BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c80613_g1_i1 len=828 path=[806:0-827]

Length=828
                                                                      Score     E

ref|XP_009783756.1|  PREDICTED: uncharacterized protein LOC104232282    169   5e-48   
ref|XP_009613648.1|  PREDICTED: uncharacterized protein LOC104106740    168   1e-47   
ref|XP_009794767.1|  PREDICTED: uncharacterized protein LOC104241517    167   4e-47   
gb|KHN12948.1|  hypothetical protein glysoja_042216                     166   1e-46   
ref|XP_009627921.1|  PREDICTED: uncharacterized protein LOC104118395    166   1e-46   
ref|XP_006339001.1|  PREDICTED: uncharacterized protein LOC102585649    166   1e-46   
gb|AFK35102.1|  unknown                                                 165   1e-46   
ref|XP_009358815.1|  PREDICTED: uncharacterized protein LOC103949427    166   1e-46   
ref|NP_001242705.1|  uncharacterized protein LOC100815307 precursor     164   2e-46   
ref|XP_010101846.1|  hypothetical protein L484_023636                   164   2e-46   
ref|XP_008388101.1|  PREDICTED: uncharacterized protein LOC103450515    164   4e-46   
emb|CDP06536.1|  unnamed protein product                                164   5e-46   
ref|XP_004249554.1|  PREDICTED: uncharacterized protein LOC101267755    164   5e-46   
ref|XP_007026832.1|  PAR1 protein                                       163   6e-46   
gb|KHN27004.1|  hypothetical protein glysoja_040812                     163   9e-46   
ref|NP_001238081.1|  uncharacterized protein LOC100500181 precursor     162   3e-45   
ref|XP_003604797.1|  hypothetical protein MTR_4g018880                  161   5e-45   
gb|AFK48062.1|  unknown                                                 161   5e-45   
ref|XP_004506651.1|  PREDICTED: uncharacterized protein LOC101492243    160   9e-45   
ref|XP_007133951.1|  hypothetical protein PHAVU_010G006000g             160   1e-44   
gb|KHF97273.1|  hypothetical protein F383_36747                         160   1e-44   
ref|XP_008442484.1|  PREDICTED: uncharacterized protein LOC103486338    159   2e-44   
ref|XP_004137744.1|  PREDICTED: uncharacterized protein LOC101218677    159   5e-44   
ref|XP_011012958.1|  PREDICTED: uncharacterized protein LOC105117111    158   6e-44   
ref|XP_004302677.1|  PREDICTED: uncharacterized protein LOC101299015    158   6e-44   
ref|XP_011008006.1|  PREDICTED: uncharacterized protein LOC105113506    158   8e-44   
ref|XP_002309105.2|  hypothetical protein POPTR_0006s09540g             158   1e-43   Populus trichocarpa [western balsam poplar]
ref|XP_008239896.1|  PREDICTED: uncharacterized protein LOC103338466    158   1e-43   
ref|XP_007207936.1|  hypothetical protein PRUPE_ppa017583mg             158   1e-43   
gb|KDP24516.1|  hypothetical protein JCGZ_25080                         157   3e-43   
ref|XP_002323542.2|  hypothetical protein POPTR_0016s11600g             156   3e-43   Populus trichocarpa [western balsam poplar]
ref|XP_002276542.1|  PREDICTED: uncharacterized protein LOC100246012    156   6e-43   Vitis vinifera
ref|XP_011019183.1|  PREDICTED: uncharacterized protein LOC105121988    155   1e-42   
ref|XP_009370270.1|  PREDICTED: uncharacterized protein LOC103959642    154   2e-42   
ref|XP_010262709.1|  PREDICTED: uncharacterized protein LOC104601167    155   2e-42   
ref|XP_009370269.1|  PREDICTED: uncharacterized protein LOC103959641    154   2e-42   
ref|XP_006848036.1|  hypothetical protein AMTR_s00029p00186810          154   3e-42   
ref|XP_008239908.1|  PREDICTED: uncharacterized protein LOC103338475    161   3e-42   
ref|XP_006429255.1|  hypothetical protein CICLE_v10012857mg             154   3e-42   
ref|XP_006488680.1|  PREDICTED: uncharacterized protein DDB_G0271...    155   4e-42   
ref|XP_009787582.1|  PREDICTED: uncharacterized protein LOC104235494    153   4e-42   
ref|XP_006349478.1|  PREDICTED: uncharacterized protein LOC102591129    153   5e-42   
ref|XP_009421325.1|  PREDICTED: uncharacterized protein LOC104000897    153   7e-42   
ref|XP_007038703.1|  PAR1 protein                                       152   1e-41   
ref|XP_010553064.1|  PREDICTED: uncharacterized protein LOC104823275    152   1e-41   
gb|KHG02999.1|  ATP-dependent RNA helicase dbp6                         152   1e-41   
ref|XP_009388026.1|  PREDICTED: uncharacterized protein LOC103974853    152   1e-41   
ref|XP_007143423.1|  hypothetical protein PHAVU_007G071100g             152   1e-41   
ref|XP_006421929.1|  hypothetical protein CICLE_v10005988mg             152   2e-41   
ref|XP_003604795.1|  hypothetical protein MTR_4g018860                  152   2e-41   
ref|XP_003604794.1|  hypothetical protein MTR_4g018850                  152   3e-41   
ref|XP_010044045.1|  PREDICTED: uncharacterized protein LOC104433099    150   1e-40   
ref|XP_004249680.1|  PREDICTED: uncharacterized protein LOC101253546    149   1e-40   
ref|XP_010256734.1|  PREDICTED: uncharacterized protein LOC104597044    149   1e-40   
gb|KHG11879.1|  uncharacterized protein F383_20075                      150   2e-40   
ref|XP_011077605.1|  PREDICTED: uncharacterized protein LOC105161572    149   2e-40   
gb|EYU41813.1|  hypothetical protein MIMGU_mgv1a014652mg                149   2e-40   
gb|ABK21049.1|  unknown                                                 149   3e-40   Picea sitchensis
ref|XP_010905376.1|  PREDICTED: uncharacterized protein LOC105032593    149   4e-40   
gb|KEH23077.1|  PAR1 protein                                            148   4e-40   
ref|XP_008370129.1|  PREDICTED: uncharacterized protein LOC103433639    150   4e-40   
gb|EYU26632.1|  hypothetical protein MIMGU_mgv1a014768mg                148   5e-40   
ref|XP_010035143.1|  PREDICTED: uncharacterized protein LOC104424423    148   6e-40   
emb|CAA58731.1|  PAR-1b                                                 148   7e-40   Nicotiana tabacum [American tobacco]
ref|NP_001241627.1|  uncharacterized protein LOC100787709 precursor     148   8e-40   
ref|XP_006361911.1|  PREDICTED: uncharacterized protein LOC102603240    147   9e-40   
ref|XP_009340031.1|  PREDICTED: uncharacterized protein LOC103932...    148   9e-40   
ref|XP_008811495.1|  PREDICTED: uncharacterized protein LOC103722643    148   1e-39   
gb|KHF98264.1|  Cytosolic beta-glucosidase                              147   1e-39   
ref|XP_010060939.1|  PREDICTED: uncharacterized protein LOC104448745    147   1e-39   
gb|AFK41674.1|  unknown                                                 147   2e-39   
gb|ABK26953.1|  unknown                                                 148   2e-39   Picea sitchensis
ref|XP_010035141.1|  PREDICTED: uncharacterized protein LOC104424421    147   2e-39   
ref|XP_010035139.1|  PREDICTED: uncharacterized protein LOC104424419    147   2e-39   
ref|XP_010529780.1|  PREDICTED: uncharacterized protein LOC104806532    146   2e-39   
gb|KDP46577.1|  hypothetical protein JCGZ_08549                         147   2e-39   
ref|XP_010039173.1|  PREDICTED: uncharacterized protein LOC104427850    149   2e-39   
gb|KCW49488.1|  hypothetical protein EUGRSUZ_K03007                     149   2e-39   
ref|XP_010035140.1|  PREDICTED: uncharacterized protein LOC104424420    146   2e-39   
ref|XP_010035142.1|  PREDICTED: uncharacterized protein LOC104424422    146   3e-39   
ref|XP_010908211.1|  PREDICTED: uncharacterized protein LOC105034670    146   3e-39   
gb|KEH26321.1|  PAR1 protein                                            146   3e-39   
ref|XP_008798941.1|  PREDICTED: uncharacterized protein LOC103713707    146   4e-39   
ref|XP_010553262.1|  PREDICTED: uncharacterized protein LOC104823394    145   5e-39   
ref|XP_009774343.1|  PREDICTED: uncharacterized protein LOC104224406    145   5e-39   
gb|ABK26944.1|  unknown                                                 146   6e-39   Picea sitchensis
ref|XP_010662746.1|  PREDICTED: uncharacterized protein LOC100254...    145   6e-39   
ref|XP_003555381.1|  PREDICTED: uncharacterized protein LOC100784217    145   7e-39   
ref|XP_008377489.1|  PREDICTED: uncharacterized protein LOC103440565    146   7e-39   
ref|XP_002267610.1|  PREDICTED: uncharacterized protein LOC100251502    145   7e-39   Vitis vinifera
ref|XP_002510782.1|  conserved hypothetical protein                     145   7e-39   Ricinus communis
ref|XP_004234399.1|  PREDICTED: uncharacterized protein LOC101252465    145   7e-39   
emb|CBI22723.3|  unnamed protein product                                145   8e-39   
ref|XP_004496561.1|  PREDICTED: uncharacterized protein LOC101495651    145   9e-39   
ref|XP_004308085.1|  PREDICTED: uncharacterized protein LOC101293047    145   1e-38   
ref|XP_009604561.1|  PREDICTED: uncharacterized protein LOC104099311    145   1e-38   
ref|XP_009599617.1|  PREDICTED: uncharacterized protein LOC104095236    145   1e-38   
ref|XP_009599697.1|  PREDICTED: uncharacterized protein LOC104095302    144   1e-38   
ref|XP_010923167.1|  PREDICTED: uncharacterized protein LOC105046...    145   1e-38   
ref|XP_006587314.1|  PREDICTED: uncharacterized protein LOC100778782    144   2e-38   
emb|CAA58732.1|  PAR-1c                                                 144   2e-38   Nicotiana tabacum [American tobacco]
emb|CDX76173.1|  BnaA04g04370D                                          144   2e-38   
ref|XP_010662745.1|  PREDICTED: uncharacterized protein LOC100254...    144   3e-38   
ref|XP_009770389.1|  PREDICTED: uncharacterized protein LOC104221096    144   3e-38   
ref|XP_002267611.1|  PREDICTED: uncharacterized protein LOC100254...    143   4e-38   Vitis vinifera
ref|XP_009139268.1|  PREDICTED: uncharacterized protein LOC103863265    143   4e-38   
ref|XP_011094948.1|  PREDICTED: uncharacterized protein LOC105174517    143   4e-38   
ref|XP_008234242.1|  PREDICTED: uncharacterized protein LOC103333213    144   5e-38   
ref|XP_006827667.1|  hypothetical protein AMTR_s00009p00254330          143   5e-38   
ref|XP_002279995.1|  PREDICTED: uncharacterized protein LOC100267406    143   5e-38   Vitis vinifera
gb|KDP22273.1|  hypothetical protein JCGZ_26104                         143   5e-38   
ref|XP_002877953.1|  hypothetical protein ARALYDRAFT_485800             143   6e-38   
ref|XP_006353293.1|  PREDICTED: uncharacterized protein LOC102592141    143   6e-38   
ref|XP_006424982.1|  hypothetical protein CICLE_v10029842mg             142   7e-38   
emb|CAA58733.1|  PAR-1a                                                 142   8e-38   Nicotiana tabacum [American tobacco]
ref|XP_006388430.1|  hypothetical protein POPTR_0187s00200g             142   8e-38   
ref|XP_009139267.1|  PREDICTED: uncharacterized protein LOC103863264    142   9e-38   
ref|XP_003592283.1|  PAR-1a protein                                     143   1e-37   
ref|XP_007218440.1|  hypothetical protein PRUPE_ppa011685mg             142   1e-37   
emb|CDY66558.1|  BnaC08g48820D                                          142   1e-37   
gb|EYU25099.1|  hypothetical protein MIMGU_mgv1a014446mg                142   1e-37   
ref|XP_009342968.1|  PREDICTED: uncharacterized protein LOC103934926    142   1e-37   
ref|XP_010909892.1|  PREDICTED: uncharacterized protein LOC105035875    142   1e-37   
ref|XP_004234398.1|  PREDICTED: uncharacterized protein LOC101252153    142   1e-37   
ref|XP_008376590.1|  PREDICTED: uncharacterized protein LOC103439761    142   2e-37   
ref|XP_009103899.1|  PREDICTED: uncharacterized protein LOC103829...    142   2e-37   
ref|XP_011085664.1|  PREDICTED: uncharacterized protein LOC105167590    143   2e-37   
gb|EYU27489.1|  hypothetical protein MIMGU_mgv1a014649mg                141   3e-37   
gb|AFK34890.1|  unknown                                                 141   3e-37   
emb|CDP05191.1|  unnamed protein product                                141   3e-37   
ref|XP_010515917.1|  PREDICTED: uncharacterized protein LOC104791676    140   4e-37   
emb|CDY13179.1|  BnaC04g26560D                                          140   4e-37   
ref|XP_011073216.1|  PREDICTED: uncharacterized protein LOC105158240    140   5e-37   
ref|XP_006291916.1|  hypothetical protein CARUB_v10018100mg             140   5e-37   
ref|XP_011030114.1|  PREDICTED: uncharacterized protein LOC105129658    140   5e-37   
emb|CDY60770.1|  BnaAnng17210D                                          140   6e-37   
ref|XP_008785460.1|  PREDICTED: uncharacterized protein LOC103704086    140   6e-37   
ref|XP_010046385.1|  PREDICTED: uncharacterized protein LOC104435305    140   7e-37   
ref|XP_011078704.1|  PREDICTED: uncharacterized protein LOC105162404    139   7e-37   
gb|KFK26839.1|  hypothetical protein AALP_AA8G300600                    140   7e-37   
emb|CDY07560.1|  BnaC06g15040D                                          140   7e-37   
ref|XP_002322474.1|  hypothetical protein POPTR_0015s13050g             140   8e-37   Populus trichocarpa [western balsam poplar]
ref|XP_011073591.1|  PREDICTED: uncharacterized protein LOC105158505    140   9e-37   
ref|XP_009601817.1|  PREDICTED: uncharacterized protein LOC104097019    140   9e-37   
ref|XP_002862543.1|  hypothetical protein ARALYDRAFT_920570             140   1e-36   
ref|XP_008778806.1|  PREDICTED: uncharacterized protein LOC103698551    140   1e-36   
gb|KEH28949.1|  PAR1 protein                                            138   1e-36   
ref|XP_006288746.1|  hypothetical protein CARUB_v10002062mg             139   1e-36   
ref|XP_008794209.1|  PREDICTED: uncharacterized protein LOC103710316    140   2e-36   
ref|XP_011048721.1|  PREDICTED: uncharacterized protein LOC105142675    139   2e-36   
ref|XP_010423911.1|  PREDICTED: uncharacterized protein LOC104708952    139   2e-36   
ref|XP_002865911.1|  hypothetical protein ARALYDRAFT_918281             139   2e-36   
ref|XP_011073219.1|  PREDICTED: uncharacterized protein LOC105158242    138   2e-36   
ref|XP_011073217.1|  PREDICTED: uncharacterized protein LOC105158241    139   2e-36   
ref|XP_010273059.1|  PREDICTED: uncharacterized protein LOC104608702    139   2e-36   
ref|NP_190972.1|  PAR1 protein                                          139   2e-36   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011094949.1|  PREDICTED: uncharacterized protein LOC105174518    138   3e-36   
ref|XP_010909577.1|  PREDICTED: uncharacterized protein LOC105035650    139   3e-36   
ref|NP_200052.1|  PAR1 protein                                          139   3e-36   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010490608.1|  PREDICTED: uncharacterized protein LOC104768360    138   3e-36   
ref|XP_011073209.1|  PREDICTED: uncharacterized protein LOC105158232    138   3e-36   
ref|XP_011073208.1|  PREDICTED: uncharacterized protein LOC105158231    138   3e-36   
ref|XP_006401831.1|  hypothetical protein EUTSA_v10014733mg             139   3e-36   
ref|XP_011073214.1|  PREDICTED: uncharacterized protein LOC105158237    138   4e-36   
gb|AAM62984.1|  photoassimilate-responsive protein PAR-like protein     138   4e-36   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011032296.1|  PREDICTED: uncharacterized protein LOC105131158    138   5e-36   
ref|XP_011076161.1|  PREDICTED: uncharacterized protein LOC105160472    138   5e-36   
emb|CDY60088.1|  BnaC02g45000D                                          138   6e-36   
ref|XP_010427069.1|  PREDICTED: uncharacterized protein LOC104711981    137   6e-36   
ref|XP_009590873.1|  PREDICTED: uncharacterized protein LOC104087977    138   7e-36   
ref|XP_002318235.1|  hypothetical protein POPTR_0012s13140g             137   9e-36   Populus trichocarpa [western balsam poplar]
ref|XP_010482600.1|  PREDICTED: uncharacterized protein LOC104761...    137   9e-36   
ref|XP_011045688.1|  PREDICTED: uncharacterized protein LOC105140517    136   1e-35   
ref|XP_010934761.1|  PREDICTED: uncharacterized protein LOC105054842    138   2e-35   
ref|XP_009763985.1|  PREDICTED: uncharacterized protein LOC104215...    137   2e-35   
ref|XP_002314136.2|  hypothetical protein POPTR_0009s04480g             136   2e-35   Populus trichocarpa [western balsam poplar]
gb|EPS70832.1|  hypothetical protein M569_03929                         136   2e-35   
ref|XP_008806881.1|  PREDICTED: uncharacterized protein LOC103719421    136   2e-35   
ref|XP_009127249.1|  PREDICTED: uncharacterized protein LOC103852106    137   2e-35   
ref|XP_010482599.1|  PREDICTED: uncharacterized protein LOC104761...    136   3e-35   
gb|AFG47202.1|  hypothetical protein 0_8609_01                          134   4e-35   
ref|XP_006358715.1|  PREDICTED: uncharacterized protein LOC102594490    135   4e-35   
ref|XP_008439229.1|  PREDICTED: uncharacterized protein LOC103484080    135   4e-35   
ref|XP_010444786.1|  PREDICTED: uncharacterized protein LOC104727386    135   5e-35   
ref|XP_011094947.1|  PREDICTED: uncharacterized protein LOC105174516    135   5e-35   
ref|XP_004230259.1|  PREDICTED: uncharacterized protein LOC101259981    137   6e-35   
gb|AFG47187.1|  hypothetical protein 0_8609_01                          134   7e-35   
gb|AFG47186.1|  hypothetical protein 0_8609_01                          133   8e-35   
ref|XP_011073213.1|  PREDICTED: uncharacterized protein LOC105158236    134   9e-35   
emb|CDP09132.1|  unnamed protein product                                134   1e-34   
ref|XP_006388432.1|  hypothetical protein POPTR_0187s00220g             134   1e-34   
ref|XP_004140776.1|  PREDICTED: uncharacterized protein LOC101216404    135   1e-34   
ref|XP_006358727.1|  PREDICTED: uncharacterized protein LOC102598423    135   1e-34   
ref|XP_004140837.1|  PREDICTED: uncharacterized protein LOC101212311    134   1e-34   
ref|XP_011081437.1|  PREDICTED: uncharacterized protein LOC105164481    134   1e-34   
ref|XP_011073221.1|  PREDICTED: uncharacterized protein LOC105158244    134   2e-34   
ref|XP_004157223.1|  PREDICTED: uncharacterized protein LOC101232096    134   2e-34   
ref|XP_011073223.1|  PREDICTED: uncharacterized protein LOC105158246    133   2e-34   
ref|XP_010671873.1|  PREDICTED: uncharacterized protein LOC104888552    134   2e-34   
ref|XP_011073211.1|  PREDICTED: uncharacterized protein LOC105158234    133   2e-34   
ref|XP_004157197.1|  PREDICTED: uncharacterized protein LOC101225828    134   2e-34   
ref|XP_010255407.1|  PREDICTED: uncharacterized protein LOC104596084    134   2e-34   
gb|ABK22647.1|  unknown                                                 134   3e-34   Picea sitchensis
ref|XP_011073210.1|  PREDICTED: uncharacterized protein LOC105158233    132   4e-34   
ref|XP_010671872.1|  PREDICTED: uncharacterized protein LOC104888551    134   4e-34   
gb|EYU38454.1|  hypothetical protein MIMGU_mgv1a024144mg                132   4e-34   
ref|XP_006388431.1|  hypothetical protein POPTR_0187s00210g             132   5e-34   
ref|XP_008439231.1|  PREDICTED: uncharacterized protein LOC103484081    133   5e-34   
ref|XP_008649530.1|  PREDICTED: uncharacterized protein LOC103630240    132   6e-34   
emb|CDY27075.1|  BnaA02g10950D                                          137   7e-34   
ref|XP_004240617.1|  PREDICTED: uncharacterized protein LOC101257567    132   8e-34   
ref|XP_002439633.1|  hypothetical protein SORBIDRAFT_09g017290          132   8e-34   Sorghum bicolor [broomcorn]
ref|XP_006363092.1|  PREDICTED: uncharacterized protein LOC102590619    132   8e-34   
ref|XP_006363091.1|  PREDICTED: uncharacterized protein LOC102590281    131   1e-33   
ref|XP_004962356.1|  PREDICTED: uncharacterized protein LOC101785352    132   1e-33   
ref|XP_010452028.1|  PREDICTED: uncharacterized protein LOC104734198    132   1e-33   
ref|XP_011073212.1|  PREDICTED: uncharacterized protein LOC105158235    130   2e-33   
ref|XP_006281102.1|  hypothetical protein CARUB_v10027132mg             132   2e-33   
ref|XP_010255408.1|  PREDICTED: uncharacterized protein LOC104596085    130   2e-33   
ref|XP_011073222.1|  PREDICTED: uncharacterized protein LOC105158245    130   3e-33   
ref|XP_002520453.1|  conserved hypothetical protein                     130   3e-33   Ricinus communis
ref|XP_011073220.1|  PREDICTED: uncharacterized protein LOC105158243    130   3e-33   
ref|XP_006848035.1|  hypothetical protein AMTR_s00029p00186480          127   2e-32   
gb|ABK24725.1|  unknown                                                 128   2e-32   Picea sitchensis
gb|ABK27044.1|  unknown                                                 128   2e-32   Picea sitchensis
ref|XP_010537178.1|  PREDICTED: LOW QUALITY PROTEIN: sulfated sur...    129   2e-32   
emb|CDY13175.1|  BnaC04g26600D                                          128   3e-32   
gb|KDO52035.1|  hypothetical protein CISIN_1g029827mg                   127   5e-32   
ref|XP_010923168.1|  PREDICTED: uncharacterized protein LOC105046...    127   5e-32   
ref|XP_010326144.1|  PREDICTED: uncharacterized protein LOC101261443    127   5e-32   
ref|XP_006403624.1|  hypothetical protein EUTSA_v10010808mg             125   7e-32   
ref|XP_010504193.1|  PREDICTED: uncharacterized protein LOC104781266    125   8e-32   
emb|CDP09133.1|  unnamed protein product                                126   9e-32   
ref|XP_004246366.2|  PREDICTED: uncharacterized protein LOC101261147    126   1e-31   
gb|KGN57378.1|  hypothetical protein Csa_3G182140                       125   2e-31   
ref|XP_010923170.1|  PREDICTED: uncharacterized protein LOC105046...    124   3e-31   
ref|XP_009420109.1|  PREDICTED: uncharacterized protein LOC103999932    126   4e-31   
ref|XP_009103900.1|  PREDICTED: uncharacterized protein LOC103829...    124   6e-31   
ref|XP_010923169.1|  PREDICTED: uncharacterized protein LOC105046...    123   1e-30   
ref|XP_001775001.1|  predicted protein                                  121   2e-30   
emb|CDP09118.1|  unnamed protein product                                127   2e-30   
ref|XP_009788534.1|  PREDICTED: uncharacterized protein LOC104236325    122   3e-30   
ref|XP_009629076.1|  PREDICTED: uncharacterized protein LOC104119315    121   7e-30   
ref|XP_009763986.1|  PREDICTED: uncharacterized protein LOC104215...    121   1e-29   
ref|XP_002993093.1|  hypothetical protein SELMODRAFT_431237             116   9e-28   
emb|CDP09117.1|  unnamed protein product                                115   1e-27   
ref|XP_002971753.1|  hypothetical protein SELMODRAFT_412334             114   5e-27   
ref|XP_010040888.1|  PREDICTED: uncharacterized protein LOC104429762    115   5e-27   
ref|XP_002971544.1|  hypothetical protein SELMODRAFT_412333             114   6e-27   
ref|XP_002993113.1|  hypothetical protein SELMODRAFT_48837              111   1e-26   
ref|XP_010108343.1|  hypothetical protein L484_006498                   113   2e-26   
ref|XP_007152257.1|  hypothetical protein PHAVU_004G1144000g            110   3e-26   
gb|AFW78200.1|  hypothetical protein ZEAMMB73_055272                    111   6e-26   
ref|XP_002439898.1|  hypothetical protein SORBIDRAFT_09g022170          110   1e-25   Sorghum bicolor [broomcorn]
ref|XP_002439897.1|  hypothetical protein SORBIDRAFT_09g022160          109   2e-25   Sorghum bicolor [broomcorn]
ref|XP_006403623.1|  hypothetical protein EUTSA_v10011155mg             108   2e-25   
ref|XP_002975599.1|  hypothetical protein SELMODRAFT_103819             108   3e-25   
ref|XP_002300182.2|  hypothetical protein POPTR_0001s32040g             106   6e-25   Populus trichocarpa [western balsam poplar]
ref|XP_011032294.1|  PREDICTED: uncharacterized protein LOC105131157    107   9e-25   
gb|KCW44819.1|  hypothetical protein EUGRSUZ_L01611                     105   2e-24   
ref|XP_002973571.1|  hypothetical protein SELMODRAFT_99579              105   4e-24   
ref|XP_002527887.1|  conserved hypothetical protein                     103   8e-24   Ricinus communis
ref|XP_002439894.1|  hypothetical protein SORBIDRAFT_09g022140          101   1e-22   Sorghum bicolor [broomcorn]
ref|XP_008352803.1|  PREDICTED: TMV resistance protein N-like           101   2e-20   
gb|AEW08582.1|  hypothetical protein CL606Contig1_05                  93.2    3e-20   
gb|AFG71371.1|  hypothetical protein CL606Contig1_05                  90.5    3e-19   
gb|AFG71360.1|  hypothetical protein CL606Contig1_05                  89.7    6e-19   
gb|AFG71365.1|  hypothetical protein CL606Contig1_05                  88.6    1e-18   
ref|XP_010058903.1|  PREDICTED: uncharacterized protein LOC104446793  91.3    2e-18   
ref|XP_002439896.1|  hypothetical protein SORBIDRAFT_09g022150        90.1    4e-18   Sorghum bicolor [broomcorn]
gb|AFG71368.1|  hypothetical protein CL606Contig1_05                  86.7    6e-18   
ref|XP_010446049.1|  PREDICTED: uncharacterized protein LOC104728819  79.0    6e-15   
gb|AFG65028.1|  hypothetical protein CL4404Contig1_01                 77.4    1e-14   
gb|KHN23208.1|  hypothetical protein glysoja_042488                   65.9    2e-10   
gb|AEW08703.1|  hypothetical protein CL1287Contig1_05                 63.9    6e-10   
gb|AFG70528.1|  hypothetical protein CL1287Contig1_05                 62.4    3e-09   
ref|XP_002439895.1|  hypothetical protein SORBIDRAFT_09g022145        57.4    3e-07   Sorghum bicolor [broomcorn]
gb|KEH23075.1|  PAR1 protein                                          51.6    2e-05   
emb|CBI16024.3|  unnamed protein product                              51.2    4e-05   
ref|XP_011079320.1|  PREDICTED: uncharacterized protein LOC105162865  51.2    1e-04   
gb|AGW97932.1|  maturase K                                            36.2    2e-04   
gb|ADX99053.1|  maturase K                                            52.0    2e-04   
gb|ADX99069.1|  maturase K                                            52.0    3e-04   
gb|ADX99070.1|  maturase K                                            52.0    3e-04   



>ref|XP_009783756.1| PREDICTED: uncharacterized protein LOC104232282 [Nicotiana sylvestris]
Length=174

 Score =   169 bits (427),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 81/134 (60%), Positives = 104/134 (78%), Gaps = 3/134 (2%)
 Frame = -1

Query  726  EIICENLPISTCAFSVSSYGKRCLIEDTVLLDGKVDYKCKTSEVVVGSSTSDYIETDKCV  547
            EIICENLP + CAFS++S GKRCL+E + L DGK +Y+CKTSEV+VG+   +YIETD+CV
Sbjct  25   EIICENLPTNICAFSIASSGKRCLLEKSTLEDGKSEYQCKTSEVIVGN-MREYIETDECV  83

Query  546  KTCGVDRKSVGMSSDPFLDSLFMAKLCARACYDYCPNLVDLYANIAAGEGVFLPELCEQI  367
              CGVDR SVG+SSD  L++ F +KLC+  CY  CPN+VDLY N+AAGEGV+LP+LC++ 
Sbjct  84   NACGVDRNSVGISSDSLLEAQFTSKLCSPDCYHKCPNVVDLYFNLAAGEGVYLPDLCKKQ  143

Query  366  RSGEGSRRGMAEIQ  325
            RS     R M E+Q
Sbjct  144  RS--NPHRAMIELQ  155



>ref|XP_009613648.1| PREDICTED: uncharacterized protein LOC104106740 [Nicotiana tomentosiformis]
Length=174

 Score =   168 bits (425),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 80/134 (60%), Positives = 104/134 (78%), Gaps = 3/134 (2%)
 Frame = -1

Query  726  EIICENLPISTCAFSVSSYGKRCLIEDTVLLDGKVDYKCKTSEVVVGSSTSDYIETDKCV  547
            EIICENLP + CAFS++S GKRCL+E + L DGK +Y+CKTSEV+VG+   +YIETD+CV
Sbjct  25   EIICENLPTNVCAFSIASSGKRCLLEKSALEDGKSEYQCKTSEVIVGN-MREYIETDECV  83

Query  546  KTCGVDRKSVGMSSDPFLDSLFMAKLCARACYDYCPNLVDLYANIAAGEGVFLPELCEQI  367
              CGVDR SVG+SSD  L++ F +KLC+  CY  CPN+VDLY N+AAGEGV+LP+LC++ 
Sbjct  84   NACGVDRNSVGISSDSLLEAQFTSKLCSPDCYHKCPNVVDLYFNLAAGEGVYLPDLCKKQ  143

Query  366  RSGEGSRRGMAEIQ  325
            R+     R M E+Q
Sbjct  144  RT--NPHRAMIELQ  155



>ref|XP_009794767.1| PREDICTED: uncharacterized protein LOC104241517 [Nicotiana sylvestris]
Length=181

 Score =   167 bits (422),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 81/133 (61%), Positives = 103/133 (77%), Gaps = 3/133 (2%)
 Frame = -1

Query  726  EIICENLPISTCAFSVSSYGKRCLIEDTVLLDGKVDYKCKTSEVVVGSSTSDYIETDKCV  547
            EIICENLP + C+FS++S GKRCL+E++   DGK++Y+CKTSEVVVG+  ++YIETD+CV
Sbjct  21   EIICENLPKNVCSFSIASSGKRCLLENSANNDGKMEYQCKTSEVVVGN-MAEYIETDECV  79

Query  546  KTCGVDRKSVGMSSDPFLDSLFMAKLCARACYDYCPNLVDLYANIAAGEGVFLPELCEQI  367
              CGVDR SVG+SSD  L+  F AKLC+  CY  CPN+VDLY N+AAGEGV+LPELC + 
Sbjct  80   NACGVDRNSVGISSDSLLEPHFTAKLCSPPCYQNCPNVVDLYFNLAAGEGVYLPELCNKQ  139

Query  366  RSGEGSRRGMAEI  328
            RS     R M E+
Sbjct  140  RS--SPHRAMIEL  150



>gb|KHN12948.1| hypothetical protein glysoja_042216 [Glycine soja]
Length=180

 Score =   166 bits (419),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 79/134 (59%), Positives = 101/134 (75%), Gaps = 3/134 (2%)
 Frame = -1

Query  729  SEIICENLPISTCAFSVSSYGKRCLIEDTVLLDGKVDYKCKTSEVVVGSSTSDYIETDKC  550
            +E++CE+LP   CAFSV+S GKRCL+E     DG V+Y+C+TSEVVV    +DYIETD+C
Sbjct  23   AEMVCEDLPKEVCAFSVASSGKRCLLETEKAADGGVEYQCRTSEVVV-ERMADYIETDQC  81

Query  549  VKTCGVDRKSVGMSSDPFLDSLFMAKLCARACYDYCPNLVDLYANIAAGEGVFLPELCEQ  370
            V+ CGVDR SVG+SSD F +  F  KLC+ ACY  CPN+VDL+ N+AAGEGVFLPELCE+
Sbjct  82   VEACGVDRNSVGISSDAFFEPQFTGKLCSPACYQKCPNIVDLFFNLAAGEGVFLPELCEK  141

Query  369  IRSGEGSRRGMAEI  328
             ++    RR M E+
Sbjct  142  HKT--NPRRAMVEL  153



>ref|XP_009627921.1| PREDICTED: uncharacterized protein LOC104118395 [Nicotiana tomentosiformis]
Length=186

 Score =   166 bits (419),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 80/133 (60%), Positives = 103/133 (77%), Gaps = 3/133 (2%)
 Frame = -1

Query  726  EIICENLPISTCAFSVSSYGKRCLIEDTVLLDGKVDYKCKTSEVVVGSSTSDYIETDKCV  547
            EIICENLP + C+FS++S GKRCL+E++   DGK++Y+CKTSEVVVG+  ++YIETD+CV
Sbjct  26   EIICENLPTNVCSFSIASSGKRCLLENSENKDGKMEYQCKTSEVVVGN-MAEYIETDECV  84

Query  546  KTCGVDRKSVGMSSDPFLDSLFMAKLCARACYDYCPNLVDLYANIAAGEGVFLPELCEQI  367
              CGVDR SVG+SSD  L+  F AKLC+  CY  CPN+VDLY N+AAGEGV+LP+LC + 
Sbjct  85   NACGVDRNSVGISSDSLLEPQFTAKLCSPPCYQNCPNVVDLYFNLAAGEGVYLPDLCNKQ  144

Query  366  RSGEGSRRGMAEI  328
            RS     R M E+
Sbjct  145  RS--SPHRAMIEL  155



>ref|XP_006339001.1| PREDICTED: uncharacterized protein LOC102585649 [Solanum tuberosum]
Length=186

 Score =   166 bits (419),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 78/133 (59%), Positives = 105/133 (79%), Gaps = 3/133 (2%)
 Frame = -1

Query  726  EIICENLPISTCAFSVSSYGKRCLIEDTVLLDGKVDYKCKTSEVVVGSSTSDYIETDKCV  547
            EI CENLPI+ C+FS+SS GKRCL+E++   DGK++Y+CKTSEV+V ++ ++YIETD+C+
Sbjct  26   EITCENLPINICSFSISSSGKRCLLENSANEDGKLEYQCKTSEVIV-ANIAEYIETDECI  84

Query  546  KTCGVDRKSVGMSSDPFLDSLFMAKLCARACYDYCPNLVDLYANIAAGEGVFLPELCEQI  367
             +CGVDR SVG+SSD  L+  F AKLC+ +CY  CPN+VDLY N+AAGEGV+LP+LC + 
Sbjct  85   NSCGVDRNSVGISSDSLLEPQFTAKLCSPSCYRNCPNVVDLYFNLAAGEGVYLPDLCSKQ  144

Query  366  RSGEGSRRGMAEI  328
            RS     R M E+
Sbjct  145  RSSP--HRAMIEL  155



>gb|AFK35102.1| unknown [Lotus japonicus]
Length=183

 Score =   165 bits (418),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 80/134 (60%), Positives = 101/134 (75%), Gaps = 3/134 (2%)
 Frame = -1

Query  729  SEIICENLPISTCAFSVSSYGKRCLIEDTVLLDGKVDYKCKTSEVVVGSSTSDYIETDKC  550
            +E++CE+LP   CAFSV+S GKRCL+E     DG V+Y+C+TSEVVV    ++YIETD+C
Sbjct  23   AEMVCEDLPKEVCAFSVASSGKRCLLETEKGADGGVEYQCRTSEVVV-ERMAEYIETDQC  81

Query  549  VKTCGVDRKSVGMSSDPFLDSLFMAKLCARACYDYCPNLVDLYANIAAGEGVFLPELCEQ  370
            V++CGVDR SVG+SSD F +  F  KLC+ ACY  CPN+VDLY N+AAGEGVFLPELCE+
Sbjct  82   VESCGVDRSSVGISSDAFFEPQFTGKLCSPACYQKCPNIVDLYFNLAAGEGVFLPELCEK  141

Query  369  IRSGEGSRRGMAEI  328
             RS     R M E+
Sbjct  142  HRS--NPHRAMVEL  153



>ref|XP_009358815.1| PREDICTED: uncharacterized protein LOC103949427 [Pyrus x bretschneideri]
Length=190

 Score =   166 bits (419),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 77/126 (61%), Positives = 97/126 (77%), Gaps = 1/126 (1%)
 Frame = -1

Query  738  IIQSEIICENLPISTCAFSVSSYGKRCLIEDTVLLDGKVDYKCKTSEVVVGSSTSDYIET  559
            ++  E ICE+LP   CAFSVSS GKRCL+E     DG ++Y+C+TSEVVV    +DYIET
Sbjct  19   VVLGEFICEDLPNDVCAFSVSSAGKRCLLETMSKKDGSIEYQCRTSEVVV-EGVADYIET  77

Query  558  DKCVKTCGVDRKSVGMSSDPFLDSLFMAKLCARACYDYCPNLVDLYANIAAGEGVFLPEL  379
            D+CV+ CG+DRKSVG+SSD  L+  FMAKLC+  CY  CPN+ DLY N+AAGEGVFLP+L
Sbjct  78   DQCVQACGIDRKSVGISSDALLEPQFMAKLCSAPCYQKCPNIADLYFNLAAGEGVFLPDL  137

Query  378  CEQIRS  361
            C++ RS
Sbjct  138  CDKQRS  143



>ref|NP_001242705.1| uncharacterized protein LOC100815307 precursor [Glycine max]
 gb|ACU17875.1| unknown [Glycine max]
Length=180

 Score =   164 bits (416),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 79/134 (59%), Positives = 101/134 (75%), Gaps = 3/134 (2%)
 Frame = -1

Query  729  SEIICENLPISTCAFSVSSYGKRCLIEDTVLLDGKVDYKCKTSEVVVGSSTSDYIETDKC  550
            +E++CE+LP   CAFSV+S GKRCL+E     DG V+Y+C+TSEVVV    +DYIETD+C
Sbjct  23   AEMVCEDLPKEVCAFSVASSGKRCLLETEKAADGGVEYQCRTSEVVV-ERMADYIETDQC  81

Query  549  VKTCGVDRKSVGMSSDPFLDSLFMAKLCARACYDYCPNLVDLYANIAAGEGVFLPELCEQ  370
            V+ CGVDR SVG+SSD F +  F  KLC+ ACY  CPN+VDL+ N+AAGEGVFLPELCE+
Sbjct  82   VEACGVDRNSVGISSDAFFEPQFTDKLCSPACYQKCPNIVDLFFNLAAGEGVFLPELCEK  141

Query  369  IRSGEGSRRGMAEI  328
             ++    RR M E+
Sbjct  142  HKT--NPRRAMVEL  153



>ref|XP_010101846.1| hypothetical protein L484_023636 [Morus notabilis]
 gb|EXB89983.1| hypothetical protein L484_023636 [Morus notabilis]
Length=180

 Score =   164 bits (416),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 79/135 (59%), Positives = 104/135 (77%), Gaps = 4/135 (3%)
 Frame = -1

Query  729  SEIICENLPISTCAFSVSSYGKRCLIEDTVL-LDGKVDYKCKTSEVVVGSSTSDYIETDK  553
            +EI+CE LP+  CAF+++S GKRCL+E T    DG+V+++C+TSEVVV    ++YIETD+
Sbjct  23   AEIVCEELPLDVCAFAIASSGKRCLLETTAAGKDGRVEHQCRTSEVVV-ERMAEYIETDR  81

Query  552  CVKTCGVDRKSVGMSSDPFLDSLFMAKLCARACYDYCPNLVDLYANIAAGEGVFLPELCE  373
            CV+ CGVDRKSVG+SSD  L+  FMAKLCA+ C+  CPN+VDLY N+AAGEGVFLP+LCE
Sbjct  82   CVEACGVDRKSVGISSDSLLEPQFMAKLCAQECHQNCPNIVDLYFNLAAGEGVFLPDLCE  141

Query  372  QIRSGEGSRRGMAEI  328
            + R      R M E+
Sbjct  142  KQRY--SPHRVMVEL  154



>ref|XP_008388101.1| PREDICTED: uncharacterized protein LOC103450515 [Malus domestica]
Length=190

 Score =   164 bits (416),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 77/125 (62%), Positives = 96/125 (77%), Gaps = 1/125 (1%)
 Frame = -1

Query  735  IQSEIICENLPISTCAFSVSSYGKRCLIEDTVLLDGKVDYKCKTSEVVVGSSTSDYIETD  556
            +  E ICE+LP   CAFSVSS GKRCL+E     DG ++Y+C+TSEVVV    +DYIETD
Sbjct  20   VLGEFICEDLPNDVCAFSVSSAGKRCLLETMSKKDGSIEYQCRTSEVVV-EGVADYIETD  78

Query  555  KCVKTCGVDRKSVGMSSDPFLDSLFMAKLCARACYDYCPNLVDLYANIAAGEGVFLPELC  376
            +CV+ CG+DRKSVG+SSD  L+  FMAKLC+  CY  CPN+ DLY N+AAGEGVFLP+LC
Sbjct  79   QCVQACGIDRKSVGISSDALLEPQFMAKLCSAPCYQKCPNIADLYFNLAAGEGVFLPDLC  138

Query  375  EQIRS  361
            ++ RS
Sbjct  139  DKQRS  143



>emb|CDP06536.1| unnamed protein product [Coffea canephora]
Length=185

 Score =   164 bits (415),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 78/135 (58%), Positives = 102/135 (76%), Gaps = 3/135 (2%)
 Frame = -1

Query  732  QSEIICENLPISTCAFSVSSYGKRCLIEDTVLLDGKVDYKCKTSEVVVGSSTSDYIETDK  553
            Q EI+CE LP + C+FS++S GKRCL+E+    DGKV+Y+C+TSEVVV    +++IETD+
Sbjct  25   QGEIVCEELPTNVCSFSIASSGKRCLLENLKGKDGKVEYQCRTSEVVV-ERMAEHIETDE  83

Query  552  CVKTCGVDRKSVGMSSDPFLDSLFMAKLCARACYDYCPNLVDLYANIAAGEGVFLPELCE  373
            CV  CGVDR +VG+SSD F + LF AKLC+ ACY  CPN++DLY N+AAGEGV+LP LCE
Sbjct  84   CVSACGVDRNAVGISSDAFFEPLFTAKLCSPACYQNCPNIIDLYFNLAAGEGVYLPALCE  143

Query  372  QIRSGEGSRRGMAEI  328
            + RS     R M E+
Sbjct  144  KQRS--RPHRAMIEL  156



>ref|XP_004249554.1| PREDICTED: uncharacterized protein LOC101267755 [Solanum lycopersicum]
Length=187

 Score =   164 bits (415),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 77/133 (58%), Positives = 103/133 (77%), Gaps = 3/133 (2%)
 Frame = -1

