPP+ESKTM+ A+  S  VTTTFY+LCGCMGYAAFGD APGNLLTGFGFYN
Sbjct  244   LIEIQDTIRSPPAESKTMKNATKISIAVTTTFYLLCGCMGYAAFGDAAPGNLLTGFGFYN  303

Query  764   PFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEKWVGAKWPDSEIITKEINLKIPGFGYPY  585
             PFWLLD+AN AIVIHLVGAYQV+ QP+FAFIEK   A++P+++++ KE  ++IPG   PY
Sbjct  304   PFWLLDVANVAIVIHLVGAYQVFAQPIFAFIEKQAAARFPNNDLVIKEHEIRIPGLKSPY  363

Query  584   KLNTFRLLWRTAFVLLTTVISMLLPFFNDVVGILGAFGFWPLTVYFPVRMYISQKKIPKW  405
             K+N FR ++R+ FV+LTTVISMLLPFFNDVVGILGA GFWPLTVYFPV MYI Q+K+ +W
Sbjct  364   KVNVFRTVYRSGFVVLTTVISMLLPFFNDVVGILGALGFWPLTVYFPVEMYIKQRKVERW  423

Query  404   STRWICLQMlsgaclavslaaaagsfagvVLDLKLYRPFKTSY  276
             S +W+CLQMLS  CL ++L A  GS AGV+LDLK+Y+PFK++Y
Sbjct  424   SMKWVCLQMLSAGCLMITLVAGVGSIAGVMLDLKVYKPFKSTY  466



>ref|XP_002520323.1| amino acid transporter, putative [Ricinus communis]
 emb|CAA07563.1| amino acid carrier [Ricinus communis]
 gb|EEF42109.1| amino acid transporter, putative [Ricinus communis]
Length=486

 Score =   733 bits (1892),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 377/488 (77%), Positives = 424/488 (87%), Gaps = 5/488 (1%)
 Frame = -3

Query  1730  MGESAAATKNHRHHL-GVSID-APPLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSGV  1557
             M E+ AA KNH H +  VSI+    + G K LDDDGR +RTGTVWTASAHIITAVIGSGV
Sbjct  1     MVENTAA-KNHPHQVFDVSINMQTQVVGSKWLDDDGRTKRTGTVWTASAHIITAVIGSGV  59

Query  1556  LSLAWAIGQLGWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRNYTYMDAVRSNLG  1377
             LSLAWAI QLGW+AGP+VM LFS V YYTSTLL+ CYR+GDPV GKRNYTYMDAVR+NLG
Sbjct  60    LSLAWAIAQLGWIAGPAVMFLFSLVTYYTSTLLSACYRSGDPVNGKRNYTYMDAVRTNLG  119

Query  1376  GYQVKICGLIQYFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFG  1197
             G +VK+CG +QY NLFG+AIGYTIA+SISMMAIKRSNCFH+SGGKNPCH+++NPYMIAFG
Sbjct  120   GAKVKLCGFVQYLNLFGVAIGYTIASSISMMAIKRSNCFHKSGGKNPCHINANPYMIAFG  179

Query  1196  IIEIILSQIPDFDQIWWLSIVAAVMSFTYSGIGLGLGIAQVVANGAFKGSLTGISIG-TV  1020
             I EII SQIPDFDQ+WWLSI+AAVMSFTYS IGLGLGIAQVV NG   GS+TGISIG  V
Sbjct  180   IAEIIFSQIPDFDQLWWLSILAAVMSFTYSTIGLGLGIAQVVENGKAMGSVTGISIGANV  239

Query  1019  TETQKIWRSFQALGDIAFAYSYSIILIEIQDTVKSPPSESKTMRKASLFSTIVTTTFYML  840
             T TQKIWRSFQALGDIAFAYSYSIILIEIQDTV+SPPSESKTM+KA+L S  VTT FYML
Sbjct  240   TPTQKIWRSFQALGDIAFAYSYSIILIEIQDTVRSPPSESKTMKKATLISVAVTTLFYML  299

Query  839   CGCMGYAAFGDDAPGNLLTGFGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEKWV  660
             CGC GYAAFGD +PGNLLTGFGFYNP+WLLDIAN AIV+HLVGAYQVYCQPLFAF+EK  
Sbjct  300   CGCFGYAAFGDMSPGNLLTGFGFYNPYWLLDIANVAIVVHLVGAYQVYCQPLFAFVEKAA  359

Query  659   GAKWPDSEIITKEINLKIPGFGYPYKLNTFRLLWRTAFVLLTTVISMLLPFFNDVVGILG  480
               ++PDS  ITK+I + +PGF  P+ LN FR +WRT FV+ TTVISMLLPFFND+VG+LG
Sbjct  360   AQRYPDSGFITKDIKIPVPGF-RPFNLNLFRSVWRTLFVVFTTVISMLLPFFNDIVGLLG  418

Query  479   AFGFWPLTVYFPVRMYISQKKIPKWSTRWICLQMlsgaclavslaaaagsfagvVLDLKL  300
             A GFWPLTVYFPV MYI+QKKIPKWSTRW+CLQ+LS ACL +++AAAAGS AGVV DLK 
Sbjct  419   ALGFWPLTVYFPVEMYIAQKKIPKWSTRWLCLQILSAACLVITIAAAAGSIAGVVGDLKS  478

Query  299   YRPFKTSY  276
              +PF+TSY
Sbjct  479   VKPFQTSY  486



>ref|XP_011027478.1| PREDICTED: amino acid permease 3-like isoform X1 [Populus euphratica]
Length=486

 Score =   732 bits (1889),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 371/488 (76%), Positives = 423/488 (87%), Gaps = 3/488 (1%)
 Frame = -3

Query  1736  MQMGESAAATKNHRHHL-GVSIDAPPLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSG  1560
             M MGE+ +A     H +  VSID  P  G K  D+D RP+RTGTVWTASAHIITAVIGSG
Sbjct  1     MTMGENTSAKNQLPHQIFSVSIDTNPQSG-KWFDEDHRPKRTGTVWTASAHIITAVIGSG  59

Query  1559  VLSLAWAIGQLGWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRNYTYMDAVRSNL  1380
             VLSLAWAIGQLGW+AGP+VMLLFS V YYTS LL+ CYR+GDPV GKRNYTYMDAVR+NL
Sbjct  60    VLSLAWAIGQLGWIAGPAVMLLFSLVTYYTSILLSACYRSGDPVNGKRNYTYMDAVRANL  119

Query  1379  GGYQVKICGLIQYFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAF  1200
             GG +VKICG +QY NLFG+AIGYTIA+SISMMAIKRSNCFH+SGGK+PCHM++ PYMIAF
Sbjct  120   GGGKVKICGYVQYVNLFGVAIGYTIASSISMMAIKRSNCFHQSGGKDPCHMNAYPYMIAF  179

Query  1199  GIIEIILSQIPDFDQIWWLSIVAAVMSFTYSGIGLGLGIAQVVANGAFKGSLTGISIGTV  1020
             GI EI+LSQIP FDQ+ WLS+VAAVMSFTYS IGLGLGI +VV N    GSLTGISIGTV
Sbjct  180   GIAEILLSQIPGFDQLHWLSLVAAVMSFTYSSIGLGLGIGKVVENRRVMGSLTGISIGTV  239

Query  1019  TETQKIWRSFQALGDIAFAYSYSIILIEIQDTVKSPPSESKTMRKASLFSTIVTTTFYML  840
             T+TQKIWRSFQALGDIAFAYSYS+ILIEIQDTVK+PP+E+KTM+KA+L S  VTT FYM 
Sbjct  240   TQTQKIWRSFQALGDIAFAYSYSMILIEIQDTVKAPPTEAKTMKKATLISVAVTTLFYMF  299

Query  839   CGCMGYAAFGDDAPGNLLTGFGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEKWV  660
             CGC GYAAFGD +PGNLLTGFGFYNP+WLLDIANAAIVIHLVGAYQVYCQPLFAF+EK  
Sbjct  300   CGCFGYAAFGDLSPGNLLTGFGFYNPYWLLDIANAAIVIHLVGAYQVYCQPLFAFVEKAA  359

Query  659   GAKWPDSEIITKEINLKIPGFGYPYKLNTFRLLWRTAFVLLTTVISMLLPFFNDVVGILG  480
               ++PDS+ +TK+I + IPG G PY LN FR++WRT FV+ TTVISMLLPFFND+VG+LG
Sbjct  360   ARRFPDSDFVTKDIKISIPGLG-PYNLNLFRMIWRTLFVVTTTVISMLLPFFNDIVGLLG  418

Query  479   AFGFWPLTVYFPVRMYISQKKIPKWSTRWICLQMlsgaclavslaaaagsfagvVLDLKL  300
             A GFWPLTVYFPV MYISQKKIPKWSTRW+CLQ+LS ACL +++AAAAGS AGV+ D+K 
Sbjct  419   ALGFWPLTVYFPVEMYISQKKIPKWSTRWLCLQILSVACLIITIAAAAGSIAGVLDDVKT  478

Query  299   YRPFKTSY  276
              +PF+TSY
Sbjct  479   IKPFQTSY  486



>ref|XP_002306650.2| hypothetical protein POPTR_0005s20400g [Populus trichocarpa]
 gb|ABK95777.1| unknown [Populus trichocarpa]
 gb|EEE93646.2| hypothetical protein POPTR_0005s20400g [Populus trichocarpa]
Length=487

 Score =   731 bits (1888),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 367/489 (75%), Positives = 423/489 (87%), Gaps = 4/489 (1%)
 Frame = -3

Query  1736  MQMGESAAATKNH--RHHLGVSIDAPPLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGS  1563
             M+MGE+ A TKNH      GVS+D  P    K  DDDGRP+RTG VWTASAHIITAVIGS
Sbjct  1     MKMGENTA-TKNHLPPQAFGVSVDTDPQSDSKWFDDDGRPKRTGNVWTASAHIITAVIGS  59

Query  1562  GVLSLAWAIGQLGWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRNYTYMDAVRSN  1383
             GVLSLAWAIGQLGW+AGP+VMLLFS V YYTS LL+ CYR+GDP  GKRNYTYM+AVR+N
Sbjct  60    GVLSLAWAIGQLGWIAGPAVMLLFSFVTYYTSILLSACYRSGDPDNGKRNYTYMEAVRAN  119

Query  1382  LGGYQVKICGLIQYFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIA  1203
             LGG +VKICG +QY NLFG+AIGYTIA+SISMMAIKRSNCFH+SGGK+PC M++NPYMI 
Sbjct  120   LGGVKVKICGFVQYVNLFGVAIGYTIASSISMMAIKRSNCFHQSGGKDPCRMNANPYMIG  179

Query  1202  FGIIEIILSQIPDFDQIWWLSIVAAVMSFTYSGIGLGLGIAQVVANGAFKGSLTGISIGT  1023
             FGI EI+LSQIP FDQ+ WLS+VAAVMSFTYS IGLGLGI +V+ N   +GSLTGIS+GT
Sbjct  180   FGIAEILLSQIPGFDQLHWLSLVAAVMSFTYSTIGLGLGIGKVIENKRVRGSLTGISVGT  239

Query  1022  VTETQKIWRSFQALGDIAFAYSYSIILIEIQDTVKSPPSESKTMRKASLFSTIVTTTFYM  843
             VT+TQKIWRSFQALGD+AFAYSYS+ILIEIQDTVK+PPSE+KTM+KA+L S +VTT FYM
Sbjct  240   VTQTQKIWRSFQALGDVAFAYSYSVILIEIQDTVKAPPSEAKTMKKATLISVVVTTLFYM  299

Query  842   LCGCMGYAAFGDDAPGNLLTGFGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEKW  663
              CGC GYAAFGD +PGNLLTGFGFYNP+WLLDIAN AIVIHLVGAYQVYCQPLFAFIEK 
Sbjct  300   FCGCFGYAAFGDQSPGNLLTGFGFYNPYWLLDIANTAIVIHLVGAYQVYCQPLFAFIEKE  359

Query  662   VGAKWPDSEIITKEINLKIPGFGYPYKLNTFRLLWRTAFVLLTTVISMLLPFFNDVVGIL  483
                ++PDS+ +TK+I + IPG    + +N FR++ RT FV+LTTVISMLLPFFND+VG+L
Sbjct  360   AARRFPDSDFVTKDIKISIPGLS-AFNINLFRMVSRTIFVVLTTVISMLLPFFNDIVGLL  418

Query  482   GAFGFWPLTVYFPVRMYISQKKIPKWSTRWICLQMlsgaclavslaaaagsfagvVLDLK  303
             GAFGFWPLTVYFPV MYISQKKIPKWSTRW+CLQ+LS ACL +++AAAAGS AGV+ D+K
Sbjct  419   GAFGFWPLTVYFPVEMYISQKKIPKWSTRWLCLQILSVACLIITIAAAAGSIAGVIDDVK  478

Query  302   LYRPFKTSY  276
               +PFKTSY
Sbjct  479   TIKPFKTSY  487



>ref|XP_007222611.1| hypothetical protein PRUPE_ppa004936mg [Prunus persica]
 gb|EMJ23810.1| hypothetical protein PRUPE_ppa004936mg [Prunus persica]
Length=484

 Score =   731 bits (1887),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 370/486 (76%), Positives = 419/486 (86%), Gaps = 4/486 (1%)
 Frame = -3

Query  1733  QMGESAAATKNHRHHLGVSIDAPPLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSGVL  1554
             +MG++      H     VS+D PP  G K  DDDGR +RTGTVWTASAHIITAVIGSGVL
Sbjct  3     KMGDNQL---THHQVFDVSVDVPPEGGSKCFDDDGRLKRTGTVWTASAHIITAVIGSGVL  59

Query  1553  SLAWAIGQLGWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRNYTYMDAVRSNLGG  1374
             SLAWA  QLGWVAGPSVMLLFS V YYTSTLLA CYR GDPV GKRNYTY DAVRSNLGG
Sbjct  60    SLAWATAQLGWVAGPSVMLLFSFVTYYTSTLLAACYRTGDPVTGKRNYTYTDAVRSNLGG  119

Query  1373  YQVKICGLIQYFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFGI  1194
             ++ KICG +QY NLFG+AIGYTIA+SISM+AIKRSNCF+++G   PCH++SNPYMIAFGI
Sbjct  120   FKEKICGFVQYLNLFGVAIGYTIASSISMVAIKRSNCFYKNGDTAPCHVNSNPYMIAFGI  179

Query  1193  IEIILSQIPDFDQIWWLSIVAAVMSFTYSGIGLGLGIAQVVANGAFKGSLTGISIGTVTE  1014
              EII SQIP+FDQ+WWLSIVAAVMSFTYS IGLGLGIA+VV  G  +GS+TGISIG VTE
Sbjct  180   AEIIFSQIPNFDQLWWLSIVAAVMSFTYSSIGLGLGIAKVVETGTIRGSMTGISIGNVTE  239

Query  1013  TQKIWRSFQALGDIAFAYSYSIILIEIQDTVKSPPSESKTMRKASLFSTIVTTTFYMLCG  834
             TQKIWRSFQALGDIAFAYSYS+ILIEIQDTVKSPPSE+KTM+KA++ S   TT FYMLCG
Sbjct  240   TQKIWRSFQALGDIAFAYSYSLILIEIQDTVKSPPSEAKTMKKATIVSVATTTLFYMLCG  299

Query  833   CMGYAAFGDDAPGNLLTGFGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEKWVGA  654
             CMGYAAFGD +PGNLLTGFGF+NP+WL+DIANAAIVIHLVGAYQV+ QPL+AF+EK    
Sbjct  300   CMGYAAFGDSSPGNLLTGFGFFNPYWLIDIANAAIVIHLVGAYQVFVQPLYAFVEKTAAE  359

Query  653   KWPDSEIITKEINLKIPGFGYPYKLNTFRLLWRTAFVLLTTVISMLLPFFNDVVGILGAF  474
             K+P S  ITK+I  +IPGFG  + LN FRL+WRT FV+LTTVISM+LPFFNDVVG+LGA 
Sbjct  360   KYPHSHFITKDIKFRIPGFGL-FNLNLFRLVWRTCFVILTTVISMILPFFNDVVGLLGAL  418

Query  473   GFWPLTVYFPVRMYISQKKIPKWSTRWICLQMlsgaclavslaaaagsfagvVLDLKLYR  294
             GFWPLTVYFPV MYI+ K+IPKWSTRWICLQ+LSGACL V++AAAAGS AGV+ DLK+Y+
Sbjct  419   GFWPLTVYFPVEMYIATKRIPKWSTRWICLQILSGACLIVTIAAAAGSIAGVISDLKIYK  478

Query  293   PFKTSY  276
             PFKTSY
Sbjct  479   PFKTSY  484



>ref|XP_009389175.1| PREDICTED: amino acid permease 4-like [Musa acuminata subsp. 
malaccensis]
Length=513

 Score =   731 bits (1888),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 368/494 (74%), Positives = 416/494 (84%), Gaps = 16/494 (3%)
 Frame = -3

Query  1709  TKNHRHHLGVSIDA----------PPLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSG  1560
             ++N R +L V              P +   K  DDDGR +RTGTVWTA++HIITAVIGSG
Sbjct  20    SRNERAYLQVETQPKIQEDTESLNPQVAHSKCFDDDGRLKRTGTVWTATSHIITAVIGSG  79

Query  1559  VLSLAWAIGQLGWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRNYTYMDAVRSNL  1380
             VLSLAWAI QLGW+AGP VM+LF+ V+YYTS LL+DCYR+GDPV G+RNYTY DAVRSNL
Sbjct  80    VLSLAWAIAQLGWIAGPIVMILFAFVIYYTSNLLSDCYRSGDPVTGRRNYTYTDAVRSNL  139

Query  1379  GGYQVKICGLIQYFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAF  1200
             GG +VKICG IQY NLFG+AIGYTIAASISMMAIKRSNCFH SGGK+PCHMSSN YMI F
Sbjct  140   GGAKVKICGAIQYVNLFGVAIGYTIAASISMMAIKRSNCFHASGGKDPCHMSSNMYMIIF  199

Query  1199  GIIEIILSQIPDFDQIWWLSIVAAVMSFTYSGIGLGLGIAQVVANGAFKGSLTGISIGTV  1020
             GI EI+ SQIPDFDQ+WWLSIVAAVMSFTYS +GLGLG+ +   NG+F+GSL GISIGTV
Sbjct  200   GITEIVFSQIPDFDQVWWLSIVAAVMSFTYSTVGLGLGVTKTAENGSFRGSLMGISIGTV  259

Query  1019  TE------TQKIWRSFQALGDIAFAYSYSIILIEIQDTVKSPPSESKTMRKASLFSTIVT  858
             T+      TQKIWR+ QALGDIAFAYSYSIILIEIQDT+KSPP+E+KTMRKA+L S +VT
Sbjct  260   TKAGTVTATQKIWRNLQALGDIAFAYSYSIILIEIQDTIKSPPAENKTMRKATLLSIVVT  319

Query  857   TTFYMLCGCMGYAAFGDDAPGNLLTGFGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFA  678
             T FYMLCGCMGYAAFGDDAPGNLLTGFGFYNP+WLLDIAN AIV+HLVGAYQV+CQPLFA
Sbjct  320   TVFYMLCGCMGYAAFGDDAPGNLLTGFGFYNPYWLLDIANLAIVVHLVGAYQVFCQPLFA  379

Query  677   FIEKWVGAKWPDSEIITKEINLKIPGFGYPYKLNTFRLLWRTAFVLLTTVISMLLPFFND  498
             F+EKW   +WP SE+IT E   +IP  G  YKLN FRL+WRTAFV+LTTVISML+PFFND
Sbjct  380   FVEKWSAKRWPKSELITHEYEARIPCTGATYKLNLFRLVWRTAFVVLTTVISMLMPFFND  439

Query  497   VVGILGAFGFWPLTVYFPVRMYISQKKIPKWSTRWICLQMlsgaclavslaaaagsfagv  318
             VVGILGAFGFWPLTVYFPV MYI+QKKI  WS+RW+ LQ+LS  CL VSLAAA GS AGV
Sbjct  440   VVGILGAFGFWPLTVYFPVEMYIAQKKIRPWSSRWVGLQLLSFTCLVVSLAAACGSMAGV  499

Query  317   VLDLKLYRPFKTSY  276
             VLDLK YRPF+++Y
Sbjct  500   VLDLKSYRPFESTY  513



>ref|XP_008219594.1| PREDICTED: amino acid permease 3-like [Prunus mume]
Length=484

 Score =   729 bits (1881),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 369/486 (76%), Positives = 419/486 (86%), Gaps = 4/486 (1%)
 Frame = -3

Query  1733  QMGESAAATKNHRHHLGVSIDAPPLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSGVL  1554
             +MG++     NH     VS+D PP  G K  DDDGR +RTGTVWTASAHIITAVIGSGVL
Sbjct  3     KMGDNQL---NHHQVFDVSVDVPPEGGSKCFDDDGRLKRTGTVWTASAHIITAVIGSGVL  59

Query  1553  SLAWAIGQLGWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRNYTYMDAVRSNLGG  1374
             SLAWA  QLGWVAGPSVMLLFS V YYTSTLLA CYR GDP+ GKRNYTY DAVRSNLGG
Sbjct  60    SLAWATAQLGWVAGPSVMLLFSFVTYYTSTLLAACYRTGDPLTGKRNYTYTDAVRSNLGG  119

Query  1373  YQVKICGLIQYFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFGI  1194
             ++ KICG +QY NLFG+AIGYTIA+SISM+AIKRSNCF+++G   PCH++SNPYMIAFGI
Sbjct  120   FKEKICGFVQYLNLFGVAIGYTIASSISMVAIKRSNCFYKNGDTAPCHVNSNPYMIAFGI  179

Query  1193  IEIILSQIPDFDQIWWLSIVAAVMSFTYSGIGLGLGIAQVVANGAFKGSLTGISIGTVTE  1014
              EII SQIP+FDQ+WWLSIVAAVMSFTYS IGLGLGIA+VV  G  +GS+TGISIG VTE
Sbjct  180   AEIIFSQIPNFDQLWWLSIVAAVMSFTYSSIGLGLGIAKVVETGTIRGSMTGISIGNVTE  239

Query  1013  TQKIWRSFQALGDIAFAYSYSIILIEIQDTVKSPPSESKTMRKASLFSTIVTTTFYMLCG  834
             TQKIWRSFQALGDIAFAYSYS+ILIEIQDTVKSPPSE+KTM+KA++ S   TT FYMLCG
Sbjct  240   TQKIWRSFQALGDIAFAYSYSLILIEIQDTVKSPPSEAKTMKKATIVSVATTTLFYMLCG  299

Query  833   CMGYAAFGDDAPGNLLTGFGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEKWVGA  654
             CMGYAAFGD +PGNLLTGFGF+NP+WL+DIANAAIVIHLVGAYQV+ QPL+AF+EK    
Sbjct  300   CMGYAAFGDSSPGNLLTGFGFFNPYWLIDIANAAIVIHLVGAYQVFVQPLYAFVEKTAAE  359

Query  653   KWPDSEIITKEINLKIPGFGYPYKLNTFRLLWRTAFVLLTTVISMLLPFFNDVVGILGAF  474
             K+P S  ITK+I  +IP FG  + LN FRL+WRT FV+LTTVISM+LPFFNDVVG+LGA 
Sbjct  360   KYPHSHFITKDIKFRIPCFGL-FNLNLFRLVWRTCFVILTTVISMILPFFNDVVGLLGAL  418

Query  473   GFWPLTVYFPVRMYISQKKIPKWSTRWICLQMlsgaclavslaaaagsfagvVLDLKLYR  294
             GFWPLTVYFPV MYI+ K+IPKWSTRWICLQ+LSGACL V++AAAAGS AGV+ DLK+Y+
Sbjct  419   GFWPLTVYFPVEMYIAAKRIPKWSTRWICLQILSGACLIVTIAAAAGSVAGVISDLKIYK  478

Query  293   PFKTSY  276
             PFKTSY
Sbjct  479   PFKTSY  484



>ref|XP_002302224.2| hypothetical protein POPTR_0002s08000g [Populus trichocarpa]
 gb|EEE81497.2| hypothetical protein POPTR_0002s08000g [Populus trichocarpa]
Length=485

 Score =   728 bits (1880),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 365/486 (75%), Positives = 419/486 (86%), Gaps = 2/486 (0%)
 Frame = -3

Query  1730  MGESAAATKNHRHHL-GVSIDAPPLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSGVL  1554
             MGE+ +A     H +  VSID  P  G +  DDDGRP+RTGTVWTASAHIITAVIGSGVL
Sbjct  1     MGENTSAENQLPHQVFSVSIDTNPRSGSEWFDDDGRPKRTGTVWTASAHIITAVIGSGVL  60

Query  1553  SLAWAIGQLGWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRNYTYMDAVRSNLGG  1374
             SLAWAIGQLGW+AGP+VMLLFS V YYTSTLL+ CYR+GDP+ GKRNYTYMD VR+NLG 
Sbjct  61    SLAWAIGQLGWIAGPAVMLLFSLVTYYTSTLLSACYRSGDPITGKRNYTYMDVVRANLGD  120

Query  1373  YQVKICGLIQYFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFGI  1194
              +VKICG + Y N FG+A GYTIA+SISMMAIKRSNCFH+SGGKNPC M++NPYMI FGI
Sbjct  121   VKVKICGFVLYLNPFGVATGYTIASSISMMAIKRSNCFHKSGGKNPCRMNANPYMIGFGI  180

Query  1193  IEIILSQIPDFDQIWWLSIVAAVMSFTYSGIGLGLGIAQVVANGAFKGSLTGISIGTVTE  1014
              EI+LSQIP FDQ+ WLS+VAAVMSFTY+ IGLGLGI +V+ NG   GSLTGISIGTVT+
Sbjct  181   TEILLSQIPGFDQLHWLSLVAAVMSFTYASIGLGLGIGKVIENGKISGSLTGISIGTVTQ  240

Query  1013  TQKIWRSFQALGDIAFAYSYSIILIEIQDTVKSPPSESKTMRKASLFSTIVTTTFYMLCG  834
             TQKIW SFQALG+IAFAYS+S+IL+EIQDT+KSPPSE+KTM+KA+L S +VTT FYM CG
Sbjct  241   TQKIWISFQALGNIAFAYSFSMILVEIQDTIKSPPSEAKTMKKATLISVVVTTLFYMFCG  300

Query  833   CMGYAAFGDDAPGNLLTGFGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEKWVGA  654
             C GYAAFGD +PGNLLTGFGFYNP+WLLDIANAAIVIHLVGAYQV CQPL+AFIEK    
Sbjct  301   CFGYAAFGDLSPGNLLTGFGFYNPYWLLDIANAAIVIHLVGAYQVSCQPLYAFIEKEAAQ  360

Query  653   KWPDSEIITKEINLKIPGFGYPYKLNTFRLLWRTAFVLLTTVISMLLPFFNDVVGILGAF  474
             ++PDSE ITK+IN+ IPGF  PY LN FR++WRT FV+LTTVISMLLPFFND+VG+LGA 
Sbjct  361   RFPDSEFITKDINIPIPGF-RPYNLNLFRMIWRTLFVVLTTVISMLLPFFNDIVGLLGAL  419

Query  473   GFWPLTVYFPVRMYISQKKIPKWSTRWICLQMlsgaclavslaaaagsfagvVLDLKLYR  294
             GFWPLTVYFPV MYI QKKIPKWSTRW+CLQ+LS ACL +++AAAAGS AG+V DLK  +
Sbjct  420   GFWPLTVYFPVEMYIVQKKIPKWSTRWLCLQILSVACLIITIAAAAGSVAGIVGDLKSIK  479

Query  293   PFKTSY  276
             PF+TSY
Sbjct  480   PFQTSY  485



>ref|XP_008444195.1| PREDICTED: amino acid permease 3-like [Cucumis melo]
Length=480

 Score =   728 bits (1878),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 367/479 (77%), Positives = 422/479 (88%), Gaps = 4/479 (1%)
 Frame = -3

Query  1703  NHRHHLGVSIDAPPLYGF---KGLDDDGRPQRTGTVWTASAHIITAVIGSGVLSLAWAIG  1533
             N+ HH  ++I APP          DDDGRP+RTGTVWTASAHIITAVIGSGVLSLAWA  
Sbjct  3     NNHHHHSLNISAPPHAAVGADTAFDDDGRPKRTGTVWTASAHIITAVIGSGVLSLAWATA  62

Query  1532  QLGWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRNYTYMDAVRSNLGGYQVKICG  1353
             QLGWVAGP VM+LFS V YYTSTLLA CYR+GD V GKRNYTYMDAVR+NLGG++VK+CG
Sbjct  63    QLGWVAGPVVMMLFSFVTYYTSTLLAACYRSGDSVNGKRNYTYMDAVRNNLGGFKVKLCG  122

Query  1352  LIQYFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFGIIEIILSQ  1173
             L+QY NLFG+AIGYTIA+SISMMAIKRSNCFH+SGGKNPCHM+SNPYMI+FGI+EI LSQ
Sbjct  123   LVQYVNLFGVAIGYTIASSISMMAIKRSNCFHKSGGKNPCHMNSNPYMISFGIMEIFLSQ  182

Query  1172  IPDFDQIWWLSIVAAVMSFTYSGIGLGLGIAQVVANGAFKGSLTGISIGTVTETQKIWRS  993
             IPDFDQ+WWLSIVAAVMSFTYS IGL LGI QV  NG FKGSLTG+SIG+VTE+QKIWRS
Sbjct  183   IPDFDQLWWLSIVAAVMSFTYSIIGLILGIIQVADNGKFKGSLTGVSIGSVTESQKIWRS  242

Query  992   FQALGDIAFAYSYSIILIEIQDTVKSPPSESKTMRKASLFSTIVTTTFYMLCGCMGYAAF  813
             FQALGD+AFAYS+SIILIEIQDT+K+PPSE+KTM+KA+  S  VTT FYMLCGCMGYAAF
Sbjct  243   FQALGDMAFAYSFSIILIEIQDTIKAPPSEAKTMKKATFLSVAVTTIFYMLCGCMGYAAF  302

Query  812   GDDAPGNLLTGFGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEKWVGAKWPDSEI  633
             GD APGNLLTGFGFYNP+WLLDIAN AIV+HLVGAYQV+CQPLFAFIEK+   ++PDS+ 
Sbjct  303   GDLAPGNLLTGFGFYNPYWLLDIANVAIVVHLVGAYQVFCQPLFAFIEKYASNRFPDSQF  362

Query  632   ITKEINLKIPGFGYPYKLNTFRLLWRTAFVLLTTVISMLLPFFNDVVGILGAFGFWPLTV  453
             I ++IN+ IPGF  P+KLN FRL+WRT FV++TT++SMLLPFFND+VG+LGA GFWPLTV
Sbjct  363   INEDINIPIPGF-RPFKLNLFRLVWRTIFVIITTLVSMLLPFFNDIVGLLGALGFWPLTV  421

Query  452   YFPVRMYISQKKIPKWSTRWICLQMlsgaclavslaaaagsfagvVLDLKLYRPFKTSY  276
             YFPV MYI+QKKIPKWSTRWI LQ+LS ACL +++AAAAGS AGV+ D K  +PF+T+Y
Sbjct  422   YFPVEMYIAQKKIPKWSTRWISLQILSMACLIITIAAAAGSVAGVIQDSKSIKPFQTTY  480



>ref|XP_006300985.1| hypothetical protein CARUB_v10021374mg [Capsella rubella]
 gb|EOA33883.1| hypothetical protein CARUB_v10021374mg [Capsella rubella]
Length=475

 Score =   727 bits (1877),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 358/469 (76%), Positives = 414/469 (88%), Gaps = 1/469 (0%)
 Frame = -3

Query  1682  VSIDAPPLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSGVLSLAWAIGQLGWVAGPSV  1503
             +++  P   G K  DDDG+ +RTG+ WTASAHIITAVIGSGVLSLAWA  QLGW+AGP V
Sbjct  8     LAVIMPQTAGSKCFDDDGKIKRTGSAWTASAHIITAVIGSGVLSLAWATAQLGWIAGPVV  67

Query  1502  MLLFSCVVYYTSTLLADCYRAGDPVFGKRNYTYMDAVRSNLGGYQVKICGLIQYFNLFGI  1323
             MLLFS V Y+TS+LLA CYR+GDP+ GKRNYTYMDAVRSNLGG +V +CG++QY N+FG+
Sbjct  68    MLLFSIVTYFTSSLLASCYRSGDPISGKRNYTYMDAVRSNLGGVKVTLCGIVQYLNIFGV  127

Query  1322  AIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFGIIEIILSQIPDFDQIWWL  1143
             AIGYTIA++ISMMAIKRSNCFH+SGGK+ CHM+SNPYMIAFG+++I+ SQIPDFDQ+WWL
Sbjct  128   AIGYTIASAISMMAIKRSNCFHKSGGKDACHMNSNPYMIAFGLVQILFSQIPDFDQLWWL  187

Query  1142  SIVAAVMSFTYSGIGLGLGIAQVVANGAFKGSLTGISIGTVTETQKIWRSFQALGDIAFA  963
             SI+AAVMSFTYS  GL LGIAQVV NG  KGSLTGISIG VTETQKIWRSFQALG+IAFA
Sbjct  188   SILAAVMSFTYSSAGLALGIAQVVVNGKVKGSLTGISIGAVTETQKIWRSFQALGNIAFA  247

Query  962   YSYSIILIEIQDTVKSPPSESKTMRKASLFSTIVTTTFYMLCGCMGYAAFGDDAPGNLLT  783
             YSYSIILIEIQDTVKSPPSE KTM+KA+L S  VTT FY+LCGCMGYAAFGD +PGNLLT
Sbjct  248   YSYSIILIEIQDTVKSPPSEEKTMKKATLVSVGVTTMFYLLCGCMGYAAFGDLSPGNLLT  307

Query  782   GFGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEKWVGAKWPDSEIITKEINLKIP  603
             GFGFYNP+WLLDIANAAIVIHL+GAYQVYCQPLFAF+EK    ++PDSE I K+I + IP
Sbjct  308   GFGFYNPYWLLDIANAAIVIHLIGAYQVYCQPLFAFVEKQASIRFPDSEFIAKDIKIPIP  367

Query  602   GFGYPYKLNTFRLLWRTAFVLLTTVISMLLPFFNDVVGILGAFGFWPLTVYFPVRMYISQ  423
             GF  P++LN FRL+WRT FV++TTVISMLLPFFNDVVG+LG+ GFWPLTVYFPV MYI+Q
Sbjct  368   GFK-PFRLNLFRLIWRTVFVIITTVISMLLPFFNDVVGLLGSLGFWPLTVYFPVEMYIAQ  426

Query  422   KKIPKWSTRWICLQMlsgaclavslaaaagsfagvVLDLKLYRPFKTSY  276
             KKIP+WSTRW+CLQ+ S  CL VS+AAAAGS AGVVLDLK Y+PF+++Y
Sbjct  427   KKIPRWSTRWVCLQVFSSGCLVVSIAAAAGSIAGVVLDLKSYKPFQSNY  475



>ref|XP_008781630.1| PREDICTED: amino acid permease 3 [Phoenix dactylifera]
Length=492

 Score =   728 bits (1879),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 373/493 (76%), Positives = 418/493 (85%), Gaps = 9/493 (2%)
 Frame = -3

Query  1730  MGESAAATKNHRHH---LGVSID----APPLYGFKGLDDDGRPQRTGTVWTASAHIITAV  1572
             MGE+ A   N +     + VSI+      P  G K  DDD R +RTGT+WTASAHIITAV
Sbjct  1     MGENGAEKHNQQASFPAMEVSIELGHHQQPQGGSKFYDDDQRLKRTGTLWTASAHIITAV  60

Query  1571  IGSGVLSLAWAIGQLGWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRNYTYMDAV  1392
             IGSGVLSLAWAI QLGWVAGP+VMLLFS V+YYTS+LLADCYR GDP+ GKRNYTYMDAV
Sbjct  61    IGSGVLSLAWAIAQLGWVAGPAVMLLFSFVIYYTSSLLADCYRFGDPITGKRNYTYMDAV  120

Query  1391  RSNLGGYQVKICGLIQYFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPY  1212
              + LGG++VK CG+IQY NLFG+AIGYTIAASISMMAI+RS+CFHE G K+PCH+SSNPY
Sbjct  121   HAYLGGFKVKFCGVIQYANLFGVAIGYTIAASISMMAIRRSDCFHEKGDKSPCHISSNPY  180

Query  1211  MIAFGIIEIILSQIPDFDQIWWLSIVAAVMSFTYSGIGLGLGIAQVVANGAFKGSLTGIS  1032
             MI FG+ EII SQIPDFDQIWWLSIVAAVMSFTYS IGL LGI Q + NG FKGSL+GIS
Sbjct  181   MIIFGVSEIIFSQIPDFDQIWWLSIVAAVMSFTYSSIGLVLGIVQTIENGGFKGSLSGIS  240

Query  1031  IGTVTETQKIWRSFQALGDIAFAYSYSIILIEIQDTVKS-PPSESKTMRKASLFSTIVTT  855
             IGTVTETQKIWRS QALGDIAFAYS+SIILIEIQDT+K+ PPSE+K M+KA++ S  VTT
Sbjct  241   IGTVTETQKIWRSLQALGDIAFAYSFSIILIEIQDTIKAPPPSEAKVMKKATMLSLAVTT  300

Query  854   TFYMLCGCMGYAAFGDDAPGNLLTGFGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAF  675
              FYMLCGCMGYAAFGDDAPGNLLTGFGFYNPFWLLDIANAAIVIHLVGAYQV+CQPLFAF
Sbjct  301   FFYMLCGCMGYAAFGDDAPGNLLTGFGFYNPFWLLDIANAAIVIHLVGAYQVFCQPLFAF  360

Query  674   IEKWVGAKWPDSEIITKEINLKIPGFGYPYKLNTFRLLWRTAFVLLTTVISMLLPFFNDV  495
             +EKW    WP S  ITKE  + +      Y LN FRL+WR+AFV+LTT+ISMLLPFFNDV
Sbjct  361   VEKWARQTWPKSTFITKETRIPLSS-ARSYNLNLFRLVWRSAFVVLTTIISMLLPFFNDV  419

Query  494   VGILGAFGFWPLTVYFPVRMYISQKKIPKWSTRWICLQMlsgaclavslaaaagsfagvV  315
             VG+LGA GFWPLTVYFP+ MYI+QKK+PKWSTRW+ LQMLS ACL VS++AAAGS AGVV
Sbjct  420   VGLLGALGFWPLTVYFPIEMYIAQKKVPKWSTRWVSLQMLSIACLIVSISAAAGSIAGVV  479

Query  314   LDLKLYRPFKTSY  276
              DLK+YRPFKTSY
Sbjct  480   TDLKVYRPFKTSY  492



>ref|XP_009377726.1| PREDICTED: amino acid permease 3-like [Pyrus x bretschneideri]
 ref|XP_009343981.1| PREDICTED: amino acid permease 3 [Pyrus x bretschneideri]
Length=484

 Score =   727 bits (1877),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 366/486 (75%), Positives = 423/486 (87%), Gaps = 4/486 (1%)
 Frame = -3

Query  1733  QMGESAAATKNHRHHLGVSIDAPPLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSGVL  1554
             +MG++     N R    +S+  PP  G K  DDDGR +RTGTVWTASAHIITAVIGSGVL
Sbjct  3     KMGDNQI---NPRQGFELSVPMPPEVGSKCYDDDGRLKRTGTVWTASAHIITAVIGSGVL  59

Query  1553  SLAWAIGQLGWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRNYTYMDAVRSNLGG  1374
             SLAWA+ QLGWVAGP+VMLLFS V YYTSTLL+ CYR+GDPV GKRNYTY +AVRSNLGG
Sbjct  60    SLAWAVAQLGWVAGPAVMLLFSFVTYYTSTLLSACYRSGDPVTGKRNYTYTNAVRSNLGG  119

Query  1373  YQVKICGLIQYFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFGI  1194
             ++VKICG +QY NLFG+AIGYTIA+SISM+AIKRSNCF+++G   PCH++SNPYMIAFG+
Sbjct  120   FKVKICGFVQYLNLFGVAIGYTIASSISMVAIKRSNCFYKNGDTAPCHVNSNPYMIAFGV  179

Query  1193  IEIILSQIPDFDQIWWLSIVAAVMSFTYSGIGLGLGIAQVVANGAFKGSLTGISIGTVTE  1014
              EII SQIPDFDQ+WWLSIVAAVMSFTYS IGLGLGIA+VV  G  KGS+TGI IG VTE
Sbjct  180   AEIIFSQIPDFDQLWWLSIVAAVMSFTYSSIGLGLGIAKVVETGTIKGSMTGIDIGAVTE  239

Query  1013  TQKIWRSFQALGDIAFAYSYSIILIEIQDTVKSPPSESKTMRKASLFSTIVTTTFYMLCG  834
             TQKIWRSFQALGDIAFAYSYS+ILIEIQDTVKSPPSE+KTM+KA+L S   TT FYMLCG
Sbjct  240   TQKIWRSFQALGDIAFAYSYSLILIEIQDTVKSPPSEAKTMKKATLVSVATTTLFYMLCG  299

Query  833   CMGYAAFGDDAPGNLLTGFGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEKWVGA  654
             CMGYAAFGD +PGNLLTGFGF+NP+WL+DIANAAIVIHLVGAYQV+ QPL+AF+EK V  
Sbjct  300   CMGYAAFGDSSPGNLLTGFGFFNPYWLIDIANAAIVIHLVGAYQVFVQPLYAFVEKTVKE  359

Query  653   KWPDSEIITKEINLKIPGFGYPYKLNTFRLLWRTAFVLLTTVISMLLPFFNDVVGILGAF  474
             K+P S+ ITK+I  ++P FG  Y LN FRL+WRT+FV++TTVISM+LPFFNDVVG+LGA 
Sbjct  360   KYPHSQFITKDIKFRLPVFG-SYNLNLFRLVWRTSFVIVTTVISMILPFFNDVVGLLGAL  418

Query  473   GFWPLTVYFPVRMYISQKKIPKWSTRWICLQMlsgaclavslaaaagsfagvVLDLKLYR  294
             GFWPLTVYFPV MYI+QK+IPKWSTRW+CLQ LSGACL +++AAAAGS AGV+ DLK+Y+
Sbjct  419   GFWPLTVYFPVEMYIAQKRIPKWSTRWLCLQTLSGACLIITIAAAAGSIAGVISDLKIYK  478

Query  293   PFKTSY  276
             PFKTSY
Sbjct  479   PFKTSY  484



>gb|KHG16478.1| Amino acid permease 2 -like protein [Gossypium arboreum]
Length=476

 Score =   727 bits (1876),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 362/478 (76%), Positives = 411/478 (86%), Gaps = 5/478 (1%)
 Frame = -3

Query  1706  KNHRHHLGVSIDAPPLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSGVLSLAWAIGQL  1527
             +NHR    V ID P L   +  DDDGR +RTGT WTASAHIITAVIGSGVLSLAWAI QL
Sbjct  3     ENHR----VFIDNPSLNDSQCFDDDGRLKRTGTFWTASAHIITAVIGSGVLSLAWAIAQL  58

Query  1526  GWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRNYTYMDAVRSNLGGYQVKICGLI  1347
             GW+AGP+VMLLFS + +YTS LL DCYR GDPV GKRNYTY  AV S LGGY+VK+CG I
Sbjct  59    GWIAGPAVMLLFSIITFYTSCLLTDCYRTGDPVSGKRNYTYTQAVGSLLGGYKVKVCGFI  118

Query  1346  QYFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFGIIEIILSQIP  1167
             QY NLFG++IGYTIAASISMMAIKRSNCFH SGGKNPCHMSS+PYM+ FG+ EI+LSQIP
Sbjct  119   QYVNLFGVSIGYTIAASISMMAIKRSNCFHNSGGKNPCHMSSSPYMMMFGVAEILLSQIP  178

Query  1166  DFDQIWWLSIVAAVMSFTYSGIGLGLGIAQVVANGAFKGSLTGISIGTVTETQKIWRSFQ  987
             DFDQIWWLSI+AAVMSFTYSGIGL LGIA+V+  G  +GSLTGIS+GTVT  QKIWRSF+
Sbjct  179   DFDQIWWLSILAAVMSFTYSGIGLALGIAKVIGIGTIRGSLTGISLGTVTPAQKIWRSFR  238

Query  986   ALGDIAFAYSYSIILIEIQDTVKSPPSESKTMRKASLFSTIVTTTFYMLCGCMGYAAFGD  807
             ALGDIAFAYS+S+ILIEIQDTVKSPP+E+KTM+KA+  S  +TT FYMLCGCMGYA+FGD
Sbjct  239   ALGDIAFAYSFSMILIEIQDTVKSPPAEAKTMKKATKLSIAITTAFYMLCGCMGYASFGD  298

Query  806   DAPGNLLTGFGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEKWVGAKWPDSEIIT  627
              AP NLLTGFGFYNPFWLLDIANAAIVIHLVGAYQV+CQP+F F+EKW   +WP+S+ IT
Sbjct  299   LAPDNLLTGFGFYNPFWLLDIANAAIVIHLVGAYQVFCQPIFTFVEKWASQRWPESKTIT  358

Query  626   KEINLKIPGFGY-PYKLNTFRLLWRTAFVLLTTVISMLLPFFNDVVGILGAFGFWPLTVY  450
             KE+ + +P  GY PYKLN FR +WRTAFV+LTTVISMLLPFF DVVGILGAFGFWPLTVY
Sbjct  359   KELKIPMPIRGYRPYKLNLFRSVWRTAFVMLTTVISMLLPFFGDVVGILGAFGFWPLTVY  418

Query  449   FPVRMYISQKKIPKWSTRWICLQMlsgaclavslaaaagsfagvVLDLKLYRPFKTSY  276
             FPV MYI QKKI KWS+RWICL+MLS +CL +S+ A  GS AGV+ DLK+Y+PFKT+Y
Sbjct  419   FPVEMYIEQKKISKWSSRWICLKMLSMSCLMISILAGTGSIAGVIHDLKVYKPFKTTY  476



>ref|XP_010416679.1| PREDICTED: amino acid permease 3-like [Camelina sativa]
Length=477

 Score =   726 bits (1874),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 362/470 (77%), Positives = 414/470 (88%), Gaps = 2/470 (0%)
 Frame = -3

Query  1682  VSIDAPPLYG-FKGLDDDGRPQRTGTVWTASAHIITAVIGSGVLSLAWAIGQLGWVAGPS  1506
             ++ID PP  G  K  DDDG+ +RTG+VWTASAHIITAVIGSGVLSLAWA  QLGW+AGP 
Sbjct  9     LAIDMPPQTGGSKCFDDDGKVKRTGSVWTASAHIITAVIGSGVLSLAWATAQLGWIAGPV  68

Query  1505  VMLLFSCVVYYTSTLLADCYRAGDPVFGKRNYTYMDAVRSNLGGYQVKICGLIQYFNLFG  1326
              MLLFS V Y+TS+LLA CYR+GDP+ GKRNYTYM AVRSNLGG +V +CG++QY N+FG
Sbjct  69    AMLLFSVVTYFTSSLLATCYRSGDPISGKRNYTYMGAVRSNLGGVKVTLCGIVQYLNIFG  128

Query  1325  IAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFGIIEIILSQIPDFDQIWW  1146
             +AIGYTIA++ISMMAIKRSNCFH+SGGK+PC M+S PYMIAFG+++I+ SQIPDFDQ+WW
Sbjct  129   VAIGYTIASAISMMAIKRSNCFHKSGGKDPCQMNSTPYMIAFGLVQILFSQIPDFDQLWW  188

Query  1145  LSIVAAVMSFTYSGIGLGLGIAQVVANGAFKGSLTGISIGTVTETQKIWRSFQALGDIAF  966
             LSI+AAVMSFTYS  GL LGIAQVV NG  KGSLTGISIGTVTETQKIWRSFQALG+IAF
Sbjct  189   LSILAAVMSFTYSSAGLALGIAQVVVNGKVKGSLTGISIGTVTETQKIWRSFQALGNIAF  248

Query  965   AYSYSIILIEIQDTVKSPPSESKTMRKASLFSTIVTTTFYMLCGCMGYAAFGDDAPGNLL  786
             AYSYSIILIEIQDTVKSPPSE KTM+KA+L S  VTT FYMLCGCMGYAAFGD +PGNLL
Sbjct  249   AYSYSIILIEIQDTVKSPPSEEKTMKKATLVSVGVTTIFYMLCGCMGYAAFGDLSPGNLL  308

Query  785   TGFGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEKWVGAKWPDSEIITKEINLKI  606
             TGFGFYNP+WLLDIANAAIVIHL+GAYQVYCQPLFAFIEK    ++PDSE I K+I + I
Sbjct  309   TGFGFYNPYWLLDIANAAIVIHLIGAYQVYCQPLFAFIEKQASIRFPDSEFIAKDIEIPI  368

Query  605   PGFGYPYKLNTFRLLWRTAFVLLTTVISMLLPFFNDVVGILGAFGFWPLTVYFPVRMYIS  426
             PGF  P +LN FRL+WRT FV++TTVISMLLPFFNDVVG+LG+ GFWPLTVYFPV MYI+
Sbjct  369   PGFK-PLRLNLFRLIWRTVFVIITTVISMLLPFFNDVVGLLGSLGFWPLTVYFPVEMYIA  427

Query  425   QKKIPKWSTRWICLQMlsgaclavslaaaagsfagvVLDLKLYRPFKTSY  276
             QKKIP+WSTRW+CLQ+ S  CL VS+AAAAGS AGVVLDLK Y+PF+++Y
Sbjct  428   QKKIPRWSTRWVCLQVFSLGCLVVSIAAAAGSIAGVVLDLKSYKPFQSNY  477



>emb|CDY43761.1| BnaA06g22970D [Brassica napus]
Length=466

 Score =   725 bits (1871),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 348/463 (75%), Positives = 403/463 (87%), Gaps = 0/463 (0%)
 Frame = -3

Query  1664  PLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSGVLSLAWAIGQLGWVAGPSVMLLFSC  1485
             P   FK  DDDGRP+R+GTVWTASAHI+TAVIGSGVLSLAWAI QLGW+AGP+VM LFS 
Sbjct  4     PRPAFKCFDDDGRPKRSGTVWTASAHILTAVIGSGVLSLAWAIAQLGWIAGPAVMFLFSF  63

Query  1484  VVYYTSTLLADCYRAGDPVFGKRNYTYMDAVRSNLGGYQVKICGLIQYFNLFGIAIGYTI  1305
             V YY++TLL+DCYR GDPV GKRNYTYMDAV+S LGG++ KICGL+Q+ NLFG  IGYTI
Sbjct  64    VTYYSTTLLSDCYRTGDPVSGKRNYTYMDAVQSILGGFRFKICGLMQFLNLFGTTIGYTI  123

Query  1304  AASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFGIIEIILSQIPDFDQIWWLSIVAAV  1125
             A+SISMMAIKRSNCFHESGGKNPCHMSSNPYMI FG+ EI+LS I DFDQIWWLS VAA+
Sbjct  124   ASSISMMAIKRSNCFHESGGKNPCHMSSNPYMIMFGVTEILLSTIKDFDQIWWLSTVAAI  183

Query  1124  MSFTYSGIGLGLGIAQVVANGAFKGSLTGISIGTVTETQKIWRSFQALGDIAFAYSYSII  945
             MSFTYS IGL LGI QV ANG FKGSLTGISIG VT+TQKIWR+FQALGDIAFAYSYS++
Sbjct  184   MSFTYSSIGLALGIIQVAANGVFKGSLTGISIGAVTQTQKIWRTFQALGDIAFAYSYSVV  243

Query  944   LIEIQDTVKSPPSESKTMRKASLFSTIVTTTFYMLCGCMGYAAFGDDAPGNLLTGFGFYN  765
             LIEIQDTV+SPP+ESKTM+ A+  S  VTTTFYMLCGCMGYAAFGD APGNLLTGFGFYN
Sbjct  244   LIEIQDTVRSPPAESKTMKNATRISIAVTTTFYMLCGCMGYAAFGDAAPGNLLTGFGFYN  303

Query  764   PFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEKWVGAKWPDSEIITKEINLKIPGFGYPY  585
             PFWLLD+ANAAIV+HLVGAYQV+ QP+FAF+EK   A++PDS++++KE  ++ PG   PY
Sbjct  304   PFWLLDVANAAIVVHLVGAYQVFAQPIFAFVEKQAAARFPDSDLVSKEFEIRFPGVRSPY  363

Query  584   KLNTFRLLWRTAFVLLTTVISMLLPFFNDVVGILGAFGFWPLTVYFPVRMYISQKKIPKW  405
             K+N FR ++R+ FV+LTTVISML+PFFNDVVGILGA  FWPLTVYFPV MYI Q+K+ +W
Sbjct  364   KVNVFRTVFRSCFVVLTTVISMLMPFFNDVVGILGALAFWPLTVYFPVEMYIKQRKVERW  423

Query  404   STRWICLQMlsgaclavslaaaagsfagvVLDLKLYRPFKTSY  276
             S +W+CLQMLS  CL V++ A  GS  GV+LDLK+Y+PFKT+Y
Sbjct  424   SMKWVCLQMLSCGCLVVTVVAGVGSVVGVMLDLKVYKPFKTTY  466



>ref|XP_006386360.1| hypothetical protein POPTR_0002s08040g [Populus trichocarpa]
 gb|ERP64157.1| hypothetical protein POPTR_0002s08040g [Populus trichocarpa]
Length=485

 Score =   725 bits (1872),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 369/486 (76%), Positives = 418/486 (86%), Gaps = 2/486 (0%)
 Frame = -3

Query  1730  MGESAAATKNHRHHL-GVSIDAPPLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSGVL  1554
             MGE+ +A     H +  VSID  P  G K  DDDGRP+RTGTVWTASAHIITAVIGSGVL
Sbjct  1     MGENTSAKNQLPHQVFSVSIDTNPQSGSKWFDDDGRPKRTGTVWTASAHIITAVIGSGVL  60

Query  1553  SLAWAIGQLGWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRNYTYMDAVRSNLGG  1374
             SLAWAIGQLGW+AGP+VMLLFS V YYTS LL+ CYR+GDPV GKRNYTYMDAVR+NLGG
Sbjct  61    SLAWAIGQLGWIAGPAVMLLFSLVTYYTSILLSACYRSGDPVNGKRNYTYMDAVRANLGG  120

Query  1373  YQVKICGLIQYFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFGI  1194
              +VKICG +QY NLFG+AIGYTIA+SISMMAIKRSNCFH+SGG++PCHM++ PYMIAFGI
Sbjct  121   GKVKICGFVQYVNLFGVAIGYTIASSISMMAIKRSNCFHQSGGQDPCHMNAYPYMIAFGI  180

Query  1193  IEIILSQIPDFDQIWWLSIVAAVMSFTYSGIGLGLGIAQVVANGAFKGSLTGISIGTVTE  1014
              EI+LSQIP FDQ+ WLS+VAAVMSFTYS IGLGLGI +VV N    GSLTGISIGTVT+
Sbjct  181   AEILLSQIPGFDQLHWLSLVAAVMSFTYSSIGLGLGIGKVVENKRVMGSLTGISIGTVTQ  240

Query  1013  TQKIWRSFQALGDIAFAYSYSIILIEIQDTVKSPPSESKTMRKASLFSTIVTTTFYMLCG  834
             TQKIWRSFQALGDIAFAYSYS+ILIEIQDTVK+PP+E+KTM+KA+L S  VTT FYM CG
Sbjct  241   TQKIWRSFQALGDIAFAYSYSMILIEIQDTVKAPPTEAKTMKKATLISVAVTTLFYMFCG  300

Query  833   CMGYAAFGDDAPGNLLTGFGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEKWVGA  654
             C GYAAFGD +PGNLLTGFGFYNP+WLLDIANAA+VIHLVG YQ  CQPL+AFIEK    
Sbjct  301   CFGYAAFGDLSPGNLLTGFGFYNPYWLLDIANAAMVIHLVGIYQFSCQPLYAFIEKEAAQ  360

Query  653   KWPDSEIITKEINLKIPGFGYPYKLNTFRLLWRTAFVLLTTVISMLLPFFNDVVGILGAF  474
             ++PDSE ITK+I + IPGF  PY LN FR++WRT FV+LTTVISMLLPFFND+V +LGA 
Sbjct  361   RFPDSEFITKDIKIPIPGF-RPYNLNLFRMIWRTLFVVLTTVISMLLPFFNDIVRLLGAL  419

Query  473   GFWPLTVYFPVRMYISQKKIPKWSTRWICLQMlsgaclavslaaaagsfagvVLDLKLYR  294
             GFWPLTVYFPV MYI QKKI KWSTRW+CLQ+LS ACL +S+AAAAGS AG+V DLK  +
Sbjct  420   GFWPLTVYFPVEMYIVQKKIRKWSTRWLCLQILSVACLIISIAAAAGSVAGIVGDLKSIK  479

Query  293   PFKTSY  276
             PF+TSY
Sbjct  480   PFQTSY  485



>ref|XP_008799058.1| PREDICTED: amino acid permease 3-like [Phoenix dactylifera]
Length=492

 Score =   724 bits (1869),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 376/494 (76%), Positives = 421/494 (85%), Gaps = 11/494 (2%)
 Frame = -3

Query  1730  MGESAAATKNHRHH----LGVSIDAPPLYGFKG----LDDDGRPQRTGTVWTASAHIITA  1575
             MGE+ A TK H+      + VSI+       +G     DDDGR +RTGT+WTASAHIITA
Sbjct  1     MGENGA-TKYHQQAGIPPMEVSIELGHQKQLQGGSKCYDDDGRLKRTGTLWTASAHIITA  59

Query  1574  VIGSGVLSLAWAIGQLGWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRNYTYMDA  1395
             VIGSGVLSLAWAI QLGWVAGP+VM LFS V++YTSTLLADCYR+GDP+ GKRNYTYMDA
Sbjct  60    VIGSGVLSLAWAIAQLGWVAGPAVMFLFSFVIFYTSTLLADCYRSGDPITGKRNYTYMDA  119

Query  1394  VRSNLGGYQVKICGLIQYFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNP  1215
             V + LGG +VK+CG IQY NLFG+AIGYTIAASISMMAI+RSNCFHE G K+PCH+SSNP
Sbjct  120   VHAYLGGLKVKMCGYIQYANLFGVAIGYTIAASISMMAIRRSNCFHEKGHKSPCHVSSNP  179

Query  1214  YMIAFGIIEIILSQIPDFDQIWWLSIVAAVMSFTYSGIGLGLGIAQVVANGAFKGSLTGI  1035
             YMIAFG++EII SQIPDFDQIWWLSIVAAVMSFTYS IGL LGI Q + N  FKGSLTGI
Sbjct  180   YMIAFGVLEIIFSQIPDFDQIWWLSIVAAVMSFTYSSIGLILGIVQTIGNKRFKGSLTGI  239

Query  1034  SIGTVTETQKIWRSFQALGDIAFAYSYSIILIEIQDTVKS-PPSESKTMRKASLFSTIVT  858
             SIG VTETQKIWR+ QALGDIAFAYS+SIILIEIQDTVK+ PPSE+K M+KA++ S  VT
Sbjct  240   SIGAVTETQKIWRTLQALGDIAFAYSFSIILIEIQDTVKAPPPSEAKVMKKAAVLSIAVT  299

Query  857   TTFYMLCGCMGYAAFGDDAPGNLLTGFGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFA  678
             T FYMLCGCMGYAAFGD+APGNLLTGFGFYNPFWLLDIANAAIVIHLVGAYQV+CQPLFA
Sbjct  300   TFFYMLCGCMGYAAFGDEAPGNLLTGFGFYNPFWLLDIANAAIVIHLVGAYQVFCQPLFA  359

Query  677   FIEKWVGAKWPDSEIITKEINLKIPGFGYPYKLNTFRLLWRTAFVLLTTVISMLLPFFND  498
             FIEKW    WP S  ITKE+ + +      Y LN FRL+WR+AFV+LTTVISMLLPFFND
Sbjct  360   FIEKWALQTWPKSTFITKEVRIPLTS-TRSYNLNLFRLVWRSAFVVLTTVISMLLPFFND  418

Query  497   VVGILGAFGFWPLTVYFPVRMYISQKKIPKWSTRWICLQMlsgaclavslaaaagsfagv  318
             VVG+LGA GFWPLTVYFPV MYI+QK++P+WSTRW+CLQMLS ACL VS+AAAAGS AGV
Sbjct  419   VVGLLGALGFWPLTVYFPVEMYIAQKEVPRWSTRWVCLQMLSIACLIVSIAAAAGSIAGV  478

Query  317   VLDLKLYRPFKTSY  276
             V DLK+YRPFKTSY
Sbjct  479   VTDLKVYRPFKTSY  492



>ref|XP_006473027.1| PREDICTED: amino acid permease 3-like [Citrus sinensis]
Length=479

 Score =   723 bits (1867),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 375/480 (78%), Positives = 413/480 (86%), Gaps = 7/480 (1%)
 Frame = -3

Query  1712  ATKNHRHHLGVSIDAPPLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSGVLSLAWAIG  1533
             A KN      VS+   P  G K  DDDGR +RTGT+WTASAHIITAVIGSGVLSLAWA  
Sbjct  6     AAKNQHQVFDVSL---PQSGSKCFDDDGRLKRTGTLWTASAHIITAVIGSGVLSLAWATA  62

Query  1532  QLGWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRNYTYMDAVRSNLGGYQVKICG  1353
             QLGW+AGPSVM LFS V YYTSTLLA CYR+GDPV GKRNYTY+DAVRSNLGG+QVKICG
Sbjct  63    QLGWIAGPSVMFLFSFVTYYTSTLLAACYRSGDPVTGKRNYTYVDAVRSNLGGFQVKICG  122

Query  1352  LIQYFNLFGIAIG-YTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFGIIEIILS  1176
             L+QY NLFG+A   Y+  +SI   AI+RSNCFH  G KNPCHM+SNPYMIAFGI+EI+LS
Sbjct  123   LVQYLNLFGVAFTRYSFFSSIR--AIERSNCFHSKGDKNPCHMNSNPYMIAFGIVEIVLS  180

Query  1175  QIPDFDQIWWLSIVAAVMSFTYSGIGLGLGIAQVVANGAFKGSLTGISIGTVTETQKIWR  996
             QIPDFDQ+WWLSIVAAVMSFTYS IGLGLGIA+V   G F+GSLTGISIGTVTETQKIWR
Sbjct  181   QIPDFDQLWWLSIVAAVMSFTYSTIGLGLGIAKVAETGKFRGSLTGISIGTVTETQKIWR  240

Query  995   SFQALGDIAFAYSYSIILIEIQDTVKSPPSESKTMRKASLFSTIVTTTFYMLCGCMGYAA  816
             SFQALGDIAFAYSYSIILIEIQDTVKSPPSESKTM+KASL S  VTT FYMLCGC GYA+
Sbjct  241   SFQALGDIAFAYSYSIILIEIQDTVKSPPSESKTMKKASLISVGVTTLFYMLCGCFGYAS  300

Query  815   FGDDAPGNLLTGFGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEKWVGAKWPDSE  636
             FGD +PGNLLTGFGFYNP+WLLDIANAAIVIHLVGAYQV+CQPLFAFIEK    ++PDSE
Sbjct  301   FGDLSPGNLLTGFGFYNPYWLLDIANAAIVIHLVGAYQVFCQPLFAFIEKQAHQRFPDSE  360

Query  635   IITKEINLKIPGFGYPYKLNTFRLLWRTAFVLLTTVISMLLPFFNDVVGILGAFGFWPLT  456
              ITK+I + IPGF   Y LN FRL+WRT FV+LTTVISMLLPFFNDVVG+LGA GFWPLT
Sbjct  361   FITKDIKVPIPGFKC-YNLNLFRLVWRTIFVILTTVISMLLPFFNDVVGLLGALGFWPLT  419

Query  455   VYFPVRMYISQKKIPKWSTRWICLQMlsgaclavslaaaagsfagvVLDLKLYRPFKTSY  276
             VYFPV MYI+QKKIPKWST+W+CLQ+LS ACL +++AAAAGS AGVV DLK Y+PF TSY
Sbjct  420   VYFPVEMYIAQKKIPKWSTKWLCLQILSVACLIITIAAAAGSIAGVVTDLKSYKPFSTSY  479



>ref|XP_009150448.1| PREDICTED: amino acid permease 4 [Brassica rapa]
Length=466

 Score =   723 bits (1865),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 347/463 (75%), Positives = 402/463 (87%), Gaps = 0/463 (0%)
 Frame = -3

Query  1664  PLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSGVLSLAWAIGQLGWVAGPSVMLLFSC  1485
             P   FK  DDDGRP+R+GTVWTASAHI+TAVIGSGVLSLAWAI QLGW+AGP+VM LFS 
Sbjct  4     PRPAFKCFDDDGRPKRSGTVWTASAHILTAVIGSGVLSLAWAIAQLGWIAGPAVMFLFSF  63

Query  1484  VVYYTSTLLADCYRAGDPVFGKRNYTYMDAVRSNLGGYQVKICGLIQYFNLFGIAIGYTI  1305
             V YY++TLL+DCYR GDPV GKRNYTYMDAV+S LGG++ KICGL+Q+ NLFG  IGYTI
Sbjct  64    VTYYSTTLLSDCYRTGDPVSGKRNYTYMDAVQSILGGFRFKICGLMQFLNLFGTTIGYTI  123

Query  1304  AASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFGIIEIILSQIPDFDQIWWLSIVAAV  1125
             A+SISMMAIKRSNCFHESGGKNPCHMSSNPYMI FG+ EI+LS I DF QIWWLS VAA+
Sbjct  124   ASSISMMAIKRSNCFHESGGKNPCHMSSNPYMIMFGVTEILLSTIKDFHQIWWLSTVAAI  183

Query  1124  MSFTYSGIGLGLGIAQVVANGAFKGSLTGISIGTVTETQKIWRSFQALGDIAFAYSYSII  945
             MSFTYS IGL LGI QV ANG FKGSLTGISIG VT+TQKIWR+FQALGDIAFAYSYS++
Sbjct  184   MSFTYSSIGLALGIIQVAANGVFKGSLTGISIGAVTQTQKIWRTFQALGDIAFAYSYSVV  243

Query  944   LIEIQDTVKSPPSESKTMRKASLFSTIVTTTFYMLCGCMGYAAFGDDAPGNLLTGFGFYN  765
             LIEIQDTV+SPP+ESKTM+ A+  S  VTTTFYMLCGCMGYAAFGD APGNLLTGFGFYN
Sbjct  244   LIEIQDTVRSPPAESKTMKNATRISIAVTTTFYMLCGCMGYAAFGDAAPGNLLTGFGFYN  303

Query  764   PFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEKWVGAKWPDSEIITKEINLKIPGFGYPY  585
             PFWLLD+ANAAIV+HLVGAYQV+ QP+FAF+EK   A++PDS++++KE  ++ PG   PY
Sbjct  304   PFWLLDVANAAIVVHLVGAYQVFAQPIFAFVEKQAAARFPDSDLVSKEFEIRFPGVRSPY  363

Query  584   KLNTFRLLWRTAFVLLTTVISMLLPFFNDVVGILGAFGFWPLTVYFPVRMYISQKKIPKW  405
             K+N FR ++R+ FV+LTTVISML+PFFNDVVGILGA  FWPLTVYFPV MYI Q+K+ +W
Sbjct  364   KVNVFRTVFRSCFVVLTTVISMLMPFFNDVVGILGALAFWPLTVYFPVEMYIKQRKVERW  423

Query  404   STRWICLQMlsgaclavslaaaagsfagvVLDLKLYRPFKTSY  276
             S +W+CLQMLS  CL V++ A  GS  GV+LDLK+Y+PFKT+Y
Sbjct  424   SMKWVCLQMLSCGCLVVTVVAGVGSVVGVMLDLKVYKPFKTTY  466



>ref|XP_011027477.1| PREDICTED: amino acid permease 3-like [Populus euphratica]
Length=480

 Score =   722 bits (1864),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 363/477 (76%), Positives = 416/477 (87%), Gaps = 2/477 (0%)
 Frame = -3

Query  1706  KNHRHHLGVSIDAPPLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSGVLSLAWAIGQL  1527
             +NH+  L +SID     G K  DDDGR +RTGTVWTASAHIITAVIGSGVLSLAWAIGQL
Sbjct  6     RNHQV-LDISIDTHQQGGSKWFDDDGRLKRTGTVWTASAHIITAVIGSGVLSLAWAIGQL  64

Query  1526  GWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRNYTYMDAVRSNLGGYQVKICGLI  1347
             GW+AGP+VM LFS V  YTSTLL+ CYR+GDP+ GKRNYTYMDAVRSNLGG +VKICG +
Sbjct  65    GWIAGPAVMFLFSFVTCYTSTLLSACYRSGDPITGKRNYTYMDAVRSNLGGVKVKICGFV  124

Query  1346  QYFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFGIIEIILSQIP  1167
             QY NLFG+AIGYTIA+SISMMAIKRSNCF++SGGKNPC M++NPYMI FGI EI+LSQIP
Sbjct  125   QYLNLFGVAIGYTIASSISMMAIKRSNCFYKSGGKNPCRMNANPYMIGFGIAEILLSQIP  184

Query  1166  DFDQIWWLSIVAAVMSFTYSGIGLGLGIAQVVANGAFKGSLTGISIGTVTETQKIWRSFQ  987
              FDQ+ WLS+VAAVMSFTYS IGLGLGI +V+ NG   GSLTGIS+GTVT+TQKIW+SFQ
Sbjct  185   GFDQLHWLSLVAAVMSFTYSSIGLGLGIGKVIENGKISGSLTGISVGTVTQTQKIWKSFQ  244

Query  986   ALGDIAFAYSYSIILIEIQDTVKSPPSESKTMRKASLFSTIVTTTFYMLCGCMGYAAFGD  807
             ALGDIAFAYS+S+IL+EIQDT+KSPPSE+KTM+KA+L S +VTT FYM CGC GYAAFGD
Sbjct  245   ALGDIAFAYSFSMILVEIQDTIKSPPSEAKTMKKATLISVVVTTLFYMFCGCFGYAAFGD  304

Query  806   DAPGNLLTGFGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEKWVGAKWPDSEIIT  627
              +PGNLLTGFGFYNP+WLLDIANAAIVIHLVGAYQVYCQPL+AFIEK    ++PDSE IT
Sbjct  305   LSPGNLLTGFGFYNPYWLLDIANAAIVIHLVGAYQVYCQPLYAFIEKEAAQRFPDSEFIT  364

Query  626   KEINLKIPGFGYPYKLNTFRLLWRTAFVLLTTVISMLLPFFNDVVGILGAFGFWPLTVYF  447
             K+I + IPGF  PY LN FR++WR  FV+LTTVISMLLPFFND+VG+LGA GFWPLTVYF
Sbjct  365   KDIKIPIPGF-RPYNLNLFRMIWRALFVVLTTVISMLLPFFNDIVGLLGALGFWPLTVYF  423

Query  446   PVRMYISQKKIPKWSTRWICLQMlsgaclavslaaaagsfagvVLDLKLYRPFKTSY  276
             PV MYI QKKIPKWS RW+CLQ+LS ACL +++AAAAGS AG+V DLK  +PF+TSY
Sbjct  424   PVEMYIVQKKIPKWSKRWLCLQILSVACLIITMAAAAGSVAGIVGDLKSIKPFQTSY  480



>emb|CDX84450.1| BnaC03g50500D [Brassica napus]
Length=466

 Score =   720 bits (1859),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 347/463 (75%), Positives = 403/463 (87%), Gaps = 0/463 (0%)
 Frame = -3

Query  1664  PLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSGVLSLAWAIGQLGWVAGPSVMLLFSC  1485
             P   FK  DDDGRP+R+GTVWTASAHI+TAVIGSGVLSLAWAIGQLGW+AGP+VM LFS 
Sbjct  4     PRPAFKCFDDDGRPKRSGTVWTASAHILTAVIGSGVLSLAWAIGQLGWIAGPAVMFLFSF  63

Query  1484  VVYYTSTLLADCYRAGDPVFGKRNYTYMDAVRSNLGGYQVKICGLIQYFNLFGIAIGYTI  1305
             V YY++TLL+DCYR GDPV GKRNYTYMDAV+S LGG++ KICGL+Q+ NLFG  IGYTI
Sbjct  64    VTYYSTTLLSDCYRTGDPVSGKRNYTYMDAVQSILGGFRFKICGLMQFLNLFGTTIGYTI  123

Query  1304  AASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFGIIEIILSQIPDFDQIWWLSIVAAV  1125
             A+SISMMAIKRSNCFHESGGKN CHMSSNPYMI FG+IEI+LS I DF QIWWLS VAA+
Sbjct  124   ASSISMMAIKRSNCFHESGGKNLCHMSSNPYMIMFGVIEILLSTIKDFHQIWWLSTVAAI  183

Query  1124  MSFTYSGIGLGLGIAQVVANGAFKGSLTGISIGTVTETQKIWRSFQALGDIAFAYSYSII  945
             MSFTYS IGL LGI QV ANG FKGSLTGISIG VT+TQKIWR+FQALGDIAFAYSYS++
Sbjct  184   MSFTYSSIGLALGIIQVAANGVFKGSLTGISIGAVTQTQKIWRTFQALGDIAFAYSYSVV  243

Query  944   LIEIQDTVKSPPSESKTMRKASLFSTIVTTTFYMLCGCMGYAAFGDDAPGNLLTGFGFYN  765
             LIEIQDTV+SPP+ESKTM+ A+  S  VTTTFYMLCGCMGYAAFGD APGNLLTGFGFYN
Sbjct  244   LIEIQDTVRSPPAESKTMKNATRISIAVTTTFYMLCGCMGYAAFGDAAPGNLLTGFGFYN  303

Query  764   PFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEKWVGAKWPDSEIITKEINLKIPGFGYPY  585
             PFWLLD+ANAAIV+HLVGAYQV+ QP+FAF+EK   A++P+S++++KE  ++ PG   PY
Sbjct  304   PFWLLDVANAAIVVHLVGAYQVFAQPIFAFVEKQAAARFPNSDLVSKEFEIRFPGVRSPY  363

Query  584   KLNTFRLLWRTAFVLLTTVISMLLPFFNDVVGILGAFGFWPLTVYFPVRMYISQKKIPKW  405
             K+N FR ++R+ FV+LTTVISML+PFFNDVVGILGA  FWPLTVYFPV MYI Q+K+ +W
Sbjct  364   KVNVFRTVFRSCFVVLTTVISMLMPFFNDVVGILGALAFWPLTVYFPVEMYIKQRKVERW  423

Query  404   STRWICLQMlsgaclavslaaaagsfagvVLDLKLYRPFKTSY  276
             S +W+CLQMLS  CL V++ A  GS  GV+LDLK+Y+PFKT+Y
Sbjct  424   SMKWVCLQMLSCGCLVVTVVAGVGSVVGVMLDLKVYKPFKTTY  466



>ref|XP_010912574.1| PREDICTED: amino acid permease 3-like [Elaeis guineensis]
Length=488

 Score =   721 bits (1861),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 366/490 (75%), Positives = 416/490 (85%), Gaps = 7/490 (1%)
 Frame = -3

Query  1730  MGESAAATKNHRHHLGVSID----APPLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGS  1563
             MGE+ AA K ++H + VSI+         G K  DDDGR +RTGT WTASAHIITAVIGS
Sbjct  1     MGENGAA-KYYQHPMEVSIELGHQQQQQGGSKFHDDDGRLKRTGTFWTASAHIITAVIGS  59

Query  1562  GVLSLAWAIGQLGWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRNYTYMDAVRSN  1383
             GVLSLAWAI QLGWVAGP+VMLLF+ V+YYTSTLLADCYR+ DP+ G RNYTYMDAV + 
Sbjct  60    GVLSLAWAIAQLGWVAGPAVMLLFAFVIYYTSTLLADCYRSEDPITGPRNYTYMDAVHAY  119

Query  1382  LGGYQVKICGLIQYFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIA  1203
             LGG +VK+CG IQY NLFG+AIGYTIAASISMMAI+RSNCFHE G KNPCH++SNPYMIA
Sbjct  120   LGGLKVKMCGFIQYANLFGVAIGYTIAASISMMAIRRSNCFHEKGHKNPCHVNSNPYMIA  179

Query  1202  FGIIEIILSQIPDFDQIWWLSIVAAVMSFTYSGIGLGLGIAQVVANGAFKGSLTGISIGT  1023
             FG++EII SQIPDFDQIWWLSIVAAVMSFTYS IGL LGI Q + N  FKGSLTGISIG 
Sbjct  180   FGVLEIIFSQIPDFDQIWWLSIVAAVMSFTYSSIGLTLGIVQTIENKGFKGSLTGISIGA  239

