BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c80585_g1_i1 len=756 path=[1:0-755]

Length=756
                                                                      Score     E

ref|XP_007152038.1|  hypothetical protein PHAVU_004G096500g             193   5e-57   
ref|XP_010246881.1|  PREDICTED: vacuolar iron transporter homolog...    188   3e-55   
ref|XP_002302185.1|  hypothetical protein POPTR_0002s07000g             187   1e-54   Populus trichocarpa [western balsam poplar]
ref|XP_007143527.1|  hypothetical protein PHAVU_007G079100g             186   1e-54   
ref|XP_011042839.1|  PREDICTED: vacuolar iron transporter homolog...    185   4e-54   
emb|CDP11375.1|  unnamed protein product                                185   6e-54   
gb|AFK49166.1|  unknown                                                 184   8e-54   
ref|XP_006606162.1|  PREDICTED: vacuolar iron transporter homolog...    184   1e-53   
gb|KHN17004.1|  Vacuolar iron transporter like 4                        184   1e-53   
ref|XP_009765332.1|  PREDICTED: vacuolar iron transporter homolog...    182   4e-53   
ref|XP_007019467.1|  Vacuolar iron transporter family protein           182   5e-53   
ref|XP_002268564.1|  PREDICTED: vacuolar iron transporter homolog...    182   7e-53   Vitis vinifera
ref|XP_009343623.1|  PREDICTED: vacuolar iron transporter homolog...    182   8e-53   
emb|CAN65436.1|  hypothetical protein VITISV_032099                     182   9e-53   Vitis vinifera
ref|XP_008381810.1|  PREDICTED: vacuolar iron transporter homolog...    182   1e-52   
ref|XP_004516646.1|  PREDICTED: vacuolar iron transporter homolog...    181   1e-52   
ref|XP_004290529.1|  PREDICTED: vacuolar iron transporter homolog...    182   1e-52   
ref|NP_189952.1|  putative nodulin-like21 protein                       181   1e-52   Arabidopsis thaliana [mouse-ear cress]
gb|ACU21390.1|  unknown                                                 182   1e-52   Glycine max [soybeans]
gb|KHN41264.1|  Vacuolar iron transporter like 4                        181   1e-52   
ref|XP_003548120.1|  PREDICTED: vacuolar iron transporter homolog...    181   2e-52   
ref|XP_011044200.1|  PREDICTED: vacuolar iron transporter homolog...    181   2e-52   
ref|XP_004237778.1|  PREDICTED: vacuolar iron transporter homolog...    181   3e-52   
emb|CBI20044.3|  unnamed protein product                                182   3e-52   
ref|XP_006362825.1|  PREDICTED: vacuolar iron transporter homolog...    180   4e-52   
gb|KHN15432.1|  Vacuolar iron transporter like 4                        180   5e-52   
ref|XP_011101499.1|  PREDICTED: vacuolar iron transporter homolog...    180   6e-52   
ref|XP_009618045.1|  PREDICTED: vacuolar iron transporter homolog...    182   6e-52   
ref|XP_003592125.1|  Nodulin-like protein                               179   6e-52   
ref|XP_002534648.1|  Nodulin, putative                                  179   1e-51   Ricinus communis
ref|XP_004139663.1|  PREDICTED: vacuolar iron transporter homolog...    179   1e-51   
ref|XP_002875613.1|  hypothetical protein ARALYDRAFT_484807             177   2e-51   
ref|XP_003518603.1|  PREDICTED: vacuolar iron transporter homolog...    179   2e-51   
ref|XP_009149595.1|  PREDICTED: vacuolar iron transporter homolog...    177   2e-51   
ref|XP_010108651.1|  hypothetical protein L484_017884                   178   2e-51   
ref|XP_006472968.1|  PREDICTED: vacuolar iron transporter homolog...    178   3e-51   
ref|XP_002306691.1|  hypothetical protein POPTR_0005s21310g             177   3e-51   Populus trichocarpa [western balsam poplar]
ref|XP_008237596.1|  PREDICTED: vacuolar iron transporter homolog...    178   3e-51   
emb|CBI18549.3|  unnamed protein product                                177   4e-51   
ref|XP_007201814.1|  hypothetical protein PRUPE_ppa010996mg             177   5e-51   
gb|EYU17457.1|  hypothetical protein MIMGU_mgv1a013396mg                177   5e-51   
ref|XP_010062127.1|  PREDICTED: vacuolar iron transporter homolog...    177   7e-51   
ref|XP_007043040.1|  Vacuolar iron transporter family protein           177   1e-50   
ref|XP_004140970.1|  PREDICTED: vacuolar iron transporter homolog...    176   1e-50   
ref|XP_002265452.1|  PREDICTED: vacuolar iron transporter homolog...    176   1e-50   Vitis vinifera
ref|XP_008441522.1|  PREDICTED: vacuolar iron transporter homolog...    176   1e-50   
ref|XP_004496484.1|  PREDICTED: vacuolar iron transporter homolog...    176   2e-50   
ref|XP_006434441.1|  hypothetical protein CICLE_v10002398mg             176   2e-50   
ref|XP_010514728.1|  PREDICTED: vacuolar iron transporter homolog...    175   2e-50   
ref|XP_002530510.1|  Nodulin, putative                                  175   3e-50   Ricinus communis
ref|XP_009368505.1|  PREDICTED: vacuolar iron transporter homolog...    176   3e-50   
ref|XP_007023068.1|  Vacuolar iron transporter family protein           175   4e-50   
emb|CDY33672.1|  BnaC08g19720D                                          174   6e-50   
ref|XP_010048737.1|  PREDICTED: vacuolar iron transporter homolog...    174   7e-50   
ref|XP_009587130.1|  PREDICTED: vacuolar iron transporter homolog...    174   9e-50   
ref|XP_009587128.1|  PREDICTED: vacuolar iron transporter homolog...    173   2e-49   
emb|CDX96601.1|  BnaA08g21440D                                          172   2e-49   
ref|XP_009772167.1|  PREDICTED: vacuolar iron transporter homolog...    173   2e-49   
ref|XP_009772168.1|  PREDICTED: vacuolar iron transporter homolog...    172   4e-49   
ref|XP_002875612.1|  hypothetical protein ARALYDRAFT_484806             171   4e-49   
ref|XP_004230629.1|  PREDICTED: vacuolar iron transporter homolog 4     172   4e-49   
ref|XP_010241729.1|  PREDICTED: vacuolar iron transporter homolog...    172   5e-49   
gb|KFK42096.1|  hypothetical protein AALP_AA2G210100                    171   6e-49   
ref|XP_002883588.1|  hypothetical protein ARALYDRAFT_480028             172   7e-49   
ref|NP_173538.2|  vacuolar iron transporter homolog 1                   171   7e-49   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002890428.1|  hypothetical protein ARALYDRAFT_889570             171   1e-48   
ref|NP_189949.1|  protein nodulin-like3                                 171   1e-48   Arabidopsis thaliana [mouse-ear cress]
gb|KEH25837.1|  vacuolar iron transporter-like protein                  171   1e-48   
ref|XP_010459823.1|  PREDICTED: vacuolar iron transporter homolog 1     170   1e-48   
ref|XP_010477374.1|  PREDICTED: vacuolar iron transporter homolog...    170   1e-48   
ref|XP_004140229.1|  PREDICTED: vacuolar iron transporter homolog...    170   1e-48   
ref|XP_006351863.1|  PREDICTED: vacuolar iron transporter homolog...    171   2e-48   
ref|XP_008449417.1|  PREDICTED: vacuolar iron transporter homolog...    170   2e-48   
ref|XP_004230639.1|  PREDICTED: vacuolar iron transporter homolog...    170   2e-48   
ref|XP_008461513.1|  PREDICTED: vacuolar iron transporter homolog...    171   2e-48   
ref|XP_006351864.1|  PREDICTED: vacuolar iron transporter homolog...    169   4e-48   
emb|CDX88318.1|  BnaC06g37620D                                          169   5e-48   
ref|XP_009106345.1|  PREDICTED: vacuolar iron transporter homolog...    168   5e-48   
ref|XP_006291836.1|  hypothetical protein CARUB_v10018010mg             169   7e-48   
ref|XP_007159063.1|  hypothetical protein PHAVU_002G205100g             169   8e-48   
ref|XP_006416327.1|  hypothetical protein EUTSA_v10008583mg             169   1e-47   
ref|XP_010245271.1|  PREDICTED: vacuolar iron transporter homolog...    169   1e-47   
ref|XP_006303183.1|  hypothetical protein CARUB_v10010334mg             168   1e-47   
ref|XP_007206311.1|  hypothetical protein PRUPE_ppa024883mg             169   1e-47   
ref|XP_010260918.1|  PREDICTED: vacuolar iron transporter homolog...    168   1e-47   
emb|CDO97494.1|  unnamed protein product                                167   2e-47   
ref|XP_006351865.1|  PREDICTED: vacuolar iron transporter homolog...    167   2e-47   
gb|KDP43005.1|  hypothetical protein JCGZ_25191                         167   3e-47   
emb|CDY71883.1|  BnaCnng74920D                                          167   3e-47   
ref|XP_010680575.1|  PREDICTED: vacuolar iron transporter homolog...    167   4e-47   
ref|XP_008246515.1|  PREDICTED: vacuolar iron transporter homolog...    167   5e-47   
ref|XP_009103303.1|  PREDICTED: vacuolar iron transporter homolog 1     166   6e-47   
ref|XP_009606689.1|  PREDICTED: vacuolar iron transporter homolog...    166   9e-47   
ref|XP_008781394.1|  PREDICTED: vacuolar iron transporter homolog...    166   1e-46   
ref|XP_006291870.1|  hypothetical protein CARUB_v10018047mg             166   1e-46   
emb|CDY01332.1|  BnaA07g11050D                                          166   1e-46   
gb|EYU36849.1|  hypothetical protein MIMGU_mgv1a025177mg                165   2e-46   
ref|XP_010514727.1|  PREDICTED: vacuolar iron transporter homolog 3     164   3e-46   
gb|KFK44209.1|  hypothetical protein AALP_AA1G228700                    164   3e-46   
emb|CBI20043.3|  unnamed protein product                                164   9e-46   
ref|XP_009780590.1|  PREDICTED: vacuolar iron transporter homolog...    163   1e-45   
emb|CAN65435.1|  hypothetical protein VITISV_032098                     163   1e-45   Vitis vinifera
ref|XP_004504756.1|  PREDICTED: vacuolar iron transporter homolog...    163   2e-45   
ref|XP_006418651.1|  hypothetical protein EUTSA_v10002660mg             163   2e-45   
ref|XP_010539736.1|  PREDICTED: vacuolar iron transporter homolog...    163   2e-45   
ref|XP_010527751.1|  PREDICTED: vacuolar iron transporter homolog...    162   2e-45   
ref|XP_009128195.1|  PREDICTED: vacuolar iron transporter homolog 2     161   3e-45   
ref|XP_002268519.2|  PREDICTED: vacuolar iron transporter homolog...    163   3e-45   Vitis vinifera
ref|XP_010251863.1|  PREDICTED: vacuolar iron transporter homolog...    162   4e-45   
ref|XP_010680543.1|  PREDICTED: vacuolar iron transporter homolog...    162   5e-45   
ref|NP_177806.1|  protein nodulin-like2                                 160   6e-45   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006390155.1|  hypothetical protein EUTSA_v10019177mg             160   8e-45   
emb|CDY15107.1|  BnaC03g44680D                                          161   9e-45   
ref|XP_002325128.1|  hypothetical protein POPTR_0018s11510g             161   1e-44   Populus trichocarpa [western balsam poplar]
emb|CDY20388.1|  BnaC02g24280D                                          160   1e-44   
ref|XP_010680555.1|  PREDICTED: vacuolar iron transporter homolog...    160   1e-44   
emb|CDX87566.1|  BnaA07g33070D                                          159   2e-44   
gb|KFK39821.1|  hypothetical protein AALP_AA3G292800                    160   2e-44   
ref|XP_008785903.1|  PREDICTED: vacuolar iron transporter homolog...    160   3e-44   
ref|XP_004230638.1|  PREDICTED: vacuolar iron transporter homolog...    159   3e-44   
ref|XP_010428749.1|  PREDICTED: vacuolar iron transporter homolog 2     159   3e-44   
ref|XP_010680566.1|  PREDICTED: vacuolar iron transporter homolog...    159   4e-44   
ref|XP_010416603.1|  PREDICTED: vacuolar iron transporter homolog 2     159   4e-44   
ref|XP_007041605.1|  Vacuolar iron transporter family protein           159   4e-44   
ref|XP_003524080.1|  PREDICTED: nodulin-21-like                         159   5e-44   
gb|KHM99124.1|  Vacuolar iron transporter like 4                        159   5e-44   
ref|XP_006302849.1|  hypothetical protein CARUB_v10020980mg             158   8e-44   
ref|XP_009587129.1|  PREDICTED: vacuolar iron transporter homolog...    158   8e-44   
ref|XP_009772166.1|  PREDICTED: vacuolar iron transporter homolog...    158   9e-44   
ref|XP_008370515.1|  PREDICTED: vacuolar iron transporter homolog...    159   1e-43   
gb|EYU18521.1|  hypothetical protein MIMGU_mgv1a025650mg                157   1e-43   
gb|KDO45014.1|  hypothetical protein CISIN_1g043274mg                   158   2e-43   
ref|XP_004485536.1|  PREDICTED: vacuolar iron transporter homolog...    157   2e-43   
gb|EPS62168.1|  hypothetical protein M569_12624                         157   2e-43   
ref|XP_006423813.1|  hypothetical protein CICLE_v10030208mg             157   2e-43   
ref|XP_006492643.1|  PREDICTED: vacuolar iron transporter homolog...    157   2e-43   
ref|XP_003532624.1|  PREDICTED: vacuolar iron transporter homolog...    157   2e-43   
ref|XP_003531055.1|  PREDICTED: vacuolar iron transporter homolog...    157   2e-43   
gb|KHN39190.1|  Nodulin-21                                              157   3e-43   
ref|XP_010103834.1|  hypothetical protein L484_024136                   157   3e-43   
ref|XP_007041604.1|  Vacuolar iron transporter family protein           156   5e-43   
ref|XP_006298517.1|  hypothetical protein CARUB_v10014595mg             156   6e-43   
ref|XP_010525582.1|  PREDICTED: vacuolar iron transporter homolog...    156   6e-43   
ref|XP_004305016.1|  PREDICTED: vacuolar iron transporter homolog...    156   6e-43   
ref|XP_009136106.1|  PREDICTED: vacuolar iron transporter homolog...    156   7e-43   
ref|XP_010466942.1|  PREDICTED: vacuolar iron transporter homolog...    156   8e-43   
ref|XP_010488631.1|  PREDICTED: vacuolar iron transporter homolog...    155   9e-43   
gb|AAK52980.1|AF375396_1  AT3g25190/MJL12_14                            155   1e-42   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010934147.1|  PREDICTED: vacuolar iron transporter homolog...    156   1e-42   
ref|XP_007159064.1|  hypothetical protein PHAVU_002G205200g             155   1e-42   
ref|XP_006586352.1|  PREDICTED: nodulin-21-like                         157   1e-42   
gb|EYU35414.1|  hypothetical protein MIMGU_mgv1a018031mg                154   2e-42   
ref|XP_003619938.1|  Nodulin-related integral membrane protein DU...    154   2e-42   
gb|AES63379.2|  vacuolar iron transporter-like protein                  154   2e-42   
ref|NP_189156.1|  vacuolar iron transporter homolog 2.1                 154   2e-42   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010514030.1|  PREDICTED: vacuolar iron transporter homolog...    154   3e-42   
ref|XP_002887657.1|  hypothetical protein ARALYDRAFT_476839             153   4e-42   
ref|XP_006590740.1|  PREDICTED: vacuolar iron transporter homolog...    154   5e-42   
ref|XP_008366847.1|  PREDICTED: vacuolar iron transporter homolog...    154   5e-42   
gb|KEH31261.1|  vacuolar iron transporter-like protein                  154   6e-42   
gb|KEH31259.1|  vacuolar iron transporter-like protein                  154   6e-42   
ref|XP_007159062.1|  hypothetical protein PHAVU_002G205000g             154   6e-42   
ref|XP_003531056.1|  PREDICTED: nodulin-21-like                         154   7e-42   
ref|XP_008388973.1|  PREDICTED: vacuolar iron transporter homolog...    154   7e-42   
gb|AFK40213.1|  unknown                                                 153   7e-42   
gb|KHN39189.1|  Nodulin-21                                              152   8e-42   
ref|XP_008784247.1|  PREDICTED: vacuolar iron transporter homolog...    153   9e-42   
ref|XP_011087827.1|  PREDICTED: vacuolar iron transporter homolog...    153   1e-41   
ref|XP_009335631.1|  PREDICTED: vacuolar iron transporter homolog...    153   1e-41   
ref|XP_009373968.1|  PREDICTED: vacuolar iron transporter homolog...    153   1e-41   
ref|XP_008350614.1|  PREDICTED: vacuolar iron transporter homolog...    153   1e-41   
dbj|BAL46698.1|  hypothetical protein                                   153   1e-41   
ref|XP_003593128.1|  Nodulin-like protein                               154   2e-41   
ref|XP_003532970.1|  PREDICTED: vacuolar iron transporter homolog...    152   2e-41   
gb|AFK37817.1|  unknown                                                 152   2e-41   
gb|KHN26718.1|  Vacuolar iron transporter like 4                        152   2e-41   
ref|XP_011088130.1|  PREDICTED: vacuolar iron transporter homolog...    152   3e-41   
ref|XP_010931000.1|  PREDICTED: vacuolar iron transporter homolog...    150   6e-41   
ref|XP_008796894.1|  PREDICTED: vacuolar iron transporter homolog...    151   7e-41   
ref|XP_002268474.1|  PREDICTED: vacuolar iron transporter homolog...    150   9e-41   Vitis vinifera
ref|XP_010030076.1|  PREDICTED: vacuolar iron transporter homolog...    150   1e-40   
gb|KHN33493.1|  Vacuolar iron transporter like 4                        150   2e-40   
ref|XP_010030077.1|  PREDICTED: vacuolar iron transporter homolog...    150   2e-40   
ref|XP_010111855.1|  hypothetical protein L484_020647                   150   2e-40   
gb|ACU24234.1|  unknown                                                 150   2e-40   Glycine max [soybeans]
ref|XP_004172912.1|  PREDICTED: vacuolar iron transporter homolog...    148   2e-40   
ref|XP_011018038.1|  PREDICTED: vacuolar iron transporter homolog...    149   3e-40   
ref|XP_007157969.1|  hypothetical protein PHAVU_002G113500g             149   3e-40   
gb|EYU18519.1|  hypothetical protein MIMGU_mgv1a0247122mg               147   6e-40   
ref|XP_004504934.1|  PREDICTED: nodulin-21-like                         148   1e-39   
ref|XP_009419407.1|  PREDICTED: vacuolar iron transporter homolog...    146   3e-39   
gb|KEH31258.1|  vacuolar iron transporter-like protein                  147   4e-39   
gb|KCW57036.1|  hypothetical protein EUGRSUZ_I02698                     145   1e-38   
ref|XP_006351862.1|  PREDICTED: vacuolar iron transporter homolog...    145   1e-38   
ref|XP_010912403.1|  PREDICTED: vacuolar iron transporter homolog...    144   2e-38   
ref|XP_010030075.1|  PREDICTED: vacuolar iron transporter homolog...    145   2e-38   
ref|XP_011092395.1|  PREDICTED: vacuolar iron transporter homolog...    144   4e-38   
ref|XP_006351817.1|  PREDICTED: vacuolar iron transporter homolog...    143   6e-38   
ref|XP_004504755.1|  PREDICTED: vacuolar iron transporter homolog...    143   8e-38   
gb|KHN35977.1|  Vacuolar iron transporter like 4                        143   9e-38   
gb|KDP42890.1|  hypothetical protein JCGZ_23832                         143   2e-37   
ref|NP_001236825.1|  nodulin-21                                         141   3e-37   
ref|XP_009420189.1|  PREDICTED: vacuolar iron transporter homolog...    141   3e-37   
ref|XP_010919446.1|  PREDICTED: vacuolar iron transporter homolog...    140   9e-37   
ref|XP_002447364.1|  hypothetical protein SORBIDRAFT_06g033760          140   1e-36   Sorghum bicolor [broomcorn]
ref|XP_003524079.2|  PREDICTED: vacuolar iron transporter homolog...    138   1e-36   
ref|XP_009411067.1|  PREDICTED: vacuolar iron transporter homolog...    139   2e-36   
ref|XP_002527771.1|  Nodulin, putative                                  139   3e-36   Ricinus communis
ref|XP_008663753.1|  PREDICTED: vacuolar iron transporter homolog...    138   5e-36   
gb|KHN39192.1|  Vacuolar iron transporter like 4                        136   6e-36   
gb|KHN39191.1|  Vacuolar iron transporter like 4                        136   6e-36   
tpg|DAA36745.1|  TPA: integral membrane protein                         137   1e-35   
ref|NP_001151908.1|  integral membrane protein                          137   1e-35   Zea mays [maize]
ref|XP_008791707.1|  PREDICTED: vacuolar iron transporter homolog...    137   2e-35   
ref|XP_009382334.1|  PREDICTED: vacuolar iron transporter homolog...    136   5e-35   
gb|AFK38519.1|  unknown                                                 133   1e-34   
gb|KHN41842.1|  Vacuolar iron transporter like 4                        133   1e-34   
gb|AFK48414.1|  unknown                                                 134   2e-34   
gb|KHM99128.1|  Nodulin-21                                              131   4e-34   
gb|KEH31262.1|  vacuolar iron transporter-like protein                  133   5e-34   
ref|XP_006292466.1|  hypothetical protein CARUB_v10018696mg             131   6e-34   
gb|AFK45846.1|  unknown                                                 133   8e-34   
ref|XP_002993072.1|  hypothetical protein SELMODRAFT_26881              131   1e-33   
ref|XP_006833495.1|  hypothetical protein AMTR_s01243p00009970          130   3e-33   
ref|XP_004230642.1|  PREDICTED: vacuolar iron transporter homolog...    129   2e-32   
sp|B7F138.1|VITH2_ORYSJ  RecName: Full=Vacuolar iron transporter ...    127   3e-32   Oryza sativa Japonica Group [Japonica rice]
gb|AFG52748.1|  hypothetical protein 2_8399_01                          125   8e-32   
gb|EAY94995.1|  hypothetical protein OsI_16802                          128   8e-32   Oryza sativa Indica Group [Indian rice]
sp|Q7XTL7.3|VITH5_ORYSJ  RecName: Full=Vacuolar iron transporter ...    127   9e-32   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001053431.1|  Os04g0538400                                       127   1e-31   Oryza sativa Japonica Group [Japonica rice]
dbj|BAJ87699.1|  predicted protein                                      125   2e-31   
ref|XP_010240184.1|  PREDICTED: vacuolar iron transporter homolog...    126   4e-31   
ref|XP_009383061.1|  PREDICTED: vacuolar iron transporter homolog...    125   4e-31   
ref|XP_002452847.1|  hypothetical protein SORBIDRAFT_04g033490          125   5e-31   Sorghum bicolor [broomcorn]
ref|XP_010243894.1|  PREDICTED: vacuolar iron transporter homolog...    121   1e-30   
ref|XP_006856176.1|  hypothetical protein AMTR_s00059p00177640          122   3e-30   
ref|XP_009401793.1|  PREDICTED: vacuolar iron transporter homolog...    122   4e-30   
ref|XP_007225009.1|  hypothetical protein PRUPE_ppa020259mg             120   4e-30   
ref|XP_010690358.1|  PREDICTED: vacuolar iron transporter homolog...    122   5e-30   
ref|XP_002971905.1|  hypothetical protein SELMODRAFT_37133              121   7e-30   
ref|XP_004976380.1|  PREDICTED: vacuolar iron transporter homolog...    122   1e-29   
gb|KDO83692.1|  hypothetical protein CISIN_1g0279832mg                  119   2e-29   
ref|XP_010030825.1|  PREDICTED: vacuolar iron transporter homolog...    120   4e-29   
ref|XP_002452846.1|  hypothetical protein SORBIDRAFT_04g033480          119   1e-28   Sorghum bicolor [broomcorn]
gb|AFK46620.1|  unknown                                                 116   2e-28   
sp|Q6H658.1|VITH1_ORYSJ  RecName: Full=Vacuolar iron transporter ...    118   3e-28   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001169225.1|  uncharacterized protein LOC100383083               118   3e-28   Zea mays [maize]
ref|XP_002990153.1|  hypothetical protein SELMODRAFT_48764              116   4e-28   
gb|EAZ05618.1|  hypothetical protein OsI_27836                          118   4e-28   Oryza sativa Indica Group [Indian rice]
ref|XP_002448241.1|  hypothetical protein SORBIDRAFT_06g023860          118   5e-28   Sorghum bicolor [broomcorn]
ref|XP_006653625.1|  PREDICTED: vacuolar iron transporter homolog...    117   6e-28   
sp|Q84ZM7.1|VITH3_ORYSJ  RecName: Full=Vacuolar iron transporter ...    117   6e-28   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008647138.1|  PREDICTED: vacuolar iron transporter homolog...    116   1e-27   
ref|NP_001054330.2|  Os04g0686800                                       115   2e-27   Oryza sativa Japonica Group [Japonica rice]
ref|XP_003572758.1|  PREDICTED: vacuolar iron transporter homolog...    114   5e-27   
ref|XP_003579519.1|  PREDICTED: vacuolar iron transporter homolog...    113   2e-26   
ref|XP_002885688.1|  hypothetical protein ARALYDRAFT_899121             112   3e-26   
ref|XP_002877268.1|  predicted protein                                  109   4e-26   
ref|XP_004955105.1|  PREDICTED: vacuolar iron transporter homolog...    112   5e-26   
ref|XP_001771442.1|  predicted protein                                  110   1e-25   
ref|XP_010042700.1|  PREDICTED: vacuolar iron transporter homolog...    108   6e-25   
ref|XP_008663417.1|  PREDICTED: vacuolar iron transporter homolog...    109   7e-25   
gb|EYU23680.1|  hypothetical protein MIMGU_mgv11b018438mg               109   7e-25   
gb|EAZ31475.1|  hypothetical protein OsJ_15611                          109   1e-24   Oryza sativa Japonica Group [Japonica rice]
gb|KHM99125.1|  Vacuolar iron transporter like 4                        105   7e-24   
gb|EMS51229.1|  hypothetical protein TRIUR3_33657                       104   9e-24   
ref|XP_010932690.1|  PREDICTED: vacuolar iron transporter homolog...    105   1e-23   
gb|KCW57038.1|  hypothetical protein EUGRSUZ_I02700                     103   3e-23   
ref|XP_002317637.1|  hypothetical protein POPTR_0011s14910g             104   4e-23   Populus trichocarpa [western balsam poplar]
gb|EMT25943.1|  hypothetical protein F775_21808                         102   4e-23   
ref|XP_002973065.1|  hypothetical protein SELMODRAFT_58851              102   7e-23   
ref|XP_002263267.1|  PREDICTED: vacuolar iron transporter homolog...    102   1e-22   Vitis vinifera
ref|XP_006653909.1|  PREDICTED: LOW QUALITY PROTEIN: vacuolar iro...    101   1e-22   
ref|XP_004289023.1|  PREDICTED: vacuolar iron transporter homolog...    100   4e-22   
ref|XP_006430460.1|  hypothetical protein CICLE_v10013873mg             101   6e-22   
ref|XP_006854523.1|  hypothetical protein AMTR_s00030p00022030        99.0    7e-22   
gb|EMT07627.1|  hypothetical protein F775_43071                       98.2    9e-22   
ref|XP_009359647.1|  PREDICTED: vacuolar iron transporter homolog...    100   1e-21   
ref|XP_004980192.1|  PREDICTED: vacuolar iron transporter homolog...  99.4    3e-21   
ref|XP_005644660.1|  DUF125-domain-containing protein                 97.8    9e-21   
ref|XP_005851755.1|  hypothetical protein CHLNCDRAFT_133135           97.8    2e-20   
emb|CDP01742.1|  unnamed protein product                              99.8    2e-20   
ref|XP_010103560.1|  hypothetical protein L484_023054                 93.2    3e-20   
ref|XP_002952458.1|  hypothetical protein VOLCADRAFT_105504           95.9    5e-20   
ref|XP_001772589.1|  predicted protein                                95.5    9e-20   
ref|XP_001700022.1|  hypothetical protein CHLREDRAFT_112030           94.7    1e-19   
gb|KHN39193.1|  Nodulin-21                                            92.0    6e-19   
ref|NP_001236723.1|  uncharacterized protein LOC100527486             92.0    7e-19   
gb|KDO57392.1|  hypothetical protein CISIN_1g039724mg                 92.0    1e-18   
ref|WP_019931067.1|  hypothetical protein                             90.5    4e-18   
ref|XP_007223979.1|  hypothetical protein PRUPE_ppa014725mg           87.4    6e-18   
ref|XP_003576279.1|  PREDICTED: vacuolar iron transporter homolog...  89.0    9e-18   
gb|EEN89653.1|  membrane protein                                      89.4    9e-18   
ref|WP_037128812.1|  membrane protein                                 89.4    1e-17   
ref|WP_020970586.1|  hypothetical protein                             89.4    1e-17   
ref|WP_035165649.1|  membrane protein                                 88.6    1e-17   
ref|WP_024487286.1|  MULTISPECIES: hypothetical protein               89.4    1e-17   
ref|WP_003702982.1|  membrane protein                                 88.2    1e-17   
ref|WP_033234345.1|  membrane protein                                 89.0    1e-17   
ref|WP_007733901.1|  MULTISPECIES: hypothetical protein               89.0    1e-17   
ref|WP_020908897.1|  hypothetical protein                             88.2    2e-17   
ref|WP_003699485.1|  membrane protein                                 87.8    2e-17   
ref|WP_019745057.1|  MULTISPECIES: membrane protein                   88.6    2e-17   
ref|XP_007159065.1|  hypothetical protein PHAVU_002G205300g           87.8    2e-17   
ref|WP_021332129.1|  membrane protein                                 88.2    2e-17   
gb|EMT01079.1|  hypothetical protein F775_14748                       86.7    2e-17   
gb|KHN47420.1|  Vacuolar iron transporter like 3                      88.2    2e-17   
emb|CBI37485.3|  unnamed protein product                              90.1    4e-17   
ref|WP_018688809.1|  hypothetical protein                             87.0    5e-17   
ref|XP_011038088.1|  PREDICTED: vacuolar iron transporter homolog...  87.0    7e-17   
ref|WP_034982158.1|  membrane protein                                 85.9    8e-17   
emb|CDK34258.1|  FIG00746553: hypothetical protein                    85.9    8e-17   
gb|EGL98030.1|  hypothetical protein NIAS840_01779                    85.9    9e-17   
ref|XP_007203917.1|  hypothetical protein PRUPE_ppa016369mg           86.7    9e-17   
ref|WP_003708479.1|  membrane protein                                 85.9    9e-17   
ref|XP_011016221.1|  PREDICTED: vacuolar iron transporter homolog...  86.7    1e-16   
gb|KFM23182.1|  Fe(2+)/Mn(2+) transporter pcl1                        85.9    2e-16   
ref|XP_002449039.1|  hypothetical protein SORBIDRAFT_05g003850        85.5    2e-16   
ref|XP_002298995.2|  hypothetical protein POPTR_0001s46020g           85.9    2e-16   
ref|WP_029004053.1|  membrane protein                                 85.5    2e-16   
ref|WP_028662613.1|  membrane protein                                 84.7    3e-16   
ref|XP_011004409.1|  PREDICTED: vacuolar iron transporter homolog...  84.3    6e-16   
ref|WP_017838261.1|  hypothetical protein                             84.0    7e-16   
ref|WP_027933571.1|  membrane protein                                 83.6    9e-16   
ref|XP_005650374.1|  DUF125-domain-containing protein                 83.6    9e-16   
ref|WP_029778992.1|  membrane protein                                 82.8    1e-15   
ref|WP_007881508.1|  hypothetical protein                             83.2    1e-15   
ref|XP_007046424.1|  Vacuolar iron transporter family protein, pu...  85.9    1e-15   
ref|WP_019673601.1|  hypothetical protein                             83.2    1e-15   
gb|ETY73217.1|  membrane protein                                      82.8    1e-15   
ref|XP_001699735.1|  hypothetical protein CHLREDRAFT_186828           83.6    1e-15   
ref|WP_024899098.1|  membrane protein                                 82.8    1e-15   
ref|WP_011983041.1|  membrane protein                                 82.8    2e-15   
ref|WP_020578627.1|  hypothetical protein                             82.8    2e-15   
ref|XP_002528533.1|  conserved hypothetical protein                   83.2    2e-15   
ref|WP_036586925.1|  membrane protein                                 82.4    2e-15   
ref|WP_019809257.1|  membrane protein                                 82.4    2e-15   
ref|XP_008365543.1|  PREDICTED: vacuolar iron transporter homolog...  83.6    2e-15   
gb|EAY80066.1|  hypothetical protein OsI_35234                        82.0    2e-15   
ref|XP_011098371.1|  PREDICTED: vacuolar iron transporter homolog...  82.4    2e-15   
ref|WP_034238146.1|  membrane protein                                 82.0    3e-15   
ref|XP_009597601.1|  PREDICTED: vacuolar iron transporter homolog...  82.4    3e-15   
ref|WP_013884387.1|  hypothetical protein [                           81.3    4e-15   
ref|WP_017985489.1|  membrane protein                                 81.6    4e-15   
ref|XP_006849926.1|  hypothetical protein AMTR_s00022p00115300        82.0    4e-15   
ref|WP_020420329.1|  membrane protein                                 81.3    5e-15   
ref|WP_028711173.1|  MULTISPECIES: membrane protein                   81.3    6e-15   
ref|XP_008392820.1|  PREDICTED: vacuolar iron transporter homolog...  79.7    6e-15   
ref|WP_018700719.1|  membrane protein                                 80.5    9e-15   
ref|WP_020632132.1|  membrane protein                                 80.5    1e-14   
emb|CAN72688.1|  hypothetical protein VITISV_037521                   82.8    1e-14   
ref|WP_028932692.1|  hypothetical protein                             80.1    1e-14   
ref|XP_010038402.1|  PREDICTED: vacuolar iron transporter homolog...  78.6    2e-14   
gb|ACU21513.1|  unknown                                               77.4    2e-14   
ref|WP_005166922.1|  hypothetical protein                             79.3    2e-14   
ref|WP_033391834.1|  membrane protein                                 79.3    2e-14   
ref|WP_007028457.1|  integral membrane protein                        79.3    3e-14   
ref|WP_016337871.1|  integral membrane protein                        79.3    3e-14   
ref|WP_028047956.1|  hypothetical protein                             79.0    3e-14   
ref|WP_015389529.1|  hypothetical protein                             79.0    3e-14   
ref|XP_010317057.1|  PREDICTED: vacuolar iron transporter homolog...  79.7    3e-14   
ref|WP_037335059.1|  membrane protein                                 79.0    3e-14   
ref|XP_011030940.1|  PREDICTED: vacuolar iron transporter homolog...  79.0    3e-14   
ref|WP_007420543.1|  membrane protein                                 79.0    3e-14   
emb|CEL18291.1|  hypothetical protein                                 79.0    3e-14   
ref|WP_007393376.1|  membrane protein                                 78.6    4e-14   
gb|KGA04756.1|  integral membrane protein                             78.6    4e-14   
ref|WP_038298678.1|  membrane protein                                 79.0    4e-14   
ref|WP_029461421.1|  membrane protein                                 78.6    4e-14   
ref|WP_029719791.1|  membrane protein                                 78.6    4e-14   
gb|AAX95090.1|  Integral membrane protein, putative                   78.2    4e-14   
ref|WP_034314747.1|  membrane protein                                 78.6    5e-14   
ref|WP_024625055.1|  membrane protein                                 77.8    5e-14   
gb|ETY73074.1|  membrane protein                                      78.2    6e-14   
ref|XP_009766194.1|  PREDICTED: vacuolar iron transporter homolog...  79.0    6e-14   
ref|WP_013559164.1|  membrane protein                                 77.8    7e-14   
ref|WP_010652646.1|  membrane protein                                 77.8    7e-14   
ref|XP_002452848.1|  hypothetical protein SORBIDRAFT_04g033500        77.8    7e-14   
ref|WP_028382075.1|  membrane protein                                 77.4    9e-14   
ref|WP_011287834.1|  membrane protein                                 77.4    9e-14   
ref|WP_037318548.1|  membrane protein                                 77.4    9e-14   
gb|AIA15548.1|  VIT family                                            77.4    1e-13   
sp|Q53PN2.2|VITH4_ORYSJ  RecName: Full=Vacuolar iron transporter ...  77.0    1e-13   
ref|WP_028848531.1|  membrane protein                                 77.4    1e-13   
ref|WP_035944516.1|  membrane protein                                 77.4    1e-13   
ref|WP_013170188.1|  membrane protein                                 77.4    1e-13   
ref|WP_030051850.1|  membrane protein                                 77.0    1e-13   
gb|KCW56453.1|  hypothetical protein EUGRSUZ_I02184                   76.3    1e-13   
ref|WP_025022545.1|  membrane protein                                 77.0    1e-13   
ref|WP_028859906.1|  membrane protein                                 77.0    1e-13   
ref|WP_037258108.1|  membrane protein                                 77.0    1e-13   
ref|XP_008799163.1|  PREDICTED: vacuolar iron transporter homolog...  77.0    2e-13   
ref|XP_002993554.1|  hypothetical protein SELMODRAFT_431624           78.2    2e-13   
ref|WP_016667402.1|  hypothetical protein                             77.0    2e-13   
gb|KDD73388.1|  VIT family protein                                    76.3    2e-13   
ref|WP_028153679.1|  membrane protein                                 76.3    2e-13   
ref|WP_004811715.1|  membrane protein                                 77.0    2e-13   
ref|WP_025025345.1|  membrane protein                                 75.5    2e-13   
ref|WP_028374882.1|  membrane protein                                 76.3    3e-13   
ref|WP_034621659.1|  membrane protein                                 75.9    3e-13   
ref|WP_024929753.1|  membrane protein                                 75.9    3e-13   
ref|WP_022977534.1|  nodulin 21                                       75.9    3e-13   
ref|WP_019881786.1|  MULTISPECIES: hypothetical protein               75.9    3e-13   
ref|WP_015582928.1|  MULTISPECIES: integral membrane protein          76.3    4e-13   
ref|WP_023032577.1|  MULTISPECIES: hypothetical protein               76.3    4e-13   
ref|WP_007433719.1|  membrane protein                                 76.6    4e-13   
ref|WP_006586937.1|  membrane protein                                 75.1    4e-13   
ref|WP_006587920.1|  membrane protein                                 75.1    4e-13   
ref|WP_003746301.1|  membrane protein                                 75.5    5e-13   
ref|WP_010619168.1|  membrane protein                                 74.7    5e-13   
ref|WP_003224802.1|  membrane protein                                 75.1    6e-13   
ref|WP_002527525.1|  membrane protein                                 75.9    6e-13   
ref|WP_020948982.1|  hypothetical protein                             75.1    6e-13   
ref|WP_014214759.1|  membrane protein                                 74.7    6e-13   
ref|WP_037249472.1|  membrane protein                                 75.1    6e-13   
ref|WP_037436327.1|  membrane protein                                 75.1    7e-13   
ref|WP_009638002.1|  membrane protein                                 75.1    7e-13   
ref|WP_021344837.1|  hypothetical protein                             75.1    8e-13   
ref|XP_008242166.1|  PREDICTED: vacuolar iron transporter homolog...  73.9    8e-13   
ref|WP_013126841.1|  membrane protein                                 75.1    8e-13   
ref|WP_007809141.1|  membrane protein                                 74.7    8e-13   
ref|WP_018985752.1|  hypothetical protein                             74.7    9e-13   
ref|WP_023457217.1|  membrane protein                                 74.7    9e-13   
ref|WP_029148518.1|  membrane protein                                 74.7    9e-13   
ref|WP_020524768.1|  hypothetical protein                             74.7    1e-12   
ref|WP_020677802.1|  hypothetical protein                             74.3    1e-12   
ref|WP_032910319.1|  membrane protein                                 74.3    1e-12   
ref|WP_026350066.1|  membrane protein                                 74.3    1e-12   
ref|WP_023493283.1|  hypothetical protein                             74.7    1e-12   
ref|WP_036491208.1|  membrane protein                                 74.3    1e-12   
ref|WP_032907311.1|  membrane protein                                 74.3    1e-12   
ref|WP_013268155.1|  membrane protein                                 74.3    1e-12   
ref|WP_015750188.1|  membrane protein                                 74.3    1e-12   
ref|WP_035091332.1|  membrane protein                                 74.3    1e-12   
ref|WP_011501463.1|  membrane protein                                 74.3    1e-12   
ref|WP_029087700.1|  membrane protein                                 74.3    1e-12   
ref|WP_003755431.1|  membrane protein                                 73.9    1e-12   
ref|XP_008354591.1|  PREDICTED: vacuolar iron transporter homolog...  72.8    1e-12   
ref|WP_010564895.1|  membrane protein                                 73.9    1e-12   
ref|WP_035679908.1|  membrane protein                                 73.9    1e-12   
ref|WP_035033656.1|  membrane protein                                 73.9    1e-12   
ref|WP_036149876.1|  membrane protein                                 73.9    1e-12   
ref|WP_025917870.1|  membrane protein                                 73.9    2e-12   
ref|WP_020742832.1|  MULTISPECIES: hypothetical protein               73.9    2e-12   
ref|WP_013948159.1|  MULTISPECIES: membrane protein                   73.9    2e-12   
ref|WP_003779375.1|  membrane protein                                 73.9    2e-12   
ref|WP_036185642.1|  membrane protein                                 73.9    2e-12   
ref|WP_008631488.1|  Putative nodulin-related protein                 73.9    2e-12   
ref|WP_017668899.1|  membrane protein                                 73.6    2e-12   
ref|WP_028092676.1|  membrane protein                                 73.9    2e-12   
ref|WP_017848224.1|  membrane protein                                 73.6    2e-12   
ref|WP_026472157.1|  hypothetical protein                             73.6    2e-12   
ref|WP_034813988.1|  membrane protein                                 73.6    2e-12   
ref|WP_020950329.1|  manganese/iron transporter                       73.6    2e-12   
ref|WP_003685490.1|  membrane protein                                 73.6    2e-12   
ref|WP_027824674.1|  membrane protein                                 72.8    2e-12   
ref|WP_003679805.1|  membrane protein                                 73.6    2e-12   
ref|WP_035040457.1|  membrane protein                                 73.6    2e-12   
ref|WP_029408523.1|  membrane protein                                 73.2    3e-12   
ref|WP_034900969.1|  membrane protein                                 73.2    3e-12   
ref|WP_004720119.1|  membrane protein                                 73.2    3e-12   
ref|WP_037393598.1|  membrane protein                                 73.2    3e-12   
ref|WP_007115697.1|  membrane protein                                 73.2    3e-12   
ref|WP_014783387.1|  membrane protein                                 73.2    3e-12   
dbj|BAO54535.1|  nodulin 21-related protein                           72.8    3e-12   
ref|WP_034959688.1|  membrane protein                                 73.2    3e-12   
ref|WP_024076284.1|  membrane protein                                 73.2    3e-12   
ref|WP_016687515.1|  membrane protein                                 73.2    3e-12   
ref|WP_010338392.1|  MULTISPECIES: membrane protein                   73.2    3e-12   
ref|WP_011464256.1|  membrane protein                                 73.2    3e-12   
ref|WP_026758265.1|  membrane protein                                 72.8    3e-12   
ref|WP_034303755.1|  membrane protein                                 72.8    4e-12   
ref|WP_011455060.1|  membrane protein                                 72.8    4e-12   
ref|WP_037489698.1|  membrane protein                                 72.8    4e-12   
ref|WP_037475619.1|  membrane protein                                 72.8    4e-12   
ref|WP_007042309.1|  membrane protein                                 72.8    4e-12   
gb|AHN27948.1|  nodulin 21-related protein                            72.8    4e-12   
ref|WP_026602027.1|  membrane protein                                 72.8    4e-12   
ref|WP_020927392.1|  hypothetical protein                             72.8    4e-12   
ref|WP_003743081.1|  membrane protein                                 72.8    4e-12   
ref|WP_013569368.1|  membrane protein                                 72.8    4e-12   
ref|WP_028153416.1|  membrane protein                                 72.8    4e-12   
ref|WP_020484919.1|  hypothetical protein                             72.8    4e-12   
ref|WP_036273349.1|  membrane protein                                 72.8    4e-12   
ref|WP_009173735.1|  membrane protein                                 72.8    4e-12   
ref|WP_026479258.1|  membrane protein                                 72.8    4e-12   
ref|WP_037492094.1|  membrane protein                                 72.8    4e-12   
ref|WP_034822974.1|  membrane protein                                 72.4    4e-12   
ref|WP_032869194.1|  membrane protein                                 72.8    5e-12   
ref|WP_015596585.1|  membrane protein                                 72.8    5e-12   
ref|WP_003765810.1|  membrane protein                                 72.4    5e-12   
gb|KES09396.1|  putative membrane protein                             72.8    5e-12   
ref|WP_003636582.1|  membrane protein                                 72.4    5e-12   
ref|WP_009312004.1|  membrane protein                                 72.4    5e-12   
ref|WP_026638596.1|  membrane protein                                 72.4    5e-12   
ref|XP_010030826.1|  PREDICTED: vacuolar iron transporter homolog...  70.9    5e-12   
ref|WP_035233094.1|  membrane protein                                 72.4    5e-12   
ref|WP_034993598.1|  membrane protein                                 72.4    6e-12   
ref|WP_033086785.1|  membrane protein                                 72.4    6e-12   
ref|WP_037408195.1|  membrane protein                                 72.4    6e-12   



>ref|XP_007152038.1| hypothetical protein PHAVU_004G096500g [Phaseolus vulgaris]
 gb|ESW24032.1| hypothetical protein PHAVU_004G096500g [Phaseolus vulgaris]
Length=224

 Score =   193 bits (490),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 125/172 (73%), Positives = 144/172 (84%), Gaps = 1/172 (1%)
 Frame = +2

Query  2    GANDGLVSIASLMMGVGTVKQDIKAMILTGFAGMVAGACSMAIGEFVSVYSQRDIEVAQM  181
            GANDGLVS ASLMMGVG VKQD+KAMIL+GFAG+VAGACSMAIGEFVSVYSQ DIEVAQM
Sbjct  50   GANDGLVSTASLMMGVGAVKQDVKAMILSGFAGLVAGACSMAIGEFVSVYSQLDIEVAQM  109

Query  182  KRKKNRRNGedageeeeeesdvdeLPNPMQAAAASVVAFTMGAMVPLLAASFIKPYKVRI  361
            KR+K R +G    E E    + + LPNP+QAA AS +AF++GAMVPLLAA+FI+ YKVRI
Sbjct  110  KREKERMHG-SGREGEGINEEKEGLPNPLQAAVASALAFSVGAMVPLLAAAFIREYKVRI  168

Query  362  GaviaavtvalvvcgwlgaalggapkgkaSVRVLIGGWLAMAITSGLTKLIG  517
            GAV+AAVT ALVV GWLGA LG AP  ++S R+L GGW+AM+IT GLTKLIG
Sbjct  169  GAVLAAVTFALVVFGWLGAVLGKAPVLRSSARILFGGWMAMSITFGLTKLIG  220



>ref|XP_010246881.1| PREDICTED: vacuolar iron transporter homolog 4-like [Nelumbo 
nucifera]
Length=220

 Score =   188 bits (477),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 123/172 (72%), Positives = 138/172 (80%), Gaps = 4/172 (2%)
 Frame = +2

Query  2    GANDGLVSIASLMMGVGTVKQDIKAMILTGFAGMVAGACSMAIGEFVSVYSQRDIEVAQM  181
            GANDGL S ASLMMGVG VKQD KAMI TGFAG+VAGACSMAIGEFVSVYSQ DIEVAQM
Sbjct  49   GANDGLXSTASLMMGVGAVKQDAKAMIXTGFAGLVAGACSMAIGEFVSVYSQLDIEVAQM  108

Query  182  KRKKNRRNGedageeeeeesdvdeLPNPMQAAAASVVAFTMGAMVPLLAASFIKPYKVRI  361
            KR+   R+      E  EE+  ++LPNP QAAAAS + F +GAMVPLLAASFIK Y+VR+
Sbjct  109  KRENRSRDD----SESNEENKKEKLPNPFQAAAASTLTFAIGAMVPLLAASFIKEYRVRL  164

Query  362  GaviaavtvalvvcgwlgaalggapkgkaSVRVLIGGWLAMAITSGLTKLIG  517
            G V+A  ++AL+V G LGAA+G AP GKA  RVLIGGWLAMAIT GLTKLIG
Sbjct  165  GVVVAVSSLALLVFGGLGAAMGKAPVGKACFRVLIGGWLAMAITFGLTKLIG  216



>ref|XP_002302185.1| hypothetical protein POPTR_0002s07000g [Populus trichocarpa]
 gb|EEE81458.1| hypothetical protein POPTR_0002s07000g [Populus trichocarpa]
Length=222

 Score =   187 bits (474),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 128/172 (74%), Positives = 149/172 (87%), Gaps = 1/172 (1%)
 Frame = +2

Query  2    GANDGLVSIASLMMGVGTVKQDIKAMILTGFAGMVAGACSMAIGEFVSVYSQRDIEVAQM  181
            GANDGLVS ASLMMGVG VKQDIK MILTGFAG+VAGACSMAIGEFVSV+SQ DIE+AQM
Sbjct  48   GANDGLVSTASLMMGVGAVKQDIKVMILTGFAGLVAGACSMAIGEFVSVHSQLDIELAQM  107

Query  182  KRKKNRRNGedageeeeeesdvdeLPNPMQAAAASVVAFTMGAMVPLLAASFIKPYKVRI  361
            KR+K RRN     EE+EE  + + LPNP+QAAAAS +AF++GA+VPLLAASFI+ YKVR+
Sbjct  108  KREKERRN-NGGKEEQEEGENKESLPNPLQAAAASALAFSVGALVPLLAASFIRGYKVRL  166

Query  362  GaviaavtvalvvcgwlgaalggapkgkaSVRVLIGGWLAMAITSGLTKLIG  517
            G V+AAVT+AL++ GWLGA LG AP  K+S+RVL+GGWLAMAIT GLTKLIG
Sbjct  167  GVVVAAVTLALLIFGWLGAVLGKAPTVKSSLRVLVGGWLAMAITFGLTKLIG  218



>ref|XP_007143527.1| hypothetical protein PHAVU_007G079100g [Phaseolus vulgaris]
 gb|ESW15521.1| hypothetical protein PHAVU_007G079100g [Phaseolus vulgaris]
Length=223

 Score =   186 bits (473),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 127/172 (74%), Positives = 144/172 (84%), Gaps = 0/172 (0%)
 Frame = +2

Query  2    GANDGLVSIASLMMGVGTVKQDIKAMILTGFAGMVAGACSMAIGEFVSVYSQRDIEVAQM  181
            GANDGLVS ASLMMGVG VKQDIK MILTGFAG+VAGACSMAIGEFVSVYSQ DIEVAQM
Sbjct  48   GANDGLVSTASLMMGVGAVKQDIKVMILTGFAGLVAGACSMAIGEFVSVYSQLDIEVAQM  107

Query  182  KRKKNRRNGedageeeeeesdvdeLPNPMQAAAASVVAFTMGAMVPLLAASFIKPYKVRI  361
            KR   R NG    EEEE+E + + LPNP+ AAAAS +AF++GA+VPLLAASFI+ YKVR+
Sbjct  108  KRDNGRNNGRHRDEEEEDEKEKESLPNPIHAAAASALAFSVGALVPLLAASFIREYKVRL  167

Query  362  GaviaavtvalvvcgwlgaalggapkgkaSVRVLIGGWLAMAITSGLTKLIG  517
            G V+ AV+ ALVV GWLGA LG AP  ++ VRVL+GGW+AMAIT GLTKLIG
Sbjct  168  GVVLGAVSFALVVFGWLGAVLGKAPTLRSCVRVLVGGWVAMAITFGLTKLIG  219



>ref|XP_011042839.1| PREDICTED: vacuolar iron transporter homolog 1-like [Populus 
euphratica]
Length=221

 Score =   185 bits (470),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 127/172 (74%), Positives = 149/172 (87%), Gaps = 2/172 (1%)
 Frame = +2

Query  2    GANDGLVSIASLMMGVGTVKQDIKAMILTGFAGMVAGACSMAIGEFVSVYSQRDIEVAQM  181
            GANDGLVS ASLMMGVG VKQDIK MILTGFAG+VAGACSMAIGEFVSV+SQ DIE+AQM
Sbjct  48   GANDGLVSTASLMMGVGAVKQDIKVMILTGFAGLVAGACSMAIGEFVSVHSQLDIELAQM  107

Query  182  KRKKNRRNGedageeeeeesdvdeLPNPMQAAAASVVAFTMGAMVPLLAASFIKPYKVRI  361
            KR+  RRN    G+EE+EE   + LPNP+QAAAAS +AF++GA+VPLLAASFI+ YKVR+
Sbjct  108  KRENERRNN--GGKEEQEEGAKESLPNPLQAAAASALAFSVGALVPLLAASFIRGYKVRL  165