Query  726  EIICENLPISTCAFSVSSYGKRCLIEDTVLLDGKVDYKCKTSEVVVGSSTSDYIETDKCV  547
            EI CENLP + C+FS+SS GKRCL+E++   DGK++Y+CKTSEVVV +  ++Y+ETD+C+
Sbjct  26   EITCENLPTNVCSFSISSSGKRCLLENSATEDGKLEYQCKTSEVVVAN-IAEYVETDECI  84

Query  546  KTCGVDRKSVGMSSDPFLDSLFMAKLCARACYDYCPNLVDLYANIAAGEGVFLPELCEQI  367
             +CGVDR SVG+SSD  L+  F AKLC+ +CY  CPN+VDLY N+AAGEGV+LP+LC + 
Sbjct  85   NSCGVDRNSVGISSDSLLEPQFTAKLCSPSCYRNCPNVVDLYFNLAAGEGVYLPDLCSKQ  144

Query  366  RSGEGSRRGMAEI  328
            RS     R M E+
Sbjct  145  RSSP--HRAMIEL  155



>ref|XP_007026832.1| PAR1 protein [Theobroma cacao]
 gb|EOY07334.1| PAR1 protein [Theobroma cacao]
Length=179

 Score =   163 bits (413),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 79/134 (59%), Positives = 101/134 (75%), Gaps = 3/134 (2%)
 Frame = -1

Query  729  SEIICENLPISTCAFSVSSYGKRCLIEDTVLLDGKVDYKCKTSEVVVGSSTSDYIETDKC  550
            +EIICE+LP   CAFS++S GKRCL+E  V+ DG V+Y+C+TSEVVV    ++YIE+D+C
Sbjct  22   AEIICEDLPKDVCAFSIASSGKRCLLETAVVKDGNVEYQCRTSEVVV-ERMAEYIESDEC  80

Query  549  VKTCGVDRKSVGMSSDPFLDSLFMAKLCARACYDYCPNLVDLYANIAAGEGVFLPELCEQ  370
            V+ CGVDR S+G+SSD  L+    AKLCA ACY  CPN+VDLY N+AAGEGVFLP+LC  
Sbjct  81   VRACGVDRSSIGISSDSLLEPQLTAKLCAPACYQKCPNIVDLYFNLAAGEGVFLPDLCHA  140

Query  369  IRSGEGSRRGMAEI  328
             R+    RR M E+
Sbjct  141  QRT--NPRRTMFEL  152



>gb|KHN27004.1| hypothetical protein glysoja_040812 [Glycine soja]
Length=181

 Score =   163 bits (413),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 76/134 (57%), Positives = 102/134 (76%), Gaps = 3/134 (2%)
 Frame = -1

Query  729  SEIICENLPISTCAFSVSSYGKRCLIEDTVLLDGKVDYKCKTSEVVVGSSTSDYIETDKC  550
            +E++CE+LP   CAFS++S GKRCL+E   + DG V+Y+C+TSEVVV    ++YIETD+C
Sbjct  23   AEMVCEDLPKEVCAFSLASSGKRCLLETEKVADGGVEYQCRTSEVVV-ERMAEYIETDQC  81

Query  549  VKTCGVDRKSVGMSSDPFLDSLFMAKLCARACYDYCPNLVDLYANIAAGEGVFLPELCEQ  370
            V+ CGVDR SVG+SSD F +  F  KLC+ ACY  CPN++DL+ N+AAGEGVFLPELCE+
Sbjct  82   VEACGVDRNSVGISSDAFFEPQFTGKLCSPACYQKCPNIIDLFFNLAAGEGVFLPELCEK  141

Query  369  IRSGEGSRRGMAEI  328
             ++    RR M E+
Sbjct  142  HKT--NPRRAMVEL  153



>ref|NP_001238081.1| uncharacterized protein LOC100500181 precursor [Glycine max]
 gb|ACU15142.1| unknown [Glycine max]
Length=181

 Score =   162 bits (410),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 76/134 (57%), Positives = 102/134 (76%), Gaps = 3/134 (2%)
 Frame = -1

Query  729  SEIICENLPISTCAFSVSSYGKRCLIEDTVLLDGKVDYKCKTSEVVVGSSTSDYIETDKC  550
            +E++CE+LP   CAFS++S GKRCL+E   + DG V+Y+C+TSEVVV    ++YIETD+C
Sbjct  23   AEMVCEDLPKEVCAFSLASSGKRCLLETEKVADGCVEYQCRTSEVVV-ERMAEYIETDQC  81

Query  549  VKTCGVDRKSVGMSSDPFLDSLFMAKLCARACYDYCPNLVDLYANIAAGEGVFLPELCEQ  370
            V+ CGVDR SVG+SSD F +  F  KLC+ ACY  CPN++DL+ N+AAGEGVFLPELCE+
Sbjct  82   VEACGVDRNSVGISSDAFFEPQFTGKLCSPACYQKCPNIIDLFFNLAAGEGVFLPELCEK  141

Query  369  IRSGEGSRRGMAEI  328
             ++    RR M E+
Sbjct  142  HKT--NPRRAMVEL  153



>ref|XP_003604797.1| hypothetical protein MTR_4g018880 [Medicago truncatula]
 gb|AES86994.1| PAR1 protein [Medicago truncatula]
 gb|AFK33904.1| unknown [Medicago truncatula]
Length=181

 Score =   161 bits (408),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 75/134 (56%), Positives = 102/134 (76%), Gaps = 3/134 (2%)
 Frame = -1

Query  729  SEIICENLPISTCAFSVSSYGKRCLIEDTVLLDGKVDYKCKTSEVVVGSSTSDYIETDKC  550
            +E++CE+LP   C FSV+S GKRCL+E    ++G+++Y+C+TSEV+V    S+YIETD+C
Sbjct  23   AEMVCEDLPKEVCTFSVASSGKRCLLETQKGVNGEIEYQCRTSEVIV-ERISEYIETDQC  81

Query  549  VKTCGVDRKSVGMSSDPFLDSLFMAKLCARACYDYCPNLVDLYANIAAGEGVFLPELCEQ  370
            V+ CGVDR SVG+SSD F +  F  KLC+ ACY  CPN+VDL+ N+AAGEGVFLPELCE+
Sbjct  82   VEACGVDRSSVGISSDAFFEPQFTGKLCSPACYKKCPNIVDLFFNMAAGEGVFLPELCEK  141

Query  369  IRSGEGSRRGMAEI  328
             ++    RR M E+
Sbjct  142  HKT--NPRRAMVEL  153



>gb|AFK48062.1| unknown [Lotus japonicus]
Length=183

 Score =   161 bits (408),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 79/134 (59%), Positives = 100/134 (75%), Gaps = 3/134 (2%)
 Frame = -1

Query  729  SEIICENLPISTCAFSVSSYGKRCLIEDTVLLDGKVDYKCKTSEVVVGSSTSDYIETDKC  550
            +E++CE+LP   CAFSV+S GKRCL+E     DG V+Y+C+TSEVVV    ++YIETD+C
Sbjct  23   AEMVCEDLPKEVCAFSVASSGKRCLLETEKGADGGVEYQCRTSEVVV-ERMAEYIETDQC  81

Query  549  VKTCGVDRKSVGMSSDPFLDSLFMAKLCARACYDYCPNLVDLYANIAAGEGVFLPELCEQ  370
            V++CGVDR SVG+SSD F +  F  KLC+ ACY  CPN+VDLY N+AAGEGVFLPEL E+
Sbjct  82   VESCGVDRSSVGISSDAFFEPQFTGKLCSPACYQKCPNIVDLYFNLAAGEGVFLPELYEK  141

Query  369  IRSGEGSRRGMAEI  328
             RS     R M E+
Sbjct  142  HRS--NPHRAMVEL  153



>ref|XP_004506651.1| PREDICTED: uncharacterized protein LOC101492243 [Cicer arietinum]
Length=180

 Score =   160 bits (406),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 75/134 (56%), Positives = 103/134 (77%), Gaps = 3/134 (2%)
 Frame = -1

Query  729  SEIICENLPISTCAFSVSSYGKRCLIEDTVLLDGKVDYKCKTSEVVVGSSTSDYIETDKC  550
            +E++CE+LP   CAFSV+S GKRCL+E    ++G+++Y+C+TSEV+V    ++YIETD+C
Sbjct  23   AEMVCEDLPKDVCAFSVASSGKRCLLETEKGMNGEIEYECRTSEVIV-ERMAEYIETDQC  81

Query  549  VKTCGVDRKSVGMSSDPFLDSLFMAKLCARACYDYCPNLVDLYANIAAGEGVFLPELCEQ  370
            V+ CGVDR SVG+SSD F +  F AKLC+  CY  CPN+VDL+ N+AAGEGVFLPELCE+
Sbjct  82   VEKCGVDRNSVGISSDAFFEPQFTAKLCSPICYQKCPNIVDLFFNLAAGEGVFLPELCEK  141

Query  369  IRSGEGSRRGMAEI  328
             ++    RR M E+
Sbjct  142  HKT--NPRRAMIEL  153



>ref|XP_007133951.1| hypothetical protein PHAVU_010G006000g [Phaseolus vulgaris]
 gb|ESW05945.1| hypothetical protein PHAVU_010G006000g [Phaseolus vulgaris]
Length=179

 Score =   160 bits (405),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 79/133 (59%), Positives = 97/133 (73%), Gaps = 3/133 (2%)
 Frame = -1

Query  726  EIICENLPISTCAFSVSSYGKRCLIEDTVLLDGKVDYKCKTSEVVVGSSTSDYIETDKCV  547
            EI+CE+LP   CAFSV+S GKRCL+E     DG V+Y+C+TSEVVV    ++YIETD+CV
Sbjct  24   EIVCEDLPKEVCAFSVASSGKRCLLETEKAADGGVEYQCRTSEVVV-ERMAEYIETDQCV  82

Query  546  KTCGVDRKSVGMSSDPFLDSLFMAKLCARACYDYCPNLVDLYANIAAGEGVFLPELCEQI  367
            + CGVDR SVG+SSD F +  F AKLC+  CY  C N+VDL+ N+AAGEGVFLPELCE  
Sbjct  83   EACGVDRNSVGISSDAFFEPQFTAKLCSSQCYQKCFNIVDLFFNLAAGEGVFLPELCE--  140

Query  366  RSGEGSRRGMAEI  328
            R     RR M E+
Sbjct  141  RQKTNPRRAMVEL  153



>gb|KHF97273.1| hypothetical protein F383_36747 [Gossypium arboreum]
Length=179

 Score =   160 bits (405),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 79/134 (59%), Positives = 97/134 (72%), Gaps = 3/134 (2%)
 Frame = -1

Query  729  SEIICENLPISTCAFSVSSYGKRCLIEDTVLLDGKVDYKCKTSEVVVGSSTSDYIETDKC  550
            +E+ICE+LP   CAFS++S GKRC++E  V  +G V Y+C+TSEVVV    ++YIETD+C
Sbjct  22   AEMICEDLPKDLCAFSIASSGKRCVLETAVKKEGDVQYQCRTSEVVV-ERMAEYIETDEC  80

Query  549  VKTCGVDRKSVGMSSDPFLDSLFMAKLCARACYDYCPNLVDLYANIAAGEGVFLPELCEQ  370
            V  CG DR SVG+SSD  LD  F AKLC  ACY  CPN+VDLY N+AAGEGVFLP+LC  
Sbjct  81   VAACGADRNSVGISSDSLLDQQFTAKLCTPACYQKCPNIVDLYFNLAAGEGVFLPDLCNA  140

Query  369  IRSGEGSRRGMAEI  328
             RS    RR M E+
Sbjct  141  QRS--NPRRSMVEL  152



>ref|XP_008442484.1| PREDICTED: uncharacterized protein LOC103486338 [Cucumis melo]
Length=181

 Score =   159 bits (403),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 74/133 (56%), Positives = 100/133 (75%), Gaps = 3/133 (2%)
 Frame = -1

Query  726  EIICENLPISTCAFSVSSYGKRCLIEDTVLLDGKVDYKCKTSEVVVGSSTSDYIETDKCV  547
            EI+CE L +  CAFS++S GKRCL+E +   +GK +Y+C+TSEV+V    +DYIETD+C+
Sbjct  24   EIVCEELSVDVCAFSIASSGKRCLLETSETKEGKFEYQCRTSEVMV-EWMADYIETDQCI  82

Query  546  KTCGVDRKSVGMSSDPFLDSLFMAKLCARACYDYCPNLVDLYANIAAGEGVFLPELCEQI  367
              CG+DR SVG++SD  L+  F AKLC+ +CY  CPN+VDLY N+AAGEGVFLP+LCE+ 
Sbjct  83   NACGLDRNSVGIASDALLEPQFTAKLCSPSCYQKCPNIVDLYFNMAAGEGVFLPDLCEKQ  142

Query  366  RSGEGSRRGMAEI  328
            R+     R MAE+
Sbjct  143  RT--NPHRAMAEL  153



>ref|XP_004137744.1| PREDICTED: uncharacterized protein LOC101218677 [Cucumis sativus]
 ref|XP_004168412.1| PREDICTED: uncharacterized LOC101218677 [Cucumis sativus]
 gb|KGN58812.1| hypothetical protein Csa_3G732680 [Cucumis sativus]
Length=183

 Score =   159 bits (401),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 73/133 (55%), Positives = 101/133 (76%), Gaps = 3/133 (2%)
 Frame = -1

Query  726  EIICENLPISTCAFSVSSYGKRCLIEDTVLLDGKVDYKCKTSEVVVGSSTSDYIETDKCV  547
            EI+CE L +  CAFS++S GKRCL+E +   +GK +Y+C+TSEV+V    +DYIE+D+C+
Sbjct  24   EIVCEELSVDVCAFSIASSGKRCLLETSETKEGKFEYQCRTSEVIV-EWMADYIESDQCI  82

Query  546  KTCGVDRKSVGMSSDPFLDSLFMAKLCARACYDYCPNLVDLYANIAAGEGVFLPELCEQI  367
              CG+DR SVG++SD  L+  F AKLC+ +CY  CPN+VDLY N+AAGEGVFLP+LCE+ 
Sbjct  83   NACGLDRNSVGIASDALLEPQFTAKLCSPSCYQKCPNIVDLYFNMAAGEGVFLPDLCEKQ  142

Query  366  RSGEGSRRGMAEI  328
            R+    RR MA++
Sbjct  143  RT--NPRRAMAQL  153



>ref|XP_011012958.1| PREDICTED: uncharacterized protein LOC105117111 [Populus euphratica]
 ref|XP_011012960.1| PREDICTED: uncharacterized protein LOC105117111 [Populus euphratica]
 ref|XP_011012961.1| PREDICTED: uncharacterized protein LOC105117111 [Populus euphratica]
Length=178

 Score =   158 bits (400),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 75/122 (61%), Positives = 92/122 (75%), Gaps = 1/122 (1%)
 Frame = -1

Query  729  SEIICENLPISTCAFSVSSYGKRCLIEDTVLLDGKVDYKCKTSEVVVGSSTSDYIETDKC  550
            +EI+CE LP   CAF++SS GKRCL+E     +G V+Y+C+TSEVVV    +DYIETD C
Sbjct  22   AEIVCEELPNDICAFTISSSGKRCLLETYATKNGAVEYQCRTSEVVV-EKMADYIETDAC  80

Query  549  VKTCGVDRKSVGMSSDPFLDSLFMAKLCARACYDYCPNLVDLYANIAAGEGVFLPELCEQ  370
            VK CGVDR SVG+SSD  L+  F AKLC+ ACY  CPN+VDLY N+AAGEG FLP+LC+ 
Sbjct  81   VKACGVDRNSVGISSDALLEPQFTAKLCSPACYQNCPNIVDLYFNLAAGEGAFLPDLCDA  140

Query  369  IR  364
             R
Sbjct  141  AR  142



>ref|XP_004302677.1| PREDICTED: uncharacterized protein LOC101299015 [Fragaria vesca 
subsp. vesca]
Length=183

 Score =   158 bits (400),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 77/132 (58%), Positives = 98/132 (74%), Gaps = 3/132 (2%)
 Frame = -1

Query  723  IICENLPISTCAFSVSSYGKRCLIEDTVLLDGKVDYKCKTSEVVVGSSTSDYIETDKCVK  544
             +CE+LP   CAFSVSS GKRCLIE     +G V+Y+C+TSEV+V    ++Y+ETD+CV 
Sbjct  23   FVCEDLPNDVCAFSVSSAGKRCLIETMAKNNGNVEYQCRTSEVMV-EGLAEYMETDECVN  81

Query  543  TCGVDRKSVGMSSDPFLDSLFMAKLCARACYDYCPNLVDLYANIAAGEGVFLPELCEQIR  364
             CGVDRKSVG+SSD  L+  FM+KLC+  CY  CPN+V+LY N+AAGEGVFLP+LCE+ R
Sbjct  82   ACGVDRKSVGISSDSLLEPQFMSKLCSPNCYQKCPNIVELYFNLAAGEGVFLPDLCERQR  141

Query  363  SGEGSRRGMAEI  328
            S     R M E+
Sbjct  142  S--NPHRAMIEL  151



>ref|XP_011008006.1| PREDICTED: uncharacterized protein LOC105113506 [Populus euphratica]
Length=171

 Score =   158 bits (399),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 75/124 (60%), Positives = 93/124 (75%), Gaps = 1/124 (1%)
 Frame = -1

Query  735  IQSEIICENLPISTCAFSVSSYGKRCLIEDTVLLDGKVDYKCKTSEVVVGSSTSDYIETD  556
            + +EI+CE LP   CAF++SS GKRCL+E     +G V+Y+C+TSEVVV    +DYIETD
Sbjct  13   LAAEIVCEELPNDICAFTISSSGKRCLLETYATKNGAVEYQCRTSEVVV-EKMADYIETD  71

Query  555  KCVKTCGVDRKSVGMSSDPFLDSLFMAKLCARACYDYCPNLVDLYANIAAGEGVFLPELC  376
             CVK CGVDR SVG+SSD  L+  F AKLC+ ACY  CPN+VDLY N+AAGEG FLP+LC
Sbjct  72   ACVKACGVDRNSVGISSDALLEPQFTAKLCSPACYQNCPNIVDLYFNLAAGEGAFLPDLC  131

Query  375  EQIR  364
            +  R
Sbjct  132  DAAR  135



>ref|XP_002309105.2| hypothetical protein POPTR_0006s09540g [Populus trichocarpa]
 gb|EEE92628.2| hypothetical protein POPTR_0006s09540g [Populus trichocarpa]
Length=178

 Score =   158 bits (399),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 75/122 (61%), Positives = 91/122 (75%), Gaps = 1/122 (1%)
 Frame = -1

Query  729  SEIICENLPISTCAFSVSSYGKRCLIEDTVLLDGKVDYKCKTSEVVVGSSTSDYIETDKC  550
            +EI+CE LP   CAF+VSS GKRCL+E     +G V+Y+C+TSEVVV    +DYIETD C
Sbjct  22   AEIVCEELPNDICAFTVSSSGKRCLLETYAKQNGAVEYQCRTSEVVV-EKMADYIETDAC  80

Query  549  VKTCGVDRKSVGMSSDPFLDSLFMAKLCARACYDYCPNLVDLYANIAAGEGVFLPELCEQ  370
            VK CGVDR SVG+SSD  L+  F  KLC+ ACY  CPN+VDLY N+AAGEG FLP+LC+ 
Sbjct  81   VKACGVDRNSVGISSDALLEPQFTGKLCSPACYQNCPNIVDLYFNLAAGEGAFLPDLCDA  140

Query  369  IR  364
             R
Sbjct  141  AR  142



>ref|XP_008239896.1| PREDICTED: uncharacterized protein LOC103338466 [Prunus mume]
Length=195

 Score =   158 bits (399),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 74/132 (56%), Positives = 97/132 (73%), Gaps = 3/132 (2%)
 Frame = -1

Query  723  IICENLPISTCAFSVSSYGKRCLIEDTVLLDGKVDYKCKTSEVVVGSSTSDYIETDKCVK  544
             ICE+LP   CAFSVSS GKRCL+E     DG ++Y+C+TSEV+V    ++YIETD+CVK
Sbjct  26   FICEDLPNDVCAFSVSSAGKRCLLETMAKKDGSIEYQCRTSEVLV-QGVAEYIETDQCVK  84

Query  543  TCGVDRKSVGMSSDPFLDSLFMAKLCARACYDYCPNLVDLYANIAAGEGVFLPELCEQIR  364
             CG+DRKSVG+SSD  L+  FM KLC+  CY  CPN+V+LY N+AAGEG FLP+LC++ R
Sbjct  85   ACGIDRKSVGISSDALLEPQFMTKLCSPTCYQKCPNIVELYFNLAAGEGAFLPDLCDKQR  144

Query  363  SGEGSRRGMAEI  328
            +     R M ++
Sbjct  145  T--NPHRAMLQL  154



>ref|XP_007207936.1| hypothetical protein PRUPE_ppa017583mg [Prunus persica]
 gb|EMJ09135.1| hypothetical protein PRUPE_ppa017583mg [Prunus persica]
Length=195

 Score =   158 bits (399),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 74/132 (56%), Positives = 97/132 (73%), Gaps = 3/132 (2%)
 Frame = -1

Query  723  IICENLPISTCAFSVSSYGKRCLIEDTVLLDGKVDYKCKTSEVVVGSSTSDYIETDKCVK  544
             ICE+LP   CAFSVSS GKRCL+E     DG ++Y+C+TSEV+V    ++YIETD+CVK
Sbjct  26   FICEDLPNDVCAFSVSSAGKRCLLETMAKKDGSIEYQCRTSEVLV-QGVAEYIETDQCVK  84

Query  543  TCGVDRKSVGMSSDPFLDSLFMAKLCARACYDYCPNLVDLYANIAAGEGVFLPELCEQIR  364
             CG+DRKSVG+SSD  L+  FM KLC+  CY  CPN+V+LY N+AAGEG FLP+LC++ R
Sbjct  85   ACGIDRKSVGISSDALLEPQFMTKLCSPTCYQKCPNIVELYFNLAAGEGAFLPDLCDKQR  144

Query  363  SGEGSRRGMAEI  328
            +     R M ++
Sbjct  145  T--NPHRAMLQL  154



>gb|KDP24516.1| hypothetical protein JCGZ_25080 [Jatropha curcas]
Length=180

 Score =   157 bits (396),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 73/122 (60%), Positives = 93/122 (76%), Gaps = 1/122 (1%)
 Frame = -1

Query  726  EIICENLPISTCAFSVSSYGKRCLIEDTVLLDGKVDYKCKTSEVVVGSSTSDYIETDKCV  547
            EI CE LP   CAFS+++ GKRCL+E     DGKV+Y+C+TSEV+V  + +DYIETD+CV
Sbjct  23   EIDCEELPKDVCAFSIAASGKRCLLETYARGDGKVEYQCRTSEVIV-ETMADYIETDQCV  81

Query  546  KTCGVDRKSVGMSSDPFLDSLFMAKLCARACYDYCPNLVDLYANIAAGEGVFLPELCEQI  367
            K CGVDR SVG+SSD  L+  F AKLC+  CY  CPN++DLY N+AAGEG FLP+LC+  
Sbjct  82   KACGVDRNSVGISSDALLEPHFTAKLCSPPCYQKCPNIIDLYFNLAAGEGAFLPDLCDAA  141

Query  366  RS  361
            R+
Sbjct  142  RT  143



>ref|XP_002323542.2| hypothetical protein POPTR_0016s11600g [Populus trichocarpa]
 gb|EEF05303.2| hypothetical protein POPTR_0016s11600g [Populus trichocarpa]
Length=178

 Score =   156 bits (395),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 74/122 (61%), Positives = 91/122 (75%), Gaps = 1/122 (1%)
 Frame = -1

Query  729  SEIICENLPISTCAFSVSSYGKRCLIEDTVLLDGKVDYKCKTSEVVVGSSTSDYIETDKC  550
            +EI+CE LP   CAF++SS GKRCL+E     +  V+Y+C+TSEVVV    +DYIETD C
Sbjct  22   AEIVCEELPNDICAFTISSSGKRCLLETYATKNDAVEYQCRTSEVVV-EKMADYIETDAC  80

Query  549  VKTCGVDRKSVGMSSDPFLDSLFMAKLCARACYDYCPNLVDLYANIAAGEGVFLPELCEQ  370
            VK CGVDR SVG+SSD  L+  F AKLC+ ACY  CPN+VDLY N+AAGEG FLP+LC+ 
Sbjct  81   VKACGVDRNSVGISSDALLEPQFTAKLCSPACYQNCPNIVDLYFNLAAGEGAFLPDLCDA  140

Query  369  IR  364
             R
Sbjct  141  AR  142



>ref|XP_002276542.1| PREDICTED: uncharacterized protein LOC100246012 [Vitis vinifera]
 emb|CBI30454.3| unnamed protein product [Vitis vinifera]
Length=185

 Score =   156 bits (394),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 76/133 (57%), Positives = 96/133 (72%), Gaps = 3/133 (2%)
 Frame = -1

Query  726  EIICENLPISTCAFSVSSYGKRCLIEDTVLLDGKVDYKCKTSEVVVGSSTSDYIETDKCV  547
            EIICE LP   CAFS++S GKRCL+E     +G+++Y+C+TSEV+V    S+YIETD+CV
Sbjct  28   EIICEELPNDKCAFSIASSGKRCLLEKYARENGEMEYQCRTSEVIV-ERMSEYIETDQCV  86

Query  546  KTCGVDRKSVGMSSDPFLDSLFMAKLCARACYDYCPNLVDLYANIAAGEGVFLPELCEQI  367
              CGVDR SVG+SSD  L+  F AKLC+  CY  CPN++DLY N+AAGEGVFLP+LCE  
Sbjct  87   SACGVDRSSVGISSDSLLEPQFTAKLCSSNCYHNCPNIIDLYFNLAAGEGVFLPDLCEAR  146

Query  366  RSGEGSRRGMAEI  328
            R      R M E+
Sbjct  147  RI--NPHRSMVEL  157



>ref|XP_011019183.1| PREDICTED: uncharacterized protein LOC105121988 [Populus euphratica]
 ref|XP_011019184.1| PREDICTED: uncharacterized protein LOC105121988 [Populus euphratica]
Length=178

 Score =   155 bits (391),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 73/122 (60%), Positives = 90/122 (74%), Gaps = 1/122 (1%)
 Frame = -1

Query  729  SEIICENLPISTCAFSVSSYGKRCLIEDTVLLDGKVDYKCKTSEVVVGSSTSDYIETDKC  550
            +EI+CE LP   CAF++SS GKRCL+E     +G V+Y+C+TSEVVV    + YIETD C
Sbjct  22   AEIVCEELPNDVCAFTISSSGKRCLLETYAKQNGAVEYQCRTSEVVV-EKMAGYIETDAC  80

Query  549  VKTCGVDRKSVGMSSDPFLDSLFMAKLCARACYDYCPNLVDLYANIAAGEGVFLPELCEQ  370
            VK CGVDR SVG+SSD  L+  F  KLC+ ACY  CPN+VDLY N+AAGEG FLP+LC+ 
Sbjct  81   VKACGVDRNSVGISSDALLEPQFTGKLCSPACYQNCPNIVDLYFNLAAGEGAFLPDLCDA  140

Query  369  IR  364
             R
Sbjct  141  AR  142



>ref|XP_009370270.1| PREDICTED: uncharacterized protein LOC103959642 [Pyrus x bretschneideri]
Length=180

 Score =   154 bits (390),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 75/133 (56%), Positives = 97/133 (73%), Gaps = 3/133 (2%)
 Frame = -1

Query  726  EIICENLPISTCAFSVSSYGKRCLIEDTVLLDGKVDYKCKTSEVVVGSSTSDYIETDKCV  547
            EI+CE+LP   CAFSVSS GKRCL+E      GKV+++C+TS VVV    ++YIETD+C+
Sbjct  20   EIVCEHLPNEICAFSVSSSGKRCLLETMAKKGGKVEHECRTSGVVV-EKMAEYIETDECI  78

Query  546  KTCGVDRKSVGMSSDPFLDSLFMAKLCARACYDYCPNLVDLYANIAAGEGVFLPELCEQI  367
            K CGVDRK++G+SSD  LD   + KLC+ ACY  CPN+++LY N+A GEGVFLP LCE+ 
Sbjct  79   KACGVDRKAIGISSDTLLDPRVLNKLCSTACYHKCPNIIELYFNMAVGEGVFLPYLCEKQ  138

Query  366  RSGEGSRRGMAEI  328
            RS     R M E+
Sbjct  139  RS--NPHRAMEEL  149



>ref|XP_010262709.1| PREDICTED: uncharacterized protein LOC104601167 [Nelumbo nucifera]
Length=191

 Score =   155 bits (391),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 76/136 (56%), Positives = 99/136 (73%), Gaps = 4/136 (3%)
 Frame = -1

Query  735  IQSEIICENLPISTCAFSVSSYGKRCLIEDTVLLDGKVDYKCKTSEVVVGSSTSDYIETD  556
            +  EIICENLP   CAFS++S G+RCL+E T L DG  +Y+C+TS+V+V   T ++IE+D
Sbjct  24   VLGEIICENLPKDLCAFSIASSGQRCLLE-TYLTDGTTEYQCRTSDVIVERMT-EWIESD  81

Query  555  KCVKTCGVDRKSVGMSSDPFLDSLFMAKLCARACYDYCPNLVDLYANIAAGEGVFLPELC  376
            +CV+ CGVDR SVG+SSD  L+  F AKLC+ ACY  CPN+VDLY N+AAGEG FLP+LC
Sbjct  82   ECVRACGVDRNSVGISSDALLEPQFTAKLCSPACYQNCPNIVDLYFNLAAGEGAFLPDLC  141

Query  375  EQIRSGEGSRRGMAEI  328
               R+     R M E+
Sbjct  142  MAQRT--NPHRAMIEL  155



>ref|XP_009370269.1| PREDICTED: uncharacterized protein LOC103959641 [Pyrus x bretschneideri]
Length=180

 Score =   154 bits (390),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 75/133 (56%), Positives = 97/133 (73%), Gaps = 3/133 (2%)
 Frame = -1

Query  726  EIICENLPISTCAFSVSSYGKRCLIEDTVLLDGKVDYKCKTSEVVVGSSTSDYIETDKCV  547
            EI+CE+LP   CAFSVSS GKRCL+E      GKV+++C+TS VVV    ++YIETD+C+
Sbjct  20   EIVCEHLPNEICAFSVSSSGKRCLLETMAKKGGKVEHECRTSGVVV-EKMAEYIETDECI  78

Query  546  KTCGVDRKSVGMSSDPFLDSLFMAKLCARACYDYCPNLVDLYANIAAGEGVFLPELCEQI  367
            K CGVDRK++G+SSD  LD   + KLC+ ACY  CPN+++LY N+A GEGVFLP LCE+ 
Sbjct  79   KACGVDRKAIGISSDTLLDPRVLNKLCSTACYHKCPNIIELYFNMAVGEGVFLPYLCEKQ  138

Query  366  RSGEGSRRGMAEI  328
            RS     R M E+
Sbjct  139  RS--NPHRAMEEL  149



>ref|XP_006848036.1| hypothetical protein AMTR_s00029p00186810 [Amborella trichopoda]
 gb|ERN09617.1| hypothetical protein AMTR_s00029p00186810 [Amborella trichopoda]
Length=175

 Score =   154 bits (388),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 76/135 (56%), Positives = 102/135 (76%), Gaps = 4/135 (3%)
 Frame = -1

Query  729  SEIICENLPISTCAFSVSSYGKRCLIEDTVLLDG-KVDYKCKTSEVVVGSSTSDYIETDK  553
            +EI+CENL    CAFS+SS GKRC++E     DG + +++C++SEVVV    S++IET++
Sbjct  18   AEIVCENLSKDKCAFSISSAGKRCVLEKYAGNDGDEAEFQCRSSEVVV-ERLSEWIETEE  76

Query  552  CVKTCGVDRKSVGMSSDPFLDSLFMAKLCARACYDYCPNLVDLYANIAAGEGVFLPELCE  373
            C++ CG+DR SVG+SSD  L+  F AKLCA AC++ CPN+VDLY N+AAGEGVFLPELC+
Sbjct  77   CIQACGLDRNSVGISSDSLLEPQFTAKLCATACFNNCPNVVDLYVNLAAGEGVFLPELCQ  136

Query  372  QIRSGEGSRRGMAEI  328
              R     RRGMAE+
Sbjct  137  VQRI--NPRRGMAEL  149



>ref|XP_008239908.1| PREDICTED: uncharacterized protein LOC103338475 [Prunus mume]
Length=468

 Score =   161 bits (407),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 77/133 (58%), Positives = 98/133 (74%), Gaps = 3/133 (2%)
 Frame = -1

Query  726  EIICENLPISTCAFSVSSYGKRCLIEDTVLLDGKVDYKCKTSEVVVGSSTSDYIETDKCV  547
            EI+CE+LP   CAFSVSS GKRCL+E     DG + Y+C+TS  VV    ++YIETD+CV
Sbjct  27   EIVCEHLPNDVCAFSVSSSGKRCLLETMSKQDGTLQYQCRTSGEVV-EKMAEYIETDQCV  85

Query  546  KTCGVDRKSVGMSSDPFLDSLFMAKLCARACYDYCPNLVDLYANIAAGEGVFLPELCEQI  367
            K CGVDRKS+G+SSD  LD  F+ +LC+ ACY+ CPN+V+LY N+A GEGVF+P LCEQ 
Sbjct  86   KACGVDRKSLGISSDTLLDPYFLNRLCSPACYEKCPNIVELYFNMAEGEGVFMPYLCEQE  145

Query  366  RSGEGSRRGMAEI  328
            RS     R M+E+
Sbjct  146  RS--NPHRAMSEL  156



>ref|XP_006429255.1| hypothetical protein CICLE_v10012857mg [Citrus clementina]
 ref|XP_006480931.1| PREDICTED: uncharacterized protein LOC102628059 [Citrus sinensis]
 gb|ESR42495.1| hypothetical protein CICLE_v10012857mg [Citrus clementina]
 gb|KDO58021.1| hypothetical protein CISIN_1g029564mg [Citrus sinensis]
Length=191

 Score =   154 bits (389),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 83/171 (49%), Positives = 113/171 (66%), Gaps = 2/171 (1%)
 Frame = -1

Query  729  SEIICENLPISTCAFSVSSYGKRCLIEDTVLLDGKVDYKCKTSEVVVGSSTSDYIETDKC  550
            +EI CE+LP + CAFS++S GKRCL+E     DG +++ CKTS+VVV    +DYIETD+C
Sbjct  23   AEIECESLPKNVCAFSIASSGKRCLLETYTTKDGSLEFLCKTSDVVV-EKMADYIETDRC  81

Query  549  VKTCGVDRKSVGMSSDPFLDSLFMAKLCARACYDYCPNLVDLYANIAAGEGVFLPELCEQ  370
            VK CGVDR +VG+SSD  L+  F +KLC+ ACY  CPN+VDLY N+AAGEG +LP++C+ 
Sbjct  82   VKACGVDRNAVGISSDALLEPEFASKLCSPACYQKCPNIVDLYFNLAAGEGAYLPDICQA  141

Query  369  IRSGEGSRRGMAEIQsgggdsaaapagapaagdDLPRRAMIGIDAEAPSPA  217
             RS    R  +  + SGG  + +      ++     +   I I A APSPA
Sbjct  142  TRSNP-HRSMLQLLSSGGDGTVSLATAPASSPVGFSKSRKIFIGAPAPSPA  191



>ref|XP_006488680.1| PREDICTED: uncharacterized protein DDB_G0271670-like [Citrus 
sinensis]
 gb|KDO66716.1| hypothetical protein CISIN_1g043358mg [Citrus sinensis]
Length=229

 Score =   155 bits (392),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 77/133 (58%), Positives = 95/133 (71%), Gaps = 3/133 (2%)
 Frame = -1

Query  723  IICENLPISTCAFSVSSYGKRCLIEDTVLLDGKVDYKCKTSEVVVGSSTSDYIETDKCVK  544
            IICE LP   C++SVSS GKRCL+E+    DG V Y+CKTSEV+V     D+IET++C  
Sbjct  21   IICEQLPKQLCSYSVSSSGKRCLLENFASSDGTVTYQCKTSEVIV-DVVHDWIETEECTN  79

Query  543  TCGVDRKSVGMSSDPFLDSLFMAKLCARACYDYCPNLVDLYANIAAGEGVFLPELCEQIR  364
             CGVDRKSVG+SSD  L   F AKLC+ ACY  CPN+VDLY N+A GEGV+LP LCE  R
Sbjct  80   ACGVDRKSVGISSDSLLQPQFTAKLCSDACYQNCPNIVDLYFNLALGEGVYLPSLCEAQR  139

Query  363  SGEGSRRGMAEIQ  325
            +    RR M++I+
Sbjct  140  TNP--RRAMSDIK  150



>ref|XP_009787582.1| PREDICTED: uncharacterized protein LOC104235494 [Nicotiana sylvestris]
 dbj|BAB16427.1| NtEIG-E80 [Nicotiana tabacum]
Length=175

 Score =   153 bits (387),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 73/132 (55%), Positives = 98/132 (74%), Gaps = 3/132 (2%)
 Frame = -1

Query  723  IICENLPISTCAFSVSSYGKRCLIEDTVLLDGKVDYKCKTSEVVVGSSTSDYIETDKCVK  544
             ICE+LP + C F++++ GKRCL+E++   DGKV+Y+CKTSEV+VG+   ++IETD+CV 
Sbjct  26   FICEDLPTNVCGFAIATSGKRCLLENSAGEDGKVEYQCKTSEVIVGN-MKEHIETDECVD  84

Query  543  TCGVDRKSVGMSSDPFLDSLFMAKLCARACYDYCPNLVDLYANIAAGEGVFLPELCEQIR  364
             CG DR SVG+SSD  LDS F  KLC+ ACY  C N+VDLY N+AAGEGV+LP+LC + R
Sbjct  85   ACGCDRNSVGISSDALLDSQFTFKLCSPACYQKCANIVDLYFNLAAGEGVYLPDLCNKQR  144

Query  363  SGEGSRRGMAEI  328
            +     R M E+
Sbjct  145  T--NPHRAMIEL  154



>ref|XP_006349478.1| PREDICTED: uncharacterized protein LOC102591129 [Solanum tuberosum]
Length=175

 Score =   153 bits (387),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 72/132 (55%), Positives = 99/132 (75%), Gaps = 3/132 (2%)
 Frame = -1

Query  723  IICENLPISTCAFSVSSYGKRCLIEDTVLLDGKVDYKCKTSEVVVGSSTSDYIETDKCVK  544
             ICE LP + C F++++  KRCL+E++   DGKV+Y+CKTSEVVV ++  ++IETD+CV 
Sbjct  26   FICEELPTNVCGFAIATSAKRCLLENSSGNDGKVEYQCKTSEVVV-ANMREHIETDECVD  84

Query  543  TCGVDRKSVGMSSDPFLDSLFMAKLCARACYDYCPNLVDLYANIAAGEGVFLPELCEQIR  364
             CGVDR SVG+SSD  LDS F +KLC+  CY +C N++DLY N+AAGEGV+LP+LC + R
Sbjct  85   ACGVDRNSVGISSDALLDSQFTSKLCSLDCYHHCANIIDLYFNLAAGEGVYLPDLCNKQR  144

Query  363  SGEGSRRGMAEI  328
            +     R MAE+
Sbjct  145  TNP--HRAMAEL  154



>ref|XP_009421325.1| PREDICTED: uncharacterized protein LOC104000897 [Musa acuminata 
subsp. malaccensis]
Length=175

 Score =   153 bits (386),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 75/138 (54%), Positives = 97/138 (70%), Gaps = 3/138 (2%)
 Frame = -1

Query  741  PIIQSEIICENLPISTCAFSVSSYGKRCLIEDTVLLDGKVDYKCKTSEVVVGSSTSDYIE  562
            P   + +ICE+LP   CAF+VSS  KRCL+E+T L  G+ DY+C+TSE V     SD+IE
Sbjct  24   PSATAGVICEDLPQDLCAFAVSSASKRCLLENTQLGGGRTDYQCRTSEAVA-EGISDWIE  82

Query  561  TDKCVKTCGVDRKSVGMSSDPFLDSLFMAKLCARACYDYCPNLVDLYANIAAGEGVFLPE  382
            TD+CV+ CGV R +VG+SSD  L+  F+ K+C+  CY  CPN+VDLY N+A+GEGVFLP+
Sbjct  83   TDECVRACGVARGNVGISSDSLLEPDFVQKICSAECYSNCPNIVDLYFNLASGEGVFLPD  142

Query  381  LCEQIRSGEGSRRGMAEI  328
            LCE  R     RR MAE 
Sbjct  143  LCEAQRGDP--RRAMAEF  158



>ref|XP_007038703.1| PAR1 protein [Theobroma cacao]
 gb|EOY23204.1| PAR1 protein [Theobroma cacao]
Length=183

 Score =   152 bits (385),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 75/134 (56%), Positives = 96/134 (72%), Gaps = 3/134 (2%)
 Frame = -1

Query  726  EIICENLPISTCAFSVSSYGKRCLIEDTVLLDGKVDYKCKTSEVVVGSSTSDYIETDKCV  547
            EI CE+L   TC ++VSS GKRC++E  V   G+ +Y C+TSE+       ++IETD+CV
Sbjct  28   EITCEHLDQDTCTYAVSSTGKRCVLEKHVRRSGEEEYTCRTSEIEA-DKIKNWIETDQCV  86

Query  546  KTCGVDRKSVGMSSDPFLDSLFMAKLCARACYDYCPNLVDLYANIAAGEGVFLPELCEQI  367
            K CG+DRKS G+SSD  LDS F   LC+  CY+ CPN+VDLY N+AAGEGVFLP+LCE  
Sbjct  87   KACGLDRKSFGISSDSLLDSRFTEMLCSPQCYNSCPNVVDLYFNLAAGEGVFLPKLCEA-  145

Query  366  RSGEGSRRGMAEIQ  325
              G  +RRGMAEI+
Sbjct  146  -QGANARRGMAEIR  158



>ref|XP_010553064.1| PREDICTED: uncharacterized protein LOC104823275 [Tarenaya hassleriana]
Length=179

 Score =   152 bits (385),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 74/135 (55%), Positives = 94/135 (70%), Gaps = 3/135 (2%)
 Frame = -1

Query  732  QSEIICENLPISTCAFSVSSYGKRCLIEDTVLLDGKVDYKCKTSEVVVGSSTSDYIETDK  553
             + IICE+LP   CAFS+S  GKRCL+E      G VD++C+TSE+ VG  T +Y+E+D 
Sbjct  22   HANIICEDLPEDICAFSISGAGKRCLLETEARFAGGVDFRCRTSEIEVGRMT-NYVESDA  80

Query  552  CVKTCGVDRKSVGMSSDPFLDSLFMAKLCARACYDYCPNLVDLYANIAAGEGVFLPELCE  373
            CV  CGVDR+SVG+SSD  LD  F AKLC+  C+D CPN+VDLY N+AAGEG FLP++C 
Sbjct  81   CVHACGVDRRSVGISSDGLLDPDFTAKLCSPECFDNCPNIVDLYFNLAAGEGAFLPDVCA  140

Query  372  QIRSGEGSRRGMAEI  328
              R+     R M EI
Sbjct  141  ARRANP--HRTMVEI  153



>gb|KHG02999.1| ATP-dependent RNA helicase dbp6 [Gossypium arboreum]
Length=182

 Score =   152 bits (385),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 74/134 (55%), Positives = 96/134 (72%), Gaps = 3/134 (2%)
 Frame = -1

Query  729  SEIICENLPISTCAFSVSSYGKRCLIEDTVLLDGKVDYKCKTSEVVVGSSTSDYIETDKC  550
            +EIICE+LP   CAFS++  GKRC++E     D  V+++C+TSEVVV    +DYIE+D+C
Sbjct  22   AEIICEDLPKDVCAFSIALSGKRCVLETAADKDSDVEHQCRTSEVVV-ERMADYIESDEC  80