Query  1022  VTETQKIWRSFQALGDIAFAYSYSIILIEIQDTVKS-PPSESKTMRKASLFSTIVTTTFY  846
             VTETQK+W S QALGDIAFAYS+SIILIEIQDT+K+ PPSE+K M+KA+L S +VTT FY
Sbjct  240   VTETQKVWHSLQALGDIAFAYSFSIILIEIQDTIKAPPPSEAKVMKKATLLSIVVTTFFY  299

Query  845   MLCGCMGYAAFGDDAPGNLLTGFGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEK  666
             MLCGCMGYAAFGD+APGNLLTGFGFYNPFWLLDIAN AIV+HL+GAYQV+CQPLFAFIEK
Sbjct  300   MLCGCMGYAAFGDEAPGNLLTGFGFYNPFWLLDIANTAIVVHLIGAYQVFCQPLFAFIEK  359

Query  665   WVGAKWPDSEIITKEINLKIPGFGYPYKLNTFRLLWRTAFVLLTTVISMLLPFFNDVVGI  486
             W    WP S  ITKE+ + +      Y LN FRL+WR+AFV+LTT+ISMLLPFFND+VG+
Sbjct  360   WALQTWPKSTFITKEMRISLTS-TKSYNLNLFRLVWRSAFVVLTTIISMLLPFFNDIVGL  418

Query  485   LGAFGFWPLTVYFPVRMYISQKKIPKWSTRWICLQMlsgaclavslaaaagsfagvVLDL  306
             LGA  FWPLTVYFP+ MY+ QKK+P+WSTRW+CLQ+LS ACL VS+AAA GS AGVV DL
Sbjct  419   LGALSFWPLTVYFPIEMYVVQKKVPRWSTRWVCLQILSVACLIVSIAAATGSIAGVVTDL  478

Query  305   KLYRPFKTSY  276
             K+YRPFKTSY
Sbjct  479   KVYRPFKTSY  488



>ref|XP_008338672.1| PREDICTED: amino acid permease 3-like [Malus domestica]
Length=484

 Score =   720 bits (1859),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 363/486 (75%), Positives = 419/486 (86%), Gaps = 4/486 (1%)
 Frame = -3

Query  1733  QMGESAAATKNHRHHLGVSIDAPPLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSGVL  1554
             +MG++     N R    +S+  PP  G K  DDDGR +RTGTVWTASAHIITAVIGSGVL
Sbjct  3     KMGDNQI---NPRQGFELSVPMPPEVGSKCYDDDGRLKRTGTVWTASAHIITAVIGSGVL  59

Query  1553  SLAWAIGQLGWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRNYTYMDAVRSNLGG  1374
             SLAWA+ QLGWVAGP+VMLLFS V  YTSTLL+ CYR+GDPV GKRNYTY DAVRSNLGG
Sbjct  60    SLAWAVAQLGWVAGPAVMLLFSFVTXYTSTLLSACYRSGDPVIGKRNYTYTDAVRSNLGG  119

Query  1373  YQVKICGLIQYFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFGI  1194
             ++VKICG +QY NLFG+AIGYTIA+SISM+AIKRSNCF+++G   PCH++SNPYMIAFG+
Sbjct  120   FKVKICGFVQYLNLFGVAIGYTIASSISMVAIKRSNCFYKNGDTAPCHVNSNPYMIAFGV  179

Query  1193  IEIILSQIPDFDQIWWLSIVAAVMSFTYSGIGLGLGIAQVVANGAFKGSLTGISIGTVTE  1014
              EII SQIPDFDQ+WWLSIVAAVMSFTYS IGLGLGIA+VV  G  KGS+TGI IG VTE
Sbjct  180   AEIIFSQIPDFDQLWWLSIVAAVMSFTYSSIGLGLGIAKVVETGTIKGSMTGIDIGAVTE  239

Query  1013  TQKIWRSFQALGDIAFAYSYSIILIEIQDTVKSPPSESKTMRKASLFSTIVTTTFYMLCG  834
             TQKIWRSFQALGDIAFAYSYS+ILIEIQDT+KSPPSE+KTM+KA+L S   TT FYMLCG
Sbjct  240   TQKIWRSFQALGDIAFAYSYSLILIEIQDTIKSPPSEAKTMKKATLVSVATTTLFYMLCG  299

Query  833   CMGYAAFGDDAPGNLLTGFGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEKWVGA  654
             CMGYAAFGD +PGNLLTGFGF+NP+WL+DIANAAIVIHLVGAYQV+ QPL+AF+EK V  
Sbjct  300   CMGYAAFGDSSPGNLLTGFGFFNPYWLIDIANAAIVIHLVGAYQVFVQPLYAFVEKTVKE  359

Query  653   KWPDSEIITKEINLKIPGFGYPYKLNTFRLLWRTAFVLLTTVISMLLPFFNDVVGILGAF  474
             K+P S  ITK+I  ++P FG  Y LN FRL+WRT+FV++TTVISM+LPFFNDVVG+LGA 
Sbjct  360   KYPHSRFITKDIKFRLPVFG-SYBLNLFRLVWRTSFVIVTTVISMILPFFNDVVGLLGAL  418

Query  473   GFWPLTVYFPVRMYISQKKIPKWSTRWICLQMlsgaclavslaaaagsfagvVLDLKLYR  294
             GFWPLTVY PV MYI+QK+IPKWST W+CLQ LSGACL +++AAAAGS AGV+ DLK+Y+
Sbjct  419   GFWPLTVYXPVEMYIAQKRIPKWSTXWLCLQTLSGACLIITIAAAAGSIAGVISDLKIYK  478

Query  293   PFKTSY  276
             PFKTSY
Sbjct  479   PFKTSY  484



>ref|XP_010428816.1| PREDICTED: amino acid permease 3 [Camelina sativa]
Length=477

 Score =   719 bits (1857),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 358/470 (76%), Positives = 412/470 (88%), Gaps = 2/470 (0%)
 Frame = -3

Query  1682  VSIDAPPLYG-FKGLDDDGRPQRTGTVWTASAHIITAVIGSGVLSLAWAIGQLGWVAGPS  1506
             ++ID P   G  K  DDDG+ +RTG+VWTASAHIITAVIGSGVLSLAWA  QLGW+AGP 
Sbjct  9     LAIDMPQQTGGSKCFDDDGKVKRTGSVWTASAHIITAVIGSGVLSLAWATAQLGWIAGPV  68

Query  1505  VMLLFSCVVYYTSTLLADCYRAGDPVFGKRNYTYMDAVRSNLGGYQVKICGLIQYFNLFG  1326
             VMLLFS V Y+TS+LLA CYR+GDP+ GKRNYTYM AVRSNLGG +V +CG++QY N+FG
Sbjct  69    VMLLFSVVTYFTSSLLASCYRSGDPISGKRNYTYMGAVRSNLGGVKVTLCGIVQYLNIFG  128

Query  1325  IAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFGIIEIILSQIPDFDQIWW  1146
             +AIGYTIA++ISMMAIKRSNCFH+SGGK+PC M+S PYMIAFG+++I+ SQIPDFDQ+WW
Sbjct  129   VAIGYTIASAISMMAIKRSNCFHKSGGKDPCQMNSTPYMIAFGLVQILFSQIPDFDQLWW  188

Query  1145  LSIVAAVMSFTYSGIGLGLGIAQVVANGAFKGSLTGISIGTVTETQKIWRSFQALGDIAF  966
             LSI+AAVMSFTYS  GL LGIAQVV NG  KGSLTGISIGTVTETQKIWR+FQALG+IAF
Sbjct  189   LSILAAVMSFTYSSAGLALGIAQVVVNGKVKGSLTGISIGTVTETQKIWRTFQALGNIAF  248

Query  965   AYSYSIILIEIQDTVKSPPSESKTMRKASLFSTIVTTTFYMLCGCMGYAAFGDDAPGNLL  786
             AYSYSIILIEIQDTVKSPPSE KTM+KA+L S  VTT FYMLCGCMGYAAFGD +PGNLL
Sbjct  249   AYSYSIILIEIQDTVKSPPSEEKTMKKATLVSVGVTTIFYMLCGCMGYAAFGDLSPGNLL  308

Query  785   TGFGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEKWVGAKWPDSEIITKEINLKI  606
             TGFGFYNP+WLLDIANAAIVIHL+GAYQVYCQPLFAFIEK    ++PD E I K+I + I
Sbjct  309   TGFGFYNPYWLLDIANAAIVIHLIGAYQVYCQPLFAFIEKQASIRFPDCEFIAKDIKIPI  368

Query  605   PGFGYPYKLNTFRLLWRTAFVLLTTVISMLLPFFNDVVGILGAFGFWPLTVYFPVRMYIS  426
             PGF  P +LN FRL+WRT FV++TTVISMLLPFFNDVVG+LG+ GFWPLTVYFPV MYI+
Sbjct  369   PGFK-PLRLNLFRLIWRTVFVIITTVISMLLPFFNDVVGLLGSLGFWPLTVYFPVEMYIA  427

Query  425   QKKIPKWSTRWICLQMlsgaclavslaaaagsfagvVLDLKLYRPFKTSY  276
             QKKIP+WSTRW+C Q+ S  CL VS+AAAAGS AG+VLDLK Y+PF+++Y
Sbjct  428   QKKIPRWSTRWVCFQVFSLGCLVVSIAAAAGSIAGIVLDLKSYKPFQSNY  477



>ref|XP_010063420.1| PREDICTED: amino acid permease 3-like [Eucalyptus grandis]
 gb|KCW70648.1| hypothetical protein EUGRSUZ_F03820 [Eucalyptus grandis]
Length=480

 Score =   719 bits (1856),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 366/485 (75%), Positives = 418/485 (86%), Gaps = 8/485 (2%)
 Frame = -3

Query  1730  MGESAAATKNHRHH--LGVSIDAPPLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSGV  1557
             MG ++A    H ++    VSI+ PP  G K  DDDGR +RTGTVWTAS+HIITAVIGSGV
Sbjct  1     MGVNSAVKNQHPNNQVFDVSINIPPQGGSKCFDDDGRLKRTGTVWTASSHIITAVIGSGV  60

Query  1556  LSLAWAIGQLGWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRNYTYMDAVRSNLG  1377
             LSLAWA  QLGW+AGP+VMLLF+ V YYTSTLLA CYR+GD   GKRNYTYMDAV +NLG
Sbjct  61    LSLAWATAQLGWIAGPAVMLLFALVTYYTSTLLAACYRSGD---GKRNYTYMDAVSANLG  117

Query  1376  GYQVKICGLIQYFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFG  1197
             G++VK+CGL+QY NLFG+AIGYTIA+SISMMAI RSNCFH++G K+PCH +S PYMIAFG
Sbjct  118   GFKVKLCGLVQYVNLFGVAIGYTIASSISMMAISRSNCFHKNGEKSPCHFNSTPYMIAFG  177

Query  1196  IIEIILSQIPDFDQIWWLSIVAAVMSFTYSGIGLGLGIAQVVANGAFKGSLTGISIGTVT  1017
             IIEII SQIPDFDQ+WWLSIVAAVMSFTYS IGLGLGIA+V   G F GSLTGISIGTVT
Sbjct  178   IIEIIFSQIPDFDQLWWLSIVAAVMSFTYSTIGLGLGIARVAETGNFMGSLTGISIGTVT  237

Query  1016  ETQKIWRSFQALGDIAFAYSYSIILIEIQDTVKSPPSESKTMRKASLFSTIVTTTFYMLC  837
              TQK+WRSFQALGDIAFAYSYS+ILIEIQDT++SPPSESKTM+KASL S  VTT FYMLC
Sbjct  238   STQKLWRSFQALGDIAFAYSYSLILIEIQDTIRSPPSESKTMKKASLVSIAVTTLFYMLC  297

Query  836   GCMGYAAFGDDAPGNLLTGFGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEKWVG  657
             GCMGYAAFGD APGNLLTGFGFYNP+W++DIANAAIVIHL+GAYQVYCQPLFAF+EK   
Sbjct  298   GCMGYAAFGDMAPGNLLTGFGFYNPYWMVDIANAAIVIHLIGAYQVYCQPLFAFVEKAAN  357

Query  656   AKWPDSEIITKEINLKIPGFGY-PYKLNTFRLLWRTAFVLLTTVISMLLPFFNDVVGILG  480
              K+P+S+ IT++I  +IP  G   YKLN FRL+WRT FV+ TTVISMLLPFFND+VG+LG
Sbjct  358   KKFPNSQFITRDI--EIPTLGLRTYKLNLFRLVWRTVFVITTTVISMLLPFFNDIVGLLG  415

Query  479   AFGFWPLTVYFPVRMYISQKKIPKWSTRWICLQMlsgaclavslaaaagsfagvVLDLKL  300
             A GFWPLTVYFPV MYI QK+IPKWST+W+CLQ+LS ACL +++AAAAGS AGVVLDLK 
Sbjct  416   ALGFWPLTVYFPVEMYIKQKQIPKWSTKWVCLQILSMACLIITIAAAAGSVAGVVLDLKS  475

Query  299   YRPFK  285
             Y+PF 
Sbjct  476   YKPFN  480



>gb|EYU23867.1| hypothetical protein MIMGU_mgv1a005496mg [Erythranthe guttata]
Length=481

 Score =   719 bits (1856),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 368/468 (79%), Positives = 408/468 (87%), Gaps = 1/468 (0%)
 Frame = -3

Query  1682  VSIDAPPLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSGVLSLAWAIGQLGWVAGPSV  1503
             VSI+ PP    K  DDDGR +RTG+VWTASAHIITAVIGSGVLSLAWA  QLGW+AGP+V
Sbjct  15    VSINVPPQLPSKCFDDDGRLKRTGSVWTASAHIITAVIGSGVLSLAWATAQLGWIAGPTV  74

Query  1502  MLLFSCVVYYTSTLLADCYRAGDPVFGKRNYTYMDAVRSNLGGYQVKICGLIQYFNLFGI  1323
             M LFS V YYTSTLLA CYR+GDP  GKRNYTYMDAVRSNLGG+QVK+CG IQY NLFG+
Sbjct  75    MFLFSFVTYYTSTLLAACYRSGDPDSGKRNYTYMDAVRSNLGGFQVKLCGAIQYLNLFGV  134

Query  1322  AIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFGIIEIILSQIPDFDQIWWL  1143
             AIGYTIA+SISMMAI RSNCFH  G ++PC +SSNPYMIAFG++EI+ SQIPDFDQI WL
Sbjct  135   AIGYTIASSISMMAIDRSNCFHSKGHESPCRVSSNPYMIAFGVVEIVFSQIPDFDQISWL  194

Query  1142  SIVAAVMSFTYSGIGLGLGIAQVVANGAFKGSLTGISIGTVTETQKIWRSFQALGDIAFA  963
             SIVAAVMSFTYS IGLGLGIA+V  NG  KGSLTGISIGTVTETQKIWRSFQALG IAFA
Sbjct  195   SIVAAVMSFTYSTIGLGLGIAKVAENGKIKGSLTGISIGTVTETQKIWRSFQALGAIAFA  254

Query  962   YSYSIILIEIQDTVKSPPSESKTMRKASLFSTIVTTTFYMLCGCMGYAAFGDDAPGNLLT  783
             YSYS+ILIEIQDT+KSPPSE KTM+KA+L S +VTT FYM CGC GYAAFGD +PGNLLT
Sbjct  255   YSYSLILIEIQDTIKSPPSEYKTMKKATLLSVVVTTAFYMSCGCFGYAAFGDSSPGNLLT  314

Query  782   GFGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEKWVGAKWPDSEIITKEINLKIP  603
             GFGFYNP+WLLDIANAAIVIHL+GAYQVYCQPLFAF+EK     +P SE ITKEI + IP
Sbjct  315   GFGFYNPYWLLDIANAAIVIHLIGAYQVYCQPLFAFVEKTAREWFPHSEFITKEIAIPIP  374

Query  602   GFGYPYKLNTFRLLWRTAFVLLTTVISMLLPFFNDVVGILGAFGFWPLTVYFPVRMYISQ  423
             G     KLN FRL+WRT FV++TT+ISML+PFFNDVVGILGAFGFWPLTVYFPV MYI Q
Sbjct  375   GLK-SLKLNLFRLVWRTVFVIITTIISMLMPFFNDVVGILGAFGFWPLTVYFPVEMYIKQ  433

Query  422   KKIPKWSTRWICLQMlsgaclavslaaaagsfagvVLDLKLYRPFKTS  279
             K+IPKWS RW+ LQ+LSGACL +S+AAAAGSFAGVV DLK+YRPFKT+
Sbjct  434   KRIPKWSPRWLSLQILSGACLMISIAAAAGSFAGVVSDLKVYRPFKTT  481



>ref|XP_006386355.1| amino acid permease which transports basic amino acids family 
protein [Populus trichocarpa]
 gb|ERP64152.1| amino acid permease which transports basic amino acids family 
protein [Populus trichocarpa]
Length=480

 Score =   719 bits (1855),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 363/477 (76%), Positives = 416/477 (87%), Gaps = 2/477 (0%)
 Frame = -3

Query  1706  KNHRHHLGVSIDAPPLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSGVLSLAWAIGQL  1527
             +NH+    +SID     G K  DDDGR +RTGTVWTASAHIITAVIGSGVLSLAWAIGQL
Sbjct  6     RNHQV-FDISIDTHQQGGSKWFDDDGRLKRTGTVWTASAHIITAVIGSGVLSLAWAIGQL  64

Query  1526  GWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRNYTYMDAVRSNLGGYQVKICGLI  1347
             GW+AGP+VM LFS V  YTSTLL+ CYR+GDP+ GKRNYTYMDAVRSNLGG +VKICG +
Sbjct  65    GWIAGPAVMFLFSFVTCYTSTLLSACYRSGDPITGKRNYTYMDAVRSNLGGVKVKICGFV  124

Query  1346  QYFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFGIIEIILSQIP  1167
             QY NLFG+AIGYTIA+SISMMAIKRSNCFH+SGG++PCHM++ PYMI FGI EI+LSQIP
Sbjct  125   QYLNLFGVAIGYTIASSISMMAIKRSNCFHKSGGQDPCHMNAYPYMIGFGIAEILLSQIP  184

Query  1166  DFDQIWWLSIVAAVMSFTYSGIGLGLGIAQVVANGAFKGSLTGISIGTVTETQKIWRSFQ  987
              FDQ+ WLS+VAAVMSFTYS IGLGLGI +V+ NG   GSLTGISIGTVT+TQKIW+SFQ
Sbjct  185   GFDQLHWLSLVAAVMSFTYSSIGLGLGIGKVIENGKISGSLTGISIGTVTQTQKIWKSFQ  244

Query  986   ALGDIAFAYSYSIILIEIQDTVKSPPSESKTMRKASLFSTIVTTTFYMLCGCMGYAAFGD  807
             ALGDIAFAYS+S+IL+EIQDT+K+PPSE+KTM+KA+L S +VTT FYM CGC GYAAFGD
Sbjct  245   ALGDIAFAYSFSMILVEIQDTIKAPPSEAKTMKKATLISVVVTTFFYMFCGCFGYAAFGD  304

Query  806   DAPGNLLTGFGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEKWVGAKWPDSEIIT  627
              +PGNLLTGFGFYNP+WLLDIANAAIVIHLVGAYQVYCQPL+AFIEK    ++PDSE IT
Sbjct  305   LSPGNLLTGFGFYNPYWLLDIANAAIVIHLVGAYQVYCQPLYAFIEKEAAQRFPDSEFIT  364

Query  626   KEINLKIPGFGYPYKLNTFRLLWRTAFVLLTTVISMLLPFFNDVVGILGAFGFWPLTVYF  447
             K+I + IPGF  PY LN FR++WRT FV+LTTVISMLLPFFND+VG+LGA GFWPLTVYF
Sbjct  365   KDIKIPIPGF-RPYNLNLFRMIWRTLFVVLTTVISMLLPFFNDIVGLLGALGFWPLTVYF  423

Query  446   PVRMYISQKKIPKWSTRWICLQMlsgaclavslaaaagsfagvVLDLKLYRPFKTSY  276
             PV MYI QKKI KWSTRW+CLQ+LS ACL +S+AAAAGS AG+V DLK  +PF+TSY
Sbjct  424   PVEMYIVQKKIRKWSTRWLCLQILSVACLIISIAAAAGSVAGIVGDLKSIKPFQTSY  480



>ref|XP_009390075.1| PREDICTED: amino acid permease 4-like isoform X2 [Musa acuminata 
subsp. malaccensis]
Length=495

 Score =   719 bits (1856),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 366/500 (73%), Positives = 416/500 (83%), Gaps = 17/500 (3%)
 Frame = -3

Query  1739  IMQMGESAAATKNHRHH-------LGVSIDAPPLY----GFKGLDDDGRPQRTGTVWTAS  1593
             + QMGE    T N +H+       + VSI+    +     F+  DDDGR +RTGTVWTAS
Sbjct  1     MQQMGE----TGNAKHYQQPAVVPMNVSIELGHAHRLEKAFECYDDDGRLKRTGTVWTAS  56

Query  1592  AHIITAVIGSGVLSLAWAIGQLGWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRN  1413
             AHI+TAVIGSGVLSLAWAI QLGWVAGP VMLLFS V YYTSTLLADCYR+GDP+ GKRN
Sbjct  57    AHIVTAVIGSGVLSLAWAIAQLGWVAGPVVMLLFSFVTYYTSTLLADCYRSGDPISGKRN  116

Query  1412  YTYMDAVRSNLGGYQVKICGLIQYFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPC  1233
             Y Y DAV S LGG +VK+CG IQY NLFG+A+GYTIAASISMMAI+RSNCFHE G  NPC
Sbjct  117   YKYTDAVHSYLGGLKVKLCGFIQYANLFGVAVGYTIAASISMMAIRRSNCFHERGHDNPC  176

Query  1232  HMSSNPYMIAFGIIEIILSQIPDFDQIWWLSIVAAVMSFTYSGIGLGLGIAQVVANGAFK  1053
             H SSNPYMI FG+ EI LSQIPDFDQIWWLSIVAAVMSFTYS IGL LGI QV+ N  FK
Sbjct  177   HTSSNPYMIMFGVAEIFLSQIPDFDQIWWLSIVAAVMSFTYSSIGLALGIVQVIGNKGFK  236

Query  1052  GSLTGISIGTVTETQKIWRSFQALGDIAFAYSYSIILIEIQDTVKS-PPSESKTMRKASL  876
             GSLTGISIG V+ TQK+WRS QA GDIAFAYS+S+ILIEIQDT+K+ PPSE+K M+KASL
Sbjct  237   GSLTGISIGVVSPTQKVWRSLQAFGDIAFAYSFSLILIEIQDTIKAPPPSEAKVMKKASL  296

Query  875   FSTIVTTTFYMLCGCMGYAAFGDDAPGNLLTGFGFYNPFWLLDIANAAIVIHLVGAYQVY  696
              S  VTT FYMLCGCMGYAAFGD+APGNLLTGFGFYNP+WLLD+ANAAIV+HLVGAYQV+
Sbjct  297   TSIAVTTIFYMLCGCMGYAAFGDEAPGNLLTGFGFYNPYWLLDVANAAIVVHLVGAYQVF  356

Query  695   CQPLFAFIEKWVGAKWPDSEIITKEINLKIPGFGYPYKLNTFRLLWRTAFVLLTTVISML  516
             CQPLFAFIEKW    WPDS  ITKE+ + +P     Y+L+ FRL+WR+AFV+LTTVISML
Sbjct  357   CQPLFAFIEKWALTTWPDSAFITKEVAVPLPSTKR-YRLSLFRLVWRSAFVVLTTVISML  415

Query  515   LPFFNDVVGILGAFGFWPLTVYFPVRMYISQKKIPKWSTRWICLQMlsgaclavslaaaa  336
             LPFFNDVVG+LGA GFWPLTVYFPV MYI+QK+IP+WSTRW+CLQ+LS ACL +++AAA 
Sbjct  416   LPFFNDVVGLLGALGFWPLTVYFPVEMYIAQKRIPRWSTRWVCLQILSLACLVITVAAAI  475

Query  335   gsfagvVLDLKLYRPFKTSY  276
             GS AGVV DL+ YRPFK+SY
Sbjct  476   GSVAGVVTDLEAYRPFKSSY  495



>ref|XP_003527948.1| PREDICTED: amino acid permease 3 [Glycine max]
 gb|KHN46995.1| Amino acid permease 3 [Glycine soja]
Length=487

 Score =   719 bits (1855),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 355/485 (73%), Positives = 416/485 (86%), Gaps = 3/485 (1%)
 Frame = -3

Query  1724  ESAAATKNHRHHLGVSIDAPPLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSGVLSLA  1545
             +    +K  +  L VSID       K  DDDGRP+RTGTVWT+SAHIITAVIGSGVLSLA
Sbjct  4     KDGVGSKYLQQTLNVSIDMHQHGISKCFDDDGRPKRTGTVWTSSAHIITAVIGSGVLSLA  63

Query  1544  WAIGQLGWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRNYTYMDAVRSNLGG--Y  1371
             WAI QLGW+AGP VM++FS + YYTSTLLADCYR GDPV GKRNYTYMDA++SN GG  +
Sbjct  64    WAIAQLGWIAGPIVMVIFSAITYYTSTLLADCYRTGDPVTGKRNYTYMDAIQSNFGGNGF  123

Query  1370  QVKICGLIQYFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFGII  1191
             +VK+CGL+QY NLFG+AIGYTIAAS SMMAI+RSNCFH+SGGK+PCH++SN YMI+FGI+
Sbjct  124   KVKLCGLVQYVNLFGVAIGYTIAASTSMMAIERSNCFHKSGGKDPCHINSNMYMISFGIV  183

Query  1190  EIILSQIPDFDQIWWLSIVAAVMSFTYSGIGLGLGIAQVVANGAFKGSLTGISIGTVTET  1011
             EI+ SQIP FDQ+WWLSIVAAVMSFTYS IGLGLGI +V+ NG   GSLTGI+IGTVT+T
Sbjct  184   EILFSQIPGFDQLWWLSIVAAVMSFTYSTIGLGLGIGKVIENGGVGGSLTGITIGTVTQT  243

Query  1010  QKIWRSFQALGDIAFAYSYSIILIEIQDTVKSPPSESKTMRKASLFSTIVTTTFYMLCGC  831
              K+WR+ QALGDIAFAYSYS+ILIEIQDTVKSPPSESKTM+KAS  S  VT+ FYMLCGC
Sbjct  244   DKVWRTMQALGDIAFAYSYSLILIEIQDTVKSPPSESKTMKKASFISVAVTSIFYMLCGC  303

Query  830   MGYAAFGDDAPGNLLTGFGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEKWVGAK  651
              GYAAFGD +PGNLLTGFGFYNP+WLLDIANAAIVIHLVG+YQVYCQPLFAF+EK     
Sbjct  304   FGYAAFGDASPGNLLTGFGFYNPYWLLDIANAAIVIHLVGSYQVYCQPLFAFVEKHAAQM  363

Query  650   WPDSEIITKEINLKIPGFGYPYKLNTFRLLWRTAFVLLTTVISMLLPFFNDVVGILGAFG  471
             +PDS+ + KEI + IPGF +PY+LN FRL+WRT +V+L+TVISMLLPFFND+ G+LGAFG
Sbjct  364   FPDSDFLNKEIEIPIPGF-HPYRLNLFRLVWRTIYVMLSTVISMLLPFFNDIGGLLGAFG  422

Query  470   FWPLTVYFPVRMYISQKKIPKWSTRWICLQMlsgaclavslaaaagsfagvVLDLKLYRP  291
             FWPLTVYFPV MYI QK+IPKWST+WICLQ+LS  CL +++ AAAGS AG+ +DL+ Y+P
Sbjct  423   FWPLTVYFPVEMYIIQKRIPKWSTKWICLQILSMTCLLMTIGAAAGSIAGIAIDLRTYKP  482

Query  290   FKTSY  276
             FKT+Y
Sbjct  483   FKTNY  487



>ref|XP_011102302.1| PREDICTED: amino acid permease 3 isoform X2 [Sesamum indicum]
Length=486

 Score =   718 bits (1853),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 368/487 (76%), Positives = 415/487 (85%), Gaps = 1/487 (0%)
 Frame = -3

Query  1736  MQMGESAAATKNHRHHLGVSIDAPPLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSGV  1557
             M M ES  + +       VSI+ P   G K  DDDGR +RTGTVWTASAHIITAVIGSGV
Sbjct  1     MTMSESTGSRQYQHQVFDVSINVPNQGGSKCYDDDGRLKRTGTVWTASAHIITAVIGSGV  60

Query  1556  LSLAWAIGQLGWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRNYTYMDAVRSNLG  1377
             LSLAWA+ QLGW+AGP+VM LFS V YYTS LL+ CYR+GDP  GKRNYTYMDAVR+NLG
Sbjct  61    LSLAWAVAQLGWIAGPTVMFLFSFVTYYTSALLSTCYRSGDPDTGKRNYTYMDAVRANLG  120

Query  1376  GYQVKICGLIQYFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFG  1197
             G++VK+CG IQY NLFG+AIGYTIA+SISMMAI+RSNCFH  G  +PC +SSNPYMIAFG
Sbjct  121   GFKVKLCGAIQYVNLFGVAIGYTIASSISMMAIERSNCFHSKGDSSPCRVSSNPYMIAFG  180

Query  1196  IIEIILSQIPDFDQIWWLSIVAAVMSFTYSGIGLGLGIAQVVANGAFKGSLTGISIGTVT  1017
             +IEII SQIPDFDQIWWLSIVAA+MSFTYS IGLGLG+A+V  NG  +GSLTGISIGTVT
Sbjct  181   VIEIIFSQIPDFDQIWWLSIVAAIMSFTYSTIGLGLGVAKVAENGKIRGSLTGISIGTVT  240

Query  1016  ETQKIWRSFQALGDIAFAYSYSIILIEIQDTVKSPPSESKTMRKASLFSTIVTTTFYMLC  837
             ETQKIWRSFQALG IAFAYSYS+ILIEIQDT+KSPPSE KTM+KA+L S  VTT FYMLC
Sbjct  241   ETQKIWRSFQALGAIAFAYSYSLILIEIQDTIKSPPSEYKTMKKATLLSVAVTTVFYMLC  300

Query  836   GCMGYAAFGDDAPGNLLTGFGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEKWVG  657
             GC GYAAFGD +PGNLLTGFGFYNP+WLLDIAN AIV+HL+GAYQVYCQPLFAFIEK   
Sbjct  301   GCFGYAAFGDLSPGNLLTGFGFYNPYWLLDIANVAIVVHLIGAYQVYCQPLFAFIEKTAL  360

Query  656   AKWPDSEIITKEINLKIPGFGYPYKLNTFRLLWRTAFVLLTTVISMLLPFFNDVVGILGA  477
               +PDS+ IT EI + IPG   PYKLN FRL+WRT FV++TT+ISML+PFFNDVVGILGA
Sbjct  361   EWYPDSKFITAEITIPIPGIK-PYKLNLFRLIWRTIFVIITTIISMLMPFFNDVVGILGA  419

Query  476   FGFWPLTVYFPVRMYISQKKIPKWSTRWICLQMlsgaclavslaaaagsfagvVLDLKLY  297
              GFWPLTVYFPV MYI+QK+IPKWS RW+CLQ+LS ACL +S+AA  GSFAGVV DLK+Y
Sbjct  420   LGFWPLTVYFPVEMYIAQKRIPKWSARWMCLQILSMACLVISVAALVGSFAGVVSDLKVY  479

Query  296   RPFKTSY  276
             +PFKTSY
Sbjct  480   KPFKTSY  486



>gb|KDP32820.1| hypothetical protein JCGZ_12112 [Jatropha curcas]
Length=487

 Score =   717 bits (1850),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 360/481 (75%), Positives = 415/481 (86%), Gaps = 5/481 (1%)
 Frame = -3

Query  1706  KNHRHH----LGVSIDAPPLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSGVLSLAWA  1539
             ++H HH    + +++      G K LDDDGR +RTGTVWTASAHIITAVIGSGVLSLAWA
Sbjct  8     RSHSHHQVFDVSINMHTQMSNGSKLLDDDGRLKRTGTVWTASAHIITAVIGSGVLSLAWA  67

Query  1538  IGQLGWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRNYTYMDAVRSNLGGYQVKI  1359
             I QLGW+AGP+VM LFS V YYTSTLL+ CYR+GD V GKRNYTYMD +RSNLGG +VKI
Sbjct  68    IAQLGWIAGPAVMFLFSFVTYYTSTLLSACYRSGDSVTGKRNYTYMDVIRSNLGGAKVKI  127

Query  1358  CGLIQYFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFGIIEIIL  1179
             CG++QY NLFG+AIGYTIA+SISMMA+KRSNCFH+SGGKNPC M++NPYMIAFGI EII 
Sbjct  128   CGIVQYLNLFGVAIGYTIASSISMMAVKRSNCFHKSGGKNPCKMNANPYMIAFGIAEIIF  187

Query  1178  SQIPDFDQIWWLSIVAAVMSFTYSGIGLGLGIAQVVANGAFKGSLTGISIGTVTETQKIW  999
             SQIPDFDQ+WWLSI+AAVMSFTYS IGLGLGIA+V  +G   GSLTGIS+  VT TQKIW
Sbjct  188   SQIPDFDQLWWLSILAAVMSFTYSTIGLGLGIAKVAESGKIMGSLTGISLNNVTPTQKIW  247

Query  998   RSFQALGDIAFAYSYSIILIEIQDTVKSPPSESKTMRKASLFSTIVTTTFYMLCGCMGYA  819
             RSFQALGDIAFAYSYS+ILIEIQDTVKSPPSE+KTM+KA+L S  VTT FYMLCGC GYA
Sbjct  248   RSFQALGDIAFAYSYSMILIEIQDTVKSPPSEAKTMKKATLISVAVTTFFYMLCGCFGYA  307

Query  818   AFGDDAPGNLLTGFGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEKWVGAKWPDS  639
             AFGD +PGNLLTGFGFYNP+WLLDIAN AIV+HLVGAYQVYCQPLF+FIEK    K+PDS
Sbjct  308   AFGDMSPGNLLTGFGFYNPYWLLDIANVAIVVHLVGAYQVYCQPLFSFIEKTAAQKYPDS  367

Query  638   EIITKEINLKIPGFGYPYKLNTFRLLWRTAFVLLTTVISMLLPFFNDVVGILGAFGFWPL  459
             + IT++I + IP  G  + LN FR+++RT FV+ TTVISMLLPFFND+VG+LGA GFWPL
Sbjct  368   DFITRDIKIPIPCLG-TFNLNLFRMVFRTVFVIFTTVISMLLPFFNDIVGLLGALGFWPL  426

Query  458   TVYFPVRMYISQKKIPKWSTRWICLQMlsgaclavslaaaagsfagvVLDLKLYRPFKTS  279
             TVYFPV MYI+QKKIPKWSTRW+CLQ+LSGACL +++AAAAGS AGV+ DLK  +PF+TS
Sbjct  427   TVYFPVEMYIAQKKIPKWSTRWLCLQILSGACLIITIAAAAGSIAGVITDLKTVKPFQTS  486

Query  278   Y  276
             Y
Sbjct  487   Y  487



>ref|XP_009390074.1| PREDICTED: amino acid permease 4-like isoform X1 [Musa acuminata 
subsp. malaccensis]
Length=509

 Score =   717 bits (1852),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 363/496 (73%), Positives = 412/496 (83%), Gaps = 13/496 (3%)
 Frame = -3

Query  1727  GESAAATKNHRHH-------LGVSIDAPPLY----GFKGLDDDGRPQRTGTVWTASAHII  1581
             G     T N +H+       + VSI+    +     F+  DDDGR +RTGTVWTASAHI+
Sbjct  15    GHKMGETGNAKHYQQPAVVPMNVSIELGHAHRLEKAFECYDDDGRLKRTGTVWTASAHIV  74

Query  1580  TAVIGSGVLSLAWAIGQLGWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRNYTYM  1401
             TAVIGSGVLSLAWAI QLGWVAGP VMLLFS V YYTSTLLADCYR+GDP+ GKRNY Y 
Sbjct  75    TAVIGSGVLSLAWAIAQLGWVAGPVVMLLFSFVTYYTSTLLADCYRSGDPISGKRNYKYT  134

Query  1400  DAVRSNLGGYQVKICGLIQYFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSS  1221
             DAV S LGG +VK+CG IQY NLFG+A+GYTIAASISMMAI+RSNCFHE G  NPCH SS
Sbjct  135   DAVHSYLGGLKVKLCGFIQYANLFGVAVGYTIAASISMMAIRRSNCFHERGHDNPCHTSS  194

Query  1220  NPYMIAFGIIEIILSQIPDFDQIWWLSIVAAVMSFTYSGIGLGLGIAQVVANGAFKGSLT  1041
             NPYMI FG+ EI LSQIPDFDQIWWLSIVAAVMSFTYS IGL LGI QV+ N  FKGSLT
Sbjct  195   NPYMIMFGVAEIFLSQIPDFDQIWWLSIVAAVMSFTYSSIGLALGIVQVIGNKGFKGSLT  254

Query  1040  GISIGTVTETQKIWRSFQALGDIAFAYSYSIILIEIQDTVKS-PPSESKTMRKASLFSTI  864
             GISIG V+ TQK+WRS QA GDIAFAYS+S+ILIEIQDT+K+ PPSE+K M+KASL S  
Sbjct  255   GISIGVVSPTQKVWRSLQAFGDIAFAYSFSLILIEIQDTIKAPPPSEAKVMKKASLTSIA  314

Query  863   VTTTFYMLCGCMGYAAFGDDAPGNLLTGFGFYNPFWLLDIANAAIVIHLVGAYQVYCQPL  684
             VTT FYMLCGCMGYAAFGD+APGNLLTGFGFYNP+WLLD+ANAAIV+HLVGAYQV+CQPL
Sbjct  315   VTTIFYMLCGCMGYAAFGDEAPGNLLTGFGFYNPYWLLDVANAAIVVHLVGAYQVFCQPL  374

Query  683   FAFIEKWVGAKWPDSEIITKEINLKIPGFGYPYKLNTFRLLWRTAFVLLTTVISMLLPFF  504
             FAFIEKW    WPDS  ITKE+ + +P     Y+L+ FRL+WR+AFV+LTTVISMLLPFF
Sbjct  375   FAFIEKWALTTWPDSAFITKEVAVPLPSTKR-YRLSLFRLVWRSAFVVLTTVISMLLPFF  433

Query  503   NDVVGILGAFGFWPLTVYFPVRMYISQKKIPKWSTRWICLQMlsgaclavslaaaagsfa  324
             NDVVG+LGA GFWPLTVYFPV MYI+QK+IP+WSTRW+CLQ+LS ACL +++AAA GS A
Sbjct  434   NDVVGLLGALGFWPLTVYFPVEMYIAQKRIPRWSTRWVCLQILSLACLVITVAAAIGSVA  493

Query  323   gvVLDLKLYRPFKTSY  276
             GVV DL+ YRPFK+SY
Sbjct  494   GVVTDLEAYRPFKSSY  509



>gb|KDP32819.1| hypothetical protein JCGZ_12111 [Jatropha curcas]
Length=482

 Score =   716 bits (1849),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 357/471 (76%), Positives = 409/471 (87%), Gaps = 0/471 (0%)
 Frame = -3

Query  1688  LGVSIDAPPLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSGVLSLAWAIGQLGWVAGP  1509
               VS+D P   G K  DDDGR +RTG+VWTASAHIITAVIGSGVLSLAWA+ QLGW+AGP
Sbjct  12    FNVSVDMPNQAGSKWYDDDGRLKRTGSVWTASAHIITAVIGSGVLSLAWAVAQLGWIAGP  71

Query  1508  SVMLLFSCVVYYTSTLLADCYRAGDPVFGKRNYTYMDAVRSNLGGYQVKICGLIQYFNLF  1329
             +VM LFS V YYTSTLL+ CYR GD V GKRNYTYMDAVRSNLGG +VKICG +QY NL 
Sbjct  72    AVMFLFSIVTYYTSTLLSACYRTGDSVNGKRNYTYMDAVRSNLGGAKVKICGYVQYLNLL  131

Query  1328  GIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFGIIEIILSQIPDFDQIW  1149
             G+AIGYTIA+SISMMA+KRSNCFH++GGK+PCHM++NPYMIAFGI EII SQI DF+++W
Sbjct  132   GVAIGYTIASSISMMAVKRSNCFHKTGGKDPCHMNANPYMIAFGIAEIIFSQIQDFEKLW  191

Query  1148  WLSIVAAVMSFTYSGIGLGLGIAQVVANGAFKGSLTGISIGTVTETQKIWRSFQALGDIA  969
             WLSI+AAVMSFTYS IGLGLGIA+V  +G  +GS TGI+IGTVTETQKIWRSFQALGDIA
Sbjct  192   WLSILAAVMSFTYSTIGLGLGIAKVAESGKIRGSFTGITIGTVTETQKIWRSFQALGDIA  251

Query  968   FAYSYSIILIEIQDTVKSPPSESKTMRKASLFSTIVTTTFYMLCGCMGYAAFGDDAPGNL  789
             FAYSYSIILIEIQDT+KSPPSE+KTM+KA+L S  VTT FYMLCGC GYAAFGD +PGNL
Sbjct  252   FAYSYSIILIEIQDTIKSPPSEAKTMKKATLISVAVTTFFYMLCGCFGYAAFGDMSPGNL  311

Query  788   LTGFGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEKWVGAKWPDSEIITKEINLK  609
             LTGFGFYNP+WL DIAN AIV+HLVGAYQVYCQPLFAFIEK    ++PDS+ ITKEI + 
Sbjct  312   LTGFGFYNPYWLPDIANVAIVVHLVGAYQVYCQPLFAFIEKTAAQRYPDSDFITKEIKIP  371

Query  608   IPGFGYPYKLNTFRLLWRTAFVLLTTVISMLLPFFNDVVGILGAFGFWPLTVYFPVRMYI  429
             IPG    Y LN FRL++RT FV+ TTVISMLLPFFND+VG+LGA GFWPLTVYFPV MYI
Sbjct  372   IPGLKSSYNLNLFRLVFRTVFVIFTTVISMLLPFFNDIVGLLGALGFWPLTVYFPVEMYI  431

Query  428   SQKKIPKWSTRWICLQMlsgaclavslaaaagsfagvVLDLKLYRPFKTSY  276
             +QKKIPKWSTRW+CLQ+LS ACL +++AAAAGS AGV+ DLK  +PF+++Y
Sbjct  432   AQKKIPKWSTRWLCLQILSAACLIITIAAAAGSIAGVITDLKTVKPFQSTY  482



>ref|XP_010471931.1| PREDICTED: amino acid permease 3-like [Camelina sativa]
Length=477

 Score =   716 bits (1849),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 356/460 (77%), Positives = 406/460 (88%), Gaps = 1/460 (0%)
 Frame = -3

Query  1655  GFKGLDDDGRPQRTGTVWTASAHIITAVIGSGVLSLAWAIGQLGWVAGPSVMLLFSCVVY  1476
             G K  DDDG+ +RTG+VWTASAHIITAVIGSGVLSLAWA  QLGW+AGP VMLLFS V Y
Sbjct  19    GSKCFDDDGKVKRTGSVWTASAHIITAVIGSGVLSLAWATAQLGWIAGPVVMLLFSVVTY  78

Query  1475  YTSTLLADCYRAGDPVFGKRNYTYMDAVRSNLGGYQVKICGLIQYFNLFGIAIGYTIAAS  1296
             +TS+LLA CYR+GDP+ GKRNYTYM AVRSNLGG +V +CG++QY N+FG+AIGYTIA++
Sbjct  79    FTSSLLASCYRSGDPISGKRNYTYMGAVRSNLGGVKVTLCGIVQYLNIFGVAIGYTIASA  138

Query  1295  ISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFGIIEIILSQIPDFDQIWWLSIVAAVMSF  1116
             ISMMAIKRSNCFH+SGGK+PC M+S PYMIAFG+++I+ SQIPDFDQ+WWLSI+AAVMSF
Sbjct  139   ISMMAIKRSNCFHKSGGKDPCQMNSTPYMIAFGLVQILFSQIPDFDQLWWLSILAAVMSF  198

Query  1115  TYSGIGLGLGIAQVVANGAFKGSLTGISIGTVTETQKIWRSFQALGDIAFAYSYSIILIE  936
             TYS  GL LGIAQVV NG  KGSLTGISIG VTETQKIWRSFQALG+IAFAYSYSIILIE
Sbjct  199   TYSSAGLALGIAQVVVNGKVKGSLTGISIGAVTETQKIWRSFQALGNIAFAYSYSIILIE  258

Query  935   IQDTVKSPPSESKTMRKASLFSTIVTTTFYMLCGCMGYAAFGDDAPGNLLTGFGFYNPFW  756
             IQD+VKSPPSE KTM+KA+L S  VTT FYMLCGCMGYAAFGD +PGNLLTGFGFYNP+W
Sbjct  259   IQDSVKSPPSEEKTMKKATLVSVGVTTIFYMLCGCMGYAAFGDLSPGNLLTGFGFYNPYW  318

Query  755   LLDIANAAIVIHLVGAYQVYCQPLFAFIEKWVGAKWPDSEIITKEINLKIPGFGYPYKLN  576
             LLDIANAAIVIHL+GAYQVYCQPLFAFIEK     +PDSE I K+I + IPGF  P +LN
Sbjct  319   LLDIANAAIVIHLIGAYQVYCQPLFAFIEKQASICFPDSEFIAKDIKIPIPGFK-PLRLN  377

Query  575   TFRLLWRTAFVLLTTVISMLLPFFNDVVGILGAFGFWPLTVYFPVRMYISQKKIPKWSTR  396
              FRL+WRT FV++TT ISMLLPFFNDVVG+LG+ GFWPLTVYFPV MYI+QKKIP+WSTR
Sbjct  378   LFRLIWRTVFVIITTDISMLLPFFNDVVGLLGSLGFWPLTVYFPVEMYIAQKKIPRWSTR  437

Query  395   WICLQMlsgaclavslaaaagsfagvVLDLKLYRPFKTSY  276
             W+CLQ+ S  CL VS+AAAAGS AGVVLDLK Y+PF+++Y
Sbjct  438   WVCLQVFSLGCLVVSIAAAAGSIAGVVLDLKSYKPFQSNY  477



>ref|XP_009379863.1| PREDICTED: amino acid permease 4-like [Musa acuminata subsp. 
malaccensis]
Length=495

 Score =   717 bits (1850),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 365/496 (74%), Positives = 413/496 (83%), Gaps = 9/496 (2%)
 Frame = -3

Query  1739  IMQMGESAAATKNHRHH---LGVSIDAPPLYGFKGL----DDDGRPQRTGTVWTASAHII  1581
             + +MGE+ AA  N R     + VS++       +GL    DDDGR +R+GT WTASAHI+
Sbjct  1     MQKMGENGAAKYNQRPTFTPMEVSVELSHGNQLQGLGKCYDDDGRLKRSGTFWTASAHIV  60

Query  1580  TAVIGSGVLSLAWAIGQLGWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRNYTYM  1401
             TAVIGSGVLSLAWAI QLGWVAGP VMLLFS V YYTSTLLADCYR+GDP  GKRNY YM
Sbjct  61    TAVIGSGVLSLAWAIAQLGWVAGPVVMLLFSFVTYYTSTLLADCYRSGDPDTGKRNYNYM  120

Query  1400  DAVRSNLGGYQVKICGLIQYFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSS  1221
             DAV + LGG +VK+CG IQY NLFG+A+GYTIAASISMMAI+RSNCFHE G KNPCH SS
Sbjct  121   DAVHAYLGGLKVKLCGCIQYANLFGVAVGYTIAASISMMAIRRSNCFHEKGHKNPCHTSS  180

Query  1220  NPYMIAFGIIEIILSQIPDFDQIWWLSIVAAVMSFTYSGIGLGLGIAQVVANGAFKGSLT  1041
             NPYMI FG++EI LSQIPDFDQIWWLSIVAAVMSFTYS IGL LGI Q + N  FKGSLT
Sbjct  181   NPYMIMFGVVEIFLSQIPDFDQIWWLSIVAAVMSFTYSSIGLALGIVQAIDNKGFKGSLT  240

Query  1040  GISIGTVTETQKIWRSFQALGDIAFAYSYSIILIEIQDTVKS-PPSESKTMRKASLFSTI  864
             GISIG ++ TQKIWRS QA GDIAFAYS+S++LIEIQDT+KS PPSE+K M+KASL S I
Sbjct  241   GISIGVISPTQKIWRSLQAFGDIAFAYSFSLVLIEIQDTIKSPPPSEAKVMKKASLLSII  300

Query  863   VTTTFYMLCGCMGYAAFGDDAPGNLLTGFGFYNPFWLLDIANAAIVIHLVGAYQVYCQPL  684
             VTT FYMLCGCMGYAAFGD APGNLLTGFGFYNP+WLLDIANAAIV+HLVGAYQV+ QPL
Sbjct  301   VTTLFYMLCGCMGYAAFGDKAPGNLLTGFGFYNPYWLLDIANAAIVVHLVGAYQVFSQPL  360

Query  683   FAFIEKWVGAKWPDSEIITKEINLKIPGFGYPYKLNTFRLLWRTAFVLLTTVISMLLPFF  504
             FAFIEKW    WPD+  I+KEI + +      YKL+ FRL+WR+AFV+LTTVISMLLPFF
Sbjct  361   FAFIEKWALKTWPDATFISKEIAVPLTPTKR-YKLSLFRLVWRSAFVVLTTVISMLLPFF  419

Query  503   NDVVGILGAFGFWPLTVYFPVRMYISQKKIPKWSTRWICLQMlsgaclavslaaaagsfa  324
             NDVVG+LGA GFWPLTVYFPV MYI QK+IP+WSTRW+CLQMLS ACL +++AA  GS A
Sbjct  420   NDVVGLLGALGFWPLTVYFPVEMYIVQKRIPRWSTRWVCLQMLSSACLVITVAAVIGSVA  479

Query  323   gvVLDLKLYRPFKTSY  276
             G+V DLK+YRPFKTSY
Sbjct  480   GIVTDLKVYRPFKTSY  495



>emb|CAN65437.1| hypothetical protein VITISV_038918 [Vitis vinifera]
Length=487

 Score =   716 bits (1849),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 380/490 (78%), Positives = 412/490 (84%), Gaps = 8/490 (2%)
 Frame = -3

Query  1730  MGESAAATKNHR----HHLGVSIDAPPLYGF-KGLDDDGRPQRTGTVWTASAHIITAVIG  1566
             MGE+AA TKNH         +SID  P     K  DDDGR +RTGTVWTASAHIITAVIG
Sbjct  1     MGENAA-TKNHHHHHHQVFDISIDVLPHQNTSKCFDDDGRLKRTGTVWTASAHIITAVIG  59

Query  1565  SGVLSLAWAIGQLGWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRNYTYMDAVRS  1386
             SGVLSLAWAI QLGW+AGP+VM LFS V+YYTS+LLADCYR+GD V GKRNYTYMDAVRS
Sbjct  60    SGVLSLAWAIAQLGWIAGPAVMFLFSFVIYYTSSLLADCYRSGDRVSGKRNYTYMDAVRS  119

Query  1385  NLGGYQVKICGLIQYFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMI  1206
             NLGG +VK+CGLIQY N+FG+AIGYTIAASISMMA+KRSNCFHESGGKNPCH+SS PYMI
Sbjct  120   NLGGVKVKVCGLIQYLNIFGVAIGYTIAASISMMAVKRSNCFHESGGKNPCHISSYPYMI  179

Query  1205  AFGIIEIILSQIPDFDQIWWLSIVAAVMSFTYSGIGLGLGIAQVVANGAFKGSLTGISIG  1026
              FGI EI  SQIPDFDQIWWLSIV       Y         +   + G FKGSLTGISIG
Sbjct  180   MFGIAEIAFSQIPDFDQIWWLSIVGR-GHVLYLLFNRSCTWSCQSSAGGFKGSLTGISIG  238

Query  1025  TVTETQKIWRSFQALGDIAFAYSYSIILIEIQDTVKSPPSESKTMRKASLFSTIVTTTFY  846
             TVT+TQKIWRSFQALGDIAFAYSYSIILIEIQDT+KSPPSESKTM+KA+L S  VTT FY
Sbjct  239   TVTQTQKIWRSFQALGDIAFAYSYSIILIEIQDTLKSPPSESKTMKKATLVSIAVTTAFY  298

Query  845   MLCGCMGYAAFGDDAPGNLLTGFGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEK  666
             MLCGCMGYAAFGD APGNLLTGFGFYNP+WLLDIAN AIV+HLVGAYQVYCQPLFAF EK
Sbjct  299   MLCGCMGYAAFGDLAPGNLLTGFGFYNPYWLLDIANVAIVVHLVGAYQVYCQPLFAFTEK  358

Query  665   WVGAKWPDSEIITKEINLKIPGFGYPYKLNTFRLLWRTAFVLLTTVISMLLPFFNDVVGI  486
             W   KWP S+ ITKEI + IPG   P+ LN FRL+WR+AFV++TTVISMLLPFFNDVVGI
Sbjct  359   WAAQKWPHSDFITKEIKIPIPGCS-PFSLNLFRLVWRSAFVVVTTVISMLLPFFNDVVGI  417

Query  485   LGAFGFWPLTVYFPVRMYISQKKIPKWSTRWICLQMlsgaclavslaaaagsfagvVLDL  306
             LGAFGFWPLTVYFPV MYI QKKIPKWSTRWICLQMLS ACL +S+AAAAGS AGVVLDL
Sbjct  418   LGAFGFWPLTVYFPVEMYIVQKKIPKWSTRWICLQMLSVACLIISIAAAAGSIAGVVLDL  477

Query  305   KLYRPFKTSY  276
             K+Y PFKTSY
Sbjct  478   KVYHPFKTSY  487



>ref|XP_003522571.1| PREDICTED: amino acid permease 3-like isoform X1 [Glycine max]
 ref|XP_006578960.1| PREDICTED: amino acid permease 3-like isoform X2 [Glycine max]
Length=487

 Score =   716 bits (1848),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 354/484 (73%), Positives = 415/484 (86%), Gaps = 3/484 (1%)
 Frame = -3

Query  1721  SAAATKNHRHHLGVSIDAPPLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSGVLSLAW  1542
                 +K H+  L  SID       K  DDDGRP+RTGTVWTASAHIITAVIGSGVLSLAW
Sbjct  5     DGVGSKYHQQTLNFSIDIHQQGISKCFDDDGRPKRTGTVWTASAHIITAVIGSGVLSLAW  64

Query  1541  AIGQLGWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRNYTYMDAVRSNLGG--YQ  1368
             AI QLGW+AGP VM+LFS + YYTSTLL+DCYR GDPV GKRNYTYMDA++SN GG  ++
Sbjct  65    AIAQLGWIAGPIVMVLFSAITYYTSTLLSDCYRTGDPVTGKRNYTYMDAIQSNFGGNGFK  124

Query  1367  VKICGLIQYFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFGIIE  1188
             VK+CGL+QY NLFG+AIGYTIAAS SMMAI+RSNC+H+SGGK+PCHM+SN YMI+FGI+E
Sbjct  125   VKLCGLVQYINLFGVAIGYTIAASTSMMAIERSNCYHKSGGKDPCHMNSNMYMISFGIVE  184

Query  1187  IILSQIPDFDQIWWLSIVAAVMSFTYSGIGLGLGIAQVVANGAFKGSLTGISIGTVTETQ  1008
             II SQIP FDQ+WWLSIVAAVMSFTYS IGLGLGI +V+ N    GSLTGI+IGTVT+T+
Sbjct  185   IIFSQIPGFDQLWWLSIVAAVMSFTYSTIGLGLGIGKVIENRGVGGSLTGITIGTVTQTE  244

Query  1007  KIWRSFQALGDIAFAYSYSIILIEIQDTVKSPPSESKTMRKASLFSTIVTTTFYMLCGCM  828
             K+WR+ QALGDIAFAYSYS+IL+EIQDTVKSPPSESKTM+KAS  S  VT+ FYMLCGC 
Sbjct  245   KVWRTMQALGDIAFAYSYSLILVEIQDTVKSPPSESKTMKKASFISVAVTSIFYMLCGCF  304

Query  827   GYAAFGDDAPGNLLTGFGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEKWVGAKW  648
             GYAAFGD +PGNLLTGFGFYNP+WLLDIANAAIVIHLVG+YQVYCQPLFAF+EK      
Sbjct  305   GYAAFGDASPGNLLTGFGFYNPYWLLDIANAAIVIHLVGSYQVYCQPLFAFVEKHAARML  364

Query  647   PDSEIITKEINLKIPGFGYPYKLNTFRLLWRTAFVLLTTVISMLLPFFNDVVGILGAFGF  468
             PDS+ + KEI + IPGF + YK+N FRL+WRT +V+++TVISMLLPFFND+ G+LGAFGF
Sbjct  365   PDSDFVNKEIEIPIPGF-HSYKVNLFRLVWRTIYVMVSTVISMLLPFFNDIGGLLGAFGF  423

Query  467   WPLTVYFPVRMYISQKKIPKWSTRWICLQMlsgaclavslaaaagsfagvVLDLKLYRPF  288
             WPLTVYFPV MYI+QK+IPKWST+WICLQ+LS ACL +++ AAAGS AG+ +DL+ Y+PF
Sbjct  424   WPLTVYFPVEMYINQKRIPKWSTKWICLQILSMACLLMTIGAAAGSIAGIAIDLQTYKPF  483

Query  287   KTSY  276
             KT+Y
Sbjct  484   KTNY  487



>ref|XP_010063933.1| PREDICTED: amino acid permease 3-like [Eucalyptus grandis]
 gb|KCW71231.1| hypothetical protein EUGRSUZ_F04329 [Eucalyptus grandis]
Length=478

 Score =   716 bits (1847),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 365/470 (78%), Positives = 412/470 (88%), Gaps = 2/470 (0%)
 Frame = -3

Query  1682  VSIDAPPLYG-FKGLDDDGRPQRTGTVWTASAHIITAVIGSGVLSLAWAIGQLGWVAGPS  1506
             V++D P   G  K  DDDGR +RTGTVWTAS+HIITAVIGSGVLSLAWA  QLGW+AGP+
Sbjct  10    VALDLPQQGGGSKCFDDDGRLKRTGTVWTASSHIITAVIGSGVLSLAWATAQLGWIAGPA  69

Query  1505  VMLLFSCVVYYTSTLLADCYRAGDPVFGKRNYTYMDAVRSNLGGYQVKICGLIQYFNLFG  1326
             VM LFS V YYTS+LLA CYR+GDPV GKRNYTYMDAV SNLGG +VK+CG++QY NLFG
Sbjct  70    VMFLFSFVTYYTSSLLAACYRSGDPVTGKRNYTYMDAVHSNLGGAKVKLCGMVQYLNLFG  129

Query  1325  IAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFGIIEIILSQIPDFDQIWW  1146
             +AIGYTIA+SISMMAI RSNCFH++G  +PCH SSNPYMIAFG+IEI LSQIPDFDQ+WW
Sbjct  130   VAIGYTIASSISMMAIARSNCFHKNGDDSPCHTSSNPYMIAFGVIEIFLSQIPDFDQLWW  189

Query  1145  LSIVAAVMSFTYSGIGLGLGIAQVVANGAFKGSLTGISIGTVTETQKIWRSFQALGDIAF  966
             LSIVAAVMSFTYS IGL LGIA+V  NG   GSLTGISI TV++TQKIWRSFQALGDIAF
Sbjct  190   LSIVAAVMSFTYSIIGLALGIAKVAENGKVGGSLTGISINTVSQTQKIWRSFQALGDIAF  249

Query  965   AYSYSIILIEIQDTVKSPPSESKTMRKASLFSTIVTTTFYMLCGCMGYAAFGDDAPGNLL  786
             AYSYSIILIEIQDT+KSPPSESKTM+KA+L S  VTT FYMLCG MGYAAFGD APGNLL
Sbjct  250   AYSYSIILIEIQDTLKSPPSESKTMKKATLVSVGVTTLFYMLCGTMGYAAFGDMAPGNLL  309

Query  785   TGFGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEKWVGAKWPDSEIITKEINLKI  606
             TGFGF+NP+WL+DIANAAIVIHL+GAYQVYCQPLFAFIEK    ++ DS+ ITKEI + +
Sbjct  310   TGFGFFNPYWLIDIANAAIVIHLIGAYQVYCQPLFAFIEKHAAKRFGDSQFITKEIEIPV  369

Query  605   PGFGYPYKLNTFRLLWRTAFVLLTTVISMLLPFFNDVVGILGAFGFWPLTVYFPVRMYIS  426
             PGF  P+KLN FR++WRT FV+LTTVISMLLPFFNDVVG+LGA GFWPLTVYFPV MYI+
Sbjct  370   PGF-RPFKLNVFRMIWRTIFVILTTVISMLLPFFNDVVGLLGALGFWPLTVYFPVEMYIA  428

Query  425   QKKIPKWSTRWICLQMlsgaclavslaaaagsfagvVLDLKLYRPFKTSY  276
             Q KIPKWST+W+ LQ+LS ACL +++AAAAGS AGVVLDLK Y+PFKTSY
Sbjct  429   QMKIPKWSTKWLSLQILSAACLIITIAAAAGSIAGVVLDLKSYKPFKTSY  478



>ref|XP_004290905.1| PREDICTED: amino acid permease 2-like [Fragaria vesca subsp. 
vesca]
Length=480

 Score =   715 bits (1846),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 360/475 (76%), Positives = 407/475 (86%), Gaps = 1/475 (0%)
 Frame = -3

Query  1700  HRHHLGVSIDAPPLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSGVLSLAWAIGQLGW  1521
                   VS+D  P  G K  DDDGR +RTGTVWTASAHIITAVIGSGVL+LAWA  QLGW
Sbjct  7     QHQAFDVSVDVQPQSGSKCFDDDGRLKRTGTVWTASAHIITAVIGSGVLALAWATAQLGW  66

Query  1520  VAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRNYTYMDAVRSNLGGYQVKICGLIQY  1341
             VAGP+VMLLF+ V YYTSTLL+ CYR GDPV GKRNYTY DAVRSNLGGY+VKICG +QY
Sbjct  67    VAGPAVMLLFAFVTYYTSTLLSFCYRTGDPVTGKRNYTYTDAVRSNLGGYKVKICGFVQY  126

Query  1340  FNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFGIIEIILSQIPDF  1161
              NLFG+AIGYTIA+SISM+AIKRSNCFH S GK+ CH++SNPYMIAFGI EII SQI +F
Sbjct  127   LNLFGVAIGYTIASSISMVAIKRSNCFHSSDGKDECHVNSNPYMIAFGIAEIIFSQIENF  186

Query  1160  DQIWWLSIVAAVMSFTYSGIGLGLGIAQVVANGAFKGSLTGISIGTVTETQKIWRSFQAL  981
             DQ+WWLSIVAAVMSFTYS IGLGLGI +VV  G  +GS+TG+ IGTVTE QKIWRSFQAL
Sbjct  187   DQLWWLSIVAAVMSFTYSTIGLGLGIGKVVETGTIRGSMTGVDIGTVTEAQKIWRSFQAL  246

Query  980   GDIAFAYSYSIILIEIQDTVKSPPSESKTMRKASLFSTIVTTTFYMLCGCMGYAAFGDDA  801
             GDIAFAYSYS+ILIEIQDTVKSPPSE+KTMRKA+L S   TT FYMLCGCMGYAAFGD +
Sbjct  247   GDIAFAYSYSLILIEIQDTVKSPPSEAKTMRKATLISVATTTLFYMLCGCMGYAAFGDAS  306

Query  800   PGNLLTGFGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEKWVGAKWPDSEIITKE  621
             PGNLLTGFGFYNP+WL+DIANAAIVIHLVGAYQV+ QPLFAF+EK    K+PDS+ I+K 
Sbjct  307   PGNLLTGFGFYNPYWLIDIANAAIVIHLVGAYQVFVQPLFAFVEKSAAEKFPDSQFISKN  366

Query  620   INLKIPGFGYPYKLNTFRLLWRTAFVLLTTVISMLLPFFNDVVGILGAFGFWPLTVYFPV  441
             I ++IP  G  Y LN FRL+WRT FV+ TTVISM+LPFFNDVVG+LGA GFWPLTVYFPV
Sbjct  367   IKIQIPCVGL-YNLNMFRLVWRTLFVITTTVISMILPFFNDVVGLLGALGFWPLTVYFPV  425

Query  440   RMYISQKKIPKWSTRWICLQMlsgaclavslaaaagsfagvVLDLKLYRPFKTSY  276
              MYI QK+IPKWST+W+CLQ LSGACL +++AAAAGS AGV+ DLK Y+PF++SY
Sbjct  426   EMYIVQKRIPKWSTKWLCLQTLSGACLIITIAAAAGSIAGVISDLKTYKPFQSSY  480



>emb|CDP10973.1| unnamed protein product [Coffea canephora]
Length=468

 Score =   714 bits (1844),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 346/454 (76%), Positives = 388/454 (85%), Gaps = 4/454 (1%)
 Frame = -3

Query  1730  MGESAAATK---NHRHHLGVSIDAPPLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSG  1560
             M ES A  +   NH    GVS++ PP  G K  DDDG+ +RTG+VWTASAHIITAVIGSG
Sbjct  1     MVESTAPKQGPQNHHQVFGVSVNVPPQGGSKCFDDDGKLKRTGSVWTASAHIITAVIGSG  60

Query  1559  VLSLAWAIGQLGWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRNYTYMDAVRSNL  1380
             VLSLAWA  QLGW+AGP+V+LLF+ V YYTS LLA CYR+GDP  GKRNYTYMDAVR+NL
Sbjct  61    VLSLAWATAQLGWIAGPTVLLLFAFVTYYTSVLLAACYRSGDPDGGKRNYTYMDAVRANL  120

Query  1379  GGYQVKICGLIQYFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAF  1200
             GG+QVK+CG IQY NLFG+AIGYTIAASISM AIK+SNCFH SGGK+PC +SS PYMI F
Sbjct  121   GGFQVKVCGAIQYMNLFGVAIGYTIAASISMTAIKKSNCFHSSGGKDPCKVSSTPYMIIF  180

Query  1199  GIIEIILSQIPDFDQIWWLSIVAAVMSFTYSGIGLGLGIAQVVANGAFKGSLTGISIGTV  1020
             G++EI+ SQIPDFDQIWWLS VAAVMSFTYS IGLGLGI +V   G F+GSLTGISIGTV
Sbjct  181   GVVEILFSQIPDFDQIWWLSFVAAVMSFTYSTIGLGLGIGKVAETGKFRGSLTGISIGTV  240

Query  1019  TETQKIWRSFQALGDIAFAYSYSIILIEIQDTVKSPPSESKTMRKASLFSTIVTTTFYML  840
             T+T KIWRSFQALG IAFAYSYS+ILIEIQDT+K+PPSE KTM+KA+L S  VTT FYM 
Sbjct  241   TQTDKIWRSFQALGAIAFAYSYSLILIEIQDTIKAPPSEYKTMKKATLLSVAVTTIFYMS  300

Query  839   CGCMGYAAFGDDAPGNLLTGFGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEKWV  660
             CGC GYAAFGD APGNLLTGFGFYNP+WLLDIAN AI IHLVGAYQVYCQPLFAFIEK  
Sbjct  301   CGCFGYAAFGDLAPGNLLTGFGFYNPYWLLDIANIAIAIHLVGAYQVYCQPLFAFIEKTA  360

Query  659   GAKWPDSEIITKEINLKIPGFGYPYKLNTFRLLWRTAFVLLTTVISMLLPFFNDVVGILG  480
              + +P+S+ ITKEI + IPGF  PYKLN FRL+WR+ FV++TTVISML+PFFNDVVGILG
Sbjct  361   RSWFPESQFITKEIEIPIPGFK-PYKLNLFRLVWRSIFVVITTVISMLMPFFNDVVGILG  419

Query  479   AFGFWPLTVYFPVRMYISQKKIPKWSTRWICLQM  378
             AFGFWPLTVYFPV MYI QKKIPKWSTRW+CLQ+
Sbjct  420   AFGFWPLTVYFPVEMYIVQKKIPKWSTRWLCLQI  453



>ref|XP_011102300.1| PREDICTED: amino acid permease 3 isoform X1 [Sesamum indicum]
Length=491

 Score =   715 bits (1846),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 367/485 (76%), Positives = 414/485 (85%), Gaps = 1/485 (0%)
 Frame = -3

Query  1730  MGESAAATKNHRHHLGVSIDAPPLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSGVLS  1551
             M ES  + +       VSI+ P   G K  DDDGR +RTGTVWTASAHIITAVIGSGVLS
Sbjct  8     MSESTGSRQYQHQVFDVSINVPNQGGSKCYDDDGRLKRTGTVWTASAHIITAVIGSGVLS  67

Query  1550  LAWAIGQLGWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRNYTYMDAVRSNLGGY  1371
             LAWA+ QLGW+AGP+VM LFS V YYTS LL+ CYR+GDP  GKRNYTYMDAVR+NLGG+
Sbjct  68    LAWAVAQLGWIAGPTVMFLFSFVTYYTSALLSTCYRSGDPDTGKRNYTYMDAVRANLGGF  127

Query  1370  QVKICGLIQYFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFGII  1191
             +VK+CG IQY NLFG+AIGYTIA+SISMMAI+RSNCFH  G  +PC +SSNPYMIAFG+I
Sbjct  128   KVKLCGAIQYVNLFGVAIGYTIASSISMMAIERSNCFHSKGDSSPCRVSSNPYMIAFGVI  187

Query  1190  EIILSQIPDFDQIWWLSIVAAVMSFTYSGIGLGLGIAQVVANGAFKGSLTGISIGTVTET  1011
             EII SQIPDFDQIWWLSIVAA+MSFTYS IGLGLG+A+V  NG  +GSLTGISIGTVTET
Sbjct  188   EIIFSQIPDFDQIWWLSIVAAIMSFTYSTIGLGLGVAKVAENGKIRGSLTGISIGTVTET  247

Query  1010  QKIWRSFQALGDIAFAYSYSIILIEIQDTVKSPPSESKTMRKASLFSTIVTTTFYMLCGC  831
             QKIWRSFQALG IAFAYSYS+ILIEIQDT+KSPPSE KTM+KA+L S  VTT FYMLCGC
Sbjct  248   QKIWRSFQALGAIAFAYSYSLILIEIQDTIKSPPSEYKTMKKATLLSVAVTTVFYMLCGC  307

Query  830   MGYAAFGDDAPGNLLTGFGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEKWVGAK  651
              GYAAFGD +PGNLLTGFGFYNP+WLLDIAN AIV+HL+GAYQVYCQPLFAFIEK     
Sbjct  308   FGYAAFGDLSPGNLLTGFGFYNPYWLLDIANVAIVVHLIGAYQVYCQPLFAFIEKTALEW  367

Query  650   WPDSEIITKEINLKIPGFGYPYKLNTFRLLWRTAFVLLTTVISMLLPFFNDVVGILGAFG  471
             +PDS+ IT EI + IPG   PYKLN FRL+WRT FV++TT+ISML+PFFNDVVGILGA G
Sbjct  368   YPDSKFITAEITIPIPGIK-PYKLNLFRLIWRTIFVIITTIISMLMPFFNDVVGILGALG  426

Query  470   FWPLTVYFPVRMYISQKKIPKWSTRWICLQMlsgaclavslaaaagsfagvVLDLKLYRP  291
             FWPLTVYFPV MYI+QK+IPKWS RW+CLQ+LS ACL +S+AA  GSFAGVV DLK+Y+P
Sbjct  427   FWPLTVYFPVEMYIAQKRIPKWSARWMCLQILSMACLVISVAALVGSFAGVVSDLKVYKP  486

Query  290   FKTSY  276
             FKTSY
Sbjct  487   FKTSY  491



>ref|XP_010063423.1| PREDICTED: amino acid permease 3-like [Eucalyptus grandis]
 gb|KCW70652.1| hypothetical protein EUGRSUZ_F03827 [Eucalyptus grandis]
Length=483

 Score =   712 bits (1838),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 365/488 (75%), Positives = 418/488 (86%), Gaps = 11/488 (2%)
 Frame = -3

Query  1730  MGESAAATKNHRHH--LGVSIDAPPLYGFKGLDDDGRPQR---TGTVWTASAHIITAVIG  1566
             MG ++A    H ++    VSI+ PP  G K  DDDGR +R   TGTVWTAS+HIITAVIG
Sbjct  1     MGVNSAVKNQHPNNQVFDVSINIPPQGGSKCFDDDGRLKRLKRTGTVWTASSHIITAVIG  60

Query  1565  SGVLSLAWAIGQLGWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRNYTYMDAVRS  1386
             SGVLSLAWA  QLGW+AGP+VMLLF+ V YYTSTLLA CYR+GD   GKRNYTYMDAV +
Sbjct  61    SGVLSLAWATAQLGWIAGPAVMLLFALVTYYTSTLLAACYRSGD---GKRNYTYMDAVSA  117

Query  1385  NLGGYQVKICGLIQYFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMI  1206
             NLGG++VK+CGL+QY NLFG+AIGYTIA+SISMMAI RSNCFH++G K+PCH +S PYMI
Sbjct  118   NLGGFKVKLCGLVQYVNLFGVAIGYTIASSISMMAISRSNCFHKNGEKSPCHFNSTPYMI  177

Query  1205  AFGIIEIILSQIPDFDQIWWLSIVAAVMSFTYSGIGLGLGIAQVVANGAFKGSLTGISIG  1026
             AFGIIEII SQIPDFDQ+WWLSIVAAVMSFTYS IGLGLGIA+V   G F GSLTGISIG
Sbjct  178   AFGIIEIIFSQIPDFDQLWWLSIVAAVMSFTYSTIGLGLGIARVAETGNFMGSLTGISIG  237

Query  1025  TVTETQKIWRSFQALGDIAFAYSYSIILIEIQDTVKSPPSESKTMRKASLFSTIVTTTFY  846
             TVT TQK+WRSFQALGDIAFAYSYS+ILIEIQDT++SPPSESKTM+KASL S  VTT FY
Sbjct  238   TVTSTQKLWRSFQALGDIAFAYSYSLILIEIQDTIRSPPSESKTMKKASLVSIAVTTLFY  297

Query  845   MLCGCMGYAAFGDDAPGNLLTGFGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEK  666
             MLCGCMGYAAFGD APGNLLTGFGFYNP+W++DIANAAIVIHL+G YQVYCQPLFAF+EK
Sbjct  298   MLCGCMGYAAFGDMAPGNLLTGFGFYNPYWMVDIANAAIVIHLIGTYQVYCQPLFAFVEK  357

Query  665   WVGAKWPDSEIITKEINLKIPGFGY-PYKLNTFRLLWRTAFVLLTTVISMLLPFFNDVVG  489
                 K+P+S+ IT++I  +IP  G   YKLN FRL+WRT FV++TTVISMLLPFFND+VG
Sbjct  358   AAIKKFPNSQFITRDI--EIPTLGLRTYKLNLFRLVWRTVFVIMTTVISMLLPFFNDIVG  415

Query  488   ILGAFGFWPLTVYFPVRMYISQKKIPKWSTRWICLQMlsgaclavslaaaagsfagvVLD  309
             +LGA GFWPLTVYFPV MYI QK+IPKWST+W+CLQ+LS ACL +++AAAAGS AGVVLD
Sbjct  416   LLGALGFWPLTVYFPVEMYIKQKQIPKWSTKWVCLQILSMACLIITIAAAAGSVAGVVLD  475

Query  308   LKLYRPFK  285
             LK Y+PF 
Sbjct  476   LKSYKPFN  483



>ref|XP_004498350.1| PREDICTED: amino acid permease 3-like isoform X1 [Cicer arietinum]
 ref|XP_004498351.1| PREDICTED: amino acid permease 3-like isoform X2 [Cicer arietinum]
Length=487

 Score =   712 bits (1838),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 357/489 (73%), Positives = 412/489 (84%), Gaps = 6/489 (1%)
 Frame = -3

Query  1730  MGESAAATKNHRHHLGVSID----APPLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGS  1563
             M     + KNH+     SID     P   G K  DDDGR +R+G  WTASAHIITAVIGS
Sbjct  1     MTMEKDSNKNHQQPFEFSIDNLQQGPA--GSKCFDDDGRLKRSGNTWTASAHIITAVIGS  58

Query  1562  GVLSLAWAIGQLGWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRNYTYMDAVRSN  1383
             GVLSLAWAI QLGWVAGPS+MLLFS V YYTSTLL+ CYR+GD + GKRNYTY DAVR+ 
Sbjct  59    GVLSLAWAIAQLGWVAGPSMMLLFSFVTYYTSTLLSVCYRSGDQLNGKRNYTYTDAVRAY  118

Query  1382  LGGYQVKICGLIQYFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIA  1203
             LGG++VKICG +QY NLFG+AIGYTIAASISMMAIKRSNCFH SGGKNPCHM+SN YMI+
Sbjct  119   LGGFKVKICGFVQYANLFGVAIGYTIAASISMMAIKRSNCFHSSGGKNPCHMNSNVYMIS  178

Query  1202  FGIIEIILSQIPDFDQIWWLSIVAAVMSFTYSGIGLGLGIAQVVANGAFKGSLTGISIGT  1023
             FGI+EII SQIPDFDQ+WWLS +AAVMSFTYS IGLGLG+ +V+ N   KGSLTGI++GT
Sbjct  179   FGIVEIIFSQIPDFDQLWWLSTLAAVMSFTYSTIGLGLGVGKVIENKGIKGSLTGITVGT  238

Query  1022  VTETQKIWRSFQALGDIAFAYSYSIILIEIQDTVKSPPSESKTMRKASLFSTIVTTTFYM  843
             VT+TQK+WRSFQALG+IAFAYSYS+ILIEIQDT+KSPPSESKTM+KA+L S IVTT FYM
Sbjct  239   VTQTQKVWRSFQALGNIAFAYSYSMILIEIQDTIKSPPSESKTMKKATLISVIVTTIFYM  298

Query  842   LCGCMGYAAFGDDAPGNLLTGFGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEKW  663
             LCGC GYAAFGD +PGNLLTGFGFYNPFWLLDIANAAIVIHLVGAYQVYCQPL++ +EK 
Sbjct  299   LCGCFGYAAFGDLSPGNLLTGFGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLYSVVEKT  358

Query  662   VGAKWPDSEIITKEINLKIPGFGYPYKLNTFRLLWRTAFVLLTTVISMLLPFFNDVVGIL  483
                ++PDS  I K+I + IPG   P K+N FRL+WR+ FV+LTT+ISMLLPFFND+VG++
Sbjct  359   ASQRFPDSNFINKDIEIPIPGVISPLKINLFRLVWRSFFVILTTIISMLLPFFNDIVGLI  418

Query  482   GAFGFWPLTVYFPVRMYISQKKIPKWSTRWICLQMlsgaclavslaaaagsfagvVLDLK  303
             GA GFWPLTVYFPV MYI Q +IPKWST+WICL +LS ACL +SLA+AAGS AGV+ DL+
Sbjct  419   GAIGFWPLTVYFPVEMYIVQMRIPKWSTKWICLHLLSAACLVISLASAAGSVAGVIADLQ  478

Query  302   LYRPFKTSY  276
             +Y+PF T Y
Sbjct  479   VYKPFHTVY  487



>gb|KHN44307.1| Amino acid permease 3 [Glycine soja]
Length=487

 Score =   712 bits (1837),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 353/484 (73%), Positives = 413/484 (85%), Gaps = 3/484 (1%)
 Frame = -3

Query  1721  SAAATKNHRHHLGVSIDAPPLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSGVLSLAW  1542
                 +K H+  L  SID       K  DDDGRP+RTGTVWTASAHIITAVIGSGVLSLAW
Sbjct  5     DGVGSKYHQQTLNFSIDIHQQGISKCFDDDGRPKRTGTVWTASAHIITAVIGSGVLSLAW  64

Query  1541  AIGQLGWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRNYTYMDAVRSNLGG--YQ  1368
             AI QLGW+AGP VM+LFS + YYTSTLL+DCYR GDPV GKRNYTYM A++SN GG  ++
Sbjct  65    AIAQLGWIAGPIVMVLFSAITYYTSTLLSDCYRTGDPVTGKRNYTYMGAIQSNFGGNGFK  124

Query  1367  VKICGLIQYFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFGIIE  1188
             VK+CGL+QY NLFG+AIGYTIAAS SMMAI+RSNC+H+SGGK+PCHM+SN YMI+FGI+E
Sbjct  125   VKLCGLVQYINLFGVAIGYTIAASTSMMAIERSNCYHKSGGKDPCHMNSNMYMISFGIVE  184

Query  1187  IILSQIPDFDQIWWLSIVAAVMSFTYSGIGLGLGIAQVVANGAFKGSLTGISIGTVTETQ  1008
             II SQIP FDQ+WWLSIVAAVMSFTYS IGLGLGI +V+ N    GSLTGI+IGTVT+T 
Sbjct  185   IIFSQIPGFDQLWWLSIVAAVMSFTYSTIGLGLGIGKVIENRGVGGSLTGITIGTVTQTD  244

Query  1007  KIWRSFQALGDIAFAYSYSIILIEIQDTVKSPPSESKTMRKASLFSTIVTTTFYMLCGCM  828
             K+WR+ QALGDIAFAYSYS+IL+EIQDTVKSPPSESKTM+KAS  S  VT+ FYMLCGC 
Sbjct  245   KVWRTMQALGDIAFAYSYSLILVEIQDTVKSPPSESKTMKKASFISVAVTSIFYMLCGCF  304

Query  827   GYAAFGDDAPGNLLTGFGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEKWVGAKW  648
             GYAAFGD +PGNLLTGFGFYNP+WLLDIANAAIVIHLVG+YQVYCQPLFAF+EK      
Sbjct  305   GYAAFGDASPGNLLTGFGFYNPYWLLDIANAAIVIHLVGSYQVYCQPLFAFVEKHAARML  364

Query  647   PDSEIITKEINLKIPGFGYPYKLNTFRLLWRTAFVLLTTVISMLLPFFNDVVGILGAFGF  468
             PDS+ + KEI + IPGF + YK+N FRL+WRT +V+++TVISMLLPFFND+ G+LGAFGF
Sbjct  365   PDSDFVNKEIEIPIPGF-HSYKVNLFRLVWRTIYVMVSTVISMLLPFFNDIGGLLGAFGF  423

Query  467   WPLTVYFPVRMYISQKKIPKWSTRWICLQMlsgaclavslaaaagsfagvVLDLKLYRPF  288
             WPLTVYFPV MYI+QK+IPKWST+WICLQ+LS ACL +++ AAAGS AG+ +DL+ Y+PF
Sbjct  424   WPLTVYFPVEMYINQKRIPKWSTKWICLQILSMACLLMTIGAAAGSIAGIAIDLQTYKPF  483

Query  287   KTSY  276
             KT+Y
Sbjct  484   KTNY  487



>gb|KHG27248.1| Amino acid permease 3 -like protein [Gossypium arboreum]
Length=468

 Score =   711 bits (1835),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 371/485 (76%), Positives = 407/485 (84%), Gaps = 17/485 (4%)
 Frame = -3

Query  1730  MGESAAATKNHRHHLGVSIDAPPLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSGVLS  1551
             MGE  A  KNH H+  +  D P      G DDDGR +RTGTVWTASAHIITAVIGSGVLS
Sbjct  1     MGEKGA-VKNHLHN-NLVFDHP-----IGFDDDGRLKRTGTVWTASAHIITAVIGSGVLS  53

Query  1550  LAWAIGQLGWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRNYTYMDAVRSNLGGY  1371
             LAWA  QLGW+A P+VM LFS V  YTSTLLA CYR  DPV GKRNYTYMDAV       
Sbjct  54    LAWATAQLGWIASPAVMFLFSFVTDYTSTLLAACYRCDDPVNGKRNYTYMDAV-------  106

Query  1370  QVKICGLIQYFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFGII  1191
               KICG +QY NLFG+AIGYTIA+SISMMAIKRSNCFH S GKNPCHM+SNPYMI FGI 
Sbjct  107   --KICGWVQYLNLFGVAIGYTIASSISMMAIKRSNCFHASRGKNPCHMNSNPYMIGFGIA  164

Query  1190  EIILSQIPDFDQIWWLSIVAAVMSFTYSGIGLGLGIAQVVANGAFKGSLTGISIGTVTET  1011
             EII SQIPDFDQ+WWLSIVAAVMSFTYS IGLGLGIA+V  NG  +GSLTGIS+GTVT+T
Sbjct  165   EIIFSQIPDFDQLWWLSIVAAVMSFTYSTIGLGLGIAKVAENGKIRGSLTGISVGTVTQT  224

Query  1010  QKIWRSFQALGDIAFAYSYSIILIEIQDTVKSPPSESKTMRKASLFSTIVTTTFYMLCGC  831
             QKIWRSFQALGD+AFAYSYS+ILIEIQDT+K+PPSESKTM KA+L S  VTT FYMLCGC
Sbjct  225   QKIWRSFQALGDMAFAYSYSLILIEIQDTLKAPPSESKTMSKATLLSVGVTTLFYMLCGC  284

Query  830   MGYAAFGDDAPGNLLTGFGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEKWVGAK  651
             MGYAAFGD +PGNLLTGFGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEK    +
Sbjct  285   MGYAAFGDLSPGNLLTGFGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEKSAAKR  344

Query  650   WPDSEIITKEINLKIPGFGYPYKLNTFRLLWRTAFVLLTTVISMLLPFFNDVVGILGAFG  471
             +PDSE ITK+I + IPGF  PY LN FRL+WRT FV+LTT+ISMLLPFFND+VG+LGA G
Sbjct  345   FPDSEFITKDIKIPIPGF-RPYNLNLFRLVWRTIFVMLTTLISMLLPFFNDIVGLLGAIG  403

Query  470   FWPLTVYFPVRMYISQKKIPKWSTRWICLQMlsgaclavslaaaagsfagvVLDLKLYRP  291
             FWPLTVYFPV MYISQ KI KWSTRW+CLQ+LS ACL +++AAAAGS AGV+LDLK Y P
Sbjct  404   FWPLTVYFPVEMYISQNKIAKWSTRWLCLQILSIACLIITIAAAAGSIAGVILDLKSYTP  463

Query  290   FKTSY  276
             F T+Y
Sbjct  464   FSTAY  468



>ref|XP_006383588.1| hypothetical protein POPTR_0005s20390g [Populus trichocarpa]
 gb|ERP61385.1| hypothetical protein POPTR_0005s20390g [Populus trichocarpa]
Length=484

 Score =   711 bits (1836),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 357/485 (74%), Positives = 412/485 (85%), Gaps = 1/485 (0%)
 Frame = -3

Query  1730  MGESAAATKNHRHHLGVSIDAPPLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSGVLS  1551
             MGE+   +        VSI        K  DDDGR +R GTVWTASAHIITAVIGSGVLS
Sbjct  1     MGETENTSAERHQVFDVSIGMHQQGSSKWFDDDGRQKRAGTVWTASAHIITAVIGSGVLS  60

Query  1550  LAWAIGQLGWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRNYTYMDAVRSNLGGY  1371
             LAWAI QLGW+AGP+ M LFS V  YTS+LL+ CYR+GDP+ GKRNYTYMDAVRSNLGG 
Sbjct  61    LAWAIAQLGWIAGPAFMFLFSIVTCYTSSLLSVCYRSGDPITGKRNYTYMDAVRSNLGGV  120

Query  1370  QVKICGLIQYFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFGII  1191
             +VKICG +QY NLFG+A+GYTIA+SISMMAIKRSNCFH+SGGK+PC M++NPYMI FGI 
Sbjct  121   KVKICGFVQYLNLFGVAVGYTIASSISMMAIKRSNCFHQSGGKDPCRMNANPYMIGFGIA  180

Query  1190  EIILSQIPDFDQIWWLSIVAAVMSFTYSGIGLGLGIAQVVANGAFKGSLTGISIGTVTET  1011
             EI+LSQIP FDQ+ WLS+VAAVMSFTYS IGLGLGI +V+ NG   GSLTGI IGTVT T
Sbjct  181   EILLSQIPGFDQLQWLSLVAAVMSFTYSSIGLGLGIGKVIENGKISGSLTGIGIGTVTPT  240

Query  1010  QKIWRSFQALGDIAFAYSYSIILIEIQDTVKSPPSESKTMRKASLFSTIVTTTFYMLCGC  831
             QK+WRSFQALGDIAFAYSYS+ILIEIQDTVKSPPSE+KT+RKA+L S  VTT FYM CGC
Sbjct  241   QKVWRSFQALGDIAFAYSYSMILIEIQDTVKSPPSEAKTIRKATLLSVAVTTLFYMFCGC  300

Query  830   MGYAAFGDDAPGNLLTGFGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEKWVGAK  651
              GYAAFGD +PGNLLTGFGFYNP+WLLDIANAAIVIHLVGAYQV+CQPLFAF+EK   A+
Sbjct  301   FGYAAFGDMSPGNLLTGFGFYNPYWLLDIANAAIVIHLVGAYQVFCQPLFAFVEKEAVAR  360

Query  650   WPDSEIITKEINLKIPGFGYPYKLNTFRLLWRTAFVLLTTVISMLLPFFNDVVGILGAFG  471
             +PDSEIITK+I + +PGF  P+ +N FR++WRT FV+ TTVISMLLPFFND+VG+LGA G
Sbjct  361   FPDSEIITKDIKVAVPGF-RPFNINLFRMIWRTLFVIFTTVISMLLPFFNDIVGLLGALG  419

Query  470   FWPLTVYFPVRMYISQKKIPKWSTRWICLQMlsgaclavslaaaagsfagvVLDLKLYRP  291
             FWPLTVYFPV MYI+Q++IPKWSTRW+ LQ+LS ACL +++AAAAGS AGVV+DLK  +P
Sbjct  420   FWPLTVYFPVEMYIAQRRIPKWSTRWLGLQVLSIACLIITIAAAAGSIAGVVVDLKSIKP  479

Query  290   FKTSY  276
             F+TSY
Sbjct  480   FQTSY  484



>ref|XP_009609434.1| PREDICTED: amino acid permease 3-like [Nicotiana tomentosiformis]
Length=482

 Score =   711 bits (1834),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 366/487 (75%), Positives = 414/487 (85%), Gaps = 5/487 (1%)
 Frame = -3

Query  1736  MQMGESAAATKNHRHHLGVSIDAPPLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSGV  1557
             M+MGE+      H+    VSI+       K  DDDGR +RTG+VWTASAHIITAVIGSGV
Sbjct  1     MKMGENNNVASKHQV-FDVSINVTES---KCFDDDGRLKRTGSVWTASAHIITAVIGSGV  56

Query  1556  LSLAWAIGQLGWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRNYTYMDAVRSNLG  1377
             LSLAWA+ QLGW+AGP VM+LFS V YYTS LLADCYR+GD V GKRNYTYMDAV++NLG
Sbjct  57    LSLAWAVAQLGWIAGPIVMILFSFVTYYTSALLADCYRSGDSVSGKRNYTYMDAVQANLG  116

Query  1376  GYQVKICGLIQYFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFG  1197
             G QVKICG IQY NLFG+AIGYTIA+SISM+AIKRSNCFH+ G + PC +SS PYMI FG
Sbjct  117   GLQVKICGWIQYANLFGVAIGYTIASSISMIAIKRSNCFHKHGDQAPCQVSSTPYMIMFG  176

Query  1196  IIEIILSQIPDFDQIWWLSIVAAVMSFTYSGIGLGLGIAQVVANGAFKGSLTGISIGTVT  1017
             I+EII SQIPDFDQIWWLSIVAAVMSFTYS IGLGLG+A+V   G   GSLTGISIGTV+
Sbjct  177   IVEIIFSQIPDFDQIWWLSIVAAVMSFTYSTIGLGLGVAKVAETGKIGGSLTGISIGTVS  236

Query  1016  ETQKIWRSFQALGDIAFAYSYSIILIEIQDTVKSPPSESKTMRKASLFSTIVTTTFYMLC  837
             E QKIW+SFQALG IAFAYSYS+ILIEIQDT+KSPPSESKTM+ A+L S  VTT FYMLC
Sbjct  237   EMQKIWKSFQALGAIAFAYSYSLILIEIQDTLKSPPSESKTMKNATLISVAVTTVFYMLC  296

Query  836   GCMGYAAFGDDAPGNLLTGFGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEKWVG  657
             GC GYAAFGD APGNLLTGFGFYNP+WLLDIAN AIV+HLVGAYQVYCQPLFAFIEK   
Sbjct  297   GCFGYAAFGDLAPGNLLTGFGFYNPYWLLDIANIAIVVHLVGAYQVYCQPLFAFIEKTAA  356

Query  656   AKWPDSEIITKEINLKIPGFGYPYKLNTFRLLWRTAFVLLTTVISMLLPFFNDVVGILGA  477
               +P+S+ ITKEI++ I G+   +KLN FR++WRT FV++TTVISMLLPFFND+VGILGA
Sbjct  357   EWYPESKFITKEISVPIMGYK-SFKLNLFRIIWRTIFVIITTVISMLLPFFNDIVGILGA  415

Query  476   FGFWPLTVYFPVRMYISQKKIPKWSTRWICLQMlsgaclavslaaaagsfagvVLDLKLY  297
             FGFWPLTVYFPV MYI QKKI KWST+WICLQMLS ACL +S+AAAAGSFAGVV DL++Y
Sbjct  416   FGFWPLTVYFPVEMYIVQKKITKWSTKWICLQMLSVACLIISIAAAAGSFAGVVSDLQVY  475

Query  296   RPFKTSY  276
             +PFKT+Y
Sbjct  476   KPFKTTY  482



>ref|XP_010920126.1| PREDICTED: amino acid permease 4-like [Elaeis guineensis]
Length=513

 Score =   710 bits (1832),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 358/494 (72%), Positives = 408/494 (83%), Gaps = 16/494 (3%)
 Frame = -3

Query  1709  TKNHRHHLGVSIDAPPLYGFKG----------LDDDGRPQRTGTVWTASAHIITAVIGSG  1560
              ++ R +L V     PL   +            DDDGR +RTGTVWTAS+HIITAVIGSG
Sbjct  20    NRDVRAYLQVETQPKPLKDIEATSARPEYSKLFDDDGRLKRTGTVWTASSHIITAVIGSG  79

Query  1559  VLSLAWAIGQLGWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRNYTYMDAVRSNL  1380
             VLSLAWAIGQLGW+AGP+VM+LF+ V+YYTS LL+DCYR GDPV GKRNYTYMDAV +NL
Sbjct  80    VLSLAWAIGQLGWIAGPAVMILFAFVIYYTSNLLSDCYRIGDPVTGKRNYTYMDAVGANL  139

Query  1379  GGYQVKICGLIQYFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAF  1200
             GG +VKICG IQY NLFG+AIGYTIAASISM AIKRSNCFH SGGK+PCH+SSN YMI F
Sbjct  140   GGAKVKICGAIQYVNLFGVAIGYTIAASISMTAIKRSNCFHASGGKDPCHISSNMYMIIF  199

Query  1199  GIIEIILSQIPDFDQIWWLSIVAAVMSFTYSGIGLGLGIAQVVANGAFKGSLTGISIGTV  1020
             GI+E+I SQIPDFDQIWWLSIVAAVMSFTYS +GL LGI +V  NG F+GSL GISIGTV
Sbjct  200   GIMEVIFSQIPDFDQIWWLSIVAAVMSFTYSTVGLSLGIGKVAENGRFRGSLMGISIGTV  259

Query  1019  TE------TQKIWRSFQALGDIAFAYSYSIILIEIQDTVKSPPSESKTMRKASLFSTIVT  858
             T+      TQK+WR+ QALGDIAFAYSYSIILIEIQDT+KSPP+E+KTMRKA+L S  VT
Sbjct  260   TKAGTVTPTQKVWRNLQALGDIAFAYSYSIILIEIQDTLKSPPAENKTMRKATLLSIAVT  319

Query  857   TTFYMLCGCMGYAAFGDDAPGNLLTGFGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFA  678
             T FY+LCGCMGYAAFGDDAPGNLLTGFGFYNP+WLLDIAN AIV+HLVGAYQVYCQPLFA
Sbjct  320   TLFYLLCGCMGYAAFGDDAPGNLLTGFGFYNPYWLLDIANLAIVVHLVGAYQVYCQPLFA  379

Query  677   FIEKWVGAKWPDSEIITKEINLKIPGFGYPYKLNTFRLLWRTAFVLLTTVISMLLPFFND  498
             F+EKW   +WP SE +++E   +IP     YKLN FR++WRT FV++TT ISML+PFFND
Sbjct  380   FVEKWSAQRWPKSEFVSREYEARIPVMETTYKLNLFRVIWRTIFVVVTTTISMLMPFFND  439

Query  497   VVGILGAFGFWPLTVYFPVRMYISQKKIPKWSTRWICLQMlsgaclavslaaaagsfagv  318
             VVGILGA GFWPLTVYFPV MYI+QKKI +WS  W+ L++LS  CL VS+AAA GS AGV
Sbjct  440   VVGILGALGFWPLTVYFPVEMYIAQKKIRRWSAPWVGLRLLSFTCLVVSVAAACGSVAGV  499

Query  317   VLDLKLYRPFKTSY  276
             VLDLK YRPFK +Y
Sbjct  500   VLDLKSYRPFKATY  513



>ref|XP_009414606.1| PREDICTED: amino acid permease 3-like [Musa acuminata subsp. 
malaccensis]
Length=491

 Score =   709 bits (1829),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 363/491 (74%), Positives = 411/491 (84%), Gaps = 8/491 (2%)
 Frame = -3

Query  1733  QMGESAAATKNHRHHLGVSIDAPPLYGF-----KGLDDDGRPQRTGTVWTASAHIITAVI  1569
             +MGE+ AA   H+H     ++     GF     K  DDDGR +RTGTVWTASAHIITAVI
Sbjct  3     KMGENGAA-NCHQHVALAPVEVSVELGFQHGASKCFDDDGRLKRTGTVWTASAHIITAVI  61

Query  1568  GSGVLSLAWAIGQLGWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRNYTYMDAVR  1389
             GSGVLSLAWAIGQLGWVAGP+VMLLFS V +YTS LLADCYR+GDPV G+RNYTYMDAV+
Sbjct  62    GSGVLSLAWAIGQLGWVAGPAVMLLFSFVTFYTSALLADCYRSGDPVTGRRNYTYMDAVQ  121

Query  1388  SNLGGYQVKICGLIQYFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYM  1209
             +NL G +VKICG +QY N+ G+AIGYTIAASISM+AIKRSNCF++ G  +PCH++SNPYM
Sbjct  122   ANLNGIKVKICGYLQYLNIVGVAIGYTIAASISMVAIKRSNCFNKEGDDSPCHVNSNPYM  181

Query  1208  IAFGIIEIILSQIPDFDQIWWLSIVAAVMSFTYSGIGLGLGIAQVVANGAFKGSLTGISI  1029
             I FG+ EI+LSQIPDFDQI WLSI+AA+MSFTYS IGL LGI QV+ NG  KGSLTGISI
Sbjct  182   IMFGVAEIVLSQIPDFDQISWLSILAAIMSFTYSSIGLVLGIVQVIQNGGIKGSLTGISI  241

Query  1028  GTVTETQKIWRSFQALGDIAFAYSYSIILIEIQDTVK-SPPSESKTMRKASLFSTIVTTT  852
             GTV++  KIWRS QA GDIAFAYSYSIILIEIQDT+K SP SE+K M+KA+L S  VTT 
Sbjct  242   GTVSQMDKIWRSLQAFGDIAFAYSYSIILIEIQDTIKSSPSSEAKVMKKATLTSVTVTTI  301

Query  851   FYMLCGCMGYAAFGDDAPGNLLTGFGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAFI  672
             FYMLCGCMGYAAFGD APGNLLTGFGFYNP+WLLDIANAAIV+HLVGAYQVYCQPLFAFI
Sbjct  302   FYMLCGCMGYAAFGDLAPGNLLTGFGFYNPYWLLDIANAAIVVHLVGAYQVYCQPLFAFI  361

Query  671   EKWVGAKWPDSEIITKEINLKIPGFGYPYKLNTFRLLWRTAFVLLTTVISMLLPFFNDVV  492
             EKW    WP SE ITK+I + I   G  Y LN FRL WRT FV++TTV+SMLLPFFNDVV
Sbjct  362   EKWTLKTWPKSEFITKDIQVPIAS-GRCYNLNLFRLTWRTMFVIVTTVVSMLLPFFNDVV  420

Query  491   GILGAFGFWPLTVYFPVRMYISQKKIPKWSTRWICLQMlsgaclavslaaaagsfagvVL  312
             G LGA GFWPLTVYFPV MYI QKKIPKWSTRW+CLQ+LS ACL +++A+AAGS AGVV 
Sbjct  421   GFLGAIGFWPLTVYFPVEMYIVQKKIPKWSTRWVCLQLLSLACLVITVASAAGSVAGVVS  480

Query  311   DLKLYRPFKTS  279
             DLK+YRPFK+S
Sbjct  481   DLKVYRPFKSS  491



>ref|XP_009801366.1| PREDICTED: amino acid permease 3-like [Nicotiana sylvestris]
Length=481

 Score =   708 bits (1827),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 366/486 (75%), Positives = 412/486 (85%), Gaps = 5/486 (1%)
 Frame = -3

Query  1736  MQMGESAAATKNHRHHLGVSIDAPPLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSGV  1557
             M+MGE+      H+    VSI+       K  DDDGR +RTG+VWTASAHIITAVIGSGV
Sbjct  1     MKMGENNNVASKHQV-FDVSINVTES---KCFDDDGRLKRTGSVWTASAHIITAVIGSGV  56

Query  1556  LSLAWAIGQLGWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRNYTYMDAVRSNLG  1377
             LSLAWA+ QLGW+AGP VM+LFS V YYTS LLADCYR+GD V GKRNYTYMDAV++NLG
Sbjct  57    LSLAWAVAQLGWIAGPIVMILFSFVTYYTSALLADCYRSGDSVSGKRNYTYMDAVQANLG  116

Query  1376  GYQVKICGLIQYFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFG  1197
             G QVKICG IQY NLFG+AIGYTIA+SISM+AIKRSNCFH+ G + PC +SS PYMI FG
Sbjct  117   GLQVKICGWIQYANLFGVAIGYTIASSISMIAIKRSNCFHKHGDQAPCQVSSTPYMIMFG  176

Query  1196  IIEIILSQIPDFDQIWWLSIVAAVMSFTYSGIGLGLGIAQVVANGAFKGSLTGISIGTVT  1017
             IIEII SQIPDFDQIWWLSIVAAVMSFTYS IGLGLG+A+V   G   GSLTGISIGTVT
Sbjct  177   IIEIIFSQIPDFDQIWWLSIVAAVMSFTYSTIGLGLGVAKVAETGKIGGSLTGISIGTVT  236

Query  1016  ETQKIWRSFQALGDIAFAYSYSIILIEIQDTVKSPPSESKTMRKASLFSTIVTTTFYMLC  837
             E QKIW+SFQALG IAFAYSYS+ILIEIQDT+KSPPSESKTM+ A+L S  VTT FYMLC
Sbjct  237   EMQKIWKSFQALGAIAFAYSYSLILIEIQDTLKSPPSESKTMKNATLISVAVTTVFYMLC  296

Query  836   GCMGYAAFGDDAPGNLLTGFGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEKWVG  657
             GC GYAAFGD APGNLLTGFGFYNP+WLLDIAN AIV+HLVGAYQVYCQPLFAFIEK   
Sbjct  297   GCFGYAAFGDLAPGNLLTGFGFYNPYWLLDIANIAIVVHLVGAYQVYCQPLFAFIEKTAA  356

Query  656   AKWPDSEIITKEINLKIPGFGYPYKLNTFRLLWRTAFVLLTTVISMLLPFFNDVVGILGA  477
               +P+S+ I KEI++ I G+   +KLN FR++WRT FV++TTVISMLLPFFND+VGILGA
Sbjct  357   EWYPESKFIAKEISVPIIGYK-SFKLNLFRIIWRTIFVIITTVISMLLPFFNDIVGILGA  415

Query  476   FGFWPLTVYFPVRMYISQKKIPKWSTRWICLQMlsgaclavslaaaagsfagvVLDLKLY  297
             FGFWPLTVYFPV MYI QKKI KWST+WICLQMLS ACL +S+AAAAGSFAGVV DL++Y
Sbjct  416   FGFWPLTVYFPVEMYIVQKKITKWSTKWICLQMLSVACLIISIAAAAGSFAGVVSDLQVY  475

Query  296   RPFKTS  279
             +PFKT+
Sbjct  476   KPFKTT  481



>ref|XP_011002449.1| PREDICTED: amino acid permease 3-like [Populus euphratica]
Length=484

 Score =   706 bits (1822),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 357/485 (74%), Positives = 408/485 (84%), Gaps = 1/485 (0%)
 Frame = -3

Query  1730  MGESAAATKNHRHHLGVSIDAPPLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSGVLS  1551
             MGE    +        VSI        +  DDDGR +RTGTVWTASAHIITAVIGSGVLS
Sbjct  1     MGEPENTSAEKHQVFDVSIAMHQQGSSEWFDDDGRQKRTGTVWTASAHIITAVIGSGVLS  60

Query  1550  LAWAIGQLGWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRNYTYMDAVRSNLGGY  1371
             LAWAI QLGW+AGP+ M LFS V  YTS+LL+ CYR+GDP+ GKRNYTYMDAVRSNLGG 
Sbjct  61    LAWAIAQLGWIAGPAFMFLFSIVTCYTSSLLSVCYRSGDPLTGKRNYTYMDAVRSNLGGV  120

Query  1370  QVKICGLIQYFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFGII  1191
             +VKICG +QY NLFG+AIGYTIA+SISMMAIKRSNCFH+SGGKN C M++NPYMI FGI 
Sbjct  121   KVKICGFVQYLNLFGVAIGYTIASSISMMAIKRSNCFHKSGGKNSCRMNANPYMIGFGIA  180

Query  1190  EIILSQIPDFDQIWWLSIVAAVMSFTYSGIGLGLGIAQVVANGAFKGSLTGISIGTVTET  1011
             E +LSQIP FDQ+ WLS+VAAVMSFTYS IGLGLGI +V+ NG   GSLTG++IG VT T
Sbjct  181   ETLLSQIPGFDQLQWLSLVAAVMSFTYSSIGLGLGIGKVIENGKISGSLTGVAIGIVTPT  240

Query  1010  QKIWRSFQALGDIAFAYSYSIILIEIQDTVKSPPSESKTMRKASLFSTIVTTTFYMLCGC  831
             QK+WRSFQALGDIAFAYSYS+ILIEIQDTVKSPPSESKTMRKA+L S  VTT FYM CGC
Sbjct  241   QKVWRSFQALGDIAFAYSYSMILIEIQDTVKSPPSESKTMRKATLISVAVTTLFYMFCGC  300

Query  830   MGYAAFGDDAPGNLLTGFGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEKWVGAK  651
              GYAAFGD +PGNLLTGFGFYNP+WLLDIANAAIVIHLVGAYQV+CQPLFAF+EK   A+
Sbjct  301   FGYAAFGDMSPGNLLTGFGFYNPYWLLDIANAAIVIHLVGAYQVFCQPLFAFVEKEAAAR  360

Query  650   WPDSEIITKEINLKIPGFGYPYKLNTFRLLWRTAFVLLTTVISMLLPFFNDVVGILGAFG  471
             +PDSEIITK+I +  PGF  P+ +N FR++WRT FV+ TTVISMLLPFFND+VG+LGA G
Sbjct  361   FPDSEIITKDIKVAFPGF-RPFNINLFRMIWRTLFVIFTTVISMLLPFFNDIVGLLGALG  419

Query  470   FWPLTVYFPVRMYISQKKIPKWSTRWICLQMlsgaclavslaaaagsfagvVLDLKLYRP  291
             FWPLTVYFPV MYI+Q++IPKWSTRW+ L++LS ACL V++AAAAGS AGVV DLK  +P
Sbjct  420   FWPLTVYFPVEMYIAQRRIPKWSTRWLGLRVLSFACLIVTIAAAAGSIAGVVDDLKSIKP  479

Query  290   FKTSY  276
             F+TSY
Sbjct  480   FQTSY  484



>gb|EYU32509.1| hypothetical protein MIMGU_mgv1a005226mg [Erythranthe guttata]
Length=492

 Score =   706 bits (1821),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 368/495 (74%), Positives = 417/495 (84%), Gaps = 11/495 (2%)
 Frame = -3

Query  1736  MQMGESAAATKNHRHHL-GVSIDAPPLYG-FKGLDDDGRPQRTGTVWTASAHIITAVIGS  1563
             M M ESAA T   RH +  VS++ P   G  K  DDDGR +RTGTVWTASAHIITAVIGS
Sbjct  1     MTMSESAAGT---RHQVFDVSVNMPSQTGGSKCYDDDGRLKRTGTVWTASAHIITAVIGS  57

Query  1562  GVLSLAWAIGQLGWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRNYTYMDAVRSN  1383
             GVLSLAWA  QLGWVAGP+++ LFS V YYTS+LLA CYR GDP  GKRNYTYMDAVR+N
Sbjct  58    GVLSLAWATAQLGWVAGPTMLFLFSFVTYYTSSLLATCYRTGDPDTGKRNYTYMDAVRAN  117

Query  1382  LGGYQVKICGLIQYFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIA  1203
             LGG+QVK+CG IQY NLFG+AIGYTIAASIS+MAI+RSNCFH  G  +PC +SSNPYMIA
Sbjct  118   LGGFQVKVCGAIQYMNLFGVAIGYTIAASISLMAIERSNCFHSKGDNSPCRVSSNPYMIA  177

Query  1202  FGIIEIILSQIPDFDQIWWLSIVAAVMSFTYSGIGLGLGIAQVVANGAFKGSLTGISIGT  1023
             FG++EI+ SQIPDFDQI WLS++AAVMSFTYS IGLGLG+A+V  NG  +GS+TGISIGT
Sbjct  178   FGVVEIVFSQIPDFDQISWLSMLAAVMSFTYSSIGLGLGVAKVAENGKIRGSMTGISIGT  237

Query  1022  VTET------QKIWRSFQALGDIAFAYSYSIILIEIQDTVKSPPSESKTMRKASLFSTIV  861
             VT T      QKIWRSFQALG IAFAYSYS+ILIEIQDT+KSPPSE KTM+KA+L S IV
Sbjct  238   VTGTTRVTETQKIWRSFQALGAIAFAYSYSLILIEIQDTIKSPPSEHKTMKKATLLSVIV  297

Query  860   TTTFYMLCGCMGYAAFGDDAPGNLLTGFGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLF  681
             TT FYM CGC GYAAFGD +PGNLLTGFGF+NP+WLLDIANAAIVIHL+GAYQVYCQPLF
Sbjct  298   TTIFYMFCGCFGYAAFGDLSPGNLLTGFGFFNPYWLLDIANAAIVIHLIGAYQVYCQPLF  357

Query  680   AFIEKWVGAKWPDSEIITKEINLKIPGFGYPYKLNTFRLLWRTAFVLLTTVISMLLPFFN  501
             AF+EK     +P+S+ ITKEI++ IPGF    KLN FRL+WRT FV++TTVISML+PFFN
Sbjct  358   AFVEKTSAHYFPNSKFITKEISIPIPGFNRLLKLNLFRLVWRTIFVIVTTVISMLMPFFN  417

Query  500   DVVGILGAFGFWPLTVYFPVRMYISQKKIPKWSTRWICLQMlsgaclavslaaaagsfag  321
             DVVGILGAFGFWPLTVYFPV MYI Q +IPKWS RWICLQ+LS ACL +S+AA  GSFAG
Sbjct  418   DVVGILGAFGFWPLTVYFPVEMYIVQMRIPKWSPRWICLQILSMACLIISIAAGVGSFAG  477

Query  320   vVLDLKLYRPFKTSY  276
             VV DLK+Y+PFKTSY
Sbjct  478   VVTDLKVYKPFKTSY  492



>ref|XP_010911278.1| PREDICTED: amino acid permease 3-like isoform X1 [Elaeis guineensis]
Length=492

 Score =   705 bits (1819),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 361/491 (74%), Positives = 414/491 (84%), Gaps = 8/491 (2%)
 Frame = -3

Query  1733  QMGESAAATKNHRHH----LGVSIDAPPLYGF-KGLDDDGRPQRTGTVWTASAHIITAVI  1569
             +MGE+ AA K H+H     + V+I+     G  K  D+DGR +RTGTVWTAS+HIITAVI
Sbjct  3     KMGENGAA-KYHQHANFTPMEVAIELGHQQGSSKCFDNDGRLKRTGTVWTASSHIITAVI  61

Query  1568  GSGVLSLAWAIGQLGWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRNYTYMDAVR  1389
             GSGVLSLAWAIGQLGWVAGP+ MLLFS V YYTS LL+DCYR+GDP+ GKRNYTYMDAV 
Sbjct  62    GSGVLSLAWAIGQLGWVAGPAAMLLFSYVTYYTSALLSDCYRSGDPMTGKRNYTYMDAVH  121

Query  1388  SNLGGYQVKICGLIQYFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYM  1209
             +NL G++VKICG +QY N+FG++IGYTIAASISM+AIKRSNCFHE G KNPC  SSNPYM
Sbjct  122   ANLNGFKVKICGFLQYANIFGVSIGYTIAASISMLAIKRSNCFHEKGHKNPCQASSNPYM  181

Query  1208  IAFGIIEIILSQIPDFDQIWWLSIVAAVMSFTYSGIGLGLGIAQVVANGAFKGSLTGISI  1029
             I FG+ EI+ SQIPDFDQIWWLSI+AA+MSFTYS IGL LGI QV+ NG  KGSLTGISI
Sbjct  182   IMFGVAEILFSQIPDFDQIWWLSILAAIMSFTYSSIGLALGIVQVIQNGGIKGSLTGISI  241

Query  1028  GTVTETQKIWRSFQALGDIAFAYSYSIILIEIQDTVK-SPPSESKTMRKASLFSTIVTTT  852
               V+ T K+WRS QA GDIAFAYSYS+ILIEIQDT+K +PPSE+K M++A+L S  VTT 
Sbjct  242   AVVSPTDKVWRSLQAFGDIAFAYSYSLILIEIQDTIKEAPPSEAKVMKRATLLSVAVTTI  301

Query  851   FYMLCGCMGYAAFGDDAPGNLLTGFGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAFI  672
             FYMLCGCMGYAAFGD APGNLLTGFGFY+P+WLLDIANAAIVIHLVGAYQVYCQPLFAF+
Sbjct  302   FYMLCGCMGYAAFGDMAPGNLLTGFGFYDPYWLLDIANAAIVIHLVGAYQVYCQPLFAFV  361

Query  671   EKWVGAKWPDSEIITKEINLKIPGFGYPYKLNTFRLLWRTAFVLLTTVISMLLPFFNDVV  492
             EKW    WPDS+ ITKE+ + + G    Y+LN  RL WRT FV+ TTVISMLLPFFNDVV
Sbjct  362   EKWALQTWPDSKFITKEVEVPL-GPSRCYRLNPLRLTWRTLFVICTTVISMLLPFFNDVV  420

Query  491   GILGAFGFWPLTVYFPVRMYISQKKIPKWSTRWICLQMlsgaclavslaaaagsfagvVL  312
             G+LGA GFWPLTVYFPV MYI QKK+PKWST+W+CLQ+LS ACLA+S+AAAAGS AGVV 
Sbjct  421   GLLGALGFWPLTVYFPVEMYIVQKKVPKWSTKWVCLQLLSMACLAISVAAAAGSIAGVVN  480

Query  311   DLKLYRPFKTS  279
             DLK+Y+PFKTS
Sbjct  481   DLKVYQPFKTS  491



>ref|XP_010911284.1| PREDICTED: amino acid permease 3-like isoform X2 [Elaeis guineensis]
Length=489

 Score =   704 bits (1818),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 361/490 (74%), Positives = 413/490 (84%), Gaps = 8/490 (2%)
 Frame = -3

Query  1730  MGESAAATKNHRHH----LGVSIDAPPLYGF-KGLDDDGRPQRTGTVWTASAHIITAVIG  1566
             MGE+ AA K H+H     + V+I+     G  K  D+DGR +RTGTVWTAS+HIITAVIG
Sbjct  1     MGENGAA-KYHQHANFTPMEVAIELGHQQGSSKCFDNDGRLKRTGTVWTASSHIITAVIG  59

Query  1565  SGVLSLAWAIGQLGWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRNYTYMDAVRS  1386
             SGVLSLAWAIGQLGWVAGP+ MLLFS V YYTS LL+DCYR+GDP+ GKRNYTYMDAV +
Sbjct  60    SGVLSLAWAIGQLGWVAGPAAMLLFSYVTYYTSALLSDCYRSGDPMTGKRNYTYMDAVHA  119

Query  1385  NLGGYQVKICGLIQYFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMI  1206
             NL G++VKICG +QY N+FG++IGYTIAASISM+AIKRSNCFHE G KNPC  SSNPYMI
Sbjct  120   NLNGFKVKICGFLQYANIFGVSIGYTIAASISMLAIKRSNCFHEKGHKNPCQASSNPYMI  179

Query  1205  AFGIIEIILSQIPDFDQIWWLSIVAAVMSFTYSGIGLGLGIAQVVANGAFKGSLTGISIG  1026
              FG+ EI+ SQIPDFDQIWWLSI+AA+MSFTYS IGL LGI QV+ NG  KGSLTGISI 
Sbjct  180   MFGVAEILFSQIPDFDQIWWLSILAAIMSFTYSSIGLALGIVQVIQNGGIKGSLTGISIA  239

Query  1025  TVTETQKIWRSFQALGDIAFAYSYSIILIEIQDTVK-SPPSESKTMRKASLFSTIVTTTF  849
              V+ T K+WRS QA GDIAFAYSYS+ILIEIQDT+K +PPSE+K M++A+L S  VTT F
Sbjct  240   VVSPTDKVWRSLQAFGDIAFAYSYSLILIEIQDTIKEAPPSEAKVMKRATLLSVAVTTIF  299

Query  848   YMLCGCMGYAAFGDDAPGNLLTGFGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAFIE  669
             YMLCGCMGYAAFGD APGNLLTGFGFY+P+WLLDIANAAIVIHLVGAYQVYCQPLFAF+E
Sbjct  300   YMLCGCMGYAAFGDMAPGNLLTGFGFYDPYWLLDIANAAIVIHLVGAYQVYCQPLFAFVE  359

Query  668   KWVGAKWPDSEIITKEINLKIPGFGYPYKLNTFRLLWRTAFVLLTTVISMLLPFFNDVVG  489
             KW    WPDS+ ITKE+ + + G    Y+LN  RL WRT FV+ TTVISMLLPFFNDVVG
Sbjct  360   KWALQTWPDSKFITKEVEVPL-GPSRCYRLNPLRLTWRTLFVICTTVISMLLPFFNDVVG  418

Query  488   ILGAFGFWPLTVYFPVRMYISQKKIPKWSTRWICLQMlsgaclavslaaaagsfagvVLD  309
             +LGA GFWPLTVYFPV MYI QKK+PKWST+W+CLQ+LS ACLA+S+AAAAGS AGVV D
Sbjct  419   LLGALGFWPLTVYFPVEMYIVQKKVPKWSTKWVCLQLLSMACLAISVAAAAGSIAGVVND  478

Query  308   LKLYRPFKTS  279
             LK+Y+PFKTS
Sbjct  479   LKVYQPFKTS  488



>ref|XP_006365537.1| PREDICTED: amino acid permease 3-like [Solanum tuberosum]
Length=473

 Score =   704 bits (1816),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 358/457 (78%), Positives = 404/457 (88%), Gaps = 2/457 (0%)
 Frame = -3

Query  1649  KGLDDDGRPQRTGTVWTASAHIITAVIGSGVLSLAWAIGQLGWVAGPSVMLLFSCVVYYT  1470
             K  DDDGR +RTG+VWTASAHIITAVIGSGVLSLAWA  QLGWVAGP+V+LLFS V YYT
Sbjct  18    KCFDDDGRIKRTGSVWTASAHIITAVIGSGVLSLAWATAQLGWVAGPTVLLLFSFVTYYT  77

Query  1469  STLLADCYRAGDPVFGKRNYTYMDAVRSNLGGYQVKICGLIQYFNLFGIAIGYTIAASIS  1290
             S LL+DCYR GDPV GKRNYTYMDAVR+NLGG+QVKICG+IQY NLFG+AIGYTIAASIS
Sbjct  78    SALLSDCYRTGDPVTGKRNYTYMDAVRANLGGFQVKICGVIQYANLFGVAIGYTIAASIS  137

Query  1289  MMAIKRSNCFHESGGKNPCHMSSNPYMIAFGIIEIILSQIPDFDQIWWLSIVAAVMSFTY  1110
             M+A+ RSNCFH+ G +  C++SS PYMI FG++EII SQIPDFDQI WLSIVAAVMSFTY
Sbjct  138   MVAVNRSNCFHKQGHRAACNVSSTPYMIIFGVMEIIFSQIPDFDQISWLSIVAAVMSFTY  197

Query  1109  SGIGLGLGIAQVVANGAFKGSLTGISIGT-VTETQKIWRSFQALGDIAFAYSYSIILIEI  933
             S IGLGLG+AQV   G  +GSLTGISIGT VTE QKIWRSFQALG IAFAYSYS+ILIEI
Sbjct  198   STIGLGLGVAQVAETGKIEGSLTGISIGTEVTEMQKIWRSFQALGAIAFAYSYSLILIEI  257

Query  932   QDTVKSPPSESKTMRKASLFSTIVTTTFYMLCGCMGYAAFGDDAPGNLLTGFGFYNPFWL  753
             QDT+KSPP+E+KTM++A+L S  VTT FYMLCGC GYAAFGD +PGNLLTGFGFYNP+WL
Sbjct  258   QDTLKSPPAEAKTMKRATLISVAVTTVFYMLCGCFGYAAFGDQSPGNLLTGFGFYNPYWL  317

Query  752   LDIANAAIVIHLVGAYQVYCQPLFAFIEKWVGAKWPDSEIITKEINLKIPGFGYPYKLNT  573
             LDIAN AIV+HLVGAYQVYCQPLFAF+EK     +PDS+IITKEI++ IPGF  P+KLN 
Sbjct  318   LDIANVAIVVHLVGAYQVYCQPLFAFVEKTATEWYPDSKIITKEIDVPIPGFK-PFKLNL  376

Query  572   FRLLWRTAFVLLTTVISMLLPFFNDVVGILGAFGFWPLTVYFPVRMYISQKKIPKWSTRW  393
             FRL+WRT FV++TTVISML+PFFNDVVGILGAFGFWPLTVYFPV MYI QK+I KWS RW
Sbjct  377   FRLVWRTIFVIITTVISMLMPFFNDVVGILGAFGFWPLTVYFPVEMYIVQKRITKWSGRW  436

Query  392   ICLQMlsgaclavslaaaagsfagvVLDLKLYRPFKT  282
             ICLQ+LSGACL +S+AAAAGSFAGV  DLK+YRPF++
Sbjct  437   ICLQILSGACLVISIAAAAGSFAGVASDLKVYRPFQS  473



>ref|XP_009767545.1| PREDICTED: amino acid permease 3-like [Nicotiana sylvestris]
Length=480

 Score =   704 bits (1817),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 360/475 (76%), Positives = 410/475 (86%), Gaps = 2/475 (0%)
 Frame = -3

Query  1703  NHRHHLGVSIDAPPLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSGVLSLAWAIGQLG  1524
             ++ HH    + A      K  DDDGR +R+G+VWTASAHIITAVIGSGVLSLAWA  QLG
Sbjct  5     DNNHHQVFDVSANGYGESKCFDDDGRLKRSGSVWTASAHIITAVIGSGVLSLAWATAQLG  64

Query  1523  WVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRNYTYMDAVRSNLGGYQVKICGLIQ  1344
             WVAGP+V+LLFS V YYTS LLADCYR+GD V GKRNYTYMDAVR+NLGG QVKICG+IQ
Sbjct  65    WVAGPAVLLLFSFVTYYTSALLADCYRSGDQVSGKRNYTYMDAVRANLGGLQVKICGVIQ  124

Query  1343  YFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFGIIEIILSQIPD  1164
             Y NLFG+A+GYTIA+SISMMA+KRS+CFH+ G +  C++SS PYMI FG++EI+ SQIPD
Sbjct  125   YVNLFGVAVGYTIASSISMMAVKRSDCFHKHGHRAACNVSSTPYMIMFGVMEILFSQIPD  184

Query  1163  FDQIWWLSIVAAVMSFTYSGIGLGLGIAQVVANGAFKGSLTGISIGT-VTETQKIWRSFQ  987
             FDQIWWLSIVAAVMSFTYS IGLGLG+AQV   G  +GSLTGISIGT VTE QKIWRSFQ
Sbjct  185   FDQIWWLSIVAAVMSFTYSTIGLGLGVAQVAETGKIQGSLTGISIGTEVTEMQKIWRSFQ  244

Query  986   ALGDIAFAYSYSIILIEIQDTVKSPPSESKTMRKASLFSTIVTTTFYMLCGCMGYAAFGD  807
             ALG IAFAYSYS+ILIEIQDT+K+PPSE+KTM+KA+L S  VTT FYMLCGC GYAAFGD
Sbjct  245   ALGAIAFAYSYSLILIEIQDTLKAPPSEAKTMKKATLLSVAVTTVFYMLCGCFGYAAFGD  304

Query  806   DAPGNLLTGFGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEKWVGAKWPDSEIIT  627
              +PGNLLTGFGFYNP+WLLDIAN AIV+HLVGAYQVYCQPLFAF+EK     +P ++ IT
Sbjct  305   QSPGNLLTGFGFYNPYWLLDIANVAIVVHLVGAYQVYCQPLFAFVEKTAFEWYPSNKFIT  364

Query  626   KEINLKIPGFGYPYKLNTFRLLWRTAFVLLTTVISMLLPFFNDVVGILGAFGFWPLTVYF  447
             KE+++ IPGF  P+KLN FRL+WRT FV++TTVISML+PFFNDVVGILGAFGFWPLTVYF
Sbjct  365   KELDVPIPGFK-PFKLNLFRLVWRTIFVIITTVISMLMPFFNDVVGILGAFGFWPLTVYF  423

Query  446   PVRMYISQKKIPKWSTRWICLQMlsgaclavslaaaagsfagvVLDLKLYRPFKT  282
             PV MYI QKKIPKWS RWI LQ+LSGACL +S+AAAAGSFAGVV DLK+YRPFKT
Sbjct  424   PVEMYIVQKKIPKWSARWISLQILSGACLVISIAAAAGSFAGVVSDLKVYRPFKT  478



>ref|XP_011003419.1| PREDICTED: amino acid permease 3-like [Populus euphratica]
Length=484

 Score =   704 bits (1817),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 356/485 (73%), Positives = 407/485 (84%), Gaps = 1/485 (0%)
 Frame = -3

Query  1730  MGESAAATKNHRHHLGVSIDAPPLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSGVLS  1551
             MGE    +        VSI        +  DDDGR +RTGTVWTASAHIITAVIGSGVLS
Sbjct  1     MGEPENTSAEKHQVFDVSIAMHQQGSSEWFDDDGRQKRTGTVWTASAHIITAVIGSGVLS  60

Query  1550  LAWAIGQLGWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRNYTYMDAVRSNLGGY  1371
             LAWAI QLGW+AGP+ M LFS V  YTS+LL+ CYR+GDP+ GKRNYTYMDAVRSNLGG 
Sbjct  61    LAWAIAQLGWIAGPAFMFLFSIVTCYTSSLLSVCYRSGDPLTGKRNYTYMDAVRSNLGGV  120

Query  1370  QVKICGLIQYFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFGII  1191
             +VKICG +QY NLFG+A GYTIA+SISMMAIKRSNCFH+SGGKN C M++NPYMI FGI 
Sbjct  121   KVKICGFVQYLNLFGVAFGYTIASSISMMAIKRSNCFHKSGGKNSCRMNANPYMIGFGIA  180

Query  1190  EIILSQIPDFDQIWWLSIVAAVMSFTYSGIGLGLGIAQVVANGAFKGSLTGISIGTVTET  1011
             E +LSQIP FDQ+ WLS+VAAVMSFTYS IGLGLGI +V+ NG   GSLTG++IG VT T
Sbjct  181   ETLLSQIPGFDQLQWLSLVAAVMSFTYSSIGLGLGIGKVIENGKISGSLTGVAIGIVTPT  240

Query  1010  QKIWRSFQALGDIAFAYSYSIILIEIQDTVKSPPSESKTMRKASLFSTIVTTTFYMLCGC  831
             QK+WRSFQALGDIAFAYSYS+ILIEIQDTVKSPPSESKTMRKA+L S  VTT FYM CGC
Sbjct  241   QKVWRSFQALGDIAFAYSYSMILIEIQDTVKSPPSESKTMRKATLISVAVTTLFYMFCGC  300

Query  830   MGYAAFGDDAPGNLLTGFGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEKWVGAK  651
              GYAAFGD +PGNLLTGFGFYNP+WLLDIANAAIVIHLVGAYQV+CQPLFAF+EK   A+
Sbjct  301   FGYAAFGDMSPGNLLTGFGFYNPYWLLDIANAAIVIHLVGAYQVFCQPLFAFVEKEAAAR  360

Query  650   WPDSEIITKEINLKIPGFGYPYKLNTFRLLWRTAFVLLTTVISMLLPFFNDVVGILGAFG  471
             +PDSEIITK+I +  PGF  P+ +N FR++WRT FV+ TTVISMLLPFFND+VG+LGA G
Sbjct  361   FPDSEIITKDIKVAFPGF-RPFNINLFRMIWRTLFVIFTTVISMLLPFFNDIVGLLGALG  419

Query  470   FWPLTVYFPVRMYISQKKIPKWSTRWICLQMlsgaclavslaaaagsfagvVLDLKLYRP  291
             FWPLTVYFPV MYI+Q++IPKWSTRW+ L++LS ACL V++AAAAGS AGVV DLK  +P
Sbjct  420   FWPLTVYFPVEMYIAQRRIPKWSTRWLGLRVLSFACLIVTIAAAAGSIAGVVDDLKSIKP  479

Query  290   FKTSY  276
             F+TSY
Sbjct  480   FQTSY  484



>gb|AII99817.1| amino acid transporter [Nicotiana tabacum]
Length=479

 Score =   703 bits (1814),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 361/474 (76%), Positives = 408/474 (86%), Gaps = 1/474 (0%)
 Frame = -3

Query  1703  NHRHHLGVSIDAPPLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSGVLSLAWAIGQLG  1524
             ++ HH    + A      K  DDDGR +R+G+VWTASAHIITAVIGSGVLSLAWA  QLG
Sbjct  5     DNNHHQVFDVSANGYGESKCFDDDGRLKRSGSVWTASAHIITAVIGSGVLSLAWATAQLG  64

Query  1523  WVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRNYTYMDAVRSNLGGYQVKICGLIQ  1344
             W+AGP+V+LLFS V YYTS LLADCYR+GD V GKRNYTYMDAVR+NLGG QVKICG+IQ
Sbjct  65    WIAGPTVLLLFSFVTYYTSALLADCYRSGDQVSGKRNYTYMDAVRANLGGLQVKICGVIQ  124

Query  1343  YFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFGIIEIILSQIPD  1164
             Y NLFG+A+GYTIA+SISMMA+KRS+CFH+ G +  C++SS PYMI FGIIEII SQIPD
Sbjct  125   YVNLFGVAVGYTIASSISMMAVKRSDCFHKHGHRAACNVSSTPYMIMFGIIEIIFSQIPD  184

Query  1163  FDQIWWLSIVAAVMSFTYSGIGLGLGIAQVVANGAFKGSLTGISIGTVTETQKIWRSFQA  984
             FDQIWWLSIVAAVMSFTYS IGLGLG+A+V   G   GSLTGISIGTVTE QKIW+SFQA
Sbjct  185   FDQIWWLSIVAAVMSFTYSTIGLGLGVAKVAETGKIGGSLTGISIGTVTEMQKIWKSFQA  244

Query  983   LGDIAFAYSYSIILIEIQDTVKSPPSESKTMRKASLFSTIVTTTFYMLCGCMGYAAFGDD  804
             LG IAFAYSYS+ILIEIQDT+KSPPSESKTM+ A+L S  VTT FYMLCGC GYAAFGD 
Sbjct  245   LGAIAFAYSYSLILIEIQDTLKSPPSESKTMKNATLISVAVTTVFYMLCGCFGYAAFGDL  304

Query  803   APGNLLTGFGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEKWVGAKWPDSEIITK  624
             APGNLLTGFGFYNP+WLLDIAN AIV+HLVGAYQVYCQPLFAF+EK     +P ++ ITK
Sbjct  305   APGNLLTGFGFYNPYWLLDIANIAIVVHLVGAYQVYCQPLFAFVEKTAFEWYPSNKFITK  364

Query  623   EINLKIPGFGYPYKLNTFRLLWRTAFVLLTTVISMLLPFFNDVVGILGAFGFWPLTVYFP  444
             +I++ IPG+  P+KLN FRL+WRT FV++TTVISML+PFFNDVVGILGAFGFWPLTVYFP
Sbjct  365   DIDVPIPGYK-PFKLNLFRLVWRTIFVIITTVISMLMPFFNDVVGILGAFGFWPLTVYFP  423

Query  443   VRMYISQKKIPKWSTRWICLQMlsgaclavslaaaagsfagvVLDLKLYRPFKT  282
             V MYI QKKIPKWS RWI LQ+LSGACL +S+AAAAGSFAGVV DLK+YRPFKT
Sbjct  424   VEMYIVQKKIPKWSARWISLQILSGACLVISIAAAAGSFAGVVSDLKVYRPFKT  477



>gb|EYU32508.1| hypothetical protein MIMGU_mgv1a005226mg [Erythranthe guttata]
Length=490

 Score =   703 bits (1815),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 367/493 (74%), Positives = 416/493 (84%), Gaps = 11/493 (2%)
 Frame = -3

Query  1730  MGESAAATKNHRHHL-GVSIDAPPLYG-FKGLDDDGRPQRTGTVWTASAHIITAVIGSGV  1557
             M ESAA T   RH +  VS++ P   G  K  DDDGR +RTGTVWTASAHIITAVIGSGV
Sbjct  1     MSESAAGT---RHQVFDVSVNMPSQTGGSKCYDDDGRLKRTGTVWTASAHIITAVIGSGV  57

Query  1556  LSLAWAIGQLGWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRNYTYMDAVRSNLG  1377
             LSLAWA  QLGWVAGP+++ LFS V YYTS+LLA CYR GDP  GKRNYTYMDAVR+NLG
Sbjct  58    LSLAWATAQLGWVAGPTMLFLFSFVTYYTSSLLATCYRTGDPDTGKRNYTYMDAVRANLG  117

Query  1376  GYQVKICGLIQYFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFG  1197
             G+QVK+CG IQY NLFG+AIGYTIAASIS+MAI+RSNCFH  G  +PC +SSNPYMIAFG
Sbjct  118   GFQVKVCGAIQYMNLFGVAIGYTIAASISLMAIERSNCFHSKGDNSPCRVSSNPYMIAFG  177

Query  1196  IIEIILSQIPDFDQIWWLSIVAAVMSFTYSGIGLGLGIAQVVANGAFKGSLTGISIGTVT  1017
             ++EI+ SQIPDFDQI WLS++AAVMSFTYS IGLGLG+A+V  NG  +GS+TGISIGTVT
Sbjct  178   VVEIVFSQIPDFDQISWLSMLAAVMSFTYSSIGLGLGVAKVAENGKIRGSMTGISIGTVT  237

Query  1016  ET------QKIWRSFQALGDIAFAYSYSIILIEIQDTVKSPPSESKTMRKASLFSTIVTT  855
              T      QKIWRSFQALG IAFAYSYS+ILIEIQDT+KSPPSE KTM+KA+L S IVTT
Sbjct  238   GTTRVTETQKIWRSFQALGAIAFAYSYSLILIEIQDTIKSPPSEHKTMKKATLLSVIVTT  297

Query  854   TFYMLCGCMGYAAFGDDAPGNLLTGFGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAF  675
              FYM CGC GYAAFGD +PGNLLTGFGF+NP+WLLDIANAAIVIHL+GAYQVYCQPLFAF
Sbjct  298   IFYMFCGCFGYAAFGDLSPGNLLTGFGFFNPYWLLDIANAAIVIHLIGAYQVYCQPLFAF  357

Query  674   IEKWVGAKWPDSEIITKEINLKIPGFGYPYKLNTFRLLWRTAFVLLTTVISMLLPFFNDV  495
             +EK     +P+S+ ITKEI++ IPGF    KLN FRL+WRT FV++TTVISML+PFFNDV
Sbjct  358   VEKTSAHYFPNSKFITKEISIPIPGFNRLLKLNLFRLVWRTIFVIVTTVISMLMPFFNDV  417

Query  494   VGILGAFGFWPLTVYFPVRMYISQKKIPKWSTRWICLQMlsgaclavslaaaagsfagvV  315
             VGILGAFGFWPLTVYFPV MYI Q +IPKWS RWICLQ+LS ACL +S+AA  GSFAGVV
Sbjct  418   VGILGAFGFWPLTVYFPVEMYIVQMRIPKWSPRWICLQILSMACLIISIAAGVGSFAGVV  477

Query  314   LDLKLYRPFKTSY  276
              DLK+Y+PFKTSY
Sbjct  478   TDLKVYKPFKTSY  490



>gb|KDP29639.1| hypothetical protein JCGZ_18801 [Jatropha curcas]
Length=522

 Score =   704 bits (1817),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 355/495 (72%), Positives = 411/495 (83%), Gaps = 8/495 (2%)
 Frame = -3

Query  1742  KIMQMGESAAATKNHRHHLGVSIDAPPLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGS  1563
             ++  + +S     N   +   +I+  P Y  K  DDDGR +RTGT WTA++HIITAVIGS
Sbjct  30    EVQPVAKSTRNNPNPNENGSEAINPQPNYS-KCFDDDGRLKRTGTFWTAASHIITAVIGS  88

Query  1562  GVLSLAWAIGQLGWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRNYTYMDAVRSN  1383
             GVLSLAWAIGQLGWVAGP+VMLLF+ V  YTS LLA CYR GDPV G RNYTYMDAV++N
Sbjct  89    GVLSLAWAIGQLGWVAGPAVMLLFAFVNLYTSNLLAQCYRTGDPVKGHRNYTYMDAVKAN  148

Query  1382  LGGYQVKICGLIQYFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIA  1203
             LGG +V  CGLIQY NLFG+AIGYTIAAS+SMMAIKRSNCFH SGGK+PCHMSSN YMIA
Sbjct  149   LGGKKVFFCGLIQYLNLFGVAIGYTIAASVSMMAIKRSNCFHASGGKDPCHMSSNGYMIA  208

Query  1202  FGIIEIILSQIPDFDQIWWLSIVAAVMSFTYSGIGLGLGIAQVVANGAFKGSLTGISIGT  1023
             FGI E+I SQIPDFDQIWWLSIVAA+MSFTYS +GLGLGI +V  NGA KGSLTGISIGT
Sbjct  209   FGITEVIFSQIPDFDQIWWLSIVAAIMSFTYSTVGLGLGIGKVAGNGAVKGSLTGISIGT  268

Query  1022  VTE------TQKIWRSFQALGDIAFAYSYSIILIEIQDTVKSPPSESKTMRKASLFSTIV  861
             VT       TQK+WRSFQALG IAFAYSYS+ILIEIQDTVKSPP+E KTM+KA+ FS  V
Sbjct  269   VTHAGLVTATQKLWRSFQALGAIAFAYSYSVILIEIQDTVKSPPAEYKTMKKATTFSIAV  328

Query  860   TTTFYMLCGCMGYAAFGDDAPGNLLTGFGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLF  681
             TT FY+LCGCMGYAAFGD APGNLLTGFGFYNP+WLLDIAN AI++HLVGAYQVYCQPLF
Sbjct  329   TTIFYLLCGCMGYAAFGDSAPGNLLTGFGFYNPYWLLDIANIAIIVHLVGAYQVYCQPLF  388

Query  680   AFIEKWVGAKWPDSEIITKEINLKIPGFGYPYKLNTFRLLWRTAFVLLTTVISMLLPFFN  501
             AF+EKW   KWP ++ +T E  + IP  G  Y+LN FR++WR+ FV++TT+I+ML+PFFN
Sbjct  389   AFVEKWSAHKWPKNDFVTAEYEIPIPHCGV-YRLNFFRIVWRSIFVIVTTLIAMLMPFFN  447

Query  500   DVVGILGAFGFWPLTVYFPVRMYISQKKIPKWSTRWICLQMlsgaclavslaaaagsfag  321
             D+VG+LGA GFWPLTVYFP+ MYISQKKI +W++RWI LQ+LS  CL +++AAA GS AG
Sbjct  448   DIVGLLGALGFWPLTVYFPIEMYISQKKIGQWTSRWIALQILSVCCLFITIAAAVGSVAG  507

Query  320   vVLDLKLYRPFKTSY  276
             VVLDLK Y+PFKTSY
Sbjct  508   VVLDLKTYKPFKTSY  522



>ref|XP_010322323.1| PREDICTED: amino acid transporter isoform X1 [Solanum lycopersicum]
Length=473

 Score =   702 bits (1811),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 358/457 (78%), Positives = 404/457 (88%), Gaps = 2/457 (0%)
 Frame = -3

Query  1649  KGLDDDGRPQRTGTVWTASAHIITAVIGSGVLSLAWAIGQLGWVAGPSVMLLFSCVVYYT  1470
             K  DDDGR +RTG+VWTASAHIITAVIGSGVLSLAWA  QLGWVAGP+V+LLFS V YYT
Sbjct  18    KCFDDDGRIKRTGSVWTASAHIITAVIGSGVLSLAWATAQLGWVAGPTVLLLFSFVTYYT  77

Query  1469  STLLADCYRAGDPVFGKRNYTYMDAVRSNLGGYQVKICGLIQYFNLFGIAIGYTIAASIS  1290
             S LL+DCYR GDPV GKRNYTYMDAVR+NLGG+QVKICG+IQY NLFG+AIGYTIA+SIS
Sbjct  78    SALLSDCYRTGDPVTGKRNYTYMDAVRANLGGFQVKICGVIQYANLFGVAIGYTIASSIS  137

Query  1289  MMAIKRSNCFHESGGKNPCHMSSNPYMIAFGIIEIILSQIPDFDQIWWLSIVAAVMSFTY  1110
             M+A+ RSNCFH+ G    C++SS PYMI FG++EII SQIPDFDQI WLSIVAAVMSFTY
Sbjct  138   MVAVNRSNCFHKQGHHAACNVSSTPYMIMFGVMEIIFSQIPDFDQISWLSIVAAVMSFTY  197

Query  1109  SGIGLGLGIAQVVANGAFKGSLTGISIGT-VTETQKIWRSFQALGDIAFAYSYSIILIEI  933
             S IGLGLG+AQV   G  +GSLTGISIGT VTE QKIWRSFQALG IAFAYSYS+ILIEI
Sbjct  198   STIGLGLGVAQVAETGKIEGSLTGISIGTEVTEMQKIWRSFQALGAIAFAYSYSLILIEI  257

Query  932   QDTVKSPPSESKTMRKASLFSTIVTTTFYMLCGCMGYAAFGDDAPGNLLTGFGFYNPFWL  753
             QDT+KSPP+E+KTM++A+L S  VTT FYMLCGC GYAAFGD +PGNLLTGFGFYNP+WL
Sbjct  258   QDTLKSPPAEAKTMKRATLISVAVTTVFYMLCGCFGYAAFGDQSPGNLLTGFGFYNPYWL  317

Query  752   LDIANAAIVIHLVGAYQVYCQPLFAFIEKWVGAKWPDSEIITKEINLKIPGFGYPYKLNT  573
             LDIAN AIV+HLVGAYQVYCQPLFAF+EK     +PDS+IITKEI++ IPGF  P+KLN 
Sbjct  318   LDIANIAIVVHLVGAYQVYCQPLFAFVEKTAAEWYPDSKIITKEIDVPIPGFK-PFKLNL  376

Query  572   FRLLWRTAFVLLTTVISMLLPFFNDVVGILGAFGFWPLTVYFPVRMYISQKKIPKWSTRW  393
             FRL+WRT FV++TTVISML+PFFNDVVGILGAFGFWPLTVYFPV MYI QK+I KWS RW
Sbjct  377   FRLVWRTIFVIITTVISMLMPFFNDVVGILGAFGFWPLTVYFPVEMYIVQKRITKWSARW  436

Query  392   ICLQMlsgaclavslaaaagsfagvVLDLKLYRPFKT  282
             ICLQ+LSGACL +S+AAAAGSFAGVV DLK+YRPF++
Sbjct  437   ICLQILSGACLVISIAAAAGSFAGVVSDLKVYRPFQS  473



>ref|XP_007137459.1| hypothetical protein PHAVU_009G128500g [Phaseolus vulgaris]
 gb|ESW09453.1| hypothetical protein PHAVU_009G128500g [Phaseolus vulgaris]
Length=487

 Score =   702 bits (1812),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 344/487 (71%), Positives = 410/487 (84%), Gaps = 3/487 (1%)
 Frame = -3

Query  1730  MGESAAATKNHRHHLGVSIDAPPLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSGVLS  1551
             +G     ++  +    VS+D       K  DDDGRP+RTGTVWTASAHIITAVIGSGVLS
Sbjct  2     VGMDGHGSRYDQQTFNVSLDMHEQGDSKCFDDDGRPKRTGTVWTASAHIITAVIGSGVLS  61

Query  1550  LAWAIGQLGWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRNYTYMDAVRSNLGG-  1374
             LAWAI QLGW+AGP+VMLLFS + Y+TS LL DCYR GDP+ GKRNYTYMDA+RSN GG 
Sbjct  62    LAWAIAQLGWIAGPAVMLLFSAITYFTSLLLTDCYRTGDPLTGKRNYTYMDAIRSNFGGN  121

Query  1373  -YQVKICGLIQYFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFG  1197
              ++VK+CGL+QY NLFGI+IGYTIAASISMMAI+RSNCFH+SGGKNPC M+SN YMI+FG
Sbjct  122   GFKVKMCGLVQYVNLFGISIGYTIAASISMMAIERSNCFHKSGGKNPCRMNSNMYMISFG  181

Query  1196  IIEIILSQIPDFDQIWWLSIVAAVMSFTYSGIGLGLGIAQVVANGAFKGSLTGISIGTVT  1017
             I+EII SQIP FDQ+WWLS VAAVMSFTYS IGLGLG+ +V+ N    GSLTGI++G VT
Sbjct  182   IVEIIFSQIPGFDQLWWLSFVAAVMSFTYSTIGLGLGVGKVIENRKVGGSLTGITVGHVT  241

Query  1016  ETQKIWRSFQALGDIAFAYSYSIILIEIQDTVKSPPSESKTMRKASLFSTIVTTTFYMLC  837
             +T K+WR+ QALGDIAFA+SYS +LIEIQDTVKSPPS SKTM+KA+L    VTT FYMLC
Sbjct  242   QTNKVWRTMQALGDIAFAFSYSFVLIEIQDTVKSPPSASKTMKKAALNGVAVTTFFYMLC  301

Query  836   GCMGYAAFGDDAPGNLLTGFGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEKWVG  657
             GC GYAAFGD +PGNLLTGFGFYNP+WLLDIANAAIVIHLVG+YQVY QP+FAF+EK V 
Sbjct  302   GCFGYAAFGDLSPGNLLTGFGFYNPYWLLDIANAAIVIHLVGSYQVYSQPIFAFVEKNVA  361

Query  656   AKWPDSEIITKEINLKIPGFGYPYKLNTFRLLWRTAFVLLTTVISMLLPFFNDVVGILGA  477
             +++PDS+ + KEI + +PGF +PY+LN FRL+WRT +V+L+TVI+MLLPFFND+ G+LGA
Sbjct  362   SRFPDSDFVNKEIEIGVPGF-HPYRLNLFRLIWRTIYVVLSTVIAMLLPFFNDIGGLLGA  420

Query  476   FGFWPLTVYFPVRMYISQKKIPKWSTRWICLQMlsgaclavslaaaagsfagvVLDLKLY  297
             FGFWPLTVYFPV MYI QK+IPKWS++WICLQ LS ACL +++ A  GS AG ++DLK Y
Sbjct  421   FGFWPLTVYFPVEMYIIQKRIPKWSSKWICLQTLSIACLLMTIGAGVGSVAGTLIDLKSY  480

Query  296   RPFKTSY  276
             +PFKT+Y
Sbjct  481   KPFKTNY  487



>gb|KEH40510.1| transmembrane amino acid transporter family protein [Medicago 
truncatula]
Length=483

 Score =   702 bits (1811),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 353/486 (73%), Positives = 407/486 (84%), Gaps = 4/486 (1%)
 Frame = -3

Query  1730  MGESAAATKNHRHH-LGVSIDAPPLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSGVL  1554
             M     +  NH+     VSID     G K  DDDGR +RTG  WTASAHIITAVIGSGVL
Sbjct  1     MTVEKGSNMNHQQQPFEVSIDTA---GSKCFDDDGRLKRTGNEWTASAHIITAVIGSGVL  57

Query  1553  SLAWAIGQLGWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRNYTYMDAVRSNLGG  1374
             SLAWAI QLGW+AGPS+MLLFS V YYTSTLL+ CYR GD + GKRNYTY DAVR+ LGG
Sbjct  58    SLAWAIAQLGWIAGPSMMLLFSFVTYYTSTLLSVCYRTGDQLNGKRNYTYTDAVRAYLGG  117

Query  1373  YQVKICGLIQYFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFGI  1194
             ++ KICG++QY NLFG+AIGYTIAASISMMAIKRSNCFH SGGKNPCHM+ N YMI+FGI
Sbjct  118   FKYKICGVVQYANLFGVAIGYTIAASISMMAIKRSNCFHSSGGKNPCHMNGNIYMISFGI  177

Query  1193  IEIILSQIPDFDQIWWLSIVAAVMSFTYSGIGLGLGIAQVVANGAFKGSLTGISIGTVTE  1014
             +EI  SQIPDFDQ+WWLS +AAVMSFTYS IGLGLGI +V+ N  FKGSLTGI++GTVTE
Sbjct  178   VEIFFSQIPDFDQLWWLSALAAVMSFTYSTIGLGLGIGKVIENKGFKGSLTGITVGTVTE  237

Query  1013  TQKIWRSFQALGDIAFAYSYSIILIEIQDTVKSPPSESKTMRKASLFSTIVTTTFYMLCG  834
             TQK+WRSFQALG+IAFAYSYS+ILIEIQDT+KSPPSESKTM+KA+L S IVTT FYM+CG
Sbjct  238   TQKVWRSFQALGNIAFAYSYSMILIEIQDTIKSPPSESKTMKKATLISVIVTTIFYMMCG  297

Query  833   CMGYAAFGDDAPGNLLTGFGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEKWVGA  654
             C GYAAFGD +PGNLLTGFGFYNPFWLLDIANAAIVIHLVGA+QVY QPL++ +EK    
Sbjct  298   CFGYAAFGDSSPGNLLTGFGFYNPFWLLDIANAAIVIHLVGAFQVYVQPLYSVVEKTAAE  357

Query  653   KWPDSEIITKEINLKIPGFGYPYKLNTFRLLWRTAFVLLTTVISMLLPFFNDVVGILGAF  474
             ++PDS+ + K+I + IP    P K+N FRL+WR+ FV++TTVISMLLPFFND+VG++GA 
Sbjct  358   RFPDSDFVNKDIEISIPCVASPLKINLFRLVWRSIFVIITTVISMLLPFFNDIVGLIGAI  417

Query  473   GFWPLTVYFPVRMYISQKKIPKWSTRWICLQMlsgaclavslaaaagsfagvVLDLKLYR  294
             GFWPLTVYFPV MYI QK+IPKWST+WICL MLS ACL +SLAAAAGS AGV+ DL +Y+
Sbjct  418   GFWPLTVYFPVEMYIVQKQIPKWSTKWICLHMLSAACLVISLAAAAGSVAGVIADLGVYK  477

Query  293   PFKTSY  276
             PF   Y
Sbjct  478   PFHAMY  483



>ref|XP_003524313.1| PREDICTED: amino acid permease 2-like [Glycine max]
 gb|KHN17398.1| Amino acid permease 2 [Glycine soja]
Length=484

 Score =   702 bits (1811),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 360/488 (74%), Positives = 402/488 (82%), Gaps = 7/488 (1%)
 Frame = -3