Query  362  GaviaavtvalvvcgwlgaalggapkgkaSVRVLIGGWLAMAITSGLTKLIG  517
            G V+AAVT+AL++ GWLGA LG AP  ++S+RVL+GGWLAMAIT GLTKLIG
Sbjct  166  GVVVAAVTLALMIFGWLGAVLGKAPAVRSSLRVLVGGWLAMAITFGLTKLIG  217



>emb|CDP11375.1| unnamed protein product [Coffea canephora]
Length=223

 Score =   185 bits (469),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 124/172 (72%), Positives = 142/172 (83%), Gaps = 0/172 (0%)
 Frame = +2

Query  2    GANDGLVSIASLMMGVGTVKQDIKAMILTGFAGMVAGACSMAIGEFVSVYSQRDIEVAQM  181
            GANDGLVS ASLMMGVG VK DIK MILTGFAG+VAGACSMAIGEFVSVYSQ DIEVAQM
Sbjct  48   GANDGLVSTASLMMGVGAVKPDIKTMILTGFAGLVAGACSMAIGEFVSVYSQLDIEVAQM  107

Query  182  KRKKNRRNGedageeeeeesdvdeLPNPMQAAAASVVAFTMGAMVPLLAASFIKPYKVRI  361
            +R   +       E EEEE D + LPNP+QAA AS +AF++GA+VPLLAASFI+ YK+R+
Sbjct  108  ERDNRKAITMQRQEAEEEEGDKESLPNPLQAAVASALAFSVGALVPLLAASFIREYKLRL  167

Query  362  GaviaavtvalvvcgwlgaalggapkgkaSVRVLIGGWLAMAITSGLTKLIG  517
            GA++AAVT ALV+ GWLGA LG AP+ ++S RVL GGWLAMAIT GLTKLIG
Sbjct  168  GAIVAAVTAALVLFGWLGAVLGKAPRIRSSARVLFGGWLAMAITFGLTKLIG  219



>gb|AFK49166.1| unknown [Lotus japonicus]
Length=225

 Score =   184 bits (468),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 122/173 (71%), Positives = 143/173 (83%), Gaps = 1/173 (1%)
 Frame = +2

Query  2    GANDGLVSIASLMMGVGTVKQDIKAMILTGFAGMVAGACSMAIGEFVSVYSQRDIEVAQM  181
            GANDGLVS A+LMMGVG VKQD+K MIL+GFAG+VAGACSMAIGEFVSVYSQ DIEVAQ+
Sbjct  49   GANDGLVSTAALMMGVGAVKQDLKVMILSGFAGLVAGACSMAIGEFVSVYSQLDIEVAQL  108

Query  182  KRKKNR-RNGedageeeeeesdvdeLPNPMQAAAASVVAFTMGAMVPLLAASFIKPYKVR  358
            KR K R  NG +  +E++ E + + LPNP+QAAAAS +AF++GAMVPLLAASFIK YKVR
Sbjct  109  KRGKKRVSNGREEDQEDDSEEEKETLPNPLQAAAASALAFSVGAMVPLLAASFIKDYKVR  168

Query  359  IGaviaavtvalvvcgwlgaalggapkgkaSVRVLIGGWLAMAITSGLTKLIG  517
            +G V  AV+ ALV  G +GA LG AP  ++ VRVL+GGWLAMAIT GLTKLIG
Sbjct  169  LGVVFVAVSFALVAFGCMGAFLGKAPALRSCVRVLVGGWLAMAITFGLTKLIG  221



>ref|XP_006606162.1| PREDICTED: vacuolar iron transporter homolog 1-like [Glycine 
max]
 gb|KHN46424.1| Vacuolar iron transporter-like protein 4 [Glycine soja]
Length=219

 Score =   184 bits (467),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 124/172 (72%), Positives = 146/172 (85%), Gaps = 4/172 (2%)
 Frame = +2

Query  2    GANDGLVSIASLMMGVGTVKQDIKAMILTGFAGMVAGACSMAIGEFVSVYSQRDIEVAQM  181
            GANDGLVS ASLMMGVG VKQDIK MILTGFAG+VAGACSMAIGEFVSVYSQ DIEVAQM
Sbjct  48   GANDGLVSTASLMMGVGAVKQDIKVMILTGFAGLVAGACSMAIGEFVSVYSQLDIEVAQM  107

Query  182  KRKKNRRNGedageeeeeesdvdeLPNPMQAAAASVVAFTMGAMVPLLAASFIKPYKVRI  361
            KR+K R N     ++EE+  + ++LPNP+ AAAAS +AF++GA+VPLLAASFI+ YKVR+
Sbjct  108  KREKERDN----IDQEEDGYEKEKLPNPIHAAAASALAFSVGALVPLLAASFIRDYKVRL  163

Query  362  GaviaavtvalvvcgwlgaalggapkgkaSVRVLIGGWLAMAITSGLTKLIG  517
            G ++ AV++ALVV GWLGA LG AP  ++ VRVL+GGWLAMAIT GLTKLIG
Sbjct  164  GVILGAVSLALVVFGWLGAVLGKAPTFRSCVRVLLGGWLAMAITFGLTKLIG  215



>gb|KHN17004.1| Vacuolar iron transporter like 4 [Glycine soja]
Length=222

 Score =   184 bits (466),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 126/172 (73%), Positives = 147/172 (85%), Gaps = 1/172 (1%)
 Frame = +2

Query  2    GANDGLVSIASLMMGVGTVKQDIKAMILTGFAGMVAGACSMAIGEFVSVYSQRDIEVAQM  181
            GANDGLVS ASLMMGVG VKQDIK MILTGFAG+VAGACSMAIGEFVSVYSQ DIEVAQM
Sbjct  48   GANDGLVSTASLMMGVGAVKQDIKVMILTGFAGLVAGACSMAIGEFVSVYSQLDIEVAQM  107

Query  182  KRKKNRRNGedageeeeeesdvdeLPNPMQAAAASVVAFTMGAMVPLLAASFIKPYKVRI  361
            KR+K  R+  D  +E+++  + ++LPNPM AAAAS +AF++GAMVPLLAASFI+ YKVR+
Sbjct  108  KREK-ERDSIDQDQEDDDGDEKEKLPNPMHAAAASALAFSVGAMVPLLAASFIRDYKVRL  166

Query  362  GaviaavtvalvvcgwlgaalggapkgkaSVRVLIGGWLAMAITSGLTKLIG  517
            G V+ AV++ALVV GWLGA LG AP  ++ VRVL+GGWLAMAIT GLTKLIG
Sbjct  167  GVVLGAVSLALVVFGWLGAVLGKAPTFRSIVRVLLGGWLAMAITFGLTKLIG  218



>ref|XP_009765332.1| PREDICTED: vacuolar iron transporter homolog 1-like [Nicotiana 
sylvestris]
Length=223

 Score =   182 bits (463),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 131/172 (76%), Positives = 148/172 (86%), Gaps = 3/172 (2%)
 Frame = +2

Query  2    GANDGLVSIASLMMGVGTVKQDIKAMILTGFAGMVAGACSMAIGEFVSVYSQRDIEVAQM  181
            GANDGLVS ASLMMGVG VK+DIK MILTGFAG+VAGACSMAIGEFVSVYSQ DIEVAQM
Sbjct  51   GANDGLVSTASLMMGVGAVKKDIKVMILTGFAGLVAGACSMAIGEFVSVYSQLDIEVAQM  110

Query  182  KRKKNRRNGedageeeeeesdvdeLPNPMQAAAASVVAFTMGAMVPLLAASFIKPYKVRI  361
            KR+K RRN     E+E+++   + LPNP QAAAAS +AF++GAMVPLLAASFI+ YKVRI
Sbjct  111  KREK-RRNA--NREKEDDDDAKESLPNPAQAAAASALAFSVGAMVPLLAASFIRDYKVRI  167

Query  362  GaviaavtvalvvcgwlgaalggapkgkaSVRVLIGGWLAMAITSGLTKLIG  517
            G V+AAVT+AL+V GWLGAALG AP  K+S RVL+GGWLAMAIT GLTKLIG
Sbjct  168  GVVVAAVTLALMVFGWLGAALGKAPVVKSSARVLLGGWLAMAITFGLTKLIG  219



>ref|XP_007019467.1| Vacuolar iron transporter family protein [Theobroma cacao]
 gb|EOY16692.1| Vacuolar iron transporter family protein [Theobroma cacao]
Length=227

 Score =   182 bits (463),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 128/173 (74%), Positives = 148/173 (86%), Gaps = 1/173 (1%)
 Frame = +2

Query  2    GANDGLVSIASLMMGVGTVKQDIKAMILTGFAGMVAGACSMAIGEFVSVYSQRDIEVAQM  181
            GANDGLVS ASLMMGVG VKQDIKAMILTGFAG+VAGACSMAIGEFVSVYSQ DIE+AQM
Sbjct  51   GANDGLVSTASLMMGVGAVKQDIKAMILTGFAGLVAGACSMAIGEFVSVYSQLDIELAQM  110

Query  182  KRKKNR-RNGedageeeeeesdvdeLPNPMQAAAASVVAFTMGAMVPLLAASFIKPYKVR  358
            KR+K R  N E   EE+ +E + + LPNP+QAAAAS ++F++GAMVPLL ASFI+ YKVR
Sbjct  111  KREKQRGENRETEAEEDGKEGEKESLPNPLQAAAASALSFSVGAMVPLLGASFIREYKVR  170

Query  359  IGaviaavtvalvvcgwlgaalggapkgkaSVRVLIGGWLAMAITSGLTKLIG  517
            +G VI AVT+AL+V GWLGA LG AP  +++VRVL+GGWLAMAIT GLTKLIG
Sbjct  171  LGVVIGAVTLALLVFGWLGAVLGKAPTVRSAVRVLVGGWLAMAITFGLTKLIG  223



>ref|XP_002268564.1| PREDICTED: vacuolar iron transporter homolog 4-like [Vitis vinifera]
Length=224

 Score =   182 bits (462),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 113/172 (66%), Positives = 140/172 (81%), Gaps = 4/172 (2%)
 Frame = +2

Query  2    GANDGLVSIASLMMGVGTVKQDIKAMILTGFAGMVAGACSMAIGEFVSVYSQRDIEVAQM  181
            GANDGLVSIASLMMGVG VK+DI AMIL GFAG+VAGACSMAIGEFVSVY+Q DIE+AQM
Sbjct  53   GANDGLVSIASLMMGVGAVKEDITAMILAGFAGLVAGACSMAIGEFVSVYTQLDIELAQM  112

Query  182  KRKKNRRNGedageeeeeesdvdeLPNPMQAAAASVVAFTMGAMVPLLAASFIKPYKVRI  361
            KR K RR+      E EE+++ ++LPNP QA  AS ++F +GAM+PLLAA+FI+ +KVR+
Sbjct  113  KRDKRRRD----STENEEKTENEKLPNPFQAGIASALSFALGAMIPLLAAAFIREHKVRL  168

Query  362  GaviaavtvalvvcgwlgaalggapkgkaSVRVLIGGWLAMAITSGLTKLIG  517
            G V+AA ++AL+  G LGA LG  P G++  RVL+GGW+AMAIT GLT+LIG
Sbjct  169  GVVVAASSLALLAFGGLGAVLGRTPVGRSCARVLVGGWMAMAITFGLTRLIG  220



>ref|XP_009343623.1| PREDICTED: vacuolar iron transporter homolog 4-like [Pyrus x 
bretschneideri]
Length=228

 Score =   182 bits (462),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 124/176 (70%), Positives = 145/176 (82%), Gaps = 4/176 (2%)
 Frame = +2

Query  2    GANDGLVSIASLMMGVGTVKQDIKAMILTGFAGMVAGACSMAIGEFVSVYSQRDIEVAQM  181
            GANDGL+S ASLMMGVG V+QDIKAMILTGFAG+VAGACSMAIGEFVSVYSQ DIEVAQM
Sbjct  49   GANDGLISTASLMMGVGAVRQDIKAMILTGFAGLVAGACSMAIGEFVSVYSQLDIEVAQM  108

Query  182  KR----KKNRRNGedageeeeeesdvdeLPNPMQAAAASVVAFTMGAMVPLLAASFIKPY  349
            KR    KKN +    A ++  +  D + LPNP+QAAAAS +AF++GAMVPLLAASFI+ Y
Sbjct  109  KRDNQNKKNNQEVHVAEDDGGDGDDKESLPNPLQAAAASALAFSVGAMVPLLAASFIRGY  168

Query  350  KVRIGaviaavtvalvvcgwlgaalggapkgkaSVRVLIGGWLAMAITSGLTKLIG  517
            KVR+G V AAV++ALVV G LGA LG AP  ++ +RVL+GGW+AMAIT GLTKLIG
Sbjct  169  KVRLGVVAAAVSLALVVFGLLGAKLGKAPVMRSVMRVLVGGWMAMAITFGLTKLIG  224



>emb|CAN65436.1| hypothetical protein VITISV_032099 [Vitis vinifera]
Length=224

 Score =   182 bits (461),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 113/172 (66%), Positives = 140/172 (81%), Gaps = 4/172 (2%)
 Frame = +2

Query  2    GANDGLVSIASLMMGVGTVKQDIKAMILTGFAGMVAGACSMAIGEFVSVYSQRDIEVAQM  181
            GANDGLVSIASLMMGVG VK+DI AMIL GFAG+VAGACSMAIGEFVSVY+Q DIE+AQM
Sbjct  53   GANDGLVSIASLMMGVGAVKEDITAMILAGFAGLVAGACSMAIGEFVSVYTQLDIELAQM  112

Query  182  KRKKNRRNGedageeeeeesdvdeLPNPMQAAAASVVAFTMGAMVPLLAASFIKPYKVRI  361
            KR K RR+      E EE+++ ++LPNP QA  AS ++F +GAM+PLLAA+FI+ +KVR+
Sbjct  113  KRDKRRRD----STENEEKTENEKLPNPFQAGIASALSFALGAMIPLLAAAFIREHKVRL  168

Query  362  GaviaavtvalvvcgwlgaalggapkgkaSVRVLIGGWLAMAITSGLTKLIG  517
            G V+AA ++AL+  G LGA LG  P G++  RVL+GGW+AMAIT GLT+LIG
Sbjct  169  GVVVAASSLALLAFGGLGAVLGRTPVGRSCARVLVGGWMAMAITFGLTRLIG  220



>ref|XP_008381810.1| PREDICTED: vacuolar iron transporter homolog 4-like [Malus domestica]
 ref|XP_008358287.1| PREDICTED: LOW QUALITY PROTEIN: vacuolar iron transporter homolog 
4-like [Malus domestica]
Length=228

 Score =   182 bits (461),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 125/176 (71%), Positives = 147/176 (84%), Gaps = 4/176 (2%)
 Frame = +2

Query  2    GANDGLVSIASLMMGVGTVKQDIKAMILTGFAGMVAGACSMAIGEFVSVYSQRDIEVAQM  181
            GANDGL+S ASLMMGVG V+QDIKAMILTGFAG+VAGACSMAIGEFVSVYSQ DIEVAQM
Sbjct  49   GANDGLISTASLMMGVGAVRQDIKAMILTGFAGLVAGACSMAIGEFVSVYSQLDIEVAQM  108

Query  182  KR----KKNRRNGedageeeeeesdvdeLPNPMQAAAASVVAFTMGAMVPLLAASFIKPY  349
            KR    KKN +    A ++  +E D + LPNP+QAAAAS +AF++GAMVPLLAASFI+ Y
Sbjct  109  KRDNQNKKNNQEVHVAEDDGGDEDDKESLPNPLQAAAASALAFSVGAMVPLLAASFIRGY  168

Query  350  KVRIGaviaavtvalvvcgwlgaalggapkgkaSVRVLIGGWLAMAITSGLTKLIG  517
            KVR+G V AAV++ALV+ GWLGA LG AP  ++ +RVL+GGW+AMAIT GLTKLIG
Sbjct  169  KVRLGVVAAAVSLALVLFGWLGAKLGKAPVMRSVMRVLVGGWMAMAITFGLTKLIG  224



>ref|XP_004516646.1| PREDICTED: vacuolar iron transporter homolog 3-like [Cicer arietinum]
Length=223

 Score =   181 bits (460),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 123/172 (72%), Positives = 139/172 (81%), Gaps = 3/172 (2%)
 Frame = +2

Query  2    GANDGLVSIASLMMGVGTVKQDIKAMILTGFAGMVAGACSMAIGEFVSVYSQRDIEVAQM  181
            GANDGLVS ASLMMGVG VK DIKAMILTGFAG+VAGACSMAIGEFVSVYSQ DIEVAQM
Sbjct  51   GANDGLVSTASLMMGVGAVKHDIKAMILTGFAGLVAGACSMAIGEFVSVYSQLDIEVAQM  110

Query  182  KRKKNRRNGedageeeeeesdvdeLPNPMQAAAASVVAFTMGAMVPLLAASFIKPYKVRI  361
            KR+K R  G     E       + LPNP+QAAAAS +AF++GAMVPLLAA FI  YKVRI
Sbjct  111  KREKERCRG---IIEHVIVDKNENLPNPLQAAAASALAFSVGAMVPLLAAFFISDYKVRI  167

Query  362  GaviaavtvalvvcgwlgaalggapkgkaSVRVLIGGWLAMAITSGLTKLIG  517
            G V+ AV+ AL+V GWLGA LG AP  ++S+RVL+GGW+AM+IT GLTKLIG
Sbjct  168  GVVVVAVSFALLVFGWLGAVLGKAPIFRSSLRVLVGGWVAMSITFGLTKLIG  219



>ref|XP_004290529.1| PREDICTED: vacuolar iron transporter homolog 4-like [Fragaria 
vesca subsp. vesca]
Length=227

 Score =   182 bits (461),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 126/172 (73%), Positives = 145/172 (84%), Gaps = 0/172 (0%)
 Frame = +2

Query  2    GANDGLVSIASLMMGVGTVKQDIKAMILTGFAGMVAGACSMAIGEFVSVYSQRDIEVAQM  181
            GANDGL+S ASLMMGVG VKQDIKAMILTGFAG+VAGACSMAIGEFVSVYSQ DIEVAQM
Sbjct  52   GANDGLISTASLMMGVGAVKQDIKAMILTGFAGLVAGACSMAIGEFVSVYSQLDIEVAQM  111

Query  182  KRKKNRRNGedageeeeeesdvdeLPNPMQAAAASVVAFTMGAMVPLLAASFIKPYKVRI  361
            KR    +        +EEE + + LPNP+QAAAAS +AF++GAMVPLLAASFI+ Y+ R+
Sbjct  112  KRDNMNKQNSPVAGGDEEEEEKENLPNPLQAAAASALAFSVGAMVPLLAASFIREYRARL  171

Query  362  GaviaavtvalvvcgwlgaalggapkgkaSVRVLIGGWLAMAITSGLTKLIG  517
            GAV AAVT+AL+V GWLGAALG AP  +++VRVL+GGWLAMAIT GLTKLIG
Sbjct  172  GAVAAAVTLALLVFGWLGAALGKAPVIRSTVRVLVGGWLAMAITFGLTKLIG  223



>ref|NP_189952.1| putative nodulin-like21 protein [Arabidopsis thaliana]
 sp|Q9M2C0.1|VITH4_ARATH RecName: Full=Vacuolar iron transporter homolog 4; AltName: Full=Protein 
NODULIN-LIKE 4 [Arabidopsis thaliana]
 emb|CAB83067.1| nodulin-like protein [Arabidopsis thaliana]
 gb|AAQ65133.1| At3g43660 [Arabidopsis thaliana]
 dbj|BAD43842.1| nodulin - like protein [Arabidopsis thaliana]
 gb|AEE77816.1| putative nodulin-like21 protein [Arabidopsis thaliana]
Length=198

 Score =   181 bits (458),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 115/172 (67%), Positives = 136/172 (79%), Gaps = 12/172 (7%)
 Frame = +2

Query  2    GANDGLVSIASLMMGVGTVKQDIKAMILTGFAGMVAGACSMAIGEFVSVYSQRDIEVAQM  181
            GANDGLVS ASLMMG+G VKQD++ M+LTGFAG+VAGACSMAIGEF+SVYSQ DIEVAQM
Sbjct  35   GANDGLVSTASLMMGIGAVKQDVRIMLLTGFAGLVAGACSMAIGEFISVYSQYDIEVAQM  94

Query  182  KRKKNRRNGedageeeeeesdvdeLPNPMQAAAASVVAFTMGAMVPLLAASFIKPYKVRI  361
            KR+                   ++LP+P QAA AS +AFT+GA+VPLLAA+F+K YKVRI
Sbjct  95   KRESGGET------------KKEKLPSPTQAAIASALAFTLGAIVPLLAAAFVKEYKVRI  142

Query  362  GaviaavtvalvvcgwlgaalggapkgkaSVRVLIGGWLAMAITSGLTKLIG  517
            G ++AAVT+ALV+ GWLGA LG AP  K+ VRVLIGGWLAMAIT G TKL+G
Sbjct  143  GVIVAAVTLALVMFGWLGAVLGKAPVVKSLVRVLIGGWLAMAITFGFTKLVG  194



>gb|ACU21390.1| unknown [Glycine max]
Length=233

 Score =   182 bits (461),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 122/172 (71%), Positives = 142/172 (83%), Gaps = 0/172 (0%)
 Frame = +2

Query  2    GANDGLVSIASLMMGVGTVKQDIKAMILTGFAGMVAGACSMAIGEFVSVYSQRDIEVAQM  181
            GANDGLVS AS+MMGVG VK DIKAMIL+GFAG+VAGACSMAIGEFVSVYSQ DIEVAQ 
Sbjct  58   GANDGLVSTASIMMGVGAVKHDIKAMILSGFAGLVAGACSMAIGEFVSVYSQLDIEVAQR  117

Query  182  KRKKNRRNGedageeeeeesdvdeLPNPMQAAAASVVAFTMGAMVPLLAASFIKPYKVRI  361
            KR+K R        EE+   + + LPNP+QAAAAS +AF++GAMVPLLAASFI+ YKVR+
Sbjct  118  KREKERGQRRVRDPEEDTNEEKESLPNPLQAAAASALAFSVGAMVPLLAASFIREYKVRL  177

Query  362  GaviaavtvalvvcgwlgaalggapkgkaSVRVLIGGWLAMAITSGLTKLIG  517
            G ++AAVT ALVV GWLGA LG AP  ++++RVL GGW+AMAIT GLTKLIG
Sbjct  178  GVIVAAVTFALVVFGWLGAVLGEAPVLRSALRVLFGGWMAMAITFGLTKLIG  229



>gb|KHN41264.1| Vacuolar iron transporter like 4 [Glycine soja]
Length=233

 Score =   181 bits (460),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 122/172 (71%), Positives = 142/172 (83%), Gaps = 0/172 (0%)
 Frame = +2

Query  2    GANDGLVSIASLMMGVGTVKQDIKAMILTGFAGMVAGACSMAIGEFVSVYSQRDIEVAQM  181
            GANDGLVS AS+MMGVG VK DIKAMIL+GFAG+VAGACSMAIGEFVSVYSQ DIEVAQ 
Sbjct  58   GANDGLVSTASIMMGVGAVKHDIKAMILSGFAGLVAGACSMAIGEFVSVYSQLDIEVAQR  117

Query  182  KRKKNRRNGedageeeeeesdvdeLPNPMQAAAASVVAFTMGAMVPLLAASFIKPYKVRI  361
            KR+K R        EE+   + + LPNP+QAAAAS +AF++GAMVPLLAASFI+ YKVR+
Sbjct  118  KREKERGQRRVRDPEEDTNEEKESLPNPLQAAAASALAFSVGAMVPLLAASFIREYKVRL  177

Query  362  GaviaavtvalvvcgwlgaalggapkgkaSVRVLIGGWLAMAITSGLTKLIG  517
            G ++AAVT ALVV GWLGA LG AP  ++++RVL GGW+AMAIT GLTKLIG
Sbjct  178  GVIVAAVTFALVVFGWLGAVLGKAPVLRSALRVLFGGWMAMAITFGLTKLIG  229



>ref|XP_003548120.1| PREDICTED: vacuolar iron transporter homolog 2-like [Glycine 
max]
Length=233

 Score =   181 bits (460),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 122/172 (71%), Positives = 142/172 (83%), Gaps = 0/172 (0%)
 Frame = +2

Query  2    GANDGLVSIASLMMGVGTVKQDIKAMILTGFAGMVAGACSMAIGEFVSVYSQRDIEVAQM  181
            GANDGLVS AS+MMGVG VK DIKAMIL+GFAG+VAGACSMAIGEFVSVYSQ DIEVAQ 
Sbjct  58   GANDGLVSTASIMMGVGAVKHDIKAMILSGFAGLVAGACSMAIGEFVSVYSQLDIEVAQR  117

Query  182  KRKKNRRNGedageeeeeesdvdeLPNPMQAAAASVVAFTMGAMVPLLAASFIKPYKVRI  361
            KR+K R        EE+   + + LPNP+QAAAAS +AF++GAMVPLLAASFI+ YKVR+
Sbjct  118  KREKERGQRRVRDPEEDTNEEKESLPNPLQAAAASALAFSVGAMVPLLAASFIREYKVRL  177

Query  362  GaviaavtvalvvcgwlgaalggapkgkaSVRVLIGGWLAMAITSGLTKLIG  517
            G ++AAVT ALVV GWLGA LG AP  ++++RVL GGW+AMAIT GLTKLIG
Sbjct  178  GVIVAAVTFALVVFGWLGAVLGKAPVLRSALRVLFGGWMAMAITFGLTKLIG  229



>ref|XP_011044200.1| PREDICTED: vacuolar iron transporter homolog 4-like [Populus 
euphratica]
Length=218

 Score =   181 bits (458),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 126/172 (73%), Positives = 147/172 (85%), Gaps = 5/172 (3%)
 Frame = +2

Query  2    GANDGLVSIASLMMGVGTVKQDIKAMILTGFAGMVAGACSMAIGEFVSVYSQRDIEVAQM  181
            GANDGLVS ASLMMGVG VKQDIKAMILTGFAG+VAGACSMAIGEFVSV+SQ DIE+AQM
Sbjct  48   GANDGLVSTASLMMGVGAVKQDIKAMILTGFAGLVAGACSMAIGEFVSVHSQLDIELAQM  107

Query  182  KRKKNRRNGedageeeeeesdvdeLPNPMQAAAASVVAFTMGAMVPLLAASFIKPYKVRI  361
             R + R++      EE+EE + + LPNP+ AAAAS +AF++GA+VPLLAASFI+ YKVRI
Sbjct  108  TRDRQRKD-----TEEKEEGENESLPNPLLAAAASALAFSVGALVPLLAASFIREYKVRI  162

Query  362  GaviaavtvalvvcgwlgaalggapkgkaSVRVLIGGWLAMAITSGLTKLIG  517
            G V+AAVT+AL++ GWLGA LG AP  K+S+RVLIGGWLAMAIT GLTKLIG
Sbjct  163  GVVVAAVTLALMIFGWLGAVLGKAPAVKSSLRVLIGGWLAMAITFGLTKLIG  214



>ref|XP_004237778.1| PREDICTED: vacuolar iron transporter homolog 1-like [Solanum 
lycopersicum]
Length=227

 Score =   181 bits (458),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 126/172 (73%), Positives = 144/172 (84%), Gaps = 4/172 (2%)
 Frame = +2

Query  2    GANDGLVSIASLMMGVGTVKQDIKAMILTGFAGMVAGACSMAIGEFVSVYSQRDIEVAQM  181
            GANDGLVS ASLMMG+G VK+DIK MILTGFAG+VAGACSMAIGEFVSVYSQ DIE+AQM
Sbjct  56   GANDGLVSTASLMMGIGAVKKDIKVMILTGFAGLVAGACSMAIGEFVSVYSQLDIEIAQM  115

Query  182  KRKKNRRNGedageeeeeesdvdeLPNPMQAAAASVVAFTMGAMVPLLAASFIKPYKVRI  361
            KR   RRN      + + E + ++LPNP QAAAAS +AF++GA+VPLLAASFI+ YKVRI
Sbjct  116  KRDNKRRN----KIQGDHEDEKNDLPNPAQAAAASALAFSVGAIVPLLAASFIRDYKVRI  171

Query  362  GaviaavtvalvvcgwlgaalggapkgkaSVRVLIGGWLAMAITSGLTKLIG  517
            GAV+AAVT+AL+V GWLGA LG AP  K+S RVL GGWLAMAIT GLTKLIG
Sbjct  172  GAVVAAVTIALMVFGWLGAVLGKAPAIKSSARVLFGGWLAMAITYGLTKLIG  223



>emb|CBI20044.3| unnamed protein product [Vitis vinifera]
Length=269

 Score =   182 bits (462),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 113/172 (66%), Positives = 140/172 (81%), Gaps = 4/172 (2%)
 Frame = +2

Query  2    GANDGLVSIASLMMGVGTVKQDIKAMILTGFAGMVAGACSMAIGEFVSVYSQRDIEVAQM  181
            GANDGLVSIASLMMGVG VK+DI AMIL GFAG+VAGACSMAIGEFVSVY+Q DIE+AQM
Sbjct  98   GANDGLVSIASLMMGVGAVKEDITAMILAGFAGLVAGACSMAIGEFVSVYTQLDIELAQM  157

Query  182  KRKKNRRNGedageeeeeesdvdeLPNPMQAAAASVVAFTMGAMVPLLAASFIKPYKVRI  361
            KR K RR+      E EE+++ ++LPNP QA  AS ++F +GAM+PLLAA+FI+ +KVR+
Sbjct  158  KRDKRRRD----STENEEKTENEKLPNPFQAGIASALSFALGAMIPLLAAAFIREHKVRL  213

Query  362  GaviaavtvalvvcgwlgaalggapkgkaSVRVLIGGWLAMAITSGLTKLIG  517
            G V+AA ++AL+  G LGA LG  P G++  RVL+GGW+AMAIT GLT+LIG
Sbjct  214  GVVVAASSLALLAFGGLGAVLGRTPVGRSCARVLVGGWMAMAITFGLTRLIG  265



>ref|XP_006362825.1| PREDICTED: vacuolar iron transporter homolog 1-like [Solanum 
tuberosum]
Length=227

 Score =   180 bits (457),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 127/172 (74%), Positives = 143/172 (83%), Gaps = 4/172 (2%)
 Frame = +2

Query  2    GANDGLVSIASLMMGVGTVKQDIKAMILTGFAGMVAGACSMAIGEFVSVYSQRDIEVAQM  181
            GANDGLVS ASLMMG+G VK+DIK MILTGFAG+VAGACSMAIGEFVSVYSQ DIEVAQM
Sbjct  56   GANDGLVSTASLMMGIGAVKKDIKVMILTGFAGLVAGACSMAIGEFVSVYSQLDIEVAQM  115

Query  182  KRKKNRRNGedageeeeeesdvdeLPNPMQAAAASVVAFTMGAMVPLLAASFIKPYKVRI  361
            KR   RRN      E  +E + + LPNP QAAAAS +AF++GA+VPLLAASFI+ YK+RI
Sbjct  116  KRDNKRRN----KIEGADEDEKNVLPNPAQAAAASALAFSVGAIVPLLAASFIRDYKLRI  171

Query  362  GaviaavtvalvvcgwlgaalggapkgkaSVRVLIGGWLAMAITSGLTKLIG  517
            GAV+AAVT+AL+V GWLGA LG AP  K+S RVL GGWLAMAIT GLTKLIG
Sbjct  172  GAVVAAVTIALMVFGWLGAVLGKAPAIKSSARVLFGGWLAMAITYGLTKLIG  223



>gb|KHN15432.1| Vacuolar iron transporter like 4 [Glycine soja]
Length=239

 Score =   180 bits (457),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 124/174 (71%), Positives = 143/174 (82%), Gaps = 2/174 (1%)
 Frame = +2

Query  2    GANDGLVSIASLMMGVGTVKQDIKAMILTGFAGMVAGACSMAIGEFVSVYSQRDIEVAQM  181
            GANDGLVS AS+MMGVG VK DIKAMIL+GFAG+VAGACSMAIGEFVSVYSQ DIEVAQ 
Sbjct  62   GANDGLVSTASIMMGVGAVKHDIKAMILSGFAGLVAGACSMAIGEFVSVYSQLDIEVAQR  121

Query  182  KRKKNR--RNGedageeeeeesdvdeLPNPMQAAAASVVAFTMGAMVPLLAASFIKPYKV  355
            KR+K R    G D  EE+    + D LPNP+QAAAAS +AF++GAMVPLLAASFI+ YKV
Sbjct  122  KREKERGQSRGRDIQEEDTNYEEKDSLPNPLQAAAASALAFSVGAMVPLLAASFIREYKV  181

Query  356  RIGaviaavtvalvvcgwlgaalggapkgkaSVRVLIGGWLAMAITSGLTKLIG  517
            R+G ++AAVT ALVV GWLGA  G AP  ++++RVL GGW+AMAIT GLTKLIG
Sbjct  182  RLGVIVAAVTFALVVFGWLGALWGKAPVLRSALRVLFGGWMAMAITFGLTKLIG  235



>ref|XP_011101499.1| PREDICTED: vacuolar iron transporter homolog 2-like [Sesamum 
indicum]
Length=221

 Score =   180 bits (456),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 130/174 (75%), Positives = 147/174 (84%), Gaps = 3/174 (2%)
 Frame = +2

Query  2    GANDGLVSIASLMMGVGTVKQDIKAMILTGFAGMVAGACSMAIGEFVSVYSQRDIEVAQM  181
            GANDGLVS ASLMMGVG VKQDIKAMILTGFAG+VAGACSMAIGEFVSVYSQ DIE+AQ+
Sbjct  49   GANDGLVSTASLMMGVGAVKQDIKAMILTGFAGLVAGACSMAIGEFVSVYSQLDIELAQI  108

Query  182  KRKKNRRNGedageeeeeesdvdeLPNPMQAAAASVVAFTMGAMVPLLAASFIKPYKVRI  361
            KR K R     AG  EE   D + LPNP+QAAAAS +AF++GAMVPLLAASFI+ Y+VRI
Sbjct  109  KRDKKR---AAAGVAEESAEDRESLPNPVQAAAASALAFSVGAMVPLLAASFIREYRVRI  165

Query  362  GaviaavtvalvvcgwlgaalggapkgkaSVRVLIGGWLAMAITSGLTKLIGIK  523
             AV+AAV+VALVV GWLGAALG AP  ++S RVL+GGWLAMA+T GLTKLIG +
Sbjct  166  AAVVAAVSVALVVFGWLGAALGRAPVVRSSARVLVGGWLAMAVTFGLTKLIGSR  219



>ref|XP_009618045.1| PREDICTED: vacuolar iron transporter homolog 1-like [Nicotiana 
tomentosiformis]
Length=317

 Score =   182 bits (463),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 132/172 (77%), Positives = 147/172 (85%), Gaps = 4/172 (2%)
 Frame = +2

Query  2    GANDGLVSIASLMMGVGTVKQDIKAMILTGFAGMVAGACSMAIGEFVSVYSQRDIEVAQM  181
            GANDGLVS ASLMMGVG VK+DIK MILTGFAG+VAGACSMAIGEFVSVYSQ DIEVAQM
Sbjct  146  GANDGLVSTASLMMGVGAVKKDIKVMILTGFAGLVAGACSMAIGEFVSVYSQLDIEVAQM  205

Query  182  KRKKNRRNGedageeeeeesdvdeLPNPMQAAAASVVAFTMGAMVPLLAASFIKPYKVRI  361
            KR+K RRN      E+E++   D LPNP QAAAAS +AF++GAMVPLLAASFI+ YKVRI
Sbjct  206  KREK-RRNA---NREKEDDDAKDSLPNPAQAAAASALAFSVGAMVPLLAASFIRDYKVRI  261

Query  362  GaviaavtvalvvcgwlgaalggapkgkaSVRVLIGGWLAMAITSGLTKLIG  517
            G V+AAVT+AL+V GWLGAALG AP  K+S RVL+GGWLAMAIT GLTKLIG
Sbjct  262  GVVVAAVTLALMVFGWLGAALGKAPVVKSSARVLLGGWLAMAITFGLTKLIG  313



>ref|XP_003592125.1| Nodulin-like protein [Medicago truncatula]
 gb|AES62376.1| vacuolar iron transporter-like protein [Medicago truncatula]
Length=217

 Score =   179 bits (455),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 120/172 (70%), Positives = 138/172 (80%), Gaps = 8/172 (5%)
 Frame = +2

Query  2    GANDGLVSIASLMMGVGTVKQDIKAMILTGFAGMVAGACSMAIGEFVSVYSQRDIEVAQM  181
            GANDGLVS ASLMMGVG VKQDIKAMIL+GFAG+VAGACSMAIGEFVSVYSQ DIE+AQ+
Sbjct  50   GANDGLVSTASLMMGVGAVKQDIKAMILSGFAGLVAGACSMAIGEFVSVYSQLDIEIAQL  109

Query  182  KRKKNRRNGedageeeeeesdvdeLPNPMQAAAASVVAFTMGAMVPLLAASFIKPYKVRI  361
            KR    R             + + LPNP+QAAAAS +AF++GAMVPLLAASFIK YKVR+
Sbjct  110  KRDNIERGN--------NIEEKESLPNPLQAAAASALAFSIGAMVPLLAASFIKDYKVRV  161

Query  362  GaviaavtvalvvcgwlgaalggapkgkaSVRVLIGGWLAMAITSGLTKLIG  517
            G V+ AV+ ALVV GWLGA LG AP  ++ +RVL+GGW+AMAIT GLTKLIG
Sbjct  162  GVVLGAVSFALVVFGWLGAVLGKAPVLRSCLRVLLGGWIAMAITFGLTKLIG  213



>ref|XP_002534648.1| Nodulin, putative [Ricinus communis]
 gb|EEF27735.1| Nodulin, putative [Ricinus communis]
Length=223

 Score =   179 bits (454),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 125/172 (73%), Positives = 144/172 (84%), Gaps = 4/172 (2%)
 Frame = +2

Query  2    GANDGLVSIASLMMGVGTVKQDIKAMILTGFAGMVAGACSMAIGEFVSVYSQRDIEVAQM  181
            GANDGLVS ASLMMGVG VKQD+KAMILTGFAG+VAGACSMAIGEFVSVYSQ DIE+AQM
Sbjct  52   GANDGLVSTASLMMGVGAVKQDVKAMILTGFAGLVAGACSMAIGEFVSVYSQLDIELAQM  111

Query  182  KRKKNRRNGedageeeeeesdvdeLPNPMQAAAASVVAFTMGAMVPLLAASFIKPYKVRI  361
            KR+K R       EE E E + + LPNP+QAAAAS +AF+MGAMVPLLAASFI+ YKVR+
Sbjct  112  KREKER----GVKEENENEGEKESLPNPLQAAAASALAFSMGAMVPLLAASFIRDYKVRL  167

Query  362  GaviaavtvalvvcgwlgaalggapkgkaSVRVLIGGWLAMAITSGLTKLIG  517
            G ++AAV++ALV+ GWLGA LG AP  ++S RV IGG +AMAIT GLTKLIG
Sbjct  168  GVIVAAVSLALVIFGWLGAVLGKAPVVRSSARVFIGGLMAMAITFGLTKLIG  219



>ref|XP_004139663.1| PREDICTED: vacuolar iron transporter homolog 4-like [Cucumis 
sativus]
 ref|XP_004169781.1| PREDICTED: vacuolar iron transporter homolog 4-like [Cucumis 
sativus]
 gb|KGN44522.1| hypothetical protein Csa_7G325150 [Cucumis sativus]
Length=217

 Score =   179 bits (453),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 117/172 (68%), Positives = 139/172 (81%), Gaps = 7/172 (4%)
 Frame = +2

Query  2    GANDGLVSIASLMMGVGTVKQDIKAMILTGFAGMVAGACSMAIGEFVSVYSQRDIEVAQM  181
            GANDGL+S ASLMMGVG VK D+KAMILTGFAG++AGACSMAIGEFVSVYSQ DIE+AQ+
Sbjct  49   GANDGLISTASLMMGVGAVKHDVKAMILTGFAGLIAGACSMAIGEFVSVYSQLDIEMAQI  108

Query  182  KRKKNRRNGedageeeeeesdvdeLPNPMQAAAASVVAFTMGAMVPLLAASFIKPYKVRI  361
            KR ++ R        E EE +  +LPNP+QAA AS +AF+ GA+VPLLAA+FI+ Y+VR+
Sbjct  109  KRSRDHRK-------ELEEEETAKLPNPLQAAVASALAFSTGAIVPLLAAAFIREYRVRL  161

Query  362  GaviaavtvalvvcgwlgaalggapkgkaSVRVLIGGWLAMAITSGLTKLIG  517
            G V+ AVTV LV  GWLGAALG AP  ++ VRVLIGGW AMA+T GLTKLIG
Sbjct  162  GVVVVAVTVTLVGFGWLGAALGKAPTVRSVVRVLIGGWAAMAVTFGLTKLIG  213



>ref|XP_002875613.1| hypothetical protein ARALYDRAFT_484807 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH51872.1| hypothetical protein ARALYDRAFT_484807 [Arabidopsis lyrata subsp. 
lyrata]
Length=197

 Score =   177 bits (450),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 112/172 (65%), Positives = 137/172 (80%), Gaps = 12/172 (7%)
 Frame = +2

Query  2    GANDGLVSIASLMMGVGTVKQDIKAMILTGFAGMVAGACSMAIGEFVSVYSQRDIEVAQM  181
            GANDGLVS ASLMMG+G VKQD++ M+LTGF+G+VAGACSMAIGEF+SVYSQ DIEVAQM
Sbjct  34   GANDGLVSTASLMMGIGAVKQDVRTMLLTGFSGLVAGACSMAIGEFISVYSQYDIEVAQM  93

Query  182  KRKKNRRNGedageeeeeesdvdeLPNPMQAAAASVVAFTMGAMVPLLAASFIKPYKVRI  361
            KR+                   ++LP+PM AA AS ++F++GA+VPLLAA+F+K YKVRI
Sbjct  94   KRESGGET------------KKEKLPSPMLAAIASALSFSLGAIVPLLAAAFVKEYKVRI  141

Query  362  GaviaavtvalvvcgwlgaalggapkgkaSVRVLIGGWLAMAITSGLTKLIG  517
            G ++AAVT+ALV+ GWLGA LG AP  K+S+RVLIGGWLAMAIT G TKL+G
Sbjct  142  GGIVAAVTLALVMFGWLGAVLGKAPVVKSSLRVLIGGWLAMAITFGFTKLVG  193



>ref|XP_003518603.1| PREDICTED: vacuolar iron transporter homolog 3-like [Glycine 
max]
Length=239

 Score =   179 bits (454),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 123/174 (71%), Positives = 143/174 (82%), Gaps = 2/174 (1%)
 Frame = +2

Query  2    GANDGLVSIASLMMGVGTVKQDIKAMILTGFAGMVAGACSMAIGEFVSVYSQRDIEVAQM  181
            GANDGLVS AS+MMGVG VK DIKAMIL+GFAG+VAGACSMAIGEFVSVYSQ DIEVAQ 
Sbjct  62   GANDGLVSTASIMMGVGAVKHDIKAMILSGFAGLVAGACSMAIGEFVSVYSQLDIEVAQR  121

Query  182  KRKKNR--RNGedageeeeeesdvdeLPNPMQAAAASVVAFTMGAMVPLLAASFIKPYKV  355
            KR+K R    G D  EE+    + D LPNP+QAAAAS +AF++GAMVPLLAASFI+ YKV
Sbjct  122  KREKERGQSRGRDIQEEDTNYEEKDSLPNPLQAAAASALAFSVGAMVPLLAASFIREYKV  181

Query  356  RIGaviaavtvalvvcgwlgaalggapkgkaSVRVLIGGWLAMAITSGLTKLIG  517
            R+G ++AAVT ALVV GWLGA  G AP  ++++RVL GGW+AMA+T GLTKLIG
Sbjct  182  RLGVIVAAVTFALVVFGWLGALWGKAPVLRSALRVLFGGWMAMAMTFGLTKLIG  235



>ref|XP_009149595.1| PREDICTED: vacuolar iron transporter homolog 1-like [Brassica 
rapa]
 emb|CDY29473.1| BnaA06g14970D [Brassica napus]
 emb|CDY04601.1| BnaC05g16390D [Brassica napus]
Length=201

 Score =   177 bits (450),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 116/172 (67%), Positives = 139/172 (81%), Gaps = 12/172 (7%)
 Frame = +2

Query  2    GANDGLVSIASLMMGVGTVKQDIKAMILTGFAGMVAGACSMAIGEFVSVYSQRDIEVAQM  181
            GANDGLV+ ASLMMGVG +K D+K M+LTGFAG+VAGACSMAIGEFVSVYSQ DIEVAQM
Sbjct  37   GANDGLVTTASLMMGVGAIKPDVKTMVLTGFAGLVAGACSMAIGEFVSVYSQYDIEVAQM  96

Query  182  KRKKNRRNGedageeeeeesdvdeLPNPMQAAAASVVAFTMGAMVPLLAASFIKPYKVRI  361
            KR     NG           D ++LP+P++AA AS +AF++GA+VPLLAA+F+K YKVRI
Sbjct  97   KRD----NG--------GVIDKEKLPSPIKAATASALAFSIGAIVPLLAAAFVKTYKVRI  144

Query  362  GaviaavtvalvvcgwlgaalggapkgkaSVRVLIGGWLAMAITSGLTKLIG  517
            G ++AAVT+ALV+ GWLGA LG AP  K+S RVLIGGWLAMA+T GLTKL+G
Sbjct  145  GVIVAAVTLALVMFGWLGAVLGKAPVVKSSARVLIGGWLAMAVTYGLTKLVG  196



>ref|XP_010108651.1| hypothetical protein L484_017884 [Morus notabilis]
 gb|EXC19907.1| hypothetical protein L484_017884 [Morus notabilis]
Length=217

 Score =   178 bits (451),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 125/172 (73%), Positives = 144/172 (84%), Gaps = 4/172 (2%)
 Frame = +2

Query  2    GANDGLVSIASLMMGVGTVKQDIKAMILTGFAGMVAGACSMAIGEFVSVYSQRDIEVAQM  181
            GANDGLVS ASLMMGVG VKQDIK MILTGFAG+VAGACSMAIGEFVSVYSQ DIE+AQM
Sbjct  46   GANDGLVSTASLMMGVGAVKQDIKVMILTGFAGLVAGACSMAIGEFVSVYSQLDIEIAQM  105

Query  182  KRKKNRRNGedageeeeeesdvdeLPNPMQAAAASVVAFTMGAMVPLLAASFIKPYKVRI  361
            KR+   R+G  A E  E+     +LPNP+QAAAAS +AF++GA+VPLLAASFIK Y+VR+
Sbjct  106  KRE---RSG-PAAEIIEDAQGEKDLPNPLQAAAASALAFSVGAIVPLLAASFIKEYRVRL  161

Query  362  GaviaavtvalvvcgwlgaalggapkgkaSVRVLIGGWLAMAITSGLTKLIG  517
            G V AAVT+ALVV GWLGA LG +P  +++ RVL+GGWLAMAIT GLTKLIG
Sbjct  162  GVVAAAVTLALVVFGWLGAVLGKSPSVRSAARVLVGGWLAMAITFGLTKLIG  213



>ref|XP_006472968.1| PREDICTED: vacuolar iron transporter homolog 3-like [Citrus sinensis]
Length=224

 Score =   178 bits (451),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 124/172 (72%), Positives = 146/172 (85%), Gaps = 3/172 (2%)
 Frame = +2

Query  2    GANDGLVSIASLMMGVGTVKQDIKAMILTGFAGMVAGACSMAIGEFVSVYSQRDIEVAQM  181
            GANDGLVS ASLMMGVG VKQDIKAMILTGFAG+VAGACSMAIGEFVSVYSQ DI+VAQM
Sbjct  52   GANDGLVSTASLMMGVGAVKQDIKAMILTGFAGLVAGACSMAIGEFVSVYSQLDIQVAQM  111

Query  182  KRKKNRRNGedageeeeeesdvdeLPNPMQAAAASVVAFTMGAMVPLLAASFIKPYKVRI  361
            KR +++ N    G    E+ + + LP+P+QAAAAS +AF++GAMVPLLAASFI+ YK+R+
Sbjct  112  KRNRDQGN---TGGVTAEKEEEEGLPSPIQAAAASALAFSLGAMVPLLAASFIRDYKIRL  168

Query  362  GaviaavtvalvvcgwlgaalggapkgkaSVRVLIGGWLAMAITSGLTKLIG  517
            G V+AAVT+AL V GWLGA LG AP  +++VRVL+GGWLAMAIT GLTKLIG
Sbjct  169  GVVVAAVTLALAVFGWLGAVLGKAPVVRSAVRVLVGGWLAMAITFGLTKLIG  220



>ref|XP_002306691.1| hypothetical protein POPTR_0005s21310g [Populus trichocarpa]
 gb|EEE93687.1| hypothetical protein POPTR_0005s21310g [Populus trichocarpa]
Length=218

 Score =   177 bits (450),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 121/172 (70%), Positives = 147/172 (85%), Gaps = 5/172 (3%)
 Frame = +2

Query  2    GANDGLVSIASLMMGVGTVKQDIKAMILTGFAGMVAGACSMAIGEFVSVYSQRDIEVAQM  181
            GANDGLVS ASLMMGVG VKQD+K MILTGFAG+VAGACSMAIGEFVSV+SQ DIE+AQM
Sbjct  48   GANDGLVSTASLMMGVGAVKQDLKVMILTGFAGLVAGACSMAIGEFVSVHSQLDIELAQM  107

Query  182  KRKKNRRNGedageeeeeesdvdeLPNPMQAAAASVVAFTMGAMVPLLAASFIKPYKVRI  361
            KR + R++      EE+EE + + LPNP+ AAAAS +AF++GA+VPLLAASFI+ YKVR+
Sbjct  108  KRDRQRKD-----TEEKEEGENESLPNPLLAAAASALAFSVGALVPLLAASFIREYKVRL  162

Query  362  GaviaavtvalvvcgwlgaalggapkgkaSVRVLIGGWLAMAITSGLTKLIG  517
            G V+AAVT+AL++ GWLGA LG AP  ++S+RVL+GGWLAMAIT GLT+LIG
Sbjct  163  GVVVAAVTLALMIFGWLGAVLGKAPAVRSSLRVLVGGWLAMAITFGLTRLIG  214



>ref|XP_008237596.1| PREDICTED: vacuolar iron transporter homolog 4-like [Prunus mume]
Length=228

 Score =   178 bits (451),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 121/176 (69%), Positives = 143/176 (81%), Gaps = 4/176 (2%)
 Frame = +2

Query  2    GANDGLVSIASLMMGVGTVKQDIKAMILTGFAGMVAGACSMAIGEFVSVYSQRDIEVAQM  181
            GANDGL+S ASLMMGVG VK+DIKAMILTGFAG+VAGACSMAIGEFVSVYSQ DIEVAQM
Sbjct  49   GANDGLISTASLMMGVGAVKEDIKAMILTGFAGLVAGACSMAIGEFVSVYSQLDIEVAQM  108

Query  182  KRKKNRRNGedagee----eeeesdvdeLPNPMQAAAASVVAFTMGAMVPLLAASFIKPY  349
            KR    +    A        E +++ + LPNP+QAAAAS +AF++GAMVPLLAASFI+ Y
Sbjct  109  KRDNQNKQKTLAHVAEDGDSEGDNEKESLPNPLQAAAASALAFSVGAMVPLLAASFIREY  168

Query  350  KVRIGaviaavtvalvvcgwlgaalggapkgkaSVRVLIGGWLAMAITSGLTKLIG  517
            KVR+G V AAV++ALV+ GWLGA LG AP  ++ +RVL+GGW+AMAIT GLTKLIG
Sbjct  169  KVRLGVVAAAVSLALVLFGWLGAKLGKAPIMRSMMRVLVGGWMAMAITFGLTKLIG  224



>emb|CBI18549.3| unnamed protein product [Vitis vinifera]
Length=207

 Score =   177 bits (448),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 127/172 (74%), Positives = 138/172 (80%), Gaps = 13/172 (8%)
 Frame = +2

Query  2    GANDGLVSIASLMMGVGTVKQDIKAMILTGFAGMVAGACSMAIGEFVSVYSQRDIEVAQM  181
            GANDGLVS ASLMMGVG VKQDIKAMILTGFAG+VAGACSMAIGEFVSVYSQ DIEVAQ 
Sbjct  45   GANDGLVSTASLMMGVGAVKQDIKAMILTGFAGLVAGACSMAIGEFVSVYSQLDIEVAQR  104

Query  182  KRKKNRRNGedageeeeeesdvdeLPNPMQAAAASVVAFTMGAMVPLLAASFIKPYKVRI  361
            KR K R                + LPNP+QAAAAS +AF +GAMVPLLAASFI+ YKVR+
Sbjct  105  KRDKRRGE-------------KENLPNPVQAAAASALAFAVGAMVPLLAASFIREYKVRL  151

Query  362  GaviaavtvalvvcgwlgaalggapkgkaSVRVLIGGWLAMAITSGLTKLIG  517
            GAVIAAVTVALVV GWLGA LG  P  ++ +RVL+GGWLAMAIT GLTKLIG
Sbjct  152  GAVIAAVTVALVVFGWLGAVLGKVPAFRSCMRVLVGGWLAMAITFGLTKLIG  203



>ref|XP_007201814.1| hypothetical protein PRUPE_ppa010996mg [Prunus persica]
 gb|EMJ03013.1| hypothetical protein PRUPE_ppa010996mg [Prunus persica]
Length=228