Query  549  VKTCGVDRKSVGMSSDPFLDSLFMAKLCARACYDYCPNLVDLYANIAAGEGVFLPELCEQ  370
            V  CGV+R S+G+SSD  LD  F AKLCA ACY  CPN++DLY N+AAGEGVFLP+LC  
Sbjct  81   VAACGVNRNSIGISSDSLLDQQFTAKLCAPACYQNCPNVIDLYFNLAAGEGVFLPDLCNA  140

Query  369  IRSGEGSRRGMAEI  328
              S    RR M ++
Sbjct  141  QWSNP--RRSMVDL  152



>ref|XP_009388026.1| PREDICTED: uncharacterized protein LOC103974853 [Musa acuminata 
subsp. malaccensis]
Length=175

 Score =   152 bits (384),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 75/138 (54%), Positives = 97/138 (70%), Gaps = 3/138 (2%)
 Frame = -1

Query  741  PIIQSEIICENLPISTCAFSVSSYGKRCLIEDTVLLDGKVDYKCKTSEVVVGSSTSDYIE  562
            P   + +ICE LP   CAF++SS  KRCL++ T    G+ +Y+C+TSE VV    SD+IE
Sbjct  24   PSALAGVICEELPQELCAFAISSTSKRCLLDSTQNQGGRTEYQCRTSEAVV-ERMSDWIE  82

Query  561  TDKCVKTCGVDRKSVGMSSDPFLDSLFMAKLCARACYDYCPNLVDLYANIAAGEGVFLPE  382
            TD+CV+ CGV R SVG+SSD  ++S F  KLC++ CY  CPN+VDLY N+AAGEGVFLP+
Sbjct  83   TDECVRACGVSRDSVGISSDSLMESDFAQKLCSQPCYRNCPNIVDLYFNLAAGEGVFLPD  142

Query  381  LCEQIRSGEGSRRGMAEI  328
            LCE  R     RR MA+I
Sbjct  143  LCEAQRVNP--RRSMAQI  158



>ref|XP_007143423.1| hypothetical protein PHAVU_007G071100g [Phaseolus vulgaris]
 gb|ESW15417.1| hypothetical protein PHAVU_007G071100g [Phaseolus vulgaris]
Length=191

 Score =   152 bits (385),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 73/131 (56%), Positives = 97/131 (74%), Gaps = 3/131 (2%)
 Frame = -1

Query  717  CENLPISTCAFSVSSYGKRCLIEDTVLLDGKVDYKCKTSEVVVGSSTSDYIETDKCVKTC  538
            CENL   TC+F+VSS GKRC++E  V   G+ +Y CKTS++    +  D+IETD+C+K C
Sbjct  30   CENLSHETCSFAVSSGGKRCVLEKRVKRSGEEEYTCKTSDIE-AENLKDHIETDQCIKAC  88

Query  537  GVDRKSVGMSSDPFLDSLFMAKLCARACYDYCPNLVDLYANIAAGEGVFLPELCEQIRSG  358
            G+DR S+G+SSD  L+S F  KLC+  CY +CPN+VDLY N+AAGEGVFLP+LCE    G
Sbjct  89   GLDRNSLGISSDSLLESTFTHKLCSPHCYHFCPNVVDLYFNLAAGEGVFLPKLCEV--EG  146

Query  357  EGSRRGMAEIQ  325
              +RRGMAE++
Sbjct  147  VNARRGMAELR  157



>ref|XP_006421929.1| hypothetical protein CICLE_v10005988mg [Citrus clementina]
 ref|XP_006490398.1| PREDICTED: uncharacterized protein LOC102613323 [Citrus sinensis]
 gb|ESR35169.1| hypothetical protein CICLE_v10005988mg [Citrus clementina]
 gb|KDO52034.1| hypothetical protein CISIN_1g029827mg [Citrus sinensis]
Length=187

 Score =   152 bits (383),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 73/134 (54%), Positives = 100/134 (75%), Gaps = 3/134 (2%)
 Frame = -1

Query  726  EIICENLPISTCAFSVSSYGKRCLIEDTVLLDGKVDYKCKTSEVVVGSSTSDYIETDKCV  547
            E+ CE+L  + CAF+VS+ GKRC++E  V   G+  Y CKTSE+      +++IETD+C+
Sbjct  29   EVTCESLDQNACAFAVSASGKRCVLEKQVKRSGQETYTCKTSEIE-AEKLNNWIETDQCI  87

Query  546  KTCGVDRKSVGMSSDPFLDSLFMAKLCARACYDYCPNLVDLYANIAAGEGVFLPELCEQI  367
            K+CG+DRKS+G+SSD  L+S F  KLC+  CY  CPN+VDLY N+AAGEGVFLP+LCE  
Sbjct  88   KSCGLDRKSLGISSDSLLESGFTQKLCSSPCYGSCPNIVDLYFNLAAGEGVFLPKLCEA-  146

Query  366  RSGEGSRRGMAEIQ  325
              G+G+RR M+EI+
Sbjct  147  -QGKGARRRMSEIK  159



>ref|XP_003604795.1| hypothetical protein MTR_4g018860 [Medicago truncatula]
 gb|AES86992.1| PAR1 protein [Medicago truncatula]
Length=211

 Score =   152 bits (385),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 71/132 (54%), Positives = 99/132 (75%), Gaps = 3/132 (2%)
 Frame = -1

Query  723  IICENLPISTCAFSVSSYGKRCLIEDTVLLDGKVDYKCKTSEVVVGSSTSDYIETDKCVK  544
            ++CE+LP   CAFSV+S GKRCL+E    ++G+ +Y+C+TSEV+V    + YIETD+CV+
Sbjct  25   MVCEDLPKEVCAFSVASSGKRCLLETEKNINGETEYQCRTSEVMV-ERIAAYIETDQCVE  83

Query  543  TCGVDRKSVGMSSDPFLDSLFMAKLCARACYDYCPNLVDLYANIAAGEGVFLPELCEQIR  364
             CGVDR SVG+SSD F +  F +KLC+ +C+  CPN+VDL+ N+AAGEGVFLPELCE+ +
Sbjct  84   ACGVDRSSVGISSDAFFEPYFTSKLCSPSCFSKCPNIVDLFFNLAAGEGVFLPELCEKHK  143

Query  363  SGEGSRRGMAEI  328
            +    RR   E+
Sbjct  144  T--NPRRATIEL  153



>ref|XP_003604794.1| hypothetical protein MTR_4g018850 [Medicago truncatula]
 gb|AES86991.1| PAR1 protein [Medicago truncatula]
Length=215

 Score =   152 bits (385),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 71/132 (54%), Positives = 99/132 (75%), Gaps = 3/132 (2%)
 Frame = -1

Query  723  IICENLPISTCAFSVSSYGKRCLIEDTVLLDGKVDYKCKTSEVVVGSSTSDYIETDKCVK  544
            ++CE+LP   CAFSV+S GKRCL+E    ++G+ +Y+C+TSEV+V    + YIETD+CV+
Sbjct  25   MVCEDLPKEVCAFSVASSGKRCLLETEKNINGETEYQCRTSEVMV-ERIAAYIETDECVE  83

Query  543  TCGVDRKSVGMSSDPFLDSLFMAKLCARACYDYCPNLVDLYANIAAGEGVFLPELCEQIR  364
             CGVDR SVG+SSD F +  F +KLC+ +C+  CPN+VDL+ N+AAGEGVFLPELCE+ +
Sbjct  84   ACGVDRSSVGISSDAFFEPYFTSKLCSPSCFSKCPNIVDLFFNLAAGEGVFLPELCEKHK  143

Query  363  SGEGSRRGMAEI  328
            +    RR   E+
Sbjct  144  N--NPRRATIEL  153



>ref|XP_010044045.1| PREDICTED: uncharacterized protein LOC104433099 [Eucalyptus grandis]
 gb|KCW86048.1| hypothetical protein EUGRSUZ_B02754 [Eucalyptus grandis]
Length=181

 Score =   150 bits (378),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 70/119 (59%), Positives = 89/119 (75%), Gaps = 1/119 (1%)
 Frame = -1

Query  729  SEIICENLPISTCAFSVSSYGKRCLIEDTVLLDGKVDYKCKTSEVVVGSSTSDYIETDKC  550
            +EI+CE LP   CAFS++S GKRC +E      G V+Y+C+TSEV+V      YIETD+C
Sbjct  24   AEIVCEELPKDLCAFSIASSGKRCSLETYANQSGGVEYQCRTSEVIV-ERMGGYIETDEC  82

Query  549  VKTCGVDRKSVGMSSDPFLDSLFMAKLCARACYDYCPNLVDLYANIAAGEGVFLPELCE  373
            V+ CGVDR +VG+SSD  L+  F AKLC+ ACY  CPN++DLY N+AAGEGVFLP+LCE
Sbjct  83   VRACGVDRDAVGISSDALLEPQFTAKLCSPACYRRCPNIIDLYYNLAAGEGVFLPDLCE  141



>ref|XP_004249680.1| PREDICTED: uncharacterized protein LOC101253546 [Solanum lycopersicum]
Length=175

 Score =   149 bits (377),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 70/132 (53%), Positives = 100/132 (76%), Gaps = 3/132 (2%)
 Frame = -1

Query  723  IICENLPISTCAFSVSSYGKRCLIEDTVLLDGKVDYKCKTSEVVVGSSTSDYIETDKCVK  544
             ICE+L  + C F++S+ GKRCL+E++   DGKV+Y+CKTSEVVV ++  ++IET++CV 
Sbjct  27   FICEDLATNVCGFAISTSGKRCLLENSSGKDGKVEYQCKTSEVVV-ANMREHIETEECVD  85

Query  543  TCGVDRKSVGMSSDPFLDSLFMAKLCARACYDYCPNLVDLYANIAAGEGVFLPELCEQIR  364
             CGVDR +VG+SSD  LDS F +KLC+  CY +CPN++DLY N+AAGEGV+LP+LC + R
Sbjct  86   ACGVDRNTVGISSDALLDSQFTSKLCSLDCYHHCPNIIDLYFNLAAGEGVYLPDLCNKQR  145

Query  363  SGEGSRRGMAEI  328
            +     R + E+
Sbjct  146  T--NPHRAIIEL  155



>ref|XP_010256734.1| PREDICTED: uncharacterized protein LOC104597044 [Nelumbo nucifera]
Length=180

 Score =   149 bits (377),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 71/132 (54%), Positives = 96/132 (73%), Gaps = 3/132 (2%)
 Frame = -1

Query  723  IICENLPISTCAFSVSSYGKRCLIEDTVLLDGKVDYKCKTSEVVVGSSTSDYIETDKCVK  544
            I+CE LP + CAFS+SS G+RC +E     DG V+Y+C+TS V V  + + +IETD+C++
Sbjct  27   IVCEELPKNICAFSISSSGQRCTLETYAAQDGNVEYQCRTSNVSV-ENMAGWIETDECIQ  85

Query  543  TCGVDRKSVGMSSDPFLDSLFMAKLCARACYDYCPNLVDLYANIAAGEGVFLPELCEQIR  364
             CG+DR SVG+SSD  L+S F A+LC+  CYD CPN+VDLY N+AAGEGVFLP++CE  R
Sbjct  86   ACGLDRNSVGISSDALLESQFTAQLCSIGCYDNCPNIVDLYFNLAAGEGVFLPDICEAQR  145

Query  363  SGEGSRRGMAEI  328
            +     R M E+
Sbjct  146  N--NLHREMIEL  155



>gb|KHG11879.1| uncharacterized protein F383_20075 [Gossypium arboreum]
Length=216

 Score =   150 bits (379),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 74/134 (55%), Positives = 97/134 (72%), Gaps = 3/134 (2%)
 Frame = -1

Query  729  SEIICENLPISTCAFSVSSYGKRCLIEDTVLLDGKVDYKCKTSEVVVGSSTSDYIETDKC  550
            +EIICE+LP   CAF+++S GKRCL+E  +  + K +Y+C+TSEV+V    ++YIE D C
Sbjct  22   AEIICEDLPNDVCAFAIASSGKRCLLETGLEKNEKEEYQCRTSEVMV-ERMAEYIENDDC  80

Query  549  VKTCGVDRKSVGMSSDPFLDSLFMAKLCARACYDYCPNLVDLYANIAAGEGVFLPELCEQ  370
            V+ CGVDR S+G+SSD  L+  F AKLCA AC   CPN+VDL+ N+AAGEGVFLP+LCE 
Sbjct  81   VRACGVDRNSIGISSDSLLEPQFTAKLCAPACCHKCPNIVDLFFNLAAGEGVFLPDLCEA  140

Query  369  IRSGEGSRRGMAEI  328
             R     RR M E+
Sbjct  141  QRV--NPRRSMVEL  152



>ref|XP_011077605.1| PREDICTED: uncharacterized protein LOC105161572 [Sesamum indicum]
Length=186

 Score =   149 bits (377),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 73/138 (53%), Positives = 99/138 (72%), Gaps = 3/138 (2%)
 Frame = -1

Query  741  PIIQSEIICENLPISTCAFSVSSYGKRCLIEDTVLLDGKVDYKCKTSEVVVGSSTSDYIE  562
            P   +E++CE+LP + CAF++++ GKRC++E+    +G VDY CKTSEVVV    + Y+E
Sbjct  22   PGTLAEVVCEDLPENLCAFAIAASGKRCVLENYKSEEGSVDYTCKTSEVVV-ERLAGYVE  80

Query  561  TDKCVKTCGVDRKSVGMSSDPFLDSLFMAKLCARACYDYCPNLVDLYANIAAGEGVFLPE  382
            TD+CV  CGVDR  VG+SSD FL   F++ LC+ ACY  CPN+VDLY N+AAGEGVFLP 
Sbjct  81   TDECVNACGVDRNFVGISSDAFLTPEFISSLCSPACYRNCPNIVDLYFNLAAGEGVFLPA  140

Query  381  LCEQIRSGEGSRRGMAEI  328
            LCE+ ++     R M E+
Sbjct  141  LCEKQKT--SPHRAMLEL  156



>gb|EYU41813.1| hypothetical protein MIMGU_mgv1a014652mg [Erythranthe guttata]
Length=182

 Score =   149 bits (376),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 74/136 (54%), Positives = 98/136 (72%), Gaps = 3/136 (2%)
 Frame = -1

Query  735  IQSEIICENLPISTCAFSVSSYGKRCLIEDTVLLDGKVDYKCKTSEVVVGSSTSDYIETD  556
            I +E+ICE+LP + C+F+++S GKRC++E+     G +DY CKTSEVVV    S YIETD
Sbjct  22   ILAELICEDLPANRCSFAIASSGKRCVLENFSDERGTLDYTCKTSEVVV-ERLSGYIETD  80

Query  555  KCVKTCGVDRKSVGMSSDPFLDSLFMAKLCARACYDYCPNLVDLYANIAAGEGVFLPELC  376
            +CV  CGVDR  VG+SSD FL + F  +LC+ ACY  CPN+VDLY N+AAGEGV+LP LC
Sbjct  81   ECVNACGVDRGFVGISSDAFLTADFTPRLCSPACYQNCPNIVDLYFNLAAGEGVYLPALC  140

Query  375  EQIRSGEGSRRGMAEI  328
            ++ +S     R M E+
Sbjct  141  QKQKSNP--HRAMLEL  154



>gb|ABK21049.1| unknown [Picea sitchensis]
Length=182

 Score =   149 bits (375),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 69/137 (50%), Positives = 99/137 (72%), Gaps = 3/137 (2%)
 Frame = -1

Query  738  IIQSEIICENLPISTCAFSVSSYGKRCLIEDTVLLDGKVDYKCKTSEVVVGSSTSDYIET  559
            ++   I+CE LP+  CAFSVS+ G RC++E ++L DG V Y+C+ SEV+   + ++ IET
Sbjct  21   VVFGGIVCEKLPVEVCAFSVSTSGARCVLEKSILSDGNVQYECQRSEVI-AENLNELIET  79

Query  558  DKCVKTCGVDRKSVGMSSDPFLDSLFMAKLCARACYDYCPNLVDLYANIAAGEGVFLPEL  379
            ++CV  CGV+R +VGMS+D   +  F  KLC+  CY+ CPN+VDLY N+AAGEGV+LP L
Sbjct  80   EECVNACGVERMTVGMSTDSLAERGFTNKLCSTRCYNNCPNIVDLYFNLAAGEGVYLPRL  139

Query  378  CEQIRSGEGSRRGMAEI  328
            CE  RS  G+RR ++E+
Sbjct  140  CEAHRS--GARRMISEV  154



>ref|XP_010905376.1| PREDICTED: uncharacterized protein LOC105032593 [Elaeis guineensis]
Length=195

 Score =   149 bits (376),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 70/123 (57%), Positives = 91/123 (74%), Gaps = 1/123 (1%)
 Frame = -1

Query  741  PIIQSEIICENLPISTCAFSVSSYGKRCLIEDTVLLDGKVDYKCKTSEVVVGSSTSDYIE  562
            P   + +ICE+LP   CAF++SS  KRC++E T    G  +Y+C+TS+VVV    SD+IE
Sbjct  27   PSASAGVICEDLPQDLCAFAISSASKRCVLESTPRSWGPTEYQCRTSDVVV-DQMSDWIE  85

Query  561  TDKCVKTCGVDRKSVGMSSDPFLDSLFMAKLCARACYDYCPNLVDLYANIAAGEGVFLPE  382
            TD+CV+ CGVDR SVG+SSD  L+  F  KLC+ AC+  CPN+VDL+ N+AAGEGVFLPE
Sbjct  86   TDECVRACGVDRNSVGISSDSLLEPQFTEKLCSPACHQNCPNIVDLFFNLAAGEGVFLPE  145

Query  381  LCE  373
            LCE
Sbjct  146  LCE  148



>gb|KEH23077.1| PAR1 protein [Medicago truncatula]
Length=169

 Score =   148 bits (373),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 71/134 (53%), Positives = 96/134 (72%), Gaps = 3/134 (2%)
 Frame = -1

Query  729  SEIICENLPISTCAFSVSSYGKRCLIEDTVLLDGKVDYKCKTSEVVVGSSTSDYIETDKC  550
            +E++CE L    C+FS++S GKRCL+E     DG ++Y+C+TSEVV+    + YIETD+C
Sbjct  13   AEVVCEELQKDLCSFSIASSGKRCLLETEKAADGGIEYQCRTSEVVL-ERMAGYIETDQC  71

Query  549  VKTCGVDRKSVGMSSDPFLDSLFMAKLCARACYDYCPNLVDLYANIAAGEGVFLPELCEQ  370
            VK CGV+R  VG+SSD  L+  F AKLC+ +CY  CPN+VDLY N+AAGEGVFLP+LCE 
Sbjct  72   VKACGVERNFVGISSDALLEPQFTAKLCSSSCYQNCPNIVDLYFNLAAGEGVFLPDLCEI  131

Query  369  IRSGEGSRRGMAEI  328
             ++     R M E+
Sbjct  132  QKT--NPHRAMIEL  143



>ref|XP_008370129.1| PREDICTED: uncharacterized protein LOC103433639 [Malus domestica]
Length=228

 Score =   150 bits (378),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 76/122 (62%), Positives = 93/122 (76%), Gaps = 1/122 (1%)
 Frame = -1

Query  726  EIICENLPISTCAFSVSSYGKRCLIEDTVLLDGKVDYKCKTSEVVVGSSTSDYIETDKCV  547
            E ICENLP   CAFSVSS GKRCL+E     DG ++Y+C+TSEVVV    ++ IETD+CV
Sbjct  53   EFICENLPNDVCAFSVSSAGKRCLLETMSKKDGSIEYQCRTSEVVV-EGVAEXIETDECV  111

Query  546  KTCGVDRKSVGMSSDPFLDSLFMAKLCARACYDYCPNLVDLYANIAAGEGVFLPELCEQI  367
            + CG+DRKSVG+SSD  L+  FMAKLC+  CY  CPN+ DLY N+AAGEGVFLP+LC + 
Sbjct  112  QACGIDRKSVGISSDTLLEPQFMAKLCSAPCYQKCPNIADLYFNLAAGEGVFLPDLCGKQ  171

Query  366  RS  361
            RS
Sbjct  172  RS  173



>gb|EYU26632.1| hypothetical protein MIMGU_mgv1a014768mg [Erythranthe guttata]
Length=179

 Score =   148 bits (373),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 70/134 (52%), Positives = 97/134 (72%), Gaps = 3/134 (2%)
 Frame = -1

Query  729  SEIICENLPISTCAFSVSSYGKRCLIEDTVLLDGKVDYKCKTSEVVVGSSTSDYIETDKC  550
            +E++CENLP + C+F+++S GKRC++E+    DGK+DY CK+SEVVV    S YIE+D+C
Sbjct  24   AEVVCENLPENLCSFAIASSGKRCVLENYKNEDGKLDYTCKSSEVVV-ERLSGYIESDQC  82

Query  549  VKTCGVDRKSVGMSSDPFLDSLFMAKLCARACYDYCPNLVDLYANIAAGEGVFLPELCEQ  370
            +  CG+DR  VG+SSD FL   F   LC+ ACY  CPN+VDLY N+AAGEGV+LP LC++
Sbjct  83   IAACGLDRTFVGISSDAFLTQEFTTSLCSPACYQNCPNIVDLYFNLAAGEGVYLPALCQK  142

Query  369  IRSGEGSRRGMAEI  328
             ++     R M E+
Sbjct  143  QKTSP--HRAMFEL  154



>ref|XP_010035143.1| PREDICTED: uncharacterized protein LOC104424423 [Eucalyptus grandis]
 gb|KCW46436.1| hypothetical protein EUGRSUZ_K00268 [Eucalyptus grandis]
Length=181

 Score =   148 bits (373),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 72/134 (54%), Positives = 98/134 (73%), Gaps = 3/134 (2%)
 Frame = -1

Query  726  EIICENLPISTCAFSVSSYGKRCLIEDTVLLDGKVDYKCKTSEVVVGSSTSDYIETDKCV  547
            +I CENL   +CAF+VSS GKRC++E  V   G+  Y C++SE+    +  D+IETD+C+
Sbjct  25   DIACENLDQGSCAFAVSSTGKRCVLEKQVRRSGEEAYTCRSSEIEA-DNLKDHIETDECI  83

Query  546  KTCGVDRKSVGMSSDPFLDSLFMAKLCARACYDYCPNLVDLYANIAAGEGVFLPELCEQI  367
              CG+DRK++G+SSD  L+S F  KLC+  CY+ CPN+VDLY ++AAGEGVFLP+LCE  
Sbjct  84   AACGLDRKTLGVSSDSLLESRFTQKLCSSGCYENCPNIVDLYFSLAAGEGVFLPKLCEAQ  143

Query  366  RSGEGSRRGMAEIQ  325
            R    +RRGMAEI+
Sbjct  144  RG--IARRGMAEIR  155



>emb|CAA58731.1| PAR-1b [Nicotiana tabacum]
Length=185

 Score =   148 bits (373),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 70/133 (53%), Positives = 94/133 (71%), Gaps = 3/133 (2%)
 Frame = -1

Query  723  IICENLPISTCAFSVSSYGKRCLIEDTVLLDGKVDYKCKTSEVVVGSSTSDYIETDKCVK  544
            I CENL   +CAF++SS GKRC++E  +   G+  Y CKTSE+       D+IETD+C++
Sbjct  28   ITCENLNKDSCAFAISSTGKRCVLEKRLQRSGEEVYTCKTSEIE-ADKLKDWIETDQCIQ  86

Query  543  TCGVDRKSVGMSSDPFLDSLFMAKLCARACYDYCPNLVDLYANIAAGEGVFLPELCEQIR  364
             CGVDR + G+SSD  L+  F  KLC+  CY +CPN++DLY N+AAGEGV+LP LCE+  
Sbjct  87   ACGVDRNTFGISSDSLLECHFTQKLCSPQCYKHCPNIIDLYFNLAAGEGVYLPRLCEE--  144

Query  363  SGEGSRRGMAEIQ  325
             G  +RRGMAEI+
Sbjct  145  QGGNARRGMAEIK  157



>ref|NP_001241627.1| uncharacterized protein LOC100787709 precursor [Glycine max]
 gb|ACU20485.1| unknown [Glycine max]
 gb|KHN21748.1| hypothetical protein glysoja_027632 [Glycine soja]
Length=194

 Score =   148 bits (373),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 73/133 (55%), Positives = 95/133 (71%), Gaps = 3/133 (2%)
 Frame = -1

Query  723  IICENLPISTCAFSVSSYGKRCLIEDTVLLDGKVDYKCKTSEVVVGSSTSDYIETDKCVK  544
            I CE L   TC+F+VSS GKRC++E  V   G+  Y C+TSE+       D+IET++C+K
Sbjct  28   IECETLSHDTCSFAVSSAGKRCVLEKRVKRTGEEAYTCRTSEIE-ADKLKDHIETEQCIK  86

Query  543  TCGVDRKSVGMSSDPFLDSLFMAKLCARACYDYCPNLVDLYANIAAGEGVFLPELCEQIR  364
             CG+DRKS+G+SSD  L+S F  KLC+  CY  CPN+VDLY N+AAGEGVFLP+LCE   
Sbjct  87   ACGLDRKSLGISSDSLLESTFTQKLCSPHCYQCCPNVVDLYFNLAAGEGVFLPKLCEA--  144

Query  363  SGEGSRRGMAEIQ  325
             G  +RRGMAE++
Sbjct  145  QGVNARRGMAELK  157



>ref|XP_006361911.1| PREDICTED: uncharacterized protein LOC102603240 [Solanum tuberosum]
Length=186

 Score =   147 bits (372),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 68/133 (51%), Positives = 95/133 (71%), Gaps = 2/133 (2%)
 Frame = -1

Query  723  IICENLPISTCAFSVSSYGKRCLIEDTVLLDGKVDYKCKTSEVVVGSSTSDYIETDKCVK  544
            I CENL   +CAF++SS GKRC++E ++   G+  Y C+TSE+   +   + IETD C++
Sbjct  29   ITCENLNKDSCAFAISSTGKRCVLEKSLRRSGEQVYTCRTSEIEADNKLKNRIETDNCIQ  88

Query  543  TCGVDRKSVGMSSDPFLDSLFMAKLCARACYDYCPNLVDLYANIAAGEGVFLPELCEQIR  364
            +CGV+R ++G+SSD  L+  F  KLC+  CY +CPN+VDLY N+AAGEGV+LP LCE+  
Sbjct  89   SCGVNRNTLGISSDSLLECHFTKKLCSPECYKHCPNIVDLYFNLAAGEGVYLPRLCEE--  146

Query  363  SGEGSRRGMAEIQ  325
             G   RRGMAEI+
Sbjct  147  QGGNGRRGMAEIR  159



>ref|XP_009340031.1| PREDICTED: uncharacterized protein LOC103932203 isoform X1 [Pyrus 
x bretschneideri]
 ref|XP_009340032.1| PREDICTED: uncharacterized protein LOC103932203 isoform X2 [Pyrus 
x bretschneideri]
Length=198

 Score =   148 bits (373),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 73/133 (55%), Positives = 95/133 (71%), Gaps = 3/133 (2%)
 Frame = -1

Query  723  IICENLPISTCAFSVSSYGKRCLIEDTVLLDGKVDYKCKTSEVVVGSSTSDYIETDKCVK  544
            I CENL    CAF+VSS GKRC++E  V   G+  Y C+TSE+    +  D+IE++KC+K
Sbjct  28   ITCENLEHDACAFAVSSSGKRCVLEKHVRRSGEEAYTCRTSEIEA-DNLKDWIESEKCIK  86

Query  543  TCGVDRKSVGMSSDPFLDSLFMAKLCARACYDYCPNLVDLYANIAAGEGVFLPELCEQIR  364
            +CG+DRKS G+SSD  L+S F  KLC+  CY  CPN+VDLY N+AAGEGVFLP+LCE   
Sbjct  87   SCGLDRKSYGISSDSLLESRFTQKLCSPQCYGNCPNIVDLYFNLAAGEGVFLPKLCEA--  144

Query  363  SGEGSRRGMAEIQ  325
             G  +RR M+EI+
Sbjct  145  QGANARREMSEIR  157



>ref|XP_008811495.1| PREDICTED: uncharacterized protein LOC103722643 [Phoenix dactylifera]
Length=194

 Score =   148 bits (373),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 73/132 (55%), Positives = 94/132 (71%), Gaps = 3/132 (2%)
 Frame = -1

Query  723  IICENLPISTCAFSVSSYGKRCLIEDTVLLDGKVDYKCKTSEVVVGSSTSDYIETDKCVK  544
            +ICE+LP   CAF++SS  KRC++E T    G  +Y+C+TS+VVV    S +IETD+CV+
Sbjct  32   VICEDLPQDLCAFAISSSSKRCVLESTPHNGGATEYQCRTSDVVV-HRMSAWIETDECVR  90

Query  543  TCGVDRKSVGMSSDPFLDSLFMAKLCARACYDYCPNLVDLYANIAAGEGVFLPELCEQIR  364
             CGVDR SVG+SSD  L+  F  KLC+ AC+  CPN+VDLY N+AAGEGVFLP+LCE  R
Sbjct  91   ACGVDRNSVGISSDSLLEPQFTEKLCSPACHRNCPNIVDLYFNLAAGEGVFLPKLCEARR  150

Query  363  SGEGSRRGMAEI  328
                 RR M E+
Sbjct  151  V--NPRRAMVEL  160



>gb|KHF98264.1| Cytosolic beta-glucosidase [Gossypium arboreum]
Length=184

 Score =   147 bits (371),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 71/134 (53%), Positives = 99/134 (74%), Gaps = 3/134 (2%)
 Frame = -1

Query  726  EIICENLPISTCAFSVSSYGKRCLIEDTVLLDGKVDYKCKTSEVVVGSSTSDYIETDKCV  547
            EIICE+L   TCA++V+S GKRC++E  V   G+ +Y C+TSE+      +++IETD+CV
Sbjct  29   EIICEHLDQDTCAYAVASTGKRCVLEKHVKRSGEEEYTCRTSEIEA-DKINNWIETDQCV  87

Query  546  KTCGVDRKSVGMSSDPFLDSLFMAKLCARACYDYCPNLVDLYANIAAGEGVFLPELCEQI  367
            K+CG+DRKS G+SSD  L+S F   LC+  CY+ CPN++DLY N+AAGEG+FLP+LCE  
Sbjct  88   KSCGLDRKSFGISSDSLLESRFTEMLCSPQCYNGCPNVIDLYFNLAAGEGIFLPKLCEAQ  147

Query  366  RSGEGSRRGMAEIQ  325
            +     RRGM+EI+
Sbjct  148  KG--NIRRGMSEIR  159



>ref|XP_010060939.1| PREDICTED: uncharacterized protein LOC104448745 [Eucalyptus grandis]
 gb|KCW90697.1| hypothetical protein EUGRSUZ_A02782 [Eucalyptus grandis]
Length=183

 Score =   147 bits (371),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 71/132 (54%), Positives = 94/132 (71%), Gaps = 3/132 (2%)
 Frame = -1

Query  723  IICENLPISTCAFSVSSYGKRCLIEDTVLLDGKVDYKCKTSEVVVGSSTSDYIETDKCVK  544
            I+CENL   +CAF+VSS GKRC++E  V   G+  Y C+ S +  G    DYIETD+C+ 
Sbjct  29   IVCENLNHDSCAFAVSSSGKRCVLEKQVTRSGEEAYTCRQSGIEAGG-LRDYIETDQCIG  87

Query  543  TCGVDRKSVGMSSDPFLDSLFMAKLCARACYDYCPNLVDLYANIAAGEGVFLPELCEQIR  364
            +CGVDR+++G++SD  L+  F  +LC+  CY  CPN+VDLY N+AAGEGVFLP+LCE  R
Sbjct  88   SCGVDRRTLGIASDALLEPHFAQQLCSSKCYGSCPNIVDLYFNLAAGEGVFLPKLCEAER  147

Query  363  SGEGSRRGMAEI  328
              +  RRGMAEI
Sbjct  148  --QEKRRGMAEI  157



>gb|AFK41674.1| unknown [Lotus japonicus]
Length=198

 Score =   147 bits (372),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 74/133 (56%), Positives = 95/133 (71%), Gaps = 3/133 (2%)
 Frame = -1

Query  723  IICENLPISTCAFSVSSYGKRCLIEDTVLLDGKVDYKCKTSEVVVGSSTSDYIETDKCVK  544
            I CENL   TC+F+VSS GKRC++E  V   G+  Y C+TSE+       D+IET++CVK
Sbjct  28   IECENLSEETCSFAVSSGGKRCVLEKRVKRTGEEAYTCRTSEIEA-DKLKDHIETEQCVK  86

Query  543  TCGVDRKSVGMSSDPFLDSLFMAKLCARACYDYCPNLVDLYANIAAGEGVFLPELCEQIR  364
             CG+DRKS+G+SSD  L+S F  +LC+  CY  CPN+VDLY N+AAGEGVFLP LCE   
Sbjct  87   ACGLDRKSLGISSDSLLESRFTHQLCSPQCYQSCPNVVDLYFNLAAGEGVFLPMLCEA--  144

Query  363  SGEGSRRGMAEIQ  325
             G  +RRGMAE++
Sbjct  145  EGGNARRGMAELK  157



>gb|ABK26953.1| unknown [Picea sitchensis]
Length=208

 Score =   148 bits (373),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 66/132 (50%), Positives = 99/132 (75%), Gaps = 3/132 (2%)
 Frame = -1

Query  723  IICENLPISTCAFSVSSYGKRCLIEDTVLLDGKVDYKCKTSEVVVGSSTSDYIETDKCVK  544
            I+CENLP+  CAFSVSS G RC++E ++L DG V Y+C++S+V+   +  ++IETD+C+ 
Sbjct  26   IVCENLPMEVCAFSVSSSGARCVLEKSILRDGNVQYECQSSDVI-AETIKEWIETDECMN  84

Query  543  TCGVDRKSVGMSSDPFLDSLFMAKLCARACYDYCPNLVDLYANIAAGEGVFLPELCEQIR  364
             CGV+R +VG+S+D  +D     KLC+  CY+ CPN+++LY N+AAGEG++LP LCE  R
Sbjct  85   ACGVERMAVGISTDALVDGRSTRKLCSPNCYNKCPNILELYFNLAAGEGIYLPRLCEAHR  144

Query  363  SGEGSRRGMAEI  328
            SG+  RR ++E+
Sbjct  145  SGD--RRMISEV  154



>ref|XP_010035141.1| PREDICTED: uncharacterized protein LOC104424421 [Eucalyptus grandis]
 gb|KCW46434.1| hypothetical protein EUGRSUZ_K00266 [Eucalyptus grandis]
Length=181

 Score =   147 bits (370),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 71/134 (53%), Positives = 97/134 (72%), Gaps = 3/134 (2%)
 Frame = -1

Query  726  EIICENLPISTCAFSVSSYGKRCLIEDTVLLDGKVDYKCKTSEVVVGSSTSDYIETDKCV  547
            +I CENL   +CAF+VSS GKRC++E  V   G+  Y C++SE+    +  D+IETD+C+
Sbjct  25   DIACENLDQGSCAFAVSSTGKRCVLEKQVRRSGEEGYTCRSSEIEA-DNLKDHIETDECI  83

Query  546  KTCGVDRKSVGMSSDPFLDSLFMAKLCARACYDYCPNLVDLYANIAAGEGVFLPELCEQI  367
              CG+DRK++G+SSD  L+S F  KLC+  CY+ CPN+VDLY ++AAGEGVFLP+LCE  
Sbjct  84   AACGLDRKTLGVSSDSLLESRFTQKLCSSGCYENCPNIVDLYFSLAAGEGVFLPKLCEAQ  143

Query  366  RSGEGSRRGMAEIQ  325
            R    +RRGM EI+
Sbjct  144  RG--IARRGMGEIR  155



>ref|XP_010035139.1| PREDICTED: uncharacterized protein LOC104424419 [Eucalyptus grandis]
 gb|KCW46433.1| hypothetical protein EUGRSUZ_K00265 [Eucalyptus grandis]
Length=181

 Score =   147 bits (370),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 71/134 (53%), Positives = 97/134 (72%), Gaps = 3/134 (2%)
 Frame = -1

Query  726  EIICENLPISTCAFSVSSYGKRCLIEDTVLLDGKVDYKCKTSEVVVGSSTSDYIETDKCV  547
            +I CENL   +CAF+VSS GKRC++E  V   G+  Y C++SE+    +  D+IETD+C+
Sbjct  25   DIACENLDQGSCAFAVSSTGKRCVLEKQVRRSGEEGYTCRSSEIEA-DNLKDHIETDECI  83

Query  546  KTCGVDRKSVGMSSDPFLDSLFMAKLCARACYDYCPNLVDLYANIAAGEGVFLPELCEQI  367
              CG+DRK++G+SSD  L+S F  KLC+  CY+ CPN+VDLY ++AAGEGVFLP+LCE  
Sbjct  84   AACGLDRKTLGVSSDSLLESRFTQKLCSSGCYENCPNIVDLYFSLAAGEGVFLPKLCEAQ  143

Query  366  RSGEGSRRGMAEIQ  325
            R    +RRGM EI+
Sbjct  144  RG--IARRGMGEIR  155



>ref|XP_010529780.1| PREDICTED: uncharacterized protein LOC104806532 [Tarenaya hassleriana]
Length=168

 Score =   146 bits (369),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 77/133 (58%), Positives = 96/133 (72%), Gaps = 6/133 (5%)
 Frame = -1

Query  726  EIICENLPISTCAFSVSSYGKRCLIEDTVLLDGKVDYKCKTSEVVVGSSTSDYIETDKCV  547
            EIICE+LP  TCAFS+S+ GKRCL+E T  + GK  + C+TSEV V     +++ETD CV
Sbjct  24   EIICEDLPAKTCAFSISAAGKRCLLE-TENVAGK--FYCRTSEVDV-EGILNHVETDDCV  79

Query  546  KTCGVDRKSVGMSSDPFLDSLFMAKLCARACYDYCPNLVDLYANIAAGEGVFLPELCEQI  367
              CGVDRK+VG+SSD  L+  F AKLC+ ACYD+CPN+VDLY N+A GEG FLP+LCE  
Sbjct  80   AACGVDRKTVGISSDALLEPGFAAKLCSSACYDFCPNIVDLYFNLAVGEGAFLPDLCEAH  139

Query  366  RSGEGSRRGMAEI  328
            R+     R M EI
Sbjct  140  RA--NPDRSMLEI  150



>gb|KDP46577.1| hypothetical protein JCGZ_08549 [Jatropha curcas]
Length=181

 Score =   147 bits (370),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 71/134 (53%), Positives = 94/134 (70%), Gaps = 4/134 (3%)
 Frame = -1

Query  726  EIICENLPISTCAFSVSSYGKRCLIEDTVLLDGKVDYKCKTSEVVVGSSTSDYIETDKCV  547
            E++CE LP+  C++S++S  KRCLIE+    DGK+ Y+CKTSEVVV     ++IE+D+C+
Sbjct  19   ELVCEKLPVELCSYSIASSSKRCLIENFATKDGKIAYQCKTSEVVV-DILHEWIESDECI  77

Query  546  KTCGVDRKSVGMSSDPFLDSLFMAKLCARACYDYCPNLVDLYANIAAGEGVFLPELCEQI  367
              CGVDR +VG+SSD  L   F+AKLC+  CY  CPN+VDLY N+A GEGVFLP+LC   
Sbjct  78   SACGVDRNTVGISSDTLLQPQFLAKLCSNDCYQSCPNIVDLYFNLALGEGVFLPDLCTNP  137

Query  366  R---SGEGSRRGMA  334
            R   S  GS   +A
Sbjct  138  RRALSATGSSSYVA  151



>ref|XP_010039173.1| PREDICTED: uncharacterized protein LOC104427850 [Eucalyptus grandis]
Length=257

 Score =   149 bits (376),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 78/186 (42%), Positives = 106/186 (57%), Gaps = 34/186 (18%)
 Frame = -1

Query  726  EIICENLPISTCAFSVSSYGKRCLIEDTVLLDGKVDYKCKTSEVVVGSSTSDYIETDKCV  547
            EI CE +P   CAF+++S GKRCL+E      G+V+Y+C+TSEVVV    + Y+E D+CV
Sbjct  101  EITCEEIPNDMCAFAIASSGKRCLLETLTSAGGEVEYQCRTSEVVV-ERMAGYVEGDECV  159

Query  546  KTCGVDRKSVGMSSDPFLDSLFMAKLCARACYDYCPNLVDLYANIAAGEGVFLPELCEQI  367
            + CGVDR+SVG+SSD  +D  F ++LCA  C+  CPN+VDLY N+AAGEGV+LP+LC+  
Sbjct  160  QACGVDRRSVGISSDSLMDPQFTSRLCAPQCFQNCPNIVDLYFNLAAGEGVYLPDLCDAQ  219

Query  366  RSGEGSRRGMAEIQsgggdsaaapagapaagdDLPRRAMIGI--DAEAPSPA*CVADTYT  193
            R+                                P R MI +     AP PA   + T  
Sbjct  220  RAN-------------------------------PHRTMIELLSSGAAPGPASAQSSTLF  248

Query  192  NLTPSP  175
             + PSP
Sbjct  249  AMAPSP  254



>gb|KCW49488.1| hypothetical protein EUGRSUZ_K03007 [Eucalyptus grandis]
Length=257

 Score =   149 bits (375),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 78/186 (42%), Positives = 106/186 (57%), Gaps = 34/186 (18%)
 Frame = -1

Query  726  EIICENLPISTCAFSVSSYGKRCLIEDTVLLDGKVDYKCKTSEVVVGSSTSDYIETDKCV  547
            EI CE +P   CAF+++S GKRCL+E      G+V+Y+C+TSEVVV    + Y+E D+CV
Sbjct  101  EITCEEIPNDMCAFAIASSGKRCLLETLTSAGGEVEYQCRTSEVVV-ERMAGYVEGDECV  159

Query  546  KTCGVDRKSVGMSSDPFLDSLFMAKLCARACYDYCPNLVDLYANIAAGEGVFLPELCEQI  367
            + CGVDR+SVG+SSD  +D  F ++LCA  C+  CPN+VDLY N+AAGEGV+LP+LC+  
Sbjct  160  QACGVDRRSVGISSDSLMDPQFTSRLCAPQCFQNCPNIVDLYFNLAAGEGVYLPDLCDAQ  219

Query  366  RSGEGSRRGMAEIQsgggdsaaapagapaagdDLPRRAMIGI--DAEAPSPA*CVADTYT  193
            R+                                P R MI +     AP PA   + T  
Sbjct  220  RAN-------------------------------PHRTMIELLSSGAAPGPASAQSSTLF  248

Query  192  NLTPSP  175
             + PSP
Sbjct  249  AMAPSP  254



>ref|XP_010035140.1| PREDICTED: uncharacterized protein LOC104424420 [Eucalyptus grandis]
Length=181

 Score =   146 bits (369),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 71/134 (53%), Positives = 97/134 (72%), Gaps = 3/134 (2%)
 Frame = -1

Query  726  EIICENLPISTCAFSVSSYGKRCLIEDTVLLDGKVDYKCKTSEVVVGSSTSDYIETDKCV  547
            +I CENL   +CAF+VSS GKRC++E  V   G+  Y C++SE+    +  D+IETD+C+
Sbjct  25   DIACENLDQGSCAFAVSSTGKRCVLEKQVRRSGEEGYTCRSSEIEA-DNLKDHIETDECI  83

Query  546  KTCGVDRKSVGMSSDPFLDSLFMAKLCARACYDYCPNLVDLYANIAAGEGVFLPELCEQI  367
              CG+DRK++G+SSD  L+S F  KLC+  CY+ CPN+VDLY ++AAGEGVFLP+LCE  
Sbjct  84   AACGLDRKTLGVSSDSLLESRFTQKLCSSGCYENCPNIVDLYFSLAAGEGVFLPKLCEAQ  143