Query  1730  MGESAAATK-NHRHHLGVSIDAPP--LYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSG  1560
             M E+AA T  NH    G+  D P       K  DDDGR +RTG VWTAS+HIITAVIGSG
Sbjct  1     MPENAATTNLNHLQVFGIEDDVPSHSQNNSKCYDDDGRLKRTGNVWTASSHIITAVIGSG  60

Query  1559  VLSLAWAIGQLGWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRNYTYMDAVRSNL  1380
             VLSLAWAI QLGW+AGP+VM LFS V +YTS+LLADCYRAGDP  GKRNYTYMDAVRS L
Sbjct  61    VLSLAWAIAQLGWIAGPTVMFLFSLVTFYTSSLLADCYRAGDPNSGKRNYTYMDAVRSIL  120

Query  1379  GGYQVKICGLIQYFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAF  1200
             GG  V +CG+ QY NL GI IGYTIAASISMMAIKRSNCFH+SGGKNPCHMSSN YMI F
Sbjct  121   GGANVTLCGIFQYLNLLGIVIGYTIAASISMMAIKRSNCFHKSGGKNPCHMSSNVYMIIF  180

Query  1199  GIIEIILSQIPDFDQIWWLSIVAAVMSFTYSGIGLGLGIAQVVANGAFKGSLTGISIGTV  1020
             G  EI LSQIPDFDQ+WWLS VAA+MSFTYS IGL LGIA+V   G FKG LTGISIG V
Sbjct  181   GATEIFLSQIPDFDQLWWLSTVAAIMSFTYSIIGLSLGIAKVAETGTFKGGLTGISIGPV  240

Query  1019  TETQKIWRSFQALGDIAFAYSYSIILIEIQDTVKSPPSESKTMRKASLFSTIVTTTFYML  840
             +ETQKIWR+ QALGDIAFAYSY+++LIEIQDT+KSPPSE+KTM+KA+L S  VTTTFYML
Sbjct  241   SETQKIWRTSQALGDIAFAYSYAVVLIEIQDTIKSPPSEAKTMKKATLISIAVTTTFYML  300

Query  839   CGCMGYAAFGDDAPGNLLTGFGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEKWV  660
             CGCMGYAAFGD APGNLLTGFGFYNP+WL+DIANAAIVIHLVGAYQV+ QP+FAF+EK V
Sbjct  301   CGCMGYAAFGDAAPGNLLTGFGFYNPYWLIDIANAAIVIHLVGAYQVFSQPIFAFVEKEV  360

Query  659   GAKWPDSEIITKEINLKIPGFGYPYKLNTFRLLWRTAFVLLTTVISMLLPFFNDVVGILG  480
               +WP  E   +E  + IPGF  PYKL  FRL+ RT FV+LTTVISMLLPFFND+VG++G
Sbjct  361   TQRWPHIE---REFKIPIPGFS-PYKLKVFRLVLRTVFVVLTTVISMLLPFFNDIVGVIG  416

Query  479   AFGFWPLTVYFPVRMYISQKKIPKWSTRWICLQMlsgaclavslaaaagsfagvVLDLKL  300
             A GFWPLTVYFPV MYISQKKIPKWS RWI L++ S ACL VS+ AA GS AGV+LDLK 
Sbjct  417   ALGFWPLTVYFPVEMYISQKKIPKWSNRWISLKIFSVACLIVSVVAAVGSVAGVLLDLKK  476

Query  299   YRPFKTSY  276
             Y+PF + Y
Sbjct  477   YKPFHSHY  484



>ref|XP_009390766.1| PREDICTED: amino acid permease 4-like [Musa acuminata subsp. 
malaccensis]
 ref|XP_009390767.1| PREDICTED: amino acid permease 4-like [Musa acuminata subsp. 
malaccensis]
Length=492

 Score =   701 bits (1810),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 353/482 (73%), Positives = 402/482 (83%), Gaps = 10/482 (2%)
 Frame = -3

Query  1721  SAAATKNHRHHLGVSIDAPPLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSGVLSLAW  1542
             S +   +H H L  +        F+  DDDGR +RTGT+WTASAHI+TAVIGSGVLSLAW
Sbjct  19    SVSVEVSHAHKLQEA--------FECYDDDGRAKRTGTLWTASAHIVTAVIGSGVLSLAW  70

Query  1541  AIGQLGWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRNYTYMDAVRSNLGGYQVK  1362
             AI QLGWVAGP VMLLFS V +YTSTLLADCYR+GDP+ GKRNY+Y DAV + LGG +VK
Sbjct  71    AIAQLGWVAGPVVMLLFSFVTHYTSTLLADCYRSGDPIAGKRNYSYTDAVHAYLGGLKVK  130

Query  1361  ICGLIQYFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFGIIEII  1182
             +CG IQY NLFG+AIGYTIA+SISMMAIKRSNCFHE G +NPCH SSNPYMI FGI EI 
Sbjct  131   LCGFIQYANLFGVAIGYTIASSISMMAIKRSNCFHERGHENPCHASSNPYMIMFGIAEIF  190

Query  1181  LSQIPDFDQIWWLSIVAAVMSFTYSGIGLGLGIAQVVANGAFKGSLTGISIGTVTETQKI  1002
             LSQIPDFDQIWWLSIVAAVMSFTYS IGL LGI QV+AN  FKGSLTGISIG V+ TQKI
Sbjct  191   LSQIPDFDQIWWLSIVAAVMSFTYSSIGLALGIVQVIANKGFKGSLTGISIGAVSPTQKI  250

Query  1001  WRSFQALGDIAFAYSYSIILIEIQDTVKS-PPSESKTMRKASLFSTIVTTTFYMLCGCMG  825
             WRS QALGDIAFAYS+S+ILIEIQDT+K+ PPSE+K M+KAS+ S  VTT FYMLCGCMG
Sbjct  251   WRSLQALGDIAFAYSFSLILIEIQDTIKAPPPSEAKVMKKASVVSIAVTTFFYMLCGCMG  310

Query  824   YAAFGDDAPGNLLTGFGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEKWVGAKWP  645
             YAAFGD APGNLLTGFGFYNP+WLLDIANAAIV+HLVGAYQV+CQPLFAF+EKW    WP
Sbjct  311   YAAFGDGAPGNLLTGFGFYNPYWLLDIANAAIVVHLVGAYQVFCQPLFAFVEKWAVRTWP  370

Query  644   DSEIITKEINLKIPGFGYPYKLNTFRLLWRTAFVLLTTVISMLLPFFNDVVGILGAFGFW  465
             DS  ITKE+ + +      ++L+ FRL+WR+ FV+LTTVISMLLPFFNDVV +LGA GFW
Sbjct  371   DSTFITKEVAVPLTP-TKRFRLSLFRLVWRSTFVVLTTVISMLLPFFNDVVALLGALGFW  429

Query  464   PLTVYFPVRMYISQKKIPKWSTRWICLQMlsgaclavslaaaagsfagvVLDLKLYRPFK  285
             PLTVYFPV MYI QK+IP+WS RW+CLQMLS  CL +++AAA GS AG+  DLK+Y PFK
Sbjct  430   PLTVYFPVEMYIVQKRIPRWSLRWVCLQMLSLGCLVITIAAAVGSVAGIFTDLKVYHPFK  489

Query  284   TS  279
             T+
Sbjct  490   TT  491



>ref|XP_002278086.1| PREDICTED: amino acid permease 3 [Vitis vinifera]
 emb|CBI37884.3| unnamed protein product [Vitis vinifera]
Length=512

 Score =   701 bits (1810),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 360/494 (73%), Positives = 415/494 (84%), Gaps = 19/494 (4%)
 Frame = -3

Query  1706  KNHRHHLGVSIDAPPLYG-----------FKGLDDDGRPQRTGTVWTASAHIITAVIGSG  1560
             ++ RH+L V +   P +G            K  DDDGR +RTGT WTAS+HIITAVIGSG
Sbjct  21    QDIRHYLQVEVQPKP-HGESEAINPQANYSKCFDDDGRLKRTGTFWTASSHIITAVIGSG  79

Query  1559  VLSLAWAIGQLGWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRNYTYMDAVRSNL  1380
             VLSLAWAIGQLGWVAGP VM+LF+ V  Y+S LLA CYR+GDP+ G+RNYTYM+AV++NL
Sbjct  80    VLSLAWAIGQLGWVAGPIVMILFAFVNLYSSNLLAQCYRSGDPLTGQRNYTYMEAVKANL  139

Query  1379  GGYQVKICGLIQYFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAF  1200
             GG +V  CG IQY NLFG AIGYTIAAS+SMMAIKRSNCFH+SGGK+PCHMSSN YMI F
Sbjct  140   GGKKVLACGWIQYLNLFGTAIGYTIAASVSMMAIKRSNCFHKSGGKDPCHMSSNGYMITF  199

Query  1199  GIIEIILSQIPDFDQIWWLSIVAAVMSFTYSGIGLGLGIAQVVANGAFKGSLTGISIGTV  1020
             GIIEII SQIPDFDQ+WWLSIVAA+MSFTYS +GLGLG+A+V  NG+FKGSLTGISIGTV
Sbjct  200   GIIEIIFSQIPDFDQVWWLSIVAAIMSFTYSSVGLGLGVAKVAENGSFKGSLTGISIGTV  259

Query  1019  TE------TQKIWRSFQALGDIAFAYSYSIILIEIQDTVKSPPSESKTMRKASLFSTIVT  858
             T       TQK+WRS QALG IAFAYS+S+ILIEIQDT+KSPP+E KTMRKA++ S  VT
Sbjct  260   THAGVVTSTQKLWRSLQALGAIAFAYSFSLILIEIQDTIKSPPAEYKTMRKATVLSIAVT  319

Query  857   TTFYMLCGCMGYAAFGDDAPGNLLTGFGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFA  678
             T FYMLCGC GYAAFGD APGNLLTGFGFY+P+WLLDIAN AI++HLVGAYQVYCQPLFA
Sbjct  320   TAFYMLCGCFGYAAFGDLAPGNLLTGFGFYDPYWLLDIANIAIIVHLVGAYQVYCQPLFA  379

Query  677   FIEKWVGAKWPDSEIITKEINLKIPGFGYPYKLNTFRLLWRTAFVLLTTVISMLLPFFND  498
             F+EKW   KWP S+ +T+E +L IP +G  Y+LN FRL+WRT FV+LTT+I+MLLPFFND
Sbjct  380   FVEKWSAHKWPKSDFVTEEYDLPIPCYGV-YQLNFFRLVWRTIFVVLTTLIAMLLPFFND  438

Query  497   VVGILGAFGFWPLTVYFPVRMYISQKKIPKWSTRWICLQMlsgaclavslaaaagsfagv  318
             VVGILGAFGFWPLTVYFPV MYISQKKI +W++RW+ LQ+LS ACL +SLAAA GS AGV
Sbjct  439   VVGILGAFGFWPLTVYFPVEMYISQKKIGRWTSRWVALQILSFACLLISLAAAVGSVAGV  498

Query  317   VLDLKLYRPFKTSY  276
             VLDLK Y+PFKTSY
Sbjct  499   VLDLKTYKPFKTSY  512



>ref|XP_009596720.1| PREDICTED: amino acid permease 3-like isoform X1 [Nicotiana tomentosiformis]
Length=480

 Score =   700 bits (1806),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 358/475 (75%), Positives = 409/475 (86%), Gaps = 2/475 (0%)
 Frame = -3

Query  1703  NHRHHLGVSIDAPPLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSGVLSLAWAIGQLG  1524
             ++ HH    + A      K  DDDGR +R+G+VWTASAHIITAVIGSGVLSLAWA  QLG
Sbjct  5     DNNHHQVFDVSANGYGESKCFDDDGRLKRSGSVWTASAHIITAVIGSGVLSLAWATAQLG  64

Query  1523  WVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRNYTYMDAVRSNLGGYQVKICGLIQ  1344
             W+AGP+V+LLFS V YYTS LLADCYR+GD V GKRNYTYMDAVR+NLGG QVKICG+IQ
Sbjct  65    WIAGPTVLLLFSFVTYYTSALLADCYRSGDQVSGKRNYTYMDAVRANLGGLQVKICGVIQ  124

Query  1343  YFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFGIIEIILSQIPD  1164
             Y NLFG+A+GYTIA+SISMMA+KRS+CFH+ G +  C++SS PYMI FGI+EI+ SQIPD
Sbjct  125   YVNLFGVAVGYTIASSISMMAVKRSDCFHKHGHRAACNVSSTPYMIMFGIMEILFSQIPD  184

Query  1163  FDQIWWLSIVAAVMSFTYSGIGLGLGIAQVVANGAFKGSLTGISIGT-VTETQKIWRSFQ  987
             FDQIWWLSIVAAVMSFTYS IGLGLG+AQV   G  +GSLTGISIG  VTE QKIWRSFQ
Sbjct  185   FDQIWWLSIVAAVMSFTYSTIGLGLGVAQVAETGKIQGSLTGISIGAEVTEMQKIWRSFQ  244

Query  986   ALGDIAFAYSYSIILIEIQDTVKSPPSESKTMRKASLFSTIVTTTFYMLCGCMGYAAFGD  807
             ALG IAFAYSYS+ILIEIQDT+K+PPSE+KTM+KA+L S  VTT FYMLCGC GYAAFGD
Sbjct  245   ALGAIAFAYSYSLILIEIQDTLKAPPSEAKTMKKATLLSVAVTTVFYMLCGCFGYAAFGD  304

Query  806   DAPGNLLTGFGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEKWVGAKWPDSEIIT  627
              +PGNLLTGFGFYNP+WLLDIAN AIV+HLVGAYQVYCQPLFAF+EK     +P ++ IT
Sbjct  305   QSPGNLLTGFGFYNPYWLLDIANVAIVVHLVGAYQVYCQPLFAFVEKTAFEWYPSNKFIT  364

Query  626   KEINLKIPGFGYPYKLNTFRLLWRTAFVLLTTVISMLLPFFNDVVGILGAFGFWPLTVYF  447
             K+I++ IPG+  P+KLN FRL+WRT FV++TTVISML+PFFNDVVGILGAFGFWPLTVYF
Sbjct  365   KDIDVPIPGYK-PFKLNLFRLVWRTIFVIITTVISMLMPFFNDVVGILGAFGFWPLTVYF  423

Query  446   PVRMYISQKKIPKWSTRWICLQMlsgaclavslaaaagsfagvVLDLKLYRPFKT  282
             PV MYI QKKIPKWS RWI LQ+LSGACL +S+AAAAGSFAGVV DLK+YRPFKT
Sbjct  424   PVEMYIVQKKIPKWSARWISLQILSGACLVISIAAAAGSFAGVVSDLKVYRPFKT  478



>ref|XP_009596721.1| PREDICTED: amino acid permease 3-like isoform X2 [Nicotiana tomentosiformis]
Length=478

 Score =   700 bits (1806),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 358/475 (75%), Positives = 409/475 (86%), Gaps = 2/475 (0%)
 Frame = -3

Query  1703  NHRHHLGVSIDAPPLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSGVLSLAWAIGQLG  1524
             ++ HH    + A      K  DDDGR +R+G+VWTASAHIITAVIGSGVLSLAWA  QLG
Sbjct  3     DNNHHQVFDVSANGYGESKCFDDDGRLKRSGSVWTASAHIITAVIGSGVLSLAWATAQLG  62

Query  1523  WVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRNYTYMDAVRSNLGGYQVKICGLIQ  1344
             W+AGP+V+LLFS V YYTS LLADCYR+GD V GKRNYTYMDAVR+NLGG QVKICG+IQ
Sbjct  63    WIAGPTVLLLFSFVTYYTSALLADCYRSGDQVSGKRNYTYMDAVRANLGGLQVKICGVIQ  122

Query  1343  YFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFGIIEIILSQIPD  1164
             Y NLFG+A+GYTIA+SISMMA+KRS+CFH+ G +  C++SS PYMI FGI+EI+ SQIPD
Sbjct  123   YVNLFGVAVGYTIASSISMMAVKRSDCFHKHGHRAACNVSSTPYMIMFGIMEILFSQIPD  182

Query  1163  FDQIWWLSIVAAVMSFTYSGIGLGLGIAQVVANGAFKGSLTGISIGT-VTETQKIWRSFQ  987
             FDQIWWLSIVAAVMSFTYS IGLGLG+AQV   G  +GSLTGISIG  VTE QKIWRSFQ
Sbjct  183   FDQIWWLSIVAAVMSFTYSTIGLGLGVAQVAETGKIQGSLTGISIGAEVTEMQKIWRSFQ  242

Query  986   ALGDIAFAYSYSIILIEIQDTVKSPPSESKTMRKASLFSTIVTTTFYMLCGCMGYAAFGD  807
             ALG IAFAYSYS+ILIEIQDT+K+PPSE+KTM+KA+L S  VTT FYMLCGC GYAAFGD
Sbjct  243   ALGAIAFAYSYSLILIEIQDTLKAPPSEAKTMKKATLLSVAVTTVFYMLCGCFGYAAFGD  302

Query  806   DAPGNLLTGFGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEKWVGAKWPDSEIIT  627
              +PGNLLTGFGFYNP+WLLDIAN AIV+HLVGAYQVYCQPLFAF+EK     +P ++ IT
Sbjct  303   QSPGNLLTGFGFYNPYWLLDIANVAIVVHLVGAYQVYCQPLFAFVEKTAFEWYPSNKFIT  362

Query  626   KEINLKIPGFGYPYKLNTFRLLWRTAFVLLTTVISMLLPFFNDVVGILGAFGFWPLTVYF  447
             K+I++ IPG+  P+KLN FRL+WRT FV++TTVISML+PFFNDVVGILGAFGFWPLTVYF
Sbjct  363   KDIDVPIPGYK-PFKLNLFRLVWRTIFVIITTVISMLMPFFNDVVGILGAFGFWPLTVYF  421

Query  446   PVRMYISQKKIPKWSTRWICLQMlsgaclavslaaaagsfagvVLDLKLYRPFKT  282
             PV MYI QKKIPKWS RWI LQ+LSGACL +S+AAAAGSFAGVV DLK+YRPFKT
Sbjct  422   PVEMYIVQKKIPKWSARWISLQILSGACLVISIAAAAGSFAGVVSDLKVYRPFKT  476



>gb|AIL30502.1| amino acid transporter [Nicotiana tabacum]
Length=480

 Score =   699 bits (1805),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 366/483 (76%), Positives = 409/483 (85%), Gaps = 5/483 (1%)
 Frame = -3

Query  1730  MGESAAATKNHRHHLGVSIDAPPLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSGVLS  1551
             MGE+      H+    VSI+       K  DDDGR +RTG+VWTASAHIITAVIGSGVLS
Sbjct  1     MGENNNVASKHQV-FDVSINVTES---KCFDDDGRLKRTGSVWTASAHIITAVIGSGVLS  56

Query  1550  LAWAIGQLGWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRNYTYMDAVRSNLGGY  1371
             LAWA+ QLGW+AGP VM+LFS V YYTS LLADCYR+GD V GKRNYTYMDAV++NLGG 
Sbjct  57    LAWAVAQLGWIAGPIVMILFSFVTYYTSALLADCYRSGDSVSGKRNYTYMDAVQANLGGL  116

Query  1370  QVKICGLIQYFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFGII  1191
             QVKICG IQY NLFG+AIGYTIA+SISM+AIKRSNCFH+ G + PC +SS PYM+ FGII
Sbjct  117   QVKICGWIQYANLFGVAIGYTIASSISMIAIKRSNCFHKHGDQAPCQVSSTPYMVMFGII  176

Query  1190  EIILSQIPDFDQIWWLSIVAAVMSFTYSGIGLGLGIAQVVANGAFKGSLTGISIGTVTET  1011
              II SQIPDFDQIWWLSIVAAVMSFTYS IGLGLG+A+V   G   GSLTGISIGTVTE 
Sbjct  177   AIIFSQIPDFDQIWWLSIVAAVMSFTYSTIGLGLGVAKVAETGRIGGSLTGISIGTVTEM  236

Query  1010  QKIWRSFQALGDIAFAYSYSIILIEIQDTVKSPPSESKTMRKASLFSTIVTTTFYMLCGC  831
             QKIW+SFQALG IAFAYSYS+ILIEIQDT+KSPPSESKTM+ A+L S  VTT FYMLCGC
Sbjct  237   QKIWKSFQALGAIAFAYSYSLILIEIQDTLKSPPSESKTMKNATLISVAVTTVFYMLCGC  296

Query  830   MGYAAFGDDAPGNLLTGFGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEKWVGAK  651
               YAAFGD APGNLLTGFGFYNP+WLLDIAN AIV+HLVGAYQVYCQPLFAFIEK     
Sbjct  297   FXYAAFGDLAPGNLLTGFGFYNPYWLLDIANIAIVVHLVGAYQVYCQPLFAFIEKTAFEW  356

Query  650   WPDSEIITKEINLKIPGFGYPYKLNTFRLLWRTAFVLLTTVISMLLPFFNDVVGILGAFG  471
             +P ++ ITK+I++ IPG+  P+KLN FRL+WRT FV++TTVISML+PFFNDVVGILGAFG
Sbjct  357   YPSNKFITKDIDVPIPGYK-PFKLNLFRLVWRTIFVIITTVISMLMPFFNDVVGILGAFG  415

Query  470   FWPLTVYFPVRMYISQKKIPKWSTRWICLQMlsgaclavslaaaagsfagvVLDLKLYRP  291
             FWPLTVYFPV MYI QKKIPKWS RWI LQ+LSGACL +S+AAAAGSFAGVV DLK+YRP
Sbjct  416   FWPLTVYFPVEMYIVQKKIPKWSARWISLQILSGACLVISIAAAAGSFAGVVSDLKVYRP  475

Query  290   FKT  282
             FKT
Sbjct  476   FKT  478



>ref|NP_001234606.1| amino acid transporter [Solanum lycopersicum]
 gb|AAO13689.1|AF013280_1 amino acid transporter [Solanum lycopersicum]
Length=471

 Score =   699 bits (1803),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 356/457 (78%), Positives = 403/457 (88%), Gaps = 2/457 (0%)
 Frame = -3

Query  1649  KGLDDDGRPQRTGTVWTASAHIITAVIGSGVLSLAWAIGQLGWVAGPSVMLLFSCVVYYT  1470
             K  DDDGR +RTG+VWTASAHIITAVIGSGVLSLAWA  QLGWVAGP+V+LLFS V YYT
Sbjct  16    KCFDDDGRIKRTGSVWTASAHIITAVIGSGVLSLAWATAQLGWVAGPTVLLLFSFVTYYT  75

Query  1469  STLLADCYRAGDPVFGKRNYTYMDAVRSNLGGYQVKICGLIQYFNLFGIAIGYTIAASIS  1290
             S LL+DCYR GDPV GKRNYTYMDAVR+NLGG+QVKICG+IQY NLFG+AIGYTIA+SIS
Sbjct  76    SALLSDCYRTGDPVTGKRNYTYMDAVRANLGGFQVKICGVIQYANLFGVAIGYTIASSIS  135

Query  1289  MMAIKRSNCFHESGGKNPCHMSSNPYMIAFGIIEIILSQIPDFDQIWWLSIVAAVMSFTY  1110
             M+A+ RSNCFH+ G    C++SS PYMI FG++EII SQIPDFDQI WLSIVAAVMSFTY
Sbjct  136   MVAVNRSNCFHKQGHHAACNVSSTPYMIMFGVMEIIFSQIPDFDQISWLSIVAAVMSFTY  195

Query  1109  SGIGLGLGIAQVVANGAFKGSLTGISIGT-VTETQKIWRSFQALGDIAFAYSYSIILIEI  933
             S IGLGLG+AQV   G  +GSLTGISIGT VTE QKIWRSFQALG IAFAYSYS+ILIEI
Sbjct  196   STIGLGLGVAQVAETGKIEGSLTGISIGTEVTEMQKIWRSFQALGAIAFAYSYSLILIEI  255

Query  932   QDTVKSPPSESKTMRKASLFSTIVTTTFYMLCGCMGYAAFGDDAPGNLLTGFGFYNPFWL  753
             QDT+KSPP+E+KTM++A+L S  VTT FYMLCGC GYAAFGD +PGNLLTGFGFYNP+WL
Sbjct  256   QDTLKSPPAEAKTMKRATLISVAVTTVFYMLCGCFGYAAFGDQSPGNLLTGFGFYNPYWL  315

Query  752   LDIANAAIVIHLVGAYQVYCQPLFAFIEKWVGAKWPDSEIITKEINLKIPGFGYPYKLNT  573
             LDIAN A+V+HLVGAYQVYCQPLFAF+EK     +PDS+IITKEI++ IPGF  P+KLN 
Sbjct  316   LDIANIAMVVHLVGAYQVYCQPLFAFVEKTAAEWYPDSKIITKEIDVPIPGFK-PFKLNL  374

Query  572   FRLLWRTAFVLLTTVISMLLPFFNDVVGILGAFGFWPLTVYFPVRMYISQKKIPKWSTRW  393
             FRL+WR  FV++TTVISML+PFFNDVVGILGAFGFWPLTVYFPV MYI QK+I KWS RW
Sbjct  375   FRLVWRAIFVIITTVISMLMPFFNDVVGILGAFGFWPLTVYFPVEMYIVQKRITKWSARW  434

Query  392   ICLQMlsgaclavslaaaagsfagvVLDLKLYRPFKT  282
             ICLQ+LSGACL +S+AAAAGSFAGVV DLK+YRPF++
Sbjct  435   ICLQILSGACLVISIAAAAGSFAGVVSDLKVYRPFQS  471



>ref|XP_008236004.1| PREDICTED: amino acid permease 3-like [Prunus mume]
Length=511

 Score =   700 bits (1807),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 352/500 (70%), Positives = 415/500 (83%), Gaps = 18/500 (4%)
 Frame = -3

Query  1724  ESAAATKNH--RHHLGVSIDA---------PPLYGFKGLDDDGRPQRTGTVWTASAHIIT  1578
                A  + H  RH+L V +           P     K  DDDGR +RTGT WT+++HIIT
Sbjct  13    HHGAVEERHDIRHYLQVEVQPKVTESEAINPQSSYIKCFDDDGRLKRTGTFWTSASHIIT  72

Query  1577  AVIGSGVLSLAWAIGQLGWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRNYTYMD  1398
             AVIGSGVLSLAWAI QLGWVAGPSV+LLF+ V  YTS LLA CYR+GDPV G+RNYTYMD
Sbjct  73    AVIGSGVLSLAWAIAQLGWVAGPSVLLLFALVNLYTSNLLAMCYRSGDPVTGQRNYTYMD  132

Query  1397  AVRSNLGGYQVKICGLIQYFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSN  1218
             A+++NLGG +V +CGL+QYFNLFG+AIGYTIA+S+SMMAIKRSNC+H+SGGK+PCHMSSN
Sbjct  133   AIKANLGGRKVMLCGLVQYFNLFGVAIGYTIASSVSMMAIKRSNCYHKSGGKDPCHMSSN  192

Query  1217  PYMIAFGIIEIILSQIPDFDQIWWLSIVAAVMSFTYSGIGLGLGIAQVVANGAFKGSLTG  1038
              YMI FGIIE+I SQIPDF+Q+WWLSIVAAVMSFTYS +GLGLGI ++V NG FKGSL G
Sbjct  193   GYMITFGIIEVIFSQIPDFNQVWWLSIVAAVMSFTYSSVGLGLGIGKIVGNGGFKGSLLG  252

Query  1037  ISIGTVTE------TQKIWRSFQALGDIAFAYSYSIILIEIQDTVKSPPSESKTMRKASL  876
             ISIGTVT       TQK+WRS QALG IAFAYSYS++LIEIQDT++SPP+E KTM+KA++
Sbjct  253   ISIGTVTHAGTVTPTQKMWRSMQALGAIAFAYSYSLVLIEIQDTIRSPPAEHKTMKKATV  312

Query  875   FSTIVTTTFYMLCGCMGYAAFGDDAPGNLLTGFGFYNPFWLLDIANAAIVIHLVGAYQVY  696
             FS  +TT FY+LCGC GYAAFGD APGNLLTGFGFYNP+WLLDIAN AIV+HLVGA+QVY
Sbjct  313   FSIALTTVFYLLCGCFGYAAFGDLAPGNLLTGFGFYNPYWLLDIANVAIVVHLVGAFQVY  372

Query  695   CQPLFAFIEKWVGAKWPDSEIITKEINLKIPGFGYPYKLNTFRLLWRTAFVLLTTVISML  516
             CQPLFAF+EKW   +WP S+ +T E ++ IP  G  Y+LN FRL+WRT FV++TT+ISML
Sbjct  373   CQPLFAFVEKWSAQRWPKSDFVTAEYDIPIPFHGV-YQLNLFRLVWRTIFVIITTLISML  431

Query  515   LPFFNDVVGILGAFGFWPLTVYFPVRMYISQKKIPKWSTRWICLQMlsgaclavslaaaa  336
             LPFFNDVVGILGAFGFWPLTVYFPV MYI+Q+KI KWS+RW+ L+MLS +CL V++AAA 
Sbjct  432   LPFFNDVVGILGAFGFWPLTVYFPVEMYIAQQKIGKWSSRWVGLKMLSISCLLVTIAAAV  491

Query  335   gsfagvVLDLKLYRPFKTSY  276
             GS AGVVLDLK Y+PFKTSY
Sbjct  492   GSVAGVVLDLKTYKPFKTSY  511



>gb|AIS71894.1| amino acid transporter [Nicotiana tabacum]
Length=480

 Score =   699 bits (1803),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 365/483 (76%), Positives = 409/483 (85%), Gaps = 5/483 (1%)
 Frame = -3

Query  1730  MGESAAATKNHRHHLGVSIDAPPLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSGVLS  1551
             MGE+      H+    VSI+       K  DDDGR +RTG+VWTASAHIITAVIGSGVLS
Sbjct  1     MGENNNVASKHQV-FDVSINVTES---KCFDDDGRLKRTGSVWTASAHIITAVIGSGVLS  56

Query  1550  LAWAIGQLGWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRNYTYMDAVRSNLGGY  1371
             LAWA+ QLGW+AGP VM+LFS V YYTS LLADCYR+GD V GKRNYTYMDAV++NLGG 
Sbjct  57    LAWAVAQLGWIAGPIVMILFSFVTYYTSALLADCYRSGDSVSGKRNYTYMDAVQANLGGL  116

Query  1370  QVKICGLIQYFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFGII  1191
             QVKICG IQY NLFG+AIGYTIA+SISM+AIKRSNCFH+ G + PC +SS PYM+ FGII
Sbjct  117   QVKICGWIQYANLFGVAIGYTIASSISMIAIKRSNCFHKHGDQAPCQVSSTPYMVMFGII  176

Query  1190  EIILSQIPDFDQIWWLSIVAAVMSFTYSGIGLGLGIAQVVANGAFKGSLTGISIGTVTET  1011
              II SQIPDFDQIWWLSIVAAVMSFTYS IGLGLG+A+V   G   GSLTGISIGTVTE 
Sbjct  177   AIIFSQIPDFDQIWWLSIVAAVMSFTYSTIGLGLGVAKVAETGRIGGSLTGISIGTVTEM  236

Query  1010  QKIWRSFQALGDIAFAYSYSIILIEIQDTVKSPPSESKTMRKASLFSTIVTTTFYMLCGC  831
             QKIW+SFQALG IAFAYSYS+ILIEIQDT+KSPPSESKTM+ A+L S  VTT FYMLCGC
Sbjct  237   QKIWKSFQALGAIAFAYSYSLILIEIQDTLKSPPSESKTMKNATLISVAVTTVFYMLCGC  296

Query  830   MGYAAFGDDAPGNLLTGFGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEKWVGAK  651
               YAAFGD APGNLLTGFGFYNP+WLLDIAN AIV+HLVGAYQVYCQPLFAF+EK     
Sbjct  297   FXYAAFGDLAPGNLLTGFGFYNPYWLLDIANIAIVVHLVGAYQVYCQPLFAFVEKTAFEW  356

Query  650   WPDSEIITKEINLKIPGFGYPYKLNTFRLLWRTAFVLLTTVISMLLPFFNDVVGILGAFG  471
             +P ++ ITK+I++ IPG+  P+KLN FRL+WRT FV++TTVISML+PFFNDVVGILGAFG
Sbjct  357   YPSNKFITKDIDVPIPGYK-PFKLNLFRLVWRTIFVIITTVISMLMPFFNDVVGILGAFG  415

Query  470   FWPLTVYFPVRMYISQKKIPKWSTRWICLQMlsgaclavslaaaagsfagvVLDLKLYRP  291
             FWPLTVYFPV MYI QKKIPKWS RWI LQ+LSGACL +S+AAAAGSFAGVV DLK+YRP
Sbjct  416   FWPLTVYFPVEMYIVQKKIPKWSARWISLQILSGACLVISIAAAAGSFAGVVSDLKVYRP  475

Query  290   FKT  282
             FKT
Sbjct  476   FKT  478



>emb|CDO96925.1| unnamed protein product [Coffea canephora]
Length=512

 Score =   698 bits (1802),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 351/493 (71%), Positives = 413/493 (84%), Gaps = 17/493 (3%)
 Frame = -3

Query  1706  KNHRHHLGVSIDAPPLYGFKGL----------DDDGRPQRTGTVWTASAHIITAVIGSGV  1557
             ++ RH+L V +   P    + +          DDDGR +RTGT+WTA++HIITAVIGSGV
Sbjct  21    QDFRHYLQVEVQPKPQQEAEAINLQANYSKCFDDDGRLKRTGTLWTATSHIITAVIGSGV  80

Query  1556  LSLAWAIGQLGWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRNYTYMDAVRSNLG  1377
             LSLAWAIGQLGWVAGP+VMLLF+ V+ YTS LL+ CYR+G+PV G RNYTYMDAV++ LG
Sbjct  81    LSLAWAIGQLGWVAGPTVMLLFAFVILYTSNLLSQCYRSGNPVTGPRNYTYMDAVKATLG  140

Query  1376  GYQVKICGLIQYFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFG  1197
             G +VKICGLIQY NLFG+AIGYTIAAS+SMMA+KRSNCFHES GK+PCHM+SN YMI FG
Sbjct  141   GRKVKICGLIQYINLFGVAIGYTIAASVSMMAVKRSNCFHESNGKDPCHMTSNGYMITFG  200

Query  1196  IIEIILSQIPDFDQIWWLSIVAAVMSFTYSGIGLGLGIAQVVANGAFKGSLTGISI----  1029
             IIEII SQIPDFDQ+WWLSIVAAVMSFTYS +GL LGIA+V  N +F+GSL GISI    
Sbjct  201   IIEIIFSQIPDFDQVWWLSIVAAVMSFTYSTVGLSLGIAKVAENKSFRGSLIGISIGTIT  260

Query  1028  --GTVTETQKIWRSFQALGDIAFAYSYSIILIEIQDTVKSPPSESKTMRKASLFSTIVTT  855
               GTVT TQK+WRS QALG IAFAYSYSIILIEIQDT+K+PP+E KTM+KA+L S   TT
Sbjct  261   HAGTVTATQKLWRSLQALGAIAFAYSYSIILIEIQDTIKAPPAEYKTMKKATLISIATTT  320

Query  854   TFYMLCGCMGYAAFGDDAPGNLLTGFGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAF  675
              FY+LCGCMGYAAFGDDAPGNLLTGFGFYNP+WLLDIAN AIVIHLVGAYQVYCQPLFAF
Sbjct  321   VFYLLCGCMGYAAFGDDAPGNLLTGFGFYNPYWLLDIANVAIVIHLVGAYQVYCQPLFAF  380

Query  674   IEKWVGAKWPDSEIITKEINLKIPGFGYPYKLNTFRLLWRTAFVLLTTVISMLLPFFNDV  495
             +EKW   +W + + +T E ++ IP +G  Y+LN FRL WRTAFV++TT+I+ML+PFFNDV
Sbjct  381   VEKWSAQRWSNGDFVTAEYDIPIPFYGV-YQLNFFRLSWRTAFVIVTTIIAMLVPFFNDV  439

Query  494   VGILGAFGFWPLTVYFPVRMYISQKKIPKWSTRWICLQMlsgaclavslaaaagsfagvV  315
             VGILGA GFWPLTVYFP+ +Y++QKKI +W+T+WI LQ+LS ACL VSL+AA GS AGVV
Sbjct  440   VGILGALGFWPLTVYFPIEIYVAQKKIGRWTTQWIGLQILSAACLLVSLSAAIGSVAGVV  499

Query  314   LDLKLYRPFKTSY  276
             L+LK Y+PFKTSY
Sbjct  500   LELKTYKPFKTSY  512



>ref|XP_008810907.1| PREDICTED: amino acid permease 3-like [Phoenix dactylifera]
Length=468

 Score =   696 bits (1797),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 353/461 (77%), Positives = 394/461 (85%), Gaps = 2/461 (0%)
 Frame = -3

Query  1655  GFKGLDDDGRPQRTGTVWTASAHIITAVIGSGVLSLAWAIGQLGWVAGPSVMLLFSCVVY  1476
             G K  DDDGR +RTGTVWTASAHIITAVIGSGVLSLAWAIGQLGWVAGP+ MLLFS V Y
Sbjct  9     GSKCYDDDGRLKRTGTVWTASAHIITAVIGSGVLSLAWAIGQLGWVAGPAAMLLFSYVTY  68

Query  1475  YTSTLLADCYRAGDPVFGKRNYTYMDAVRSNLGGYQVKICGLIQYFNLFGIAIGYTIAAS  1296
             YTS LLADCYR+ DP+ GKRNYTYMDAV++NL G++VK+CG IQY N+FG++IGYTIAA+
Sbjct  69    YTSALLADCYRSCDPINGKRNYTYMDAVQANLNGFKVKLCGFIQYANIFGVSIGYTIAAA  128

Query  1295  ISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFGIIEIILSQIPDFDQIWWLSIVAAVMSF  1116
             ISM AIKRSNCFHE G  NPC +SSNPYMI FG+ EI LSQIPDFDQIWWLSI+AAVMSF
Sbjct  129   ISMTAIKRSNCFHEKGHSNPCQVSSNPYMIIFGVAEIFLSQIPDFDQIWWLSILAAVMSF  188

Query  1115  TYSGIGLGLGIAQVVANGAFKGSLTGISIGTVTETQKIWRSFQALGDIAFAYSYSIILIE  936
             TYS IGL LGI QV+ NG  KGSLTGISI  V+   K+WRS QA GDIAFAYSYS+ILIE
Sbjct  189   TYSSIGLTLGIVQVIKNGGIKGSLTGISIAVVSPADKVWRSLQAFGDIAFAYSYSLILIE  248

Query  935   IQDTVK-SPPSESKTMRKASLFSTIVTTTFYMLCGCMGYAAFGDDAPGNLLTGFGFYNPF  759
             IQDT+K SPPSE+K M+KA+L S  VTT FYMLCGCMGYAAFGD APGNLLTGFGFY+P+
Sbjct  249   IQDTIKESPPSEAKVMKKATLLSVAVTTIFYMLCGCMGYAAFGDMAPGNLLTGFGFYDPY  308

Query  758   WLLDIANAAIVIHLVGAYQVYCQPLFAFIEKWVGAKWPDSEIITKEINLKIPGFGYPYKL  579
             WLLDIANAAIVIHLVGAYQVYCQPLFAF+EKW    WP+S+ ITK I + + G    Y+L
Sbjct  309   WLLDIANAAIVIHLVGAYQVYCQPLFAFVEKWALQTWPESKFITKGIEVPL-GPSRSYRL  367

Query  578   NTFRLLWRTAFVLLTTVISMLLPFFNDVVGILGAFGFWPLTVYFPVRMYISQKKIPKWST  399
             N FRL WRT FV+ TTVISMLLPFFNDVVG LGA GFWPLTVYFPV MYI QKK+PKWST
Sbjct  368   NLFRLTWRTVFVICTTVISMLLPFFNDVVGFLGALGFWPLTVYFPVEMYIVQKKVPKWST  427

Query  398   RWICLQMlsgaclavslaaaagsfagvVLDLKLYRPFKTSY  276
             +W+CLQ+LS ACL +S+AAAAGS AGV+ DLK+YRPF TSY
Sbjct  428   KWVCLQLLSLACLIISVAAAAGSIAGVMNDLKVYRPFTTSY  468



>ref|XP_009404321.1| PREDICTED: amino acid permease 4-like [Musa acuminata subsp. 
malaccensis]
 ref|XP_009404322.1| PREDICTED: amino acid permease 4-like [Musa acuminata subsp. 
malaccensis]
Length=485

 Score =   697 bits (1798),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 352/459 (77%), Positives = 396/459 (86%), Gaps = 2/459 (0%)
 Frame = -3

Query  1649  KGLDDDGRPQRTGTVWTASAHIITAVIGSGVLSLAWAIGQLGWVAGPSVMLLFSCVVYYT  1470
             K  DDDGR +RTGTVWTA+AHI+TAVIGSGVLSLAW I QLGWVAGP VM LFS V YYT
Sbjct  28    KSYDDDGRLKRTGTVWTATAHIVTAVIGSGVLSLAWTIAQLGWVAGPVVMFLFSFVTYYT  87

Query  1469  STLLADCYRAGDPVFGKRNYTYMDAVRSNLGGYQVKICGLIQYFNLFGIAIGYTIAASIS  1290
             STLLADCYR+GDP+ GKRNY Y DAV + LGG +VK+CG IQY NLFG+AIGYTIAASIS
Sbjct  88    STLLADCYRSGDPINGKRNYNYTDAVHAYLGGLKVKLCGFIQYANLFGVAIGYTIAASIS  147

Query  1289  MMAIKRSNCFHESGGKNPCHMSSNPYMIAFGIIEIILSQIPDFDQIWWLSIVAAVMSFTY  1110
             MMAIKRS+CFHE G KNPC  SSNPYMI FG+ EI LSQIPDFDQIWWLSIVAAVMSFTY
Sbjct  148   MMAIKRSDCFHEKGHKNPCLTSSNPYMIMFGVAEIFLSQIPDFDQIWWLSIVAAVMSFTY  207

Query  1109  SGIGLGLGIAQVVANGAFKGSLTGISIGTVTETQKIWRSFQALGDIAFAYSYSIILIEIQ  930
             S IGL LGI QV+ N +FKGSLTGISIG ++ TQKIWRS +ALGDIAFAYS+S++LIEIQ
Sbjct  208   SSIGLALGIVQVIGNKSFKGSLTGISIGVISPTQKIWRSLKALGDIAFAYSFSVVLIEIQ  267

Query  929   DTVKS-PPSESKTMRKASLFSTIVTTTFYMLCGCMGYAAFGDDAPGNLLTGFGFYNPFWL  753
             DT+++ PPSE+K M+KASL S +VTT FYMLCGCMGYAAFGD APGNLLTGFGFYNP+WL
Sbjct  268   DTIRAPPPSEAKVMKKASLLSIVVTTLFYMLCGCMGYAAFGDSAPGNLLTGFGFYNPYWL  327

Query  752   LDIANAAIVIHLVGAYQVYCQPLFAFIEKWVGAKWPDSEIITKEINLKIPGFGYPYKLNT  573
             L+IANAAIV+HLVGAYQV+CQPLFAFIEKW    WP+S  I KEI + +      Y L+ 
Sbjct  328   LNIANAAIVVHLVGAYQVFCQPLFAFIEKWAVKTWPESTFIAKEIAVPLTP-TRRYNLSL  386

Query  572   FRLLWRTAFVLLTTVISMLLPFFNDVVGILGAFGFWPLTVYFPVRMYISQKKIPKWSTRW  393
             FRL+WR++FV+LTTVISMLLPFFNDVVG+LGA GFWPLTVYFPV MYI +++IP+WSTRW
Sbjct  387   FRLVWRSSFVVLTTVISMLLPFFNDVVGLLGALGFWPLTVYFPVEMYIVRQRIPRWSTRW  446

Query  392   ICLQMlsgaclavslaaaagsfagvVLDLKLYRPFKTSY  276
             +CLQMLS ACLAVS+AAA GS AGVV DL LYRPFKTSY
Sbjct  447   VCLQMLSLACLAVSIAAAIGSVAGVVTDLNLYRPFKTSY  485



>ref|XP_010028716.1| PREDICTED: amino acid permease 4-like [Eucalyptus grandis]
 gb|KCW55513.1| hypothetical protein EUGRSUZ_I01405 [Eucalyptus grandis]
Length=512

 Score =   696 bits (1797),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 352/489 (72%), Positives = 409/489 (84%), Gaps = 10/489 (2%)
 Frame = -3

Query  1724  ESAAATKNHRHHLGVSIDAPPLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSGVLSLA  1545
             E  A  K H     ++   P     K  DDDGR +RTGT WTAS+HIITAVIGSGVLSLA
Sbjct  28    EVEAQPKPHADSEAIN---PQTNYSKCFDDDGRLKRTGTFWTASSHIITAVIGSGVLSLA  84

Query  1544  WAIGQLGWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRNYTYMDAVRSNLGGYQV  1365
             WAIGQLGWVAGP+VM+LF+ V +YT+ LL+ CYR+GDP+ G+RNYTYMD V++NLGG +V
Sbjct  85    WAIGQLGWVAGPTVMVLFAFVNFYTTNLLSQCYRSGDPITGQRNYTYMDVVKANLGGKRV  144

Query  1364  KICGLIQYFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFGIIEI  1185
              +CGLIQY NLFG+AIGYTIAAS+SMMAIKRSNCFH+SGGK+PCHMSSN +MI FG++EI
Sbjct  145   MLCGLIQYLNLFGVAIGYTIAASVSMMAIKRSNCFHKSGGKDPCHMSSNGFMITFGVMEI  204

Query  1184  ILSQIPDFDQIWWLSIVAAVMSFTYSGIGLGLGIAQVVANGAFKGSLTGISIGT------  1023
              LSQIPDFDQ+WWLSIVAA+MSFTYS +GLGLGI +V  NG FKGSLTGI IGT      
Sbjct  205   FLSQIPDFDQVWWLSIVAAIMSFTYSTVGLGLGIDKVAENGNFKGSLTGIKIGTPTAAGV  264

Query  1022  VTETQKIWRSFQALGDIAFAYSYSIILIEIQDTVKSPPSESKTMRKASLFSTIVTTTFYM  843
             VT T+K+WRSFQALG IAFAYSYS+ILIEIQDTV+SPP+E KTM+KA+L S  VTT FYM
Sbjct  265   VTSTEKLWRSFQALGAIAFAYSYSVILIEIQDTVRSPPAEHKTMKKATLLSITVTTVFYM  324

Query  842   LCGCMGYAAFGDDAPGNLLTGFGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEKW  663
             LCGCMGYAAFGD APGN+LTGFGFY+P+WLLDIANAAIVIHLVGAYQVYCQPLFAF+EKW
Sbjct  325   LCGCMGYAAFGDLAPGNILTGFGFYDPYWLLDIANAAIVIHLVGAYQVYCQPLFAFVEKW  384

Query  662   VGAKWPDSEIITKEINLKIPGFGYPYKLNTFRLLWRTAFVLLTTVISMLLPFFNDVVGIL  483
                KW  S+ +T E ++ IP  G  Y+LN FRL+WRT FV+LTTVI+ML+PFFNDVVGIL
Sbjct  385   SAQKWSTSDFVTAEYDIPIPFCGM-YQLNFFRLVWRTLFVILTTVIAMLMPFFNDVVGIL  443

Query  482   GAFGFWPLTVYFPVRMYISQKKIPKWSTRWICLQMlsgaclavslaaaagsfagvVLDLK  303
             GAFGFWPLTVYFPV MYIS ++I +W+T W+ LQ+LS  CL +S+AAA GS AGVVLDLK
Sbjct  444   GAFGFWPLTVYFPVEMYISSRRIKRWTTMWVGLQILSMTCLLISIAAAVGSVAGVVLDLK  503

Query  302   LYRPFKTSY  276
              Y+PFKTSY
Sbjct  504   TYKPFKTSY  512



>ref|XP_009388107.1| PREDICTED: amino acid permease 3-like [Musa acuminata subsp. 
malaccensis]
Length=471

 Score =   694 bits (1790),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 346/458 (76%), Positives = 395/458 (86%), Gaps = 2/458 (0%)
 Frame = -3

Query  1649  KGLDDDGRPQRTGTVWTASAHIITAVIGSGVLSLAWAIGQLGWVAGPSVMLLFSCVVYYT  1470
             K  DDDGR +RTGT+WTASAHIITAVIGSGVLSLAWAIGQLGWVAGP  MLLFS V YYT
Sbjct  15    KCFDDDGRLKRTGTLWTASAHIITAVIGSGVLSLAWAIGQLGWVAGPIAMLLFSFVTYYT  74

Query  1469  STLLADCYRAGDPVFGKRNYTYMDAVRSNLGGYQVKICGLIQYFNLFGIAIGYTIAASIS  1290
             S LLADCYR+GDP  GKRNYTYMD VR+NL G++VK+CG +QY N+ G+AIGYTIAASIS
Sbjct  75    SALLADCYRSGDPNTGKRNYTYMDTVRANLDGFKVKLCGYLQYLNIVGVAIGYTIAASIS  134

Query  1289  MMAIKRSNCFHESGGKNPCHMSSNPYMIAFGIIEIILSQIPDFDQIWWLSIVAAVMSFTY  1110
             M+AI+RSNCFH++G  +PC ++SNPYMI FG+ EII SQIPDFDQIWWLSIVAAVMSFTY
Sbjct  135   MVAIERSNCFHKNGDDSPCQVNSNPYMIMFGVAEIIFSQIPDFDQIWWLSIVAAVMSFTY  194

Query  1109  SGIGLGLGIAQVVANGAFKGSLTGISIGTVTETQKIWRSFQALGDIAFAYSYSIILIEIQ  930
             S IGL LGI QV+ NG  +GSLTGISIGTV+E  KIWRS QA GDIAFAYSYSIILIEIQ
Sbjct  195   SSIGLSLGIVQVIKNGGVRGSLTGISIGTVSEMDKIWRSLQAFGDIAFAYSYSIILIEIQ  254

Query  929   DTVKS-PPSESKTMRKASLFSTIVTTTFYMLCGCMGYAAFGDDAPGNLLTGFGFYNPFWL  753
             DT+++ PPSE+K M++A+L S  VTT FYMLCGCMGYAAFGD APGNLLTGFGFYNP+WL
Sbjct  255   DTIRAPPPSEAKVMKRATLISVAVTTVFYMLCGCMGYAAFGDMAPGNLLTGFGFYNPYWL  314

Query  752   LDIANAAIVIHLVGAYQVYCQPLFAFIEKWVGAKWPDSEIITKEINLKIPGFGYPYKLNT  573
             LDIAN AIV+HLVGAYQVYCQPLFAF+EKW    WP S+ I KEI + +P     YKLN 
Sbjct  315   LDIANVAIVVHLVGAYQVYCQPLFAFVEKWALETWPRSQFIGKEIQVPLPA-RRSYKLNL  373

Query  572   FRLLWRTAFVLLTTVISMLLPFFNDVVGILGAFGFWPLTVYFPVRMYISQKKIPKWSTRW  393
             FRL+WRT FV+++TV+SMLLPFFNDVVG+LGA GFWPLTVYFPV MYI QKK+ +WSTRW
Sbjct  374   FRLIWRTTFVVISTVVSMLLPFFNDVVGLLGAIGFWPLTVYFPVEMYIVQKKVARWSTRW  433

Query  392   ICLQMlsgaclavslaaaagsfagvVLDLKLYRPFKTS  279
             +CLQ+LS ACLA+++A+AAGS AGVV DLK+YRPFK S
Sbjct  434   VCLQLLSLACLAITIASAAGSIAGVVSDLKVYRPFKAS  471



>ref|XP_008788441.1| PREDICTED: amino acid permease 4-like [Phoenix dactylifera]
Length=514

 Score =   693 bits (1789),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 350/471 (74%), Positives = 399/471 (85%), Gaps = 7/471 (1%)
 Frame = -3

Query  1670  APPLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSGVLSLAWAIGQLGWVAGPSVMLLF  1491
             A P Y  K  DDDGR +RTGT WTAS+HIITAVIGSGVLSLAW +GQLGW+AGP+VM+LF
Sbjct  45    AQPEYS-KLFDDDGRLKRTGTFWTASSHIITAVIGSGVLSLAWGVGQLGWIAGPAVMILF  103

Query  1490  SCVVYYTSTLLADCYRAGDPVFGKRNYTYMDAVRSNLGGYQVKICGLIQYFNLFGIAIGY  1311
             + V+ YTS LL+DCYR GDPV GKRNYTYMDAV +NLGG +VKICG IQY NLFG+AIGY
Sbjct  104   AFVIQYTSNLLSDCYRTGDPVTGKRNYTYMDAVGANLGGAKVKICGAIQYVNLFGVAIGY  163

Query  1310  TIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFGIIEIILSQIPDFDQIWWLSIVA  1131
             TIAASISMMAIKRSNCFH SGGK+PCH+SSN YMI FGIIE+ILSQIPDFDQ+ WLSIVA
Sbjct  164   TIAASISMMAIKRSNCFHASGGKDPCHVSSNIYMIIFGIIEVILSQIPDFDQVSWLSIVA  223

Query  1130  AVMSFTYSGIGLGLGIAQVVANGAFKGSLTGISIGTVTE------TQKIWRSFQALGDIA  969
             AVMS TYS +GL LGIA V  NG+ +G+L GI+IGTVT+      TQK+WR+ QALGDIA
Sbjct  224   AVMSLTYSTVGLSLGIANVAENGSIRGNLMGINIGTVTKAGTVTATQKVWRNLQALGDIA  283

Query  968   FAYSYSIILIEIQDTVKSPPSESKTMRKASLFSTIVTTTFYMLCGCMGYAAFGDDAPGNL  789
             FAYS+S+ILIEIQDT+KSPP+E+KTM+KA+L S  VTT FY+LCGCMGYAAFGDD PGNL
Sbjct  284   FAYSFSMILIEIQDTLKSPPAENKTMKKATLVSIAVTTIFYLLCGCMGYAAFGDDVPGNL  343

Query  788   LTGFGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEKWVGAKWPDSEIITKEINLK  609
             LTGFGFYNP+WLLDIAN AIV+HLVGAYQV+CQPLFAF+EKW   +W  SE IT E    
Sbjct  344   LTGFGFYNPYWLLDIANLAIVVHLVGAYQVFCQPLFAFVEKWSAQRWDKSEFITHEYEAH  403

Query  608   IPGFGYPYKLNTFRLLWRTAFVLLTTVISMLLPFFNDVVGILGAFGFWPLTVYFPVRMYI  429
             +P  G  YKLN FRL+WRT FV++TT+ISML+PFFNDVVGILGA GFWPLTVYFPV MYI
Sbjct  404   LPLVGSSYKLNLFRLVWRTIFVVVTTLISMLMPFFNDVVGILGAIGFWPLTVYFPVEMYI  463

Query  428   SQKKIPKWSTRWICLQMlsgaclavslaaaagsfagvVLDLKLYRPFKTSY  276
              QKKI +WS RW+ L++LS  CL VSLAAA GS AGVVLDLK YRPFK++Y
Sbjct  464   VQKKIRRWSARWVGLRLLSFTCLVVSLAAACGSVAGVVLDLKSYRPFKSTY  514



>ref|XP_007198986.1| hypothetical protein PRUPE_ppa020916mg [Prunus persica]
 gb|EMJ00185.1| hypothetical protein PRUPE_ppa020916mg [Prunus persica]
Length=511

 Score =   693 bits (1788),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 348/500 (70%), Positives = 412/500 (82%), Gaps = 18/500 (4%)
 Frame = -3

Query  1724  ESAAATKNH--RHHLGVSIDA---------PPLYGFKGLDDDGRPQRTGTVWTASAHIIT  1578
                A  + H  RH+L V +           P     K  DDDGR +RTG  WT+++HIIT
Sbjct  13    HHGAVEERHDIRHYLQVEVQPKVTESEAINPQSSYSKCFDDDGRLKRTGNFWTSASHIIT  72

Query  1577  AVIGSGVLSLAWAIGQLGWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRNYTYMD  1398
             AVIGSGVLSLAWAI QLGWVAGPSV+LLF+ V  YTS LLA CYR+GDPV G+RNYTYMD
Sbjct  73    AVIGSGVLSLAWAIAQLGWVAGPSVLLLFALVNLYTSNLLAMCYRSGDPVTGQRNYTYMD  132

Query  1397  AVRSNLGGYQVKICGLIQYFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSN  1218
             A+++NLGG +V +CGL+QYFNLFG+AIGYTIA+S+SMMAIKRSNC+H+SGGK+PCHMSSN
Sbjct  133   AIKANLGGRKVMLCGLVQYFNLFGVAIGYTIASSVSMMAIKRSNCYHKSGGKDPCHMSSN  192

Query  1217  PYMIAFGIIEIILSQIPDFDQIWWLSIVAAVMSFTYSGIGLGLGIAQVVANGAFKGSLTG  1038
              YMI FGIIE+I SQIPDF+Q+WWLSIVAA+MSFTYS +GLGLGI +VV NG FKGSL G
Sbjct  193   GYMITFGIIEVIFSQIPDFNQVWWLSIVAAIMSFTYSSVGLGLGIGKVVGNGGFKGSLLG  252

Query  1037  ISIGTVTE------TQKIWRSFQALGDIAFAYSYSIILIEIQDTVKSPPSESKTMRKASL  876
             ISIGTVT       TQK+WRS QALG IAFAYSYS++LIEIQDT++SPP+E KTM+KA++
Sbjct  253   ISIGTVTHAGTVTPTQKMWRSMQALGAIAFAYSYSLVLIEIQDTIRSPPAEHKTMKKATV  312

Query  875   FSTIVTTTFYMLCGCMGYAAFGDDAPGNLLTGFGFYNPFWLLDIANAAIVIHLVGAYQVY  696
             FS  +TT FY+ CGC GYAAFGD APGNLLTGFGFY P+WLLDIAN AIV+HLVGA+QVY
Sbjct  313   FSIALTTVFYLFCGCFGYAAFGDLAPGNLLTGFGFYKPYWLLDIANVAIVVHLVGAFQVY  372

Query  695   CQPLFAFIEKWVGAKWPDSEIITKEINLKIPGFGYPYKLNTFRLLWRTAFVLLTTVISML  516
             CQPLFAF+EKW   +WP  + +T E ++ IP +G  Y+LN FRL+WRT FV++TT+ISML
Sbjct  373   CQPLFAFVEKWSAQRWPKRDFVTAEYDIPIPFYGV-YQLNLFRLVWRTIFVMITTLISML  431

Query  515   LPFFNDVVGILGAFGFWPLTVYFPVRMYISQKKIPKWSTRWICLQMlsgaclavslaaaa  336
             LPFFNDVVGILGAFGFWPLTVYFPV MYI+Q+KI KWS+RW+ L+MLS +CL V++AAA 
Sbjct  432   LPFFNDVVGILGAFGFWPLTVYFPVEMYIAQQKIGKWSSRWVGLKMLSISCLLVTIAAAV  491

Query  335   gsfagvVLDLKLYRPFKTSY  276
             GS AGVVLDLK Y+PFKTSY
Sbjct  492   GSVAGVVLDLKTYKPFKTSY  511



>ref|XP_004289864.1| PREDICTED: amino acid permease 2-like [Fragaria vesca subsp. 
vesca]
Length=512

 Score =   692 bits (1787),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 350/501 (70%), Positives = 412/501 (82%), Gaps = 19/501 (4%)
 Frame = -3

Query  1724  ESAAATKNH--RHHLGVSIDA---------PPLYGFKGLDDDGRPQRTGTVWTASAHIIT  1578
                A  + H  RH+L V +           P     K  DDDGR +RTGT WT+++HIIT
Sbjct  13    HHGAVEERHDVRHYLQVEVQPKVGESEAINPQSNYSKCFDDDGRLKRTGTFWTSTSHIIT  72

Query  1577  AVIGSGVLSLAWAIGQLGWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRNYTYMD  1398
             AVIGSGVLSLAWAI QLGWVAGP+V+ LF+ V  YTS LLA CYRAGDPV G+RNYTYMD
Sbjct  73    AVIGSGVLSLAWAIAQLGWVAGPTVLALFAIVNLYTSNLLAMCYRAGDPVTGQRNYTYMD  132

Query  1397  AVRSNLGGYQVKICGLIQYFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSN  1218
             AV++NLGG +V +CGL+QY NLFG+AIGYTIA+S+SMMAIKRSNC+H+SGGK+PCHMSSN
Sbjct  133   AVKANLGGRRVMLCGLVQYLNLFGVAIGYTIASSVSMMAIKRSNCYHKSGGKDPCHMSSN  192

Query  1217  PYMIAFGIIEIILSQIPDFDQIWWLSIVAAVMSFTYSGIGLGLGIAQVVANGAFKGSLTG  1038
              YMI FGIIE+I SQI DF+++WWLSIVAA+MSFTYS +GLGLGI +V  NG FKGSL G
Sbjct  193   GYMITFGIIEVIFSQIKDFNEVWWLSIVAAIMSFTYSTVGLGLGIGKVAGNGGFKGSLLG  252

Query  1037  ISIGTVTE-------TQKIWRSFQALGDIAFAYSYSIILIEIQDTVKSPPSESKTMRKAS  879
             ISIGTVT        T+K+WR+ QALG IAFAYSYS++LIEIQDT++SPP+E KTM+KA+
Sbjct  253   ISIGTVTHSGTVVTSTEKMWRTMQALGAIAFAYSYSLVLIEIQDTIRSPPAEHKTMKKAT  312

Query  878   LFSTIVTTTFYMLCGCMGYAAFGDDAPGNLLTGFGFYNPFWLLDIANAAIVIHLVGAYQV  699
             +FS  VTT FYMLCGC GYAAFGD APGNLLTGFGFYNP+WLLDIAN AIV+HLVGA+QV
Sbjct  313   VFSITVTTVFYMLCGCFGYAAFGDLAPGNLLTGFGFYNPYWLLDIANVAIVVHLVGAFQV  372

Query  698   YCQPLFAFIEKWVGAKWPDSEIITKEINLKIPGFGYPYKLNTFRLLWRTAFVLLTTVISM  519
             +CQPLFAF+EKW   KWP S+ +T E ++ IP +G  Y+LN FRL+WRT FV+LTT+ISM
Sbjct  373   FCQPLFAFVEKWSAQKWPKSDFVTAEYDIPIPFYGV-YQLNLFRLVWRTLFVILTTLISM  431

Query  518   LLPFFNDVVGILGAFGFWPLTVYFPVRMYISQKKIPKWSTRWICLQMlsgaclavslaaa  339
             LLPFFNDVVGILGAFGFWPLTVYFPV MYI+Q+KI KWS+RW+ LQMLS +CL VS+ AA
Sbjct  432   LLPFFNDVVGILGAFGFWPLTVYFPVEMYIAQQKIEKWSSRWLGLQMLSMSCLVVSIVAA  491

Query  338   agsfagvVLDLKLYRPFKTSY  276
              GSFAGVVLDLK Y+PFKT+Y
Sbjct  492   VGSFAGVVLDLKSYKPFKTTY  512



>ref|XP_011046334.1| PREDICTED: amino acid permease 3-like [Populus euphratica]
 ref|XP_011046342.1| PREDICTED: amino acid permease 3-like [Populus euphratica]
Length=511

 Score =   691 bits (1784),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 350/489 (72%), Positives = 403/489 (82%), Gaps = 16/489 (3%)
 Frame = -3

Query  1697  RHHLGVSIDA---------PPLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSGVLSLA  1545
             RH+L V +           P     K  DDDGR +RTG  WT+S+HIITAVIGSGVLSLA
Sbjct  24    RHYLEVEVQPKVSESEAINPQSNYSKCFDDDGRLKRTGNFWTSSSHIITAVIGSGVLSLA  83

Query  1544  WAIGQLGWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRNYTYMDAVRSNLGGYQV  1365
             WAI QLGWVAGP+VM+LF+ V  YTS LLA CYR+GDPV G+RNYTYMDAV+S LGG +V
Sbjct  84    WAIAQLGWVAGPAVMVLFAFVNLYTSNLLAQCYRSGDPVTGQRNYTYMDAVKSYLGGRKV  143

Query  1364  KICGLIQYFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFGIIEI  1185
              +CGLIQY NLFG+AIGYTIAAS+SMMAIKRSNCFH SGGK+PCHMS N +MI FGIIEI
Sbjct  144   MLCGLIQYLNLFGVAIGYTIAASVSMMAIKRSNCFHSSGGKDPCHMSCNGFMITFGIIEI  203

Query  1184  ILSQIPDFDQIWWLSIVAAVMSFTYSGIGLGLGIAQVVANGAFKGSLTGISIGT------  1023
             + SQIPDFDQ+WWLSIVAA+MSFTYS +GLGLGI +V  NG FKGSLTGISIGT      
Sbjct  204   LFSQIPDFDQVWWLSIVAAIMSFTYSTVGLGLGIGKVAGNGTFKGSLTGISIGTETHAGP  263

Query  1022  VTETQKIWRSFQALGDIAFAYSYSIILIEIQDTVKSPPSESKTMRKASLFSTIVTTTFYM  843
             VT TQK+WRS QALG IAFAYS+S+ILIEIQDT++SPP+E KTM+KA+LFS I TT FY+
Sbjct  264   VTSTQKLWRSLQALGAIAFAYSFSVILIEIQDTIRSPPAEYKTMKKATLFSIITTTIFYL  323

Query  842   LCGCMGYAAFGDDAPGNLLTGFGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEKW  663
             LCGCMGYAAFGD APGNLLTGFGFYNP+WLLDIAN AI +HLVGAYQVYCQPLFAF+EKW
Sbjct  324   LCGCMGYAAFGDLAPGNLLTGFGFYNPYWLLDIANVAIFVHLVGAYQVYCQPLFAFVEKW  383

Query  662   VGAKWPDSEIITKEINLKIPGFGYPYKLNTFRLLWRTAFVLLTTVISMLLPFFNDVVGIL  483
                KWP S  +T E  + IP +G  Y+LN FRL+WRT FV+LTT+I+ML+PFFNDVVG+L
Sbjct  384   SARKWPQSNFVTAEYEVPIPFYGV-YQLNFFRLVWRTIFVMLTTLIAMLMPFFNDVVGLL  442

Query  482   GAFGFWPLTVYFPVRMYISQKKIPKWSTRWICLQMlsgaclavslaaaagsfagvVLDLK  303
             GA GFWPLTV+FP+ MYISQKKI +W+ +WI LQ+LS  CL +++AAA GS AGVVLDLK
Sbjct  443   GALGFWPLTVFFPIEMYISQKKIGRWTNQWIGLQILSMTCLVITIAAAVGSVAGVVLDLK  502

Query  302   LYRPFKTSY  276
              YRPFKTSY
Sbjct  503   TYRPFKTSY  511



>ref|XP_009411898.1| PREDICTED: amino acid permease 3-like isoform X2 [Musa acuminata 
subsp. malaccensis]
Length=471

 Score =   689 bits (1779),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 346/456 (76%), Positives = 398/456 (87%), Gaps = 2/456 (0%)
 Frame = -3

Query  1649  KGLDDDGRPQRTGTVWTASAHIITAVIGSGVLSLAWAIGQLGWVAGPSVMLLFSCVVYYT  1470
             K  DDDGR +RTGT+WTASAHIITAVIGSGVLSLAWAIGQLGWVAGP+VM+LFS V YYT
Sbjct  15    KCFDDDGRLKRTGTMWTASAHIITAVIGSGVLSLAWAIGQLGWVAGPAVMILFSFVTYYT  74

Query  1469  STLLADCYRAGDPVFGKRNYTYMDAVRSNLGGYQVKICGLIQYFNLFGIAIGYTIAASIS  1290
             S LLADCYR+GDPV GKRNYTYMDAVR+NL G++V++CG +QY N+ G+AIGYTIAASIS
Sbjct  75    SALLADCYRSGDPVAGKRNYTYMDAVRANLNGFKVELCGYLQYLNIVGVAIGYTIAASIS  134

Query  1289  MMAIKRSNCFHESGGKNPCHMSSNPYMIAFGIIEIILSQIPDFDQIWWLSIVAAVMSFTY  1110
             M+AIKRSNCFHE+G  +PC ++SNPY+I FG+ EI+ SQIPDFDQIWWLSIVAAVMSFTY
Sbjct  135   MVAIKRSNCFHENGDDSPCQVNSNPYIIMFGVAEIVFSQIPDFDQIWWLSIVAAVMSFTY  194

Query  1109  SGIGLGLGIAQVVANGAFKGSLTGISIGTVTETQKIWRSFQALGDIAFAYSYSIILIEIQ  930
             S IGL LGI QV+ NG  +GSLTGISIGTV++ +K+WRS QA GDIAFAYSYSIILIEIQ
Sbjct  195   SSIGLALGIVQVIKNGGMRGSLTGISIGTVSQMEKVWRSLQAFGDIAFAYSYSIILIEIQ  254

Query  929   DTVKS-PPSESKTMRKASLFSTIVTTTFYMLCGCMGYAAFGDDAPGNLLTGFGFYNPFWL  753
             DT+++ PPSE+K M+KA+L S  VTTTFYMLCGCMGYAAFGD APGNLLTGFGFYNP+WL
Sbjct  255   DTIRAPPPSEAKVMKKATLISVAVTTTFYMLCGCMGYAAFGDLAPGNLLTGFGFYNPYWL  314

Query  752   LDIANAAIVIHLVGAYQVYCQPLFAFIEKWVGAKWPDSEIITKEINLKIPGFGYPYKLNT  573
             LDIAN AIVIHLVGAYQVYCQPLFAF+EKW    WP+S+ I+K+I + +P     YK N 
Sbjct  315   LDIANVAIVIHLVGAYQVYCQPLFAFVEKWALRTWPESQFISKDIQVPLPA-SRSYKFNL  373

Query  572   FRLLWRTAFVLLTTVISMLLPFFNDVVGILGAFGFWPLTVYFPVRMYISQKKIPKWSTRW  393
             FRL WRTAFV++TTV+SMLLPFFNDVVG LGA GFWPLTVYFPV MYI QKK+ KWSTRW
Sbjct  374   FRLTWRTAFVVVTTVVSMLLPFFNDVVGFLGAVGFWPLTVYFPVEMYIMQKKVAKWSTRW  433

Query  392   ICLQMlsgaclavslaaaagsfagvVLDLKLYRPFK  285
             +CLQ+LS ACL +++A+AAGS AGVV DLK+Y PFK
Sbjct  434   MCLQLLSLACLIITIASAAGSIAGVVSDLKVYHPFK  469



>ref|XP_008377748.1| PREDICTED: amino acid permease 3-like [Malus domestica]
Length=514

 Score =   691 bits (1782),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 347/501 (69%), Positives = 415/501 (83%), Gaps = 20/501 (4%)
 Frame = -3

Query  1724  ESAAATKNH--RHHLGVSIDAPPLYGFKGL----------DDDGRPQRTGTVWTASAHII  1581
                A  + H  RH+L V +  P +   K +          DDDGR +RTGT WT+++HII
Sbjct  16    HHGAVEERHDIRHYLQVEVQ-PKVSESKAINPQSNYSTCFDDDGRLKRTGTFWTSASHII  74

Query  1580  TAVIGSGVLSLAWAIGQLGWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRNYTYM  1401
             TAVIGSGVLSLAWAI QLGWVAGP+V+LLF+ V  YTS LLA CYR G+P+ G+RNYTYM
Sbjct  75    TAVIGSGVLSLAWAIAQLGWVAGPTVLLLFAFVNLYTSNLLAMCYRTGNPITGQRNYTYM  134

Query  1400  DAVRSNLGGYQVKICGLIQYFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSS  1221
             DAV++NLGG +V +CGL+QY NLFG+AIGYTIA+S+SMMAIKRSNC+H SGG++PCHMSS
Sbjct  135   DAVKANLGGRKVMMCGLVQYLNLFGVAIGYTIASSVSMMAIKRSNCYHRSGGRDPCHMSS  194

Query  1220  NPYMIAFGIIEIILSQIPDFDQIWWLSIVAAVMSFTYSGIGLGLGIAQVVANGAFKGSLT  1041
             N YMI FGIIE+I SQIPDF+Q+WWLSIVAA+MSFTYS +GLGLGI +V  NG+FKGSL 
Sbjct  195   NGYMITFGIIEVIFSQIPDFNQVWWLSIVAAIMSFTYSSVGLGLGIXKVAGNGSFKGSLL  254

Query  1040  GISIGTVTE------TQKIWRSFQALGDIAFAYSYSIILIEIQDTVKSPPSESKTMRKAS  879
             GISIGTVT+      TQKIWRS QALG IAFAYSYS++LIEIQDT++SPP E KTM+KA+
Sbjct  255   GISIGTVTKSGTVTSTQKIWRSMQALGAIAFAYSYSLVLIEIQDTIRSPPXEHKTMKKAT  314

Query  878   LFSTIVTTTFYMLCGCMGYAAFGDDAPGNLLTGFGFYNPFWLLDIANAAIVIHLVGAYQV  699
             +FS  +TT FY+LCGC GYAAFGD APGNLLTGFGFYNP+WLLDIAN AIV+HLVGA+QV
Sbjct  315   VFSIAITTVFYLLCGCFGYAAFGDLAPGNLLTGFGFYNPYWLLDIANVAIVVHLVGAFQV  374

Query  698   YCQPLFAFIEKWVGAKWPDSEIITKEINLKIPGFGYPYKLNTFRLLWRTAFVLLTTVISM  519
             +CQPLFAF+EKW   +WP+S+ +T E  + IP +G  Y+LN FRL+WRT FV++TT+ISM
Sbjct  375   FCQPLFAFVEKWSAKRWPNSDFVTAEYEIPIPFYGV-YQLNLFRLVWRTIFVIITTLISM  433

Query  518   LLPFFNDVVGILGAFGFWPLTVYFPVRMYISQKKIPKWSTRWICLQMlsgaclavslaaa  339
             LLPFFNDVVGILGAFGFWPLTVYFPV MYI+Q+KI KWS++W+ LQMLS +CL VS+AAA
Sbjct  434   LLPFFNDVVGILGAFGFWPLTVYFPVEMYIAQEKIRKWSSKWVGLQMLSVSCLFVSIAAA  493

Query  338   agsfagvVLDLKLYRPFKTSY  276
              GS AGVVLDL+ Y+PFKTSY
Sbjct  494   VGSVAGVVLDLQTYKPFKTSY  514



>ref|XP_006847199.1| hypothetical protein AMTR_s00017p00252280 [Amborella trichopoda]
 gb|ERN08780.1| hypothetical protein AMTR_s00017p00252280 [Amborella trichopoda]
Length=497

 Score =   689 bits (1779),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 340/467 (73%), Positives = 396/467 (85%), Gaps = 7/467 (1%)
 Frame = -3

Query  1655  GFKGLDDDGRPQRTGTVWTASAHIITAVIGSGVLSLAWAIGQLGWVAGPSVMLLFSCVVY  1476
             G K  DDDGR +RTGTVWTASAHIITAVIGSGVLSLA+AIGQLGWVAGP+VM+LFS V Y
Sbjct  31    GSKCYDDDGRLKRTGTVWTASAHIITAVIGSGVLSLAFAIGQLGWVAGPTVMVLFSFVTY  90

Query  1475  YTSTLLADCYRAGDPVFGKRNYTYMDAVRSNLGGYQVKICGLIQYFNLFGIAIGYTIAAS  1296
             YTSTLL+DCYR+GDP+ GKRNYTY+DAVR+N+  + V++CG +QY  L G+AIGYTIA+S
Sbjct  91    YTSTLLSDCYRSGDPLTGKRNYTYVDAVRANMSEFNVRLCGWLQYAGLVGVAIGYTIASS  150

Query  1295  ISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFGIIEIILSQIPDFDQIWWLSIVAAVMSF  1116
             ISMMAIKRSNCFHE+ GKNPCH+SSNPYMI FGI EI+LSQIPDFDQIWWLS +AAVMSF
Sbjct  151   ISMMAIKRSNCFHETRGKNPCHVSSNPYMIMFGITEIVLSQIPDFDQIWWLSFLAAVMSF  210

Query  1115  TYSGIGLGLGIAQVVANGAFKGSLTGISIGTVTET------QKIWRSFQALGDIAFAYSY  954
             TYS IGLG+GI +V  NG  KGS+TGISIG +T        QK+WR+FQA+GDIAFAYSY
Sbjct  211   TYSSIGLGMGIGKVAVNGTIKGSMTGISIGAMTHAGPITAMQKVWRTFQAMGDIAFAYSY  270