 Score =   177 bits (450),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 123/176 (70%), Positives = 144/176 (82%), Gaps = 4/176 (2%)
 Frame = +2

Query  2    GANDGLVSIASLMMGVGTVKQDIKAMILTGFAGMVAGACSMAIGEFVSVYSQRDIEVAQM  181
            GANDGL+S ASLMMGVG VK+DIKAMILTGFAG+VAGACSMAIGEFVSVYSQ DIEVAQM
Sbjct  49   GANDGLISTASLMMGVGAVKEDIKAMILTGFAGLVAGACSMAIGEFVSVYSQLDIEVAQM  108

Query  182  KRKKNRRNGedageeeeees----dvdeLPNPMQAAAASVVAFTMGAMVPLLAASFIKPY  349
            KR    +    A   E+ +S    + + LPNP+QAAAAS +AF++GAMVPLLAASFI+ Y
Sbjct  109  KRDDQNKQKTPAHVAEDGDSEGDNEKESLPNPLQAAAASALAFSVGAMVPLLAASFIREY  168

Query  350  KVRIGaviaavtvalvvcgwlgaalggapkgkaSVRVLIGGWLAMAITSGLTKLIG  517
            KVR+G V AAV++ALVV GWLGA LG AP  ++ +RVL+GGW+AMAIT GLTKLIG
Sbjct  169  KVRLGVVAAAVSLALVVFGWLGAKLGKAPIMRSMMRVLVGGWMAMAITFGLTKLIG  224



>gb|EYU17457.1| hypothetical protein MIMGU_mgv1a013396mg [Erythranthe guttata]
Length=221

 Score =   177 bits (449),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 124/174 (71%), Positives = 143/174 (82%), Gaps = 0/174 (0%)
 Frame = +2

Query  2    GANDGLVSIASLMMGVGTVKQDIKAMILTGFAGMVAGACSMAIGEFVSVYSQRDIEVAQM  181
            GANDGLVS A+LM+GVG VK  +KAMILTGFAG+VAGACSMAIGE+VSV+SQ DIE AQM
Sbjct  43   GANDGLVSTAALMVGVGAVKHGMKAMILTGFAGLVAGACSMAIGEYVSVHSQLDIEYAQM  102

Query  182  KRKKNRRNGedageeeeeesdvdeLPNPMQAAAASVVAFTMGAMVPLLAASFIKPYKVRI  361
            KR   +R G  A   E+   D + LPNP+QAAAAS +AF++GAMVPLLAASFIK Y+VRI
Sbjct  103  KRDSEKRAGGGADAVEDGGGDKESLPNPVQAAAASALAFSVGAMVPLLAASFIKEYRVRI  162

Query  362  GaviaavtvalvvcgwlgaalggapkgkaSVRVLIGGWLAMAITSGLTKLIGIK  523
            G V+AAVTVALVV GWLGA LG AP  ++S RVL+GGWLAMA+T GLTKLIG K
Sbjct  163  GVVVAAVTVALVVFGWLGAVLGRAPVVRSSARVLVGGWLAMAVTFGLTKLIGTK  216



>ref|XP_010062127.1| PREDICTED: vacuolar iron transporter homolog 1-like [Eucalyptus 
grandis]
 gb|KCW69193.1| hypothetical protein EUGRSUZ_F02714 [Eucalyptus grandis]
Length=227

 Score =   177 bits (449),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 123/173 (71%), Positives = 147/173 (85%), Gaps = 1/173 (1%)
 Frame = +2

Query  2    GANDGLVSIASLMMGVGTVKQDIKAMILTGFAGMVAGACSMAIGEFVSVYSQRDIEVAQM  181
            GANDGLVS ASLMMGVG+VKQD+KAMILTGFAG+VAGACSMAIGEFVSVYSQ DIE+AQM
Sbjct  51   GANDGLVSTASLMMGVGSVKQDLKAMILTGFAGLVAGACSMAIGEFVSVYSQLDIELAQM  110

Query  182  KR-KKNRRNGedageeeeeesdvdeLPNPMQAAAASVVAFTMGAMVPLLAASFIKPYKVR  358
            KR K+   +G+     + +  + + LPNP+QAA+AS ++F++GAMVPLLAASFI+ Y+ R
Sbjct  111  KRDKEGAADGQMDKGGDGDNGEEECLPNPLQAASASALSFSVGAMVPLLAASFIRSYRAR  170

Query  359  IGaviaavtvalvvcgwlgaalggapkgkaSVRVLIGGWLAMAITSGLTKLIG  517
            +GAVIAAVTVALV  GW+GA LG AP  ++S+RVLIGGWLAMAIT GLTKLIG
Sbjct  171  LGAVIAAVTVALVAFGWIGAVLGKAPVLRSSLRVLIGGWLAMAITFGLTKLIG  223



>ref|XP_007043040.1| Vacuolar iron transporter family protein [Theobroma cacao]
 gb|EOX98871.1| Vacuolar iron transporter family protein [Theobroma cacao]
Length=229

 Score =   177 bits (448),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 114/172 (66%), Positives = 143/172 (83%), Gaps = 0/172 (0%)
 Frame = +2

Query  2    GANDGLVSIASLMMGVGTVKQDIKAMILTGFAGMVAGACSMAIGEFVSVYSQRDIEVAQM  181
            GANDGLVSIASLMMGVG+VK+D+KAMI+ GFAG+VAGACSMAIGEFVSVY+QRD+EVAQM
Sbjct  52   GANDGLVSIASLMMGVGSVKEDVKAMIVAGFAGLVAGACSMAIGEFVSVYTQRDVEVAQM  111

Query  182  KRKKNRRNGedageeeeeesdvdeLPNPMQAAAASVVAFTMGAMVPLLAASFIKPYKVRI  361
            KR+K +R  E+    EE     ++LPNP  AAAAS +AF++GA++PLLAA+FI+ +KVR+
Sbjct  112  KREKQKRESENVHGNEEVGDQKEQLPNPGLAAAASALAFSVGAVLPLLAAAFIRDHKVRM  171

Query  362  GaviaavtvalvvcgwlgaalggapkgkaSVRVLIGGWLAMAITSGLTKLIG  517
              V+A  T+AL+V G +G+ LGG P  K+S RVL+GGW+AMAIT GLTKLIG
Sbjct  172  AVVVAVATIALMVFGAVGSLLGGTPVVKSSARVLVGGWMAMAITFGLTKLIG  223



>ref|XP_004140970.1| PREDICTED: vacuolar iron transporter homolog 4-like [Cucumis 
sativus]
 ref|XP_004160306.1| PREDICTED: vacuolar iron transporter homolog 4-like [Cucumis 
sativus]
 gb|KGN46147.1| hypothetical protein Csa_6G057130 [Cucumis sativus]
Length=217

 Score =   176 bits (447),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 125/174 (72%), Positives = 146/174 (84%), Gaps = 2/174 (1%)
 Frame = +2

Query  2    GANDGLVSIASLMMGVGTVKQDIKAMILTGFAGMVAGACSMAIGEFVSVYSQRDIEVAQM  181
            GANDGLVS ASLMMGVG VKQDIKAMILTGFAG+VAGACSMAIGEFVSVYSQ DIE+AQ+
Sbjct  40   GANDGLVSTASLMMGVGAVKQDIKAMILTGFAGLVAGACSMAIGEFVSVYSQLDIEMAQI  99

Query  182  KRKKNRR--NGedageeeeeesdvdeLPNPMQAAAASVVAFTMGAMVPLLAASFIKPYKV  355
            KR+K +R  N E    + ++  D ++LPNP+QAAAAS +AF++GAMVPLLAASFI+ YKV
Sbjct  100  KREKLQRSNNMEGGVVQGQDSKDKEKLPNPLQAAAASALAFSLGAMVPLLAASFIREYKV  159

Query  356  RIGaviaavtvalvvcgwlgaalggapkgkaSVRVLIGGWLAMAITSGLTKLIG  517
            R+  V+A+VT+AL V GWLGA LG A   K++ RVLIGGWLAMAIT GLTKLIG
Sbjct  160  RLAVVVASVTLALAVFGWLGAILGKASPIKSAARVLIGGWLAMAITFGLTKLIG  213



>ref|XP_002265452.1| PREDICTED: vacuolar iron transporter homolog 2-like [Vitis vinifera]
Length=221

 Score =   176 bits (446),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 133/172 (77%), Positives = 146/172 (85%), Gaps = 3/172 (2%)
 Frame = +2

Query  2    GANDGLVSIASLMMGVGTVKQDIKAMILTGFAGMVAGACSMAIGEFVSVYSQRDIEVAQM  181
            GANDGLVS ASLMMGVG VKQDIKAMILTGFAG+VAGACSMAIGEFVSVYSQ DIEVAQ 
Sbjct  49   GANDGLVSTASLMMGVGAVKQDIKAMILTGFAGLVAGACSMAIGEFVSVYSQLDIEVAQR  108

Query  182  KRKKNRRNGedageeeeeesdvdeLPNPMQAAAASVVAFTMGAMVPLLAASFIKPYKVRI  361
            KR K R     +GE EEEE + + LPNP+QAAAAS +AF +GAMVPLLAASFI+ YKVR+
Sbjct  109  KRDKRR---VGSGESEEEEGEKENLPNPVQAAAASALAFAVGAMVPLLAASFIREYKVRL  165

Query  362  GaviaavtvalvvcgwlgaalggapkgkaSVRVLIGGWLAMAITSGLTKLIG  517
            GAVIAAVTVALVV GWLGA LG  P  ++ +RVL+GGWLAMAIT GLTKLIG
Sbjct  166  GAVIAAVTVALVVFGWLGAVLGKVPAFRSCMRVLVGGWLAMAITFGLTKLIG  217



>ref|XP_008441522.1| PREDICTED: vacuolar iron transporter homolog 4-like [Cucumis 
melo]
Length=217

 Score =   176 bits (446),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 125/174 (72%), Positives = 146/174 (84%), Gaps = 2/174 (1%)
 Frame = +2

Query  2    GANDGLVSIASLMMGVGTVKQDIKAMILTGFAGMVAGACSMAIGEFVSVYSQRDIEVAQM  181
            GANDGLVS ASLMMGVG VKQDIKAMILTGFAG+VAGACSMAIGEFVSVYSQ DIE+AQ+
Sbjct  40   GANDGLVSTASLMMGVGAVKQDIKAMILTGFAGLVAGACSMAIGEFVSVYSQLDIEMAQI  99

Query  182  KRKKNRR--NGedageeeeeesdvdeLPNPMQAAAASVVAFTMGAMVPLLAASFIKPYKV  355
            KR+K +R  N E    + +E  D ++LPNP+QAAAAS +AF++GAMVPLLAASFI+ YKV
Sbjct  100  KREKLQRSNNMEGGVVQGQESKDKEKLPNPLQAAAASALAFSLGAMVPLLAASFIREYKV  159

Query  356  RIGaviaavtvalvvcgwlgaalggapkgkaSVRVLIGGWLAMAITSGLTKLIG  517
            R+  V+A+VT+AL V GWLGA LG A   K++ RVL+GGWLAMAIT GLTKLIG
Sbjct  160  RLAVVVASVTLALAVFGWLGAVLGKASPIKSAARVLVGGWLAMAITFGLTKLIG  213



>ref|XP_004496484.1| PREDICTED: vacuolar iron transporter homolog 3-like [Cicer arietinum]
Length=220

 Score =   176 bits (446),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 124/172 (72%), Positives = 139/172 (81%), Gaps = 5/172 (3%)
 Frame = +2

Query  2    GANDGLVSIASLMMGVGTVKQDIKAMILTGFAGMVAGACSMAIGEFVSVYSQRDIEVAQM  181
            GANDGLVS ASLMMGVG VKQDIKAMIL+GFAG+VAGACSMAIGEFVSVYSQ DIEVAQ+
Sbjct  50   GANDGLVSTASLMMGVGAVKQDIKAMILSGFAGLVAGACSMAIGEFVSVYSQLDIEVAQL  109

Query  182  KRKKNRRNGedageeeeeesdvdeLPNPMQAAAASVVAFTMGAMVPLLAASFIKPYKVRI  361
            K     R+ E     +EEE + + LPNP+QAAAAS +AF++GAMVPLLAASFIK YKVRI
Sbjct  110  K-----RDNERGNNNDEEEEEKESLPNPLQAAAASALAFSIGAMVPLLAASFIKGYKVRI  164

Query  362  GaviaavtvalvvcgwlgaalggapkgkaSVRVLIGGWLAMAITSGLTKLIG  517
            G V+ AV+ ALVV G  GA LG AP  K+ +RVL GGW AMAIT GLTKLIG
Sbjct  165  GVVLGAVSFALVVFGLFGALLGKAPILKSCLRVLFGGWFAMAITFGLTKLIG  216



>ref|XP_006434441.1| hypothetical protein CICLE_v10002398mg [Citrus clementina]
 gb|ESR47681.1| hypothetical protein CICLE_v10002398mg [Citrus clementina]
Length=224

 Score =   176 bits (445),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 124/172 (72%), Positives = 147/172 (85%), Gaps = 3/172 (2%)
 Frame = +2

Query  2    GANDGLVSIASLMMGVGTVKQDIKAMILTGFAGMVAGACSMAIGEFVSVYSQRDIEVAQM  181
            GANDGLVS ASLMMGVG VKQDIKAMILTGFAG+VAGACSMAIGEFVSVYSQ DI+VAQ+
Sbjct  52   GANDGLVSTASLMMGVGAVKQDIKAMILTGFAGLVAGACSMAIGEFVSVYSQLDIQVAQL  111

Query  182  KRKKNRRNGedageeeeeesdvdeLPNPMQAAAASVVAFTMGAMVPLLAASFIKPYKVRI  361
            KR +++ N    G   EE+ + + LP+P+QAAAAS +AF++GAMVPLLAASFI+ YK+R+
Sbjct  112  KRNRDQGN---TGGVTEEKEEEEGLPSPIQAAAASALAFSLGAMVPLLAASFIRDYKIRL  168

Query  362  GaviaavtvalvvcgwlgaalggapkgkaSVRVLIGGWLAMAITSGLTKLIG  517
            G V+AAVT+AL V GWLGA LG AP  +++VRVL+GGWLAMAIT GLTKLIG
Sbjct  169  GVVVAAVTLALAVFGWLGAILGKAPVVRSAVRVLVGGWLAMAITFGLTKLIG  220



>ref|XP_010514728.1| PREDICTED: vacuolar iron transporter homolog 4-like [Camelina 
sativa]
Length=199

 Score =   175 bits (443),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 113/175 (65%), Positives = 138/175 (79%), Gaps = 10/175 (6%)
 Frame = +2

Query  2    GANDGLVSIASLMMGVGTVKQDIKAMILTGFAGMVAGACSMAIGEFVSVYSQRDIEVAQM  181
            GANDGLVS A+LMMGVG VKQD+K M+LTGFAG+VAGACSMAIGEFVSVYSQ D E AQM
Sbjct  34   GANDGLVSTAALMMGVGAVKQDVKIMLLTGFAGLVAGACSMAIGEFVSVYSQYDKEKAQM  93

Query  182  KRKKNRRNGedageeeeeesdvdeLPNPMQAAAASVVAFTMGAMVPLLAASFIKPYKVRI  361
            KR+                ++ ++LP+P QAA AS +AF++G +VPLLAA+F+K YKVRI
Sbjct  94   KRESGGEGD----------TEKEKLPSPTQAAVASALAFSIGGIVPLLAATFVKEYKVRI  143

Query  362  GaviaavtvalvvcgwlgaalggapkgkaSVRVLIGGWLAMAITSGLTKLIGIKS  526
            G ++AAVT+ALVV GWLGA LG AP  K+S+RVLIGGWLAMAIT G TK++G+ +
Sbjct  144  GVILAAVTLALVVFGWLGAVLGKAPAIKSSLRVLIGGWLAMAITFGFTKIVGLHA  198



>ref|XP_002530510.1| Nodulin, putative [Ricinus communis]
 gb|EEF31894.1| Nodulin, putative [Ricinus communis]
Length=220

 Score =   175 bits (444),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 121/172 (70%), Positives = 140/172 (81%), Gaps = 6/172 (3%)
 Frame = +2

Query  2    GANDGLVSIASLMMGVGTVKQDIKAMILTGFAGMVAGACSMAIGEFVSVYSQRDIEVAQM  181
            GANDGLVSI SLMMGVG +KQDIKAMILTGFAG+VAGACSMAIGEFVSVYSQ DIE+AQ 
Sbjct  51   GANDGLVSIGSLMMGVGAIKQDIKAMILTGFAGLVAGACSMAIGEFVSVYSQLDIELAQE  110

Query  182  KRKKNRRNGedageeeeeesdvdeLPNPMQAAAASVVAFTMGAMVPLLAASFIKPYKVRI  361
            KR           EEEEEE D + LPNP+QAA AS +AF+MGA+VPLLAASFI  YK R+
Sbjct  111  KRDHGNE------EEEEEEGDKESLPNPLQAAVASALAFSMGAIVPLLAASFISNYKARL  164

Query  362  GaviaavtvalvvcgwlgaalggapkgkaSVRVLIGGWLAMAITSGLTKLIG  517
            GAV+ AV++ALV+ GW+GA LG AP  ++S RVL+GG +A+AIT GLTKLIG
Sbjct  165  GAVVGAVSLALVIFGWVGAVLGKAPVVRSSARVLVGGLIAIAITFGLTKLIG  216



>ref|XP_009368505.1| PREDICTED: vacuolar iron transporter homolog 1-like [Pyrus x 
bretschneideri]
Length=228

 Score =   176 bits (445),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 121/176 (69%), Positives = 143/176 (81%), Gaps = 4/176 (2%)
 Frame = +2

Query  2    GANDGLVSIASLMMGVGTVKQDIKAMILTGFAGMVAGACSMAIGEFVSVYSQRDIEVAQM  181
            GANDGL+S ASLMMGVG V+QD KAMIL+GFAG+VAGACSMAIGEFVSVYSQ DIEVAQM
Sbjct  49   GANDGLISTASLMMGVGAVRQDFKAMILSGFAGLVAGACSMAIGEFVSVYSQLDIEVAQM  108

Query  182  KR----KKNRRNGedageeeeeesdvdeLPNPMQAAAASVVAFTMGAMVPLLAASFIKPY  349
            KR    KK  +      ++  +  D + LPNP+QAAAAS +AF++GAMVPLLAASFI+ Y
Sbjct  109  KRDDQKKKKNQEVHVEEDDGGDGDDEESLPNPLQAAAASALAFSVGAMVPLLAASFIRGY  168

Query  350  KVRIGaviaavtvalvvcgwlgaalggapkgkaSVRVLIGGWLAMAITSGLTKLIG  517
            KVR+G V AAV++ALVV GWLGA LG AP  ++ +RVL+GGW+AMAIT GLTKLIG
Sbjct  169  KVRLGVVAAAVSLALVVFGWLGAKLGKAPVMRSVMRVLVGGWMAMAITFGLTKLIG  224



>ref|XP_007023068.1| Vacuolar iron transporter family protein [Theobroma cacao]
 gb|EOY25690.1| Vacuolar iron transporter family protein [Theobroma cacao]
Length=226

 Score =   175 bits (444),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 110/172 (64%), Positives = 137/172 (80%), Gaps = 3/172 (2%)
 Frame = +2

Query  2    GANDGLVSIASLMMGVGTVKQDIKAMILTGFAGMVAGACSMAIGEFVSVYSQRDIEVAQM  181
            GANDGLVS+ASLMMGVG VK DIKAM++ GFAG+VAGACSMAIGEFVSVY+QRDIEVAQM
Sbjct  54   GANDGLVSVASLMMGVGAVKDDIKAMLVAGFAGLVAGACSMAIGEFVSVYTQRDIEVAQM  113

Query  182  KRKKNRRNGedageeeeeesdvdeLPNPMQAAAASVVAFTMGAMVPLLAASFIKPYKVRI  361
            KR++ +R       + E+E++ ++LPNP QAA AS +AF++GA+VPLLAA+FI+  KVR+
Sbjct  114  KRERRKRES---SGDYEQETEREKLPNPGQAAIASALAFSIGAVVPLLAAAFIRQKKVRL  170

Query  362  GaviaavtvalvvcgwlgaalggapkgkaSVRVLIGGWLAMAITSGLTKLIG  517
              V A  ++AL V G  GA +G  P   +S RVLIGGW+AMAIT GLTKL+G
Sbjct  171  AVVAAVASLALAVFGATGAVIGRTPVVSSSFRVLIGGWMAMAITFGLTKLVG  222



>emb|CDY33672.1| BnaC08g19720D [Brassica napus]
Length=195

 Score =   174 bits (440),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 116/172 (67%), Positives = 135/172 (78%), Gaps = 12/172 (7%)
 Frame = +2

Query  2    GANDGLVSIASLMMGVGTVKQDIKAMILTGFAGMVAGACSMAIGEFVSVYSQRDIEVAQM  181
            GA DGLVS ASLMMGVG VK D K MILTGFAG+VAGACSMAIGEFVSVYSQ DIEVAQ+
Sbjct  32   GAIDGLVSTASLMMGVGAVKPDFKTMILTGFAGLVAGACSMAIGEFVSVYSQYDIEVAQI  91

Query  182  KRKKNRRNGedageeeeeesdvdeLPNPMQAAAASVVAFTMGAMVPLLAASFIKPYKVRI  361
            KR+               + + ++LPNPM AAAASV+AF +GA+VPLLAA+ +K YKVR+
Sbjct  92   KREN------------AGDIEKEKLPNPMHAAAASVIAFFLGAVVPLLAAAPVKTYKVRV  139

Query  362  GaviaavtvalvvcgwlgaalggapkgkaSVRVLIGGWLAMAITSGLTKLIG  517
            G ++AAVT+ALV+ GWLGA LG AP  K+S RVLIGGWLAMAIT GLT+L G
Sbjct  140  GVIVAAVTLALVMFGWLGAVLGKAPVVKSSARVLIGGWLAMAITYGLTRLFG  191



>ref|XP_010048737.1| PREDICTED: vacuolar iron transporter homolog 1-like [Eucalyptus 
grandis]
 gb|KCW81099.1| hypothetical protein EUGRSUZ_C02475 [Eucalyptus grandis]
Length=227

 Score =   174 bits (442),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 118/173 (68%), Positives = 144/173 (83%), Gaps = 1/173 (1%)
 Frame = +2

Query  2    GANDGLVSIASLMMGVGTVKQDIKAMILTGFAGMVAGACSMAIGEFVSVYSQRDIEVAQM  181
            GANDGLVS ASLMMGVG+VKQD+KAMILTGFAG+VAGACSMAIGEFVSVYSQ DIE AQM
Sbjct  51   GANDGLVSTASLMMGVGSVKQDMKAMILTGFAGLVAGACSMAIGEFVSVYSQLDIESAQM  110

Query  182  KR-KKNRRNGedageeeeeesdvdeLPNPMQAAAASVVAFTMGAMVPLLAASFIKPYKVR  358
            KR K+   +G+   E + +  + + LPNP+QAA+AS ++F++GAMVPLLAASFI+ Y+ R
Sbjct  111  KRDKEGAADGQMDKEGDGDNGEEESLPNPLQAASASALSFSVGAMVPLLAASFIRSYRAR  170

Query  359  IGaviaavtvalvvcgwlgaalggapkgkaSVRVLIGGWLAMAITSGLTKLIG  517
            +GA+I A T+AL+  GW+GA LG AP  ++S+RVLIG WLAMAIT GLTKLIG
Sbjct  171  LGAMIVAATIALMAFGWIGAVLGKAPVLRSSLRVLIGAWLAMAITFGLTKLIG  223



>ref|XP_009587130.1| PREDICTED: vacuolar iron transporter homolog 4-like [Nicotiana 
tomentosiformis]
Length=220

 Score =   174 bits (440),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 108/172 (63%), Positives = 138/172 (80%), Gaps = 0/172 (0%)
 Frame = +2

Query  2    GANDGLVSIASLMMGVGTVKQDIKAMILTGFAGMVAGACSMAIGEFVSVYSQRDIEVAQM  181
            GANDGLVS ASLMMGVG V++++ AMILTGFAG+ AGACSMAIGEFVSVYSQ DIE+AQM
Sbjct  43   GANDGLVSTASLMMGVGAVQKNVNAMILTGFAGLFAGACSMAIGEFVSVYSQLDIELAQM  102

Query  182  KRKKNRRNGedageeeeeesdvdeLPNPMQAAAASVVAFTMGAMVPLLAASFIKPYKVRI  361
            KR K         ++++EE + ++LPNP QAA AS +AF++GA+VP+LAA+FI  +KVR+
Sbjct  103  KRDKTTEGQNQEHQQQQEEGNKEQLPNPFQAAVASAIAFSLGAIVPILAAAFIANHKVRL  162

Query  362  GaviaavtvalvvcgwlgaalggapkgkaSVRVLIGGWLAMAITSGLTKLIG  517
              ++AAV++AL+  G +GA LG +P  K+  RVLIGGW+AMAIT GLTKLIG
Sbjct  163  AVIVAAVSLALLAFGGIGAFLGRSPMLKSCARVLIGGWMAMAITFGLTKLIG  214



>ref|XP_009587128.1| PREDICTED: vacuolar iron transporter homolog 4-like [Nicotiana 
tomentosiformis]
Length=221

 Score =   173 bits (439),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 110/175 (63%), Positives = 142/175 (81%), Gaps = 3/175 (2%)
 Frame = +2

Query  2    GANDGLVSIASLMMGVGTVKQDIKAMILTGFAGMVAGACSMAIGEFVSVYSQRDIEVAQM  181
            GANDGLVS+ASLMMGVG V++++K MILTGFAG+ AGACSMAIGEFVSVYSQ DIE+AQM
Sbjct  41   GANDGLVSVASLMMGVGAVQENVKTMILTGFAGLFAGACSMAIGEFVSVYSQLDIELAQM  100

Query  182  KRKKNR---RNGedageeeeeesdvdeLPNPMQAAAASVVAFTMGAMVPLLAASFIKPYK  352
            KR+K     +N E   + +EEE + ++LPNP QAA AS +AF++GA+VP+LAA+FI  +K
Sbjct  101  KREKTTGGGQNQEHQHQHQEEEGNKEQLPNPFQAAGASSIAFSLGAIVPILAAAFIADHK  160

Query  353  VRIGaviaavtvalvvcgwlgaalggapkgkaSVRVLIGGWLAMAITSGLTKLIG  517
            VR+  ++AAV++AL+  G +GA LG +P  K+  RVLIGGW+AMAIT GLT+LIG
Sbjct  161  VRLAVIVAAVSLALLAFGGVGAFLGRSPMVKSCARVLIGGWMAMAITFGLTRLIG  215



>emb|CDX96601.1| BnaA08g21440D [Brassica napus]
Length=200

 Score =   172 bits (437),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 114/172 (66%), Positives = 134/172 (78%), Gaps = 12/172 (7%)
 Frame = +2

Query  2    GANDGLVSIASLMMGVGTVKQDIKAMILTGFAGMVAGACSMAIGEFVSVYSQRDIEVAQM  181
            GA DGLVS ASLMMGVG VK D K MILTGFAG+VAGACSMAIGEFVSVYSQ DIEVAQ+
Sbjct  37   GAIDGLVSTASLMMGVGAVKPDFKTMILTGFAGLVAGACSMAIGEFVSVYSQYDIEVAQI  96

Query  182  KRKKNRRNGedageeeeeesdvdeLPNPMQAAAASVVAFTMGAMVPLLAASFIKPYKVRI  361
            KR+               + + ++LPNPM AAAASV+AF +GA+VPLLAA+ +K Y+VR+
Sbjct  97   KREN------------AGDIEKEKLPNPMHAAAASVIAFFLGAVVPLLAAAPVKTYEVRV  144

Query  362  GaviaavtvalvvcgwlgaalggapkgkaSVRVLIGGWLAMAITSGLTKLIG  517
            G ++AAVT+ALV+ GWLGA LG  P  K+S RVLIGGWLAMAIT GLT+L G
Sbjct  145  GVIVAAVTLALVMFGWLGAVLGKTPVVKSSARVLIGGWLAMAITYGLTRLFG  196



>ref|XP_009772167.1| PREDICTED: vacuolar iron transporter homolog 4-like [Nicotiana 
sylvestris]
Length=218

 Score =   173 bits (438),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 107/172 (62%), Positives = 136/172 (79%), Gaps = 0/172 (0%)
 Frame = +2

Query  2    GANDGLVSIASLMMGVGTVKQDIKAMILTGFAGMVAGACSMAIGEFVSVYSQRDIEVAQM  181
            GANDGLVS ASLMMGVG V++++  MILTGFAG+ AGACSMAIGEFVSVYSQ DIE AQM
Sbjct  41   GANDGLVSTASLMMGVGAVQKNVNTMILTGFAGLFAGACSMAIGEFVSVYSQLDIERAQM  100

Query  182  KRKKNRRNGedageeeeeesdvdeLPNPMQAAAASVVAFTMGAMVPLLAASFIKPYKVRI  361
            KR K         + +++E + ++LPNP QAA AS +AF++GA+VP+LAA+FI  +KVR+
Sbjct  101  KRDKTTGGQNQKHQRQQDEGNKEQLPNPFQAAVASAIAFSLGAIVPILAAAFIADHKVRL  160

Query  362  GaviaavtvalvvcgwlgaalggapkgkaSVRVLIGGWLAMAITSGLTKLIG  517
            G ++AAV++AL+  G +GA LG +P  K+  RVLIGGW+AMAIT GLTKLIG
Sbjct  161  GVIVAAVSLALLAFGGIGAFLGRSPMLKSCARVLIGGWMAMAITFGLTKLIG  212



>ref|XP_009772168.1| PREDICTED: vacuolar iron transporter homolog 4-like [Nicotiana 
sylvestris]
Length=219

 Score =   172 bits (436),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 109/173 (63%), Positives = 141/173 (82%), Gaps = 1/173 (1%)
 Frame = +2

Query  2    GANDGLVSIASLMMGVGTVKQDIKAMILTGFAGMVAGACSMAIGEFVSVYSQRDIEVAQM  181
            GANDGLVS+ASLMMGVG V++++K MILTGFAG+ AGACSMAIGEFVSVYSQ DIE+AQM
Sbjct  41   GANDGLVSVASLMMGVGAVQENVKTMILTGFAGLFAGACSMAIGEFVSVYSQLDIELAQM  100

Query  182  KRKKNR-RNGedageeeeeesdvdeLPNPMQAAAASVVAFTMGAMVPLLAASFIKPYKVR  358
            KR K      ++  ++E EES+ ++LPNP QAA AS +AF++GA+VP+LAA+FI  +KVR
Sbjct  101  KRDKTTGGQNKEHQQQEVEESNKEQLPNPFQAAGASSIAFSLGAIVPILAAAFIADHKVR  160

Query  359  IGaviaavtvalvvcgwlgaalggapkgkaSVRVLIGGWLAMAITSGLTKLIG  517
            +  ++AAV++AL+  G +GA LG +P  K+  RVLIGGW+AMAIT GLT+LIG
Sbjct  161  LAVIVAAVSLALLAFGGVGAFLGRSPMVKSCARVLIGGWMAMAITFGLTRLIG  213



>ref|XP_002875612.1| hypothetical protein ARALYDRAFT_484806 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH51871.1| hypothetical protein ARALYDRAFT_484806 [Arabidopsis lyrata subsp. 
lyrata]
Length=190

 Score =   171 bits (434),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 120/172 (70%), Positives = 139/172 (81%), Gaps = 12/172 (7%)
 Frame = +2

Query  2    GANDGLVSIASLMMGVGTVKQDIKAMILTGFAGMVAGACSMAIGEFVSVYSQRDIEVAQM  181
            GANDGLVS ASLMMGVG VKQD+K MILTGFAG+VAGACSMAIGEFVSVYSQ DIEVAQM
Sbjct  24   GANDGLVSTASLMMGVGAVKQDVKIMILTGFAGLVAGACSMAIGEFVSVYSQYDIEVAQM  83

Query  182  KRKKNRRNGedageeeeeesdvdeLPNPMQAAAASVVAFTMGAMVPLLAASFIKPYKVRI  361
            KR+                 + ++LP+P QAAAAS +AF++GAMVPLLAA+F+K YKVRI
Sbjct  84   KRETGGE------------VEKEKLPSPTQAAAASALAFSLGAMVPLLAAAFVKEYKVRI  131

Query  362  GaviaavtvalvvcgwlgaalggapkgkaSVRVLIGGWLAMAITSGLTKLIG  517
            G ++AAVT+ALV+ GWLGA LG AP  K+S+RVL+GGWLAMAIT G TKLIG
Sbjct  132  GVIVAAVTLALVMFGWLGAVLGKAPVVKSSLRVLVGGWLAMAITFGFTKLIG  183



>ref|XP_004230629.1| PREDICTED: vacuolar iron transporter homolog 4 [Solanum lycopersicum]
Length=215

 Score =   172 bits (436),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 111/172 (65%), Positives = 136/172 (79%), Gaps = 4/172 (2%)
 Frame = +2

Query  2    GANDGLVSIASLMMGVGTVKQDIKAMILTGFAGMVAGACSMAIGEFVSVYSQRDIEVAQM  181
            GANDGLVSIASLMMGVG V++D+KAMIL GFAG+ AGACSMAIGEFVSVYSQ DIE AQM
Sbjct  41   GANDGLVSIASLMMGVGAVQKDVKAMILIGFAGLFAGACSMAIGEFVSVYSQLDIERAQM  100

Query  182  KRKKNRRNGedageeeeeesdvdeLPNPMQAAAASVVAFTMGAMVPLLAASFIKPYKVRI  361
            KR K          +E EE + ++LPNP QAA AS +AF++GA+VP+LAA+FI  +KVR+
Sbjct  101  KRDK----AAAGQNQEHEEGNKEQLPNPFQAAVASAIAFSLGAIVPILAAAFIANHKVRL  156

Query  362  GaviaavtvalvvcgwlgaalggapkgkaSVRVLIGGWLAMAITSGLTKLIG  517
              ++AAV++AL+  G +GA LG +P  K+  RVLIGGW+AMAIT GLTKLIG
Sbjct  157  AVIVAAVSLALLAFGGIGAFLGRSPMVKSCARVLIGGWMAMAITFGLTKLIG  208



>ref|XP_010241729.1| PREDICTED: vacuolar iron transporter homolog 4-like [Nelumbo 
nucifera]
Length=220

 Score =   172 bits (436),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 114/179 (64%), Positives = 140/179 (78%), Gaps = 18/179 (10%)
 Frame = +2

Query  2    GANDGLVSIASLMMGVGTVKQDIKAMILTGFAGMVAGACSMAIGEFVSVYSQRDIEVAQM  181
            GANDGLVS ASLMMG+G V+QDIKAMILTGFAG+VAGACSMAIGEFVSVYSQ DIE AQM
Sbjct  49   GANDGLVSTASLMMGIGAVRQDIKAMILTGFAGLVAGACSMAIGEFVSVYSQLDIERAQM  108

Query  182  KR-------KKNRRNGedageeeeeesdvdeLPNPMQAAAASVVAFTMGAMVPLLAASFI  340
            KR       ++++ +G           + + LP+P+QAAAAS +AF++GA+VPLLAASFI
Sbjct  109  KRVKATGDDRESKEDG-----------ETERLPSPIQAAAASALAFSVGAVVPLLAASFI  157

Query  341  KPYKVRIGaviaavtvalvvcgwlgaalggapkgkaSVRVLIGGWLAMAITSGLTKLIG  517
            K +KVR+G V A  ++AL+V G +GA LG AP  ++ +RVL+GGWLAMAIT GLTKLIG
Sbjct  158  KQHKVRLGVVAAVASLALLVFGGVGARLGRAPMVRSCLRVLVGGWLAMAITFGLTKLIG  216



>gb|KFK42096.1| hypothetical protein AALP_AA2G210100 [Arabis alpina]
Length=195

 Score =   171 bits (433),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 117/174 (67%), Positives = 139/174 (80%), Gaps = 13/174 (7%)
 Frame = +2

Query  2    GANDGLVSIASLMMGVGTVKQDIKAMILTGFAGMVAGACSMAIGEFVSVYSQRDIEVAQM  181
            GANDGLVS ASLMMGVG VK D+KAM+L+GFAGMVAGACSMAIGEFVSVYSQ DIEVAQM
Sbjct  33   GANDGLVSTASLMMGVGAVKHDVKAMLLSGFAGMVAGACSMAIGEFVSVYSQYDIEVAQM  92

Query  182  KRKKNRRNGedageeeeeesdvdeLPNPMQAAAASVVAFTMGAMVPLLAASFIKPYKVRI  361
            +R+               E + ++LP+P+QA+ AS +AF+ GA+VPLLAA F+K YKVRI
Sbjct  93   EREN-------------VEIEKEKLPSPLQASCASALAFSAGAIVPLLAAWFVKEYKVRI  139

Query  362  GaviaavtvalvvcgwlgaalggapkgkaSVRVLIGGWLAMAITSGLTKLIGIK  523
             AV+ AVT+ALVV GWLGAALG AP  ++S RVL+GGWLAMA+T GLTKLIG+ 
Sbjct  140  IAVVVAVTMALVVFGWLGAALGKAPVLRSSARVLLGGWLAMAVTFGLTKLIGLH  193



>ref|XP_002883588.1| hypothetical protein ARALYDRAFT_480028 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH59847.1| hypothetical protein ARALYDRAFT_480028 [Arabidopsis lyrata subsp. 
lyrata]
Length=219

 Score =   172 bits (435),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 107/172 (62%), Positives = 132/172 (77%), Gaps = 0/172 (0%)
 Frame = +2

Query  2    GANDGLVSIASLMMGVGTVKQDIKAMILTGFAGMVAGACSMAIGEFVSVYSQRDIEVAQM  181
            GANDGLV++ASLMMGVG++K+D+KAM+L GFAG+VAGACSMAIGEFVSV +QRDIE AQM
Sbjct  42   GANDGLVTVASLMMGVGSIKEDVKAMLLVGFAGLVAGACSMAIGEFVSVCTQRDIETAQM  101

Query  182  KRKKNRRNGedageeeeeesdvdeLPNPMQAAAASVVAFTMGAMVPLLAASFIKPYKVRI  361
            KR    +      +E+EEE   + LPNP QAA AS +AF++GA +PLLAA FI+ +KVR+
Sbjct  102  KRAIENKTSLSEIDEQEEEEKKERLPNPGQAAIASALAFSVGAAMPLLAAVFIENHKVRM  161

Query  362  GaviaavtvalvvcgwlgaalggapkgkaSVRVLIGGWLAMAITSGLTKLIG  517
              V    T+ALVV G  GA LG     K+SVRV+IGGW+AMA+T GLTK IG
Sbjct  162  VVVAIVATIALVVFGVTGAVLGKTSVAKSSVRVVIGGWMAMALTFGLTKFIG  213



>ref|NP_173538.2| vacuolar iron transporter homolog 1 [Arabidopsis thaliana]
 sp|Q9LPU9.1|VITH1_ARATH RecName: Full=Vacuolar iron transporter homolog 1; AltName: Full=Protein 
NODULIN-LIKE 1 [Arabidopsis thaliana]
 gb|AAF80647.1|AC012190_3 Contains similarity to Nodulin 21 from Soybean gb|X16488 [Arabidopsis 
thaliana]
 gb|AAO41881.1| putative tonoplast intrinsic protein, alpha (alpha-TIP) [Arabidopsis 
thaliana]
 gb|AAO50663.1| putative tonoplast intrinsic protein, alpha (alpha-TIP) [Arabidopsis 
thaliana]
 gb|AEE30069.1| vacuolar iron transporter homolog 1 [Arabidopsis thaliana]
Length=200

 Score =   171 bits (433),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 122/175 (70%), Positives = 144/175 (82%), Gaps = 12/175 (7%)
 Frame = +2

Query  2    GANDGLVSIASLMMGVGTVKQDIKAMILTGFAGMVAGACSMAIGEFVSVYSQRDIEVAQM  181
            GANDGLVS ASLMMGVG VKQD+K MIL+GFAG+VAGACSMAIGEFVSVYSQ DIEVAQM
Sbjct  37   GANDGLVSTASLMMGVGAVKQDVKVMILSGFAGLVAGACSMAIGEFVSVYSQYDIEVAQM  96

Query  182  KRKKNRRNGedageeeeeesdvdeLPNPMQAAAASVVAFTMGAMVPLLAASFIKPYKVRI  361
            KR+    NG         + + ++LP+PMQAAAAS +AF++GA+VPL+AA+F+K Y VRI
Sbjct  97   KRE----NG--------GQVEKEKLPSPMQAAAASALAFSLGAIVPLMAAAFVKDYHVRI  144

Query  362  GaviaavtvalvvcgwlgaalggapkgkaSVRVLIGGWLAMAITSGLTKLIGIKS  526
            GA++AAVT+ALV+ GWLGA LG AP  K+S RVLIGGWLAMA+T GLTKLIG  S
Sbjct  145  GAIVAAVTLALVMFGWLGAVLGKAPVFKSSARVLIGGWLAMAVTFGLTKLIGTHS  199



>ref|XP_002890428.1| hypothetical protein ARALYDRAFT_889570 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH66687.1| hypothetical protein ARALYDRAFT_889570 [Arabidopsis lyrata subsp. 
lyrata]
Length=200

 Score =   171 bits (432),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 122/175 (70%), Positives = 144/175 (82%), Gaps = 12/175 (7%)
 Frame = +2

Query  2    GANDGLVSIASLMMGVGTVKQDIKAMILTGFAGMVAGACSMAIGEFVSVYSQRDIEVAQM  181
            GANDGLVS ASLMMGVG VKQD+K MIL+GFAG+VAGACSMAIGEFVSVYSQ DIEVAQM
Sbjct  37   GANDGLVSTASLMMGVGAVKQDVKVMILSGFAGLVAGACSMAIGEFVSVYSQYDIEVAQM  96

Query  182  KRKKNRRNGedageeeeeesdvdeLPNPMQAAAASVVAFTMGAMVPLLAASFIKPYKVRI  361
            KR+    NG         + + ++LP+PMQAAAAS +AF++GA+VPL+AA+F+K Y VRI
Sbjct  97   KRE----NG--------GQVEKEKLPSPMQAAAASALAFSLGAIVPLMAAAFVKDYHVRI  144

Query  362  GaviaavtvalvvcgwlgaalggapkgkaSVRVLIGGWLAMAITSGLTKLIGIKS  526
            GA++AAVT+ALV+ GWLGA LG AP  K+S RVLIGGWLAMA+T GLTKLIG  S
Sbjct  145  GAIVAAVTLALVMFGWLGAVLGKAPVFKSSARVLIGGWLAMAVTFGLTKLIGTHS  199



>ref|NP_189949.1| protein nodulin-like3 [Arabidopsis thaliana]
 sp|Q9M2C3.1|VITH3_ARATH RecName: Full=Vacuolar iron transporter homolog 3; AltName: Full=Protein 
NODULIN-LIKE 3 [Arabidopsis thaliana]
 emb|CAB83064.1| nodulin-like protein [Arabidopsis thaliana]
 gb|AEE77815.1| protein nodulin-like3 [Arabidopsis thaliana]
Length=200

 Score =   171 bits (432),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 121/175 (69%), Positives = 141/175 (81%), Gaps = 12/175 (7%)
 Frame = +2

Query  2    GANDGLVSIASLMMGVGTVKQDIKAMILTGFAGMVAGACSMAIGEFVSVYSQRDIEVAQM  181
            GANDGLVS ASLMMGVG VKQ++K MILTGFAG+VAGACSMAIGEFVSVYSQ DIEVAQM
Sbjct  34   GANDGLVSTASLMMGVGAVKQNVKIMILTGFAGLVAGACSMAIGEFVSVYSQYDIEVAQM  93

Query  182  KRKKNRRNGedageeeeeesdvdeLPNPMQAAAASVVAFTMGAMVPLLAASFIKPYKVRI  361
            KR+                 + ++LP+P QAAAAS +AF++GAMVPLLAA+F+K YKVRI
Sbjct  94   KRETGGE------------IEKEKLPSPTQAAAASALAFSLGAMVPLLAAAFVKEYKVRI  141

Query  362  GaviaavtvalvvcgwlgaalggapkgkaSVRVLIGGWLAMAITSGLTKLIGIKS  526
            GA++AAVT+ALV+ GWLGA LG AP  K+S+RVL+GGWLAMAIT G TKLIG  S
Sbjct  142  GAIVAAVTLALVMFGWLGAVLGKAPVVKSSLRVLVGGWLAMAITYGFTKLIGSHS  196



>gb|KEH25837.1| vacuolar iron transporter-like protein [Medicago truncatula]
Length=210

 Score =   171 bits (432),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 123/172 (72%), Positives = 143/172 (83%), Gaps = 6/172 (3%)
 Frame = +2

Query  2    GANDGLVSIASLMMGVGTVKQDIKAMILTGFAGMVAGACSMAIGEFVSVYSQRDIEVAQM  181
            GANDGLVS ASLMMGVG VKQDIKAMILTGFAG+VAGACSMAIGEFVSVYSQ DIEVAQM
Sbjct  41   GANDGLVSTASLMMGVGAVKQDIKAMILTGFAGLVAGACSMAIGEFVSVYSQLDIEVAQM  100

Query  182  KRKKNRRNGedageeeeeesdvdeLPNPMQAAAASVVAFTMGAMVPLLAASFIKPYKVRI  361
            KR+K R      G E  ++ + + LPNP+QAAAAS +AF++GAMVPLLAA FI+ YKVR+
Sbjct  101  KREKER------GREINDDEEKESLPNPLQAAAASALAFSIGAMVPLLAAFFIRDYKVRV  154

Query  362  GaviaavtvalvvcgwlgaalggapkgkaSVRVLIGGWLAMAITSGLTKLIG  517
            G V+AAV+ AL+V GWLGA LG AP  ++ +RVL GGW+AM+IT GLTKLIG
Sbjct  155  GVVVAAVSFALLVFGWLGAVLGKAPIFRSVLRVLFGGWMAMSITFGLTKLIG  206



>ref|XP_010459823.1| PREDICTED: vacuolar iron transporter homolog 1 [Camelina sativa]
 ref|XP_010477375.1| PREDICTED: vacuolar iron transporter homolog 1 [Camelina sativa]
Length=200

 Score =   170 bits (431),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 122/175 (70%), Positives = 143/175 (82%), Gaps = 12/175 (7%)
 Frame = +2

Query  2    GANDGLVSIASLMMGVGTVKQDIKAMILTGFAGMVAGACSMAIGEFVSVYSQRDIEVAQM  181
            GANDGLVS ASLMMGVG VKQD+K MIL+GFAG+VAGACSMAIGEFVSVYSQ DIEVAQM
Sbjct  37   GANDGLVSTASLMMGVGAVKQDVKVMILSGFAGLVAGACSMAIGEFVSVYSQYDIEVAQM  96

Query  182  KRKKNRRNGedageeeeeesdvdeLPNPMQAAAASVVAFTMGAMVPLLAASFIKPYKVRI  361
            KR+    NG           + ++LP+PMQAAAAS +AF++GA+VPL+AA+FIK YKVRI
Sbjct  97   KRE----NG--------GHVEKEKLPSPMQAAAASALAFSLGAIVPLMAAAFIKEYKVRI  144

Query  362  GaviaavtvalvvcgwlgaalggapkgkaSVRVLIGGWLAMAITSGLTKLIGIKS  526
            GA++AAV++ALV+ GWLGA LG AP  K+S RVLIGGWLAM +T GLTKLIG  S
Sbjct  145  GAIVAAVSLALVMFGWLGAFLGKAPVLKSSSRVLIGGWLAMGVTFGLTKLIGSHS  199



>ref|XP_010477374.1| PREDICTED: vacuolar iron transporter homolog 1-like [Camelina 
sativa]
Length=200

 Score =   170 bits (431),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 122/175 (70%), Positives = 143/175 (82%), Gaps = 12/175 (7%)
 Frame = +2

Query  2    GANDGLVSIASLMMGVGTVKQDIKAMILTGFAGMVAGACSMAIGEFVSVYSQRDIEVAQM  181
            GANDGLVS ASLMMGVG VKQD+K MIL+GFAG+VAGACSMAIGEFVSVYSQ DIEVAQM
Sbjct  37   GANDGLVSTASLMMGVGAVKQDVKVMILSGFAGLVAGACSMAIGEFVSVYSQYDIEVAQM  96

Query  182  KRKKNRRNGedageeeeeesdvdeLPNPMQAAAASVVAFTMGAMVPLLAASFIKPYKVRI  361
            KR+    NG           + ++LP+PMQAAAAS +AF++GA+VPL+AA+FIK YKVRI
Sbjct  97   KRE----NG--------GHVEKEKLPSPMQAAAASALAFSLGAIVPLMAAAFIKEYKVRI  144

Query  362  GaviaavtvalvvcgwlgaalggapkgkaSVRVLIGGWLAMAITSGLTKLIGIKS  526
            GA++AAV++ALV+ GWLGA LG AP  K+S RVLIGGWLAM +T GLTKLIG  S
Sbjct  145  GAIVAAVSLALVMFGWLGAFLGKAPVLKSSSRVLIGGWLAMGVTFGLTKLIGSHS  199



>ref|XP_004140229.1| PREDICTED: vacuolar iron transporter homolog 4-like [Cucumis 
sativus]
 gb|KGN47924.1| hypothetical protein Csa_6G411280 [Cucumis sativus]
Length=196

 Score =   170 bits (431),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 104/174 (60%), Positives = 134/174 (77%), Gaps = 2/174 (1%)
 Frame = +2

Query  2    GANDGLVSIASLMMGVGTVKQDIKAMILTGFAGMVAGACSMAIGEFVSVYSQRDIEVAQM  181
            GANDGLVS+ASLMMGVG VK D KAM++ GFAG+VAGACSMAIGEFVSVY+Q DIE AQ+
Sbjct  23   GANDGLVSVASLMMGVGAVKPDAKAMLIAGFAGLVAGACSMAIGEFVSVYTQYDIEKAQL  82

Query  182  KRKKNRRNGedageeeeeesdvdeLPNPMQAAAASVVAFTMGAMVPLLAASFIKPYKVRI  361
            KR    +N     E      + ++LPNP+QAA AS +AF++GA++PL+AA FI+ +KVR+
Sbjct  83   KRNGKEKNN--NMEPNHPGEEEEKLPNPLQAALASAIAFSVGAVIPLVAAVFIRDHKVRL  140

Query  362  GaviaavtvalvvcgwlgaalggapkgkaSVRVLIGGWLAMAITSGLTKLIGIK  523
            G V A  ++ L+V G +GA LG  P GK++ RV++GGW+AMAIT GLTKL+G K
Sbjct  141  GVVAAVASLTLLVFGIVGAILGRTPVGKSAARVVVGGWMAMAITFGLTKLLGSK  194



>ref|XP_006351863.1| PREDICTED: vacuolar iron transporter homolog 4-like [Solanum 
tuberosum]
Length=215

 Score =   171 bits (432),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 111/172 (65%), Positives = 138/172 (80%), Gaps = 4/172 (2%)
 Frame = +2

Query  2    GANDGLVSIASLMMGVGTVKQDIKAMILTGFAGMVAGACSMAIGEFVSVYSQRDIEVAQM  181
            GANDGLVSIASLMMGVG V++D+KAMIL GFAG+ AGACSMAIGEFVSVYSQ DIE AQM
Sbjct  41   GANDGLVSIASLMMGVGAVQKDVKAMILIGFAGLFAGACSMAIGEFVSVYSQLDIERAQM  100

Query  182  KRKKNRRNGedageeeeeesdvdeLPNPMQAAAASVVAFTMGAMVPLLAASFIKPYKVRI  361
            KR  +R  G     +E EE + ++LPNP QAA AS +AF++GA+VP++AA+FI  +KVR+
Sbjct  101  KR--DRATG--GQNQEHEEGNKEQLPNPFQAAVASAIAFSLGAIVPIIAAAFIANHKVRL  156

Query  362  GaviaavtvalvvcgwlgaalggapkgkaSVRVLIGGWLAMAITSGLTKLIG  517
              ++AAV++AL+  G +GA LG +P  K+  RVLIGGW+AMAIT GLTKLIG
Sbjct  157  AVIVAAVSLALLAFGVIGAFLGRSPMVKSCARVLIGGWMAMAITFGLTKLIG  208



>ref|XP_008449417.1| PREDICTED: vacuolar iron transporter homolog 2.1-like [Cucumis 
melo]
Length=196

 Score =   170 bits (430),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 104/174 (60%), Positives = 136/174 (78%), Gaps = 2/174 (1%)
 Frame = +2

Query  2    GANDGLVSIASLMMGVGTVKQDIKAMILTGFAGMVAGACSMAIGEFVSVYSQRDIEVAQM  181
            GANDGLVS+ASLMMGVG VK D KAM++ GFAG+VAGACSMAIGEFVSVY+Q DIE AQ+
Sbjct  23   GANDGLVSVASLMMGVGAVKPDAKAMLIAGFAGLVAGACSMAIGEFVSVYTQYDIEKAQL  82

Query  182  KRKKNRRNGedageeeeeesdvdeLPNPMQAAAASVVAFTMGAMVPLLAASFIKPYKVRI  361
            KR    +N     E ++   + ++LPNP+QAA AS +AF++GA++PL+AA FI+ +KVR+
Sbjct  83   KRNGKEKNN--NMEPKQPGEEEEKLPNPLQAALASAIAFSVGAVIPLVAAVFIRDHKVRL  140