Query  366  RSGEGSRRGMAEIQ  325
            R    +RRGM EI+
Sbjct  144  RG--IARRGMGEIR  155



>ref|XP_010035142.1| PREDICTED: uncharacterized protein LOC104424422 [Eucalyptus grandis]
 gb|KCW46435.1| hypothetical protein EUGRSUZ_K00267 [Eucalyptus grandis]
Length=181

 Score =   146 bits (369),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 71/134 (53%), Positives = 97/134 (72%), Gaps = 3/134 (2%)
 Frame = -1

Query  726  EIICENLPISTCAFSVSSYGKRCLIEDTVLLDGKVDYKCKTSEVVVGSSTSDYIETDKCV  547
            +I CENL   +CAF+VSS GKRC++E  V   G+  Y C++SE+    +  D+IETD+C+
Sbjct  25   DIACENLDQGSCAFAVSSTGKRCVLEKQVRRSGEEAYTCRSSEIEA-DNLKDHIETDECI  83

Query  546  KTCGVDRKSVGMSSDPFLDSLFMAKLCARACYDYCPNLVDLYANIAAGEGVFLPELCEQI  367
              CG+DRK++G+SSD  L+S F  KLC+  CY+ CPN+VDLY ++AAGEGVFLP+LCE  
Sbjct  84   AACGLDRKTLGVSSDSLLESRFTQKLCSSGCYENCPNIVDLYFSLAAGEGVFLPKLCEAQ  143

Query  366  RSGEGSRRGMAEIQ  325
            R    +RRGM EI+
Sbjct  144  RG--IARRGMGEIR  155



>ref|XP_010908211.1| PREDICTED: uncharacterized protein LOC105034670 [Elaeis guineensis]
Length=191

 Score =   146 bits (369),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 68/126 (54%), Positives = 91/126 (72%), Gaps = 1/126 (1%)
 Frame = -1

Query  741  PIIQSEIICENLPISTCAFSVSSYGKRCLIEDTVLLDGKVDYKCKTSEVVVGSSTSDYIE  562
            P   + ++CE+LP   CAF++SS  KRC++E T       +Y+C+TSEVVV    SD+IE
Sbjct  23   PSTSAGVVCEDLPQDLCAFAISSSSKRCVLESTQHSGRPTEYQCRTSEVVV-ERMSDWIE  81

Query  561  TDKCVKTCGVDRKSVGMSSDPFLDSLFMAKLCARACYDYCPNLVDLYANIAAGEGVFLPE  382
            TD+CV+ CG DR SVG+SSD  L+  F  KLC+ AC++ CPN++DLY N+AAGEGVFLP+
Sbjct  82   TDECVRACGADRNSVGISSDSLLEPQFTEKLCSPACHENCPNIIDLYFNLAAGEGVFLPD  141

Query  381  LCEQIR  364
            LCE  R
Sbjct  142  LCEARR  147



>gb|KEH26321.1| PAR1 protein [Medicago truncatula]
Length=192

 Score =   146 bits (369),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 73/133 (55%), Positives = 94/133 (71%), Gaps = 3/133 (2%)
 Frame = -1

Query  723  IICENLPISTCAFSVSSYGKRCLIEDTVLLDGKVDYKCKTSEVVVGSSTSDYIETDKCVK  544
            I CENL   TCAF+VS  GKRC++E  V  +G+  Y C+TSE+       D+IE+D+C+K
Sbjct  22   IECENLNQDTCAFAVSYAGKRCVLEKHVKRNGEEKYTCRTSEIE-ADKLKDHIESDQCIK  80

Query  543  TCGVDRKSVGMSSDPFLDSLFMAKLCARACYDYCPNLVDLYANIAAGEGVFLPELCEQIR  364
            +CG+DRKS G+SSD  L+S F   LC+  CY  CPN+VDLY N+AAGEGVFLP+LCE   
Sbjct  81   SCGLDRKSFGISSDSLLESSFTKNLCSPQCYKSCPNIVDLYFNLAAGEGVFLPKLCEA--  138

Query  363  SGEGSRRGMAEIQ  325
             G  +RR MAEI+
Sbjct  139  QGANARREMAEIK  151



>ref|XP_008798941.1| PREDICTED: uncharacterized protein LOC103713707 [Phoenix dactylifera]
Length=192

 Score =   146 bits (369),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 69/126 (55%), Positives = 90/126 (71%), Gaps = 1/126 (1%)
 Frame = -1

Query  741  PIIQSEIICENLPISTCAFSVSSYGKRCLIEDTVLLDGKVDYKCKTSEVVVGSSTSDYIE  562
            P   + + CE+LP   CAF++SS  KRC++E T       +Y+C+TSEVVV    S++IE
Sbjct  23   PSTSAGVTCEDLPQDLCAFAISSSSKRCVLESTQHSGRPTEYQCRTSEVVVAR-MSNWIE  81

Query  561  TDKCVKTCGVDRKSVGMSSDPFLDSLFMAKLCARACYDYCPNLVDLYANIAAGEGVFLPE  382
            TD+CVK CGVDR SVG+SSD  L+  F  KLC+ AC++ CPN++DLY N+AAGEGV LPE
Sbjct  82   TDECVKACGVDRNSVGISSDSLLEPQFTEKLCSPACHENCPNIIDLYFNLAAGEGVLLPE  141

Query  381  LCEQIR  364
            LCE  R
Sbjct  142  LCEARR  147



>ref|XP_010553262.1| PREDICTED: uncharacterized protein LOC104823394 [Tarenaya hassleriana]
Length=162

 Score =   145 bits (366),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 76/133 (57%), Positives = 96/133 (72%), Gaps = 6/133 (5%)
 Frame = -1

Query  726  EIICENLPISTCAFSVSSYGKRCLIEDTVLLDGKVDYKCKTSEVVVGSSTSDYIETDKCV  547
            +IICENLP   CAFS+S+ GKRC++E T  + GK  + C+TSEV V     +++ETD C+
Sbjct  24   DIICENLPEEMCAFSISASGKRCVLE-TENVAGK--FYCRTSEVDV-EGMVNHVETDDCM  79

Query  546  KTCGVDRKSVGMSSDPFLDSLFMAKLCARACYDYCPNLVDLYANIAAGEGVFLPELCEQI  367
              CGVDRK+VG+SSD  L+  F AKLC+RACYD CPN+VDLY N+AAGEG FLP+LCE  
Sbjct  80   AACGVDRKTVGISSDKLLEPGFAAKLCSRACYDNCPNIVDLYFNLAAGEGAFLPDLCEAH  139

Query  366  RSGEGSRRGMAEI  328
            R+     R M EI
Sbjct  140  RA--NPHRSMLEI  150



>ref|XP_009774343.1| PREDICTED: uncharacterized protein LOC104224406, partial [Nicotiana 
sylvestris]
Length=179

 Score =   145 bits (367),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 69/133 (52%), Positives = 97/133 (73%), Gaps = 3/133 (2%)
 Frame = -1

Query  723  IICENLPISTCAFSVSSYGKRCLIEDTVLLDGKVDYKCKTSEVVVGSSTSDYIETDKCVK  544
            I CENL   +CAF++SS GKRC++E  +   G+  Y C+TSE+       D+IETD+C++
Sbjct  23   IACENLNEDSCAFAISSNGKRCVLEKHLRRSGEEGYTCRTSEIE-ADKLKDWIETDECIE  81

Query  543  TCGVDRKSVGMSSDPFLDSLFMAKLCARACYDYCPNLVDLYANIAAGEGVFLPELCEQIR  364
             CGVDR ++G+SSD  L+S F  KLC+ ACY +CPN+VDLY N+AAGEGV+LP+LC +  
Sbjct  82   ACGVDRNALGISSDALLESRFTNKLCSPACYKHCPNIVDLYFNLAAGEGVYLPKLCAE--  139

Query  363  SGEGSRRGMAEIQ  325
             G+ +RR +AEI+
Sbjct  140  QGKSARREIAEIR  152



>gb|ABK26944.1| unknown [Picea sitchensis]
Length=208

 Score =   146 bits (369),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 66/132 (50%), Positives = 98/132 (74%), Gaps = 3/132 (2%)
 Frame = -1

Query  723  IICENLPISTCAFSVSSYGKRCLIEDTVLLDGKVDYKCKTSEVVVGSSTSDYIETDKCVK  544
            I+CENLP+  CAFSVSS G RC++E ++L DG V Y+C++S+V+      ++IET++C+ 
Sbjct  26   IVCENLPMEVCAFSVSSSGARCVLEKSILRDGNVQYECQSSDVI-AEIIKEWIETEECMN  84

Query  543  TCGVDRKSVGMSSDPFLDSLFMAKLCARACYDYCPNLVDLYANIAAGEGVFLPELCEQIR  364
             CGV+R +VGMS+D  +D     KLC+  CY+ CPN+++LY N+AAGEG++LP LCE  R
Sbjct  85   ACGVERMAVGMSTDALVDGRSTRKLCSPNCYNKCPNILELYFNLAAGEGIYLPRLCEAHR  144

Query  363  SGEGSRRGMAEI  328
            SG+  RR ++E+
Sbjct  145  SGD--RRMISEV  154



>ref|XP_010662746.1| PREDICTED: uncharacterized protein LOC100254969 isoform X3 [Vitis 
vinifera]
Length=186

 Score =   145 bits (367),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 72/133 (54%), Positives = 95/133 (71%), Gaps = 3/133 (2%)
 Frame = -1

Query  723  IICENLPISTCAFSVSSYGKRCLIEDTVLLDGKVDYKCKTSEVVVGSSTSDYIETDKCVK  544
            I CENL   TCAF+VSS GKRC++E  V   G+  Y C+TSE+       D++E+D+C++
Sbjct  28   ITCENLNKDTCAFAVSSSGKRCVLEKHVRRSGEEAYVCRTSEIEA-DKVKDWVESDQCIE  86

Query  543  TCGVDRKSVGMSSDPFLDSLFMAKLCARACYDYCPNLVDLYANIAAGEGVFLPELCEQIR  364
             CG+DRKS+G+SSD  L+  F  KLC+  CY+ CPN+VDLY N+AAGEGVFLP+LCE  R
Sbjct  87   ACGLDRKSLGISSDSLLECGFTRKLCSTQCYNGCPNIVDLYFNVAAGEGVFLPKLCEAQR  146

Query  363  SGEGSRRGMAEIQ  325
                +RR MAEI+
Sbjct  147  G--DARREMAEIR  157



>ref|XP_003555381.1| PREDICTED: uncharacterized protein LOC100784217 [Glycine max]
 gb|KHN26645.1| hypothetical protein glysoja_041469 [Glycine soja]
Length=194

 Score =   145 bits (367),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 72/133 (54%), Positives = 95/133 (71%), Gaps = 3/133 (2%)
 Frame = -1

Query  723  IICENLPISTCAFSVSSYGKRCLIEDTVLLDGKVDYKCKTSEVVVGSSTSDYIETDKCVK  544
            I CE+L   TC+F+V+S GKRC++E  V   G+  Y C+TSE+       D+IET++C+K
Sbjct  28   IECESLSHDTCSFAVTSAGKRCVLEKQVKRTGEEAYTCRTSEIE-ADKLKDHIETEQCIK  86

Query  543  TCGVDRKSVGMSSDPFLDSLFMAKLCARACYDYCPNLVDLYANIAAGEGVFLPELCEQIR  364
             CG+DRKS+G+SSD  L S F  KLC+  CY  CPN+VDLY N+AAGEGVFLP+LCE   
Sbjct  87   ACGLDRKSLGISSDSLLQSSFTQKLCSPICYQCCPNVVDLYFNLAAGEGVFLPKLCEA--  144

Query  363  SGEGSRRGMAEIQ  325
             G  +RRGMAE++
Sbjct  145  QGLNARRGMAELK  157



>ref|XP_008377489.1| PREDICTED: uncharacterized protein LOC103440565 [Malus domestica]
Length=198

 Score =   146 bits (368),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 72/133 (54%), Positives = 95/133 (71%), Gaps = 3/133 (2%)
 Frame = -1

Query  723  IICENLPISTCAFSVSSYGKRCLIEDTVLLDGKVDYKCKTSEVVVGSSTSDYIETDKCVK  544
            I CENL    CAF+VSS GKRC++E  V   G+  Y C+TSE+    +  D+IE++KC+K
Sbjct  28   ITCENLEHDACAFAVSSSGKRCVLEKHVKRSGEEAYTCRTSEIEA-DNLKDWIESEKCIK  86

Query  543  TCGVDRKSVGMSSDPFLDSLFMAKLCARACYDYCPNLVDLYANIAAGEGVFLPELCEQIR  364
            +CG+DRKS G+SSD  L+S F  KLC+  CY  CPN+VDLY N+AAGEGVFLP+LCE   
Sbjct  87   SCGLDRKSYGISSDSLLESRFTQKLCSPQCYGNCPNIVDLYFNLAAGEGVFLPKLCEAQE  146

Query  363  SGEGSRRGMAEIQ  325
            +   +RR M+EI+
Sbjct  147  A--NARREMSEIR  157



>ref|XP_002267610.1| PREDICTED: uncharacterized protein LOC100251502 [Vitis vinifera]
 emb|CBI22724.3| unnamed protein product [Vitis vinifera]
Length=186

 Score =   145 bits (366),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 72/133 (54%), Positives = 95/133 (71%), Gaps = 3/133 (2%)
 Frame = -1

Query  723  IICENLPISTCAFSVSSYGKRCLIEDTVLLDGKVDYKCKTSEVVVGSSTSDYIETDKCVK  544
            I CENL   TCA++VSS GKRC++E  V   G+  Y C+TSE+       D++E+D+C++
Sbjct  28   ITCENLNKDTCAYAVSSSGKRCVLEKHVRRSGEEAYVCRTSEIEA-DKVKDWVESDQCIE  86

Query  543  TCGVDRKSVGMSSDPFLDSLFMAKLCARACYDYCPNLVDLYANIAAGEGVFLPELCEQIR  364
             CGVDRKS+G+SSD  L+  F  KLC+  CY+ CPN+VDLY N+AAGEGVFLP+LCE  R
Sbjct  87   ACGVDRKSLGISSDSLLECGFTHKLCSSQCYNSCPNIVDLYFNLAAGEGVFLPKLCEAQR  146

Query  363  SGEGSRRGMAEIQ  325
                +RR MAEI+
Sbjct  147  G--DARREMAEIR  157



>ref|XP_002510782.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF51384.1| conserved hypothetical protein [Ricinus communis]
Length=185

 Score =   145 bits (366),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 69/134 (51%), Positives = 94/134 (70%), Gaps = 2/134 (1%)
 Frame = -1

Query  726  EIICENLPISTCAFSVSSYGKRCLIEDTVLLDGKVDYKCKTSEVVVGSSTSDYIETDKCV  547
            EI CENL   TC+++VSS GKRC++E  V   GK  Y C+ SE+       ++IETD+C+
Sbjct  24   EITCENLDQETCSYAVSSSGKRCVLETHVKRSGKASYACRNSEIE-ADRLRNWIETDQCI  82

Query  546  KTCGVDRKSVGMSSDPFLDSLFMAKLCARACYDYCPNLVDLYANIAAGEGVFLPELCEQI  367
            K CG+DRKS+G+SSD  L+S F  +LC+  CYD CPN++DLY N+AAGEGVFLP+LC+  
Sbjct  83   KACGLDRKSLGISSDSLLESSFTKQLCSPQCYDSCPNIIDLYFNLAAGEGVFLPKLCQAT  142

Query  366  RSGEGSRRGMAEIQ  325
            + G   R   A+I+
Sbjct  143  K-GNARRELTADIR  155



>ref|XP_004234399.1| PREDICTED: uncharacterized protein LOC101252465 [Solanum lycopersicum]
Length=181

 Score =   145 bits (366),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 71/138 (51%), Positives = 101/138 (73%), Gaps = 3/138 (2%)
 Frame = -1

Query  738  IIQSEIICENLPISTCAFSVSSYGKRCLIEDTVLLDGKVDYKCKTSEVVVGSSTSDYIET  559
            +   +I CENL   +CAF++SS GKRC++E  V   G+  Y C+TSE+       D+IET
Sbjct  20   VTLGDIACENLNEDSCAFAISSTGKRCVLEKHVRRSGEEVYICRTSEIE-SDKLKDWIET  78

Query  558  DKCVKTCGVDRKSVGMSSDPFLDSLFMAKLCARACYDYCPNLVDLYANIAAGEGVFLPEL  379
            D+C++ CGVDR ++G+SSD  L+S F +KLC+ ACY+ CPN++DLY N+AAGEGV+LP+L
Sbjct  79   DECIEACGVDRNALGISSDALLESRFTSKLCSSACYNKCPNIIDLYFNLAAGEGVYLPKL  138

Query  378  CEQIRSGEGSRRGMAEIQ  325
            C + + G+G RR MAEI+
Sbjct  139  CAE-QKGKG-RREMAEIR  154



>emb|CBI22723.3| unnamed protein product [Vitis vinifera]
Length=196

 Score =   145 bits (367),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 72/133 (54%), Positives = 95/133 (71%), Gaps = 3/133 (2%)
 Frame = -1

Query  723  IICENLPISTCAFSVSSYGKRCLIEDTVLLDGKVDYKCKTSEVVVGSSTSDYIETDKCVK  544
            I CENL   TCAF+VSS GKRC++E  V   G+  Y C+TSE+       D++E+D+C++
Sbjct  38   ITCENLNKDTCAFAVSSSGKRCVLEKHVRRSGEEAYVCRTSEIE-ADKVKDWVESDQCIE  96

Query  543  TCGVDRKSVGMSSDPFLDSLFMAKLCARACYDYCPNLVDLYANIAAGEGVFLPELCEQIR  364
             CG+DRKS+G+SSD  L+  F  KLC+  CY+ CPN+VDLY N+AAGEGVFLP+LCE  R
Sbjct  97   ACGLDRKSLGISSDSLLECGFTRKLCSTQCYNGCPNIVDLYFNVAAGEGVFLPKLCEAQR  156

Query  363  SGEGSRRGMAEIQ  325
                +RR MAEI+
Sbjct  157  G--DARREMAEIR  167



>ref|XP_004496561.1| PREDICTED: uncharacterized protein LOC101495651 [Cicer arietinum]
Length=197

 Score =   145 bits (367),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 72/134 (54%), Positives = 97/134 (72%), Gaps = 2/134 (1%)
 Frame = -1

Query  726  EIICENLPISTCAFSVSSYGKRCLIEDTVLLDGKVDYKCKTSEVVVGSSTSDYIETDKCV  547
            +I CENL   TCAF+VSS  KRC++E  V   G+  Y C+TS++       D+IE+D+C+
Sbjct  27   DIECENLNEKTCAFAVSSSSKRCVLEKHVKRTGEEAYTCRTSDIE-ADKLKDHIESDQCI  85

Query  546  KTCGVDRKSVGMSSDPFLDSLFMAKLCARACYDYCPNLVDLYANIAAGEGVFLPELCEQI  367
            K+C +DRKS+G+SSD  L+S F  KLC+  CY  CPN+VDLY N+AAGEGVFLP+LCE +
Sbjct  86   KSCDLDRKSLGISSDSLLESRFTEKLCSPQCYKSCPNVVDLYFNLAAGEGVFLPKLCE-V  144

Query  366  RSGEGSRRGMAEIQ  325
            + G   RRGMAE++
Sbjct  145  QGGFNVRRGMAELK  158



>ref|XP_004308085.1| PREDICTED: uncharacterized protein LOC101293047 [Fragaria vesca 
subsp. vesca]
Length=197

 Score =   145 bits (366),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 71/133 (53%), Positives = 95/133 (71%), Gaps = 3/133 (2%)
 Frame = -1

Query  723  IICENLPISTCAFSVSSYGKRCLIEDTVLLDGKVDYKCKTSEVVVGSSTSDYIETDKCVK  544
            + CENL  STCAF+VSS  KRC++E  +   G+  Y C+TSE+       D+IE+++C+K
Sbjct  28   VTCENLDESTCAFAVSSSAKRCVLEKHIKRSGEEAYTCRTSEIEA-DKLKDWIESEECIK  86

Query  543  TCGVDRKSVGMSSDPFLDSLFMAKLCARACYDYCPNLVDLYANIAAGEGVFLPELCEQIR  364
            +CG+DRKS G+SSD  L+S F  KLC+  CY  CPN+VDLY N+AAGEGVFLP+LCE   
Sbjct  87   SCGLDRKSYGISSDSLLESCFAQKLCSPQCYGSCPNIVDLYFNLAAGEGVFLPKLCEA--  144

Query  363  SGEGSRRGMAEIQ  325
             G  +RR M+EI+
Sbjct  145  QGANARRQMSEIR  157



>ref|XP_009604561.1| PREDICTED: uncharacterized protein LOC104099311 [Nicotiana tomentosiformis]
Length=185

 Score =   145 bits (365),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 70/133 (53%), Positives = 95/133 (71%), Gaps = 3/133 (2%)
 Frame = -1

Query  723  IICENLPISTCAFSVSSYGKRCLIEDTVLLDGKVDYKCKTSEVVVGSSTSDYIETDKCVK  544
            I CENL   +CAF++SS GKRC++E  +   G+  Y CKTSE+       D+IETD+C++
Sbjct  28   ITCENLNKDSCAFAISSTGKRCVLEKRLQRSGEEVYTCKTSEIE-ADKLKDWIETDQCIQ  86

Query  543  TCGVDRKSVGMSSDPFLDSLFMAKLCARACYDYCPNLVDLYANIAAGEGVFLPELCEQIR  364
             CGVDR + G+SSD  L+  F  KLC+  CY +CPN++DLY N+AAGEGV+LP LCE+ +
Sbjct  87   ACGVDRNTFGISSDSLLECHFTQKLCSLQCYKHCPNIIDLYFNLAAGEGVYLPRLCEE-Q  145

Query  363  SGEGSRRGMAEIQ  325
             G  +RRGMAEI+
Sbjct  146  VG-NARRGMAEIK  157



>ref|XP_009599617.1| PREDICTED: uncharacterized protein LOC104095236 [Nicotiana tomentosiformis]
Length=185

 Score =   145 bits (365),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 68/133 (51%), Positives = 93/133 (70%), Gaps = 3/133 (2%)
 Frame = -1

Query  723  IICENLPISTCAFSVSSYGKRCLIEDTVLLDGKVDYKCKTSEVVVGSSTSDYIETDKCVK  544
            I CENL   +C F++SS GKRC +E  +   G+  Y CKTSE+       D+IETD+C++
Sbjct  28   ITCENLNKDSCEFAISSTGKRCALEKHLRRSGEEVYTCKTSEIE-ADKLKDWIETDQCIQ  86

Query  543  TCGVDRKSVGMSSDPFLDSLFMAKLCARACYDYCPNLVDLYANIAAGEGVFLPELCEQIR  364
             CGVDR ++G+SSD  L+  F  KLC+  CY +CPN++DLY N+AAGEG++LP LCE+  
Sbjct  87   ACGVDRNTLGISSDSLLECHFTQKLCSPQCYKHCPNIIDLYFNLAAGEGIYLPRLCEE--  144

Query  363  SGEGSRRGMAEIQ  325
             G  +RRGMAEI+
Sbjct  145  QGGNARRGMAEIK  157



>ref|XP_009599697.1| PREDICTED: uncharacterized protein LOC104095302, partial [Nicotiana 
tomentosiformis]
Length=180

 Score =   144 bits (364),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 69/138 (50%), Positives = 99/138 (72%), Gaps = 3/138 (2%)
 Frame = -1

Query  738  IIQSEIICENLPISTCAFSVSSYGKRCLIEDTVLLDGKVDYKCKTSEVVVGSSTSDYIET  559
            I   +I CENL   +CAF++SS GKRC++E  +   G+  Y C+TSE+       D+IET
Sbjct  19   IHAGDIACENLNEDSCAFAISSNGKRCVLEKHLRRSGEEVYTCRTSEIE-ADKLKDWIET  77

Query  558  DKCVKTCGVDRKSVGMSSDPFLDSLFMAKLCARACYDYCPNLVDLYANIAAGEGVFLPEL  379
            ++C++ CGVDR ++G+SSD  L+S F  KLC+ ACY +CPN+VDLY N+AAGEGV+LP+L
Sbjct  78   NECIEACGVDRNALGISSDALLESRFTNKLCSLACYKHCPNIVDLYFNLAAGEGVYLPKL  137

Query  378  CEQIRSGEGSRRGMAEIQ  325
            C +   G+ +RR +AEI+
Sbjct  138  CAE--QGKSARREIAEIR  153



>ref|XP_010923167.1| PREDICTED: uncharacterized protein LOC105046307 isoform X1 [Elaeis 
guineensis]
Length=186

 Score =   145 bits (365),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 70/132 (53%), Positives = 92/132 (70%), Gaps = 3/132 (2%)
 Frame = -1

Query  723  IICENLPISTCAFSVSSYGKRCLIEDTVLLDGKVDYKCKTSEVVVGSSTSDYIETDKCVK  544
            +ICE+LP   CAF++SS  KRC++E      G  +Y+C+TSEVVV    SD+IETD+CVK
Sbjct  33   VICEDLPQDLCAFAISSSSKRCVLESIPHNGGPTEYQCRTSEVVV-ERMSDWIETDECVK  91

Query  543  TCGVDRKSVGMSSDPFLDSLFMAKLCARACYDYCPNLVDLYANIAAGEGVFLPELCEQIR  364
             CGVDR +VG+SSD  L+  F  K+C+ +C+  CPN++DLY N+AA EGVFLP+LCE  R
Sbjct  92   ACGVDRNTVGISSDSLLEPQFTEKICSPSCHQNCPNIIDLYFNLAAAEGVFLPDLCEARR  151

Query  363  SGEGSRRGMAEI  328
                 RR M  I
Sbjct  152  G--NPRRSMQVI  161



>ref|XP_006587314.1| PREDICTED: uncharacterized protein LOC100778782 [Glycine max]
Length=199

 Score =   144 bits (364),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 70/131 (53%), Positives = 90/131 (69%), Gaps = 2/131 (2%)
 Frame = -1

Query  717  CENLPISTCAFSVSSYGKRCLIEDTVLLDGKVDYKCKTSEVVVGSSTSDYIETDKCVKTC  538
            CENL   TCAF+VSS GKRC++E  V   G+  Y C+TSE+ V      +IE+D+C+K C
Sbjct  31   CENLSHDTCAFAVSSEGKRCVLEKRVKRTGEEAYTCRTSEIEVEKQIKGHIESDECIKAC  90

Query  537  GVDRKSVGMSSDPFLDSLFMAKLCARACYDYCPNLVDLYANIAAGEGVFLPELCEQIRSG  358
            G+DRKS G+SSD  ++  F   LC+  CY  CPN+VDLY N+AAGEGVFLP+LC     G
Sbjct  91   GLDRKSFGISSDSLMERGFTQNLCSPQCYQSCPNIVDLYFNLAAGEGVFLPKLCAA--KG  148

Query  357  EGSRRGMAEIQ  325
              +RR MAEI+
Sbjct  149  ANARRQMAEIK  159



>emb|CAA58732.1| PAR-1c [Nicotiana tabacum]
Length=183

 Score =   144 bits (363),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 69/133 (52%), Positives = 96/133 (72%), Gaps = 3/133 (2%)
 Frame = -1

Query  723  IICENLPISTCAFSVSSYGKRCLIEDTVLLDGKVDYKCKTSEVVVGSSTSDYIETDKCVK  544
            I CENL   +CAF++SS GKRC++E  +   G+  Y C+TSE+       D+IETD+C++
Sbjct  28   IACENLNEDSCAFAISSNGKRCVLEKHLRRSGEEGYTCRTSEIE-ADKLKDWIETDECIE  86

Query  543  TCGVDRKSVGMSSDPFLDSLFMAKLCARACYDYCPNLVDLYANIAAGEGVFLPELCEQIR  364
             CGVDR ++G+SSD  L+S F  KLC+ ACY +CPN+VDLY N+AAGEGV+LP+LC +  
Sbjct  87   ACGVDRNALGISSDALLESRFTNKLCSPACYKHCPNIVDLYFNLAAGEGVYLPKLCAE--  144

Query  363  SGEGSRRGMAEIQ  325
             G  +RR +AEI+
Sbjct  145  QGGKARREIAEIR  157



>emb|CDX76173.1| BnaA04g04370D [Brassica napus]
Length=182

 Score =   144 bits (363),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 73/136 (54%), Positives = 97/136 (71%), Gaps = 6/136 (4%)
 Frame = -1

Query  735  IQSEIICENLPISTCAFSVSSYGKRCLIEDTVLLDGKVDYKCKTSEVVVGSSTSDYIETD  556
            +  EIICENLP S CAFS+S+ GKRCL+E T  + G  +Y C+TS V V     +++E+D
Sbjct  22   LGEEIICENLPTSMCAFSISASGKRCLLE-TANVAG--EYTCRTSAVEV-EGIVNHVESD  77

Query  555  KCVKTCGVDRKSVGMSSDPFLDSLFMAKLCARACYDYCPNLVDLYANIAAGEGVFLPELC  376
            +CV  CGVDRK+VG+SSD  ++  F AKLC+ AC DYCPN++DLY N+AAGEG FLP+LC
Sbjct  78   ECVAACGVDRKTVGISSDAMMEPGFAAKLCSPACLDYCPNILDLYFNLAAGEGAFLPDLC  137

Query  375  EQIRSGEGSRRGMAEI  328
            +  R+     R M E+
Sbjct  138  DAQRT--NPHRSMMEM  151



>ref|XP_010662745.1| PREDICTED: uncharacterized protein LOC100254969 isoform X1 [Vitis 
vinifera]
Length=186

 Score =   144 bits (362),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 71/131 (54%), Positives = 94/131 (72%), Gaps = 3/131 (2%)
 Frame = -1

Query  717  CENLPISTCAFSVSSYGKRCLIEDTVLLDGKVDYKCKTSEVVVGSSTSDYIETDKCVKTC  538
            CENL   TCAF+VSS GKRC++E  V   G+  Y C+TSE+       D++E+D+C++ C
Sbjct  30   CENLNKDTCAFAVSSSGKRCVLEKHVRRSGEEAYVCRTSEIEA-DKVKDWVESDQCIEAC  88

Query  537  GVDRKSVGMSSDPFLDSLFMAKLCARACYDYCPNLVDLYANIAAGEGVFLPELCEQIRSG  358
            G+DRKS+G+SSD  L+  F  KLC+  CY+ CPN+VDLY N+AAGEGVFLP+LCE  R  
Sbjct  89   GLDRKSLGISSDSLLECGFTRKLCSTQCYNGCPNIVDLYFNLAAGEGVFLPKLCEAQRG-  147

Query  357  EGSRRGMAEIQ  325
              +RR MAEI+
Sbjct  148  -DARREMAEIR  157



>ref|XP_009770389.1| PREDICTED: uncharacterized protein LOC104221096 [Nicotiana sylvestris]
Length=185

 Score =   144 bits (362),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 68/133 (51%), Positives = 93/133 (70%), Gaps = 3/133 (2%)
 Frame = -1

Query  723  IICENLPISTCAFSVSSYGKRCLIEDTVLLDGKVDYKCKTSEVVVGSSTSDYIETDKCVK  544
            I CENL   +C F++SS GKRC++E  +   G+  Y CKT E+       ++IETD+C++
Sbjct  28   ITCENLNKDSCTFAISSTGKRCVLEKHLRRSGEEVYACKTLEIE-ADKLKNWIETDQCIQ  86

Query  543  TCGVDRKSVGMSSDPFLDSLFMAKLCARACYDYCPNLVDLYANIAAGEGVFLPELCEQIR  364
             CGVDR ++G+SSD  L+  F  KLC+  CY +CPN+VDLY N+AAGEGV+LP LCE  +
Sbjct  87   ACGVDRNTLGISSDSLLECHFTQKLCSPQCYKHCPNIVDLYFNLAAGEGVYLPRLCE--K  144

Query  363  SGEGSRRGMAEIQ  325
             G  +RRGMAEI+
Sbjct  145  QGGNARRGMAEIK  157



>ref|XP_002267611.1| PREDICTED: uncharacterized protein LOC100254969 isoform X2 [Vitis 
vinifera]
 emb|CAN82560.1| hypothetical protein VITISV_031304 [Vitis vinifera]
 emb|CBI22722.3| unnamed protein product [Vitis vinifera]
Length=186

 Score =   143 bits (361),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 71/131 (54%), Positives = 94/131 (72%), Gaps = 3/131 (2%)
 Frame = -1

Query  717  CENLPISTCAFSVSSYGKRCLIEDTVLLDGKVDYKCKTSEVVVGSSTSDYIETDKCVKTC  538
            CENL   TCAF+VSS GKRC++E  V   G+  Y C+TSE+       D++E+D+C++ C
Sbjct  30   CENLNKDTCAFAVSSSGKRCVLEKHVRRSGEEAYVCRTSEIEA-DKVKDWVESDQCIEAC  88

Query  537  GVDRKSVGMSSDPFLDSLFMAKLCARACYDYCPNLVDLYANIAAGEGVFLPELCEQIRSG  358
            G+DRKS+G+SSD  L+  F  KLC+  CY+ CPN+VDLY N+AAGEGVFLP+LCE  R  
Sbjct  89   GLDRKSLGISSDSLLECGFTRKLCSTQCYNGCPNIVDLYFNLAAGEGVFLPKLCEAQRG-  147

Query  357  EGSRRGMAEIQ  325
              +RR MAEI+
Sbjct  148  -DARREMAEIR  157



>ref|XP_009139268.1| PREDICTED: uncharacterized protein LOC103863265 [Brassica rapa]
Length=182

 Score =   143 bits (361),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 73/136 (54%), Positives = 96/136 (71%), Gaps = 6/136 (4%)
 Frame = -1

Query  735  IQSEIICENLPISTCAFSVSSYGKRCLIEDTVLLDGKVDYKCKTSEVVVGSSTSDYIETD  556
            +  EIICENLP S CAFS+S+ GKRCL+E T  + G  +Y C+ S V V     +Y+E+D
Sbjct  22   LGEEIICENLPTSMCAFSISASGKRCLLE-TANVAG--EYTCRNSAVEV-KGIVNYVESD  77

Query  555  KCVKTCGVDRKSVGMSSDPFLDSLFMAKLCARACYDYCPNLVDLYANIAAGEGVFLPELC  376
            +CV  CGVDRK+VG+SSD  ++  F AKLC+ AC DYCPN++DLY N+AAGEG FLP+LC
Sbjct  78   ECVAACGVDRKTVGISSDAMMEPGFAAKLCSPACLDYCPNILDLYFNLAAGEGAFLPDLC  137

Query  375  EQIRSGEGSRRGMAEI  328
            +  R+     R M E+
Sbjct  138  DAQRTNP--HRSMMEM  151



>ref|XP_011094948.1| PREDICTED: uncharacterized protein LOC105174517 [Sesamum indicum]
Length=176

 Score =   143 bits (360),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 69/134 (51%), Positives = 95/134 (71%), Gaps = 4/134 (3%)
 Frame = -1

Query  729  SEIICENLPISTCAFSVSSYGKRCLIEDTVLLDGKVDYKCKTSEVVVGSSTSDYIETDKC  550
            +E+ICENLP++ CAF+++S GKRC++E T    G++ + CKTSEVVV    S Y+ETD+C
Sbjct  25   AEVICENLPMNLCAFAIASSGKRCVLEKTKNARGEIGFTCKTSEVVV-ERLSGYLETDQC  83

Query  549  VKTCGVDRKSVGMSSDPFLDSLFMAKLCARACYDYCPNLVDLYANIAAGEGVFLPELCEQ  370
            V  CG+ R+ +G+SSD F+ S F A LC+ AC+  CPN+VDLY N+AAGEGV LP LC+ 
Sbjct  84   VNGCGLHREFIGLSSDVFISSEFTAHLCSPACFQNCPNIVDLYLNLAAGEGVSLPILCQN  143

Query  369  IRSGEGSRRGMAEI  328
             +    + R M  I
Sbjct  144  QKE---NHRAMLTI  154



>ref|XP_008234242.1| PREDICTED: uncharacterized protein LOC103333213 [Prunus mume]
Length=200

 Score =   144 bits (362),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 70/133 (53%), Positives = 94/133 (71%), Gaps = 3/133 (2%)
 Frame = -1

Query  723  IICENLPISTCAFSVSSYGKRCLIEDTVLLDGKVDYKCKTSEVVVGSSTSDYIETDKCVK  544
            I CE+L   TCAF+VSS  KRC++E  V   G+  Y C+TSE+       D++E+++C+K
Sbjct  28   ISCEDLDQDTCAFAVSSSSKRCVLEKHVRRSGEEAYTCRTSEIE-ADKLKDWVESEQCIK  86

Query  543  TCGVDRKSVGMSSDPFLDSLFMAKLCARACYDYCPNLVDLYANIAAGEGVFLPELCEQIR  364
            +CG+DRKS G+ SD  L+S F  KLC+  CYD CPN+VDLY N+AAGEGVFLP+LCE   
Sbjct  87   SCGLDRKSYGICSDSLLESRFTQKLCSPQCYDTCPNIVDLYFNLAAGEGVFLPKLCEA--  144

Query  363  SGEGSRRGMAEIQ  325
             G  +RR M+EI+
Sbjct  145  QGANARRQMSEIR  157



>ref|XP_006827667.1| hypothetical protein AMTR_s00009p00254330 [Amborella trichopoda]
 gb|ERM95083.1| hypothetical protein AMTR_s00009p00254330 [Amborella trichopoda]
Length=186

 Score =   143 bits (361),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 68/135 (50%), Positives = 95/135 (70%), Gaps = 3/135 (2%)
 Frame = -1

Query  729  SEIICENLPISTCAFSVSSYGKRCLIEDTVLLDGKVDYKCKTSEVVVGSSTSDYIETDKC  550
            ++I+CE L    CAFSVSS G RC++E  +      +Y+CK SE+   +  S++IETDKC
Sbjct  28   AKIVCEQLHKDKCAFSVSSSGTRCVLEQRMTHSTSTEYECKASEIA-AAHLSNWIETDKC  86

Query  549  VKTCGVDRKSVGMSSDPFLDSLFMAKLCARACYDYCPNLVDLYANIAAGEGVFLPELCEQ  370
            ++ CG++R  VG+SSD  L+  F+ KLCA  CY  CPN+++LY N+AAGEGV+LP+LCE 
Sbjct  87   LEACGLNRNMVGISSDFLLEPQFVKKLCATQCYHGCPNILNLYFNLAAGEGVYLPKLCEA  146

Query  369  IRSGEGSRRGMAEIQ  325
             R+   SRR MAEI+
Sbjct  147  QRA--SSRRAMAEIR  159



>ref|XP_002279995.1| PREDICTED: uncharacterized protein LOC100267406 [Vitis vinifera]
Length=180

 Score =   143 bits (360),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 68/133 (51%), Positives = 90/133 (68%), Gaps = 7/133 (5%)
 Frame = -1

Query  726  EIICENLPISTCAFSVSSYGKRCLIEDTVLLDGKVDYKCKTSEVVVGSSTSDYIETDKCV  547
            E+ICE LP   C+FS++S GKRCL+E     DG  + +CKTSEVVV    S +IET++C+
Sbjct  19   ELICEGLPTDLCSFSIASSGKRCLLEKCASTDGTTELQCKTSEVVV-DGMSAWIETEQCI  77

Query  546  KTCGVDRKSVGMSSDPFLDSLFMAKLCARACYDYCPNLVDLYANIAAGEGVFLPELCEQI  367
              CGVDR S+G+SSD  LD  F A+LC+ ACY  CPN++DLY N+A+ EG FLP+LC   
Sbjct  78   HACGVDRNSIGISSDSLLDPQFTAQLCSLACYQNCPNIIDLYFNLASAEGGFLPDLCAN-  136

Query  366  RSGEGSRRGMAEI  328
                   R M+E+
Sbjct  137  -----PHRAMSEL  144



>gb|KDP22273.1| hypothetical protein JCGZ_26104 [Jatropha curcas]
Length=184

 Score =   143 bits (360),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 68/134 (51%), Positives = 96/134 (72%), Gaps = 2/134 (1%)
 Frame = -1

Query  726  EIICENLPISTCAFSVSSYGKRCLIEDTVLLDGKVDYKCKTSEVVVGSSTSDYIETDKCV  547
            EI CE+L   TC++++SS GKRC++E  V   G+  Y C+TSE+       ++IE+D+C+
Sbjct  24   EIKCEHLDQDTCSYAISSTGKRCVLEKHVKRSGQESYNCRTSEIEA-DRLRNWIESDQCI  82

Query  546  KTCGVDRKSVGMSSDPFLDSLFMAKLCARACYDYCPNLVDLYANIAAGEGVFLPELCEQI  367
            K CG+DRK++G+SSD  LDS F   LC+  CY+ CPN+VDLY N+AAGEGVFLP+LCE  
Sbjct  83   KACGLDRKTLGISSDSLLDSCFTKHLCSSECYNSCPNVVDLYFNLAAGEGVFLPKLCEA-  141

Query  366  RSGEGSRRGMAEIQ  325
            + G G R  +A+I+
Sbjct  142  KEGNGRRELIADIK  155



>ref|XP_002877953.1| hypothetical protein ARALYDRAFT_485800 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH54212.1| hypothetical protein ARALYDRAFT_485800 [Arabidopsis lyrata subsp. 
lyrata]
Length=183

 Score =   143 bits (360),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 72/132 (55%), Positives = 96/132 (73%), Gaps = 6/132 (5%)
 Frame = -1

Query  723  IICENLPISTCAFSVSSYGKRCLIEDTVLLDGKVDYKCKTSEVVVGSSTSDYIETDKCVK  544
            IICENLP + CAFS+S+ GKRC++E T  + G  ++ C+TS V V     +++ETD+CV 
Sbjct  26   IICENLPTTMCAFSISASGKRCILE-TANVAG--EFTCRTSAVDV-EGIVNHVETDECVS  81

Query  543  TCGVDRKSVGMSSDPFLDSLFMAKLCARACYDYCPNLVDLYANIAAGEGVFLPELCEQIR  364
             CGVDRK+VG+SSD  +++ F AKLC+ AC DYCPN++DLY N+AAGEGVFLP+LC+  R
Sbjct  82   ACGVDRKTVGISSDSLMEAGFAAKLCSSACLDYCPNILDLYFNLAAGEGVFLPDLCDAQR  141

Query  363  SGEGSRRGMAEI  328
                  R M EI
Sbjct  142  MNP--HRSMLEI  151



>ref|XP_006353293.1| PREDICTED: uncharacterized protein LOC102592141 [Solanum tuberosum]
Length=184

 Score =   143 bits (360),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 70/138 (51%), Positives = 99/138 (72%), Gaps = 3/138 (2%)
 Frame = -1

Query  738  IIQSEIICENLPISTCAFSVSSYGKRCLIEDTVLLDGKVDYKCKTSEVVVGSSTSDYIET  559
            +   +I CENL   +CAF++SS GKRC++E  +   G+  Y C+TSE+       D+IET
Sbjct  23   VTLGDIACENLNEDSCAFAISSTGKRCVLEKHLRRSGEEVYICRTSEIE-ADKLKDWIET  81

Query  558  DKCVKTCGVDRKSVGMSSDPFLDSLFMAKLCARACYDYCPNLVDLYANIAAGEGVFLPEL  379
            D+C+  CGVDR ++G+SSD  L+S F +KLC+ ACY+ CPN++DLY N+AAGEGV+LP+L
Sbjct  82   DECIGECGVDRNALGISSDALLESRFTSKLCSSACYNNCPNIIDLYFNLAAGEGVYLPKL  141

Query  378  CEQIRSGEGSRRGMAEIQ  325
            C + + G G RR MAEI+
Sbjct  142  CAE-QKGNG-RREMAEIR  157



>ref|XP_006424982.1| hypothetical protein CICLE_v10029842mg [Citrus clementina]
 gb|ESR38222.1| hypothetical protein CICLE_v10029842mg [Citrus clementina]
Length=157