Query  953   SIILIEIQDTVKSPPSESKTMRKASLFSTIVTTTFYMLCGCMGYAAFGDDAPGNLLTGFG  774
             SI+LIEIQD++KSPPSE+KTMRKA++ S  VTT FYMLCGCMGYAAFGD APGNLLTGFG
Sbjct  271   SIVLIEIQDSLKSPPSEAKTMRKATMISVTVTTIFYMLCGCMGYAAFGDQAPGNLLTGFG  330

Query  773   FYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEKWVGAKWPDSEIITKEINLKIPGFG  594
             FYNP+WLLDIANAAIV+HLVGAYQVYCQPLFAF+EK+   KWP S  I  E  L++P + 
Sbjct  331   FYNPYWLLDIANAAIVVHLVGAYQVYCQPLFAFVEKYAVRKWPKSWFINHEFELRVPFYS  390

Query  593   YPYKLNTFRLLWRTAFVLLTTVISMLLPFFNDVVGILGAFGFWPLTVYFPVRMYISQKKI  414
               + LN FRL+WRT+FV +TT+I+ML PFFN VVGILGAFGFWPLTVYFPV MYIS   I
Sbjct  391   KSFSLNLFRLVWRTSFVCMTTLIAMLFPFFNGVVGILGAFGFWPLTVYFPVEMYISHMHI  450

Query  413   PKWSTRWICLQMlsgaclavslaaaagsfagvVLDLK-LYRPFKTSY  276
             PKWST+W+CL+ LS ACL +S+ AA GS AG++ ++K  YRPF T+Y
Sbjct  451   PKWSTKWVCLRALSLACLVISMLAATGSVAGMIFEMKAAYRPFHTNY  497



>ref|XP_009411897.1| PREDICTED: amino acid permease 3-like isoform X1 [Musa acuminata 
subsp. malaccensis]
Length=478

 Score =   689 bits (1777),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 346/456 (76%), Positives = 398/456 (87%), Gaps = 2/456 (0%)
 Frame = -3

Query  1649  KGLDDDGRPQRTGTVWTASAHIITAVIGSGVLSLAWAIGQLGWVAGPSVMLLFSCVVYYT  1470
             K  DDDGR +RTGT+WTASAHIITAVIGSGVLSLAWAIGQLGWVAGP+VM+LFS V YYT
Sbjct  22    KCFDDDGRLKRTGTMWTASAHIITAVIGSGVLSLAWAIGQLGWVAGPAVMILFSFVTYYT  81

Query  1469  STLLADCYRAGDPVFGKRNYTYMDAVRSNLGGYQVKICGLIQYFNLFGIAIGYTIAASIS  1290
             S LLADCYR+GDPV GKRNYTYMDAVR+NL G++V++CG +QY N+ G+AIGYTIAASIS
Sbjct  82    SALLADCYRSGDPVAGKRNYTYMDAVRANLNGFKVELCGYLQYLNIVGVAIGYTIAASIS  141

Query  1289  MMAIKRSNCFHESGGKNPCHMSSNPYMIAFGIIEIILSQIPDFDQIWWLSIVAAVMSFTY  1110
             M+AIKRSNCFHE+G  +PC ++SNPY+I FG+ EI+ SQIPDFDQIWWLSIVAAVMSFTY
Sbjct  142   MVAIKRSNCFHENGDDSPCQVNSNPYIIMFGVAEIVFSQIPDFDQIWWLSIVAAVMSFTY  201

Query  1109  SGIGLGLGIAQVVANGAFKGSLTGISIGTVTETQKIWRSFQALGDIAFAYSYSIILIEIQ  930
             S IGL LGI QV+ NG  +GSLTGISIGTV++ +K+WRS QA GDIAFAYSYSIILIEIQ
Sbjct  202   SSIGLALGIVQVIKNGGMRGSLTGISIGTVSQMEKVWRSLQAFGDIAFAYSYSIILIEIQ  261

Query  929   DTVKS-PPSESKTMRKASLFSTIVTTTFYMLCGCMGYAAFGDDAPGNLLTGFGFYNPFWL  753
             DT+++ PPSE+K M+KA+L S  VTTTFYMLCGCMGYAAFGD APGNLLTGFGFYNP+WL
Sbjct  262   DTIRAPPPSEAKVMKKATLISVAVTTTFYMLCGCMGYAAFGDLAPGNLLTGFGFYNPYWL  321

Query  752   LDIANAAIVIHLVGAYQVYCQPLFAFIEKWVGAKWPDSEIITKEINLKIPGFGYPYKLNT  573
             LDIAN AIVIHLVGAYQVYCQPLFAF+EKW    WP+S+ I+K+I + +P     YK N 
Sbjct  322   LDIANVAIVIHLVGAYQVYCQPLFAFVEKWALRTWPESQFISKDIQVPLPA-SRSYKFNL  380

Query  572   FRLLWRTAFVLLTTVISMLLPFFNDVVGILGAFGFWPLTVYFPVRMYISQKKIPKWSTRW  393
             FRL WRTAFV++TTV+SMLLPFFNDVVG LGA GFWPLTVYFPV MYI QKK+ KWSTRW
Sbjct  381   FRLTWRTAFVVVTTVVSMLLPFFNDVVGFLGAVGFWPLTVYFPVEMYIMQKKVAKWSTRW  440

Query  392   ICLQMlsgaclavslaaaagsfagvVLDLKLYRPFK  285
             +CLQ+LS ACL +++A+AAGS AGVV DLK+Y PFK
Sbjct  441   MCLQLLSLACLIITIASAAGSIAGVVSDLKVYHPFK  476



>emb|CAN77083.1| hypothetical protein VITISV_003992 [Vitis vinifera]
Length=546

 Score =   691 bits (1783),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 340/492 (69%), Positives = 405/492 (82%), Gaps = 2/492 (0%)
 Frame = -3

Query  1751  GGSKIMQMGESAAATKNHRHHLGVSIDAPPLYGFKGLDDDGRPQRTGTVWTASAHIITAV  1572
             GG     M ++    K H+  L +  D  P    K LDDDG P+RTGTVWTASAHIIT++
Sbjct  57    GGKAGTTMLQTKVDEKPHQM-LHLPSDVLPHDISKCLDDDGXPKRTGTVWTASAHIITSI  115

Query  1571  IGSGVLSLAWAIGQLGWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRNYTYMDAV  1392
             IGSGVLSLAWA+ QLGW+ GP+V+L+F+ V+ YTS+LLADCYR+GDP+ GKRNYTYM+ V
Sbjct  116   IGSGVLSLAWAVAQLGWIGGPTVILMFAVVICYTSSLLADCYRSGDPISGKRNYTYMEVV  175

Query  1391  RSNLGGYQVKICGLIQYFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPY  1212
             +SNLGG +VKICGLIQY NLFGI +GYTIA S+SMMA+ RSNCFH SG KNPCH SSNPY
Sbjct  176   QSNLGGAKVKICGLIQYCNLFGITVGYTIATSVSMMAVMRSNCFHRSGNKNPCHESSNPY  235

Query  1211  MIAFGIIEIILSQIPDFDQIWWLSIVAAVMSFTYSGIGLGLGIAQVVANGAFKGSLTGIS  1032
             MI FGIIEI+LSQIPDFDQIWWLSI+A++MSFTYS IGLGLG++ V ANG FKG+LTGIS
Sbjct  236   MIMFGIIEIVLSQIPDFDQIWWLSILASIMSFTYSSIGLGLGVSTVAANGIFKGTLTGIS  295

Query  1031  IGTVTETQKIWRSFQALGDIAFAYSYSIILIEIQDTVKSPPSESKTMRKASLFSTIVTTT  852
             IGT+T TQK+W+ FQAL +IAF+Y YS +L+EIQDT+KSPPSE+ TM+KA+L S  +TT+
Sbjct  296   IGTITRTQKLWKCFQALANIAFSYCYSFVLVEIQDTIKSPPSEATTMKKANLISVAITTS  355

Query  851   FYMLCGCMGYAAFGDDAPGNLLTGFGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAFI  672
             FYMLCGCMGYAA GD APGNLLT FGF +PFWL+DIAN AIVIHLVGAYQV+ QPLFAFI
Sbjct  356   FYMLCGCMGYAALGDQAPGNLLTEFGFRDPFWLIDIANIAIVIHLVGAYQVFSQPLFAFI  415

Query  671   EKWVGAKWPDSEIITKEINLKIPGFGYPYKLNTFRLLWRTAFVLLTTVISMLLPFFNDVV  492
             EKW+  K P S  ITKEI + IP +G  Y LN FRL+WR+AFV++TT++SMLLPFFNDV+
Sbjct  416   EKWLSKKCPSSTFITKEIKVPIPCWGV-YNLNLFRLVWRSAFVMVTTLVSMLLPFFNDVL  474

Query  491   GILGAFGFWPLTVYFPVRMYISQKKIPKWSTRWICLQMlsgaclavslaaaagsfagvVL  312
             GI+GAF FWPL VYFPV MYI+Q++IPKW  +W C QMLS ACL +S+ A  GS AGVV 
Sbjct  475   GIIGAFAFWPLAVYFPVEMYIAQRRIPKWGVKWTCFQMLSLACLMISIVAGIGSIAGVVT  534

Query  311   DLKLYRPFKTSY  276
             DL+ Y+PFKT Y
Sbjct  535   DLRAYQPFKTRY  546



>ref|XP_004503904.1| PREDICTED: amino acid permease 2-like [Cicer arietinum]
Length=486

 Score =   689 bits (1777),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 346/458 (76%), Positives = 393/458 (86%), Gaps = 4/458 (1%)
 Frame = -3

Query  1649  KGLDDDGRPQRTGTVWTASAHIITAVIGSGVLSLAWAIGQLGWVAGPSVMLLFSCVVYYT  1470
             K  DDDGR +RTG+VWTAS+HIITAVIGSGVLSLAWAI QLGW+AGP+VM+LFS V  YT
Sbjct  33    KSYDDDGRLKRTGSVWTASSHIITAVIGSGVLSLAWAIAQLGWIAGPAVMILFSMVTIYT  92

Query  1469  STLLADCYRAGDPVFGKRNYTYMDAVRSNLGGYQVKICGLIQYFNLFGIAIGYTIAASIS  1290
             S+ LADCYR+GD   GKRNYTYMDAVRS LGG  V  CG+ QY NLFGI IGYTIAASIS
Sbjct  93    SSFLADCYRSGDLNSGKRNYTYMDAVRSILGGVNVTFCGIFQYLNLFGIVIGYTIAASIS  152

Query  1289  MMAIKRSNCFHESGGKNPCHMSSNPYMIAFGIIEIILSQIPDFDQIWWLSIVAAVMSFTY  1110
             M AIKRSNCFH+SGGKNPCHMSSN YMI FGI EI LSQIPDFDQIWWLS VAA+MSFTY
Sbjct  153   MTAIKRSNCFHQSGGKNPCHMSSNQYMIIFGITEIFLSQIPDFDQIWWLSSVAAIMSFTY  212

Query  1109  SGIGLGLGIAQVVANGAFKGSLTGISIGTVTETQKIWRSFQALGDIAFAYSYSIILIEIQ  930
             S IGL LGIA+V  NG+  GSLTGISIGTV+ETQKIWR+ QALGDIAFAYSY+++LIEIQ
Sbjct  213   SIIGLALGIAKVAENGSIMGSLTGISIGTVSETQKIWRTSQALGDIAFAYSYAVVLIEIQ  272

Query  929   DTVKSPPSESKTMRKASLFSTIVTTTFYMLCGCMGYAAFGDDAPGNLLTGFGFYNPFWLL  750
             DT+KSPPSE+K+M+KA+  S  VTTTFYMLCGCMGYAAFGD +PGNLLTGFGFYNP+WL+
Sbjct  273   DTLKSPPSEAKSMKKATKISIAVTTTFYMLCGCMGYAAFGDASPGNLLTGFGFYNPYWLI  332

Query  749   DIANAAIVIHLVGAYQVYCQPLFAFIEKWVGAKWPDSEIITKEINLKIPGFGYPYKLNTF  570
             DIANAAIV+HLVGAYQV+ QP+FAF+EK    +WP+   I KE  + +PG   PYKLN F
Sbjct  333   DIANAAIVVHLVGAYQVFSQPIFAFVEKSATQRWPN---IEKEFKIAVPGVP-PYKLNLF  388

Query  569   RLLWRTAFVLLTTVISMLLPFFNDVVGILGAFGFWPLTVYFPVRMYISQKKIPKWSTRWI  390
             RL+WRT FV+LTTVISMLLPFFND+VG++GA GFWPLTVYFPV MYISQK+IPKWS RWI
Sbjct  389   RLVWRTVFVVLTTVISMLLPFFNDIVGVIGALGFWPLTVYFPVEMYISQKRIPKWSNRWI  448

Query  389   CLQMlsgaclavslaaaagsfagvVLDLKLYRPFKTSY  276
              LQ+ S ACL VS+ AA GS AGV+LDLK Y+PF+++Y
Sbjct  449   WLQIFSVACLVVSVVAAVGSVAGVLLDLKKYKPFQSNY  486



>ref|XP_003542145.1| PREDICTED: amino acid permease 3 isoform X1 [Glycine max]
 ref|XP_006593825.1| PREDICTED: amino acid permease 3 isoform X2 [Glycine max]
 ref|XP_006593826.1| PREDICTED: amino acid permease 3 isoform X3 [Glycine max]
 gb|KHN05187.1| Amino acid permease 2 [Glycine soja]
Length=479

 Score =   687 bits (1774),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 342/474 (72%), Positives = 400/474 (84%), Gaps = 1/474 (0%)
 Frame = -3

Query  1697  RHHLGVSIDAPPLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSGVLSLAWAIGQLGWV  1518
             +    VS D     G K  DDDGR +RTGT+WTASAHIITAVIGSGVLSLAWAI QLGW+
Sbjct  7     KQTFEVSNDTLQRVGSKSFDDDGRLKRTGTIWTASAHIITAVIGSGVLSLAWAIAQLGWI  66

Query  1517  AGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRNYTYMDAVRSNLGGYQVKICGLIQYF  1338
             AGP VM+LFS V YYTSTLLA CYR+GD + GKRNYTY  AVRS LGG+ VK CG +QY 
Sbjct  67    AGPVVMILFSIVTYYTSTLLATCYRSGDQLSGKRNYTYTQAVRSYLGGFSVKFCGWVQYA  126

Query  1337  NLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFGIIEIILSQIPDFD  1158
             NLFG+AIGYTIAASISMMAIKRSNC+H SGGKNPC M+SN YMI++G+ EII SQIPDF 
Sbjct  127   NLFGVAIGYTIAASISMMAIKRSNCYHSSGGKNPCKMNSNWYMISYGVSEIIFSQIPDFH  186

Query  1157  QIWWLSIVAAVMSFTYSGIGLGLGIAQVVANGAFKGSLTGISIGTVTETQKIWRSFQALG  978
             ++WWLSIVAAVMSFTYS IGLGLGI +V+ NG  KGSLTG++IGTVTE+QKIWR+FQALG
Sbjct  187   ELWWLSIVAAVMSFTYSFIGLGLGIGKVIGNGRIKGSLTGVTIGTVTESQKIWRTFQALG  246

Query  977   DIAFAYSYSIILIEIQDTVKSPPSESKTMRKASLFSTIVTTTFYMLCGCMGYAAFGDDAP  798
             +IAFAYSYS+ILIEIQDT+KSPP+ES+TM KA+L S +VTT FYMLCGC GYA+FGD +P
Sbjct  247   NIAFAYSYSMILIEIQDTIKSPPAESETMSKATLISVLVTTVFYMLCGCFGYASFGDASP  306

Query  797   GNLLTGFGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEKWVGAKWPDSEIITKEI  618
             GNLLTGFGFYNPFWL+DIANA IVIHLVGAYQVYCQPLF+F+E     ++P+S+ +++E 
Sbjct  307   GNLLTGFGFYNPFWLIDIANAGIVIHLVGAYQVYCQPLFSFVESNAAERFPNSDFMSREF  366

Query  617   NLKIPGFGYPYKLNTFRLLWRTAFVLLTTVISMLLPFFNDVVGILGAFGFWPLTVYFPVR  438
              + IPG   PYKLN FRL+WRT FV+L+TVI+MLLPFFND+VG++GA GFWPLTVY PV 
Sbjct  367   EVPIPGCK-PYKLNLFRLVWRTLFVILSTVIAMLLPFFNDIVGLIGAIGFWPLTVYLPVE  425

Query  437   MYISQKKIPKWSTRWICLQMlsgaclavslaaaagsfagvVLDLKLYRPFKTSY  276
             MYI+Q KIPKW  +WI LQMLS AC  +++ AAAGS AGV+ DLK+Y+PF TSY
Sbjct  426   MYITQTKIPKWGIKWIGLQMLSVACFVITILAAAGSIAGVIDDLKVYKPFVTSY  479



>emb|CAC51425.1| amino acid permease AAP4 [Vicia faba var. minor]
Length=481

 Score =   687 bits (1773),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 344/480 (72%), Positives = 403/480 (84%), Gaps = 6/480 (1%)
 Frame = -3

Query  1712  ATKNHRHHLGVSIDAPPLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSGVLSLAWAIG  1533
             A+ NH     VSID       K  DDDGR +RTGT WTASAH+ITAVIGSGVLSLAWAI 
Sbjct  7     ASNNHHQTFYVSIDQQ--IDSKFFDDDGRVKRTGTSWTASAHVITAVIGSGVLSLAWAIA  64

Query  1532  QLGWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRNYTYMDAVRSNLGGYQVKICG  1353
             QLGW+AGP VM LF+ V YYTS LL +CYR GDPV GKRNYTYM+ V SNLGG+QV++CG
Sbjct  65    QLGWIAGPIVMFLFAWVTYYTSVLLCECYRNGDPVNGKRNYTYMEVVHSNLGGFQVQLCG  124

Query  1352  LIQYFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFGIIEIILSQ  1173
             LIQY NL G+AIGYT+A++ISMMAI RSNCFH SGGK+PCHM+SN YMIAFG ++II SQ
Sbjct  125   LIQYLNLVGVAIGYTVASAISMMAIVRSNCFHRSGGKDPCHMNSNIYMIAFGAVQIIFSQ  184

Query  1172  IPDFDQIWWLSIVAAVMSFTYSGIGLGLGIAQVVANGAFKGSLTGISIGTVTETQKIWRS  993
             IPDFDQ+WWLSIVA VMSFTYS IGLGLGI +V+ N  F G++TGI+   VT+ QK W S
Sbjct  185   IPDFDQLWWLSIVAVVMSFTYSTIGLGLGIGKVIENKKFAGTITGIN--DVTKAQKTWGS  242

Query  992   FQALGDIAFAYSYSIILIEIQDTVKS-PPSESKTMRKASLFSTIVTTTFYMLCGCMGYAA  816
              QALGDIAFAYS+S+ILIEIQDT+K+ PPSESKTM+KA+L S IVTT FYMLCGC GYAA
Sbjct  243   LQALGDIAFAYSFSMILIEIQDTIKAPPPSESKTMKKATLISVIVTTFFYMLCGCFGYAA  302

Query  815   FGDDAPGNLLTGFGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEKWVGAKWPDSE  636
             FG+ +PGNLLTGFGFYNPFWLLDIANAAIVIHL+GAYQVYCQPLFAF+E +   ++PDS+
Sbjct  303   FGNSSPGNLLTGFGFYNPFWLLDIANAAIVIHLIGAYQVYCQPLFAFVENYTAKRFPDSD  362

Query  635   IITKEINLKIPGFGYPYKLNTFRLLWRTAFVLLTTVISMLLPFFNDVVGILGAFGFWPLT  456
              + K++ + IPG    YKLN FRL+WRT +V+LTT+ISMLLPFFND+VG+LGA GFWPLT
Sbjct  363   FVNKDVKIPIPGLD-RYKLNLFRLVWRTVYVILTTLISMLLPFFNDIVGLLGAIGFWPLT  421

Query  455   VYFPVRMYISQKKIPKWSTRWICLQMlsgaclavslaaaagsfagvVLDLKLYRPFKTSY  276
             VYFPV MYI QKKIPKWST+WICLQ+LSGACL +++AA  GS AG++LDLK+++PFKT Y
Sbjct  422   VYFPVEMYIIQKKIPKWSTKWICLQLLSGACLIITIAATIGSIAGLILDLKVFKPFKTIY  481



>gb|KHN19623.1| Amino acid permease 3 [Glycine soja]
Length=478

 Score =   686 bits (1770),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 341/474 (72%), Positives = 400/474 (84%), Gaps = 1/474 (0%)
 Frame = -3

Query  1697  RHHLGVSIDAPPLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSGVLSLAWAIGQLGWV  1518
             +    VS D     G K  DDDGR +RTGT+WTASAHI+TAVIGSGVLSLAWAI QLGW+
Sbjct  6     KQTFEVSNDTLQQGGSKSFDDDGRLKRTGTIWTASAHIVTAVIGSGVLSLAWAIAQLGWL  65

Query  1517  AGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRNYTYMDAVRSNLGGYQVKICGLIQYF  1338
             AGP VM+LFS V YYTSTLLA CYR+GD + GKRNYTY  AVRSNLGG  V  CG +QY 
Sbjct  66    AGPIVMILFSIVTYYTSTLLACCYRSGDQLSGKRNYTYTQAVRSNLGGLAVMFCGWVQYA  125

Query  1337  NLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFGIIEIILSQIPDFD  1158
             NLFG+AIGYTIAASISMMA+KRSNC+H SGGKNPC M+SN YMI++G+ EII SQIPDF 
Sbjct  126   NLFGVAIGYTIAASISMMAVKRSNCYHSSGGKNPCKMNSNWYMISYGVAEIIFSQIPDFH  185

Query  1157  QIWWLSIVAAVMSFTYSGIGLGLGIAQVVANGAFKGSLTGISIGTVTETQKIWRSFQALG  978
             ++WWLSIVAAVMSFTYS IGLGLGI +V+ NG  KGSLTG+++GTVTE+QKIWRSFQALG
Sbjct  186   ELWWLSIVAAVMSFTYSFIGLGLGIGKVIGNGRIKGSLTGVTVGTVTESQKIWRSFQALG  245

Query  977   DIAFAYSYSIILIEIQDTVKSPPSESKTMRKASLFSTIVTTTFYMLCGCMGYAAFGDDAP  798
             +IAFAYSYS+ILIEIQDT+KSPP+ES+TM KA+L S ++TT FYMLCGC GYA+FGD +P
Sbjct  246   NIAFAYSYSMILIEIQDTIKSPPAESQTMSKATLISVLITTVFYMLCGCFGYASFGDASP  305

Query  797   GNLLTGFGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEKWVGAKWPDSEIITKEI  618
             GNLLTGFGFYNP+WL+DIAN  IVIHLVGAYQVYCQPLF+F+E    A++P+S+ +++E 
Sbjct  306   GNLLTGFGFYNPYWLIDIANVGIVIHLVGAYQVYCQPLFSFVESHAAARFPNSDFMSREF  365

Query  617   NLKIPGFGYPYKLNTFRLLWRTAFVLLTTVISMLLPFFNDVVGILGAFGFWPLTVYFPVR  438
              + IPG   PY+LN FRL+WRT FV+L+TVI+MLLPFFND+VG++GA GFWPLTVY PV 
Sbjct  366   EVPIPGCK-PYRLNLFRLVWRTIFVILSTVIAMLLPFFNDIVGLIGAIGFWPLTVYLPVE  424

Query  437   MYISQKKIPKWSTRWICLQMlsgaclavslaaaagsfagvVLDLKLYRPFKTSY  276
             MYI+Q KIPKW  RWICLQMLS AC  V+L AAAGS AGV+ DLK+Y+PF TSY
Sbjct  425   MYITQTKIPKWGPRWICLQMLSAACFVVTLLAAAGSIAGVIDDLKVYKPFVTSY  478



>gb|KHN25477.1| Amino acid permease 2 [Glycine soja]
Length=513

 Score =   687 bits (1774),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 347/464 (75%), Positives = 392/464 (84%), Gaps = 7/464 (2%)
 Frame = -3

Query  1649  KGLDDDGRPQRTGTVWTASAHIITAVIGSGVLSLAWAIGQLGWVAGPSVMLLFSCVVYYT  1470
             K  DDDGR +RTGT WTA+AHIITAVIGSGVLSLAWA+ QLGWVAGP VM LF+ V  YT
Sbjct  51    KCFDDDGRLKRTGTFWTATAHIITAVIGSGVLSLAWAVAQLGWVAGPVVMFLFAVVNLYT  110

Query  1469  STLLADCYRAGDPVFGKRNYTYMDAVRSNLGGYQVKICGLIQYFNLFGIAIGYTIAASIS  1290
             S LL  CYR GD V G RNYTYM+AV+S LGG +VK+CGLIQY NLFG+AIGYTIAAS+S
Sbjct  111   SNLLTQCYRTGDSVNGHRNYTYMEAVKSILGGKKVKLCGLIQYINLFGVAIGYTIAASVS  170

Query  1289  MMAIKRSNCFHESGGKNPCHMSSNPYMIAFGIIEIILSQIPDFDQIWWLSIVAAVMSFTY  1110
             MMAIKRSNC+H S GK+PCHMSSN YMI FGI E+I SQIPDFDQ+WWLSIVAA+MSFTY
Sbjct  171   MMAIKRSNCYHSSHGKDPCHMSSNGYMITFGIAEVIFSQIPDFDQVWWLSIVAAIMSFTY  230

Query  1109  SGIGLGLGIAQVVANGAFKGSLTGISIGTVTE------TQKIWRSFQALGDIAFAYSYSI  948
             S +GL LG+A+V  N  FKGSL GISIGTVT+      TQKIWRS QALG +AFAYS+SI
Sbjct  231   SSVGLSLGVAKVAENKTFKGSLMGISIGTVTQAGTVTSTQKIWRSLQALGAMAFAYSFSI  290

Query  947   ILIEIQDTVKSPPSESKTMRKASLFSTIVTTTFYMLCGCMGYAAFGDDAPGNLLTGFGFY  768
             ILIEIQDT+KSPP+E KTMRKA+  S  VTT FY+LCGCMGYAAFGD+APGNLLTGFGFY
Sbjct  291   ILIEIQDTIKSPPAEHKTMRKATTLSIAVTTVFYLLCGCMGYAAFGDNAPGNLLTGFGFY  350

Query  767   NPFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEKWVGAKWPDSEIITKEINLKIPGFGYP  588
             NP+WLLDIAN AIVIHLVGAYQV+ QPLFAF+EKW   KWP S  +T E ++ IP FG  
Sbjct  351   NPYWLLDIANLAIVIHLVGAYQVFSQPLFAFVEKWSVRKWPKSNFVTAEYDIPIPCFGV-  409

Query  587   YKLNTFRLLWRTAFVLLTTVISMLLPFFNDVVGILGAFGFWPLTVYFPVRMYISQKKIPK  408
             Y+LN FRL+WRT FVLLTT+I+ML+PFFNDVVGILGAFGFWPLTVYFP+ MYISQKKI +
Sbjct  410   YQLNFFRLVWRTIFVLLTTLIAMLMPFFNDVVGILGAFGFWPLTVYFPIDMYISQKKIGR  469

Query  407   WSTRWICLQMlsgaclavslaaaagsfagvVLDLKLYRPFKTSY  276
             W++RWI LQ+LS +CL +SL AA GS AGVVLDLK Y+PFKTSY
Sbjct  470   WTSRWIGLQLLSVSCLIISLLAAVGSMAGVVLDLKTYKPFKTSY  513



>dbj|BAO45885.1| amino acid permease [Acacia mangium]
Length=486

 Score =   686 bits (1771),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 344/474 (73%), Positives = 397/474 (84%), Gaps = 6/474 (1%)
 Frame = -3

Query  1682  VSIDAPPLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSGVLSLAWAIGQLGWVAGPSV  1503
             V I+  P    K  DDDGR +RTGTVWTASAHIITAVIGSGVLSLAWAI QLGW+AGP+V
Sbjct  12    VDIEVAPQGESKCFDDDGRLKRTGTVWTASAHIITAVIGSGVLSLAWAIAQLGWIAGPAV  71

Query  1502  MLLFSCVVYYTSTLLADCYRAGDPVFGKRNYTYMDAVRSNLGGYQVKICGLIQYFNLFGI  1323
             M+LFS V YYTS+LLA CYR+GDP+ GKRNYTYMDAVRSNLGG++VKICGLIQY NLFG+
Sbjct  72    MILFSLVTYYTSSLLAACYRSGDPLTGKRNYTYMDAVRSNLGGFKVKICGLIQYVNLFGV  131

Query  1322  AIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFGIIEIILSQIPDFDQIWWL  1143
             AIGYTIAASISMMA+++SNC H++G K+ C M+ + Y+IAFGI+EII SQIPDFDQ+WWL
Sbjct  132   AIGYTIAASISMMAVQKSNCIHKTGSKDECKMNGDIYIIAFGIVEIIFSQIPDFDQLWWL  191

Query  1142  SIVAAVMSFTYSGIGLGLGIAQVVANGAFKGSLTGISIGTV------TETQKIWRSFQAL  981
             SI+AAVMSFTYS IGLGLG+AQ + N    GSLTGIS+G V      TETQKIWRSFQAL
Sbjct  192   SILAAVMSFTYSTIGLGLGVAQTIENKKIGGSLTGISVGAVIDSLVITETQKIWRSFQAL  251

Query  980   GDIAFAYSYSIILIEIQDTVKSPPSESKTMRKASLFSTIVTTTFYMLCGCMGYAAFGDDA  801
             GDIAFAYSYS+ILIEIQDT+K+PPSE+KTMR+A+  S  VTT FYMLCGC GYAAFGD +
Sbjct  252   GDIAFAYSYSMILIEIQDTLKAPPSEAKTMRRATFISVAVTTFFYMLCGCFGYAAFGDAS  311

Query  800   PGNLLTGFGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEKWVGAKWPDSEIITKE  621
             PGNLLTGFGFY P+WLLDIAN AIV+HLVGAYQVYCQPLF+FIEK    ++P S  I KE
Sbjct  312   PGNLLTGFGFYKPYWLLDIANVAIVVHLVGAYQVYCQPLFSFIEKTAADRFPGSNFINKE  371

Query  620   INLKIPGFGYPYKLNTFRLLWRTAFVLLTTVISMLLPFFNDVVGILGAFGFWPLTVYFPV  441
             I + IPG   PY+LN FRL+WRT FV+ TTVISMLLPFF  V G+LGA GFWPLTV+FPV
Sbjct  372   IEVPIPGLRSPYQLNFFRLVWRTIFVITTTVISMLLPFFGGVAGLLGALGFWPLTVFFPV  431

Query  440   RMYISQKKIPKWSTRWICLQMlsgaclavslaaaagsfagvVLDLKLYRPFKTS  279
              MYI+QKKIP+WST+W+CL MLS ACL +SLAAAAGS A ++  LK Y+PF  +
Sbjct  432   EMYINQKKIPRWSTKWVCLHMLSIACLFISLAAAAGSIADIIDQLKSYKPFAVT  485



>ref|XP_006596218.1| PREDICTED: amino acid permease 3-like isoform X1 [Glycine max]
 ref|XP_006596219.1| PREDICTED: amino acid permease 3-like isoform X2 [Glycine max]
Length=479

 Score =   686 bits (1770),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 341/474 (72%), Positives = 400/474 (84%), Gaps = 1/474 (0%)
 Frame = -3

Query  1697  RHHLGVSIDAPPLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSGVLSLAWAIGQLGWV  1518
             +    VS D     G K  DDDGR +RTGT+WTASAHI+TAVIGSGVLSLAWAI QLGW+
Sbjct  7     KQTFEVSNDTLQQGGSKSFDDDGRLKRTGTIWTASAHIVTAVIGSGVLSLAWAIAQLGWL  66

Query  1517  AGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRNYTYMDAVRSNLGGYQVKICGLIQYF  1338
             AGP VM+LFS V YYTSTLLA CYR+GD + GKRNYTY  AVRSNLGG  V  CG +QY 
Sbjct  67    AGPIVMILFSIVTYYTSTLLACCYRSGDQLSGKRNYTYTQAVRSNLGGLAVMFCGWVQYA  126

Query  1337  NLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFGIIEIILSQIPDFD  1158
             NLFG+AIGYTIAASISMMA+KRSNC+H SGGKNPC M+SN YMI++G+ EII SQIPDF 
Sbjct  127   NLFGVAIGYTIAASISMMAVKRSNCYHSSGGKNPCKMNSNWYMISYGVAEIIFSQIPDFH  186

Query  1157  QIWWLSIVAAVMSFTYSGIGLGLGIAQVVANGAFKGSLTGISIGTVTETQKIWRSFQALG  978
             ++WWLSIVAAVMSFTYS IGLGLGI +V+ NG  KGSLTG+++GTVTE+QKIWRSFQALG
Sbjct  187   ELWWLSIVAAVMSFTYSFIGLGLGIGKVIGNGRIKGSLTGVTVGTVTESQKIWRSFQALG  246

Query  977   DIAFAYSYSIILIEIQDTVKSPPSESKTMRKASLFSTIVTTTFYMLCGCMGYAAFGDDAP  798
             +IAFAYSYS+ILIEIQDT+KSPP+ES+TM KA+L S ++TT FYMLCGC GYA+FGD +P
Sbjct  247   NIAFAYSYSMILIEIQDTIKSPPAESQTMSKATLISVLITTVFYMLCGCFGYASFGDASP  306

Query  797   GNLLTGFGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEKWVGAKWPDSEIITKEI  618
             GNLLTGFGFYNP+WL+DIAN  IVIHLVGAYQVYCQPLF+F+E    A++P+S+ +++E 
Sbjct  307   GNLLTGFGFYNPYWLIDIANVGIVIHLVGAYQVYCQPLFSFVESHAAARFPNSDFMSREF  366

Query  617   NLKIPGFGYPYKLNTFRLLWRTAFVLLTTVISMLLPFFNDVVGILGAFGFWPLTVYFPVR  438
              + IPG   PY+LN FRL+WRT FV+L+TVI+MLLPFFND+VG++GA GFWPLTVY PV 
Sbjct  367   EVPIPGCK-PYRLNLFRLVWRTIFVILSTVIAMLLPFFNDIVGLIGAIGFWPLTVYLPVE  425

Query  437   MYISQKKIPKWSTRWICLQMlsgaclavslaaaagsfagvVLDLKLYRPFKTSY  276
             MYI+Q KIPKW  RWICLQMLS AC  V+L AAAGS AGV+ DLK+Y+PF TSY
Sbjct  426   MYITQTKIPKWGPRWICLQMLSAACFVVTLLAAAGSIAGVIDDLKVYKPFVTSY  479



>ref|XP_010527720.1| PREDICTED: amino acid permease 5-like isoform X2 [Tarenaya hassleriana]
Length=480

 Score =   685 bits (1767),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 337/478 (71%), Positives = 399/478 (83%), Gaps = 1/478 (0%)
 Frame = -3

Query  1709  TKNHRHHLGVSIDAPPLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSGVLSLAWAIGQ  1530
             T N     GVS+D  P       DDDGRP+RTGTVWTASAHIITAVIGSGVLSLAWA+ Q
Sbjct  4     TVNGTQSFGVSMDVLPKNRSDLFDDDGRPKRTGTVWTASAHIITAVIGSGVLSLAWAVAQ  63

Query  1529  LGWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRNYTYMDAVRSNLGGYQVKICGL  1350
             LGWVAGP+VM LFS V YYTS LL  CYR+GD V GKRNYTYMDAV++NLGG +VK+CGL
Sbjct  64    LGWVAGPAVMFLFSLVTYYTSILLCSCYRSGDSVSGKRNYTYMDAVQANLGGVKVKLCGL  123

Query  1349  IQYFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFGIIEIILSQI  1170
             +QY NLFG AIGYTIA+++SM+AI+RSNC H+S GK+PCH++ NPYMIAFG+ +I+ SQI
Sbjct  124   VQYLNLFGTAIGYTIASAVSMIAIQRSNCHHKSHGKDPCHINGNPYMIAFGVAQIVFSQI  183

Query  1169  PDFDQIWWLSIVAAVMSFTYSGIGLGLGIAQVVANGAFKGSLTGISIGTVTETQKIWRSF  990
             PDFD++WWLSIVAAVMSF YS IGL LG+++V  N   KGSLTGI +GTVT +QK+WRSF
Sbjct  184   PDFDRLWWLSIVAAVMSFMYSSIGLALGVSKVAENKEIKGSLTGIGVGTVTPSQKVWRSF  243

Query  989   QALGDIAFAYSYSIILIEIQDTVKSPPSESKTMRKASLFSTIVTTTFYMLCGCMGYAAFG  810
             QALG+IAFAYSYS+ILIEIQDT+KSPP E KTMRKA+L S  VTT FYMLCGC+GYAAFG
Sbjct  244   QALGNIAFAYSYSMILIEIQDTLKSPPVEEKTMRKATLISVAVTTLFYMLCGCIGYAAFG  303

Query  809   DDAPGNLLTGFGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEKWVGAKWPDSEII  630
             D +PGNLL+G GF+NP+WL+DIAN  IVIHLVGAYQVYCQPLFAF+E     ++PDS++I
Sbjct  304   DTSPGNLLSG-GFFNPYWLIDIANLTIVIHLVGAYQVYCQPLFAFVENQASKRFPDSKLI  362

Query  629   TKEINLKIPGFGYPYKLNTFRLLWRTAFVLLTTVISMLLPFFNDVVGILGAFGFWPLTVY  450
             TKEI +++     PY LN FRL+WRT FV+LTT+ISML+PFFNDV+G LGA GFWPLTVY
Sbjct  363   TKEIKIRLFPGREPYNLNLFRLVWRTLFVILTTLISMLMPFFNDVLGFLGAIGFWPLTVY  422

Query  449   FPVRMYISQKKIPKWSTRWICLQMlsgaclavslaaaagsfagvVLDLKLYRPFKTSY  276
             FPV MYI  K+I +WSTRW+CLQ+LS ACL V+LA+AAGS  G+V DLK Y+PFKT +
Sbjct  423   FPVEMYIEHKRIQRWSTRWVCLQVLSFACLVVTLASAAGSVVGIVTDLKTYKPFKTDF  480



>gb|AAX56951.1| amino acid transporter [Pisum sativum]
Length=482

 Score =   685 bits (1767),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 343/481 (71%), Positives = 406/481 (84%), Gaps = 7/481 (1%)
 Frame = -3

Query  1712  ATKNHRHH-LGVSIDAPPLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSGVLSLAWAI  1536
             A+KNH H    VSID       K  DDDGR +RTGT WTASAH+ITAVIGSGVLSLAWAI
Sbjct  7     ASKNHHHQTFDVSIDQQ--LDSKFFDDDGRVKRTGTSWTASAHVITAVIGSGVLSLAWAI  64

Query  1535  GQLGWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRNYTYMDAVRSNLGGYQVKIC  1356
              QLGW+AGP VM+LF+ V YYTS LLA+CYR GDPV GKRNYTYM+ V SNLGG QV+ C
Sbjct  65    AQLGWIAGPVVMILFAWVTYYTSVLLAECYRNGDPVNGKRNYTYMEVVHSNLGGLQVQFC  124

Query  1355  GLIQYFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFGIIEIILS  1176
             G IQY NL G+AIGYT+A++ISMMAI+RSNC+H SGGK+PCHM+SN YMIAFG ++II+S
Sbjct  125   GFIQYLNLIGVAIGYTVASAISMMAIERSNCYHRSGGKDPCHMNSNAYMIAFGAVQIIVS  184

Query  1175  QIPDFDQIWWLSIVAAVMSFTYSGIGLGLGIAQVVANGAFKGSLTGISIGTVTETQKIWR  996
             QIPDFDQ+WWLSIVAAVMSFTYS IGLGLGI +V+ N  F G++TG++   VT+ QK W 
Sbjct  185   QIPDFDQLWWLSIVAAVMSFTYSTIGLGLGIGKVMENKKFAGTITGVN--DVTKAQKTWG  242

Query  995   SFQALGDIAFAYSYSIILIEIQDTVKS-PPSESKTMRKASLFSTIVTTTFYMLCGCMGYA  819
             S QALGDIAFAYS+S+ILIEIQDTVK+ PPSESKTM+KA+L S IVTT FYMLCGC+GYA
Sbjct  243   SLQALGDIAFAYSFSMILIEIQDTVKAPPPSESKTMKKATLISVIVTTFFYMLCGCLGYA  302

Query  818   AFGDDAPGNLLTGFGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEKWVGAKWPDS  639
             AFG+ +PGNLLTGFGFYNPFWLLDIANAAIVIHL+GAYQVYCQPL+AF+E ++  ++PD+
Sbjct  303   AFGNSSPGNLLTGFGFYNPFWLLDIANAAIVIHLIGAYQVYCQPLYAFVENYMVKRFPDN  362

Query  638   EIITKEINLKIPGFGYPYKLNTFRLLWRTAFVLLTTVISMLLPFFNDVVGILGAFGFWPL  459
               + K I + IPG    YKLN F+L+WRT FV+LTT++SMLLPFFND+VG+LGA GFWPL
Sbjct  363   YFLNKNIKIPIPGLDM-YKLNLFKLVWRTVFVILTTLVSMLLPFFNDIVGLLGALGFWPL  421

Query  458   TVYFPVRMYISQKKIPKWSTRWICLQMlsgaclavslaaaagsfagvVLDLKLYRPFKTS  279
             TVYFPV MYI QKKIPKWST+W CLQ+LSGACL +++AA+ GS AG+ LDLK+++PFKT 
Sbjct  422   TVYFPVEMYIIQKKIPKWSTKWTCLQLLSGACLIITIAASVGSIAGIYLDLKVFKPFKTI  481

Query  278   Y  276
             Y
Sbjct  482   Y  482



>ref|XP_006590854.1| PREDICTED: amino acid permease 2-like [Glycine max]
Length=513

 Score =   686 bits (1769),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 345/464 (74%), Positives = 391/464 (84%), Gaps = 7/464 (2%)
 Frame = -3

Query  1649  KGLDDDGRPQRTGTVWTASAHIITAVIGSGVLSLAWAIGQLGWVAGPSVMLLFSCVVYYT  1470
             K  DDDGR +RTGT W A+AHIITAVIGSGVLSLAWA+ QLGWVAGP VM LF+ V  YT
Sbjct  51    KCFDDDGRLKRTGTFWMATAHIITAVIGSGVLSLAWAVAQLGWVAGPIVMFLFAVVNLYT  110

Query  1469  STLLADCYRAGDPVFGKRNYTYMDAVRSNLGGYQVKICGLIQYFNLFGIAIGYTIAASIS  1290
             S LL  CYR GD V G RNYTYM+AV S LGG +VK+CGLIQY NLFG+AIGYTIAAS+S
Sbjct  111   SNLLTQCYRTGDSVTGHRNYTYMEAVNSILGGKKVKLCGLIQYINLFGVAIGYTIAASVS  170

Query  1289  MMAIKRSNCFHESGGKNPCHMSSNPYMIAFGIIEIILSQIPDFDQIWWLSIVAAVMSFTY  1110
             MMAIKRSNC+H S GK+PCHMSSN YMI FGI E+I SQIPDFDQ+WWLSIVAA+MSFTY
Sbjct  171   MMAIKRSNCYHSSHGKDPCHMSSNGYMITFGIAEVIFSQIPDFDQVWWLSIVAAIMSFTY  230

Query  1109  SGIGLGLGIAQVVANGAFKGSLTGISIGTVTE------TQKIWRSFQALGDIAFAYSYSI  948
             S +GL LG+A+V  N +FKGSL GISIGTVT+      TQKIWRS QALG +AFAYS+SI
Sbjct  231   SSVGLSLGVAKVAENKSFKGSLMGISIGTVTQAGTVTSTQKIWRSLQALGAMAFAYSFSI  290

Query  947   ILIEIQDTVKSPPSESKTMRKASLFSTIVTTTFYMLCGCMGYAAFGDDAPGNLLTGFGFY  768
             ILIEIQDT+KSPP+E KTMRKA+  S  VTT FY+LCGCMGYAAFGD+APGNLLTGFGFY
Sbjct  291   ILIEIQDTIKSPPAEHKTMRKATTLSIAVTTVFYLLCGCMGYAAFGDNAPGNLLTGFGFY  350

Query  767   NPFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEKWVGAKWPDSEIITKEINLKIPGFGYP  588
             NP+WLLDIAN AIVIHLVGAYQV+ QPLFAF+EKW   KWP S  +T E ++ IP FG  
Sbjct  351   NPYWLLDIANLAIVIHLVGAYQVFSQPLFAFVEKWSARKWPKSNFVTAEYDIPIPCFGV-  409

Query  587   YKLNTFRLLWRTAFVLLTTVISMLLPFFNDVVGILGAFGFWPLTVYFPVRMYISQKKIPK  408
             Y+LN FRL+WRT FVLLTT+I+ML+PFFNDVVGILGAFGFWPLTVYFP+ MYISQKKI +
Sbjct  410   YQLNFFRLVWRTIFVLLTTLIAMLMPFFNDVVGILGAFGFWPLTVYFPIDMYISQKKIGR  469

Query  407   WSTRWICLQMlsgaclavslaaaagsfagvVLDLKLYRPFKTSY  276
             W++RW+ LQ+LS +CL +SL AA GS AGVVLDLK Y+PFKTSY
Sbjct  470   WTSRWLGLQLLSASCLIISLLAAVGSMAGVVLDLKTYKPFKTSY  513



>ref|XP_010653015.1| PREDICTED: amino acid permease 4-like [Vitis vinifera]
Length=504

 Score =   685 bits (1768),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 321/460 (70%), Positives = 384/460 (83%), Gaps = 7/460 (2%)
 Frame = -3

Query  1757  GIGGSKIMQMGESAAATKNHRHHLGVSIDAPPLYGFKGLDDDGRPQRTGTVWTASAHIIT  1578
             G  G+ ++Q+ E     K H+  L +  D  P    K LDDDGRP+RTGTVWTASAHIIT
Sbjct  30    GKAGTTMLQVDE-----KPHQM-LHLPSDVLPHDISKCLDDDGRPKRTGTVWTASAHIIT  83

Query  1577  AVIGSGVLSLAWAIGQLGWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRNYTYMD  1398
             ++IGSGVLSLAWA+ QLGW+ GP+V+L+F+ V+ YTS+LLADCYR+GDP+ GKRNYTYM+
Sbjct  84    SIIGSGVLSLAWAVAQLGWIGGPTVILMFAVVICYTSSLLADCYRSGDPISGKRNYTYME  143

Query  1397  AVRSNLGGYQVKICGLIQYFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSN  1218
              V+SNLGG +VKICGLIQY NLFGI +GYTIA S+SMMA+ RSNCFH SG KNPCH SSN
Sbjct  144   VVQSNLGGAKVKICGLIQYCNLFGITVGYTIATSVSMMAVMRSNCFHRSGNKNPCHESSN  203

Query  1217  PYMIAFGIIEIILSQIPDFDQIWWLSIVAAVMSFTYSGIGLGLGIAQVVANGAFKGSLTG  1038
             PYMI FGIIEI+LSQIPDFDQIWWLSI+A++MSFTYS IGLGLG++ V ANG FKG+LTG
Sbjct  204   PYMIMFGIIEIVLSQIPDFDQIWWLSILASIMSFTYSSIGLGLGVSTVAANGIFKGTLTG  263

Query  1037  ISIGTVTETQKIWRSFQALGDIAFAYSYSIILIEIQDTVKSPPSESKTMRKASLFSTIVT  858
             ISIGT+T TQK+W+ FQAL +IAF+Y YS +L+EIQDT+KSPPSE+ TM+KA+L S  +T
Sbjct  264   ISIGTITRTQKLWKCFQALANIAFSYCYSFVLVEIQDTIKSPPSEATTMKKANLISVAIT  323

Query  857   TTFYMLCGCMGYAAFGDDAPGNLLTGFGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFA  678
             T+FYMLCGCMGYAA GD APGNLLT FGF +PFWL+DIAN AIVIHLVGAYQV+ QPLFA
Sbjct  324   TSFYMLCGCMGYAALGDQAPGNLLTEFGFRDPFWLIDIANIAIVIHLVGAYQVFSQPLFA  383

Query  677   FIEKWVGAKWPDSEIITKEINLKIPGFGYPYKLNTFRLLWRTAFVLLTTVISMLLPFFND  498
             FIEKW+  K P S  ITKEI + IP +G  Y LN FRL+WR+AFV++TT++SMLLPFFND
Sbjct  384   FIEKWLSKKCPSSTFITKEIKVPIPCWGV-YNLNLFRLVWRSAFVMVTTLVSMLLPFFND  442

Query  497   VVGILGAFGFWPLTVYFPVRMYISQKKIPKWSTRWICLQM  378
             V+GI+GAF FWPL VYFPV MYI+Q++IPKW  +W C QM
Sbjct  443   VLGIIGAFAFWPLAVYFPVEMYIAQRRIPKWGVKWTCFQM  482



>ref|XP_009604405.1| PREDICTED: amino acid permease 4-like [Nicotiana tomentosiformis]
Length=512

 Score =   685 bits (1767),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 342/464 (74%), Positives = 399/464 (86%), Gaps = 7/464 (2%)
 Frame = -3

Query  1649  KGLDDDGRPQRTGTVWTASAHIITAVIGSGVLSLAWAIGQLGWVAGPSVMLLFSCVVYYT  1470
             K  DDDGR +RTGT WTA++HIITAVIGSGVLSLAWAIGQLGWVAGP+VM+LF+ V+ YT
Sbjct  50    KCFDDDGRLKRTGTFWTATSHIITAVIGSGVLSLAWAIGQLGWVAGPAVMILFAFVILYT  109

Query  1469  STLLADCYRAGDPVFGKRNYTYMDAVRSNLGGYQVKICGLIQYFNLFGIAIGYTIAASIS  1290
             S LL+ CYR GDP  G RN+TYM+AV+  LGG +VK+CGLIQY NLFG+AIGYTIAAS+S
Sbjct  110   SNLLSQCYRTGDPANGPRNHTYMEAVKGILGGKKVKVCGLIQYLNLFGVAIGYTIAASVS  169

Query  1289  MMAIKRSNCFHESGGKNPCHMSSNPYMIAFGIIEIILSQIPDFDQIWWLSIVAAVMSFTY  1110
             M+AIKRSNCFH+S  ++PCHMSSN YMIAFG+IEI+ SQIPDFDQ+WWLSIVAA+MSFTY
Sbjct  170   MLAIKRSNCFHKSHRRDPCHMSSNGYMIAFGVIEILFSQIPDFDQVWWLSIVAAIMSFTY  229

Query  1109  SGIGLGLGIAQVVANGAFKGSLTGISI------GTVTETQKIWRSFQALGDIAFAYSYSI  948
             S +GL LGIA+V  N +FKGSLTGISI      GTVT TQK+WRS QALG IAFAYS+SI
Sbjct  230   STVGLVLGIAKVAENKSFKGSLTGISIGTVTYVGTVTSTQKLWRSLQALGAIAFAYSFSI  289

Query  947   ILIEIQDTVKSPPSESKTMRKASLFSTIVTTTFYMLCGCMGYAAFGDDAPGNLLTGFGFY  768
             ILIEIQDT+KSPP+E KTM+KAS+ S  +TT FY+LCGCMGYAAFGDDAPGNLLTGFGF+
Sbjct  290   ILIEIQDTIKSPPAEHKTMKKASMLSIGITTIFYLLCGCMGYAAFGDDAPGNLLTGFGFF  349

Query  767   NPFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEKWVGAKWPDSEIITKEINLKIPGFGYP  588
             +P+WLLDIANAAIVIHL+GAYQVYCQPLFAF+EKW   KW +S  +T E  ++IP FG  
Sbjct  350   DPYWLLDIANAAIVIHLIGAYQVYCQPLFAFVEKWSAKKWSNSNFVTAEHGIRIPLFGV-  408

Query  587   YKLNTFRLLWRTAFVLLTTVISMLLPFFNDVVGILGAFGFWPLTVYFPVRMYISQKKIPK  408
             Y+LN FR++WRT FV+LTT+I+MLLPFFNDVVG+LGA GFWPLTVYFP+ MYI QKKI +
Sbjct  409   YQLNFFRVIWRTIFVILTTIIAMLLPFFNDVVGLLGALGFWPLTVYFPIEMYIKQKKIGR  468

Query  407   WSTRWICLQMlsgaclavslaaaagsfagvVLDLKLYRPFKTSY  276
             W+ +WI LQMLS ACL VS+AAA GS AGVVLDLK Y+PF T+Y
Sbjct  469   WTNQWIGLQMLSAACLFVSIAAAVGSIAGVVLDLKTYKPFNTTY  512



>ref|XP_004962032.1| PREDICTED: amino acid permease 3-like isoform X1 [Setaria italica]
 ref|XP_004962033.1| PREDICTED: amino acid permease 3-like isoform X2 [Setaria italica]
Length=494

 Score =   684 bits (1764),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 343/462 (74%), Positives = 392/462 (85%), Gaps = 4/462 (1%)
 Frame = -3

Query  1649  KGLDDDGRPQRTGTVWTASAHIITAVIGSGVLSLAWAIGQLGWVAGPSVMLLFSCVVYYT  1470
             K  DDDGR +RTGT+WTASAHIITAVIGSGVLSLAWAI QLGWVAGP+VMLLFS V YYT
Sbjct  33    KCYDDDGRLKRTGTMWTASAHIITAVIGSGVLSLAWAIAQLGWVAGPTVMLLFSFVTYYT  92

Query  1469  STLLADCYRAGDPVFGKRNYTYMDAVRSNLGGYQVKICGLIQYFNLFGIAIGYTIAASIS  1290
             S LLADCYR+GDP  GKRNYTYMDAV +NL G +V+ICG +QY N+ G+AIGYTIAASIS
Sbjct  93    SALLADCYRSGDPCTGKRNYTYMDAVNANLSGIKVQICGFLQYANIVGVAIGYTIAASIS  152

Query  1289  MMAIKRSNCFHESGGKNPCHMSSNPYMIAFGIIEIILSQIPDFDQIWWLSIVAAVMSFTY  1110
             M+AIK++NCFH  G  +PC +SS PYMI FG+ EI  SQIPDFDQI WLSI+AAVMSFTY
Sbjct  153   MLAIKKANCFHVEGHGDPCSISSTPYMIIFGVAEIFFSQIPDFDQISWLSILAAVMSFTY  212

Query  1109  SGIGLGLGIAQVVANGAFKGSLTGISIGTVTETQKIWRSFQALGDIAFAYSYSIILIEIQ  930
             S IGLGLGI QVVAN   +GSLTGISIG VT   K+WRS QA GDIAFAYSYS+ILIEIQ
Sbjct  213   STIGLGLGIVQVVANKGVQGSLTGISIGAVTPIDKVWRSLQAFGDIAFAYSYSLILIEIQ  272

Query  929   DTVKS-PPSESKTMRKASLFSTIVTTTFYMLCGCMGYAAFGDDAPGNLLTGFGFYNPFWL  753
             DT+++ PPSESK MR+A++ S  VTT FYMLCGCMGYAAFGD+APGNLLTGFGFY PFWL
Sbjct  273   DTIRAPPPSESKVMRRATVVSVAVTTLFYMLCGCMGYAAFGDNAPGNLLTGFGFYEPFWL  332

Query  752   LDIANAAIVIHLVGAYQVYCQPLFAFIEKWVGAKWPDSEIITKEINLKIP---GFGYPYK  582
             LD+ANAAIV+HLVGAYQVYCQPLFAF+EKW   KWP S+ IT E+++ +      G  YK
Sbjct  333   LDVANAAIVVHLVGAYQVYCQPLFAFVEKWAKQKWPKSKYITGEVDVPLSLSGSAGRCYK  392

Query  581   LNTFRLLWRTAFVLLTTVISMLLPFFNDVVGILGAFGFWPLTVYFPVRMYISQKKIPKWS  402
             LN FRL WRTAFV+ TTVISMLLPFFNDVVG+LGA GFWPLTVYFPV MYI QKK+P+WS
Sbjct  393   LNLFRLTWRTAFVVATTVISMLLPFFNDVVGLLGALGFWPLTVYFPVEMYIVQKKVPRWS  452

Query  401   TRWICLQMlsgaclavslaaaagsfagvVLDLKLYRPFKTSY  276
             TRW+CLQMLS ACL +++A+AAGS AG++ DLK+Y+PF T+Y
Sbjct  453   TRWVCLQMLSLACLIITVASAAGSVAGIISDLKVYKPFVTTY  494



>ref|XP_006486755.1| PREDICTED: amino acid permease 3-like [Citrus sinensis]
Length=512

 Score =   684 bits (1766),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 342/480 (71%), Positives = 401/480 (84%), Gaps = 7/480 (1%)
 Frame = -3

Query  1697  RHHLGVSIDAPPLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSGVLSLAWAIGQLGWV  1518
             + H+      P        DDDGR +RTG  WT S+HIITAVIGSGVLSLAWAI QLGWV
Sbjct  34    KAHIETEATNPQANYSNCFDDDGRLKRTGNFWTTSSHIITAVIGSGVLSLAWAIAQLGWV  93

Query  1517  AGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRNYTYMDAVRSNLGGYQVKICGLIQYF  1338
             AGP+V++LF+ V  YT+ LL+ CYR+GDPV G+RNYTYMDAV++NLGG +V  CGLIQY 
Sbjct  94    AGPTVLILFALVNLYTANLLSQCYRSGDPVTGQRNYTYMDAVKANLGGKKVIFCGLIQYL  153

Query  1337  NLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFGIIEIILSQIPDFD  1158
             NLFG+AIGYTIAAS+SMMAIKRSNCF +SGGK+PCHMSSN YMI FGIIE++ SQIPDFD
Sbjct  154   NLFGVAIGYTIAASVSMMAIKRSNCFQKSGGKDPCHMSSNGYMITFGIIEVLFSQIPDFD  213

Query  1157  QIWWLSIVAAVMSFTYSGIGLGLGIAQVVANGAFKGSLTGISI------GTVTETQKIWR  996
             Q+WWLSIVAA+MSFTYS  GLGLGI +V  NG+FKGSLTGISI      GTVT TQK+WR
Sbjct  214   QVWWLSIVAAIMSFTYSTAGLGLGIGKVAGNGSFKGSLTGISIGTLTSAGTVTGTQKLWR  273

Query  995   SFQALGDIAFAYSYSIILIEIQDTVKSPPSESKTMRKASLFSTIVTTTFYMLCGCMGYAA  816
             S QALG IAFAYS+SIIL+EIQDT++SPP+E KTM+KA+LFS IVTTTFY+LCGCMGYAA
Sbjct  274   SLQALGAIAFAYSFSIILLEIQDTIRSPPAEYKTMKKATLFSIIVTTTFYLLCGCMGYAA  333

Query  815   FGDDAPGNLLTGFGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEKWVGAKWPDSE  636
             FGD AP NLLTGFGFYNP+WL+DIANAAIV+HLVGAYQV+CQPLFAF+EKW   KWP S+
Sbjct  334   FGDLAPNNLLTGFGFYNPYWLIDIANAAIVVHLVGAYQVFCQPLFAFVEKWSAKKWPKSD  393

Query  635   IITKEINLKIPGFGYPYKLNTFRLLWRTAFVLLTTVISMLLPFFNDVVGILGAFGFWPLT  456
             ++T E  + IP +G  Y+LN FRL+WRT FV+LTT+ISMLLPFFNDVVGILGA GFWPLT
Sbjct  394   LVTAEYEIPIPFWGV-YQLNLFRLVWRTIFVVLTTLISMLLPFFNDVVGILGAMGFWPLT  452

Query  455   VYFPVRMYISQKKIPKWSTRWICLQMlsgaclavslaaaagsfagvVLDLKLYRPFKTSY  276
             VYFP+ MY +QKKI + +TRW+ LQ+L+ +C  ++L AA GS AGVVLDLK Y+PFKT Y
Sbjct  453   VYFPIEMYKAQKKIGRGTTRWLGLQILNVSCFFITLVAAIGSVAGVVLDLKTYKPFKTRY  512



>gb|EYU37943.1| hypothetical protein MIMGU_mgv1a004721mg [Erythranthe guttata]
Length=513

 Score =   684 bits (1765),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 348/494 (70%), Positives = 406/494 (82%), Gaps = 18/494 (4%)
 Frame = -3

Query  1706  KNHRHHLGVSIDAPPLYG-----------FKGLDDDGRPQRTGTVWTASAHIITAVIGSG  1560
             ++ RH+L V     P               K  DDDGR +RTGT+WTA++HIITAVIGSG
Sbjct  21    QDVRHYLQVETQPKPQETESRAINLQENYSKCFDDDGRLKRTGTLWTATSHIITAVIGSG  80

Query  1559  VLSLAWAIGQLGWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRNYTYMDAVRSNL  1380
             VLSLAWA+GQLGWVAGP VM+LF+ V  YTS LL+ CYR+GDPV G+RNYTYMDAV++NL
Sbjct  81    VLSLAWAVGQLGWVAGPIVMILFAFVNLYTSDLLSKCYRSGDPVVGQRNYTYMDAVKANL  140

Query  1379  GGYQVKICGLIQYFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAF  1200
             GG +VKICGLIQY NLFG+AIGYTIAAS+SM+AIKRSNCFH++  K+ CHMSSN YMI F
Sbjct  141   GGVKVKICGLIQYINLFGVAIGYTIAASVSMLAIKRSNCFHKTHKKSRCHMSSNGYMITF  200

Query  1199  GIIEIILSQIPDFDQIWWLSIVAAVMSFTYSGIGLGLGIAQVVANGAFKGSLTGISIGTV  1020
             GIIEI+ SQIPDFDQ+WWLSIVAA+MSFTYS IGL LGI QV  N + KGSLTGI+IGT+
Sbjct  201   GIIEILFSQIPDFDQVWWLSIVAAIMSFTYSTIGLALGIVQVAENKSIKGSLTGITIGTI  260

Query  1019  TE------TQKIWRSFQALGDIAFAYSYSIILIEIQDTVKSPPSESKTMRKASLFSTIVT  858
             T       TQK+WRS QALG IAFAYSYSIILIEIQDT+KSPP+E KTM+KA+  S  VT
Sbjct  261   THAGTVTPTQKMWRSLQALGAIAFAYSYSIILIEIQDTIKSPPAEHKTMKKATSISIAVT  320

Query  857   TTFYMLCGCMGYAAFGDDAPGNLLTGFGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFA  678
             T FY+LCGCMGYAAFGD APGNLLTGFGF++P+WLLDIAN +IV+HLVGAYQVYCQPLFA
Sbjct  321   TIFYLLCGCMGYAAFGDQAPGNLLTGFGFFDPYWLLDIANVSIVVHLVGAYQVYCQPLFA  380

Query  677   FIEKWVGAKWPDSEIITKEINLKIPGFGYPYKLNTFRLLWRTAFVLLTTVISMLLPFFND  498
             F+EKW  AKW  S  +T E ++ +P FG  Y+LN FR++WRT FV+LTT+I+ML+PFFND
Sbjct  381   FVEKWSAAKWSRSNFVTAEYDIPVPFFGV-YQLNFFRVVWRTCFVVLTTLIAMLMPFFND  439

Query  497   VVGILGAFGFWPLTVYFPVRMYISQKKIPKWSTRWICLQMlsgaclavslaaaagsfagv  318
             VVGILGA GFWPLTVYFPV MYI++ KI KW++RWI LQMLS ACL VS+AAA GS AGV
Sbjct  440   VVGILGALGFWPLTVYFPVEMYIAKNKIGKWTSRWIGLQMLSMACLLVSVAAAVGSVAGV  499

Query  317   VLDLKLYRPFKTSY  276
             VLDL+ Y+PFKTSY
Sbjct  500   VLDLQTYKPFKTSY  513



>ref|XP_003540867.1| PREDICTED: amino acid permease 2 [Glycine max]
Length=513

 Score =   684 bits (1765),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 346/464 (75%), Positives = 391/464 (84%), Gaps = 7/464 (2%)
 Frame = -3

Query  1649  KGLDDDGRPQRTGTVWTASAHIITAVIGSGVLSLAWAIGQLGWVAGPSVMLLFSCVVYYT  1470
             K  DDDGR +RTGT WTA+AHIITAVIGSGVLSLAWA+ QLGWVAGP VM LF+ V  YT
Sbjct  51    KCFDDDGRLKRTGTFWTATAHIITAVIGSGVLSLAWAVAQLGWVAGPVVMFLFAVVNLYT  110

Query  1469  STLLADCYRAGDPVFGKRNYTYMDAVRSNLGGYQVKICGLIQYFNLFGIAIGYTIAASIS  1290
             S LL  CYR GD V G RNYTYM+AV+S LGG +VK+CGLIQY NLFG+AIGYTIAAS+S
Sbjct  111   SNLLTQCYRTGDSVNGHRNYTYMEAVKSILGGKKVKLCGLIQYINLFGVAIGYTIAASVS  170

Query  1289  MMAIKRSNCFHESGGKNPCHMSSNPYMIAFGIIEIILSQIPDFDQIWWLSIVAAVMSFTY  1110
             MMAIKRSNC+H S GK+PCHMSSN YMI FGI E+I SQIPDFDQ+WWLSIVAA+MSFTY
Sbjct  171   MMAIKRSNCYHSSHGKDPCHMSSNGYMITFGIAEVIFSQIPDFDQVWWLSIVAAIMSFTY  230

Query  1109  SGIGLGLGIAQVVANGAFKGSLTGISIGTVTE------TQKIWRSFQALGDIAFAYSYSI  948
             S +GL LG+A+V  N  FKGSL GISIGTVT+      TQKIWRS QALG +AFAYS+SI
Sbjct  231   SSVGLSLGVAKVAENKTFKGSLMGISIGTVTQAGTVTSTQKIWRSLQALGAMAFAYSFSI  290

Query  947   ILIEIQDTVKSPPSESKTMRKASLFSTIVTTTFYMLCGCMGYAAFGDDAPGNLLTGFGFY  768
             ILIEIQDT+K PP+E KTMRKA+  S  VTT FY+LCGCMGYAAFGD+APGNLLTGFGFY
Sbjct  291   ILIEIQDTIKFPPAEHKTMRKATTLSIAVTTVFYLLCGCMGYAAFGDNAPGNLLTGFGFY  350

Query  767   NPFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEKWVGAKWPDSEIITKEINLKIPGFGYP  588
             NP+WLLDIAN AIVIHLVGAYQV+ QPLFAF+EKW   KWP S  +T E ++ IP FG  
Sbjct  351   NPYWLLDIANLAIVIHLVGAYQVFSQPLFAFVEKWSVRKWPKSNFVTAEYDIPIPCFGV-  409

Query  587   YKLNTFRLLWRTAFVLLTTVISMLLPFFNDVVGILGAFGFWPLTVYFPVRMYISQKKIPK  408
             Y+LN FRL+WRT FVLLTT+I+ML+PFFNDVVGILGAFGFWPLTVYFP+ MYISQKKI +
Sbjct  410   YQLNFFRLVWRTIFVLLTTLIAMLMPFFNDVVGILGAFGFWPLTVYFPIDMYISQKKIGR  469

Query  407   WSTRWICLQMlsgaclavslaaaagsfagvVLDLKLYRPFKTSY  276
             W++RWI LQ+LS +CL +SL AA GS AGVVLDLK Y+PFKTSY
Sbjct  470   WTSRWIGLQLLSVSCLIISLLAAVGSMAGVVLDLKTYKPFKTSY  513



>ref|XP_006422618.1| hypothetical protein CICLE_v10028230mg [Citrus clementina]
 gb|ESR35858.1| hypothetical protein CICLE_v10028230mg [Citrus clementina]
Length=512

 Score =   684 bits (1765),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 342/480 (71%), Positives = 401/480 (84%), Gaps = 7/480 (1%)
 Frame = -3

Query  1697  RHHLGVSIDAPPLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSGVLSLAWAIGQLGWV  1518
             + H+      P        DDDGR +RTG  WT S+HIITAVIGSGVLSLAWAI QLGWV
Sbjct  34    KAHIETEATNPQANYSNCFDDDGRLKRTGNFWTTSSHIITAVIGSGVLSLAWAIAQLGWV  93

Query  1517  AGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRNYTYMDAVRSNLGGYQVKICGLIQYF  1338
             AGP+V++LF+ V  YT+ LL+ CYR+GDPV G+RNYTYMDAV++NLGG +V  CGLIQY 
Sbjct  94    AGPTVLILFALVNLYTANLLSQCYRSGDPVTGQRNYTYMDAVKANLGGKKVIFCGLIQYL  153

Query  1337  NLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFGIIEIILSQIPDFD  1158
             NLFG+AIGYTIAAS+SMMAIKRSNCF +SGGK+PCHMSSN YMI FGIIE++ SQIPDFD
Sbjct  154   NLFGVAIGYTIAASVSMMAIKRSNCFQKSGGKDPCHMSSNGYMITFGIIEVLFSQIPDFD  213

Query  1157  QIWWLSIVAAVMSFTYSGIGLGLGIAQVVANGAFKGSLTGISI------GTVTETQKIWR  996
             Q+WWLSIVAA+MSFTYS  GLGLGI +V  N +FKGSLTGISI      GTVT TQK+WR
Sbjct  214   QVWWLSIVAAIMSFTYSTAGLGLGIGKVAGNRSFKGSLTGISIGTLTSAGTVTGTQKLWR  273

Query  995   SFQALGDIAFAYSYSIILIEIQDTVKSPPSESKTMRKASLFSTIVTTTFYMLCGCMGYAA  816
             S QALG IAFAYS+SIIL+EIQDT++SPP+E KTM+KA+LFS IVTTTFY+LCGCMGYAA
Sbjct  274   SLQALGAIAFAYSFSIILLEIQDTIRSPPAEYKTMKKATLFSIIVTTTFYLLCGCMGYAA  333

Query  815   FGDDAPGNLLTGFGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEKWVGAKWPDSE  636
             FGD AP NLLTGFGFYNP+WL+DIANAAIV+HLVGAYQV+CQPLFAF+EKW   KWP S+
Sbjct  334   FGDLAPNNLLTGFGFYNPYWLIDIANAAIVVHLVGAYQVFCQPLFAFVEKWSAKKWPKSD  393

Query  635   IITKEINLKIPGFGYPYKLNTFRLLWRTAFVLLTTVISMLLPFFNDVVGILGAFGFWPLT  456
             ++T E  + IP +G  Y+LN FRL+WRT FV+LTT+ISMLLPFFNDVVGILGA GFWPLT
Sbjct  394   LVTAEYEIPIPFWGV-YQLNLFRLVWRTLFVVLTTLISMLLPFFNDVVGILGAMGFWPLT  452

Query  455   VYFPVRMYISQKKIPKWSTRWICLQMlsgaclavslaaaagsfagvVLDLKLYRPFKTSY  276
             VYFP+ MY +QKKI + +TRW+ LQ+L+ +C  ++L AA GS AGVVLDLK Y+PFKTSY
Sbjct  453   VYFPIEMYKAQKKIGRGTTRWLGLQILNVSCFFITLVAAIGSVAGVVLDLKTYKPFKTSY  512



>gb|AAK33098.1| amino acid transporter [Glycine max]
Length=513

 Score =   684 bits (1764),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 344/464 (74%), Positives = 390/464 (84%), Gaps = 7/464 (2%)
 Frame = -3

Query  1649  KGLDDDGRPQRTGTVWTASAHIITAVIGSGVLSLAWAIGQLGWVAGPSVMLLFSCVVYYT  1470
             K  DDDGR +RTGT W A+AHIITAVIGSGVLSLAWA+ QLGWVAGP VM LF+ V  YT
Sbjct  51    KCFDDDGRLKRTGTFWMATAHIITAVIGSGVLSLAWAVAQLGWVAGPIVMFLFAVVNLYT  110

Query  1469  STLLADCYRAGDPVFGKRNYTYMDAVRSNLGGYQVKICGLIQYFNLFGIAIGYTIAASIS  1290
             S LL  CYR GD V G RNYTYM+AV S LGG +VK+CGL QY NLFG+AIGYTIAAS+S
Sbjct  111   SNLLTQCYRTGDSVSGHRNYTYMEAVNSILGGKKVKLCGLTQYINLFGVAIGYTIAASVS  170

Query  1289  MMAIKRSNCFHESGGKNPCHMSSNPYMIAFGIIEIILSQIPDFDQIWWLSIVAAVMSFTY  1110
             MMAIKRSNC+H S GK+PCHMSSN YMI FGI E+I SQIPDFDQ+WWLSIVAA+MSFTY
Sbjct  171   MMAIKRSNCYHSSHGKDPCHMSSNGYMITFGIAEVIFSQIPDFDQVWWLSIVAAIMSFTY  230

Query  1109  SGIGLGLGIAQVVANGAFKGSLTGISIGTVTE------TQKIWRSFQALGDIAFAYSYSI  948
             S +GL LG+A+V  N +FKGSL GISIGTVT+      TQKIWRS QALG +AFAYS+SI
Sbjct  231   SSVGLSLGVAKVAENKSFKGSLMGISIGTVTQAGTVTSTQKIWRSLQALGAMAFAYSFSI  290

Query  947   ILIEIQDTVKSPPSESKTMRKASLFSTIVTTTFYMLCGCMGYAAFGDDAPGNLLTGFGFY  768
             ILIEIQDT+KSPP+E KTMRKA+  S  VTT FY+LCGCMGYAAFGD+APGNLLTGFGFY
Sbjct  291   ILIEIQDTIKSPPAEHKTMRKATTLSIAVTTVFYLLCGCMGYAAFGDNAPGNLLTGFGFY  350

Query  767   NPFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEKWVGAKWPDSEIITKEINLKIPGFGYP  588
             NP+WLLDIAN AIVIHLVGAYQV+ QPLFAF+EKW   KWP S  +T E ++ IP FG  
Sbjct  351   NPYWLLDIANLAIVIHLVGAYQVFSQPLFAFVEKWSARKWPKSNFVTAEYDIPIPCFGV-  409

Query  587   YKLNTFRLLWRTAFVLLTTVISMLLPFFNDVVGILGAFGFWPLTVYFPVRMYISQKKIPK  408
             Y+LN FRL+WRT FVLLTT+I+ML+PFFNDVVGILGAFGFWPLTVYFP+ MYISQKKI +
Sbjct  410   YQLNFFRLVWRTIFVLLTTLIAMLMPFFNDVVGILGAFGFWPLTVYFPIDMYISQKKIGR  469

Query  407   WSTRWICLQMlsgaclavslaaaagsfagvVLDLKLYRPFKTSY  276
             W++RW+ LQ+LS +CL +SL AA GS AGVVLDLK Y+PFKTSY
Sbjct  470   WTSRWLGLQLLSASCLIISLLAAVGSMAGVVLDLKTYKPFKTSY  513



>ref|XP_006351135.1| PREDICTED: amino acid permease 3-like [Solanum tuberosum]
Length=479

 Score =   682 bits (1761),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 351/483 (73%), Positives = 406/483 (84%), Gaps = 7/483 (1%)
 Frame = -3

Query  1730  MGESAA-ATKNHRHHLGVSIDAPPLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSGVL  1554
             MG+S   A+K+    + V++        K  DDDGR +RTG+VWTASAHIITAVIGSGVL
Sbjct  1     MGDSTNFASKHQLFDVSVNVTES-----KRFDDDGRIKRTGSVWTASAHIITAVIGSGVL  55

Query  1553  SLAWAIGQLGWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRNYTYMDAVRSNLGG  1374
             SLAWA+ QLGW+AGP VMLLFS V YYTS+LL+DCYR+GDP+ GKRNYTYMDAV++NLGG
Sbjct  56    SLAWAVAQLGWIAGPIVMLLFSFVTYYTSSLLSDCYRSGDPLSGKRNYTYMDAVQANLGG  115

Query  1373  YQVKICGLIQYFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFGI  1194
              QVKICG IQY NLFG+AIGYTIA+SISMMA+KRS+CFH+ G K PC   + PYMI FG+
Sbjct  116   LQVKICGWIQYVNLFGVAIGYTIASSISMMAVKRSDCFHKHGHKAPCLEPNTPYMIIFGV  175

Query  1193  IEIILSQIPDFDQIWWLSIVAAVMSFTYSGIGLGLGIAQVVANGAFKGSLTGISIGTVTE  1014
             IEI+ SQIPDFDQIWWLSIVAAVMSFTYS IGLGLGIAQV       GSLTG+SIGTVTE
Sbjct  176   IEIVFSQIPDFDQIWWLSIVAAVMSFTYSTIGLGLGIAQVAETRKIGGSLTGVSIGTVTE  235