Query  362  GaviaavtvalvvcgwlgaalggapkgkaSVRVLIGGWLAMAITSGLTKLIGIK  523
            G V A  ++ L+V G +GA LG  P GK++ RV++GGW+AMAIT GLTKL+G K
Sbjct  141  GVVAAVASLTLLVFGIVGAILGRTPVGKSAARVVVGGWMAMAITFGLTKLLGSK  194



>ref|XP_004230639.1| PREDICTED: vacuolar iron transporter homolog 4-like [Solanum 
lycopersicum]
Length=205

 Score =   170 bits (431),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 106/172 (62%), Positives = 135/172 (78%), Gaps = 9/172 (5%)
 Frame = +2

Query  2    GANDGLVSIASLMMGVGTVKQDIKAMILTGFAGMVAGACSMAIGEFVSVYSQRDIEVAQM  181
            GANDGLVS+ASLMMGVG V++++K MI+TGFAG+ AGACSMAIGEFVSVYSQ DIE AQM
Sbjct  37   GANDGLVSVASLMMGVGAVQENVKTMIITGFAGLFAGACSMAIGEFVSVYSQLDIERAQM  96

Query  182  KRKKNRRNGedageeeeeesdvdeLPNPMQAAAASVVAFTMGAMVPLLAASFIKPYKVRI  361
            KR K  R          ++ + ++LPNP QAA AS +AF++GA+VP+LAA+FI  +K+R+
Sbjct  97   KRDKATRG---------QDREHEQLPNPFQAAVASSIAFSLGAIVPILAAAFIANHKLRL  147

Query  362  GaviaavtvalvvcgwlgaalggapkgkaSVRVLIGGWLAMAITSGLTKLIG  517
              ++AAV++ALV  G +GA LG +P  K+  RVLIGGW+AMAIT GLTKLIG
Sbjct  148  AVIVAAVSLALVAFGGMGAFLGRSPMMKSCARVLIGGWMAMAITFGLTKLIG  199



>ref|XP_008461513.1| PREDICTED: vacuolar iron transporter homolog 2-like [Cucumis 
melo]
Length=217

 Score =   171 bits (432),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 117/172 (68%), Positives = 139/172 (81%), Gaps = 7/172 (4%)
 Frame = +2

Query  2    GANDGLVSIASLMMGVGTVKQDIKAMILTGFAGMVAGACSMAIGEFVSVYSQRDIEVAQM  181
            GANDGLVS ASLMMGVG VK D+KAMILTGFAG++AGACSMAIGEFVSVYSQ DIE+A +
Sbjct  49   GANDGLVSTASLMMGVGAVKHDVKAMILTGFAGLIAGACSMAIGEFVSVYSQLDIEMAHI  108

Query  182  KRKKNRRNGedageeeeeesdvdeLPNPMQAAAASVVAFTMGAMVPLLAASFIKPYKVRI  361
            KR  +         +E EE + ++LPNP+QAA AS +AF+ GA+VPLLAA+FI+ Y+VR+
Sbjct  109  KRSSDH-------RKELEEEEREKLPNPLQAATASALAFSTGAIVPLLAAAFIREYRVRL  161

Query  362  GaviaavtvalvvcgwlgaalggapkgkaSVRVLIGGWLAMAITSGLTKLIG  517
            G V+ AVTVALV  GWLGAALG AP  ++ VRVLIGGW AMA+T GLTKLIG
Sbjct  162  GVVVVAVTVALVGFGWLGAALGKAPTVRSVVRVLIGGWAAMAVTFGLTKLIG  213



>ref|XP_006351864.1| PREDICTED: vacuolar iron transporter homolog 3-like [Solanum 
tuberosum]
Length=210

 Score =   169 bits (428),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 109/177 (62%), Positives = 136/177 (77%), Gaps = 14/177 (8%)
 Frame = +2

Query  2    GANDGLVSIASLMMGVGTVKQDIKAMILTGFAGMVAGACSMAIGEFVSVYSQRDIEVAQM  181
            GANDGLVS+ASLMMGVG V++++K MI+TGFAG+ AGACSMAIGEFVSVYSQ DIE AQM
Sbjct  37   GANDGLVSVASLMMGVGAVQENVKTMIITGFAGLFAGACSMAIGEFVSVYSQLDIERAQM  96

Query  182  KRKK-----NRRNGedageeeeeesdvdeLPNPMQAAAASVVAFTMGAMVPLLAASFIKP  346
             R K     NR +         EE + ++LPNP QAA AS +AF++GA+VP+LAA+FI  
Sbjct  97   NRDKATGGQNREH---------EEGNKEQLPNPFQAAGASSIAFSLGAIVPILAAAFIAN  147

Query  347  YKVRIGaviaavtvalvvcgwlgaalggapkgkaSVRVLIGGWLAMAITSGLTKLIG  517
            +KVR+  ++AAV++ALV  G +GA LG +P  K+  RVLIGGW+AMAIT GLTKLIG
Sbjct  148  HKVRLAVIVAAVSLALVAFGVIGAFLGRSPIVKSCARVLIGGWMAMAITFGLTKLIG  204



>emb|CDX88318.1| BnaC06g37620D [Brassica napus]
Length=194

 Score =   169 bits (427),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 118/173 (68%), Positives = 139/173 (80%), Gaps = 13/173 (8%)
 Frame = +2

Query  2    GANDGLVSIASLMMGVGTVKQDIKAMILTGFAGMVAGACSMAIGEFVSVYSQRDIEVAQM  181
            GANDGLVS ASLMMGVG VK D+KAMIL+GFAGMVAGACSMAIGEFVSVYSQ DIEVAQM
Sbjct  32   GANDGLVSTASLMMGVGAVKHDVKAMILSGFAGMVAGACSMAIGEFVSVYSQYDIEVAQM  91

Query  182  KRKKNRRNGedageeeeeesdvdeLPNPMQAAAASVVAFTMGAMVPLLAASFIKPYKVRI  361
            +R+                 + ++LP+P+QAAAAS +AF++GA+VPLLAA+F+K Y+VRI
Sbjct  92   ERESGE-------------VEKEKLPSPLQAAAASALAFSVGAIVPLLAAAFVKEYRVRI  138

Query  362  GaviaavtvalvvcgwlgaalggapkgkaSVRVLIGGWLAMAITSGLTKLIGI  520
             AV+ AVTVALV  GWLGAALG AP  ++S RVL GGWLAMA+T GLTKLIG+
Sbjct  139  IAVVTAVTVALVGFGWLGAALGKAPAVRSSARVLFGGWLAMAVTFGLTKLIGL  191



>ref|XP_009106345.1| PREDICTED: vacuolar iron transporter homolog 2-like [Brassica 
rapa]
Length=194

 Score =   168 bits (426),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 118/173 (68%), Positives = 139/173 (80%), Gaps = 13/173 (8%)
 Frame = +2

Query  2    GANDGLVSIASLMMGVGTVKQDIKAMILTGFAGMVAGACSMAIGEFVSVYSQRDIEVAQM  181
            GANDGLVS ASLMMGVG VK D+KAMIL+GFAGMVAGACSMAIGEFVSVYSQ DIEVAQM
Sbjct  32   GANDGLVSTASLMMGVGAVKHDVKAMILSGFAGMVAGACSMAIGEFVSVYSQYDIEVAQM  91

Query  182  KRKKNRRNGedageeeeeesdvdeLPNPMQAAAASVVAFTMGAMVPLLAASFIKPYKVRI  361
            +R+                 + ++LP+P+QAAAAS +AF++GA+VPLLAA+F+K Y+VRI
Sbjct  92   ERESGE-------------VEKEKLPSPLQAAAASALAFSVGAIVPLLAAAFVKEYRVRI  138

Query  362  GaviaavtvalvvcgwlgaalggapkgkaSVRVLIGGWLAMAITSGLTKLIGI  520
             AV+ AVTVALV  GWLGAALG AP  ++S RVL GGWLAMA+T GLTKLIG+
Sbjct  139  IAVVTAVTVALVGFGWLGAALGKAPAVRSSARVLFGGWLAMAVTFGLTKLIGL  191



>ref|XP_006291836.1| hypothetical protein CARUB_v10018010mg, partial [Capsella rubella]
 gb|EOA24734.1| hypothetical protein CARUB_v10018010mg, partial [Capsella rubella]
Length=214

 Score =   169 bits (427),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 121/172 (70%), Positives = 140/172 (81%), Gaps = 10/172 (6%)
 Frame = +2

Query  2    GANDGLVSIASLMMGVGTVKQDIKAMILTGFAGMVAGACSMAIGEFVSVYSQRDIEVAQM  181
            GANDGLVS ASLMMGVG VKQDIK MILTGFAG+VAGACSMAIGEFVSVYSQ DIE AQM
Sbjct  46   GANDGLVSTASLMMGVGAVKQDIKIMILTGFAGLVAGACSMAIGEFVSVYSQYDIEKAQM  105

Query  182  KRKKNRRNGedageeeeeesdvdeLPNPMQAAAASVVAFTMGAMVPLLAASFIKPYKVRI  361
            KR + R            E++ ++LP+P QAAAAS +AF++GA+VPLLAA+F+K YKVRI
Sbjct  106  KRDQTRGG----------EAEKEKLPSPTQAAAASALAFSLGAVVPLLAAAFVKEYKVRI  155

Query  362  GaviaavtvalvvcgwlgaalggapkgkaSVRVLIGGWLAMAITSGLTKLIG  517
            G ++AAVT+ALV+ GWLGA LG AP  K+S+RVLIGGWLAM IT G TKLIG
Sbjct  156  GVIVAAVTLALVMFGWLGAVLGKAPVVKSSLRVLIGGWLAMVITFGFTKLIG  207



>ref|XP_007159063.1| hypothetical protein PHAVU_002G205100g [Phaseolus vulgaris]
 gb|ESW31057.1| hypothetical protein PHAVU_002G205100g [Phaseolus vulgaris]
Length=221

 Score =   169 bits (428),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 105/172 (61%), Positives = 135/172 (78%), Gaps = 4/172 (2%)
 Frame = +2

Query  2    GANDGLVSIASLMMGVGTVKQDIKAMILTGFAGMVAGACSMAIGEFVSVYSQRDIEVAQM  181
            GANDGLVS+ASLMMGVG VK+DI AM++ GFAG+VAGACSMAIGEFVSVY+Q DIE+ Q+
Sbjct  50   GANDGLVSVASLMMGVGAVKKDIGAMLVAGFAGLVAGACSMAIGEFVSVYTQYDIEMNQL  109

Query  182  KRKKNRRNGedageeeeeesdvdeLPNPMQAAAASVVAFTMGAMVPLLAASFIKPYKVRI  361
            KR++   N        + E   ++LPNP QAA AS +AF++GA+VP+LAA F++ +K+R+
Sbjct  110  KREREANNN----GGVDGEPKREKLPNPFQAAVASALAFSVGALVPMLAAGFMRSHKIRM  165

Query  362  GaviaavtvalvvcgwlgaalggapkgkaSVRVLIGGWLAMAITSGLTKLIG  517
            G + AAVT+AL+V G +GA LG  P  K+  RVLIGGW+AMAIT GLTKL+G
Sbjct  166  GVIAAAVTLALLVFGGVGAVLGKTPVKKSCFRVLIGGWMAMAITFGLTKLVG  217



>ref|XP_006416327.1| hypothetical protein EUTSA_v10008583mg [Eutrema salsugineum]
 gb|ESQ34680.1| hypothetical protein EUTSA_v10008583mg [Eutrema salsugineum]
Length=248

 Score =   169 bits (429),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 118/172 (69%), Positives = 140/172 (81%), Gaps = 11/172 (6%)
 Frame = +2

Query  2    GANDGLVSIASLMMGVGTVKQDIKAMILTGFAGMVAGACSMAIGEFVSVYSQRDIEVAQM  181
            GANDGLVS ASLMMGVG VKQD+K MIL+GFAG+VAGACSMAIGEFVSVYSQ DIEVAQM
Sbjct  84   GANDGLVSTASLMMGVGAVKQDVKTMILSGFAGLVAGACSMAIGEFVSVYSQYDIEVAQM  143

Query  182  KRKKNRRNGedageeeeeesdvdeLPNPMQAAAASVVAFTMGAMVPLLAASFIKPYKVRI  361
            KR+    +            + ++LP+PMQAAAAS +AF++GA+VPLLAA+F+K Y VR+
Sbjct  144  KRESGGED-----------IEKEKLPSPMQAAAASALAFSLGAIVPLLAAAFVKDYNVRL  192

Query  362  GaviaavtvalvvcgwlgaalggapkgkaSVRVLIGGWLAMAITSGLTKLIG  517
            G ++AAVT+ALV+ GWLGA LG AP  K+S RVLIGGWLAMA+T GLTKLIG
Sbjct  193  GVIVAAVTLALVMFGWLGAVLGKAPVVKSSARVLIGGWLAMAVTFGLTKLIG  244



>ref|XP_010245271.1| PREDICTED: vacuolar iron transporter homolog 4-like [Nelumbo 
nucifera]
Length=224

 Score =   169 bits (427),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 120/174 (69%), Positives = 145/174 (83%), Gaps = 2/174 (1%)
 Frame = +2

Query  2    GANDGLVSIASLMMGVGTVKQDIKAMILTGFAGMVAGACSMAIGEFVSVYSQRDIEVAQM  181
            GANDGLVS ASLMMG+G+VK D KAMILTGFAG+VAGACSMAIGEFVSVYSQ DIEVAQ+
Sbjct  47   GANDGLVSTASLMMGIGSVKDDAKAMILTGFAGLVAGACSMAIGEFVSVYSQVDIEVAQL  106

Query  182  KRKKN-RRNGe-dageeeeeesdvdeLPNPMQAAAASVVAFTMGAMVPLLAASFIKPYKV  355
            KR+K   R+G  +  EEEEE   V +LP+P+QAA AS +AF+ GA++PLLAA+F+K +KV
Sbjct  107  KRQKRMSRDGVENEEEEEEEREKVVQLPSPVQAALASALAFSAGAVLPLLAAAFLKEWKV  166

Query  356  RIGaviaavtvalvvcgwlgaalggapkgkaSVRVLIGGWLAMAITSGLTKLIG  517
            R+G V+   ++AL+V G +GA LG AP G++SVRVL GGWLAMAITSGLTKLIG
Sbjct  167  RLGVVVGVASLALLVFGVVGAVLGRAPVGRSSVRVLTGGWLAMAITSGLTKLIG  220



>ref|XP_006303183.1| hypothetical protein CARUB_v10010334mg [Capsella rubella]
 gb|EOA36081.1| hypothetical protein CARUB_v10010334mg [Capsella rubella]
Length=200

 Score =   168 bits (425),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 121/175 (69%), Positives = 143/175 (82%), Gaps = 12/175 (7%)
 Frame = +2

Query  2    GANDGLVSIASLMMGVGTVKQDIKAMILTGFAGMVAGACSMAIGEFVSVYSQRDIEVAQM  181
            GANDGLVS ASLMMGVG VKQD+K MIL+GFAG+VAGACSMAIGEFVSVYSQ DIEVAQM
Sbjct  37   GANDGLVSTASLMMGVGAVKQDVKVMILSGFAGLVAGACSMAIGEFVSVYSQYDIEVAQM  96

Query  182  KRKKNRRNGedageeeeeesdvdeLPNPMQAAAASVVAFTMGAMVPLLAASFIKPYKVRI  361
            KR+    NG           + ++LP+PMQAAAAS +AF++GA+VPL+AA+F+K YKVRI
Sbjct  97   KRE----NG--------GHVEKEKLPSPMQAAAASALAFSLGAIVPLMAAAFLKDYKVRI  144

Query  362  GaviaavtvalvvcgwlgaalggapkgkaSVRVLIGGWLAMAITSGLTKLIGIKS  526
            GA++AAVT+ALV+ GWLGA LG AP  K++ RVLIGGWLAM +T GLTKLIG  S
Sbjct  145  GAIVAAVTLALVMFGWLGAVLGKAPVLKSASRVLIGGWLAMGVTFGLTKLIGSHS  199



>ref|XP_007206311.1| hypothetical protein PRUPE_ppa024883mg, partial [Prunus persica]
 gb|EMJ07510.1| hypothetical protein PRUPE_ppa024883mg, partial [Prunus persica]
Length=229

 Score =   169 bits (427),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 111/172 (65%), Positives = 133/172 (77%), Gaps = 0/172 (0%)
 Frame = +2

Query  2    GANDGLVSIASLMMGVGTVKQDIKAMILTGFAGMVAGACSMAIGEFVSVYSQRDIEVAQM  181
            GANDGLVS+ASLMMGVG VKQD+KAM+L GFAG+VAGACSMAIGEFVSVY+Q DIEV+QM
Sbjct  52   GANDGLVSVASLMMGVGAVKQDVKAMLLAGFAGLVAGACSMAIGEFVSVYTQYDIEVSQM  111

Query  182  KRKKNRRNGedageeeeeesdvdeLPNPMQAAAASVVAFTMGAMVPLLAASFIKPYKVRI  361
            KR + R NG      +E +    +LPNP QAA AS +AF++GA+VPLL A+FI  +KVR+
Sbjct  112  KRDETRTNGAATENAQEAKKKKLQLPNPAQAAMASAIAFSIGAVVPLLGAAFISEHKVRL  171

Query  362  GaviaavtvalvvcgwlgaalggapkgkaSVRVLIGGWLAMAITSGLTKLIG  517
              V+   TVALVV G +GA LG     K+  RVL+GGW+AMAIT GLTKLIG
Sbjct  172  AVVVVLATVALVVFGGVGARLGRTSMMKSCARVLVGGWMAMAITFGLTKLIG  223



>ref|XP_010260918.1| PREDICTED: vacuolar iron transporter homolog 4-like [Nelumbo 
nucifera]
Length=226

 Score =   168 bits (426),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 115/172 (67%), Positives = 138/172 (80%), Gaps = 5/172 (3%)
 Frame = +2

Query  2    GANDGLVSIASLMMGVGTVKQDIKAMILTGFAGMVAGACSMAIGEFVSVYSQRDIEVAQM  181
            GANDGLVS ASLMMGVG V+ DIKAMILTGF+G++AGACSMAIGEFVSVYSQ DIE+AQ+
Sbjct  56   GANDGLVSTASLMMGVGAVRHDIKAMILTGFSGLIAGACSMAIGEFVSVYSQLDIEMAQI  115

Query  182  KRKKNRRNGedageeeeeesdvdeLPNPMQAAAASVVAFTMGAMVPLLAASFIKPYKVRI  361
            KR K   N       ++EE   + LPNP+QAAAAS  AF++GA+VPLLAA F++ YKVR+
Sbjct  116  KRMKESVNN-----GDQEERTTERLPNPIQAAAASAFAFSVGALVPLLAALFVREYKVRL  170

Query  362  GaviaavtvalvvcgwlgaalggapkgkaSVRVLIGGWLAMAITSGLTKLIG  517
            G V AA ++AL+V G +GA LG AP  ++ +RVLIGGWLAMAIT GLTKLIG
Sbjct  171  GVVSAAASLALLVFGGVGAVLGRAPVVRSCLRVLIGGWLAMAITFGLTKLIG  222



>emb|CDO97494.1| unnamed protein product [Coffea canephora]
Length=216

 Score =   167 bits (424),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 111/171 (65%), Positives = 136/171 (80%), Gaps = 4/171 (2%)
 Frame = +2

Query  2    GANDGLVSIASLMMGVGTVKQDIKAMILTGFAGMVAGACSMAIGEFVSVYSQRDIEVAQM  181
            GANDGLVSIASLMMGVG VK D+KAMILTGFAG+VAGACSMAIGEFVSVYSQ +IEVAQ+
Sbjct  43   GANDGLVSIASLMMGVGAVKTDVKAMILTGFAGLVAGACSMAIGEFVSVYSQLEIEVAQI  102

Query  182  KRKKNRRNGedageeeeeesdvdeLPNPMQAAAASVVAFTMGAMVPLLAASFIKPYKVRI  361
            KR+           ++EE++  + LPNP+ AA AS +AF++GA+VPLLAA+FI  +KVR+
Sbjct  103  KRETE----MIETGQDEEKNKKENLPNPLSAAMASGLAFSLGAIVPLLAAAFIGDHKVRL  158

Query  362  GaviaavtvalvvcgwlgaalggapkgkaSVRVLIGGWLAMAITSGLTKLI  514
             A+I AV++AL+V GW+GA LG A   K   R LIGGW+AMAIT G+TKLI
Sbjct  159  AAIITAVSLALLVFGWVGAVLGKASVTKNCARALIGGWMAMAITFGMTKLI  209



>ref|XP_006351865.1| PREDICTED: vacuolar iron transporter homolog 4-like [Solanum 
tuberosum]
Length=210

 Score =   167 bits (423),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 107/172 (62%), Positives = 136/172 (79%), Gaps = 4/172 (2%)
 Frame = +2

Query  2    GANDGLVSIASLMMGVGTVKQDIKAMILTGFAGMVAGACSMAIGEFVSVYSQRDIEVAQM  181
            GANDGLVSIASLMMGVG V++++K M+LTGFAG+ AGACSMAIGEFVSVYSQ DIE AQ+
Sbjct  37   GANDGLVSIASLMMGVGAVQENVKTMMLTGFAGLFAGACSMAIGEFVSVYSQLDIERAQI  96

Query  182  KRKKNRRNGedageeeeeesdvdeLPNPMQAAAASVVAFTMGAMVPLLAASFIKPYKVRI  361
            KR K  R        E EE + ++LPNP QAA AS +AF++GA+VP+LAA+ I+ ++VR+
Sbjct  97   KRDKATRG----QNREHEEGNKEQLPNPFQAAVASSIAFSLGAIVPILAAALIENHEVRL  152

Query  362  GaviaavtvalvvcgwlgaalggapkgkaSVRVLIGGWLAMAITSGLTKLIG  517
              ++AAV++AL+  G +GA LG +P  K+  RVLIGGW+AMAIT GLTKLIG
Sbjct  153  AVIVAAVSLALLAFGGIGAFLGRSPMVKSCARVLIGGWMAMAITFGLTKLIG  204



>gb|KDP43005.1| hypothetical protein JCGZ_25191 [Jatropha curcas]
Length=226

 Score =   167 bits (424),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 127/172 (74%), Positives = 149/172 (87%), Gaps = 1/172 (1%)
 Frame = +2

Query  2    GANDGLVSIASLMMGVGTVKQDIKAMILTGFAGMVAGACSMAIGEFVSVYSQRDIEVAQM  181
            GANDGLVS ASLMMGVG VKQDIK+MILTGFAG+VAGACSMAIGEFVSVYSQ DIE+AQM
Sbjct  52   GANDGLVSTASLMMGVGAVKQDIKSMILTGFAGLVAGACSMAIGEFVSVYSQLDIELAQM  111

Query  182  KRKKNRRNGedageeeeeesdvdeLPNPMQAAAASVVAFTMGAMVPLLAASFIKPYKVRI  361
            KRK+  + GED   +E+EE + ++LPNP+QAAAAS +AF++GAMVPLLAASFI+ YKVR+
Sbjct  112  KRKR-EKEGEDRNGQEDEEEEKEKLPNPLQAAAASALAFSVGAMVPLLAASFIRNYKVRL  170

Query  362  GaviaavtvalvvcgwlgaalggapkgkaSVRVLIGGWLAMAITSGLTKLIG  517
            GAV+  V +ALVV GWLGA LG AP  ++SVRVL+GG +AMAIT GLTKLIG
Sbjct  171  GAVVGTVGLALVVFGWLGAVLGKAPVVRSSVRVLVGGLIAMAITFGLTKLIG  222



>emb|CDY71883.1| BnaCnng74920D [Brassica napus]
Length=200

 Score =   167 bits (422),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 120/172 (70%), Positives = 142/172 (83%), Gaps = 12/172 (7%)
 Frame = +2

Query  2    GANDGLVSIASLMMGVGTVKQDIKAMILTGFAGMVAGACSMAIGEFVSVYSQRDIEVAQM  181
            GANDGLVS ASLMMGVG VK DIK M+L+GFAG+VAGACSMAIGEFVSVYSQ DIEVAQM
Sbjct  37   GANDGLVSTASLMMGVGAVKGDIKTMMLSGFAGLVAGACSMAIGEFVSVYSQYDIEVAQM  96

Query  182  KRKKNRRNGedageeeeeesdvdeLPNPMQAAAASVVAFTMGAMVPLLAASFIKPYKVRI  361
            KR+    NG         E + ++LP+PMQAAAAS +AF++GA+VPLLAA+F+K YKVR+
Sbjct  97   KRE----NG--------GEIEKEKLPSPMQAAAASALAFSLGAIVPLLAAAFVKEYKVRV  144

Query  362  GaviaavtvalvvcgwlgaalggapkgkaSVRVLIGGWLAMAITSGLTKLIG  517
            G ++AAVT+ALV+ GWLGA LG AP  K+S RVLIGGWLAMA+T GLTKL+G
Sbjct  145  GVILAAVTLALVMFGWLGAVLGKAPVVKSSARVLIGGWLAMAVTFGLTKLVG  196



>ref|XP_010680575.1| PREDICTED: vacuolar iron transporter homolog 2-like [Beta vulgaris 
subsp. vulgaris]
Length=222

 Score =   167 bits (423),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 121/172 (70%), Positives = 140/172 (81%), Gaps = 3/172 (2%)
 Frame = +2

Query  2    GANDGLVSIASLMMGVGTVKQDIKAMILTGFAGMVAGACSMAIGEFVSVYSQRDIEVAQM  181
            GANDGLVS A+LMMGVG VKQD+KAMILTGFAG+VAGACSMAIGEFVSVYSQ DIEVAQM
Sbjct  50   GANDGLVSTAALMMGVGAVKQDVKAMILTGFAGLVAGACSMAIGEFVSVYSQLDIEVAQM  109

Query  182  KRKKNRRNGedageeeeeesdvdeLPNPMQAAAASVVAFTMGAMVPLLAASFIKPYKVRI  361
             R+K +       E+EE   D + LPNP+QAA AS +AF++GA+VPLLAASFIK YKVR+
Sbjct  110  NREKIKEGD---KEKEEGRGDEENLPNPLQAAFASALAFSIGAIVPLLAASFIKDYKVRL  166

Query  362  GaviaavtvalvvcgwlgaalggapkgkaSVRVLIGGWLAMAITSGLTKLIG  517
              V+ AVT AL + GWLGA LG A   ++S+RVL+GGWLAMAIT GLTKLIG
Sbjct  167  AVVVVAVTAALAMFGWLGAFLGKASLVRSSLRVLLGGWLAMAITFGLTKLIG  218



>ref|XP_008246515.1| PREDICTED: vacuolar iron transporter homolog 4-like [Prunus mume]
Length=234

 Score =   167 bits (423),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 110/172 (64%), Positives = 132/172 (77%), Gaps = 0/172 (0%)
 Frame = +2

Query  2    GANDGLVSIASLMMGVGTVKQDIKAMILTGFAGMVAGACSMAIGEFVSVYSQRDIEVAQM  181
            GANDGLVS+ASLMMGVG VKQD+KAM+L GFAG+VAGACSMAIGEFVSVY+Q DIEV+QM
Sbjct  57   GANDGLVSVASLMMGVGAVKQDVKAMLLAGFAGLVAGACSMAIGEFVSVYTQYDIEVSQM  116

Query  182  KRKKNRRNGedageeeeeesdvdeLPNPMQAAAASVVAFTMGAMVPLLAASFIKPYKVRI  361
            KR + R NG      +E +     LPNP QAA AS +AF++GA+VPLL A+FI  +KVR+
Sbjct  117  KRDEMRTNGAATENAQEAKKKKLLLPNPAQAAMASAIAFSIGAVVPLLGAAFISEHKVRL  176

Query  362  GaviaavtvalvvcgwlgaalggapkgkaSVRVLIGGWLAMAITSGLTKLIG  517
              V+   +VALVV G +GA LG     K+  RVL+GGW+AMAIT GLTKLIG
Sbjct  177  AVVVVLASVALVVFGGVGARLGRTSMMKSCARVLVGGWMAMAITFGLTKLIG  228



>ref|XP_009103303.1| PREDICTED: vacuolar iron transporter homolog 1 [Brassica rapa]
Length=200

 Score =   166 bits (420),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 119/172 (69%), Positives = 142/172 (83%), Gaps = 12/172 (7%)
 Frame = +2

Query  2    GANDGLVSIASLMMGVGTVKQDIKAMILTGFAGMVAGACSMAIGEFVSVYSQRDIEVAQM  181
            GANDGLVS ASLMMGVG VK D+K M+L+GFAG+VAGACSMAIGEFVSVYSQ DIEVAQM
Sbjct  37   GANDGLVSTASLMMGVGAVKGDVKTMMLSGFAGLVAGACSMAIGEFVSVYSQYDIEVAQM  96

Query  182  KRKKNRRNGedageeeeeesdvdeLPNPMQAAAASVVAFTMGAMVPLLAASFIKPYKVRI  361
            KR+    NG         E + ++LP+PMQAAAAS +AF++GA+VPLLAA+F+K YKVR+
Sbjct  97   KRE----NG--------GEIEKEKLPSPMQAAAASALAFSLGAIVPLLAAAFVKEYKVRV  144

Query  362  GaviaavtvalvvcgwlgaalggapkgkaSVRVLIGGWLAMAITSGLTKLIG  517
            G ++AAVT+ALV+ GWLGA LG AP  K+S RVLIGGWLAMA+T GLTKL+G
Sbjct  145  GVILAAVTLALVMFGWLGAVLGKAPVVKSSARVLIGGWLAMAVTFGLTKLVG  196



>ref|XP_009606689.1| PREDICTED: vacuolar iron transporter homolog 1-like [Nicotiana 
tomentosiformis]
Length=219

 Score =   166 bits (420),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 114/173 (66%), Positives = 136/173 (79%), Gaps = 7/173 (4%)
 Frame = +2

Query  2    GANDGLVSIASLMMGVGTVKQDIKAMILTGFAGMVAGACSMAIGEFVSVYSQRDIEVAQM  181
            GANDGL+S +SLMMG+G VKQD KAMILTG AG+VAGACSMAIGEFVSVYSQ DIEV+QM
Sbjct  49   GANDGLLSTSSLMMGIGAVKQDAKAMILTGIAGLVAGACSMAIGEFVSVYSQYDIEVSQM  108

Query  182  KRKKNRRNGedageeeeeesdvdeLPNPMQAAAASVVAFTMGAMVPLLAASFIKPYKVRI  361
            KR+ N           E E    +LP+P+QAAAAS  AF +GA+VPLLAA+F+K Y VR+
Sbjct  109  KRENN-------ASTHELEEKKKKLPSPLQAAAASAFAFAIGAIVPLLAAAFVKDYHVRL  161

Query  362  GaviaavtvalvvcgwlgaalggapkgkaSVRVLIGGWLAMAITSGLTKLIGI  520
            G V+AAV+ AL++ G LGA LG AP  K+S+RVLIGGWLAM IT GLTKL+G+
Sbjct  162  GIVVAAVSFALLMFGGLGAYLGNAPLMKSSLRVLIGGWLAMGITFGLTKLVGV  214



>ref|XP_008781394.1| PREDICTED: vacuolar iron transporter homolog 4-like [Phoenix 
dactylifera]
Length=205

 Score =   166 bits (419),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 109/172 (63%), Positives = 130/172 (76%), Gaps = 8/172 (5%)
 Frame = +2

Query  2    GANDGLVSIASLMMGVGTVKQDIKAMILTGFAGMVAGACSMAIGEFVSVYSQRDIEVAQM  181
            GANDGLVS +SLMMGVG VK D KAM+L+GFAG+VAGACSMAIGEFVSVYSQ DIEVAQM
Sbjct  38   GANDGLVSTSSLMMGVGAVKADAKAMLLSGFAGLVAGACSMAIGEFVSVYSQLDIEVAQM  97

Query  182  KRKKNRRNGedageeeeeesdvdeLPNPMQAAAASVVAFTMGAMVPLLAASFIKPYKVRI  361
            KR++  + G         E   D LP+P+QAA AS +AF+ GAMVPLLAA FI  YKVR+
Sbjct  98   KREQRIKGG--------GEVHQDGLPSPVQAAVASALAFSAGAMVPLLAAGFISSYKVRL  149

Query  362  GaviaavtvalvvcgwlgaalggapkgkaSVRVLIGGWLAMAITSGLTKLIG  517
              V +A TVALVV G +GA LG AP  K++ RVL+GGW+AMA+T  + K+ G
Sbjct  150  EVVASAATVALVVFGSVGALLGRAPVAKSAARVLVGGWMAMAVTFAVMKVFG  201



>ref|XP_006291870.1| hypothetical protein CARUB_v10018047mg [Capsella rubella]
 gb|EOA24768.1| hypothetical protein CARUB_v10018047mg [Capsella rubella]
Length=202

 Score =   166 bits (419),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 120/172 (70%), Positives = 139/172 (81%), Gaps = 10/172 (6%)
 Frame = +2

Query  2    GANDGLVSIASLMMGVGTVKQDIKAMILTGFAGMVAGACSMAIGEFVSVYSQRDIEVAQM  181
            GANDGLVS ASLMMGVG VKQDIK MILTGFAG+VAGACSMAIGEFVSVYSQ DIE AQM
Sbjct  34   GANDGLVSTASLMMGVGAVKQDIKIMILTGFAGLVAGACSMAIGEFVSVYSQYDIEKAQM  93

Query  182  KRKKNRRNGedageeeeeesdvdeLPNPMQAAAASVVAFTMGAMVPLLAASFIKPYKVRI  361
            KR +              E++ ++LP+P QAAAAS +AF++GA+VPLLAA+F+K YKVRI
Sbjct  94   KRDQT----------GGGEAEKEKLPSPTQAAAASALAFSLGAVVPLLAAAFVKEYKVRI  143

Query  362  GaviaavtvalvvcgwlgaalggapkgkaSVRVLIGGWLAMAITSGLTKLIG  517
            G ++AAVT+ALV+ GWLGA LG AP  K+S+RVLIGGWLAM IT G TKLIG
Sbjct  144  GVIVAAVTLALVMFGWLGAVLGKAPVVKSSLRVLIGGWLAMVITFGFTKLIG  195



>emb|CDY01332.1| BnaA07g11050D [Brassica napus]
Length=210

 Score =   166 bits (419),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 119/172 (69%), Positives = 142/172 (83%), Gaps = 12/172 (7%)
 Frame = +2

Query  2    GANDGLVSIASLMMGVGTVKQDIKAMILTGFAGMVAGACSMAIGEFVSVYSQRDIEVAQM  181
            GANDGLVS ASLMMGVG VK D+K M+L+GFAG+VAGACSMAIGEFVSVYSQ DIEVAQM
Sbjct  37   GANDGLVSTASLMMGVGAVKGDVKTMMLSGFAGLVAGACSMAIGEFVSVYSQYDIEVAQM  96

Query  182  KRKKNRRNGedageeeeeesdvdeLPNPMQAAAASVVAFTMGAMVPLLAASFIKPYKVRI  361
            KR+    NG         E + ++LP+PMQAAAAS +AF++GA+VPLLAA+F+K YKVR+
Sbjct  97   KRE----NG--------GEIEKEKLPSPMQAAAASALAFSLGAIVPLLAAAFVKEYKVRV  144

Query  362  GaviaavtvalvvcgwlgaalggapkgkaSVRVLIGGWLAMAITSGLTKLIG  517
            G ++AAVT+ALV+ GWLGA LG AP  K+S RVLIGGWLAMA+T GLTKL+G
Sbjct  145  GVILAAVTLALVMFGWLGAVLGKAPVVKSSARVLIGGWLAMAVTFGLTKLVG  196



>gb|EYU36849.1| hypothetical protein MIMGU_mgv1a025177mg [Erythranthe guttata]
Length=220

 Score =   165 bits (418),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 127/175 (73%), Positives = 146/175 (83%), Gaps = 1/175 (1%)
 Frame = +2

Query  2    GANDGLVSIASLMMGVGTVKQDIKAMILTGFAGMVAGACSMAIGEFVSVYSQRDIEVAQM  181
            GANDGLVS ASLMMGVG VKQDIKAMILTGFAG+VAGACSMAIGEFVSVYSQ DIEV+QM
Sbjct  44   GANDGLVSTASLMMGVGAVKQDIKAMILTGFAGLVAGACSMAIGEFVSVYSQLDIEVSQM  103

Query  182  KRKKNRRNGedageeeeeesdvde-LPNPMQAAAASVVAFTMGAMVPLLAASFIKPYKVR  358
            KR+K +      G  ++   + +E LPNP+QAAAAS +AFT GAMVP+LAASFI+ Y+VR
Sbjct  104  KREKQKAAAVVGGGVDDGGCENEEGLPNPVQAAAASALAFTAGAMVPMLAASFIREYRVR  163

Query  359  IGaviaavtvalvvcgwlgaalggapkgkaSVRVLIGGWLAMAITSGLTKLIGIK  523
            +G V+AAVTVAL+V GWLGAALG AP  K+S RVL+GGW AMAIT GLTKLIG +
Sbjct  164  VGVVVAAVTVALMVFGWLGAALGRAPVVKSSARVLLGGWFAMAITFGLTKLIGSR  218



>ref|XP_010514727.1| PREDICTED: vacuolar iron transporter homolog 3 [Camelina sativa]
Length=202

 Score =   164 bits (416),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 119/172 (69%), Positives = 138/172 (80%), Gaps = 10/172 (6%)
 Frame = +2

Query  2    GANDGLVSIASLMMGVGTVKQDIKAMILTGFAGMVAGACSMAIGEFVSVYSQRDIEVAQM  181
            GANDGLVS ASLMMGVG VKQD+K MILTGFAG+VAGACSMAIGEFVSVYSQ DIE AQM
Sbjct  34   GANDGLVSTASLMMGVGAVKQDVKIMILTGFAGLVAGACSMAIGEFVSVYSQYDIEKAQM  93

Query  182  KRKKNRRNGedageeeeeesdvdeLPNPMQAAAASVVAFTMGAMVPLLAASFIKPYKVRI  361
            KR+               E + ++LP+P QAAAAS +AF++GA+VPLL A+F+K YKVRI
Sbjct  94   KRESG----------GGGEVEKEKLPSPTQAAAASALAFSLGAVVPLLGAAFVKEYKVRI  143

Query  362  GaviaavtvalvvcgwlgaalggapkgkaSVRVLIGGWLAMAITSGLTKLIG  517
            G ++AAVT+ALV+ GWLGA LG AP  K+S+RVLIGGWLAMAIT G TKLIG
Sbjct  144  GVIVAAVTLALVMFGWLGAVLGKAPVIKSSLRVLIGGWLAMAITFGFTKLIG  195



>gb|KFK44209.1| hypothetical protein AALP_AA1G228700 [Arabis alpina]
Length=201

 Score =   164 bits (416),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 118/172 (69%), Positives = 139/172 (81%), Gaps = 11/172 (6%)
 Frame = +2

Query  2    GANDGLVSIASLMMGVGTVKQDIKAMILTGFAGMVAGACSMAIGEFVSVYSQRDIEVAQM  181
            GANDGLVS ASLMMGVG VKQD+K MIL+GFAG+VAGACSMAIGEFVSVYSQ DIEVAQM
Sbjct  37   GANDGLVSTASLMMGVGAVKQDVKTMILSGFAGLVAGACSMAIGEFVSVYSQYDIEVAQM  96

Query  182  KRKKNRRNGedageeeeeesdvdeLPNPMQAAAASVVAFTMGAMVPLLAASFIKPYKVRI  361
            KR+               E + ++LP+PMQAAAAS +AF++GA+VPLLAA+F+K Y  RI
Sbjct  97   KRESG-----------GGEIEKEKLPSPMQAAAASALAFSLGAIVPLLAAAFVKDYHWRI  145

Query  362  GaviaavtvalvvcgwlgaalggapkgkaSVRVLIGGWLAMAITSGLTKLIG  517
            GA++A+VT+ALV+ GWLGA LG AP  K+S RVLIGGWLAM +T GLTKLIG
Sbjct  146  GAIVASVTLALVMFGWLGAVLGKAPVVKSSGRVLIGGWLAMGVTYGLTKLIG  197



>emb|CBI20043.3| unnamed protein product [Vitis vinifera]
Length=243

 Score =   164 bits (416),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 104/172 (60%), Positives = 126/172 (73%), Gaps = 10/172 (6%)
 Frame = +2

Query  2    GANDGLVSIASLMMGVGTVKQDIKAMILTGFAGMVAGACSMAIGEFVSVYSQRDIEVAQM  181
            GANDGLVS+ASLMMGVG VK+D+ AMIL GFAG+VAGACSMAIGEFVSVY+Q DIEVAQM
Sbjct  79   GANDGLVSVASLMMGVGAVKRDVMAMILAGFAGLVAGACSMAIGEFVSVYTQLDIEVAQM  138

Query  182  KRKKNRRNGedageeeeeesdvdeLPNPMQAAAASVVAFTMGAMVPLLAASFIKPYKVRI  361
            KR+K               S   ELPNP Q A  S + F +GAMVP++AA+  + +KVR+
Sbjct  139  KREKGTNKD----------SKNLELPNPFQVAITSALTFVVGAMVPVVAAAITRDHKVRL  188

Query  362  GaviaavtvalvvcgwlgaalggapkgkaSVRVLIGGWLAMAITSGLTKLIG  517
            G V+A  ++A +V G +GA LG  P G +  RVL+GGW+AMAITSGLT LIG
Sbjct  189  GVVVAVSSLAFLVFGGVGAILGRTPVGWSCARVLVGGWMAMAITSGLTMLIG  240



>ref|XP_009780590.1| PREDICTED: vacuolar iron transporter homolog 1-like [Nicotiana 
sylvestris]
Length=218

 Score =   163 bits (413),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 111/173 (64%), Positives = 134/173 (77%), Gaps = 7/173 (4%)
 Frame = +2

Query  2    GANDGLVSIASLMMGVGTVKQDIKAMILTGFAGMVAGACSMAIGEFVSVYSQRDIEVAQM  181
            GANDGL+S +SLMMG+G VKQD KAMILTG AG+VAGACSMAIGEFVSVYSQ DIE++QM
Sbjct  48   GANDGLLSTSSLMMGIGAVKQDAKAMILTGIAGLVAGACSMAIGEFVSVYSQYDIEMSQM  107

Query  182  KRKKNRRNGedageeeeeesdvdeLPNPMQAAAASVVAFTMGAMVPLLAASFIKPYKVRI  361
            KR+ N           E E     LP+P+QAAAAS  AF +GA+VPLLAA+F+K Y +R+
Sbjct  108  KRQNNSST-------HELEEKKKNLPSPLQAAAASAFAFAIGAIVPLLAAAFVKNYHIRL  160

Query  362  GaviaavtvalvvcgwlgaalggapkgkaSVRVLIGGWLAMAITSGLTKLIGI  520
            G V+ AV+ AL+V G LGA LG AP  K+S+RVLIGGWL+M IT GLTKL+G+
Sbjct  161  GIVVTAVSFALLVFGGLGAYLGNAPLLKSSLRVLIGGWLSMGITFGLTKLVGV  213



>emb|CAN65435.1| hypothetical protein VITISV_032098 [Vitis vinifera]
Length=223

 Score =   163 bits (413),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 112/172 (65%), Positives = 137/172 (80%), Gaps = 5/172 (3%)
 Frame = +2

Query  2    GANDGLVSIASLMMGVGTVKQDIKAMILTGFAGMVAGACSMAIGEFVSVYSQRDIEVAQM  181
            GANDGLVS+ASLMMGVG VK+D+ AMIL GFAG+VAGACSMAIGEFVSVY+Q DIEVAQM
Sbjct  53   GANDGLVSVASLMMGVGAVKRDVMAMILAGFAGLVAGACSMAIGEFVSVYTQLDIEVAQM  112

Query  182  KRKKNRRNGedageeeeeesdvdeLPNPMQAAAASVVAFTMGAMVPLLAASFIKPYKVRI  361
            KR+K   +        EE+ + ++LPNP QAA AS +AF +GA+VPLLAA+FIK +KVR+
Sbjct  113  KREKGTNS-----AGNEEKPEDEQLPNPFQAAIASALAFAVGAVVPLLAAAFIKEHKVRL  167

Query  362  GaviaavtvalvvcgwlgaalggapkgkaSVRVLIGGWLAMAITSGLTKLIG  517
            G VIA  ++AL+V G +GAALG  P  ++  RVL+GGW+AM IT GLTKLIG
Sbjct  168  GVVIAVSSLALLVFGGVGAALGRTPMARSCARVLVGGWMAMGITFGLTKLIG  219



>ref|XP_004504756.1| PREDICTED: vacuolar iron transporter homolog 1-like [Cicer arietinum]
Length=227

 Score =   163 bits (413),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 107/172 (62%), Positives = 137/172 (80%), Gaps = 5/172 (3%)
 Frame = +2

Query  2    GANDGLVSIASLMMGVGTVKQDIKAMILTGFAGMVAGACSMAIGEFVSVYSQRDIEVAQM  181
            GANDGLV++ASLM+GVG +KQDI  M+L GFAG+VAGACSMAIGEFVSVY+Q DIEVAQ+
Sbjct  57   GANDGLVTVASLMIGVGAIKQDISVMLLAGFAGLVAGACSMAIGEFVSVYTQYDIEVAQI  116

Query  182  KRKKNRRNGedageeeeeesdvdeLPNPMQAAAASVVAFTMGAMVPLLAASFIKPYKVRI  361
            KR++           EEE S+ ++LPNP QAA AS +AF++GA++PLLAA+FIK +++R+
Sbjct  117  KREREAN-----NNNEEESSEREKLPNPFQAAVASALAFSVGAVMPLLAAAFIKDHRIRM  171

Query  362  GaviaavtvalvvcgwlgaalggapkgkaSVRVLIGGWLAMAITSGLTKLIG  517
              V A V++AL+V G +GA LG  P  K+ VRVLIGGW+AMA+T GLTKLIG
Sbjct  172  SVVAAVVSLALLVFGGIGAMLGKTPMMKSCVRVLIGGWMAMAVTFGLTKLIG  223



>ref|XP_006418651.1| hypothetical protein EUTSA_v10002660mg [Eutrema salsugineum]
 gb|ESQ37087.1| hypothetical protein EUTSA_v10002660mg [Eutrema salsugineum]
Length=219

 Score =   163 bits (412),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 105/172 (61%), Positives = 133/172 (77%), Gaps = 0/172 (0%)
 Frame = +2

Query  2    GANDGLVSIASLMMGVGTVKQDIKAMILTGFAGMVAGACSMAIGEFVSVYSQRDIEVAQM  181
            GANDGLV++ASLMMGVG++K+D+KAM+L GFAG+VAGACSMAIGEFVSV +QRDIE AQM
Sbjct  42   GANDGLVTVASLMMGVGSIKEDVKAMLLVGFAGLVAGACSMAIGEFVSVCTQRDIETAQM  101

Query  182  KRKKNRRNGedageeeeeesdvdeLPNPMQAAAASVVAFTMGAMVPLLAASFIKPYKVRI  361
            KR    +    A +E+EE+   + LPNP QAA AS +AF++GA +PLLAA FI+ +KVR+
Sbjct  102  KRAIETKTSLSAIDEQEEDEKKERLPNPGQAAIASALAFSVGAAMPLLAAVFIENHKVRM  161

Query  362  GaviaavtvalvvcgwlgaalggapkgkaSVRVLIGGWLAMAITSGLTKLIG  517
              V    T+AL+V G  GA LG     ++SVRV+IGGW+AMA+T GLTK IG
Sbjct  162  AVVAIVATLALLVFGVTGAVLGKTSVVRSSVRVVIGGWMAMALTFGLTKFIG  213



>ref|XP_010539736.1| PREDICTED: vacuolar iron transporter homolog 1-like [Tarenaya 
hassleriana]
Length=225

 Score =   163 bits (412),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 117/172 (68%), Positives = 140/172 (81%), Gaps = 3/172 (2%)
 Frame = +2

Query  2    GANDGLVSIASLMMGVGTVKQDIKAMILTGFAGMVAGACSMAIGEFVSVYSQRDIEVAQM  181
            GANDGLVS ASLMMGVG VK+D+K MILTGFAG+VAGACSMAIGEFVSVYSQ DI+VAQ+
Sbjct  53   GANDGLVSTASLMMGVGAVKEDVKVMILTGFAGLVAGACSMAIGEFVSVYSQYDIQVAQI  112

Query  182  KRKKNRRNGedageeeeeesdvdeLPNPMQAAAASVVAFTMGAMVPLLAASFIKPYKVRI  361
            KR++ +R+           ++ + LP+P+QAAAAS +AF  GA+VPLLAA+FI+ YK RI
Sbjct  113  KRERRQRS---PESTAATAAEGERLPSPLQAAAASALAFAAGAIVPLLAAAFIRGYKTRI  169

Query  362  GaviaavtvalvvcgwlgaalggapkgkaSVRVLIGGWLAMAITSGLTKLIG  517
            GAV+AAVT ALVV GWLGA LG AP  +++ RVL GGWLAMA+T GLTKLIG
Sbjct  170  GAVVAAVTAALVVFGWLGAVLGKAPAARSAARVLFGGWLAMAVTFGLTKLIG  221



>ref|XP_010527751.1| PREDICTED: vacuolar iron transporter homolog 2.1 [Tarenaya hassleriana]
Length=210

 Score =   162 bits (410),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 106/172 (62%), Positives = 130/172 (76%), Gaps = 4/172 (2%)
 Frame = +2

Query  2    GANDGLVSIASLMMGVGTVKQDIKAMILTGFAGMVAGACSMAIGEFVSVYSQRDIEVAQM  181
            GANDGLVS+ASLMMGVG+VKQD+KAM+L GFAG+VAGACSMAIGEFVSV +QRDI+ A +
Sbjct  37   GANDGLVSVASLMMGVGSVKQDVKAMLLAGFAGLVAGACSMAIGEFVSVCTQRDIQAAHI  96

Query  182  KRKKNRRNGedageeeeeesdvdeLPNPMQAAAASVVAFTMGAMVPLLAASFIKPYKVRI  361
            KR++         + E  E + +ELPNP QAA AS +AF++GA  PLLAA FI  +K+R+
Sbjct  97   KREE----AAPKTQGEANEEEEEELPNPGQAAIASALAFSVGAAAPLLAAVFIDNHKIRL  152

Query  362  GaviaavtvalvvcgwlgaalggapkgkaSVRVLIGGWLAMAITSGLTKLIG  517
              V    T AL+V G LGA LG  P  K++VRV+ GGWLAMA+T GLTKLIG
Sbjct  153  MVVAVVATSALMVFGGLGALLGKTPLLKSTVRVVFGGWLAMALTFGLTKLIG  204



>ref|XP_009128195.1| PREDICTED: vacuolar iron transporter homolog 2 [Brassica rapa]
 emb|CDY45946.1| BnaA02g17720D [Brassica napus]
Length=194

 Score =   161 bits (408),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 120/174 (69%), Positives = 140/174 (80%), Gaps = 13/174 (7%)
 Frame = +2

Query  2    GANDGLVSIASLMMGVGTVKQDIKAMILTGFAGMVAGACSMAIGEFVSVYSQRDIEVAQM  181
            GANDGLVS ASLMMGVG VK D+KAMIL+GFAGMVAGACSMAIGEFVSVYSQ DIEVAQM
Sbjct  32   GANDGLVSTASLMMGVGAVKHDVKAMILSGFAGMVAGACSMAIGEFVSVYSQYDIEVAQM  91

Query  182  KRKKNRRNGedageeeeeesdvdeLPNPMQAAAASVVAFTMGAMVPLLAASFIKPYKVRI  361
            +R+                 + ++LP+P+QAAAAS +AF+ GA+VPLLAA+F+K Y+VRI
Sbjct  92   ERESGE-------------VEKEKLPSPLQAAAASALAFSAGAIVPLLAAAFVKEYRVRI  138

Query  362  GaviaavtvalvvcgwlgaalggapkgkaSVRVLIGGWLAMAITSGLTKLIGIK  523
             AV+AAVTVALVV GWLGAALG AP  ++S RVL GGWLAMA+T GLTKLIG+ 
Sbjct  139  VAVVAAVTVALVVFGWLGAALGKAPAVRSSARVLFGGWLAMAVTFGLTKLIGLH  192



>ref|XP_002268519.2| PREDICTED: vacuolar iron transporter homolog 4-like [Vitis vinifera]
Length=249

 Score =   163 bits (412),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 112/172 (65%), Positives = 137/172 (80%), Gaps = 5/172 (3%)
 Frame = +2

Query  2    GANDGLVSIASLMMGVGTVKQDIKAMILTGFAGMVAGACSMAIGEFVSVYSQRDIEVAQM  181
            GANDGLVS+ASLMMGVG VK+D+ AMIL GFAG+VAGACSMAIGEFVSVY+Q DIEVAQM
Sbjct  79   GANDGLVSVASLMMGVGAVKRDVMAMILAGFAGLVAGACSMAIGEFVSVYTQLDIEVAQM  138

Query  182  KRKKNRRNGedageeeeeesdvdeLPNPMQAAAASVVAFTMGAMVPLLAASFIKPYKVRI  361
            KR+K   +        EE+ + ++LPNP QAA AS +AF +GA+VPLLAA+FIK +KVR+
Sbjct  139  KREKGTNS-----AGNEEKPEDEQLPNPFQAAIASALAFAVGAVVPLLAAAFIKEHKVRL  193

