BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c80584_g1_i1 len=795 path=[773:0-794]

Length=795
                                                                      Score     E

gb|EYU28504.1|  hypothetical protein MIMGU_mgv1a016168mg                135   1e-35   
gb|EYU24293.1|  hypothetical protein MIMGU_mgv1a016063mg                133   7e-35   
ref|XP_011084146.1|  PREDICTED: cysteine proteinase inhibitor B         132   1e-34   
ref|XP_009589279.1|  PREDICTED: cysteine proteinase inhibitor B-like    132   2e-34   
gb|AEQ54766.1|  cysteine proteinase inhibitor CPI-1                     125   1e-31   
ref|XP_009762060.1|  PREDICTED: cysteine proteinase inhibitor B-like    124   2e-31   
ref|XP_006358790.1|  PREDICTED: cysteine proteinase inhibitor B-like    122   2e-30   
ref|XP_009763807.1|  PREDICTED: cysteine proteinase inhibitor B-like    120   5e-30   
ref|XP_009588279.1|  PREDICTED: cysteine proteinase inhibitor B-like    119   1e-29   
ref|XP_010326957.1|  PREDICTED: cysteine proteinase inhibitor B         116   2e-28   
ref|XP_010101112.1|  Cysteine proteinase inhibitor 10                   116   2e-28   
ref|XP_002516375.1|  Cysteine proteinase inhibitor B, putative          113   3e-27   Ricinus communis
ref|XP_008465470.1|  PREDICTED: cysteine proteinase inhibitor B         112   5e-27   
ref|XP_010243158.1|  PREDICTED: cysteine proteinase inhibitor 4-like    112   6e-27   
ref|XP_002265736.1|  PREDICTED: cysteine proteinase inhibitor 4         112   7e-27   Vitis vinifera
ref|XP_003538534.1|  PREDICTED: cysteine proteinase inhibitor 4         111   1e-26   
ref|XP_007034159.1|  Cystatin                                           111   1e-26   
ref|XP_004160226.1|  PREDICTED: cysteine proteinase inhibitor B-like    111   1e-26   
ref|XP_004138536.1|  PREDICTED: cysteine proteinase inhibitor B-like    111   1e-26   
gb|ACU17144.1|  unknown                                                 110   3e-26   Glycine max [soybeans]
gb|KHN44464.1|  Cysteine proteinase inhibitor 2                         111   3e-26   
ref|XP_002456830.1|  hypothetical protein SORBIDRAFT_03g043680          110   8e-26   Sorghum bicolor [broomcorn]
sp|Q10993.1|CYTB_HELAN  RecName: Full=Cysteine proteinase inhibit...    108   9e-26   Helianthus annuus
ref|XP_011024794.1|  PREDICTED: cysteine proteinase inhibitor B-like    109   9e-26   
ref|XP_007223412.1|  hypothetical protein PRUPE_ppa013391mg             108   2e-25   
gb|AHV85520.1|  cysteine proteinase inhibitor TrcC-6                    108   2e-25   
pir||JE0308  cysteine proteinase inhibitor - common sunflower           107   5e-25
ref|XP_004297057.1|  PREDICTED: cysteine proteinase inhibitor B-like    107   6e-25   
ref|XP_008365221.1|  PREDICTED: cysteine proteinase inhibitor B-like    106   8e-25   
ref|XP_006349967.1|  PREDICTED: cysteine proteinase inhibitor B-like    106   1e-24   
gb|KEH20629.1|  cysteine protease inhibitor cystatin                    105   2e-24   
ref|XP_010314744.1|  PREDICTED: cysteine proteinase inhibitor B-like    105   2e-24   
ref|XP_002320446.1|  cystatin family protein                            105   2e-24   Populus trichocarpa [western balsam poplar]
emb|CAG38126.1|  cystatin Hv-CPI5                                       105   3e-24   Hordeum vulgare [barley]
ref|XP_010673372.1|  PREDICTED: cysteine proteinase inhibitor B         105   4e-24   
ref|XP_003524913.1|  PREDICTED: cysteine proteinase inhibitor 4-l...    104   4e-24   
ref|XP_006492987.1|  PREDICTED: cysteine proteinase inhibitor 2-like    104   6e-24   
ref|XP_009373605.1|  PREDICTED: cysteine proteinase inhibitor B-like    103   7e-24   
gb|KDP32576.1|  hypothetical protein JCGZ_13126                         105   8e-24   
ref|XP_009378164.1|  PREDICTED: cysteine proteinase inhibitor B-like    103   8e-24   
ref|XP_010926673.1|  PREDICTED: cysteine proteinase inhibitor 5         103   1e-23   
ref|XP_009371093.1|  PREDICTED: cysteine proteinase inhibitor B         103   1e-23   
ref|XP_009402733.1|  PREDICTED: cysteine proteinase inhibitor 4-like    103   1e-23   
ref|XP_004971036.1|  PREDICTED: cysteine proteinase inhibitor 4-like    103   2e-23   
ref|XP_008792948.1|  PREDICTED: cysteine proteinase inhibitor 4         102   2e-23   
ref|XP_004504436.1|  PREDICTED: cysteine proteinase inhibitor 4-like    102   2e-23   
ref|XP_006421050.1|  hypothetical protein CICLE_v10006584mg             102   3e-23   
ref|XP_010522274.1|  PREDICTED: cysteine proteinase inhibitor 2-like    102   4e-23   
ref|XP_008337489.1|  PREDICTED: cysteine proteinase inhibitor B         101   5e-23   
ref|XP_007163791.1|  hypothetical protein PHAVU_001G264400g             100   1e-22   
ref|XP_003552894.1|  PREDICTED: cysteine proteinase inhibitor 4-like    100   2e-22   
gb|KHN24041.1|  Cysteine proteinase inhibitor 2                         100   2e-22   
ref|XP_010557035.1|  PREDICTED: cysteine proteinase inhibitor 2-like    100   2e-22   
ref|XP_010542782.1|  PREDICTED: cysteine proteinase inhibitor 2-like  99.8    3e-22   
gb|AFK48234.1|  unknown                                               99.4    5e-22   
emb|CAJ20032.1|  putative cystatin                                    98.2    7e-22   Zea mays [maize]
ref|XP_008799565.1|  PREDICTED: cysteine proteinase inhibitor 10-...    100   9e-22   
ref|XP_006646602.1|  PREDICTED: cysteine proteinase inhibitor 4-like  98.6    1e-21   
ref|XP_004502264.1|  PREDICTED: cysteine proteinase inhibitor 2-like  97.8    1e-21   
ref|XP_003564913.1|  PREDICTED: cysteine proteinase inhibitor 4-like  98.6    1e-21   
ref|XP_002301749.1|  cystatin family protein                          97.8    2e-21   Populus trichocarpa [western balsam poplar]
gb|ABS52572.1|  cysteine proteinase inhibitor                         97.4    2e-21   Gossypium hirsutum [American cotton]
emb|CDM85644.1|  unnamed protein product                              97.8    2e-21   
gb|EMT28873.1|  Cysteine proteinase inhibitor 4                       97.8    3e-21   
ref|XP_010243160.1|  PREDICTED: cysteine proteinase inhibitor 2-like  97.1    4e-21   
ref|NP_180758.1|  cysteine proteinase inhibitor 2                     95.9    1e-20   Arabidopsis thaliana [mouse-ear cress]
gb|AAM64985.1|  putative cysteine proteinase inhibitor B (cystati...  95.9    1e-20   Arabidopsis thaliana [mouse-ear cress]
gb|ACK87021.1|  cysteine protease inhibitor                           94.7    2e-20   Gossypium hirsutum [American cotton]
ref|NP_001045185.1|  Os01g0915200                                     95.9    2e-20   Oryza sativa Japonica Group [Japonica rice]
gb|EAY76949.1|  hypothetical protein OsI_04907                        95.9    2e-20   Oryza sativa Indica Group [Indian rice]
ref|XP_006645220.1|  PREDICTED: cysteine proteinase inhibitor 5-like  95.1    2e-20   
ref|XP_002862941.1|  hypothetical protein ARALYDRAFT_497243           94.7    3e-20   
emb|CDY68279.1|  BnaC04g54180D                                        94.4    4e-20   
ref|XP_007153801.1|  hypothetical protein PHAVU_003G065700g           93.6    5e-20   
ref|XP_010469645.1|  PREDICTED: cysteine proteinase inhibitor 2-like  94.0    5e-20   
ref|XP_009132828.1|  PREDICTED: cysteine proteinase inhibitor 2-like  93.6    5e-20   
ref|XP_006296241.1|  hypothetical protein CARUB_v10025408mg           93.6    7e-20   
ref|XP_010510121.1|  PREDICTED: cysteine proteinase inhibitor 2-like  93.6    7e-20   
ref|NP_001146946.1|  cysteine proteinase inhibitor B precursor        93.6    7e-20   Zea mays [maize]
ref|XP_009387215.1|  PREDICTED: cysteine proteinase inhibitor 4-like  93.2    9e-20   
emb|CAN70300.1|  hypothetical protein VITISV_001398                   94.7    9e-20   Vitis vinifera
gb|AFW84200.1|  putative cystatin                                     93.2    1e-19   
ref|XP_010414055.1|  PREDICTED: cysteine proteinase inhibitor 2-like  92.8    1e-19   
gb|ACD85810.1|  cystcine proteinase inhibitor                         92.0    1e-19   Gossypium hirsutum [American cotton]
ref|XP_006410333.1|  hypothetical protein EUTSA_v10017392mg           92.4    1e-19   
emb|CDY42085.1|  BnaA05g11010D                                        92.4    2e-19   
gb|EMT28874.1|  Cysteine proteinase inhibitor 4                       92.4    2e-19   
ref|XP_009144029.1|  PREDICTED: cysteine proteinase inhibitor 2-like  92.0    2e-19   
ref|NP_001052530.1|  Os04g0350100                                     92.4    2e-19   Oryza sativa Japonica Group [Japonica rice]
gb|KFK31166.1|  hypothetical protein AALP_AA6G077400                  92.0    2e-19   
tpe|CAG29029.1|  TPA: putative cystatin                               92.0    3e-19   
gb|AES71980.2|  phloem filament protein PP1                           90.9    5e-19   
ref|XP_003601729.1|  Cysteine proteinase inhibitor                    90.9    5e-19   
ref|XP_010039949.1|  PREDICTED: cysteine proteinase inhibitor B       90.9    6e-19   
gb|EAY93675.1|  hypothetical protein OsI_15462                        90.9    7e-19   Oryza sativa Indica Group [Indian rice]
ref|XP_006840905.1|  hypothetical protein AMTR_s00087p00085650        90.1    8e-19   
emb|CDX79450.1|  BnaC03g17860D                                        96.3    9e-19   
emb|CDX84749.1|  BnaA03g14810D                                        96.3    9e-19   
dbj|BAA20464.1|  extracellular insoluble cystatin                     89.7    1e-18   Daucus carota [carrots]
ref|XP_006840903.1|  hypothetical protein AMTR_s00087p00084520        89.0    2e-18   
ref|XP_010244063.1|  PREDICTED: cysteine proteinase inhibitor B-like  89.4    2e-18   
emb|CDY62192.1|  BnaCnng39540D                                        89.4    2e-18   
ref|XP_009141203.1|  PREDICTED: cysteine proteinase inhibitor 2-like  88.2    5e-18   
ref|XP_007153806.1|  hypothetical protein PHAVU_003G066200g           86.3    6e-17   
emb|CAG38125.1|  cystatin Hv-CPI9                                     85.1    6e-17   Hordeum vulgare [barley]
ref|NP_001172709.1|  Os01g0915401                                     85.5    6e-17   
gb|ADV02771.1|  cysteine protease inhibitor                           84.7    8e-17   
ref|XP_010522275.1|  PREDICTED: cysteine proteinase inhibitor 2-like  84.7    8e-17   
gb|KDO52834.1|  hypothetical protein CISIN_1g035532mg                 77.8    1e-14   
ref|XP_003532730.1|  PREDICTED: cysteine proteinase inhibitor 4-like  76.6    2e-14   
ref|XP_004975327.1|  PREDICTED: cysteine proteinase inhibitor 10-...  76.6    6e-14   
gb|EMT18217.1|  Cysteine proteinase inhibitor 10                      76.6    7e-14   
ref|XP_007153809.1|  hypothetical protein PHAVU_003G066500g           75.9    8e-14   
ref|XP_007153810.1|  hypothetical protein PHAVU_003G066600g           74.3    3e-13   
ref|XP_010906414.1|  PREDICTED: cysteine proteinase inhibitor 12-...  75.1    5e-13   
ref|XP_007153804.1|  hypothetical protein PHAVU_003G066000g           72.8    6e-13   
ref|XP_008786873.1|  PREDICTED: cysteine proteinase inhibitor 12-...  74.3    1e-12   
gb|ABK21379.1|  unknown                                               72.0    2e-12   Picea sitchensis
ref|XP_003579572.1|  PREDICTED: cysteine proteinase inhibitor 10-...  71.6    3e-12   
ref|XP_010931548.1|  PREDICTED: cysteine proteinase inhibitor 12-...  70.1    3e-11   
ref|XP_008788566.1|  PREDICTED: cysteine proteinase inhibitor A-like  68.2    3e-11   
gb|AAM88397.1|AF525880_1  cysteine proteinase inhibitor               70.1    3e-11   Colocasia esculenta [cocoyam]
pdb|3IMA|B  Chain B, Complex Strcuture Of Tarocystatin And Papain     66.6    8e-11   
ref|XP_009394387.1|  PREDICTED: cysteine proteinase inhibitor 1 {...  68.6    1e-10   
gb|AAS21216.1|  cysteine proteinase inhibitor                         66.6    1e-10   Aegiceras corniculatum
ref|XP_004308672.1|  PREDICTED: cysteine proteinase inhibitor 6-like  67.8    1e-10   
gb|ABK23108.1|  unknown                                               66.6    2e-10   Picea sitchensis
pdb|4N6T|A  Chain A, Adhiron: A Stable And Versatile Peptide Disp...  65.5    2e-10   
ref|NP_001106013.1|  cystatin2 precursor                              66.6    2e-10   Zea mays [maize]
gb|AAY57859.1|  cysteine proteinase inhibitor                         66.2    2e-10   Zea mays subsp. parviglumis [Balsas teosinte]
ref|XP_009385315.1|  PREDICTED: cysteine proteinase inhibitor 6-like  65.5    3e-10   
dbj|BAA95416.1|  multicystatin                                        68.6    3e-10   Helianthus annuus
ref|XP_010096012.1|  Cysteine proteinase inhibitor 12                 67.8    4e-10   
ref|XP_009394087.1|  PREDICTED: cysteine proteinase inhibitor-like    65.9    5e-10   
dbj|BAB21558.1|  cystatin                                             65.5    5e-10   Coix lacryma-jobi
ref|XP_010256520.1|  PREDICTED: cysteine proteinase inhibitor 1-like  64.7    7e-10   
ref|XP_010245150.1|  PREDICTED: cysteine proteinase inhibitor 12-...  65.9    9e-10   
ref|NP_001105295.1|  cystatin-1 precursor                             64.7    1e-09   Zea mays [maize]
gb|AAA96316.1|  cysteine proteinase inhibitor                         65.9    1e-09   Brassica rapa
ref|XP_010910533.1|  PREDICTED: cysteine proteinase inhibitor 1-like  63.9    1e-09   
dbj|BAA09666.1|  cysteine proteinase inhibitor                        64.3    1e-09   Zea mays [maize]
emb|CAA60610.1|  cysteine proteinase inhibitor                        64.3    2e-09   Zea mays [maize]
gb|AAB71505.1|  cysteine protease inhibitor                           63.2    2e-09   Pyrus communis
gb|AJD79052.1|  CPI-1                                                 65.9    2e-09   
gb|ABK22677.1|  unknown                                               63.9    2e-09   Picea sitchensis
ref|XP_010670580.1|  PREDICTED: cysteine proteinase inhibitor 6       65.9    2e-09   
ref|XP_009120653.1|  PREDICTED: cysteine proteinase inhibitor 6-like  65.5    2e-09   
emb|CAJ20023.1|  putative cystatin                                    63.9    2e-09   Zea mays [maize]
emb|CEJ09683.1|  Cystatin protein                                     63.5    2e-09   
ref|XP_008673426.1|  PREDICTED: cystatin-1 isoform X1                 63.5    2e-09   
gb|AEQ54767.1|  cysteine proteinase inhibitor CPI-2                   63.2    2e-09   
ref|XP_010689648.1|  PREDICTED: cysteine proteinase inhibitor 6-like  64.7    3e-09   
ref|XP_004511090.1|  PREDICTED: cysteine proteinase inhibitor 12-...  65.5    3e-09   
emb|CBI32827.3|  unnamed protein product                              64.7    3e-09   
prf||2203261A  Cys protease inhibitor                                 62.8    3e-09
gb|ABK23250.1|  unknown                                               64.7    3e-09   Picea sitchensis
gb|EPS68642.1|  cysteine proteinase inhibitor                         62.0    3e-09   
ref|XP_004970285.1|  PREDICTED: cystatin-1-like                       63.2    3e-09   
gb|ABR16995.1|  unknown                                               64.7    3e-09   Picea sitchensis
ref|XP_008245515.1|  PREDICTED: cysteine proteinase inhibitor 6-like  62.4    3e-09   
ref|XP_010938907.1|  PREDICTED: cysteine proteinase inhibitor 12-...  64.3    4e-09   
gb|ACN40125.1|  unknown                                               64.7    4e-09   Picea sitchensis
emb|CEJ09687.1|  Cystatin protein                                     63.2    4e-09   
gb|AFW97773.1|  cysteine protease inhibitor                           64.3    4e-09   
gb|AAY57857.1|  cysteine proteinase inhibitor                         63.2    4e-09   Zea mays subsp. parviglumis [Balsas teosinte]
gb|ABK23526.1|  unknown                                               63.2    4e-09   Picea sitchensis
gb|ABG89856.1|  cystatin                                              64.7    4e-09   Amaranthus hypochondriacus [prince's feather]
ref|XP_002283400.1|  PREDICTED: cysteine proteinase inhibitor 12-...  64.7    4e-09   Vitis vinifera
ref|XP_006407331.1|  hypothetical protein EUTSA_v10021442mg           64.7    5e-09   
ref|XP_009384360.1|  PREDICTED: cysteine proteinase inhibitor A-like  62.0    5e-09   
ref|NP_001288858.1|  cysteine proteinase inhibitor 6-like             63.9    5e-09   
emb|CEJ09684.1|  Cystatin protein                                     62.8    5e-09   
gb|AAN65082.1|  cysteine proteinase inhibitor, putative 1             63.9    5e-09   Arabidopsis thaliana [mouse-ear cress]
ref|NP_566425.1|  cysteine proteinase inhibitor 6                     63.9    5e-09   Arabidopsis thaliana [mouse-ear cress]
gb|AAG31653.1|  PRLI-interacting factor M                             63.9    6e-09   Arabidopsis thaliana [mouse-ear cress]
gb|ABK26812.1|  unknown                                               63.9    7e-09   Picea sitchensis
ref|XP_010031030.1|  PREDICTED: cysteine proteinase inhibitor 12      64.3    7e-09   
gb|ABK22339.1|  unknown                                               63.9    7e-09   Picea sitchensis
ref|XP_007220494.1|  hypothetical protein PRUPE_ppa013935mg           61.6    7e-09   
gb|KCW50301.1|  hypothetical protein EUGRSUZ_J00085                   63.9    7e-09   
ref|XP_008375331.1|  PREDICTED: cysteine proteinase inhibitor 6-l...  64.3    7e-09   
ref|XP_008375332.1|  PREDICTED: cysteine proteinase inhibitor 6-l...  64.3    7e-09   
emb|CDY42150.1|  BnaC05g40690D                                        63.5    8e-09   
gb|KCW50299.1|  hypothetical protein EUGRSUZ_J00085                   63.9    8e-09   
ref|XP_006446360.1|  hypothetical protein CICLE_v10017285mg           61.6    8e-09   
gb|AGX28142.1|  cysteine protease inhibitor                           61.6    8e-09   
ref|XP_009361915.1|  PREDICTED: cysteine proteinase inhibitor A-like  61.2    9e-09   
gb|KFK41155.1|  hypothetical protein AALP_AA2G092800                  61.6    9e-09   
ref|NP_850570.2|  cysteine proteinase inhibitor 6                     63.5    1e-08   Arabidopsis thaliana [mouse-ear cress]
gb|AFK41117.1|  unknown                                               60.8    1e-08   
emb|CDY08429.1|  BnaA05g26650D                                        63.2    1e-08   
gb|AHZ92270.1|  cystatin 4                                            63.2    2e-08   
gb|AAC37479.1|  cysteine proteinase inhibitor                         62.4    2e-08   Brassica rapa
emb|CAA60634.1|  cysteine proteinase inhibitor                        61.2    2e-08   Sorghum bicolor [broomcorn]
dbj|BAH47556.1|  cystatin                                             60.8    2e-08   Spinacia oleracea
gb|AAY57867.1|  cysteine proteinase inhibitor                         61.2    2e-08   Zea mays subsp. parviglumis [Balsas teosinte]
ref|XP_002298154.1|  cysteine protease inhibitor family protein       60.5    2e-08   Populus trichocarpa [western balsam poplar]
ref|NP_001242786.1|  uncharacterized protein LOC100810979             62.0    2e-08   
gb|ABQ32295.1|  cysteine protease inhibitor                           61.2    2e-08   Zea mays [maize]
ref|XP_002314231.1|  hypothetical protein POPTR_0009s02740g           60.5    2e-08   Populus trichocarpa [western balsam poplar]
sp|Q10992.1|CYTA_HELAN  RecName: Full=Cysteine proteinase inhibit...  60.1    2e-08   Helianthus annuus
emb|CAD21441.1|  putative cysteine proteinase inhibitor               60.5    2e-08   Rumex obtusifolius
ref|XP_009383251.1|  PREDICTED: cysteine proteinase inhibitor A-like  60.8    2e-08   
gb|AAY57864.1|  cysteine proteinase inhibitor                         60.8    2e-08   Zea mays subsp. parviglumis [Balsas teosinte]
ref|XP_006281295.1|  hypothetical protein CARUB_v10027345mg           60.8    2e-08   
ref|XP_010441439.1|  PREDICTED: cysteine proteinase inhibitor 5-like  60.8    2e-08   
ref|XP_006432368.1|  hypothetical protein CICLE_v10002346mg           62.8    2e-08   
gb|KHN37731.1|  Cysteine proteinase inhibitor 12                      62.8    2e-08   
ref|XP_010094696.1|  Cysteine proteinase inhibitor 5                  60.5    2e-08   
gb|ABW03251.1|  cysteine proteinase inhibitor                         59.7    2e-08   Sonneratia caseolaris
ref|XP_010481310.1|  PREDICTED: cysteine proteinase inhibitor 5-like  60.5    3e-08   
gb|AAF72202.1|AF265551_1  cysteine protease inhibitor                 60.1    3e-08   Manihot esculenta [manioc]
ref|XP_002267841.1|  PREDICTED: cysteine proteinase inhibitor 12      61.6    3e-08   Vitis vinifera
ref|XP_006836222.1|  hypothetical protein AMTR_s00101p00100170        61.6    3e-08   
gb|ADK13078.1|  phytocystatin 5-3                                     60.1    3e-08   
ref|NP_199566.1|  cysteine proteinase inhibitor 5                     60.1    3e-08   Arabidopsis thaliana [mouse-ear cress]
gb|AAM64661.1|  cystatin-like protein                                 60.1    3e-08   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008364741.1|  PREDICTED: cysteine proteinase inhibitor 6-l...  62.4    4e-08   
ref|XP_008364740.1|  PREDICTED: cysteine proteinase inhibitor 6-l...  62.4    4e-08   
ref|XP_006398453.1|  hypothetical protein EUTSA_v10001076mg           60.1    4e-08   
ref|XP_001771745.1|  predicted protein                                60.5    4e-08   
gb|ACN85343.1|  cystatin                                              59.7    4e-08   Camellia sinensis [black tea]
gb|AGX28141.1|  cysteine protease inhibitor                           59.7    5e-08   
ref|XP_006471323.1|  PREDICTED: cysteine proteinase inhibitor 12-...  61.6    5e-08   
gb|ABN42208.1|  proteinase inhibitor                                  61.2    5e-08   Cakile maritima [European sea-rocket]
gb|ACZ02398.1|  latex cystatin                                        59.3    5e-08   
emb|CAN78115.1|  hypothetical protein VITISV_031522                   59.3    5e-08   Vitis vinifera
ref|XP_009759630.1|  PREDICTED: cysteine proteinase inhibitor A-like  59.3    6e-08   
gb|AHA85335.1|  cysteine protease inhibitor                           61.2    6e-08   
ref|NP_001105851.1|  cystatin8 precursor                              59.7    6e-08   Zea mays [maize]
emb|CDP06249.1|  unnamed protein product                              60.1    7e-08   
gb|KGN65048.1|  Cystatin-like protein                                 59.3    7e-08   
gb|ACO39782.1|  cysteine inhibitor 1                                  59.3    7e-08   Populus balsamifera [balsam poplar]
ref|XP_010055538.1|  PREDICTED: cysteine proteinase inhibitor-like    59.7    7e-08   
ref|XP_004170582.1|  PREDICTED: cysteine proteinase inhibitor 5-like  59.3    7e-08   
ref|XP_008354847.1|  PREDICTED: cysteine proteinase inhibitor 12-...  61.6    7e-08   
ref|XP_010055569.1|  PREDICTED: cysteine proteinase inhibitor-like    59.7    7e-08   
emb|CDY33126.1|  BnaC09g22220D                                        59.7    8e-08   
gb|ACO39758.1|  cysteine inhibitor 1                                  59.3    8e-08   Populus balsamifera [balsam poplar]
ref|XP_011080491.1|  PREDICTED: cysteine proteinase inhibitor A-like  58.5    8e-08   
ref|XP_010465015.1|  PREDICTED: cysteine proteinase inhibitor 6       60.8    8e-08   
ref|NP_001237443.1|  uncharacterized protein LOC100499887 precursor   61.2    9e-08   
gb|AGX28139.1|  cysteine protease inhibitor                           58.9    9e-08   
ref|XP_002863337.1|  hypothetical protein ARALYDRAFT_494218           58.9    1e-07   
ref|XP_010486966.1|  PREDICTED: cysteine proteinase inhibitor 6-like  60.8    1e-07   
ref|XP_010499025.1|  PREDICTED: cysteine proteinase inhibitor 6-like  60.8    1e-07   
ref|XP_008346634.1|  PREDICTED: cysteine proteinase inhibitor 6-like  60.8    1e-07   
gb|AHZ92269.1|  cystatin 3                                            60.8    1e-07   
gb|EMT09480.1|  Cysteine proteinase inhibitor 1                       59.3    1e-07   
ref|XP_006470502.1|  PREDICTED: cysteine proteinase inhibitor-like    58.5    1e-07   
gb|KDP40574.1|  hypothetical protein JCGZ_24573                       60.5    1e-07   
ref|XP_007133641.1|  hypothetical protein PHAVU_011G196600g           60.8    1e-07   
gb|AAO19652.1|  cysteine protease inhibitor cystatin                  60.8    1e-07   Malus domestica [apple tree]
gb|ADD51191.1|  cystatin                                              60.8    1e-07   Vitis cinerea var. helleri x Vitis riparia
ref|XP_010031687.1|  PREDICTED: cysteine proteinase inhibitor A-like  58.5    1e-07   
ref|XP_010244435.1|  PREDICTED: cysteine proteinase inhibitor 12-...  60.8    1e-07   
gb|AJD79055.1|  CPI-4                                                 58.5    1e-07   
ref|XP_002268378.1|  PREDICTED: cysteine proteinase inhibitor A       58.5    1e-07   Vitis vinifera
ref|XP_009396391.1|  PREDICTED: cysteine proteinase inhibitor 1 {...  58.5    1e-07   
ref|XP_009361916.1|  PREDICTED: cysteine proteinase inhibitor 6-l...  60.8    1e-07   
gb|ABG81097.1|  cysteine proteinase inhibitor                         58.2    1e-07   
gb|AAD33907.1|AF143677_1  cysteine proteinase inhibitor               58.2    1e-07   Artemisia vulgaris [common wormwood]
ref|XP_009361917.1|  PREDICTED: cysteine proteinase inhibitor 6-l...  60.8    1e-07   
gb|ABK20186.1|  cysteine protease inhibitor                           58.9    1e-07   Populus tomentosa [Chinese white poplar]
ref|XP_010909027.1|  PREDICTED: cysteine proteinase inhibitor 6-like  60.5    1e-07   
ref|XP_010520100.1|  PREDICTED: cysteine proteinase inhibitor 6       59.7    1e-07   
gb|KDO66413.1|  hypothetical protein CISIN_1g034261mg                 58.2    1e-07   
ref|XP_002966258.1|  hypothetical protein SELMODRAFT_85303            59.7    1e-07   
gb|ACO39793.1|  cysteine inhibitor 1                                  58.5    1e-07   Populus balsamifera [balsam poplar]
emb|CDY04170.1|  BnaA09g19480D                                        60.1    1e-07   
gb|AAL79831.1|AF469485_1  cystatin                                    58.2    2e-07   Sandersonia aurantiaca [Chinese-lantern lily]
ref|XP_011042012.1|  PREDICTED: cysteine proteinase inhibitor-like    58.2    2e-07   
gb|ACU24145.1|  unknown                                               60.5    2e-07   Glycine max [soybeans]
emb|CAH57557.1|  cysteine protease inhibitor                          58.5    2e-07   Populus tremula [European aspen]
ref|XP_006298448.1|  hypothetical protein CARUB_v10014520mg           60.1    2e-07   
ref|NP_001237734.1|  cysteine proteinase inhibitor precursor          60.5    2e-07   
gb|KHN11196.1|  Cysteine proteinase inhibitor 12                      60.5    2e-07   
gb|ABB89766.1|  At3g12490-like protein                                60.1    2e-07   Boechera stricta
gb|ACU13141.1|  unknown                                               57.8    2e-07   Glycine max [soybeans]
ref|XP_009114123.1|  PREDICTED: cysteine proteinase inhibitor 5-like  58.2    2e-07   
sp|Q06445.1|CYTI_VIGUN  RecName: Full=Cysteine proteinase inhibit...  57.8    2e-07   
gb|AAA97907.1|  cysteine proteinase inhibitor                         57.8    2e-07   
ref|XP_004228480.1|  PREDICTED: cysteine proteinase inhibitor A       57.8    2e-07   
emb|CAH57551.1|  cysteine protease inhibitor                          58.5    2e-07   
gb|AAY41807.1|  cysteine proteinase inhibitor                         58.5    2e-07   
ref|XP_009609320.1|  PREDICTED: cysteine proteinase inhibitor A-like  57.8    2e-07   
ref|XP_003594241.1|  Cysteine proteinase inhibitor                    58.2    2e-07   
gb|KCW89988.1|  hypothetical protein EUGRSUZ_A02187                   58.9    2e-07   
ref|XP_008455746.1|  PREDICTED: cysteine proteinase inhibitor A       58.2    2e-07   
gb|KFK38602.1|  hypothetical protein AALP_AA3G134900                  59.3    2e-07   
gb|AFK43152.1|  unknown                                               58.2    2e-07   
ref|XP_010494993.1|  PREDICTED: cysteine proteinase inhibitor 5-like  58.2    2e-07   
ref|XP_006644859.1|  PREDICTED: cysteine proteinase inhibitor 1-like  58.5    2e-07   
gb|KHG00945.1|  Cysteinease inhibitor                                 58.2    2e-07   
ref|XP_002465058.1|  hypothetical protein SORBIDRAFT_01g031440        57.8    2e-07   
ref|XP_004967724.1|  PREDICTED: cysteine proteinase inhibitor 12-...  60.1    2e-07   
ref|XP_009114124.1|  PREDICTED: cysteine proteinase inhibitor 5-like  57.8    2e-07   
emb|CAH57534.1|  cysteine protease inhibitor                          58.2    3e-07   
emb|CAH57531.1|  cysteine protease inhibitor                          58.2    3e-07   
ref|XP_002303955.1|  cysteine proteinase inhibitor                    59.7    3e-07   
emb|CAJ20030.1|  putative cystatin                                    57.8    3e-07   
ref|XP_002884906.1|  hypothetical protein ARALYDRAFT_897457           58.9    3e-07   
emb|CAH57573.1|  cysteine protease inhibitor                          58.2    3e-07   
gb|AAF23127.1|AF198389_1  cystatin                                    57.0    3e-07   
emb|CDY66113.1|  BnaCnng49600D                                        57.4    3e-07   
gb|ADB02894.1|  multicystatin/cysteine protease inhibitor             57.4    3e-07   
gb|AFK34375.1|  unknown                                               59.7    3e-07   
ref|XP_003628013.1|  Cysteine proteinase inhibitor                    59.7    3e-07   
gb|AAA97906.1|  cysteine proteinase inhibitor                         57.0    3e-07   
ref|XP_007028256.1|  Cystatin, putative                               58.9    4e-07   
ref|XP_011011604.1|  PREDICTED: cysteine proteinase inhibitor-like    57.0    4e-07   
pdb|2W9P|A  Chain A, Crystal Structure Of Potato Multicystatin        56.6    4e-07   
ref|NP_001049339.1|  Os03g0210200                                     57.0    4e-07   
emb|CDY08430.1|  BnaA05g26660D                                        59.3    4e-07   
gb|ACF49366.1|  cystatin                                              59.3    4e-07   
gb|AAU21498.1|  cysteine proteinase inhibitor                         56.6    4e-07   
ref|XP_010449778.1|  PREDICTED: cysteine proteinase inhibitor 4-like  57.0    4e-07   
emb|CAH57541.1|  cysteine protease inhibitor                          57.4    5e-07   
emb|CAH57549.1|  cysteine protease inhibitor                          57.4    5e-07   
emb|CAH57560.1|  cysteine protease inhibitor                          57.4    5e-07   
emb|CAH57538.1|  cysteine protease inhibitor                          57.4    5e-07   
ref|XP_003561917.1|  PREDICTED: cysteine proteinase inhibitor 8-like  57.0    5e-07   
ref|XP_008245488.1|  PREDICTED: cysteine proteinase inhibitor A-like  57.4    5e-07   
emb|CDM82757.1|  unnamed protein product                              58.9    5e-07   
ref|XP_003545443.2|  PREDICTED: multicystatin isoform 2               59.7    5e-07   
ref|XP_002523225.1|  Cysteine proteinase inhibitor, putative          56.6    5e-07   
ref|XP_002299179.1|  cysteine protease inhibitor family protein       58.2    5e-07   
emb|CAH57571.1|  cysteine protease inhibitor                          57.0    6e-07   
gb|AGF33489.1|  cysteine proteinase inhibitor                         57.0    6e-07   
emb|CAH57539.1|  cysteine protease inhibitor                          57.0    6e-07   
gb|ACH61340.1|  cysteine protease inhibitor                           56.2    6e-07   
emb|CBI17297.3|  unnamed protein product                              57.0    6e-07   
gb|AAA32672.1|  cystatin proteinase inhibitor                         56.2    7e-07   
emb|CAH57545.1|  cysteine protease inhibitor                          57.0    7e-07   
ref|XP_002277752.1|  PREDICTED: cysteine proteinase inhibitor 5-like  56.6    7e-07   
ref|XP_003546187.1|  PREDICTED: cysteine proteinase inhibitor 1       56.6    7e-07   
ref|XP_011020467.1|  PREDICTED: cysteine proteinase inhibitor 6-like  58.5    7e-07   
gb|KHN32962.1|  Cysteine proteinase inhibitor 1                       56.6    7e-07   
ref|XP_002978314.1|  hypothetical protein SELMODRAFT_418098           57.8    7e-07   
emb|CAA11899.1|  cystatin                                             56.2    7e-07   
ref|XP_006295814.1|  hypothetical protein CARUB_v10024940mg           56.2    9e-07   
ref|XP_007220532.1|  hypothetical protein PRUPE_ppa010412mg           58.5    9e-07   
emb|CAH57547.1|  cysteine protease inhibitor                          56.6    9e-07   
ref|XP_010557894.1|  PREDICTED: cysteine proteinase inhibitor 6-like  58.2    9e-07   
gb|KEH28914.1|  phloem filament protein PP1                           56.2    9e-07   
ref|XP_009101410.1|  PREDICTED: cysteine proteinase inhibitor 5       56.2    9e-07   
emb|CAG38130.1|  cystatin Hv-CPI4                                     58.2    9e-07   
dbj|BAK03203.1|  predicted protein                                    58.2    1e-06   
emb|CAH57562.1|  cysteine protease inhibitor                          56.6    1e-06   
ref|XP_002879896.1|  FL3-27                                           56.2    1e-06   
dbj|BAD81175.1|  putative cysteine proteinase inhibitor               57.4    1e-06   
emb|CAH57554.1|  cysteine protease inhibitor                          56.2    1e-06   
emb|CAH57550.1|  cysteine protease inhibitor                          56.2    1e-06   
ref|XP_011090213.1|  PREDICTED: cysteine proteinase inhibitor A-like  55.5    1e-06   
emb|CAH57546.1|  cysteine protease inhibitor                          56.2    1e-06   
emb|CAA89697.1|  cysteine proteinase inhibitor                        57.4    1e-06   
ref|XP_006380966.1|  hypothetical protein POPTR_0006s03170g           57.4    1e-06   
ref|XP_006411355.1|  hypothetical protein EUTSA_v10017418mg           55.8    1e-06   
emb|CDY14750.1|  BnaC04g47470D                                        55.8    1e-06   
ref|XP_008375329.1|  PREDICTED: cysteine proteinase inhibitor A-like  55.5    1e-06   
emb|CAG38132.1|  cystatin Hv-CPI11                                    55.8    1e-06   
pdb|4LZI|A  Chain A, Characterization Of Solanum Tuberosum Multic...  58.2    1e-06   
dbj|BAB18769.1|  cysteine proteinase inhibitor                        55.1    1e-06   
ref|XP_010434812.1|  PREDICTED: cysteine proteinase inhibitor 4-like  55.5    2e-06   
ref|XP_003635016.1|  PREDICTED: cysteine proteinase inhibitor 1-like  55.5    2e-06   
ref|XP_010673809.1|  PREDICTED: cysteine proteinase inhibitor A-like  55.5    2e-06   
ref|XP_010440147.1|  PREDICTED: cysteine proteinase inhibitor 4-like  55.5    2e-06   
ref|XP_004980293.1|  PREDICTED: cysteine proteinase inhibitor 8-like  56.2    2e-06   
ref|XP_004978939.1|  PREDICTED: cysteine proteinase inhibitor 8-like  56.2    2e-06   
ref|XP_011040719.1|  PREDICTED: cysteine proteinase inhibitor A-l...  55.5    2e-06   
ref|XP_002525552.1|  cysteine protease inhibitor, putative            57.4    2e-06   
gb|ABK94227.1|  unknown                                               55.8    2e-06   
gb|ABK20185.1|  cysteine protease inhibitor                           55.8    2e-06   
ref|XP_006644042.1|  PREDICTED: cysteine proteinase inhibitor 12-...  57.4    2e-06   
gb|ADD69946.1|  cysteine protease inhibitor                           55.1    2e-06   
emb|CAN82794.1|  hypothetical protein VITISV_013491                   55.5    2e-06   
ref|XP_006414340.1|  hypothetical protein EUTSA_v10026611mg           55.1    2e-06   
ref|XP_002457629.1|  hypothetical protein SORBIDRAFT_03g010730        57.4    2e-06   
emb|CDY14748.1|  BnaC04g47450D                                        54.7    2e-06   
gb|ACG33316.1|  multidomain cystatin                                  57.4    2e-06   
emb|CAH57567.1|  cysteine protease inhibitor                          55.8    2e-06   
ref|NP_193383.1|  cysteine proteinase inhibitor 4                     55.1    2e-06   
emb|CBI33099.3|  unnamed protein product                              55.8    2e-06   
emb|CAJ20026.1|  putative cystatin                                    57.0    2e-06   
ref|XP_002881241.1|  hypothetical protein ARALYDRAFT_902339           55.1    2e-06   
gb|KHG15686.1|  hypothetical protein F383_23695                       57.4    2e-06   
emb|CAH57564.1|  cysteine protease inhibitor                          55.5    2e-06   
ref|NP_001042702.1|  Os01g0270100                                     57.4    2e-06   
emb|CBX19819.1|  cystein proteinase inhibitor                         54.7    2e-06   
ref|XP_008655485.1|  PREDICTED: cysteine proteinase inhibitor 12      57.0    2e-06   
ref|XP_008227467.1|  PREDICTED: cysteine proteinase inhibitor 1       55.5    3e-06   
emb|CCC55944.1|  cystatin                                             54.7    3e-06   
ref|XP_010473877.1|  PREDICTED: cysteine proteinase inhibitor 5-like  55.1    3e-06   
emb|CAH57533.1|  cysteine protease inhibitor                          55.5    3e-06   
emb|CDY06956.1|  BnaA04g23590D                                        55.1    3e-06   
ref|XP_008245514.1|  PREDICTED: cysteine proteinase inhibitor 12-...  57.0    3e-06   
dbj|BAB17683.1|  cysteine proteinase inhibitor homolog                54.3    3e-06   
ref|NP_001050419.1|  Os03g0429000                                     54.7    3e-06   
ref|XP_006482025.1|  PREDICTED: cysteine proteinase inhibitor 6-like  56.6    3e-06   
ref|XP_009141947.1|  PREDICTED: cysteine proteinase inhibitor 3-like  55.1    3e-06   
gb|AFW79583.1|  hypothetical protein ZEAMMB73_655229                  56.6    3e-06   
ref|XP_011034690.1|  PREDICTED: cysteine proteinase inhibitor 12-...  55.8    3e-06   
ref|XP_006373685.1|  hypothetical protein POPTR_0016s03070g           56.2    3e-06   
ref|XP_007010774.1|  Cysteine proteinase inhibitor 12                 56.6    4e-06   
gb|AHZ31431.1|  cysteine proteinase inhibitor                         53.5    4e-06   
gb|AFI57926.1|  cystatin 3                                            57.0    4e-06   
ref|XP_011040718.1|  PREDICTED: cysteine proteinase inhibitor-lik...  55.1    4e-06   
ref|XP_006362733.1|  PREDICTED: cysteine proteinase inhibitor-like    54.3    4e-06   
gb|ABK20187.1|  cysteine protease inhibitor                           54.7    4e-06   
gb|AAM78598.1|  cystatin                                              54.3    4e-06   
ref|XP_002465059.1|  hypothetical protein SORBIDRAFT_01g031450        54.7    4e-06   
gb|ABQ41938.1|  cysteine proteinase inhibitor                         53.1    4e-06   
gb|AFK41721.1|  unknown                                               56.2    4e-06   
dbj|BAO79365.1|  cysteine proteinase inhibitor                        53.9    5e-06   
gb|AAK30004.1|  cysteine proteinase inhibitor                         53.9    5e-06   
sp|Q10Q47.1|CYT7_ORYSJ  RecName: Full=Putative cysteine proteinas...  54.3    5e-06   
gb|AAL86314.1|  putative cysteine proteinase inhibitor cystatin B     53.9    5e-06   
ref|XP_002531171.1|  Cysteine proteinase inhibitor, putative          53.9    5e-06   
gb|ACD11666.1|  cysteine proteinase inhibitor                         53.1    6e-06   
ref|XP_004980292.1|  PREDICTED: cysteine proteinase inhibitor 8-like  54.7    6e-06   
ref|XP_011041371.1|  PREDICTED: cysteine proteinase inhibitor 6-like  55.8    6e-06   
gb|ABD64972.1|  cystatin domain containing protein                    53.9    6e-06   
ref|XP_008795132.1|  PREDICTED: cysteine proteinase inhibitor 12      55.8    6e-06   
dbj|BAB18768.1|  cysteine proteinase inhibitor                        53.9    6e-06   
gb|AAZ32937.1|  cystatin                                              53.1    7e-06   
ref|NP_181620.1|  cysteine proteinase inhibitor 3                     53.9    7e-06   
ref|XP_006295236.1|  hypothetical protein CARUB_v10024323mg           53.9    7e-06   
gb|KFK36955.1|  hypothetical protein AALP_AA4G194100                  53.1    7e-06   
pdb|3UL5|A  Chain A, Saccharum Officinarum Canecystatin-1 In Spac...  53.9    7e-06   
ref|XP_004307210.1|  PREDICTED: cysteine proteinase inhibitor 12-...  55.5    7e-06   
tpe|CAG29024.1|  TPA: putative cystatin                               55.8    8e-06   
ref|XP_011008977.1|  PREDICTED: cysteine proteinase inhibitor 5-like  53.5    8e-06   
ref|XP_010057838.1|  PREDICTED: cysteine proteinase inhibitor 1-like  53.5    8e-06   
ref|XP_002526201.1|  cysteine protease inhibitor, putative            55.1    8e-06   
ref|XP_004491211.1|  PREDICTED: cysteine proteinase inhibitor-like    53.1    9e-06   
ref|XP_009128980.1|  PREDICTED: cysteine proteinase inhibitor 5-like  53.5    9e-06   
ref|XP_004253396.2|  PREDICTED: multicystatin                         56.6    9e-06   
emb|CAH60163.1|  cystatin CPI-1                                       55.5    9e-06   
dbj|BAE92726.1|  multidomain cystatin                                 55.5    9e-06   
gb|KFK26534.1|  hypothetical protein AALP_AA8G261400                  53.5    9e-06   
ref|XP_004307209.1|  PREDICTED: cysteine proteinase inhibitor 12-...  55.5    9e-06   
ref|XP_007212196.1|  hypothetical protein PRUPE_ppa012846mg           53.9    1e-05   
ref|XP_003561918.1|  PREDICTED: putative cysteine proteinase inhi...  53.1    1e-05   
gb|AAO22603.1|  putative cysteine proteinase inhibitor                53.1    1e-05   
sp|P37842.1|CYTM_SOLTU  RecName: Full=Multicystatin; Short=MC         56.2    1e-05   
ref|XP_006431771.1|  hypothetical protein CICLE_v10002632mg           54.3    1e-05   
emb|CAH57537.1|  cysteine protease inhibitor                          53.5    1e-05   
ref|NP_001239817.1|  cysteine proteinase inhibitor                    52.8    1e-05   
emb|CAH57532.1|  cysteine protease inhibitor                          53.5    1e-05   
gb|AAG38521.1|AF283536_1  cystatin-like protein                       53.1    1e-05   
gb|KHN35444.1|  Cysteine proteinase inhibitor                         52.8    1e-05   
gb|ACD11668.1|  cysteine proteinase inhibitor                         52.0    1e-05   
emb|CAH57540.1|  cysteine protease inhibitor                          53.5    1e-05   
gb|EPS59271.1|  hypothetical protein M569_15537                       53.1    1e-05   
gb|ACM43995.1|  cysteine proteinase inhibitor                         52.8    1e-05   
pdb|1EQK|A  Chain A, Solution Structure Of Oryzacystatin-I, A Cys...  52.8    1e-05   
gb|ACD11664.1|  cysteine proteinase inhibitor                         51.6    2e-05   
ref|XP_010543916.1|  PREDICTED: cysteine proteinase inhibitor 7       55.1    2e-05   
ref|XP_008445944.1|  PREDICTED: cysteine proteinase inhibitor 12      54.7    2e-05   
gb|AAQ14319.1|  protease inhibitor                                    53.9    2e-05   
ref|XP_006840810.1|  hypothetical protein AMTR_s00214p00026510        52.8    2e-05   
ref|XP_006430494.1|  hypothetical protein CICLE_v10012693mg           54.3    2e-05   
ref|XP_003543365.1|  PREDICTED: cysteine proteinase inhibitor         52.4    2e-05   
gb|EMT09912.1|  Cysteine proteinase inhibitor                         52.4    2e-05   
gb|AAL56612.1|AF454396_1  cystatin                                    52.0    2e-05   
gb|AAB24011.1|  oryzacystatin=cysteine protease inhibitor             52.0    2e-05   
ref|XP_010440146.1|  PREDICTED: cysteine proteinase inhibitor 4-like  52.4    2e-05   
ref|XP_002465663.1|  hypothetical protein SORBIDRAFT_01g043320        52.4    2e-05   
gb|ACU19157.1|  unknown                                               52.0    2e-05   
ref|XP_010449777.1|  PREDICTED: cysteine proteinase inhibitor 4-like  52.4    2e-05   
ref|XP_004978941.1|  PREDICTED: cysteine proteinase inhibitor 8-like  53.1    3e-05   
ref|XP_006431770.1|  hypothetical protein CICLE_v10004025mg           51.6    3e-05   
gb|AIY68266.1|  oryzacystatin I                                       52.4    3e-05   
ref|XP_002441309.1|  hypothetical protein SORBIDRAFT_09g024230        52.8    3e-05   
gb|EYU44874.1|  hypothetical protein MIMGU_mgv1a013007mg              53.9    3e-05   
ref|XP_010686713.1|  PREDICTED: cysteine proteinase inhibitor 1       52.0    3e-05   
ref|XP_006431769.1|  hypothetical protein CICLE_v10003705mg           51.6    3e-05   
ref|XP_008811323.1|  PREDICTED: cysteine proteinase inhibitor 1-like  52.8    3e-05   
gb|ADP50761.1|  cysteine proteinase inhibitor TrcC-5                  52.0    3e-05   
ref|NP_001044550.1|  Os01g0803200                                     52.4    3e-05   
ref|XP_006449877.1|  hypothetical protein CICLE_v10017209mg           52.0    3e-05   
gb|KDO57435.1|  hypothetical protein CISIN_1g027502mg                 53.5    4e-05   
gb|ACH61362.1|  cysteine protease inhibitor                           51.2    4e-05   
ref|XP_003617185.1|  Cysteine proteinase inhibitor                    51.2    4e-05   
ref|XP_006467325.1|  PREDICTED: multicystatin-like                    53.9    5e-05   
gb|AAL56401.1|  cystatin                                              51.6    5e-05   
gb|EMT27255.1|  Cysteine proteinase inhibitor 8                       51.6    5e-05   
gb|ACD11683.1|  cysteine proteinase inhibitor                         50.1    6e-05   
ref|XP_008346621.1|  PREDICTED: cysteine proteinase inhibitor A-like  50.8    6e-05   
ref|XP_002976277.1|  hypothetical protein SELMODRAFT_19455            50.8    6e-05   
ref|XP_011070080.1|  PREDICTED: cysteine proteinase inhibitor iso...  52.0    6e-05   
gb|AAQ62561.1|  multicystatin                                         53.5    6e-05   
ref|XP_006346810.1|  PREDICTED: cysteine proteinase inhibitor 5-like  51.2    6e-05   
emb|CDY69151.1|  BnaCnng62150D                                        51.2    6e-05   
ref|XP_003562768.1|  PREDICTED: cysteine proteinase inhibitor 8-like  51.2    6e-05   
ref|XP_004165517.1|  PREDICTED: cysteine proteinase inhibitor 12-...  52.4    6e-05   
ref|XP_010045098.1|  PREDICTED: cysteine proteinase inhibitor-like    50.8    7e-05   
ref|XP_009605348.1|  PREDICTED: cysteine proteinase inhibitor A-like  50.4    7e-05   
sp|Q9LEI7.1|CYT1_HORVU  RecName: Full=Cysteine proteinase inhibit...  50.8    8e-05   
emb|CAH57553.1|  cysteine protease inhibitor                          51.2    8e-05   