Query  1013  TQKIWRSFQALGDIAFAYSYSIILIEIQDTVKSPPSESKTMRKASLFSTIVTTTFYMLCG  834
              QK+WR+FQALG IAFAYSYS+ILIEIQDT+KSPPSE+KTM+ A+L S  VTT FYMLCG
Sbjct  236   MQKVWRTFQALGAIAFAYSYSLILIEIQDTIKSPPSEAKTMKNATLISVSVTTVFYMLCG  295

Query  833   CMGYAAFGDDAPGNLLTGFGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEKWVGA  654
             C GYAAFGD AP NLLTGFGFY+P+WLLDIAN AIV+HLVGAYQVYCQPLFAFIEK    
Sbjct  296   CFGYAAFGDHAPDNLLTGFGFYDPYWLLDIANIAIVVHLVGAYQVYCQPLFAFIEKTAAE  355

Query  653   KWPDSEIITKEINLKIPGFGYPYKLNTFRLLWRTAFVLLTTVISMLLPFFNDVVGILGAF  474
              +P+S+ ITK I++ IPG+   Y LN FRL+WRT FV+++T ISMLLPFF+D+VGILGAF
Sbjct  356   WYPNSKFITKNISVPIPGYK-SYNLNLFRLVWRTIFVIISTFISMLLPFFSDIVGILGAF  414

Query  473   GFWPLTVYFPVRMYISQKKIPKWSTRWICLQMlsgaclavslaaaagsfagvVLDLKLYR  294
             GFWPLTVY+PV MYI+QKKIPKWS +W+ LQ+LS  CL VS+AAAAGSFAGVV DLK+Y+
Sbjct  415   GFWPLTVYYPVEMYIAQKKIPKWSRKWVGLQILSVTCLIVSIAAAAGSFAGVVSDLKVYK  474

Query  293   PFK  285
             PFK
Sbjct  475   PFK  477



>ref|XP_010530203.1| PREDICTED: amino acid permease 5 [Tarenaya hassleriana]
 ref|XP_010530205.1| PREDICTED: amino acid permease 5 [Tarenaya hassleriana]
Length=480

 Score =   682 bits (1759),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 336/479 (70%), Positives = 398/479 (83%), Gaps = 3/479 (1%)
 Frame = -3

Query  1709  TKNHRHHLGVSIDAPPLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSGVLSLAWAIGQ  1530
             T  +     VSID  P       DDDGRP+RTGTVWTASAHIITAVIGSGVLSLAWA+ Q
Sbjct  4     TVKNTQSFVVSIDVLPKSSSDLFDDDGRPKRTGTVWTASAHIITAVIGSGVLSLAWAMAQ  63

Query  1529  LGWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRNYTYMDAVRSNLGGYQVKICGL  1350
             LGWVAGP+VM LFS V YYTS LL+ CYR+GD V GKRNYTYMDAV++NLGG +VK+CGL
Sbjct  64    LGWVAGPAVMFLFSLVTYYTSILLSSCYRSGDSVSGKRNYTYMDAVQANLGGVKVKLCGL  123

Query  1349  IQYFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFGIIEIILSQI  1170
             +QY NLFG AIGYTIA++ISM+AI+RSNC H S GK+PCH++ NPYMIAFG+ +I+ SQI
Sbjct  124   VQYLNLFGTAIGYTIASAISMIAIQRSNCHHRSHGKDPCHINGNPYMIAFGVAQIVFSQI  183

Query  1169  PDFDQIWWLSIVAAVMSFTYSGIGLGLGIAQVVANGAFKGSLTGISIGTVTETQKIWRSF  990
             PDFDQ+WWLSI+AAVMSFTYS IGL LGI++V  N   KGSLTGI +GTVT  QK+WRSF
Sbjct  184   PDFDQLWWLSILAAVMSFTYSSIGLALGISKVTENKEVKGSLTGIGLGTVTPAQKVWRSF  243

Query  989   QALGDIAFAYSYSIILIEIQDTVKSPPSESKTMRKASLFSTIVTTTFYMLCGCMGYAAFG  810
             QALG++AFAYSYS+ILIEIQDT+KS P+E KTMRKA+L S  VTT FYMLCGC+GYAAFG
Sbjct  244   QALGNVAFAYSYSVILIEIQDTLKSSPAEEKTMRKATLISVAVTTMFYMLCGCIGYAAFG  303

Query  809   DDAPGNLLTGFGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEKWVGAKWPDSEII  630
             D +PGNLL+G GF++P+WLLDIAN  IVIHLVGAYQVYCQPLFAF+EK    ++PDS+ I
Sbjct  304   DMSPGNLLSG-GFFSPYWLLDIANLTIVIHLVGAYQVYCQPLFAFVEKQASKRFPDSKFI  362

Query  629   TKEINLK-IPGFGYPYKLNTFRLLWRTAFVLLTTVISMLLPFFNDVVGILGAFGFWPLTV  453
             TKEI ++  PG   PY LN FRL+WRT FV+LTT+ISML+PFFNDV+G+LGA GFWPLTV
Sbjct  363   TKEIKIRFFPGLK-PYNLNLFRLVWRTFFVILTTLISMLMPFFNDVLGLLGAIGFWPLTV  421

Query  452   YFPVRMYISQKKIPKWSTRWICLQMlsgaclavslaaaagsfagvVLDLKLYRPFKTSY  276
             YFPV MYIS  +I +WSTRW+CLQ+L+ ACL V++ +AAGS  GV+ DL  Y+PFKT +
Sbjct  422   YFPVEMYISHNRIQRWSTRWVCLQILNLACLVVTVVSAAGSVVGVMTDLNTYKPFKTDF  480



>gb|KDO68035.1| hypothetical protein CISIN_1g010376mg [Citrus sinensis]
Length=512

 Score =   682 bits (1760),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 341/480 (71%), Positives = 400/480 (83%), Gaps = 7/480 (1%)
 Frame = -3

Query  1697  RHHLGVSIDAPPLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSGVLSLAWAIGQLGWV  1518
             + H+      P        DDDGR +RTG  WT S+HIITAVIGSGVLSLAWAI QLGWV
Sbjct  34    KAHIETEATNPQANYSNCFDDDGRLKRTGNFWTTSSHIITAVIGSGVLSLAWAIAQLGWV  93

Query  1517  AGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRNYTYMDAVRSNLGGYQVKICGLIQYF  1338
             AGP+V++LF+ V  YT+ LL+ CYR+GDPV G+RNYTYMDAV++NLGG +V  CGLIQY 
Sbjct  94    AGPTVLILFALVNLYTANLLSQCYRSGDPVTGQRNYTYMDAVKANLGGKKVIFCGLIQYL  153

Query  1337  NLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFGIIEIILSQIPDFD  1158
             NLFG+AIGYTIAAS+SMMAIKRSNCF +SGGK+PCHMSSN YMI FGIIE++ SQIPDFD
Sbjct  154   NLFGVAIGYTIAASVSMMAIKRSNCFQKSGGKDPCHMSSNGYMITFGIIEVLFSQIPDFD  213

Query  1157  QIWWLSIVAAVMSFTYSGIGLGLGIAQVVANGAFKGSLTGISI------GTVTETQKIWR  996
             Q+WWLSIVAA+MSFTYS  GLGLGI +V  N +FKGSLTGISI      GTVT TQK+WR
Sbjct  214   QVWWLSIVAAIMSFTYSTAGLGLGIGKVAGNRSFKGSLTGISIGTLTSAGTVTGTQKLWR  273

Query  995   SFQALGDIAFAYSYSIILIEIQDTVKSPPSESKTMRKASLFSTIVTTTFYMLCGCMGYAA  816
             S QALG IAFAYS+SIIL+EIQDT++SPP+E KTM+KA+LFS IVTTTFY+LCGCMGYAA
Sbjct  274   SLQALGAIAFAYSFSIILLEIQDTIRSPPAEYKTMKKATLFSIIVTTTFYLLCGCMGYAA  333

Query  815   FGDDAPGNLLTGFGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEKWVGAKWPDSE  636
             FGD AP NLLTGFGFYNP+WL+DIANAAIV+HLVGAYQV+CQPLFAF+EKW   KWP S+
Sbjct  334   FGDLAPNNLLTGFGFYNPYWLIDIANAAIVVHLVGAYQVFCQPLFAFVEKWSAKKWPKSD  393

Query  635   IITKEINLKIPGFGYPYKLNTFRLLWRTAFVLLTTVISMLLPFFNDVVGILGAFGFWPLT  456
             ++T E  + IP +G  Y+LN FRL+WRT FV+LTT+ISMLLPFFNDVVGILGA GFWPLT
Sbjct  394   LVTAEYEIPIPFWGV-YQLNLFRLVWRTLFVVLTTLISMLLPFFNDVVGILGAMGFWPLT  452

Query  455   VYFPVRMYISQKKIPKWSTRWICLQMlsgaclavslaaaagsfagvVLDLKLYRPFKTSY  276
             VYFP+ MY +QKKI + +TRW+ LQ+L+ +C  ++L AA GS AGVVLDLK Y+PFKT Y
Sbjct  453   VYFPIEMYKAQKKIGRGTTRWLGLQILNVSCFFITLVAAIGSVAGVVLDLKTYKPFKTRY  512



>emb|CAA10608.1| amino acid carrier [Ricinus communis]
Length=466

 Score =   681 bits (1756),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 348/466 (75%), Positives = 395/466 (85%), Gaps = 3/466 (1%)
 Frame = -3

Query  1667  PPLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSGVLSLAWAIGQLGWVAGPSVMLLFS  1488
             PP  G K  DDDG+ +RTGTVWTASAHIITAVIGSGVLSLAWA+ QLGWVAGP+VM LFS
Sbjct  2     PPQAGSKWYDDDGKLKRTGTVWTASAHIITAVIGSGVLSLAWAVAQLGWVAGPAVMFLFS  61

Query  1487  CVVYYTSTLLADCYRAGDPVFGKRNYTYMDAVRSNLGGYQVKICGLIQYFNLFGIAIGYT  1308
              V YYTSTLL+ CYR GDPV GKRNYTYMDAVRSNLGG + KICG +QY NL G+AIGYT
Sbjct  62    LVTYYTSTLLSACYRTGDPVNGKRNYTYMDAVRSNLGGAKFKICGYVQYVNLIGVAIGYT  121

Query  1307  IAASISMMAIKRSNCFHESGGKNPCHMSSNP-YMIAFGIIEIILSQIPDFDQ-IWWLSIV  1134
             IA+SISMMA+KRSNCFH+S  KNPCHM     +     ++E   SQIPDFDQ +  LSIV
Sbjct  122   IASSISMMAVKRSNCFHKSEAKNPCHMKCQSLHDCILEVVESSSSQIPDFDQTMGGLSIV  181

Query  1133  AAVMSFTYSGIGLGLGIAQVVANGAFKGSLTGISIGTVTETQKIWRSFQALGDIAFAYSY  954
             AA+MSFTYS IGLGLGIA+V  NG   GS+TGISIGTVTETQKIWRSFQALGDIAFAYSY
Sbjct  182   AAIMSFTYSTIGLGLGIAEVTKNGKAMGSMTGISIGTVTETQKIWRSFQALGDIAFAYSY  241

Query  953   SIILIEIQDTVKSPPSESKTMRKASLFSTIVTTTFYMLCGCMGYAAFGDDAPGNLLTGFG  774
             S+ILIEIQDT++SPP+ESKTMRKA+L S  VTT FYMLCGC GYAAFGD +PGNLLTGFG
Sbjct  242   SLILIEIQDTIRSPPAESKTMRKATLISVSVTTLFYMLCGCFGYAAFGDMSPGNLLTGFG  301

Query  773   FYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEKWVGAKWPDSEIITKEINLKIPGFG  594
             FYNP+WLLDIAN AIV+HLVGAYQVYCQPLFAF+EK    ++PDSE I K+I + IPG  
Sbjct  302   FYNPYWLLDIANVAIVVHLVGAYQVYCQPLFAFVEKAAVQRFPDSEFILKDIKIPIPGCK  361

Query  593   YPYKLNTFRLLWRTAFVLLTTVISMLLPFFNDVVGILGAFGFWPLTVYFPVRMYISQKKI  414
              PY LN FR++WRT FV+ TTVISMLLPFFND+VG+LGA GFWPLTVYFPV MYI+QKKI
Sbjct  362   -PYNLNLFRMVWRTVFVIFTTVISMLLPFFNDIVGLLGALGFWPLTVYFPVEMYIAQKKI  420

Query  413   PKWSTRWICLQMlsgaclavslaaaagsfagvVLDLKLYRPFKTSY  276
             PKWSTRW+CLQ+LS ACL +++AAAAGS AGV++DLK  +PF+T+Y
Sbjct  421   PKWSTRWLCLQILSAACLIITIAAAAGSIAGVIVDLKTVKPFQTTY  466



>ref|XP_008219720.1| PREDICTED: amino acid permease 3-like [Prunus mume]
Length=483

 Score =   681 bits (1757),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 345/486 (71%), Positives = 410/486 (84%), Gaps = 6/486 (1%)
 Frame = -3

Query  1730  MGESAAATKNHRHHLGVSIDAPPLY--GFKGLDDDGRPQRTGTVWTASAHIITAVIGSGV  1557
             MG+    T+N + H     D   +   G K +DDDGRP+RTGTVWT+SAHIITAVIGSGV
Sbjct  1     MGDHTT-TRNLQLHHNPVFDVSLIVQGGSKYIDDDGRPKRTGTVWTSSAHIITAVIGSGV  59

Query  1556  LSLAWAIGQLGWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRNYTYMDAVRSNLG  1377
             LSLAWA+ QLGW+AGP VM++FS + YYTSTLLA CYR  DPV GKRNYTY DAVRSNLG
Sbjct  60    LSLAWAVAQLGWIAGPVVMVMFSFITYYTSTLLAACYR--DPVTGKRNYTYSDAVRSNLG  117

Query  1376  GYQVKICGLIQYFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFG  1197
               QVK CG +Q   L G+ IGYTIAA+ISM+AIKRSNC+H+SGGKNPCH+++NPYMIAFG
Sbjct  118   ELQVKFCGSVQNVVLTGVTIGYTIAAAISMVAIKRSNCYHKSGGKNPCHINNNPYMIAFG  177

Query  1196  IIEIILSQIPDFDQIWWLSIVAAVMSFTYSGIGLGLGIAQVVANGAFKGSLTGISIGTVT  1017
             I EI+LSQIP+FD++ WLSIVAAVMSFTYSGIGL LGIA+V ANG  KG++TGI+IGTV 
Sbjct  178   ISEILLSQIPNFDKLSWLSIVAAVMSFTYSGIGLALGIAEVAANGKIKGNVTGITIGTVN  237

Query  1016  ETQKIWRSFQALGDIAFAYSYSIILIEIQDTVKSPPSESKTMRKASLFSTIVTTTFYMLC  837
               +K+WR+FQALGD+AFAYSYSIILIEIQDT+KSPPSE KTM+KA+LFS IVT+ FY+LC
Sbjct  238   PIEKMWRTFQALGDVAFAYSYSIILIEIQDTIKSPPSEYKTMKKATLFSLIVTSIFYILC  297

Query  836   GCMGYAAFGDDAPGNLLTGFGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEKWVG  657
             GCMGYAAFGD +PGNLLT  GF+NPFWL+DIANAAIVIHLVGAYQV+ QP+FA +EK   
Sbjct  298   GCMGYAAFGDLSPGNLLTDKGFHNPFWLIDIANAAIVIHLVGAYQVFAQPIFALVEKTAA  357

Query  656   AKWPDSEIITKEINLKIPGFGYPYKLNTFRLLWRTAFVLLTTVISMLLPFFNDVVGILGA  477
               +P+S+ IT++I + IPGFG  Y LN FRL+WRT +V++TT+ISM+LPFFNDVVG LGA
Sbjct  358   EFFPNSQFITEDIRIPIPGFG-AYNLNLFRLVWRTFYVIITTLISMILPFFNDVVGFLGA  416

Query  476   FGFWPLTVYFPVRMYISQKKIPKWSTRWICLQMlsgaclavslaaaagsfagvVLDLKLY  297
              G+WPLTVYFPV MYI+QKK+PKWSTRWICLQ+LS + L ++LAAAAGS  GVV DLK+Y
Sbjct  417   LGYWPLTVYFPVEMYIAQKKVPKWSTRWICLQILSLSVLVIALAAAAGSVIGVVQDLKIY  476

Query  296   RPFKTS  279
             +PFKTS
Sbjct  477   KPFKTS  482



>ref|XP_004505788.1| PREDICTED: amino acid permease 2-like [Cicer arietinum]
Length=513

 Score =   681 bits (1758),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 341/464 (73%), Positives = 389/464 (84%), Gaps = 7/464 (2%)
 Frame = -3

Query  1649  KGLDDDGRPQRTGTVWTASAHIITAVIGSGVLSLAWAIGQLGWVAGPSVMLLFSCVVYYT  1470
             K  DDDGR +RTGT WTA+AHIITAVIGSGVLSLAWAI QLGW  GP VM LF+ V  YT
Sbjct  51    KCFDDDGRLKRTGTFWTATAHIITAVIGSGVLSLAWAIAQLGWAVGPVVMFLFAVVNLYT  110

Query  1469  STLLADCYRAGDPVFGKRNYTYMDAVRSNLGGYQVKICGLIQYFNLFGIAIGYTIAASIS  1290
             S+LL  CYR  D V G+RNYTYMDAV+S LGG +VKICG+IQY NLFG+AIGYTIAAS+S
Sbjct  111   SSLLTQCYRTDDSVTGQRNYTYMDAVKSILGGKKVKICGVIQYVNLFGVAIGYTIAASVS  170

Query  1289  MMAIKRSNCFHESGGKNPCHMSSNPYMIAFGIIEIILSQIPDFDQIWWLSIVAAVMSFTY  1110
             MMAIKRSNC+HES GK+PCHMSSN YMI FG+ E++LSQIPDFDQ+WWLSIVAA+MSFTY
Sbjct  171   MMAIKRSNCYHESHGKDPCHMSSNGYMITFGVAEVLLSQIPDFDQVWWLSIVAAIMSFTY  230

Query  1109  SGIGLGLGIAQVVANGAFKGSLTGISIGTVTE------TQKIWRSFQALGDIAFAYSYSI  948
             S +GLGLG+A+V  N +FKGSL GISIGTVT+      T KIWRS QALG +AFAYS+SI
Sbjct  231   SAVGLGLGVAKVAENRSFKGSLMGISIGTVTQAGTVTGTNKIWRSLQALGAMAFAYSFSI  290

Query  947   ILIEIQDTVKSPPSESKTMRKASLFSTIVTTTFYMLCGCMGYAAFGDDAPGNLLTGFGFY  768
             ILIEIQDT+KSPPSE KTM+KA++ S ++TT FY+LCG MGYAAFGD  PGNLLTGFGFY
Sbjct  291   ILIEIQDTIKSPPSEHKTMKKATMLSIMITTVFYILCGSMGYAAFGDHVPGNLLTGFGFY  350

Query  767   NPFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEKWVGAKWPDSEIITKEINLKIPGFGYP  588
             NP+WLLDIAN AIV+HL+GAYQV+ QPLFAF+EKW   KWP +  +T E  + IP  G  
Sbjct  351   NPYWLLDIANFAIVVHLIGAYQVFSQPLFAFVEKWSARKWPKNNFVTAEYEIAIPCTGV-  409

Query  587   YKLNTFRLLWRTAFVLLTTVISMLLPFFNDVVGILGAFGFWPLTVYFPVRMYISQKKIPK  408
             YKLN FRL+WRT FVLLTT+I+MLLPFFNDVVGILGAFGFWPLTVYFP+ MYISQKKI +
Sbjct  410   YKLNFFRLIWRTIFVLLTTIIAMLLPFFNDVVGILGAFGFWPLTVYFPIDMYISQKKIGR  469

Query  407   WSTRWICLQMlsgaclavslaaaagsfagvVLDLKLYRPFKTSY  276
             W+ +WI LQMLS  CL +SL AA GS AGVVLDLK Y+PFKTSY
Sbjct  470   WTNKWIGLQMLSVCCLIISLLAAVGSIAGVVLDLKTYKPFKTSY  513



>ref|XP_003630316.1| Amino acid permease [Medicago truncatula]
 gb|AET04792.1| transmembrane amino acid transporter family protein [Medicago 
truncatula]
Length=475

 Score =   680 bits (1754),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 340/455 (75%), Positives = 390/455 (86%), Gaps = 4/455 (1%)
 Frame = -3

Query  1640  DDDGRPQRTGTVWTASAHIITAVIGSGVLSLAWAIGQLGWVAGPSVMLLFSCVVYYTSTL  1461
             DDDGR +RTG+VWTAS+HIITAVIGSGVLSLAWAI QLGW+AGP+VM+LFS V   TS+ 
Sbjct  25    DDDGRLKRTGSVWTASSHIITAVIGSGVLSLAWAIAQLGWIAGPAVMILFSLVTVSTSSF  84

Query  1460  LADCYRAGDPVFGKRNYTYMDAVRSNLGGYQVKICGLIQYFNLFGIAIGYTIAASISMMA  1281
             LADCYRAGDP  GKRNYTYMDAVRS LGG +V  CG+ QY NLFGI IGYTIAASISM A
Sbjct  85    LADCYRAGDPHSGKRNYTYMDAVRSILGGAKVTFCGIFQYLNLFGIVIGYTIAASISMTA  144

Query  1280  IKRSNCFHESGGKNPCHMSSNPYMIAFGIIEIILSQIPDFDQIWWLSIVAAVMSFTYSGI  1101
             IK+SNCFH+ G K+PCHMSSN YMI FG+I+I LSQIPDFDQIWWLS VAAVMSFTYS I
Sbjct  145   IKKSNCFHQHGDKSPCHMSSNLYMIMFGVIQIFLSQIPDFDQIWWLSSVAAVMSFTYSLI  204

Query  1100  GLGLGIAQVVANGAFKGSLTGISIGTVTETQKIWRSFQALGDIAFAYSYSIILIEIQDTV  921
             GL LGIA+V  NG   GSLTGISIG V+ETQKIWR+ QALG+IAFAYSY+++LIEIQDT+
Sbjct  205   GLALGIAKVAENGTILGSLTGISIGAVSETQKIWRTSQALGNIAFAYSYAVVLIEIQDTL  264

Query  920   KSPPSESKTMRKASLFSTIVTTTFYMLCGCMGYAAFGDDAPGNLLTGFGFYNPFWLLDIA  741
             KSPPSE+K+M+KA+  S  VTT FYMLCGCMGYAAFGDDAPGNLLTGFGFYNP+WL+DIA
Sbjct  265   KSPPSEAKSMKKATKISIAVTTVFYMLCGCMGYAAFGDDAPGNLLTGFGFYNPYWLIDIA  324

Query  740   NAAIVIHLVGAYQVYCQPLFAFIEKWVGAKWPDSEIITKEINLKIPGFGYPYKLNTFRLL  561
             NAAIV+HLVGAYQV+ QP+FAF+EK    +WP+ E   KE  +++P    PYKLN FR+L
Sbjct  325   NAAIVVHLVGAYQVFSQPIFAFVEKSATQRWPNIE---KEYKIELPCLP-PYKLNLFRML  380

Query  560   WRTAFVLLTTVISMLLPFFNDVVGILGAFGFWPLTVYFPVRMYISQKKIPKWSTRWICLQ  381
             WRT FV LTTVISMLLPFFND+VG++GA GFWPLTVYFPV MYI+QKKIPKW+ +WICLQ
Sbjct  381   WRTVFVTLTTVISMLLPFFNDIVGVIGALGFWPLTVYFPVEMYIAQKKIPKWNKKWICLQ  440

Query  380   MlsgaclavslaaaagsfagvVLDLKLYRPFKTSY  276
             + S ACL VS+AAA GS AGV++DLK Y PF++SY
Sbjct  441   IFSFACLVVSIAAAVGSIAGVLVDLKKYTPFQSSY  475



>ref|XP_007137460.1| hypothetical protein PHAVU_009G128600g [Phaseolus vulgaris]
 gb|ESW09454.1| hypothetical protein PHAVU_009G128600g [Phaseolus vulgaris]
Length=487

 Score =   680 bits (1754),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 336/481 (70%), Positives = 404/481 (84%), Gaps = 3/481 (1%)
 Frame = -3

Query  1712  ATKNHRHHLGVSIDAPPLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSGVLSLAWAIG  1533
              +K+ +    VS+D       K  DDDGRP+RTGTVWTASAHIITAVIGSGVLSLAWAI 
Sbjct  8     GSKSDQETFSVSLDMHEQGDSKCFDDDGRPKRTGTVWTASAHIITAVIGSGVLSLAWAIA  67

Query  1532  QLGWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRNYTYMDAVRSNLGG--YQVKI  1359
             QLGW+AGP+VMLLFS + Y+TS LL DCYR GDP+ GKRNYTYMDA+RSN GG  ++VK+
Sbjct  68    QLGWIAGPAVMLLFSAITYFTSLLLTDCYRTGDPLTGKRNYTYMDAIRSNFGGNDFKVKM  127

Query  1358  CGLIQYFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFGIIEIIL  1179
             CGL+QY NLFGI+IGYTIAASISMMAI+RS+CFH++GGK+ C M+SN YMI+FGI+E+I 
Sbjct  128   CGLVQYVNLFGISIGYTIAASISMMAIERSDCFHKNGGKSHCRMNSNMYMISFGIVEMIF  187

Query  1178  SQIPDFDQIWWLSIVAAVMSFTYSGIGLGLGIAQVVANGAFKGSLTGISIGTVTETQKIW  999
             SQIPDFDQ+WWLSIVAAVMS TYS IGLG+GI +V+ N   KG +TGI +GTVT+  KI 
Sbjct  188   SQIPDFDQLWWLSIVAAVMSVTYSTIGLGMGIGKVIGNRRIKGGVTGIIVGTVTKPDKIL  247

Query  998   RSFQALGDIAFAYSYSIILIEIQDTVKSPPSESKTMRKASLFSTIVTTTFYMLCGCMGYA  819
             R+ QA+G+IAFAYSYS ILIEIQDTVKSPPS SKTM+K++L    VTT FYMLCGC GYA
Sbjct  248   RAMQAVGNIAFAYSYSFILIEIQDTVKSPPSASKTMKKSALIGVAVTTFFYMLCGCSGYA  307

Query  818   AFGDDAPGNLLTGFGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEKWVGAKWPDS  639
             AFGD +PGNLLTGFGFYNP+WLLDIANAAIV+HLVG+YQV+ QPLFAF+EK V +++PDS
Sbjct  308   AFGDLSPGNLLTGFGFYNPYWLLDIANAAIVVHLVGSYQVFSQPLFAFVEKIVASRFPDS  367

Query  638   EIITKEINLKIPGFGYPYKLNTFRLLWRTAFVLLTTVISMLLPFFNDVVGILGAFGFWPL  459
             + + KEI + +PG   PYKLN FRL+WRT +V+++TVI+MLLPFFND+ G+LGA GFWPL
Sbjct  368   DFVKKEIEIGVPGL-RPYKLNLFRLVWRTIYVVISTVIAMLLPFFNDMGGLLGALGFWPL  426

Query  458   TVYFPVRMYISQKKIPKWSTRWICLQMlsgaclavslaaaagsfagvVLDLKLYRPFKTS  279
              VYFPV MYI QK+IPKWST+WIC Q+L+ +CL V+L AA GS AG+V DLK Y+PFKT+
Sbjct  427   AVYFPVEMYIVQKRIPKWSTKWICFQILNISCLLVTLCAAVGSLAGIVFDLKTYKPFKTN  486

Query  278   Y  276
             Y
Sbjct  487   Y  487



>ref|XP_002439825.1| hypothetical protein SORBIDRAFT_09g020790 [Sorghum bicolor]
 gb|EES18255.1| hypothetical protein SORBIDRAFT_09g020790 [Sorghum bicolor]
Length=485

 Score =   678 bits (1750),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 337/462 (73%), Positives = 390/462 (84%), Gaps = 4/462 (1%)
 Frame = -3

Query  1649  KGLDDDGRPQRTGTVWTASAHIITAVIGSGVLSLAWAIGQLGWVAGPSVMLLFSCVVYYT  1470
             K  DDDGR +RTGT+WTASAHIITAVIGSGVLSLAWAI QLGWVAGP+VMLLFS V YYT
Sbjct  24    KCYDDDGRLKRTGTMWTASAHIITAVIGSGVLSLAWAIAQLGWVAGPAVMLLFSFVTYYT  83

Query  1469  STLLADCYRAGDPVFGKRNYTYMDAVRSNLGGYQVKICGLIQYFNLFGIAIGYTIAASIS  1290
             S LLADCYR+GDP  GKRNYTYMDAV +NL G +V++CG +QY N+ G+AIGYTIAASIS
Sbjct  84    SALLADCYRSGDPCTGKRNYTYMDAVNANLSGIKVQLCGFLQYANIVGVAIGYTIAASIS  143

Query  1289  MMAIKRSNCFHESGGKNPCHMSSNPYMIAFGIIEIILSQIPDFDQIWWLSIVAAVMSFTY  1110
             M+AIKR+NCFH  G  +PC++SS PYMI FG+ EI  SQIPDFDQI WLSI+AAVMSFTY
Sbjct  144   MLAIKRANCFHVEGHGDPCNISSTPYMIIFGVAEIFFSQIPDFDQISWLSILAAVMSFTY  203

Query  1109  SGIGLGLGIAQVVANGAFKGSLTGISIGTVTETQKIWRSFQALGDIAFAYSYSIILIEIQ  930
             S IGLGLGI QVVAN   +GSLTGIS+G VT   K+WRS QA GDIAFAYSYS+ILIEIQ
Sbjct  204   STIGLGLGIVQVVANKGVQGSLTGISVGAVTPLDKVWRSLQAFGDIAFAYSYSLILIEIQ  263

Query  929   DTVKS-PPSESKTMRKASLFSTIVTTTFYMLCGCMGYAAFGDDAPGNLLTGFGFYNPFWL  753
             DT+++ PPSESK MR+A++ S  VTT FYMLCGCMGYAAFGD+APGNLLTGFGFY PFWL
Sbjct  264   DTIRAPPPSESKVMRRATIVSVAVTTLFYMLCGCMGYAAFGDNAPGNLLTGFGFYEPFWL  323

Query  752   LDIANAAIVIHLVGAYQVYCQPLFAFIEKWVGAKWPDSEIITKEINLKIP---GFGYPYK  582
             LD+ANAAIV+HLVGAYQVYCQPLFAF+EKW   +WP S  IT E+++ +      G  YK
Sbjct  324   LDVANAAIVVHLVGAYQVYCQPLFAFVEKWAQQRWPKSSYITGEVDVPLSLAGAAGRCYK  383

Query  581   LNTFRLLWRTAFVLLTTVISMLLPFFNDVVGILGAFGFWPLTVYFPVRMYISQKKIPKWS  402
             LN FRL WRTAFV+ TTV+SMLLPFFNDVVG+LGA GFWPLTVYFPV MYI QKK+P+WS
Sbjct  384   LNLFRLTWRTAFVVATTVVSMLLPFFNDVVGLLGALGFWPLTVYFPVEMYIVQKKVPRWS  443

Query  401   TRWICLQMlsgaclavslaaaagsfagvVLDLKLYRPFKTSY  276
             T W+CLQ+LS  CL +++A+AAGS AG++ DLK+Y+PF T+Y
Sbjct  444   TLWVCLQLLSLGCLIITVASAAGSVAGIISDLKVYKPFVTTY  485



>ref|XP_007224395.1| hypothetical protein PRUPE_ppa021701mg [Prunus persica]
 gb|EMJ25594.1| hypothetical protein PRUPE_ppa021701mg [Prunus persica]
Length=483

 Score =   678 bits (1749),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 344/487 (71%), Positives = 405/487 (83%), Gaps = 8/487 (2%)
 Frame = -3

Query  1730  MGESAAATKNHRHH---LGVSIDAPPLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSG  1560
             MG+         HH     VS++     G K +DDDGRP+RTGTVWT+SAHIITAVIGSG
Sbjct  1     MGDHTTTRNLQLHHNPVFDVSLNVRG--GSKYIDDDGRPKRTGTVWTSSAHIITAVIGSG  58

Query  1559  VLSLAWAIGQLGWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRNYTYMDAVRSNL  1380
             VLSLAWAI QLGW+AGP VM+LFS + YYTSTLLA CYR  DPV GKRNYTY DAVRSNL
Sbjct  59    VLSLAWAIAQLGWIAGPVVMVLFSFITYYTSTLLAACYR--DPVTGKRNYTYSDAVRSNL  116

Query  1379  GGYQVKICGLIQYFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAF  1200
             G  QVK C  +Q   L G+ IGYTIAA+ISM+AIKRSNC+H+SGGKNPCH+++NPYMIAF
Sbjct  117   GELQVKFCASVQNVVLIGVTIGYTIAAAISMVAIKRSNCYHKSGGKNPCHINNNPYMIAF  176

Query  1199  GIIEIILSQIPDFDQIWWLSIVAAVMSFTYSGIGLGLGIAQVVANGAFKGSLTGISIGTV  1020
             GI EI+LSQIP+FD++ WLSIVAAVMSFTYSGIGL LGIA+V  NG  KG++TGI+IGTV
Sbjct  177   GISEIVLSQIPNFDKLSWLSIVAAVMSFTYSGIGLALGIAEVAVNGKIKGNITGITIGTV  236

Query  1019  TETQKIWRSFQALGDIAFAYSYSIILIEIQDTVKSPPSESKTMRKASLFSTIVTTTFYML  840
                QK+WR+FQALGDIAFAYSYSIILIEIQDT+KSPPSE KTM+KA+LFS IVT+ FY+L
Sbjct  237   NPIQKMWRTFQALGDIAFAYSYSIILIEIQDTIKSPPSEYKTMKKATLFSLIVTSIFYIL  296

Query  839   CGCMGYAAFGDDAPGNLLTGFGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEKWV  660
             CGCMGYAAFGD +PGNLLT  GF+NPFWL+DIANAAIVIHLVGAYQV+ QP+FA +EK  
Sbjct  297   CGCMGYAAFGDLSPGNLLTDKGFHNPFWLIDIANAAIVIHLVGAYQVFAQPIFALVEKTA  356

Query  659   GAKWPDSEIITKEINLKIPGFGYPYKLNTFRLLWRTAFVLLTTVISMLLPFFNDVVGILG  480
                +P+S+ IT++I + IPGFG  Y  N FR +WRT +V++TT+ISM+LPFFNDVVG LG
Sbjct  357   AEFFPNSQFITEDIRIPIPGFG-AYNFNLFRFVWRTFYVIITTLISMILPFFNDVVGFLG  415

Query  479   AFGFWPLTVYFPVRMYISQKKIPKWSTRWICLQMlsgaclavslaaaagsfagvVLDLKL  300
             A G+WPLTVYFPV MYI+QKK+PKWST+WICLQ+LS + L ++LAAAAGS  GVV DLK+
Sbjct  416   ALGYWPLTVYFPVEMYIAQKKVPKWSTKWICLQILSLSVLVIALAAAAGSVTGVVQDLKI  475

Query  299   YRPFKTS  279
             Y+PFKTS
Sbjct  476   YKPFKTS  482



>ref|XP_008442173.1| PREDICTED: amino acid permease 4-like [Cucumis melo]
Length=466

 Score =   677 bits (1746),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 330/463 (71%), Positives = 395/463 (85%), Gaps = 1/463 (0%)
 Frame = -3

Query  1664  PLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSGVLSLAWAIGQLGWVAGPSVMLLFSC  1485
             P+      DDDGRP+RTGT WTASAHIITAVIGSGVLSLAWAI QLGW+AGPSVMLLFS 
Sbjct  5     PVNDSASFDDDGRPKRTGTFWTASAHIITAVIGSGVLSLAWAIAQLGWIAGPSVMLLFSF  64

Query  1484  VVYYTSTLLADCYRAGDPVFGKRNYTYMDAVRSNLGGYQVKICGLIQYFNLFGIAIGYTI  1305
             + YYTS LLADCYR+GDPV GKRN TYM AVRS LG   +  CG++QY NL GI IGYTI
Sbjct  65    IGYYTSCLLADCYRSGDPVSGKRNPTYMHAVRSLLGETHMVACGIMQYINLIGITIGYTI  124

Query  1304  AASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFGIIEIILSQIPDFDQIWWLSIVAAV  1125
             A+SISMMAIKRSNCFH SGGKNPCH+SSNP+M++FGI+EIILSQIP+FDQIWWLSIVAA+
Sbjct  125   ASSISMMAIKRSNCFHSSGGKNPCHISSNPFMLSFGIVEIILSQIPNFDQIWWLSIVAAI  184

Query  1124  MSFTYSGIGLGLGIAQVVANGAFKGSLTGISIGTVTETQKIWRSFQALGDIAFAYSYSII  945
             MSFTYS IGL LGIA+V  +G FKG+L+GI++GTVT+++KIWRSFQALGDIAFAYS++I+
Sbjct  185   MSFTYSSIGLTLGIAKVAESGVFKGTLSGITVGTVTQSEKIWRSFQALGDIAFAYSFAIV  244

Query  944   LIEIQDTVKSPPSESKTMRKASLFSTIVTTTFYMLCGCMGYAAFGDDAPGNLLTGFGFYN  765
             LIE+QDT++ PPSE+KTM+KA+ FS  +TT FY+LCGCMGYAAFG+ APGNLLTGFGFYN
Sbjct  245   LIEVQDTIRCPPSEAKTMKKAAGFSITLTTIFYILCGCMGYAAFGNTAPGNLLTGFGFYN  304

Query  764   PFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEKWVGAKWPDSEIITKEINLKIPGFGYPY  585
             PFWLLDIAN +IV+HLVGAYQV+ QP++AF+EK V   WPD+   TKE  L +    + Y
Sbjct  305   PFWLLDIANVSIVVHLVGAYQVFSQPVYAFVEKKVVQTWPDTPFFTKEYKLSLFSSRF-Y  363

Query  584   KLNTFRLLWRTAFVLLTTVISMLLPFFNDVVGILGAFGFWPLTVYFPVRMYISQKKIPKW  405
              +N FRL+WRT FV  TT+++MLLPFFND+VGI+GA  FWP+TVYFPV+MY+ QKK+PKW
Sbjct  364   NINLFRLVWRTLFVCFTTIVAMLLPFFNDIVGIIGALQFWPMTVYFPVQMYVVQKKVPKW  423

Query  404   STRWICLQMlsgaclavslaaaagsfagvVLDLKLYRPFKTSY  276
             S +WIC+Q +S  CL +SLAAA GS +GV+LDLK+Y+PFKT Y
Sbjct  424   SVKWICVQTMSMGCLLISLAAAVGSISGVMLDLKVYKPFKTMY  466



>ref|XP_008368062.1| PREDICTED: amino acid permease 3-like [Malus domestica]
Length=484

 Score =   675 bits (1742),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 342/488 (70%), Positives = 398/488 (82%), Gaps = 9/488 (2%)
 Frame = -3

Query  1730  MGESAAATKNHRHH----LGVSIDAPPLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGS  1563
             M E+ A     + H      VS++     G K +DDDGRP+RTGTVWTAS+HIITA+IGS
Sbjct  1     MSENTATRNQLQLHYNPVFDVSLNVQG--GSKYIDDDGRPKRTGTVWTASSHIITAIIGS  58

Query  1562  GVLSLAWAIGQLGWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRNYTYMDAVRSN  1383
             GVLSLAWAI QLGW+AGP+ M +FS + YYTSTLLA CYR  DPV GKRNY+Y DAVRSN
Sbjct  59    GVLSLAWAIAQLGWIAGPAAMAIFSFITYYTSTLLASCYR--DPVTGKRNYSYSDAVRSN  116

Query  1382  LGGYQVKICGLIQYFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIA  1203
             LG + VK CG +Q  NLFGI IGYT+AASISMMAIKRSNCFH SGGK+PCH++ NPYMIA
Sbjct  117   LGEFLVKXCGFVQQLNLFGITIGYTVAASISMMAIKRSNCFHNSGGKDPCHINYNPYMIA  176

Query  1202  FGIIEIILSQIPDFDQIWWLSIVAAVMSFTYSGIGLGLGIAQVVANGAFKGSLTGISIGT  1023
             FG  EIILSQIP+FD++ WLS+VAAVMSFTYSGIGL LGIA+V  N    GS TGIS+G 
Sbjct  177   FGTSEIILSQIPNFDKLSWLSVVAAVMSFTYSGIGLALGIAKVAENEKINGSRTGISLGI  236

Query  1022  VTETQKIWRSFQALGDIAFAYSYSIILIEIQDTVKSPPSESKTMRKASLFSTIVTTTFYM  843
             VT  QK+WR+FQALG+IAFAYSYSIILIEIQDTVKSPPSE+KTM+KA+  S  VT+ FY+
Sbjct  237   VTPAQKMWRAFQALGNIAFAYSYSIILIEIQDTVKSPPSETKTMKKATRLSLTVTSIFYI  296

Query  842   LCGCMGYAAFGDDAPGNLLTGFGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEKW  663
             LCGCMGYAAFGD APGNLLT  GF NPFWL+DIANAAIVIHLVGAYQV+ QP+FA +EK 
Sbjct  297   LCGCMGYAAFGDLAPGNLLTDKGFSNPFWLIDIANAAIVIHLVGAYQVFAQPIFALVEKT  356

Query  662   VGAKWPDSEIITKEINLKIPGFGYPYKLNTFRLLWRTAFVLLTTVISMLLPFFNDVVGIL  483
                 +P+S+ +TK+I ++IPGF Y Y LN FRL+WRT FV+LTTVISM+ PFFND+VG L
Sbjct  357   TTKNFPNSQFVTKDIKIQIPGFSY-YTLNLFRLVWRTIFVILTTVISMIFPFFNDIVGFL  415

Query  482   GAFGFWPLTVYFPVRMYISQKKIPKWSTRWICLQMlsgaclavslaaaagsfagvVLDLK  303
             GA GFWPLTVYFPV MYI+QKKIP WSTRW+CLQ LS   L ++L+AAAGS  GV+ +LK
Sbjct  416   GALGFWPLTVYFPVEMYIAQKKIPMWSTRWMCLQTLSLCVLIIALSAAAGSVTGVIHNLK  475

Query  302   LYRPFKTS  279
             +YRPFKTS
Sbjct  476   VYRPFKTS  483



>ref|XP_003568418.2| PREDICTED: amino acid permease 3-like isoform X1 [Brachypodium 
distachyon]
Length=488

 Score =   675 bits (1742),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 339/487 (70%), Positives = 395/487 (81%), Gaps = 7/487 (1%)
 Frame = -3

Query  1733  QMGESAAATKNHRHHLGVS-IDAPPLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSGV  1557
             +MGE+    + +   + VS ++     G K  DDDGR +RTGT+WTASAHIITAVIGSGV
Sbjct  6     EMGENGVGRQPYYPAMEVSGVENGHTAGSKCYDDDGRLKRTGTMWTASAHIITAVIGSGV  65

Query  1556  LSLAWAIGQLGWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRNYTYMDAVRSNLG  1377
             LSL WAI QLGWVAGP+VMLLFS V YYTS LL+DCYR+GD   GKRNYTYMDAV +NL 
Sbjct  66    LSLGWAIAQLGWVAGPAVMLLFSLVTYYTSALLSDCYRSGDETTGKRNYTYMDAVNANLS  125

Query  1376  GYQVKICGLIQYFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFG  1197
             G +V+ICG +QY N+ G+AIGYTIAASISM+AIKR+NCFH  G  NPCH+SS PYMI FG
Sbjct  126   GIKVQICGFLQYANIVGVAIGYTIAASISMLAIKRANCFHAKGHVNPCHISSTPYMIIFG  185

Query  1196  IIEIILSQIPDFDQIWWLSIVAAVMSFTYSGIGLGLGIAQVVANGAFKGSLTGISIGTVT  1017
               +I  SQIPDFDQI WLSIVAA+MSFTYS IGLGLGI QVVAN   KGSLTGISIG VT
Sbjct  186   AAQIFFSQIPDFDQISWLSIVAAIMSFTYSTIGLGLGIVQVVANRGVKGSLTGISIGVVT  245

Query  1016  ETQKIWRSFQALGDIAFAYSYSIILIEIQDTVKS-PPSESKTMRKASLFSTIVTTTFYML  840
                K+WRS QA GDIAFAYSYS+ILIEIQDT+++ PPSESK MR+A++ S   TT FYML
Sbjct  246   PMDKVWRSLQAFGDIAFAYSYSLILIEIQDTIRAPPPSESKVMRRATVVSVATTTLFYML  305

Query  839   CGCMGYAAFGDDAPGNLLTGFGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEKWV  660
             CGCMGYAAFGD+APGNLLTGFGFY PFWLLD+ANAAIV+HLVGAYQVYCQPLFAF+EKW 
Sbjct  306   CGCMGYAAFGDEAPGNLLTGFGFYEPFWLLDVANAAIVVHLVGAYQVYCQPLFAFVEKWA  365

Query  659   GAKWPDSEIITKEINLKIPGFGYPYKLNTFRLLWRTAFVLLTTVISMLLPFFNDVVGILG  480
               +WP S  I  EI +      + +K+N FRL WR+AFV+ TTV+SMLLPFFNDVVG LG
Sbjct  366   QQRWPKSSFIVGEIEVS-----FGFKVNLFRLTWRSAFVVATTVVSMLLPFFNDVVGFLG  420

Query  479   AFGFWPLTVYFPVRMYISQKKIPKWSTRWICLQMlsgaclavslaaaagsfagvVLDLKL  300
             A GFWPLTVYFPV MYI QKKIP+W ++W+CLQ+LS ACL +++A+AAGS AG++ DLK+
Sbjct  421   ALGFWPLTVYFPVEMYIVQKKIPRWGSQWVCLQLLSLACLVITVASAAGSVAGIMSDLKV  480

Query  299   YRPFKTS  279
             Y+PF TS
Sbjct  481   YKPFSTS  487



>emb|CAA70778.1| amino acid transporter [Vicia faba]
Length=509

 Score =   676 bits (1743),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 341/464 (73%), Positives = 389/464 (84%), Gaps = 7/464 (2%)
 Frame = -3

Query  1649  KGLDDDGRPQRTGTVWTASAHIITAVIGSGVLSLAWAIGQLGWVAGPSVMLLFSCVVYYT  1470
             K LDDDGR +RTGT WTASAHIITAVIGSGVLSL+WAI QLGW  GP VM+LF+ V  YT
Sbjct  47    KCLDDDGRVKRTGTFWTASAHIITAVIGSGVLSLSWAIAQLGWAVGPVVMVLFAVVNLYT  106

Query  1469  STLLADCYRAGDPVFGKRNYTYMDAVRSNLGGYQVKICGLIQYFNLFGIAIGYTIAASIS  1290
             STLL  CYR+ D V G RNYTY DAV+S LGG + KICG+IQY NLFG+AIGYTIAAS+S
Sbjct  107   STLLTQCYRSDDSVAGPRNYTYTDAVKSILGGKKFKICGVIQYVNLFGVAIGYTIAASVS  166

Query  1289  MMAIKRSNCFHESGGKNPCHMSSNPYMIAFGIIEIILSQIPDFDQIWWLSIVAAVMSFTY  1110
             MMAIKRSNC+HES G +PCHMSSN YMIAFGI E+ILSQIPDFDQ+WWLSIVAA+MSFTY
Sbjct  167   MMAIKRSNCYHESHGNDPCHMSSNVYMIAFGIAEVILSQIPDFDQVWWLSIVAAIMSFTY  226

Query  1109  SGIGLGLGIAQVVANGAFKGSLTGISIGTVTE------TQKIWRSFQALGDIAFAYSYSI  948
             S +GLGLG+A+V  NG F G L GISIGTVT       TQK+WRS QALG +AFAYS+SI
Sbjct  227   SAVGLGLGVAKVAENGTFHGRLMGISIGTVTPAGTVTGTQKVWRSLQALGAMAFAYSFSI  286

Query  947   ILIEIQDTVKSPPSESKTMRKASLFSTIVTTTFYMLCGCMGYAAFGDDAPGNLLTGFGFY  768
             ILIEIQDT+KSPP+E KTM+KA++ S +VTT FY+LCG MGYAAFGD  PGNLLTGFGFY
Sbjct  287   ILIEIQDTIKSPPAEHKTMKKATMLSIMVTTVFYILCGSMGYAAFGDHVPGNLLTGFGFY  346

Query  767   NPFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEKWVGAKWPDSEIITKEINLKIPGFGYP  588
             NP+WLLDIAN AIV+HLVGAYQV+ QP FAF+EKW   KWP ++ +T+E ++ IP  G  
Sbjct  347   NPYWLLDIANFAIVVHLVGAYQVFSQPFFAFVEKWSAHKWPKNKFVTEEYDIPIPCIGV-  405

Query  587   YKLNTFRLLWRTAFVLLTTVISMLLPFFNDVVGILGAFGFWPLTVYFPVRMYISQKKIPK  408
             YKLN FRL+WRT FVLLTT+I+MLLPFFNDVVG+LGAFGFWPLTVYFP+ MYISQKKI +
Sbjct  406   YKLNLFRLIWRTIFVLLTTLIAMLLPFFNDVVGLLGAFGFWPLTVYFPIDMYISQKKIGR  465

Query  407   WSTRWICLQMlsgaclavslaaaagsfagvVLDLKLYRPFKTSY  276
             W+ RW+ LQMLSG CL +S  AA GS AGVVLDLK Y+PFKTSY
Sbjct  466   WTNRWLGLQMLSGCCLIISTLAAVGSIAGVVLDLKTYKPFKTSY  509



>ref|XP_007041865.1| Amino acid permease 2 isoform 1 [Theobroma cacao]
 ref|XP_007041866.1| Amino acid permease 2 isoform 1 [Theobroma cacao]
 gb|EOX97696.1| Amino acid permease 2 isoform 1 [Theobroma cacao]
 gb|EOX97697.1| Amino acid permease 2 isoform 1 [Theobroma cacao]
Length=512

 Score =   676 bits (1743),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 340/490 (69%), Positives = 400/490 (82%), Gaps = 17/490 (3%)
 Frame = -3

Query  1697  RHHLGVSIDA----------PPLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSGVLSL  1548
             RH+L V +            P     K  DDDGR +RTGT WTA++HIITAVIGSGVLSL
Sbjct  24    RHYLQVEVQPKAQNESEAMDPQANHSKCFDDDGRLKRTGTFWTATSHIITAVIGSGVLSL  83

Query  1547  AWAIGQLGWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRNYTYMDAVRSNLGGYQ  1368
             AWAI QLGWVAGP+V++LF+ V  YTS LL +CYR+GDP+ G+RNYTYM+AV+++LGG++
Sbjct  84    AWAIAQLGWVAGPTVLVLFAFVNLYTSNLLTECYRSGDPITGQRNYTYMEAVKAHLGGWK  143

Query  1367  VKICGLIQYFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFGIIE  1188
             VK+CG IQY NLFG+A+GYTIAAS+SMMAIKR+NC H+SGG +PCHMSSN YMI+FGI E
Sbjct  144   VKLCGWIQYLNLFGVAVGYTIAASVSMMAIKRANCLHKSGGTDPCHMSSNGYMISFGIAE  203

Query  1187  IILSQIPDFDQIWWLSIVAAVMSFTYSGIGLGLGIAQVVANGAFKGSLTGISIGTVTET-  1011
             +I SQIPDF  +WWLSIVAA+MSFTYS +GL LGI +V  +G   GSL GISIGTVT   
Sbjct  204   VIFSQIPDFSHVWWLSIVAAIMSFTYSAVGLALGIGKVAEHGKIDGSLLGISIGTVTHAG  263

Query  1010  -----QKIWRSFQALGDIAFAYSYSIILIEIQDTVKSPPSESKTMRKASLFSTIVTTTFY  846
                  QKIWR+ QALG IAFAYSYSIILIEIQDTVKSPP+E KTM+KA+LFS  VTT FY
Sbjct  264   TVTGMQKIWRTLQALGAIAFAYSYSIILIEIQDTVKSPPAEYKTMKKATLFSITVTTVFY  323

Query  845   MLCGCMGYAAFGDDAPGNLLTGFGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEK  666
             + CGCMGYAAFGD APGNLLTGFGFYNP+WLLDIAN AIV+HLVGAYQV+CQPLFAF+EK
Sbjct  324   LFCGCMGYAAFGDLAPGNLLTGFGFYNPYWLLDIANLAIVVHLVGAYQVFCQPLFAFVEK  383

Query  665   WVGAKWPDSEIITKEINLKIPGFGYPYKLNTFRLLWRTAFVLLTTVISMLLPFFNDVVGI  486
             W   KWP S+++T E ++ IP FG  Y+LN FRL WRT FV++TTVI+ML+PFFNDVVG 
Sbjct  384   WCAQKWPKSDLVTAEYDIPIP-FGGVYQLNLFRLAWRTIFVVMTTVIAMLMPFFNDVVGF  442

Query  485   LGAFGFWPLTVYFPVRMYISQKKIPKWSTRWICLQMlsgaclavslaaaagsfagvVLDL  306
             LGA GFWPLTVYFPV MYISQKKI + +TRW+ LQ++S AC  V++AAA GS AGVVLDL
Sbjct  443   LGAMGFWPLTVYFPVEMYISQKKIGRGTTRWLALQIISVACFFVTVAAAVGSVAGVVLDL  502

Query  305   KLYRPFKTSY  276
             K Y+PFKTSY
Sbjct  503   KTYKPFKTSY  512



>ref|NP_001233979.1| amino acid transporter [Solanum lycopersicum]
 gb|AAO13687.1|AF013278_1 amino acid transporter [Solanum lycopersicum]
Length=476

 Score =   674 bits (1738),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 341/471 (72%), Positives = 397/471 (84%), Gaps = 6/471 (1%)
 Frame = -3

Query  1697  RHHLGVSIDAPPLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSGVLSLAWAIGQLGWV  1518
             +H + ++I    L+     DDDGR +R+G+VWTASAHIITAVIGSGVLSLAWA+ QLGW+
Sbjct  10    KHPVSINITESKLF-----DDDGRIKRSGSVWTASAHIITAVIGSGVLSLAWAVAQLGWI  64

Query  1517  AGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRNYTYMDAVRSNLGGYQVKICGLIQYF  1338
             AGP VMLLFS V YYTS+LL+DCYR+GDP+FGKRNYTYMD V++NL G QVKICG IQY 
Sbjct  65    AGPIVMLLFSFVTYYTSSLLSDCYRSGDPLFGKRNYTYMDVVQANLSGLQVKICGWIQYV  124

Query  1337  NLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFGIIEIILSQIPDFD  1158
             NLFG+AIGYTIA+SIS+MA+KRS+CFH+ G K PC   + PYMI FG+IEII SQIPDFD
Sbjct  125   NLFGVAIGYTIASSISLMAVKRSDCFHKHGHKAPCLQPNTPYMIIFGVIEIIFSQIPDFD  184

Query  1157  QIWWLSIVAAVMSFTYSGIGLGLGIAQVVANGAFKGSLTGISIGTVTETQKIWRSFQALG  978
             QIWWLSIVAAVMSFTYS IGLGLGIA V   G   GSLTG+SIGTVTE QK+WR+FQALG
Sbjct  185   QIWWLSIVAAVMSFTYSTIGLGLGIAHVAETGKIGGSLTGVSIGTVTEMQKVWRTFQALG  244

Query  977   DIAFAYSYSIILIEIQDTVKSPPSESKTMRKASLFSTIVTTTFYMLCGCMGYAAFGDDAP  798
              IAFAYSYS+ILIEIQDT+KSPPSE+KTM+ A++ S  VTT FYMLCGC GYAAFGD AP
Sbjct  245   AIAFAYSYSLILIEIQDTIKSPPSEAKTMKNATIISVSVTTVFYMLCGCFGYAAFGDHAP  304

Query  797   GNLLTGFGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEKWVGAKWPDSEIITKEI  618
              NLLTGFGFY+P+WLLDIAN AI +HLVGAYQVYCQPLFAFIEK     +P+S+IITK I
Sbjct  305   DNLLTGFGFYDPYWLLDIANIAIFVHLVGAYQVYCQPLFAFIEKTAAEWYPNSKIITKNI  364

Query  617   NLKIPGFGYPYKLNTFRLLWRTAFVLLTTVISMLLPFFNDVVGILGAFGFWPLTVYFPVR  438
             ++ IPGF   Y +  FRL+WRT FV+++T+ISMLLPFF+D+VGILGAFGFWPLTVY+PV 
Sbjct  365   SVPIPGFK-SYNIYLFRLVWRTIFVIISTIISMLLPFFSDIVGILGAFGFWPLTVYYPVE  423

Query  437   MYISQKKIPKWSTRWICLQMlsgaclavslaaaagsfagvVLDLKLYRPFK  285
             +YI QKKIPKWS +W  LQ+LS  CL VS+AAA GSFAGVV DLK+Y+PFK
Sbjct  424   IYIVQKKIPKWSRKWFGLQILSVTCLIVSIAAAVGSFAGVVSDLKVYKPFK  474



>dbj|BAK03497.1| predicted protein [Hordeum vulgare subsp. vulgare]
 emb|CCI51007.2| amino acid permease [Hordeum vulgare subsp. vulgare]
Length=489

 Score =   674 bits (1739),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 337/458 (74%), Positives = 388/458 (85%), Gaps = 3/458 (1%)
 Frame = -3

Query  1649  KGLDDDGRPQRTGTVWTASAHIITAVIGSGVLSLAWAIGQLGWVAGPSVMLLFSCVVYYT  1470
             K  DDDGR +RTGT+WTASAHIITAVIGSGVLSLAWAIGQLGWVAGP+VMLLFS V YYT
Sbjct  33    KCYDDDGRLKRTGTMWTASAHIITAVIGSGVLSLAWAIGQLGWVAGPAVMLLFSLVTYYT  92

Query  1469  STLLADCYRAGDPVFGKRNYTYMDAVRSNLGGYQVKICGLIQYFNLFGIAIGYTIAASIS  1290
             S+LL+DCYR+GD   GKRNYTYMDAV +NL G +V++CG +QY N+ G+AIGYTIAASIS
Sbjct  93    SSLLSDCYRSGDETTGKRNYTYMDAVNANLSGIKVQLCGFLQYANIVGVAIGYTIAASIS  152

Query  1289  MMAIKRSNCFHESGGKNPCHMSSNPYMIAFGIIEIILSQIPDFDQIWWLSIVAAVMSFTY  1110
             M+AIK++NCFH  G  NPCH+SS PYMI FG+ EI  SQIPDFDQI WLSI+AA+MSFTY
Sbjct  153   MLAIKKANCFHVKGHVNPCHISSTPYMIIFGVAEIFFSQIPDFDQISWLSILAAIMSFTY  212

Query  1109  SGIGLGLGIAQVVANGAFKGSLTGISIGTVTETQKIWRSFQALGDIAFAYSYSIILIEIQ  930
             S IGL LGI QVVAN   KGSLTGISIG VT   K+WRS QA GDIAFAYSYS+ILIEIQ
Sbjct  213   SIIGLSLGIVQVVANKGVKGSLTGISIGVVTPMDKVWRSLQAFGDIAFAYSYSLILIEIQ  272

Query  929   DTVKS-PPSESKTMRKASLFSTIVTTTFYMLCGCMGYAAFGDDAPGNLLTGFGFYNPFWL  753
             DT+++ PPSESK MR+A++ S   TT FYMLCGCMGYAAFGD+APGNLLTGFGFY PFWL
Sbjct  273   DTIRAPPPSESKVMRRATVVSVATTTLFYMLCGCMGYAAFGDNAPGNLLTGFGFYEPFWL  332

Query  752   LDIANAAIVIHLVGAYQVYCQPLFAFIEKWVGAKWPDSEIITKEINLKIPGFGYPYKLNT  573
             LDIANAAIV+HLVGAYQVYCQPLFAF+EKW   +WP S  IT EI  ++P     +K+N 
Sbjct  333   LDIANAAIVVHLVGAYQVYCQPLFAFVEKWAQQRWPKSRFITGEI--QVPLISSGFKINL  390

Query  572   FRLLWRTAFVLLTTVISMLLPFFNDVVGILGAFGFWPLTVYFPVRMYISQKKIPKWSTRW  393
             FRL WR+AFV+ TTV+SMLLPFFNDVVG LGA GFWPLTVYFPV MYI QKKIPKWS++W
Sbjct  391   FRLTWRSAFVVATTVVSMLLPFFNDVVGFLGAIGFWPLTVYFPVEMYIVQKKIPKWSSQW  450

Query  392   ICLQMlsgaclavslaaaagsfagvVLDLKLYRPFKTS  279
             +CLQ+LS ACL +++AAAAGS AG++ DLK+Y+PF T+
Sbjct  451   VCLQLLSLACLIITIAAAAGSIAGIMSDLKVYKPFSTT  488



>ref|XP_010232650.1| PREDICTED: amino acid permease 3-like [Brachypodium distachyon]
 ref|XP_010232651.1| PREDICTED: amino acid permease 3-like [Brachypodium distachyon]
Length=487

 Score =   674 bits (1738),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 340/492 (69%), Positives = 401/492 (82%), Gaps = 14/492 (3%)
 Frame = -3

Query  1730  MGESAAATKNHRHHLGVSIDAPPLYGFK------GLDDDGRPQRTGTVWTASAHIITAVI  1569
             MGES  AT  +     + + A  L   K      G DDD RP RTGT+WTAS+HIITAVI
Sbjct  1     MGESVVATY-YYPSAAMEVSAAELGQSKQPGSKGGCDDDDRPSRTGTMWTASSHIITAVI  59

Query  1568  GSGVLSLAWAIGQLGWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRNYTYMDAVR  1389
             GSGVLSL WAI QLGWVAGP+VMLLFS V Y+TS+LLADCYR+GD   GKRNYTYMDAV 
Sbjct  60    GSGVLSLGWAIAQLGWVAGPAVMLLFSLVTYFTSSLLADCYRSGDQSTGKRNYTYMDAVN  119

Query  1388  SNLGGYQVKICGLIQYFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYM  1209
             +NL G++VK+CGL+QY N+ G+AIGYTIAASISM+AI R+NCFH  G  +PC +SS PYM
Sbjct  120   ANLSGFKVKVCGLLQYANIVGVAIGYTIAASISMLAISRANCFHRKGHADPCKISSVPYM  179

Query  1208  IAFGIIEIILSQIPDFDQIWWLSIVAAVMSFTYSGIGLGLGIAQVVANGAFKGSLTGISI  1029
             + FG+ ++  SQIPDFDQI WLS++AA MSFTYS IGLGLG+AQV+ANG  +GS+TGISI
Sbjct  180   LVFGVAQVFFSQIPDFDQISWLSMLAAAMSFTYSSIGLGLGVAQVIANGGVQGSMTGISI  239

Query  1028  GT-VTETQKIWRSFQALGDIAFAYSYSIILIEIQDTVKSPP--SESKTMRKASLFSTIVT  858
             G  VT  QK+WRS QA GDIAFAYSYS+ILIEIQDT+++PP  +ESK M++A+L S  VT
Sbjct  240   GAGVTPMQKVWRSTQAFGDIAFAYSYSLILIEIQDTIRAPPKSTESKVMKRATLVSVAVT  299

Query  857   TTFYMLCGCMGYAAFGDDAPGNLLTGFGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFA  678
             T FYMLCGCMGYAAFGD APGNLLTGFGFY PFWLLD+ANAAIV+HLVGAYQVYCQPLFA
Sbjct  300   TVFYMLCGCMGYAAFGDRAPGNLLTGFGFYEPFWLLDVANAAIVVHLVGAYQVYCQPLFA  359

Query  677   FIEKWVGAKWPDSEIITKEINLKIPGFGYPYKLNTFRLLWRTAFVLLTTVISMLLPFFND  498
             F+EK+ G +WP+S  +T+EI L + GF    ++N FRL WRTAFV+ TTV+SM+LPFFND
Sbjct  360   FVEKYAGQRWPESRYVTREIELSVGGF----RVNMFRLTWRTAFVVATTVVSMMLPFFND  415

Query  497   VVGILGAFGFWPLTVYFPVRMYISQKKIPKWSTRWICLQMlsgaclavslaaaagsfagv  318
             VVG LGA GFWPLTVYFPV MYI Q+K+P+WSTRW+CLQMLSG CL +SLAAAAGS AG+
Sbjct  416   VVGFLGALGFWPLTVYFPVEMYIVQRKVPRWSTRWVCLQMLSGGCLVISLAAAAGSIAGI  475

Query  317   VLDLKLYRPFKT  282
               DLK+Y PFK+
Sbjct  476   KSDLKVYHPFKS  487



>ref|XP_010231354.1| PREDICTED: amino acid permease 3-like isoform X2 [Brachypodium 
distachyon]
 ref|XP_010231355.1| PREDICTED: amino acid permease 3-like isoform X2 [Brachypodium 
distachyon]
Length=482

 Score =   673 bits (1737),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 339/486 (70%), Positives = 394/486 (81%), Gaps = 7/486 (1%)
 Frame = -3

Query  1730  MGESAAATKNHRHHLGVS-IDAPPLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSGVL  1554
             MGE+    + +   + VS ++     G K  DDDGR +RTGT+WTASAHIITAVIGSGVL
Sbjct  1     MGENGVGRQPYYPAMEVSGVENGHTAGSKCYDDDGRLKRTGTMWTASAHIITAVIGSGVL  60

Query  1553  SLAWAIGQLGWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRNYTYMDAVRSNLGG  1374
             SL WAI QLGWVAGP+VMLLFS V YYTS LL+DCYR+GD   GKRNYTYMDAV +NL G
Sbjct  61    SLGWAIAQLGWVAGPAVMLLFSLVTYYTSALLSDCYRSGDETTGKRNYTYMDAVNANLSG  120

Query  1373  YQVKICGLIQYFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFGI  1194
              +V+ICG +QY N+ G+AIGYTIAASISM+AIKR+NCFH  G  NPCH+SS PYMI FG 
Sbjct  121   IKVQICGFLQYANIVGVAIGYTIAASISMLAIKRANCFHAKGHVNPCHISSTPYMIIFGA  180

Query  1193  IEIILSQIPDFDQIWWLSIVAAVMSFTYSGIGLGLGIAQVVANGAFKGSLTGISIGTVTE  1014
              +I  SQIPDFDQI WLSIVAA+MSFTYS IGLGLGI QVVAN   KGSLTGISIG VT 
Sbjct  181   AQIFFSQIPDFDQISWLSIVAAIMSFTYSTIGLGLGIVQVVANRGVKGSLTGISIGVVTP  240

Query  1013  TQKIWRSFQALGDIAFAYSYSIILIEIQDTVKS-PPSESKTMRKASLFSTIVTTTFYMLC  837
               K+WRS QA GDIAFAYSYS+ILIEIQDT+++ PPSESK MR+A++ S   TT FYMLC
Sbjct  241   MDKVWRSLQAFGDIAFAYSYSLILIEIQDTIRAPPPSESKVMRRATVVSVATTTLFYMLC  300

Query  836   GCMGYAAFGDDAPGNLLTGFGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEKWVG  657
             GCMGYAAFGD+APGNLLTGFGFY PFWLLD+ANAAIV+HLVGAYQVYCQPLFAF+EKW  
Sbjct  301   GCMGYAAFGDEAPGNLLTGFGFYEPFWLLDVANAAIVVHLVGAYQVYCQPLFAFVEKWAQ  360

Query  656   AKWPDSEIITKEINLKIPGFGYPYKLNTFRLLWRTAFVLLTTVISMLLPFFNDVVGILGA  477
              +WP S  I  EI +      + +K+N FRL WR+AFV+ TTV+SMLLPFFNDVVG LGA
Sbjct  361   QRWPKSSFIVGEIEVS-----FGFKVNLFRLTWRSAFVVATTVVSMLLPFFNDVVGFLGA  415

Query  476   FGFWPLTVYFPVRMYISQKKIPKWSTRWICLQMlsgaclavslaaaagsfagvVLDLKLY  297
              GFWPLTVYFPV MYI QKKIP+W ++W+CLQ+LS ACL +++A+AAGS AG++ DLK+Y
Sbjct  416   LGFWPLTVYFPVEMYIVQKKIPRWGSQWVCLQLLSLACLVITVASAAGSVAGIMSDLKVY  475

Query  296   RPFKTS  279
             +PF TS
Sbjct  476   KPFSTS  481



>gb|KEH30491.1| transmembrane amino acid transporter family protein [Medicago 
truncatula]
Length=512

 Score =   674 bits (1739),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 348/493 (71%), Positives = 398/493 (81%), Gaps = 19/493 (4%)
 Frame = -3

Query  1703  NHRHHLGV-----------SIDAPPLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSGV  1557
             + RH+L V           S+   P Y  K  DDDGR +RTGT WTA+AHIITAVIGSGV
Sbjct  22    DFRHYLEVEAQPKIQTETESVSIEPNYS-KCFDDDGRLKRTGTFWTATAHIITAVIGSGV  80

Query  1556  LSLAWAIGQLGWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRNYTYMDAVRSNLG  1377
             LSLAWAI QLGW  GP VM+LF+ V  YTS+LL  CYR  D V G+RNYTY DAV+S LG
Sbjct  81    LSLAWAIAQLGWAVGPVVMILFAVVNLYTSSLLTQCYRTDDSVNGQRNYTYTDAVKSILG  140

Query  1376  GYQVKICGLIQYFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFG  1197
             G + K+CGLIQY NLFGIAIGYTIAAS+SMMAIKRSNC+HES GK+PCHMSSN YMI F 
Sbjct  141   GKKFKMCGLIQYVNLFGIAIGYTIAASVSMMAIKRSNCYHESHGKDPCHMSSNGYMITFA  200

Query  1196  IIEIILSQIPDFDQIWWLSIVAAVMSFTYSGIGLGLGIAQVVANGAFKGSLTGISI----  1029
             I E+ILSQIPDFDQ+WWLSIVAA+MSFTYS +GLGLGIA+V  NGAF+GSL GISI    
Sbjct  201   IAEVILSQIPDFDQVWWLSIVAAIMSFTYSAVGLGLGIAKVAENGAFQGSLMGISIGAVT  260

Query  1028  --GTVTETQKIWRSFQALGDIAFAYSYSIILIEIQDTVKSPPSESKTMRKASLFSTIVTT  855
               GTVT TQKIWRS QALG +AF+YS+SIILIEIQDT+KSPPSE KTM+KA+L S +VTT
Sbjct  261   QAGTVTGTQKIWRSLQALGAMAFSYSFSIILIEIQDTLKSPPSEHKTMKKATLVSIMVTT  320

Query  854   TFYMLCGCMGYAAFGDDAPGNLLTGFGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAF  675
              FY+LCG MGYAAFGD  PGNLLTGFGFYNP+WLLDIAN AIV+HL+GAYQV+ QP FAF
Sbjct  321   VFYLLCGGMGYAAFGDHVPGNLLTGFGFYNPYWLLDIANLAIVVHLIGAYQVFSQPFFAF  380

Query  674   IEKWVGAKWPDSEIITKEINLKIPGFGYPYKLNTFRLLWRTAFVLLTTVISMLLPFFNDV  495
             +EKW   KWP +  +T E  + IP  G  Y+LN FRL+WRT FVLLTT+I+MLLPFFNDV
Sbjct  381   VEKWSARKWPKNNFVTAEHEIPIPCIGV-YQLNFFRLIWRTLFVLLTTIIAMLLPFFNDV  439

Query  494   VGILGAFGFWPLTVYFPVRMYISQKKIPKWSTRWICLQMlsgaclavslaaaagsfagvV  315
             VGILGAFGFWPLTVY+P+ MYISQKKI +W+ +W+ LQMLSG CL +S+ AA GS AGVV
Sbjct  440   VGILGAFGFWPLTVYYPIDMYISQKKIGRWTKKWLALQMLSGCCLIISILAAVGSIAGVV  499

Query  314   LDLKLYRPFKTSY  276
             LDLK Y+PFKTSY
Sbjct  500   LDLKTYKPFKTSY  512



>gb|KEH30492.1| transmembrane amino acid transporter family protein [Medicago 
truncatula]
Length=512

 Score =   674 bits (1739),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 348/493 (71%), Positives = 398/493 (81%), Gaps = 19/493 (4%)
 Frame = -3

Query  1703  NHRHHLGV-----------SIDAPPLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSGV  1557
             + RH+L V           S+   P Y  K  DDDGR +RTGT WTA+AHIITAVIGSGV
Sbjct  22    DFRHYLEVEAQPKIQTETESVSIEPNYS-KCFDDDGRLKRTGTFWTATAHIITAVIGSGV  80

Query  1556  LSLAWAIGQLGWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRNYTYMDAVRSNLG  1377
             LSLAWAI QLGW  GP VM+LF+ V  YTS+LL  CYR  D V G+RNYTY DAV+S LG
Sbjct  81    LSLAWAIAQLGWAVGPVVMILFAVVNLYTSSLLTQCYRTDDSVNGQRNYTYTDAVKSILG  140

Query  1376  GYQVKICGLIQYFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFG  1197
             G + K+CGLIQY NLFGIAIGYTIAAS+SMMAIKRSNC+HES GK+PCHMSSN YMI F 
Sbjct  141   GKKFKMCGLIQYVNLFGIAIGYTIAASVSMMAIKRSNCYHESHGKDPCHMSSNGYMITFA  200

Query  1196  IIEIILSQIPDFDQIWWLSIVAAVMSFTYSGIGLGLGIAQVVANGAFKGSLTGISI----  1029
             I E+ILSQIPDFDQ+WWLSIVAA+MSFTYS +GLGLGIA+V  NGAF+GSL GISI    
Sbjct  201   IAEVILSQIPDFDQVWWLSIVAAIMSFTYSAVGLGLGIAKVAENGAFQGSLMGISIGAVT  260

Query  1028  --GTVTETQKIWRSFQALGDIAFAYSYSIILIEIQDTVKSPPSESKTMRKASLFSTIVTT  855
               GTVT TQKIWRS QALG +AF+YS+SIILIEIQDT+KSPPSE KTM+KA+L S +VTT
Sbjct  261   QAGTVTGTQKIWRSLQALGAMAFSYSFSIILIEIQDTLKSPPSEHKTMKKATLVSIMVTT  320

Query  854   TFYMLCGCMGYAAFGDDAPGNLLTGFGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAF  675
              FY+LCG MGYAAFGD  PGNLLTGFGFYNP+WLLDIAN AIV+HL+GAYQV+ QP FAF
Sbjct  321   VFYLLCGGMGYAAFGDHVPGNLLTGFGFYNPYWLLDIANLAIVVHLIGAYQVFSQPFFAF  380

Query  674   IEKWVGAKWPDSEIITKEINLKIPGFGYPYKLNTFRLLWRTAFVLLTTVISMLLPFFNDV  495
             +EKW   KWP +  +T E  + IP  G  Y+LN FRL+WRT FVLLTT+I+MLLPFFNDV
Sbjct  381   VEKWSARKWPKNNFVTAEHEIPIPCIGV-YQLNFFRLIWRTLFVLLTTIIAMLLPFFNDV  439

Query  494   VGILGAFGFWPLTVYFPVRMYISQKKIPKWSTRWICLQMlsgaclavslaaaagsfagvV  315
             VGILGAFGFWPLTVY+P+ MYISQKKI +W+ +W+ LQMLSG CL +S+ AA GS AGVV
Sbjct  440   VGILGAFGFWPLTVYYPIDMYISQKKIGRWTKKWLALQMLSGCCLIISILAAVGSIAGVV  499

Query  314   LDLKLYRPFKTSY  276
             LDLK Y+PFKTSY
Sbjct  500   LDLKTYKPFKTSY  512



>ref|XP_004156002.1| PREDICTED: amino acid permease 4-like [Cucumis sativus]
Length=467

 Score =   672 bits (1734),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 326/463 (70%), Positives = 393/463 (85%), Gaps = 0/463 (0%)
 Frame = -3

Query  1664  PLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSGVLSLAWAIGQLGWVAGPSVMLLFSC  1485
             P+      DDDG P+RTGT WTASAHIITAVIGSGVLSLAWAI QLGW+AGPSVM+LF+ 
Sbjct  5     PVNDSASFDDDGCPKRTGTFWTASAHIITAVIGSGVLSLAWAIAQLGWIAGPSVMILFAF  64

Query  1484  VVYYTSTLLADCYRAGDPVFGKRNYTYMDAVRSNLGGYQVKICGLIQYFNLFGIAIGYTI  1305
             + YYTS LLADCYR+GDPV GKRN TYM AVRS LG   +  CG++QY NL GI IGYTI
Sbjct  65    IGYYTSCLLADCYRSGDPVNGKRNPTYMHAVRSLLGETHMVACGIMQYINLIGITIGYTI  124