Query  362  GaviaavtvalvvcgwlgaalggapkgkaSVRVLIGGWLAMAITSGLTKLIG  517
            G VIA  ++AL+V G +GAALG  P  ++  RVL+GGW+AM IT GLTKLIG
Sbjct  194  GVVIAVSSLALLVFGGVGAALGRTPMARSCARVLVGGWMAMGITFGLTKLIG  245



>ref|XP_010251863.1| PREDICTED: vacuolar iron transporter homolog 3-like [Nelumbo 
nucifera]
Length=231

 Score =   162 bits (411),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 117/173 (68%), Positives = 141/173 (82%), Gaps = 5/173 (3%)
 Frame = +2

Query  2    GANDGLVSIASLMMGVGTVKQDIKAMILTGFAGMVAGACSMAIGEFVSVYSQRDIEVAQM  181
            GANDGLVS ASLMMGVG VK D+KAMI+TGFAG+VAGACSMAIGE+VSVYSQ DIE+AQ+
Sbjct  58   GANDGLVSTASLMMGVGAVKTDVKAMIITGFAGLVAGACSMAIGEYVSVYSQLDIELAQI  117

Query  182  KR--KKNRRNGedageeeeeesdvdeLPNPMQAAAASVVAFTMGAMVPLLAASFIKPYKV  355
            KR  K+ R +G     E+EE S+ ++LP+P QAAAAS +AF +GA VPLL+ASFIK Y+V
Sbjct  118  KRDQKRARESG---KSEDEENSEKEKLPSPFQAAAASTLAFAVGAAVPLLSASFIKEYRV  174

Query  356  RIGaviaavtvalvvcgwlgaalggapkgkaSVRVLIGGWLAMAITSGLTKLI  514
            R+G V A  ++AL+V G LGAALG AP  +A +RVL+GGWLAMAIT GLTK I
Sbjct  175  RLGVVAAVSSLALLVFGGLGAALGRAPVARACLRVLVGGWLAMAITYGLTKSI  227



>ref|XP_010680543.1| PREDICTED: vacuolar iron transporter homolog 4-like [Beta vulgaris 
subsp. vulgaris]
Length=220

 Score =   162 bits (409),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 119/172 (69%), Positives = 140/172 (81%), Gaps = 6/172 (3%)
 Frame = +2

Query  2    GANDGLVSIASLMMGVGTVKQDIKAMILTGFAGMVAGACSMAIGEFVSVYSQRDIEVAQM  181
            GANDGLVS ASLMMG+G VKQD+KAMILTGFAG+VAGACSMAIGEFVSVYSQ DIE+A  
Sbjct  51   GANDGLVSTASLMMGIGAVKQDVKAMILTGFAGLVAGACSMAIGEFVSVYSQLDIEIAHR  110

Query  182  KRKKNRRNGedageeeeeesdvdeLPNPMQAAAASVVAFTMGAMVPLLAASFIKPYKVRI  361
            KR+K R         E+ + + + LPNP+QAA AS +AF++GA+VPLLAASFI  YKVR+
Sbjct  111  KREKIRE------IIEKVDEEKEALPNPLQAALASALAFSVGALVPLLAASFITEYKVRV  164

Query  362  GaviaavtvalvvcgwlgaalggapkgkaSVRVLIGGWLAMAITSGLTKLIG  517
            G V+AAVT+AL   GWLGA LGGAP  +AS RVL+GGWLAMA+T GLTKL+G
Sbjct  165  GVVVAAVTLALAGFGWLGAVLGGAPVVRASFRVLVGGWLAMAVTFGLTKLMG  216



>ref|NP_177806.1| protein nodulin-like2 [Arabidopsis thaliana]
 sp|Q9SRD3.1|VITH2_ARATH RecName: Full=Vacuolar iron transporter homolog 2; AltName: Full=Protein 
NODULIN-LIKE 2 [Arabidopsis thaliana]
 gb|AAF04441.1|AC010718_10 nodulin-like protein; 66117-66707 [Arabidopsis thaliana]
 gb|AAT47793.1| At1g76800 [Arabidopsis thaliana]
 gb|AAU15133.1| At1g76800 [Arabidopsis thaliana]
 gb|AEE35890.1| protein nodulin-like2 [Arabidopsis thaliana]
Length=196

 Score =   160 bits (406),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 119/173 (69%), Positives = 139/173 (80%), Gaps = 13/173 (8%)
 Frame = +2

Query  2    GANDGLVSIASLMMGVGTVKQDIKAMILTGFAGMVAGACSMAIGEFVSVYSQRDIEVAQM  181
            GANDGLVS ASLMMGVG VK D+KAMIL+GFAGMVAGACSMAIGEFVSVYSQ DIEVAQM
Sbjct  34   GANDGLVSTASLMMGVGAVKHDVKAMILSGFAGMVAGACSMAIGEFVSVYSQYDIEVAQM  93

Query  182  KRKKNRRNGedageeeeeesdvdeLPNPMQAAAASVVAFTMGAMVPLLAASFIKPYKVRI  361
            +R                E + ++LP+PMQAAAAS +AF+ GA+VPLLAA+F+K YK+RI
Sbjct  94   ERDS-------------VEIEKEKLPSPMQAAAASALAFSAGAIVPLLAAAFVKEYKMRI  140

Query  362  GaviaavtvalvvcgwlgaalggapkgkaSVRVLIGGWLAMAITSGLTKLIGI  520
             +V+ AVTVAL+V GWLGAALG AP  ++S RVL GGWLAMA+T GLTKLIG+
Sbjct  141  ISVVVAVTVALMVFGWLGAALGKAPAVRSSARVLFGGWLAMAVTFGLTKLIGL  193



>ref|XP_006390155.1| hypothetical protein EUTSA_v10019177mg [Eutrema salsugineum]
 gb|ESQ27441.1| hypothetical protein EUTSA_v10019177mg [Eutrema salsugineum]
Length=195

 Score =   160 bits (405),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 121/174 (70%), Positives = 140/174 (80%), Gaps = 13/174 (7%)
 Frame = +2

Query  2    GANDGLVSIASLMMGVGTVKQDIKAMILTGFAGMVAGACSMAIGEFVSVYSQRDIEVAQM  181
            GANDGLVS ASLMMGVG VKQ++KAMIL+GFAGMVAGACSMAIGEFVSVYSQ DIEVAQM
Sbjct  33   GANDGLVSTASLMMGVGAVKQEVKAMILSGFAGMVAGACSMAIGEFVSVYSQYDIEVAQM  92

Query  182  KRKKNRRNGedageeeeeesdvdeLPNPMQAAAASVVAFTMGAMVPLLAASFIKPYKVRI  361
            +R+                 + ++LP+P+QAAAAS +AF+ GA+VPLLAA+F+K Y+VRI
Sbjct  93   ERESGE-------------IEKEKLPSPLQAAAASALAFSAGAIVPLLAAAFVKEYRVRI  139

Query  362  GaviaavtvalvvcgwlgaalggapkgkaSVRVLIGGWLAMAITSGLTKLIGIK  523
             AV+AAVTVALVV GWLGAALG AP  ++S RVL GGWLAMAIT GLTKLIG  
Sbjct  140  IAVVAAVTVALVVFGWLGAALGKAPVVRSSARVLFGGWLAMAITYGLTKLIGFH  193



>emb|CDY15107.1| BnaC03g44680D [Brassica napus]
Length=219

 Score =   161 bits (407),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 106/172 (62%), Positives = 132/172 (77%), Gaps = 0/172 (0%)
 Frame = +2

Query  2    GANDGLVSIASLMMGVGTVKQDIKAMILTGFAGMVAGACSMAIGEFVSVYSQRDIEVAQM  181
            GANDGLV++ASLMMGVG++K+D+KAM+L GFAG+VAGACSMAIGEFVSV +QRDIE AQM
Sbjct  42   GANDGLVTVASLMMGVGSIKEDVKAMLLVGFAGLVAGACSMAIGEFVSVCTQRDIETAQM  101

Query  182  KRKKNRRNGedageeeeeesdvdeLPNPMQAAAASVVAFTMGAMVPLLAASFIKPYKVRI  361
            KR    +    A +E+ EE   + LPNP QAA AS +AF++GA +PLLAA FI+ +KVR+
Sbjct  102  KRASETKTSLPAIDEQYEEEKKERLPNPGQAALASALAFSVGAAMPLLAAVFIENHKVRM  161

Query  362  GaviaavtvalvvcgwlgaalggapkgkaSVRVLIGGWLAMAITSGLTKLIG  517
              V    T+AL+V G  GA LG     K+SVRV+IGGW+AMA+T GLTK IG
Sbjct  162  AVVAIVATLALLVFGVTGAVLGKTSVFKSSVRVVIGGWMAMALTFGLTKFIG  213



>ref|XP_002325128.1| hypothetical protein POPTR_0018s11510g [Populus trichocarpa]
 gb|EEF03693.1| hypothetical protein POPTR_0018s11510g [Populus trichocarpa]
Length=224

 Score =   161 bits (407),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 119/172 (69%), Positives = 137/172 (80%), Gaps = 2/172 (1%)
 Frame = +2

Query  2    GANDGLVSIASLMMGVGTVKQDIKAMILTGFAGMVAGACSMAIGEFVSVYSQRDIEVAQM  181
            GANDGLVSI SLMMGVG VKQD+KAMILTG AG+VAGA SMAIGEFVSV SQ DIE+AQ+
Sbjct  51   GANDGLVSIGSLMMGVGAVKQDVKAMILTGCAGLVAGASSMAIGEFVSVQSQLDIELAQI  110

Query  182  KRKKNRRNGedageeeeeesdvdeLPNPMQAAAASVVAFTMGAMVPLLAASFIKPYKVRI  361
            KR K RR+       EEEE +   LP+P QA+AAS +AF +GA VP+LAASFI  YK+R+
Sbjct  111  KRNKQRRD--SEEVPEEEEGEKANLPSPTQASAASAIAFALGASVPVLAASFIGQYKLRL  168

Query  362  GaviaavtvalvvcgwlgaalggapkgkaSVRVLIGGWLAMAITSGLTKLIG  517
            G V+ AVT+AL+  GWLGA LG AP  K+S+RVLIGGW AMAIT GLTKLIG
Sbjct  169  GVVVGAVTLALMAFGWLGAVLGKAPTVKSSLRVLIGGWFAMAITFGLTKLIG  220



>emb|CDY20388.1| BnaC02g24280D [Brassica napus]
Length=194

 Score =   160 bits (404),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 118/174 (68%), Positives = 138/174 (79%), Gaps = 13/174 (7%)
 Frame = +2

Query  2    GANDGLVSIASLMMGVGTVKQDIKAMILTGFAGMVAGACSMAIGEFVSVYSQRDIEVAQM  181
            GANDGLVS ASLMMGVG VK D+K MIL+GFAGMVAGACSMAIGEFVSVYSQ DIEVAQM
Sbjct  32   GANDGLVSTASLMMGVGAVKHDVKVMILSGFAGMVAGACSMAIGEFVSVYSQYDIEVAQM  91

Query  182  KRKKNRRNGedageeeeeesdvdeLPNPMQAAAASVVAFTMGAMVPLLAASFIKPYKVRI  361
            +R+                 + ++LP+P+QAAAAS +AF+ GA+VPLLAA+F+K Y+VRI
Sbjct  92   ERESGE-------------VEKEKLPSPLQAAAASALAFSAGAIVPLLAAAFVKEYRVRI  138

Query  362  GaviaavtvalvvcgwlgaalggapkgkaSVRVLIGGWLAMAITSGLTKLIGIK  523
             AV+AAVTVALVV GWLGA LG AP  ++S RVL GGWLAMA+T GLTKLIG+ 
Sbjct  139  VAVVAAVTVALVVFGWLGATLGKAPAVRSSARVLFGGWLAMAVTFGLTKLIGLH  192



>ref|XP_010680555.1| PREDICTED: vacuolar iron transporter homolog 4-like [Beta vulgaris 
subsp. vulgaris]
Length=220

 Score =   160 bits (406),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 115/172 (67%), Positives = 132/172 (77%), Gaps = 10/172 (6%)
 Frame = +2

Query  2    GANDGLVSIASLMMGVGTVKQDIKAMILTGFAGMVAGACSMAIGEFVSVYSQRDIEVAQM  181
            GANDGL++ ASLMMGVG VKQD+KAMILTGFAG+VA ACSMAIGEFVSV SQ DIEVAQ 
Sbjct  55   GANDGLITTASLMMGVGAVKQDVKAMILTGFAGLVAAACSMAIGEFVSVQSQVDIEVAQR  114

Query  182  KRKKNRRNGedageeeeeesdvdeLPNPMQAAAASVVAFTMGAMVPLLAASFIKPYKVRI  361
            KR+K              E + + LP+P QAA AS +A  +GAMVPLLAA  +K YKVR+
Sbjct  115  KREKQEDK----------EDEKESLPSPTQAAFASALAVAVGAMVPLLAALCVKDYKVRL  164

Query  362  GaviaavtvalvvcgwlgaalggapkgkaSVRVLIGGWLAMAITSGLTKLIG  517
            G V AAVT+ALVV GWLGA LG AP  ++S+RVL+GGW AMAIT GLTKLIG
Sbjct  165  GVVPAAVTMALVVFGWLGAYLGKAPILRSSLRVLLGGWFAMAITFGLTKLIG  216



>emb|CDX87566.1| BnaA07g33070D [Brassica napus]
Length=194

 Score =   159 bits (403),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 118/173 (68%), Positives = 138/173 (80%), Gaps = 13/173 (8%)
 Frame = +2

Query  2    GANDGLVSIASLMMGVGTVKQDIKAMILTGFAGMVAGACSMAIGEFVSVYSQRDIEVAQM  181
            GANDGLVS ASLMMGVG VK D+KAMIL+GFAGMVAGACSMAIGEFVSVYSQ DIEVAQM
Sbjct  32   GANDGLVSTASLMMGVGAVKHDVKAMILSGFAGMVAGACSMAIGEFVSVYSQYDIEVAQM  91

Query  182  KRKKNRRNGedageeeeeesdvdeLPNPMQAAAASVVAFTMGAMVPLLAASFIKPYKVRI  361
            +R+                 + ++LP+P+QAAAAS +AF+ GA+VPLLAA+F+K Y+VRI
Sbjct  92   ERESGE-------------VEKEKLPSPLQAAAASALAFSAGAIVPLLAAAFVKEYRVRI  138

Query  362  GaviaavtvalvvcgwlgaalggapkgkaSVRVLIGGWLAMAITSGLTKLIGI  520
             AV+ AVTVALV  GWLGAALG AP  ++S RVL GGWLAMA+T GLTKLIG+
Sbjct  139  IAVVTAVTVALVGFGWLGAALGKAPAVRSSARVLFGGWLAMAVTFGLTKLIGL  191



>gb|KFK39821.1| hypothetical protein AALP_AA3G292800 [Arabis alpina]
Length=223

 Score =   160 bits (405),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 105/172 (61%), Positives = 132/172 (77%), Gaps = 0/172 (0%)
 Frame = +2

Query  2    GANDGLVSIASLMMGVGTVKQDIKAMILTGFAGMVAGACSMAIGEFVSVYSQRDIEVAQM  181
            GANDGLV++ASLMMGVG++K+D+KAM+L GFAG++AGACSMAIGEFVSV +QRDIE AQ+
Sbjct  46   GANDGLVTVASLMMGVGSIKEDVKAMLLVGFAGLIAGACSMAIGEFVSVCTQRDIEAAQI  105

Query  182  KRKKNRRNGedageeeeeesdvdeLPNPMQAAAASVVAFTMGAMVPLLAASFIKPYKVRI  361
            KR    +      +E+EEE   + LPNP QAA AS +AF++GA VPLLAA FI+ +KVR+
Sbjct  106  KRAIETKTSLSEIDEQEEEEKKERLPNPGQAAMASALAFSVGAAVPLLAAVFIENHKVRM  165

Query  362  GaviaavtvalvvcgwlgaalggapkgkaSVRVLIGGWLAMAITSGLTKLIG  517
              V    T+AL+V G  GA LG     K+SVRV+IGGW+AMA+T GLTK IG
Sbjct  166  VVVAVVATIALLVFGVTGAVLGKTSVVKSSVRVVIGGWMAMALTFGLTKFIG  217



>ref|XP_008785903.1| PREDICTED: vacuolar iron transporter homolog 4-like [Phoenix 
dactylifera]
Length=224

 Score =   160 bits (404),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 110/175 (63%), Positives = 136/175 (78%), Gaps = 2/175 (1%)
 Frame = +2

Query  2    GANDGLVSIASLMMGVGTVKQDIKAMILTGFAGMVAGACSMAIGEFVSVYSQRDIEVAQM  181
            GANDGL+S  SLMMGVG VK D KAMI++G AG+VAGACSMA  EFVSVYSQ DIEVAQM
Sbjct  38   GANDGLLSTVSLMMGVGAVKDDAKAMIISGLAGLVAGACSMATAEFVSVYSQYDIEVAQM  97

Query  182  KRKKNRRNGedageeeeeesdvdeLPNPMQAAAASVVAFTMGAMVPLLAASFIKPYKVRI  361
            KR+K  +   D   E  +E + D LP+P++AA AS +AF+ GAMVPLLAA FI+ Y+VR+
Sbjct  98   KREKQAKG--DHNGEGIDEGNRDRLPSPVKAAVASALAFSAGAMVPLLAAGFIRSYEVRL  155

Query  362  GaviaavtvalvvcgwlgaalggapkgkaSVRVLIGGWLAMAITSGLTKLIGIKS  526
            G V+AA + ALVV G LGAALG AP G++ VRV++GGW+AMA+T GL KL G ++
Sbjct  156  GVVVAAASAALVVLGCLGAALGRAPVGRSCVRVVVGGWVAMAMTFGLMKLFGSRN  210



>ref|XP_004230638.1| PREDICTED: vacuolar iron transporter homolog 4-like [Solanum 
lycopersicum]
Length=217

 Score =   159 bits (403),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 105/172 (61%), Positives = 131/172 (76%), Gaps = 3/172 (2%)
 Frame = +2

Query  2    GANDGLVSIASLMMGVGTVKQDIKAMILTGFAGMVAGACSMAIGEFVSVYSQRDIEVAQM  181
            GA DGLV+ ASLMMGVG VK+D+ AMIL GFA + AGACSMAIGEFVSVYSQ DIE+AQ+
Sbjct  43   GATDGLVTTASLMMGVGAVKKDVDAMILIGFAALFAGACSMAIGEFVSVYSQLDIELAQI  102

Query  182  KRKKNRRNGedageeeeeesdvdeLPNPMQAAAASVVAFTMGAMVPLLAASFIKPYKVRI  361
            KR+   R       E++EE D + LPNP  AA AS +AF++G ++P+LAA FI  +KVR+
Sbjct  103  KREAKTRG---QNHEQKEEEDKEGLPNPFLAAVASAIAFSLGGIIPILAAGFISNHKVRM  159

Query  362  GaviaavtvalvvcgwlgaalggapkgkaSVRVLIGGWLAMAITSGLTKLIG  517
            G V+AAV++AL V G +GA LG +P  ++  RVLIGGW+AM IT GLTKLIG
Sbjct  160  GVVVAAVSLALFVFGGVGAVLGKSPAVRSCARVLIGGWMAMGITFGLTKLIG  211



>ref|XP_010428749.1| PREDICTED: vacuolar iron transporter homolog 2 [Camelina sativa]
 ref|XP_010471839.1| PREDICTED: vacuolar iron transporter homolog 2 [Camelina sativa]
Length=196

 Score =   159 bits (401),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 120/174 (69%), Positives = 141/174 (81%), Gaps = 13/174 (7%)
 Frame = +2

Query  2    GANDGLVSIASLMMGVGTVKQDIKAMILTGFAGMVAGACSMAIGEFVSVYSQRDIEVAQM  181
            GANDGLVS ASLMMGVG VK D+KAMIL+GFAGMVAGACSMAIGEFVSVYSQ DIE+AQM
Sbjct  34   GANDGLVSTASLMMGVGAVKHDVKAMILSGFAGMVAGACSMAIGEFVSVYSQYDIELAQM  93

Query  182  KRKKNRRNGedageeeeeesdvdeLPNPMQAAAASVVAFTMGAMVPLLAASFIKPYKVRI  361
            +R     NG         E + ++LP+P+QAAAAS +AF+ GA+VPLLAA+F+K YK+RI
Sbjct  94   ERD----NG---------EIEKEKLPSPIQAAAASALAFSAGAIVPLLAAAFVKEYKMRI  140

Query  362  GaviaavtvalvvcgwlgaalggapkgkaSVRVLIGGWLAMAITSGLTKLIGIK  523
             AV+ AVTVAL+V GWLGAALG AP  ++S RVL GGWLAMA+T GLTKLIG+ 
Sbjct  141  VAVVVAVTVALMVFGWLGAALGKAPAVRSSARVLFGGWLAMAVTFGLTKLIGLH  194



>ref|XP_010680566.1| PREDICTED: vacuolar iron transporter homolog 3-like [Beta vulgaris 
subsp. vulgaris]
Length=214

 Score =   159 bits (402),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 123/172 (72%), Positives = 142/172 (83%), Gaps = 5/172 (3%)
 Frame = +2

Query  2    GANDGLVSIASLMMGVGTVKQDIKAMILTGFAGMVAGACSMAIGEFVSVYSQRDIEVAQM  181
            GANDGLVS ASLMMGVG VKQD+KAMILTGFAG+V GACSMAIGE+VSVYSQ DIEVAQ+
Sbjct  44   GANDGLVSTASLMMGVGAVKQDVKAMILTGFAGLVGGACSMAIGEYVSVYSQVDIEVAQL  103

Query  182  KRKKNRRNGedageeeeeesdvdeLPNPMQAAAASVVAFTMGAMVPLLAASFIKPYKVRI  361
            KR K  +NG    + +E   + +ELPNP+QAA AS  AF++GA+VPLLAASFIK YKVR+
Sbjct  104  KRDK-LKNG----DIQEGCGEEEELPNPLQAALASAFAFSVGALVPLLAASFIKDYKVRL  158

Query  362  GaviaavtvalvvcgwlgaalggapkgkaSVRVLIGGWLAMAITSGLTKLIG  517
              V AAVT+AL+V GWLGA LG AP  KAS+RVL+GGWLAMAIT G TKL+G
Sbjct  159  AVVAAAVTLALLVFGWLGAVLGKAPGLKASLRVLVGGWLAMAITFGATKLVG  210



>ref|XP_010416603.1| PREDICTED: vacuolar iron transporter homolog 2 [Camelina sativa]
Length=196

 Score =   159 bits (401),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 120/174 (69%), Positives = 140/174 (80%), Gaps = 13/174 (7%)
 Frame = +2

Query  2    GANDGLVSIASLMMGVGTVKQDIKAMILTGFAGMVAGACSMAIGEFVSVYSQRDIEVAQM  181
            GANDGLVS ASLMMGVG VK D+KAMIL+GFAGMVAGACSMAIGEFVSVYSQ DIE+AQM
Sbjct  34   GANDGLVSTASLMMGVGAVKHDVKAMILSGFAGMVAGACSMAIGEFVSVYSQYDIELAQM  93

Query  182  KRKKNRRNGedageeeeeesdvdeLPNPMQAAAASVVAFTMGAMVPLLAASFIKPYKVRI  361
            +R     NG           + ++LP+PMQAAAAS +AF+ GA+VPLLAA+F+K YK+RI
Sbjct  94   ERD----NG---------GIEKEKLPSPMQAAAASALAFSAGAIVPLLAAAFVKEYKMRI  140

Query  362  GaviaavtvalvvcgwlgaalggapkgkaSVRVLIGGWLAMAITSGLTKLIGIK  523
             AV+ AVTVAL+V GWLGAALG AP  ++S RVL GGWLAMA+T GLTKLIG+ 
Sbjct  141  IAVVVAVTVALMVFGWLGAALGKAPAVRSSARVLFGGWLAMAVTFGLTKLIGLH  194



>ref|XP_007041605.1| Vacuolar iron transporter family protein [Theobroma cacao]
 gb|EOX97436.1| Vacuolar iron transporter family protein [Theobroma cacao]
Length=215

 Score =   159 bits (402),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 110/172 (64%), Positives = 132/172 (77%), Gaps = 6/172 (3%)
 Frame = +2

Query  2    GANDGLVSIASLMMGVGTVKQDIKAMILTGFAGMVAGACSMAIGEFVSVYSQRDIEVAQM  181
            GANDGL+S ASLMMGVG V++D K MILTG AG+VAGACSMAIGEFVSVYSQ DIE++QM
Sbjct  46   GANDGLLSTASLMMGVGAVRKDSKTMILTGIAGLVAGACSMAIGEFVSVYSQYDIELSQM  105

Query  182  KRKKNRRNGedageeeeeesdvdeLPNPMQAAAASVVAFTMGAMVPLLAASFIKPYKVRI  361
            KR K  +N          + D + LPNP+QAAAAS VAF +GA++PLL A+FI+ Y VR+
Sbjct  106  KRDKMTKNN------VLADHDKESLPNPLQAAAASAVAFAIGAVIPLLGAAFIRDYMVRL  159

Query  362  GaviaavtvalvvcgwlgaalggapkgkaSVRVLIGGWLAMAITSGLTKLIG  517
              V+  VT+AL+  G LGA LGGA   K+S+RVL+GGWLAM IT GLTKLIG
Sbjct  160  TVVLGVVTLALIGFGALGALLGGAHMLKSSLRVLVGGWLAMGITFGLTKLIG  211



>ref|XP_003524080.1| PREDICTED: nodulin-21-like [Glycine max]
 gb|KHM99127.1| Nodulin-21 [Glycine soja]
Length=223

 Score =   159 bits (402),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 98/175 (56%), Positives = 131/175 (75%), Gaps = 5/175 (3%)
 Frame = +2

Query  2    GANDGLVSIASLMMGVGTVKQDIKAMILTGFAGMVAGACSMAIGEFVSVYSQRDIEVAQM  181
            GANDGLVS++SLMMGVG VK+D +AM+L GFAG+VAG C MAIGEFV+V +Q ++EV QM
Sbjct  50   GANDGLVSVSSLMMGVGAVKKDERAMLLAGFAGLVAGTCGMAIGEFVAVCTQYEVEVGQM  109

Query  182  KRKKNRRNGedageeeeeesdvdeLPNPMQAAAASVVAFTMGAMVPLLAASFIKPYKVRI  361
            KR+ N        ++ E   +   LPNP+QA  AS V+F++GA+VPLL+A+FI+ Y+ R+
Sbjct  110  KREMNNEE-----KDLEMGMEKRGLPNPLQATLASAVSFSIGALVPLLSAAFIENYRTRV  164

Query  362  GaviaavtvalvvcgwlgaalggapkgkaSVRVLIGGWLAMAITSGLTKLIGIKS  526
              V+A V++ALVV G + A LG   K K+ VR L+GGW+AMAIT GLTKL+G K+
Sbjct  165  IVVVAMVSLALVVFGRVVAQLGKTHKMKSCVRFLLGGWIAMAITFGLTKLLGAKA  219



>gb|KHM99124.1| Vacuolar iron transporter like 4 [Glycine soja]
Length=229

 Score =   159 bits (402),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 108/172 (63%), Positives = 134/172 (78%), Gaps = 4/172 (2%)
 Frame = +2

Query  2    GANDGLVSIASLMMGVGTVKQDIKAMILTGFAGMVAGACSMAIGEFVSVYSQRDIEVAQM  181
            GANDGLVS+ASLMMGVG VK+DI AMIL GFAG+VAGACSMAIGEFVSVY+Q DIE  Q+
Sbjct  58   GANDGLVSVASLMMGVGAVKKDISAMILAGFAGLVAGACSMAIGEFVSVYTQYDIEKTQL  117

Query  182  KRKKNRRNGedageeeeeesdvdeLPNPMQAAAASVVAFTMGAMVPLLAASFIKPYKVRI  361
            KR++   N         EE+  ++LPNP  AA AS +AF++GA+VP+LAA FI+ +KVR+
Sbjct  118  KREREADNN----RGVNEEARREKLPNPFHAALASALAFSVGALVPMLAAVFIRSHKVRM  173

Query  362  GaviaavtvalvvcgwlgaalggapkgkaSVRVLIGGWLAMAITSGLTKLIG  517
            G V AAV++AL+V G  GA LG  P  ++ +RVL+GGW+AMAIT GLTKLIG
Sbjct  174  GVVAAAVSLALLVFGGAGAVLGKTPVTRSCIRVLVGGWMAMAITFGLTKLIG  225



>ref|XP_006302849.1| hypothetical protein CARUB_v10020980mg [Capsella rubella]
 gb|EOA35747.1| hypothetical protein CARUB_v10020980mg [Capsella rubella]
Length=196

 Score =   158 bits (399),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 117/174 (67%), Positives = 137/174 (79%), Gaps = 13/174 (7%)
 Frame = +2

Query  2    GANDGLVSIASLMMGVGTVKQDIKAMILTGFAGMVAGACSMAIGEFVSVYSQRDIEVAQM  181
            GANDGLVS ASLMMGVG VK D+KAMIL+GFAGMVAGACSMAIGEFVSVYSQ DIE+AQM
Sbjct  34   GANDGLVSTASLMMGVGAVKHDVKAMILSGFAGMVAGACSMAIGEFVSVYSQYDIELAQM  93

Query  182  KRKKNRRNGedageeeeeesdvdeLPNPMQAAAASVVAFTMGAMVPLLAASFIKPYKVRI  361
            +R+                 + ++LP+P QAAAAS +AF+ GA+VPLLAA+F+K YK RI
Sbjct  94   ERESGE-------------IEKEKLPSPTQAAAASALAFSAGAIVPLLAAAFVKEYKTRI  140

Query  362  GaviaavtvalvvcgwlgaalggapkgkaSVRVLIGGWLAMAITSGLTKLIGIK  523
             AV+ AVTVAL+V GWLGAALG AP  ++S RVL GGWLAMA+T GLTKLIG+ 
Sbjct  141  IAVVVAVTVALMVFGWLGAALGKAPAVRSSARVLFGGWLAMAVTFGLTKLIGLH  194



>ref|XP_009587129.1| PREDICTED: vacuolar iron transporter homolog 4-like [Nicotiana 
tomentosiformis]
Length=218

 Score =   158 bits (400),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 107/172 (62%), Positives = 130/172 (76%), Gaps = 2/172 (1%)
 Frame = +2

Query  2    GANDGLVSIASLMMGVGTVKQDIKAMILTGFAGMVAGACSMAIGEFVSVYSQRDIEVAQM  181
            GANDGLV+ ASLMMGVG V++D+ AMIL GFA + AGACSMAIGEFVSVYSQ DIE+AQ+
Sbjct  43   GANDGLVTTASLMMGVGAVQKDVNAMILIGFAALFAGACSMAIGEFVSVYSQLDIELAQI  102

Query  182  KRKKNRRNGedageeeeeesdvdeLPNPMQAAAASVVAFTMGAMVPLLAASFIKPYKVRI  361
            KR+   R      EE+ EE   + LPNP  AA AS VAF++G ++P+LAA FI  +KVR+
Sbjct  103  KRENTIRG--QNHEEQGEEDKKEGLPNPFLAAIASAVAFSLGGIIPILAAGFISNHKVRM  160

Query  362  GaviaavtvalvvcgwlgaalggapkgkaSVRVLIGGWLAMAITSGLTKLIG  517
              V+AAV+VAL V G +GA LG  P  ++  RVLIGGW+AMAIT GLTKLIG
Sbjct  161  AVVVAAVSVALFVFGGVGAVLGRTPAVRSCARVLIGGWMAMAITFGLTKLIG  212



>ref|XP_009772166.1| PREDICTED: vacuolar iron transporter homolog 4-like [Nicotiana 
sylvestris]
Length=218

 Score =   158 bits (400),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 106/172 (62%), Positives = 130/172 (76%), Gaps = 2/172 (1%)
 Frame = +2

Query  2    GANDGLVSIASLMMGVGTVKQDIKAMILTGFAGMVAGACSMAIGEFVSVYSQRDIEVAQM  181
            GANDGLV+ ASLMMGVG V++D+ AMIL GFA + AGACSMAIGEFVSVYSQ DIE+AQ+
Sbjct  43   GANDGLVTTASLMMGVGAVQKDVNAMILVGFAALFAGACSMAIGEFVSVYSQLDIELAQI  102

Query  182  KRKKNRRNGedageeeeeesdvdeLPNPMQAAAASVVAFTMGAMVPLLAASFIKPYKVRI  361
            KR+   R      EE+ EE   + LPNP  AA AS VAF++G ++P+LAA FI  +KVR+
Sbjct  103  KRENTIRG--QNHEEQGEEDKKEGLPNPFLAAIASAVAFSLGGIIPILAAGFISNHKVRM  160

Query  362  GaviaavtvalvvcgwlgaalggapkgkaSVRVLIGGWLAMAITSGLTKLIG  517
              V+AAV++AL V G +GA LG  P  ++  RVLIGGW+AMAIT GLTKLIG
Sbjct  161  AVVVAAVSLALFVFGGVGAVLGRTPAVRSCARVLIGGWMAMAITFGLTKLIG  212



>ref|XP_008370515.1| PREDICTED: vacuolar iron transporter homolog 4-like [Malus domestica]
Length=227

 Score =   159 bits (401),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 114/176 (65%), Positives = 136/176 (77%), Gaps = 12/176 (7%)
 Frame = +2

Query  2    GANDGLVSIASLMMGVGTVKQDIKAMILTGFAGMVAGACSMAIGEFVSVYSQRDIEVAQM  181
            GANDGLVS+ASLMMGVG VKQD+KAM+L GFAG+VAGACSMAIGEFVSVY+Q DIE++QM
Sbjct  54   GANDGLVSVASLMMGVGAVKQDVKAMLLAGFAGLVAGACSMAIGEFVSVYTQYDIEISQM  113

Query  182  KR--KKNRR--NGedageeeeeesdvdeLPNPMQAAAASVVAFTMGAMVPLLAASFIKPY  349
            KR  K+N R  NG        EE+    LPNP QAA AS +AF++GA+VPLL A+FI  +
Sbjct  114  KREMKENGRTENG--------EEAKKKSLPNPAQAALASAIAFSIGAVVPLLGAAFITEH  165

Query  350  KVRIGaviaavtvalvvcgwlgaalggapkgkaSVRVLIGGWLAMAITSGLTKLIG  517
            K R+  V   V+VALVV G + A LGG+P GK+  RVL+GGW+AMAIT GLTKLIG
Sbjct  166  KARLAVVAVLVSVALVVFGGVXARLGGSPVGKSCARVLVGGWMAMAITFGLTKLIG  221



>gb|EYU18521.1| hypothetical protein MIMGU_mgv1a025650mg, partial [Erythranthe 
guttata]
Length=190

 Score =   157 bits (396),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 113/172 (66%), Positives = 136/172 (79%), Gaps = 7/172 (4%)
 Frame = +2

Query  2    GANDGLVSIASLMMGVGTVKQDIKAMILTGFAGMVAGACSMAIGEFVSVYSQRDIEVAQM  181
            GANDGL+S ASLMMG+G V+ D K MILTG AG+VAGACSMAIGEFVSVYSQ D+EVAQM
Sbjct  22   GANDGLLSTASLMMGIGAVRPDAKTMILTGVAGLVAGACSMAIGEFVSVYSQYDVEVAQM  81

Query  182  KRKKNRRNGedageeeeeesdvdeLPNPMQAAAASVVAFTMGAMVPLLAASFIKPYKVRI  361
            KR+     G        +    ++LPNPMQAAAAS +AF +GA+VPLLAA+F++ Y+VR+
Sbjct  82   KREGQMSGG-------NDGGVREKLPNPMQAAAASALAFAVGAVVPLLAAAFVRDYRVRL  134

Query  362  GaviaavtvalvvcgwlgaalggapkgkaSVRVLIGGWLAMAITSGLTKLIG  517
            GAV+AAV+VALV  GWLGA +G AP  +++ RVLIGGWLAM IT GLTKLIG
Sbjct  135  GAVVAAVSVALVGFGWLGAVIGRAPPSRSASRVLIGGWLAMGITFGLTKLIG  186



>gb|KDO45014.1| hypothetical protein CISIN_1g043274mg [Citrus sinensis]
Length=226

 Score =   158 bits (399),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 109/174 (63%), Positives = 136/174 (78%), Gaps = 2/174 (1%)
 Frame = +2

Query  2    GANDGLVSIASLMMGVGTVKQDIKAMILTGFAGMVAGACSMAIGEFVSVYSQRDIEVAQM  181
            GANDGLVS+ASLMMGVG VK DIKAM+L GFAG+VAGA SMAIGEFVSV +QRDIE+AQM
Sbjct  47   GANDGLVSVASLMMGVGAVKTDIKAMLLAGFAGLVAGAGSMAIGEFVSVCTQRDIEIAQM  106

Query  182  KRKKNRR--NGedageeeeeesdvdeLPNPMQAAAASVVAFTMGAMVPLLAASFIKPYKV  355
            KR + ++  + E+  E +E     + LPNP QAA AS +AF++GA+VPLL ++F++ +KV
Sbjct  107  KRDQQKKITSNENHEEPDENIQREEALPNPAQAAIASALAFSVGAVVPLLGSAFVRDHKV  166

Query  356  RIGaviaavtvalvvcgwlgaalggapkgkaSVRVLIGGWLAMAITSGLTKLIG  517
            R+  V A  ++ALVV G LGA LG  P  K+S RVL+GGW+AMAIT GLTKLIG
Sbjct  167  RLAVVAAVASIALVVFGVLGALLGKTPIVKSSARVLVGGWMAMAITFGLTKLIG  220



>ref|XP_004485536.1| PREDICTED: vacuolar iron transporter homolog 4-like [Cicer arietinum]
Length=217

 Score =   157 bits (398),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 107/171 (63%), Positives = 126/171 (74%), Gaps = 12/171 (7%)
 Frame = +2

Query  2    GANDGLVSIASLMMGVGTVKQDIKAMILTGFAGMVAGACSMAIGEFVSVYSQRDIEVAQM  181
            GANDGL+S +SLMMGVG V+QD+K MILTG AG+VAGACSMAIGEFVSVYSQ DIE+AQM
Sbjct  54   GANDGLLSTSSLMMGVGAVRQDVKTMILTGIAGLVAGACSMAIGEFVSVYSQYDIELAQM  113

Query  182  KRKKNRRNGedageeeeeesdvdeLPNPMQAAAASVVAFTMGAMVPLLAASFIKPYKVRI  361
            KR+ N                 D+LPNP  AA AS +AF +GA VPLL A+F+K YKVR+
Sbjct  114  KRQGNYNT------------QKDKLPNPYYAAFASAIAFALGAFVPLLGAAFVKDYKVRL  161

Query  362  GaviaavtvalvvcgwlgaalggapkgkaSVRVLIGGWLAMAITSGLTKLI  514
            G V+  V++AL V G L A LG AP  K+S RVLIGGW AMA+T GLTKL+
Sbjct  162  GVVVGVVSLALFVFGGLSAILGKAPLVKSSFRVLIGGWFAMALTFGLTKLV  212



>gb|EPS62168.1| hypothetical protein M569_12624, partial [Genlisea aurea]
Length=194

 Score =   157 bits (396),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 101/175 (58%), Positives = 131/175 (75%), Gaps = 3/175 (2%)
 Frame = +2

Query  2    GANDGLVSIASLMMGVGTVKQDIKAMILTGFAGMVAGACSMAIGEFVSVYSQRDIEVAQM  181
            GANDGL+S ASLM+G+G VK+D K+M+L G AG++AGACSMAIGEFVSVY+Q DIEVAQ+
Sbjct  16   GANDGLLSTASLMVGIGAVKKDTKSMVLAGIAGLLAGACSMAIGEFVSVYAQYDIEVAQI  75

Query  182  KRKKNRRNGedage---eeeeesdvdeLPNPMQAAAASVVAFTMGAMVPLLAASFIKPYK  352
            +R+KN R           + E  + ++LPNP  AA +S  +F +GA VPLLAA FIK Y+
Sbjct  76   EREKNPREVAARVSGGGSQAEAEEEEKLPNPYYAAISSGFSFVVGAAVPLLAAGFIKNYQ  135

Query  353  VRIGaviaavtvalvvcgwlgaalggapkgkaSVRVLIGGWLAMAITSGLTKLIG  517
            +R+G V+AAVT ALV  G++GA LG A   K++ RVLIGGW+AM +T GLTK +G
Sbjct  136  LRLGVVVAAVTSALVSFGYVGAVLGKANPLKSTARVLIGGWVAMGLTFGLTKAVG  190



>ref|XP_006423813.1| hypothetical protein CICLE_v10030208mg [Citrus clementina]
 gb|ESR37053.1| hypothetical protein CICLE_v10030208mg [Citrus clementina]
Length=226

 Score =   157 bits (398),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 109/174 (63%), Positives = 136/174 (78%), Gaps = 2/174 (1%)
 Frame = +2

Query  2    GANDGLVSIASLMMGVGTVKQDIKAMILTGFAGMVAGACSMAIGEFVSVYSQRDIEVAQM  181
            GANDGLVS+ASLMMGVG VK DIKAM+L GFAG+VAGA SMAIGEFVSV +QRDIE+AQM
Sbjct  47   GANDGLVSVASLMMGVGAVKTDIKAMLLAGFAGLVAGAGSMAIGEFVSVCTQRDIEIAQM  106

Query  182  KRKKNRR--NGedageeeeeesdvdeLPNPMQAAAASVVAFTMGAMVPLLAASFIKPYKV  355
            KR + ++  + E+  E +E     + LPNP QAA AS +AF++GA+VPLL ++F++ +KV
Sbjct  107  KRDQQKKITSNENHEEPDENIQREEALPNPAQAAIASALAFSVGAVVPLLGSAFVRDHKV  166

Query  356  RIGaviaavtvalvvcgwlgaalggapkgkaSVRVLIGGWLAMAITSGLTKLIG  517
            R+  V A  ++ALVV G LGA LG  P  K+S RVL+GGW+AMAIT GLTKLIG
Sbjct  167  RLAVVAAVASIALVVFGVLGALLGKTPIVKSSARVLVGGWMAMAITFGLTKLIG  220



>ref|XP_006492643.1| PREDICTED: vacuolar iron transporter homolog 2.1-like [Citrus 
sinensis]
Length=226

 Score =   157 bits (398),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 109/174 (63%), Positives = 136/174 (78%), Gaps = 2/174 (1%)
 Frame = +2

Query  2    GANDGLVSIASLMMGVGTVKQDIKAMILTGFAGMVAGACSMAIGEFVSVYSQRDIEVAQM  181
            GANDGLVS+ASLMMGVG VK DIKAM+L GFAG+VAGA SMAIGEFVSV +QRDIE+AQM
Sbjct  47   GANDGLVSVASLMMGVGAVKTDIKAMLLAGFAGLVAGAGSMAIGEFVSVCTQRDIEIAQM  106

Query  182  KRKKNRR--NGedageeeeeesdvdeLPNPMQAAAASVVAFTMGAMVPLLAASFIKPYKV  355
            KR + ++  + E+  E +E     + LPNP QAA AS +AF++GA+VPLL ++F++ +KV
Sbjct  107  KRDQQKKIISNENHEEPDENIQREEALPNPAQAAIASALAFSVGAVVPLLGSAFVRDHKV  166

Query  356  RIGaviaavtvalvvcgwlgaalggapkgkaSVRVLIGGWLAMAITSGLTKLIG  517
            R+  V A  ++ALVV G LGA LG  P  K+S RVL+GGW+AMAIT GLTKLIG
Sbjct  167  RLAVVAAVASIALVVFGVLGALLGKTPIVKSSARVLVGGWMAMAITFGLTKLIG  220



>ref|XP_003532624.1| PREDICTED: vacuolar iron transporter homolog 4-like [Glycine 
max]
Length=221

 Score =   157 bits (398),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 110/172 (64%), Positives = 135/172 (78%), Gaps = 4/172 (2%)
 Frame = +2

Query  2    GANDGLVSIASLMMGVGTVKQDIKAMILTGFAGMVAGACSMAIGEFVSVYSQRDIEVAQM  181
            GANDGLVS+ASLMMGVG VK+DI AMIL GFAG+VAGACSMAIGEFVSVY+Q DIE AQ+
Sbjct  50   GANDGLVSVASLMMGVGAVKKDISAMILAGFAGLVAGACSMAIGEFVSVYTQYDIEKAQL  109

Query  182  KRKKNRRNGedageeeeeesdvdeLPNPMQAAAASVVAFTMGAMVPLLAASFIKPYKVRI  361
            KR+    N         EE+  ++LP P QAA AS +AF++GA+VP+LAA FI+ +KVR+
Sbjct  110  KRESESNNN----RGVNEEAQREKLPKPFQAALASALAFSVGALVPMLAAVFIRSHKVRM  165

Query  362  GaviaavtvalvvcgwlgaalggapkgkaSVRVLIGGWLAMAITSGLTKLIG  517
            G V AAV++AL+V G +GA LG  P  ++ +RVLIGGW+AMAIT GLTKLIG
Sbjct  166  GVVAAAVSLALLVFGGVGAVLGNTPVKRSCLRVLIGGWMAMAITFGLTKLIG  217



>ref|XP_003531055.1| PREDICTED: vacuolar iron transporter homolog 4-like [Glycine 
max]
Length=230

 Score =   157 bits (398),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 107/172 (62%), Positives = 137/172 (80%), Gaps = 4/172 (2%)
 Frame = +2

Query  2    GANDGLVSIASLMMGVGTVKQDIKAMILTGFAGMVAGACSMAIGEFVSVYSQRDIEVAQM  181
            GANDGLVS+ASLMMGVG VK+DI AM+L GFAG+VAGACSMAIGEFVSVY+Q DIE+ Q+
Sbjct  59   GANDGLVSVASLMMGVGAVKKDISAMLLAGFAGLVAGACSMAIGEFVSVYTQYDIEMTQI  118

Query  182  KRKKNRRNGedageeeeeesdvdeLPNPMQAAAASVVAFTMGAMVPLLAASFIKPYKVRI  361
            KR++   N         EE+  ++LPNP QAA AS +AF++GA+VPL+AA FI+ +K+R+
Sbjct  119  KREREANNN----RGVNEETQREKLPNPFQAALASALAFSVGALVPLIAAVFIRNHKIRM  174

Query  362  GaviaavtvalvvcgwlgaalggapkgkaSVRVLIGGWLAMAITSGLTKLIG  517
            G V AAV++AL+V G +GA LG  P  ++ +RVL+GGW+AMAIT GLTKLIG
Sbjct  175  GVVAAAVSLALLVFGGVGAVLGKTPVTRSCLRVLVGGWMAMAITFGLTKLIG  226



>gb|KHN39190.1| Nodulin-21 [Glycine soja]
Length=226

 Score =   157 bits (397),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 98/175 (56%), Positives = 129/175 (74%), Gaps = 2/175 (1%)
 Frame = +2

Query  2    GANDGLVSIASLMMGVGTVKQDIKAMILTGFAGMVAGACSMAIGEFVSVYSQRDIEVAQM  181
            GANDGLVS+ SLMMGVG VK+D KAM+L GFAG+VAG C MAIGEFV+V +Q ++E+ QM
Sbjct  50   GANDGLVSVTSLMMGVGAVKRDEKAMLLAGFAGLVAGTCGMAIGEFVAVCTQYEVELGQM  109

Query  182  KRKKNRRNGedageeeeeesdvdeLPNPMQAAAASVVAFTMGAMVPLLAASFIKPYKVRI  361
            KR  N   G    ++ E   +   LPNP+QA  AS V+F++GA+VPLL+A+FI+ Y+ R+
Sbjct  110  KRDMNMTVG--EEKDLEMGMEKRALPNPLQATLASAVSFSIGALVPLLSAAFIENYRNRV  167

Query  362  GaviaavtvalvvcgwlgaalggapkgkaSVRVLIGGWLAMAITSGLTKLIGIKS  526
              V+A  ++ALVV G + A LG   K K+ VR L+GGW+AMAIT GLTKL+G K+
Sbjct  168  IVVVAMASLALVVFGRVVAQLGKTHKMKSCVRFLLGGWIAMAITFGLTKLLGAKA  222



>ref|XP_010103834.1| hypothetical protein L484_024136 [Morus notabilis]
 gb|EXB97275.1| hypothetical protein L484_024136 [Morus notabilis]
Length=212

 Score =   157 bits (396),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 111/172 (65%), Positives = 131/172 (76%), Gaps = 11/172 (6%)
 Frame = +2

Query  2    GANDGLVSIASLMMGVGTVKQDIKAMILTGFAGMVAGACSMAIGEFVSVYSQRDIEVAQM  181
            GANDGL+S ASLMMGVG V+ D+K MILTG AG+VAGACSMAIGEFVSVYSQRD+EVAQM
Sbjct  48   GANDGLLSTASLMMGVGAVRTDMKTMILTGIAGLVAGACSMAIGEFVSVYSQRDMEVAQM  107

Query  182  KRKKNRRNGedageeeeeesdvdeLPNPMQAAAASVVAFTMGAMVPLLAASFIKPYKVRI  361
            +RK N+                ++LP+P++AAAAS VAF  GA VPLL ASF++ YKVR+
Sbjct  108  QRKGNKEG-----------VKKEKLPSPLRAAAASAVAFAAGAAVPLLGASFVRDYKVRL  156

Query  362  GaviaavtvalvvcgwlgaalggapkgkaSVRVLIGGWLAMAITSGLTKLIG  517
            G V+  VT+AL+  G LGA LG AP  K+SVRVL+GGWLAM IT GLTKL G
Sbjct  157  GVVVMVVTLALLGFGALGALLGKAPPVKSSVRVLLGGWLAMGITFGLTKLFG  208



>ref|XP_007041604.1| Vacuolar iron transporter family protein [Theobroma cacao]
 gb|EOX97435.1| Vacuolar iron transporter family protein [Theobroma cacao]
Length=216

 Score =   156 bits (395),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 109/172 (63%), Positives = 133/172 (77%), Gaps = 6/172 (3%)
 Frame = +2

Query  2    GANDGLVSIASLMMGVGTVKQDIKAMILTGFAGMVAGACSMAIGEFVSVYSQRDIEVAQM  181
            GANDGL+S ASLMMGVG V++D K MILTG AG+VAGACSMAIGE+VSVYSQ DIE++QM
Sbjct  47   GANDGLLSTASLMMGVGAVRKDSKTMILTGIAGLVAGACSMAIGEYVSVYSQYDIELSQM  106

Query  182  KRKKNRRNGedageeeeeesdvdeLPNPMQAAAASVVAFTMGAMVPLLAASFIKPYKVRI  361
            KR K  +N          + D + LPNP+QAAAAS VAF +GA++PLL A+FI+ Y VR+
Sbjct  107  KRDKMTKNN------VLADHDKESLPNPLQAAAASAVAFAIGAVIPLLGAAFIRDYMVRL  160

Query  362  GaviaavtvalvvcgwlgaalggapkgkaSVRVLIGGWLAMAITSGLTKLIG  517
              V+  VT+AL+  G LG+ LGGAP  K+S+RVL+GGWLAM IT GLTKLIG
Sbjct  161  TVVLGVVTLALIGFGALGSLLGGAPMLKSSLRVLVGGWLAMGITFGLTKLIG  212



>ref|XP_006298517.1| hypothetical protein CARUB_v10014595mg [Capsella rubella]
 gb|EOA31415.1| hypothetical protein CARUB_v10014595mg [Capsella rubella]
Length=219

 Score =   156 bits (395),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 104/172 (60%), Positives = 131/172 (76%), Gaps = 0/172 (0%)
 Frame = +2

Query  2    GANDGLVSIASLMMGVGTVKQDIKAMILTGFAGMVAGACSMAIGEFVSVYSQRDIEVAQM  181
            GANDGLV++ASLMMGVG++K+D+KAM+L GFAG+VAGACSMAIGEFVSV +QRDIE AQM
Sbjct  42   GANDGLVTVASLMMGVGSIKEDVKAMLLVGFAGLVAGACSMAIGEFVSVCTQRDIETAQM  101

Query  182  KRKKNRRNGedageeeeeesdvdeLPNPMQAAAASVVAFTMGAMVPLLAASFIKPYKVRI  361
            KR    +    A +E+EEE   + LPNP QAA AS +AF++GA +PLL+A  I+ +KVR+
Sbjct  102  KRNIENKTSLSAIDEQEEEEKNERLPNPGQAAIASALAFSVGAAMPLLSAVIIENHKVRM  161

Query  362  GaviaavtvalvvcgwlgaalggapkgkaSVRVLIGGWLAMAITSGLTKLIG  517
              V    T+AL+V G  GA LG     K+SVRV+IGGW+AMA+T  LTK IG
Sbjct  162  VVVAVVATIALIVFGVTGAVLGKTSVVKSSVRVVIGGWMAMALTFALTKFIG  213



>ref|XP_010525582.1| PREDICTED: vacuolar iron transporter homolog 1-like [Tarenaya 
hassleriana]
Length=215

 Score =   156 bits (394),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 114/172 (66%), Positives = 138/172 (80%), Gaps = 5/172 (3%)
 Frame = +2

Query  2    GANDGLVSIASLMMGVGTVKQDIKAMILTGFAGMVAGACSMAIGEFVSVYSQRDIEVAQM  181
            GANDGLVS ASLMMGVG VK+D+KAMIL+GFAG+VAGA SMAIGEFVSVYSQ DI++AQ+
Sbjct  45   GANDGLVSTASLMMGVGAVKEDVKAMILSGFAGLVAGASSMAIGEFVSVYSQYDIQLAQI  104