 Score =   142 bits (357),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 69/116 (59%), Positives = 83/116 (72%), Gaps = 1/116 (1%)
 Frame = -1

Query  723  IICENLPISTCAFSVSSYGKRCLIEDTVLLDGKVDYKCKTSEVVVGSSTSDYIETDKCVK  544
            IICE LP   C++SVSS GKRCL+E+    DG V Y+CKTSEV+V     D+IET++C  
Sbjct  25   IICEQLPKQLCSYSVSSSGKRCLLENFASSDGTVTYQCKTSEVIV-DVVHDWIETEECTN  83

Query  543  TCGVDRKSVGMSSDPFLDSLFMAKLCARACYDYCPNLVDLYANIAAGEGVFLPELC  376
             CGVDRKSVG+SSD  L   F AKLC+ ACY  CPN+VDLY N+A GEG F P +C
Sbjct  84   ACGVDRKSVGISSDSLLQPQFTAKLCSDACYQNCPNIVDLYFNLALGEGKFHPTIC  139



>emb|CAA58733.1| PAR-1a [Nicotiana tabacum]
Length=185

 Score =   142 bits (359),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 67/133 (50%), Positives = 93/133 (70%), Gaps = 3/133 (2%)
 Frame = -1

Query  723  IICENLPISTCAFSVSSYGKRCLIEDTVLLDGKVDYKCKTSEVVVGSSTSDYIETDKCVK  544
            I CENL   +C F++SS GKRC++E  +   G+  Y CKT E+       ++IETD+C++
Sbjct  28   ITCENLNKDSCTFAISSTGKRCVLEKHLRRSGEEVYACKTLEIE-ADKLKNWIETDQCIQ  86

Query  543  TCGVDRKSVGMSSDPFLDSLFMAKLCARACYDYCPNLVDLYANIAAGEGVFLPELCEQIR  364
             CGVDR ++G+SSD  L+  F  KLC+  CY +CPN+VDLY N+AAG+GV+LP LCE  +
Sbjct  87   ACGVDRNTLGISSDSLLECHFTQKLCSPQCYKHCPNIVDLYFNLAAGQGVYLPRLCE--K  144

Query  363  SGEGSRRGMAEIQ  325
             G  +RRGMAEI+
Sbjct  145  QGGNARRGMAEIK  157



>ref|XP_006388430.1| hypothetical protein POPTR_0187s00200g [Populus trichocarpa]
 gb|ERP47344.1| hypothetical protein POPTR_0187s00200g [Populus trichocarpa]
Length=180

 Score =   142 bits (359),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 63/128 (49%), Positives = 89/128 (70%), Gaps = 0/128 (0%)
 Frame = -1

Query  726  EIICENLPISTCAFSVSSYGKRCLIEDTVLLDGKVDYKCKTSEVVVGSSTSDYIETDKCV  547
            E++CE LP+  C++S+++ GKRCL+E+    DG V Y+CKTSEVVVG   S++IE D+C+
Sbjct  19   ELVCEQLPVDLCSYSIATSGKRCLLENYATKDGGVKYQCKTSEVVVGIVLSEWIEIDECI  78

Query  546  KTCGVDRKSVGMSSDPFLDSLFMAKLCARACYDYCPNLVDLYANIAAGEGVFLPELCEQI  367
              CG+ R +VG+SSD  L   F+ KLC+++C   CPN+VDLY+N+A  EGV+LP LC   
Sbjct  79   TACGLSRNTVGISSDSLLQPQFLTKLCSKSCSQACPNIVDLYSNLALAEGVYLPNLCASP  138

Query  366  RSGEGSRR  343
            R      R
Sbjct  139  RRAMYQTR  146



>ref|XP_009139267.1| PREDICTED: uncharacterized protein LOC103863264 [Brassica rapa]
 emb|CDX76172.1| BnaA04g04360D [Brassica napus]
Length=183

 Score =   142 bits (359),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 71/136 (52%), Positives = 98/136 (72%), Gaps = 6/136 (4%)
 Frame = -1

Query  735  IQSEIICENLPISTCAFSVSSYGKRCLIEDTVLLDGKVDYKCKTSEVVVGSSTSDYIETD  556
            +  +IICENLP + CAFS+S+ GKRCL+E T  + G  +Y C+TS V V     +++E+D
Sbjct  22   LGEDIICENLPTNMCAFSISASGKRCLLE-TANVAG--EYTCRTSAVEV-EGIVNHVESD  77

Query  555  KCVKTCGVDRKSVGMSSDPFLDSLFMAKLCARACYDYCPNLVDLYANIAAGEGVFLPELC  376
            +CV  CGVDRK+VG+SSD  +++ F AKLC+ AC DYCPN++DLY N+AAGEG FLP+LC
Sbjct  78   ECVAACGVDRKTVGISSDAMMEAGFAAKLCSPACLDYCPNILDLYFNLAAGEGAFLPDLC  137

Query  375  EQIRSGEGSRRGMAEI  328
            +  R+     R M E+
Sbjct  138  DAQRTNP--HRSMLEM  151



>ref|XP_003592283.1| PAR-1a protein [Medicago truncatula]
 gb|AES62534.1| PAR1 protein [Medicago truncatula]
Length=198

 Score =   143 bits (360),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 72/133 (54%), Positives = 93/133 (70%), Gaps = 3/133 (2%)
 Frame = -1

Query  723  IICENLPISTCAFSVSSYGKRCLIEDTVLLDGKVDYKCKTSEVVVGSSTSDYIETDKCVK  544
            I CENL   TC+F+VSS  KRC++E  V   G+  Y CKT E+       D+IE+D+C+K
Sbjct  28   IECENLSKETCSFAVSSSSKRCVLEKHVKRTGEEAYTCKTLEIE-ADKLKDHIESDQCIK  86

Query  543  TCGVDRKSVGMSSDPFLDSLFMAKLCARACYDYCPNLVDLYANIAAGEGVFLPELCEQIR  364
             C +DRKS+G+SSD  L+S F  KLC+  CY  CPN+VDLY N+AAGEGVFLP+LCE   
Sbjct  87   ACDLDRKSLGISSDSLLESSFTKKLCSPQCYKSCPNVVDLYFNLAAGEGVFLPKLCE--V  144

Query  363  SGEGSRRGMAEIQ  325
             G  +RRGMAE++
Sbjct  145  QGGNARRGMAELK  157



>ref|XP_007218440.1| hypothetical protein PRUPE_ppa011685mg [Prunus persica]
 gb|EMJ19639.1| hypothetical protein PRUPE_ppa011685mg [Prunus persica]
Length=200

 Score =   142 bits (359),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 69/133 (52%), Positives = 94/133 (71%), Gaps = 3/133 (2%)
 Frame = -1

Query  723  IICENLPISTCAFSVSSYGKRCLIEDTVLLDGKVDYKCKTSEVVVGSSTSDYIETDKCVK  544
            I CE+L   TCAF+VSS  KRC++E  V   G+  Y C+TSE+       D++E+++C+K
Sbjct  28   ITCEDLDKDTCAFAVSSSSKRCVLEKHVRRSGEEAYTCRTSEIE-ADKLKDWVESEQCIK  86

Query  543  TCGVDRKSVGMSSDPFLDSLFMAKLCARACYDYCPNLVDLYANIAAGEGVFLPELCEQIR  364
            +CG+DRKS G+ SD  L+S F  KLC+  CY+ CPN+VDLY N+AAGEGVFLP+LCE   
Sbjct  87   SCGLDRKSYGICSDSLLESRFTQKLCSPQCYNTCPNIVDLYFNLAAGEGVFLPKLCEA--  144

Query  363  SGEGSRRGMAEIQ  325
             G  +RR M+EI+
Sbjct  145  QGANARRQMSEIR  157



>emb|CDY66558.1| BnaC08g48820D [Brassica napus]
Length=181

 Score =   142 bits (358),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 69/120 (58%), Positives = 91/120 (76%), Gaps = 4/120 (3%)
 Frame = -1

Query  723  IICENLPISTCAFSVSSYGKRCLIEDTVLLDGKVDYKCKTSEVVVGSSTSDYIETDKCVK  544
            IICENLP + CAFS+S+ GKRCL+E T  + G  +Y C+TSEV V     +++E+D CV 
Sbjct  26   IICENLPTNICAFSISASGKRCLLE-TANVAG--EYTCRTSEVEV-EGIVNHVESDACVA  81

Query  543  TCGVDRKSVGMSSDPFLDSLFMAKLCARACYDYCPNLVDLYANIAAGEGVFLPELCEQIR  364
             CGVDRK+VG+SSD  +++ F AKLC+ AC DYCPN++DLY N+AAGEG FLP+LC+  R
Sbjct  82   ACGVDRKTVGISSDAMMEAGFAAKLCSPACLDYCPNILDLYFNLAAGEGAFLPDLCDAQR  141



>gb|EYU25099.1| hypothetical protein MIMGU_mgv1a014446mg [Erythranthe guttata]
Length=189

 Score =   142 bits (358),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 68/134 (51%), Positives = 92/134 (69%), Gaps = 2/134 (1%)
 Frame = -1

Query  726  EIICENLPISTCAFSVSSYGKRCLIEDTVLLDGKVDYKCKTSEVVVGSSTSDYIETDKCV  547
            +I C+NL   TC+++VS  GKRC++E  V   G  +Y C TSE+       D+IE+D+C+
Sbjct  25   KIECQNLSKDTCSYAVSYVGKRCVLEKHVRRSGVEEYTCGTSEIEAAGRMKDWIESDECI  84

Query  546  KTCGVDRKSVGMSSDPFLDSLFMAKLCARACYDYCPNLVDLYANIAAGEGVFLPELCEQI  367
            K CG+DR ++G+SSD  L+S F  KLC+  CY  CPN+VDLY N+AAGEGV+LP+LCE  
Sbjct  85   KACGLDRSALGISSDSMLESHFAGKLCSDECYGGCPNIVDLYFNLAAGEGVYLPKLCEA-  143

Query  366  RSGEGSRRGMAEIQ  325
              G   RR MAEI+
Sbjct  144  -QGTNKRREMAEIK  156



>ref|XP_009342968.1| PREDICTED: uncharacterized protein LOC103934926 [Pyrus x bretschneideri]
Length=198

 Score =   142 bits (359),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 71/133 (53%), Positives = 92/133 (69%), Gaps = 3/133 (2%)
 Frame = -1

Query  723  IICENLPISTCAFSVSSYGKRCLIEDTVLLDGKVDYKCKTSEVVVGSSTSDYIETDKCVK  544
            I CENL    CAF+VSS GKRC++E  V   G+  Y C+TSE+ V     D+IE++ C+K
Sbjct  28   ITCENLNHDACAFAVSSSGKRCVLEKHVRRSGEEAYTCRTSEIEV-DKLKDWIESETCIK  86

Query  543  TCGVDRKSVGMSSDPFLDSLFMAKLCARACYDYCPNLVDLYANIAAGEGVFLPELCEQIR  364
            +CG+DRKS G+SSD  L+S F  KLC+  CY  CPN+VDLY N+AAGEGVFLP LC    
Sbjct  87   SCGLDRKSYGISSDSLLESRFTQKLCSPQCYGSCPNIVDLYFNLAAGEGVFLPTLCAA--  144

Query  363  SGEGSRRGMAEIQ  325
             G  +RR ++EI+
Sbjct  145  QGANARRELSEIR  157



>ref|XP_010909892.1| PREDICTED: uncharacterized protein LOC105035875 [Elaeis guineensis]
Length=193

 Score =   142 bits (358),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 70/139 (50%), Positives = 95/139 (68%), Gaps = 3/139 (2%)
 Frame = -1

Query  741  PIIQSEIICENLPISTCAFSVSSYGKRCLIEDTVLLDGKVDYKCKTSEVVVGSSTSDYIE  562
            P +   + CE L  STCAF+VSS G RC++E  V   G+ +Y C+ S V       D++E
Sbjct  16   PHVLGAVTCERLDRSTCAFAVSSAGTRCVLEKRVRRGGQEEYTCRASRVE-ADGLKDHVE  74

Query  561  TDKCVKTCGVDRKSVGMSSDPFLDSLFMAKLCARACYDYCPNLVDLYANIAAGEGVFLPE  382
            TD+C+K CG+ R S+G+SSD  LDS F  KLC+  CY+ CPN+V+LY N+AAGEGVFLP+
Sbjct  75   TDECLKACGLVRGSLGISSDSLLDSRFTQKLCSARCYNGCPNIVNLYFNLAAGEGVFLPK  134

Query  381  LCEQIRSGEGSRRGMAEIQ  325
            LC+  R+ +  RR MAEI+
Sbjct  135  LCKTHRASK--RRAMAEIR  151



>ref|XP_004234398.1| PREDICTED: uncharacterized protein LOC101252153 [Solanum lycopersicum]
Length=184

 Score =   142 bits (357),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 70/134 (52%), Positives = 97/134 (72%), Gaps = 3/134 (2%)
 Frame = -1

Query  726  EIICENLPISTCAFSVSSYGKRCLIEDTVLLDGKVDYKCKTSEVVVGSSTSDYIETDKCV  547
             I CENL   +CAF++SS GKRC++E  V   G+  Y C+TSE+       D+IETD+C+
Sbjct  27   HIACENLNEDSCAFAISSTGKRCVLEKHVRRSGEEVYICRTSEIE-SDKLKDWIETDECI  85

Query  546  KTCGVDRKSVGMSSDPFLDSLFMAKLCARACYDYCPNLVDLYANIAAGEGVFLPELCEQI  367
            + CGVDR ++G+SSD  L+  F  KLC+ ACY+ CPN++DLY N+AAGEGV+LP+LC + 
Sbjct  86   EACGVDRNALGISSDALLEYRFTRKLCSSACYNNCPNIIDLYFNLAAGEGVYLPKLCAE-  144

Query  366  RSGEGSRRGMAEIQ  325
            + G+G RR MAEI+
Sbjct  145  QKGKG-RREMAEIR  157



>ref|XP_008376590.1| PREDICTED: uncharacterized protein LOC103439761 [Malus domestica]
Length=198

 Score =   142 bits (358),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 71/133 (53%), Positives = 91/133 (68%), Gaps = 3/133 (2%)
 Frame = -1

Query  723  IICENLPISTCAFSVSSYGKRCLIEDTVLLDGKVDYKCKTSEVVVGSSTSDYIETDKCVK  544
            I CENL    CAF+VSS GKRC++E  V   G+  Y C+TSE+       D+IE++ C+K
Sbjct  28   ITCENLDHDACAFAVSSSGKRCVLEKHVRRSGEEAYTCRTSEIE-ADKLKDWIESETCIK  86

Query  543  TCGVDRKSVGMSSDPFLDSLFMAKLCARACYDYCPNLVDLYANIAAGEGVFLPELCEQIR  364
            +CG+DRKS G+SSD  L+S F  KLC+  CY  CPN+VDLY N+AAGEGVFLP LC    
Sbjct  87   SCGLDRKSYGISSDSLLESSFTQKLCSPQCYGSCPNIVDLYFNLAAGEGVFLPTLCAA--  144

Query  363  SGEGSRRGMAEIQ  325
             G  +RR M+EI+
Sbjct  145  QGANARREMSEIR  157



>ref|XP_009103899.1| PREDICTED: uncharacterized protein LOC103829961 isoform X1 [Brassica 
rapa]
 emb|CDX67585.1| BnaA07g16250D [Brassica napus]
Length=186

 Score =   142 bits (357),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 71/136 (52%), Positives = 97/136 (71%), Gaps = 6/136 (4%)
 Frame = -1

Query  735  IQSEIICENLPISTCAFSVSSYGKRCLIEDTVLLDGKVDYKCKTSEVVVGSSTSDYIETD  556
            +  +I+CENLP + CAFS+S+ GKRCL+E T  + G  +Y C+TS V V     +++E+D
Sbjct  22   LGEDIVCENLPTNMCAFSISASGKRCLLE-TANVTG--EYTCRTSAVEV-EGIVNHVESD  77

Query  555  KCVKTCGVDRKSVGMSSDPFLDSLFMAKLCARACYDYCPNLVDLYANIAAGEGVFLPELC  376
            +CV  CGVDRK+VG+SSD  +++ F AKLC+ AC DYCPN++DLY N+AAGEG FLP+LC
Sbjct  78   ECVAACGVDRKTVGISSDAMMEAGFAAKLCSPACLDYCPNILDLYFNLAAGEGAFLPDLC  137

Query  375  EQIRSGEGSRRGMAEI  328
            +  R      R M EI
Sbjct  138  DAQRINP--HRSMLEI  151



>ref|XP_011085664.1| PREDICTED: uncharacterized protein LOC105167590 [Sesamum indicum]
Length=254

 Score =   143 bits (361),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 68/133 (51%), Positives = 93/133 (70%), Gaps = 4/133 (3%)
 Frame = -1

Query  726  EIICENLPISTCAFSVSSYGKRCLIEDTVLLDGKVDYKCKTSEVVVGSSTSDYIETDKCV  547
            ++ICENLP   C+F+V+S GKRC++E+     GK DY CKTSEVVV    S YIET++C+
Sbjct  107  DVICENLPTKLCSFAVASSGKRCVLENYKNAQGKTDYTCKTSEVVV-EKLSGYIETNQCM  165

Query  546  KTCGVDRKSVGMSSDPFLDSLFMAKLCARACYDYCPNLVDLYANIAAGEGVFLPELCEQI  367
              CGV R+ +G+SS+ FL S F A+LC+ ACY  CPN+VDL+ N+A GEG+ LP LC+  
Sbjct  166  NACGVHREFIGISSEAFLSSEFTARLCSSACYQNCPNIVDLFFNLAVGEGISLPALCQNQ  225

Query  366  RSGEGSRRGMAEI  328
            +    + R + EI
Sbjct  226  KE---NHRAILEI  235



>gb|EYU27489.1| hypothetical protein MIMGU_mgv1a014649mg [Erythranthe guttata]
Length=182

 Score =   141 bits (355),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 71/134 (53%), Positives = 96/134 (72%), Gaps = 4/134 (3%)
 Frame = -1

Query  726  EIICENLPISTCAFSVSSYGKRCLIEDTV-LLDGKVDYKCKTSEVVVGSSTSDYIETDKC  550
            E++CENLP + CAF+++S GKRC++E+     +GK+DY CK+SEVVV    S YIE+D+C
Sbjct  27   EVVCENLPENLCAFAIASSGKRCVLENYKNEEEGKLDYTCKSSEVVV-ERLSGYIESDQC  85

Query  549  VKTCGVDRKSVGMSSDPFLDSLFMAKLCARACYDYCPNLVDLYANIAAGEGVFLPELCEQ  370
            +  CGVDR  VG+SSD FL   F + LC+  CY  CPN+VDLY N+AAGEGV+LP LC++
Sbjct  86   INACGVDRTFVGISSDAFLTQEFTSSLCSPDCYRNCPNIVDLYFNLAAGEGVYLPALCDK  145

Query  369  IRSGEGSRRGMAEI  328
             +S     R M E+
Sbjct  146  QKS--SPHRAMFEL  157



>gb|AFK34890.1| unknown [Medicago truncatula]
Length=198

 Score =   141 bits (356),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 71/133 (53%), Positives = 92/133 (69%), Gaps = 3/133 (2%)
 Frame = -1

Query  723  IICENLPISTCAFSVSSYGKRCLIEDTVLLDGKVDYKCKTSEVVVGSSTSDYIETDKCVK  544
            I CENL   TC+F+VSS  KRC++E      G+  Y CKT E+       D+IE+D+C+K
Sbjct  28   IECENLSKETCSFAVSSSSKRCVLEKHAKRTGEEAYTCKTLEIE-ADKLKDHIESDQCIK  86

Query  543  TCGVDRKSVGMSSDPFLDSLFMAKLCARACYDYCPNLVDLYANIAAGEGVFLPELCEQIR  364
             C +DRKS+G+SSD  L+S F  KLC+  CY  CPN+VDLY N+AAGEGVFLP+LCE   
Sbjct  87   ACDLDRKSLGISSDSLLESSFTKKLCSPQCYKSCPNVVDLYFNLAAGEGVFLPKLCE--V  144

Query  363  SGEGSRRGMAEIQ  325
             G  +RRGMAE++
Sbjct  145  QGGNARRGMAELK  157



>emb|CDP05191.1| unnamed protein product [Coffea canephora]
Length=187

 Score =   141 bits (355),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 69/133 (52%), Positives = 93/133 (70%), Gaps = 3/133 (2%)
 Frame = -1

Query  723  IICENLPISTCAFSVSSYGKRCLIEDTVLLDGKVDYKCKTSEVVVGSSTSDYIETDKCVK  544
            I CE+L   +CA++VSS GKRC++E  V   G+  Y C+ S++       D+IETDKC++
Sbjct  29   IACEDLKEDSCAYAVSSSGKRCVLEKHVRRSGEEKYTCRASDIE-AEKLKDWIETDKCIE  87

Query  543  TCGVDRKSVGMSSDPFLDSLFMAKLCARACYDYCPNLVDLYANIAAGEGVFLPELCEQIR  364
             CGVDR ++G+SSD  L+  F  KLC+ ACY  CPN+VDLY N+AAGEGV+LP+LCE  R
Sbjct  88   ACGVDRHALGISSDSLLEPQFTHKLCSSACYRSCPNIVDLYFNLAAGEGVYLPKLCEAQR  147

Query  363  SGEGSRRGMAEIQ  325
            +    RR MAEI+
Sbjct  148  A--HGRREMAEIK  158



>ref|XP_010515917.1| PREDICTED: uncharacterized protein LOC104791676 [Camelina sativa]
Length=183

 Score =   140 bits (354),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 71/132 (54%), Positives = 95/132 (72%), Gaps = 6/132 (5%)
 Frame = -1

Query  723  IICENLPISTCAFSVSSYGKRCLIEDTVLLDGKVDYKCKTSEVVVGSSTSDYIETDKCVK  544
            IICENLP + CAFS+S+ GKRCL+E T  + G  +Y C+TS V V     +++E+D+CV 
Sbjct  26   IICENLPTNMCAFSISASGKRCLLE-TANVAG--EYTCRTSAVDV-EGIVNHVESDECVA  81

Query  543  TCGVDRKSVGMSSDPFLDSLFMAKLCARACYDYCPNLVDLYANIAAGEGVFLPELCEQIR  364
             CGVDRK+VG+SSD  +++ F AK+C+ AC DYCPN++DLY N+AAGEG FLP+LC+  R
Sbjct  82   ACGVDRKTVGISSDSLMEAGFAAKICSPACLDYCPNILDLYFNLAAGEGAFLPDLCDAHR  141

Query  363  SGEGSRRGMAEI  328
                  R M EI
Sbjct  142  MNP--HRSMLEI  151



>emb|CDY13179.1| BnaC04g26560D [Brassica napus]
Length=183

 Score =   140 bits (354),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 70/136 (51%), Positives = 98/136 (72%), Gaps = 6/136 (4%)
 Frame = -1

Query  735  IQSEIICENLPISTCAFSVSSYGKRCLIEDTVLLDGKVDYKCKTSEVVVGSSTSDYIETD  556
            +  +IICENLP + CAFS+S+ GKRCL+E T  + G  +Y C+TS V V     +++E+D
Sbjct  22   LGEDIICENLPTNMCAFSISASGKRCLLE-TANVAG--EYTCRTSAVEV-EGIVNHVESD  77

Query  555  KCVKTCGVDRKSVGMSSDPFLDSLFMAKLCARACYDYCPNLVDLYANIAAGEGVFLPELC  376
            +CV  CGVDRK+VG+SSD  +++ F AK+C+ AC DYCPN++DLY N+AAGEG FLP+LC
Sbjct  78   ECVAACGVDRKTVGISSDAMMEAGFAAKICSPACLDYCPNILDLYFNLAAGEGAFLPDLC  137

Query  375  EQIRSGEGSRRGMAEI  328
            +  R+     R M E+
Sbjct  138  DAQRTNP--HRSMLEM  151



>ref|XP_011073216.1| PREDICTED: uncharacterized protein LOC105158240 [Sesamum indicum]
Length=170

 Score =   140 bits (353),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 74/133 (56%), Positives = 93/133 (70%), Gaps = 7/133 (5%)
 Frame = -1

Query  735  IQSEIICENLPISTCAFSVSSYGKRCLIEDTVLLDGKVDYKCKTSEVVVGSSTSDYIETD  556
            I  ++ICENLP + C+F+++S GKRC++E+     GK    CKTSEVVV    S YIETD
Sbjct  23   IAEDVICENLPTNLCSFAIASSGKRCVLENHKNAHGKT---CKTSEVVV-DKLSGYIETD  78

Query  555  KCVKTCGVDRKSVGMSSDPFLDSLFMAKLCARACYDYCPNLVDLYANIAAGEGVFLPELC  376
            +CVK CGV R+SVG+SSD FL S F A LC+ ACY  CPN+VDL+ N+AAGEGV LP LC
Sbjct  79   ECVKACGVCRESVGLSSDAFLSSKFTAHLCSPACYHKCPNIVDLFFNLAAGEGVSLPALC  138

Query  375  EQIRSGEGSRRGM  337
               ++ E   R M
Sbjct  139  ---KNQEDKHREM  148



>ref|XP_006291916.1| hypothetical protein CARUB_v10018100mg [Capsella rubella]
 gb|EOA24814.1| hypothetical protein CARUB_v10018100mg [Capsella rubella]
Length=181

 Score =   140 bits (353),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 71/132 (54%), Positives = 95/132 (72%), Gaps = 6/132 (5%)
 Frame = -1

Query  723  IICENLPISTCAFSVSSYGKRCLIEDTVLLDGKVDYKCKTSEVVVGSSTSDYIETDKCVK  544
            IICENLP + CAFS+S+ GKRCL+E T  + G  ++ C+TS V V     +++E+D+CV 
Sbjct  26   IICENLPTNMCAFSISASGKRCLLE-TANVAG--EFTCRTSAVDV-EGIVNHVESDECVS  81

Query  543  TCGVDRKSVGMSSDPFLDSLFMAKLCARACYDYCPNLVDLYANIAAGEGVFLPELCEQIR  364
             CGVDRK+VG+SSD  ++S F +KLC+ AC DYCPN++DLY N+AAGEG FLP+LC+  R
Sbjct  82   ACGVDRKTVGISSDALMESGFASKLCSPACLDYCPNILDLYFNLAAGEGAFLPDLCDAQR  141

Query  363  SGEGSRRGMAEI  328
                  R M EI
Sbjct  142  MNP--HRSMLEI  151



>ref|XP_011030114.1| PREDICTED: uncharacterized protein LOC105129658 [Populus euphratica]
Length=191

 Score =   140 bits (354),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 68/134 (51%), Positives = 95/134 (71%), Gaps = 2/134 (1%)
 Frame = -1

Query  726  EIICENLPISTCAFSVSSYGKRCLIEDTVLLDGKVDYKCKTSEVVVGSSTSDYIETDKCV  547
            EI CE+L   TCA+++SS GKRC++E  V   G+  Y C+TSE+       ++IETD+C+
Sbjct  25   EIACEHLDQDTCAYAISSAGKRCVLEKRVKRTGEEAYTCRTSEIE-ADRLRNWIETDQCI  83

Query  546  KTCGVDRKSVGMSSDPFLDSLFMAKLCARACYDYCPNLVDLYANIAAGEGVFLPELCEQI  367
            K CG+DRKS+G+S+D  L+S F  +LC+  CYD CPN++DLY N+AA EGVFLP+LCE  
Sbjct  84   KACGLDRKSLGISTDSLLESSFAQQLCSPQCYDSCPNVIDLYFNLAAAEGVFLPKLCEA-  142

Query  366  RSGEGSRRGMAEIQ  325
            + G   R  MA+I+
Sbjct  143  QEGNARRGLMADIK  156



>emb|CDY60770.1| BnaAnng17210D [Brassica napus]
Length=181

 Score =   140 bits (353),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 68/120 (57%), Positives = 91/120 (76%), Gaps = 4/120 (3%)
 Frame = -1

Query  723  IICENLPISTCAFSVSSYGKRCLIEDTVLLDGKVDYKCKTSEVVVGSSTSDYIETDKCVK  544
            IICENLP + CAFS+S+ GKRCL+E T  + G  +Y C+TS V V     +++E+D+CV 
Sbjct  26   IICENLPTNICAFSISASGKRCLLE-TANVAG--EYTCRTSAVEV-EGIVNHVESDECVA  81

Query  543  TCGVDRKSVGMSSDPFLDSLFMAKLCARACYDYCPNLVDLYANIAAGEGVFLPELCEQIR  364
             CGVDRK+VG+SSD  +++ F AKLC+ AC DYCPN++DLY N+AAGEG FLP+LC+  R
Sbjct  82   ACGVDRKTVGISSDAMMEAGFAAKLCSPACLDYCPNILDLYFNLAAGEGAFLPDLCDAQR  141



>ref|XP_008785460.1| PREDICTED: uncharacterized protein LOC103704086 [Phoenix dactylifera]
Length=174

 Score =   140 bits (352),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 69/135 (51%), Positives = 89/135 (66%), Gaps = 2/135 (1%)
 Frame = -1

Query  741  PIIQSEIICENLPISTCAFSVSSYGKRCLIEDTVLLDGKVDYKCKTSEVVVGSSTSDYIE  562
            P   + +ICE+LP   CAF++SS  KRC++E      G   Y+C+TSEVVV      +IE
Sbjct  14   PSALAGVICEDLPQDLCAFAISSSSKRCVLETIPRKGGPTKYQCQTSEVVV-ERMPGWIE  72

Query  561  TDKCVKTCGVDRKSVGMSSDPFLDSLFMAKLCARACYDYCPNLVDLYANIAAGEGVFLPE  382
            TDKCV+ CGVDR SVG+SSD  L+  F   LC+ AC+  CPN++DLY N+AA E VFLP+
Sbjct  73   TDKCVRACGVDRNSVGISSDSLLEPQFTENLCSPACHQNCPNIIDLYFNLAAAEDVFLPD  132

Query  381  LCEQIRSGEGSRRGM  337
            LC + R G   RR M
Sbjct  133  LC-KARQGRNPRRSM  146



>ref|XP_010046385.1| PREDICTED: uncharacterized protein LOC104435305 [Eucalyptus grandis]
Length=185

 Score =   140 bits (353),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 67/122 (55%), Positives = 90/122 (74%), Gaps = 2/122 (2%)
 Frame = -1

Query  723  IICENLPISTCAFSVSSYGKRCLIEDTV-LLDGKVDYKCKTSEVVVGSSTSDYIETDKCV  547
            I CE LP   C+FS++S G+RC++E+ V L+DGK++Y+CKTS+V V     ++IETD C+
Sbjct  20   IACEQLPTELCSFSIASNGRRCVLENYVSLMDGKMEYECKTSQVAV-DIMHEWIETDDCI  78

Query  546  KTCGVDRKSVGMSSDPFLDSLFMAKLCARACYDYCPNLVDLYANIAAGEGVFLPELCEQI  367
            + CGVDR+SVG+SSD  L   F  KLC+ ACY  CPN+VDLY N+A GEGV+L + CE  
Sbjct  79   RACGVDRQSVGISSDALLQPSFTTKLCSPACYHNCPNIVDLYFNLALGEGVYLADHCEVR  138

Query  366  RS  361
            RS
Sbjct  139  RS  140



>ref|XP_011078704.1| PREDICTED: uncharacterized protein LOC105162404 [Sesamum indicum]
Length=171

 Score =   139 bits (351),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 68/132 (52%), Positives = 92/132 (70%), Gaps = 3/132 (2%)
 Frame = -1

Query  729  SEIICENLPISTCAFSVSSYGKRCLIEDTVLLDGKVDYKCKTSEVVVGSSTSDYIETDKC  550
            +E++CENLP + C+F++SS GKRC++E   +  G++DY C+TSEVVV      YIE+D C
Sbjct  24   AEVVCENLPANLCSFAISSTGKRCVLESYKIGRGEIDYMCRTSEVVV-ERLYGYIESDHC  82

Query  549  VKTCGVDRKSVGMSSDPFLDSLFMAKLCARACYDYCPNLVDLYANIAAGEGVFLPELCEQ  370
            VK CGV R+S  +SSD FL S F A LC+ ACY  CPN+V+L+ N+AAGEG+ LP LC  
Sbjct  83   VKACGVHRESTSISSDVFLSSEFTAHLCSPACYQNCPNIVELFFNLAAGEGLSLPTLCHN  142

Query  369  IRSGEGSRRGMA  334
             +  E  R  +A
Sbjct  143  QK--ENHRTMLA  152



>gb|KFK26839.1| hypothetical protein AALP_AA8G300600 [Arabis alpina]
Length=196

 Score =   140 bits (353),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 82/187 (44%), Positives = 112/187 (60%), Gaps = 16/187 (9%)
 Frame = -1

Query  726  EIICENLPISTCAFSVSSYGKRCLIEDTVLLDGKVDYKCKTSEVVVGSSTSDYIETDKCV  547
            E+ CENL   TCAF+VSS GKRC++E +V   G   Y C+ SE+     T + IE+D+C+
Sbjct  25   EVKCENLNKDTCAFAVSSTGKRCVLEKSVRRSGIEMYTCRASEIEADKIT-NIIESDECI  83

Query  546  KTCGVDRKSVGMSSDPFLDSLFMAKLCARACYDYCPNLVDLYANIAAGEGVFLPELCEQI  367
             +CG+DR+S+G+SSD  L+S F  KLC+  C + CPN+VDL+ N+AAGEGVFLP+LCE  
Sbjct  84   NSCGLDRRSLGISSDALLESRFTQKLCSAKCLNQCPNVVDLFFNLAAGEGVFLPKLCE--  141

Query  366  RSGEG-SRRGMAEIQsgggdsaaapagapaagdDLPRRAMIGIDAEAPSPA*CVADTYTN  190
             S EG SRR M+EI+            +    D L     + +   AP PA  +      
Sbjct  142  -SQEGKSRRVMSEIR-----------SSGIVMDTLGPVGPVRLGEMAPEPATSMDHMLLA  189

Query  189  LTPSPFY  169
              PSP+Y
Sbjct  190  QAPSPYY  196



>emb|CDY07560.1| BnaC06g15040D [Brassica napus]
Length=182

 Score =   140 bits (352),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 71/136 (52%), Positives = 96/136 (71%), Gaps = 6/136 (4%)
 Frame = -1

Query  735  IQSEIICENLPISTCAFSVSSYGKRCLIEDTVLLDGKVDYKCKTSEVVVGSSTSDYIETD  556
            +  +I+CENLP + CAFS+S+ GKRCL+E T  + G  +Y C+TS V V     +++E+D
Sbjct  22   LGEDIVCENLPTNMCAFSISASGKRCLLE-TANVAG--EYTCRTSAVEV-EGIVNHVESD  77

Query  555  KCVKTCGVDRKSVGMSSDPFLDSLFMAKLCARACYDYCPNLVDLYANIAAGEGVFLPELC  376
            +CV  CGVDRK+VG+SSD  ++  F AKLC+ AC DYCPN++DLY N+AAGEG FLP+LC
Sbjct  78   ECVAACGVDRKTVGISSDAMMEEGFAAKLCSPACLDYCPNILDLYFNLAAGEGAFLPDLC  137

Query  375  EQIRSGEGSRRGMAEI  328
            +  R      R M EI
Sbjct  138  DAQRI--NPHRSMLEI  151



>ref|XP_002322474.1| hypothetical protein POPTR_0015s13050g [Populus trichocarpa]
 gb|ABK94866.1| unknown [Populus trichocarpa]
 gb|EEF06601.1| hypothetical protein POPTR_0015s13050g [Populus trichocarpa]
Length=193

 Score =   140 bits (353),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 73/136 (54%), Positives = 99/136 (73%), Gaps = 6/136 (4%)
 Frame = -1

Query  726  EIICENLPISTCAFSVSSYGKRCLIEDTVLLDGKVDYKCKTSEVVVGSSTSDYIETDKCV  547
            EI CE+L   TCA+++SS GKRC++E +V   G+  Y C+TSE+       ++IETD+C+
Sbjct  25   EITCEHLDQDTCAYAISSSGKRCVLEKSVKRTGEEAYTCRTSEID-ADRLRNWIETDQCI  83

Query  546  KTCGVDRKSVGMSSDPFLDSLFMAKLCARACYDYCPNLVDLYANIAAGEGVFLPELCEQI  367
            K CG+DRKS+G+SSD  L+S F  +LC+  CYD CPN+VDLY N+AA EGVFLP LCE  
Sbjct  84   KACGLDRKSLGISSDSLLESRFAQQLCSPQCYDSCPNVVDLYFNLAAAEGVFLPGLCE--  141

Query  366  RSGEGS-RRG-MAEIQ  325
             + EG+ RRG MA+I+
Sbjct  142  -AQEGNVRRGLMADIK  156



>ref|XP_011073591.1| PREDICTED: uncharacterized protein LOC105158505 [Sesamum indicum]
Length=202

 Score =   140 bits (353),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 74/135 (55%), Positives = 95/135 (70%), Gaps = 7/135 (5%)
 Frame = -1

Query  732  QSEIICENLPISTCAFSVSSYGKRCLIEDTVLLDGKVDYKCKTSEVVVGSSTSDYIETDK  553
            +++++CENLP + C+F+V+S GKRC++E      GK   KCKTSEVVV    S YIETD+
Sbjct  56   EADVVCENLPTNLCSFAVASSGKRCVLEICKNAQGK---KCKTSEVVV-EKLSGYIETDQ  111

Query  552  CVKTCGVDRKSVGMSSDPFLDSLFMAKLCARACYDYCPNLVDLYANIAAGEGVFLPELCE  373
            CV +CGV R+SVG+SSD FL S F A LC+ ACY  CPN+VDL+ N+AAGEGV LP LC 
Sbjct  112  CVNSCGVCRESVGLSSDAFLSSKFTAHLCSPACYHNCPNIVDLFFNLAAGEGVSLPALC-  170

Query  372  QIRSGEGSRRGMAEI  328
              ++ E   R M  I
Sbjct  171  --KNQEEKHREMLAI  183



>ref|XP_009601817.1| PREDICTED: uncharacterized protein LOC104097019 [Nicotiana tomentosiformis]
Length=186

 Score =   140 bits (352),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 68/136 (50%), Positives = 98/136 (72%), Gaps = 5/136 (4%)
 Frame = -1

Query  726  EIICENL--PISTCAFSVSSYGKRCLIEDTVLLDGKVDYKCKTSEVVVGSSTSDYIETDK  553
            +I CENL     +CAF++SS GKRC++E  +   G+  Y C+TSE+       D+IET++
Sbjct  27   DIACENLNEXEDSCAFAISSNGKRCVLEKHLRRSGEEVYTCRTSEIE-ADKLKDWIETNE  85

Query  552  CVKTCGVDRKSVGMSSDPFLDSLFMAKLCARACYDYCPNLVDLYANIAAGEGVFLPELCE  373
            C++ CGVDR ++G+SSD  L+S F  KLC+ ACY +CPN+VDLY N+AAGEGV+LP+LC 
Sbjct  86   CIEACGVDRNALGISSDALLESRFTNKLCSLACYKHCPNIVDLYFNLAAGEGVYLPKLCA  145

Query  372  QIRSGEGSRRGMAEIQ  325
            +   G+ +RR +AEI+
Sbjct  146  E--QGKSARREIAEIR  159



>ref|XP_002862543.1| hypothetical protein ARALYDRAFT_920570 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH38801.1| hypothetical protein ARALYDRAFT_920570 [Arabidopsis lyrata subsp. 
lyrata]
Length=193

 Score =   140 bits (352),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 72/139 (52%), Positives = 100/139 (72%), Gaps = 5/139 (4%)
 Frame = -1

Query  738  IIQSEIICENLPISTCAFSVSSYGKRCLIEDTVLLDGKVDYKCKTSEVVVGSSTSDYIET  559
            ++  ++ CENL   TCAF+VSS GKRC++E +V   G   Y C++SE+     T + IE+
Sbjct  19   LVGHDVKCENLDEDTCAFAVSSTGKRCVLEKSVRRSGIEVYTCRSSEIEADKVT-NIIES  77

Query  558  DKCVKTCGVDRKSVGMSSDPFLDSLFMAKLCARACYDYCPNLVDLYANIAAGEGVFLPEL  379
            D+C+K CG+DRKS+G+SSD  L+S F  KLC+  C + CPN+VDL+ N+AAGEGV+LP+L
Sbjct  78   DECIKACGLDRKSLGISSDALLESRFTQKLCSVKCLNQCPNVVDLFFNLAAGEGVYLPKL  137

Query  378  CEQIRSGEG-SRRGMAEIQ  325
            CE   S EG SRR M+EI+
Sbjct  138  CE---SQEGKSRRAMSEIR  153



>ref|XP_008778806.1| PREDICTED: uncharacterized protein LOC103698551 [Phoenix dactylifera]
 ref|XP_008779191.1| PREDICTED: uncharacterized protein LOC103698922 [Phoenix dactylifera]
Length=192

 Score =   140 bits (352),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 67/133 (50%), Positives = 94/133 (71%), Gaps = 4/133 (3%)
 Frame = -1

Query  723  IICENLPISTCAFSVSSYGKRCLIEDTVLLDGKVDYKCKTSEVVVGSSTSDYIETDKCVK  544
            I CE+L  +TCAF+VSS G RC++E+ V   G+ ++ C TS++    +  D++ETD+C+K
Sbjct  28   ITCESLARNTCAFAVSSSGMRCVLENRVRRGGQEEFSCSTSDIEA-ENLKDWVETDECIK  86

Query  543  TCGVDRKSVGMSSDPFLDSLFMAKLCARACYDYCPNLVDLYANIAAGEGVFLPELCEQIR  364
             CG+ R +VG+SSD  LD  F  KLC+  CY  CPN+VDLY N+AAGEGVFLP+LC+   
Sbjct  87   ACGLTRSTVGISSDSLLDPRFAQKLCSPPCYQECPNIVDLYFNLAAGEGVFLPKLCQ---  143

Query  363  SGEGSRRGMAEIQ  325
            +   +RRGM EI+
Sbjct  144  ASSNARRGMEEIK  156



>gb|KEH28949.1| PAR1 protein [Medicago truncatula]
Length=138

 Score =   138 bits (348),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 63/111 (57%), Positives = 86/111 (77%), Gaps = 1/111 (1%)
 Frame = -1

Query  729  SEIICENLPISTCAFSVSSYGKRCLIEDTVLLDGKVDYKCKTSEVVVGSSTSDYIETDKC  550
            +E++CE+LP   C FSV+S GKRCL+E    ++G+++Y+C+TSEV+V    S+YIETD+C
Sbjct  23   AEMVCEDLPKEVCTFSVASSGKRCLLETQKGVNGEIEYQCRTSEVIV-ERISEYIETDQC  81

Query  549  VKTCGVDRKSVGMSSDPFLDSLFMAKLCARACYDYCPNLVDLYANIAAGEG  397
            V+ CGVDR SVG+SSD F +  F  KLC+ ACY  CPN+VDL+ N+AAGEG
Sbjct  82   VEACGVDRSSVGISSDAFFEPQFTGKLCSPACYKKCPNIVDLFFNMAAGEG  132



>ref|XP_006288746.1| hypothetical protein CARUB_v10002062mg [Capsella rubella]
 gb|EOA21644.1| hypothetical protein CARUB_v10002062mg [Capsella rubella]
Length=183

 Score =   139 bits (351),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 65/135 (48%), Positives = 92/135 (68%), Gaps = 2/135 (1%)
 Frame = -1

Query  732  QSEIICENLPISTCAFSVSSYGKRCLIEDTVLLDGKVDYKCKTSEVVVGSSTSDYIETDK  553
             + +ICE++P   C+FS+S+ GKRC++E  V   G ++Y+C++SEV V  + ++YIETD+
Sbjct  22   HANVICEDIPDDMCSFSISALGKRCVLETEVRQTGGINYRCRSSEVDVDVTLANYIETDE  81