Query  1304  AASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFGIIEIILSQIPDFDQIWWLSIVAAV  1125
             A+SISMMAIKRSNCFH SGGKNPCH+SSNP+M++FGI+EIILSQIP+FDQIWWLSIVAA+
Sbjct  125   ASSISMMAIKRSNCFHSSGGKNPCHISSNPFMLSFGIVEIILSQIPNFDQIWWLSIVAAI  184

Query  1124  MSFTYSGIGLGLGIAQVVANGAFKGSLTGISIGTVTETQKIWRSFQALGDIAFAYSYSII  945
             MSFTYS IGL LGIA+V  +G+FKG+L+GI++GTVT+++KIWRSFQALGDIAFA S++I+
Sbjct  185   MSFTYSSIGLTLGIAKVAESGSFKGTLSGITVGTVTQSEKIWRSFQALGDIAFASSFAIV  244

Query  944   LIEIQDTVKSPPSESKTMRKASLFSTIVTTTFYMLCGCMGYAAFGDDAPGNLLTGFGFYN  765
             LIE+QDT++SPPSE+KTM+KA+ FS  +TT FYMLCGCMGYAAFG+ APGNLLTGFGFYN
Sbjct  245   LIEVQDTIRSPPSETKTMKKAAGFSITLTTIFYMLCGCMGYAAFGNTAPGNLLTGFGFYN  304

Query  764   PFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEKWVGAKWPDSEIITKEINLKIPGFGYPY  585
             PFWLLDIAN +IV+HLVGAYQV+ QP++AF+EK V   WPD+   TKE  L +      Y
Sbjct  305   PFWLLDIANVSIVVHLVGAYQVFSQPVYAFVEKKVVQTWPDTPFFTKEYKLSLFSSRSSY  364

Query  584   KLNTFRLLWRTAFVLLTTVISMLLPFFNDVVGILGAFGFWPLTVYFPVRMYISQKKIPKW  405
              +N FRL+WRT FV  TT+++MLLPFFND+VG +GA  FWP+TVYFPV+MY+ QKK+PKW
Sbjct  365   NVNLFRLVWRTLFVCFTTIVAMLLPFFNDIVGFIGALQFWPMTVYFPVQMYVVQKKVPKW  424

Query  404   STRWICLQMlsgaclavslaaaagsfagvVLDLKLYRPFKTSY  276
             S +WIC+Q +S  CL +SLAAA GS +G++LDLK+Y+PFKT Y
Sbjct  425   SVKWICVQTMSMGCLLISLAAAVGSISGIMLDLKVYKPFKTMY  467



>dbj|BAJ95327.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=480

 Score =   672 bits (1735),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 335/455 (74%), Positives = 388/455 (85%), Gaps = 4/455 (1%)
 Frame = -3

Query  1643  LDDDGRPQRTGTVWTASAHIITAVIGSGVLSLAWAIGQLGWVAGPSVMLLFSCVVYYTST  1464
             LDDDGR +RTGT+WTAS+HIITAVIGSGVLSL WAI QLGWVAGP+VMLLFS V Y+TS+
Sbjct  29    LDDDGRNKRTGTMWTASSHIITAVIGSGVLSLGWAIAQLGWVAGPAVMLLFSLVTYFTSS  88

Query  1463  LLADCYRAGDPVFGKRNYTYMDAVRSNLGGYQVKICGLIQYFNLFGIAIGYTIAASISMM  1284
             LLADCYR+GD   GKRNYTYMDAV +NL G +V+ICG++QY N+ G+AIGYTIAASISM+
Sbjct  89    LLADCYRSGDQSTGKRNYTYMDAVNANLSGIKVQICGVLQYANIVGVAIGYTIAASISML  148

Query  1283  AIKRSNCFHESGGKNPCHMSSNPYMIAFGIIEIILSQIPDFDQIWWLSIVAAVMSFTYSG  1104
             AIKR+NCFH +G  +PC +SS PYMI FG+ ++  SQIPDFDQI WLS++AA MSFTYS 
Sbjct  149   AIKRANCFHGNGHADPCKVSSVPYMIIFGVAQVFFSQIPDFDQISWLSMLAAAMSFTYSS  208

Query  1103  IGLGLGIAQVVANGAFKGSLTGISIGTVTETQKIWRSFQALGDIAFAYSYSIILIEIQDT  924
             IGLGLGI QV+ANG  KGSLTGISIGTVT  QK+WRS QA GDIAFAYSYS+ILIEIQDT
Sbjct  209   IGLGLGIVQVIANGGMKGSLTGISIGTVTPMQKVWRSLQAFGDIAFAYSYSLILIEIQDT  268

Query  923   VKS-PPSESKTMRKASLFSTIVTTTFYMLCGCMGYAAFGDDAPGNLLTGFGFYNPFWLLD  747
             +++ PPSES  M++A++ S  VTT FYMLCGCMGYAAFGD APGNLLTGFGFY PFWLLD
Sbjct  269   IRAPPPSESTVMKRATMVSVAVTTVFYMLCGCMGYAAFGDAAPGNLLTGFGFYEPFWLLD  328

Query  746   IANAAIVIHLVGAYQVYCQPLFAFIEKWVGAKWPDSEIITKEINLKIPGFGYPYKLNTFR  567
             +ANAAIV+HLVGAYQVYCQPLFAF+EKW   +WP+S  +T E+  ++P F   YK+N FR
Sbjct  329   VANAAIVVHLVGAYQVYCQPLFAFVEKWAAKRWPESTFVTGEV--EVPLF-RTYKVNMFR  385

Query  566   LLWRTAFVLLTTVISMLLPFFNDVVGILGAFGFWPLTVYFPVRMYISQKKIPKWSTRWIC  387
               WRTAFV+ TTV+SM+LPFFNDVVG LGA GFWPLTVYFPV MY+ QKK+PKWSTRW+C
Sbjct  386   ATWRTAFVVATTVVSMMLPFFNDVVGFLGALGFWPLTVYFPVEMYVVQKKVPKWSTRWVC  445

Query  386   LQMlsgaclavslaaaagsfagvVLDLKLYRPFKT  282
             LQMLS  CLA+SLAAAAGS AG+  DLK+Y PFKT
Sbjct  446   LQMLSVGCLAISLAAAAGSIAGIKSDLKVYHPFKT  480



>emb|CDY36017.1| BnaA08g04440D [Brassica napus]
Length=481

 Score =   672 bits (1733),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 329/478 (69%), Positives = 396/478 (83%), Gaps = 0/478 (0%)
 Frame = -3

Query  1709  TKNHRHHLGVSIDAPPLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSGVLSLAWAIGQ  1530
                +R  LG+SID  P       D+DGR +RTGTVWTASAHIITAVIGSGVLSLAWA+ Q
Sbjct  4     NSKNRQELGISIDVLPRNSSDLFDEDGRVKRTGTVWTASAHIITAVIGSGVLSLAWAVAQ  63

Query  1529  LGWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRNYTYMDAVRSNLGGYQVKICGL  1350
             +GWV GP VM+LFS V YYTS LL  CYR+GD V GKRNYTYMDA+ SNLGG +VK+CG+
Sbjct  64    IGWVGGPVVMILFSLVTYYTSILLCACYRSGDSVTGKRNYTYMDAIHSNLGGIKVKLCGV  123

Query  1349  IQYFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFGIIEIILSQI  1170
             +QY NLFG AIGYTIA++ISM+AI+R++C   +G K+PCH++ NPYMIAFG I+II SQI
Sbjct  124   VQYVNLFGTAIGYTIASAISMIAIQRTSCQQSNGDKDPCHVNGNPYMIAFGAIQIIFSQI  183

Query  1169  PDFDQIWWLSIVAAVMSFTYSGIGLGLGIAQVVANGAFKGSLTGISIGTVTETQKIWRSF  990
             PDFDQ+WWLSIVAA+MSF YS IGLGLGI+++V N   KG+LTG++IGTVT T+K+WR+F
Sbjct  184   PDFDQLWWLSIVAALMSFGYSTIGLGLGISRMVDNKEIKGTLTGVTIGTVTPTEKVWRTF  243

Query  989   QALGDIAFAYSYSIILIEIQDTVKSPPSESKTMRKASLFSTIVTTTFYMLCGCMGYAAFG  810
             Q+LG+IAFAYSYS+ILIEIQDT+K+PP+E KTMRKA+L S  VTT FYMLCGC+GYAAFG
Sbjct  244   QSLGNIAFAYSYSMILIEIQDTLKAPPAEEKTMRKATLISVAVTTLFYMLCGCVGYAAFG  303

Query  809   DDAPGNLLTGFGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEKWVGAKWPDSEII  630
             D APGNLL   GF NP+WLLDIAN AIVIHLVGAYQVYCQPLFAF+E+    ++P+S+ I
Sbjct  304   DSAPGNLLAAGGFRNPYWLLDIANLAIVIHLVGAYQVYCQPLFAFVEREASKRYPESKFI  363

Query  629   TKEINLKIPGFGYPYKLNTFRLLWRTAFVLLTTVISMLLPFFNDVVGILGAFGFWPLTVY  450
             TKE  + I     P+ LN FRL+WRT FV+ TT+ISM++PFFNDV+G+LGA GFWPLTVY
Sbjct  364   TKETKIHIFPGSKPFNLNLFRLVWRTVFVITTTLISMIMPFFNDVLGLLGAIGFWPLTVY  423

Query  449   FPVRMYISQKKIPKWSTRWICLQMlsgaclavslaaaagsfagvVLDLKLYRPFKTSY  276
             FPV MYI QK +P+WSTRW+CLQ+LS ACL VS+AAAAGS  G+V DLK Y+PFKT +
Sbjct  424   FPVEMYIVQKNVPRWSTRWVCLQVLSLACLVVSVAAAAGSVVGIVTDLKSYKPFKTDF  481



>ref|XP_002458869.1| hypothetical protein SORBIDRAFT_03g041840 [Sorghum bicolor]
 gb|EES03989.1| hypothetical protein SORBIDRAFT_03g041840 [Sorghum bicolor]
Length=491

 Score =   672 bits (1734),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 332/458 (72%), Positives = 382/458 (83%), Gaps = 2/458 (0%)
 Frame = -3

Query  1649  KGLDDDGRPQRTGTVWTASAHIITAVIGSGVLSLAWAIGQLGWVAGPSVMLLFSCVVYYT  1470
             K  DDDGRP+R GT+WTAS+HIITAVIGSGVLSL WAI QLGWVAGP+ MLLFS V YYT
Sbjct  33    KCFDDDGRPKRNGTMWTASSHIITAVIGSGVLSLGWAIAQLGWVAGPAAMLLFSLVTYYT  92

Query  1469  STLLADCYRAGDPVFGKRNYTYMDAVRSNLGGYQVKICGLIQYFNLFGIAIGYTIAASIS  1290
             S+LLADCYR+GDP  GKRNYTYMDAV +NL G +V+ICG +QY N+ G+AIGYTIAASIS
Sbjct  93    SSLLADCYRSGDPSTGKRNYTYMDAVNANLSGIKVQICGFLQYANIVGVAIGYTIAASIS  152

Query  1289  MMAIKRSNCFHESGGKNPCHMSSNPYMIAFGIIEIILSQIPDFDQIWWLSIVAAVMSFTY  1110
             M+AI+R+NCFH+ G  NPC +SS PYMI FG+ EI  SQIPDFDQI WLSI+AAVMSFTY
Sbjct  153   MLAIRRANCFHQKGHGNPCKVSSTPYMIIFGVAEIFFSQIPDFDQISWLSILAAVMSFTY  212

Query  1109  SGIGLGLGIAQVVANGAFKGSLTGISIGTVTETQKIWRSFQALGDIAFAYSYSIILIEIQ  930
             S IGLGLGI QV+AN   +GSLTGISIG VT   K+WRS QA GDIAFAYSYS+ILIEIQ
Sbjct  213   SSIGLGLGIVQVIANRGVQGSLTGISIGVVTPMDKVWRSLQAFGDIAFAYSYSLILIEIQ  272

Query  929   DTVKS-PPSESKTMRKASLFSTIVTTTFYMLCGCMGYAAFGDDAPGNLLTGFGFYNPFWL  753
             DT+++ PPSES  M++A++ S  VTT FYMLCGCMGYAAFGD APGNLLTGFGFY PFWL
Sbjct  273   DTIRAPPPSESTVMKRATVVSVAVTTLFYMLCGCMGYAAFGDGAPGNLLTGFGFYEPFWL  332

Query  752   LDIANAAIVIHLVGAYQVYCQPLFAFIEKWVGAKWPDSEIITKEINLKIPGF-GYPYKLN  576
             LD+ANAAIV+HLVGAYQVYCQPLFAF+EKW   +WPDS  +T E+ + +P       K+N
Sbjct  333   LDVANAAIVVHLVGAYQVYCQPLFAFVEKWAAQRWPDSAFVTGEVEVPLPATRRRSCKVN  392

Query  575   TFRLLWRTAFVLLTTVISMLLPFFNDVVGILGAFGFWPLTVYFPVRMYISQKKIPKWSTR  396
              FR  WRTAFV+ TTV+SMLLPFFNDVVG LGA GFWPLTVYFPV MY+ QKK+P+WS R
Sbjct  393   LFRATWRTAFVVATTVVSMLLPFFNDVVGFLGALGFWPLTVYFPVEMYVVQKKVPRWSPR  452

Query  395   WICLQMlsgaclavslaaaagsfagvVLDLKLYRPFKT  282
             W+CLQMLS  CL +S+AAAAGS AG+  DLK+YRPFK+
Sbjct  453   WVCLQMLSLGCLVISVAAAAGSIAGIASDLKVYRPFKS  490



>dbj|BAK03421.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=480

 Score =   671 bits (1732),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 334/455 (73%), Positives = 388/455 (85%), Gaps = 4/455 (1%)
 Frame = -3

Query  1643  LDDDGRPQRTGTVWTASAHIITAVIGSGVLSLAWAIGQLGWVAGPSVMLLFSCVVYYTST  1464
             LDDDGR +RTGT+WTAS+HIITAVIGSGVLSL WAI QLGWVAGP+VMLLFS V Y+TS+
Sbjct  29    LDDDGRNKRTGTMWTASSHIITAVIGSGVLSLGWAIAQLGWVAGPAVMLLFSLVTYFTSS  88

Query  1463  LLADCYRAGDPVFGKRNYTYMDAVRSNLGGYQVKICGLIQYFNLFGIAIGYTIAASISMM  1284
             LLADCYR+GD   GKRNYTYMDAV +NL G +V+ICG++QY N+ G+AIGYTIAASISM+
Sbjct  89    LLADCYRSGDQSTGKRNYTYMDAVNANLSGIKVQICGVLQYANIVGVAIGYTIAASISML  148

Query  1283  AIKRSNCFHESGGKNPCHMSSNPYMIAFGIIEIILSQIPDFDQIWWLSIVAAVMSFTYSG  1104
             AIKR+NCFH +G  +PC +SS PYMI FG+ ++  SQIPDFDQI WLS++AA MSFTYS 
Sbjct  149   AIKRANCFHGNGHADPCKVSSVPYMIIFGVAQVFFSQIPDFDQISWLSMLAAAMSFTYSS  208

Query  1103  IGLGLGIAQVVANGAFKGSLTGISIGTVTETQKIWRSFQALGDIAFAYSYSIILIEIQDT  924
             IGLGLGI QV+ANG  KGSLTGISIGTVT  QK+WRS QA GDIAFAYSYS+ILIEIQDT
Sbjct  209   IGLGLGIVQVIANGGMKGSLTGISIGTVTPMQKVWRSLQAFGDIAFAYSYSLILIEIQDT  268

Query  923   VKS-PPSESKTMRKASLFSTIVTTTFYMLCGCMGYAAFGDDAPGNLLTGFGFYNPFWLLD  747
             +++ PPSES  M++A++ S  VTT FYMLCGCMGYAAFGD APGNLLTGFGFY PFWLLD
Sbjct  269   IRAPPPSESTVMKRATMVSVAVTTVFYMLCGCMGYAAFGDAAPGNLLTGFGFYEPFWLLD  328

Query  746   IANAAIVIHLVGAYQVYCQPLFAFIEKWVGAKWPDSEIITKEINLKIPGFGYPYKLNTFR  567
             +ANAAIV+HLVGAYQVYCQPLFAF+EKW   +WP+S  +T E+  ++P F   YK+N FR
Sbjct  329   VANAAIVVHLVGAYQVYCQPLFAFVEKWAAKRWPESTFVTGEV--EVPLF-RTYKVNMFR  385

Query  566   LLWRTAFVLLTTVISMLLPFFNDVVGILGAFGFWPLTVYFPVRMYISQKKIPKWSTRWIC  387
               WRTAFV+ TTV+SM+LPFFNDVVG LGA GFWPLTVYFPV MY+ QKK+PKWSTRW+C
Sbjct  386   ATWRTAFVVATTVVSMMLPFFNDVVGFLGALGFWPLTVYFPVEMYVVQKKVPKWSTRWVC  445

Query  386   LQMlsgaclavslaaaagsfagvVLDLKLYRPFKT  282
             LQMLS  CLA+SLAAAAGS AG+  DLK+Y PFK+
Sbjct  446   LQMLSVGCLAISLAAAAGSIAGIKSDLKVYHPFKS  480



>ref|XP_008654977.1| PREDICTED: amino acid carrier isoform X1 [Zea mays]
 gb|AFW81885.1| amino acid carrier [Zea mays]
Length=478

 Score =   671 bits (1731),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 335/461 (73%), Positives = 390/461 (85%), Gaps = 4/461 (1%)
 Frame = -3

Query  1649  KGLDDDGRPQRTGTVWTASAHIITAVIGSGVLSLAWAIGQLGWVAGPSVMLLFSCVVYYT  1470
             K  DDDGR +RTGT+WTASAHIITAVIGSGVLSLAWAI QLGWVAGP+VMLLFS V YYT
Sbjct  17    KCFDDDGRLKRTGTMWTASAHIITAVIGSGVLSLAWAIAQLGWVAGPTVMLLFSFVTYYT  76

Query  1469  STLLADCYRAGDPVFGKRNYTYMDAVRSNLGGYQVKICGLIQYFNLFGIAIGYTIAASIS  1290
             S LLADCYR+GD   GKRNYTYMDAV +NL G +V  CG +QY N+ G+AIGYTIAASIS
Sbjct  77    SALLADCYRSGDACTGKRNYTYMDAVNANLSGVKVWFCGFLQYANIVGVAIGYTIAASIS  136

Query  1289  MMAIKRSNCFHESGGKNPCHMSSNPYMIAFGIIEIILSQIPDFDQIWWLSIVAAVMSFTY  1110
             M+AI+R+NCFH  G  +PC++SS PYMI FG+++I  SQIPDFDQI WLSI+AAVMSFTY
Sbjct  137   MLAIQRANCFHVEGHGDPCNISSTPYMIIFGVVQIFFSQIPDFDQISWLSILAAVMSFTY  196

Query  1109  SGIGLGLGIAQVVANGAFKGSLTGISIGTVTETQKIWRSFQALGDIAFAYSYSIILIEIQ  930
             S IGLGLGIAQVV+N   +GSLTGIS+G VT   K+WRS QA GDIAFAYSYS+ILIEIQ
Sbjct  197   STIGLGLGIAQVVSNKGVQGSLTGISVGLVTPVDKMWRSLQAFGDIAFAYSYSLILIEIQ  256

Query  929   DTVKS-PPSESKTMRKASLFSTIVTTTFYMLCGCMGYAAFGDDAPGNLLTGFGFYNPFWL  753
             DT+++ PPSESK MR+A++ S  VTT FYMLCGCMGYAAFGD+APGNLLTGFGFY PFWL
Sbjct  257   DTIRAPPPSESKVMRRATVVSVAVTTFFYMLCGCMGYAAFGDNAPGNLLTGFGFYEPFWL  316

Query  752   LDIANAAIVIHLVGAYQVYCQPLFAFIEKWVGAKWPDSEIITKEINLKIP---GFGYPYK  582
             LD+ANAAI +HLVGAYQVYCQPLFAF+EKW   +WP S  IT E+++ +P     G  YK
Sbjct  317   LDVANAAIAVHLVGAYQVYCQPLFAFVEKWARQRWPKSRYITGEVDVPLPLGTAGGRCYK  376

Query  581   LNTFRLLWRTAFVLLTTVISMLLPFFNDVVGILGAFGFWPLTVYFPVRMYISQKKIPKWS  402
             L+ FRL WRTAFV+ TTV+SMLLPFFNDVVG+LGA GFWPLTVYFPV MYI QKK+P+WS
Sbjct  377   LSLFRLTWRTAFVVATTVVSMLLPFFNDVVGLLGALGFWPLTVYFPVEMYIVQKKVPRWS  436

Query  401   TRWICLQMlsgaclavslaaaagsfagvVLDLKLYRPFKTS  279
             TRW+CLQ+LS ACL +++A+AAGS AG+V DLK+Y+PF T+
Sbjct  437   TRWVCLQLLSVACLVITVASAAGSVAGIVSDLKVYKPFVTT  477



>ref|XP_008679681.1| PREDICTED: amino acid permease 3-like [Zea mays]
 gb|AFW65568.1| hypothetical protein ZEAMMB73_193502 [Zea mays]
Length=472

 Score =   671 bits (1730),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 336/459 (73%), Positives = 384/459 (84%), Gaps = 8/459 (2%)
 Frame = -3

Query  1655  GFKGLDDDGRPQRTGTVWTASAHIITAVIGSGVLSLAWAIGQLGWVAGPSVMLLFSCVVY  1476
              + G DDDGRP+RTGTVWTASAHIITAVIGSGVLSLAWAI QLGW AGP+VMLLF+ V+Y
Sbjct  19    AYGGRDDDGRPRRTGTVWTASAHIITAVIGSGVLSLAWAIAQLGWAAGPAVMLLFAVVIY  78

Query  1475  YTSTLLADCYRAGDPVFGKRNYTYMDAVRSNLGGYQVKICGLIQYFNLFGIAIGYTIAAS  1296
             YTSTLLA+CYR+GDPV GKRNYTYMDAVR++LGG +V++CG IQY NLFG+AIGYTIAAS
Sbjct  79    YTSTLLAECYRSGDPVAGKRNYTYMDAVRASLGGAKVRLCGAIQYANLFGVAIGYTIAAS  138

Query  1295  ISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFGIIEIILSQIPDFDQIWWLSIVAAVMSF  1116
             ISM+AIKR++CFH  G K+ C  SSNPYMI FG+ E++ SQIPDFDQIWWLSIVAAVMSF
Sbjct  139   ISMLAIKRADCFHAKGHKHACRSSSNPYMILFGVAEVVFSQIPDFDQIWWLSIVAAVMSF  198

Query  1115  TYSGIGLGLGIAQVVANGAFKGSLTGISIGT-VTETQKIWRSFQALGDIAFAYSYSIILI  939
             TY+ IGL LGI Q VANG F+GSLTGISIG  VT T+K+WRS QA G+IAFAYSYSIILI
Sbjct  199   TYATIGLVLGIMQTVANGGFQGSLTGISIGAGVTPTEKVWRSLQAFGNIAFAYSYSIILI  258

Query  938   EIQDTVKS-PPSESKTMRKASLFSTIVTTTFYMLCGCMGYAAFGDDAPGNLLTGFGFYNP  762
             EIQDTVK+ PPSE+K M++A++ S   TT FYMLCGCMGYAAFGD AP NLLTGFGFY P
Sbjct  259   EIQDTVKAPPPSEAKVMKRATMVSVATTTVFYMLCGCMGYAAFGDAAPDNLLTGFGFYEP  318

Query  761   FWLLDIANAAIVIHLVGAYQVYCQPLFAFIEKWVGAKWPDSEIITKEINLKIPGFGYPYK  582
             FWLLDIAN AIV+HLVGAYQV+CQPLFAF+EKW  A WPDS  I +E  +       P+ 
Sbjct  319   FWLLDIANVAIVVHLVGAYQVFCQPLFAFVEKWAAATWPDSAFIAREFRVG------PFA  372

Query  581   LNTFRLLWRTAFVLLTTVISMLLPFFNDVVGILGAFGFWPLTVYFPVRMYISQKKIPKWS  402
             L+ FRL WRTAFV LTTV +MLLPFF DVVG+LGA  FWPLTVYFP+ MY+ Q+ + +WS
Sbjct  373   LSLFRLTWRTAFVCLTTVAAMLLPFFGDVVGLLGAVSFWPLTVYFPIEMYVVQRAVRRWS  432

Query  401   TRWICLQMlsgaclavslaaaagsfagvVLDLKLYRPFK  285
             T WICLQMLS ACL VS+AAAAGS A V+  LK+YRPF 
Sbjct  433   THWICLQMLSAACLLVSVAAAAGSIADVIGALKVYRPFS  471



>gb|KEH35328.1| transmembrane amino acid transporter family protein [Medicago 
truncatula]
Length=479

 Score =   670 bits (1729),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 327/478 (68%), Positives = 397/478 (83%), Gaps = 5/478 (1%)
 Frame = -3

Query  1709  TKNHRHHLGVSIDAPPLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSGVLSLAWAIGQ  1530
             +KNH     VSID       K  DDDGR +RTGT WTASAH+ITAV+GSGVLSL+WAI Q
Sbjct  7     SKNHHQTFDVSIDQQR--DSKYFDDDGRIKRTGTAWTASAHVITAVVGSGVLSLSWAIAQ  64

Query  1529  LGWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRNYTYMDAVRSNLGGYQVKICGL  1350
             LGW+AGP VM+LF+ V YYTS LL +CYR  DP+ GKRNYTYMDAV SNLGG+QV +CG+
Sbjct  65    LGWIAGPIVMILFAWVTYYTSILLCECYRNDDPINGKRNYTYMDAVHSNLGGFQVTLCGI  124

Query  1349  IQYFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFGIIEIILSQI  1170
             +QY NL G AIGYTIA++ISMMAI+RSNCFH SGGK+PCHM+SN YMI+FG ++II SQI
Sbjct  125   VQYLNLAGAAIGYTIASAISMMAIERSNCFHRSGGKDPCHMNSNIYMISFGAVQIIFSQI  184

Query  1169  PDFDQIWWLSIVAAVMSFTYSGIGLGLGIAQVVANGAFKGSLTGISIGTVTETQKIWRSF  990
             PDFDQ+WWLS +AAVMSFTYS IGLGLGI +V+ N    G++ G++   VT+ QK+W S 
Sbjct  185   PDFDQLWWLSSLAAVMSFTYSTIGLGLGIGKVIGNKKIDGTMAGVT--DVTKAQKVWGSL  242

Query  989   QALGDIAFAYSYSIILIEIQDTVKSPPSESKTMRKASLFSTIVTTTFYMLCGCMGYAAFG  810
             QALGDIAFAY+YS+ILIEIQDTVK+PPSE+KTM+KA++ S   TT FYMLCGC GYAAFG
Sbjct  243   QALGDIAFAYAYSMILIEIQDTVKAPPSEAKTMKKATIISVAATTIFYMLCGCFGYAAFG  302

Query  809   DDAPGNLLTGFGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEKWVGAKWPDSEII  630
             + +PGNLLTGFGFYNPFWLLDIANAAIVIHL+G+YQVYCQPL+AF+E +   ++P S+ +
Sbjct  303   NSSPGNLLTGFGFYNPFWLLDIANAAIVIHLIGSYQVYCQPLYAFVESYTAKRFPQSDFV  362

Query  629   TKEINLKIPGFGYPYKLNTFRLLWRTAFVLLTTVISMLLPFFNDVVGILGAFGFWPLTVY  450
              K I + IPG    YKLN FRL+WRT FV+L+T+++MLLPFFND+VG+LGA GFWPLTVY
Sbjct  363   NKNIKIPIPGIQM-YKLNLFRLVWRTIFVILSTLVAMLLPFFNDIVGLLGAIGFWPLTVY  421

Query  449   FPVRMYISQKKIPKWSTRWICLQMlsgaclavslaaaagsfagvVLDLKLYRPFKTSY  276
             FPV MYI QK+IPKWS++WICLQ+LS  CL +S+AAA GS AG+VLDLK+++PFK+ Y
Sbjct  422   FPVEMYIVQKRIPKWSSKWICLQLLSVVCLIISIAAAVGSIAGIVLDLKVFKPFKSVY  479



>ref|XP_009764609.1| PREDICTED: amino acid permease 4-like isoform X1 [Nicotiana sylvestris]
Length=513

 Score =   671 bits (1732),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 340/464 (73%), Positives = 393/464 (85%), Gaps = 7/464 (2%)
 Frame = -3

Query  1649  KGLDDDGRPQRTGTVWTASAHIITAVIGSGVLSLAWAIGQLGWVAGPSVMLLFSCVVYYT  1470
             K  DDDG  +RTGT WT ++HIITAVIGSGVLSLAWAIGQLGWVAGP+VM+LF+ VV YT
Sbjct  51    KCFDDDGHLRRTGTFWTTTSHIITAVIGSGVLSLAWAIGQLGWVAGPTVMILFAFVVLYT  110

Query  1469  STLLADCYRAGDPVFGKRNYTYMDAVRSNLGGYQVKICGLIQYFNLFGIAIGYTIAASIS  1290
             S LL+ CYR GDPV G RNYTYM+AV+  LGG +VK+CGLIQY NLFG+AIGYTIAAS+S
Sbjct  111   SNLLSQCYRTGDPVNGPRNYTYMEAVKGILGGKKVKVCGLIQYLNLFGVAIGYTIAASVS  170

Query  1289  MMAIKRSNCFHESGGKNPCHMSSNPYMIAFGIIEIILSQIPDFDQIWWLSIVAAVMSFTY  1110
             M+AIKRSNCFH +  ++PCHMSSN YMIAFG+ EI+ SQIP FDQ+WWLSIVAA+MSFTY
Sbjct  171   MLAIKRSNCFHRNHRRDPCHMSSNGYMIAFGVTEILFSQIPGFDQVWWLSIVAAIMSFTY  230

Query  1109  SGIGLGLGIAQVVANGAFKGSLTGISIGTVTE------TQKIWRSFQALGDIAFAYSYSI  948
             S +GL LGIA+V  N +FKGSLTGISIGTVT       TQKIWRS QALG IAFAYS+SI
Sbjct  231   STVGLVLGIAKVAGNKSFKGSLTGISIGTVTHIGTVTSTQKIWRSLQALGAIAFAYSFSI  290

Query  947   ILIEIQDTVKSPPSESKTMRKASLFSTIVTTTFYMLCGCMGYAAFGDDAPGNLLTGFGFY  768
             ILIEIQDT+KSPP+E KTM+KAS+ S  VTT FY+LCGC+GYAAFG+DAPGNLLTGFGF+
Sbjct  291   ILIEIQDTIKSPPAEHKTMKKASMLSIGVTTIFYLLCGCIGYAAFGNDAPGNLLTGFGFF  350

Query  767   NPFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEKWVGAKWPDSEIITKEINLKIPGFGYP  588
             +P+WLLDIANAAIVIHLVGAYQVYCQPLFAF+EKW   KW  S  +T E ++ IP  G  
Sbjct  351   DPYWLLDIANAAIVIHLVGAYQVYCQPLFAFVEKWSAKKWSKSNFVTAEHDIPIPFVGV-  409

Query  587   YKLNTFRLLWRTAFVLLTTVISMLLPFFNDVVGILGAFGFWPLTVYFPVRMYISQKKIPK  408
             Y+LN FR++WRT FV+LTT+I+MLLPFFNDVVG+LGA GFWPLTVYFP+ MYI QKKI +
Sbjct  410   YQLNFFRVIWRTIFVILTTIIAMLLPFFNDVVGLLGALGFWPLTVYFPIEMYIKQKKIGR  469

Query  407   WSTRWICLQMlsgaclavslaaaagsfagvVLDLKLYRPFKTSY  276
             W+ +WI L+MLS ACL VS+AAA GS AGVVLDLK Y+PFKT Y
Sbjct  470   WTNQWIGLEMLSAACLFVSIAAAVGSIAGVVLDLKTYKPFKTIY  513



>ref|XP_009145052.1| PREDICTED: amino acid permease 5 [Brassica rapa]
 ref|XP_009145053.1| PREDICTED: amino acid permease 5 [Brassica rapa]
 ref|XP_009145054.1| PREDICTED: amino acid permease 5 [Brassica rapa]
 emb|CDY43854.1| BnaA05g18660D [Brassica napus]
Length=487

 Score =   670 bits (1728),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 329/477 (69%), Positives = 396/477 (83%), Gaps = 6/477 (1%)
 Frame = -3

Query  1688  LGVSIDAPPLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSGVLSLAWAIGQLGWVAGP  1509
             LGVS+D  P       D+DGRP+RTGTVWTASAHIITAVIGSGVLSLAWA+ Q+GWV GP
Sbjct  11    LGVSMDVLPRNSSDLFDEDGRPKRTGTVWTASAHIITAVIGSGVLSLAWAVAQIGWVGGP  70

Query  1508  SVMLLFSCVVYYTSTLLADCYRAGDPVFGKRNYTYMDAVRSNLGGYQVKICGLIQYFNLF  1329
             +VM+LFS V YYTS LL  CYR+GD V GKRNYTYMDA+ SNLGG +VKICG++QY NLF
Sbjct  71    AVMILFSLVTYYTSILLCTCYRSGDSVTGKRNYTYMDAIHSNLGGIKVKICGVVQYVNLF  130

Query  1328  GIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFGIIEIILSQIPDFDQIW  1149
             G AIGYTIA+++SM+AI+R++C   +G K+PCH++ NPYMIAFG+I+I+ SQIPDFDQ+W
Sbjct  131   GTAIGYTIASAVSMIAIQRTSCQQSNGDKDPCHVNGNPYMIAFGVIQIVFSQIPDFDQLW  190

Query  1148  WLSIVAAVMSFTYSGIGLGLGIAQVVANGAFKGSLTGISIGTVTE------TQKIWRSFQ  987
             WLSIVAAVMSF YS +GLGLGI++VV N   KG+LTG++IGTVT       TQK+WR+FQ
Sbjct  191   WLSIVAAVMSFGYSTVGLGLGISKVVENKEIKGTLTGVTIGTVTSSGTVTPTQKVWRTFQ  250

Query  986   ALGDIAFAYSYSIILIEIQDTVKSPPSESKTMRKASLFSTIVTTTFYMLCGCMGYAAFGD  807
             +LG+IAFAY+YS+ILIEIQDT+KSPP+E  TMRKA+L S +VTT FYMLCGC+GYAAFGD
Sbjct  251   SLGNIAFAYAYSMILIEIQDTLKSPPAEENTMRKATLISVVVTTLFYMLCGCVGYAAFGD  310

Query  806   DAPGNLLTGFGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEKWVGAKWPDSEIIT  627
              +PGNLL   GF NP+WLLDIAN AIVIHLVGAYQVYCQPLFAF+EK    ++P+S+ IT
Sbjct  311   SSPGNLLAAGGFRNPYWLLDIANLAIVIHLVGAYQVYCQPLFAFVEKEASKRYPESKFIT  370

Query  626   KEINLKIPGFGYPYKLNTFRLLWRTAFVLLTTVISMLLPFFNDVVGILGAFGFWPLTVYF  447
              E  + +     P+KLN FRL+WRT FV+ TT+ISML+PFFNDV+G+LGA GFWPLTVYF
Sbjct  371   NETKIHLFPGSKPFKLNLFRLVWRTIFVITTTLISMLMPFFNDVLGLLGAIGFWPLTVYF  430

Query  446   PVRMYISQKKIPKWSTRWICLQMlsgaclavslaaaagsfagvVLDLKLYRPFKTSY  276
             PV MYI QK + +WSTRW+CLQ+LS ACL VS+AAAAGS  G+V DLK YRPFKT +
Sbjct  431   PVEMYIVQKNVRRWSTRWVCLQVLSLACLVVSVAAAAGSVVGIVTDLKSYRPFKTDF  487



>ref|NP_001142349.1| hypothetical protein [Zea mays]
 ref|XP_008672537.1| PREDICTED: hypothetical protein isoform X1 [Zea mays]
 ref|XP_008672538.1| PREDICTED: hypothetical protein isoform X1 [Zea mays]
 ref|XP_008672539.1| PREDICTED: hypothetical protein isoform X1 [Zea mays]
 gb|ACF88256.1| unknown [Zea mays]
 tpg|DAA56510.1| TPA: hypothetical protein ZEAMMB73_220445 [Zea mays]
Length=494

 Score =   670 bits (1729),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 332/460 (72%), Positives = 383/460 (83%), Gaps = 4/460 (1%)
 Frame = -3

Query  1649  KGLDDDGRPQRTGTVWTASAHIITAVIGSGVLSLAWAIGQLGWVAGPSVMLLFSCVVYYT  1470
             K  DDDGRP+R GT+WTASAHIITAVIGSGVLSL WAI QLGWVAGP VMLLFS V YYT
Sbjct  34    KCFDDDGRPKRNGTMWTASAHIITAVIGSGVLSLGWAIAQLGWVAGPVVMLLFSLVTYYT  93

Query  1469  STLLADCYRAGDPVFGKRNYTYMDAVRSNLGGYQVKICGLIQYFNLFGIAIGYTIAASIS  1290
             S+LLADCYR+GDP  GKRNYTYMDAV +NL G +V+ICG +QY N+ G+AIGYTIAASIS
Sbjct  94    SSLLADCYRSGDPSTGKRNYTYMDAVNANLSGIKVQICGFLQYANIVGVAIGYTIAASIS  153

Query  1289  MMAIKRSNCFHESGGKNPCHMSSNPYMIAFGIIEIILSQIPDFDQIWWLSIVAAVMSFTY  1110
             M+AI+R+NCFH+ G  NPC +SS PYMI FG+ EI  SQIPDFDQI WLSI+AAVMSFTY
Sbjct  154   MLAIRRANCFHQKGHGNPCKISSTPYMIIFGVAEIFFSQIPDFDQISWLSILAAVMSFTY  213

Query  1109  SGIGLGLGIAQVVANGAFKGSLTGISIGTVTETQKIWRSFQALGDIAFAYSYSIILIEIQ  930
             S IGLGLG+ QV+AN   +GSLTGI+IG VT   K+WRS QA GD+AFAYSYS+ILIEIQ
Sbjct  214   SSIGLGLGVVQVIANRGVQGSLTGITIGVVTPMDKVWRSLQAFGDVAFAYSYSLILIEIQ  273

Query  929   DTVKS-PPSESKTMRKASLFSTIVTTTFYMLCGCMGYAAFGDDAPGNLLTGFGFYNPFWL  753
             DT+++ PPSES  M++A++ S  VTT FYMLCGCMGYAAFGD APGNLLTGFGFY PFWL
Sbjct  274   DTIRAPPPSESTVMKRATVVSVAVTTLFYMLCGCMGYAAFGDGAPGNLLTGFGFYEPFWL  333

Query  752   LDIANAAIVIHLVGAYQVYCQPLFAFIEKWVGAKWPDSEIITKEINLKIP---GFGYPYK  582
             LD+ANAAIV+HLVGAYQVYCQPLFAF+EKW   +WPDS  IT E+ + +P         K
Sbjct  334   LDVANAAIVVHLVGAYQVYCQPLFAFVEKWAAQRWPDSAYITGEVEVPLPLPASRRRCCK  393

Query  581   LNTFRLLWRTAFVLLTTVISMLLPFFNDVVGILGAFGFWPLTVYFPVRMYISQKKIPKWS  402
             +N FR  WRTAFV+ TTV+SMLLPFFNDVVG LGA GFWPLTVYFPV MY+ QKK+P+WS
Sbjct  394   VNLFRATWRTAFVVATTVVSMLLPFFNDVVGFLGALGFWPLTVYFPVEMYVVQKKVPRWS  453

Query  401   TRWICLQMlsgaclavslaaaagsfagvVLDLKLYRPFKT  282
             +RW+CLQMLS  CL +S+AAAAGS AG+  DLK+YRPFK+
Sbjct  454   SRWVCLQMLSLGCLVISIAAAAGSIAGIASDLKVYRPFKS  493



>ref|NP_001149036.1| amino acid carrier [Zea mays]
 gb|ACG33909.1| amino acid carrier [Zea mays]
Length=478

 Score =   669 bits (1726),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 334/461 (72%), Positives = 389/461 (84%), Gaps = 4/461 (1%)
 Frame = -3

Query  1649  KGLDDDGRPQRTGTVWTASAHIITAVIGSGVLSLAWAIGQLGWVAGPSVMLLFSCVVYYT  1470
             K  DDDGR +RTGT+WTASAHIITAVIGSGVLSLAWAI QLGWVAGP+VMLLFS V YYT
Sbjct  17    KCFDDDGRLKRTGTMWTASAHIITAVIGSGVLSLAWAIAQLGWVAGPTVMLLFSFVTYYT  76

Query  1469  STLLADCYRAGDPVFGKRNYTYMDAVRSNLGGYQVKICGLIQYFNLFGIAIGYTIAASIS  1290
             S LLADCYR+GD   GKRNYTYMDAV +NL G +V  CG +QY N+ G+AIGYTIAASIS
Sbjct  77    SALLADCYRSGDACTGKRNYTYMDAVNANLSGVKVWFCGFLQYANIVGVAIGYTIAASIS  136

Query  1289  MMAIKRSNCFHESGGKNPCHMSSNPYMIAFGIIEIILSQIPDFDQIWWLSIVAAVMSFTY  1110
             M+AI+R+NCFH  G  +PC++SS PYMI FG+++I  SQIPDFDQI WLSI+AAVMSFTY
Sbjct  137   MLAIQRANCFHVEGHGDPCNISSTPYMIIFGVVQIFFSQIPDFDQISWLSILAAVMSFTY  196

Query  1109  SGIGLGLGIAQVVANGAFKGSLTGISIGTVTETQKIWRSFQALGDIAFAYSYSIILIEIQ  930
             S IGLGLGIAQVV+N   +GSLTGIS+G VT   K+WRS QA GDIAFAYSYS+ILIEIQ
Sbjct  197   STIGLGLGIAQVVSNKGVQGSLTGISVGAVTPVDKMWRSLQAFGDIAFAYSYSLILIEIQ  256

Query  929   DTVKS-PPSESKTMRKASLFSTIVTTTFYMLCGCMGYAAFGDDAPGNLLTGFGFYNPFWL  753
             DT+++ PPSESK MR+A++ S  VTT  YMLCGCMGYAAFGD+APGNLLTGFGFY PFWL
Sbjct  257   DTIRAPPPSESKVMRRATVVSVAVTTFXYMLCGCMGYAAFGDNAPGNLLTGFGFYEPFWL  316

Query  752   LDIANAAIVIHLVGAYQVYCQPLFAFIEKWVGAKWPDSEIITKEINLKIP---GFGYPYK  582
             LD+ANAAI +HLVGAYQVYCQPLFAF+EKW   +WP S  IT E+++ +P     G  YK
Sbjct  317   LDVANAAIAVHLVGAYQVYCQPLFAFVEKWARQRWPKSRYITGEVDVPLPLGTAGGRCYK  376

Query  581   LNTFRLLWRTAFVLLTTVISMLLPFFNDVVGILGAFGFWPLTVYFPVRMYISQKKIPKWS  402
             L+ FRL WRTAFV+ TTV+SMLLPFFNDVVG+LGA GFWPLTVYFPV MYI QKK+P+WS
Sbjct  377   LSLFRLTWRTAFVVATTVVSMLLPFFNDVVGLLGALGFWPLTVYFPVEMYIVQKKVPRWS  436

Query  401   TRWICLQMlsgaclavslaaaagsfagvVLDLKLYRPFKTS  279
             TRW+CLQ+LS ACL +++A+AAGS AG+V DLK+Y+PF T+
Sbjct  437   TRWVCLQLLSVACLVITVASAAGSVAGIVSDLKVYKPFVTT  477



>ref|NP_001055592.1| Os05g0424000 [Oryza sativa Japonica Group]
 gb|AAV24773.1| putative amino acid transporter [Oryza sativa Japonica Group]
 dbj|BAF17506.1| Os05g0424000 [Oryza sativa Japonica Group]
 gb|EAY98107.1| hypothetical protein OsI_20024 [Oryza sativa Indica Group]
 gb|EEE63778.1| hypothetical protein OsJ_18601 [Oryza sativa Japonica Group]
Length=496

 Score =   669 bits (1727),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 340/467 (73%), Positives = 392/467 (84%), Gaps = 7/467 (1%)
 Frame = -3

Query  1655  GFKGLDDDGRPQRTGTVWTASAHIITAVIGSGVLSLAWAIGQLGWVAGPSVMLLFSCVVY  1476
             G K  DDDGR +RTGT+WTASAHIITAVIGSGVLSL WAI QLGWVAGP+VMLLFS V Y
Sbjct  30    GSKLYDDDGRLKRTGTMWTASAHIITAVIGSGVLSLGWAIAQLGWVAGPAVMLLFSFVTY  89

Query  1475  YTSTLLADCYRAGDPVFGKRNYTYMDAVRSNLGGYQVKICGLIQYFNLFGIAIGYTIAAS  1296
             YTS LLADCYR+GD   GKRNYTYMDAV +NL G +V++CG +QY N+ G+AIGYTIAAS
Sbjct  90    YTSALLADCYRSGDESTGKRNYTYMDAVNANLSGIKVQVCGFLQYANIVGVAIGYTIAAS  149

Query  1295  ISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFGIIEIILSQIPDFDQIWWLSIVAAVMSF  1116
             ISM+AIKR+NCFH  G  +PC++SS PYMI FG+ EI  SQIPDFDQI WLSI+AAVMSF
Sbjct  150   ISMLAIKRANCFHVEGHGDPCNISSTPYMIIFGVAEIFFSQIPDFDQISWLSILAAVMSF  209

Query  1115  TYSGIGLGLGIAQVVANGAFKGSLTGISIGTVTETQKIWRSFQALGDIAFAYSYSIILIE  936
             TYS IGLGLG+ QVVANG  KGSLTGISIG VT   K+WRS QA GDIAFAYSYS+ILIE
Sbjct  210   TYSTIGLGLGVVQVVANGGVKGSLTGISIGVVTPMDKVWRSLQAFGDIAFAYSYSLILIE  269

Query  935   IQDTVKS-PPSESKTMRKASLFSTIVTTTFYMLCGCMGYAAFGDDAPGNLLTGFGFYNPF  759
             IQDT+++ PPSES+ MR+A++ S  VTT FYMLCGC GYAAFGD APGNLLTGFGFY PF
Sbjct  270   IQDTIRAPPPSESRVMRRATVVSVAVTTLFYMLCGCTGYAAFGDAAPGNLLTGFGFYEPF  329

Query  758   WLLDIANAAIVIHLVGAYQVYCQPLFAFIEKWVGAKWPDSEIITKEINLKIP------GF  597
             WLLD+ANAAIV+HLVGAYQVYCQPLFAF+EKW   +WP S  ITK+I++ +       G 
Sbjct  330   WLLDVANAAIVVHLVGAYQVYCQPLFAFVEKWAQQRWPKSWYITKDIDVPLSLSGGGGGG  389

Query  596   GYPYKLNTFRLLWRTAFVLLTTVISMLLPFFNDVVGILGAFGFWPLTVYFPVRMYISQKK  417
             G  YKLN FRL WR+AFV+ TTV+SMLLPFFNDVVG LGA GFWPLTVYFPV MYI QK+
Sbjct  390   GRCYKLNLFRLTWRSAFVVATTVVSMLLPFFNDVVGFLGAVGFWPLTVYFPVEMYIVQKR  449

Query  416   IPKWSTRWICLQMlsgaclavslaaaagsfagvVLDLKLYRPFKTSY  276
             IP+WSTRW+CLQ+LS ACLA+++A+AAGS AG++ DLK+Y+PF T+Y
Sbjct  450   IPRWSTRWVCLQLLSLACLAITVASAAGSIAGILSDLKVYKPFATTY  496



>gb|AFK37021.1| unknown [Medicago truncatula]
Length=512

 Score =   670 bits (1729),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 346/493 (70%), Positives = 397/493 (81%), Gaps = 19/493 (4%)
 Frame = -3

Query  1703  NHRHHLGV-----------SIDAPPLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSGV  1557
             + RH+L V           S+   P Y  K  DDDGR +RTGT WTA+AHIITAVIGSGV
Sbjct  22    DFRHYLEVEAQPKIQTETESVSIEPNYS-KCFDDDGRLKRTGTFWTATAHIITAVIGSGV  80

Query  1556  LSLAWAIGQLGWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRNYTYMDAVRSNLG  1377
             LSLAWAI QLGW  GP VM+LF+ V  YTS+LL  CYR  D V G+RNYTY DAV+S LG
Sbjct  81    LSLAWAIAQLGWAVGPVVMILFAVVNLYTSSLLTQCYRTDDSVNGQRNYTYTDAVKSILG  140

Query  1376  GYQVKICGLIQYFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFG  1197
             G + K+CGLIQY NLFGIAIGYTIAAS+SMMAIKRSNC+HES GK+PCHMSSN YMI F 
Sbjct  141   GKKFKMCGLIQYVNLFGIAIGYTIAASVSMMAIKRSNCYHESHGKDPCHMSSNGYMITFA  200

Query  1196  IIEIILSQIPDFDQIWWLSIVAAVMSFTYSGIGLGLGIAQVVANGAFKGSLTGISI----  1029
             I E+ILSQIPDFDQ+WWLSIVAA+MSFTYS +GLGLGIA+V  NGAF+GSL GISI    
Sbjct  201   IAEVILSQIPDFDQVWWLSIVAAIMSFTYSAVGLGLGIAKVAENGAFQGSLMGISIGAVT  260

Query  1028  --GTVTETQKIWRSFQALGDIAFAYSYSIILIEIQDTVKSPPSESKTMRKASLFSTIVTT  855
               GTVT TQKIWRS QALG +AF+YS+SIILIEIQDT+KSPPSE KTM+KA+L S +VT 
Sbjct  261   QAGTVTGTQKIWRSLQALGAMAFSYSFSIILIEIQDTLKSPPSEHKTMKKATLVSIMVTA  320

Query  854   TFYMLCGCMGYAAFGDDAPGNLLTGFGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAF  675
              FY+LCG MGYAAFGD  PGNLLTGFGFYNP+WLLDIAN AIV+HL+GAYQV+ QP FAF
Sbjct  321   VFYLLCGGMGYAAFGDHVPGNLLTGFGFYNPYWLLDIANLAIVVHLIGAYQVFSQPFFAF  380

Query  674   IEKWVGAKWPDSEIITKEINLKIPGFGYPYKLNTFRLLWRTAFVLLTTVISMLLPFFNDV  495
             +EKW   KWP +  +T E  + IP  G  Y+LN FRL+WRT FVLLTT+I+MLLPFFNDV
Sbjct  381   VEKWSARKWPKNNFVTAEHEIPIPCIGV-YQLNFFRLIWRTLFVLLTTIIAMLLPFFNDV  439

Query  494   VGILGAFGFWPLTVYFPVRMYISQKKIPKWSTRWICLQMlsgaclavslaaaagsfagvV  315
             VGILGAFGFWPLTVY+P+ MYISQKKI +W+ +W+ LQ+LSG CL +S+ AA GS AGVV
Sbjct  440   VGILGAFGFWPLTVYYPIDMYISQKKIGRWTKKWLALQVLSGCCLIISILAAVGSIAGVV  499

Query  314   LDLKLYRPFKTSY  276
             LDLK Y+PFKTSY
Sbjct  500   LDLKTYKPFKTSY  512



>emb|CDM85442.1| unnamed protein product [Triticum aestivum]
Length=480

 Score =   668 bits (1724),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 335/455 (74%), Positives = 387/455 (85%), Gaps = 4/455 (1%)
 Frame = -3

Query  1643  LDDDGRPQRTGTVWTASAHIITAVIGSGVLSLAWAIGQLGWVAGPSVMLLFSCVVYYTST  1464
             LDDDGR +RTGT+WTAS+HIITAVIGSGVLSL WAI QLGWVAGP+VMLLFS V Y+TS+
Sbjct  29    LDDDGRNKRTGTMWTASSHIITAVIGSGVLSLGWAIAQLGWVAGPAVMLLFSLVTYFTSS  88

Query  1463  LLADCYRAGDPVFGKRNYTYMDAVRSNLGGYQVKICGLIQYFNLFGIAIGYTIAASISMM  1284
             LLADCYR+GD   GKRNYTYMDAV +NL G +V+ICG++QY N+ G++IGYTIAASISM+
Sbjct  89    LLADCYRSGDQSTGKRNYTYMDAVNANLSGIKVQICGVLQYANIVGVSIGYTIAASISML  148

Query  1283  AIKRSNCFHESGGKNPCHMSSNPYMIAFGIIEIILSQIPDFDQIWWLSIVAAVMSFTYSG  1104
             AIKR+NCFH +G  +PC +SS PYMI FG+ ++  SQIPDFDQI WLS++AA MSFTYS 
Sbjct  149   AIKRANCFHGNGHADPCKVSSVPYMIIFGVAQVFFSQIPDFDQISWLSMLAAAMSFTYSS  208

Query  1103  IGLGLGIAQVVANGAFKGSLTGISIGTVTETQKIWRSFQALGDIAFAYSYSIILIEIQDT  924
             IGLGLGI QV+ANG  KGSLTGISIGTVT  QK+WRS QA GDIAFAYSYS+ILIEIQDT
Sbjct  209   IGLGLGIVQVIANGGIKGSLTGISIGTVTPMQKVWRSTQAFGDIAFAYSYSLILIEIQDT  268

Query  923   VKS-PPSESKTMRKASLFSTIVTTTFYMLCGCMGYAAFGDDAPGNLLTGFGFYNPFWLLD  747
             +++ PPSES  M++A++ S  VTT FYMLCGCMGYAAFGD APGNLLTGFGFY PFWLLD
Sbjct  269   IRAPPPSESTVMKRATMVSVAVTTVFYMLCGCMGYAAFGDAAPGNLLTGFGFYEPFWLLD  328

Query  746   IANAAIVIHLVGAYQVYCQPLFAFIEKWVGAKWPDSEIITKEINLKIPGFGYPYKLNTFR  567
             IANAAIVIHLVGAYQVYCQPLFAF+EKW   +WP+S  +T E+  ++P F   YK+N FR
Sbjct  329   IANAAIVIHLVGAYQVYCQPLFAFVEKWAAKRWPESTYVTGEV--EVPLF-RTYKVNMFR  385

Query  566   LLWRTAFVLLTTVISMLLPFFNDVVGILGAFGFWPLTVYFPVRMYISQKKIPKWSTRWIC  387
               WRTAFV  TTV+SM+LPFFNDVVG LGA GFWPLTVYFPV MY+ QKK+PKWST+W+C
Sbjct  386   ATWRTAFVTATTVVSMMLPFFNDVVGFLGALGFWPLTVYFPVEMYVVQKKVPKWSTQWVC  445

Query  386   LQMlsgaclavslaaaagsfagvVLDLKLYRPFKT  282
             LQMLS  CLA+SLAAAAGS AG+  DLK+Y PFKT
Sbjct  446   LQMLSLGCLAISLAAAAGSIAGIKSDLKVYHPFKT  480



>ref|XP_009339433.1| PREDICTED: amino acid permease 3-like [Pyrus x bretschneideri]
Length=484

 Score =   668 bits (1724),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 341/491 (69%), Positives = 401/491 (82%), Gaps = 15/491 (3%)
 Frame = -3

Query  1730  MGESAAATKNHR--HH-----LGVSIDAPPLYGFKGLDDDGRPQRTGTVWTASAHIITAV  1572
             M E+ A T+N    HH     + +++D     G K +DDDGRP+RTGTVWTAS+HIITAV
Sbjct  1     MSENTA-TRNQLQLHHNPVFDVSLNVDG----GSKYIDDDGRPKRTGTVWTASSHIITAV  55

Query  1571  IGSGVLSLAWAIGQLGWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRNYTYMDAV  1392
             IGSGVLSLAWAI QLGW+AGP+ M +FS + YYTSTLL  CYR  DPV GKRNY+Y DAV
Sbjct  56    IGSGVLSLAWAIAQLGWIAGPAAMAIFSFITYYTSTLLTSCYR--DPVTGKRNYSYSDAV  113

Query  1391  RSNLGGYQVKICGLIQYFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPY  1212
             +S LG +QVK+CG +Q  NLFGI IGYT+AA+ISMMAIKRSN FH SGGK+PCH++ NPY
Sbjct  114   QSTLGEFQVKMCGFVQQLNLFGITIGYTVAAAISMMAIKRSNYFHNSGGKDPCHINYNPY  173

Query  1211  MIAFGIIEIILSQIPDFDQIWWLSIVAAVMSFTYSGIGLGLGIAQVVANGAFKGSLTGIS  1032
             MIAFG  EIILSQIP+FD++ WLS+VAAVMSFTYSGIGL LGIA+V  N    GS TGIS
Sbjct  174   MIAFGTSEIILSQIPNFDKLSWLSVVAAVMSFTYSGIGLALGIAKVAENEKINGSRTGIS  233

Query  1031  IGTVTETQKIWRSFQALGDIAFAYSYSIILIEIQDTVKSPPSESKTMRKASLFSTIVTTT  852
             +G VT  QK+WR+FQALG+IAFAYSYSIILIEIQDTVKSPPSE+KTM+KA+  S  VT+ 
Sbjct  234   LGIVTPAQKMWRTFQALGNIAFAYSYSIILIEIQDTVKSPPSETKTMKKATRLSLTVTSI  293

Query  851   FYMLCGCMGYAAFGDDAPGNLLTGFGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAFI  672
             FY+LCGCMGYAAFGD APGNLLTG GF NPFWL+DIANAAIVIHLVGAYQV+ QP+FA +
Sbjct  294   FYILCGCMGYAAFGDLAPGNLLTGKGFSNPFWLIDIANAAIVIHLVGAYQVFAQPIFALV  353

Query  671   EKWVGAKWPDSEIITKEINLKIPGFGYPYKLNTFRLLWRTAFVLLTTVISMLLPFFNDVV  492
             EK     +P+S+ +TK+I + IPGF Y Y LN FRL+WRT FV++TTVISM+LPFFN++V
Sbjct  354   EKTATKNFPNSQFVTKDIKILIPGFSY-YTLNLFRLVWRTIFVIITTVISMILPFFNNIV  412

Query  491   GILGAFGFWPLTVYFPVRMYISQKKIPKWSTRWICLQMlsgaclavslaaaagsfagvVL  312
             G LGA GFWPLTVYFPV MYI+QKKIP WSTRW+CLQ LS   L ++L+AAAGS  GV+ 
Sbjct  413   GFLGALGFWPLTVYFPVEMYIAQKKIPMWSTRWMCLQTLSLCVLIIALSAAAGSVTGVID  472

Query  311   DLKLYRPFKTS  279
              LK+YRPFKTS
Sbjct  473   SLKVYRPFKTS  483



>ref|XP_002449174.1| hypothetical protein SORBIDRAFT_05g006010 [Sorghum bicolor]
 gb|EES08162.1| hypothetical protein SORBIDRAFT_05g006010 [Sorghum bicolor]
Length=481

 Score =   667 bits (1722),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 336/454 (74%), Positives = 384/454 (85%), Gaps = 7/454 (2%)
 Frame = -3

Query  1640  DDDGRPQRTGTVWTASAHIITAVIGSGVLSLAWAIGQLGWVAGPSVMLLFSCVVYYTSTL  1461
             DDDGRP+RTGTVWTASAHIITAVIGSGVLSLAWAI QLGW AGP+VM+LF+ V+YYTSTL
Sbjct  32    DDDGRPRRTGTVWTASAHIITAVIGSGVLSLAWAIAQLGWAAGPAVMILFAVVIYYTSTL  91

Query  1460  LADCYRAGDPVFGKRNYTYMDAVRSNLGGYQVKICGLIQYFNLFGIAIGYTIAASISMMA  1281
             LA+CYR+GDPV GKRNYTYMDAVRS+LGG +V +CG IQY NLFG+AIGYTIAASISM+A
Sbjct  92    LAECYRSGDPVAGKRNYTYMDAVRSSLGGAKVTLCGSIQYANLFGVAIGYTIAASISMLA  151

Query  1280  IKRSNCFHESGGKNPCHMSSNPYMIAFGIIEIILSQIPDFDQIWWLSIVAAVMSFTYSGI  1101
             IKR++CFH  G +NPC  SSNPYMI FG+ E++ SQIPDFDQIWWLSIVAAVMSFTYS I
Sbjct  152   IKRADCFHVKGHRNPCRSSSNPYMILFGVAEVVFSQIPDFDQIWWLSIVAAVMSFTYSTI  211

Query  1100  GLGLGIAQVVANGAFKGSLTGISIGT-VTETQKIWRSFQALGDIAFAYSYSIILIEIQDT  924
             GL LG+ Q VANG F+GSLTGISIG  +T TQK+WRS QA G+IAFAYSYSIILIEIQDT
Sbjct  212   GLVLGVMQTVANGGFQGSLTGISIGAGITPTQKVWRSLQAFGNIAFAYSYSIILIEIQDT  271

Query  923   VKS-PPSESKTMRKASLFSTIVTTTFYMLCGCMGYAAFGDDAPGNLLTGFGFYNPFWLLD  747
             VK+ PPSE+K M++A++ S   TT FYMLCGCMGYAAFGD AP NLLTGFGFY PFWLLD
Sbjct  272   VKAPPPSEAKVMKRATMVSVATTTVFYMLCGCMGYAAFGDGAPDNLLTGFGFYEPFWLLD  331

Query  746   IANAAIVIHLVGAYQVYCQPLFAFIEKWVGAKWPDSEIITKEINLKIPGFGYPYKLNTFR  567
             IAN AIV+HLVGAYQV+CQPLFAF+EKW  A WPDS  I +E+     G   P+KL+ FR
Sbjct  332   IANVAIVVHLVGAYQVFCQPLFAFVEKWAAATWPDSAFIAREL-----GAVGPFKLSAFR  386

Query  566   LLWRTAFVLLTTVISMLLPFFNDVVGILGAFGFWPLTVYFPVRMYISQKKIPKWSTRWIC  387
             L WRTAFV LTTV++M+LPFF DVVG+LGA  FWPLTVYFP+ MY+ Q+ + + ST WIC
Sbjct  387   LAWRTAFVCLTTVVAMMLPFFGDVVGLLGAVSFWPLTVYFPIEMYVVQRGVRRGSTHWIC  446

Query  386   LQMlsgaclavslaaaagsfagvVLDLKLYRPFK  285
             LQMLS ACL VS+AAAAGS A V+  LK+YRPF 
Sbjct  447   LQMLSVACLVVSVAAAAGSIADVIGALKVYRPFS  480



>ref|XP_002534252.1| amino acid transporter, putative [Ricinus communis]
 gb|EEF28130.1| amino acid transporter, putative [Ricinus communis]
Length=484

 Score =   667 bits (1722),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 334/464 (72%), Positives = 392/464 (84%), Gaps = 7/464 (2%)
 Frame = -3

Query  1649  KGLDDDGRPQRTGTVWTASAHIITAVIGSGVLSLAWAIGQLGWVAGPSVMLLFSCVVYYT  1470
             K  DDDG  +RTGT WTA++HIITAVIG GVLSLAWAI QLGW+AGP+VM+LF+ V  YT
Sbjct  22    KCYDDDGHSKRTGTFWTAASHIITAVIGPGVLSLAWAIAQLGWIAGPAVMVLFAIVNLYT  81

Query  1469  STLLADCYRAGDPVFGKRNYTYMDAVRSNLGGYQVKICGLIQYFNLFGIAIGYTIAASIS  1290
             S LLA CYRAGDPV G+ NYTYM+AV++NLGG +V  CGLIQY NLFG+ IGYTIAAS+S
Sbjct  82    SNLLAQCYRAGDPVTGQINYTYMEAVKANLGGRKVFFCGLIQYLNLFGVVIGYTIAASVS  141

Query  1289  MMAIKRSNCFHESGGKNPCHMSSNPYMIAFGIIEIILSQIPDFDQIWWLSIVAAVMSFTY  1110
             MMAIKRSNCFH SGGK+PCHMSSN YMI FGI E+I SQIPDFDQIWWLSIVAA+MSFTY
Sbjct  142   MMAIKRSNCFHASGGKDPCHMSSNGYMITFGIAEVIFSQIPDFDQIWWLSIVAAIMSFTY  201

Query  1109  SGIGLGLGIAQVVANGAFKGSLTGISIGTVTE------TQKIWRSFQALGDIAFAYSYSI  948
             S +GLGLG+ +V  N A KGSLTGISIGTVT       TQK+WRS QALG IAFAYS+S 
Sbjct  202   STVGLGLGVGKVAGNAAAKGSLTGISIGTVTHAGLLTSTQKLWRSLQALGAIAFAYSFSA  261

Query  947   ILIEIQDTVKSPPSESKTMRKASLFSTIVTTTFYMLCGCMGYAAFGDDAPGNLLTGFGFY  768
             ILIEIQ+TVKSPP+E KTM+KA+ FS  VTT FY+LCGC GYAAFGD+APGN+LTGFGFY
Sbjct  262   ILIEIQETVKSPPAEYKTMKKATAFSIAVTTFFYLLCGCFGYAAFGDNAPGNILTGFGFY  321

Query  767   NPFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEKWVGAKWPDSEIITKEINLKIPGFGYP  588
             NP+WLLDIAN AI++HLVGAYQV+CQPLFAFIEKW   KWP+S+ +T E  ++I  F   
Sbjct  322   NPYWLLDIANVAIIVHLVGAYQVFCQPLFAFIEKWSARKWPNSDFVTAEYEIRIL-FSGV  380

Query  587   YKLNTFRLLWRTAFVLLTTVISMLLPFFNDVVGILGAFGFWPLTVYFPVRMYISQKKIPK  408
             Y+LN FR++WRT FV++TT+I+ML+PFFNDVVGILGA GFWPLTVYFP+ MYISQK+I +
Sbjct  381   YQLNFFRIVWRTIFVIVTTLIAMLMPFFNDVVGILGAMGFWPLTVYFPIEMYISQKRIGR  440

Query  407   WSTRWICLQMlsgaclavslaaaagsfagvVLDLKLYRPFKTSY  276
              +++W+ LQ+LS  CL +++AAA GS AGVVLDLK Y+PFKTSY
Sbjct  441   RTSQWLALQILSVCCLFITIAAAVGSVAGVVLDLKTYKPFKTSY  484



>emb|CDM85443.1| unnamed protein product [Triticum aestivum]
Length=480

 Score =   667 bits (1722),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 334/455 (73%), Positives = 388/455 (85%), Gaps = 4/455 (1%)
 Frame = -3

Query  1643  LDDDGRPQRTGTVWTASAHIITAVIGSGVLSLAWAIGQLGWVAGPSVMLLFSCVVYYTST  1464
             LDDDGR +RTGT+WTAS+HIITAVIGSGVLSL WAI QLGWVAGP+VMLLFS V Y+TS+
Sbjct  29    LDDDGRNKRTGTMWTASSHIITAVIGSGVLSLGWAIAQLGWVAGPAVMLLFSLVTYFTSS  88

Query  1463  LLADCYRAGDPVFGKRNYTYMDAVRSNLGGYQVKICGLIQYFNLFGIAIGYTIAASISMM  1284
             LLADCYR+GD   GKRNYTYMDAV +NL G +V+ICG++QY N+ G++IGYTIAASISM+
Sbjct  89    LLADCYRSGDQSTGKRNYTYMDAVNANLSGIKVQICGVLQYANIVGVSIGYTIAASISML  148

Query  1283  AIKRSNCFHESGGKNPCHMSSNPYMIAFGIIEIILSQIPDFDQIWWLSIVAAVMSFTYSG  1104
             AIKR+NCFH +G  +PC +SS PYMI FG+ ++  SQIPDFDQI WLS++AA MSFTYS 
Sbjct  149   AIKRANCFHGNGHADPCKVSSVPYMIIFGVAQVFFSQIPDFDQISWLSMLAAAMSFTYSS  208

Query  1103  IGLGLGIAQVVANGAFKGSLTGISIGTVTETQKIWRSFQALGDIAFAYSYSIILIEIQDT  924
             IGLGLGI QV+ANG  KGSLTGISIGTVT  QK+WRS QA GDIAFAYSYS+ILIEIQDT
Sbjct  209   IGLGLGIVQVIANGGIKGSLTGISIGTVTPMQKVWRSTQAFGDIAFAYSYSLILIEIQDT  268

Query  923   VKS-PPSESKTMRKASLFSTIVTTTFYMLCGCMGYAAFGDDAPGNLLTGFGFYNPFWLLD  747
             +++ PPSES  M++A++ S  VTT FYMLCGCMGYAAFGD APGNLLTGFGFY PFWLLD
Sbjct  269   IRAPPPSESTVMKRATMVSVAVTTVFYMLCGCMGYAAFGDAAPGNLLTGFGFYEPFWLLD  328

Query  746   IANAAIVIHLVGAYQVYCQPLFAFIEKWVGAKWPDSEIITKEINLKIPGFGYPYKLNTFR  567
             IANAAIVIHLVGAYQVYCQPLFAF+EKW   +WP+S  +T E+  ++P F   YK+N FR
Sbjct  329   IANAAIVIHLVGAYQVYCQPLFAFVEKWAAKRWPESTYVTGEV--EVPLF-RTYKVNMFR  385

Query  566   LLWRTAFVLLTTVISMLLPFFNDVVGILGAFGFWPLTVYFPVRMYISQKKIPKWSTRWIC  387
               WRTAFV+ TTV+SM+LPFFNDVVG LGA GFWPLTVYFPV MY+ QKK+PKWST+W+C
Sbjct  386   AAWRTAFVVATTVVSMMLPFFNDVVGFLGALGFWPLTVYFPVEMYVVQKKVPKWSTQWVC  445

Query  386   LQMlsgaclavslaaaagsfagvVLDLKLYRPFKT  282
             LQMLS  CLA+SLAAAAGS AG+  DLK+Y PFK+
Sbjct  446   LQMLSLGCLAISLAAAAGSIAGIKSDLKVYHPFKS  480



>ref|XP_004978920.1| PREDICTED: amino acid permease 3-like [Setaria italica]
Length=473

 Score =   667 bits (1721),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 340/471 (72%), Positives = 390/471 (83%), Gaps = 9/471 (2%)
 Frame = -3

Query  1688  LGVSIDAPPLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSGVLSLAWAIGQLGWVAGP  1509
             L VS++A        LDDDGRP+RTGTVWTASAHIITAVIGSGVLSLAWAI QLGW AGP
Sbjct  8     LEVSVEAGNGRDGAWLDDDGRPRRTGTVWTASAHIITAVIGSGVLSLAWAIAQLGWAAGP  67

Query  1508  SVMLLFSCVVYYTSTLLADCYRAG-DPVFGKRNYTYMDAVRSNLGGYQVKICGLIQYFNL  1332
             +VMLLF+ V+YYTSTLLA+CYR+G DPV GKRNYTYMDAVR++LGG +V++CG IQY NL
Sbjct  68    AVMLLFAFVIYYTSTLLAECYRSGGDPVAGKRNYTYMDAVRASLGGAKVRLCGAIQYANL  127

Query  1331  FGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFGIIEIILSQIPDFDQI  1152
             FG+AIGYTIAASISM+AIKR++CFH  G +NPC  SSNPYMI FG+ E++ SQIPDFDQI
Sbjct  128   FGVAIGYTIAASISMLAIKRADCFHAKGHRNPCRSSSNPYMILFGVAEVVFSQIPDFDQI  187

Query  1151  WWLSIVAAVMSFTYSGIGLGLGIAQVVANGAFKGSLTGISIGT-VTETQKIWRSFQALGD  975
             WWLSIVAAVMSFTYS IGL LG+ Q VANG F+GSLTG+++G  VT  QKI+RS QA G+
Sbjct  188   WWLSIVAAVMSFTYSAIGLALGVMQTVANGGFRGSLTGVAVGAGVTSAQKIFRSLQAFGN  247

Query  974   IAFAYSYSIILIEIQDTVKS-PPSESKTMRKASLFSTIVTTTFYMLCGCMGYAAFGDDAP  798
             IAFAYSY+IILIEIQDT+K+ PPSE+K M+KA++ S   TT FYMLCGCMGYAAFGDDAP
Sbjct  248   IAFAYSYAIILIEIQDTIKAPPPSEAKVMKKATMISVATTTVFYMLCGCMGYAAFGDDAP  307

Query  797   GNLLTGFGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEKWVGAKWPDSEIITKEI  618
              NLLTGFGFY PFWLLDIANAAIV+HLVGAYQV+CQPLFAF+EKW  A WPDS  I++E+
Sbjct  308   DNLLTGFGFYEPFWLLDIANAAIVVHLVGAYQVFCQPLFAFVEKWAAATWPDSAFISREV  367

Query  617   NLKIPGFGYPYKLNTFRLLWRTAFVLLTTVISMLLPFFNDVVGILGAFGFWPLTVYFPVR  438
              L       P+ L+ FRL WRTAFV LTTV +MLLPFF DVVG+LGA  FWPLTVYFPV 
Sbjct  368   RLG------PFVLSVFRLTWRTAFVALTTVTAMLLPFFGDVVGLLGAVSFWPLTVYFPVE  421

Query  437   MYISQKKIPKWSTRWICLQMlsgaclavslaaaagsfagvVLDLKLYRPFK  285
             MYI Q  + + STRW CLQ LS ACL VS+AAAAGS A V+  LK+YRPF 
Sbjct  422   MYIVQHGVRRGSTRWACLQTLSAACLFVSVAAAAGSIADVIDALKVYRPFS  472



>ref|XP_009107481.1| PREDICTED: amino acid permease 5-like [Brassica rapa]
Length=481

 Score =   667 bits (1722),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 327/478 (68%), Positives = 394/478 (82%), Gaps = 0/478 (0%)
 Frame = -3

Query  1709  TKNHRHHLGVSIDAPPLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSGVLSLAWAIGQ  1530
                 R  LG+SID  P       D+DGR +RTGTVWTASAHIITAVIGSGVLSLAWA+ Q
Sbjct  4     NSKSRQELGISIDVLPRNSSDLFDEDGRVKRTGTVWTASAHIITAVIGSGVLSLAWAVAQ  63

Query  1529  LGWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRNYTYMDAVRSNLGGYQVKICGL  1350
             +GWV GP VM+LFS V YYTS LL  CYR+GD   GKRNYTYMDA+ SNLGG +VK+CG+
Sbjct  64    IGWVGGPVVMILFSLVTYYTSILLCACYRSGDSDTGKRNYTYMDAIHSNLGGIKVKLCGV  123

Query  1349  IQYFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFGIIEIILSQI  1170
             +QY NLFG AIGYTIA++ISM+AI+R++C   +G K+PCH++ NPYMIAFG I+II SQI
Sbjct  124   VQYVNLFGTAIGYTIASAISMIAIQRTSCQQSNGDKDPCHVNGNPYMIAFGAIQIIFSQI  183

Query  1169  PDFDQIWWLSIVAAVMSFTYSGIGLGLGIAQVVANGAFKGSLTGISIGTVTETQKIWRSF  990
             PDFDQ+WWLSIVAA+MSF YS IGLGLGI+++V N   KG+LTG++IGTVT T+K+WR+F
Sbjct  184   PDFDQLWWLSIVAALMSFGYSTIGLGLGISRMVDNKEIKGTLTGVAIGTVTPTEKVWRTF  243

Query  989   QALGDIAFAYSYSIILIEIQDTVKSPPSESKTMRKASLFSTIVTTTFYMLCGCMGYAAFG  810
             Q+LG+IAFAYSYS+ILIEIQDT+K+PP+E KTMRKA+L S  VTT FYMLCGC+GYAAFG
Sbjct  244   QSLGNIAFAYSYSMILIEIQDTLKAPPAEEKTMRKATLISVAVTTLFYMLCGCVGYAAFG  303

Query  809   DDAPGNLLTGFGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEKWVGAKWPDSEII  630
             D APGNLL   GF NP+WLLDIAN AIVIHLVGAYQVYCQP+FAF+EK    ++P+S+ I
Sbjct  304   DSAPGNLLAAGGFRNPYWLLDIANLAIVIHLVGAYQVYCQPVFAFVEKEASKRYPESKFI  363

Query  629   TKEINLKIPGFGYPYKLNTFRLLWRTAFVLLTTVISMLLPFFNDVVGILGAFGFWPLTVY  450
             TKE  + I     P+ LN F+L+WRT FV+ TT+ISM++PFFNDV+G+LGA GFWPLTVY
Sbjct  364   TKETKIHIFPRSKPFNLNLFKLVWRTVFVITTTLISMIVPFFNDVLGLLGAIGFWPLTVY  423