Query  182  KRKKNRRNGedageeeeeesdvdeLPNPMQAAAASVVAFTMGAMVPLLAASFIKPYKVRI  361
             R++ R     + E      + + LP+P+QAAAAS +AF +GA+VPLLAA+FIK Y+VRI
Sbjct  105  NRQRQR-----SPESTAAAEEEERLPSPVQAAAASALAFAVGAIVPLLAAAFIKGYRVRI  159

Query  362  GaviaavtvalvvcgwlgaalggapkgkaSVRVLIGGWLAMAITSGLTKLIG  517
             AV AAVT ALVV GWLGA LG  P  +++ RVL+GGWLAMA+T GLTKLIG
Sbjct  160  AAVTAAVTAALVVFGWLGAVLGKGPARRSAARVLVGGWLAMAVTFGLTKLIG  211



>ref|XP_004305016.1| PREDICTED: vacuolar iron transporter homolog 4-like [Fragaria 
vesca subsp. vesca]
Length=229

 Score =   156 bits (395),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 110/172 (64%), Positives = 134/172 (78%), Gaps = 3/172 (2%)
 Frame = +2

Query  2    GANDGLVSIASLMMGVGTVKQDIKAMILTGFAGMVAGACSMAIGEFVSVYSQRDIEVAQM  181
            GANDGLVS+ASLMMGVG VKQD+KAM+L GFAG+VAGACSMAIGEFVSVY+Q DIE++QM
Sbjct  55   GANDGLVSVASLMMGVGAVKQDVKAMLLAGFAGLVAGACSMAIGEFVSVYTQYDIEISQM  114

Query  182  KRKKNRRNGedageeeeeesdvdeLPNPMQAAAASVVAFTMGAMVPLLAASFIKPYKVRI  361
            KR+  + NG   G   EEE+   +LPNP QAA AS +AF++GA+VPLL A+FI  + VR+
Sbjct  115  KREVMKGNG---GSASEEEAKKKKLPNPAQAAIASAIAFSIGAVVPLLGAAFIGQHNVRM  171

Query  362  GaviaavtvalvvcgwlgaalggapkgkaSVRVLIGGWLAMAITSGLTKLIG  517
              V    ++ALVV G +GA +G  P   + VRVLIGGW+AMAIT GLTKLIG
Sbjct  172  LVVALLASIALVVFGGIGARMGRTPMINSCVRVLIGGWMAMAITFGLTKLIG  223



>ref|XP_009136106.1| PREDICTED: vacuolar iron transporter homolog 2.1 [Brassica rapa]
 emb|CDY52279.1| BnaA03g57720D [Brassica napus]
Length=219

 Score =   156 bits (394),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 104/172 (60%), Positives = 131/172 (76%), Gaps = 0/172 (0%)
 Frame = +2

Query  2    GANDGLVSIASLMMGVGTVKQDIKAMILTGFAGMVAGACSMAIGEFVSVYSQRDIEVAQM  181
            G+NDGLV++ASLMMGVG++K+D+KAM+L GFAG+VAGACSMAIGEFVSV +QRDIE AQM
Sbjct  42   GSNDGLVTVASLMMGVGSIKEDVKAMLLVGFAGLVAGACSMAIGEFVSVCTQRDIETAQM  101

Query  182  KRKKNRRNGedageeeeeesdvdeLPNPMQAAAASVVAFTMGAMVPLLAASFIKPYKVRI  361
            KR         A +E++EE   + LPNP QAA AS +AF++GA +PLLAA FI+ +KVR+
Sbjct  102  KRAIETETSLSAIDEQDEEEKKERLPNPGQAALASALAFSVGAAMPLLAAVFIENHKVRM  161

Query  362  GaviaavtvalvvcgwlgaalggapkgkaSVRVLIGGWLAMAITSGLTKLIG  517
              V    T+AL+V G  GA LG     K+SVRV+IGGW+AM +T GLTK IG
Sbjct  162  AVVAIVATLALLVFGVTGAVLGKTSVFKSSVRVVIGGWMAMVLTFGLTKFIG  213



>ref|XP_010466942.1| PREDICTED: vacuolar iron transporter homolog 2.1-like [Camelina 
sativa]
Length=219

 Score =   156 bits (394),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 108/172 (63%), Positives = 133/172 (77%), Gaps = 0/172 (0%)
 Frame = +2

Query  2    GANDGLVSIASLMMGVGTVKQDIKAMILTGFAGMVAGACSMAIGEFVSVYSQRDIEVAQM  181
            GANDGLV++ASLMMGVG++K+D+KAM+L GFAG+VAGACSMAIGEFVSV +QRDIE AQM
Sbjct  42   GANDGLVTVASLMMGVGSIKEDVKAMLLVGFAGLVAGACSMAIGEFVSVCTQRDIETAQM  101

Query  182  KRKKNRRNGedageeeeeesdvdeLPNPMQAAAASVVAFTMGAMVPLLAASFIKPYKVRI  361
            KR    +    A +E+EEE   + LPNP QAA AS +AF++GA +PLLAA FI+ +KVR+
Sbjct  102  KRAIENKTSLSAIDEQEEEEKKERLPNPGQAAIASALAFSVGAAMPLLAAVFIENHKVRM  161

Query  362  GaviaavtvalvvcgwlgaalggapkgkaSVRVLIGGWLAMAITSGLTKLIG  517
              V    T+ALVV G  GA LG     K+SVRV+IGGW+AMA+T GLTK IG
Sbjct  162  AVVAVVATIALVVFGVTGAVLGKTSVVKSSVRVVIGGWMAMALTFGLTKFIG  213



>ref|XP_010488631.1| PREDICTED: vacuolar iron transporter homolog 2.1-like [Camelina 
sativa]
Length=219

 Score =   155 bits (393),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 108/172 (63%), Positives = 133/172 (77%), Gaps = 0/172 (0%)
 Frame = +2

Query  2    GANDGLVSIASLMMGVGTVKQDIKAMILTGFAGMVAGACSMAIGEFVSVYSQRDIEVAQM  181
            GANDGLV++ASLMMGVG++K+D+KAM+L GFAG+VAGACSMAIGEFVSV +QRDIE AQM
Sbjct  42   GANDGLVTVASLMMGVGSIKEDVKAMLLVGFAGLVAGACSMAIGEFVSVCTQRDIETAQM  101

Query  182  KRKKNRRNGedageeeeeesdvdeLPNPMQAAAASVVAFTMGAMVPLLAASFIKPYKVRI  361
            KR    +    A +E+EEE   + LPNP QAA AS +AF++GA +PLLAA FI+ +KVR+
Sbjct  102  KRAIENKTSLSAIDEQEEEEKKERLPNPGQAAIASALAFSVGAAMPLLAAVFIENHKVRM  161

Query  362  GaviaavtvalvvcgwlgaalggapkgkaSVRVLIGGWLAMAITSGLTKLIG  517
              V    T+ALVV G  GA LG     K+SVRV+IGGW+AMA+T GLTK IG
Sbjct  162  AVVAVVATIALVVFGVTGAVLGKTSVVKSSVRVVIGGWMAMALTFGLTKFIG  213



>gb|AAK52980.1|AF375396_1 AT3g25190/MJL12_14 [Arabidopsis thaliana]
 gb|AAL47414.1| AT3g25190/MJL12_14 [Arabidopsis thaliana]
Length=190

 Score =   155 bits (391),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 107/172 (62%), Positives = 132/172 (77%), Gaps = 0/172 (0%)
 Frame = +2

Query  2    GANDGLVSIASLMMGVGTVKQDIKAMILTGFAGMVAGACSMAIGEFVSVYSQRDIEVAQM  181
            GANDGLV++ASLMMGVG++K+D+KAM+L GFAG+VAGACSMAIGEFVSV +QRDIE AQM
Sbjct  13   GANDGLVTVASLMMGVGSIKEDVKAMLLVGFAGLVAGACSMAIGEFVSVCTQRDIETAQM  72

Query  182  KRKKNRRNGedageeeeeesdvdeLPNPMQAAAASVVAFTMGAMVPLLAASFIKPYKVRI  361
            KR    +    A +E+EEE   + LPNP QAA AS +AF++GA +PLL A FI+ +KVR+
Sbjct  73   KRAIEHKTSLSAIDEQEEEEKKERLPNPGQAAIASALAFSVGAAMPLLGAVFIENHKVRM  132

Query  362  GaviaavtvalvvcgwlgaalggapkgkaSVRVLIGGWLAMAITSGLTKLIG  517
              V    T+ALVV G  GA LG     K+SVRV+IGGW+AMA+T GLTK IG
Sbjct  133  VVVAVVATIALVVFGVTGAVLGKTSVVKSSVRVVIGGWMAMALTFGLTKFIG  184



>ref|XP_010934147.1| PREDICTED: vacuolar iron transporter homolog 2-like [Elaeis guineensis]
Length=235

 Score =   156 bits (394),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 96/173 (55%), Positives = 125/173 (72%), Gaps = 6/173 (3%)
 Frame = +2

Query  2    GANDGLVSIASLMMGVGTVKQDIKAMILTGFAGMVAGACSMAIGEFVSVYSQRDIEVAQM  181
            GANDGLVS+ASLM+GVG V Q  KAM+++G AG+VAGACSMAIGEFVSVY+Q DIEVAQM
Sbjct  60   GANDGLVSVASLMIGVGAVNQTAKAMLVSGLAGLVAGACSMAIGEFVSVYAQYDIEVAQM  119

Query  182  KRKKNRRNGedageeeeeesdvdeLPNPMQAAAASVVAFTMGAMVPLLAASFIKPYKVRI  361
            +R+    +G       E   + + LPNP+ AA AS +AF MGA++PLLA  FI+ + VR+
Sbjct  120  ERESLESSG------SEAGKEKESLPNPLMAAGASALAFGMGALLPLLAGGFIRSWGVRV  173

Query  362  GaviaavtvalvvcgwlgaalggapkgkaSVRVLIGGWLAMAITSGLTKLIGI  520
            G V A  ++ L   G  GA LGGA   K+++RVL+GGWLAM +T G+ +L G+
Sbjct  174  GVVCAVSSLGLAGFGAAGAVLGGANVSKSALRVLLGGWLAMLVTFGVLRLFGL  226



>ref|XP_007159064.1| hypothetical protein PHAVU_002G205200g [Phaseolus vulgaris]
 gb|ESW31058.1| hypothetical protein PHAVU_002G205200g [Phaseolus vulgaris]
Length=221

 Score =   155 bits (393),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 106/172 (62%), Positives = 138/172 (80%), Gaps = 4/172 (2%)
 Frame = +2

Query  2    GANDGLVSIASLMMGVGTVKQDIKAMILTGFAGMVAGACSMAIGEFVSVYSQRDIEVAQM  181
            GANDGLVS+ASLMMGVG VK+DI AM++ GFAG+VAGACSMAIGEFVSVY+Q DIE+ Q+
Sbjct  50   GANDGLVSVASLMMGVGAVKKDISAMLIAGFAGLVAGACSMAIGEFVSVYTQYDIEMTQL  109

Query  182  KRKKNRRNGedageeeeeesdvdeLPNPMQAAAASVVAFTMGAMVPLLAASFIKPYKVRI  361
            KR++   N        +EE + ++LPNP QAA AS +AF++GA+VP+LAA FI+ +K+R+
Sbjct  110  KREREANNN----GGVDEEPEREKLPNPFQAALASALAFSIGALVPMLAAVFIRNHKIRM  165

Query  362  GaviaavtvalvvcgwlgaalggapkgkaSVRVLIGGWLAMAITSGLTKLIG  517
            G + AAV++AL+V G +GA LG  P  ++ +RVLIGGW+AMAIT GLTKLIG
Sbjct  166  GVIGAAVSLALLVFGGVGAVLGKTPVMRSCLRVLIGGWIAMAITFGLTKLIG  217



>ref|XP_006586352.1| PREDICTED: nodulin-21-like [Glycine max]
Length=274

 Score =   157 bits (397),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 98/175 (56%), Positives = 129/175 (74%), Gaps = 2/175 (1%)
 Frame = +2

Query  2    GANDGLVSIASLMMGVGTVKQDIKAMILTGFAGMVAGACSMAIGEFVSVYSQRDIEVAQM  181
            GANDGLVS+ SLMMGVG VK+D KAM+L GFAG+VAG C MAIGEFV+V +Q ++E+ QM
Sbjct  98   GANDGLVSVTSLMMGVGAVKRDEKAMLLAGFAGLVAGTCGMAIGEFVAVCTQYEVELGQM  157

Query  182  KRKKNRRNGedageeeeeesdvdeLPNPMQAAAASVVAFTMGAMVPLLAASFIKPYKVRI  361
            KR  N   G    ++ E   +   LPNP+QA  AS V+F++GA+VPLL+A+FI+ Y+ R+
Sbjct  158  KRDMNMTVG--EEKDLEMGMEKRALPNPLQATLASAVSFSIGALVPLLSAAFIENYRNRV  215

Query  362  GaviaavtvalvvcgwlgaalggapkgkaSVRVLIGGWLAMAITSGLTKLIGIKS  526
              V+A  ++ALVV G + A LG   K K+ VR L+GGW+AMAIT GLTKL+G K+
Sbjct  216  IVVVAMASLALVVFGRVVAQLGKTHKMKSCVRFLLGGWIAMAITFGLTKLLGAKA  270



>gb|EYU35414.1| hypothetical protein MIMGU_mgv1a018031mg, partial [Erythranthe 
guttata]
Length=212

 Score =   154 bits (390),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 110/172 (64%), Positives = 130/172 (76%), Gaps = 8/172 (5%)
 Frame = +2

Query  2    GANDGLVSIASLMMGVGTVKQDIKAMILTGFAGMVAGACSMAIGEFVSVYSQRDIEVAQM  181
            GANDGLVSIASLMMGVG VK D+KAMILTGFAG+ AGACSMAIGEFVSVYSQ DIE AQM
Sbjct  43   GANDGLVSIASLMMGVGAVKDDVKAMILTGFAGLCAGACSMAIGEFVSVYSQLDIERAQM  102

Query  182  KRKKNRRNGedageeeeeesdvdeLPNPMQAAAASVVAFTMGAMVPLLAASFIKPYKVRI  361
            KR     NG         E     +PNP QAA AS +AF++GA+VPLLAA+F+  Y+VR+
Sbjct  103  KRVAG-ING-------TSEESGKNMPNPFQAAFASAIAFSLGAVVPLLAAAFVTEYEVRL  154

Query  362  GaviaavtvalvvcgwlgaalggapkgkaSVRVLIGGWLAMAITSGLTKLIG  517
              V+AA T+ LVV GW+GA LG    G++  RVL+GGW+AMAIT GLT+L+G
Sbjct  155  AVVVAATTLMLVVFGWVGAVLGKTRVGRSCGRVLVGGWMAMAITFGLTRLLG  206



>ref|XP_003619938.1| Nodulin-related integral membrane protein DUF125 [Medicago truncatula]
 gb|KEH16669.1| vacuolar iron transporter-like protein [Medicago truncatula]
 gb|KEH16670.1| vacuolar iron transporter-like protein [Medicago truncatula]
Length=212

 Score =   154 bits (390),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 107/171 (63%), Positives = 126/171 (74%), Gaps = 13/171 (8%)
 Frame = +2

Query  2    GANDGLVSIASLMMGVGTVKQDIKAMILTGFAGMVAGACSMAIGEFVSVYSQRDIEVAQM  181
            GANDGL+S ASLMMGVG V +D+K MILTG AG+VAGACSMAIGEFVSVYSQ DIE AQM
Sbjct  50   GANDGLLSTASLMMGVGAVTKDVKTMILTGIAGLVAGACSMAIGEFVSVYSQYDIEFAQM  109

Query  182  KRKKNRRNGedageeeeeesdvdeLPNPMQAAAASVVAFTMGAMVPLLAASFIKPYKVRI  361
            KR+ N              S  D+LPNP  AA AS +AF +GA VPLL A+F+K YKVR+
Sbjct  110  KRQGN-------------ISQKDKLPNPYYAAFASAIAFAVGAFVPLLGAAFVKDYKVRL  156

Query  362  GaviaavtvalvvcgwlgaalggapkgkaSVRVLIGGWLAMAITSGLTKLI  514
            G V+  V++AL   G L A LG AP  K+S+RVLIGGWLAM++T GLTKL+
Sbjct  157  GVVVGVVSLALFGFGLLSAVLGKAPLVKSSLRVLIGGWLAMSLTFGLTKLV  207



>gb|AES63379.2| vacuolar iron transporter-like protein [Medicago truncatula]
Length=212

 Score =   154 bits (390),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 107/171 (63%), Positives = 126/171 (74%), Gaps = 13/171 (8%)
 Frame = +2

Query  2    GANDGLVSIASLMMGVGTVKQDIKAMILTGFAGMVAGACSMAIGEFVSVYSQRDIEVAQM  181
            GANDGL+S ASLMMGVG V +D+K MILTG AG+VAGACSMAIGEFVSVYSQ DIE AQM
Sbjct  50   GANDGLLSTASLMMGVGAVTKDVKTMILTGIAGLVAGACSMAIGEFVSVYSQYDIEFAQM  109

Query  182  KRKKNRRNGedageeeeeesdvdeLPNPMQAAAASVVAFTMGAMVPLLAASFIKPYKVRI  361
            KR+ N              S  D+LPNP  AA AS +AF +GA VPLL A+F+K YKVR+
Sbjct  110  KRQGN-------------ISQKDKLPNPYYAAFASAIAFAVGAFVPLLGAAFVKDYKVRL  156

Query  362  GaviaavtvalvvcgwlgaalggapkgkaSVRVLIGGWLAMAITSGLTKLI  514
            G V+  V++AL   G L A LG AP  K+S+RVLIGGWLAM++T GLTKL+
Sbjct  157  GVVVGVVSLALFGFGLLSAVLGKAPLVKSSLRVLIGGWLAMSLTFGLTKLV  207



>ref|NP_189156.1| vacuolar iron transporter homolog 2.1 [Arabidopsis thaliana]
 sp|Q9LSF6.1|VTH21_ARATH RecName: Full=Vacuolar iron transporter homolog 2.1; AltName: 
Full=Protein NODULIN-LIKE 21 [Arabidopsis thaliana]
 dbj|BAB02079.1| nodulin-lile protein [Arabidopsis thaliana]
 gb|AEE76991.1| vacuolar iron transporter homolog 2.1 [Arabidopsis thaliana]
Length=219

 Score =   154 bits (390),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 107/172 (62%), Positives = 132/172 (77%), Gaps = 0/172 (0%)
 Frame = +2

Query  2    GANDGLVSIASLMMGVGTVKQDIKAMILTGFAGMVAGACSMAIGEFVSVYSQRDIEVAQM  181
            GANDGLV++ASLMMGVG++K+D+KAM+L GFAG+VAGACSMAIGEFVSV +QRDIE AQM
Sbjct  42   GANDGLVTVASLMMGVGSIKEDVKAMLLVGFAGLVAGACSMAIGEFVSVCTQRDIETAQM  101

Query  182  KRKKNRRNGedageeeeeesdvdeLPNPMQAAAASVVAFTMGAMVPLLAASFIKPYKVRI  361
            KR    +    A +E+EEE   + LPNP QAA AS +AF++GA +PLL A FI+ +KVR+
Sbjct  102  KRAIEHKTSLSAIDEQEEEEKKERLPNPGQAAIASALAFSVGAAMPLLGAVFIENHKVRM  161

Query  362  GaviaavtvalvvcgwlgaalggapkgkaSVRVLIGGWLAMAITSGLTKLIG  517
              V    T+ALVV G  GA LG     K+SVRV+IGGW+AMA+T GLTK IG
Sbjct  162  VVVAVVATIALVVFGVTGAVLGKTSVVKSSVRVVIGGWMAMALTFGLTKFIG  213



>ref|XP_010514030.1| PREDICTED: vacuolar iron transporter homolog 2.1 [Camelina sativa]
Length=219

 Score =   154 bits (390),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 108/172 (63%), Positives = 132/172 (77%), Gaps = 0/172 (0%)
 Frame = +2

Query  2    GANDGLVSIASLMMGVGTVKQDIKAMILTGFAGMVAGACSMAIGEFVSVYSQRDIEVAQM  181
            GANDGLV++ASLMMGVG++K+D+KAM+L GFAG+VAGACSMAIGEFVSV +QRDIE AQM
Sbjct  42   GANDGLVTVASLMMGVGSIKEDVKAMLLVGFAGLVAGACSMAIGEFVSVCTQRDIETAQM  101

Query  182  KRKKNRRNGedageeeeeesdvdeLPNPMQAAAASVVAFTMGAMVPLLAASFIKPYKVRI  361
            KR         A +E+EEE   + LPNP QAA AS +AF++GA +PLLAA FI+ +KVR+
Sbjct  102  KRAIENMTSLSAIDEQEEEEKKERLPNPGQAAIASALAFSVGAAMPLLAAVFIENHKVRM  161

Query  362  GaviaavtvalvvcgwlgaalggapkgkaSVRVLIGGWLAMAITSGLTKLIG  517
              V    T+ALVV G  GA LG     K+SVRV+IGGW+AMA+T GLTK IG
Sbjct  162  AVVAVVATIALVVFGVTGAVLGKTSVVKSSVRVVIGGWMAMALTFGLTKFIG  213



>ref|XP_002887657.1| hypothetical protein ARALYDRAFT_476839 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH63916.1| hypothetical protein ARALYDRAFT_476839 [Arabidopsis lyrata subsp. 
lyrata]
Length=196

 Score =   153 bits (387),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 120/173 (69%), Positives = 139/173 (80%), Gaps = 13/173 (8%)
 Frame = +2

Query  2    GANDGLVSIASLMMGVGTVKQDIKAMILTGFAGMVAGACSMAIGEFVSVYSQRDIEVAQM  181
            GANDGLVS ASLMMGVG VK D+KAMIL+GFAGMVAGACSMAIGEFVSVYSQ DIEVAQM
Sbjct  34   GANDGLVSTASLMMGVGAVKHDVKAMILSGFAGMVAGACSMAIGEFVSVYSQYDIEVAQM  93

Query  182  KRKKNRRNGedageeeeeesdvdeLPNPMQAAAASVVAFTMGAMVPLLAASFIKPYKVRI  361
            +R                E + ++LP+P+QAAAAS +AF+ GA+VPLLAA+F+K YKVRI
Sbjct  94   ERDS-------------VEIEKEKLPSPIQAAAASALAFSAGAIVPLLAAAFVKEYKVRI  140

Query  362  GaviaavtvalvvcgwlgaalggapkgkaSVRVLIGGWLAMAITSGLTKLIGI  520
             AV+ AVTVAL+V GWLGAALG AP  ++S RVL GGWLAMA+T GLTKLIG+
Sbjct  141  IAVVVAVTVALMVFGWLGAALGKAPAVRSSARVLFGGWLAMAVTFGLTKLIGL  193



>ref|XP_006590740.1| PREDICTED: vacuolar iron transporter homolog 2.1-like [Glycine 
max]
Length=230

 Score =   154 bits (389),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 102/173 (59%), Positives = 133/173 (77%), Gaps = 3/173 (2%)
 Frame = +2

Query  2    GANDGLVSIASLMMGVGTVKQDIKAMILTGFAGMVAGACSMAIGEFVSVYSQRDIEVAQM  181
            GANDGLVS+ASLM+G+G VK++I AM+L GFAG++AGACSMAIGEFVSVY+Q DIE+AQ+
Sbjct  56   GANDGLVSVASLMIGIGAVKENITAMLLAGFAGLIAGACSMAIGEFVSVYTQYDIEIAQI  115

Query  182  KRKKNRRNGedageeeeeesdvdeLPNPMQAAAASVVAFTMGAMVPLLAASFIKPYKVRI  361
            KR K   N    G   EE +  ++LPNP QAA AS +AF++GA++PLLAA+FI+ YK+R+
Sbjct  116  KRDKENNN---IGGVGEELAQREKLPNPFQAALASALAFSVGAVIPLLAAAFIRNYKIRL  172

Query  362  GaviaavtvalvvcgwlgaalggapkgkaSVRVLIGGWLAMAITSGLTKLIGI  520
              V    T+ L++ G +GA LG     K+ +RVLIGGW+AM+IT GLTKL GI
Sbjct  173  VVVAVVATLTLLLFGGVGAVLGKTLVRKSCIRVLIGGWMAMSITFGLTKLFGI  225



>ref|XP_008366847.1| PREDICTED: vacuolar iron transporter homolog 4-like [Malus domestica]
Length=227

 Score =   154 bits (389),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 108/172 (63%), Positives = 132/172 (77%), Gaps = 4/172 (2%)
 Frame = +2

Query  2    GANDGLVSIASLMMGVGTVKQDIKAMILTGFAGMVAGACSMAIGEFVSVYSQRDIEVAQM  181
            GANDGLVS+ASLMMGVG VKQD+K M++ GFAG+VAGACSMAIGEFVSVY+Q DIE++QM
Sbjct  54   GANDGLVSVASLMMGVGAVKQDVKTMLIAGFAGLVAGACSMAIGEFVSVYTQYDIEISQM  113

Query  182  KRKKNRRNGedageeeeeesdvdeLPNPMQAAAASVVAFTMGAMVPLLAASFIKPYKVRI  361
            KR+  + NG     E  EE+    LPNP QAA AS +AF++GA+VPLL A+FI  +KVR+
Sbjct  114  KREM-KTNG---RTENVEEAKKKMLPNPAQAALASAIAFSIGAVVPLLGAAFISEHKVRL  169

Query  362  GaviaavtvalvvcgwlgaalggapkgkaSVRVLIGGWLAMAITSGLTKLIG  517
              V A V+VALVV G + A LGG+   K+  RVL+GGW+AM IT  LTKLIG
Sbjct  170  AVVAALVSVALVVFGGVAARLGGSSVVKSCARVLVGGWMAMTITFALTKLIG  221



>gb|KEH31261.1| vacuolar iron transporter-like protein [Medicago truncatula]
Length=224

 Score =   154 bits (388),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 103/172 (60%), Positives = 137/172 (80%), Gaps = 4/172 (2%)
 Frame = +2

Query  2    GANDGLVSIASLMMGVGTVKQDIKAMILTGFAGMVAGACSMAIGEFVSVYSQRDIEVAQM  181
            GANDGL+++ASLM+GVG +K+DIK M+L GFAG+VAGACSMAIGEFVSVY+Q DIE+AQ+
Sbjct  53   GANDGLITVASLMIGVGAIKEDIKVMLLAGFAGLVAGACSMAIGEFVSVYTQYDIEIAQI  112

Query  182  KRKKNRRNGedageeeeeesdvdeLPNPMQAAAASVVAFTMGAMVPLLAASFIKPYKVRI  361
            KR++      +    ++E S+ ++LPNP QAA AS +AF++GA++PLLAA+FIK +K R+
Sbjct  113  KRERE----ANNNNNDDESSEREKLPNPFQAALASALAFSIGAVMPLLAAAFIKNHKTRM  168

Query  362  GaviaavtvalvvcgwlgaalggapkgkaSVRVLIGGWLAMAITSGLTKLIG  517
            G V A V+ AL+V G +GA +G  P  ++ VRVLIGGW+AMAIT G TKLIG
Sbjct  169  GVVAAVVSFALLVFGGVGALVGKTPLMRSCVRVLIGGWMAMAITFGFTKLIG  220



>gb|KEH31259.1| vacuolar iron transporter-like protein [Medicago truncatula]
 gb|KEH31260.1| vacuolar iron transporter-like protein [Medicago truncatula]
Length=224

 Score =   154 bits (388),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 103/172 (60%), Positives = 137/172 (80%), Gaps = 4/172 (2%)
 Frame = +2

Query  2    GANDGLVSIASLMMGVGTVKQDIKAMILTGFAGMVAGACSMAIGEFVSVYSQRDIEVAQM  181
            GANDGL+++ASLM+GVG +K+DIK M+L GFAG+VAGACSMAIGEFVSVY+Q DIE+AQ+
Sbjct  53   GANDGLITVASLMIGVGAIKEDIKVMLLAGFAGLVAGACSMAIGEFVSVYTQYDIEIAQI  112

Query  182  KRKKNRRNGedageeeeeesdvdeLPNPMQAAAASVVAFTMGAMVPLLAASFIKPYKVRI  361
            KR++      +    ++E S+ ++LPNP QAA AS +AF++GA++PLLAA+FIK +K R+
Sbjct  113  KRERE----ANNNNNDDESSEREKLPNPFQAALASALAFSIGAVMPLLAAAFIKNHKTRM  168

Query  362  GaviaavtvalvvcgwlgaalggapkgkaSVRVLIGGWLAMAITSGLTKLIG  517
            G V A V+ AL+V G +GA +G  P  ++ VRVLIGGW+AMAIT G TKLIG
Sbjct  169  GVVAAVVSFALLVFGGVGALVGKTPLMRSCVRVLIGGWMAMAITFGFTKLIG  220



>ref|XP_007159062.1| hypothetical protein PHAVU_002G205000g [Phaseolus vulgaris]
 gb|ESW31056.1| hypothetical protein PHAVU_002G205000g [Phaseolus vulgaris]
Length=229

 Score =   154 bits (388),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 94/172 (55%), Positives = 128/172 (74%), Gaps = 2/172 (1%)
 Frame = +2

Query  2    GANDGLVSIASLMMGVGTVKQDIKAMILTGFAGMVAGACSMAIGEFVSVYSQRDIEVAQM  181
            GANDGLVS+ASLMMGVG V++D KAM+L+GFAG+V+GAC MAIGEFV+VY+Q ++EV QM
Sbjct  56   GANDGLVSVASLMMGVGAVQKDAKAMLLSGFAGLVSGACGMAIGEFVAVYTQYEVEVGQM  115

Query  182  KRKKNRRNGedageeeeeesdvdeLPNPMQAAAASVVAFTMGAMVPLLAASFIKPYKVRI  361
            KR      G    ++ E E +    PNP++A  AS V+F++GA++PLL+A+FI+ +K RI
Sbjct  116  KRDMKMSVG--GEKDLEMEMEKRTFPNPLKATLASAVSFSIGALIPLLSAAFIESFKTRI  173

Query  362  GaviaavtvalvvcgwlgaalggapkgkaSVRVLIGGWLAMAITSGLTKLIG  517
              ++   ++ALVV G + A LG  P  K+  R L+GGWLAMA+T GLTKL+G
Sbjct  174  IVIVVVASLALVVFGRVVAQLGKTPTTKSYARFLLGGWLAMALTFGLTKLLG  225



>ref|XP_003531056.1| PREDICTED: nodulin-21-like [Glycine max]
Length=229

 Score =   154 bits (388),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 97/172 (56%), Positives = 131/172 (76%), Gaps = 4/172 (2%)
 Frame = +2

Query  2    GANDGLVSIASLMMGVGTVKQDIKAMILTGFAGMVAGACSMAIGEFVSVYSQRDIEVAQM  181
            GANDGLVS+ SLMMGVG VK+D KAM++ GFAG+VAGAC MAIGEFV+V +Q ++E+ QM
Sbjct  57   GANDGLVSVTSLMMGVGAVKKDAKAMLVAGFAGLVAGACGMAIGEFVAVCTQYEVELGQM  116

Query  182  KRKKNRRNGedageeeeeesdvdeLPNPMQAAAASVVAFTMGAMVPLLAASFIKPYKVRI  361
            KR+ N   G     E + E++   LPNP+QA  AS ++F++GA+VPLL+A+F+  Y+ R+
Sbjct  117  KREMNMSEG----GERDLETEKRTLPNPLQATWASALSFSIGALVPLLSAAFVADYRTRV  172

Query  362  GaviaavtvalvvcgwlgaalggapkgkaSVRVLIGGWLAMAITSGLTKLIG  517
              V+A  ++ALVV G +GA LG  PK K+ VR L+GGW+AM+IT GLTKL+G
Sbjct  173  IVVVAMASLALVVFGSVGAQLGKTPKLKSCVRFLLGGWIAMSITFGLTKLMG  224



>ref|XP_008388973.1| PREDICTED: vacuolar iron transporter homolog 4-like [Malus domestica]
Length=227

 Score =   154 bits (388),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 105/172 (61%), Positives = 130/172 (76%), Gaps = 4/172 (2%)
 Frame = +2

Query  2    GANDGLVSIASLMMGVGTVKQDIKAMILTGFAGMVAGACSMAIGEFVSVYSQRDIEVAQM  181
            GANDGLVS+ASLMMGVG VKQD+K M++ GFAG+VAGACSMAIGEFVSVY+Q DIE++QM
Sbjct  54   GANDGLVSVASLMMGVGAVKQDVKTMLIAGFAGLVAGACSMAIGEFVSVYTQYDIEISQM  113

Query  182  KRKKNRRNGedageeeeeesdvdeLPNPMQAAAASVVAFTMGAMVPLLAASFIKPYKVRI  361
            KR+  + NG     E  EE+    LPNP  AA AS +AF++GA+VPLL A+FI  +K+R+
Sbjct  114  KREM-KENG---RTENVEEAKKKMLPNPAHAALASAIAFSIGAVVPLLGAAFISEHKMRL  169

Query  362  GaviaavtvalvvcgwlgaalggapkgkaSVRVLIGGWLAMAITSGLTKLIG  517
              V A V+VALVV G + A  GG+   K+  RVL+GGW+AM IT  LTKLIG
Sbjct  170  AVVAALVSVALVVFGGVXARXGGSSVVKSCARVLVGGWMAMTITFALTKLIG  221



>gb|AFK40213.1| unknown [Lotus japonicus]
Length=207

 Score =   153 bits (386),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 105/174 (60%), Positives = 135/174 (78%), Gaps = 2/174 (1%)
 Frame = +2

Query  2    GANDGLVSIASLMMGVGTVKQDIKAMILTGFAGMVAGACSMAIGEFVSVYSQRDIEVAQM  181
            GANDGLVS+ASLMMGVG +K+D+ AM+L GFAG+VAGACSMAIGEFVSVY+Q DIE AQ+
Sbjct  30   GANDGLVSVASLMMGVGAIKEDVSAMLLAGFAGLVAGACSMAIGEFVSVYTQYDIEKAQI  89

Query  182  KRKK--NRRNGedageeeeeesdvdeLPNPMQAAAASVVAFTMGAMVPLLAASFIKPYKV  355
            KRK+  +  N       ++EE++ ++LPNP QAA AS +AF++GA+VPL+AA FI+  K+
Sbjct  90   KRKREADNNNNNKGLSVDDEEAEREKLPNPFQAALASALAFSVGALVPLIAAVFIRNRKI  149

Query  356  RIGaviaavtvalvvcgwlgaalggapkgkaSVRVLIGGWLAMAITSGLTKLIG  517
            R+G V A  ++AL+  G +GA LG  P G +  RVLIGGW+AMAIT  LTKLIG
Sbjct  150  RLGIVAAVASLALLAFGVVGAVLGKTPVGMSCFRVLIGGWMAMAITFYLTKLIG  203



>gb|KHN39189.1| Nodulin-21, partial [Glycine soja]
Length=189

 Score =   152 bits (385),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 98/172 (57%), Positives = 129/172 (75%), Gaps = 2/172 (1%)
 Frame = +2

Query  2    GANDGLVSIASLMMGVGTVKQDIKAMILTGFAGMVAGACSMAIGEFVSVYSQRDIEVAQM  181
            GANDGLVS+ SLMMGVG VK+D KAM+L GFAG+VAG C MAIGEFV+V +Q ++E+ QM
Sbjct  15   GANDGLVSVTSLMMGVGAVKRDEKAMLLAGFAGLVAGTCGMAIGEFVAVCTQYEVELGQM  74

Query  182  KRKKNRRNGedageeeeeesdvdeLPNPMQAAAASVVAFTMGAMVPLLAASFIKPYKVRI  361
            KR  N   G    ++ E   +   LPNP+QA  AS V+F++GA+VPLL+A+FI+ Y+ R+
Sbjct  75   KRDMNMTVG--EEKDLEMGMEKRALPNPLQATLASAVSFSIGALVPLLSAAFIENYRNRV  132

Query  362  GaviaavtvalvvcgwlgaalggapkgkaSVRVLIGGWLAMAITSGLTKLIG  517
              V+A  ++ALVV G +GA LG  PK K+ VR L+GGW+AM+IT GLTKL+G
Sbjct  133  IVVVAMASLALVVFGSVGAQLGKTPKLKSCVRFLLGGWIAMSITFGLTKLMG  184



>ref|XP_008784247.1| PREDICTED: vacuolar iron transporter homolog 4-like [Phoenix 
dactylifera]
Length=206

 Score =   153 bits (386),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 108/172 (63%), Positives = 132/172 (77%), Gaps = 8/172 (5%)
 Frame = +2

Query  2    GANDGLVSIASLMMGVGTVKQDIKAMILTGFAGMVAGACSMAIGEFVSVYSQRDIEVAQM  181
            GA+DGLVS +SLMMG+G VK ++KAM+LTGFAG+VAGACSMAIGEFVSV SQ D+EVAQ 
Sbjct  39   GASDGLVSTSSLMMGIGAVKGELKAMVLTGFAGLVAGACSMAIGEFVSVCSQLDVEVAQR  98

Query  182  KRKKNRRNGedageeeeeesdvdeLPNPMQAAAASVVAFTMGAMVPLLAASFIKPYKVRI  361
            KR++          E   E D D LP+P+QAA AS +AF +GA VPLLAA FI  +KVR+
Sbjct  99   KREQR--------IEGGGEVDGDGLPSPVQAAVASSLAFAVGAGVPLLAAGFISSHKVRL  150

Query  362  GaviaavtvalvvcgwlgaalggapkgkaSVRVLIGGWLAMAITSGLTKLIG  517
            G V AA +VALVV G +GAALG AP G+++VRVL+GGW+AMA T GL +L G
Sbjct  151  GVVAAAASVALVVFGCVGAALGRAPVGRSAVRVLVGGWMAMAATYGLVRLFG  202



>ref|XP_011087827.1| PREDICTED: vacuolar iron transporter homolog 1-like [Sesamum 
indicum]
Length=224

 Score =   153 bits (387),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 112/172 (65%), Positives = 135/172 (78%), Gaps = 5/172 (3%)
 Frame = +2

Query  2    GANDGLVSIASLMMGVGTVKQDIKAMILTGFAGMVAGACSMAIGEFVSVYSQRDIEVAQM  181
            GANDGL+S ASLMMGVG V+QD K MILTG AG+VAGACSMAIGEFVSVYSQ DIEVAQ+
Sbjct  54   GANDGLLSTASLMMGVGAVRQDAKTMILTGIAGLVAGACSMAIGEFVSVYSQYDIEVAQL  113

Query  182  KRKKNRRNGedageeeeeesdvdeLPNPMQAAAASVVAFTMGAMVPLLAASFIKPYKVRI  361
            KR++ R  G       + E+   +LPNP+QAAAAS  AF +GA+VPLLAA+FI+ Y VR+
Sbjct  114  KREQ-RATG----NNSDLEAMKKKLPNPLQAAAASAFAFAVGAVVPLLAAAFIRNYHVRV  168

Query  362  GaviaavtvalvvcgwlgaalggapkgkaSVRVLIGGWLAMAITSGLTKLIG  517
              V+ AV+VAL+  G +GA LG AP  ++S+RV+IGGWLAM IT GLTKLIG
Sbjct  169  VVVVGAVSVALLGFGAVGAVLGQAPVLRSSLRVVIGGWLAMGITFGLTKLIG  220



>ref|XP_009335631.1| PREDICTED: vacuolar iron transporter homolog 4-like [Pyrus x 
bretschneideri]
Length=227

 Score =   153 bits (387),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 113/176 (64%), Positives = 137/176 (78%), Gaps = 12/176 (7%)
 Frame = +2

Query  2    GANDGLVSIASLMMGVGTVKQDIKAMILTGFAGMVAGACSMAIGEFVSVYSQRDIEVAQM  181
            GANDGLVS+ASLMMGVG VKQD+KAM+L GFAG+VAGACSMAIGEFVSVY+Q D+E++QM
Sbjct  54   GANDGLVSVASLMMGVGAVKQDVKAMLLAGFAGLVAGACSMAIGEFVSVYTQYDVEISQM  113

Query  182  KR--KKNRR--NGedageeeeeesdvdeLPNPMQAAAASVVAFTMGAMVPLLAASFIKPY  349
            KR  K N R  NG        EE+    LPNP QAA AS +AF++GA+VPLL A+FI  +
Sbjct  114  KREMKANGRTENG--------EEAKKKSLPNPAQAALASAIAFSIGAVVPLLGAAFITEH  165

Query  350  KVRIGaviaavtvalvvcgwlgaalggapkgkaSVRVLIGGWLAMAITSGLTKLIG  517
            KVR+  V   V++AL+V G +GA LGG+P GK+  RVL+GGW+AMAIT GLTKLIG
Sbjct  166  KVRLAVVAVLVSIALIVFGGVGARLGGSPVGKSCARVLVGGWMAMAITFGLTKLIG  221



>ref|XP_009373968.1| PREDICTED: vacuolar iron transporter homolog 4-like [Pyrus x 
bretschneideri]
Length=227

 Score =   153 bits (387),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 110/172 (64%), Positives = 133/172 (77%), Gaps = 4/172 (2%)
 Frame = +2

Query  2    GANDGLVSIASLMMGVGTVKQDIKAMILTGFAGMVAGACSMAIGEFVSVYSQRDIEVAQM  181
            GANDGLVS+ASLMMGVG VKQD+K M++ GFAG+VAGACSMAIGEFVSVY+Q DIE++QM
Sbjct  54   GANDGLVSVASLMMGVGAVKQDVKTMLIAGFAGLVAGACSMAIGEFVSVYTQYDIEISQM  113

Query  182  KRKKNRRNGedageeeeeesdvdeLPNPMQAAAASVVAFTMGAMVPLLAASFIKPYKVRI  361
            KR+  + NG     E  EE+    LPNP QAA AS VAF++GA+VPLL A+FI  +KVR+
Sbjct  114  KREM-KANG---RTENAEEAKKKMLPNPAQAALASAVAFSIGAVVPLLGAAFISEHKVRL  169

Query  362  GaviaavtvalvvcgwlgaalggapkgkaSVRVLIGGWLAMAITSGLTKLIG  517
              V A V+VALVV G +GA LGG+   K+  RVL+GGW+AM IT  LTKLIG
Sbjct  170  AVVAALVSVALVVFGGVGAWLGGSSVVKSCARVLVGGWMAMTITFALTKLIG  221



>ref|XP_008350614.1| PREDICTED: vacuolar iron transporter homolog 4-like [Malus domestica]
 ref|XP_008366849.1| PREDICTED: vacuolar iron transporter homolog 4-like [Malus domestica]
Length=227

 Score =   153 bits (386),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 107/172 (62%), Positives = 132/172 (77%), Gaps = 4/172 (2%)
 Frame = +2

Query  2    GANDGLVSIASLMMGVGTVKQDIKAMILTGFAGMVAGACSMAIGEFVSVYSQRDIEVAQM  181
            GANDGLVS+ASLMMGVG VKQD+K M++ GFAG+VAGACSMAIGEFVSVY+Q DIE++QM
Sbjct  54   GANDGLVSVASLMMGVGAVKQDVKTMLIAGFAGLVAGACSMAIGEFVSVYTQYDIEISQM  113

Query  182  KRKKNRRNGedageeeeeesdvdeLPNPMQAAAASVVAFTMGAMVPLLAASFIKPYKVRI  361
            KR+  + NG     E  EE+    LPNP  AA AS +AF++GA+VPLL A+FI  +K+R+
Sbjct  114  KREM-KENG---RTENVEEAKKKMLPNPAHAALASAIAFSIGAVVPLLGAAFISEHKMRL  169

Query  362  GaviaavtvalvvcgwlgaalggapkgkaSVRVLIGGWLAMAITSGLTKLIG  517
              V A V+VALVV G +GA LGG+   K+  RVL+GGW+AM IT  LTKLIG
Sbjct  170  AVVAALVSVALVVFGGVGARLGGSSVVKSCARVLVGGWMAMTITFALTKLIG  221



>dbj|BAL46698.1| hypothetical protein [Lotus japonicus]
Length=226

 Score =   153 bits (386),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 94/176 (53%), Positives = 125/176 (71%), Gaps = 11/176 (6%)
 Frame = +2

Query  2    GANDGLVSIASLMMGVGTVKQDIKAMILTGFAGMVAGACSMAIGEFVSVYSQRDIEVAQM  181
            GANDGLVS+ASLMMGVG V +D KAM+L GFAG+VAGAC MAIGEFVSV++Q ++EV QM
Sbjct  50   GANDGLVSVASLMMGVGAVNKDAKAMLLAGFAGLVAGACGMAIGEFVSVFTQYEVEVGQM  109

Query  182  KR-----KKNRRNGedageeeeeesdvdeLPNPMQAAAASVVAFTMGAMVPLLAASFIKP  346
            KR     ++  R+       E        +PNPMQAA AS  +F++G +VPLL+ SF+  
Sbjct  110  KRDMIKSEQGERD------LEMAMEKRKSIPNPMQAALASAFSFSIGGLVPLLSGSFVSV  163

Query  347  YKVRIGaviaavtvalvvcgwlgaalggapkgkaSVRVLIGGWLAMAITSGLTKLI  514
            YK+R+  ++  V++ALV  G +G+ LG  P  ++ VR +IGGW+AMAIT GLTKL+
Sbjct  164  YKIRLLVIVVVVSLALVAFGSVGSLLGKTPMTRSCVRFMIGGWMAMAITFGLTKLL  219



>ref|XP_003593128.1| Nodulin-like protein [Medicago truncatula]
Length=262

 Score =   154 bits (388),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 107/171 (63%), Positives = 126/171 (74%), Gaps = 13/171 (8%)
 Frame = +2

Query  2    GANDGLVSIASLMMGVGTVKQDIKAMILTGFAGMVAGACSMAIGEFVSVYSQRDIEVAQM  181
            GANDGL+S ASLMMGVG V +D+K MILTG AG+VAGACSMAIGEFVSVYSQ DIE AQM
Sbjct  50   GANDGLLSTASLMMGVGAVTKDVKTMILTGIAGLVAGACSMAIGEFVSVYSQYDIEFAQM  109

Query  182  KRKKNRRNGedageeeeeesdvdeLPNPMQAAAASVVAFTMGAMVPLLAASFIKPYKVRI  361
            KR+ N              S  D+LPNP  AA AS +AF +GA VPLL A+F+K YKVR+
Sbjct  110  KRQGN-------------ISQKDKLPNPYYAAFASAIAFAVGAFVPLLGAAFVKDYKVRL  156

Query  362  GaviaavtvalvvcgwlgaalggapkgkaSVRVLIGGWLAMAITSGLTKLI  514
            G V+  V++AL   G L A LG AP  K+S+RVLIGGWLAM++T GLTKL+
Sbjct  157  GVVVGVVSLALFGFGLLSAVLGKAPLVKSSLRVLIGGWLAMSLTFGLTKLV  207



>ref|XP_003532970.1| PREDICTED: vacuolar iron transporter homolog 4-like [Glycine 
max]
Length=217

 Score =   152 bits (385),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 108/171 (63%), Positives = 130/171 (76%), Gaps = 12/171 (7%)
 Frame = +2

Query  2    GANDGLVSIASLMMGVGTVKQDIKAMILTGFAGMVAGACSMAIGEFVSVYSQRDIEVAQM  181
            GANDGL+S ASLMMGVG V++D+K+M+LTG AG+VAGACSMAIGEFVSVYSQ DIE+AQM
Sbjct  51   GANDGLLSTASLMMGVGAVRKDVKSMMLTGVAGLVAGACSMAIGEFVSVYSQYDIELAQM  110

Query  182  KRKKNRRNGedageeeeeesdvdeLPNPMQAAAASVVAFTMGAMVPLLAASFIKPYKVRI  361
            KR+ N                 D+LPNP  AA AS +AF +GA VPLL A+F+  YK R+
Sbjct  111  KREGNMDE------------KKDKLPNPYYAAFASALAFAIGAGVPLLGAAFVNSYKARL  158

Query  362  GaviaavtvalvvcgwlgaalggapkgkaSVRVLIGGWLAMAITSGLTKLI  514
            G V A VT+AL+V G LGA LG AP+ K+++RVLIGGWLAMAIT GLTKL+
Sbjct  159  GVVAAVVTLALIVFGDLGAFLGKAPRVKSTLRVLIGGWLAMAITFGLTKLV  209



>gb|AFK37817.1| unknown [Lotus japonicus]
Length=227

 Score =   152 bits (385),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 94/176 (53%), Positives = 125/176 (71%), Gaps = 11/176 (6%)
 Frame = +2

Query  2    GANDGLVSIASLMMGVGTVKQDIKAMILTGFAGMVAGACSMAIGEFVSVYSQRDIEVAQM  181
            GANDGLVS+ASLMMGVG V +D KAM+L GFAG+VAGAC MAIGEFVSV++Q ++EV QM
Sbjct  51   GANDGLVSVASLMMGVGAVNKDAKAMLLAGFAGLVAGACGMAIGEFVSVFTQYEVEVGQM  110

Query  182  KR-----KKNRRNGedageeeeeesdvdeLPNPMQAAAASVVAFTMGAMVPLLAASFIKP  346
            KR     ++  R+       E        +PNPMQAA AS  +F++G +VPLL+ SF+  
Sbjct  111  KRDMIKSEQGERD------LEMAMEKGKSIPNPMQAALASAFSFSIGGLVPLLSGSFVSV  164

Query  347  YKVRIGaviaavtvalvvcgwlgaalggapkgkaSVRVLIGGWLAMAITSGLTKLI  514
            YK+R+  ++  V++ALV  G +G+ LG  P  ++ VR +IGGW+AMAIT GLTKL+
Sbjct  165  YKIRLLVIVVVVSLALVAFGSVGSLLGKTPMTRSCVRFMIGGWMAMAITFGLTKLL  220



>gb|KHN26718.1| Vacuolar iron transporter like 4 [Glycine soja]
Length=217

 Score =   152 bits (383),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 108/171 (63%), Positives = 132/171 (77%), Gaps = 12/171 (7%)
 Frame = +2

Query  2    GANDGLVSIASLMMGVGTVKQDIKAMILTGFAGMVAGACSMAIGEFVSVYSQRDIEVAQM  181
            GANDGL+S ASLMMGVG V++D+K+M+LTG AG+VAGACSMAIGEFVSVYSQ DIE+AQM
Sbjct  51   GANDGLLSTASLMMGVGAVRKDVKSMMLTGVAGLVAGACSMAIGEFVSVYSQYDIELAQM  110

Query  182  KRKKNRRNGedageeeeeesdvdeLPNPMQAAAASVVAFTMGAMVPLLAASFIKPYKVRI  361
            KR+ N             +   D+LPNP  AA AS +AF +GA VPLL A+F+  YK R+
Sbjct  111  KREGN------------MDEKKDKLPNPYYAAFASALAFAIGAGVPLLGAAFVNSYKARL  158

Query  362  GaviaavtvalvvcgwlgaalggapkgkaSVRVLIGGWLAMAITSGLTKLI  514
            G V+A VT+AL+V G LGA LG AP+ K+++RVLIGGWLAMAIT GLTKL+
Sbjct  159  GVVVAVVTLALIVFGDLGAFLGKAPRVKSTLRVLIGGWLAMAITFGLTKLV  209



>ref|XP_011088130.1| PREDICTED: vacuolar iron transporter homolog 4-like [Sesamum 
indicum]
Length=212

 Score =   152 bits (383),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 106/172 (62%), Positives = 127/172 (74%), Gaps = 9/172 (5%)
 Frame = +2

Query  2    GANDGLVSIASLMMGVGTVKQDIKAMILTGFAGMVAGACSMAIGEFVSVYSQRDIEVAQM  181
            GANDGLVS+ASLMMGVG  K D  AMILTGFAG+ AGACSMAIGEFVSVYSQ DIEV QM
Sbjct  44   GANDGLVSVASLMMGVGAFKGDATAMILTGFAGLFAGACSMAIGEFVSVYSQLDIEVEQM  103

Query  182  KRKKNRRNGedageeeeeesdvdeLPNPMQAAAASVVAFTMGAMVPLLAASFIKPYKVRI  361
            KR+K                + ++LPNP+QAA AS +AF+ GA+VPLLAA FI  YKVR+
Sbjct  104  KREKR---------STANVEENEKLPNPLQAALASALAFSSGAIVPLLAAGFISEYKVRV  154

Query  362  GaviaavtvalvvcgwlgaalggapkgkaSVRVLIGGWLAMAITSGLTKLIG  517
            G V+AA T+AL   G +GA LG +   ++  RV++GGW+AMAIT GLTKL+G
Sbjct  155  GVVVAATTLALAAFGGIGAVLGRSGVVRSCGRVVVGGWMAMAITFGLTKLLG  206



>ref|XP_010931000.1| PREDICTED: vacuolar iron transporter homolog 4-like [Elaeis guineensis]
Length=205

 Score =   150 bits (380),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 113/172 (66%), Positives = 134/172 (78%), Gaps = 8/172 (5%)
 Frame = +2

Query  2    GANDGLVSIASLMMGVGTVKQDIKAMILTGFAGMVAGACSMAIGEFVSVYSQRDIEVAQM  181
            GANDGLVS ASLMMGVG VK D KAM+L+GFAG+VAGACSMAIGEFVSVYSQ DIEVAQM
Sbjct  38   GANDGLVSTASLMMGVGAVKPDAKAMLLSGFAGLVAGACSMAIGEFVSVYSQLDIEVAQM  97