Query  552  CVKTCGVDRKSVGMSSDPFLDSLFMAKLCARACYDYCPNLVDLYANIAAGEGVFLPELCE  373
            CV  CGVDR+SVG+SSD  L+  F  KLC   C + CPN+ DLY+N+ A EG FLP+LC 
Sbjct  82   CVNACGVDRRSVGISSDALLEPGFAVKLCTPECLEDCPNIADLYSNLVAAEGSFLPDLCA  141

Query  372  QIRSGEGSRRGMAEI  328
              R+     R M EI
Sbjct  142  ARRNNP--HRSMFEI  154



>ref|XP_008794209.1| PREDICTED: uncharacterized protein LOC103710316 [Phoenix dactylifera]
Length=199

 Score =   140 bits (352),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 67/139 (48%), Positives = 95/139 (68%), Gaps = 3/139 (2%)
 Frame = -1

Query  741  PIIQSEIICENLPISTCAFSVSSYGKRCLIEDTVLLDGKVDYKCKTSEVVVGSSTSDYIE  562
            P +   + CE L  STCAF+VSS G RC++E  V   G+ +Y C+ S +       D++E
Sbjct  22   PQVLGAVTCERLDRSTCAFAVSSAGTRCVLEKRVRRGGQEEYTCRASRIE-ADGLKDHVE  80

Query  561  TDKCVKTCGVDRKSVGMSSDPFLDSLFMAKLCARACYDYCPNLVDLYANIAAGEGVFLPE  382
            TD+C++ CG+ R ++G+SSD  LDS F  KLC+  C++ CPN+V+LY N+AAGEGVFLP+
Sbjct  81   TDECLEACGLGRDTLGISSDSLLDSRFTQKLCSARCFNGCPNIVNLYFNLAAGEGVFLPK  140

Query  381  LCEQIRSGEGSRRGMAEIQ  325
            LCE  R+   +RR MAEI+
Sbjct  141  LCETHRT--SNRRTMAEIR  157



>ref|XP_011048721.1| PREDICTED: uncharacterized protein LOC105142675 [Populus euphratica]
Length=194

 Score =   139 bits (351),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 72/136 (53%), Positives = 98/136 (72%), Gaps = 6/136 (4%)
 Frame = -1

Query  726  EIICENLPISTCAFSVSSYGKRCLIEDTVLLDGKVDYKCKTSEVVVGSSTSDYIETDKCV  547
            EI CE+L   TCA+++SS GKRC++E +V   G+  Y C+ SE+       ++IETD+C+
Sbjct  25   EITCEHLDQDTCAYAISSSGKRCVLEKSVKRTGEEAYTCRASEIE-ADRLRNWIETDQCI  83

Query  546  KTCGVDRKSVGMSSDPFLDSLFMAKLCARACYDYCPNLVDLYANIAAGEGVFLPELCEQI  367
            K CG+DRKS+G+SSD  L+S F  +LC+  CYD CPN+VDLY N+AA EGVFLP LCE  
Sbjct  84   KACGLDRKSLGISSDSLLESRFAQQLCSPQCYDSCPNVVDLYFNLAAAEGVFLPGLCE--  141

Query  366  RSGEGS-RRG-MAEIQ  325
             + EG+ RRG MA+I+
Sbjct  142  -AQEGNVRRGLMADIK  156



>ref|XP_010423911.1| PREDICTED: uncharacterized protein LOC104708952 [Camelina sativa]
Length=183

 Score =   139 bits (350),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 67/135 (50%), Positives = 89/135 (66%), Gaps = 2/135 (1%)
 Frame = -1

Query  732  QSEIICENLPISTCAFSVSSYGKRCLIEDTVLLDGKVDYKCKTSEVVVGSSTSDYIETDK  553
             + +ICE+LP   C+FS+S+ GKRC++E  V   G VDY+C+ SEV V  + ++YIETD+
Sbjct  22   HANVICEDLPDDICSFSISASGKRCVLETEVRQTGGVDYRCRGSEVDVDGTMANYIETDE  81

Query  552  CVKTCGVDRKSVGMSSDPFLDSLFMAKLCARACYDYCPNLVDLYANIAAGEGVFLPELCE  373
            CV  CGVDR+S+G+SSD  LD  F  KLC   C + CPN+ DLY N+ A EG  LP+LC 
Sbjct  82   CVNACGVDRRSIGISSDALLDPGFAVKLCTPECLEDCPNIADLYFNLVAAEGSHLPDLCA  141

Query  372  QIRSGEGSRRGMAEI  328
              R+     R M EI
Sbjct  142  ARRN--NPHRSMFEI  154



>ref|XP_002865911.1| hypothetical protein ARALYDRAFT_918281 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH42170.1| hypothetical protein ARALYDRAFT_918281 [Arabidopsis lyrata subsp. 
lyrata]
Length=192

 Score =   139 bits (350),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 72/138 (52%), Positives = 99/138 (72%), Gaps = 5/138 (4%)
 Frame = -1

Query  735  IQSEIICENLPISTCAFSVSSYGKRCLIEDTVLLDGKVDYKCKTSEVVVGSSTSDYIETD  556
            +  ++ CENL   TCAF+VSS GKRC++E +V   G   Y C++SE+     T + IE+D
Sbjct  22   LGHDVKCENLDEDTCAFAVSSTGKRCVLEKSVRRSGIEVYTCRSSEIEADKVT-NIIESD  80

Query  555  KCVKTCGVDRKSVGMSSDPFLDSLFMAKLCARACYDYCPNLVDLYANIAAGEGVFLPELC  376
            +C+K CG+DRKS+G+SSD  L+S F  KLC+  C + CPN+VDL+ N+AAGEGV+LP+LC
Sbjct  81   ECIKACGLDRKSLGISSDALLESRFTQKLCSVKCLNQCPNVVDLFFNLAAGEGVYLPKLC  140

Query  375  EQIRSGEG-SRRGMAEIQ  325
            E   S EG SRR M+EI+
Sbjct  141  E---SQEGKSRRAMSEIR  155



>ref|XP_011073219.1| PREDICTED: uncharacterized protein LOC105158242 [Sesamum indicum]
Length=169

 Score =   138 bits (348),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 75/133 (56%), Positives = 93/133 (70%), Gaps = 7/133 (5%)
 Frame = -1

Query  726  EIICENLPISTCAFSVSSYGKRCLIEDTVLLDGKVDYKCKTSEVVVGSSTSDYIETDKCV  547
            ++ICENLP + C+F+V+S GKRC++E      GK   KCKTSEVVV    S YIETD+CV
Sbjct  25   DVICENLPTNLCSFAVASSGKRCVLEICKNAQGK---KCKTSEVVV-EKLSGYIETDQCV  80

Query  546  KTCGVDRKSVGMSSDPFLDSLFMAKLCARACYDYCPNLVDLYANIAAGEGVFLPELCEQI  367
             +CGV R+SVG+SSD FL S F A LC+ ACY  CPN+VDL+ N+AAGEGV LP LC   
Sbjct  81   NSCGVCRESVGLSSDAFLSSKFTAHLCSPACYHNCPNIVDLFFNLAAGEGVSLPALC---  137

Query  366  RSGEGSRRGMAEI  328
            ++ E   R M  I
Sbjct  138  KNQEEKHREMLAI  150



>ref|XP_011073217.1| PREDICTED: uncharacterized protein LOC105158241 [Sesamum indicum]
Length=173

 Score =   139 bits (349),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 72/134 (54%), Positives = 95/134 (71%), Gaps = 7/134 (5%)
 Frame = -1

Query  729  SEIICENLPISTCAFSVSSYGKRCLIEDTVLLDGKVDYKCKTSEVVVGSSTSDYIETDKC  550
            +++ICENLP + C+F+++S GKRC++E+        + KCKTSEVVV    S YIETD+C
Sbjct  24   ADVICENLPTNLCSFAIASSGKRCVLENC---KNAQEKKCKTSEVVV-EKLSGYIETDQC  79

Query  549  VKTCGVDRKSVGMSSDPFLDSLFMAKLCARACYDYCPNLVDLYANIAAGEGVFLPELCEQ  370
            VK CGV R+SVG+SSD FL S F A+LC+ ACY  CPN++DL+ N+AAGEGV LP LC  
Sbjct  80   VKACGVCRESVGISSDTFLSSEFTARLCSPACYHNCPNIIDLFFNLAAGEGVSLPALC--  137

Query  369  IRSGEGSRRGMAEI  328
             ++ E   R M  I
Sbjct  138  -KNQEEKHREMLAI  150



>ref|XP_010273059.1| PREDICTED: uncharacterized protein LOC104608702 [Nelumbo nucifera]
Length=200

 Score =   139 bits (351),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 65/133 (49%), Positives = 94/133 (71%), Gaps = 3/133 (2%)
 Frame = -1

Query  723  IICENLPISTCAFSVSSYGKRCLIEDTVLLDGKVDYKCKTSEVVVGSSTSDYIETDKCVK  544
            I CE+L  +TCAF+VSS G RC++E  V   G   Y C+TSE+       D++ETD+C++
Sbjct  29   ITCEHLDKNTCAFAVSSSGTRCVLEKHVKRSGDEVYTCRTSEIE-ADKLKDWVETDECIQ  87

Query  543  TCGVDRKSVGMSSDPFLDSLFMAKLCARACYDYCPNLVDLYANIAAGEGVFLPELCEQIR  364
             CG++R ++G+SSD  ++  F+ KLC+  CYD CPN++DLY N+AAGEG+FLP+LCE   
Sbjct  88   ACGLNRNTLGISSDALVEPCFVHKLCSSRCYDNCPNIIDLYFNLAAGEGIFLPKLCEA--  145

Query  363  SGEGSRRGMAEIQ  325
             G  +RR M+EI+
Sbjct  146  QGANARREMSEIR  158



>ref|NP_190972.1| PAR1 protein [Arabidopsis thaliana]
 emb|CAB88366.1| photoassimilate-responsive protein PAR-1b-like protein [Arabidopsis 
thaliana]
 gb|AAL62396.1| photoassimilate-responsive protein PAR-1b -like protein [Arabidopsis 
thaliana]
 gb|AAM48022.1| photoassimilate-responsive protein PAR-1b-like protein [Arabidopsis 
thaliana]
 gb|AEE79178.1| PAR1 protein [Arabidopsis thaliana]
Length=183

 Score =   139 bits (349),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 69/136 (51%), Positives = 96/136 (71%), Gaps = 6/136 (4%)
 Frame = -1

Query  735  IQSEIICENLPISTCAFSVSSYGKRCLIEDTVLLDGKVDYKCKTSEVVVGSSTSDYIETD  556
            I   I+CENLP + C+FS+S+ GKRC++E T  + G  ++ C+TS V V     +++ETD
Sbjct  22   IGENIVCENLPTNMCSFSISASGKRCILE-TANVAG--EFTCRTSAVDV-EGIVNHVETD  77

Query  555  KCVKTCGVDRKSVGMSSDPFLDSLFMAKLCARACYDYCPNLVDLYANIAAGEGVFLPELC  376
            +CV  CGVDRK+VG+SSD  +++ F AKLC+ AC DYCPN++DLY N+AAGEG FLP+LC
Sbjct  78   ECVSACGVDRKTVGISSDSLMEAGFAAKLCSSACLDYCPNILDLYFNLAAGEGAFLPDLC  137

Query  375  EQIRSGEGSRRGMAEI  328
            +  R     +R M E 
Sbjct  138  DAQRMNP--QRSMMEF  151



>ref|XP_011094949.1| PREDICTED: uncharacterized protein LOC105174518 [Sesamum indicum]
Length=175

 Score =   138 bits (348),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 63/120 (53%), Positives = 89/120 (74%), Gaps = 1/120 (1%)
 Frame = -1

Query  729  SEIICENLPISTCAFSVSSYGKRCLIEDTVLLDGKVDYKCKTSEVVVGSSTSDYIETDKC  550
            +E++CE LP + CAF+++S GKRC++E      G VD+ CKT+EVVV    + +IE+D+C
Sbjct  24   AEVLCEKLPSNLCAFAIASSGKRCILETYRNEQGDVDFICKTTEVVV-ERMAGHIESDQC  82

Query  549  VKTCGVDRKSVGMSSDPFLDSLFMAKLCARACYDYCPNLVDLYANIAAGEGVFLPELCEQ  370
            +  CGV+R+ +G+S+D FL S F A LC+ ACY  CPN++DL+ N+AAGEGV LP LCEQ
Sbjct  83   INACGVEREFIGISTDSFLSSEFTAHLCSSACYHNCPNVIDLFFNLAAGEGVSLPALCEQ  142



>ref|XP_010909577.1| PREDICTED: uncharacterized protein LOC105035650 [Elaeis guineensis]
Length=199

 Score =   139 bits (350),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 66/133 (50%), Positives = 94/133 (71%), Gaps = 4/133 (3%)
 Frame = -1

Query  723  IICENLPISTCAFSVSSYGKRCLIEDTVLLDGKVDYKCKTSEVVVGSSTSDYIETDKCVK  544
            I CE+L  STCAF+VSS G RC++E+ +   G+ ++ C+TS++    +  D++ETDKC+ 
Sbjct  28   ITCESLDRSTCAFAVSSSGMRCVLENRLRRGGQEEFSCRTSDIEA-ENLKDWVETDKCIN  86

Query  543  TCGVDRKSVGMSSDPFLDSLFMAKLCARACYDYCPNLVDLYANIAAGEGVFLPELCEQIR  364
             CG+ R +VG+SSD  L+  F  KLC+  CY  CPN+VDLY N+AAGEGVFLP+LC+   
Sbjct  87   ACGLTRNTVGISSDSLLEPQFAQKLCSPQCYQECPNVVDLYFNLAAGEGVFLPKLCQ---  143

Query  363  SGEGSRRGMAEIQ  325
            +   +RR MAEI+
Sbjct  144  ASSNARRSMAEIK  156



>ref|NP_200052.1| PAR1 protein [Arabidopsis thaliana]
 dbj|BAB10536.1| photoassimilate-responsive protein PAR-like protein [Arabidopsis 
thaliana]
 gb|AAM14066.1| putative photoassimilate-responsive protein PAR [Arabidopsis 
thaliana]
 gb|AAM67513.1| putative photoassimilate-responsive protein PAR [Arabidopsis 
thaliana]
 gb|AED96208.1| PAR1 protein [Arabidopsis thaliana]
Length=195

 Score =   139 bits (349),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 71/135 (53%), Positives = 99/135 (73%), Gaps = 5/135 (4%)
 Frame = -1

Query  726  EIICENLPISTCAFSVSSYGKRCLIEDTVLLDGKVDYKCKTSEVVVGSSTSDYIETDKCV  547
            ++ CENL  +TCAF+VSS GKRC++E ++   G   Y C++SE+     T + IE+D+C+
Sbjct  25   DVKCENLDENTCAFAVSSTGKRCVLEKSMKRSGIEVYTCRSSEIEANKVT-NIIESDECI  83

Query  546  KTCGVDRKSVGMSSDPFLDSLFMAKLCARACYDYCPNLVDLYANIAAGEGVFLPELCEQI  367
            K CG+DRK++G+SSD  L+S F  KLC+  C + CPN+VDLY N+AAGEGV+LP+LCE  
Sbjct  84   KACGLDRKALGISSDALLESQFTHKLCSVKCLNQCPNVVDLYFNLAAGEGVYLPKLCE--  141

Query  366  RSGEG-SRRGMAEIQ  325
             S EG SRR M+EI+
Sbjct  142  -SQEGKSRRAMSEIR  155



>ref|XP_010490608.1| PREDICTED: uncharacterized protein LOC104768360 [Camelina sativa]
Length=182

 Score =   138 bits (348),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 66/135 (49%), Positives = 90/135 (67%), Gaps = 2/135 (1%)
 Frame = -1

Query  732  QSEIICENLPISTCAFSVSSYGKRCLIEDTVLLDGKVDYKCKTSEVVVGSSTSDYIETDK  553
             + +ICE+LP   C+FS+S+ GKRC++E  V   G VDY+C++SE+ V  + ++YIETD+
Sbjct  22   HANVICEDLPDDICSFSISASGKRCVLETEVRQTGGVDYRCQSSEIDVDGTMANYIETDE  81

Query  552  CVKTCGVDRKSVGMSSDPFLDSLFMAKLCARACYDYCPNLVDLYANIAAGEGVFLPELCE  373
            CV  CGVDR+SVG+SSD  L+  F  KLC   C + CPN+ DLY N+ A EG  LP+LC 
Sbjct  82   CVNACGVDRRSVGISSDALLEPGFAVKLCTPQCLEDCPNIADLYFNLVAAEGSHLPDLCA  141

Query  372  QIRSGEGSRRGMAEI  328
              R+     R M EI
Sbjct  142  ARRN--NPHRSMFEI  154



>ref|XP_011073209.1| PREDICTED: uncharacterized protein LOC105158232 [Sesamum indicum]
Length=170

 Score =   138 bits (347),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 74/136 (54%), Positives = 94/136 (69%), Gaps = 7/136 (5%)
 Frame = -1

Query  735  IQSEIICENLPISTCAFSVSSYGKRCLIEDTVLLDGKVDYKCKTSEVVVGSSTSDYIETD  556
            I  ++ICENL  + C+F+++S GKRC++E+     GK    CKTSEVVV    S YIETD
Sbjct  23   IAEDVICENLSTNLCSFAIASSGKRCVLENHKNAHGKT---CKTSEVVV-DKLSGYIETD  78

Query  555  KCVKTCGVDRKSVGMSSDPFLDSLFMAKLCARACYDYCPNLVDLYANIAAGEGVFLPELC  376
            +CVK CGV R+SVG+SSD FL S F A LC+ ACY  CPN+VDL++N+AAGEGV LP LC
Sbjct  79   ECVKACGVCRESVGLSSDVFLSSEFTAHLCSPACYHKCPNIVDLFSNLAAGEGVSLPALC  138

Query  375  EQIRSGEGSRRGMAEI  328
               ++ E   R M  I
Sbjct  139  ---KNQEDKHREMLAI  151



>ref|XP_011073208.1| PREDICTED: uncharacterized protein LOC105158231 [Sesamum indicum]
Length=173

 Score =   138 bits (347),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 72/134 (54%), Positives = 94/134 (70%), Gaps = 7/134 (5%)
 Frame = -1

Query  729  SEIICENLPISTCAFSVSSYGKRCLIEDTVLLDGKVDYKCKTSEVVVGSSTSDYIETDKC  550
            +++ICENLP + C+F+++S GKRC++E+        + KCKTSEVVV    S YIETD+C
Sbjct  24   ADVICENLPTNLCSFAIASSGKRCVLENC---KNAQEKKCKTSEVVV-EKLSGYIETDQC  79

Query  549  VKTCGVDRKSVGMSSDPFLDSLFMAKLCARACYDYCPNLVDLYANIAAGEGVFLPELCEQ  370
            V  CGV R+SVG+SSD FL S F A LC+ ACY  CPN+VDL+ N+AAGEGV LP LC  
Sbjct  80   VNACGVCRESVGISSDAFLSSEFTAHLCSPACYHNCPNIVDLFFNLAAGEGVSLPALC--  137

Query  369  IRSGEGSRRGMAEI  328
             ++ E + R M  I
Sbjct  138  -KNQEENHRSMLAI  150



>ref|XP_006401831.1| hypothetical protein EUTSA_v10014733mg [Eutrema salsugineum]
 gb|ESQ43284.1| hypothetical protein EUTSA_v10014733mg [Eutrema salsugineum]
Length=195

 Score =   139 bits (349),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 72/138 (52%), Positives = 98/138 (71%), Gaps = 5/138 (4%)
 Frame = -1

Query  735  IQSEIICENLPISTCAFSVSSYGKRCLIEDTVLLDGKVDYKCKTSEVVVGSSTSDYIETD  556
            +  E+ CENL   TCAF+VS+ GKRC++E +V   G   Y C+ SE+     T + IE+D
Sbjct  22   LGHEVKCENLDKDTCAFAVSAAGKRCVLEKSVKRSGIEVYMCRASEIEADKVT-NIIESD  80

Query  555  KCVKTCGVDRKSVGMSSDPFLDSLFMAKLCARACYDYCPNLVDLYANIAAGEGVFLPELC  376
            +C+K CG+DRKS+G+SSD FL+S F  KLC+  C   CPN+VDL+ N+AAGEGV+LP+LC
Sbjct  81   ECIKACGLDRKSLGISSDGFLESRFTQKLCSVKCLTQCPNIVDLFYNLAAGEGVYLPKLC  140

Query  375  EQIRSGEG-SRRGMAEIQ  325
            E   S +G SRR M+EI+
Sbjct  141  E---SQQGKSRRAMSEIR  155



>ref|XP_011073214.1| PREDICTED: uncharacterized protein LOC105158237 [Sesamum indicum]
Length=173

 Score =   138 bits (347),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 72/134 (54%), Positives = 95/134 (71%), Gaps = 7/134 (5%)
 Frame = -1

Query  729  SEIICENLPISTCAFSVSSYGKRCLIEDTVLLDGKVDYKCKTSEVVVGSSTSDYIETDKC  550
            +++ICENLP + C+F+++S GKRC++E+        + KCKTSEVVV    S YIETD+C
Sbjct  24   ADVICENLPTNLCSFAIASSGKRCVLENC---KNAQEKKCKTSEVVV-DKLSGYIETDQC  79

Query  549  VKTCGVDRKSVGMSSDPFLDSLFMAKLCARACYDYCPNLVDLYANIAAGEGVFLPELCEQ  370
            VK CGV R+SVG+SSD FL S F A+LC+ ACY  CPN++DL+ N+AAGEGV LP LC  
Sbjct  80   VKACGVCRESVGISSDTFLSSEFTARLCSPACYHNCPNIIDLFFNLAAGEGVSLPALC--  137

Query  369  IRSGEGSRRGMAEI  328
             ++ E   R M  I
Sbjct  138  -KNQEEKHREMLAI  150



>gb|AAM62984.1| photoassimilate-responsive protein PAR-like protein [Arabidopsis 
thaliana]
Length=195

 Score =   138 bits (348),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 71/135 (53%), Positives = 99/135 (73%), Gaps = 5/135 (4%)
 Frame = -1

Query  726  EIICENLPISTCAFSVSSYGKRCLIEDTVLLDGKVDYKCKTSEVVVGSSTSDYIETDKCV  547
            ++ CENL  +TCAF+VSS GKRC++E ++   G   Y C++SE+     T + IE+D+C+
Sbjct  25   DVKCENLDENTCAFAVSSTGKRCVLEKSMKRTGIEVYTCRSSEIEANKVT-NIIESDECI  83

Query  546  KTCGVDRKSVGMSSDPFLDSLFMAKLCARACYDYCPNLVDLYANIAAGEGVFLPELCEQI  367
            K CG+DRK++G+SSD  L+S F  KLC+  C + CPN+VDLY N+AAGEGV+LP+LCE  
Sbjct  84   KACGLDRKALGISSDALLESQFTHKLCSVKCLNQCPNVVDLYFNLAAGEGVYLPKLCE--  141

Query  366  RSGEG-SRRGMAEIQ  325
             S EG SRR M+EI+
Sbjct  142  -SQEGKSRRAMSEIR  155



>ref|XP_011032296.1| PREDICTED: uncharacterized protein LOC105131158 [Populus euphratica]
Length=179

 Score =   138 bits (347),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 60/121 (50%), Positives = 88/121 (73%), Gaps = 1/121 (1%)
 Frame = -1

Query  726  EIICENLPISTCAFSVSSYGKRCLIEDTVLLDGKVDYKCKTSEVVVGSSTSDYIETDKCV  547
            E++CE LP+  C++S+++ GKRCL+E+    DG V Y+CKTSEVVV    +++IE D+C+
Sbjct  19   ELVCEQLPVDFCSYSIATSGKRCLLENYATKDGGVKYQCKTSEVVV-DKLNEWIEIDECI  77

Query  546  KTCGVDRKSVGMSSDPFLDSLFMAKLCARACYDYCPNLVDLYANIAAGEGVFLPELCEQI  367
              CG++R +VG+SSD  L   F+ KLC+++C   CPN+VDLY+N+A  EGV+LP LC   
Sbjct  78   TACGLNRNTVGISSDSLLQPQFLTKLCSKSCSQACPNIVDLYSNLALAEGVYLPNLCASP  137

Query  366  R  364
            R
Sbjct  138  R  138



>ref|XP_011076161.1| PREDICTED: uncharacterized protein LOC105160472 [Sesamum indicum]
Length=189

 Score =   138 bits (347),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 68/133 (51%), Positives = 92/133 (69%), Gaps = 3/133 (2%)
 Frame = -1

Query  723  IICENLPISTCAFSVSSYGKRCLIEDTVLLDGKVDYKCKTSEVVVGSSTSDYIETDKCVK  544
            I CENL   +CAF+VSS GKRC++E  V   G  +Y C TS++       ++IETD C+ 
Sbjct  31   IECENLNKDSCAFAVSSTGKRCVLEKHVRRSGAEEYACATSQIEA-DKMKNWIETDACID  89

Query  543  TCGVDRKSVGMSSDPFLDSLFMAKLCARACYDYCPNLVDLYANIAAGEGVFLPELCEQIR  364
             CG+DR ++G+SSD  L+S F+ KLC++ CY  CPN+VDLY N+AAGEG +LP+LCE   
Sbjct  90   ACGLDRSALGISSDSLLESRFVRKLCSQQCYRGCPNVVDLYFNLAAGEGAYLPKLCEA--  147

Query  363  SGEGSRRGMAEIQ  325
             G  +RR MAEI+
Sbjct  148  QGAKARREMAEIK  160



>emb|CDY60088.1| BnaC02g45000D [Brassica napus]
Length=210

 Score =   138 bits (348),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 70/138 (51%), Positives = 99/138 (72%), Gaps = 5/138 (4%)
 Frame = -1

Query  735  IQSEIICENLPISTCAFSVSSYGKRCLIEDTVLLDGKVDYKCKTSEVVVGSSTSDYIETD  556
            + +E+ CE L   TCAF+VSS GKRC++E ++   G   Y C++SE+     T + IE+D
Sbjct  22   LGNEVKCEKLDKDTCAFAVSSTGKRCVLEQSIKRSGIEGYTCRSSEIEADKVT-NIIESD  80

Query  555  KCVKTCGVDRKSVGMSSDPFLDSLFMAKLCARACYDYCPNLVDLYANIAAGEGVFLPELC  376
            +C+K CG+DRKS+G+SSD  L+S F  KLC+  C   CPN+VDL++N+AAGEGV+LP+LC
Sbjct  81   ECIKACGLDRKSLGISSDALLESRFTQKLCSVKCLTQCPNVVDLFSNLAAGEGVYLPKLC  140

Query  375  EQIRSGEG-SRRGMAEIQ  325
            E   S EG SRR M+E++
Sbjct  141  E---SQEGQSRRAMSELR  155



>ref|XP_010427069.1| PREDICTED: uncharacterized protein LOC104711981 [Camelina sativa]
Length=183

 Score =   137 bits (346),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 70/132 (53%), Positives = 94/132 (71%), Gaps = 6/132 (5%)
 Frame = -1

Query  723  IICENLPISTCAFSVSSYGKRCLIEDTVLLDGKVDYKCKTSEVVVGSSTSDYIETDKCVK  544
            IICENLP + CAFS+S+ GKRCL+E T  + G  +Y C+TS V V     +++E+D+CV 
Sbjct  26   IICENLPTNMCAFSISASGKRCLLE-TANVAG--EYTCRTSAVDV-EGIVNHVESDECVA  81

Query  543  TCGVDRKSVGMSSDPFLDSLFMAKLCARACYDYCPNLVDLYANIAAGEGVFLPELCEQIR  364
             CGVDRK+VG+SSD  +++ F AKLC+  C +YCPN++DLY N+AAGEG FLP+LC+  R
Sbjct  82   ACGVDRKTVGISSDTLMEAGFAAKLCSPDCLNYCPNILDLYFNLAAGEGAFLPDLCDAHR  141

Query  363  SGEGSRRGMAEI  328
                  R M EI
Sbjct  142  MNP--HRSMLEI  151



>ref|XP_009590873.1| PREDICTED: uncharacterized protein LOC104087977 [Nicotiana tomentosiformis]
Length=213

 Score =   138 bits (348),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 67/135 (50%), Positives = 95/135 (70%), Gaps = 3/135 (2%)
 Frame = -1

Query  726  EIICENLPISTCAFSVSSYGKRCLIEDTVLLDGKVDYKCKTSEVVVG-SSTSDYIETDKC  550
            EI+CE+L +  CA+SV+S GKRC +E     +G   Y+CKTSEVVV  +  +++IE+D+C
Sbjct  21   EIVCEDLSVGKCAYSVASSGKRCTLETYESSEGTRGYQCKTSEVVVAINGIANWIESDEC  80

Query  549  VKTCGVDRKSVGMSSDPFLDSLFMAKLCARACYDYCPNLVDLYANIAAGEGVFLPELCEQ  370
            +  CG +R SVG+SSD  L+S F +KLC++ CY  CPN+VDLY N+A GEGV+LP  C+ 
Sbjct  81   ISACGANRDSVGISSDYLLESSFTSKLCSQECYQKCPNIVDLYYNLALGEGVYLPAFCKG  140

Query  369  IRSGEGSRRGMAEIQ  325
             +     RR M++IQ
Sbjct  141  KKL--NGRREMSQIQ  153



>ref|XP_002318235.1| hypothetical protein POPTR_0012s13140g [Populus trichocarpa]
 gb|EEE96455.1| hypothetical protein POPTR_0012s13140g [Populus trichocarpa]
Length=191

 Score =   137 bits (346),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 67/134 (50%), Positives = 94/134 (70%), Gaps = 2/134 (1%)
 Frame = -1

Query  726  EIICENLPISTCAFSVSSYGKRCLIEDTVLLDGKVDYKCKTSEVVVGSSTSDYIETDKCV  547
            EI CE+L   TCA+++SS GKRC++E  V   G+  Y C+TSE+       ++IETD+C+
Sbjct  25   EIACEHLDQDTCAYAISSAGKRCVLEKRVKRTGEEAYTCRTSEIE-ADRLRNWIETDQCI  83

Query  546  KTCGVDRKSVGMSSDPFLDSLFMAKLCARACYDYCPNLVDLYANIAAGEGVFLPELCEQI  367
            K CG+DRKS+G+S+D  L+S F  +LC+  CY  CPN++DLY N+AA EGVFLP+LCE  
Sbjct  84   KACGLDRKSLGISTDSLLESRFAQQLCSPQCYYSCPNVIDLYFNLAAAEGVFLPKLCEA-  142

Query  366  RSGEGSRRGMAEIQ  325
            + G   R  MA+I+
Sbjct  143  QEGNARRGLMADIK  156



>ref|XP_010482600.1| PREDICTED: uncharacterized protein LOC104761248 isoform X2 [Camelina 
sativa]
Length=195

 Score =   137 bits (346),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 67/137 (49%), Positives = 97/137 (71%), Gaps = 3/137 (2%)
 Frame = -1

Query  735  IQSEIICENLPISTCAFSVSSYGKRCLIEDTVLLDGKVDYKCKTSEVVVGSSTSDYIETD  556
            +  E+ CENL   TCAF+VSS GKRC++E +V   G   Y C++S +      ++ IE++
Sbjct  22   LGHEVKCENLDEDTCAFAVSSTGKRCVLEKSVRRSGIEVYSCRSSGIE-SDKVTNIIESN  80

Query  555  KCVKTCGVDRKSVGMSSDPFLDSLFMAKLCARACYDYCPNLVDLYANIAAGEGVFLPELC  376
            +C++ CG+DRKS+G+SSD  L+S F  KLC+  C++ CPN+VDL+ N+AAGEGVFLP+LC
Sbjct  81   ECIEACGLDRKSLGISSDALLESRFTQKLCSAKCFNQCPNVVDLFFNLAAGEGVFLPKLC  140

Query  375  EQIRSGEGSRRGMAEIQ  325
            E  R    +RR M+EI+
Sbjct  141  ESQRG--KTRRAMSEIR  155



>ref|XP_011045688.1| PREDICTED: uncharacterized protein LOC105140517 [Populus euphratica]
Length=163

 Score =   136 bits (343),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 60/117 (51%), Positives = 88/117 (75%), Gaps = 1/117 (1%)
 Frame = -1

Query  726  EIICENLPISTCAFSVSSYGKRCLIEDTVLLDGKVDYKCKTSEVVVGSSTSDYIETDKCV  547
            E+ICE LP+  CA+S+++ G+RCL+E+    DG V Y+CKT+E+ V    +++IE+D+CV
Sbjct  19   ELICEQLPVDLCAYSIATSGQRCLLENYEENDGTVKYQCKTTEIFV-DILNEWIESDECV  77

Query  546  KTCGVDRKSVGMSSDPFLDSLFMAKLCARACYDYCPNLVDLYANIAAGEGVFLPELC  376
             +CG+ R++VG+SSD  L   F+AKLC+  CY  CPN+VDLY+N+A GEG +LP LC
Sbjct  78   SSCGLHRETVGVSSDTLLQPQFLAKLCSDECYQACPNIVDLYSNMALGEGTYLPTLC  134



>ref|XP_010934761.1| PREDICTED: uncharacterized protein LOC105054842 [Elaeis guineensis]
Length=233

 Score =   138 bits (347),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 71/133 (53%), Positives = 92/133 (69%), Gaps = 3/133 (2%)
 Frame = -1

Query  723  IICENLPISTCAFSVSSYGKRCLIEDTVLLDGKVDYKCKTSEVVVGSSTSDYIETDKCVK  544
            I CE+L  STCA++VSS G RCL+E  V   G+  Y C TS++       D +ETD+CV+
Sbjct  70   ITCESLGKSTCAYAVSSAGMRCLLEKHVRRGGQEVYTCGTSDIEA-DGIKDRVETDECVE  128

Query  543  TCGVDRKSVGMSSDPFLDSLFMAKLCARACYDYCPNLVDLYANIAAGEGVFLPELCEQIR  364
             CG++R ++G+SSD  LDS F  KLC+ ACY  CPN+VDLY N+AAGEGVFLP+LCE   
Sbjct  129  ACGLNRGTLGISSDSLLDSNFRQKLCSPACYRGCPNVVDLYFNLAAGEGVFLPKLCEAQE  188

Query  363  SGEGSRRGMAEIQ  325
            +    RR MAEI+
Sbjct  189  T--NVRRAMAEIR  199



>ref|XP_009763985.1| PREDICTED: uncharacterized protein LOC104215785 isoform X1 [Nicotiana 
sylvestris]
Length=209

 Score =   137 bits (345),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 66/135 (49%), Positives = 93/135 (69%), Gaps = 3/135 (2%)
 Frame = -1

Query  726  EIICENLPISTCAFSVSSYGKRCLIEDTVLLDGKVDYKCKTSEVVVG-SSTSDYIETDKC  550
            EI+CE+L +  CA+SV+  GKRC +E     +G   Y+CKTSEVVV  +  +++IE+D+C
Sbjct  21   EIVCEDLSVGKCAYSVAFSGKRCTLETYESSEGTTGYQCKTSEVVVAINGIANWIESDEC  80

Query  549  VKTCGVDRKSVGMSSDPFLDSLFMAKLCARACYDYCPNLVDLYANIAAGEGVFLPELCEQ  370
            +  CG +R SVG+SSD  L+S F +KLC++ CY  CPN+VDLY N+A GEGV+LP  C+ 
Sbjct  81   ISACGANRDSVGISSDSLLESSFTSKLCSQQCYQKCPNIVDLYYNLALGEGVYLPAFCK-  139

Query  369  IRSGEGSRRGMAEIQ  325
                   RR M++IQ
Sbjct  140  -GKNLNGRREMSQIQ  153



>ref|XP_002314136.2| hypothetical protein POPTR_0009s04480g [Populus trichocarpa]
 gb|EEE88091.2| hypothetical protein POPTR_0009s04480g [Populus trichocarpa]
Length=179

 Score =   136 bits (342),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 60/121 (50%), Positives = 87/121 (72%), Gaps = 1/121 (1%)
 Frame = -1

Query  726  EIICENLPISTCAFSVSSYGKRCLIEDTVLLDGKVDYKCKTSEVVVGSSTSDYIETDKCV  547
            E++CE LP+  C++S+++ GKRCL+E+    DG V Y+CKTSEVVV    +++IE D+C+
Sbjct  19   ELVCEQLPVDLCSYSIATSGKRCLLENYATKDGGVKYQCKTSEVVV-DKLNEWIEIDECI  77

Query  546  KTCGVDRKSVGMSSDPFLDSLFMAKLCARACYDYCPNLVDLYANIAAGEGVFLPELCEQI  367
              CG+ R +VG+SSD  L   F+ KLC+++C   CPN+VDLY+N+A  EGV+LP LC   
Sbjct  78   TACGLSRNTVGISSDSLLQPQFLTKLCSKSCSQACPNIVDLYSNLALAEGVYLPNLCASP  137

Query  366  R  364
            R
Sbjct  138  R  138



>gb|EPS70832.1| hypothetical protein M569_03929 [Genlisea aurea]
Length=177

 Score =   136 bits (342),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 67/134 (50%), Positives = 89/134 (66%), Gaps = 3/134 (2%)
 Frame = -1

Query  729  SEIICENLPISTCAFSVSSYGKRCLIEDTVLLDGKVDYKCKTSEVVVGSSTSDYIETDKC  550
            +E+ICE LP   CAF+++S GKRC++E+TV   G+ ++ C+TS VVV  S   YIETD+C
Sbjct  22   AEVICEELPTDLCAFAIASSGKRCVLENTVNGGGESEFTCETSPVVV-ESLPGYIETDQC  80

Query  549  VKTCGVDRKSVGMSSDPFLDSLFMAKLCARACYDYCPNLVDLYANIAAGEGVFLPELCEQ  370
            V  CG DR  VG+SSD FL   F + LCA  C+  CPN+VDLY ++AA EGV LP+LC  
Sbjct  81   VAACGADRNFVGISSDAFLSPSFTSSLCADECFQNCPNIVDLYVDLAAAEGVNLPDLCRM  140

Query  369  IRSGEGSRRGMAEI  328
             +  E   R M  +
Sbjct  141  QK--ENPHRSMLAV  152



>ref|XP_008806881.1| PREDICTED: uncharacterized protein LOC103719421 [Phoenix dactylifera]
Length=191

 Score =   136 bits (343),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 70/133 (53%), Positives = 92/133 (69%), Gaps = 3/133 (2%)
 Frame = -1

Query  723  IICENLPISTCAFSVSSYGKRCLIEDTVLLDGKVDYKCKTSEVVVGSSTSDYIETDKCVK  544
            I CE+L  STCA++VSS G RC++E  V   G+  Y C TS++       + +ETD CV+
Sbjct  25   ITCESLEKSTCAYAVSSAGMRCVLEKRVRRGGQEVYTCGTSDIQA-DGVKNRVETDACVE  83

Query  543  TCGVDRKSVGMSSDPFLDSLFMAKLCARACYDYCPNLVDLYANIAAGEGVFLPELCEQIR  364
             CG+DR ++G+SSD  LDS F  KLC+ ACY  CPN+VDLY N+AAGEGVFLP+LCE   
Sbjct  84   ACGLDRGTLGISSDSLLDSNFRQKLCSPACYRGCPNVVDLYFNLAAGEGVFLPKLCEVQE  143

Query  363  SGEGSRRGMAEIQ  325
            +   +RR MAEI+
Sbjct  144  T--NARRAMAEIR  154



>ref|XP_009127249.1| PREDICTED: uncharacterized protein LOC103852106 [Brassica rapa]
Length=210

 Score =   137 bits (344),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 70/138 (51%), Positives = 98/138 (71%), Gaps = 5/138 (4%)
 Frame = -1

Query  735  IQSEIICENLPISTCAFSVSSYGKRCLIEDTVLLDGKVDYKCKTSEVVVGSSTSDYIETD  556
            + +E+ CE L   TCAF+VSS GKRC++E ++   G   Y C++SE+     T + IE+D
Sbjct  22   LGNEVKCEKLDKDTCAFAVSSTGKRCVLEQSIKRSGIEGYTCRSSEIEADKVT-NIIESD  80

Query  555  KCVKTCGVDRKSVGMSSDPFLDSLFMAKLCARACYDYCPNLVDLYANIAAGEGVFLPELC  376
            +C+K CG+DRKS+G+SSD  L+S F  KLC+  C   CPN+VDL+ N+AAGEGV+LP+LC
Sbjct  81   ECIKACGLDRKSLGISSDALLESRFTQKLCSVKCLTQCPNVVDLFFNLAAGEGVYLPKLC  140

Query  375  EQIRSGEG-SRRGMAEIQ  325
            E   S EG SRR M+E++
Sbjct  141  E---SQEGQSRRAMSELR  155



>ref|XP_010482599.1| PREDICTED: uncharacterized protein LOC104761248 isoform X1 [Camelina 
sativa]
Length=195

 Score =   136 bits (343),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 66/137 (48%), Positives = 97/137 (71%), Gaps = 3/137 (2%)
 Frame = -1

Query  735  IQSEIICENLPISTCAFSVSSYGKRCLIEDTVLLDGKVDYKCKTSEVVVGSSTSDYIETD  556
            +  E+ CENL   TCAF+VSS GKRC++E ++   G   Y C++S +      ++ IE++
Sbjct  22   LGHEVKCENLDEDTCAFAVSSTGKRCVLEKSLRRSGIEVYSCRSSGIE-SDKVTNIIESN  80

Query  555  KCVKTCGVDRKSVGMSSDPFLDSLFMAKLCARACYDYCPNLVDLYANIAAGEGVFLPELC  376
            +C++ CG+DRKS+G+SSD  L+S F  KLC+  C++ CPN+VDL+ N+AAGEGVFLP+LC
Sbjct  81   ECIEACGLDRKSLGISSDALLESRFTQKLCSAKCFNQCPNVVDLFFNLAAGEGVFLPKLC  140

Query  375  EQIRSGEGSRRGMAEIQ  325
            E  R    +RR M+EI+
Sbjct  141  ESQRG--KTRRAMSEIR  155



>gb|AFG47202.1| hypothetical protein 0_8609_01, partial [Pinus taeda]
Length=142

 Score =   134 bits (337),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 62/123 (50%), Positives = 88/123 (72%), Gaps = 3/123 (2%)
 Frame = -1

Query  696  TCAFSVSSYGKRCLIEDTVLLDGKVDYKCKTSEVVVGSSTSDYIETDKCVKTCGVDRKSV  517
             CAFSVSS G RC++E ++L DG + Y+C++SEV+   +  ++IETD+C+  CGV+R +V
Sbjct  2    VCAFSVSSSGARCVLEKSILRDGNMQYECQSSEVI-AENMKEWIETDECMNACGVERMTV  60

Query  516  GMSSDPFLDSLFMAKLCARACYDYCPNLVDLYANIAAGEGVFLPELCEQIRSGEGSRRGM  337
            GMS+D   +  F+  LC   CY+ CPN++DLY N+AAGEGV+LP LC+  RSG+  RR M
Sbjct  61   GMSTDSIAERGFIGNLCLPRCYNKCPNIIDLYFNLAAGEGVYLPRLCQAHRSGD--RRMM  118

Query  336  AEI  328
             E 
Sbjct  119  TEF  121



>ref|XP_006358715.1| PREDICTED: uncharacterized protein LOC102594490 [Solanum tuberosum]
Length=177

 Score =   135 bits (340),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 68/135 (50%), Positives = 96/135 (71%), Gaps = 3/135 (2%)
 Frame = -1

Query  726  EIICENLPISTCAFSVSSYGKRCLIEDTVLLDGKVDYKCKTSEVVVGS-STSDYIETDKC  550
            EI+CE+L I  CA+SV+S GKRC +E    ++G+  Y+CKTSEV+V +   ++ IE+D+C
Sbjct  22   EIVCEDLSIGMCAYSVASSGKRCSLESYESIEGRRGYQCKTSEVLVSNIGITNLIESDEC  81