>gb|EYU28504.1| hypothetical protein MIMGU_mgv1a016168mg [Erythranthe guttata]
Length=132

 Score =   135 bits (340),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 70/107 (65%), Positives = 86/107 (80%), Gaps = 4/107 (4%)
 Frame = -2

Query  656  GRKVGGRTEVKDVKNNEEVQELGRYCVREYNKVLQEKQGGGGLLSFSEVVKAETQVVSGF  477
            G KVGGRTEVK+VK N++VQ+LGRYCV+EYN+ LQ+K  G  LL FS+VV AETQVVSG 
Sbjct  25   GGKVGGRTEVKNVKANKDVQDLGRYCVQEYNRQLQQKANGTKLLVFSQVVAAETQVVSGI  84

Query  476  KYYLKISAAS-SGGARRIYDAVVVVKPWAADSRELLDFAPS--PDSD  345
            KYYLKISAA+  GGA + ++AV+VVKPW   S+EL++FAPS  P  D
Sbjct  85   KYYLKISAATRGGGAAKSFEAVIVVKPW-IHSKELVNFAPSTPPSRD  130



>gb|EYU24293.1| hypothetical protein MIMGU_mgv1a016063mg [Erythranthe guttata]
Length=135

 Score =   133 bits (334),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 69/106 (65%), Positives = 85/106 (80%), Gaps = 3/106 (3%)
 Frame = -2

Query  656  GRKVGGRTEVKDVKNNEEVQELGRYCVREYNKVLQEKQGGGGLLSFSEVVKAETQVVSGF  477
            G KVGGRTEVK+VK N++VQ+LGRYCV+EYN+ LQ+K  G  LL FS+VV AETQVVSG 
Sbjct  29   GGKVGGRTEVKNVKANKDVQDLGRYCVQEYNRQLQQKANGTKLLVFSQVVAAETQVVSGI  88

Query  476  KYYLKISAAS-SGGARRIYDAVVVVKPWAADSRELLDFAPS-PDSD  345
            KYYLKISAA+  GG  + ++AV+VVKPW   S+EL++FAPS P  D
Sbjct  89   KYYLKISAATRGGGPAKNFEAVIVVKPW-IHSKELVNFAPSTPPRD  133



>ref|XP_011084146.1| PREDICTED: cysteine proteinase inhibitor B [Sesamum indicum]
Length=131

 Score =   132 bits (332),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 68/100 (68%), Positives = 78/100 (78%), Gaps = 2/100 (2%)
 Frame = -2

Query  650  KVGGRTEVKDVKNNEEVQELGRYCVREYNKVLQEKQGGGGLLSFSEVVKAETQVVSGFKY  471
            KVGGRT+VK+VK N+E+QELGRYCV EYN  LQ K  G   L FS+VV AETQV+SG KY
Sbjct  27   KVGGRTQVKNVKQNQEIQELGRYCVGEYNHQLQLKANGSTALVFSQVVAAETQVISGIKY  86

Query  470  YLKISAASSGGA-RRIYDAVVVVKPWAADSRELLDFAPSP  354
            YLKISA +  GA  R +DAVVVVKPW   S+ELL+FAPSP
Sbjct  87   YLKISAVTRDGAPARTFDAVVVVKPW-LHSKELLNFAPSP  125



>ref|XP_009589279.1| PREDICTED: cysteine proteinase inhibitor B-like [Nicotiana tomentosiformis]
 gb|AIE76376.1| cysteine protease inhibitor [Nicotiana tabacum]
Length=136

 Score =   132 bits (332),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 62/105 (59%), Positives = 85/105 (81%), Gaps = 5/105 (5%)
 Frame = -2

Query  656  GRKVGGRTEVKDVKNNEEVQELGRYCVREYNKVLQEKQ----GGGGLLSFSEVVKAETQV  489
            G+K+GGRT+++DVK N+E+Q+LG++CV EYN+ LQ+++       GLLSFSEVV+AE QV
Sbjct  30   GKKLGGRTQIQDVKTNKEIQDLGKFCVEEYNRNLQKQKQKVNNNNGLLSFSEVVEAEKQV  89

Query  488  VSGFKYYLKISAASSGGARRIYDAVVVVKPWAADSRELLDFAPSP  354
            VSG KYYLKISA +S GA +++DAV+VVK W    +ELL+F+PSP
Sbjct  90   VSGIKYYLKISATTSSGAPKMFDAVLVVKAW-EKKKELLNFSPSP  133



>gb|AEQ54766.1| cysteine proteinase inhibitor CPI-1 [Coffea canephora]
Length=139

 Score =   125 bits (313),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 59/105 (56%), Positives = 79/105 (75%), Gaps = 2/105 (2%)
 Frame = -2

Query  656  GRKVGGRTEVKDVKNNEEVQELGRYCVREYNKVLQEKQG-GGGLLSFSEVVKAETQVVSG  480
            GRKVG R +++DVK+N+EVQELG YCV EYNK L++K    G  + F+ VV+AE QVV+G
Sbjct  34   GRKVGAREKIEDVKSNKEVQELGEYCVSEYNKSLRKKNNESGAPIIFTSVVEAEKQVVAG  93

Query  479  FKYYLKISAASSGGARRIYDAVVVVKPWA-ADSRELLDFAPSPDS  348
             KYYLKI A +S G  ++YDA+VVV+PW     R+LL+F+PSP +
Sbjct  94   IKYYLKIKATTSSGVPKVYDAIVVVRPWVHTKPRQLLNFSPSPAT  138



>ref|XP_009762060.1| PREDICTED: cysteine proteinase inhibitor B-like [Nicotiana sylvestris]
Length=138

 Score =   124 bits (311),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 61/109 (56%), Positives = 86/109 (79%), Gaps = 7/109 (6%)
 Frame = -2

Query  656  GRKVGGRTEVKDVKNNEEVQELGRYCVREYNKVLQEKQGGG------GLLSFSEVVKAET  495
            G+K+GGRT+++DVK N+E+Q+LG++CV EYN+ LQ+++         GLLSFSEVV+AE 
Sbjct  30   GKKLGGRTQIQDVKTNKEIQDLGKFCVEEYNRNLQKQKQKVNNNNNNGLLSFSEVVEAEK  89

Query  494  QVVSGFKYYLKISAASSGGARRIYDAVVVVKPWAADSRELLDFAPSPDS  348
            QVVSG KYYLKISA +S G+ +++DAV+VVK W    +ELL+F+PSP +
Sbjct  90   QVVSGIKYYLKISATTSSGSPKMFDAVLVVKAW-EKKKELLNFSPSPAT  137



>ref|XP_006358790.1| PREDICTED: cysteine proteinase inhibitor B-like [Solanum tuberosum]
Length=135

 Score =   122 bits (305),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 60/104 (58%), Positives = 78/104 (75%), Gaps = 2/104 (2%)
 Frame = -2

Query  656  GRKVGGRTEVKDVKNNEEVQELGRYCVREYNKVLQEKQGG-GGLLSFSEVVKAETQVVSG  480
            G K+GGRT++KDVK N+E+Q+LG+YCV E+N+ L+++ G    LLSFS+VV+AE QVVSG
Sbjct  28   GGKLGGRTQIKDVKTNQEIQDLGKYCVEEHNRNLRKQNGALSSLLSFSQVVEAEKQVVSG  87

Query  479  FKYYLKISA-ASSGGARRIYDAVVVVKPWAADSRELLDFAPSPD  351
             KYYLKISA   S  + +++DAVVVVK W     ELL F PSP 
Sbjct  88   VKYYLKISAIVKSSSSPKLFDAVVVVKSWEKKKEELLTFFPSPS  131



>ref|XP_009763807.1| PREDICTED: cysteine proteinase inhibitor B-like [Nicotiana sylvestris]
Length=142

 Score =   120 bits (302),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 59/112 (53%), Positives = 81/112 (72%), Gaps = 6/112 (5%)
 Frame = -2

Query  656  GRKVGGRTEVKDVKNNEEVQELGRYCVREYNKVLQE-----KQGGGGLLSFSEVVKAETQ  492
            GRKVGGRT +KDVK N+++Q+LG+YCV EYN+ L++     ++     LSF+EVV+AETQ
Sbjct  29   GRKVGGRTPIKDVKTNKKIQDLGKYCVEEYNRSLRKYKQILQEDNIEFLSFAEVVEAETQ  88

Query  491  VVSGFKYYLKISAASSGGARRIYDAVVVVKPWAADSRELLDFAPSPDSDHPS  336
            VVSG KYYLKISA  S    +++DA +V+KPW    +EL+ F+P P +D  S
Sbjct  89   VVSGIKYYLKISATVSSETPKMFDAELVIKPWEK-KKELIHFSPFPANDKDS  139



>ref|XP_009588279.1| PREDICTED: cysteine proteinase inhibitor B-like [Nicotiana tomentosiformis]
 gb|AIE76382.1| cysteine protease inhibitor [Nicotiana tabacum]
Length=142

 Score =   119 bits (299),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 59/112 (53%), Positives = 80/112 (71%), Gaps = 6/112 (5%)
 Frame = -2

Query  656  GRKVGGRTEVKDVKNNEEVQELGRYCVREYNKVLQE-----KQGGGGLLSFSEVVKAETQ  492
            GRKVGGRT +KDVK N+++Q+LG+YCV EYN+ L++     ++     LSF+EV++AETQ
Sbjct  29   GRKVGGRTPIKDVKTNKKIQDLGKYCVEEYNRSLRKYKQILQEDNIEFLSFAEVLEAETQ  88

Query  491  VVSGFKYYLKISAASSGGARRIYDAVVVVKPWAADSRELLDFAPSPDSDHPS  336
            VVSG KYYLKISA  S G  + +DA +V+KPW  + +EL+ F P P  D  S
Sbjct  89   VVSGIKYYLKISAIVSSGIPKTFDAELVIKPW-EEKKELIHFLPFPAHDKDS  139



>ref|XP_010326957.1| PREDICTED: cysteine proteinase inhibitor B [Solanum lycopersicum]
Length=134

 Score =   116 bits (290),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 59/104 (57%), Positives = 78/104 (75%), Gaps = 3/104 (3%)
 Frame = -2

Query  656  GRKVGGRTEVKDVKNNEEVQELGRYCVREYNKVLQEKQGG-GGLLSFSEVVKAETQVVSG  480
            G K+GGRT++K+VK N+E+Q+LG+YCV E+N+ L+   G    LLSFS+VV+AE QVVSG
Sbjct  28   GGKLGGRTQIKNVKTNQEIQDLGKYCVEEHNRDLRHINGALSSLLSFSQVVEAEKQVVSG  87

Query  479  FKYYLKISA-ASSGGARRIYDAVVVVKPWAADSRELLDFAPSPD  351
             KYYLKISA   S  + +++DAVVVVK W    +ELL F+PSP 
Sbjct  88   VKYYLKISAIVKSSSSPKLFDAVVVVKAW-EKKKELLTFSPSPS  130



>ref|XP_010101112.1| Cysteine proteinase inhibitor 10 [Morus notabilis]
 gb|EXB87085.1| Cysteine proteinase inhibitor 10 [Morus notabilis]
 gb|AJD79057.1| CPI-6 [Morus alba var. atropurpurea]
Length=143

 Score =   116 bits (290),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 66/112 (59%), Positives = 80/112 (71%), Gaps = 12/112 (11%)
 Frame = -2