Query  449   FPVRMYISQKKIPKWSTRWICLQMlsgaclavslaaaagsfagvVLDLKLYRPFKTSY  276
             FPV MYI QK +P+WSTRW+CLQ+LS ACL VS+AAAAGS  G+V DLK Y+PFKT +
Sbjct  424   FPVEMYIVQKNVPRWSTRWVCLQVLSLACLVVSVAAAAGSVVGIVTDLKSYKPFKTDF  481



>ref|NP_001067425.1| Os11g0195600 [Oryza sativa Japonica Group]
 gb|AAX96051.1| Transmembrane amino acid transporter protein [Oryza sativa Japonica 
Group]
 gb|ABA91874.1| amino acid carrier, putative, expressed [Oryza sativa Japonica 
Group]
 dbj|BAF27788.1| Os11g0195600 [Oryza sativa Japonica Group]
 dbj|BAG90706.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG96629.1| unnamed protein product [Oryza sativa Japonica Group]
Length=476

 Score =   666 bits (1719),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 332/454 (73%), Positives = 386/454 (85%), Gaps = 8/454 (2%)
 Frame = -3

Query  1640  DDDGRPQRTGTVWTASAHIITAVIGSGVLSLAWAIGQLGWVAGPSVMLLFSCVVYYTSTL  1461
             DDDGR +R GTVWTASAHIITAVIGSGVLSLAWAI QLGWVAGP+VMLLF+ V+YYTSTL
Sbjct  28    DDDGRARRMGTVWTASAHIITAVIGSGVLSLAWAIAQLGWVAGPAVMLLFAFVIYYTSTL  87

Query  1460  LADCYRAGDPVFGKRNYTYMDAVRSNLGGYQVKICGLIQYFNLFGIAIGYTIAASISMMA  1281
             LA+CYR+GDP  GKRNYTYMDAVR+NLGG +V++CG+IQY NLFG+AIGYTIAASISM+A
Sbjct  88    LAECYRSGDPCTGKRNYTYMDAVRANLGGSKVRLCGVIQYANLFGVAIGYTIAASISMLA  147

Query  1280  IKRSNCFHESGGKNPCHMSSNPYMIAFGIIEIILSQIPDFDQIWWLSIVAAVMSFTYSGI  1101
             IKR++CFHE G KNPC  SSNPYMI FG+++I+ SQIPDFDQIWWLSIVAA+MSFTYS I
Sbjct  148   IKRADCFHEKGHKNPCRSSSNPYMILFGVVQIVFSQIPDFDQIWWLSIVAAIMSFTYSTI  207

Query  1100  GLGLGIAQVVANGAFKGSLTGISIGT-VTETQKIWRSFQALGDIAFAYSYSIILIEIQDT  924
             GL LGIAQ VANG F GSLTGIS+GT VT  QK+WRS QA GDIAFAYSYSIILIEIQDT
Sbjct  208   GLSLGIAQTVANGGFMGSLTGISVGTGVTSMQKVWRSLQAFGDIAFAYSYSIILIEIQDT  267

Query  923   VKS-PPSESKTMRKASLFSTIVTTTFYMLCGCMGYAAFGDDAPGNLLTGFGFYNPFWLLD  747
             +K+ PPSE+K M++A++ S   TT FYMLCGCMGYAAFGD +P NLLTGFGFY PFWLLD
Sbjct  268   IKAPPPSEAKVMKRATMVSVATTTVFYMLCGCMGYAAFGDKSPDNLLTGFGFYEPFWLLD  327

Query  746   IANAAIVIHLVGAYQVYCQPLFAFIEKWVGAKWPDSEIITKEINLKIPGFGYPYKLNTFR  567
             +ANAAIV+HLVGAYQV+ QP+FAF+E+W  A+WPD   I++E+ +       P+ L+ FR
Sbjct  328   VANAAIVVHLVGAYQVFVQPIFAFVERWAAARWPDGGFISRELRVG------PFSLSVFR  381

Query  566   LLWRTAFVLLTTVISMLLPFFNDVVGILGAFGFWPLTVYFPVRMYISQKKIPKWSTRWIC  387
             L WRTAFV  TTV+SMLLPFF DVVG+LGA  FWPLTVYFPV MYI+Q+ + + S RW+C
Sbjct  382   LTWRTAFVCATTVVSMLLPFFGDVVGLLGAVSFWPLTVYFPVEMYIAQRGVRRGSARWLC  441

Query  386   LQMlsgaclavslaaaagsfagvVLDLKLYRPFK  285
             L++LS ACL VS+AAAAGS A VV  LK+YRPF 
Sbjct  442   LKVLSAACLVVSVAAAAGSIADVVDALKVYRPFS  475



>gb|KDO57534.1| hypothetical protein CISIN_1g015342mg [Citrus sinensis]
Length=408

 Score =   663 bits (1711),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 333/409 (81%), Positives = 360/409 (88%), Gaps = 1/409 (0%)
 Frame = -3

Query  1502  MLLFSCVVYYTSTLLADCYRAGDPVFGKRNYTYMDAVRSNLGGYQVKICGLIQYFNLFGI  1323
             M LFS V YYTS+LL DCYR  DPVFGKRNYTYMDAVRS LGG +VK CGLIQY NLFGI
Sbjct  1     MFLFSFVTYYTSSLLTDCYRTADPVFGKRNYTYMDAVRSILGGAKVKACGLIQYLNLFGI  60

Query  1322  AIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFGIIEIILSQIPDFDQIWWL  1143
             AIGYTIAASISMMAIKRSNCFHESGG NPCHMSSNPYMI FG++EI LSQIPDFDQIWWL
Sbjct  61    AIGYTIAASISMMAIKRSNCFHESGGNNPCHMSSNPYMILFGVMEIFLSQIPDFDQIWWL  120

Query  1142  SIVAAVMSFTYSGIGLGLGIAQVVANGAFKGSLTGISIGTVTETQKIWRSFQALGDIAFA  963
             SIVAAVMSFTYS IGL LGI QV ANGAFKGSLTGISIGTVT+TQKIWRSFQALGDIAFA
Sbjct  121   SIVAAVMSFTYSAIGLALGIVQVAANGAFKGSLTGISIGTVTQTQKIWRSFQALGDIAFA  180

Query  962   YSYSIILIEIQDTVKSPPSESKTMRKASLFSTIVTTTFYMLCGCMGYAAFGDDAPGNLLT  783
             YSYS+ILIEIQDT+KSPP+ESKTM+KA+  S  VTT FYMLCGCMGYAAFGD APGNLLT
Sbjct  181   YSYSVILIEIQDTLKSPPAESKTMKKAAKLSIAVTTAFYMLCGCMGYAAFGDFAPGNLLT  240

Query  782   GFGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEKWVGAKWPDSEIITKEINLKIP  603
             GFGFYNPFWLLDIANAAIV+HLVGAYQV+CQP+FAF+EK V   WPDS  ++KE  + +P
Sbjct  241   GFGFYNPFWLLDIANAAIVVHLVGAYQVFCQPIFAFVEKQVAESWPDSYFLSKEFKIPVP  300

Query  602   GFGYPYKLNTFRLLWRTAFVLLTTVISMLLPFFNDVVGILGAFGFWPLTVYFPVRMYISQ  423
             G   PYKLN FRL+WR+ FV+LTTVISMLLPFFNDVVGILGA GFWPLTVYFPV MYI+Q
Sbjct  301   GL-LPYKLNLFRLVWRSCFVILTTVISMLLPFFNDVVGILGALGFWPLTVYFPVEMYIAQ  359

Query  422   KKIPKWSTRWICLQMlsgaclavslaaaagsfagvVLDLKLYRPFKTSY  276
             KKI KWSTRW+CLQMLS ACL +S+ A AGS  GVV D+K Y PFKT+Y
Sbjct  360   KKITKWSTRWMCLQMLSMACLVLSIIAGAGSIVGVVNDVKAYTPFKTTY  408



>ref|XP_010090330.1| hypothetical protein L484_024995 [Morus notabilis]
 gb|EXB39300.1| hypothetical protein L484_024995 [Morus notabilis]
Length=511

 Score =   667 bits (1721),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 345/489 (71%), Positives = 400/489 (82%), Gaps = 16/489 (3%)
 Frame = -3

Query  1697  RHHLGVSIDA---------PPLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSGVLSLA  1545
             RH+L V +           P     K  DDDGR +RTGT WTA++HIITAVIGSGVLSLA
Sbjct  24    RHYLQVEVQPKASEAEAINPQSNYSKCFDDDGRLKRTGTFWTATSHIITAVIGSGVLSLA  83

Query  1544  WAIGQLGWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRNYTYMDAVRSNLGGYQV  1365
             WA+ QLGWV GP VMLLF+ V  YTS LLA CYR GD V G+RNYTYM+AV++NLGG + 
Sbjct  84    WAVAQLGWVTGPIVMLLFAFVNLYTSNLLAQCYRTGDRVTGQRNYTYMEAVKANLGGKRT  143

Query  1364  KICGLIQYFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFGIIEI  1185
              +CGLIQY NLFG+AIGYTIAAS+SMMAIKRSNCFH+SGGK+PCHMSSN YMI FGI EI
Sbjct  144   MLCGLIQYLNLFGVAIGYTIAASVSMMAIKRSNCFHKSGGKDPCHMSSNGYMITFGISEI  203

Query  1184  ILSQIPDFDQIWWLSIVAAVMSFTYSGIGLGLGIAQVVANGAFKGSLTGISIGTVTE---  1014
             I SQI DF Q+WWLSIVAA+MSFTYS +GLGLGI +V  NG  KGSL GISIGTVT    
Sbjct  204   IFSQIQDFSQVWWLSIVAAIMSFTYSTVGLGLGIGKVAVNGKVKGSLLGISIGTVTRAGT  263

Query  1013  ---TQKIWRSFQALGDIAFAYSYSIILIEIQDTVKSPPSESKTMRKASLFSTIVTTTFYM  843
                TQK+WRS QALG IAFAYS+S++LIEIQDT++SPP+E KTM+KA++ S  VTT FYM
Sbjct  264   VTATQKMWRSLQALGAIAFAYSFSLVLIEIQDTIRSPPAEHKTMKKATVLSVTVTTVFYM  323

Query  842   LCGCMGYAAFGDDAPGNLLTGFGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEKW  663
             LCG  GYAAFGD++PGNLLTGFGFYNP+WLLDIAN AIV+HLVGAYQV+CQPLFAF+EKW
Sbjct  324   LCGSFGYAAFGDESPGNLLTGFGFYNPYWLLDIANVAIVVHLVGAYQVFCQPLFAFVEKW  383

Query  662   VGAKWPDSEIITKEINLKIPGFGYPYKLNTFRLLWRTAFVLLTTVISMLLPFFNDVVGIL  483
                KWP S+ +T E ++ IP +G  Y++N FRL+WRT FV+LTTVI+ML+PFFNDVVGIL
Sbjct  384   SAQKWPKSDFVTAEYDIPIPFYGV-YQVNFFRLVWRTIFVMLTTVIAMLMPFFNDVVGIL  442

Query  482   GAFGFWPLTVYFPVRMYISQKKIPKWSTRWICLQMlsgaclavslaaaagsfagvVLDLK  303
             GAFGFWPLTVYFPV MYI+QKKI +W+ RW+ LQ+LS  CL VS+AAA GSFAGVVLDLK
Sbjct  443   GAFGFWPLTVYFPVEMYIAQKKIGRWTGRWLGLQILSVTCLFVSIAAAVGSFAGVVLDLK  502

Query  302   LYRPFKTSY  276
              Y+PFKTSY
Sbjct  503   TYKPFKTSY  511



>ref|XP_006654425.1| PREDICTED: amino acid permease 3-like [Oryza brachyantha]
Length=495

 Score =   666 bits (1718),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 336/467 (72%), Positives = 388/467 (83%), Gaps = 7/467 (1%)
 Frame = -3

Query  1655  GFKGLDDDGRPQRTGTVWTASAHIITAVIGSGVLSLAWAIGQLGWVAGPSVMLLFSCVVY  1476
             G K   D GR +RTGT+WTASAHIITAVIGSGVLSL WAI QLGWVAGP+VMLLFS V Y
Sbjct  29    GSKLYADAGRLKRTGTMWTASAHIITAVIGSGVLSLGWAIAQLGWVAGPAVMLLFSFVTY  88

Query  1475  YTSTLLADCYRAGDPVFGKRNYTYMDAVRSNLGGYQVKICGLIQYFNLFGIAIGYTIAAS  1296
             YTS LLADCYR+GD   GKRNYTYMDAV +NL G +V++CG +QY  + G+AIGYTIAAS
Sbjct  89    YTSALLADCYRSGDESSGKRNYTYMDAVNANLSGIKVQVCGFLQYATIVGVAIGYTIAAS  148

Query  1295  ISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFGIIEIILSQIPDFDQIWWLSIVAAVMSF  1116
             ISM+AIKR+NCFH  G  +PC++SS PYMI FG+ EI  SQIPDFDQI WLSI+AAVMSF
Sbjct  149   ISMLAIKRANCFHVEGHGDPCNISSTPYMIIFGVAEIFFSQIPDFDQISWLSILAAVMSF  208

Query  1115  TYSGIGLGLGIAQVVANGAFKGSLTGISIGTVTETQKIWRSFQALGDIAFAYSYSIILIE  936
             TYS IGLGLG+ QVVAN   KGS TGISIG VT   K+WRS QA GDIAFAYSYS+ILIE
Sbjct  209   TYSTIGLGLGVVQVVANKGAKGSFTGISIGVVTPMDKVWRSLQAFGDIAFAYSYSLILIE  268

Query  935   IQDTVKS-PPSESKTMRKASLFSTIVTTTFYMLCGCMGYAAFGDDAPGNLLTGFGFYNPF  759
             IQDT+K+ PPSESK MR+A++ S  VTT FYMLCGC GYAAFGD+APGNLLTGFGFY PF
Sbjct  269   IQDTIKAPPPSESKVMRRATIVSVAVTTLFYMLCGCSGYAAFGDEAPGNLLTGFGFYEPF  328

Query  758   WLLDIANAAIVIHLVGAYQVYCQPLFAFIEKWVGAKWPDSEIITKEINLKIP-----GFG  594
             WLLD+ANAAIV+HLVGAYQVYCQPLFAF+EKW   +WP S  IT EI++ +P     G G
Sbjct  329   WLLDVANAAIVVHLVGAYQVYCQPLFAFVEKWAQQRWPKSRYITGEIDVPLPLPSSSGAG  388

Query  593   YP-YKLNTFRLLWRTAFVLLTTVISMLLPFFNDVVGILGAFGFWPLTVYFPVRMYISQKK  417
                ++LN FRL WR+AFV++TTV+SMLLPFFNDVVG LGA GFWPLTVYFPV MYI QK+
Sbjct  389   RRCFRLNLFRLTWRSAFVVVTTVVSMLLPFFNDVVGFLGALGFWPLTVYFPVEMYIVQKR  448

Query  416   IPKWSTRWICLQMlsgaclavslaaaagsfagvVLDLKLYRPFKTSY  276
             IPKWSTRW+CLQ+LS ACL +++A+AAGS AG++ DLK+Y+PF T+Y
Sbjct  449   IPKWSTRWVCLQLLSLACLIITVASAAGSVAGIISDLKVYKPFATTY  495



>ref|XP_006393747.1| hypothetical protein EUTSA_v10011449mg [Eutrema salsugineum]
 gb|ESQ31033.1| hypothetical protein EUTSA_v10011449mg [Eutrema salsugineum]
Length=477

 Score =   664 bits (1712),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 326/470 (69%), Positives = 392/470 (83%), Gaps = 0/470 (0%)
 Frame = -3

Query  1685  GVSIDAPPLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSGVLSLAWAIGQLGWVAGPS  1506
             GVS+   P    +  D+DGRP+RTGTVWTASAHIITAVIGSGVLSLAWA+ Q+GWV GP+
Sbjct  8     GVSMGVLPQNSSELFDEDGRPKRTGTVWTASAHIITAVIGSGVLSLAWAVAQIGWVGGPA  67

Query  1505  VMLLFSCVVYYTSTLLADCYRAGDPVFGKRNYTYMDAVRSNLGGYQVKICGLIQYFNLFG  1326
             VMLLFS V YYTS LL  CYR+GD V GKRNYTYMDA+ SNLGG +VKICG++QY NLFG
Sbjct  68    VMLLFSLVTYYTSILLCSCYRSGDSVTGKRNYTYMDAIHSNLGGIKVKICGVVQYVNLFG  127

Query  1325  IAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFGIIEIILSQIPDFDQIWW  1146
              AIGYTIA++ISM+AI+R++C   +G K+PCH++ NPYMI FG+ +II SQIPDFDQ+WW
Sbjct  128   TAIGYTIASAISMIAIQRTSCQQINGDKDPCHVNGNPYMIGFGVAQIIFSQIPDFDQLWW  187

Query  1145  LSIVAAVMSFTYSGIGLGLGIAQVVANGAFKGSLTGISIGTVTETQKIWRSFQALGDIAF  966
             LSI+AAVMSF YS IGLGLGI++VV N   KG+LTG+SIGTVT T K+WR+FQ+LG+IAF
Sbjct  188   LSILAAVMSFGYSTIGLGLGISRVVENKEIKGTLTGVSIGTVTPTDKVWRTFQSLGNIAF  247

Query  965   AYSYSIILIEIQDTVKSPPSESKTMRKASLFSTIVTTTFYMLCGCMGYAAFGDDAPGNLL  786
             AY+YS+ILIEIQDT+KSPP+E  TM+KA+L S  VTT FYMLCGC+GYAAFGD APGNLL
Sbjct  248   AYAYSMILIEIQDTLKSPPAEENTMKKATLISVAVTTLFYMLCGCVGYAAFGDTAPGNLL  307

Query  785   TGFGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEKWVGAKWPDSEIITKEINLKI  606
                GF NP+WLLDIAN AI+IHLVGAYQVYCQPLFAF+EK    ++P+S+ ITKE  + +
Sbjct  308   AQGGFRNPYWLLDIANLAIIIHLVGAYQVYCQPLFAFVEKEASKRYPESKFITKETKIHL  367

Query  605   PGFGYPYKLNTFRLLWRTAFVLLTTVISMLLPFFNDVVGILGAFGFWPLTVYFPVRMYIS  426
                  P+ LN FRL+WRT FV++TT+ISML+PFFNDV+G+LGA GFWPLTVYFPV MYI 
Sbjct  368   FPGSKPFNLNLFRLVWRTVFVIITTLISMLMPFFNDVLGLLGAIGFWPLTVYFPVEMYIV  427

Query  425   QKKIPKWSTRWICLQMlsgaclavslaaaagsfagvVLDLKLYRPFKTSY  276
             QK +P+W TRW+CLQ+LS ACL VS+AAAAGS  G+V DLK Y+PFKT +
Sbjct  428   QKNVPRWGTRWVCLQVLSLACLVVSIAAAAGSVVGIVTDLKSYKPFKTDF  477



>ref|XP_008442267.1| PREDICTED: amino acid permease 4-like [Cucumis melo]
Length=466

 Score =   662 bits (1707),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 324/463 (70%), Positives = 387/463 (84%), Gaps = 1/463 (0%)
 Frame = -3

Query  1664  PLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSGVLSLAWAIGQLGWVAGPSVMLLFSC  1485
             P+     LDDDG P+RTGT WTASAHIIT VIGSGVLSLAWAI QLGW+ GPSVMLLF+ 
Sbjct  5     PVNDSASLDDDGHPKRTGTFWTASAHIITTVIGSGVLSLAWAIAQLGWIVGPSVMLLFAF  64

Query  1484  VVYYTSTLLADCYRAGDPVFGKRNYTYMDAVRSNLGGYQVKICGLIQYFNLFGIAIGYTI  1305
             + YYTS LLADCYR+GDP+ GKRN+TYM AVRS LG   +  CG++Q  NL GI IGYTI
Sbjct  65    IGYYTSCLLADCYRSGDPLNGKRNHTYMHAVRSLLGEAHMVACGVMQNINLIGITIGYTI  124

Query  1304  AASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFGIIEIILSQIPDFDQIWWLSIVAAV  1125
             A+SISMMAIKRSNCFH SGGKNPCH+SSNP+M++FG++EIILSQIP+FDQIWWLS +AA+
Sbjct  125   ASSISMMAIKRSNCFHSSGGKNPCHISSNPFMVSFGVLEIILSQIPNFDQIWWLSTLAAI  184

Query  1124  MSFTYSGIGLGLGIAQVVANGAFKGSLTGISIGTVTETQKIWRSFQALGDIAFAYSYSII  945
             MSFTYS IGL LGIA+V  +G FKG+++G+S+GT+++T+K  RSFQALGDIAFAYS++I+
Sbjct  185   MSFTYSFIGLSLGIAKVAESGRFKGTISGVSVGTISKTEKKLRSFQALGDIAFAYSFAIV  244

Query  944   LIEIQDTVKSPPSESKTMRKASLFSTIVTTTFYMLCGCMGYAAFGDDAPGNLLTGFGFYN  765
             LIEIQDT+K PPSE+KTM+KA+ FS I+TT FY+LCGCMGYAAFG++APGNLLTGFGFYN
Sbjct  245   LIEIQDTIKCPPSEAKTMKKATTFSIILTTLFYLLCGCMGYAAFGNNAPGNLLTGFGFYN  304

Query  764   PFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEKWVGAKWPDSEIITKEINLKIPGFGYPY  585
             PFWL+DIAN AIV+HLVGAYQV  QP+FAF+EK     WPDS  I K+  L I      Y
Sbjct  305   PFWLIDIANVAIVVHLVGAYQVLSQPIFAFVEKKAAQAWPDSPFINKDYKLSISS-SRLY  363

Query  584   KLNTFRLLWRTAFVLLTTVISMLLPFFNDVVGILGAFGFWPLTVYFPVRMYISQKKIPKW  405
              +N FRL WRT FV  TT I+ML+PFFND+VGI+GA  FWPLTVYFP++MYI QKKIP+W
Sbjct  364   NINLFRLFWRTLFVCFTTTIAMLIPFFNDIVGIIGALQFWPLTVYFPIQMYIVQKKIPQW  423

Query  404   STRWICLQMlsgaclavslaaaagsfagvVLDLKLYRPFKTSY  276
             S +WIC+Q +S  CL VSLAAA GS +GV+LDLK+Y+PFKT Y
Sbjct  424   SVKWICVQTMSVGCLLVSLAAAVGSISGVMLDLKVYKPFKTMY  466



>ref|XP_010527719.1| PREDICTED: amino acid permease 5-like isoform X1 [Tarenaya hassleriana]
Length=525

 Score =   664 bits (1712),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 337/523 (64%), Positives = 399/523 (76%), Gaps = 46/523 (9%)
 Frame = -3

Query  1709  TKNHRHHLGVSIDAPPLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSGVLSLAWAIGQ  1530
             T N     GVS+D  P       DDDGRP+RTGTVWTASAHIITAVIGSGVLSLAWA+ Q
Sbjct  4     TVNGTQSFGVSMDVLPKNRSDLFDDDGRPKRTGTVWTASAHIITAVIGSGVLSLAWAVAQ  63

Query  1529  LGWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRNYTYMDAVRSNL----------  1380
             LGWVAGP+VM LFS V YYTS LL  CYR+GD V GKRNYTYMDAV++NL          
Sbjct  64    LGWVAGPAVMFLFSLVTYYTSILLCSCYRSGDSVSGKRNYTYMDAVQANLEPLKSIWARS  123

Query  1379  -----------------------------------GGYQVKICGLIQYFNLFGIAIGYTI  1305
                                                GG +VK+CGL+QY NLFG AIGYTI
Sbjct  124   SLNLFTQTEAKFESSHLGCCWDSQFEFQSVFGVNSGGVKVKLCGLVQYLNLFGTAIGYTI  183

Query  1304  AASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFGIIEIILSQIPDFDQIWWLSIVAAV  1125
             A+++SM+AI+RSNC H+S GK+PCH++ NPYMIAFG+ +I+ SQIPDFD++WWLSIVAAV
Sbjct  184   ASAVSMIAIQRSNCHHKSHGKDPCHINGNPYMIAFGVAQIVFSQIPDFDRLWWLSIVAAV  243

Query  1124  MSFTYSGIGLGLGIAQVVANGAFKGSLTGISIGTVTETQKIWRSFQALGDIAFAYSYSII  945
             MSF YS IGL LG+++V  N   KGSLTGI +GTVT +QK+WRSFQALG+IAFAYSYS+I
Sbjct  244   MSFMYSSIGLALGVSKVAENKEIKGSLTGIGVGTVTPSQKVWRSFQALGNIAFAYSYSMI  303

Query  944   LIEIQDTVKSPPSESKTMRKASLFSTIVTTTFYMLCGCMGYAAFGDDAPGNLLTGFGFYN  765
             LIEIQDT+KSPP E KTMRKA+L S  VTT FYMLCGC+GYAAFGD +PGNLL+G GF+N
Sbjct  304   LIEIQDTLKSPPVEEKTMRKATLISVAVTTLFYMLCGCIGYAAFGDTSPGNLLSG-GFFN  362

Query  764   PFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEKWVGAKWPDSEIITKEINLKIPGFGYPY  585
             P+WL+DIAN  IVIHLVGAYQVYCQPLFAF+E     ++PDS++ITKEI +++     PY
Sbjct  363   PYWLIDIANLTIVIHLVGAYQVYCQPLFAFVENQASKRFPDSKLITKEIKIRLFPGREPY  422

Query  584   KLNTFRLLWRTAFVLLTTVISMLLPFFNDVVGILGAFGFWPLTVYFPVRMYISQKKIPKW  405
              LN FRL+WRT FV+LTT+ISML+PFFNDV+G LGA GFWPLTVYFPV MYI  K+I +W
Sbjct  423   NLNLFRLVWRTLFVILTTLISMLMPFFNDVLGFLGAIGFWPLTVYFPVEMYIEHKRIQRW  482

Query  404   STRWICLQMlsgaclavslaaaagsfagvVLDLKLYRPFKTSY  276
             STRW+CLQ+LS ACL V+LA+AAGS  G+V DLK Y+PFKT +
Sbjct  483   STRWVCLQVLSFACLVVTLASAAGSVVGIVTDLKTYKPFKTDF  525



>gb|AAD16014.1| amino acid transporter [Nepenthes alata]
Length=377

 Score =   657 bits (1695),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 318/378 (84%), Positives = 339/378 (90%), Gaps = 1/378 (0%)
 Frame = -3

Query  1577  AVIGSGVLSLAWAIGQLGWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRNYTYMD  1398
             AVIGSGVLSLAWAI QLGW+AGP+VMLLFS V+YYTS LLADCYR  DP+FG RNYTYMD
Sbjct  1     AVIGSGVLSLAWAIAQLGWIAGPAVMLLFSFVIYYTSILLADCYRVDDPIFGNRNYTYMD  60

Query  1397  AVRSNLGGYQVKICGLIQYFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSN  1218
             AVRSNLGG +VK+CGLIQY NL G+AIGYTIAASISMMAI+RSNCFH SG K PCHMSSN
Sbjct  61    AVRSNLGGVKVKVCGLIQYLNLIGVAIGYTIAASISMMAIRRSNCFHNSGAKKPCHMSSN  120

Query  1217  PYMIAFGIIEIILSQIPDFDQIWWLSIVAAVMSFTYSGIGLGLGIAQVVANGAFKGSLTG  1038
             PYMI FGI+EIILSQIPDFDQIWWLSIVAAVMSFTYS IGL LGIAQV AN AFKGSLTG
Sbjct  121   PYMIMFGILEIILSQIPDFDQIWWLSIVAAVMSFTYSTIGLSLGIAQVAANKAFKGSLTG  180

Query  1037  ISIGTVTETQKIWRSFQALGDIAFAYSYSIILIEIQDTVKSPPSESKTMRKASLFSTIVT  858
             ISIG VT+TQKIWRSFQALGDIAFAYSYSIILIEIQDTVKSPPSE+KTM+KASL S +VT
Sbjct  181   ISIGAVTQTQKIWRSFQALGDIAFAYSYSIILIEIQDTVKSPPSEAKTMKKASLISIVVT  240

Query  857   TTFYMLCGCMGYAAFGDDAPGNLLTGFGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFA  678
             T FYMLCGCMGYAAFGD APGNLLTGFGFYNPFWLLDIANAAIV+HLVGAYQVYCQPLFA
Sbjct  241   TAFYMLCGCMGYAAFGDIAPGNLLTGFGFYNPFWLLDIANAAIVVHLVGAYQVYCQPLFA  300

Query  677   FIEKWVGAKWPDSEIITKEINLKIPGFGYPYKLNTFRLLWRTAFVLLTTVISMLLPFFND  498
             F+EK    KWP +  I K I ++IPGFG  Y LN FRL WRTAFV+ TT+ISMLLPFFND
Sbjct  301   FVEKSASGKWPKNAFINKGIKIQIPGFG-AYDLNIFRLAWRTAFVITTTIISMLLPFFND  359

Query  497   VVGILGAFGFWPLTVYFP  444
             +VGILGAFGFWP TVYFP
Sbjct  360   IVGILGAFGFWPFTVYFP  377



>ref|XP_006307383.1| hypothetical protein CARUB_v10009009mg [Capsella rubella]
 gb|EOA40281.1| hypothetical protein CARUB_v10009009mg [Capsella rubella]
Length=480

 Score =   661 bits (1706),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 324/475 (68%), Positives = 391/475 (82%), Gaps = 9/475 (2%)
 Frame = -3

Query  1679  SIDAPPLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSGVLSLAWAIGQLGWVAGPSVM  1500
              +D  P       DDDGRP+RTGTVWTASAHIITAVIGSGVLSLAWA+ Q+GWV GP  M
Sbjct  8     DLDVLPRSSSDLFDDDGRPKRTGTVWTASAHIITAVIGSGVLSLAWAVAQIGWVGGPVTM  67

Query  1499  LLFSCVVYYTSTLLADCYRAGDPVFGKRNYTYMDAVRSNLGGYQVKICGLIQYFNLFGIA  1320
             LLFS V YYTSTLL  CYR+GD V GKRNYTYMDA+ SNLGG +VKICG++QY NLFG A
Sbjct  68    LLFSLVTYYTSTLLCSCYRSGDSVTGKRNYTYMDAIHSNLGGIKVKICGVVQYVNLFGTA  127

Query  1319  IGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFGIIEIILSQIPDFDQIWWLS  1140
             IGYTIA++IS++AI+R+ C   +G  +PCH++ NPYMIAFGI++II SQIPDFDQ+WWLS
Sbjct  128   IGYTIASAISLIAIQRTTCQQTNGANDPCHVNGNPYMIAFGIVQIIFSQIPDFDQLWWLS  187

Query  1139  IVAAVMSFTYSGIGLGLGIAQVVANGAFKGSLTGISIGTVTET------QKIWRSFQALG  978
             IVAAVMSF YS IGLGLG+++VV N   KG+LTG++IGTVT +      QK+WR+FQ+LG
Sbjct  188   IVAAVMSFGYSAIGLGLGVSKVVENKEIKGTLTGVTIGTVTSSGTVTPPQKVWRTFQSLG  247

Query  977   DIAFAYSYSIILIEIQDTVKSPPSESKTMRKASLFSTIVTTTFYMLCGCMGYAAFGDDAP  798
             +IAFAYSYS+ILIEIQDTVKSPP+E  TMRKA+  S +VTT FYMLCGC+GYAAFGD AP
Sbjct  248   NIAFAYSYSMILIEIQDTVKSPPAEENTMRKATFVSVVVTTLFYMLCGCIGYAAFGDSAP  307

Query  797   GNLLTGFGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEKWVGAKWPDSEIITKEI  618
             GNLL   GF NPFWLLD+AN AIV+HLVGAYQVYCQPLF+F+EK    ++PDS+ IT EI
Sbjct  308   GNLLAAGGFRNPFWLLDVANIAIVVHLVGAYQVYCQPLFSFVEKEASKRYPDSKFITNEI  367

Query  617   NLK-IPGFGYPYKLNTFRLLWRTAFVLLTTVISMLLPFFNDVVGILGAFGFWPLTVYFPV  441
              ++ +P  G P+ LN FRL+WRT FV+ TT+I+ML+PFFNDV+G+LGA GFWPLTVYFPV
Sbjct  368   KIQLVP--GKPFNLNLFRLVWRTIFVMTTTLIAMLMPFFNDVLGLLGAIGFWPLTVYFPV  425

Query  440   RMYISQKKIPKWSTRWICLQMlsgaclavslaaaagsfagvVLDLKLYRPFKTSY  276
              MYISQK + +W TRW+CL++LS ACL VS+AAAAGS  G+  DLK+Y+PF+T +
Sbjct  426   EMYISQKNVQRWGTRWVCLKVLSLACLVVSVAAAAGSVVGIASDLKVYKPFQTDF  480



>ref|NP_001045010.1| Os01g0882800 [Oryza sativa Japonica Group]
 dbj|BAB90366.1| putative amino acid carrier [Oryza sativa Japonica Group]
 dbj|BAF06924.1| Os01g0882800 [Oryza sativa Japonica Group]
 gb|EAY76727.1| hypothetical protein OsI_04682 [Oryza sativa Indica Group]
 gb|EAZ14390.1| hypothetical protein OsJ_04310 [Oryza sativa Japonica Group]
Length=488

 Score =   661 bits (1706),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 335/458 (73%), Positives = 386/458 (84%), Gaps = 1/458 (0%)
 Frame = -3

Query  1655  GFKGLDDDGRPQRTGTVWTASAHIITAVIGSGVLSLAWAIGQLGWVAGPSVMLLFSCVVY  1476
             G K  DDDGRP+R GT+WTASAHIITAVIGSGVLSL WAI QLGWVAGP+VM+LFS V Y
Sbjct  29    GSKLFDDDGRPRRNGTMWTASAHIITAVIGSGVLSLGWAIAQLGWVAGPAVMVLFSLVTY  88

Query  1475  YTSTLLADCYRAGDPVFGKRNYTYMDAVRSNLGGYQVKICGLIQYFNLFGIAIGYTIAAS  1296
             YTS+LL+DCYR+GDPV GKRNYTYMDAV +NL G++VKICG +QY N+ G+AIGYTIAAS
Sbjct  89    YTSSLLSDCYRSGDPVTGKRNYTYMDAVNANLSGFKVKICGFLQYANIVGVAIGYTIAAS  148

Query  1295  ISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFGIIEIILSQIPDFDQIWWLSIVAAVMSF  1116
             ISM+AI R+NCFH  G  +PC++SS PYMI FG+ E+  SQIPDFDQI WLS++AAVMSF
Sbjct  149   ISMLAIGRANCFHRKGHGDPCNVSSVPYMIVFGVAEVFFSQIPDFDQISWLSMLAAVMSF  208

Query  1115  TYSGIGLGLGIAQVVANGAFKGSLTGISIGTVTETQKIWRSFQALGDIAFAYSYSIILIE  936
             TYS IGL LGI QVVANG  KGSLTGISIG VT   K+WRS QA GDIAFAYSYS+ILIE
Sbjct  209   TYSVIGLSLGIVQVVANGGLKGSLTGISIGVVTPMDKVWRSLQAFGDIAFAYSYSLILIE  268

Query  935   IQDTVKS-PPSESKTMRKASLFSTIVTTTFYMLCGCMGYAAFGDDAPGNLLTGFGFYNPF  759
             IQDT+++ PPSES  M++A++ S  VTT FYMLCG MGYAAFGDDAPGNLLTGFGFY PF
Sbjct  269   IQDTIRAPPPSESAVMKRATVVSVAVTTVFYMLCGSMGYAAFGDDAPGNLLTGFGFYEPF  328

Query  758   WLLDIANAAIVIHLVGAYQVYCQPLFAFIEKWVGAKWPDSEIITKEINLKIPGFGYPYKL  579
             WLLDIANAAIV+HLVGAYQV+CQPLFAF+EKW   +WP+S  IT E+ L++       ++
Sbjct  329   WLLDIANAAIVVHLVGAYQVFCQPLFAFVEKWAAQRWPESPYITGEVELRLSPSSRRCRV  388

Query  578   NTFRLLWRTAFVLLTTVISMLLPFFNDVVGILGAFGFWPLTVYFPVRMYISQKKIPKWST  399
             N FR  WRTAFV+ TTV+SMLLPFFNDVVG LGA GFWPLTVYFPV MY+ QKK+P+WST
Sbjct  389   NLFRSTWRTAFVVATTVVSMLLPFFNDVVGFLGALGFWPLTVYFPVEMYVVQKKVPRWST  448

Query  398   RWICLQMlsgaclavslaaaagsfagvVLDLKLYRPFK  285
             RW+CLQMLS  CL +S+AAAAGS AGV+ DLK+YRPFK
Sbjct  449   RWVCLQMLSVGCLVISIAAAAGSIAGVMSDLKVYRPFK  486



>ref|NP_175076.2| amino acid permease 5 [Arabidopsis thaliana]
 sp|Q8GUM3.1|AAP5_ARATH RecName: Full=Amino acid permease 5; AltName: Full=Amino acid 
transporter AAP5 [Arabidopsis thaliana]
 gb|AAO00749.1| amino acid permease, putative [Arabidopsis thaliana]
 gb|AAP81798.1| At1g44100 [Arabidopsis thaliana]
 gb|AEE32020.1| amino acid permease 5 [Arabidopsis thaliana]
Length=480

 Score =   659 bits (1701),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 324/475 (68%), Positives = 394/475 (83%), Gaps = 9/475 (2%)
 Frame = -3

Query  1679  SIDAPPLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSGVLSLAWAIGQLGWVAGPSVM  1500
              +D  P +     DDDGRP+RTGTVWTASAHIITAVIGSGVLSLAWA+ Q+GW+ GP  M
Sbjct  8     DLDVLPKHSSDSFDDDGRPKRTGTVWTASAHIITAVIGSGVLSLAWAVAQIGWIGGPVAM  67

Query  1499  LLFSCVVYYTSTLLADCYRAGDPVFGKRNYTYMDAVRSNLGGYQVKICGLIQYFNLFGIA  1320
             LLFS V +YTSTLL  CYR+GD V GKRNYTYMDA+ SNLGG +VK+CG++QY NLFG A
Sbjct  68    LLFSFVTFYTSTLLCSCYRSGDSVTGKRNYTYMDAIHSNLGGIKVKVCGVVQYVNLFGTA  127

Query  1319  IGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFGIIEIILSQIPDFDQIWWLS  1140
             IGYTIA++IS++AI+R++C   +G  +PCH++ N YMIAFGI++II SQIPDFDQ+WWLS
Sbjct  128   IGYTIASAISLVAIQRTSCQQMNGPNDPCHVNGNVYMIAFGIVQIIFSQIPDFDQLWWLS  187

Query  1139  IVAAVMSFTYSGIGLGLGIAQVVANGAFKGSLTGISI------GTVTETQKIWRSFQALG  978
             IVAAVMSF YS IGLGLG+++VV N   KGSLTG+++      GTVT +QKIWR+FQ+LG
Sbjct  188   IVAAVMSFAYSAIGLGLGVSKVVENKEIKGSLTGVTVGTVTLSGTVTSSQKIWRTFQSLG  247

Query  977   DIAFAYSYSIILIEIQDTVKSPPSESKTMRKASLFSTIVTTTFYMLCGCMGYAAFGDDAP  798
             +IAFAYSYS+ILIEIQDTVKSPP+E  TMRKA+  S  VTT FYMLCGC+GYAAFGD+AP
Sbjct  248   NIAFAYSYSMILIEIQDTVKSPPAEVNTMRKATFVSVAVTTVFYMLCGCVGYAAFGDNAP  307

Query  797   GNLLTGFGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEKWVGAKWPDSEIITKEI  618
             GNLL   GF NP+WLLDIAN AIVIHLVGAYQVYCQPLFAF+EK    ++P+SE +TKEI
Sbjct  308   GNLLAHGGFRNPYWLLDIANLAIVIHLVGAYQVYCQPLFAFVEKEASRRFPESEFVTKEI  367

Query  617   NLKI-PGFGYPYKLNTFRLLWRTAFVLLTTVISMLLPFFNDVVGILGAFGFWPLTVYFPV  441
              +++ P  G P+ LN FRL+WRT FV+ TT+ISML+PFFNDVVG+LGA GFWPLTVYFPV
Sbjct  368   KIQLFP--GKPFNLNLFRLVWRTFFVMTTTLISMLMPFFNDVVGLLGAIGFWPLTVYFPV  425

Query  440   RMYISQKKIPKWSTRWICLQMlsgaclavslaaaagsfagvVLDLKLYRPFKTSY  276
              MYI+QK +P+W T+W+CLQ+LS  CL VS+AAAAGS  G+V DLK+Y+PF++ +
Sbjct  426   EMYIAQKNVPRWGTKWVCLQVLSVTCLFVSVAAAAGSVIGIVSDLKVYKPFQSEF  480



>emb|CAA54632.1| amino acid permease [Arabidopsis thaliana]
Length=480

 Score =   659 bits (1700),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 324/475 (68%), Positives = 394/475 (83%), Gaps = 9/475 (2%)
 Frame = -3

Query  1679  SIDAPPLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSGVLSLAWAIGQLGWVAGPSVM  1500
              +D  P +     DDDGRP+RTGTVWTASAHIITAVIGSGVLSLAWA+ Q+GW+ GP  M
Sbjct  8     DLDVLPKHSSDSFDDDGRPKRTGTVWTASAHIITAVIGSGVLSLAWAVAQIGWIGGPVAM  67

Query  1499  LLFSCVVYYTSTLLADCYRAGDPVFGKRNYTYMDAVRSNLGGYQVKICGLIQYFNLFGIA  1320
             LLFS V +YTSTLL  CYR+GD V GKRNYTYMDA+ SNLGG +VK+CG++QY NLFG A
Sbjct  68    LLFSFVTFYTSTLLCSCYRSGDSVTGKRNYTYMDAIHSNLGGIKVKVCGVVQYVNLFGTA  127

Query  1319  IGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFGIIEIILSQIPDFDQIWWLS  1140
             IGYTIA++IS++AI+R++C   +G  +PCH++ N YMIAFGI++II SQIPDFDQ+WWLS
Sbjct  128   IGYTIASAISLVAIQRTSCQQMNGPNDPCHVNGNVYMIAFGIVQIIFSQIPDFDQLWWLS  187

Query  1139  IVAAVMSFTYSGIGLGLGIAQVVANGAFKGSLTGISI------GTVTETQKIWRSFQALG  978
             IVAAVMSF YS IGLGLG+++VV N   KGSLTG+++      GTVT +QKIWR+FQ+LG
Sbjct  188   IVAAVMSFAYSAIGLGLGVSKVVENKEIKGSLTGVTVGTVTLSGTVTSSQKIWRTFQSLG  247

Query  977   DIAFAYSYSIILIEIQDTVKSPPSESKTMRKASLFSTIVTTTFYMLCGCMGYAAFGDDAP  798
             +IAFAYSYS+ILIEIQDTVKSPP+E  TMRKA+  S  VTT FYMLCGC+GYAAFGD+AP
Sbjct  248   NIAFAYSYSMILIEIQDTVKSPPAEVNTMRKATFVSVAVTTVFYMLCGCVGYAAFGDNAP  307

Query  797   GNLLTGFGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEKWVGAKWPDSEIITKEI  618
             GNLL   GF NP+WLLDIAN AIVIHLVGAYQVYCQPLFAF+EK    ++P+SE +TKEI
Sbjct  308   GNLLAHGGFRNPYWLLDIANLAIVIHLVGAYQVYCQPLFAFVEKEASRRFPESEFVTKEI  367

Query  617   NLKI-PGFGYPYKLNTFRLLWRTAFVLLTTVISMLLPFFNDVVGILGAFGFWPLTVYFPV  441
              +++ P  G P+ LN FRL+WRT FV+ TT+ISML+PFFNDVVG+LGA GFWPLTVYFPV
Sbjct  368   KIQLFP--GKPFNLNLFRLVWRTFFVITTTLISMLMPFFNDVVGLLGAIGFWPLTVYFPV  425

Query  440   RMYISQKKIPKWSTRWICLQMlsgaclavslaaaagsfagvVLDLKLYRPFKTSY  276
              MYI+QK +P+W T+W+CLQ+LS  CL VS+AAAAGS  G+V DLK+Y+PF++ +
Sbjct  426   EMYIAQKNVPRWGTKWVCLQVLSVTCLFVSVAAAAGSVIGIVSDLKVYKPFQSEF  480



>gb|KEH35330.1| transmembrane amino acid transporter family protein [Medicago 
truncatula]
Length=480

 Score =   659 bits (1700),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 327/479 (68%), Positives = 393/479 (82%), Gaps = 6/479 (1%)
 Frame = -3

Query  1709  TKNHRHHLGVSIDAPPLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSGVLSLAWAIGQ  1530
             + NH     VSID       K  DDDGR +RTGTVWTASAH+ITAV+GSGVLSLAWAI Q
Sbjct  7     STNHHQTFDVSIDQQ--RDSKYFDDDGRVKRTGTVWTASAHVITAVVGSGVLSLAWAIAQ  64

Query  1529  LGWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRNYTYMDAVRSNLGGYQVKICGL  1350
             LGW+AGP VM+LF+ V YYT+ LL +CYR  DP+ GKRNYTYMD V SNLGG+QV +CG+
Sbjct  65    LGWIAGPIVMILFAWVTYYTAILLCECYRNDDPINGKRNYTYMDVVHSNLGGFQVTLCGI  124

Query  1349  IQYFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFGIIEIILSQI  1170
             +QY NL G+AIGYTIA++ISMMAI+RSNCFH SGGK+PCHM SN YMI+FG ++II SQI
Sbjct  125   VQYLNLVGVAIGYTIASAISMMAIERSNCFHRSGGKDPCHMKSNIYMISFGAVQIIFSQI  184

Query  1169  PDFDQIWWLSIVAAVMSFTYSGIGLGLGIAQVVANGAFKGSLTGISIGTVTETQKIWRSF  990
             PDFDQ+WWLS +AAVMSFTYS IGLGLGI +V+ N    G++ G++   VT+ QK+W S 
Sbjct  185   PDFDQLWWLSSLAAVMSFTYSTIGLGLGIGKVIGNKKIDGTMAGVT--DVTKAQKVWGSL  242

Query  989   QALGDIAFAYSYSIILIEIQDTVKS-PPSESKTMRKASLFSTIVTTTFYMLCGCMGYAAF  813
             QALGDIAFAYSYS+ILIEIQDTVK+ PPSE+KTM+KA++     T  FYMLCGC GYAAF
Sbjct  243   QALGDIAFAYSYSMILIEIQDTVKAPPPSEAKTMKKATIIGVAATAFFYMLCGCFGYAAF  302

Query  812   GDDAPGNLLTGFGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEKWVGAKWPDSEI  633
             G+ +PGNLLTGFGFYNPFWLLDIAN AIVIHL+GAYQVYCQPL+AF+E +   ++P S++
Sbjct  303   GNSSPGNLLTGFGFYNPFWLLDIANVAIVIHLIGAYQVYCQPLYAFVENYTAKRFPQSDL  362

Query  632   ITKEINLKIPGFGYPYKLNTFRLLWRTAFVLLTTVISMLLPFFNDVVGILGAFGFWPLTV  453
             + K I + IPG     KLN FRL+WRT FV+LTT++SMLLPFFND+ G+LGA GFWPLTV
Sbjct  363   VNKNIKIPIPGRQM-CKLNLFRLVWRTIFVILTTLVSMLLPFFNDIAGLLGALGFWPLTV  421

Query  452   YFPVRMYISQKKIPKWSTRWICLQMlsgaclavslaaaagsfagvVLDLKLYRPFKTSY  276
             YFPV MYI QK+IPKWS++WICLQ+LS ACL +S+AAA GS AG+VLDLK+++PFKT Y
Sbjct  422   YFPVEMYIIQKRIPKWSSKWICLQLLSVACLIISIAAAVGSIAGIVLDLKVFKPFKTVY  480



>ref|XP_006645132.1| PREDICTED: amino acid permease 2-like [Oryza brachyantha]
Length=484

 Score =   658 bits (1697),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 332/457 (73%), Positives = 387/457 (85%), Gaps = 2/457 (0%)
 Frame = -3

Query  1655  GFKGLDDDGRPQRTGTVWTASAHIITAVIGSGVLSLAWAIGQLGWVAGPSVMLLFSCVVY  1476
             G K +DDDGRP+R GT+WTAS+HIITAVIGSGVLSL WAI QLGWVAGP+VM+LFS V Y
Sbjct  29    GSKLVDDDGRPKRNGTMWTASSHIITAVIGSGVLSLGWAIAQLGWVAGPAVMVLFSLVTY  88

Query  1475  YTSTLLADCYRAGDPVFGKRNYTYMDAVRSNLGGYQVKICGLIQYFNLFGIAIGYTIAAS  1296
             YTS LLADCYR+GD   GKRNYTYMDAV +NL G++VKICG +QY N+ G+AIGYTIAAS
Sbjct  89    YTSALLADCYRSGDQTSGKRNYTYMDAVNANLSGFKVKICGFLQYANIVGVAIGYTIAAS  148

Query  1295  ISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFGIIEIILSQIPDFDQIWWLSIVAAVMSF  1116
             ISMMAI R+NCFH+ G  NPC++SS PYM  FG+ E++ SQIPDFDQI WLS++AAVMSF
Sbjct  149   ISMMAIGRANCFHKKGHANPCNVSSVPYMAIFGVAEVLFSQIPDFDQISWLSMLAAVMSF  208

Query  1115  TYSGIGLGLGIAQVVANGAFKGSLTGISIGTVTETQKIWRSFQALGDIAFAYSYSIILIE  936
             TYS IGL LGI QVVANG FKGSLTGISIG VT   K+WRS QA GDIAFAYSYS+ILIE
Sbjct  209   TYSVIGLSLGIVQVVANGGFKGSLTGISIGVVTPMDKVWRSLQAFGDIAFAYSYSLILIE  268

Query  935   IQDTVKS-PPSESKTMRKASLFSTIVTTTFYMLCGCMGYAAFGDDAPGNLLTGFGFYNPF  759
             IQDT+++ PPSE+  M++A++ S  VTT FYMLCG MGYAAFGDDAPGNLLTGFGFY PF
Sbjct  269   IQDTIRAPPPSEATVMKRATVVSVAVTTVFYMLCGSMGYAAFGDDAPGNLLTGFGFYEPF  328

Query  758   WLLDIANAAIVIHLVGAYQVYCQPLFAFIEKWVGAKWPDSEIITKEINLKIPGFGYPYKL  579
             WLLDIANAAIV+HLVGAYQV+CQPLFAF+EKW   +WP+S  IT+E+ +++      YKL
Sbjct  329   WLLDIANAAIVVHLVGAYQVFCQPLFAFVEKWAAQRWPESPYITREVEVRLSP-SRRYKL  387

Query  578   NTFRLLWRTAFVLLTTVISMLLPFFNDVVGILGAFGFWPLTVYFPVRMYISQKKIPKWST  399
             + FR  WRTAFV+ TTV+SMLLPFFNDVVG LGA GFWPLTVYFPV MY+ QKK+P+WST
Sbjct  388   SLFRSTWRTAFVVATTVVSMLLPFFNDVVGFLGALGFWPLTVYFPVEMYVVQKKVPRWST  447

Query  398   RWICLQMlsgaclavslaaaagsfagvVLDLKLYRPF  288
             +W+CLQMLS  CL +S+AAAAGS AG++ DLK+YRPF
Sbjct  448   QWVCLQMLSVGCLVISIAAAAGSIAGIMSDLKVYRPF  484



>ref|XP_007226332.1| hypothetical protein PRUPE_ppa022253mg [Prunus persica]
 gb|EMJ27531.1| hypothetical protein PRUPE_ppa022253mg [Prunus persica]
Length=483

 Score =   657 bits (1696),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 334/487 (69%), Positives = 402/487 (83%), Gaps = 8/487 (2%)
 Frame = -3

Query  1730  MGESAAATKNHRHH---LGVSIDAPPLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSG  1560
             MG+  A      HH     VS++     G   +DDDGRP+RTGTVWT+SAHIITAVIGSG
Sbjct  1     MGDHTATGNLQLHHNPVFDVSLNVQE--GSNYIDDDGRPKRTGTVWTSSAHIITAVIGSG  58

Query  1559  VLSLAWAIGQLGWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRNYTYMDAVRSNL  1380
             VLSLAWA+ QLGW+AGP VM+LFS + YYTSTLLA CYR  DPV GKRNYTY DAVRSNL
Sbjct  59    VLSLAWAMAQLGWIAGPIVMVLFSFITYYTSTLLAACYR--DPVTGKRNYTYSDAVRSNL  116

Query  1379  GGYQVKICGLIQYFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAF  1200
             G  QVK CG +Q   LFGI+IG+ IAA+ISM+AI+R NC H+SGGKNPCH++ NPYMIAF
Sbjct  117   GALQVKFCGSVQNVALFGISIGFNIAAAISMVAIQRCNCNHKSGGKNPCHININPYMIAF  176

Query  1199  GIIEIILSQIPDFDQIWWLSIVAAVMSFTYSGIGLGLGIAQVVANGAFKGSLTGISIGTV  1020
             GI EI+LSQIP+FD++ WLSIVAAVMSFTYSGIGL LGIA+V  NG  KG++TGI++GTV
Sbjct  177   GISEILLSQIPNFDKLSWLSIVAAVMSFTYSGIGLALGIAKVAENGKIKGNITGITVGTV  236

Query  1019  TETQKIWRSFQALGDIAFAYSYSIILIEIQDTVKSPPSESKTMRKASLFSTIVTTTFYML  840
             T  QK+WR+FQALG+IAFAYSYSIILIEIQDT+KSPPSE KTM+KA+L S  +T+ FY+L
Sbjct  237   TPIQKMWRTFQALGNIAFAYSYSIILIEIQDTIKSPPSEYKTMKKATLLSLTLTSIFYIL  296

Query  839   CGCMGYAAFGDDAPGNLLTGFGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEKWV  660
             CGCMGYAAFGD +PGNLL+  GF+NP+WL++IANAAIVIH+VGAYQV+ QP+FA +EK  
Sbjct  297   CGCMGYAAFGDLSPGNLLSDKGFHNPYWLINIANAAIVIHVVGAYQVFVQPIFALVEKTA  356

Query  659   GAKWPDSEIITKEINLKIPGFGYPYKLNTFRLLWRTAFVLLTTVISMLLPFFNDVVGILG  480
                +PDS+ ITK+I + IPGFG  Y LN FRL+WRT +V++TT+ISM+LPFFNDVVG LG
Sbjct  357   AKVFPDSQFITKDIKIPIPGFGV-YNLNLFRLVWRTFYVIITTLISMILPFFNDVVGFLG  415

Query  479   AFGFWPLTVYFPVRMYISQKKIPKWSTRWICLQMlsgaclavslaaaagsfagvVLDLKL  300
             A  +WPLTVYFPV MYI+QKK+PKWST+WI LQ++S + L ++LAAAAGS  GVV +LK 
Sbjct  416   ALVYWPLTVYFPVEMYIAQKKVPKWSTKWIFLQIISLSVLVIALAAAAGSVTGVVQNLKN  475

Query  299   YRPFKTS  279
             Y+PFKTS
Sbjct  476   YKPFKTS  482



>ref|XP_010266973.1| PREDICTED: amino acid permease 3-like [Nelumbo nucifera]
Length=475

 Score =   656 bits (1693),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 316/424 (75%), Positives = 359/424 (85%), Gaps = 1/424 (0%)
 Frame = -3

Query  1649  KGLDDDGRPQRTGTVWTASAHIITAVIGSGVLSLAWAIGQLGWVAGPSVMLLFSCVVYYT  1470
             K  DDDGR +RTG      +HIITAVIGSGVLSLAWAIGQLGWVAGP+VM+LF+ V++YT
Sbjct  45    KCFDDDGRLKRTGYSLDGVSHIITAVIGSGVLSLAWAIGQLGWVAGPAVMVLFAFVIFYT  104

Query  1469  STLLADCYRAGDPVFGKRNYTYMDAVRSNLGGYQVKICGLIQYFNLFGIAIGYTIAASIS  1290
             S LL+ CYR+ DP  GKRNYTYMDAV++NLGG +  ICG IQY NLFG+AIGYTIAASIS
Sbjct  105   SNLLSQCYRSVDPATGKRNYTYMDAVKANLGGKKFSICGAIQYINLFGVAIGYTIAASIS  164

Query  1289  MMAIKRSNCFHESGGKNPCHMSSNPYMIAFGIIEIILSQIPDFDQIWWLSIVAAVMSFTY  1110
             MMAIKRSNCFH+SGGK+PCHMSSN YMIAFGI E++ SQ PDFDQ+WWLSIVAAVMSFTY
Sbjct  165   MMAIKRSNCFHKSGGKDPCHMSSNEYMIAFGITEVVFSQNPDFDQVWWLSIVAAVMSFTY  224

Query  1109  SGIGLGLGIAQVVANGAFKGSLTGISIGTVTETQKIWRSFQALGDIAFAYSYSIILIEIQ  930
             S +GL LGIA+V  N  FKGSL GISIG VT TQK+WRS QALG IAFAYSYS ILIEIQ
Sbjct  225   STVGLSLGIAKVAENKGFKGSLMGISIGKVTGTQKMWRSLQALGAIAFAYSYSFILIEIQ  284

Query  929   DTVKSPPSESKTMRKASLFSTIVTTTFYMLCGCMGYAAFGDDAPGNLLTGFGFYNPFWLL  750
             DT+KSPP+E KTM+KA+L S  VTT FY+LCGCMGYAAFGDDAPGNLLTGFGFYNP+ LL
Sbjct  285   DTLKSPPAEHKTMKKATLMSISVTTVFYLLCGCMGYAAFGDDAPGNLLTGFGFYNPYRLL  344

Query  749   DIANAAIVIHLVGAYQVYCQPLFAFIEKWVGAKWPDSEIITKEINLKIPGFGYPYKLNTF  570
             DIAN AIV++L+GAYQVYCQPL AF+EKW   KWP SE I KE  + IP +G  YKLN F
Sbjct  345   DIANVAIVVYLIGAYQVYCQPLSAFVEKWSVKKWPRSEFIGKEFEVPIPWYG-CYKLNLF  403

Query  569   RLLWRTAFVLLTTVISMLLPFFNDVVGILGAFGFWPLTVYFPVRMYISQKKIPKWSTRWI  390
             RL+WRT FV +TTV +ML+PFFN VVGI+GAFGFWPLTVYFP+ MYI+QKKI KW+ RW+
Sbjct  404   RLVWRTIFVAVTTVKAMLMPFFNVVVGIMGAFGFWPLTVYFPIEMYIAQKKIEKWTARWV  463

Query  389   CLQM  378
              LQ+
Sbjct  464   GLQI  467



>ref|XP_006662801.1| PREDICTED: amino acid permease 3-like [Oryza brachyantha]
Length=475

 Score =   656 bits (1693),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 328/454 (72%), Positives = 382/454 (84%), Gaps = 8/454 (2%)
 Frame = -3

Query  1640  DDDGRPQRTGTVWTASAHIITAVIGSGVLSLAWAIGQLGWVAGPSVMLLFSCVVYYTSTL  1461
             DDDGRP+RTGTVWTASAHIITAVIGSGVLSLAWAI QLGWVAGP+VMLLF+ V+YYTSTL
Sbjct  27    DDDGRPRRTGTVWTASAHIITAVIGSGVLSLAWAIAQLGWVAGPAVMLLFAFVIYYTSTL  86

Query  1460  LADCYRAGDPVFGKRNYTYMDAVRSNLGGYQVKICGLIQYFNLFGIAIGYTIAASISMMA  1281
             LA+CYR+GDP  GKRNYTYMDAVR+NLGG +V++CG+IQY NLFG+AIGYTIAASISM+A
Sbjct  87    LAECYRSGDPCSGKRNYTYMDAVRANLGGAKVRLCGVIQYANLFGVAIGYTIAASISMLA  146

Query  1280  IKRSNCFHESGGKNPCHMSSNPYMIAFGIIEIILSQIPDFDQIWWLSIVAAVMSFTYSGI  1101
             IKR++CFHE G KN C  SSNPYMI FG +EI+ SQIPDFDQIWWLSIVAA++SFTYS I
Sbjct  147   IKRADCFHEKGHKNACRSSSNPYMILFGAVEIVFSQIPDFDQIWWLSIVAALLSFTYSPI  206

Query  1100  GLGLGIAQVVANGAFKGSLTGISIGT-VTETQKIWRSFQALGDIAFAYSYSIILIEIQDT  924
             GL  GIA  VA+G F GSLTGIS+G  VT  QK+WRS QA GDIAFAYSY+IILIEIQDT
Sbjct  207   GLPSGIAPTVASGGFSGSLTGISVGAGVTSMQKVWRSLQAFGDIAFAYSYAIILIEIQDT  266

Query  923   VKS-PPSESKTMRKASLFSTIVTTTFYMLCGCMGYAAFGDDAPGNLLTGFGFYNPFWLLD  747
             +K+ PPSE+K M++A++ S   TT FYMLCGCMGYAAFGD +P NLLTGFGFY PFWLLD
Sbjct  267   IKAPPPSEAKVMKRATMVSVATTTVFYMLCGCMGYAAFGDRSPDNLLTGFGFYEPFWLLD  326

Query  746   IANAAIVIHLVGAYQVYCQPLFAFIEKWVGAKWPDSEIITKEINLKIPGFGYPYKLNTFR  567
             +ANAAIV+HLVGAYQV+CQP+FAF+E+W  A WPDS  I++E+ +       P  L+ FR
Sbjct  327   VANAAIVVHLVGAYQVFCQPIFAFVERWAAATWPDSGFISREVRVG------PLALSVFR  380

Query  566   LLWRTAFVLLTTVISMLLPFFNDVVGILGAFGFWPLTVYFPVRMYISQKKIPKWSTRWIC  387
             L WRTAFV  TTV+SMLLPFF DVVG+LGA  FWPLTVYFPV MYI+Q+ + + S RW+C
Sbjct  381   LTWRTAFVCATTVVSMLLPFFGDVVGLLGAVSFWPLTVYFPVEMYIAQRGVRRGSARWLC  440

Query  386   LQMlsgaclavslaaaagsfagvVLDLKLYRPFK  285
             L+ LS ACL V++AAAAGS A VV  L++YRPF 
Sbjct  441   LKTLSAACLVVTVAAAAGSIADVVDALRVYRPFS  474



>ref|XP_010546307.1| PREDICTED: amino acid permease 2 isoform X2 [Tarenaya hassleriana]
Length=409

 Score =   653 bits (1685),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 317/409 (78%), Positives = 363/409 (89%), Gaps = 0/409 (0%)
 Frame = -3

Query  1502  MLLFSCVVYYTSTLLADCYRAGDPVFGKRNYTYMDAVRSNLGGYQVKICGLIQYFNLFGI  1323
             MLLFS V YY+STLL+DCYR GDPV GKRNYTYMDAVRS LGG++ KICGLIQY NLFGI
Sbjct  1     MLLFSFVTYYSSTLLSDCYRTGDPVSGKRNYTYMDAVRSILGGFKFKICGLIQYLNLFGI  60

Query  1322  AIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFGIIEIILSQIPDFDQIWWL  1143
             A+GYTIAASISMMAIKRSNCFH+SGGKNPCHMSSNPYMI FG+ EI+LSQIPDFDQIWWL
Sbjct  61    AVGYTIAASISMMAIKRSNCFHKSGGKNPCHMSSNPYMIMFGLTEILLSQIPDFDQIWWL  120

Query  1142  SIVAAVMSFTYSGIGLGLGIAQVVANGAFKGSLTGISIGTVTETQKIWRSFQALGDIAFA  963
             SIVAAVMSFTYS IGL LGI QV ANG FKGSLTGISIGTVTETQKIWRSFQALGDIAFA
Sbjct  121   SIVAAVMSFTYSAIGLSLGILQVTANGFFKGSLTGISIGTVTETQKIWRSFQALGDIAFA  180

Query  962   YSYSIILIEIQDTVKSPPSESKTMRKASLFSTIVTTTFYMLCGCMGYAAFGDDAPGNLLT  783
             YSYS++LIEIQDTV+SPP+ESKTM+KA+  S  VTT FYMLCGCMGYAAFGD APGNLLT
Sbjct  181   YSYSVVLIEIQDTVRSPPAESKTMKKATRISIAVTTMFYMLCGCMGYAAFGDFAPGNLLT  240

Query  782   GFGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEKWVGAKWPDSEIITKEINLKIP  603
             GFG+Y PFWLLD+ANAAIVIHLVGAYQV+CQP+FAF+EKWV  ++P + ++ KE  +++P
Sbjct  241   GFGYYEPFWLLDVANAAIVIHLVGAYQVFCQPIFAFVEKWVSERFPGNGLLGKEFEIRVP  300

Query  602   GFGYPYKLNTFRLLWRTAFVLLTTVISMLLPFFNDVVGILGAFGFWPLTVYFPVRMYISQ  423
             GF  PY+ N FR ++R+ FV+ TTVISML+PFFNDVVGILGA GFWPLTVYFPV MY+ Q
Sbjct  301   GFRAPYRANVFRAVFRSGFVVSTTVISMLMPFFNDVVGILGALGFWPLTVYFPVEMYVRQ  360

Query  422   KKIPKWSTRWICLQMlsgaclavslaaaagsfagvVLDLKLYRPFKTSY  276
             +K+ +WS RW+CLQMLS +CL +S+ A  GS AGV+LDLK+Y+PFK++Y
Sbjct  361   RKVERWSVRWVCLQMLSVSCLVISVVAGVGSIAGVMLDLKVYKPFKSTY  409



>dbj|BAJ86012.1| predicted protein [Hordeum vulgare subsp. vulgare]
 emb|CCI51006.1| amino acid permease [Hordeum vulgare subsp. vulgare]
Length=487

 Score =   656 bits (1693),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 336/475 (71%), Positives = 389/475 (82%), Gaps = 13/475 (3%)
 Frame = -3

Query  1688  LGVSIDAPPLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSGVLSLAWAIGQLGWVAGP  1509
             + VS++A        LDDDGRP+R+GTVWTASAHIITAVIGSGVLSLAWAI QLGW AGP
Sbjct  18    MEVSVEAGNGRESDWLDDDGRPRRSGTVWTASAHIITAVIGSGVLSLAWAIAQLGWAAGP  77

Query  1508  SVMLLFSCVVYYTSTLLADCYRAGDPVFGKRNYTYMDAVRSNLGGYQVKICGLIQYFNLF  1329
             ++MLLF+ V+YYTSTLLA+CYR+GDP  GKR+YTYMDAVRS L G +VK+CG+IQY NL 
Sbjct  78    AIMLLFALVIYYTSTLLAECYRSGDPETGKRHYTYMDAVRSYLPGTKVKLCGVIQYANLV  137

Query  1328  GIAIGYTIAASISMMAIKRSNCFH-----ESGGKNPCHMSSNPYMIAFGIIEIILSQIPD  1164
             G+AIGYTIAASISM A++R++CFH        GK+ C  SSNPYMI FG+++I+ SQIPD
Sbjct  138   GVAIGYTIAASISMRAVRRADCFHYHDVRGRSGKDSCKSSSNPYMIVFGVVQILFSQIPD  197

Query  1163  FDQIWWLSIVAAVMSFTYSGIGLGLGIAQVVANGAFKGSLTGISIGT-VTETQKIWRSFQ  987
             FDQIWWLSIVAAVMSFTYS IGLGLGIAQ VANG  +GSLTG+S+G  VT  QK+WRS Q
Sbjct  198   FDQIWWLSIVAAVMSFTYSTIGLGLGIAQTVANGGIQGSLTGLSVGPGVTSMQKVWRSLQ  257

Query  986   ALGDIAFAYSYSIILIEIQDTVKS-PPSESKTMRKASLFSTIVTTTFYMLCGCMGYAAFG  810
             A G+IAFAYSYSIILIEIQDTVK+ PPSE+K M+KA+  S   TT FYMLCGCMGYAAFG
Sbjct  258   AFGNIAFAYSYSIILIEIQDTVKAPPPSEAKVMKKATGISVATTTVFYMLCGCMGYAAFG  317

Query  809   DDAPGNLLTGFGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEKWVGAKWPDSEII  630
             D AP NLLTGFGFY PFWLLD+ANAAIV+HLVGAYQV+CQPLFAF+EKW  A+WPDS  I
Sbjct  318   DAAPDNLLTGFGFYEPFWLLDVANAAIVVHLVGAYQVFCQPLFAFVEKWAAARWPDSAFI  377

Query  629   TKEINLKIPGFGYPYKLNTFRLLWRTAFVLLTTVISMLLPFFNDVVGILGAFGFWPLTVY  450
              +E+ +       P  ++ FRL WRTAFV LTTV+SMLLPFF DVVG+LGA  FWPLTVY
Sbjct  378   ARELRVG------PLAISVFRLTWRTAFVCLTTVVSMLLPFFGDVVGLLGAVAFWPLTVY  431

Query  449   FPVRMYISQKKIPKWSTRWICLQMlsgaclavslaaaagsfagvVLDLKLYRPFK  285
             FPV MYI Q+ +P+ STRW+CLQMLS ACL VS+AAAAGS A V+ +LK YRPF 
Sbjct  432   FPVEMYIVQRGVPRGSTRWVCLQMLSAACLVVSVAAAAGSIADVIGELKEYRPFS  486



>gb|AAX56952.1| amino acid transporter, partial [Pisum sativum]
Length=468

 Score =   655 bits (1691),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 326/458 (71%), Positives = 381/458 (83%), Gaps = 4/458 (1%)
 Frame = -3

Query  1649  KGLDDDGRPQRTGTVWTASAHIITAVIGSGVLSLAWAIGQLGWVAGPSVMLLFSCVVYYT  1470
             K  DDD R +RTGTVWT S+HIITAV+GSGVLSLAWAI QLGWV GPSVML FS + +YT
Sbjct  15    KLFDDDDRLKRTGTVWTTSSHIITAVVGSGVLSLAWAIAQLGWVIGPSVMLFFSLITWYT  74

Query  1469  STLLADCYRAGDPVFGKRNYTYMDAVRSNLGGYQVKICGLIQYFNLFGIAIGYTIAASIS  1290
             S+LLA+CYR GDP  GKRNYT+M+AV + LGG+   +CG++QY NL+G AIGYTIAA+IS
Sbjct  75    SSLLAECYRIGDPHSGKRNYTFMEAVHTILGGFNDTLCGIVQYSNLYGTAIGYTIAAAIS  134

Query  1289  MMAIKRSNCFHESGGKNPCHMSSNPYMIAFGIIEIILSQIPDFDQIWWLSIVAAVMSFTY  1110
             MMAIKRS CFH SGGK+ CH+SSNPYMI+FG+I+I  SQIPDF ++WWLSIVAA+MSFTY
Sbjct  135   MMAIKRSGCFHSSGGKDGCHISSNPYMISFGVIQIFFSQIPDFHKMWWLSIVAAIMSFTY  194

Query  1109  SGIGLGLGIAQVVANGAFKGSLTGISIGTVTETQKIWRSFQALGDIAFAYSYSIILIEIQ  930
             S IGLGL IA+V  NG+FKGSLTG++IG VTE QK+W  FQALG+IAFAYSYS ILIEIQ
Sbjct  195   SLIGLGLAIAKVAENGSFKGSLTGVTIGMVTEAQKVWGVFQALGNIAFAYSYSQILIEIQ  254

Query  929   DTVKSPPSESKTMRKASLFSTIVTTTFYMLCGCMGYAAFGDDAPGNLLTGFGFYNPFWLL  750
             DT+K+PPSE KTM++A+  S  VTT FYMLCG MGYAAFGD +PGNLLTGFGFYNP+WL+
Sbjct  255   DTIKNPPSEVKTMKQATRISIGVTTIFYMLCGGMGYAAFGDTSPGNLLTGFGFYNPYWLI  314

Query  749   DIANAAIVIHLVGAYQVYCQPLFAFIEKWVGAKWPDSEIITKEINLKIPGFGYPYKLNTF  570
             DIANAAIVIHLVGAYQVY QPLFAF+EK +  +WP    I KE  + IPGF +PY LN F
Sbjct  315   DIANAAIVIHLVGAYQVYAQPLFAFVEKIMIKRWPK---INKEYIVTIPGF-HPYHLNLF  370

Query  569   RLLWRTAFVLLTTVISMLLPFFNDVVGILGAFGFWPLTVYFPVRMYISQKKIPKWSTRWI  390
             RL+WRT FV+ TTVISML+PFFNDV+G++GA GFWPLTVYFPV MYI QKKIPKW+ +WI
Sbjct  371   RLIWRTIFVITTTVISMLIPFFNDVLGLIGAVGFWPLTVYFPVEMYIKQKKIPKWNYKWI  430

Query  389   CLQMlsgaclavslaaaagsfagvVLDLKLYRPFKTSY  276
             C+Q LS  C  VS+ A  GS A +VLDLK Y+PF T Y
Sbjct  431   CMQTLSVICFVVSVVATVGSVASIVLDLKKYKPFTTDY  468



>ref|XP_004977213.1| PREDICTED: amino acid permease 3-like [Setaria italica]
Length=477

 Score =   655 bits (1691),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 331/475 (70%), Positives = 387/475 (81%), Gaps = 8/475 (2%)
 Frame = -3

Query  1703  NHRHHLGVSIDAPPLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSGVLSLAWAIGQLG  1524
             NH   + VS++A      + LDDDGRP+RTGT WTAS+HIITAVIGSGVLSLAWAI QLG
Sbjct  8     NHVAPMEVSVEAGNAGAAEWLDDDGRPRRTGTFWTASSHIITAVIGSGVLSLAWAIAQLG  67

Query  1523  WVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRNYTYMDAVRSNLGGYQVKICGLIQ  1344
             WVAGP+ MLLF+ V YYT+TLLA+CYR GDP  GKRNYTYMDAVRSNLGG +V  CG+IQ
Sbjct  68    WVAGPAAMLLFAFVTYYTATLLAECYRTGDPETGKRNYTYMDAVRSNLGGAKVVFCGVIQ  127

Query  1343  YFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFGIIEIILSQIPD  1164
             Y NL G+AIGYTIA+SISM AI+R++CFH +G  +PC  SS PYMI FG+++I+ SQIPD
Sbjct  128   YANLVGVAIGYTIASSISMRAIRRADCFHTNGHADPCKSSSTPYMILFGVVQILFSQIPD  187

Query  1163  FDQIWWLSIVAAVMSFTYSGIGLGLGIAQVVANGAFKGSLTGISIGT-VTETQKIWRSFQ  987
             FDQIWWLSIVAAVMSFTYS IGL LGIAQ ++NG FKGSLTG+SIG  VT TQKIW S Q
Sbjct  188   FDQIWWLSIVAAVMSFTYSSIGLSLGIAQTISNGGFKGSLTGVSIGADVTSTQKIWHSLQ  247

Query  986   ALGDIAFAYSYSIILIEIQDTVKS-PPSESKTMRKASLFSTIVTTTFYMLCGCMGYAAFG  810
             A GDIAFAYS+S ILIEIQDT+K+ PPSESK M+KA+  S   TT FYMLCGCMGYAAFG
Sbjct  248   AFGDIAFAYSFSNILIEIQDTIKAPPPSESKVMQKATRLSVATTTIFYMLCGCMGYAAFG  307

Query  809   DDAPGNLLTGFGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEKWVGAKWPDSEII  630
             D+AP NLLTGFGFY PFWLLD+AN AIV+HLVGAYQV+CQP+FAF+E+   A WPDS  I
Sbjct  308   DNAPDNLLTGFGFYEPFWLLDVANVAIVVHLVGAYQVFCQPIFAFVERRAAAAWPDSAFI  367

Query  629   TKEINLKIPGFGYPYKLNTFRLLWRTAFVLLTTVISMLLPFFNDVVGILGAFGFWPLTVY  450
             +KE+ +       P+ L+ FRL WR+AFV +TTV++MLLPFF +VVG LGA  FWPLTVY
Sbjct  368   SKEVRVG------PFALSVFRLTWRSAFVCVTTVVAMLLPFFGNVVGFLGAVSFWPLTVY  421

Query  449   FPVRMYISQKKIPKWSTRWICLQMlsgaclavslaaaagsfagvVLDLKLYRPFK  285
             FPV MYI Q+++P+ ST+WICLQMLS  CL VS+AAAAGS A V+  LK+YRPF 
Sbjct  422   FPVEMYIKQRRVPRGSTKWICLQMLSVGCLIVSIAAAAGSIADVIAALKVYRPFS  476



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 5719068280782