Query  549  VKTCGVDRKSVGMSSDPFLDSLFMAKLCARACYDYCPNLVDLYANIAAGEGVFLPELCEQ  370
            +  CG DR S+G+SSD  L+S F +KLC++ C   CPN+VDLY N+A GEGV+LP  C+ 
Sbjct  82   ISACGADRNSLGISSDSLLESSFTSKLCSQQCCQKCPNIVDLYYNLALGEGVYLPAFCKG  141

Query  369  IRSGEGSRRGMAEIQ  325
             R   G RR M++IQ
Sbjct  142  -RDLNG-RREMSQIQ  154



>ref|XP_008439229.1| PREDICTED: uncharacterized protein LOC103484080 [Cucumis melo]
Length=174

 Score =   135 bits (340),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 61/134 (46%), Positives = 92/134 (69%), Gaps = 2/134 (1%)
 Frame = -1

Query  726  EIICENLPISTCAFSVSSYGKRCLIEDTVLLDGKVDYKCKTSEVVVGSSTSDYIETDKCV  547
            +I CE+L I+ CAF+VS +GKRC++E TV  DG+  + C+ S+++      + +ETDKCV
Sbjct  3    KIKCEDLGINMCAFAVSWWGKRCVLEKTVKHDGEEGFTCQISKIMEVKKLRNRVETDKCV  62

Query  546  KTCGVDRKSVGMSSDPFLDSLFMAKLCARACYDYCPNLVDLYANIAAGEGVFLPELCEQI  367
            + CG+DR ++G+SSD  LD+ F   LC   CY++CPN+V L+ N+AA EG++LP+LC   
Sbjct  63   RRCGLDRNTLGISSDSLLDTRFTCNLCFSHCYNHCPNIVHLFTNLAAAEGLYLPKLCNA-  121

Query  366  RSGEGSRRGMAEIQ  325
              G   RR M+ I+
Sbjct  122  -EGGNVRREMSNIR  134



>ref|XP_010444786.1| PREDICTED: uncharacterized protein LOC104727386 [Camelina sativa]
Length=195

 Score =   135 bits (341),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 69/138 (50%), Positives = 98/138 (71%), Gaps = 5/138 (4%)
 Frame = -1

Query  735  IQSEIICENLPISTCAFSVSSYGKRCLIEDTVLLDGKVDYKCKTSEVVVGSSTSDYIETD  556
            +  E+ CENL   TCAF+VSS GKRC++E +V   G   Y C++S +      ++ IE++
Sbjct  22   LGHEVKCENLDEDTCAFAVSSTGKRCVLEKSVRRSGIEVYSCRSSGIE-SDKVTNIIESN  80

Query  555  KCVKTCGVDRKSVGMSSDPFLDSLFMAKLCARACYDYCPNLVDLYANIAAGEGVFLPELC  376
            +C++ CG+DRKS+G+SSD  L+S F  KLC+  C+  CPN+VDL+ N+AAGEGVFLP+LC
Sbjct  81   ECIEACGLDRKSLGISSDALLESRFTQKLCSDKCFKQCPNVVDLFYNLAAGEGVFLPKLC  140

Query  375  EQIRSGEG-SRRGMAEIQ  325
            E   S EG +RR M+EI+
Sbjct  141  E---SQEGKTRRAMSEIR  155



>ref|XP_011094947.1| PREDICTED: uncharacterized protein LOC105174516 [Sesamum indicum]
Length=176

 Score =   135 bits (339),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 69/134 (51%), Positives = 91/134 (68%), Gaps = 4/134 (3%)
 Frame = -1

Query  729  SEIICENLPISTCAFSVSSYGKRCLIEDTVLLDGKVDYKCKTSEVVVGSSTSDYIETDKC  550
            +E+ICENLP + C+F+V+S GKRC+++       K D  CKTSEVVV    S YIE+D+C
Sbjct  24   AEVICENLPKNLCSFAVASSGKRCVLDHHKNAQEKTDCTCKTSEVVV-ERLSGYIESDQC  82

Query  549  VKTCGVDRKSVGMSSDPFLDSLFMAKLCARACYDYCPNLVDLYANIAAGEGVFLPELCEQ  370
            V  CGV R+S  +SSD FL S F A+LC+ ACY  CPN+V+L+ N+AAGEGV LP LC+ 
Sbjct  83   VNACGVHRESAEISSDVFLSSEFTARLCSPACYQNCPNIVELFVNLAAGEGVSLPTLCQD  142

Query  369  IRSGEGSRRGMAEI  328
             +    + R M  I
Sbjct  143  QKE---NHRAMLAI  153



>ref|XP_004230259.1| PREDICTED: uncharacterized protein LOC101259981 [Solanum lycopersicum]
Length=258

 Score =   137 bits (345),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 63/133 (47%), Positives = 95/133 (71%), Gaps = 3/133 (2%)
 Frame = -1

Query  726  EIICENLPISTCAFSVSSYGKRCLIEDTVLLDGKVDYKCKTSEVVVGSST-SDYIETDKC  550
            E+ICE LP+  CA S+SS GKRC++E     +G  + +C+TSE    +    +YIETD+C
Sbjct  37   ELICEELPVEMCALSISSDGKRCVLESRPSEEGNNEVECQTSEAFASNKMLQEYIETDEC  96

Query  549  VKTCGVDRKSVGMSSDPFLDSLFMAKLCARACYDYCPNLVDLYANIAAGEGVFLPELCEQ  370
            V  CGVDR+S+G+SSD  +DS F+AKLC+  CY+ CPN++DLY+++A+ EG+ LP++C  
Sbjct  97   VGACGVDRQSLGLSSDALVDSKFVAKLCSHHCYNNCPNIIDLYSSVASAEGLSLPKMCAS  156

Query  369  IRSGEGSRRGMAE  331
             ++    RRGM++
Sbjct  157  QKTRP--RRGMSQ  167



>gb|AFG47187.1| hypothetical protein 0_8609_01, partial [Pinus taeda]
 gb|AFG47188.1| hypothetical protein 0_8609_01, partial [Pinus taeda]
 gb|AFG47191.1| hypothetical protein 0_8609_01, partial [Pinus taeda]
 gb|AFG47192.1| hypothetical protein 0_8609_01, partial [Pinus taeda]
 gb|AFG47193.1| hypothetical protein 0_8609_01, partial [Pinus taeda]
 gb|AFG47195.1| hypothetical protein 0_8609_01, partial [Pinus taeda]
 gb|AFG47196.1| hypothetical protein 0_8609_01, partial [Pinus taeda]
 gb|AFG47197.1| hypothetical protein 0_8609_01, partial [Pinus taeda]
 gb|AFG47198.1| hypothetical protein 0_8609_01, partial [Pinus taeda]
 gb|AFG47199.1| hypothetical protein 0_8609_01, partial [Pinus taeda]
 gb|AFG47200.1| hypothetical protein 0_8609_01, partial [Pinus taeda]
Length=142

 Score =   134 bits (336),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 62/122 (51%), Positives = 87/122 (71%), Gaps = 3/122 (2%)
 Frame = -1

Query  693  CAFSVSSYGKRCLIEDTVLLDGKVDYKCKTSEVVVGSSTSDYIETDKCVKTCGVDRKSVG  514
            CAFSVSS G RC++E ++L DG + Y+C++SEV+   +  ++IETD+C+  CGV+R +VG
Sbjct  3    CAFSVSSSGARCVLEKSILRDGNMQYECQSSEVI-AENMKEWIETDECMNACGVERMTVG  61

Query  513  MSSDPFLDSLFMAKLCARACYDYCPNLVDLYANIAAGEGVFLPELCEQIRSGEGSRRGMA  334
            MS+D   +  F   LC   CY+ CPN++DLY N+AAGEGV+LP LC+  RSG+  RR M 
Sbjct  62   MSTDSIAERGFTGNLCLPRCYNKCPNIIDLYFNLAAGEGVYLPRLCQAHRSGD--RRMMT  119

Query  333  EI  328
            E 
Sbjct  120  EF  121



>gb|AFG47186.1| hypothetical protein 0_8609_01, partial [Pinus taeda]
 gb|AFG47189.1| hypothetical protein 0_8609_01, partial [Pinus taeda]
 gb|AFG47190.1| hypothetical protein 0_8609_01, partial [Pinus taeda]
 gb|AFG47194.1| hypothetical protein 0_8609_01, partial [Pinus taeda]
 gb|AFG47201.1| hypothetical protein 0_8609_01, partial [Pinus taeda]
Length=142

 Score =   133 bits (335),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 62/122 (51%), Positives = 87/122 (71%), Gaps = 3/122 (2%)
 Frame = -1

Query  693  CAFSVSSYGKRCLIEDTVLLDGKVDYKCKTSEVVVGSSTSDYIETDKCVKTCGVDRKSVG  514
            CAFSVSS G RC++E ++L DG + Y+C++SEV+   +  ++IETD+C+  CGV+R +VG
Sbjct  3    CAFSVSSSGARCVLEKSILRDGNMQYECQSSEVIA-ENMKEWIETDECMNACGVERMTVG  61

Query  513  MSSDPFLDSLFMAKLCARACYDYCPNLVDLYANIAAGEGVFLPELCEQIRSGEGSRRGMA  334
            MS+D   +  F   LC   CY+ CPN++DLY N+AAGEGV+LP LC+  RSG+  RR M 
Sbjct  62   MSTDSIAERGFTGNLCLPRCYNKCPNIIDLYFNLAAGEGVYLPRLCQAHRSGD--RRMMT  119

Query  333  EI  328
            E 
Sbjct  120  EF  121



>ref|XP_011073213.1| PREDICTED: uncharacterized protein LOC105158236 [Sesamum indicum]
Length=167

 Score =   134 bits (337),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 71/134 (53%), Positives = 93/134 (69%), Gaps = 7/134 (5%)
 Frame = -1

Query  729  SEIICENLPISTCAFSVSSYGKRCLIEDTVLLDGKVDYKCKTSEVVVGSSTSDYIETDKC  550
            +++ICENLP + C+F+++S GKRC++E       K+   CKTSE+VV    S YIETD+C
Sbjct  24   ADVICENLPTNLCSFAIASSGKRCVLECHKNTQEKI---CKTSEIVV-EKLSGYIETDQC  79

Query  549  VKTCGVDRKSVGMSSDPFLDSLFMAKLCARACYDYCPNLVDLYANIAAGEGVFLPELCEQ  370
            VK CGV R+SVG+SSD  L S F A LC+ ACY  CPN+VDL+ N+AAGEGV LP LC  
Sbjct  80   VKACGVCRESVGLSSDALLSSEFTAHLCSPACYHNCPNIVDLFFNLAAGEGVSLPALC--  137

Query  369  IRSGEGSRRGMAEI  328
             ++ E + R M  I
Sbjct  138  -KNQEENHRSMLAI  150



>emb|CDP09132.1| unnamed protein product [Coffea canephora]
Length=188

 Score =   134 bits (338),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 62/134 (46%), Positives = 92/134 (69%), Gaps = 2/134 (1%)
 Frame = -1

Query  726  EIICENLPISTCAFSVSSYGKRCLIEDTVLLDGKVDYKCKTSEVVVGSSTSDYIETDKCV  547
            E+ICE LP   CAFS+SS GKRCL+E     D    Y+CKTSEV    + + ++ET++C+
Sbjct  19   ELICEELPAEMCAFSISSSGKRCLLETYAPTDATTTYQCKTSEVAANINMNGHVETEECI  78

Query  546  KTCGVDRKSVGMSSDPFLDSLFMAKLCARACYDYCPNLVDLYANIAAGEGVFLPELCEQI  367
            K CG+ R  VG+SSD  LDS F ++LC++ C + CPN+VDLY ++A  EG+ L E+C+ +
Sbjct  79   KACGLQRNVVGISSDTLLDSGFASELCSQDCSENCPNIVDLYNDLALAEGLNLSEMCKAL  138

Query  366  RSGEGSRRGMAEIQ  325
            ++    RR MA+++
Sbjct  139  KN--SPRRIMAQVR  150



>ref|XP_006388432.1| hypothetical protein POPTR_0187s00220g [Populus trichocarpa]
 gb|ERP47346.1| hypothetical protein POPTR_0187s00220g [Populus trichocarpa]
Length=179

 Score =   134 bits (337),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 60/121 (50%), Positives = 86/121 (71%), Gaps = 1/121 (1%)
 Frame = -1

Query  726  EIICENLPISTCAFSVSSYGKRCLIEDTVLLDGKVDYKCKTSEVVVGSSTSDYIETDKCV  547
            E++CE LP+  C++S+++ GKRCL+E+    DG V Y+CKTSEVVV    ++ IE D+C+
Sbjct  19   ELVCEQLPVDLCSYSIATSGKRCLLENYATKDGGVKYQCKTSEVVV-DKLNELIEIDECI  77

Query  546  KTCGVDRKSVGMSSDPFLDSLFMAKLCARACYDYCPNLVDLYANIAAGEGVFLPELCEQI  367
              CG+ R +VG+SSD  L   F+ KLC+++C   CPN+VDLY+N+A  EGV+LP LC   
Sbjct  78   TACGLSRNTVGISSDSLLQPQFLTKLCSKSCSQACPNIVDLYSNLALAEGVYLPNLCASP  137

Query  366  R  364
            R
Sbjct  138  R  138



>ref|XP_004140776.1| PREDICTED: uncharacterized protein LOC101216404 [Cucumis sativus]
 gb|KGN57379.1| hypothetical protein Csa_3G182150 [Cucumis sativus]
Length=206

 Score =   135 bits (339),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 65/133 (49%), Positives = 95/133 (71%), Gaps = 3/133 (2%)
 Frame = -1

Query  723  IICENLPISTCAFSVSSYGKRCLIEDTVLLDGKVDYKCKTSEVVVGSSTSDYIETDKCVK  544
            I CE+L  + CAF+VS  GKRC++E +V   G+  + C+TSE+       + +ET++CV+
Sbjct  33   IKCESLEKNKCAFAVSWSGKRCVLEKSVKRSGEDAFTCRTSEIEA-DRLQNIVETEECVE  91

Query  543  TCGVDRKSVGMSSDPFLDSLFMAKLCARACYDYCPNLVDLYANIAAGEGVFLPELCEQIR  364
             CG+DR ++G+SSD  LD+ F  KLC+  CY++C N+VDL+ N+AAGEGVFLP+LCE   
Sbjct  92   GCGIDRNTLGISSDSLLDTSFTRKLCSSRCYNHCANVVDLFFNLAAGEGVFLPKLCEV--  149

Query  363  SGEGSRRGMAEIQ  325
             G  +RRGM+EI+
Sbjct  150  QGGNARRGMSEIR  162



>ref|XP_006358727.1| PREDICTED: uncharacterized protein LOC102598423 [Solanum tuberosum]
Length=208

 Score =   135 bits (339),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 67/135 (50%), Positives = 96/135 (71%), Gaps = 3/135 (2%)
 Frame = -1

Query  726  EIICENLPISTCAFSVSSYGKRCLIEDTVLLDGKVDYKCKTSEVVVGS-STSDYIETDKC  550
            EI+CE+L +  CA+SV+S GKRC +E    ++G   Y+CKTSEV+V +   ++ IE+D+C
Sbjct  39   EIVCEDLSVGLCAYSVASSGKRCSLESYESIEGTRGYQCKTSEVLVSNIDITNLIESDEC  98

Query  549  VKTCGVDRKSVGMSSDPFLDSLFMAKLCARACYDYCPNLVDLYANIAAGEGVFLPELCEQ  370
            +  CG DR S+G+SSD  L+S F +KLC++ C   CPN+VDLY N+A GEGV+LP  C+ 
Sbjct  99   ISACGADRNSLGISSDSLLESTFTSKLCSQQCNQKCPNIVDLYYNLALGEGVYLPSFCKG  158

Query  369  IRSGEGSRRGMAEIQ  325
             R+  G RR M++IQ
Sbjct  159  -RNLNG-RREMSQIQ  171



>ref|XP_004140837.1| PREDICTED: uncharacterized protein LOC101212311 [Cucumis sativus]
Length=202

 Score =   134 bits (338),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 60/134 (45%), Positives = 92/134 (69%), Gaps = 1/134 (1%)
 Frame = -1

Query  726  EIICENLPISTCAFSVSSYGKRCLIEDTVLLDGKVDYKCKTSEVVVGSSTSDYIETDKCV  547
            +I CE+L I+ CAF+VS +G RC++E TV LDG+  + C+TS+++      + +ET+KCV
Sbjct  30   KIKCEDLEINMCAFAVSWWGNRCVLEKTVKLDGEEGFTCRTSKIMEVKKLRNRVETEKCV  89

Query  546  KTCGVDRKSVGMSSDPFLDSLFMAKLCARACYDYCPNLVDLYANIAAGEGVFLPELCEQI  367
            + CG+DR ++G+SSD  LD+ F   LC+  CY++CPN+V L+ N+AA EG+ LP+LC   
Sbjct  90   RRCGLDRNTLGISSDSLLDTRFTQNLCSSRCYNHCPNIVHLFTNLAAAEGLSLPKLC-NA  148

Query  366  RSGEGSRRGMAEIQ  325
              G    R M+ I+
Sbjct  149  EGGNMRSREMSNIR  162



>ref|XP_011081437.1| PREDICTED: uncharacterized protein LOC105164481 [Sesamum indicum]
Length=171

 Score =   134 bits (336),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 70/134 (52%), Positives = 93/134 (69%), Gaps = 7/134 (5%)
 Frame = -1

Query  729  SEIICENLPISTCAFSVSSYGKRCLIEDTVLLDGKVDYKCKTSEVVVGSSTSDYIETDKC  550
            +++IC+NLP + C+F+++S GKRC++E         + KCKTSEVVV    S YIET++C
Sbjct  24   ADVICDNLPANLCSFAIASSGKRCVLESH---KNTQEKKCKTSEVVV-EKLSGYIETEQC  79

Query  549  VKTCGVDRKSVGMSSDPFLDSLFMAKLCARACYDYCPNLVDLYANIAAGEGVFLPELCEQ  370
            VK CGV R+SVG+SSD FL S F A LC+ ACY  CPN+VDL+ N+AA EGV LP LC  
Sbjct  80   VKACGVCRESVGISSDVFLSSEFTAHLCSPACYHNCPNIVDLFFNLAASEGVSLPTLC--  137

Query  369  IRSGEGSRRGMAEI  328
             ++ E + R M  I
Sbjct  138  -KNQEENHRAMLAI  150



>ref|XP_011073221.1| PREDICTED: uncharacterized protein LOC105158244 [Sesamum indicum]
Length=175

 Score =   134 bits (336),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 71/134 (53%), Positives = 93/134 (69%), Gaps = 7/134 (5%)
 Frame = -1

Query  729  SEIICENLPISTCAFSVSSYGKRCLIEDTVLLDGKVDYKCKTSEVVVGSSTSDYIETDKC  550
            +++ICENLP + C+F+++S GKRC++E         + KCKTSEVVV    S YIET++C
Sbjct  24   ADVICENLPANLCSFAIASSGKRCVLE---CHKNTQEKKCKTSEVVV-EKLSGYIETEQC  79

Query  549  VKTCGVDRKSVGMSSDPFLDSLFMAKLCARACYDYCPNLVDLYANIAAGEGVFLPELCEQ  370
            VK CGV R+SVG+SSD FL S F A LC+ ACY  CPN+VDL+ N+AA EGV LP LC  
Sbjct  80   VKACGVCRESVGISSDVFLSSEFTAHLCSPACYHNCPNIVDLFFNLAASEGVSLPTLC--  137

Query  369  IRSGEGSRRGMAEI  328
             ++ E + R M  I
Sbjct  138  -KNQEENHRAMLAI  150



>ref|XP_004157223.1| PREDICTED: uncharacterized protein LOC101232096 [Cucumis sativus]
Length=199

 Score =   134 bits (338),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 60/134 (45%), Positives = 92/134 (69%), Gaps = 1/134 (1%)
 Frame = -1

Query  726  EIICENLPISTCAFSVSSYGKRCLIEDTVLLDGKVDYKCKTSEVVVGSSTSDYIETDKCV  547
            +I CE+L I+ CAF+VS +G RC++E TV LDG+  + C+TS+++      + +ET+KCV
Sbjct  27   KIKCEDLEINMCAFAVSWWGNRCVLEKTVKLDGEEGFTCRTSKIMEVKKLRNRVETEKCV  86

Query  546  KTCGVDRKSVGMSSDPFLDSLFMAKLCARACYDYCPNLVDLYANIAAGEGVFLPELCEQI  367
            + CG+DR ++G+SSD  LD+ F   LC+  CY++CPN+V L+ N+AA EG+ LP+LC   
Sbjct  87   RRCGLDRNTLGISSDSLLDTRFTQNLCSSRCYNHCPNIVHLFTNLAAAEGLSLPKLC-NA  145

Query  366  RSGEGSRRGMAEIQ  325
              G    R M+ I+
Sbjct  146  EGGNMRSREMSNIR  159



>ref|XP_011073223.1| PREDICTED: uncharacterized protein LOC105158246 [Sesamum indicum]
Length=171

 Score =   133 bits (335),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 69/132 (52%), Positives = 92/132 (70%), Gaps = 7/132 (5%)
 Frame = -1

Query  723  IICENLPISTCAFSVSSYGKRCLIEDTVLLDGKVDYKCKTSEVVVGSSTSDYIETDKCVK  544
            +ICENLP++ C+F+++S G+RC++E         + KCK+SEVVV    S YIET++CVK
Sbjct  26   VICENLPVNLCSFAIASSGERCVLESH---KNTQEKKCKSSEVVV-EKLSGYIETEQCVK  81

Query  543  TCGVDRKSVGMSSDPFLDSLFMAKLCARACYDYCPNLVDLYANIAAGEGVFLPELCEQIR  364
             CGV R+SVG+SSD FL S F A LC+ ACY  CPN+VDL+ N+AA EGV LP LC   +
Sbjct  82   ACGVCRESVGISSDVFLSSEFTAHLCSPACYHNCPNIVDLFFNLAASEGVSLPTLC---K  138

Query  363  SGEGSRRGMAEI  328
            + E + R M  I
Sbjct  139  NQEENHRAMLAI  150



>ref|XP_010671873.1| PREDICTED: uncharacterized protein LOC104888552 [Beta vulgaris 
subsp. vulgaris]
Length=214

 Score =   134 bits (338),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 66/134 (49%), Positives = 89/134 (66%), Gaps = 3/134 (2%)
 Frame = -1

Query  726  EIICENLPISTCAFSVSSYGKRCLIEDTVLLDGKVDYKCKTSEVVVGSSTSDYIETDKCV  547
            E+ CE L    CAF+VSS GKRC++E  V   G   YKC TS +       D +E++ C+
Sbjct  27   EVTCEQLNKEACAFAVSSIGKRCVLEKYVRRSGLEAYKCTTSAIDT-DELKDMVESNHCI  85

Query  546  KTCGVDRKSVGMSSDPFLDSLFMAKLCARACYDYCPNLVDLYANIAAGEGVFLPELCEQI  367
            + CG+DR ++G+SSD  L+S F  KLC+  CY  CPN++DLY N+AAGEGVFLP+LC   
Sbjct  86   EACGLDRDTLGISSDSLLESRFTRKLCSPQCYQKCPNVIDLYFNLAAGEGVFLPKLCASQ  145

Query  366  RSGEGSRRGMAEIQ  325
            R  E  RRG++EI+
Sbjct  146  R--ENPRRGLSEIK  157



>ref|XP_011073211.1| PREDICTED: uncharacterized protein LOC105158234 [Sesamum indicum]
Length=171

 Score =   133 bits (335),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 69/134 (51%), Positives = 92/134 (69%), Gaps = 7/134 (5%)
 Frame = -1

Query  729  SEIICENLPISTCAFSVSSYGKRCLIEDTVLLDGKVDYKCKTSEVVVGSSTSDYIETDKC  550
            + +ICENLP + C+F+++S GKRC++E+     GK    CKTSEVVV    S YIETD+C
Sbjct  24   ANVICENLPTNMCSFAIASSGKRCVLENHKSPQGKT---CKTSEVVV-EKLSGYIETDQC  79

Query  549  VKTCGVDRKSVGMSSDPFLDSLFMAKLCARACYDYCPNLVDLYANIAAGEGVFLPELCEQ  370
            V  CGV R++VG+SSD FL S F A LC+ AC+  CPN+VDL+ N+AA EGV LP LC  
Sbjct  80   VNACGVCREAVGISSDAFLSSEFTAHLCSPACFHNCPNIVDLFFNLAASEGVSLPTLC--  137

Query  369  IRSGEGSRRGMAEI  328
             ++ E + R +  I
Sbjct  138  -KNQEENHRALLTI  150



>ref|XP_004157197.1| PREDICTED: uncharacterized protein LOC101225828 [Cucumis sativus]
Length=206

 Score =   134 bits (337),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 66/133 (50%), Positives = 94/133 (71%), Gaps = 3/133 (2%)
 Frame = -1

Query  723  IICENLPISTCAFSVSSYGKRCLIEDTVLLDGKVDYKCKTSEVVVGSSTSDYIETDKCVK  544
            I CE+L  + CAF+VS  GKRC++E +V   G+  + C+TSE+       + +ET++CV+
Sbjct  33   IKCESLEKNKCAFAVSWSGKRCVLEKSVKRSGEDAFTCRTSEIE-ADRLQNIVETEECVE  91

Query  543  TCGVDRKSVGMSSDPFLDSLFMAKLCARACYDYCPNLVDLYANIAAGEGVFLPELCEQIR  364
             CGVDR ++G+SSD  LD+ F  KLC+  CY++C N+VDL+ N+AAGEGVFLP+LCE   
Sbjct  92   GCGVDRNTLGISSDSLLDTSFTRKLCSSRCYNHCANVVDLFFNLAAGEGVFLPKLCEV--  149

Query  363  SGEGSRRGMAEIQ  325
             G   RRGM+EI+
Sbjct  150  QGGNVRRGMSEIR  162



>ref|XP_010255407.1| PREDICTED: uncharacterized protein LOC104596084 [Nelumbo nucifera]
Length=204

 Score =   134 bits (337),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 67/133 (50%), Positives = 90/133 (68%), Gaps = 3/133 (2%)
 Frame = -1

Query  723  IICENLPISTCAFSVSSYGKRCLIEDTVLLDGKVDYKCKTSEVVVGSSTSDYIETDKCVK  544
            I CENL   +CAF+VSS G RC++E  V   G+  Y C++SE+       D+IE+D+C++
Sbjct  33   IRCENLGKDSCAFAVSSSGTRCVLEKKVRRSGEEVYTCRSSEIE-ADKLKDWIESDECIE  91

Query  543  TCGVDRKSVGMSSDPFLDSLFMAKLCARACYDYCPNLVDLYANIAAGEGVFLPELCEQIR  364
             CG+ R SVG+SSD  L+  F   LC+  CY  CPN+VDLY N+AAGEGVFLP+LCE   
Sbjct  92   ACGLSRNSVGISSDALLEPCFTQHLCSSHCYANCPNIVDLYFNLAAGEGVFLPKLCEV--  149

Query  363  SGEGSRRGMAEIQ  325
             G  +RR M+EI+
Sbjct  150  QGTNARRQMSEIR  162



>gb|ABK22647.1| unknown [Picea sitchensis]
 gb|ABK27026.1| unknown [Picea sitchensis]
 gb|ABR18111.1| unknown [Picea sitchensis]
 gb|ACN40842.1| unknown [Picea sitchensis]
Length=202

 Score =   134 bits (337),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 56/121 (46%), Positives = 88/121 (73%), Gaps = 1/121 (1%)
 Frame = -1

Query  723  IICENLPISTCAFSVSSYGKRCLIEDTVLLDGKVDYKCKTSEVVVGSSTSDYIETDKCVK  544
            + CE LP+  CAFSVSS G RC++E  +++DG + ++C++S VVV    +++IE+++C+ 
Sbjct  36   MTCEELPVEVCAFSVSSSGNRCVLEKALMMDGTLQFQCQSS-VVVAEKLAEWIESEECIN  94

Query  543  TCGVDRKSVGMSSDPFLDSLFMAKLCARACYDYCPNLVDLYANIAAGEGVFLPELCEQIR  364
             CG++R +VGMS+D  L+  F  KLC+  C + CPN+VDLY N+AAGEG+ LP +CE  +
Sbjct  95   ACGLERMAVGMSTDSLLEPEFSRKLCSSQCRNSCPNIVDLYVNLAAGEGISLPRMCESQK  154

Query  363  S  361
            +
Sbjct  155  T  155



>ref|XP_011073210.1| PREDICTED: uncharacterized protein LOC105158233 [Sesamum indicum]
Length=171

 Score =   132 bits (333),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 69/134 (51%), Positives = 91/134 (68%), Gaps = 7/134 (5%)
 Frame = -1

Query  729  SEIICENLPISTCAFSVSSYGKRCLIEDTVLLDGKVDYKCKTSEVVVGSSTSDYIETDKC  550
            + +ICENLP + C+F+++S GKRC++E+     GK    CKTSEVVV    S YIETD+C
Sbjct  24   ANVICENLPTNLCSFAIASSGKRCVLENHKSPQGKT---CKTSEVVV-EKLSGYIETDQC  79

Query  549  VKTCGVDRKSVGMSSDPFLDSLFMAKLCARACYDYCPNLVDLYANIAAGEGVFLPELCEQ  370
            V  CGV R+S G+SSD FL S F A LC+ AC+  CPN+VDL+ N+AA EGV LP LC  
Sbjct  80   VNACGVCRESFGISSDAFLSSEFTAHLCSSACFQNCPNIVDLFFNLAASEGVSLPTLC--  137

Query  369  IRSGEGSRRGMAEI  328
             ++ E + R +  I
Sbjct  138  -KNQEENHRALLTI  150



>ref|XP_010671872.1| PREDICTED: uncharacterized protein LOC104888551 [Beta vulgaris 
subsp. vulgaris]
Length=231

 Score =   134 bits (337),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 66/134 (49%), Positives = 89/134 (66%), Gaps = 3/134 (2%)
 Frame = -1

Query  726  EIICENLPISTCAFSVSSYGKRCLIEDTVLLDGKVDYKCKTSEVVVGSSTSDYIETDKCV  547
            E+ CE L    CAF+VSS GKRC++E  V   G   YKC TS +       D +E++ C+
Sbjct  27   EVTCEQLNKEACAFAVSSIGKRCVLEKYVRRSGLEAYKCTTSAIDT-DELKDMVESNHCI  85

Query  546  KTCGVDRKSVGMSSDPFLDSLFMAKLCARACYDYCPNLVDLYANIAAGEGVFLPELCEQI  367
            + CG+DR ++G+SSD  L+S F  KLC+  CY  CPN+VDLY N+AAGEGVFLP+LCE  
Sbjct  86   EACGLDRDTLGISSDSLLESRFTRKLCSPQCYQKCPNVVDLYFNLAAGEGVFLPKLCES-  144

Query  366  RSGEGSRRGMAEIQ  325
               +  RRG++EI+
Sbjct  145  -QSQNPRRGLSEIK  157



>gb|EYU38454.1| hypothetical protein MIMGU_mgv1a024144mg [Erythranthe guttata]
Length=174

 Score =   132 bits (333),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 67/135 (50%), Positives = 88/135 (65%), Gaps = 4/135 (3%)
 Frame = -1

Query  726  EIICENLPISTCAFSVSSYGKRCLIEDT-VLLDGKVDYKCKTSEVVVGSSTSDYIETDKC  550
            E++CE LP+  C+FS++S GKRC++E     L G   Y+CKTSEV V      YIE D C
Sbjct  17   ELVCEELPVEVCSFSIASSGKRCVLETWESSLPGI--YQCKTSEVAVAIGMQGYIENDDC  74

Query  549  VKTCGVDRKSVGMSSDPFLDSLFMAKLCARACYDYCPNLVDLYANIAAGEGVFLPELCEQ  370
            V  CGVDR +VG+SSD  +++ F   LC+  CYD CPN+VDLY N+A  EGV L ELC+ 
Sbjct  75   VSACGVDRNTVGISSDSLMETQFTFNLCSPQCYDNCPNIVDLYYNLALAEGVVLGELCKS  134

Query  369  IRSGEGSRRGMAEIQ  325
             R+   SRR   ++Q
Sbjct  135  QRT-TSSRRSAIQLQ  148



>ref|XP_006388431.1| hypothetical protein POPTR_0187s00210g, partial [Populus trichocarpa]
 gb|ERP47345.1| hypothetical protein POPTR_0187s00210g, partial [Populus trichocarpa]
Length=184

 Score =   132 bits (333),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 60/128 (47%), Positives = 87/128 (68%), Gaps = 1/128 (1%)
 Frame = -1

Query  726  EIICENLPISTCAFSVSSYGKRCLIEDTVLLDGKVDYKCKTSEVVVGSSTSDYIETDKCV  547
            E++CE LP+  C++S+++ GKRCL+E+    DG V Y+CKTSEVVV    ++ IE D+C+
Sbjct  24   ELVCEQLPVDLCSYSIATSGKRCLLENYATKDGGVKYQCKTSEVVV-DKLNELIEIDECI  82

Query  546  KTCGVDRKSVGMSSDPFLDSLFMAKLCARACYDYCPNLVDLYANIAAGEGVFLPELCEQI  367
              CG+ R +VG+SSD  L   F+ KLC+++C   CPN+VDLY+N++  EGV+LP LC   
Sbjct  83   TACGLSRNTVGISSDSLLQPQFLTKLCSKSCSQACPNIVDLYSNLSLAEGVYLPNLCASP  142

Query  366  RSGEGSRR  343
            R      R
Sbjct  143  RRAMYQTR  150



>ref|XP_008439231.1| PREDICTED: uncharacterized protein LOC103484081 [Cucumis melo]
Length=206

 Score =   133 bits (335),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 65/133 (49%), Positives = 94/133 (71%), Gaps = 3/133 (2%)
 Frame = -1

Query  723  IICENLPISTCAFSVSSYGKRCLIEDTVLLDGKVDYKCKTSEVVVGSSTSDYIETDKCVK  544
            I C++L  + CAF+VS  GKRC++E +V   G+  + C+TSE+       + +ET++CVK
Sbjct  33   IKCKSLEKNKCAFAVSWSGKRCVLEKSVKRSGEEAFTCRTSEIE-ADRLQNIVETEECVK  91

Query  543  TCGVDRKSVGMSSDPFLDSLFMAKLCARACYDYCPNLVDLYANIAAGEGVFLPELCEQIR  364
             CG+DR ++G+SSD  LD+ F  KLC+  CY++C N+VDL+ N+AAGEGVFLP+LCE   
Sbjct  92   GCGLDRNTLGISSDSLLDTSFTRKLCSSRCYNHCANVVDLFFNLAAGEGVFLPKLCEV--  149

Query  363  SGEGSRRGMAEIQ  325
             G   RRGM+EI+
Sbjct  150  QGGNVRRGMSEIR  162



>ref|XP_008649530.1| PREDICTED: uncharacterized protein LOC103630240 [Zea mays]
 gb|AFW77700.1| hypothetical protein ZEAMMB73_689082 [Zea mays]
Length=178

 Score =   132 bits (332),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 65/136 (48%), Positives = 87/136 (64%), Gaps = 3/136 (2%)
 Frame = -1

Query  729  SEIICENLPISTCAFSVSSYGKRCLIEDTVLLDGKVDYKCKTSEVVVGSST-SDYIETDK  553
            + ++CE L    CAF+VSS  +RC++E T       +Y+C+TSEVV      S  +ETD 
Sbjct  26   ARVVCEQLTAEVCAFAVSSTSRRCVLETTHCAGRPTEYECRTSEVVAADGRLSGLVETDA  85

Query  552  CVKTCGVDRKSVGMSSDPFLDSLFMAKLCARACYDYCPNLVDLYANIAAGEGVFLPELCE  373
            CV+ CGVDR +VG+SSD  LD      +C+ AC   CPN+VDLYAN+AAGEGV   ELCE
Sbjct  86   CVRACGVDRATVGISSDSLLDPRVAGAVCSAACLRGCPNIVDLYANLAAGEGVAFSELCE  145

Query  372  QIRSGEGSRRGMAEIQ  325
              R+    RR M+++Q
Sbjct  146  VHRANP--RRAMSQLQ  159



>emb|CDY27075.1| BnaA02g10950D [Brassica napus]
Length=401

 Score =   137 bits (345),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 70/138 (51%), Positives = 98/138 (71%), Gaps = 5/138 (4%)
 Frame = -1

Query  735  IQSEIICENLPISTCAFSVSSYGKRCLIEDTVLLDGKVDYKCKTSEVVVGSSTSDYIETD  556
            + +E+ CE L   TCAF+VSS GKRC++E ++   G   Y C++SE+     T + IE+D
Sbjct  22   LGNEVKCEKLDKDTCAFAVSSTGKRCVLEQSIKRSGIEGYTCRSSEIEADKVT-NIIESD  80

Query  555  KCVKTCGVDRKSVGMSSDPFLDSLFMAKLCARACYDYCPNLVDLYANIAAGEGVFLPELC  376
            +C+K CG+DRKS+G+SSD  L+S F  KLC+  C   CPN+VDL+ N+AAGEGV+LP+LC
Sbjct  81   ECIKACGLDRKSLGISSDALLESRFTQKLCSVKCLTQCPNVVDLFFNLAAGEGVYLPKLC  140

Query  375  EQIRSGEG-SRRGMAEIQ  325
            E   S EG SRR M+E++
Sbjct  141  E---SQEGQSRRAMSELR  155



>ref|XP_004240617.1| PREDICTED: uncharacterized protein LOC101257567 [Solanum lycopersicum]
Length=191

 Score =   132 bits (332),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 66/135 (49%), Positives = 95/135 (70%), Gaps = 3/135 (2%)
 Frame = -1

Query  726  EIICENLPISTCAFSVSSYGKRCLIEDTVLLDGKVDYKCKTSEVVVGS-STSDYIETDKC  550
            EI+CE+L +  CA+SV+S GKRC +E    + G   Y+CKTS+V+V +   ++ IE+D+C
Sbjct  22   EIVCEDLSVGLCAYSVASSGKRCSLESYESIKGTRGYQCKTSDVLVSNIDITNSIESDEC  81

Query  549  VKTCGVDRKSVGMSSDPFLDSLFMAKLCARACYDYCPNLVDLYANIAAGEGVFLPELCEQ  370
            +  CG DR S+G+SSD  L+S F +KLC++ C   CPN+VDLY N+A GEGV+LP  C+ 
Sbjct  82   ISACGADRNSLGISSDSLLESTFTSKLCSQECNQKCPNIVDLYYNLALGEGVYLPAFCKG  141

Query  369  IRSGEGSRRGMAEIQ  325
             R+  G RR M++IQ
Sbjct  142  -RNLNG-RREMSQIQ  154



>ref|XP_002439633.1| hypothetical protein SORBIDRAFT_09g017290 [Sorghum bicolor]
 gb|EES18063.1| hypothetical protein SORBIDRAFT_09g017290 [Sorghum bicolor]
Length=182

 Score =   132 bits (332),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 66/134 (49%), Positives = 88/134 (66%), Gaps = 3/134 (2%)
 Frame = -1

Query  723  IICENLPISTCAFSVSSYGKRCLIEDTVLLDGKVDYKCKTSEVVV-GSSTSDYIETDKCV  547
            ++CE L    CAF+VSS  +RC++E+T       +Y+C+TSEVVV     S  +ETD CV
Sbjct  30   VVCEQLTAELCAFAVSSTSRRCVLENTHCAGRATEYQCRTSEVVVEDGRLSGLVETDGCV  89

Query  546  KTCGVDRKSVGMSSDPFLDSLFMAKLCARACYDYCPNLVDLYANIAAGEGVFLPELCEQI  367
            + CGVDR +VG+SSD  LD      +C+ AC   CPN+VDLY+N+AAGEGV   ELCE  
Sbjct  90   RACGVDRATVGISSDSLLDPRVAGAVCSPACLRGCPNIVDLYSNLAAGEGVAFSELCEVH  149

Query  366  RSGEGSRRGMAEIQ  325
            RS    RR +A++Q
Sbjct  150  RSNP--RRALAQLQ  161



>ref|XP_006363092.1| PREDICTED: uncharacterized protein LOC102590619 [Solanum tuberosum]
Length=169

 Score =   132 bits (331),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 72/177 (41%), Positives = 107/177 (60%), Gaps = 33/177 (19%)
 Frame = -1

Query  738  IIQSEIICENLPISTCAFSVSSYGKRCLIEDTVLLDGKV---DYKCKTSEVVVGSSTSDY  568
            + ++E+ CE+LP   CAF++SS GKRC++E        +   +Y+CKTSEV+V  +  ++
Sbjct  21   VYKTEVKCESLPNGDCAFAISSTGKRCVLEKATTPKDDLISSEYECKTSEVIV-ENMKEH  79

Query  567  IETDKCVKTCGVDRKSVGMSSDPFLDSLFMAKLCARACYDYCPNLVDLYANIAAGEGVFL  388
            IETD+C+++CG++R   G+SSD  L+  F++KLCA ACY  CPN+VDLY N+AAGEG +L
Sbjct  80   IETDECIESCGLNRNFFGISSDDLLEPQFVSKLCAPACYQECPNIVDLYFNLAAGEGAYL  139

Query  387  PELCEQIRSGEGSRRGMAEIQsgggdsaaapagapaagdDLPRRAMIGIDAEAPSPA  217
            P+LC + +  + S  G AE                            G+DA APSP+
Sbjct  140  PDLCNKNKKLQSS--GAAE---------------------------DGVDAPAPSPS  167



>ref|XP_006363091.1| PREDICTED: uncharacterized protein LOC102590281 [Solanum tuberosum]
Length=173

 Score =   131 bits (330),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 63/140 (45%), Positives = 98/140 (70%), Gaps = 7/140 (5%)
 Frame = -1

Query  738  IIQSEIICENLPISTCAFSVSSYGKRCLIEDTVLLDGKV---DYKCKTSEVVVGSSTSDY  568
            + ++E+ CE+LP   CAF++SS GKRC++E        +   +Y+CKTSEV+V  +  ++
Sbjct  25   VYKTEVKCESLPNGDCAFAISSTGKRCILEKATTPKDDLISSEYECKTSEVIV-ENMKEH  83

Query  567  IETDKCVKTCGVDRKSVGMSSDPFLDSLFMAKLCARACYDYCPNLVDLYANIAAGEGVFL  388
            IETD+C+++CG++R   G+SSD  L+  F++KLCA ACY  CPN+VDLY N+AAGEG +L
Sbjct  84   IETDECIESCGLNRNFFGISSDDLLEPQFVSKLCAPACYQECPNIVDLYFNLAAGEGAYL  143

Query  387  PELC---EQIRSGEGSRRGM  337
            P+LC    +++S   +  G+
Sbjct  144  PDLCNKNNKLKSSGAAEDGV  163



>ref|XP_004962356.1| PREDICTED: uncharacterized protein LOC101785352 [Setaria italica]
Length=191

 Score =   132 bits (332),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 65/138 (47%), Positives = 90/138 (65%), Gaps = 3/138 (2%)
 Frame = -1

Query  735  IQSEIICENLPISTCAFSVSSYGKRCLIEDTVLLDGKVDYKCKTSEVVV-GSSTSDYIET  559
            + + ++CE L    CAF+VSS  +RC++E+T        Y+C+TSEVVV     +  +ET
Sbjct  27   LGARVVCEQLAAELCAFAVSSTSRRCVLENTHCAGRPTAYQCRTSEVVVEDGRLAGTVET  86

Query  558  DKCVKTCGVDRKSVGMSSDPFLDSLFMAKLCARACYDYCPNLVDLYANIAAGEGVFLPEL  379
            D+CV+ CGVDR +VG+SSD  LD      +C+ AC   CPN+V+LYAN+AAGEGV   EL
Sbjct  87   DRCVRACGVDRATVGISSDSLLDPRVAGAVCSPACLQGCPNIVNLYANLAAGEGVAFSEL  146