Query  647  VGGRTEVKDVKNNEEVQELGRYCVREYNKVLQE--KQGGGGL--------LSFSEVVKAE  498
            VGGRT + DVK NEEVQELGR+ V EYN+  Q+  ++G GG         LSFS+VV+AE
Sbjct  30   VGGRTAISDVKTNEEVQELGRFSVEEYNRRSQKLIRRGNGGARDGYGDGELSFSQVVEAE  89

Query  497  TQVVSGFKYYLKISA-ASSGGARRIYDAVVVVKPWAADSRELLDFAPSPDSD  345
             QVVSG KYYLK+SA A+  G  RI+D+VVVVKPW   SR+LL+FAPS   D
Sbjct  90   KQVVSGIKYYLKVSATATETGESRIFDSVVVVKPW-LRSRQLLNFAPSTARD  140



>ref|XP_002516375.1| Cysteine proteinase inhibitor B, putative [Ricinus communis]
 gb|EEF45992.1| Cysteine proteinase inhibitor B, putative [Ricinus communis]
Length=138

 Score =   113 bits (282),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 60/110 (55%), Positives = 80/110 (73%), Gaps = 7/110 (6%)
 Frame = -2

Query  656  GRKVGGRTEVKDVKNNEEVQELGRYCVREYNKVLQEKQGGGG------LLSFSEVVKAET  495
            G  VGGRT+V+DVK+NE VQELGR+CV+E+NK    +Q GG       LL FSEVV AET
Sbjct  24   GMMVGGRTQVRDVKSNEAVQELGRFCVKEFNKQQLRQQHGGSNGGGGELLMFSEVVAAET  83

Query  494  QVVSGFKYYLKISAASSGGARRIYDAVVVVKPWAADSRELLDFAPSPDSD  345
            QVVSG KYYLKI+A++  G  +++D+VVVVK W  D ++L+ F P+  ++
Sbjct  84   QVVSGIKYYLKIAASNGKGEAKVFDSVVVVKAW-IDDKQLITFEPAAANE  132



>ref|XP_008465470.1| PREDICTED: cysteine proteinase inhibitor B [Cucumis melo]
Length=128

 Score =   112 bits (280),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 60/110 (55%), Positives = 75/110 (68%), Gaps = 6/110 (5%)
 Frame = -2

Query  656  GRKVGGRTEVKDVKNNEEVQELGRYCVREYNKVLQEKQGGGGLLSFSEVVKAETQVVSGF  477
            G KVGGR E+KDVK NEEVQ LGR+ V EYN+    + GGGG + F+ VV A+ QVVSG 
Sbjct  25   GGKVGGRMEIKDVKRNEEVQRLGRFSVEEYNR----RMGGGGEVKFTAVVAADRQVVSGT  80

Query  476  KYYLKISAASSGGARRIYDAVVVVKPWAADSRELLDFAPSPDSDHPSKQF  327
            KYYL+I    + G R+I+D+VV+VKPW   S+ LLDF+PS     P   F
Sbjct  81   KYYLRILGIQN-GERKIFDSVVIVKPWIG-SKRLLDFSPSTVFSTPFSYF  128



>ref|XP_010243158.1| PREDICTED: cysteine proteinase inhibitor 4-like [Nelumbo nucifera]
Length=133

 Score =   112 bits (280),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 60/104 (58%), Positives = 78/104 (75%), Gaps = 4/104 (4%)
 Frame = -2

Query  656  GRKVGGRTEVKDVKNNEEVQELGRYCVREYNKVLQEKQGGGG--LLSFSEVVKAETQVVS  483
            GRKVGGRTE++DVK+NEEVQELGR+ V E+N+  +E++   G   L FSEVV+AE QVVS
Sbjct  32   GRKVGGRTEIEDVKDNEEVQELGRFSVEEFNRSQREEERSRGNVYLVFSEVVRAERQVVS  91

Query  482  GFKYYLKISAASSGGARRIYDAVVVVKPWAADSRELLDFAPSPD  351
            G KYYL + A   G A++ +DAVVVVKPW  +S++LL F P  +
Sbjct  92   GIKYYLNVEALEEGEAKK-FDAVVVVKPW-LESKQLLTFIPCTN  133



>ref|XP_002265736.1| PREDICTED: cysteine proteinase inhibitor 4 [Vitis vinifera]
Length=140

 Score =   112 bits (280),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 62/109 (57%), Positives = 79/109 (72%), Gaps = 11/109 (10%)
 Frame = -2

Query  656  GRKVGGRTEVKDVKNNEEVQELGRYCVREYNKVL--QEKQGGGGL-------LSFSEVVK  504
            GR VGGRTE+KDVK N+EVQ+LGR+ V EYN+    + ++  G +       L+FSEVV+
Sbjct  31   GRMVGGRTEIKDVKTNKEVQQLGRFSVEEYNRSHGRRWREAIGNVLGMDYEYLTFSEVVE  90

Query  503  AETQVVSGFKYYLKISAASSGGARRIYDAVVVVKPWAADSRELLDFAPS  357
            A+ QVVSGFKYYLKI AA+  G R  +DAVVVVKPW   S++LL F+PS
Sbjct  91   AQKQVVSGFKYYLKI-AATQNGVRNTFDAVVVVKPWLP-SKQLLHFSPS  137



>ref|XP_003538534.1| PREDICTED: cysteine proteinase inhibitor 4 [Glycine max]
Length=126

 Score =   111 bits (277),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 60/105 (57%), Positives = 75/105 (71%), Gaps = 3/105 (3%)
 Frame = -2

Query  656  GRKVGGRTEVKDVKNNEEVQELGRYCVREYNKVL-QEKQGGGGLLSFSEVVKAETQVVSG  480
             R VGG+TEV DV+ N EVQELGR+ V EYN+ L Q K  G   L+FSEVV+A+ QVVSG
Sbjct  21   ARMVGGKTEVPDVRTNREVQELGRFAVEEYNRGLKQWKNNGSEQLNFSEVVEAQQQVVSG  80

Query  479  FKYYLKISAASSGGARRIYDAVVVVKPWAADSRELLDFAPSPDSD  345
             KYYLKIS A+  G  +++ +VVVVKPW   S++LL FAP+  S 
Sbjct  81   MKYYLKIS-ATHKGVHKMFTSVVVVKPW-LHSKQLLHFAPAAPSS  123



>ref|XP_007034159.1| Cystatin [Theobroma cacao]
 gb|EOY05085.1| Cystatin [Theobroma cacao]
Length=127

 Score =   111 bits (277),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 59/102 (58%), Positives = 75/102 (74%), Gaps = 3/102 (3%)
 Frame = -2

Query  656  GRKVGGRTEVKDVKNNEEVQELGRYCVREYNKVLQEKQGGGGL-LSFSEVVKAETQVVSG  480
            G  VGG+TE+ DVK N+EVQELGR+ V E+N+     +  GG  L FS+VV+A+ QVVSG
Sbjct  27   GTLVGGKTEINDVKTNKEVQELGRFSVEEFNRSRGGLRSNGGTELVFSQVVEAQKQVVSG  86

Query  479  FKYYLKISAASSGGARRIYDAVVVVKPWAADSRELLDFAPSP  354
             KYYLKI A  S G  R +++VVVVKPW  DS+ELL+F+PSP
Sbjct  87   IKYYLKIEAMQS-GLTRTFESVVVVKPW-EDSKELLNFSPSP  126



>ref|XP_004160226.1| PREDICTED: cysteine proteinase inhibitor B-like [Cucumis sativus]
Length=128

 Score =   111 bits (277),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 59/110 (54%), Positives = 75/110 (68%), Gaps = 6/110 (5%)
 Frame = -2

Query  656  GRKVGGRTEVKDVKNNEEVQELGRYCVREYNKVLQEKQGGGGLLSFSEVVKAETQVVSGF  477
            G +VGGR EVKDV+ NEEVQ LGR+ V EYN+    + GGGG + F+ VV AE QVVSG 
Sbjct  25   GGRVGGRMEVKDVRRNEEVQRLGRFSVEEYNR----RMGGGGEVKFTAVVAAERQVVSGT  80

Query  476  KYYLKISAASSGGARRIYDAVVVVKPWAADSRELLDFAPSPDSDHPSKQF  327
            KYYL+I   +  G R+++D+VV+VKPW   S+ LLDF+PS     P   F
Sbjct  81   KYYLRI-LGTQNGERKVFDSVVIVKPWIG-SKRLLDFSPSTVFRTPIFNF  128



>ref|XP_004138536.1| PREDICTED: cysteine proteinase inhibitor B-like [Cucumis sativus]
 gb|KGN45922.1| Cystatin [Cucumis sativus]
Length=128

 Score =   111 bits (277),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 59/110 (54%), Positives = 75/110 (68%), Gaps = 6/110 (5%)
 Frame = -2

Query  656  GRKVGGRTEVKDVKNNEEVQELGRYCVREYNKVLQEKQGGGGLLSFSEVVKAETQVVSGF  477
            G +VGGR EVKDV+ NEEVQ LGR+ V EYN+    + GGGG + F+ VV AE QVVSG 
Sbjct  25   GGRVGGRMEVKDVRRNEEVQRLGRFSVEEYNR----RMGGGGEVKFTAVVAAERQVVSGT  80

Query  476  KYYLKISAASSGGARRIYDAVVVVKPWAADSRELLDFAPSPDSDHPSKQF  327
            KYYL+I   +  G R+++D+VV+VKPW   S+ LLDF+PS     P   F
Sbjct  81   KYYLRI-LGTQNGERKVFDSVVIVKPWIG-SKRLLDFSPSAVFRTPIFNF  128



>gb|ACU17144.1| unknown [Glycine max]
Length=122

 Score =   110 bits (274),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 59/104 (57%), Positives = 74/104 (71%), Gaps = 3/104 (3%)
 Frame = -2

Query  656  GRKVGGRTEVKDVKNNEEVQELGRYCVREYNKVL-QEKQGGGGLLSFSEVVKAETQVVSG  480
             R VGG+TEV DV+ N EVQELGR+ V EYN+ L Q K  G   L+FSEVV+A+ QVVSG
Sbjct  21   ARMVGGKTEVPDVRTNREVQELGRFAVEEYNRGLKQWKNNGSEQLNFSEVVEAQQQVVSG  80

Query  479  FKYYLKISAASSGGARRIYDAVVVVKPWAADSRELLDFAPSPDS  348
              YYLKIS A+  G  +++ +VVVVKPW   S++LL FAP+  S
Sbjct  81   MMYYLKIS-ATHKGVHKMFTSVVVVKPW-LHSKQLLHFAPAAPS  122



>gb|KHN44464.1| Cysteine proteinase inhibitor 2 [Glycine soja]
Length=169

 Score =   111 bits (277),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 60/104 (58%), Positives = 75/104 (72%), Gaps = 3/104 (3%)
 Frame = -2

Query  656  GRKVGGRTEVKDVKNNEEVQELGRYCVREYNKVL-QEKQGGGGLLSFSEVVKAETQVVSG  480
             R VGG+TEV DV+ N EVQELGR+ V EYN+ L Q K  G   L+FSEVV+A+ QVVSG
Sbjct  21   ARMVGGKTEVPDVRTNREVQELGRFAVEEYNRGLKQWKNNGSEQLNFSEVVEAQQQVVSG  80

Query  479  FKYYLKISAASSGGARRIYDAVVVVKPWAADSRELLDFAPSPDS  348
             KYYLKIS A+  G  +++ +VVVVKPW   S++LL FAP+  S
Sbjct  81   MKYYLKIS-ATHKGVHKMFTSVVVVKPW-LHSKQLLHFAPAAPS  122



>ref|XP_002456830.1| hypothetical protein SORBIDRAFT_03g043680 [Sorghum bicolor]
 gb|EES01950.1| hypothetical protein SORBIDRAFT_03g043680 [Sorghum bicolor]
Length=155

 Score =   110 bits (274),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 60/104 (58%), Positives = 75/104 (72%), Gaps = 7/104 (7%)
 Frame = -2

Query  656  GRKVGGRTEVKDVKNNEEVQELGRYCVREYNKVLQEKQGGGGLLSFSEVVKAETQVVSGF  477
            GRKVG RTEV+DV+++ EVQELGR+ V EYN+ L  +  GGG L F  VV A+ QVVSG 
Sbjct  52   GRKVGARTEVRDVESDGEVQELGRFSVAEYNRQL--RGDGGGRLEFGRVVAAQRQVVSGL  109

Query  476  KYYLKISA----ASSGGARRIYDAVVVVKPWAADSRELLDFAPS  357
            KYYL+++A    A + G  R +DAVVVVKPW  +SR LL FAP+
Sbjct  110  KYYLRVAAVEEGAQNAGGERAFDAVVVVKPW-LESRTLLTFAPA  152



>sp|Q10993.1|CYTB_HELAN RecName: Full=Cysteine proteinase inhibitor B; AltName: Full=Cystatin-B; 
AltName: Full=SCB [Helianthus annuus]
Length=101

 Score =   108 bits (269),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 52/97 (54%), Positives = 72/97 (74%), Gaps = 1/97 (1%)
 Frame = -2

Query  644  GGRTEVKDVKNNEEVQELGRYCVREYNKVLQEKQGGGGLLSFSEVVKAETQVVSGFKYYL  465
            GGRT+VK+VK + E+Q+LG Y V EYN++ + K+ G G L FS+V+ AETQVV+G KYYL
Sbjct  3    GGRTKVKNVKTDTEIQQLGSYSVDEYNRLQRTKKTGAGDLKFSQVIAAETQVVAGTKYYL  62

Query  464  KISAASSGGARRIYDAVVVVKPWAADSRELLDFAPSP  354
            KI A + GG  +++DA VVV+ W   S++LL F P+P
Sbjct  63   KIEAITKGGKMKVFDAEVVVQSW-KHSKKLLGFKPAP  98



>ref|XP_011024794.1| PREDICTED: cysteine proteinase inhibitor B-like [Populus euphratica]
 ref|XP_011011101.1| PREDICTED: cysteine proteinase inhibitor B-like [Populus euphratica]
Length=137

 Score =   109 bits (272),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 57/102 (56%), Positives = 72/102 (71%), Gaps = 3/102 (3%)
 Frame = -2

Query  656  GRKVGGRTEVKDVKNNEEVQELGRYCVREYNKVLQEKQGGG--GLLSFSEVVKAETQVVS  483
            GR VGGR +V DVKNN+E+QELGR+ V+E+N        GG  G L FSEVV+A+TQVVS
Sbjct  30   GRMVGGRAKVNDVKNNKEIQELGRFSVKEFNNHRSTYGKGGEVGELMFSEVVEAQTQVVS  89

Query  482  GFKYYLKISAASSGGARRIYDAVVVVKPWAADSRELLDFAPS  357
            G KYYLKI   +    + ++D+V+VVKPW   S+ELL F PS
Sbjct  90   GLKYYLKIEVTTQSEEKLVFDSVLVVKPW-LRSKELLSFEPS  130



>ref|XP_007223412.1| hypothetical protein PRUPE_ppa013391mg [Prunus persica]
 ref|XP_008222787.1| PREDICTED: cysteine proteinase inhibitor B [Prunus mume]
 gb|EMJ24611.1| hypothetical protein PRUPE_ppa013391mg [Prunus persica]
Length=125

 Score =   108 bits (269),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 56/101 (55%), Positives = 76/101 (75%), Gaps = 4/101 (4%)
 Frame = -2

Query  656  GRKVGGRTEVKDVKNNEEVQELGRYCVREYNKVLQ--EKQGGGGLLSFSEVVKAETQVVS  483
            G KVGGR +++DVK N+EVQ+LGR+ V EYN+  +   +  GGG L F EVV+A++QVVS
Sbjct  23   GTKVGGRQQIEDVKTNKEVQKLGRFSVAEYNRTQRKSHQSNGGGELQFLEVVEAQSQVVS  82

Query  482  GFKYYLKISAASSGGARRIYDAVVVVKPWAADSRELLDFAP  360
            G KYYLK+SA  + GA  ++D+ VVVKPW   S++LL+FAP
Sbjct  83   GIKYYLKVSAVRN-GAHMLFDSEVVVKPW-LHSKQLLNFAP  121



>gb|AHV85520.1| cysteine proteinase inhibitor TrcC-6 [Secale cereale x Triticum 
aestivum]
Length=152

 Score =   108 bits (270),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 61/111 (55%), Positives = 79/111 (71%), Gaps = 12/111 (11%)
 Frame = -2

Query  656  GRKVGGRTEVKDVKNNEEVQELGRYCVREYNKVLQEK-QGGGGL---LSFSEVVKAETQV  489
            GRKVGGRTEV+DV+ + EVQELGRY V E+N+  +E  +G GG+   L F+ VV A+ Q+
Sbjct  40   GRKVGGRTEVRDVEGDREVQELGRYSVEEHNRRREEGCEGSGGVCGRLEFARVVSAQRQM  99

Query  488  VSGFKYYLKISAASSGGA-------RRIYDAVVVVKPWAADSRELLDFAPS  357
            VSG KYYL+++AA  GGA        R++DAVVVVKPW   SR L+ FAP+
Sbjct  100  VSGIKYYLRVAAAEEGGAGSNGVSDGRVFDAVVVVKPW-LQSRALVRFAPA  149



>pir||JE0308 cysteine proteinase inhibitor - common sunflower
Length=123

 Score =   107 bits (266),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 52/97 (54%), Positives = 71/97 (73%), Gaps = 1/97 (1%)
 Frame = -2

Query  644  GGRTEVKDVKNNEEVQELGRYCVREYNKVLQEKQGGGGLLSFSEVVKAETQVVSGFKYYL  465
            GGRT+VK+VK + E+Q+LG Y V EYN++ + K+ G G L FS+V+ AETQVV+G KYYL
Sbjct  25   GGRTKVKNVKTDTEIQQLGSYSVDEYNRLQRTKKTGAGDLKFSQVIAAETQVVAGTKYYL  84

Query  464  KISAASSGGARRIYDAVVVVKPWAADSRELLDFAPSP  354
            KI A   GG  +++DA VVV+ W   S++LL F P+P
Sbjct  85   KIEAIYKGGKMKVFDAEVVVQSW-KHSKKLLGFKPAP  120



>ref|XP_004297057.1| PREDICTED: cysteine proteinase inhibitor B-like [Fragaria vesca 
subsp. vesca]
Length=138

 Score =   107 bits (266),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 59/104 (57%), Positives = 74/104 (71%), Gaps = 6/104 (6%)
 Frame = -2

Query  656  GRKVGGRTEVKDVKNNEEVQELGRYCVREYNKVLQE--KQGGGGLLSFSEVVKAETQVVS  483
            G  VGGR  V+DVK N+EVQELGR+ V EYN++ ++  +  GGG L F EVV+AETQVVS
Sbjct  29   GGLVGGRRPVEDVKTNKEVQELGRFSVAEYNRMQRQSLRSNGGGELQFREVVEAETQVVS  88

Query  482  GFKYYLKISAAS---SGGARRIYDAVVVVKPWAADSRELLDFAP  360
            G KYYLKIS      +GG   ++D+ VVVKPW   S+ LL+FAP
Sbjct  89   GIKYYLKISTVRNGLNGGTPLLFDSQVVVKPW-LRSKRLLNFAP  131



>ref|XP_008365221.1| PREDICTED: cysteine proteinase inhibitor B-like [Malus domestica]
 ref|XP_008365234.1| PREDICTED: cysteine proteinase inhibitor B-like [Malus domestica]
 gb|AAO18638.1| cystatin [Malus domestica]
 gb|AHZ92268.1| cystatin 2 [Malus prunifolia]
Length=123

 Score =   106 bits (264),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 57/100 (57%), Positives = 75/100 (75%), Gaps = 3/100 (3%)
 Frame = -2

Query  656  GRKVGGRTEVKDVKNNEEVQELGRYCVREYNKVL-QEKQGGGGLLSFSEVVKAETQVVSG  480
            G  VGGR E+++VK N+EVQELGR+ V EYN+    +K  GGG L F EVV+A++QVVSG
Sbjct  22   GGMVGGRKEIENVKTNKEVQELGRFSVEEYNRQRGTQKMDGGGELQFLEVVEAQSQVVSG  81

Query  479  FKYYLKISAASSGGARRIYDAVVVVKPWAADSRELLDFAP  360
             KYYLK+SA  + G  R++D+ VVVKPW   S++LL+FAP
Sbjct  82   IKYYLKVSAVRN-GVHRLFDSEVVVKPW-LRSKQLLNFAP  119



>ref|XP_006349967.1| PREDICTED: cysteine proteinase inhibitor B-like [Solanum tuberosum]
Length=136

 Score =   106 bits (264),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 55/104 (53%), Positives = 75/104 (72%), Gaps = 7/104 (7%)
 Frame = -2

Query  656  GRKVGGRTEVKDVKNNEEVQELGRYCVREYNKVLQE-----KQGGGGLLSFSEVVKAETQ  492
            GRKVGGRT +KDVK N+++QELG+YCV EYN  L++     ++    LL+F EV++AETQ
Sbjct  29   GRKVGGRTPIKDVKTNKKIQELGKYCVEEYNHSLRKYNQIMQKDNIELLNFVEVLEAETQ  88

Query  491  VVSGFKYYLKISAASSGGARRIYDAVVVVKPWAADSRELLDFAP  360
            VVSG KYYLKIS  + G   ++YDA +V+K W    +EL+ F+P
Sbjct  89   VVSGIKYYLKISTFTLGIV-KVYDAELVIKSW-EKKKELIHFSP  130



>gb|KEH20629.1| cysteine protease inhibitor cystatin [Medicago truncatula]
Length=133

 Score =   105 bits (263),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 57/105 (54%), Positives = 75/105 (71%), Gaps = 5/105 (5%)
 Frame = -2

Query  656  GRKVGGRTEVKDVKNNEEVQELGRYCVREYNKVLQEKQGGGGLLSFSEVVKAETQVVSGF  477
             R VGG+TEV +V+ N+EVQELGR+ V EYN+ ++  + G G L F EVV+A+ QVVSG 
Sbjct  29   SRMVGGKTEVANVRTNDEVQELGRFAVEEYNRSVKIWKEGEGELRFVEVVEAQQQVVSGI  88

Query  476  KYYLKI---SAASSG-GARRIYDAVVVVKPWAADSRELLDFAPSP  354
            KYY+KI    A S G G   ++D+VV+VKPW  +S+ LL FAPSP
Sbjct  89   KYYMKIWVTQAKSDGVGDPTMFDSVVLVKPW-LNSKHLLHFAPSP  132



>ref|XP_010314744.1| PREDICTED: cysteine proteinase inhibitor B-like [Solanum lycopersicum]
Length=136

 Score =   105 bits (263),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 53/104 (51%), Positives = 74/104 (71%), Gaps = 7/104 (7%)
 Frame = -2

Query  656  GRKVGGRTEVKDVKNNEEVQELGRYCVREYNKVLQE-----KQGGGGLLSFSEVVKAETQ  492
            GRKVGGRT +KDVK N+++QELG+YCV EYN  L++     ++     L+F EV++AETQ
Sbjct  29   GRKVGGRTPIKDVKTNKKIQELGKYCVEEYNHSLKKYNHIMQKDNIEFLNFVEVLEAETQ  88

Query  491  VVSGFKYYLKISAASSGGARRIYDAVVVVKPWAADSRELLDFAP  360
            +VSG KYYLKIS  + G   +I+DA +V+K W    +EL+ F+P
Sbjct  89   IVSGIKYYLKISTFTLGMV-KIFDAELVIKSW-EKKKELIHFSP  130



>ref|XP_002320446.1| cystatin family protein [Populus trichocarpa]
 gb|EEE98761.1| cystatin family protein [Populus trichocarpa]
Length=138

 Score =   105 bits (262),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 57/102 (56%), Positives = 72/102 (71%), Gaps = 3/102 (3%)
 Frame = -2

Query  656  GRKVGGRTEVKDVKNNEEVQELGRYCVREYN--KVLQEKQGGGGLLSFSEVVKAETQVVS  483
            G  VGGR+EV DVK N++VQELGR+ V+E+N  + L  K GG G L FSEVV+A  QVVS
Sbjct  31   GGMVGGRSEVSDVKTNKQVQELGRFSVKEFNSHRSLYWKGGGVGKLMFSEVVEAHKQVVS  90

Query  482  GFKYYLKISAASSGGARRIYDAVVVVKPWAADSRELLDFAPS  357
            G KYYL I A +  G +R++D+VVVV+P    + ELL F PS
Sbjct  91   GLKYYLNIVATTQNGEKRMFDSVVVVQP-GLRTTELLTFEPS  131



>emb|CAG38126.1| cystatin Hv-CPI5 [Hordeum vulgare subsp. vulgare]
 dbj|BAK02746.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=151

 Score =   105 bits (262),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 61/111 (55%), Positives = 78/111 (70%), Gaps = 12/111 (11%)
 Frame = -2

Query  656  GRKVGGRTEVKDVKNNEEVQELGRYCVREYNKVLQEK-QGGG---GLLSFSEVVKAETQV  489
            GRKVGG TEV+DV+ + EVQELGRY V E+N+  +E  +GGG   G L F+ VV A+ QV
Sbjct  40   GRKVGGWTEVRDVEGDREVQELGRYSVEEHNRRREEGCEGGGAVCGRLEFARVVSAQRQV  99

Query  488  VSGFKYYLKISAASSGGA-------RRIYDAVVVVKPWAADSRELLDFAPS  357
            VSG KYYL+++AA + GA        R++DAVVVVKPW   SR L+ FAP+
Sbjct  100  VSGVKYYLRVAAAEANGAGSNGVSDGRVFDAVVVVKPW-LQSRSLVRFAPA  149



>ref|XP_010673372.1| PREDICTED: cysteine proteinase inhibitor B [Beta vulgaris subsp. 
vulgaris]
Length=147

 Score =   105 bits (261),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 58/123 (47%), Positives = 79/123 (64%), Gaps = 14/123 (11%)
 Frame = -2

Query  656  GRKVGGRTEVKDVKNNEEVQELGRYCVREYNK-VLQEKQG---------GGGLLSFSEVV  507
            GR VG + E+ DV  N+EVQELG++ V EYN+ +L  +Q            G L+F +VV
Sbjct  26   GRMVGTKKEITDVNTNKEVQELGKFSVEEYNREILNMQQSPLRSVGLGDTNGPLNFVKVV  85

Query  506  KAETQVVSGFKYYLKISAASSGGARRIYDAVVVVKPWAADSRELLDFAPSPD---SDHPS  336
            KA+ QVV+G KYYLK+ A +  G  RI+DAVVVVKPW  +S++LL+F PS      + PS
Sbjct  86   KAQKQVVAGLKYYLKVEA-TKDGVTRIFDAVVVVKPWVHESKKLLNFGPSSRLSLPEAPS  144

Query  335  KQF  327
            +Q 
Sbjct  145  EQM  147



>ref|XP_003524913.1| PREDICTED: cysteine proteinase inhibitor 4-like isoform 1 [Glycine 
max]
Length=130

 Score =   104 bits (260),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 54/102 (53%), Positives = 77/102 (75%), Gaps = 3/102 (3%)
 Frame = -2

Query  656  GRKVGGRTEVKDVKNNEEVQELGRYCVREYNKVLQEKQGGGGLLSFSEVVKAETQVVSGF  477
            G  VGGR+++ DVK N++VQ+LGR+ V E+N++L++ Q     ++F EVV+A+ QVVSG 
Sbjct  28   GGLVGGRSKIPDVKANKKVQDLGRFSVEEHNRMLRQAQKEEEQVTFVEVVEAQQQVVSGI  87

Query  476  KYYLKISAAS--SGGARRIYDAVVVVKPWAADSRELLDFAPS  357
            KYY+KISA     GG  RI+++VVVVKPW   S++LL+FAPS
Sbjct  88   KYYMKISATQGGDGGDSRIFESVVVVKPW-LRSKQLLNFAPS  128



>ref|XP_006492987.1| PREDICTED: cysteine proteinase inhibitor 2-like [Citrus sinensis]
Length=130

 Score =   104 bits (259),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 57/106 (54%), Positives = 77/106 (73%), Gaps = 9/106 (8%)
 Frame = -2

Query  653  RKVGGRTEVKDVKNNEEVQELGRYCVREYNKVLQEKQG------GGGLLSFSEVVKAETQ  492
            R VGGR+EVKDVK N+EVQELG++CV E+N+  Q++QG        G L FS+V++A+ Q
Sbjct  26   RLVGGRSEVKDVKKNKEVQELGKFCVEEFNRS-QQRQGKVIRNVAFGRLRFSQVLEAQKQ  84

Query  491  VVSGFKYYLKISAAS-SGGARRIYDAVVVVKPWAADSRELLDFAPS  357
            VVSG KYYL I A +   G  ++++++VVVKPW   S+ELL FAPS
Sbjct  85   VVSGIKYYLIIEATTGENGEIQMFNSIVVVKPW-LHSKELLKFAPS  129



>ref|XP_009373605.1| PREDICTED: cysteine proteinase inhibitor B-like [Pyrus x bretschneideri]
Length=123

 Score =   103 bits (258),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 55/100 (55%), Positives = 74/100 (74%), Gaps = 3/100 (3%)
 Frame = -2

Query  656  GRKVGGRTEVKDVKNNEEVQELGRYCVREYNKVL-QEKQGGGGLLSFSEVVKAETQVVSG  480
            G  +GGR E+++VK NEEVQELGR+ V EYN+    +K  GGG L F EVV+A++QVVSG
Sbjct  22   GGMLGGRKEIENVKTNEEVQELGRFSVEEYNRQRGTQKMDGGGELQFLEVVEAQSQVVSG  81

Query  479  FKYYLKISAASSGGARRIYDAVVVVKPWAADSRELLDFAP  360
             KYY+K+SA  + G   ++D+ VVVKPW   S++LL+FAP
Sbjct  82   LKYYIKVSAVRN-GVHMLFDSEVVVKPW-LRSKQLLNFAP  119



>gb|KDP32576.1| hypothetical protein JCGZ_13126 [Jatropha curcas]
Length=197

 Score =   105 bits (263),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 54/97 (56%), Positives = 72/97 (74%), Gaps = 2/97 (2%)
 Frame = -2

Query  647  VGGRTEVKDVKNNEEVQELGRYCVREYNKVLQEKQGGGGLLSFSEVVKAETQVVSGFKYY  468
            VGGRTEVKDV+ N+EVQ+LG++ V E+N+ +     GG  L FSEVV+A+ QVVSG KYY
Sbjct  28   VGGRTEVKDVETNQEVQDLGKFSVEEFNEQIHRHGNGGEELIFSEVVEAQRQVVSGIKYY  87

Query  467  LKISAASS-GGARRIYDAVVVVKPWAADSRELLDFAP  360
            LKI AA+   G  +++D+VVVVK W  +S+EL+ F P
Sbjct  88   LKIEAATKVNGEMKVFDSVVVVKAW-LESKELISFEP  123



>ref|XP_009378164.1| PREDICTED: cysteine proteinase inhibitor B-like [Pyrus x bretschneideri]
Length=124

 Score =   103 bits (257),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 56/101 (55%), Positives = 75/101 (74%), Gaps = 4/101 (4%)
 Frame = -2

Query  656  GRKVGGRTEVKDVKNNEEVQELGRYCVREYN--KVLQEKQGGGGLLSFSEVVKAETQVVS  483
            G  VGGR ++++VK+N+EVQELGR+ V EYN  +    K  GGG L F EVV+A++QVVS
Sbjct  22   GGMVGGRRQIENVKSNKEVQELGRFSVAEYNSRQKASRKMDGGGELQFLEVVEAQSQVVS  81