Query  182  KRKKNRRNGedageeeeeesdvdeLPNPMQAAAASVVAFTMGAMVPLLAASFIKPYKVRI  361
            KR++  + G         E + D LP+P+QAAAAS +AF+ GAMVPLLAA FI  YKVR+
Sbjct  98   KREQRIKGG--------GEVEQDGLPSPVQAAAASALAFSAGAMVPLLAAGFISSYKVRL  149

Query  362  GaviaavtvalvvcgwlgaalggapkgkaSVRVLIGGWLAMAITSGLTKLIG  517
            G V AA TVALVV G +GA LG AP  +++VRVL+GGW+AMA+T  + K+ G
Sbjct  150  GVVAAAATVALVVFGSVGALLGRAPVVRSAVRVLVGGWMAMAVTFAVMKIFG  201



>ref|XP_008796894.1| PREDICTED: vacuolar iron transporter homolog 2-like [Phoenix 
dactylifera]
Length=235

 Score =   151 bits (382),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 93/173 (54%), Positives = 125/173 (72%), Gaps = 6/173 (3%)
 Frame = +2

Query  2    GANDGLVSIASLMMGVGTVKQDIKAMILTGFAGMVAGACSMAIGEFVSVYSQRDIEVAQM  181
            GANDGLVS+ASLM+GVG V Q  KAM+++G AG+VAGACSMAIGEFVSVY+Q DIEVA+M
Sbjct  60   GANDGLVSVASLMIGVGAVNQTAKAMLVSGLAGLVAGACSMAIGEFVSVYAQYDIEVARM  119

Query  182  KRKKNRRNGedageeeeeesdvdeLPNPMQAAAASVVAFTMGAMVPLLAASFIKPYKVRI  361
            +R+     G       E   + + LP+P+ AA AS +AF MGA++PLLA +F++ + VR+
Sbjct  120  ERESLESGG------IEAGREKESLPDPLMAAGASALAFGMGAVLPLLAGAFVRSWGVRV  173

Query  362  GaviaavtvalvvcgwlgaalggapkgkaSVRVLIGGWLAMAITSGLTKLIGI  520
            G V A  ++ L   G  GA LGGA   K+++RVL+GGWLAM +T G+ +L G+
Sbjct  174  GLVCAVSSLGLAGFGAAGAVLGGANVSKSALRVLLGGWLAMLVTYGVLRLFGL  226



>ref|XP_002268474.1| PREDICTED: vacuolar iron transporter homolog 4-like [Vitis vinifera]
Length=211

 Score =   150 bits (379),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 94/174 (54%), Positives = 125/174 (72%), Gaps = 16/174 (9%)
 Frame = +2

Query  2    GANDGLVSIASLMMGVGTVKQDIKAMILTGFAGMVAGACSMAIGEFVSVYSQRDIEVAQM  181
            GAN+GLVS+ASLMMGVG +K+D+ AM L GFAG+VAG+CS+AIGEFVS+Y+Q DIE  QM
Sbjct  49   GANNGLVSVASLMMGVGALKRDVMAMALAGFAGLVAGSCSVAIGEFVSIYTQLDIEATQM  108

Query  182  KR--KKNRRNGedageeeeeesdvdeLPNPMQAAAASVVAFTMGAMVPLLAASFIKPYKV  355
            +R  +++ +N               ELPNP Q A  S + F +GAMVP++AA+  + +KV
Sbjct  109  RRNSREDSKN--------------LELPNPFQVAITSALTFVVGAMVPVVAAAITRDHKV  154

Query  356  RIGaviaavtvalvvcgwlgaalggapkgkaSVRVLIGGWLAMAITSGLTKLIG  517
            R+G V+A  ++A +V G +GA LG  P G +  RVL+GGW+AMAITSGLT LIG
Sbjct  155  RLGVVVAVSSLAFLVFGGVGAILGRTPVGWSCARVLVGGWMAMAITSGLTMLIG  208



>ref|XP_010030076.1| PREDICTED: vacuolar iron transporter homolog 4-like [Eucalyptus 
grandis]
 gb|KCW57037.1| hypothetical protein EUGRSUZ_I02699 [Eucalyptus grandis]
Length=227

 Score =   150 bits (380),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 108/172 (63%), Positives = 136/172 (79%), Gaps = 4/172 (2%)
 Frame = +2

Query  2    GANDGLVSIASLMMGVGTVKQDIKAMILTGFAGMVAGACSMAIGEFVSVYSQRDIEVAQM  181
            GANDGL+S ASLMMGVG V++D K M++TG AG++ GACSMAIGE VSVYSQ DIEVAQ+
Sbjct  56   GANDGLLSTASLMMGVGAVRKDSKTMVITGVAGLIGGACSMAIGELVSVYSQYDIEVAQI  115

Query  182  KRKKNRRNGedageeeeeesdvdeLPNPMQAAAASVVAFTMGAMVPLLAASFIKPYKVRI  361
            KR+   RNG  A   EE ++  ++LP+P QAA AS +AF +GA+VPLLAA+F+K YKVR+
Sbjct  116  KRED--RNG--ALGAEEIDARKEKLPSPWQAAGASALAFAVGALVPLLAAAFVKEYKVRL  171

Query  362  GaviaavtvalvvcgwlgaalggapkgkaSVRVLIGGWLAMAITSGLTKLIG  517
              VIAAV++AL+  GWL A LG AP  K++ RVL+GGWLAM +T GLTKL+G
Sbjct  172  AVVIAAVSLALIGFGWLSAVLGKAPVAKSASRVLVGGWLAMGLTFGLTKLVG  223



>gb|KHN33493.1| Vacuolar iron transporter like 4 [Glycine soja]
Length=218

 Score =   150 bits (378),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 107/171 (63%), Positives = 128/171 (75%), Gaps = 13/171 (8%)
 Frame = +2

Query  2    GANDGLVSIASLMMGVGTVKQDIKAMILTGFAGMVAGACSMAIGEFVSVYSQRDIEVAQM  181
            GANDGL+S ASLMMGVG V++D+K+MILTG AG+VAGACSMAIGEFVSVYSQ DIE+AQM
Sbjct  53   GANDGLLSTASLMMGVGAVRKDVKSMILTGVAGLVAGACSMAIGEFVSVYSQYDIELAQM  112

Query  182  KRKKNRRNGedageeeeeesdvdeLPNPMQAAAASVVAFTMGAMVPLLAASFIKPYKVRI  361
            KR+ N                 D+LPNP  AA AS +AF +GA VPLL A+F+  YK R+
Sbjct  113  KREGNMDQ-------------KDKLPNPYYAAFASALAFAVGAGVPLLGAAFVNSYKARL  159

Query  362  GaviaavtvalvvcgwlgaalggapkgkaSVRVLIGGWLAMAITSGLTKLI  514
            G V A VT+AL+V G LGA LG AP+ K++ RVLIGGW+AMAIT  LTKL+
Sbjct  160  GVVAAVVTLALIVFGDLGAFLGKAPRVKSTFRVLIGGWMAMAITFALTKLV  210



>ref|XP_010030077.1| PREDICTED: vacuolar iron transporter homolog 2-like [Eucalyptus 
grandis]
Length=227

 Score =   150 bits (378),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 109/172 (63%), Positives = 135/172 (78%), Gaps = 4/172 (2%)
 Frame = +2

Query  2    GANDGLVSIASLMMGVGTVKQDIKAMILTGFAGMVAGACSMAIGEFVSVYSQRDIEVAQM  181
            GANDGL+S ASLMMGVG V++D K M++TG AG++ GACSMAIGE VSVYSQ DIEVAQ+
Sbjct  56   GANDGLLSTASLMMGVGAVRKDPKTMVITGVAGLIGGACSMAIGELVSVYSQYDIEVAQI  115

Query  182  KRKKNRRNGedageeeeeesdvdeLPNPMQAAAASVVAFTMGAMVPLLAASFIKPYKVRI  361
            KR+   RNG  A   EE ++  ++LP+P QAA AS +AF +GA+VPLLAA+F+K YKVR+
Sbjct  116  KRED--RNG--ALGVEEIDARKEKLPSPWQAAGASALAFAVGALVPLLAAAFVKEYKVRL  171

Query  362  GaviaavtvalvvcgwlgaalggapkgkaSVRVLIGGWLAMAITSGLTKLIG  517
              VIAAV++AL+  GWL A LG  P  K++ RVL+GGWLAM IT GLTKLIG
Sbjct  172  VVVIAAVSMALIGFGWLSAVLGKVPAAKSASRVLVGGWLAMGITFGLTKLIG  223



>ref|XP_010111855.1| hypothetical protein L484_020647 [Morus notabilis]
 gb|EXC31820.1| hypothetical protein L484_020647 [Morus notabilis]
Length=221

 Score =   150 bits (378),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 101/172 (59%), Positives = 133/172 (77%), Gaps = 6/172 (3%)
 Frame = +2

Query  2    GANDGLVSIASLMMGVGTVKQDIKAMILTGFAGMVAGACSMAIGEFVSVYSQRDIEVAQM  181
            GANDGLVS+ASLMMGVG+VK+D+KAM+L GFAG+VAGACSMAIGEFVSVY+Q DIE++QM
Sbjct  50   GANDGLVSVASLMMGVGSVKKDVKAMLLAGFAGLVAGACSMAIGEFVSVYTQYDIEMSQM  109

Query  182  KRKKNRRNGedageeeeeesdvdeLPNPMQAAAASVVAFTMGAMVPLLAASFIKPYKVRI  361
            KR+    +G       E   + ++LPNP QAA AS +AF++GA+ PLLAA+F+  ++VR+
Sbjct  110  KREIKPESG------MENGVEKEKLPNPAQAALASAMAFSIGAVAPLLAAAFVSEHRVRL  163

Query  362  GaviaavtvalvvcgwlgaalggapkgkaSVRVLIGGWLAMAITSGLTKLIG  517
              V    +VAL+V G +GA LG  P  ++  RVL+GGW+AMA+T GLT+LIG
Sbjct  164  AVVAVVASVALLVFGAVGAVLGRTPVMRSCTRVLVGGWMAMAVTFGLTRLIG  215



>gb|ACU24234.1| unknown [Glycine max]
Length=229

 Score =   150 bits (378),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 96/172 (56%), Positives = 129/172 (75%), Gaps = 4/172 (2%)
 Frame = +2

Query  2    GANDGLVSIASLMMGVGTVKQDIKAMILTGFAGMVAGACSMAIGEFVSVYSQRDIEVAQM  181
            GANDGLVS+ SLMMGVG VK+D KAM++ GFAG+VAGAC MAIGEFV+V +Q ++E+ QM
Sbjct  57   GANDGLVSVTSLMMGVGAVKKDAKAMLVAGFAGLVAGACGMAIGEFVAVCTQYEVELGQM  116

Query  182  KRKKNRRNGedageeeeeesdvdeLPNPMQAAAASVVAFTMGAMVPLLAASFIKPYKVRI  361
            KR+ N   G     E + E++   LPNP+QA  A  ++F++GA+VPLL A+F+  Y+ R+
Sbjct  117  KREMNMSEG----GERDLETEKRTLPNPLQATWAFALSFSIGALVPLLFAAFVADYRTRV  172

Query  362  GaviaavtvalvvcgwlgaalggapkgkaSVRVLIGGWLAMAITSGLTKLIG  517
              V+A  ++ALVV G +GA LG  PK K+ VR L+GGW+AM+IT GLTKL+G
Sbjct  173  IVVVAMASLALVVFGSVGAQLGKTPKLKSCVRFLLGGWIAMSITFGLTKLMG  224



>ref|XP_004172912.1| PREDICTED: vacuolar iron transporter homolog 4-like, partial 
[Cucumis sativus]
Length=174

 Score =   148 bits (374),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 74/121 (61%), Positives = 94/121 (78%), Gaps = 12/121 (10%)
 Frame = +2

Query  2    GANDGLVSIASLMMGVGTVKQDIKAMILTGFAGMVAGACSMAIGEFVSVYSQRDIEVAQM  181
            GANDGLVS+ASLMMGVG VK D KAM++ GFAG+VAGACSMAIGEFVSVY+Q DIE AQ+
Sbjct  35   GANDGLVSVASLMMGVGAVKPDAKAMLIAGFAGLVAGACSMAIGEFVSVYTQYDIEKAQL  94

Query  182  KRKKNRRNGedageeeeeesdvdeLPNPMQAAAASVVAFTMGAMVPLLAASFIKPYKVRI  361
            KR    +N            + ++LPNP+QAA AS +AF++GA++PL+AA FI+ +KVR+
Sbjct  95   KRNGKEKN------------EEEKLPNPLQAALASAIAFSVGAVIPLVAAVFIRDHKVRL  142

Query  362  G  364
            G
Sbjct  143  G  143



>ref|XP_011018038.1| PREDICTED: vacuolar iron transporter homolog 4-like [Populus 
euphratica]
Length=221

 Score =   149 bits (377),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 117/172 (68%), Positives = 136/172 (79%), Gaps = 4/172 (2%)
 Frame = +2

Query  2    GANDGLVSIASLMMGVGTVKQDIKAMILTGFAGMVAGACSMAIGEFVSVYSQRDIEVAQM  181
            GANDGLVSI SLMMGVG VKQD+KAMILTG AG++AGA SMAIGEFVSV SQ DIE+AQ+
Sbjct  50   GANDGLVSIGSLMMGVGAVKQDVKAMILTGCAGLIAGASSMAIGEFVSVQSQLDIELAQI  109

Query  182  KRKKNRRNGedageeeeeesdvdeLPNPMQAAAASVVAFTMGAMVPLLAASFIKPYKVRI  361
            KR K RR+      E EEE +   LP+P QA+AAS +AF +GA VP+LAASFI  YK+R+
Sbjct  110  KRDKQRRD----SREPEEEGEKGNLPSPAQASAASAIAFAIGASVPVLAASFIGQYKLRL  165

Query  362  GaviaavtvalvvcgwlgaalggapkgkaSVRVLIGGWLAMAITSGLTKLIG  517
            G V+ AVT+AL+  GWLGA LG AP  K+S+RVLIGGW AMAIT GLTK IG
Sbjct  166  GMVVGAVTLALMAFGWLGAVLGKAPTVKSSLRVLIGGWFAMAITFGLTKSIG  217



>ref|XP_007157969.1| hypothetical protein PHAVU_002G113500g [Phaseolus vulgaris]
 gb|ESW29963.1| hypothetical protein PHAVU_002G113500g [Phaseolus vulgaris]
Length=232

 Score =   149 bits (377),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 100/170 (59%), Positives = 129/170 (76%), Gaps = 4/170 (2%)
 Frame = +2

Query  2    GANDGLVSIASLMMGVGTVKQDIKAMILTGFAGMVAGACSMAIGEFVSVYSQRDIEVAQM  181
            GANDGL+S+ASLMMGVG VK++I AM+L GFAG++AGACSMAIGEFVSVY+Q DIE+A M
Sbjct  54   GANDGLISVASLMMGVGAVKENITAMLLAGFAGLIAGACSMAIGEFVSVYTQYDIEIAHM  113

Query  182  KRKKNRRNGedageeeeeesdvdeLPNPMQAAAASVVAFTMGAMVPLLAASFIKPYKVRI  361
            KR++             EE   ++LPNP QAA AS +AF++GA+VPLLAA+FI+ +K+R+
Sbjct  114  KRERENN----IIGGVSEEGQREKLPNPFQAALASALAFSVGAVVPLLAAAFIRSHKIRL  169

Query  362  GaviaavtvalvvcgwlgaalggapkgkaSVRVLIGGWLAMAITSGLTKL  511
              V+   ++ LVV G +GA LG  P  K+ +R+LIGGWLAM IT GLTKL
Sbjct  170  AVVVIVASLTLVVFGGVGAVLGKTPLTKSCLRMLIGGWLAMTITFGLTKL  219



>gb|EYU18519.1| hypothetical protein MIMGU_mgv1a0247122mg, partial [Erythranthe 
guttata]
Length=191

 Score =   147 bits (372),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 108/176 (61%), Positives = 126/176 (72%), Gaps = 4/176 (2%)
 Frame = +2

Query  2    GANDGLVSIASLMMGVGTVKQDIKAMILTGFAGMVAGACSMAIGEFVSVYSQRDIEVAQM  181
            GANDGLVSIASLMMGVG VK DIKAMILTGFAG+ AGACSMAIGEFVSVYSQRDIE+AQM
Sbjct  10   GANDGLVSIASLMMGVGAVKDDIKAMILTGFAGLFAGACSMAIGEFVSVYSQRDIEIAQM  69

Query  182  KRKKNRRNGedageeeeee---sdvdeLPNPMQAAAASVVAFTMGAMVPLLAASFIKPYK  352
            KR+K  +N                   LPNP QAA AS +AF +GA+VPLLAA F+   +
Sbjct  70   KREKINKNITTTTTTNNSMGENEKEKRLPNPFQAALASALAFALGAVVPLLAAGFVTERE  129

Query  353  VRIGaviaavtvalvvcgwlgaalggapkgkaSV-RVLIGGWLAMAITSGLTKLIG  517
            VR+  V+ A T+AL   G +GA LGG  +   S  RV++GGW+AM IT GLTKL+G
Sbjct  130  VRLAVVVGATTLALAAFGGVGAVLGGTSRVGVSCGRVVVGGWMAMGITFGLTKLLG  185



>ref|XP_004504934.1| PREDICTED: nodulin-21-like [Cicer arietinum]
Length=226

 Score =   148 bits (373),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 95/174 (55%), Positives = 125/174 (72%), Gaps = 7/174 (4%)
 Frame = +2

Query  2    GANDGLVSIASLMMGVGTVKQDIKAMILTGFAGMVAGACSMAIGEFVSVYSQRDIEVAQM  181
            GANDGLVS+ASLMMGVG VK    AM++ GFAG+VAGAC M IGEFVSVY+Q ++E+ QM
Sbjct  49   GANDGLVSVASLMMGVGAVKTANTAMLVAGFAGLVAGACGMGIGEFVSVYTQYEVEIGQM  108

Query  182  KRK---KNRRNGedageeeeeesdvdeLPNPMQAAAASVVAFTMGAMVPLLAASFIKPYK  352
             R+    +R+        E E      LPNP+QAA AS  +F++G +VPLL  SFIK YK
Sbjct  109  MRELGTCDRKE----KALEMELEKRRSLPNPLQAALASAFSFSVGGLVPLLCGSFIKAYK  164

Query  353  VRIGaviaavtvalvvcgwlgaalggapkgkaSVRVLIGGWLAMAITSGLTKLI  514
            +R+  ++A  ++AL+V G +GA LG  PK ++S+R L+GGW+AMAIT GLTKL+
Sbjct  165  IRVIVIVAISSLALLVFGRVGAQLGKTPKIRSSIRFLLGGWMAMAITFGLTKLL  218



>ref|XP_009419407.1| PREDICTED: vacuolar iron transporter homolog 1-like [Musa acuminata 
subsp. malaccensis]
Length=204

 Score =   146 bits (368),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 107/176 (61%), Positives = 134/176 (76%), Gaps = 11/176 (6%)
 Frame = +2

Query  2    GANDGLVSIASLMMGVGTVKQDIKAMILTGFAGMVAGACSMAIGEFVSVYSQRDIEVAQM  181
            GANDGLVS ASLMMGVG VK D KAMI++GFAG+VAGACSMAIGEFVSVY+Q DIEVAQM
Sbjct  38   GANDGLVSTASLMMGVGAVKDDPKAMIISGFAGLVAGACSMAIGEFVSVYAQLDIEVAQM  97

Query  182  KRK-KNRRNGedageeeeeesdvdeLPNPMQAAAASVVAFTMGAMVPLLAASFIKPYKVR  358
            KR+ + + +G          +  D LP+P+QAAAAS +AF++GA+VPLLAA FI  YKVR
Sbjct  98   KRELQTKGDG----------ASADRLPSPVQAAAASALAFSLGAVVPLLAAGFIGNYKVR  147

Query  359  IGaviaavtvalvvcgwlgaalggapkgkaSVRVLIGGWLAMAITSGLTKLIGIKS  526
            +G V AA + ALVV G +GA LG AP G++ +R ++GGW AMA+T GL +L  + +
Sbjct  148  LGVVAAAASAALVVFGSVGAVLGRAPVGRSCLRAVVGGWAAMAVTFGLMRLFSVSA  203



>gb|KEH31258.1| vacuolar iron transporter-like protein [Medicago truncatula]
Length=239

 Score =   147 bits (370),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 97/175 (55%), Positives = 123/175 (70%), Gaps = 7/175 (4%)
 Frame = +2

Query  2    GANDGLVSIASLMMGVGTVKQDIKAMILTGFAGMVAGACSMAIGEFVSVYSQRDIEVAQM  181
            GANDGLVSI SL++GVG V +DIK M+L GFAG++AGACSM IGEFVSVY+Q DI VAQM
Sbjct  71   GANDGLVSITSLILGVGAVHEDIKTMLLAGFAGLIAGACSMGIGEFVSVYTQFDIMVAQM  130

Query  182  KRKKNRRNGedageeeeeesdvdeLPNPMQAAAASVVAFTMGAMVPLLAASFIKPYKVRI  361
            KR +N+ N          E +   LPNP QAA AS +AF+ GA VPLL A+ ++ YK+R+
Sbjct  131  KR-ENKINS------TFVEEEKQLLPNPFQAAIASAIAFSFGATVPLLGAALVRDYKIRL  183

Query  362  GaviaavtvalvvcgwlgaalggapkgkaSVRVLIGGWLAMAITSGLTKLIGIKS  526
              V+   + AL+V G +GA LG      + VRV++GGW+AMAIT GLTK +G  S
Sbjct  184  FVVVGMASFALLVFGGVGAILGKTSVKMSCVRVVVGGWMAMAITFGLTKFVGYSS  238



>gb|KCW57036.1| hypothetical protein EUGRSUZ_I02698, partial [Eucalyptus grandis]
Length=210

 Score =   145 bits (365),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 106/173 (61%), Positives = 132/173 (76%), Gaps = 4/173 (2%)
 Frame = +2

Query  2    GANDGLVSIASLMMGVGTVKQDIKAMILTGFAGMVAGACSMAIGEFVSVYSQRDIEVAQM  181
            GANDGL+S ASLMMGVG V++D K+M+L+G AG++ GACSMAIGE VSVYSQ DIEVAQ+
Sbjct  29   GANDGLLSTASLMMGVGAVRKDTKSMVLSGVAGLIGGACSMAIGELVSVYSQYDIEVAQI  88

Query  182  KRKKNRRNGedageeeeeesdvdeLPNPMQAAAASVVAFTMGAMVPLLAASFIKPYKVRI  361
            KR+   RNG      EE ++  + LP+P QAA AS +AF +GA+VPLLAA+F+  YKVR+
Sbjct  89   KRED--RNG--TLGAEEMDARKEMLPSPWQAAGASALAFAVGALVPLLAAAFVTVYKVRL  144

Query  362  GaviaavtvalvvcgwlgaalggapkgkaSVRVLIGGWLAMAITSGLTKLIGI  520
              VIAAV++AL+  GWL A LG AP  K+  RVL+GGWLAM IT GLT LI +
Sbjct  145  AVVIAAVSMALIGFGWLSAVLGKAPVAKSVSRVLVGGWLAMGITFGLTTLINV  197



>ref|XP_006351862.1| PREDICTED: vacuolar iron transporter homolog 2.1-like [Solanum 
tuberosum]
Length=218

 Score =   145 bits (365),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 106/172 (62%), Positives = 131/172 (76%), Gaps = 2/172 (1%)
 Frame = +2

Query  2    GANDGLVSIASLMMGVGTVKQDIKAMILTGFAGMVAGACSMAIGEFVSVYSQRDIEVAQM  181
            GA DGLV+ ASLMMGVG VK+D+ AMIL GFA + AGACSMAIGEFVSVYSQ DIE+AQ+
Sbjct  43   GATDGLVTTASLMMGVGAVKKDVDAMILIGFAALFAGACSMAIGEFVSVYSQLDIELAQI  102

Query  182  KRKKNRRNGedageeeeeesdvdeLPNPMQAAAASVVAFTMGAMVPLLAASFIKPYKVRI  361
            KR+   R      E++EEE   + LPNP  AA AS VAF++G ++P+LAA FI  +KVR+
Sbjct  103  KRETKTRG--QNHEQQEEEDKKEGLPNPFLAAVASAVAFSLGGIIPILAAGFISNHKVRM  160

Query  362  GaviaavtvalvvcgwlgaalggapkgkaSVRVLIGGWLAMAITSGLTKLIG  517
            G V+AAV++AL V G +GA LG +P  ++  RVLIGGW+AM IT GLTKLIG
Sbjct  161  GVVVAAVSLALFVFGGVGAVLGKSPAVRSCARVLIGGWMAMGITFGLTKLIG  212



>ref|XP_010912403.1| PREDICTED: vacuolar iron transporter homolog 1-like [Elaeis guineensis]
Length=206

 Score =   144 bits (363),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 108/172 (63%), Positives = 135/172 (78%), Gaps = 8/172 (5%)
 Frame = +2

Query  2    GANDGLVSIASLMMGVGTVKQDIKAMILTGFAGMVAGACSMAIGEFVSVYSQRDIEVAQM  181
            GA+DGLVS ASLM+GVG VK D KAM+L+GFAG+VAGA SMAIGEFVSV SQ DIEVAQ 
Sbjct  39   GASDGLVSTASLMLGVGAVKGDAKAMVLSGFAGLVAGASSMAIGEFVSVSSQLDIEVAQR  98

Query  182  KRKKNRRNGedageeeeeesdvdeLPNPMQAAAASVVAFTMGAMVPLLAASFIKPYKVRI  361
            KR++  + G         E + D LP+P+ AAAAS +AF +GAMVPLLAA FI+ +KVR+
Sbjct  99   KRERMSKGG--------GEVERDGLPSPVLAAAASALAFAVGAMVPLLAAGFIRSHKVRL  150

Query  362  GaviaavtvalvvcgwlgaalggapkgkaSVRVLIGGWLAMAITSGLTKLIG  517
            G V AA +VALVV G++GAA+G AP G+++VRVL+GGW+AMA+T GL +L G
Sbjct  151  GMVAAAGSVALVVFGYVGAAVGRAPVGRSAVRVLVGGWMAMAVTFGLVRLFG  202



>ref|XP_010030075.1| PREDICTED: vacuolar iron transporter homolog 4-like [Eucalyptus 
grandis]
Length=234

 Score =   145 bits (365),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 106/173 (61%), Positives = 132/173 (76%), Gaps = 4/173 (2%)
 Frame = +2

Query  2    GANDGLVSIASLMMGVGTVKQDIKAMILTGFAGMVAGACSMAIGEFVSVYSQRDIEVAQM  181
            GANDGL+S ASLMMGVG V++D K+M+L+G AG++ GACSMAIGE VSVYSQ DIEVAQ+
Sbjct  53   GANDGLLSTASLMMGVGAVRKDTKSMVLSGVAGLIGGACSMAIGELVSVYSQYDIEVAQI  112

Query  182  KRKKNRRNGedageeeeeesdvdeLPNPMQAAAASVVAFTMGAMVPLLAASFIKPYKVRI  361
            KR+   RNG      EE ++  + LP+P QAA AS +AF +GA+VPLLAA+F+  YKVR+
Sbjct  113  KRED--RNG--TLGAEEMDARKEMLPSPWQAAGASALAFAVGALVPLLAAAFVTVYKVRL  168

Query  362  GaviaavtvalvvcgwlgaalggapkgkaSVRVLIGGWLAMAITSGLTKLIGI  520
              VIAAV++AL+  GWL A LG AP  K+  RVL+GGWLAM IT GLT LI +
Sbjct  169  AVVIAAVSMALIGFGWLSAVLGKAPVAKSVSRVLVGGWLAMGITFGLTTLINV  221



>ref|XP_011092395.1| PREDICTED: vacuolar iron transporter homolog 4-like [Sesamum 
indicum]
Length=219

 Score =   144 bits (362),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 108/171 (63%), Positives = 129/171 (75%), Gaps = 6/171 (4%)
 Frame = +2

Query  2    GANDGLVSIASLMMGVGTVKQDIKAMILTGFAGMVAGACSMAIGEFVSVYSQRDIEVAQM  181
            GANDGLVSIASLMMGVG VK D+K MILTGFAG+ AGACSMAIGEFVSVYSQ DIEVAQM
Sbjct  48   GANDGLVSIASLMMGVGAVKDDVKVMILTGFAGLFAGACSMAIGEFVSVYSQLDIEVAQM  107

Query  182  KRKKNRRNGedageeeeeesdvdeLPNPMQAAAASVVAFTMGAMVPLLAASFIKPYKVRI  361
            KR+          E +EE  + ++LPNP QAA AS +AF++GA+VPLLAA+FI  YKVR+
Sbjct  108  KRE------TIMVENDEENVEKEKLPNPFQAALASALAFSLGAIVPLLAAAFIADYKVRL  161

Query  362  GaviaavtvalvvcgwlgaalggapkgkaSVRVLIGGWLAMAITSGLTKLI  514
              V+AA T ALV  G +GA LG     ++  RV++GG +AM IT GLTKL+
Sbjct  162  AVVMAATTAALVAFGGVGAVLGRTNVVRSCCRVVVGGLMAMGITFGLTKLL  212



>ref|XP_006351817.1| PREDICTED: vacuolar iron transporter homolog 4-like [Solanum 
tuberosum]
Length=217

 Score =   143 bits (360),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 102/173 (59%), Positives = 128/173 (74%), Gaps = 9/173 (5%)
 Frame = +2

Query  2    GANDGLVSIASLMMGVGTVKQDIKAMILTGFAGMVAGACSMAIGEFVSVYSQRDIEVAQM  181
            GANDGL+S +SLMMG+G + QD K+MILTG AG+VAGACSMAIGEFVSVYSQ DIE++Q+
Sbjct  49   GANDGLLSTSSLMMGIGAIHQDSKSMILTGIAGLVAGACSMAIGEFVSVYSQYDIEMSQI  108

Query  182  KRKKNRRNGedageeeeeesdvdeLPNPMQAAAASVVAFTMGAMVPLLAASFIKPYKVRI  361
            KR+            E  E    +LP+P+QAA AS  AF +GA+VPLL A+F+K Y VR+
Sbjct  109  KREN---------AIELFEEKKKKLPSPVQAAGASAFAFAIGAIVPLLGAAFVKDYHVRL  159

Query  362  GaviaavtvalvvcgwlgaalggapkgkaSVRVLIGGWLAMAITSGLTKLIGI  520
            G V+  V++AL+  G L A LG AP  K+S+RVLIGGWLAM IT G TKL+G+
Sbjct  160  GVVVGVVSLALLGFGGLSAYLGKAPFVKSSLRVLIGGWLAMGITFGFTKLVGV  212



>ref|XP_004504755.1| PREDICTED: vacuolar iron transporter homolog 2.1-like [Cicer 
arietinum]
Length=216

 Score =   143 bits (360),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 99/175 (57%), Positives = 127/175 (73%), Gaps = 3/175 (2%)
 Frame = +2

Query  2    GANDGLVSIASLMMGVGTVKQDIKAMILTGFAGMVAGACSMAIGEFVSVYSQRDIEVAQM  181
            GANDGLVS+ SLMMGVG V +D   M+L GFAG++AGACSM IGEFVSVY+Q DI VAQ+
Sbjct  44   GANDGLVSVTSLMMGVGAVNEDSTTMLLAGFAGLIAGACSMGIGEFVSVYTQLDIMVAQI  103

Query  182  KRKKNRRNGedageeeeeesdvdeLPNPMQAAAASVVAFTMGAMVPLLAASFIKPYKVRI  361
            KR+   R         ++  + ++LPNP QAA AS +AF++GA VP++ A+FI+ YK+R+
Sbjct  104  KRE---REISGIISSLKKGCEDEKLPNPFQAAIASAIAFSLGASVPMIGAAFIRDYKIRL  160

Query  362  GaviaavtvalvvcgwlgaalggapkgkaSVRVLIGGWLAMAITSGLTKLIGIKS  526
              V    ++AL+V G +GA LG AP   + VRVLIGGW+AMAIT GLTKLIG  S
Sbjct  161  VVVAVLSSLALLVFGGVGAILGKAPVRLSCVRVLIGGWMAMAITFGLTKLIGYSS  215



>gb|KHN35977.1| Vacuolar iron transporter like 4 [Glycine soja]
Length=233

 Score =   143 bits (361),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 94/166 (57%), Positives = 125/166 (75%), Gaps = 7/166 (4%)
 Frame = +2

Query  2    GANDGLVSIASLMMGVGTVKQDIKAMILTGFAGMVAGACSMAIGEFVSVYSQRDIEVAQM  181
            GANDGLVS+ASL+MGVG VK++I AM+L GFAG++AGACSMAIGEFVSVY+Q D E+AQ+
Sbjct  56   GANDGLVSVASLLMGVGAVKENITAMLLAGFAGLIAGACSMAIGEFVSVYTQYDTEIAQI  115

Query  182  KRKKNRRNGedageeeeeesdvdeLPNPMQAAAASVVAFTMGAMVPLLAASFIKPYKVRI  361
            KR K   N         EE+  ++LPNP QAA AS +AF++GA++PLLAA+FI+ YK+R+
Sbjct  116  KRDKENNN-------IGEEAQREKLPNPFQAALASALAFSVGAVIPLLAAAFIRNYKIRL  168

Query  362  GaviaavtvalvvcgwlgaalggapkgkaSVRVLIGGWLAMAITSG  499
              V    ++ L++ G +GA LG  P  K+ +RVL+GGW+AM IT G
Sbjct  169  VVVAVVASLTLLLFGGVGAVLGKTPVRKSCIRVLLGGWMAMTITFG  214



>gb|KDP42890.1| hypothetical protein JCGZ_23832 [Jatropha curcas]
Length=247

 Score =   143 bits (360),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 102/172 (59%), Positives = 127/172 (74%), Gaps = 4/172 (2%)
 Frame = +2

Query  2    GANDGLVSIASLMMGVGTVKQDIKAMILTGFAGMVAGACSMAIGEFVSVYSQRDIEVAQM  181
            GANDGL+S +SLMMGVG V++D K M+LTG AG+VAGACSMA+GEFVSVYSQ D E+AQ+
Sbjct  76   GANDGLLSTSSLMMGVGAVRKDPKTMVLTGIAGLVAGACSMALGEFVSVYSQYDTELAQL  135

Query  182  KRKKNRRNGedageeeeeesdvdeLPNPMQAAAASVVAFTMGAMVPLLAASFIKPYKVRI  361
            KR+    N     +  + E+   +LP+P+QAAAAS  AF +GA++PLL A+F+  Y VRI
Sbjct  136  KREIKSGN----MQTCDIEAKKQDLPSPLQAAAASAFAFAVGAVIPLLGAAFVVDYVVRI  191

Query  362  GaviaavtvalvvcgwlgaalggapkgkaSVRVLIGGWLAMAITSGLTKLIG  517
            G VI   ++ALV  GWLGA LG A   ++  RVLIGGWLAM IT GLTK IG
Sbjct  192  GVVIGIASLALVGFGWLGAVLGHANVIRSCFRVLIGGWLAMGITFGLTKAIG  243



>ref|NP_001236825.1| nodulin-21 [Glycine max]
 sp|P16313.1|NO21_SOYBN RecName: Full=Nodulin-21; Short=N-21 [Glycine max]
 emb|CAA34506.1| unnamed protein product [Glycine max]
Length=206

 Score =   141 bits (355),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 73/120 (61%), Positives = 92/120 (77%), Gaps = 2/120 (2%)
 Frame = +2

Query  2    GANDGLVSIASLMMGVGTVKQDIKAMILTGFAGMVAGACSMAIGEFVSVYSQRDIEVAQM  181
            GANDGLVS+ASLMMGVG VK+D KAM+L GFAG+VAGAC MAIGEFV+VY+Q ++EV QM
Sbjct  63   GANDGLVSVASLMMGVGAVKRDAKAMLLAGFAGLVAGACGMAIGEFVAVYTQYEVEVGQM  122

Query  182  KRKKNRRNGedageeeeeesdvdeLPNPMQAAAASVVAFTMGAMVPLLAASFIKPYKVRI  361
            KR  N   G     + E E +   LPNP+QA  AS + F++GA+VPLL+A+FI+ Y+ RI
Sbjct  123  KRDMNMSVG--GERDLEMEMERRTLPNPLQATLASALCFSIGALVPLLSAAFIENYRTRI  180



>ref|XP_009420189.1| PREDICTED: vacuolar iron transporter homolog 3-like [Musa acuminata 
subsp. malaccensis]
Length=208

 Score =   141 bits (355),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 106/172 (62%), Positives = 130/172 (76%), Gaps = 4/172 (2%)
 Frame = +2

Query  2    GANDGLVSIASLMMGVGTVKQDIKAMILTGFAGMVAGACSMAIGEFVSVYSQRDIEVAQM  181
            GANDGLVS ASLMMGVG VK D KAMI++GFAG+VAGACSMAIGEFVSVYSQ DIEVAQ 
Sbjct  38   GANDGLVSTASLMMGVGAVKGDAKAMIVSGFAGLVAGACSMAIGEFVSVYSQLDIEVAQR  97

Query  182  KRKKNRRNGedageeeeeesdvdeLPNPMQAAAASVVAFTMGAMVPLLAASFIKPYKVRI  361
            KR++  +       E  + +  + LP+P+QAAAAS +AF++GA+VPLLAA FI  Y+VR+
Sbjct  98   KREQQTK----VEGESSDGTGGEGLPSPLQAAAASALAFSLGAVVPLLAAGFISSYRVRL  153

Query  362  GaviaavtvalvvcgwlgaalggapkgkaSVRVLIGGWLAMAITSGLTKLIG  517
            G   AA +  LVV G +GAALG AP G++  RV+ GGWLAMA+T G  +L G
Sbjct  154  GVAAAATSAGLVVFGCVGAALGRAPVGRSCFRVVAGGWLAMAVTYGFMRLFG  205



>ref|XP_010919446.1| PREDICTED: vacuolar iron transporter homolog 2-like [Elaeis guineensis]
Length=219

 Score =   140 bits (353),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 96/175 (55%), Positives = 125/175 (71%), Gaps = 11/175 (6%)
 Frame = +2

Query  2    GANDGLVSIASLMMGVGTVKQDIKAMILTGFAGMVAGACSMAIGEFVSVYSQRDIEVAQM  181
            GANDGLVS+ASLM+GVG V Q  KAM+++G AG+VAGACSMAIGEFVSVY+Q DIEVAQM
Sbjct  45   GANDGLVSVASLMIGVGAVNQTAKAMLVSGLAGLVAGACSMAIGEFVSVYAQYDIEVAQM  104

Query  182  KRK--KNRRNGedageeeeeesdvdeLPNPMQAAAASVVAFTMGAMVPLLAASFIKPYKV  355
            +R   ++R +            + + LP+P+ AA AS +AF +GA++PLLA  FIK + V
Sbjct  105  ERATLESRESS---------NKEKESLPSPLMAAGASALAFAVGALLPLLAGGFIKSWGV  155

Query  356  RIGaviaavtvalvvcgwlgaalggapkgkaSVRVLIGGWLAMAITSGLTKLIGI  520
            R+G V A  T+ L   G  GA LGGA   K+S+RVL+GGWLAM +T G+ +L G+
Sbjct  156  RVGVVCAVSTLGLAGFGAAGAVLGGANISKSSLRVLVGGWLAMLVTYGVLRLFGL  210



>ref|XP_002447364.1| hypothetical protein SORBIDRAFT_06g033760 [Sorghum bicolor]
 gb|EES11692.1| hypothetical protein SORBIDRAFT_06g033760 [Sorghum bicolor]
Length=229

 Score =   140 bits (353),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 93/171 (54%), Positives = 124/171 (73%), Gaps = 11/171 (6%)
 Frame = +2

Query  2    GANDGLVSIASLMMGVGTVKQDIKAMILTGFAGMVAGACSMAIGEFVSVYSQRDIEVAQM  181
            GANDGLVS ASLM+GVG VK D +AM+++GFAG++AGACSMAIGEFVSV SQR++E+A++
Sbjct  65   GANDGLVSTASLMLGVGAVKADARAMVISGFAGLLAGACSMAIGEFVSVCSQREVELARL  124

Query  182  KRKKNRRNGedageeeeeesdvdeLPNPMQAAAASVVAFTMGAMVPLLAASFIKPYKVRI  361
             R   +R G           +   LP+P+QAAAAS +AF++GA++PLLAA FI  Y++RI
Sbjct  125  DR-DGKRGG----------EEEKALPSPVQAAAASALAFSVGALLPLLAAGFIADYRLRI  173

Query  362  GaviaavtvalvvcgwlgaalggapkgkaSVRVLIGGWLAMAITSGLTKLI  514
            G V A  T  L   G +GA LG AP  ++  RV++GGW+AMA+T GL +L 
Sbjct  174  GVVAAVATATLAAFGCVGAVLGRAPVARSCARVVVGGWVAMAVTFGLMRLF  224



>ref|XP_003524079.2| PREDICTED: vacuolar iron transporter homolog 4-like [Glycine 
max]
Length=160

 Score =   138 bits (347),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 97/160 (61%), Positives = 122/160 (76%), Gaps = 4/160 (3%)
 Frame = +2

Query  38   MMGVGTVKQDIKAMILTGFAGMVAGACSMAIGEFVSVYSQRDIEVAQMKRKKNRRNGeda  217
            MMGVG VK+DI AMIL GFAG+VAGACSMAIGEFVSVY+Q DIE  Q+KR++   N    
Sbjct  1    MMGVGAVKKDISAMILAGFAGLVAGACSMAIGEFVSVYTQYDIEKTQLKREREADNN---  57

Query  218  geeeeeesdvdeLPNPMQAAAASVVAFTMGAMVPLLAASFIKPYKVRIGaviaavtvalv  397
                 EE+  ++LPNP  AA AS +AF++GA+VP+LAA FI+ +KVR+G V AAV++AL+
Sbjct  58   -RGVNEEARREKLPNPFHAALASALAFSVGALVPMLAAVFIRSHKVRMGVVAAAVSLALL  116

Query  398  vcgwlgaalggapkgkaSVRVLIGGWLAMAITSGLTKLIG  517
            V G  GA LG  P  ++ +RVL+GGW+AMAIT GLTKLIG
Sbjct  117  VFGGAGAVLGKTPVTRSCIRVLVGGWMAMAITFGLTKLIG  156



>ref|XP_009411067.1| PREDICTED: vacuolar iron transporter homolog 2-like [Musa acuminata 
subsp. malaccensis]
Length=234

 Score =   139 bits (351),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 98/173 (57%), Positives = 124/173 (72%), Gaps = 5/173 (3%)
 Frame = +2

Query  2    GANDGLVSIASLMMGVGTVKQDIKAMILTGFAGMVAGACSMAIGEFVSVYSQRDIEVAQM  181
            GANDGLVS+ASLM+GVG V Q  KAM+++G AG+VAGACSMAIGEFVSVY+Q DIEVAQM
Sbjct  58   GANDGLVSVASLMIGVGAVNQASKAMLVSGLAGLVAGACSMAIGEFVSVYAQYDIEVAQM  117

Query  182  KRKKNRRNGedageeeeeesdvdeLPNPMQAAAASVVAFTMGAMVPLLAASFIKPYKVRI  361
            KR++  +       EE  E     LP+P QAAAAS +AF  GA++PLLA  F+KP+ +RI
Sbjct  118  KREEEVKG-----VEEASEEKRRRLPSPFQAAAASALAFGAGALLPLLAGGFVKPWGIRI  172

Query  362  GaviaavtvalvvcgwlgaalggapkgkaSVRVLIGGWLAMAITSGLTKLIGI  520
              V A  ++ L   G  GA LGGA   K+S+RVL+GGW+AMA   G+ +L G+
Sbjct  173  AVVCAVTSLGLAGFGAAGALLGGASLRKSSIRVLVGGWMAMAACYGVLRLFGL  225



>ref|XP_002527771.1| Nodulin, putative [Ricinus communis]
 gb|EEF34632.1| Nodulin, putative [Ricinus communis]
Length=225

 Score =   139 bits (350),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 100/173 (58%), Positives = 125/173 (72%), Gaps = 4/173 (2%)
 Frame = +2

Query  2    GANDGLVSIASLMMGVGTVKQDIKAMILTGFAGMVAGACSMAIGEFVSVYSQRDIEVAQM  181
            GANDGL+S AS+MMGVG V++D K MILTG A +VAGACSMAIGEFVSVYSQ D E+AQ+
Sbjct  54   GANDGLLSTASIMMGVGAVRKDPKTMILTGIASLVAGACSMAIGEFVSVYSQYDTEMAQI  113

Query  182  KRKKNRRNGedageeeeeesdvdeLPNPMQAAAASVVAFTMGAMVPLLAASFIKPYKVRI  361
            +R+   R      +  + E+   +LPNP+QAA AS  AF  GA +PLL A+F+K Y  R+
Sbjct  114  EREIESRT----IQPIDVEARKKDLPNPLQAAGASAFAFAAGAAIPLLGAAFVKEYAARV  169

Query  362  GaviaavtvalvvcgwlgaalggapkgkaSVRVLIGGWLAMAITSGLTKLIGI  520
              VI   ++AL+  GWL A LG AP  K+S+RVL+GGWLAM IT G+TK IGI
Sbjct  170  WVVIGLASLALLGFGWLSAVLGHAPVVKSSLRVLVGGWLAMGITFGVTKAIGI  222



>ref|XP_008663753.1| PREDICTED: vacuolar iron transporter homolog 5-like [Zea mays]
 gb|AFW59999.1| hypothetical protein ZEAMMB73_890659 [Zea mays]
Length=207

 Score =   138 bits (347),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 91/171 (53%), Positives = 118/171 (69%), Gaps = 15/171 (9%)
 Frame = +2

Query  2    GANDGLVSIASLMMGVGTVKQDIKAMILTGFAGMVAGACSMAIGEFVSVYSQRDIEVAQM  181
            GANDGLVS ASLM+GVG VK D +AM+++GFAG++AGACSMAIGEFVSV SQRD+E+A++
Sbjct  47   GANDGLVSTASLMLGVGAVKADARAMVISGFAGLLAGACSMAIGEFVSVCSQRDVELARL  106

Query  182  KRKKNRRNGedageeeeeesdvdeLPNPMQAAAASVVAFTMGAMVPLLAASFIKPYKVRI  361
             R                      LP+P+QAAAAS +AF++GA++PLLAA F+  Y++RI
Sbjct  107  DRGAEEEK---------------ALPSPVQAAAASALAFSVGALLPLLAAGFVTDYRLRI  151

Query  362  GaviaavtvalvvcgwlgaalggapkgkaSVRVLIGGWLAMAITSGLTKLI  514
            G V A  T  L   G +GA LG AP  ++  RV+ GGW AMA+T GL +L 
Sbjct  152  GVVAAVATATLAAFGCVGAVLGRAPVARSCARVVSGGWAAMAVTFGLMRLF  202



>gb|KHN39192.1| Vacuolar iron transporter like 4 [Glycine soja]
Length=160

 Score =   136 bits (343),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 96/160 (60%), Positives = 125/160 (78%), Gaps = 4/160 (3%)
 Frame = +2

Query  38   MMGVGTVKQDIKAMILTGFAGMVAGACSMAIGEFVSVYSQRDIEVAQMKRKKNRRNGeda  217
            MMGVG VK+DI AM+L GFAG+VAGACSMAIGEFVSVY+Q DIE+ Q+KR++   N    
Sbjct  1    MMGVGAVKKDISAMLLAGFAGLVAGACSMAIGEFVSVYTQYDIEMTQIKREREANNN---  57

Query  218  geeeeeesdvdeLPNPMQAAAASVVAFTMGAMVPLLAASFIKPYKVRIGaviaavtvalv  397
                 EE+  ++LPNP QAA AS +AF++GA+VPL+AA FI+ +K+R+G V AAV++AL+
Sbjct  58   -RGVNEETQREKLPNPFQAALASALAFSVGALVPLIAAVFIRNHKIRMGVVAAAVSLALL  116

Query  398  vcgwlgaalggapkgkaSVRVLIGGWLAMAITSGLTKLIG  517
            V G +GA LG  P  ++ +RVL+GGW+AMAIT GLTKLIG
Sbjct  117  VFGGVGAVLGKTPVTRSCLRVLVGGWMAMAITFGLTKLIG  156



>gb|KHN39191.1| Vacuolar iron transporter like 4 [Glycine soja]
Length=160

 Score =   136 bits (342),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 99/160 (62%), Positives = 123/160 (77%), Gaps = 4/160 (3%)
 Frame = +2

Query  38   MMGVGTVKQDIKAMILTGFAGMVAGACSMAIGEFVSVYSQRDIEVAQMKRKKNRRNGeda  217
            MMGVG VK+DI AMIL GFAG+VAGACSMAIGEFVSVY+Q DIE AQ+KR+    N    
Sbjct  1    MMGVGAVKKDISAMILAGFAGLVAGACSMAIGEFVSVYTQYDIEKAQLKRESESNNN---  57

Query  218  geeeeeesdvdeLPNPMQAAAASVVAFTMGAMVPLLAASFIKPYKVRIGaviaavtvalv  397
                 EE+  ++LP P QAA AS +AF++GA+VP+LAA FI+ +KVR+G V AAV++AL+
Sbjct  58   -RGVNEEAQREKLPKPFQAALASALAFSVGALVPMLAAVFIRSHKVRMGVVAAAVSLALL  116

Query  398  vcgwlgaalggapkgkaSVRVLIGGWLAMAITSGLTKLIG  517
            V G +GA LG  P  ++ +RVLIGGW+AMAIT GLTKLIG
Sbjct  117  VFGGVGAVLGNTPVKRSCLRVLIGGWMAMAITFGLTKLIG  156



>tpg|DAA36745.1| TPA: integral membrane protein [Zea mays]
Length=214

 Score =   137 bits (344),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 92/171 (54%), Positives = 119/171 (70%), Gaps = 13/171 (8%)
 Frame = +2

Query  2    GANDGLVSIASLMMGVGTVKQDIKAMILTGFAGMVAGACSMAIGEFVSVYSQRDIEVAQM  181
            GANDGLVS ASLM+GVG VK D +AM+++GFAG++AGACSMAIGEFVSV SQRD+E+A++
Sbjct  52   GANDGLVSTASLMLGVGAVKADARAMVISGFAGLLAGACSMAIGEFVSVCSQRDVELARL  111

Query  182  KRKKNRRNGedageeeeeesdvdeLPNPMQAAAASVVAFTMGAMVPLLAASFIKPYKVRI  361
             R                      LP+P+QAAAAS +AF++GA++PLLAA FI  Y++RI
Sbjct  112  DRGGGDDE-------------KAALPSPVQAAAASALAFSVGALLPLLAAGFIADYRLRI  158

Query  362  GaviaavtvalvvcgwlgaalggapkgkaSVRVLIGGWLAMAITSGLTKLI  514
            G V A  T  L   G +GA LG AP  ++  RV+ GGW+AMA+T GL +L 
Sbjct  159  GVVAAVATATLAAFGCVGAVLGRAPVARSCARVVGGGWVAMAVTFGLMRLF  209



>ref|NP_001151908.1| integral membrane protein [Zea mays]
 gb|ACG44898.1| integral membrane protein [Zea mays]
Length=214

 Score =   137 bits (344),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 91/171 (53%), Positives = 118/171 (69%), Gaps = 13/171 (8%)
 Frame = +2

Query  2    GANDGLVSIASLMMGVGTVKQDIKAMILTGFAGMVAGACSMAIGEFVSVYSQRDIEVAQM  181
            GANDGLVS ASLM+GVG VK D +AM+++GFAG++AGACSMAIGEFVSV SQRD+E+A++
Sbjct  52   GANDGLVSTASLMLGVGAVKADARAMVISGFAGLLAGACSMAIGEFVSVCSQRDVELARL  111

Query  182  KRKKNRRNGedageeeeeesdvdeLPNPMQAAAASVVAFTMGAMVPLLAASFIKPYKVRI  361
             R                      LP+P+QAAAAS +AF++GA++PLLAA FI  Y++RI
Sbjct  112  DRGGGDDE-------------KAALPSPVQAAAASALAFSVGALLPLLAAGFIADYRLRI  158

Query  362  GaviaavtvalvvcgwlgaalggapkgkaSVRVLIGGWLAMAITSGLTKLI  514
            G V A  T  L   G +GA  G AP  ++  RV+ GGW+AMA+T GL +L 
Sbjct  159  GVVAAVATATLAAFGCVGAVXGRAPVARSCARVVGGGWVAMAVTFGLMRLF  209



>ref|XP_008791707.1| PREDICTED: vacuolar iron transporter homolog 2-like [Phoenix 
dactylifera]
Length=235

 Score =   137 bits (344),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 93/173 (54%), Positives = 125/173 (72%), Gaps = 7/173 (4%)
 Frame = +2

Query  2    GANDGLVSIASLMMGVGTVKQDIKAMILTGFAGMVAGACSMAIGEFVSVYSQRDIEVAQM  181
            GANDGLVS+ASLM+GVG V Q  KAM+++G AG+VAGACSMAIGEFVSVY+Q DIEVAQM
Sbjct  61   GANDGLVSVASLMIGVGAVNQTAKAMLVSGLAGLVAGACSMAIGEFVSVYAQYDIEVAQM  120

Query  182  KRKKNRRNGedageeeeeesdvdeLPNPMQAAAASVVAFTMGAMVPLLAASFIKPYKVRI  361
            +R     +       E  + + + LP+P+ AA AS +AF +GA++PLLA  FI+ + VR+
Sbjct  121  ERASLESS-------ESRDKEKESLPSPVMAAGASALAFAVGALLPLLAGGFIRSWGVRV  173