Query  378  CEQIRSGEGSRRGMAEIQ  325
            CE  R+    RR MA++Q
Sbjct  147  CEVHRANP--RRAMAQLQ  162



>ref|XP_010452028.1| PREDICTED: uncharacterized protein LOC104734198 [Camelina sativa]
Length=183

 Score =   132 bits (331),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 64/135 (47%), Positives = 89/135 (66%), Gaps = 2/135 (1%)
 Frame = -1

Query  732  QSEIICENLPISTCAFSVSSYGKRCLIEDTVLLDGKVDYKCKTSEVVVGSSTSDYIETDK  553
             + +ICE+LP    +FS+S+ GKRC++E  +   G VDY+C++SEV V  + ++YIETD+
Sbjct  22   HANVICEDLPDDIYSFSISASGKRCVLETEMRQTGGVDYRCRSSEVDVDGTMANYIETDE  81

Query  552  CVKTCGVDRKSVGMSSDPFLDSLFMAKLCARACYDYCPNLVDLYANIAAGEGVFLPELCE  373
            CV  CGVDR+S+G+SSD  LD  F  KLC   C + CPN+ DLY+ + A EG  LP+LC 
Sbjct  82   CVNACGVDRRSLGISSDALLDPGFAVKLCTPECLEDCPNIADLYSILVAAEGSHLPDLCA  141

Query  372  QIRSGEGSRRGMAEI  328
              R+     R M EI
Sbjct  142  ARRN--NPHRSMFEI  154



>ref|XP_011073212.1| PREDICTED: uncharacterized protein LOC105158235 [Sesamum indicum]
Length=171

 Score =   130 bits (328),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 69/133 (52%), Positives = 90/133 (68%), Gaps = 7/133 (5%)
 Frame = -1

Query  726  EIICENLPISTCAFSVSSYGKRCLIEDTVLLDGKVDYKCKTSEVVVGSSTSDYIETDKCV  547
            ++ICENLP + C+F+++S GKRC++E+        + KCKTSEVVV    S YIETD+CV
Sbjct  25   DVICENLPTNLCSFAIASSGKRCVLENC---KNTQEKKCKTSEVVV-EKLSGYIETDQCV  80

Query  546  KTCGVDRKSVGMSSDPFLDSLFMAKLCARACYDYCPNLVDLYANIAAGEGVFLPELCEQI  367
              CGV R+SVG+SSD FL S F A LC+ AC+  CPN+VDL+ N+AA EGV L  LC   
Sbjct  81   NACGVCRESVGISSDAFLSSKFTAHLCSPACFHNCPNIVDLFVNLAASEGVSLSTLC---  137

Query  366  RSGEGSRRGMAEI  328
            ++ E   R M  I
Sbjct  138  KNQEEIHRSMLAI  150



>ref|XP_006281102.1| hypothetical protein CARUB_v10027132mg [Capsella rubella]
 gb|EOA14000.1| hypothetical protein CARUB_v10027132mg [Capsella rubella]
Length=210

 Score =   132 bits (331),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 66/138 (48%), Positives = 98/138 (71%), Gaps = 5/138 (4%)
 Frame = -1

Query  735  IQSEIICENLPISTCAFSVSSYGKRCLIEDTVLLDGKVDYKCKTSEVVVGSSTSDYIETD  556
            + SE+ CENL   TCAF+VS+ GKRC++E ++   G   Y C++S +      ++ +E++
Sbjct  22   LGSEVKCENLDEDTCAFAVSATGKRCVLEKSMRRSGIEVYSCRSSGIE-SDKVTNIVESN  80

Query  555  KCVKTCGVDRKSVGMSSDPFLDSLFMAKLCARACYDYCPNLVDLYANIAAGEGVFLPELC  376
            +C+  CG+ RKS+G+SSD  L+S F  KLC+  C ++CPN+VDL+ N+AAGEGVFLP+LC
Sbjct  81   ECINACGLGRKSLGISSDALLESRFTQKLCSVKCLNHCPNVVDLFFNLAAGEGVFLPKLC  140

Query  375  EQIRSGEG-SRRGMAEIQ  325
            E   S EG +RR M+EI+
Sbjct  141  E---SQEGKTRRAMSEIR  155



>ref|XP_010255408.1| PREDICTED: uncharacterized protein LOC104596085 [Nelumbo nucifera]
Length=172

 Score =   130 bits (328),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 63/124 (51%), Positives = 89/124 (72%), Gaps = 1/124 (1%)
 Frame = -1

Query  723  IICENLPISTCAFSVSSYGKRCLIEDTVLLDGKVDYKCKTSEVVVGSSTSDYIETDKCVK  544
            I CENLP   CAFSVSS G RC++E        V   CK+S+V+V  +T+ ++E D C++
Sbjct  30   ITCENLPNEYCAFSVSSAGFRCVLEKYEAGADGVKLGCKSSDVLV-ENTASWVEIDDCIE  88

Query  543  TCGVDRKSVGMSSDPFLDSLFMAKLCARACYDYCPNLVDLYANIAAGEGVFLPELCEQIR  364
            +CG+ RKSVG+SSD  L+  F+ KLC+  C+ +CPN+VDLY N+AA EGV+LP+LC+++R
Sbjct  89   SCGLKRKSVGISSDSLLEPNFLHKLCSPKCFQFCPNIVDLYFNLAAAEGVYLPKLCQKMR  148

Query  363  SGEG  352
            S  G
Sbjct  149  SKFG  152



>ref|XP_011073222.1| PREDICTED: uncharacterized protein LOC105158245 [Sesamum indicum]
Length=171

 Score =   130 bits (327),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 69/134 (51%), Positives = 90/134 (67%), Gaps = 7/134 (5%)
 Frame = -1

Query  729  SEIICENLPISTCAFSVSSYGKRCLIEDTVLLDGKVDYKCKTSEVVVGSSTSDYIETDKC  550
            + +ICENLP + C+F+++S GKRC++E+     GK    CKTSEVVV    S YIETD+C
Sbjct  24   ANVICENLPTNMCSFAIASSGKRCVLENHKSPQGKT---CKTSEVVV-EKLSGYIETDQC  79

Query  549  VKTCGVDRKSVGMSSDPFLDSLFMAKLCARACYDYCPNLVDLYANIAAGEGVFLPELCEQ  370
            V  CGV R+ VG+SSD FL S F A LC+ AC   CPN+VDL+ N+AA EGV LP LC  
Sbjct  80   VNACGVCREVVGISSDAFLSSEFTAHLCSPACLQNCPNIVDLFFNLAASEGVSLPTLC--  137

Query  369  IRSGEGSRRGMAEI  328
             ++ E + R +  I
Sbjct  138  -KNQEENHRALLTI  150



>ref|XP_002520453.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF41866.1| conserved hypothetical protein [Ricinus communis]
Length=180

 Score =   130 bits (328),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 61/129 (47%), Positives = 88/129 (68%), Gaps = 2/129 (2%)
 Frame = -1

Query  726  EIICENLPISTCAFSVSSYGKRCLIEDTVLL-DGKVDYKCKTSEVVVGSSTSDYIETDKC  550
            E++CE LP+  C++SV+S+GKRCL+E      D +V Y+CKTSEVVV     + IE+D+C
Sbjct  19   ELVCEQLPVELCSYSVASFGKRCLLETFATEEDREVIYQCKTSEVVV-DVIQERIESDEC  77

Query  549  VKTCGVDRKSVGMSSDPFLDSLFMAKLCARACYDYCPNLVDLYANIAAGEGVFLPELCEQ  370
            V  CG+DR +VG+SSD   +   +AKLC+   Y  CPN++DLY N+A GEG++LP++C  
Sbjct  78   VNACGLDRNTVGISSDTLFEPHLLAKLCSSDSYQSCPNIIDLYFNLALGEGIYLPDICAN  137

Query  369  IRSGEGSRR  343
             R    + R
Sbjct  138  PRHALSTTR  146



>ref|XP_011073220.1| PREDICTED: uncharacterized protein LOC105158243 [Sesamum indicum]
Length=171

 Score =   130 bits (327),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 69/134 (51%), Positives = 92/134 (69%), Gaps = 7/134 (5%)
 Frame = -1

Query  729  SEIICENLPISTCAFSVSSYGKRCLIEDTVLLDGKVDYKCKTSEVVVGSSTSDYIETDKC  550
            +++ICENLP + C+F+++S GKRC++E         + KCK+ EVVV    S YIET++C
Sbjct  24   ADVICENLPANLCSFAIASSGKRCVLE---CHKNTQEKKCKSLEVVV-EKLSGYIETEQC  79

Query  549  VKTCGVDRKSVGMSSDPFLDSLFMAKLCARACYDYCPNLVDLYANIAAGEGVFLPELCEQ  370
            VK CGV R+SVG+SSD FL S F A LC+ ACY  CPN+VDL+ N+AA EGV LP LC  
Sbjct  80   VKACGVCRESVGISSDVFLSSEFTAHLCSPACYHNCPNIVDLFFNLAASEGVSLPTLC--  137

Query  369  IRSGEGSRRGMAEI  328
             ++ E + R M  I
Sbjct  138  -KNQEENHRAMLAI  150



>ref|XP_006848035.1| hypothetical protein AMTR_s00029p00186480 [Amborella trichopoda]
 gb|ERN09616.1| hypothetical protein AMTR_s00029p00186480 [Amborella trichopoda]
Length=150

 Score =   127 bits (319),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 62/116 (53%), Positives = 85/116 (73%), Gaps = 2/116 (2%)
 Frame = -1

Query  738  IIQSEIICENLPISTCAFSVSSYGKRCLIEDTVLLDGKV-DYKCKTSEVVVGSSTSDYIE  562
            +  +EI+CENL    CAFS+SS GKRC++E     DG+  ++KC +SEV V    S++IE
Sbjct  34   VFAAEIVCENLSKEECAFSISSAGKRCVLEKYTGNDGEEGEFKCTSSEVEV-ERLSEWIE  92

Query  561  TDKCVKTCGVDRKSVGMSSDPFLDSLFMAKLCARACYDYCPNLVDLYANIAAGEGV  394
             ++C+++CG+DR SVG+SSD  LD  F AKLCA  C+D CPN+VDLY N+AAGEG+
Sbjct  93   IEECIQSCGLDRNSVGISSDSLLDPQFTAKLCASPCFDNCPNVVDLYFNLAAGEGI  148



>gb|ABK24725.1| unknown [Picea sitchensis]
Length=167

 Score =   128 bits (321),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 57/121 (47%), Positives = 87/121 (72%), Gaps = 2/121 (2%)
 Frame = -1

Query  735  IQSEII-CENLPISTCAFSVSSYGKRCLIEDTVLLDGKVDYKCKTSEVVVGSSTSDYIET  559
            +QS II CE LP   CAFS+SS G RC++E  +++DG + ++C++S VV+     ++IE+
Sbjct  8    VQSAIIKCEELPAELCAFSISSSGNRCVLEKDLMMDGTLQFQCQSS-VVLVEKLVEWIES  66

Query  558  DKCVKTCGVDRKSVGMSSDPFLDSLFMAKLCARACYDYCPNLVDLYANIAAGEGVFLPEL  379
            ++C+  CG++R +VGMS+D  L+  F AKLC+  C + CPN+VDLY N+AAGEG+ L  +
Sbjct  67   EECINACGLERMAVGMSTDSLLEPEFSAKLCSSECRNNCPNIVDLYVNLAAGEGISLSSM  126

Query  378  C  376
            C
Sbjct  127  C  127



>gb|ABK27044.1| unknown [Picea sitchensis]
Length=190

 Score =   128 bits (322),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 58/123 (47%), Positives = 87/123 (71%), Gaps = 2/123 (2%)
 Frame = -1

Query  741  PIIQSEII-CENLPISTCAFSVSSYGKRCLIEDTVLLDGKVDYKCKTSEVVVGSSTSDYI  565
            P +QS II CE LP   CAFS+SS G RC++E  +++DG + ++C++S VV      ++I
Sbjct  29   PGVQSAIIKCEELPAELCAFSISSSGNRCVLEKDLMMDGTLQFQCQSS-VVSVEKLVEWI  87

Query  564  ETDKCVKTCGVDRKSVGMSSDPFLDSLFMAKLCARACYDYCPNLVDLYANIAAGEGVFLP  385
            E+++C+  CG++R +VGMS+D  L+  F AKLC+  C + CPN+VDLY N+AAGEG+ L 
Sbjct  88   ESEECINACGLERMAVGMSTDSLLEPEFSAKLCSSECRNNCPNIVDLYVNLAAGEGISLS  147

Query  384  ELC  376
             +C
Sbjct  148  SMC  150



>ref|XP_010537178.1| PREDICTED: LOW QUALITY PROTEIN: sulfated surface glycoprotein 
185 [Tarenaya hassleriana]
Length=229

 Score =   129 bits (325),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 71/155 (46%), Positives = 103/155 (66%), Gaps = 9/155 (6%)
 Frame = -1

Query  789  AAFMKSlllllactlLPIIQSEIICENLPISTCAFSVSSYGKRCLIEDTVLLDGKVDYKC  610
            AAF+ SLL+L   +   ++  E+ CE+L   TCAF+VSS GKR          G   Y C
Sbjct  9    AAFVASLLVLTTLSFQTVLGHEVTCESLSEDTCAFAVSSTGKR-------XRSGVEVYTC  61

Query  609  KTSEVVVGSSTSDYIETDKCVKTCGVDRKSVGMSSDPFLDSLFMAKLCARACYDYCPNLV  430
            + SE+      ++ IE+++CVK CG+DRK++G+SSD  L+  F  KLC+  C+++CPN+V
Sbjct  62   RASEIE-ADKVANVIESERCVKDCGLDRKTLGISSDALLEPRFTRKLCSPQCFNHCPNVV  120

Query  429  DLYANIAAGEGVFLPELCEQIRSGEGSRRGMAEIQ  325
            DLY N+AAGEGVFLP+LCE  ++ +  RR M+EI+
Sbjct  121  DLYFNLAAGEGVFLPKLCEA-QNEKNKRREMSEIR  154



>emb|CDY13175.1| BnaC04g26600D [Brassica napus]
Length=203

 Score =   128 bits (322),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 64/113 (57%), Positives = 84/113 (74%), Gaps = 4/113 (4%)
 Frame = -1

Query  726  EIICENLPISTCAFSVSSYGKRCLIEDTVLLDGKVDYKCKTSEVVVGSSTSDYIETDKCV  547
            EIICENLP S CAFS+S+ GKRCL+E T  + G  +Y C+ S V V     +++E+D+CV
Sbjct  48   EIICENLPTSICAFSISATGKRCLLE-TANVAG--EYTCRNSAVEV-EGIVNHVESDECV  103

Query  546  KTCGVDRKSVGMSSDPFLDSLFMAKLCARACYDYCPNLVDLYANIAAGEGVFL  388
              CGVDRK+VG+SSD  ++  F AKLC+ AC+DYCPN++DLY N+AAGEG  L
Sbjct  104  AACGVDRKTVGISSDAMMEPGFAAKLCSPACFDYCPNILDLYFNLAAGEGKIL  156



>gb|KDO52035.1| hypothetical protein CISIN_1g029827mg [Citrus sinensis]
Length=158

 Score =   127 bits (318),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 59/111 (53%), Positives = 81/111 (73%), Gaps = 1/111 (1%)
 Frame = -1

Query  726  EIICENLPISTCAFSVSSYGKRCLIEDTVLLDGKVDYKCKTSEVVVGSSTSDYIETDKCV  547
            E+ CE+L  + CAF+VS+ GKRC++E  V   G+  Y CKTSE+      +++IETD+C+
Sbjct  29   EVTCESLDQNACAFAVSASGKRCVLEKQVKRSGQETYTCKTSEIE-AEKLNNWIETDQCI  87

Query  546  KTCGVDRKSVGMSSDPFLDSLFMAKLCARACYDYCPNLVDLYANIAAGEGV  394
            K+CG+DRKS+G+SSD  L+S F  KLC+  CY  CPN+VDLY N+AAGEG 
Sbjct  88   KSCGLDRKSLGISSDSLLESGFTQKLCSSPCYGSCPNIVDLYFNLAAGEGT  138



>ref|XP_010923168.1| PREDICTED: uncharacterized protein LOC105046307 isoform X2 [Elaeis 
guineensis]
Length=181

 Score =   127 bits (319),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 65/132 (49%), Positives = 87/132 (66%), Gaps = 8/132 (6%)
 Frame = -1

Query  723  IICENLPISTCAFSVSSYGKRCLIEDTVLLDGKVDYKCKTSEVVVGSSTSDYIETDKCVK  544
            +ICE+LP   CAF++SS  KRC++E      G  +Y+C+TSEVVV    SD+IETD+CVK
Sbjct  33   VICEDLPQDLCAFAISSSSKRCVLESIPHNGGPTEYQCRTSEVVV-ERMSDWIETDECVK  91

Query  543  TCGVDRKSVGMSSDPFLDSLFMAKLCARACYDYCPNLVDLYANIAAGEGVFLPELCEQIR  364
             CGVDR +VG+SSD  L+  F  K+C+ +C+  CPN++DLY N+AA E     +LCE  R
Sbjct  92   ACGVDRNTVGISSDSLLEPQFTEKICSPSCHQNCPNIIDLYFNLAAAE-----DLCEARR  146

Query  363  SGEGSRRGMAEI  328
                 RR M  I
Sbjct  147  G--NPRRSMQVI  156



>ref|XP_010326144.1| PREDICTED: uncharacterized protein LOC101261443 [Solanum lycopersicum]
Length=168

 Score =   127 bits (318),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 71/172 (41%), Positives = 104/172 (60%), Gaps = 33/172 (19%)
 Frame = -1

Query  723  IICENLPISTCAFSVSSYGKRCLIEDTVLLDGKV---DYKCKTSEVVVGSSTSDYIETDK  553
            + CE+LP S CAF++SS GKRC++E        +   +Y+CKTSEV+V  +  ++IETD+
Sbjct  25   VKCESLPNSDCAFAISSTGKRCVLEKAKKPKDDLISSEYECKTSEVMV-QNMKEHIETDE  83

Query  552  CVKTCGVDRKSVGMSSDPFLDSLFMAKLCARACYDYCPNLVDLYANIAAGEGVFLPELCE  373
            C+++CG++R   G+SSD  L+  F++KLCA ACY  CPN+VDLY N+AAGEG +LP++C 
Sbjct  84   CIESCGLNRNFFGISSDDLLEPRFVSKLCAPACYQQCPNIVDLYFNLAAGEGAYLPDICN  143

Query  372  QIRSGEGSRRGMAEIQsgggdsaaapagapaagdDLPRRAMIGIDAEAPSPA  217
            + +  + S  G AE                            G+DA APSP+
Sbjct  144  KNKKLKSS--GAAE---------------------------DGVDAPAPSPS  166



>ref|XP_006403624.1| hypothetical protein EUTSA_v10010808mg [Eutrema salsugineum]
 gb|ESQ45077.1| hypothetical protein EUTSA_v10010808mg [Eutrema salsugineum]
Length=140

 Score =   125 bits (315),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 65/122 (53%), Positives = 87/122 (71%), Gaps = 6/122 (5%)
 Frame = -1

Query  693  CAFSVSSYGKRCLIEDTVLLDGKVDYKCKTSEVVVGSSTSDYIETDKCVKTCGVDRKSVG  514
            CAFS+S+ GKRCL+E T  + G  +Y C+TS V V     +++E+D CV  CGVDRK+VG
Sbjct  2    CAFSISASGKRCLLE-TANVAG--EYTCRTSTVEV-EGIVNHVESDACVSACGVDRKTVG  57

Query  513  MSSDPFLDSLFMAKLCARACYDYCPNLVDLYANIAAGEGVFLPELCEQIRSGEGSRRGMA  334
            +SSD  +++ F AKLC+ AC DYCPN++DLY N+AAGEG FLP+LC+  R     RR M 
Sbjct  58   ISSDTMMEAGFAAKLCSPACLDYCPNILDLYFNLAAGEGAFLPDLCDAQRINP--RRSML  115

Query  333  EI  328
            +I
Sbjct  116  DI  117



>ref|XP_010504193.1| PREDICTED: uncharacterized protein LOC104781266 [Camelina sativa]
Length=149

 Score =   125 bits (315),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 64/122 (52%), Positives = 87/122 (71%), Gaps = 6/122 (5%)
 Frame = -1

Query  693  CAFSVSSYGKRCLIEDTVLLDGKVDYKCKTSEVVVGSSTSDYIETDKCVKTCGVDRKSVG  514
            CAFS+S+ GKRCL+E T  + G  +Y C+TS V V     +++E+D+CV  CGVDRK+VG
Sbjct  2    CAFSISASGKRCLLE-TANVAG--EYTCRTSAVDV-EGIVNHVESDECVAACGVDRKTVG  57

Query  513  MSSDPFLDSLFMAKLCARACYDYCPNLVDLYANIAAGEGVFLPELCEQIRSGEGSRRGMA  334
            +SSD  +++ F AK+C+ AC DYCPN++DLY N+AAGEG FLP+LC+  R      R M 
Sbjct  58   ISSDSLMEAGFAAKICSPACLDYCPNILDLYFNLAAGEGAFLPDLCDAHRMNP--HRSML  115

Query  333  EI  328
            EI
Sbjct  116  EI  117



>emb|CDP09133.1| unnamed protein product [Coffea canephora]
Length=178

 Score =   126 bits (317),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 57/133 (43%), Positives = 88/133 (66%), Gaps = 1/133 (1%)
 Frame = -1

Query  726  EIICENLPISTCAFSVSSYGKRCLIEDTVLLDGKVDYKCKTSEVVVGSSTSDYIETDKCV  547
            E++CE LPI  C+F+V+S GKRC +E     DGK+  +C++SE++   +  ++IE D+C+
Sbjct  20   ELVCEELPIKMCSFAVASSGKRCSLETYAAKDGKIGLQCRSSEILASDNIHEHIEKDECI  79

Query  546  KTCGVDRKSVGMSSDPFLDSLFMAKLCARACYDYCPNLVDLYANIAAGEGVFLPELCEQI  367
              CGV RK+VG+SSD         K+C+  C   C N+VDLY+N+A  EG++LP +C++ 
Sbjct  80   SACGVSRKTVGISSDNLFQPRHTHKICSPKCQHNCLNIVDLYSNLALAEGLYLPGVCKKA  139

Query  366  RSGEGSRRGMAEI  328
                GSR+ M+EI
Sbjct  140  LES-GSRQEMSEI  151



>ref|XP_004246366.2| PREDICTED: uncharacterized protein LOC101261147 [Solanum lycopersicum]
Length=169

 Score =   126 bits (316),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 61/140 (44%), Positives = 96/140 (69%), Gaps = 7/140 (5%)
 Frame = -1

Query  738  IIQSEIICENLPISTCAFSVSSYGKRCLIEDTVLLDGKV---DYKCKTSEVVVGSSTSDY  568
            + ++E+ CE+LP   CAF++SS GKRC++E        +   +Y+CKTSEV+V  +  ++
Sbjct  21   VYKTEVKCESLPNGDCAFAISSTGKRCVLEKAKTPKDDLISSEYECKTSEVMV-QNMKEH  79

Query  567  IETDKCVKTCGVDRKSVGMSSDPFLDSLFMAKLCARACYDYCPNLVDLYANIAAGEGVFL  388
            IETD+C+++CG++R   G+SSD  L+  F++KLCA ACY  CPN+VDLY N+A  EG +L
Sbjct  80   IETDECIESCGLNRNFFGISSDDLLEPQFVSKLCAPACYQQCPNIVDLYFNLAVAEGAYL  139

Query  387  PELC---EQIRSGEGSRRGM  337
            P+LC    +++S   +  G+
Sbjct  140  PDLCNKNNKLKSSGAAEDGV  159



>gb|KGN57378.1| hypothetical protein Csa_3G182140 [Cucumis sativus]
Length=163

 Score =   125 bits (314),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 55/123 (45%), Positives = 84/123 (68%), Gaps = 1/123 (1%)
 Frame = -1

Query  693  CAFSVSSYGKRCLIEDTVLLDGKVDYKCKTSEVVVGSSTSDYIETDKCVKTCGVDRKSVG  514
            CAF+VS +G RC++E TV LDG+  + C+TS+++      + +ET+KCV+ CG+DR ++G
Sbjct  2    CAFAVSWWGNRCVLEKTVKLDGEEGFTCRTSKIMEVKKLRNRVETEKCVRRCGLDRNTLG  61

Query  513  MSSDPFLDSLFMAKLCARACYDYCPNLVDLYANIAAGEGVFLPELCEQIRSGEGSRRGMA  334
            +SSD  LD+ F   LC+  CY++CPN+V L+ N+AA EG+ LP+LC     G    R M+
Sbjct  62   ISSDSLLDTRFTQNLCSSRCYNHCPNIVHLFTNLAAAEGLSLPKLC-NAEGGNMRSREMS  120

Query  333  EIQ  325
             I+
Sbjct  121  NIR  123



>ref|XP_010923170.1| PREDICTED: uncharacterized protein LOC105046307 isoform X4 [Elaeis 
guineensis]
Length=157

 Score =   124 bits (312),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 57/110 (52%), Positives = 79/110 (72%), Gaps = 1/110 (1%)
 Frame = -1

Query  723  IICENLPISTCAFSVSSYGKRCLIEDTVLLDGKVDYKCKTSEVVVGSSTSDYIETDKCVK  544
            +ICE+LP   CAF++SS  KRC++E      G  +Y+C+TSEVVV    SD+IETD+CVK
Sbjct  33   VICEDLPQDLCAFAISSSSKRCVLESIPHNGGPTEYQCRTSEVVV-ERMSDWIETDECVK  91

Query  543  TCGVDRKSVGMSSDPFLDSLFMAKLCARACYDYCPNLVDLYANIAAGEGV  394
             CGVDR +VG+SSD  L+  F  K+C+ +C+  CPN++DLY N+AA E +
Sbjct  92   ACGVDRNTVGISSDSLLEPQFTEKICSPSCHQNCPNIIDLYFNLAAAEEI  141



>ref|XP_009420109.1| PREDICTED: uncharacterized protein LOC103999932 [Musa acuminata 
subsp. malaccensis]
Length=233

 Score =   126 bits (317),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 60/127 (47%), Positives = 83/127 (65%), Gaps = 3/127 (2%)
 Frame = -1

Query  708  LPISTCAFSVSSYGKRCLIEDTVLLDGKVDYKCKTSEVVVGSSTSDYIETDKCVKTCGVD  529
            L +  CAF+VSS   RCL+E +    G   Y+C+ SE+VV     D+IET++CV  CGVD
Sbjct  85   LLLEVCAFAVSSSSNRCLLESSQDSGGNTVYQCRASEIVV-ERLRDWIETEQCVSVCGVD  143

Query  528  RKSVGMSSDPFLDSLFMAKLCARACYDYCPNLVDLYANIAAGEGVFLPELCEQIRSGEGS  349
            R +VG+SSD  L+  F  +LC+ AC+  CPN++DL+ ++AA EG+FLP+LCE  R     
Sbjct  144  RNAVGISSDALLEPHFTQQLCSAACHQNCPNIIDLHLDLAAAEGIFLPDLCEAQRVNP--  201

Query  348  RRGMAEI  328
             R M EI
Sbjct  202  HRAMVEI  208



>ref|XP_009103900.1| PREDICTED: uncharacterized protein LOC103829961 isoform X2 [Brassica 
rapa]
Length=183

 Score =   124 bits (312),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 62/116 (53%), Positives = 86/116 (74%), Gaps = 4/116 (3%)
 Frame = -1

Query  735  IQSEIICENLPISTCAFSVSSYGKRCLIEDTVLLDGKVDYKCKTSEVVVGSSTSDYIETD  556
            +  +I+CENLP + CAFS+S+ GKRCL+E T  + G  +Y C+TS V V     +++E+D
Sbjct  22   LGEDIVCENLPTNMCAFSISASGKRCLLE-TANVTG--EYTCRTSAVEV-EGIVNHVESD  77

Query  555  KCVKTCGVDRKSVGMSSDPFLDSLFMAKLCARACYDYCPNLVDLYANIAAGEGVFL  388
            +CV  CGVDRK+VG+SSD  +++ F AKLC+ AC DYCPN++DLY N+AAGEG  L
Sbjct  78   ECVAACGVDRKTVGISSDAMMEAGFAAKLCSPACLDYCPNILDLYFNLAAGEGTIL  133



>ref|XP_010923169.1| PREDICTED: uncharacterized protein LOC105046307 isoform X3 [Elaeis 
guineensis]
Length=169

 Score =   123 bits (308),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 57/108 (53%), Positives = 78/108 (72%), Gaps = 1/108 (1%)
 Frame = -1

Query  723  IICENLPISTCAFSVSSYGKRCLIEDTVLLDGKVDYKCKTSEVVVGSSTSDYIETDKCVK  544
            +ICE+LP   CAF++SS  KRC++E      G  +Y+C+TSEVVV    SD+IETD+CVK
Sbjct  33   VICEDLPQDLCAFAISSSSKRCVLESIPHNGGPTEYQCRTSEVVV-ERMSDWIETDECVK  91

Query  543  TCGVDRKSVGMSSDPFLDSLFMAKLCARACYDYCPNLVDLYANIAAGE  400
             CGVDR +VG+SSD  L+  F  K+C+ +C+  CPN++DLY N+AA E
Sbjct  92   ACGVDRNTVGISSDSLLEPQFTEKICSPSCHQNCPNIIDLYFNLAAAE  139



>ref|XP_001775001.1| predicted protein [Physcomitrella patens]
 gb|EDQ60108.1| predicted protein [Physcomitrella patens]
Length=120

 Score =   121 bits (304),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 54/116 (47%), Positives = 85/116 (73%), Gaps = 1/116 (1%)
 Frame = -1

Query  717  CENLPISTCAFSVSSYGKRCLIEDTVLLDGKVDYKCKTSEVVVGSSTSDYIETDKCVKTC  538
            CE+LPI  CAFSV+S G RC++E     DG + Y+C++S + +     ++IE+D+C+ +C
Sbjct  5    CEDLPIEYCAFSVASSGTRCVLEKYRGKDGIILYECQSS-MTMAEREEEWIESDECIISC  63

Query  537  GVDRKSVGMSSDPFLDSLFMAKLCARACYDYCPNLVDLYANIAAGEGVFLPELCEQ  370
            G++R SVG+S+D  +DS F   LC+  C + CPNL+DLY ++AAGEG++LP+LC++
Sbjct  64   GMERISVGLSTDLLMDSHFTKMLCSSECLNNCPNLIDLYTSLAAGEGMYLPQLCKE  119



>emb|CDP09118.1| unnamed protein product [Coffea canephora]
Length=349

 Score =   127 bits (318),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 61/138 (44%), Positives = 88/138 (64%), Gaps = 4/138 (3%)
 Frame = -1

Query  738  IIQSEIICENLPISTCAFSVSSYGKRCLIEDTVLLDGKVDYKCKTSEVVVGSSTSDYIET  559
            + + E+IC+ LP+  CAFS+SS GKRC +E +   D    ++CKTSE++V     ++IET
Sbjct  122  LAEGELICDELPVGMCAFSISSSGKRCSLETS---DEPGVFQCKTSEILV-HKIREHIET  177

Query  558  DKCVKTCGVDRKSVGMSSDPFLDSLFMAKLCARACYDYCPNLVDLYANIAAGEGVFLPEL  379
            D+C+  CG DR   G+SSD   D +F AKLC+  C + CPN+VDLY+N+A  EG  L + 
Sbjct  178  DECITACGADRNVTGISSDFLFDPIFTAKLCSNRCLNNCPNMVDLYSNLALAEGKLLSKR  237

Query  378  CEQIRSGEGSRRGMAEIQ  325
            C+   +    RR M+E Q
Sbjct  238  CKAQETHGTPRRAMSEFQ  255


 Score =   115 bits (289),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 56/126 (44%), Positives = 82/126 (65%), Gaps = 7/126 (6%)
 Frame = -1

Query  735  IQSEIICENLPISTCAFSVSSYGKRCLIEDTVLLDGKVDYKCKTSEVVVGSSTSDYIETD  556
            +  E+IC+ LP+  CAFS+SS GKRC +E +   D    ++CKTSE++V     ++IETD
Sbjct  17   LAGELICDELPVGMCAFSISSSGKRCSLETS---DEPGVFQCKTSEILV-HKIREHIETD  72

Query  555  KCVKTCGVDRKSVGMSSDPFLDSLFMAKLCARACYDYCPNLVDLYANIAAGEGVFLPELC  376
            +C+  CG DR   G+SSD   D +F AKLC+  C + CPN+VDLY+N+A  EG     +C
Sbjct  73   ECITACGADRNVTGISSDFLFDPIFTAKLCSNRCLNNCPNMVDLYSNLALAEGEL---IC  129

Query  375  EQIRSG  358
            +++  G
Sbjct  130  DELPVG  135



>ref|XP_009788534.1| PREDICTED: uncharacterized protein LOC104236325 [Nicotiana sylvestris]
Length=176

 Score =   122 bits (306),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 63/136 (46%), Positives = 97/136 (71%), Gaps = 2/136 (1%)
 Frame = -1

Query  735  IQSEIICENLPISTCAFSVSSYGKRCLIEDTVLLDGKVDYKCKTSEVVVGSSTSDYIETD  556
            +  ++ICE LP   C+FS++S GKRCL+E  V  +G ++ +C+TSEV   +   +YIETD
Sbjct  16   VLGDLICEELPEEMCSFSIASSGKRCLLESHVSAEGNLEMECQTSEVFATNKMQEYIETD  75

Query  555  KCVKTCGVDRKSVGMSSDPFLDSLFMAKLCARACYDYCPNLVDLYANIAAGEGVFLPELC  376
            +C+  CGVDR+S+G+SSD  LD  F+AK+C+  CY+ CPN+VDLY+N+A+ EGV L  LC
Sbjct  76   ECIGACGVDRQSLGLSSDSLLDPKFIAKICSAQCYNNCPNIVDLYSNLASAEGVSLHGLC  135

Query  375  --EQIRSGEGSRRGMA  334
              ++ R+  G+ + ++
Sbjct  136  LTQKTRAHHGTSQPLS  151



>ref|XP_009629076.1| PREDICTED: uncharacterized protein LOC104119315 [Nicotiana tomentosiformis]
Length=177

 Score =   121 bits (304),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 64/133 (48%), Positives = 95/133 (71%), Gaps = 2/133 (2%)
 Frame = -1

Query  735  IQSEIICENLPISTCAFSVSSYGKRCLIEDTVLLDGKVDYKCKTSEVVVGSSTSDYIETD  556
            +  ++ICE LP   C FS++S GKRCL+E  V  +G ++ +C+TSEV   +   +YIETD
Sbjct  17   VLGDLICEELPEEMCTFSIASSGKRCLLESHVSSEGNLEMECQTSEVFATNKMQEYIETD  76

Query  555  KCVKTCGVDRKSVGMSSDPFLDSLFMAKLCARACYDYCPNLVDLYANIAAGEGVFLPELC  376
            +C+  CGVDR+S+G+SSD  LDS F+AKLC+  CY+ CPN+VDLY+N+A+ EG+ L  LC
Sbjct  77   ECIGACGVDRQSLGLSSDSLLDSKFIAKLCSAQCYNNCPNIVDLYSNLASAEGISLHGLC  136

Query  375  --EQIRSGEGSRR  343
              ++ R+  G+ +
Sbjct  137  LSQKTRAHHGTSQ  149



>ref|XP_009763986.1| PREDICTED: uncharacterized protein LOC104215785 isoform X2 [Nicotiana 
sylvestris]
Length=204

 Score =   121 bits (304),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 56/110 (51%), Positives = 79/110 (72%), Gaps = 1/110 (1%)
 Frame = -1

Query  726  EIICENLPISTCAFSVSSYGKRCLIEDTVLLDGKVDYKCKTSEVVVG-SSTSDYIETDKC  550
            EI+CE+L +  CA+SV+  GKRC +E     +G   Y+CKTSEVVV  +  +++IE+D+C
Sbjct  21   EIVCEDLSVGKCAYSVAFSGKRCTLETYESSEGTTGYQCKTSEVVVAINGIANWIESDEC  80

Query  549  VKTCGVDRKSVGMSSDPFLDSLFMAKLCARACYDYCPNLVDLYANIAAGE  400
            +  CG +R SVG+SSD  L+S F +KLC++ CY  CPN+VDLY N+A GE
Sbjct  81   ISACGANRDSVGISSDSLLESSFTSKLCSQQCYQKCPNIVDLYYNLALGE  130



>ref|XP_002993093.1| hypothetical protein SELMODRAFT_431237 [Selaginella moellendorffii]
 gb|EFJ05841.1| hypothetical protein SELMODRAFT_431237 [Selaginella moellendorffii]
Length=196

 Score =   116 bits (291),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 56/125 (45%), Positives = 81/125 (65%), Gaps = 1/125 (1%)
 Frame = -1

Query  738  IIQSEIICENLPISTCAFSVSSYGKRCLIEDTVLLDGKVDYKCKTSEVVVGSSTSDYIET  559
            I  S + CE+LP   CAF+VS+ G RC++E  +  D    Y+C+TS V+       +IE+
Sbjct  24   IAGSRLECEDLPPQDCAFAVSTMGNRCVLEKFIAQDSSAIYECQTSNVM-AEKQEAWIES  82

Query  558  DKCVKTCGVDRKSVGMSSDPFLDSLFMAKLCARACYDYCPNLVDLYANIAAGEGVFLPEL  379
            DKCVK CGV+R  VG SSD   +  F+ +LC+  C + CPN+V+L+ ++AAGEGV L E+
Sbjct  83   DKCVKECGVERMWVGFSSDGLANRNFVNRLCSPVCQNNCPNIVNLFESLAAGEGVNLAEV  142

Query  378  CEQIR  364
            C  +R
Sbjct  143  CNYVR  147



>emb|CDP09117.1| unnamed protein product [Coffea canephora]
Length=162

 Score =   115 bits (288),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 58/123 (47%), Positives = 81/123 (66%), Gaps = 6/123 (5%)
 Frame = -1

Query  693  CAFSVSSYGKRCLIEDTVLLDGKVDYKCKTSEVVVGSSTSDYIETDKCVKTCGVDRKSVG  514
            CA SV+S GKRC +E     D     +CKTSE+ V     ++IETD+CV  CG DR   G
Sbjct  2    CALSVASSGKRCSLEAG---DEPGLPQCKTSEISV-HGIREHIETDECVAACGSDRNVTG  57

Query  513  MSSDPFLDSLFMAKLCARACYDYCPNLVDLYANIAAGEGVFLPELCEQIRSGEGSRRGMA  334
            +SSD  LD +F AKLC++ C + CPN+VDLY+N+A+ EGV L +LC+ + +    RR M+
Sbjct  58   ISSDSLLDPIFTAKLCSKHCVNNCPNIVDLYSNLASAEGVLLSKLCKSLETSP--RRAMS  115

Query  333  EIQ  325
            ++Q
Sbjct  116  QLQ  118



>ref|XP_002971753.1| hypothetical protein SELMODRAFT_412334 [Selaginella moellendorffii]
 gb|EFJ27502.1| hypothetical protein SELMODRAFT_412334 [Selaginella moellendorffii]
Length=196

 Score =   114 bits (286),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 55/125 (44%), Positives = 81/125 (65%), Gaps = 1/125 (1%)
 Frame = -1

Query  738  IIQSEIICENLPISTCAFSVSSYGKRCLIEDTVLLDGKVDYKCKTSEVVVGSSTSDYIET  559
            I  S + CE+LP   CAF+VS+ G RC++E  +  D    Y+C+TS V+       +IE+
Sbjct  24   IAGSRLECEDLPPQDCAFAVSTMGNRCVLEKFIAQDTSAIYECQTSNVM-AEKQEAWIES  82

Query  558  DKCVKTCGVDRKSVGMSSDPFLDSLFMAKLCARACYDYCPNLVDLYANIAAGEGVFLPEL  379
            D+CVK CGV+R  VG SSD   +  F+ +LC+  C + CPN+V+L+ ++AAGEGV L E+
Sbjct  83   DECVKECGVERMWVGFSSDGLANRNFVNRLCSPVCQNNCPNIVNLFESLAAGEGVNLAEV  142

Query  378  CEQIR  364
            C  +R
Sbjct  143  CNYVR  147



>ref|XP_010040888.1| PREDICTED: uncharacterized protein LOC104429762 [Eucalyptus grandis]
Length=217

 Score =   115 bits (287),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 53/106 (50%), Positives = 76/106 (72%), Gaps = 1/106 (1%)
 Frame = -1

Query  726  EIICENLPISTCAFSVSSYGKRCLIEDTVLLDGKVDYKCKTSEVVVGSSTSDYIETDKCV  547
            +I CENL   +CAF+VSS GKRC++E  V   G+  Y C++SE+    +  D+IETD+C+
Sbjct  25   DIACENLDQGSCAFAVSSTGKRCVLEKQVRRSGEEGYTCRSSEIEA-DNLKDHIETDECI  83

Query  546  KTCGVDRKSVGMSSDPFLDSLFMAKLCARACYDYCPNLVDLYANIA  409
              CG+DRK++G+SSD  L+S F  KLC+  CY+ CPN+VDLY ++A
Sbjct  84   AACGLDRKTLGVSSDSLLESRFTQKLCSSGCYENCPNIVDLYFSLA  129



>ref|XP_002971544.1| hypothetical protein SELMODRAFT_412333 [Selaginella moellendorffii]
 gb|EFJ27293.1| hypothetical protein SELMODRAFT_412333 [Selaginella moellendorffii]
Length=200

 Score =   114 bits (285),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 56/135 (41%), Positives = 86/135 (64%), Gaps = 3/135 (2%)
 Frame = -1

Query  735  IQSEIICENLPISTCAFSVSSYGKRCLIEDTVLLDGKVDYKCKTSEVVVGSSTSDYIETD  556
            IQ+ + CE L +  CAF+VS  G RC++E  VL    V Y+C+TS V+   S + +IETD
Sbjct  19   IQAALECEELAVEDCAFAVSGLGSRCVLEKRVLESKIVVYQCQTSPVLAERSEA-WIETD  77

Query  555  KCVKTCGVDRKSVGMSSDPFLDSLFMAKLCARACYDYCPNLVDLYANIAAGEGVFLPELC  376
            +C+  CG++R SVG+S+D  +   F+++ C+  C   CPN+VDL+  +A+GE + LP +C
Sbjct  78   ECLAACGLERMSVGISTDGIIRKEFLSRWCSSQCQANCPNVVDLFTKLASGEDIHLPHIC  137

Query  375  EQIRSGEGSRRGMAE  331
              IR    SR+ + E
Sbjct  138  NFIRP--SSRKLIGE  150



>ref|XP_002993113.1| hypothetical protein SELMODRAFT_48837, partial [Selaginella moellendorffii]
 gb|EFJ05861.1| hypothetical protein SELMODRAFT_48837, partial [Selaginella moellendorffii]
Length=132

 Score =   111 bits (278),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 51/118 (43%), Positives = 77/118 (65%), Gaps = 1/118 (1%)
 Frame = -1

Query  717  CENLPISTCAFSVSSYGKRCLIEDTVLLDGKVDYKCKTSEVVVGSSTSDYIETDKCVKTC  538
            CE L +  CAF+VS  G RC++E  VL    V Y+C+TS V+   S + +IETD+C+  C
Sbjct  3    CEELAVEDCAFAVSGLGSRCVLEKRVLESKIVVYQCQTSPVLAERSEA-WIETDECLAAC  61

Query  537  GVDRKSVGMSSDPFLDSLFMAKLCARACYDYCPNLVDLYANIAAGEGVFLPELCEQIR  364
            G++R SVG+S+D  +   F+++ C+  C   CPN+VDL+  +A+GE + LP +C  IR
Sbjct  62   GLERMSVGISTDGIIRKEFLSRWCSSQCQANCPNVVDLFTKLASGEDIHLPHICNSIR  119



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1578431504286