Query  482  GFKYYLKISAASSGGARRIYDAVVVVKPWAADSRELLDFAP  360
            G KYYLK+SA  + GA  ++D+ VVVKPW   S++LL+FAP
Sbjct  82   GIKYYLKVSAVKN-GAHMLFDSEVVVKPW-LRSKQLLNFAP  120



>ref|XP_010926673.1| PREDICTED: cysteine proteinase inhibitor 5 [Elaeis guineensis]
Length=126

 Score =   103 bits (257),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 58/100 (58%), Positives = 69/100 (69%), Gaps = 5/100 (5%)
 Frame = -2

Query  656  GRKVGGRTEVKDVKNNEEVQELGRYCVREYNKVLQEKQGGGGLLSFSEVVKAETQVVSGF  477
            GRKVGGRTEV  V++++EVQ+LG +CV EYN+ L    G    L+F  VV AE QVVSG 
Sbjct  29   GRKVGGRTEVPHVESDKEVQDLGLFCVEEYNQRLH--GGRSEALTFLRVVAAERQVVSGI  86

Query  476  KYYLKISAASSGGARRIYDAVVVVKPWAADSRELLDFAPS  357
            KYYLKI+A    G  R +DA+VVVKPW   SR LL F PS
Sbjct  87   KYYLKIAARD--GRERTFDAIVVVKPW-LKSRSLLSFTPS  123



>ref|XP_009371093.1| PREDICTED: cysteine proteinase inhibitor B [Pyrus x bretschneideri]
Length=123

 Score =   103 bits (256),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 55/100 (55%), Positives = 74/100 (74%), Gaps = 3/100 (3%)
 Frame = -2

Query  656  GRKVGGRTEVKDVKNNEEVQELGRYCVREYNKVL-QEKQGGGGLLSFSEVVKAETQVVSG  480
            G  +GGR E+++VK N+EVQELGR+ V EYN+    +K  GGG L F EVV+A++QVVSG
Sbjct  22   GGMLGGRKEIENVKTNKEVQELGRFSVEEYNRQRGTQKMDGGGELQFLEVVEAQSQVVSG  81

Query  479  FKYYLKISAASSGGARRIYDAVVVVKPWAADSRELLDFAP  360
             KYYLK+SA  + G   ++D+ VVVKPW   S++LL+FAP
Sbjct  82   LKYYLKVSAVRN-GVHMLFDSEVVVKPW-LRSKQLLNFAP  119



>ref|XP_009402733.1| PREDICTED: cysteine proteinase inhibitor 4-like [Musa acuminata 
subsp. malaccensis]
Length=147

 Score =   103 bits (257),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 56/104 (54%), Positives = 71/104 (68%), Gaps = 8/104 (8%)
 Frame = -2

Query  656  GRKVGGRTEVKDVKNNEEVQELGRYCVREYNKVLQEKQGGGGLLSFSEVVKAETQVVSGF  477
            GR VG RTEV+DV+ N+EVQ+LG + V EYN+ L  +  G GLL+FS V  A+ QVVSG 
Sbjct  28   GRMVGARTEVQDVETNKEVQDLGLFSVDEYNRRLALR--GAGLLTFSRVAAAQRQVVSGI  85

Query  476  KYYLKISAASSGGA-----RRIYDAVVVVKPWAADSRELLDFAP  360
            KYYL++ AA  G        R +DAVV+VKPW + SR L+ FAP
Sbjct  86   KYYLQVVAAVEGTGEEGQQHRTFDAVVIVKPWLS-SRSLVSFAP  128



>ref|XP_004971036.1| PREDICTED: cysteine proteinase inhibitor 4-like [Setaria italica]
Length=160

 Score =   103 bits (258),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 59/108 (55%), Positives = 73/108 (68%), Gaps = 12/108 (11%)
 Frame = -2

Query  656  GRKVGGRTEVKDVKNNEEVQELGRYCVREYNKVLQEKQGGGGLLSFSEVVKAETQVVSGF  477
            GRKVG RTEV+DV+ +EEVQELGR+ V EYN+         G L F+ VV A+ QVVSG 
Sbjct  54   GRKVGARTEVRDVEGDEEVQELGRFSVAEYNRRRVGGG---GRLEFARVVAAQRQVVSGL  110

Query  476  KYYLKISAASSGGA--------RRIYDAVVVVKPWAADSRELLDFAPS  357
            KYYL+++A   GGA         R++DAVVVVKPW  +SR LL FAP+
Sbjct  111  KYYLRVAAEEEGGAENAGSGEGERVFDAVVVVKPW-LESRTLLRFAPA  157



>ref|XP_008792948.1| PREDICTED: cysteine proteinase inhibitor 4 [Phoenix dactylifera]
Length=125

 Score =   102 bits (254),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 56/94 (60%), Positives = 66/94 (70%), Gaps = 6/94 (6%)
 Frame = -2

Query  638  RTEVKDVKNNEEVQELGRYCVREYNKVLQEKQGGGGLLSFSEVVKAETQVVSGFKYYLKI  459
            RTEV  V++N+EVQ+LG +CV EYN   Q   GGG +L+F  V+ AE QVVSG KYYLKI
Sbjct  35   RTEVPHVESNKEVQDLGLFCVEEYN---QHLHGGGEVLTFLRVLAAERQVVSGIKYYLKI  91

Query  458  SAASSGGARRIYDAVVVVKPWAADSRELLDFAPS  357
              A+  G  R +DAVVVVKPW   SR LL FAPS
Sbjct  92   --AARDGRERSFDAVVVVKPW-LKSRSLLSFAPS  122



>ref|XP_004504436.1| PREDICTED: cysteine proteinase inhibitor 4-like [Cicer arietinum]
Length=130

 Score =   102 bits (255),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 54/106 (51%), Positives = 72/106 (68%), Gaps = 7/106 (7%)
 Frame = -2

Query  656  GRKVGGRTEVKDVKNNEEVQELGRYCVREYNKVLQEKQGGGGLLSFSEVVKAETQVVSGF  477
            GR VGG+TE+ +V+ NEEVQ++GRY V EYN+  +  + G G L F EVV+A+ QVVSG 
Sbjct  24   GRMVGGKTEISNVRTNEEVQDIGRYSVEEYNRSKKVWKEGEGELQFVEVVEAQQQVVSGI  83

Query  476  KYYLKISAASS------GGARRIYDAVVVVKPWAADSRELLDFAPS  357
            KYY+K+    S       G   ++D+VVVVKPW  +S+ LL FAPS
Sbjct  84   KYYMKLWVTRSQIDGDGDGVPTMFDSVVVVKPW-LNSKHLLHFAPS  128



>ref|XP_006421050.1| hypothetical protein CICLE_v10006584mg [Citrus clementina]
 gb|ESR34290.1| hypothetical protein CICLE_v10006584mg [Citrus clementina]
Length=130

 Score =   102 bits (254),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 56/106 (53%), Positives = 76/106 (72%), Gaps = 9/106 (8%)
 Frame = -2

Query  653  RKVGGRTEVKDVKNNEEVQELGRYCVREYNKVLQEKQG------GGGLLSFSEVVKAETQ  492
            R VGGR+EVKDVK N+EVQELG++ V E+N+  Q++QG        G L FS+V++A+ Q
Sbjct  26   RLVGGRSEVKDVKKNKEVQELGKFSVEEFNRS-QQRQGKVIRNVAFGRLRFSQVLEAQKQ  84

Query  491  VVSGFKYYLKISAAS-SGGARRIYDAVVVVKPWAADSRELLDFAPS  357
            VVSG KYYL I A +   G  +++D++VV+KPW   S+ELL FAPS
Sbjct  85   VVSGIKYYLTIEATTGENGEIQMFDSIVVIKPW-LHSKELLKFAPS  129



>ref|XP_010522274.1| PREDICTED: cysteine proteinase inhibitor 2-like [Tarenaya hassleriana]
Length=132

 Score =   102 bits (253),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 51/96 (53%), Positives = 69/96 (72%), Gaps = 1/96 (1%)
 Frame = -2

Query  650  KVGGRTEVKDVKNNEEVQELGRYCVREYNKVLQEKQGGGGLLSFSEVVKAETQVVSGFKY  471
            +VGG+TE++ V  N+EVQ+LGRYCV E+N+  QEK G    L F+ VV+A  QVVSG KY
Sbjct  35   EVGGKTEIQGVDGNKEVQDLGRYCVEEFNRKEQEKNGNVAPLVFNRVVEARQQVVSGTKY  94

Query  470  YLKISAASSGGARRIYDAVVVVKPWAADSRELLDFA  363
            +LKI    S    +++++VVVVKPW   SREL+DF+
Sbjct  95   FLKIETTLSDRTTKMFNSVVVVKPW-LQSRELVDFS  129



>ref|XP_008337489.1| PREDICTED: cysteine proteinase inhibitor B [Malus domestica]
Length=123

 Score =   101 bits (252),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 54/100 (54%), Positives = 74/100 (74%), Gaps = 3/100 (3%)
 Frame = -2

Query  656  GRKVGGRTEVKDVKNNEEVQELGRYCVREYNKVL-QEKQGGGGLLSFSEVVKAETQVVSG  480
            G  +GGR E+++VK N+EVQELGR+ V EYN+    +K  GGG L F EVV+A++QVVSG
Sbjct  22   GGMLGGRKEIENVKTNKEVQELGRFSVEEYNRQRGTQKMDGGGELQFLEVVEAQSQVVSG  81

Query  479  FKYYLKISAASSGGARRIYDAVVVVKPWAADSRELLDFAP  360
             KYY+K+SA  + G   ++D+ VVVKPW   S++LL+FAP
Sbjct  82   IKYYVKVSAVRN-GVHMLFDSEVVVKPW-LRSKQLLNFAP  119



>ref|XP_007163791.1| hypothetical protein PHAVU_001G264400g [Phaseolus vulgaris]
 gb|ESW35785.1| hypothetical protein PHAVU_001G264400g [Phaseolus vulgaris]
Length=130

 Score =   100 bits (249),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 54/101 (53%), Positives = 71/101 (70%), Gaps = 3/101 (3%)
 Frame = -2

Query  656  GRKVGGRTEVKDVKNNEEVQELGRYCVREYNKVLQ-EKQGGGGLLSFSEVVKAETQVVSG  480
             R VGG+TE+ DV+ N EVQELGR+ V EYN  L+         L+FSEVV+A+ QVVSG
Sbjct  21   ARLVGGKTEIPDVRTNREVQELGRFSVEEYNNGLKLYNDSDNEKLTFSEVVEAQQQVVSG  80

Query  479  FKYYLKISAASSGGARRIYDAVVVVKPWAADSRELLDFAPS  357
             KYYLKIS A+  G  +++ +VVVVKPW   S++LL F+P+
Sbjct  81   VKYYLKIS-ATHRGIHKMFSSVVVVKPW-IHSKKLLHFSPA  119



>ref|XP_003552894.1| PREDICTED: cysteine proteinase inhibitor 4-like [Glycine max]
Length=142

 Score =   100 bits (250),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 54/105 (51%), Positives = 73/105 (70%), Gaps = 7/105 (7%)
 Frame = -2

Query  656  GRKVGGRTEVKDVKNNEEVQELGRYCVREYN---KVLQEKQGGGGL--LSFSEVVKAETQ  492
             R VGG+TE+ +V+ N +VQELGR+ V EYN   K+L+      G   L+FS VV+A+ Q
Sbjct  21   ARMVGGKTEIPEVRKNRQVQELGRFAVEEYNLGLKLLKNNNVDNGREQLNFSAVVEAQQQ  80

Query  491  VVSGFKYYLKISAASSGGARRIYDAVVVVKPWAADSRELLDFAPS  357
            VVSG KYYLKIS A+  G   ++++VVVVKPW   S++LL FAP+
Sbjct  81   VVSGMKYYLKIS-ATHNGVHEMFNSVVVVKPW-LHSKQLLHFAPA  123



>gb|KHN24041.1| Cysteine proteinase inhibitor 2, partial [Glycine soja]
Length=151

 Score =   100 bits (250),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 54/105 (51%), Positives = 73/105 (70%), Gaps = 7/105 (7%)
 Frame = -2

Query  656  GRKVGGRTEVKDVKNNEEVQELGRYCVREYN---KVLQEKQGGGGL--LSFSEVVKAETQ  492
             R VGG+TE+ +V+ N +VQELGR+ V EYN   K+L+      G   L+FS VV+A+ Q
Sbjct  30   ARMVGGKTEIPEVRKNRQVQELGRFAVEEYNLGLKLLKNNNVDNGREQLNFSAVVEAQQQ  89

Query  491  VVSGFKYYLKISAASSGGARRIYDAVVVVKPWAADSRELLDFAPS  357
            VVSG KYYLKIS A+  G   ++++VVVVKPW   S++LL FAP+
Sbjct  90   VVSGMKYYLKIS-ATHNGVHEMFNSVVVVKPW-LHSKQLLHFAPA  132



>ref|XP_010557035.1| PREDICTED: cysteine proteinase inhibitor 2-like [Tarenaya hassleriana]
Length=149

 Score =   100 bits (249),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 54/106 (51%), Positives = 72/106 (68%), Gaps = 12/106 (11%)
 Frame = -2

Query  644  GGRTEVKDVKNNEEVQELGRYCVREYN-KVLQEKQGGGG----------LLSFSEVVKAE  498
            GGR+EV+DV++N E+QELGRYCV+E+N +  +E + G G           L FS VV+A+
Sbjct  34   GGRSEVQDVESNRELQELGRYCVQEFNLREEREHEKGRGSTSEEAAVFDPLMFSRVVEAQ  93

Query  497  TQVVSGFKYYLKISAASSGGARRIYDAVVVVKPWAADSRELLDFAP  360
             QVVSG KY+LKI    S    R++ +VVV+KPW   SRELLDF+P
Sbjct  94   EQVVSGIKYFLKIEVTLSDRTTRMFTSVVVIKPW-LQSRELLDFSP  138



>ref|XP_010542782.1| PREDICTED: cysteine proteinase inhibitor 2-like [Tarenaya hassleriana]
Length=145

 Score = 99.8 bits (247),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 54/104 (52%), Positives = 72/104 (69%), Gaps = 9/104 (9%)
 Frame = -2

Query  647  VGGRTEVKDVKNNEEVQELGRYCVREYN-KVLQEKQGGG-------GLLSFSEVVKAETQ  492
            VGG+++V DV++N+E+QELGRYCV E+N K  + ++G G       G L FS VV+A+ Q
Sbjct  34   VGGKSDVPDVESNKELQELGRYCVEEFNLKEGRREKGSGEEEEEVLGPLVFSRVVEAQRQ  93

Query  491  VVSGFKYYLKISAASSGGARRIYDAVVVVKPWAADSRELLDFAP  360
            VVSG KY+LKI         R++ +VVVVKPW   SRELLDF+P
Sbjct  94   VVSGIKYFLKIEVTLPDRTTRMFSSVVVVKPWLP-SRELLDFSP  136



>gb|AFK48234.1| unknown [Medicago truncatula]
Length=133

 Score = 99.4 bits (246),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 53/98 (54%), Positives = 68/98 (69%), Gaps = 1/98 (1%)
 Frame = -2

Query  647  VGGRTEVKDVKNNEEVQELGRYCVREYN-KVLQEKQGGGGLLSFSEVVKAETQVVSGFKY  471
            VG RTE+ DV  N+EVQELG++ V+EYN K      GGG  L F EVV+AE QVVSG KY
Sbjct  27   VGARTEISDVGTNKEVQELGKFAVKEYNYKQGLNNGGGGEGLKFVEVVEAEQQVVSGMKY  86

Query  470  YLKISAASSGGARRIYDAVVVVKPWAADSRELLDFAPS  357
            YL ISA    G +R++++VVVVKPW    ++++ F PS
Sbjct  87   YLNISAVDHNGVQRMFNSVVVVKPWLHQYKKVIHFGPS  124



>emb|CAJ20032.1| putative cystatin [Zea mays]
Length=120

 Score = 98.2 bits (243),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 60/105 (57%), Positives = 74/105 (70%), Gaps = 7/105 (7%)
 Frame = -2

Query  656  GRKVGGRTEVKDVKNNEEVQELGRYCVREYNKVLQEKQGGGGLLSFSEVVKAETQVVSGF  477
            GRKVG RTEV+DV+ + EVQELGR+ V EYN+ L++   GGG L F  VV A+ QVVSG 
Sbjct  15   GRKVGARTEVRDVEGDGEVQELGRFSVAEYNRQLRDGG-GGGRLEFGRVVAAQRQVVSGL  73

Query  476  KYYLKISAA-----SSGGARRIYDAVVVVKPWAADSRELLDFAPS  357
            KYYL++ A      +  G  R++DAVVVVKPW  DSR LL FAP+
Sbjct  74   KYYLRVVAVEEGGGAGNGGERVFDAVVVVKPW-LDSRTLLTFAPA  117



>ref|XP_008799565.1| PREDICTED: cysteine proteinase inhibitor 10-like [Phoenix dactylifera]
Length=219

 Score =   100 bits (249),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 56/97 (58%), Positives = 69/97 (71%), Gaps = 5/97 (5%)
 Frame = -2

Query  647  VGGRTEVKDVKNNEEVQELGRYCVREYNKVLQEKQGGGGLLSFSEVVKAETQVVSGFKYY  468
            VGGR EV +V++++EVQ+LG +CV EYN   + + GG  LL+F  VV AE QVVSG KYY
Sbjct  125  VGGRKEVPNVESDKEVQDLGLFCVEEYNH--RRRVGGEELLTFLRVVAAERQVVSGIKYY  182

Query  467  LKISAASSGGARRIYDAVVVVKPWAADSRELLDFAPS  357
            LKI  A+  G    +DAVVVV+PW  DSR LL FAPS
Sbjct  183  LKI--AARDGREVTFDAVVVVRPW-LDSRFLLSFAPS  216



>ref|XP_006646602.1| PREDICTED: cysteine proteinase inhibitor 4-like [Oryza brachyantha]
Length=146

 Score = 98.6 bits (244),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 61/114 (54%), Positives = 75/114 (66%), Gaps = 14/114 (12%)
 Frame = -2

Query  656  GRKVGGRTEVKDVKNNEEVQELGRYCVREYNKVLQEKQGGGGLLSFSEVVKAETQVVSGF  477
            GRKVGGRTEV DV+ + EVQELGR+ V E+N+  +    G   L FS VV A+ QVVSG 
Sbjct  35   GRKVGGRTEVMDVEGDREVQELGRFSVEEHNR--RRDCCGDVRLEFSRVVAAQRQVVSGL  92

Query  476  KYYLKISAAS--------SGGA---RRIYDAVVVVKPWAADSRELLDFAPSPDS  348
             YYL+++AA         +GG     R+YDAVVVVKPW  +SR LL FAP+ DS
Sbjct  93   MYYLRVAAAEEGAAAADQNGGGDHHARVYDAVVVVKPW-LESRTLLTFAPAADS  145



>ref|XP_004502264.1| PREDICTED: cysteine proteinase inhibitor 2-like [Cicer arietinum]
Length=134

 Score = 97.8 bits (242),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 51/97 (53%), Positives = 63/97 (65%), Gaps = 2/97 (2%)
 Frame = -2

Query  647  VGGRTEVKDVKNNEEVQELGRYCVREYNKVLQEKQGGGG-LLSFSEVVKAETQVVSGFKY  471
            VG +TE+ D + N EVQELG++ V EYN       GGGG  L F EVV+A+ QVVSG KY
Sbjct  26   VGAKTEISDARTNREVQELGKFAVEEYNYKQGLNNGGGGEALKFVEVVEAQQQVVSGMKY  85

Query  470  YLKISAASSGGARRIYDAVVVVKPWAADSRELLDFAP  360
            YL ISA    G  R++ +VVVVKPW    ++LL F P
Sbjct  86   YLNISATDRSGIHRMFTSVVVVKPW-LQYKKLLHFEP  121



>ref|XP_003564913.1| PREDICTED: cysteine proteinase inhibitor 4-like [Brachypodium 
distachyon]
Length=161

 Score = 98.6 bits (244),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 57/114 (50%), Positives = 71/114 (62%), Gaps = 20/114 (18%)
 Frame = -2

Query  653  RKVGGRTEVKDVKNNEEVQELGRYCVREYNKVLQEKQGGGGLLSFSEVVKAETQVVSGFK  474
            RKVG RTEV+DV+ N EVQELGRY V E+N+  ++     G L F  VV A+ QVVSG K
Sbjct  50   RKVGARTEVRDVEGNREVQELGRYSVDEHNRRREDD----GRLEFGRVVSAQRQVVSGLK  105

Query  473  YYLKISAAS---------------SGGARRIYDAVVVVKPWAADSRELLDFAPS  357
            YYL+++AA                +    R++DAVVVVKPW  DSR LL FAP+
Sbjct  106  YYLRVAAAELPQQQQEEGINNNNKAVEGERVFDAVVVVKPW-LDSRALLRFAPA  158



>ref|XP_002301749.1| cystatin family protein [Populus trichocarpa]
 gb|EEE81022.1| cystatin family protein [Populus trichocarpa]
Length=135

 Score = 97.8 bits (242),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 52/96 (54%), Positives = 67/96 (70%), Gaps = 3/96 (3%)
 Frame = -2

Query  638  RTEVKDVKNNEEVQELGRYCVREYNKVLQEKQGGG--GLLSFSEVVKAETQVVSGFKYYL  465
            R +V DVK N+E+QELGR+ V+E+N        GG  G L FSEVV+A+TQVVSG KYYL
Sbjct  36   RAKVSDVKTNKEIQELGRFSVKEFNNHRSTYGKGGEVGELMFSEVVEAQTQVVSGVKYYL  95

Query  464  KISAASSGGARRIYDAVVVVKPWAADSRELLDFAPS  357
            KI A +    + ++D+V+VVKPW   S+ELL F PS
Sbjct  96   KIEATTQSEEKLMFDSVLVVKPW-LRSKELLAFEPS  130



>gb|ABS52572.1| cysteine proteinase inhibitor [Gossypium hirsutum]
Length=125

 Score = 97.4 bits (241),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 53/104 (51%), Positives = 70/104 (67%), Gaps = 9/104 (9%)
 Frame = -2

Query  647  VGGRTEVKDVKNNEEVQELGRYCVREYNKVLQEKQ-------GGGGLLSFSEVVKAETQV  489
            +GGR  + DVKNN+EVQELGR+ V EYN+  Q +        G    L FS+VV AE QV
Sbjct  22   LGGRMRINDVKNNKEVQELGRFSVEEYNRRSQGRLRFSLANGGPSTALVFSQVVGAEKQV  81

Query  488  VSGFKYYLKISAASSGGARRIYDAVVVVKPWAADSRELLDFAPS  357
            V+G KYYLKI A   GG  + +++VV+VKPW   S++LL+F+PS
Sbjct  82   VAGIKYYLKIKAM-QGGVTKTFESVVLVKPW-VQSKDLLNFSPS  123



>emb|CDM85644.1| unnamed protein product [Triticum aestivum]
Length=153

 Score = 97.8 bits (242),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 60/112 (54%), Positives = 75/112 (67%), Gaps = 13/112 (12%)
 Frame = -2

Query  656  GRKVGGRTEVKDVKNNEEVQELGRYCVREYNKVLQEKQGGG-----GLLSFSEVVKAETQ  492
            GRKVGGRTEV+DV+ + EVQELGRY V E+N+  +E   GG       L F+ VV A+ Q
Sbjct  40   GRKVGGRTEVRDVEGDREVQELGRYSVEEHNRRREEGCEGGGGGVCARLEFARVVSAQRQ  99

Query  491  VVSGFKYYLKISAASSGGA-------RRIYDAVVVVKPWAADSRELLDFAPS  357
            VVSG KYYL+++AA   GA        R++DAVVVVKPW   SR L+ FAP+
Sbjct  100  VVSGIKYYLRVAAAVDNGAGSNGISDGRVFDAVVVVKPW-LQSRALVRFAPA  150



>gb|EMT28873.1| Cysteine proteinase inhibitor 4 [Aegilops tauschii]
Length=152

 Score = 97.8 bits (242),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 59/111 (53%), Positives = 73/111 (66%), Gaps = 12/111 (11%)
 Frame = -2

Query  656  GRKVGGRTEVKDVKNNEEVQELGRYCVREYN----KVLQEKQGGGGLLSFSEVVKAETQV  489
            GRKVGGRTEV DV+ + E QELGRY V E+N    +  +   G  G L F+ VV A+ QV
Sbjct  40   GRKVGGRTEVTDVEGDREGQELGRYSVEEHNRRREEGCEGGGGVCGRLEFARVVSAQRQV  99

Query  488  VSGFKYYLKISAASSGGA-------RRIYDAVVVVKPWAADSRELLDFAPS  357
            VSG KYYL+++AA  GGA        R++DAVVVVKPW   SR L+ FAP+
Sbjct  100  VSGIKYYLRVAAAEEGGAGSNGVTDGRVFDAVVVVKPW-LQSRALIRFAPA  149



>ref|XP_010243160.1| PREDICTED: cysteine proteinase inhibitor 2-like [Nelumbo nucifera]
Length=145

 Score = 97.1 bits (240),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 57/110 (52%), Positives = 70/110 (64%), Gaps = 13/110 (12%)
 Frame = -2

Query  647  VGGRTEVKDVKNNEEVQELGRYCVREYNK-------VLQEKQGGG----GLLSFSEVVKA  501
            VGGRT+VK+VK N E+Q+LGR+ V E+N+       VL   QG      G L FSEVV A
Sbjct  35   VGGRTDVKNVKCNHEIQKLGRFSVEEFNRRKQQEEVVLLHGQGTSNSDDGELVFSEVVMA  94

Query  500  ETQVVSGFKYYLKISAASSGGARRIYDAVVVVKPWAADSRELLDFAPSPD  351
            E QVVSG  YYL I A   G  +R +DAVV VKPW   S++LL F+PS +
Sbjct  95   ERQVVSGINYYLHIEALQHGMTKR-FDAVVAVKPWLP-SKQLLAFSPSTN  142



>ref|NP_180758.1| cysteine proteinase inhibitor 2 [Arabidopsis thaliana]
 sp|Q8L5T9.2|CYT2_ARATH RecName: Full=Cysteine proteinase inhibitor 2; Short=AtCYS-2; 
Flags: Precursor [Arabidopsis thaliana]
 gb|AAD15406.1| putative cysteine proteinase inhibitor B (cystatin B) [Arabidopsis 
thaliana]
 dbj|BAF01107.1| putative cysteine proteinase inhibitor B [Arabidopsis thaliana]
 gb|AEC08615.1| cysteine proteinase inhibitor 2 [Arabidopsis thaliana]
Length=147

 Score = 95.9 bits (237),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 45/107 (42%), Positives = 68/107 (64%), Gaps = 12/107 (11%)
 Frame = -2

Query  647  VGGRTEVKDVKNNEEVQELGRYCVREYNKVLQEKQGGGG-----------LLSFSEVVKA  501
            +GG++ V +++ N E+Q+LGRYCV ++N+  Q +QG  G            L FS VV A
Sbjct  36   LGGKSGVPNIRTNREIQQLGRYCVEQFNQQAQNEQGNIGSIAKTDTAISNPLQFSRVVSA  95

Query  500  ETQVVSGFKYYLKISAASSGGARRIYDAVVVVKPWAADSRELLDFAP  360
            + QVV+G KYYL+I      G+ R++D+VVV++PW   S++LL F P
Sbjct  96   QKQVVAGLKYYLRIEVTQPNGSTRMFDSVVVIQPW-LHSKQLLGFTP  141



>gb|AAM64985.1| putative cysteine proteinase inhibitor B (cystatin B) [Arabidopsis 
thaliana]
Length=144

 Score = 95.9 bits (237),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 45/107 (42%), Positives = 68/107 (64%), Gaps = 12/107 (11%)
 Frame = -2

Query  647  VGGRTEVKDVKNNEEVQELGRYCVREYNKVLQEKQGGGG-----------LLSFSEVVKA  501
            +GG++ V +++ N E+Q+LGRYCV ++N+  Q +QG  G            L FS VV A
Sbjct  33   LGGKSGVPNIRTNREIQQLGRYCVEQFNQQAQNEQGNIGSIAKTDTAISNPLQFSRVVSA  92

Query  500  ETQVVSGFKYYLKISAASSGGARRIYDAVVVVKPWAADSRELLDFAP  360
            + QVV+G KYYL+I      G+ R++D+VVV++PW   S++LL F P
Sbjct  93   QKQVVAGLKYYLRIEVTQPNGSTRMFDSVVVIQPW-LHSKQLLGFTP  138



>gb|ACK87021.1| cysteine protease inhibitor [Gossypium hirsutum]
Length=119

 Score = 94.7 bits (234),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 52/104 (50%), Positives = 69/104 (66%), Gaps = 9/104 (9%)
 Frame = -2

Query  647  VGGRTEVKDVKNNEEVQELGRYCVREYNKVLQEKQ-------GGGGLLSFSEVVKAETQV  489
            +GGR  + DVK N+EVQELGR+ V EYN+  Q +        G    L FS+VV AE QV
Sbjct  16   LGGRMRINDVKKNKEVQELGRFSVEEYNRRSQGRLRFSLANGGPSTALVFSQVVGAEKQV  75

Query  488  VSGFKYYLKISAASSGGARRIYDAVVVVKPWAADSRELLDFAPS  357
            V+G KYYLKI A   GG  + +++VV+VKPW   S++LL+F+PS
Sbjct  76   VAGIKYYLKIKAM-QGGVTKTFESVVLVKPW-VQSKDLLNFSPS  117



>ref|NP_001045185.1| Os01g0915200 [Oryza sativa Japonica Group]
 sp|Q5N806.1|CYT4_ORYSJ RecName: Full=Cysteine proteinase inhibitor 4; AltName: Full=Oryzacystatin 
IV; Short=OC-IV; AltName: Full=Oryzacystatin-4; 
Flags: Precursor [Oryza sativa Japonica Group]
 dbj|BAD82395.1| putative cystatin [Oryza sativa Japonica Group]
 dbj|BAF07099.1| Os01g0915200 [Oryza sativa Japonica Group]
 gb|EAZ14605.1| hypothetical protein OsJ_04530 [Oryza sativa Japonica Group]
 dbj|BAH00694.1| unnamed protein product [Oryza sativa Japonica Group]
Length=158

 Score = 95.9 bits (237),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 54/107 (50%), Positives = 72/107 (67%), Gaps = 7/107 (7%)
 Frame = -2

Query  638  RTEVKDVKNNEEVQELGRYCVREYNKVLQEKQGGGGLLSFSEVVKAETQVVSGFKYYLKI  459
            RTEV+DV+ + EVQELGR+ V E+N+  + +  G   L F  VV A+ QVVSG KYYL++
Sbjct  53   RTEVRDVEGDREVQELGRFSVEEHNRRRRSRDCGDVRLEFGRVVAAQRQVVSGLKYYLRV  112

Query  458  ------SAASSGGARRIYDAVVVVKPWAADSRELLDFAPSPDSDHPS  336
                  +A  +GG  R++DAVVVVKPW  +SR LL FAP+ DS + S
Sbjct  113  AAAEEGAAGQNGGEPRVFDAVVVVKPW-LESRTLLTFAPAADSPNES  158



>gb|EAY76949.1| hypothetical protein OsI_04907 [Oryza sativa Indica Group]
Length=159