Query  362  GaviaavtvalvvcgwlgaalggapkgkaSVRVLIGGWLAMAITSGLTKLIGI  520
            G V A  ++ L   G  GA +GGA   K+++RVL+GGWLAMA+T G+ +L G+
Sbjct  174  GVVCAVSSLGLAGFGVAGAVIGGANVSKSALRVLVGGWLAMALTYGVLRLFGL  226



>ref|XP_009382334.1| PREDICTED: vacuolar iron transporter homolog 2-like [Musa acuminata 
subsp. malaccensis]
Length=232

 Score =   136 bits (342),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 90/173 (52%), Positives = 120/173 (69%), Gaps = 10/173 (6%)
 Frame = +2

Query  2    GANDGLVSIASLMMGVGTVKQDIKAMILTGFAGMVAGACSMAIGEFVSVYSQRDIEVAQM  181
            GANDGLVS+ASLM+GVG V Q  KAM+++G AG+VAGACSMAIGEFVSVY+Q DIEVA+ 
Sbjct  61   GANDGLVSVASLMVGVGAVGQSAKAMLVSGLAGLVAGACSMAIGEFVSVYAQYDIEVAER  120

Query  182  KRKKNRRNGedageeeeeesdvdeLPNPMQAAAASVVAFTMGAMVPLLAASFIKPYKVRI  361
            +R++                +   LPNP+ AA AS +AF++GA++PLLA  FI+ + VR+
Sbjct  121  ERRRQD----------CGSEEEGSLPNPLLAAVASALAFSLGAVLPLLAGGFIRSWGVRV  170

Query  362  GaviaavtvalvvcgwlgaalggapkgkaSVRVLIGGWLAMAITSGLTKLIGI  520
            GAV A  ++ L   G  GA LGGA    + +R+L GGWLAM +T G+ ++ GI
Sbjct  171  GAVCAVSSLGLAGFGAAGAVLGGANVPNSVLRLLFGGWLAMLVTYGVLRVFGI  223



>gb|AFK38519.1| unknown [Medicago truncatula]
Length=151

 Score =   133 bits (334),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 95/159 (60%), Positives = 113/159 (71%), Gaps = 13/159 (8%)
 Frame = +2

Query  38   MMGVGTVKQDIKAMILTGFAGMVAGACSMAIGEFVSVYSQRDIEVAQMKRKKNRRNGeda  217
            MMGVG V +D+K MILTG AG+VAGACS AIGEFVSVYSQ DIE AQMKR+ N       
Sbjct  1    MMGVGAVTKDVKTMILTGIAGLVAGACSTAIGEFVSVYSQYDIEFAQMKRQGNISQ----  56

Query  218  geeeeeesdvdeLPNPMQAAAASVVAFTMGAMVPLLAASFIKPYKVRIGaviaavtvalv  397
                      D+LPNP  AA AS +AF +GA VPLL A+F+K YKVR+G V+  V++AL 
Sbjct  57   ---------KDKLPNPYYAAFASAIAFAVGAFVPLLGAAFVKDYKVRLGVVVGVVSLALF  107

Query  398  vcgwlgaalggapkgkaSVRVLIGGWLAMAITSGLTKLI  514
              G L A LG AP  K+S+RVLIGGWLAM++T GLTKL+
Sbjct  108  GFGLLSAVLGKAPLVKSSLRVLIGGWLAMSLTFGLTKLV  146



>gb|KHN41842.1| Vacuolar iron transporter like 4 [Glycine soja]
Length=163

 Score =   133 bits (334),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 91/161 (57%), Positives = 121/161 (75%), Gaps = 3/161 (2%)
 Frame = +2

Query  38   MMGVGTVKQDIKAMILTGFAGMVAGACSMAIGEFVSVYSQRDIEVAQMKRKKNRRNGeda  217
            M+G+G VK++I AM+L GFAG++AGACSMAIGEFVSVY+Q DIE+AQ+KR K   N    
Sbjct  1    MIGIGAVKENITAMLLAGFAGLIAGACSMAIGEFVSVYTQYDIEIAQIKRDKENNN---I  57

Query  218  geeeeeesdvdeLPNPMQAAAASVVAFTMGAMVPLLAASFIKPYKVRIGaviaavtvalv  397
            G   EE +  ++LPNP QAA AS +AF++GA++PLLAA+FI+ YK+R+  V    T+ L+
Sbjct  58   GGVGEELAQREKLPNPFQAALASALAFSVGAVIPLLAAAFIRNYKIRLVVVAVVATLTLL  117

Query  398  vcgwlgaalggapkgkaSVRVLIGGWLAMAITSGLTKLIGI  520
            + G +GA LG     K+ +RVLIGGW+AM+IT GLTKL GI
Sbjct  118  LFGGVGAVLGKTLVRKSCIRVLIGGWMAMSITFGLTKLFGI  158



>gb|AFK48414.1| unknown [Lotus japonicus]
Length=201

 Score =   134 bits (336),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 69/124 (56%), Positives = 88/124 (71%), Gaps = 11/124 (9%)
 Frame = +2

Query  2    GANDGLVSIASLMMGVGTVKQDIKAMILTGFAGMVAGACSMAIGEFVSVYSQRDIEVAQM  181
            GANDGLVS+ASLMMGVG V +D KAM+L GFAG+VAGAC MAIGEFVSV++Q ++EV QM
Sbjct  50   GANDGLVSVASLMMGVGAVNKDAKAMLLAGFAGLVAGACGMAIGEFVSVFTQYEVEVGQM  109

Query  182  KR-----KKNRRNGedageeeeeesdvdeLPNPMQAAAASVVAFTMGAMVPLLAASFIKP  346
            KR     ++  R+       E        +PNPMQAA AS  +F++G +VPLL+ SF+  
Sbjct  110  KRDMIKSEQGERD------LEMAMEKRKSIPNPMQAALASAFSFSIGGLVPLLSGSFVSV  163

Query  347  YKVR  358
            YK+R
Sbjct  164  YKIR  167



>gb|KHM99128.1| Nodulin-21 [Glycine soja]
Length=162

 Score =   131 bits (330),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 91/160 (57%), Positives = 117/160 (73%), Gaps = 2/160 (1%)
 Frame = +2

Query  38   MMGVGTVKQDIKAMILTGFAGMVAGACSMAIGEFVSVYSQRDIEVAQMKRKKNRRNGeda  217
            MMGVG VK+D KAM+L GFAG+VAGAC MAIGEFV+VY+Q ++EV QMKR  N   G   
Sbjct  1    MMGVGAVKRDAKAMLLAGFAGLVAGACGMAIGEFVAVYTQYEVEVGQMKRDMNMSVG--G  58

Query  218  geeeeeesdvdeLPNPMQAAAASVVAFTMGAMVPLLAASFIKPYKVRIGaviaavtvalv  397
              + E E +   LPNP+QA  AS + F++GA+VPLL+A+FI+ Y+ RI  V+A   +ALV
Sbjct  59   ERDLEMEMERRTLPNPLQATLASALCFSIGALVPLLSAAFIENYRTRIIVVVAMSCLALV  118

Query  398  vcgwlgaalggapkgkaSVRVLIGGWLAMAITSGLTKLIG  517
            V GW+GA LG  PK K+ VR L+GG +AM+IT G TKL+G
Sbjct  119  VFGWVGAKLGKTPKLKSCVRFLLGGCIAMSITFGSTKLLG  158



>gb|KEH31262.1| vacuolar iron transporter-like protein [Medicago truncatula]
Length=235

 Score =   133 bits (335),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 99/171 (58%), Positives = 127/171 (74%), Gaps = 1/171 (1%)
 Frame = +2

Query  2    GANDGLVSIASLMMGVGTVKQDIKAMILTGFAGMVAGACSMAIGEFVSVYSQRDIEVAQM  181
            GANDGLVS+ASLMMGVG VK D   M++ GFAG++AGAC MAIGEFVSVY+Q ++E+ QM
Sbjct  56   GANDGLVSVASLMMGVGAVKTDSATMLVAGFAGLIAGACGMAIGEFVSVYTQYEVEIGQM  115

Query  182  KRKKNRRNGedageeeeeesdvdeLPNPMQAAAASVVAFTMGAMVPLLAASFIKPYKVRI  361
             R     +     E E E      LPNP+QAAAAS  +F++G +VPLL+ SFI+ YK+RI
Sbjct  116  MRDLGTSD-RKEKELEIELEKRRSLPNPLQAAAASAFSFSIGGLVPLLSGSFIRVYKIRI  174

Query  362  GaviaavtvalvvcgwlgaalggapkgkaSVRVLIGGWLAMAITSGLTKLI  514
             A++A  ++ALVV G +GA LG  PK K+S+R L+GGW+AMAIT GLTKL+
Sbjct  175  IAIMAIASLALVVFGGVGAMLGKTPKVKSSIRFLLGGWMAMAITFGLTKLL  225



>ref|XP_006292466.1| hypothetical protein CARUB_v10018696mg, partial [Capsella rubella]
 gb|EOA25364.1| hypothetical protein CARUB_v10018696mg, partial [Capsella rubella]
Length=171

 Score =   131 bits (330),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 105/171 (61%), Positives = 128/171 (75%), Gaps = 20/171 (12%)
 Frame = +2

Query  2    GANDGLVSIASLMMGVGTVKQDIKAMILTGFAGMVAGACSMAIGEFVSVYSQRDIEVAQM  181
            GA DGLVS ASLMMGVG VKQDIK M+LTGFAG+           FVSVYSQ DIEVAQM
Sbjct  16   GATDGLVSTASLMMGVGAVKQDIKIMLLTGFAGL-----------FVSVYSQYDIEVAQM  64

Query  182  KRKKNRRNGedageeeeeesdvdeLPNPMQAAAASVVAFTMGAMVPLLAASFIKPYKVRI  361
            KR ++            ++ + D+LP+P QAAAAS +AF++G +VPLLAA+F+K YKVRI
Sbjct  65   KRDQSGGG---------DQGEKDKLPSPTQAAAASALAFSLGGIVPLLAAAFVKEYKVRI  115

Query  362  GaviaavtvalvvcgwlgaalggapkgkaSVRVLIGGWLAMAITSGLTKLI  514
            G ++AAVT+ALV+ GWLGA LG AP  K+S+RVLIGGWLAMA+T G TKL+
Sbjct  116  GVIVAAVTLALVMFGWLGAVLGKAPLVKSSLRVLIGGWLAMAVTFGFTKLV  166



>gb|AFK45846.1| unknown [Medicago truncatula]
Length=235

 Score =   133 bits (334),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 99/174 (57%), Positives = 128/174 (74%), Gaps = 7/174 (4%)
 Frame = +2

Query  2    GANDGLVSIASLMMGVGTVKQDIKAMILTGFAGMVAGACSMAIGEFVSVYSQRDIEVAQM  181
            GANDGLVS+ASLMMGVG VK D   M++ GFAG++AGAC MAIGEFVSVY+Q ++E+ QM
Sbjct  56   GANDGLVSVASLMMGVGAVKTDSATMLVAGFAGLIAGACGMAIGEFVSVYTQYEVEIGQM  115

Query  182  KRK---KNRRNGedageeeeeesdvdeLPNPMQAAAASVVAFTMGAMVPLLAASFIKPYK  352
             R     +R+      E E E      LPNP+QAAAAS  +F++G +VPLL+ SF + YK
Sbjct  116  MRDLGTSDRKE----KESEIELEKRRSLPNPLQAAAASAFSFSIGGLVPLLSGSFTRVYK  171

Query  353  VRIGaviaavtvalvvcgwlgaalggapkgkaSVRVLIGGWLAMAITSGLTKLI  514
            +RI A++A  ++ALVV G +GA LG  PK K+S+R L+GGW+AMAIT GLTKL+
Sbjct  172  IRIIAIMAIASLALVVFGGVGAMLGKTPKVKSSIRFLLGGWMAMAITFGLTKLL  225



>ref|XP_002993072.1| hypothetical protein SELMODRAFT_26881, partial [Selaginella moellendorffii]
 gb|EFJ05911.1| hypothetical protein SELMODRAFT_26881, partial [Selaginella moellendorffii]
Length=187

 Score =   131 bits (329),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 88/170 (52%), Positives = 116/170 (68%), Gaps = 1/170 (1%)
 Frame = +2

Query  2    GANDGLVSIASLMMGVGTVKQDIKAMILTGFAGMVAGACSMAIGEFVSVYSQRDIEVAQM  181
            GANDGLVSIASL++GV     + +++IL+G AG++AGACSMA+GEFVSV SQRD EVA++
Sbjct  19   GANDGLVSIASLLLGVSAGNSNERSIILSGIAGLIAGACSMAVGEFVSVSSQRDTEVAEI  78

Query  182  KRKKNRRNGedageeeeeesdvdeLPNPMQAAAASVVAFTMGAMVPLLAASFIKPYKVRI  361
            +R++ R++       EE   DVD L  P QAAA S VAFT G  VPLLAA F++ Y+ R+
Sbjct  79   ERER-RQHAAGVHAREELGIDVDALARPWQAAAVSAVAFTTGGAVPLLAAGFVEAYRWRL  137

Query  362  GaviaavtvalvvcgwlgaalggapkgkaSVRVLIGGWLAMAITSGLTKL  511
             A+  + ++ L   G  GA LG AP   AS RV +GGW+AM  T G+  L
Sbjct  138  AAIGLSTSMGLAAFGACGARLGKAPILAASTRVTVGGWIAMLATFGILYL  187



>ref|XP_006833495.1| hypothetical protein AMTR_s01243p00009970 [Amborella trichopoda]
 gb|ERM98773.1| hypothetical protein AMTR_s01243p00009970 [Amborella trichopoda]
Length=208

 Score =   130 bits (328),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 105/172 (61%), Positives = 130/172 (76%), Gaps = 9/172 (5%)
 Frame = +2

Query  2    GANDGLVSIASLMMGVGTVKQDIKAMILTGFAGMVAGACSMAIGEFVSVYSQRDIEVAQM  181
            GANDGLVS ASLM+GVG +K D KAM+L+G AG+VAGACSMAIGEFVSVYSQ DIEVAQ+
Sbjct  42   GANDGLVSTASLMVGVGAIKTDPKAMLLSGLAGLVAGACSMAIGEFVSVYSQLDIEVAQL  101

Query  182  KRKKNRRNGedageeeeeesdvdeLPNPMQAAAASVVAFTMGAMVPLLAASFIKPYKVRI  361
            +R++            E+ES+   LP+P QAAAAS +AF +GA VP+LAA+F++  KVR+
Sbjct  102  ERER---------VGGEKESEGLRLPSPFQAAAASAMAFALGAAVPILAAAFVRTVKVRV  152

Query  362  GaviaavtvalvvcgwlgaalggapkgkaSVRVLIGGWLAMAITSGLTKLIG  517
            G V  A TVALV  G LGA LG AP  +++ RVL+GGWLAMA+T GL  L+G
Sbjct  153  GVVAVAATVALVGFGVLGARLGRAPVVRSAARVLVGGWLAMAVTYGLMVLVG  204



>ref|XP_004230642.1| PREDICTED: vacuolar iron transporter homolog 4-like [Solanum 
lycopersicum]
Length=212

 Score =   129 bits (323),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 100/173 (58%), Positives = 128/173 (74%), Gaps = 9/173 (5%)
 Frame = +2

Query  2    GANDGLVSIASLMMGVGTVKQDIKAMILTGFAGMVAGACSMAIGEFVSVYSQRDIEVAQM  181
            GANDGL+S +SLMMG+G + QD K+MI+TG AG+VAGACSMAIGEFVSVYSQ DIE++Q+
Sbjct  44   GANDGLLSTSSLMMGIGAIHQDSKSMIVTGMAGLVAGACSMAIGEFVSVYSQYDIEMSQI  103

Query  182  KRKKNRRNGedageeeeeesdvdeLPNPMQAAAASVVAFTMGAMVPLLAASFIKPYKVRI  361
            KR+            E  E    +LP+P++AA AS  AF +GA+VPLL A+F+K Y VR+
Sbjct  104  KREN---------AMELFEEKKKKLPSPLKAAGASAFAFAIGAIVPLLGAAFVKDYHVRL  154

Query  362  GaviaavtvalvvcgwlgaalggapkgkaSVRVLIGGWLAMAITSGLTKLIGI  520
            G V+  V++AL+  G L A LG AP  K+S+RVLIGGWLAM IT G TKL+G+
Sbjct  155  GVVVGVVSLALLGFGGLSAYLGKAPLVKSSLRVLIGGWLAMGITFGFTKLVGV  207



>sp|B7F138.1|VITH2_ORYSJ RecName: Full=Vacuolar iron transporter homolog 2; AltName: Full=Protein 
NODULIN-LIKE 2 [Oryza sativa Japonica Group]
 emb|CAE03023.3| OSJNBa0091D06.17 [Oryza sativa Japonica Group]
 dbj|BAG98335.1| unnamed protein product [Oryza sativa Japonica Group]
Length=189

 Score =   127 bits (319),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 87/170 (51%), Positives = 118/170 (69%), Gaps = 7/170 (4%)
 Frame = +2

Query  2    GANDGLVSIASLMMGVGTVKQDIKAMILTGFAGMVAGACSMAIGEFVSVYSQRDIEVAQM  181
            GANDGLVS+ASLM+G+G V ++ KAM+++G AG+VAGACSMAIGEFVSVY+Q DIEV Q+
Sbjct  13   GANDGLVSVASLMIGIGAVNENNKAMLVSGLAGLVAGACSMAIGEFVSVYAQYDIEVTQI  72

Query  182  KRKKNRRNGedageeeeeesdvdeLPNPMQAAAASVVAFTMGAMVPLLAASFIKPYKVRI  361
            +R           +  +  +  ++LP+P QAA AS +AF +G ++PLL + FIKP+  R+
Sbjct  73   ERDG-------DIDGADAAAAREKLPSPTQAAFASALAFAIGGLLPLLTSGFIKPWGPRV  125

Query  362  GaviaavtvalvvcgwlgaalggapkgkaSVRVLIGGWLAMAITSGLTKL  511
            G V AA +V L   G  G  LGGA   ++  RVL+GGWLAM IT  + +L
Sbjct  126  GVVCAASSVGLAGFGAAGGYLGGANMVRSGTRVLLGGWLAMLITYAVLRL  175



>gb|AFG52748.1| hypothetical protein 2_8399_01, partial [Pinus taeda]
 gb|AFG52749.1| hypothetical protein 2_8399_01, partial [Pinus taeda]
 gb|AFG52750.1| hypothetical protein 2_8399_01, partial [Pinus taeda]
 gb|AFG52751.1| hypothetical protein 2_8399_01, partial [Pinus taeda]
 gb|AFG52752.1| hypothetical protein 2_8399_01, partial [Pinus taeda]
 gb|AFG52753.1| hypothetical protein 2_8399_01, partial [Pinus taeda]
Length=137

 Score =   125 bits (313),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 66/121 (55%), Positives = 86/121 (71%), Gaps = 11/121 (9%)
 Frame = +2

Query  2    GANDGLVSIASLMMGVGTVKQDIKAMILTGFAGMVAGACSMAIGEFVSVYSQRDIEVAQM  181
            GANDGLV+IASLM+GVG V+ + K M++TG A +VAGACSMAIGEFVSVY+QRD+EV  +
Sbjct  23   GANDGLVTIASLMIGVGAVQSNAKTMVVTGLAALVAGACSMAIGEFVSVYAQRDVEVCTI  82

Query  182  K-RKKNRRNGedageeeeeesdvdeLPNPMQAAAASVVAFTMGAMVPLLAASFIKPYKVR  358
            K R KN  N           +  + LP P  AA AS +AF++G +VPLL+A+FI  Y +R
Sbjct  83   KIRAKNVLN----------PNKDESLPKPFLAAIASSLAFSVGGVVPLLSAAFITNYTIR  132

Query  359  I  361
            +
Sbjct  133  V  133



>gb|EAY94995.1| hypothetical protein OsI_16802 [Oryza sativa Indica Group]
Length=264

 Score =   128 bits (322),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 87/171 (51%), Positives = 118/171 (69%), Gaps = 7/171 (4%)
 Frame = +2

Query  2    GANDGLVSIASLMMGVGTVKQDIKAMILTGFAGMVAGACSMAIGEFVSVYSQRDIEVAQM  181
            GANDGLVS+ASLM+G+G V ++ KAM+++G AG+VAGACSMAIGEFVSVY+Q DIEV Q+
Sbjct  88   GANDGLVSVASLMIGIGAVNENNKAMLVSGLAGLVAGACSMAIGEFVSVYAQYDIEVTQI  147

Query  182  KRKKNRRNGedageeeeeesdvdeLPNPMQAAAASVVAFTMGAMVPLLAASFIKPYKVRI  361
            +R           +  +  +  ++LP+P QAA AS +AF +G ++PLL + FIKP+  R+
Sbjct  148  ERDG-------DIDGADAAAAREKLPSPTQAAFASALAFAIGGLLPLLTSGFIKPWGPRV  200

Query  362  GaviaavtvalvvcgwlgaalggapkgkaSVRVLIGGWLAMAITSGLTKLI  514
            G V AA +V L   G  G  LGGA   ++  RVL+GGWLAM IT  + +L 
Sbjct  201  GVVCAASSVGLAGFGAAGGYLGGANMVRSGTRVLLGGWLAMLITYAVLRLF  251



>sp|Q7XTL7.3|VITH5_ORYSJ RecName: Full=Vacuolar iron transporter homolog 5; AltName: Full=Protein 
NODULIN-LIKE 5 [Oryza sativa Japonica Group]
 emb|CAJ86136.1| H0701F11.2 [Oryza sativa Indica Group]
 emb|CAH68365.1| H0723C07.15 [Oryza sativa Indica Group]
 gb|EAY96130.1| hypothetical protein OsI_18009 [Oryza sativa Indica Group]
 gb|EAZ32489.1| hypothetical protein OsJ_16707 [Oryza sativa Japonica Group]
Length=208

 Score =   127 bits (318),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 94/171 (55%), Positives = 122/171 (71%), Gaps = 11/171 (6%)
 Frame = +2

Query  2    GANDGLVSIASLMMGVGTVKQDIKAMILTGFAGMVAGACSMAIGEFVSVYSQRDIEVAQM  181
            GANDGLVS ASLM+GVG VK + +AM+++GFAG++AGACSMAIGEFVSV SQRD+E+AQ+
Sbjct  44   GANDGLVSTASLMLGVGAVKAEARAMVISGFAGLLAGACSMAIGEFVSVCSQRDVELAQL  103

Query  182  KRKKNRRNGedageeeeeesdvdeLPNPMQAAAASVVAFTMGAMVPLLAASFIKPYKVRI  361
            +R   +R GE+                P QAAAAS +AF++GA+VPLLAA FI  Y++RI
Sbjct  104  ER-DGKRGGEEEKALPS----------PAQAAAASAMAFSVGAVVPLLAAGFIVNYRLRI  152

Query  362  GaviaavtvalvvcgwlgaalggapkgkaSVRVLIGGWLAMAITSGLTKLI  514
              V+A  +VAL   G +GA LG A   ++S RV++GGW AM IT GL +L 
Sbjct  153  AVVVAVASVALAAFGCVGAVLGRAAVARSSARVVLGGWAAMGITFGLMRLF  203



>ref|NP_001053431.1| Os04g0538400 [Oryza sativa Japonica Group]
 dbj|BAF15345.1| Os04g0538400, partial [Oryza sativa Japonica Group]
Length=247

 Score =   127 bits (320),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 87/170 (51%), Positives = 118/170 (69%), Gaps = 7/170 (4%)
 Frame = +2

Query  2    GANDGLVSIASLMMGVGTVKQDIKAMILTGFAGMVAGACSMAIGEFVSVYSQRDIEVAQM  181
            GANDGLVS+ASLM+G+G V ++ KAM+++G AG+VAGACSMAIGEFVSVY+Q DIEV Q+
Sbjct  71   GANDGLVSVASLMIGIGAVNENNKAMLVSGLAGLVAGACSMAIGEFVSVYAQYDIEVTQI  130

Query  182  KRKKNRRNGedageeeeeesdvdeLPNPMQAAAASVVAFTMGAMVPLLAASFIKPYKVRI  361
            +R           +  +  +  ++LP+P QAA AS +AF +G ++PLL + FIKP+  R+
Sbjct  131  ERDG-------DIDGADAAAAREKLPSPTQAAFASALAFAIGGLLPLLTSGFIKPWGPRV  183

Query  362  GaviaavtvalvvcgwlgaalggapkgkaSVRVLIGGWLAMAITSGLTKL  511
            G V AA +V L   G  G  LGGA   ++  RVL+GGWLAM IT  + +L
Sbjct  184  GVVCAASSVGLAGFGAAGGYLGGANMVRSGTRVLLGGWLAMLITYAVLRL  233



>dbj|BAJ87699.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=206

 Score =   125 bits (315),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 68/119 (57%), Positives = 90/119 (76%), Gaps = 11/119 (9%)
 Frame = +2

Query  2    GANDGLVSIASLMMGVGTVKQDIKAMILTGFAGMVAGACSMAIGEFVSVYSQRDIEVAQM  181
            GANDGLVS ASLM+G+G VK +++AM+++GFAG++AGACSMAIGEFVSV SQRD+E+AQ+
Sbjct  42   GANDGLVSTASLMLGMGAVKHEVRAMVISGFAGLLAGACSMAIGEFVSVCSQRDVEIAQL  101

Query  182  KRKKNRRNGedageeeeeesdvdeLPNPMQAAAASVVAFTMGAMVPLLAASFIKPYKVR  358
             R   R              +   LP+P+QAAAAS +AF++GA++PLLAA FI  YK+R
Sbjct  102  DRDGKR-----------GGDEERALPSPIQAAAASALAFSVGALLPLLAAGFIVGYKLR  149



>ref|XP_010240184.1| PREDICTED: vacuolar iron transporter homolog 2-like [Brachypodium 
distachyon]
Length=244

 Score =   126 bits (316),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 89/171 (52%), Positives = 113/171 (66%), Gaps = 10/171 (6%)
 Frame = +2

Query  2    GANDGLVSIASLMMGVGTVKQDIKAMILTGFAGMVAGACSMAIGEFVSVYSQRDIEVAQM  181
            GANDGLVS+ASLM+GV  V    K M+++G AG+VAGACSMAIGEFVSVY+Q DIE++Q+
Sbjct  72   GANDGLVSVASLMIGVSAVNDAGKTMLVSGLAGLVAGACSMAIGEFVSVYAQYDIELSQI  131

Query  182  KRKKNRRNGedageeeeeesdvdeLPNPMQAAAASVVAFTMGAMVPLLAASFIKPYKVRI  361
            KR+     G             + LP+P  AA AS +AF +G +VPLLA  F+KP+  R 
Sbjct  132  KREAKDARG----------KKKENLPSPAMAALASALAFAVGGLVPLLAGGFVKPWGARF  181

Query  362  GaviaavtvalvvcgwlgaalggapkgkaSVRVLIGGWLAMAITSGLTKLI  514
            GAV AA +V L   G  G  LGGA   +++ RVL GGWLAMA+T G+  L 
Sbjct  182  GAVCAATSVGLAGFGAAGGHLGGASVPRSACRVLAGGWLAMAVTYGVLWLF  232



>ref|XP_009383061.1| PREDICTED: vacuolar iron transporter homolog 2-like [Musa acuminata 
subsp. malaccensis]
Length=202

 Score =   125 bits (313),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 96/173 (55%), Positives = 129/173 (75%), Gaps = 0/173 (0%)
 Frame = +2

Query  2    GANDGLVSIASLMMGVGTVKQDIKAMILTGFAGMVAGACSMAIGEFVSVYSQRDIEVAQM  181
            GANDGLVS+ASLM+GVG V Q  KAM+++G AG+VAGACSMAIGEFVSVY+Q DIEVA+ 
Sbjct  21   GANDGLVSVASLMVGVGAVGQSSKAMLVSGLAGLVAGACSMAIGEFVSVYAQYDIEVAER  80

Query  182  KRKKNRRNGedageeeeeesdvdeLPNPMQAAAASVVAFTMGAMVPLLAASFIKPYKVRI  361
            +R++     E  G +EEEE +   LPNP+ AAAAS +AF++GA++PLLA +FI+  +VR+
Sbjct  81   ERRRRDCGSEKEGVKEEEEEEEGSLPNPLLAAAASALAFSLGAVLPLLAGAFIRSGEVRV  140

Query  362  GaviaavtvalvvcgwlgaalggapkgkaSVRVLIGGWLAMAITSGLTKLIGI  520
            G V A  ++ L   G  GA LGGA    + +R+LIGGWLAM +T G+ ++ G+
Sbjct  141  GVVCAVSSLGLAGFGAAGAVLGGANVPNSVLRLLIGGWLAMLVTYGVLRVSGL  193



>ref|XP_002452847.1| hypothetical protein SORBIDRAFT_04g033490 [Sorghum bicolor]
 gb|EES05823.1| hypothetical protein SORBIDRAFT_04g033490 [Sorghum bicolor]
Length=234

 Score =   125 bits (315),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 87/173 (50%), Positives = 123/173 (71%), Gaps = 1/173 (1%)
 Frame = +2

Query  2    GANDGLVSIASLMMGVGTVKQDIKAMILTGFAGMVAGACSMAIGEFVSVYSQRDIEVAQM  181
            GANDGLVS+ASLM+GVG V    + M+++G AG+VAGACSMAIGEFVSVY+Q D++VA  
Sbjct  54   GANDGLVSVASLMIGVGAVNDGAREMLVSGLAGLVAGACSMAIGEFVSVYAQYDVQVAHS  113

Query  182  KRKKNRRNGedageeeeeesdvdeLPNPMQAAAASVVAFTMGAMVPLLAASFIKPYKVRI  361
            +R  +  +          E DV+ LP+PM+AAAAS +AF +GA +PLL+  F++P+ +R+
Sbjct  114  ERGSS-DDSSSEVGRGGGEGDVERLPSPMKAAAASALAFAVGAALPLLSGGFVRPWAIRV  172

Query  362  GaviaavtvalvvcgwlgaalggapkgkaSVRVLIGGWLAMAITSGLTKLIGI  520
              V AA ++ L   G  GA LGGA   ++ +RVL+GGWLAMA+T G+ +L+ +
Sbjct  173  AVVCAASSLGLTGFGAAGAYLGGASIVRSGLRVLLGGWLAMAVTFGILRLLSL  225



>ref|XP_010243894.1| PREDICTED: vacuolar iron transporter homolog 4-like [Nelumbo 
nucifera]
Length=132

 Score =   121 bits (304),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 88/132 (67%), Positives = 104/132 (79%), Gaps = 4/132 (3%)
 Frame = +2

Query  122  MAIGEFVSVYSQRDIEVAQMKRKKNRRNGedageeeeeesdvdeLPNPMQAAAASVVAFT  301
            MAIGEFVSVYSQ DIEVAQMKR+   R+G ++ EE ++E     LPNP  AAAAS + F 
Sbjct  1    MAIGEFVSVYSQLDIEVAQMKRENRSRDGSESNEENKKEK----LPNPFLAAAASTLTFA  56

Query  302  MGAMVPLLAASFIKPYKVRIGaviaavtvalvvcgwlgaalggapkgkaSVRVLIGGWLA  481
            +GAMVPLLAASFIK Y+VR+G V+A  ++AL+V G LGAA+G AP G+A  RVLIGGWLA
Sbjct  57   IGAMVPLLAASFIKEYRVRLGVVVAVSSLALLVFGGLGAAIGKAPVGRACFRVLIGGWLA  116

Query  482  MAITSGLTKLIG  517
            MAIT GLTKLIG
Sbjct  117  MAITFGLTKLIG  128



>ref|XP_006856176.1| hypothetical protein AMTR_s00059p00177640 [Amborella trichopoda]
 gb|ERN17643.1| hypothetical protein AMTR_s00059p00177640 [Amborella trichopoda]
Length=198

 Score =   122 bits (306),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 83/173 (48%), Positives = 114/173 (66%), Gaps = 11/173 (6%)
 Frame = +2

Query  2    GANDGLVSIASLMMGVGTVKQDIKAMILTGFAGMVAGACSMAIGEFVSVYSQRDIEVAQM  181
            GANDGLVS  SLM+G+  V+ D +++ ++G A + AGA SMAIGEFVSVY+QRDI+  + 
Sbjct  35   GANDGLVSTTSLMLGISAVRGDARSVAISGIAALAAGASSMAIGEFVSVYTQRDIQAFER  94

Query  182  KRKKNRR--NGedageeeeeesdvdeLPNPMQAAAASVVAFTMGAMVPLLAASFIKPYKV  355
            +R+   R  NG         +   D LPNP +AA AS ++F  GA+VPLL  +F++ Y  
Sbjct  95   ERQGTLRTING---------DKADDPLPNPFRAATASALSFMCGALVPLLCGAFVQNYVA  145

Query  356  RIGaviaavtvalvvcgwlgaalggapkgkaSVRVLIGGWLAMAITSGLTKLI  514
            R+ A++ A +  L++ G LGA LGG+   +AS+RVL GGWLAMA T G  KL 
Sbjct  146  RVLALVGASSFTLLLFGSLGAHLGGSSIWRASLRVLFGGWLAMAATYGFLKLF  198



>ref|XP_009401793.1| PREDICTED: vacuolar iron transporter homolog 2-like [Musa acuminata 
subsp. malaccensis]
Length=190

 Score =   122 bits (305),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 92/173 (53%), Positives = 122/173 (71%), Gaps = 4/173 (2%)
 Frame = +2

Query  2    GANDGLVSIASLMMGVGTVKQDIKAMILTGFAGMVAGACSMAIGEFVSVYSQRDIEVAQM  181
            G+NDGLVSIASLM+GVG V Q  KAM+++G AG+VAGACSMAIGEFVSV++Q DIEVA+M
Sbjct  13   GSNDGLVSIASLMIGVGAVNQSAKAMLVSGLAGLVAGACSMAIGEFVSVHAQYDIEVAEM  72

Query  182  KRKKNRRNGedageeeeeesdvdeLPNPMQAAAASVVAFTMGAMVPLLAASFIKPYKVRI  361
            +R++           EE     + LP+PM AA AS +AF +GA++PLLA  FI+ + VR+
Sbjct  73   ERRRR----GSGSGSEEGVRGEESLPSPMLAAGASALAFALGAVLPLLAGGFIRSWSVRV  128

Query  362  GaviaavtvalvvcgwlgaalggapkgkaSVRVLIGGWLAMAITSGLTKLIGI  520
            GAV A  ++ L   G  GA LGGA   K ++RVL GGWLAM +T  + ++ G+
Sbjct  129  GAVCAVSSLGLAGFGAAGAVLGGADIWKPALRVLGGGWLAMLVTYCVLRIFGL  181



>ref|XP_007225009.1| hypothetical protein PRUPE_ppa020259mg, partial [Prunus persica]
 gb|EMJ26208.1| hypothetical protein PRUPE_ppa020259mg, partial [Prunus persica]
Length=130

 Score =   120 bits (300),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 64/115 (56%), Positives = 84/115 (73%), Gaps = 5/115 (4%)
 Frame = +2

Query  8    NDGLVSIASLMMGVGTVKQDIKAMILTGFAGMVAGACSMAIGEFVSVYSQRDIEVAQMKR  187
            NDGLV IAS+MMGVG VK+DIKA++L GFA +VAGACS+A+GEFV+VY+Q D E AQ+KR
Sbjct  2    NDGLVPIASVMMGVGAVKRDIKAILLAGFAELVAGACSVAMGEFVAVYTQLDSETAQIKR  61

Query  188  KKNRRNGedageeeeeesdvdeLPNPMQAAAASVVAFTMGAMVPLLAASFIKPYK  352
            + N         E+E     ++LP+P QA+ AS  +F +  +VPLLAA+FI  YK
Sbjct  62   ENNN-----IINEKEIAKAKEKLPSPFQASVASAFSFLVDGLVPLLAAAFITNYK  111



>ref|XP_010690358.1| PREDICTED: vacuolar iron transporter homolog 2-like [Beta vulgaris 
subsp. vulgaris]
Length=219

 Score =   122 bits (307),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 93/173 (54%), Positives = 122/173 (71%), Gaps = 4/173 (2%)
 Frame = +2

Query  2    GANDGLVSIASLMMGVGTVKQDIKAMILTGFAGMVAGACSMAIGEFVSVYSQRDIEVAQM  181
            GANDGL+S+ASLM+GVG V+ D   M LTG AG+  GACSMA+GE VSV++QRD E+AQ+
Sbjct  48   GANDGLLSVASLMIGVGAVRPDPGTMALTGLAGLFGGACSMALGELVSVWAQRDAELAQL  107

Query  182  KRKKNRRNGedageeeeeesdvdeLPNPMQAAAASVVAFTMGAMVPLLAASFIKPYKVRI  361
             R    ++G     E+++ +        + AAAAS  AF  G  VPLLAA FIKPY+ R+
Sbjct  108  LRDHEAQHGPPGILEDQKRALPSP----LSAAAASAAAFAAGGGVPLLAAVFIKPYRARL  163

Query  362  GaviaavtvalvvcgwlgaalggapkgkaSVRVLIGGWLAMAITSGLTKLIGI  520
              V+A V++AL   GWLGA LG AP  ++S+RVLIGGW+AM +T GLTKL+G+
Sbjct  164  AMVLATVSLALFAFGWLGAFLGKAPVLRSSLRVLIGGWVAMGVTFGLTKLVGL  216



>ref|XP_002971905.1| hypothetical protein SELMODRAFT_37133, partial [Selaginella moellendorffii]
 gb|EFJ26822.1| hypothetical protein SELMODRAFT_37133, partial [Selaginella moellendorffii]
Length=187

 Score =   121 bits (303),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 87/170 (51%), Positives = 115/170 (68%), Gaps = 1/170 (1%)
 Frame = +2

Query  2    GANDGLVSIASLMMGVGTVKQDIKAMILTGFAGMVAGACSMAIGEFVSVYSQRDIEVAQM  181
            GANDGLVSIASL++GV     + +++IL+G AG++AGACSMA+GEFVSV SQRD EVA++
Sbjct  19   GANDGLVSIASLLLGVSAGNSNERSIILSGIAGLIAGACSMAVGEFVSVSSQRDTEVAEI  78

Query  182  KRKKNRRNGedageeeeeesdvdeLPNPMQAAAASVVAFTMGAMVPLLAASFIKPYKVRI  361
            +R++ R++       EE   DVD L  P QAAA S  AFT G  VPLLAA F++ Y+ R+
Sbjct  79   ERER-RQHAAGVHAREELGIDVDALARPWQAAAVSAAAFTTGGAVPLLAAGFVEAYRWRL  137

Query  362  GaviaavtvalvvcgwlgaalggapkgkaSVRVLIGGWLAMAITSGLTKL  511
             A+  + ++ L   G  GA LG AP   AS RV +GGW+AM  T G+  L
Sbjct  138  AAIGLSTSMGLAAFGACGARLGKAPILAASTRVTVGGWIAMLATFGILYL  187



>ref|XP_004976380.1| PREDICTED: vacuolar iron transporter homolog 2-like [Setaria 
italica]
Length=241

 Score =   122 bits (305),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 90/177 (51%), Positives = 118/177 (67%), Gaps = 20/177 (11%)
 Frame = +2

Query  2    GANDGLVSIASLMMGVGTVKQDIKAMILTGFAGMVAGACSMAIGEFVSVYSQRDIEVAQM  181
            GANDGLVS+ASLM+GVG V    KAM+++G AG+VAGACSMAIGEFVSVY+Q DIEV+Q+
Sbjct  70   GANDGLVSVASLMIGVGAVNASRKAMLVSGMAGLVAGACSMAIGEFVSVYAQYDIEVSQL  129

Query  182  KR-----KKNRRNGedageeeeeesdvdeLPNPMQAAAASVVAFTMGAMVPLLAASFIKP  346
            KR      ++ R+G               LP+P QAA AS +AF  GA++PLL+  F+  
Sbjct  130  KRDGTDGDEDARDG---------------LPSPTQAALASALAFAFGAILPLLSGGFVAL  174

Query  347  YKVRIGaviaavtvalvvcgwlgaalggapkgkaSVRVLIGGWLAMAITSGLTKLIG  517
            +  R+ AV AA TV L   G  GA LGG+   K+ +RVL+GGW AM ++ G+ +L G
Sbjct  175  WWARLIAVAAASTVGLAAFGAAGAYLGGSSMVKSGLRVLLGGWFAMLVSFGVLRLFG  231



>gb|KDO83692.1| hypothetical protein CISIN_1g0279832mg, partial [Citrus sinensis]
Length=149

 Score =   119 bits (297),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 57/68 (84%), Positives = 63/68 (93%), Gaps = 0/68 (0%)
 Frame = +2

Query  2    GANDGLVSIASLMMGVGTVKQDIKAMILTGFAGMVAGACSMAIGEFVSVYSQRDIEVAQM  181
            GANDGLVS ASLMMGVG VKQDIKAMILTGFAG+VAGACSMAIGEFVSVYSQ DI+VAQ+
Sbjct  52   GANDGLVSTASLMMGVGAVKQDIKAMILTGFAGLVAGACSMAIGEFVSVYSQLDIQVAQL  111

Query  182  KRKKNRRN  205
            KR +++ N
Sbjct  112  KRNRDQGN  119



>ref|XP_010030825.1| PREDICTED: vacuolar iron transporter homolog 5-like [Eucalyptus 
grandis]
Length=244

 Score =   120 bits (302),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 82/170 (48%), Positives = 111/170 (65%), Gaps = 11/170 (6%)
 Frame = +2

Query  2    GANDGLVSIASLMMGVGTVKQDIKAMILTGFAGMVAGACSMAIGEFVSVYSQRDIEVAQM  181
            GANDGL+S  SLM+GVG  K D ++M+L+G AG +AGA SMA+GEFVSV +QR+IE A +
Sbjct  77   GANDGLLSTTSLMLGVGAAKDDHRSMVLSGIAGALAGAFSMAVGEFVSVATQREIEQANL  136

Query  182  -KRKKNRRNGedageeeeeesdvdeLPNPMQAAAASVVAFTMGAMVPLLAASFIKPYKVR  358
             KR  + R G           + + LPNP +AAAAS  AF  G++ PLL A F+  + +R
Sbjct  137  EKRASHERTG----------GEEEALPNPYKAAAASGSAFLCGSLFPLLPAIFVAQHTLR  186

Query  359  IGaviaavtvalvvcgwlgaalggapkgkaSVRVLIGGWLAMAITSGLTK  508
               V    ++AL + G +GA LGG+P   ++ RVL+GGW+AM IT GL K
Sbjct  187  AVIVAVVASIALALFGGVGAHLGGSPVKVSAARVLVGGWIAMGITYGLLK  236



>ref|XP_002452846.1| hypothetical protein SORBIDRAFT_04g033480 [Sorghum bicolor]
 gb|EES05822.1| hypothetical protein SORBIDRAFT_04g033480 [Sorghum bicolor]
Length=238

 Score =   119 bits (298),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 86/175 (49%), Positives = 123/175 (70%), Gaps = 2/175 (1%)
 Frame = +2

Query  2    GANDGLVSIASLMMGVGTVKQDIKAMILTGFAGMVAGACSMAIGEFVSVYSQRDIEVAQM  181
            GANDGLVS+ASLM+GVG V    + M+++G AG+VAGACSMA+GEFVSVY+Q DI+VA  
Sbjct  55   GANDGLVSVASLMIGVGAVHDGAREMLVSGLAGLVAGACSMAVGEFVSVYAQYDIQVAHS  114

Query  182  KRKKNRRNGedageeeeeesd--vdeLPNPMQAAAASVVAFTMGAMVPLLAASFIKPYKV  355
            +R  +  +   +  E         + LP+P +AAAAS +AF +GA +PLL+ +F++P+ +
Sbjct  115  ERGSSDDDSSSSSSEVGRGGGGDEERLPSPTKAAAASALAFAVGAALPLLSGAFVRPWAI  174

Query  356  RIGaviaavtvalvvcgwlgaalggapkgkaSVRVLIGGWLAMAITSGLTKLIGI  520
            R+ AV AA ++ L   G  GA LGGA   ++ VRVL+GGWLAMA+T G+ +L+ +
Sbjct  175  RVAAVCAASSLGLAGFGAAGAYLGGASIVRSGVRVLLGGWLAMAVTFGILRLLSL  229



>gb|AFK46620.1| unknown [Lotus japonicus]
Length=162

 Score =   116 bits (291),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 61/98 (62%), Positives = 77/98 (79%), Gaps = 6/98 (6%)
 Frame = +2

Query  2    GANDGLVSIASLMMGVGTVKQDIKAMILTGFAGMVAGACSMAIGEFVSVYSQRDIEVAQM  181
            GANDGLVS+ASLMMGVG VK+D  A++L GFAG+VAGACSMAIGEFVSVY+Q DIE+AQ+
Sbjct  46   GANDGLVSVASLMMGVGAVKKDASALLLAGFAGLVAGACSMAIGEFVSVYTQYDIEIAQI  105

Query  182  KRKK--NRRNGedageeeeeesdvdeLPNPMQAAAASV  289
            +R++  N  NG       +EE+  ++LPNP QAA  S+
Sbjct  106  EREREANHNNG----VNLDEEAQREKLPNPFQAACPSI  139



>sp|Q6H658.1|VITH1_ORYSJ RecName: Full=Vacuolar iron transporter homolog 1; AltName: Full=Protein 
NODULIN-LIKE 1 [Oryza sativa Japonica Group]
 dbj|BAD25791.1| nodulin-21-like [Oryza sativa Japonica Group]
 gb|EAY86871.1| hypothetical protein OsI_08255 [Oryza sativa Indica Group]
Length=232

 Score =   118 bits (295),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 86/174 (49%), Positives = 120/174 (69%), Gaps = 7/174 (4%)
 Frame = +2

Query  2    GANDGLVSIASLMMGVGTVKQDIKAMILTGFAGMVAGACSMAIGEFVSVYSQRDIEVAQM  181
            GANDGLVS+ASLM+GVG      +AM+++G AG+VAGACSMAIGEFVSVY+Q DI+ AQ+
Sbjct  64   GANDGLVSVASLMVGVGAANGTRRAMLVSGLAGLVAGACSMAIGEFVSVYAQCDIQAAQI  123

Query  182  KRKKNRRNGedageeeeeesdvdeLPNPMQAAAASVVAFTMGAMVPLLAASFIKPYKVRI  361
            +R +  ++        +   + +ELP+P  AA AS ++F  GA +PLLA  F++P+  R+
Sbjct  124  ERARGGKD-------ADGGEEEEELPSPTMAAVASALSFAAGAALPLLAGGFVRPWAARV  176

Query  362  GaviaavtvalvvcgwlgaalggapkgkaSVRVLIGGWLAMAITSGLTKLIGIK  523
             AV AA ++ L   G   A LGGA   ++ VR+L+GGWLAMA+T G+ KL G+ 
Sbjct  177  AAVCAASSLGLAGFGVASAYLGGAGVARSGVRMLVGGWLAMAVTYGVLKLFGMH  230



>ref|NP_001169225.1| uncharacterized protein LOC100383083 [Zea mays]
 gb|ACN32022.1| unknown [Zea mays]
 tpg|DAA36665.1| TPA: hypothetical protein ZEAMMB73_707986 [Zea mays]
Length=245

 Score =   118 bits (296),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 89/172 (52%), Positives = 115/172 (67%), Gaps = 13/172 (8%)
 Frame = +2

Query  2    GANDGLVSIASLMMGVGTVKQDIKAMILTGFAGMVAGACSMAIGEFVSVYSQRDIEVAQM  181
            GANDGLVS+ASLM+G+G V    KAM+++G AG+VAGACSMAIGEFVSVY+Q DIEV+Q+
Sbjct  77   GANDGLVSVASLMIGIGAVNATRKAMLVSGMAGLVAGACSMAIGEFVSVYAQYDIEVSQI  136

Query  182  KRKKNRRNGedageeeeeesdvdeLPNPMQAAAASVVAFTMGAMVPLLAASFIKPYKVRI  361
            KR                 +  D LP+P QAA AS +AF  GA++PLLA  F+  +  R+
Sbjct  137  KRDGEE-------------AARDSLPSPTQAAIASALAFAFGALLPLLAGVFVPSWAARV  183

Query  362  GaviaavtvalvvcgwlgaalggapkgkaSVRVLIGGWLAMAITSGLTKLIG  517
             AV AA +V L   G  GA LGGA   ++ +RVL+GGW AM +T G+ +L G
Sbjct  184  AAVCAATSVGLAGFGVAGAYLGGANMLRSGLRVLLGGWFAMLVTFGVLRLFG  235



>ref|XP_002990153.1| hypothetical protein SELMODRAFT_48764, partial [Selaginella moellendorffii]
 ref|XP_002992536.1| hypothetical protein SELMODRAFT_48765, partial [Selaginella moellendorffii]
 gb|EFJ06474.1| hypothetical protein SELMODRAFT_48765, partial [Selaginella moellendorffii]
 gb|EFJ08713.1| hypothetical protein SELMODRAFT_48764, partial [Selaginella moellendorffii]
Length=174

 Score =   116 bits (290),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 84/167 (50%), Positives = 110/167 (66%), Gaps = 13/167 (8%)
 Frame = +2

Query  2    GANDGLVSIASLMMGVGTVKQDIKAMILTGFAGMVAGACSMAIGEFVSVYSQRDIEVAQM  181
            GANDGL+S+AS+M+GV  VK D+KA +L+G AG++AGACSMAIGEFVS+ S  D  +   
Sbjct  14   GANDGLISVASIMVGVSAVKYDVKASLLSGIAGLIAGACSMAIGEFVSLSSHADGALKAH  73

Query  182  KRKKNRRNGedageeeeeesdvdeLPNPMQAAAASVVAFTMGAMVPLLAASFIKPYKVRI  361
             R +                D+D L NPMQAA AS +AF++G  VPLLA +F+  YK R+
Sbjct  74   ARDE-------------LGIDLDGLSNPMQAATASALAFSVGGAVPLLAGAFVGTYKYRL  120

Query  362  GaviaavtvalvvcgwlgaalggapkgkaSVRVLIGGWLAMAITSGL  502
             A++ + T AL   G LGA LGGA  GKA++RV +GGW AM +T G 
Sbjct  121  TALLVSSTAALAAFGALGARLGGAAMGKAALRVTLGGWAAMLVTYGF  167



>gb|EAZ05618.1| hypothetical protein OsI_27836 [Oryza sativa Indica Group]
Length=249

 Score =   118 bits (295),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 94/171 (55%), Positives = 126/171 (74%), Gaps = 2/171 (1%)
 Frame = +2

Query  2    GANDGLVSIASLMMGVGTVKQDIKAMILTGFAGMVAGACSMAIGEFVSVYSQRDIEVAQM  181
            GANDGLVS+ASLM+GVG V +  +AM+++G AG+VAGACSMAIGEFVSVY+Q DIEVA  
Sbjct  77   GANDGLVSVASLMIGVGAVSESGRAMLVSGVAGLVAGACSMAIGEFVSVYAQYDIEVAVA  136

Query  182  KRKKNRRNGedageeeeeesdvdeLPNPMQAAAASVVAFTMGAMVPLLAASFIKPYKVRI  361
            +R++ +R     G+ + EE     LP+P +AAAAS +AFT+GA++PLLA  F++P+  R+
Sbjct  137  RRRRRQRR--RRGDGDGEEEGSGRLPSPFKAAAASALAFTVGALLPLLAGGFVRPWAPRV  194

Query  362  GaviaavtvalvvcgwlgaalggapkgkaSVRVLIGGWLAMAITSGLTKLI  514
             AV AA + AL   G LGAALGGA   +++ RVL+GGW AMA   G+ +L 
Sbjct  195  AAVCAATSAALAGFGALGAALGGASPARSAARVLLGGWAAMAACYGVLRLF  245



>ref|XP_002448241.1| hypothetical protein SORBIDRAFT_06g023860 [Sorghum bicolor]
 gb|EES12569.1| hypothetical protein SORBIDRAFT_06g023860 [Sorghum bicolor]
Length=254

 Score =   118 bits (295),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 94/172 (55%), Positives = 118/172 (69%), Gaps = 8/172 (5%)
 Frame = +2

Query  2    GANDGLVSIASLMMGVGTVKQDIKAMILTGFAGMVAGACSMAIGEFVSVYSQRDIEVAQM  181
            GANDGLVS+ASLM+GVG V    KAM+++G AG+VAGACSMAIGEFVSVY+Q DIEV+Q+
Sbjct  81   GANDGLVSVASLMIGVGAVSATRKAMLVSGLAGLVAGACSMAIGEFVSVYAQYDIEVSQI  140

Query  182  KRKKNRRNGedageeeeeesdvdeLPNPMQAAAASVVAFTMGAMVPLLAASFIKPYKVRI  361
            KR     +        EEE   D LP+P QAA AS +AF  GA++PLLA  FI  +  R+
Sbjct  141  KRDGGGED--------EEEGARDSLPSPTQAAVASALAFAFGALLPLLAGVFIPSWAARV  192

Query  362  GaviaavtvalvvcgwlgaalggapkgkaSVRVLIGGWLAMAITSGLTKLIG  517
             AV AA +V L   G  GA LGGA   ++ +RVL+GGW AM +T G+ +L G
Sbjct  193  AAVCAATSVGLAGFGVAGAYLGGASMLRSGLRVLLGGWFAMLVTFGVLRLFG  244



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1321621760038