 Score = 95.9 bits (237),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 54/107 (50%), Positives = 72/107 (67%), Gaps = 7/107 (7%)
 Frame = -2

Query  638  RTEVKDVKNNEEVQELGRYCVREYNKVLQEKQGGGGLLSFSEVVKAETQVVSGFKYYLKI  459
            RTEV+DV+ + EVQELGR+ V E+N+  + +  G   L F  VV A+ QVVSG KYYL++
Sbjct  54   RTEVRDVEGDREVQELGRFSVEEHNRRRRSRDCGDVRLEFGRVVAAQRQVVSGLKYYLRV  113

Query  458  ------SAASSGGARRIYDAVVVVKPWAADSRELLDFAPSPDSDHPS  336
                  +A  +GG  R++DAVVVVKPW  +SR LL FAP+ DS + S
Sbjct  114  AAAEEGAAGQNGGEPRVFDAVVVVKPW-LESRTLLTFAPAADSPNES  159



>ref|XP_006645220.1| PREDICTED: cysteine proteinase inhibitor 5-like [Oryza brachyantha]
Length=143

 Score = 95.1 bits (235),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 56/109 (51%), Positives = 72/109 (66%), Gaps = 11/109 (10%)
 Frame = -2

Query  656  GRKVGGRTEVKDVKNNEEVQELGRYCVREYNKVLQEKQGGGGLLSFSEVVKAETQVVSGF  477
            GRKVGG T V+DV+ N EVQELG +CV E+N+        G  L FS VV A+TQVV+G 
Sbjct  35   GRKVGGTTAVEDVEGNREVQELGLFCVVEHNR-RGSPTARGHRLVFSRVVAAQTQVVAGI  93

Query  476  KYYLKISAASSGGAR-------RIYDAVVVVKPWAADSRELLDFAPSPD  351
            KYYL+I+A +  G R       +++DAVVVVK W   SRE+L FAP+ +
Sbjct  94   KYYLRIAARN--GLREGDDDEEKVFDAVVVVKAW-VPSREMLSFAPAAE  139



>ref|XP_002862941.1| hypothetical protein ARALYDRAFT_497243 [Arabidopsis lyrata subsp. 
lyrata]
 ref|XP_002881207.1| hypothetical protein ARALYDRAFT_482126 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH39200.1| hypothetical protein ARALYDRAFT_497243 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH57466.1| hypothetical protein ARALYDRAFT_482126 [Arabidopsis lyrata subsp. 
lyrata]
Length=147

 Score = 94.7 bits (234),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 46/107 (43%), Positives = 68/107 (64%), Gaps = 12/107 (11%)
 Frame = -2

Query  647  VGGRTEVKDVKNNEEVQELGRYCVREYNKVLQEKQGGGG-----------LLSFSEVVKA  501
            +GG++ V +++ N E+QELGRYCV ++N+  Q +QG  G            L FS VV A
Sbjct  36   LGGKSGVPNIRTNREIQELGRYCVEQFNQQEQTEQGNIGSIAKTDTAMSNPLVFSRVVSA  95

Query  500  ETQVVSGFKYYLKISAASSGGARRIYDAVVVVKPWAADSRELLDFAP  360
            + QVV+G KYYL+I      G+ R++D+VVV++PW   S++LL F P
Sbjct  96   QKQVVAGTKYYLRIEVTQPNGSTRMFDSVVVIQPW-LHSKQLLGFTP  141



>emb|CDY68279.1| BnaC04g54180D [Brassica napus]
Length=140

 Score = 94.4 bits (233),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 45/107 (42%), Positives = 68/107 (64%), Gaps = 12/107 (11%)
 Frame = -2

Query  647  VGGRTEVKDVKNNEEVQELGRYCVREYNKVLQEKQGGGGL-----------LSFSEVVKA  501
            +GGR++V +V+ N E+QELGRYCV+++N   Q KQG               L FS V  A
Sbjct  29   LGGRSDVGNVRTNMEIQELGRYCVKQFNLQQQSKQGNDATNARTDTAVLSPLKFSRVESA  88

Query  500  ETQVVSGFKYYLKISAASSGGARRIYDAVVVVKPWAADSRELLDFAP  360
            + QVV+G KYYL+I+     G  R++D+V+V++PW   S++L++F P
Sbjct  89   QKQVVAGTKYYLRIAVTQPDGTSRMFDSVIVIQPWLF-SKKLIEFTP  134



>ref|XP_007153801.1| hypothetical protein PHAVU_003G065700g [Phaseolus vulgaris]
 gb|ESW25795.1| hypothetical protein PHAVU_003G065700g [Phaseolus vulgaris]
Length=130

 Score = 93.6 bits (231),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 52/101 (51%), Positives = 71/101 (70%), Gaps = 3/101 (3%)
 Frame = -2

Query  656  GRKVGGRTEVKDVKNNEEVQELGRYCVREYNKVL-QEKQGGGGLLSFSEVVKAETQVVSG  480
            G  +G +TE+ DVK N+EVQ+LG + V E+N++L Q  +G      F EVV+A+ Q+VSG
Sbjct  27   GTMLGAKTEITDVKRNKEVQDLGSFSVEEHNRMLRQALKGMSEETKFVEVVEAQKQMVSG  86

Query  479  FKYYLKISAASSGGARRIYDAVVVVKPWAADSRELLDFAPS  357
             KYYLKISA  SG    ++D+VVVV+P  A S++LL FAPS
Sbjct  87   TKYYLKISATQSGNP-VMFDSVVVVQPGLA-SKDLLSFAPS  125



>ref|XP_010469645.1| PREDICTED: cysteine proteinase inhibitor 2-like [Camelina sativa]
Length=146

 Score = 94.0 bits (232),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 46/107 (43%), Positives = 68/107 (64%), Gaps = 12/107 (11%)
 Frame = -2

Query  647  VGGRTEVKDVKNNEEVQELGRYCVREYNKVLQEKQGG-----------GGLLSFSEVVKA  501
            +GG+++V +VK N E+QELGRYCV ++N+  Q ++G               L FS VV A
Sbjct  35   LGGKSDVANVKANREIQELGRYCVEQFNQRGQSEEGNVESIAKTDTDMSNPLRFSRVVSA  94

Query  500  ETQVVSGFKYYLKISAASSGGARRIYDAVVVVKPWAADSRELLDFAP  360
            + QVV+G KYYL+I      G+ R++D+VVV++PW   S++LL F P
Sbjct  95   QKQVVAGTKYYLRIEVTQPNGSTRMFDSVVVIQPW-LHSKQLLGFTP  140



>ref|XP_009132828.1| PREDICTED: cysteine proteinase inhibitor 2-like [Brassica rapa]
 gb|ADD10747.1| phytocystatin 2-2 [Brassica rapa subsp. pekinensis]
Length=141

 Score = 93.6 bits (231),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 48/107 (45%), Positives = 67/107 (63%), Gaps = 14/107 (13%)
 Frame = -2

Query  647  VGGRTEVKDVKNNEEVQELGRYCVREYNKVLQEKQGGGGL-----------LSFSEVVKA  501
            +GG+++V +V+ N EVQELGRYCV ++N  L E+ G G +           L+FS VV A
Sbjct  32   LGGKSDVPNVQTNMEVQELGRYCVEQFN--LHEQSGKGNVASSIDRAVLNPLTFSRVVSA  89

Query  500  ETQVVSGFKYYLKISAASSGGARRIYDAVVVVKPWAADSRELLDFAP  360
            + QVV+G KYYL+I         R++D+VVVV+PW   S+ LL F P
Sbjct  90   QQQVVAGLKYYLRIEVTQPDRTSRMFDSVVVVQPW-LHSKTLLGFTP  135



>ref|XP_006296241.1| hypothetical protein CARUB_v10025408mg [Capsella rubella]
 gb|EOA29139.1| hypothetical protein CARUB_v10025408mg [Capsella rubella]
Length=144

 Score = 93.6 bits (231),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 45/107 (42%), Positives = 68/107 (64%), Gaps = 12/107 (11%)
 Frame = -2

Query  647  VGGRTEVKDVKNNEEVQELGRYCVREYNKVLQEKQGG-----------GGLLSFSEVVKA  501
            +GG+++V +VK N E+Q+LGRYCV ++N+  Q ++G               L FS VV A
Sbjct  33   LGGKSDVPNVKANREIQQLGRYCVEQFNQREQSEEGNVESIAKTDTDMSNPLMFSRVVSA  92

Query  500  ETQVVSGFKYYLKISAASSGGARRIYDAVVVVKPWAADSRELLDFAP  360
            + QVV+G KYYL+I      G+ R++D+VVV++PW   S++LL F P
Sbjct  93   QKQVVAGTKYYLRIEVTQPNGSTRMFDSVVVIQPW-LHSKQLLGFTP  138



>ref|XP_010510121.1| PREDICTED: cysteine proteinase inhibitor 2-like [Camelina sativa]
Length=146

 Score = 93.6 bits (231),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 46/107 (43%), Positives = 68/107 (64%), Gaps = 12/107 (11%)
 Frame = -2

Query  647  VGGRTEVKDVKNNEEVQELGRYCVREYNKVLQEKQGG-----------GGLLSFSEVVKA  501
            +GG+++V +VK N E+QELGRYCV ++N+  Q ++G               L FS VV A
Sbjct  35   LGGKSDVANVKANREIQELGRYCVEQFNQRDQSEEGKVESIAKSDTDMSNPLRFSRVVSA  94

Query  500  ETQVVSGFKYYLKISAASSGGARRIYDAVVVVKPWAADSRELLDFAP  360
            + QVV+G KYYL+I      G+ R++D+VVV++PW   S++LL F P
Sbjct  95   QKQVVAGTKYYLRIEVTQPNGSTRMFDSVVVIQPW-LHSKQLLGFTP  140



>ref|NP_001146946.1| cysteine proteinase inhibitor B precursor [Zea mays]
 gb|ACG24630.1| cysteine proteinase inhibitor B [Zea mays]
Length=150

 Score = 93.6 bits (231),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 62/104 (60%), Positives = 75/104 (72%), Gaps = 5/104 (5%)
 Frame = -2

Query  656  GRKVGGRTEVKDVKNNEEVQELGRYCVREYNKVLQEKQGGGGLLSFSEVVKAETQVVSGF  477
            GRKVG RTEV+DV+ + EVQELGR+ V EYN+ L+E  GGGG L F  VV A+ QVVSG 
Sbjct  45   GRKVGARTEVRDVEGDGEVQELGRFSVAEYNRQLREGGGGGGRLEFGRVVAAQRQVVSGL  104

Query  476  KYYLKISAA----SSGGARRIYDAVVVVKPWAADSRELLDFAPS  357
            KYYL++ A     +  G  R++DAVVVVKPW  DSR LL FAP+
Sbjct  105  KYYLRVVAVEEGGAGNGGERVFDAVVVVKPW-LDSRTLLTFAPA  147



>ref|XP_009387215.1| PREDICTED: cysteine proteinase inhibitor 4-like [Musa acuminata 
subsp. malaccensis]
Length=140

 Score = 93.2 bits (230),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 52/96 (54%), Positives = 65/96 (68%), Gaps = 9/96 (9%)
 Frame = -2

Query  635  TEVKDVKNNEEVQELGRYCVREYNKVLQEKQGGGGLLSFSEVVKAETQVVSGFKYYLKIS  456
            TEV+DV++N+EVQ+LGRY V EYN+     QG    L+F+ VV A+ QVVSG KYYL++ 
Sbjct  47   TEVRDVESNKEVQDLGRYSVEEYNR----HQGPAHPLTFARVVGAQRQVVSGIKYYLRVL  102

Query  455  AA----SSGGARRIYDAVVVVKPWAADSRELLDFAP  360
            A      S G +R YDAVVVVK W   SREL+ F P
Sbjct  103  ATEGDGGSAGQQRTYDAVVVVKAWLG-SRELISFVP  137



>emb|CAN70300.1| hypothetical protein VITISV_001398 [Vitis vinifera]
Length=199

 Score = 94.7 bits (234),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 56/112 (50%), Positives = 72/112 (64%), Gaps = 10/112 (9%)
 Frame = -2

Query  656  GRKVGGRTEVKDVKNNEEVQELGRYCVREYNKVL--QEKQGGGGL-------LSFSEVVK  504
            GR VGGRTE+KDVK N+EVQ+LGR+ V EYN+    + ++  G +       L+FSEVV+
Sbjct  31   GRMVGGRTEIKDVKTNKEVQQLGRFSVEEYNRSHGRRWREAIGNVLGMDYEYLTFSEVVE  90

Query  503  AETQVVSGFKYYLKISAASSGGARRIYDAVVVVKPWAADSRELLDFAPSPDS  348
            A+ QVVSGFKYYLKI AA+  G R  +DAVVVV    +   E     P P +
Sbjct  91   AQKQVVSGFKYYLKI-AATQNGVRNTFDAVVVVGDTISTMDERWYCLPKPPT  141



>gb|AFW84200.1| putative cystatin [Zea mays]
Length=155

 Score = 93.2 bits (230),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 62/105 (59%), Positives = 75/105 (71%), Gaps = 6/105 (6%)
 Frame = -2

Query  656  GRKVGGRTEVKDVKNNEEVQELGRYCVREYNKVLQEKQGGGGLLSFSEVVKAETQVVSGF  477
            GRKVG RTEV+DV+ + EVQELGR+ V EYN+ L+E  GGGG L F  VV A+ QVVSG 
Sbjct  49   GRKVGARTEVRDVEGDGEVQELGRFSVAEYNRQLREGGGGGGRLEFGRVVAAQRQVVSGL  108

Query  476  KYYLKISA-----ASSGGARRIYDAVVVVKPWAADSRELLDFAPS  357
            KYYL++ A      +  G  R++DAVVVVKPW  DSR LL FAP+
Sbjct  109  KYYLRVVAVEEGGGAGNGGERVFDAVVVVKPW-LDSRTLLTFAPA  152



>ref|XP_010414055.1| PREDICTED: cysteine proteinase inhibitor 2-like [Camelina sativa]
Length=146

 Score = 92.8 bits (229),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 45/107 (42%), Positives = 68/107 (64%), Gaps = 12/107 (11%)
 Frame = -2

Query  647  VGGRTEVKDVKNNEEVQELGRYCVREYNKVLQEKQGG-----------GGLLSFSEVVKA  501
            +GG+++V +VK N E+QELGRYCV ++N+  Q ++G               L FS VV A
Sbjct  35   LGGKSDVANVKANREIQELGRYCVEQFNQRDQSEEGNVESIAKTDTDMSNPLRFSRVVSA  94

Query  500  ETQVVSGFKYYLKISAASSGGARRIYDAVVVVKPWAADSRELLDFAP  360
            + QVV+G KYYL+I      G+ +++D+VVV++PW   S++LL F P
Sbjct  95   QKQVVAGTKYYLRIEVTQPNGSTKMFDSVVVIQPW-LHSKQLLGFTP  140



>gb|ACD85810.1| cystcine proteinase inhibitor [Gossypium hirsutum]
Length=125

 Score = 92.0 bits (227),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 51/104 (49%), Positives = 68/104 (65%), Gaps = 9/104 (9%)
 Frame = -2

Query  647  VGGRTEVKDVKNNEEVQELGRYCVREYNKVLQEKQ-------GGGGLLSFSEVVKAETQV  489
            +GGR  + DVK N+EVQELGR+ V EYN+  Q +        G    L FS+VV AE QV
Sbjct  22   LGGRMRINDVKKNKEVQELGRFSVEEYNRRSQGRLRFSLANGGPSTALVFSQVVGAEKQV  81

Query  488  VSGFKYYLKISAASSGGARRIYDAVVVVKPWAADSRELLDFAPS  357
            V+G KYYL+I A   GG  + +++VV+VKPW   S++LL F+PS
Sbjct  82   VAGIKYYLEIKAM-QGGVTKTFESVVLVKPW-VQSKDLLKFSPS  123



>ref|XP_006410333.1| hypothetical protein EUTSA_v10017392mg [Eutrema salsugineum]
 gb|ESQ51786.1| hypothetical protein EUTSA_v10017392mg [Eutrema salsugineum]
Length=142

 Score = 92.4 bits (228),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 46/109 (42%), Positives = 69/109 (63%), Gaps = 16/109 (15%)
 Frame = -2

Query  647  VGGRTEVKDVKNNEEVQELGRYCVREYNKVLQEKQGGGGL-------------LSFSEVV  507
            +GG++++ +V+ N E+QELGRYCV ++N  LQE+   G +             L FS VV
Sbjct  31   LGGKSDISNVQTNMEIQELGRYCVEQFN--LQEQSEQGNVASIAKTDPAVLNPLKFSRVV  88

Query  506  KAETQVVSGFKYYLKISAASSGGARRIYDAVVVVKPWAADSRELLDFAP  360
             A+ QVV+G KYYL+I  +   G  R++D+V+V++PW   SR+LL F P
Sbjct  89   SAQKQVVAGTKYYLRIEVSQPDGTTRMFDSVLVIQPW-LHSRKLLGFTP  136



>emb|CDY42085.1| BnaA05g11010D [Brassica napus]
Length=136

 Score = 92.4 bits (228),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 46/107 (43%), Positives = 70/107 (65%), Gaps = 12/107 (11%)
 Frame = -2

Query  647  VGGRTEVKDVKNNEEVQELGRYCVREYNKVLQEKQGG--------GGLLS---FSEVVKA  501
            +GG+++V +V+ N E+QELGRYCV+++N   Q KQG           +LS   FS V  A
Sbjct  29   LGGKSDVGNVRTNIEIQELGRYCVKQFNLQQQSKQGNEASNARTDAAVLSPLKFSRVESA  88

Query  500  ETQVVSGFKYYLKISAASSGGARRIYDAVVVVKPWAADSRELLDFAP  360
            + QVV+G KYYL+I+     G  R++D+V+V++PW   S++LL+F P
Sbjct  89   QKQVVAGTKYYLRIAVTQPDGTSRMFDSVIVIQPWLF-SKKLLEFTP  134



>gb|EMT28874.1| Cysteine proteinase inhibitor 4 [Aegilops tauschii]
Length=149

 Score = 92.4 bits (228),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 57/110 (52%), Positives = 71/110 (65%), Gaps = 13/110 (12%)
 Frame = -2

Query  656  GRKVGGRTEVKDVKNNEEVQELGRYCVREYNKVLQEKQGGGGL---LSFSEVVKAETQVV  486
            GRKVGGRTEV D + + E  ELGRY V E+N+   E    GG+   L F+ VV A+ QVV
Sbjct  40   GRKVGGRTEVTDEEGDRE--ELGRYSVEEHNRRRGEGCEDGGVCGRLEFARVVSAQRQVV  97

Query  485  SGFKYYLKISAASSGGA-------RRIYDAVVVVKPWAADSRELLDFAPS  357
            SG KYYL+++AA   GA        R++DAVVVVKPW   SR L+ FAP+
Sbjct  98   SGVKYYLRVAAAEENGAGTNGVSDGRVFDAVVVVKPW-LQSRALVRFAPA  146



>ref|XP_009144029.1| PREDICTED: cysteine proteinase inhibitor 2-like [Brassica rapa]
 gb|ABB97037.1| cystatin-like protein [Brassica rapa]
Length=136

 Score = 92.0 bits (227),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 46/107 (43%), Positives = 70/107 (65%), Gaps = 12/107 (11%)
 Frame = -2

Query  647  VGGRTEVKDVKNNEEVQELGRYCVREYNKVLQEKQGG--------GGLLS---FSEVVKA  501
            +GG+++V +V+ N E+QELGRYCV+++N   Q KQG           +LS   FS V  A
Sbjct  29   LGGKSDVGNVRTNIEIQELGRYCVKQFNLQQQSKQGNEASNARTDAAVLSPLKFSRVESA  88

Query  500  ETQVVSGFKYYLKISAASSGGARRIYDAVVVVKPWAADSRELLDFAP  360
            + QVV+G KYYL+I+     G  R++D+V+V++PW   S++LL+F P
Sbjct  89   QKQVVAGTKYYLRIAVTQPDGTSRMFDSVIVIQPWLF-SKKLLEFTP  134



>ref|NP_001052530.1| Os04g0350100 [Oryza sativa Japonica Group]
 sp|A2XS65.2|CYT10_ORYSI RecName: Full=Cysteine proteinase inhibitor 10; AltName: Full=Oryzacystatin 
X; Short=OC-X; AltName: Full=Oryzacystatin-10; 
Flags: Precursor [Oryza sativa Indica Group]
 sp|P0C579.1|CYT10_ORYSJ RecName: Full=Cysteine proteinase inhibitor 10; AltName: Full=Oryzacystatin 
X; Short=OC-X; AltName: Full=Oryzacystatin-10; 
Flags: Precursor [Oryza sativa Japonica Group]
 emb|CAE05518.1| OSJNBa0038P21.11 [Oryza sativa Japonica Group]
 dbj|BAF14444.1| Os04g0350100 [Oryza sativa Japonica Group]
 emb|CAH66615.1| OSIGBa0144C23.1 [Oryza sativa Indica Group]
 dbj|BAG88896.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG95408.1| unnamed protein product [Oryza sativa Japonica Group]
Length=151

 Score = 92.4 bits (228),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 50/110 (45%), Positives = 72/110 (65%), Gaps = 14/110 (13%)
 Frame = -2

Query  647  VGGRTEVKDVKNNEEVQELGRYCVREYNKVLQEKQGGGGL------LSFSEVVKAETQVV  486
            VGGRTE++DV +N+ VQ LGR+ V E+N+ L+    GG        L+F+ VV+A+ QVV
Sbjct  39   VGGRTEIRDVGSNKAVQSLGRFAVAEHNRRLRHGGSGGPADPVPVKLAFARVVEAQKQVV  98

Query  485  SGFKYYLKISAA-------SSGGARRIYDAVVVVKPWAADSRELLDFAPS  357
            SG  YYLK++A+       ++ G  R++DAVVVVK W   S+EL+ F P+
Sbjct  99   SGVAYYLKVAASARDPRGGAAAGGDRVFDAVVVVKAW-LKSKELVSFTPA  147



>gb|KFK31166.1| hypothetical protein AALP_AA6G077400 [Arabis alpina]
Length=139

 Score = 92.0 bits (227),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 44/105 (42%), Positives = 67/105 (64%), Gaps = 9/105 (9%)
 Frame = -2

Query  650  KVGGRTEVKDVKNNEEVQELGRYCVREYNKVLQEKQGG--------GGLLSFSEVVKAET  495
            ++GG+++V +V+ N E+QELGRYCV ++N   Q +QG            L FS VV A+ 
Sbjct  30   RLGGKSDVANVQANREIQELGRYCVEQFNLREQREQGNIESISKTVTNTLKFSRVVSAQK  89

Query  494  QVVSGFKYYLKISAASSGGARRIYDAVVVVKPWAADSRELLDFAP  360
            QVV+G KY+L+I      G+RR++D+VVV++PW    R ++ F P
Sbjct  90   QVVAGMKYFLRIEVTQPDGSRRMFDSVVVIQPWLHYKR-VIGFTP  133



>tpe|CAG29029.1| TPA: putative cystatin [Zea mays]
Length=155

 Score = 92.0 bits (227),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 62/105 (59%), Positives = 74/105 (70%), Gaps = 6/105 (6%)
 Frame = -2

Query  656  GRKVGGRTEVKDVKNNEEVQELGRYCVREYNKVLQEKQGGGGLLSFSEVVKAETQVVSGF  477
            GRKVG RTEV DV+ + EVQELGR+ V EYN+ L+E  GGGG L F  VV A+ QVVSG 
Sbjct  49   GRKVGARTEVPDVEGDGEVQELGRFSVAEYNRQLREGGGGGGRLEFGRVVAAQRQVVSGL  108

Query  476  KYYLKISA-----ASSGGARRIYDAVVVVKPWAADSRELLDFAPS  357
            KYYL++ A      +  G  R++DAVVVVKPW  DSR LL FAP+
Sbjct  109  KYYLRVVAVEEGGGAGNGGERVFDAVVVVKPW-LDSRTLLTFAPA  152



>gb|AES71980.2| phloem filament protein PP1 [Medicago truncatula]
Length=130

 Score = 90.9 bits (224),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 50/93 (54%), Positives = 65/93 (70%), Gaps = 1/93 (1%)
 Frame = -2

Query  647  VGGRTEVKDVKNNEEVQELGRYCVREYN-KVLQEKQGGGGLLSFSEVVKAETQVVSGFKY  471
            VG RTE+ DV  N+EVQELG++ V+EYN K      GGG  L F EVV+AE QVVSG KY
Sbjct  27   VGARTEISDVGTNKEVQELGKFAVKEYNYKQGLNNGGGGEGLKFVEVVEAEQQVVSGMKY  86

Query  470  YLKISAASSGGARRIYDAVVVVKPWAADSRELL  372
            YL ISA    G +R++++VVVVKPW    ++++
Sbjct  87   YLNISAVDHNGVQRMFNSVVVVKPWLHQYKKVI  119



>ref|XP_003601729.1| Cysteine proteinase inhibitor [Medicago truncatula]
Length=129

 Score = 90.9 bits (224),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 50/93 (54%), Positives = 65/93 (70%), Gaps = 1/93 (1%)
 Frame = -2

Query  647  VGGRTEVKDVKNNEEVQELGRYCVREYN-KVLQEKQGGGGLLSFSEVVKAETQVVSGFKY  471
            VG RTE+ DV  N+EVQELG++ V+EYN K      GGG  L F EVV+AE QVVSG KY
Sbjct  26   VGARTEISDVGTNKEVQELGKFAVKEYNYKQGLNNGGGGEGLKFVEVVEAEQQVVSGMKY  85

Query  470  YLKISAASSGGARRIYDAVVVVKPWAADSRELL  372
            YL ISA    G +R++++VVVVKPW    ++++
Sbjct  86   YLNISAVDHNGVQRMFNSVVVVKPWLHQYKKVI  118



>ref|XP_010039949.1| PREDICTED: cysteine proteinase inhibitor B [Eucalyptus grandis]
 gb|KCW45610.1| hypothetical protein EUGRSUZ_L00642 [Eucalyptus grandis]
Length=146

 Score = 90.9 bits (224),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 54/106 (51%), Positives = 71/106 (67%), Gaps = 12/106 (11%)
 Frame = -2

Query  656  GRKVGGRTEVKDVKNNEEVQELGRYCVREYNKVLQEKQGG---------GGLLSFSEVVK  504
            G +VGGRT V DV++N+EVQ+LGRY V EYN+ +Q  Q G          G + F EVV 
Sbjct  26   GPRVGGRTAVPDVRSNQEVQDLGRYSVEEYNR-MQRWQRGGGGGRGGGDNGEIVFGEVVG  84

Query  503  AETQVVSGFKYYLKISAASSGGARRIYDAVVVVKPWAADSRELLDF  366
            AE QVV+G KYYLKI      GAR+++++VVVV+PW   S+EL+ F
Sbjct  85   AERQVVAGIKYYLKIEGMQR-GARKVFESVVVVRPW-VRSKELVTF  128



>gb|EAY93675.1| hypothetical protein OsI_15462 [Oryza sativa Indica Group]
Length=151

 Score = 90.9 bits (224),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 52/106 (49%), Positives = 70/106 (66%), Gaps = 10/106 (9%)
 Frame = -2

Query  647  VGGRTEVKDVKNNEEVQELGRYCVREYNKVLQEKQGGGG-----LLSFSEVVKAETQVVS  483
            VGGRTE++DV  N+ VQ LGR+ V E+N+ L+   GG        L+F+ VV+A+ QVVS
Sbjct  43   VGGRTEIRDVGGNKAVQSLGRFAVAEHNRRLRHGSGGPADPVPVKLAFARVVEAQKQVVS  102

Query  482  GFKYYLKISAASS-GGAR---RIYDAVVVVKPWAADSRELLDFAPS  357
            G  YYLK++A    GGA    R++DAVVVVK W   S+EL+ F P+
Sbjct  103  GVAYYLKVAARDPRGGAAAGDRVFDAVVVVKAW-LKSKELVSFTPA  147



>ref|XP_006840905.1| hypothetical protein AMTR_s00087p00085650 [Amborella trichopoda]
 gb|ERN02580.1| hypothetical protein AMTR_s00087p00085650 [Amborella trichopoda]
Length=120

 Score = 90.1 bits (222),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 49/100 (49%), Positives = 66/100 (66%), Gaps = 8/100 (8%)
 Frame = -2

Query  650  KVGGRTEVKDVKNNEEVQELGRYCVREYNKVLQEKQGGGGLLSFSEVVKAETQVVSGFKY  471
            ++GGR E+ +VK++ EVQ+LG++CV  YN      Q     L F+EVVK E QVVSG KY
Sbjct  29   RLGGRAEIPNVKSSTEVQDLGKFCVETYN------QDHHPQLDFNEVVKGERQVVSGIKY  82

Query  470  YLKISAASSGGARRIYDAVVVVKPWAADSRELLDFAPSPD  351
            YL I  A  GG  + +DAVVVV+ W   S+++L F+PS D
Sbjct  83   YLLIE-AKDGGVLKKFDAVVVVQAW-RHSKQMLSFSPSTD  120



>emb|CDX79450.1| BnaC03g17860D [Brassica napus]
Length=752

 Score = 96.3 bits (238),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 49/107 (46%), Positives = 68/107 (64%), Gaps = 14/107 (13%)
 Frame = -2

Query  647  VGGRTEVKDVKNNEEVQELGRYCVREYNKVLQEKQGGGGL-----------LSFSEVVKA  501
            +GG+++V +V+ N EVQELGRYCV ++N  L E+ G G +           L+FS VV A
Sbjct  643  LGGKSDVPNVQTNMEVQELGRYCVEQFN--LHEQSGKGNVASSIDRAVLNPLTFSRVVSA  700

Query  500  ETQVVSGFKYYLKISAASSGGARRIYDAVVVVKPWAADSRELLDFAP  360
            + QVV+G KYYL+I      G  R++D+VVVV+PW   S+ LL F P
Sbjct  701  QQQVVAGLKYYLRIEVTQPDGTNRMFDSVVVVQPW-LHSKTLLGFTP  746



>emb|CDX84749.1| BnaA03g14810D [Brassica napus]
Length=757

 Score = 96.3 bits (238),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 49/107 (46%), Positives = 68/107 (64%), Gaps = 14/107 (13%)
 Frame = -2

Query  647  VGGRTEVKDVKNNEEVQELGRYCVREYNKVLQEKQGGGGL-----------LSFSEVVKA  501
            +GG+++V +V+ N EVQELGRYCV ++N  L E+ G G +           L+FS VV A
Sbjct  648  LGGKSDVPNVQTNMEVQELGRYCVEQFN--LHEQSGKGNVASSIERAVLNPLTFSRVVSA  705

Query  500  ETQVVSGFKYYLKISAASSGGARRIYDAVVVVKPWAADSRELLDFAP  360
            + QVV+G KYYL+I      G  R++D+VVVV+PW   S+ LL F P
Sbjct  706  QQQVVAGLKYYLRIEVTQPDGTNRMFDSVVVVQPW-LHSKTLLGFTP  751



>dbj|BAA20464.1| extracellular insoluble cystatin [Daucus carota]
Length=133

 Score = 89.7 bits (221),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 48/99 (48%), Positives = 66/99 (67%), Gaps = 7/99 (7%)
 Frame = -2

Query  638  RTEVKDVKNNEEVQELGRYCVREYNKVLQEKQGG-----GGLLSFSEVVKAETQVVSGFK  474
            RTE+ DV++NEE+Q+LG Y V +YN+      GG      G L F +VV AE QVV+G K
Sbjct  35   RTEIPDVESNEEIQQLGEYSVEQYNQQHHNGDGGDSTDSAGDLKFVKVVAAEKQVVAGIK  94

Query  473  YYLKISAASSGGARRIYDAVVVVKPWAADSRELLDFAPS  357
            YYLKI AA  GG ++ +DA +VV+ W   +++L+ FAPS
Sbjct  95   YYLKIVAA-KGGHKKKFDAEIVVQAW-KKTKQLMSFAPS  131



>ref|XP_006840903.1| hypothetical protein AMTR_s00087p00084520 [Amborella trichopoda]
 gb|ERN02578.1| hypothetical protein AMTR_s00087p00084520 [Amborella trichopoda]
Length=120

 Score = 89.0 bits (219),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 48/98 (49%), Positives = 66/98 (67%), Gaps = 8/98 (8%)
 Frame = -2

Query  644  GGRTEVKDVKNNEEVQELGRYCVREYNKVLQEKQGGGGLLSFSEVVKAETQVVSGFKYYL  465
            GGR+ + +VK+N EVQ+LG++CV +YN+V   +      L FSEVV+ E QVVSG KYYL
Sbjct  31   GGRSAIPNVKSNTEVQDLGKFCVEKYNQVHDSR------LVFSEVVQGERQVVSGMKYYL  84

Query  464  KISAASSGGARRIYDAVVVVKPWAADSRELLDFAPSPD  351
             I  A  G   + +DAVVVV+ W   S+++L F+PS D
Sbjct  85   LIE-AKDGDVLKKFDAVVVVQAW-RHSKQMLSFSPSTD  120



>ref|XP_010244063.1| PREDICTED: cysteine proteinase inhibitor B-like [Nelumbo nucifera]
Length=139

 Score = 89.4 bits (220),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 56/111 (50%), Positives = 73/111 (66%), Gaps = 12/111 (11%)
 Frame = -2

Query  656  GRK--VGGRTEVKDVKNNEEVQELGRYCVREYNKVLQEK-----QGG---GGLLSFSEVV  507
            GR+  VGG TEV+DV  N+EVQE+GR+ V E+N+   ++     QG    GG L FSEVV
Sbjct  27   GRRIMVGGWTEVQDVGCNDEVQEVGRFSVDEFNRKQHQEAEARGQGSSSNGGDLVFSEVV  86

Query  506  KAETQVVSGFKYYLKISAASSGGARRIYDAVVVVKPWAADSRELLDFAPSP  354
             A+ QV++G KYYL I A   G  +R +DA+V VKPW   S+ELL F+PS 
Sbjct  87   MAKQQVITGVKYYLYIEAFRDGFRQR-FDAIVAVKPW-LQSKELLIFSPSS  135



>emb|CDY62192.1| BnaCnng39540D [Brassica napus]
Length=142

 Score = 89.4 bits (220),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 42/105 (40%), Positives = 66/105 (63%), Gaps = 10/105 (10%)
 Frame = -2

Query  647  VGGRTEVKDVKNNEEVQELGRYCVREYNKVLQEKQGGG---------GLLSFSEVVKAET  495
            +GG+ ++ +V+ N E+QELGRYCV ++N + + +QG             L+FS VV A+ 
Sbjct  33   LGGKADIPNVQTNIEIQELGRYCVEQFNLMEESEQGNAESIANTAVLNPLNFSRVVSAQK  92

Query  494  QVVSGFKYYLKISAASSGGARRIYDAVVVVKPWAADSRELLDFAP  360
            QVV+G KY L+I      G  R++D+VV+++PW   S++LL F P
Sbjct  93   QVVAGLKYDLRIEVIQPDGTNRMFDSVVIIQPW-LHSKKLLGFTP  136



>ref|XP_009141203.1| PREDICTED: cysteine proteinase inhibitor 2-like [Brassica rapa]
 gb|ADD10746.1| phytocystatin 2-1 [Brassica rapa subsp. pekinensis]
 emb|CDY60964.1| BnaA04g28930D [Brassica napus]
Length=142

 Score = 88.2 bits (217),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 42/105 (40%), Positives = 65/105 (62%), Gaps = 10/105 (10%)
 Frame = -2

Query  647  VGGRTEVKDVKNNEEVQELGRYCVREYNKVLQEKQGGG---------GLLSFSEVVKAET  495
            +GG  ++ +V+ N E+QELGRYCV ++N + + +QG             L+FS VV A+ 
Sbjct  33   LGGEADIPNVQTNIEIQELGRYCVEQFNLMEESEQGNAESIADTAVLNPLNFSRVVSAQK  92

Query  494  QVVSGFKYYLKISAASSGGARRIYDAVVVVKPWAADSRELLDFAP  360
            QVV+G KY L+I      G  R++D+VV+++PW   S++LL F P
Sbjct  93   QVVAGLKYDLRIEVIQPDGTSRMFDSVVIIQPW-LHSKKLLGFTP  136



>ref|XP_007153806.1| hypothetical protein PHAVU_003G066200g [Phaseolus vulgaris]
 gb|ESW25800.1| hypothetical protein PHAVU_003G066200g [Phaseolus vulgaris]
Length=173

 Score = 86.3 bits (212),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 48/101 (48%), Positives = 69/101 (68%), Gaps = 4/101 (4%)
 Frame = -2

Query  656  GRKVGGRTEVKDVKNNEEVQELGRYCVREYNKVLQEKQGGGGLLSFSEVVKAETQVVSGF  477
            G  VG ++E+ +V  N+EVQ+LG++ V E N+ ++E       L+F EV++A+ QVVS  
Sbjct  76   GELVGEKSEIANVNMNKEVQDLGQFAVEERNQSMKEIAFAKPELTFVEVLEAQKQVVSVT  135

Query  476  KYYLKISAASSGGARRIYDAVVVVKPWAADSRELLDFAPSP  354
            KYYLKIS   SGG+ + YD+VVVVKP    S++LL+F  SP
Sbjct  136  KYYLKISTNKSGGS-KTYDSVVVVKP---SSKQLLNFTASP  172



>emb|CAG38125.1| cystatin Hv-CPI9 [Hordeum vulgare subsp. vulgare]
 dbj|BAJ91797.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=143

 Score = 85.1 bits (209),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 50/105 (48%), Positives = 64/105 (61%), Gaps = 13/105 (12%)
 Frame = -2

Query  638  RTEVKDVKNNEEVQELGRYCVREYNKVLQEKQGGGG--------LLSFSEVVKAETQVVS  483
            RTE+ DV  N+ VQ LGR+ V E+N+ L    GG G         L+F+ V  A+ QV+S
Sbjct  41   RTEISDVGKNKLVQSLGRFAVAEHNRRL--GHGGSGNNGDPVQVQLAFTAVAAAQKQVIS  98

Query  482  GFKYYLKI--SAASSGGARRIYDAVVVVKPWAADSRELLDFAPSP  354
            G  YYLK+   A + GG  R +DAVVVVK W A S+EL+ F PSP
Sbjct  99   GVVYYLKVIARAPAGGGGDRPFDAVVVVKAW-AKSKELVSFMPSP  142



>ref|NP_001172709.1| Os01g0915401 [Oryza sativa Japonica Group]
 sp|Q0JGM8.2|CYT5_ORYSJ RecName: Full=Cysteine proteinase inhibitor 5; AltName: Full=Oryzacystatin 
V; Short=OC-V; AltName: Full=Oryzacystatin-5; 
Flags: Precursor [Oryza sativa Japonica Group]
 gb|EAY76950.1| hypothetical protein OsI_04908 [Oryza sativa Indica Group]
 gb|EAZ14606.1| hypothetical protein OsJ_04531 [Oryza sativa Japonica Group]
 dbj|BAH91439.1| Os01g0915401 [Oryza sativa Japonica Group]
Length=148

 Score = 85.5 bits (210),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 50/96 (52%), Positives = 65/96 (68%), Gaps = 3/96 (3%)
 Frame = -2

Query  638  RTEVKDVKNNEEVQELGRYCVREYNKVLQEKQGGGGLLSFSEVVKAETQVVSGFKYYLKI  459
            RT+V+DV+ N EVQELG +CV E+N+       G GL+ FS VV A+TQVVSG KYYL+I
Sbjct  52   RTDVEDVEGNREVQELGLFCVVEHNRRGGSATRGRGLV-FSRVVAAQTQVVSGIKYYLRI  110

Query  458  SAASSGGARRIYDAVVVVKPWAADSRELLDFAPSPD  351
             AA       ++DAVVVVK W   SRE++ F P+ +
Sbjct  111  -AAQEADDELVFDAVVVVKAW-VPSREMVSFVPAAE  144



>gb|ADV02771.1| cysteine protease inhibitor [Ipomoea batatas]
Length=134

 Score = 84.7 bits (208),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 46/97 (47%), Positives = 60/97 (62%), Gaps = 3/97 (3%)
 Frame = -2

Query  638  RTEVKDVKNNEEVQELGRYCVREYNKVLQEK---QGGGGLLSFSEVVKAETQVVSGFKYY  468
            +TEV DVK N EVQ LGR  V E+NK L  K   +     L F+EV+KAE QVV+G KY+
Sbjct  35   KTEVSDVKTNAEVQNLGRKAVMEFNKRLNVKVNPENNAKRLVFTEVIKAEKQVVAGEKYF  94

Query  467  LKISAASSGGARRIYDAVVVVKPWAADSRELLDFAPS  357
            L I A S  G  + Y++ + VKP      E+L+FAP+
Sbjct  95   LTIKATSEDGQTKTYESEMWVKPGDETVHEMLNFAPA  131



>ref|XP_010522275.1| PREDICTED: cysteine proteinase inhibitor 2-like [Tarenaya hassleriana]
Length=142

 Score = 84.7 bits (208),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 52/102 (51%), Positives = 68/102 (67%), Gaps = 7/102 (7%)
 Frame = -2

Query  647  VGGRTEVKDVKNNEEVQELGRYCVREYNKVLQEKQGGGG------LLSFSEVVKAETQVV  486
            VGGR+ V DV +N+E+QELGRYCV E+N   Q + G  G       L F EVV+ + QVV
Sbjct  33   VGGRSVVLDVASNKELQELGRYCVEEFNLKEQREHGKSGGEEGFNPLMFGEVVEVQRQVV  92

Query  485  SGFKYYLKISAASSGGARRIYDAVVVVKPWAADSRELLDFAP  360
            SG KY+L+I A       R++++VVVVKPW   S+ELLDF+P
Sbjct  93   SGIKYFLRIQATLPDRTTRMFNSVVVVKPW-LQSKELLDFSP  133



>gb|KDO52834.1| hypothetical protein CISIN_1g035532mg, partial [Citrus sinensis]
Length=112

 Score = 77.8 bits (190),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 44/88 (50%), Positives = 62/88 (70%), Gaps = 8/88 (9%)
 Frame = -2

Query  653  RKVGGRTEVKDVKNNEEVQELGRYCVREYNKVLQEKQG------GGGLLSFSEVVKAETQ  492
            R VGGR+EVKDVK N+EVQELG++ V E+N+  Q++QG        G L FS+V++A+ Q
Sbjct  26   RLVGGRSEVKDVKKNKEVQELGKFSVEEFNRS-QQRQGKVIRNVAFGRLRFSQVLEAQKQ  84

Query  491  VVSGFKYYLKISAAS-SGGARRIYDAVV  411
            VVSG KYYL I A +   G  +++D++V
Sbjct  85   VVSGIKYYLTIEATTGENGEIQMFDSIV  112



>ref|XP_003532730.1| PREDICTED: cysteine proteinase inhibitor 4-like [Glycine max]
Length=103

 Score = 76.6 bits (187),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 44/83 (53%), Positives = 63/83 (76%), Gaps = 3/83 (4%)
 Frame = -2

Query  602  VQELGRYCVREYNKVLQEKQGGGGLLSFSEVVKAETQVVSGFKYYLKISAAS--SGGARR  429
            VQ+LGR+ V E+N++L++ Q     ++F EVV+A++QVVSG KYY+KISA     GG  R
Sbjct  4    VQDLGRFSVEEHNRMLRQAQKEEEEVTFEEVVEAQSQVVSGIKYYMKISATQGGDGGDSR  63

Query  428  IYDAVVVVKPWAADSRELLDFAP  360
            I+++VVVVKPW   S++LL+FAP
Sbjct  64   IFESVVVVKPW-LRSKQLLNFAP  85



>ref|XP_004975327.1| PREDICTED: cysteine proteinase inhibitor 10-like [Setaria italica]
Length=135

 Score = 76.6 bits (187),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 50/104 (48%), Positives = 65/104 (63%), Gaps = 8/104 (8%)
 Frame = -2

Query  644  GGRTEVKDVKNNEEVQELGRYCVREYNKVLQEKQGGG-------GLLSFSEVVKAETQVV  486
            GGR ++KDV +N+ VQ LG++ V E+N+ L+   G G        LLSF  V  A+ QVV
Sbjct  32   GGRRDIKDVGSNKLVQSLGQFAVAEHNRHLRRNGGVGTSSDPVTALLSFRAVAAAQQQVV  91

Query  485  SGFKYYLKISAASSGGARRIYDAVVVVKPWAADSRELLDFAPSP  354
            +G  YYLK+ A   GG  R +DAVVVVK W   S+EL+ F PSP
Sbjct  92   AGVAYYLKVIARDHGGGDRPFDAVVVVKAW-LKSKELVSFTPSP  134



>gb|EMT18217.1| Cysteine proteinase inhibitor 10 [Aegilops tauschii]
Length=144

 Score = 76.6 bits (187),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 52/112 (46%), Positives = 66/112 (59%), Gaps = 14/112 (13%)
 Frame = -2

Query  656  GRKVGGRTEVKDVKNNEEVQELGRYCVREYNKVLQEKQGGGGL---------LSFSEVVK  504
            G  VGGRTE++DV  N+ VQ LGR+ V E+N+ L    GGG +         L F+ V  
Sbjct  35   GGAVGGRTEIRDVGKNKLVQSLGRFAVSEHNRRLS--HGGGPVNNGDPVKVQLVFTAVAA  92

Query  503  AETQVVSGFKYYLKISA--ASSGGARRIYDAVVVVKPWAADSRELLDFAPSP  354
            A+ QV SG  YYLK+ A   + GG  R +DAVVVVK W   S+EL+   PSP
Sbjct  93   AQKQVASGVVYYLKVIARDRAGGGGDRPFDAVVVVKAW-IKSKELVSLMPSP  143



>ref|XP_007153809.1| hypothetical protein PHAVU_003G066500g [Phaseolus vulgaris]
 gb|ESW25803.1| hypothetical protein PHAVU_003G066500g [Phaseolus vulgaris]
Length=125

 Score = 75.9 bits (185),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 43/95 (45%), Positives = 64/95 (67%), Gaps = 4/95 (4%)
 Frame = -2

Query  656  GRKVGGRTEVKDVKNNEEVQELGRYCVREYNKVLQEKQGGGGLLSFSEVVKAETQVVSGF  477
            G  VG +T++ +VK N+EVQ++GR+ V + N++++E       L+F EV++A+ QVVSG 
Sbjct  28   GELVGEKTKIANVKMNKEVQDVGRFAVEDSNRIMKEMASAKPELTFVEVLEAQKQVVSGT  87

Query  476  KYYLKISAASSGGARRI-YDAVVVVKPWAADSREL  375
            KYYLKI    +GG   I Y++VVVVK     S+EL
Sbjct  88   KYYLKILVNENGGRNSITYNSVVVVK---GSSKEL  119



>ref|XP_007153810.1| hypothetical protein PHAVU_003G066600g [Phaseolus vulgaris]
 gb|ESW25804.1| hypothetical protein PHAVU_003G066600g [Phaseolus vulgaris]
Length=126

 Score = 74.3 bits (181),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 48/102 (47%), Positives = 64/102 (63%), Gaps = 6/102 (6%)
 Frame = -2

Query  656  GRKVGGRTEVKDVKNNEEVQELGRYCVREYNKVLQEKQGGGGLLSFSEVVKAETQVVSGF  477
            G  VG +T + D K N+EVQ+LGR+ V E N+ L+E      +++F  V++A+ QVVSG 
Sbjct  28   GELVGEKTVIADAKTNQEVQDLGRFAVDERNRKLKESGAMRPVVAFVTVLEAQKQVVSGT  87

Query  476  KYYLKISAASSGGARR--IYDAVVVVKPWAADSRELLDFAPS  357
            KYYLKIS  +   AR   IYD+VVVVK     S+EL  F  S
Sbjct  88   KYYLKIS-TNQNEARESVIYDSVVVVK---GSSKELQIFTVS  125



>ref|XP_010906414.1| PREDICTED: cysteine proteinase inhibitor 12-like [Elaeis guineensis]
Length=202

 Score = 75.1 bits (183),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 42/99 (42%), Positives = 60/99 (61%), Gaps = 8/99 (8%)
 Frame = -2

Query  647  VGGRTEVKDVKNNEEVQELGRYCVREYNKVLQEKQGGGGLLSFSEVVKAETQVVSGFKYY  468
            +GG  + K+++N+ E++EL R+ V E+NK          LL F  VVK + QVVSG  YY
Sbjct  4    LGGVHDAKEIQNSVEIEELARFAVEEHNK------KANTLLEFGRVVKVKEQVVSGIIYY  57

Query  467  LKISAASSGGARRIYDAVVVVKPWAADSRELLDFAPSPD  351
            + I  AS GG +++Y+A V VKPW    +EL +F P  D
Sbjct  58   ITIE-ASDGGKKKLYEAKVWVKPWMK-FKELQEFIPLGD  94



>ref|XP_007153804.1| hypothetical protein PHAVU_003G066000g [Phaseolus vulgaris]
 gb|ESW25798.1| hypothetical protein PHAVU_003G066000g [Phaseolus vulgaris]
Length=102

 Score = 72.8 bits (177),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 46/98 (47%), Positives = 65/98 (66%), Gaps = 6/98 (6%)
 Frame = -2

Query  644  GGRTEVKDVKNNEEVQELGRYCVREYNKVLQEKQGGGGLLSFSEVVKAETQVVSGFKYYL  465
            G +TE+ +VK N+EVQ+LGR+ V E N+ ++EK     +++F +V++A+ Q VSG KYYL
Sbjct  8    GEKTEIANVKMNKEVQDLGRFAVDERNRNVKEKAFARPIVAFVQVLEAQKQEVSGTKYYL  67

Query  464  KISAASSGGARR--IYDAVVVVKPWAADSRELLDFAPS  357
            KI A +   AR   IYD+VVVVK     S+EL  F  S
Sbjct  68   KI-ATNQNEARDSVIYDSVVVVK---GSSKELQIFTVS  101



>ref|XP_008786873.1| PREDICTED: cysteine proteinase inhibitor 12-like [Phoenix dactylifera]
Length=202

 Score = 74.3 bits (181),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 41/105 (39%), Positives = 62/105 (59%), Gaps = 8/105 (8%)
 Frame = -2

Query  647  VGGRTEVKDVKNNEEVQELGRYCVREYNKVLQEKQGGGGLLSFSEVVKAETQVVSGFKYY  468
            +GG  + K+++N+ E++EL R+ V E+NK          LL F  VVK + QVV+G  YY
Sbjct  4    LGGVHDAKEIENSVEIEELARFAVEEHNK------KANTLLEFVRVVKVKEQVVAGIIYY  57

Query  467  LKISAASSGGARRIYDAVVVVKPWAADSRELLDFAPSPDSDHPSK  333
            + I A   GG +++Y+A V VKPW    +EL +F+P  D    S+
Sbjct  58   ITIEAI-EGGKKKLYEAKVWVKPW-MKFKELQEFSPLDDCSSESQ  100



>gb|ABK21379.1| unknown [Picea sitchensis]
 gb|ABK22996.1| unknown [Picea sitchensis]
 gb|ACN40467.1| unknown [Picea sitchensis]
Length=130

 Score = 72.0 bits (175),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 41/97 (42%), Positives = 61/97 (63%), Gaps = 8/97 (8%)
 Frame = -2

Query  650  KVGGRTEVKDVKNNEEVQELGRYCVREYNKVLQEKQGGGGLLSFSEVVKAETQVVSGFKY  471
            ++GG  ++ DV++ +E+Q+LGR+ V EYN     +Q  G  +SFS+VVKA+ QVVSG  Y
Sbjct  36   RIGGIRDIPDVEHKKEIQDLGRFAVDEYN----TQQNVG--ISFSKVVKAQEQVVSGLLY  89

Query  470  YLKISAASSGGARRIYDAVVVVKPWAADSRELLDFAP  360
            YL I     G   ++Y A + VKPW    ++L +F P
Sbjct  90   YLTIK-TKEGSKTKLYAAKIWVKPW-EKFKQLQEFKP  124



>ref|XP_003579572.1| PREDICTED: cysteine proteinase inhibitor 10-like [Brachypodium 
distachyon]
Length=129

 Score = 71.6 bits (174),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 44/100 (44%), Positives = 60/100 (60%), Gaps = 2/100 (2%)
 Frame = -2

Query  647  VGGRTEVKDVKNNEEVQELGRYCVREYNKVLQEKQGGGGLLSFSEVVKAETQVVSGFKYY  468
            VGGRT++K+V  N  VQ LGR+ V E+N++++        L F  V  A+ Q+VSG KYY
Sbjct  29   VGGRTDIKNVGRNTFVQSLGRFAVAEHNRLVRGVGPATAQLKFVAVEAAQKQIVSGVKYY  88

Query  467  LKISAASSGGARRIYDAVVVVKP--WAADSRELLDFAPSP  354
            LK+ A +       +DAVVVVK       ++ELL F PSP
Sbjct  89   LKVIARARAAGNAPFDAVVVVKSGLKKKKTKELLSFTPSP  128



>ref|XP_010931548.1| PREDICTED: cysteine proteinase inhibitor 12-like [Elaeis guineensis]
Length=202

 Score = 70.1 bits (170),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 41/99 (41%), Positives = 57/99 (58%), Gaps = 8/99 (8%)
 Frame = -2

Query  647  VGGRTEVKDVKNNEEVQELGRYCVREYNKVLQEKQGGGGLLSFSEVVKAETQVVSGFKYY  468
            +GG  + K ++N+ E++EL R+ V E NK          LL F  VVK + QVVSG  YY
Sbjct  4    LGGVHDAKGIENSVEIEELARFAVEEQNK------KANTLLEFVRVVKVKEQVVSGIIYY  57

Query  467  LKISAASSGGARRIYDAVVVVKPWAADSRELLDFAPSPD  351
            + I A   GG +++Y+A V VKPW    +EL +F P  D
Sbjct  58   ITIEAI-DGGEKKLYEAKVWVKPWMK-FKELQEFIPLDD  94



>ref|XP_008788566.1| PREDICTED: cysteine proteinase inhibitor A-like [Phoenix dactylifera]
Length=105

 Score = 68.2 bits (165),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 38/96 (40%), Positives = 58/96 (60%), Gaps = 8/96 (8%)
 Frame = -2

Query  647  VGGRTEVKDVKNNEEVQELGRYCVREYNKVLQEKQGGGGLLSFSEVVKAETQVVSGFKYY  468
            +GG  + K+++N+ E++EL R+ V EY+K          LL F  VVK + QVV+G  YY
Sbjct  4    LGGVRDAKEIENSVEIEELARFAVEEYDK------KANALLEFVRVVKVKEQVVAGIVYY  57

Query  467  LKISAASSGGARRIYDAVVVVKPWAADSRELLDFAP  360
            + I     GG +++Y+A V VKPW    +EL +F+P
Sbjct  58   ITIEVI-DGGKKKLYEAKVWVKPW-MKFKELQEFSP  91



>gb|AAM88397.1|AF525880_1 cysteine proteinase inhibitor [Colocasia esculenta]
Length=205

 Score = 70.1 bits (170),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 39/100 (39%), Positives = 62/100 (62%), Gaps = 8/100 (8%)
 Frame = -2

Query  647  VGGRTEVKDVKNNEEVQELGRYCVREYNKVLQEKQGGGGLLSFSEVVKAETQVVSGFKYY  468
            +GG  +V+  +N+ EV+EL R+ V E+NK          LL FS +VKA+ QVVSG  ++
Sbjct  4    MGGIVDVEGAQNSAEVEELARFAVDEHNK------KENALLQFSRLVKAKQQVVSGIMHH  57

Query  467  LKISAASSGGARRIYDAVVVVKPWAADSRELLDFAPSPDS  348
            L +     GG +++Y+A V V+ W  +S++L +F+P  DS
Sbjct  58   LTVEVI-EGGKKKVYEAKVWVQAW-LNSKKLHEFSPIGDS  95



>pdb|3IMA|B Chain B, Complex Strcuture Of Tarocystatin And Papain
 pdb|3IMA|D Chain D, Complex Strcuture Of Tarocystatin And Papain
Length=91

 Score = 66.6 bits (161),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 37/96 (39%), Positives = 60/96 (63%), Gaps = 8/96 (8%)
 Frame = -2

Query  647  VGGRTEVKDVKNNEEVQELGRYCVREYNKVLQEKQGGGGLLSFSEVVKAETQVVSGFKYY  468
            +GG  +V+  +N+ EV+EL R+ V E+NK          LL FS +VKA+ QVVSG  ++
Sbjct  3    MGGIVDVEGAQNSAEVEELARFAVDEHNK------KENALLQFSRLVKAKQQVVSGIMHH  56

Query  467  LKISAASSGGARRIYDAVVVVKPWAADSRELLDFAP  360
            L +     GG +++Y+A V V+ W  +S++L +F+P
Sbjct  57   LTVEVI-EGGKKKVYEAKVWVQAW-LNSKKLHEFSP  90



>ref|XP_009394387.1| PREDICTED: cysteine proteinase inhibitor 1 {ECO:0000303|PubMed:14697268}-like 
[Musa acuminata subsp. malaccensis]
Length=194

 Score = 68.6 bits (166),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 41/97 (42%), Positives = 55/97 (57%), Gaps = 8/97 (8%)
 Frame = -2

Query  656  GRKVGGRTEVKDVKNNEEVQELGRYCVREYNKVLQEKQGGGGLLSFSEVVKAETQVVSGF  477
            G+ +GG T +KDV N+  VQE+ ++ V E+NK           L+  +V K ETQVVSG 
Sbjct  100  GKALGGWTPIKDV-NDPHVQEIAQFAVSEHNK------QANAALALGKVAKGETQVVSGT  152

Query  476  KYYLKISAASSGGARRIYDAVVVVKPWAADSRELLDF  366
             Y L +SA+   GA   Y+AVV  KPW    R+L  F
Sbjct  153  NYRLVLSASDGSGASAKYEAVVWEKPW-EKFRQLTSF  188



>gb|AAS21216.1| cysteine proteinase inhibitor [Aegiceras corniculatum]
Length=95

 Score = 66.6 bits (161),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 42/101 (42%), Positives = 61/101 (60%), Gaps = 8/101 (8%)
 Frame = -2

Query  650  KVGGRTEVKDVKNNEEVQELGRYCVREYNKVLQEKQGGGGLLSFSEVVKAETQVVSGFKY  471
            KVGG  E +   N+ E+ EL R+ V ++NK    KQ    LL F +VV  + QVVSG  Y
Sbjct  3    KVGGIHEKEGSANSVEMDELARFAVDQHNK----KQNA--LLEFVKVVNVKEQVVSGTLY  56

Query  470  YLKISAASSGGARRIYDAVVVVKPWAADSRELLDFAPSPDS  348
            Y+ +  A+ GG +++Y+A V VKPW  + +EL DF  + D+
Sbjct  57   YITLE-ATGGGQKKLYEAKVWVKPW-MNFKELQDFQLASDA  95



>ref|XP_004308672.1| PREDICTED: cysteine proteinase inhibitor 6-like [Fragaria vesca 
subsp. vesca]
Length=171

 Score = 67.8 bits (164),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 40/99 (40%), Positives = 58/99 (59%), Gaps = 8/99 (8%)
 Frame = -2

Query  647  VGGRTEVKDVKNNEEVQELGRYCVREYNKVLQEKQGGGGLLSFSEVVKAETQVVSGFKYY  468
            +GG  E +  +N+ E  EL R+ V+E+NK          LL F  VVK + QVVSG  YY
Sbjct  80   LGGVHESQGSQNSLETDELARFAVQEHNK------KENALLEFVRVVKTKEQVVSGTVYY  133

Query  467  LKISAASSGGARRIYDAVVVVKPWAADSRELLDFAPSPD  351
            L I  A+ GG +++++A V VKPW  + +E+ +F P  D
Sbjct  134  LTIE-ATDGGQKKLFEAKVWVKPW-LNFKEVQEFKPVAD  170



>gb|ABK23108.1| unknown [Picea sitchensis]
Length=128

 Score = 66.6 bits (161),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 38/97 (39%), Positives = 58/97 (60%), Gaps = 8/97 (8%)
 Frame = -2

Query  650  KVGGRTEVKDVKNNEEVQELGRYCVREYNKVLQEKQGGGGLLSFSEVVKAETQVVSGFKY  471
            ++GG  ++   ++ +E+Q+LGR+ V EYN      Q    +L FS V+KA+ QVVSG  Y
Sbjct  34   RIGGIRDIPGFEHKKEIQDLGRFAVNEYNV-----QQNARIL-FSRVLKAQEQVVSGLLY  87

Query  470  YLKISAASSGGARRIYDAVVVVKPWAADSRELLDFAP  360
            YL++     GG  ++Y A + VKPW    R+L +F P
Sbjct  88   YLRVETM-DGGKTKLYAAKIWVKPW-EKFRQLQEFKP  122



>pdb|4N6T|A Chain A, Adhiron: A Stable And Versatile Peptide Display Scaffold 
- Full Length Adhiron
 pdb|4N6U|A Chain A, Adhiron: A Stable And Versatile Peptide Display Scaffold 
- Truncated Adhiron
Length=79

 Score = 65.5 bits (158),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 37/85 (44%), Positives = 52/85 (61%), Gaps = 8/85 (9%)
 Frame = -2

Query  614  NNEEVQELGRYCVREYNKVLQEKQGGGGLLSFSEVVKAETQVVSGFKYYLKISAASSGGA  435
            N+ E++EL R+ V E+NK          LL F  VVKA+ QVV+G  YYL +  A  GG 
Sbjct  2    NSLEIEELARFAVDEHNK------KENALLEFVRVVKAKEQVVAGTMYYLTLE-AKDGGK  54

Query  434  RRIYDAVVVVKPWAADSRELLDFAP  360
            +++Y+A V VKPW  + +EL +F P
Sbjct  55   KKLYEAKVWVKPW-ENFKELQEFKP  78



>ref|NP_001106013.1| cystatin2 precursor [Zea mays]
 dbj|BAA07327.1| cystatin II [Zea mays]
Length=134

 Score = 66.6 bits (161),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 40/99 (40%), Positives = 57/99 (58%), Gaps = 8/99 (8%)
 Frame = -2

Query  656  GRKVGGRTEVKDVKNNEEVQELGRYCVREYNKVLQEKQGGGGLLSFSEVVKAETQVVSGF  477
            G  VGG  +V + +N+  +QEL R+ V E+NK          LL F ++VKA+TQVV+G 
Sbjct  37   GTLVGGIQDVPENENDLHLQELARFAVDEHNK------KANALLGFEKLVKAKTQVVAGT  90

Query  476  KYYLKISAASSGGARRIYDAVVVVKPWAADSRELLDFAP  360
             YYL I     G  +++Y+A V  KPW    +EL +F P
Sbjct  91   MYYLTIE-VKDGEVKKLYEAKVWEKPWEK-FKELQEFKP  127



>gb|AAY57859.1| cysteine proteinase inhibitor [Zea mays subsp. parviglumis]
Length=134

 Score = 66.2 bits (160),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 40/99 (40%), Positives = 57/99 (58%), Gaps = 8/99 (8%)
 Frame = -2

Query  656  GRKVGGRTEVKDVKNNEEVQELGRYCVREYNKVLQEKQGGGGLLSFSEVVKAETQVVSGF  477
            G  VGG  +V   +N+  +QEL R+ V E+NK          LL F ++VKA+TQVV+G 
Sbjct  37   GTLVGGIQDVPGSENDLHLQELARFAVDEHNK------KANALLGFEKLVKAKTQVVAGT  90

Query  476  KYYLKISAASSGGARRIYDAVVVVKPWAADSRELLDFAP  360
             YYL I     G  +++Y+A V  KPW  + +EL +F P
Sbjct  91   MYYLTIE-VKDGEVKKLYEAKVWEKPW-ENFKELQEFKP  127



>ref|XP_009385315.1| PREDICTED: cysteine proteinase inhibitor 6-like [Musa acuminata 
subsp. malaccensis]
Length=96

 Score = 65.5 bits (158),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 38/100 (38%), Positives = 60/100 (60%), Gaps = 8/100 (8%)
 Frame = -2

Query  647  VGGRTEVKDVKNNEEVQELGRYCVREYNKVLQEKQGGGGLLSFSEVVKAETQVVSGFKYY  468
            VGG  EV+ + N+ E ++L R+ V E+NK          LL F  VV+A+ QVV+G  ++
Sbjct  4    VGGIKEVEGIANSAETEQLARFAVDEHNK------KENALLEFVRVVEAKEQVVAGTLHH  57

Query  467  LKISAASSGGARRIYDAVVVVKPWAADSRELLDFAPSPDS  348
            L + A  +G  +++Y+A V VKPW  + +EL +F  + DS
Sbjct  58   LTVEAVDAGK-KKVYEAKVWVKPW-LNFKELQEFRHAADS  95



>dbj|BAA95416.1| multicystatin [Helianthus annuus]
Length=282

 Score = 68.6 bits (166),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 40/96 (42%), Positives = 61/96 (64%), Gaps = 8/96 (8%)
 Frame = -2

Query  647  VGGRTEVKDVKNNEEVQELGRYCVREYNKVLQEKQGGGGLLSFSEVVKAETQVVSGFKYY  468
            +GG TEVKD  N+ E+++L R+ V E+NK    KQ    LL F +V+ A+ Q+V+G   Y
Sbjct  99   IGGITEVKDFANSLEIEDLARFAVDEHNK----KQ--NTLLEFGKVLNAKEQIVAGKLCY  152

Query  467  LKISAASSGGARRIYDAVVVVKPWAADSRELLDFAP  360
            + +  A+ GG ++ Y+A V VKPW  + +EL +F P
Sbjct  153  ITLE-ATDGGVKKTYEAKVWVKPW-ENFKELQEFKP  186


 Score = 67.8 bits (164),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 43/96 (45%), Positives = 59/96 (61%), Gaps = 8/96 (8%)
 Frame = -2

Query  647  VGGRTEVKDVKNNEEVQELGRYCVREYNKVLQEKQGGGGLLSFSEVVKAETQVVSGFKYY  468
            VGG TEVKD  N+  + +L R+ V EYNK    KQ    LL F +V+ A+ Q+VSG  YY
Sbjct  4    VGGFTEVKDFANSIVIDDLARFAVDEYNK----KQ--NTLLEFRKVLNAKEQIVSGTLYY  57

Query  467  LKISAASSGGARRIYDAVVVVKPWAADSRELLDFAP  360
            + + AA +GG  + Y+A V VK W  + +EL +F P
Sbjct  58   ITLDAA-NGGIIKTYEAKVWVKKW-ENLKELQEFKP  91


 Score = 59.7 bits (143),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 39/94 (41%), Positives = 56/94 (60%), Gaps = 9/94 (10%)
 Frame = -2

Query  647  VGGRTEVKDVKNNEEVQELGRYCVREYNKVLQEKQGGGGLLSFSEVVKAETQVVSGFKYY  468
            +GG TEVKD  N+  + +L R+ V EY+K    KQ    LL F  V+ A+ Q+V+G  YY
Sbjct  194  IGGITEVKDFANSLVIDDLARFAVDEYSK----KQ--NTLLEFERVLDAKQQIVAGTMYY  247

Query  467  LKISAASSGGARRIYDAVVVVKPWAADSRELLDF  366
              I  A+ GG +  Y A V++KP   +S+EL +F
Sbjct  248  F-ILEATVGGVKNTYVAKVLLKP--DNSKELKEF  278



>ref|XP_010096012.1| Cysteine proteinase inhibitor 12 [Morus notabilis]
 gb|EXB62705.1| Cysteine proteinase inhibitor 12 [Morus notabilis]
Length=239

 Score = 67.8 bits (164),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 39/101 (39%), Positives = 62/101 (61%), Gaps = 8/101 (8%)
 Frame = -2

Query  647  VGGRTEVKDVKNNEEVQELGRYCVREYNKVLQEKQGGGGLLSFSEVVKAETQVVSGFKYY  468
            +GG  + +  +N+ +V++L R+ V+E+NK          LL F+ VVKAE QVV+G  ++
Sbjct  39   LGGVRQSRGCENSADVEDLARFAVQEHNK------KENALLEFARVVKAEEQVVAGTLHH  92

Query  467  LKISAASSGGARRIYDAVVVVKPWAADSRELLDFAPSPDSD  345
            L + A   GG ++IY+A V VKPW  + +EL +F  + D D
Sbjct  93   LTLEAI-EGGKKKIYEAKVWVKPW-LNFKELQEFKHTGDGD  131



>ref|XP_009394087.1| PREDICTED: cysteine proteinase inhibitor-like [Musa acuminata 
subsp. malaccensis]
Length=147

 Score = 65.9 bits (159),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 40/100 (40%), Positives = 59/100 (59%), Gaps = 8/100 (8%)
 Frame = -2

Query  647  VGGRTEVKDVKNNEEVQELGRYCVREYNKVLQEKQGGGGLLSFSEVVKAETQVVSGFKYY  468
            VGG  E +  +N+ E++EL R+ V E+NK          LL F+ VVKA+ QVV+G  ++
Sbjct  36   VGGLKESEGSQNSAEIEELARFAVDEHNK------KENALLEFARVVKAKEQVVTGTLHH  89

Query  467  LKISAASSGGARRIYDAVVVVKPWAADSRELLDFAPSPDS  348
            L + A  + G +++Y+A V VKPW    +EL DF    DS
Sbjct  90   LTVEAIDA-GKKKLYEAKVWVKPW-LHFKELQDFKHVADS  127



>dbj|BAB21558.1| cystatin [Coix lacryma-jobi]
Length=135

 Score = 65.5 bits (158),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 39/99 (39%), Positives = 57/99 (58%), Gaps = 8/99 (8%)
 Frame = -2

Query  656  GRKVGGRTEVKDVKNNEEVQELGRYCVREYNKVLQEKQGGGGLLSFSEVVKAETQVVSGF  477
            G   GG  +V   +N+  +QEL R+ V E+NK          LL + ++VKA+TQVV+G 
Sbjct  38   GMLAGGIKDVPANENDLHLQELARFAVDEHNK------KANALLGYEKLVKAKTQVVAGT  91

Query  476  KYYLKISAASSGGARRIYDAVVVVKPWAADSRELLDFAP  360
             YYL I     G  +++Y+A V  KPW  + +ELL+F P
Sbjct  92   MYYLTIE-VKDGEVKKLYEAKVWEKPW-ENFKELLEFKP  128



>ref|XP_010256520.1| PREDICTED: cysteine proteinase inhibitor 1-like [Nelumbo nucifera]
Length=123

 Score = 64.7 bits (156),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 40/94 (43%), Positives = 53/94 (56%), Gaps = 8/94 (9%)
 Frame = -2

Query  647  VGGRTEVKDVKNNEEVQELGRYCVREYNKVLQEKQGGGGLLSFSEVVKAETQVVSGFKYY  468
            +GG   +KDV++   VQEL R+ + ++NK           L F +VV+ ETQVV+G KY 
Sbjct  35   LGGWQPIKDVED-PHVQELARFVITQHNKEANTN------LKFQKVVRGETQVVAGTKYR  87

Query  467  LKISAASSGGARRIYDAVVVVKPWAADSRELLDF  366
            L I AA+ G A   Y+AVV  KPW    R L  F
Sbjct  88   L-IVAANDGHATNNYEAVVWEKPWEISGRTLTSF  120



>ref|XP_010245150.1| PREDICTED: cysteine proteinase inhibitor 12-like [Nelumbo nucifera]
Length=204

 Score = 65.9 bits (159),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 39/99 (39%), Positives = 61/99 (62%), Gaps = 8/99 (8%)
 Frame = -2

Query  647  VGGRTEVKDVKNNEEVQELGRYCVREYNKVLQEKQGGGGLLSFSEVVKAETQVVSGFKYY  468
            VGG  + + V+N+ E++ LGR+ V EYNK    KQ    LL F  VV+A+ Q+V+G  ++
Sbjct  7    VGGVHDSEGVQNSVEIESLGRFAVDEYNK----KQ--NALLEFGRVVEAKEQLVAGTLHH  60

Query  467  LKISAASSGGARRIYDAVVVVKPWAADSRELLDFAPSPD  351
            L +   +  G +++Y+A V VKPW  + +EL +F P  D
Sbjct  61   LTLE-VTEAGMKKLYEAKVWVKPW-LNFKELQEFTPVSD  97



>ref|NP_001105295.1| cystatin-1 precursor [Zea mays]
 sp|P31726.1|CYT1_MAIZE RecName: Full=Cystatin-1; AltName: Full=Corn kernel cysteine 
proteinase inhibitor; AltName: Full=Cystatin I; Flags: Precursor 
[Zea mays]
 dbj|BAA01472.1| corn cystatin I [Zea mays]
Length=135

 Score = 64.7 bits (156),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 38/99 (38%), Positives = 57/99 (58%), Gaps = 8/99 (8%)
 Frame = -2

Query  656  GRKVGGRTEVKDVKNNEEVQELGRYCVREYNKVLQEKQGGGGLLSFSEVVKAETQVVSGF  477
            G   GG  +V   +N+ ++QEL R+ V E+N      Q    LL F ++VKA+TQVV+G 
Sbjct  38   GMLAGGIKDVPANENDLQLQELARFAVNEHN------QKANALLGFEKLVKAKTQVVAGT  91

Query  476  KYYLKISAASSGGARRIYDAVVVVKPWAADSRELLDFAP  360
             YYL I     G  +++Y+A V  KPW  + ++L +F P
Sbjct  92   MYYLTIE-VKDGEVKKLYEAKVWEKPW-ENFKQLQEFKP  128



>gb|AAA96316.1| cysteine proteinase inhibitor [Brassica rapa subsp. oleifera]
Length=205

 Score = 65.9 bits (159),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 39/104 (38%), Positives = 61/104 (59%), Gaps = 9/104 (9%)
 Frame = -2

Query  647  VGGRTEVKDVKNNEEVQELGRYCVREYNKVLQEKQGGGGLLSFSEVVKAETQVVSGFKYY  468
            +GG  +V   +N+ EV+ L R+ V E+NK          LL F+ VVKA+ QVV+G  ++
Sbjct  4    LGGVRDVPANQNSGEVESLARFAVDEHNK------KENALLEFARVVKAKEQVVAGTMHH  57

Query  467  LKISAASSGGARRIYDAVVVVKPWAADSRELLDFAPSPDSDHPS  336
            L +    +G  +++Y+A V VKPW  + +EL +F P+ D   PS
Sbjct  58   LTLEIIEAG--KKLYEAKVWVKPW-LNFKELQEFKPASDDGSPS  98



>ref|XP_010910533.1| PREDICTED: cysteine proteinase inhibitor 1-like [Elaeis guineensis]
Length=119

 Score = 63.9 bits (154),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 40/96 (42%), Positives = 57/96 (59%), Gaps = 9/96 (9%)
 Frame = -2

Query  647  VGGRTEVKDVKNNEEVQELGRYCVREYNKVLQEKQGGGGLLSFSEVVKAETQVVSGFKYY  468
            +GG   +K+V N+  VQE+ ++ V E+NK+   +      L+FS+VVK ETQVVSG  Y 
Sbjct  30   LGGWQPIKNV-NDAHVQEIAKFAVSEHNKLANSR------LAFSKVVKGETQVVSGINYR  82

Query  467  LKISAASSGGARRIYDAVVVVKPWAADSRELLDFAP  360
            L +  A +GGA   Y+A+V  K W    R+L  F P
Sbjct  83   LVVE-AKNGGAMAKYEAIVWEKAWEG-FRKLTSFQP  116



>dbj|BAA09666.1| cysteine proteinase inhibitor [Zea mays]
 gb|AAY57865.1| cysteine proteinase inhibitor [Zea mays subsp. parviglumis]
 emb|CAJ20024.1| putative cystatin [Zea mays]
 gb|AFW84824.1| cystatin2 [Zea mays]
 emb|CEJ09685.1| Cystatin protein [Zea mays]
Length=134

 Score = 64.3 bits (155),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 39/99 (39%), Positives = 56/99 (57%), Gaps = 8/99 (8%)
 Frame = -2

Query  656  GRKVGGRTEVKDVKNNEEVQELGRYCVREYNKVLQEKQGGGGLLSFSEVVKAETQVVSGF  477
            G   GG  +V   +N+  +QEL R+ V E+NK          LL F ++VKA+TQVV+G 
Sbjct  37   GTLAGGIKDVPGNENDLHLQELARFAVDEHNK------KANALLGFEKLVKAKTQVVAGT  90

Query  476  KYYLKISAASSGGARRIYDAVVVVKPWAADSRELLDFAP  360
             YYL I     G  +++Y+A V  KPW  + +EL +F P
Sbjct  91   MYYLTIE-VKDGEVKKLYEAKVWEKPW-ENFKELQEFKP  127



>emb|CAA60610.1| cysteine proteinase inhibitor [Zea mays]
Length=134

 Score = 64.3 bits (155),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 39/99 (39%), Positives = 56/99 (57%), Gaps = 8/99 (8%)
 Frame = -2

Query  656  GRKVGGRTEVKDVKNNEEVQELGRYCVREYNKVLQEKQGGGGLLSFSEVVKAETQVVSGF  477
            G   GG  +V   +N+  +QEL R+ V E+NK          LL F ++VKA+TQVV+G 
Sbjct  37   GTLAGGIKDVPGNENDLHLQELARFAVDEHNK------KANALLGFEKLVKAKTQVVAGT  90

Query  476  KYYLKISAASSGGARRIYDAVVVVKPWAADSRELLDFAP  360
             YYL I     G  +++Y+A V  KPW  + +EL +F P
Sbjct  91   MYYLTIE-VKDGEVKKLYEAKVWEKPW-ENFKELQEFKP  127



>gb|AAB71505.1| cysteine protease inhibitor [Pyrus communis]
Length=95

 Score = 63.2 bits (152),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 39/100 (39%), Positives = 57/100 (57%), Gaps = 8/100 (8%)
 Frame = -2

Query  647  VGGRTEVKDVKNNEEVQELGRYCVREYNKVLQEKQGGGGLLSFSEVVKAETQVVSGFKYY  468
            VG   + + V N+ E + L RY V E+NK          LL F  V+  + QVVSG  +Y
Sbjct  4    VGAVRDNQGVANSVETESLARYAVDEHNK------KENDLLEFVRVLDDKVQVVSGTMHY  57

Query  467  LKISAASSGGARRIYDAVVVVKPWAADSRELLDFAPSPDS  348
            LKI  A+ GG +++Y+A V VKPW  + +++ +F P  DS
Sbjct  58   LKIE-ATEGGKKKVYEAKVWVKPW-ENFKQVQEFKPVSDS  95



>gb|AJD79052.1| CPI-1 [Morus alba var. atropurpurea]
Length=239

 Score = 65.9 bits (159),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 38/101 (38%), Positives = 62/101 (61%), Gaps = 8/101 (8%)
 Frame = -2

Query  647  VGGRTEVKDVKNNEEVQELGRYCVREYNKVLQEKQGGGGLLSFSEVVKAETQVVSGFKYY  468
            +GG  + +  +N+ +V++L R+ V+E+NK          LL F+ V+KAE QVV+G  ++
Sbjct  39   LGGVRQSRGCENSADVEDLARFAVQEHNK------KENALLEFAGVLKAEEQVVAGTLHH  92

Query  467  LKISAASSGGARRIYDAVVVVKPWAADSRELLDFAPSPDSD  345
            L + A   GG ++IY+A V VKPW  + +EL +F  + D D
Sbjct  93   LTLEAV-EGGKKKIYEAKVWVKPW-LNFKELQEFKHTGDGD  131



>gb|ABK22677.1| unknown [Picea sitchensis]
 gb|ABK25151.1| unknown [Picea sitchensis]
 gb|ABK26069.1| unknown [Picea sitchensis]
 gb|ABR17453.1| unknown [Picea sitchensis]
 gb|ACN40099.1| unknown [Picea sitchensis]
 gb|ACN40953.1| unknown [Picea sitchensis]
Length=141

 Score = 63.9 bits (154),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 41/96 (43%), Positives = 57/96 (59%), Gaps = 8/96 (8%)
 Frame = -2

Query  647  VGGRTEVKDVKNNEEVQELGRYCVREYNKVLQEKQGGGGLLSFSEVVKAETQVVSGFKYY  468
            +GG  +VKD +N+ E  +LGR+ V E+NK    +Q G   +SF  VV A+ QVV+G  Y+
Sbjct  37   LGGLRDVKDFQNSIETLDLGRFAVDEHNK----QQNGD--ISFRRVVAAQEQVVAGTMYH  90

Query  467  LKISAASSGGARRIYDAVVVVKPWAADSRELLDFAP  360
            L I  A  G   ++Y A V VKPW  + + L DF P
Sbjct  91   LTIE-AEDGDHPKLYKAKVWVKPW-ENFKRLEDFKP  124



>ref|XP_010670580.1| PREDICTED: cysteine proteinase inhibitor 6 [Beta vulgaris subsp. 
vulgaris]
Length=250

 Score = 65.9 bits (159),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 38/100 (38%), Positives = 58/100 (58%), Gaps = 8/100 (8%)
 Frame = -2

Query  647  VGGRTEVKDVKNNEEVQELGRYCVREYNKVLQEKQGGGGLLSFSEVVKAETQVVSGFKYY  468
            +GG  E +   N+ E++ L R+ V E+NK          LL F+ VVKA+ QVV+G  ++
Sbjct  49   LGGLRESQGASNDAEIESLARFAVEEHNK------KENALLEFARVVKAKEQVVAGTLHH  102

Query  467  LKISAASSGGARRIYDAVVVVKPWAADSRELLDFAPSPDS  348
              I A  + G +++YDA V VKPW  + +EL +F  + DS
Sbjct  103  FTIEAIEA-GKKKLYDAKVWVKPW-MNFKELQEFKHADDS  140



>ref|XP_009120653.1| PREDICTED: cysteine proteinase inhibitor 6-like [Brassica rapa]
Length=235

 Score = 65.5 bits (158),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 39/104 (38%), Positives = 61/104 (59%), Gaps = 8/104 (8%)
 Frame = -2

Query  647  VGGRTEVKDVKNNEEVQELGRYCVREYNKVLQEKQGGGGLLSFSEVVKAETQVVSGFKYY  468
            +GG  +V   +N+ EV+ L R+ V E+NK          LL F+ VVKA+ QVV+G  ++
Sbjct  34   LGGVRDVPANQNSGEVESLARFAVDEHNK------KENALLEFARVVKAKEQVVAGTMHH  87

Query  467  LKISAASSGGARRIYDAVVVVKPWAADSRELLDFAPSPDSDHPS  336
            L +    + G +++Y+A V VKPW  + +EL +F P+ D   PS
Sbjct  88   LTLEIIEA-GKKKLYEAKVWVKPW-LNFKELQEFKPASDDGSPS  129



>emb|CAJ20023.1| putative cystatin [Zea mays]
Length=135

 Score = 63.9 bits (154),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 38/99 (38%), Positives = 56/99 (57%), Gaps = 8/99 (8%)
 Frame = -2

Query  656  GRKVGGRTEVKDVKNNEEVQELGRYCVREYNKVLQEKQGGGGLLSFSEVVKAETQVVSGF  477
            G   GG  +V   +N+ ++QEL R+ V E+N      Q    LL F ++VKA+TQVV+G 
Sbjct  38   GMLAGGIKDVPANENDLQLQELARFAVNEHN------QKANALLGFEKLVKAKTQVVAGT  91

Query  476  KYYLKISAASSGGARRIYDAVVVVKPWAADSRELLDFAP  360
             YYL I     G   ++Y+A V  KPW  + ++L +F P
Sbjct  92   MYYLTIE-VKDGEVNKLYEAKVWEKPW-ENFKQLQEFKP  128



>emb|CEJ09683.1| Cystatin protein [Zea mays]
Length=134

 Score = 63.5 bits (153),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 38/99 (38%), Positives = 56/99 (57%), Gaps = 8/99 (8%)
 Frame = -2

Query  656  GRKVGGRTEVKDVKNNEEVQELGRYCVREYNKVLQEKQGGGGLLSFSEVVKAETQVVSGF  477
            G   GG  +V   +N+ ++QEL R+ V E+N      Q    LL F ++VKA+TQVV+G 
Sbjct  37   GMLAGGIKDVPANENDLQLQELARFAVNEHN------QKANALLGFEKLVKAKTQVVAGT  90

Query  476  KYYLKISAASSGGARRIYDAVVVVKPWAADSRELLDFAP  360
             YYL I     G   ++Y+A V  KPW  + ++L +F P
Sbjct  91   MYYLTIE-VKDGEVNKLYEAKVWEKPW-ENFKQLQEFKP  127



>ref|XP_008673426.1| PREDICTED: cystatin-1 isoform X1 [Zea mays]
 ref|XP_008673427.1| PREDICTED: cystatin-1 isoform X1 [Zea mays]
 gb|ACG38283.1| cystatin-1 precursor [Zea mays]
 tpg|DAA57226.1| TPA: cystatin1 isoform 1 [Zea mays]
 tpg|DAA57227.1| TPA: cystatin1 isoform 2 [Zea mays]
Length=135

 Score = 63.5 bits (153),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 38/99 (38%), Positives = 56/99 (57%), Gaps = 8/99 (8%)
 Frame = -2

Query  656  GRKVGGRTEVKDVKNNEEVQELGRYCVREYNKVLQEKQGGGGLLSFSEVVKAETQVVSGF  477
            G   GG  +V   +N+ ++QEL R+ V E+N      Q    LL F ++VKA+TQVV+G 
Sbjct  38   GMLAGGIKDVPANENDLQLQELARFAVNEHN------QKANALLGFEKLVKAKTQVVAGT  91

Query  476  KYYLKISAASSGGARRIYDAVVVVKPWAADSRELLDFAP  360
             YYL I     G   ++Y+A V  KPW  + ++L +F P
Sbjct  92   MYYLTIE-VKDGEVNKLYEAKVWEKPW-ENFKQLQEFKP  128



>gb|AEQ54767.1| cysteine proteinase inhibitor CPI-2 [Coffea canephora]
 emb|CDP09706.1| unnamed protein product [Coffea canephora]
Length=98

 Score = 63.2 bits (152),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 38/98 (39%), Positives = 60/98 (61%), Gaps = 8/98 (8%)
 Frame = -2

Query  650  KVGGRTEVKDVKNNEEVQELGRYCVREYNKVLQEKQGGGGLLSFSEVVKAETQVVSGFKY  471
            KVGG +E K  +N+ E++ L ++ V +YNK    KQ    LL F +V+ ++ QVV+G  Y
Sbjct  3    KVGGISESKGNENSLEIESLAKFAVDDYNK----KQ--NALLEFQKVINSKEQVVAGTVY  56

Query  470  YLKISAASSGGARRIYDAVVVVKPWAADSRELLDFAPS  357
            YL I     G  +++Y+A V VKPW  + +E+ +F P+
Sbjct  57   YLTIE-VKDGNEKKLYEAKVWVKPW-LNFKEVQEFKPA  92



>ref|XP_010689648.1| PREDICTED: cysteine proteinase inhibitor 6-like [Beta vulgaris 
subsp. vulgaris]
Length=213

 Score = 64.7 bits (156),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 38/100 (38%), Positives = 57/100 (57%), Gaps = 8/100 (8%)
 Frame = -2

Query  647  VGGRTEVKDVKNNEEVQELGRYCVREYNKVLQEKQGGGGLLSFSEVVKAETQVVSGFKYY  468
            +GG  E +   N+ E++ L R+ V E+NK          LL F+ VVKA+ QVV+G  ++
Sbjct  49   LGGLRESQGASNDAEIESLARFAVEEHNK------KENALLEFARVVKAKEQVVAGTLHH  102

Query  467  LKISAASSGGARRIYDAVVVVKPWAADSRELLDFAPSPDS  348
              I A    G +++YDA V VKPW  + +EL +F  + DS
Sbjct  103  FTIEAI-EAGKKKLYDAKVWVKPW-MNFKELQEFKHADDS  140



>ref|XP_004511090.1| PREDICTED: cysteine proteinase inhibitor 12-like [Cicer arietinum]
Length=247

 Score = 65.5 bits (158),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 40/107 (37%), Positives = 63/107 (59%), Gaps = 8/107 (7%)
 Frame = -2

Query  656  GRKVGGRTEVKDVKNNEEVQELGRYCVREYNKVLQEKQGGGGLLSFSEVVKAETQVVSGF  477
              K+GG  +    +N++E++ L R+ V ++N     KQ    LL F+ VVKA  QVV+G 
Sbjct  45   ATKLGGIHDSHSSQNSDEIESLARFAVDQHNT----KQNS--LLEFARVVKAREQVVAGT  98

Query  476  KYYLKISAASSGGARRIYDAVVVVKPWAADSRELLDFAPSPDSDHPS  336
             ++L + A  + G ++IY+A V VKPW  + +EL +F  + D D PS
Sbjct  99   LHHLTLEAIDA-GEKKIYEAKVWVKPW-LNFKELQEFKHAGDGDAPS  143



>emb|CBI32827.3| unnamed protein product [Vitis vinifera]
Length=201

 Score = 64.7 bits (156),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 38/105 (36%), Positives = 60/105 (57%), Gaps = 15/105 (14%)
 Frame = -2

Query  647  VGGRTEVKDVKNNEEVQELGRYCVREYNKVLQEKQGGGGLLSFSEVVKAETQVVSGFKYY  468
            +GG  +   ++N+ E++ + R+ V+E+NK          LL F++V+KA+ QVV+G  YY
Sbjct  4    LGGVRDCGGIQNSAEIESIARFAVQEHNK------NQNALLEFAKVLKAKEQVVAGKIYY  57

Query  467  LKISAASSGGARRIYDAVVVVKPWA--------ADSRELLDFAPS  357
            L + A  + G ++IY+A V VKPW           S+E   FAPS
Sbjct  58   LTLEAIDA-GKKKIYEAKVWVKPWMNFKELQEFKHSQETKSFAPS  101



>prf||2203261A Cys protease inhibitor
Length=100

 Score = 62.8 bits (151),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 41/104 (39%), Positives = 59/104 (57%), Gaps = 9/104 (9%)
 Frame = -2

Query  647  VGGRTEVKDVKNNEEVQELGRYCVREYNKVLQEKQGGGGLLSFSEVVKAETQVVSGFKYY  468
            +GG  +V D  N+ E +EL R+ V+E+NK           L FS VVKA+ QVV+G  YY
Sbjct  3    LGGVRDVPD-HNSAETEELARFAVQEHNK------KANTRLEFSRVVKAKEQVVAGTMYY  55

Query  467  LKISAASSGGARRIYDAVVVVKPWAADSRELLDFAPSPDSDHPS  336
            + +    + G ++IY+A V VK W  + +EL +F P  DS   S
Sbjct  56   ITLEVVEA-GQKKIYEAKVWVKLW-ENFKELQEFKPVGDSSSTS  97



>gb|ABK23250.1| unknown [Picea sitchensis]
 gb|ABR17663.1| unknown [Picea sitchensis]
 gb|ACN40769.1| unknown [Picea sitchensis]
Length=231

 Score = 64.7 bits (156),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 41/96 (43%), Positives = 57/96 (59%), Gaps = 8/96 (8%)
 Frame = -2

Query  647  VGGRTEVKDVKNNEEVQELGRYCVREYNKVLQEKQGGGGLLSFSEVVKAETQVVSGFKYY  468
            +GG  +VKD +N+ E  +LGR+ V E+NK    +Q G   +SF  VV A+ QVV+G  Y+
Sbjct  37   LGGLRDVKDFQNSIETLDLGRFAVDEHNK----QQNGD--ISFRRVVAAQEQVVAGTMYH  90

Query  467  LKISAASSGGARRIYDAVVVVKPWAADSRELLDFAP  360
            L I  A  G   ++Y A V VKPW  + + L DF P
Sbjct  91   LTIE-AEDGDHPKLYKAKVWVKPW-ENFKRLEDFKP  124



>gb|EPS68642.1| cysteine proteinase inhibitor, partial [Genlisea aurea]
Length=79

 Score = 62.0 bits (149),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 33/74 (45%), Positives = 47/74 (64%), Gaps = 7/74 (9%)
 Frame = -2

Query  617  KNNEEVQELGRYCVREYNKVLQEKQGGGGLLSFSEVVKAETQVVSGFKYYLKISAASSGG  438
            +N+ EV+ LGR+ ++E+NK           L F+ VVKAE QVVSG  Y+L + A   GG
Sbjct  1    QNDGEVESLGRFAIQEHNK------NQNAALEFTRVVKAEQQVVSGKLYHLTVEAV-DGG  53

Query  437  ARRIYDAVVVVKPW  396
             +++Y+A V VKPW
Sbjct  54   QKQVYEAKVWVKPW  67



>ref|XP_004970285.1| PREDICTED: cystatin-1-like [Setaria italica]
Length=136

 Score = 63.2 bits (152),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 40/103 (39%), Positives = 58/103 (56%), Gaps = 8/103 (8%)
 Frame = -2

Query  656  GRKVGGRTEVKDVKNNEEVQELGRYCVREYNKVLQEKQGGGGLLSFSEVVKAETQVVSGF  477
            G   GG T+V   +N+  +QE+ R+ V E NK          LLS+  +VKA+TQVV+G 
Sbjct  40   GTLAGGITDVPQGENDIHLQEIARFAVDENNK------KTNALLSYERIVKAKTQVVAGA  93

Query  476  KYYLKISAASSGGARRIYDAVVVVKPWAADSRELLDFAPSPDS  348
             YYL I     G A+++Y+A V  K W  + +EL +F P  +S
Sbjct  94   MYYLTIE-VKDGTAKKLYEAKVWEKSW-ENFKELQEFKPVEES  134



>gb|ABR16995.1| unknown [Picea sitchensis]
Length=231

 Score = 64.7 bits (156),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 41/96 (43%), Positives = 57/96 (59%), Gaps = 8/96 (8%)
 Frame = -2

Query  647  VGGRTEVKDVKNNEEVQELGRYCVREYNKVLQEKQGGGGLLSFSEVVKAETQVVSGFKYY  468
            +GG  +VKD +N+ E  +LGR+ V E+NK    +Q G   +SF  VV A+ QVV+G  Y+
Sbjct  37   LGGLRDVKDFQNSIETLDLGRFAVDEHNK----QQNGD--ISFRRVVAAQEQVVAGTMYH  90

Query  467  LKISAASSGGARRIYDAVVVVKPWAADSRELLDFAP  360
            L I  A  G   ++Y A V VKPW  + + L DF P
Sbjct  91   LTIE-AEDGDHPKLYKAKVWVKPW-ENFKRLEDFKP  124



>ref|XP_008245515.1| PREDICTED: cysteine proteinase inhibitor 6-like [Prunus mume]
 ref|XP_008245658.1| PREDICTED: cysteine proteinase inhibitor 6-like [Prunus mume]
Length=95

 Score = 62.4 bits (150),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 39/100 (39%), Positives = 55/100 (55%), Gaps = 8/100 (8%)
 Frame = -2

Query  647  VGGRTEVKDVKNNEEVQELGRYCVREYNKVLQEKQGGGGLLSFSEVVKAETQVVSGFKYY  468
            VG   E +  +N+ E + L R+ V EYNK          LL F  VV  + QVVSG  +Y
Sbjct  4    VGTVRESQGSENSVETESLARFAVEEYNK------KENALLEFVRVVNEKVQVVSGTLHY  57

Query  467  LKISAASSGGARRIYDAVVVVKPWAADSRELLDFAPSPDS  348
            L I   S  G +++++A V VKPW A+ +E+ +F P  DS
Sbjct  58   LTIE-VSDAGKKKLFEAKVWVKPW-ANFKEVQEFKPVADS  95



>ref|XP_010938907.1| PREDICTED: cysteine proteinase inhibitor 12-like [Elaeis guineensis]
Length=200

 Score = 64.3 bits (155),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 38/100 (38%), Positives = 60/100 (60%), Gaps = 8/100 (8%)
 Frame = -2

Query  647  VGGRTEVKDVKNNEEVQELGRYCVREYNKVLQEKQGGGGLLSFSEVVKAETQVVSGFKYY  468
            +G  +E +  +NN +++ELGR+ VRE+NK          LL F  VVKA+ QVV+G  ++
Sbjct  4    LGRASESQSNENNMDIEELGRFAVREHNK------KENALLEFGRVVKAKEQVVAGTLHH  57

Query  467  LKISAASSGGARRIYDAVVVVKPWAADSRELLDFAPSPDS  348
            L +    + G ++I +A V VKPW  + +EL +F  + DS
Sbjct  58   LTLEVMEA-GKKKICEAKVWVKPW-LNFKELQEFKHAGDS  95



>gb|ACN40125.1| unknown [Picea sitchensis]
Length=225

 Score = 64.7 bits (156),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 41/96 (43%), Positives = 57/96 (59%), Gaps = 8/96 (8%)
 Frame = -2

Query  647  VGGRTEVKDVKNNEEVQELGRYCVREYNKVLQEKQGGGGLLSFSEVVKAETQVVSGFKYY  468
            +GG  +VKD +N+ E  +LGR+ V E+NK    +Q G   +SF  VV A+ QVV+G  Y+
Sbjct  37   LGGLRDVKDFQNSIETLDLGRFAVDEHNK----QQNGD--ISFRRVVAAQEQVVAGTMYH  90

Query  467  LKISAASSGGARRIYDAVVVVKPWAADSRELLDFAP  360
            L I  A  G   ++Y A V VKPW  + + L DF P
Sbjct  91   LTIE-AEDGDHPKLYKAKVWVKPW-ENFKRLEDFKP  124



>emb|CEJ09687.1| Cystatin protein [Zea mays]
Length=134

 Score = 63.2 bits (152),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 39/99 (39%), Positives = 56/99 (57%), Gaps = 8/99 (8%)
 Frame = -2

Query  656  GRKVGGRTEVKDVKNNEEVQELGRYCVREYNKVLQEKQGGGGLLSFSEVVKAETQVVSGF  477
            G  VGG  +V   +N+  +QEL R+ V E+NK          LL F ++VKA+TQVV+G 
Sbjct  37   GTLVGGIQDVPGSENDLHLQELARFAVDEHNK------KANALLGFEKLVKAKTQVVAGT  90

Query  476  KYYLKISAASSGGARRIYDAVVVVKPWAADSRELLDFAP  360
             YYL I     G  +++Y+A V  KPW  + + L +F P
Sbjct  91   MYYLTIE-VKDGEVKKLYEAKVWEKPW-ENLKGLQEFKP  127



>gb|AFW97773.1| cysteine protease inhibitor [Brassica oleracea var. italica]
 emb|CDY50343.1| BnaC01g38380D [Brassica napus]
Length=205

 Score = 64.3 bits (155),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 38/104 (37%), Positives = 61/104 (59%), Gaps = 8/104 (8%)
 Frame = -2

Query  647  VGGRTEVKDVKNNEEVQELGRYCVREYNKVLQEKQGGGGLLSFSEVVKAETQVVSGFKYY  468
            +GG  ++   +N+ EV+ L R+ V E+NK          LL F+ VVKA+ QVV+G  ++
Sbjct  4    LGGVRDLPANENSVEVESLARFAVDEHNK------KENALLEFARVVKAKEQVVAGTMHH  57

Query  467  LKISAASSGGARRIYDAVVVVKPWAADSRELLDFAPSPDSDHPS  336
            L +    + G +++Y+A V VKPW  + +EL +F P+ D   PS
Sbjct  58   LTLEIIEA-GKKKLYEAKVWVKPW-LNFKELQEFKPASDDGAPS  99



>gb|AAY57857.1| cysteine proteinase inhibitor [Zea mays subsp. parviglumis]
 gb|AAY57858.1| cysteine proteinase inhibitor [Zea mays subsp. parviglumis]
 gb|AAY57860.1| cysteine proteinase inhibitor [Zea mays subsp. parviglumis]
 gb|AAY57861.1| cysteine proteinase inhibitor [Zea mays subsp. parviglumis]
 gb|AAY57862.1| cysteine proteinase inhibitor [Zea mays subsp. parviglumis]
 gb|AAY57863.1| cysteine proteinase inhibitor [Zea mays subsp. parviglumis]
 gb|AAY57866.1| cysteine proteinase inhibitor [Zea mays subsp. parviglumis]
 emb|CDL74704.1| Cystatin protein [Zea mays subsp. mays]
 gb|AHG97965.1| cystatin II [Zea mays]
 emb|CEJ09686.1| Cystatin protein [Zea mays]
Length=134

 Score = 63.2 bits (152),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 39/99 (39%), Positives = 56/99 (57%), Gaps = 8/99 (8%)
 Frame = -2

Query  656  GRKVGGRTEVKDVKNNEEVQELGRYCVREYNKVLQEKQGGGGLLSFSEVVKAETQVVSGF  477
            G  VGG  +V   +N+  +QEL R+ V E+NK          LL F ++VKA+TQVV+G 
Sbjct  37   GTLVGGIQDVPGSENDLHLQELARFAVDEHNK------KANALLGFEKLVKAKTQVVAGT  90

Query  476  KYYLKISAASSGGARRIYDAVVVVKPWAADSRELLDFAP  360
             YYL I     G  +++Y+A V  KPW  + + L +F P
Sbjct  91   MYYLTIE-VKDGEVKKLYEAKVWEKPW-ENLKGLQEFKP  127



>gb|ABK23526.1| unknown [Picea sitchensis]
 gb|ABK24580.1| unknown [Picea sitchensis]
 gb|ABK25596.1| unknown [Picea sitchensis]
 gb|ABK26416.1| unknown [Picea sitchensis]
 gb|ABR16656.1| unknown [Picea sitchensis]
 gb|ACN40019.1| unknown [Picea sitchensis]
 gb|ACN40233.1| unknown [Picea sitchensis]
 gb|ACN40884.1| unknown [Picea sitchensis]
 gb|ACN41060.1| unknown [Picea sitchensis]
Length=141

 Score = 63.2 bits (152),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 40/96 (42%), Positives = 57/96 (59%), Gaps = 8/96 (8%)
 Frame = -2

Query  647  VGGRTEVKDVKNNEEVQELGRYCVREYNKVLQEKQGGGGLLSFSEVVKAETQVVSGFKYY  468
            +GG  +VKD +N+ E  +LGR+ V E+NK    +Q G   ++F  VV A+ QVV+G  Y+
Sbjct  37   LGGLRDVKDFQNSIETLDLGRFAVDEHNK----QQNGD--ITFRRVVAAQEQVVAGTMYH  90

Query  467  LKISAASSGGARRIYDAVVVVKPWAADSRELLDFAP  360
            L I  A  G   ++Y A V VKPW  + + L DF P
Sbjct  91   LTIE-AEDGDHPKLYKAKVWVKPW-ENFKRLEDFKP  124



>gb|ABG89856.1| cystatin [Amaranthus hypochondriacus]
Length=247

 Score = 64.7 bits (156),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 38/100 (38%), Positives = 58/100 (58%), Gaps = 8/100 (8%)
 Frame = -2

Query  647  VGGRTEVKDVKNNEEVQELGRYCVREYNKVLQEKQGGGGLLSFSEVVKAETQVVSGFKYY  468
            +GG  E +   N+ E++ L R+ V E+NK          LL F+ VVKA+ QVV+G  ++
Sbjct  45   LGGLRESQGAANDAEIESLARFAVDEHNK------KENALLEFARVVKAKEQVVAGTLHH  98

Query  467  LKISAASSGGARRIYDAVVVVKPWAADSRELLDFAPSPDS  348
              I A  + G +++YDA V VKPW  + +EL +F  + DS
Sbjct  99   FTIEAIDA-GKKKLYDAKVWVKPW-MNFKELQEFKHTEDS  136



>ref|XP_002283400.1| PREDICTED: cysteine proteinase inhibitor 12-like [Vitis vinifera]
Length=234

 Score = 64.7 bits (156),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 38/105 (36%), Positives = 60/105 (57%), Gaps = 15/105 (14%)
 Frame = -2

Query  647  VGGRTEVKDVKNNEEVQELGRYCVREYNKVLQEKQGGGGLLSFSEVVKAETQVVSGFKYY  468
            +GG  +   ++N+ E++ + R+ V+E+NK          LL F++V+KA+ QVV+G  YY
Sbjct  37   LGGVRDCGGIQNSAEIESIARFAVQEHNK------NQNALLEFAKVLKAKEQVVAGKIYY  90

Query  467  LKISAASSGGARRIYDAVVVVKPWA--------ADSRELLDFAPS  357
            L + A  + G ++IY+A V VKPW           S+E   FAPS
Sbjct  91   LTLEAIDA-GKKKIYEAKVWVKPWMNFKELQEFKHSQETKSFAPS  134



>ref|XP_006407331.1| hypothetical protein EUTSA_v10021442mg [Eutrema salsugineum]
 dbj|BAJ34340.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ48784.1| hypothetical protein EUTSA_v10021442mg [Eutrema salsugineum]
Length=234

 Score = 64.7 bits (156),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 37/100 (37%), Positives = 61/100 (61%), Gaps = 8/100 (8%)
 Frame = -2

Query  647  VGGRTEVKDVKNNEEVQELGRYCVREYNKVLQEKQGGGGLLSFSEVVKAETQVVSGFKYY  468
            +GG  +V   +N++EV+ L R+ V E+NK          LL F+ VVKA+ QVV+G  ++
Sbjct  37   LGGVRDVPVNQNSDEVESLARFAVDEHNK------KENALLEFARVVKAKEQVVAGTLHH  90

Query  467  LKISAASSGGARRIYDAVVVVKPWAADSRELLDFAPSPDS  348
            L +    + G +++Y+A V VKPW  + +EL +F P+ D+
Sbjct  91   LTLEIVEA-GKKKLYEAKVWVKPW-LNFKELQEFKPASDA  128



>ref|XP_009384360.1| PREDICTED: cysteine proteinase inhibitor A-like [Musa acuminata 
subsp. malaccensis]
Length=99

 Score = 62.0 bits (149),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 34/90 (38%), Positives = 51/90 (57%), Gaps = 7/90 (8%)
 Frame = -2

Query  617  KNNEEVQELGRYCVREYNKVLQEKQGGGGLLSFSEVVKAETQVVSGFKYYLKISAASSGG  438
            +N+ +V+EL R+ + E+NK           L    VVK + QVV+G  YYL + A  S G
Sbjct  14   QNSSKVEELARFAIDEHNK------KANATLELVGVVKVKEQVVAGQMYYLTLEAKESNG  67

Query  437  ARRIYDAVVVVKPWAADSRELLDFAPSPDS  348
             +++Y+A + VKPW  D +EL +F    DS
Sbjct  68   EKKLYEAKIWVKPW-MDFKELQEFKELDDS  96



>ref|NP_001288858.1| cysteine proteinase inhibitor 6-like [Brassica rapa]
 gb|ABK78689.1| cysteine proteinase inhibitor [Brassica rapa]
Length=202

 Score = 63.9 bits (154),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 37/99 (37%), Positives = 60/99 (61%), Gaps = 8/99 (8%)
 Frame = -2

Query  647  VGGRTEVKDVKNNEEVQELGRYCVREYNKVLQEKQGGGGLLSFSEVVKAETQVVSGFKYY  468
            +GG  +V   +N++EV+ L R+ V E+NK          LL F+ VVKA+ QVV+G  ++
Sbjct  4    LGGVRDVPAYQNSDEVESLARFAVDEHNK------KENVLLEFARVVKAKEQVVAGTMHH  57

Query  467  LKISAASSGGARRIYDAVVVVKPWAADSRELLDFAPSPD  351
            L +    + G +++Y+A V VKPW  + +EL +F P+ D
Sbjct  58   LTLEIVEA-GKKKLYEAKVWVKPW-LNFKELQEFKPASD  94



>emb|CEJ09684.1| Cystatin protein [Zea mays]
Length=134

 Score = 62.8 bits (151),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 39/99 (39%), Positives = 56/99 (57%), Gaps = 8/99 (8%)
 Frame = -2

Query  656  GRKVGGRTEVKDVKNNEEVQELGRYCVREYNKVLQEKQGGGGLLSFSEVVKAETQVVSGF  477
            G  VGG  +V   +N+  +QEL R+ V E+NK          LL F ++VKA+TQVV+G 
Sbjct  37   GPLVGGIQDVPGSENDLHLQELARFAVDEHNK------KANALLGFEKLVKAKTQVVAGT  90

Query  476  KYYLKISAASSGGARRIYDAVVVVKPWAADSRELLDFAP  360
             YYL I     G  +++Y+A V  KPW  + + L +F P
Sbjct  91   MYYLTIE-VKDGEVKKLYEAKVWEKPW-ENLKGLQEFKP  127



>gb|AAN65082.1| cysteine proteinase inhibitor, putative 1 [Arabidopsis thaliana]
Length=201

 Score = 63.9 bits (154),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 38/100 (38%), Positives = 60/100 (60%), Gaps = 8/100 (8%)
 Frame = -2

Query  647  VGGRTEVKDVKNNEEVQELGRYCVREYNKVLQEKQGGGGLLSFSEVVKAETQVVSGFKYY  468
            VGG  +V   +N+ EV+ L R+ V E+NK          LL F+ VVKA+ QVV+G  ++
Sbjct  4    VGGVGDVPANQNSGEVESLARFAVDEHNK------KENALLEFARVVKAKEQVVAGTLHH  57

Query  467  LKISAASSGGARRIYDAVVVVKPWAADSRELLDFAPSPDS  348
            L +    + G +++Y+A V VKPW  + +EL +F P+ D+
Sbjct  58   LTLEILEA-GQKKLYEAKVWVKPW-LNFKELQEFKPASDA  95



>ref|NP_566425.1| cysteine proteinase inhibitor 6 [Arabidopsis thaliana]
 gb|AAL38303.1| cysteine proteinase inhibitor, putative 1 [Arabidopsis thaliana]
 gb|AAM63160.1| cysteine proteinase inhibitor, putative [Arabidopsis thaliana]
 gb|AEE75202.1| cysteine proteinase inhibitor 6 [Arabidopsis thaliana]
Length=201

 Score = 63.9 bits (154),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 38/100 (38%), Positives = 60/100 (60%), Gaps = 8/100 (8%)
 Frame = -2

Query  647  VGGRTEVKDVKNNEEVQELGRYCVREYNKVLQEKQGGGGLLSFSEVVKAETQVVSGFKYY  468
            VGG  +V   +N+ EV+ L R+ V E+NK          LL F+ VVKA+ QVV+G  ++
Sbjct  4    VGGVGDVPANQNSGEVESLARFAVDEHNK------KENALLEFARVVKAKEQVVAGTLHH  57

Query  467  LKISAASSGGARRIYDAVVVVKPWAADSRELLDFAPSPDS  348
            L +    + G +++Y+A V VKPW  + +EL +F P+ D+
Sbjct  58   LTLEILEA-GQKKLYEAKVWVKPW-LNFKELQEFKPASDA  95



>gb|AAG31653.1| PRLI-interacting factor M [Arabidopsis thaliana]
Length=209

 Score = 63.9 bits (154),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 38/100 (38%), Positives = 60/100 (60%), Gaps = 8/100 (8%)
 Frame = -2

Query  647  VGGRTEVKDVKNNEEVQELGRYCVREYNKVLQEKQGGGGLLSFSEVVKAETQVVSGFKYY  468
            VGG  +V   +N+ EV+ L R+ V E+NK          LL F+ VVKA+ QVV+G  ++
Sbjct  12   VGGVGDVPANQNSGEVESLARFAVDEHNK------KENALLEFARVVKAKEQVVAGTLHH  65

Query  467  LKISAASSGGARRIYDAVVVVKPWAADSRELLDFAPSPDS  348
            L +    + G +++Y+A V VKPW  + +EL +F P+ D+
Sbjct  66   LTLEILEA-GQKKLYEAKVWVKPW-LNFKELQEFTPASDA  103



>gb|ABK26812.1| unknown [Picea sitchensis]
Length=231

 Score = 63.9 bits (154),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 40/96 (42%), Positives = 57/96 (59%), Gaps = 8/96 (8%)
 Frame = -2

Query  647  VGGRTEVKDVKNNEEVQELGRYCVREYNKVLQEKQGGGGLLSFSEVVKAETQVVSGFKYY  468
            +GG  +VKD +N+ E  +LGR+ V E+NK    +Q G   ++F  VV A+ QVV+G  Y+
Sbjct  37   LGGLRDVKDFQNSIETLDLGRFAVDEHNK----QQNGD--ITFRRVVAAQEQVVAGTMYH  90

Query  467  LKISAASSGGARRIYDAVVVVKPWAADSRELLDFAP  360
            L I  A  G   ++Y A V VKPW  + + L DF P
Sbjct  91   LTIE-AEDGDHPKLYKAKVWVKPW-ENFKRLEDFKP  124



>ref|XP_010031030.1| PREDICTED: cysteine proteinase inhibitor 12 [Eucalyptus grandis]
 gb|KCW50300.1| hypothetical protein EUGRSUZ_J00085 [Eucalyptus grandis]
Length=239

 Score = 64.3 bits (155),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 38/99 (38%), Positives = 59/99 (60%), Gaps = 8/99 (8%)
 Frame = -2

Query  647  VGGRTEVKDVKNNEEVQELGRYCVREYNKVLQEKQGGGGLLSFSEVVKAETQVVSGFKYY  468
            +GG  E    +N+ EV+ LGR+ V E+N          GLL F+ VVKA  QVV+G  ++
Sbjct  42   LGGVHESCGAENSVEVESLGRFAVDEHN------SKENGLLEFARVVKAHEQVVAGTLHH  95

Query  467  LKISAASSGGARRIYDAVVVVKPWAADSRELLDFAPSPD  351
            L I A  + G +++Y+A + V+PW  +S+EL +F  + D
Sbjct  96   LTIEAVDA-GKKKLYEAKIWVRPW-MNSKELQEFKHAGD  132



>gb|ABK22339.1| unknown [Picea sitchensis]
Length=231

 Score = 63.9 bits (154),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 40/96 (42%), Positives = 57/96 (59%), Gaps = 8/96 (8%)
 Frame = -2

Query  647  VGGRTEVKDVKNNEEVQELGRYCVREYNKVLQEKQGGGGLLSFSEVVKAETQVVSGFKYY  468
            +GG  +VKD +N+ E  +LGR+ V E+NK    +Q G   ++F  VV A+ QVV+G  Y+
Sbjct  37   LGGLRDVKDFQNSIETLDLGRFAVDEHNK----QQNGD--ITFRRVVAAQEQVVAGTMYH  90

Query  467  LKISAASSGGARRIYDAVVVVKPWAADSRELLDFAP  360
            L I  A  G   ++Y A V VKPW  + + L DF P
Sbjct  91   LTIE-AEDGDHPKLYKAKVWVKPW-ENFKRLEDFKP  124



>ref|XP_007220494.1| hypothetical protein PRUPE_ppa013935mg [Prunus persica]
 gb|EMJ21693.1| hypothetical protein PRUPE_ppa013935mg [Prunus persica]
Length=95

 Score = 61.6 bits (148),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 38/100 (38%), Positives = 55/100 (55%), Gaps = 8/100 (8%)
 Frame = -2

Query  647  VGGRTEVKDVKNNEEVQELGRYCVREYNKVLQEKQGGGGLLSFSEVVKAETQVVSGFKYY  468
            VG   E +  +N+ E + L R+ V EYNK          LL F  VV  + QVVSG  +Y
Sbjct  4    VGTVRESQGSENSVETESLARFAVEEYNK------KENALLEFVRVVNEKVQVVSGTLHY  57

Query  467  LKISAASSGGARRIYDAVVVVKPWAADSRELLDFAPSPDS  348
            L I   +  G +++++A V VKPW A+ +E+ +F P  DS
Sbjct  58   LTIE-VTDAGKKKLFEAKVWVKPW-ANFKEVQEFKPVADS  95



>gb|KCW50301.1| hypothetical protein EUGRSUZ_J00085 [Eucalyptus grandis]
Length=218

 Score = 63.9 bits (154),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 38/99 (38%), Positives = 59/99 (60%), Gaps = 8/99 (8%)
 Frame = -2

Query  647  VGGRTEVKDVKNNEEVQELGRYCVREYNKVLQEKQGGGGLLSFSEVVKAETQVVSGFKYY  468
            +GG  E    +N+ EV+ LGR+ V E+N          GLL F+ VVKA  QVV+G  ++
Sbjct  42   LGGVHESCGAENSVEVESLGRFAVDEHNS------KENGLLEFARVVKAHEQVVAGTLHH  95

Query  467  LKISAASSGGARRIYDAVVVVKPWAADSRELLDFAPSPD  351
            L I A  + G +++Y+A + V+PW  +S+EL +F  + D
Sbjct  96   LTIEAVDA-GKKKLYEAKIWVRPW-MNSKELQEFKHAGD  132



>ref|XP_008375331.1| PREDICTED: cysteine proteinase inhibitor 6-like isoform X1 [Malus 
domestica]
Length=248

 Score = 64.3 bits (155),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 40/110 (36%), Positives = 63/110 (57%), Gaps = 8/110 (7%)
 Frame = -2

Query  647  VGGRTEVKDVKNNEEVQELGRYCVREYNKVLQEKQGGGGLLSFSEVVKAETQVVSGFKYY  468
            VGG  E + V+N+ EV++L R+ V+E+N           LL F  VVKA+ QVV+G  ++
Sbjct  48   VGGIQESRGVQNSAEVEDLARFAVQEHN------NKENALLEFVRVVKAKEQVVAGTLHH  101

Query  467  LKISAASSGGARRIYDAVVVVKPWAADSRELLDFAPSPDSDHPSKQFLDI  318
            L I A  + G +++Y+A V VKPW    +E  +F  + + + PS    D+
Sbjct  102  LTIEAIEA-GKKKLYEAKVWVKPWMG-FKEEQEFKQADEEETPSVTSSDL  149



>ref|XP_008375332.1| PREDICTED: cysteine proteinase inhibitor 6-like isoform X2 [Malus 
domestica]
Length=247

 Score = 64.3 bits (155),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 40/110 (36%), Positives = 63/110 (57%), Gaps = 8/110 (7%)
 Frame = -2

Query  647  VGGRTEVKDVKNNEEVQELGRYCVREYNKVLQEKQGGGGLLSFSEVVKAETQVVSGFKYY  468
            VGG  E + V+N+ EV++L R+ V+E+N           LL F  VVKA+ QVV+G  ++
Sbjct  48   VGGIQESRGVQNSAEVEDLARFAVQEHN------NKENALLEFVRVVKAKEQVVAGTLHH  101

Query  467  LKISAASSGGARRIYDAVVVVKPWAADSRELLDFAPSPDSDHPSKQFLDI  318
            L I A  + G +++Y+A V VKPW    +E  +F  + + + PS    D+
Sbjct  102  LTIEAIEA-GKKKLYEAKVWVKPWMG-FKEEQEFKQADEEETPSVTSSDL  149



>emb|CDY42150.1| BnaC05g40690D [Brassica napus]
Length=203

 Score = 63.5 bits (153),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 37/100 (37%), Positives = 60/100 (60%), Gaps = 8/100 (8%)
 Frame = -2

Query  647  VGGRTEVKDVKNNEEVQELGRYCVREYNKVLQEKQGGGGLLSFSEVVKAETQVVSGFKYY  468
            +GG  +V   +N+ EV+ L R+ V E+NK          LL F+ VVKA+ QVV+G  ++
Sbjct  4    LGGVRDVPANQNSGEVESLARFAVDEHNK------KENSLLEFARVVKAKEQVVAGTMHH  57

Query  467  LKISAASSGGARRIYDAVVVVKPWAADSRELLDFAPSPDS  348
            L +    + G +++Y+A V VKPW  + +EL +F P+ D+
Sbjct  58   LTLEIVEA-GKKKLYEAKVWVKPW-LNFKELQEFKPASDA  95



>gb|KCW50299.1| hypothetical protein EUGRSUZ_J00085 [Eucalyptus grandis]
Length=240

 Score = 63.9 bits (154),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 38/99 (38%), Positives = 60/99 (61%), Gaps = 7/99 (7%)
 Frame = -2

Query  647  VGGRTEVKDVKNNEEVQELGRYCVREYNKVLQEKQGGGGLLSFSEVVKAETQVVSGFKYY  468
            +GG  E    +N+ EV+ LGR+ V E+N      +   GLL F+ VVKA  QVV+G  ++
Sbjct  42   LGGVHESCGAENSVEVESLGRFAVDEHNS-----KEVNGLLEFARVVKAHEQVVAGTLHH  96

Query  467  LKISAASSGGARRIYDAVVVVKPWAADSRELLDFAPSPD  351
            L I A  + G +++Y+A + V+PW  +S+EL +F  + D
Sbjct  97   LTIEAVDA-GKKKLYEAKIWVRPW-MNSKELQEFKHAGD  133



>ref|XP_006446360.1| hypothetical protein CICLE_v10017285mg [Citrus clementina]
 ref|XP_006446361.1| hypothetical protein CICLE_v10017285mg [Citrus clementina]
 ref|XP_006446362.1| hypothetical protein CICLE_v10017285mg [Citrus clementina]
 ref|XP_006446363.1| hypothetical protein CICLE_v10017285mg [Citrus clementina]
 gb|ESR59600.1| hypothetical protein CICLE_v10017285mg [Citrus clementina]
 gb|ESR59601.1| hypothetical protein CICLE_v10017285mg [Citrus clementina]
 gb|ESR59602.1| hypothetical protein CICLE_v10017285mg [Citrus clementina]
 gb|ESR59603.1| hypothetical protein CICLE_v10017285mg [Citrus clementina]
Length=100

 Score = 61.6 bits (148),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 42/104 (40%), Positives = 58/104 (56%), Gaps = 9/104 (9%)
 Frame = -2

Query  647  VGGRTEVKDVKNNEEVQELGRYCVREYNKVLQEKQGGGGLLSFSEVVKAETQVVSGFKYY  468
            VGG  EV+   NN+E+  L R+ V E+NK    KQ     L F +VV A+ QVVSG  Y 
Sbjct  4    VGGVREVEATANNQEIVNLARFAVDEHNK----KQNSN--LQFVKVVSAKQQVVSGTLYD  57

Query  467  LKISAASSGGARRIYDAVVVVKPWAADSRELLDFAPSPDSDHPS  336
            + + A   GG +++++A V  KPW    +EL +F P   S H S
Sbjct  58   ITLEAV-EGGQKKLFEAKVWEKPW-MQFKELKEFNPVAQS-HSS  98



>gb|AGX28142.1| cysteine protease inhibitor, partial [Populus euphratica]
Length=107

 Score = 61.6 bits (148),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 36/99 (36%), Positives = 58/99 (59%), Gaps = 8/99 (8%)
 Frame = -2

Query  647  VGGRTEVKDVKNNEEVQELGRYCVREYNKVLQEKQGGGGLLSFSEVVKAETQVVSGFKYY  468
            +GG  + +  +N+ E+  L R+ V E+NK          +L F+ VVKA+ QVV+G  ++
Sbjct  4    LGGVHDSQSSQNSAEIDSLARFAVDEHNK------KENAILEFARVVKAKEQVVAGTMHH  57

Query  467  LKISAASSGGARRIYDAVVVVKPWAADSRELLDFAPSPD  351
            L I  AS  G +++Y+A V VKPW  + +EL +F  + D
Sbjct  58   LTIE-ASEAGKKKLYEAKVWVKPW-LNFKELHEFKDAGD  94



>ref|XP_009361915.1| PREDICTED: cysteine proteinase inhibitor A-like [Pyrus x bretschneideri]
Length=95

 Score = 61.2 bits (147),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 36/89 (40%), Positives = 52/89 (58%), Gaps = 8/89 (9%)
 Frame = -2

Query  614  NNEEVQELGRYCVREYNKVLQEKQGGGGLLSFSEVVKAETQVVSGFKYYLKISAASSGGA  435
            N+ E + L RY V E+NK          LL F  V+  + QVVSG  +YLKI  A+ GG 
Sbjct  15   NSVETENLARYAVDEHNK------KENDLLEFVRVLDDKVQVVSGTMHYLKIE-ATDGGK  67

Query  434  RRIYDAVVVVKPWAADSRELLDFAPSPDS  348
            +++Y+A V VKPW  + +++ +F P  DS
Sbjct  68   KKVYEAKVWVKPW-ENFKQVQEFKPVSDS  95



>gb|KFK41155.1| hypothetical protein AALP_AA2G092800 [Arabis alpina]
Length=117

 Score = 61.6 bits (148),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 40/98 (41%), Positives = 58/98 (59%), Gaps = 9/98 (9%)
 Frame = -2

Query  650  KVGGRTEVKDVKNNEEVQELGRYCVREYNKVLQEKQGGGGLLSFSEVVKAETQVVSGFKY  471
            +VGG + + DVK+   VQ +G + V EY+K  + K G    L F  VV+ ETQVV+G  Y
Sbjct  27   RVGGWSPITDVKDPHVVQ-IGEFAVSEYDK--RSKSG----LKFETVVRGETQVVAGTNY  79

Query  470  YLKISAASSGGARRIYDAVVVVKPWAADSRELLDFAPS  357
             L+++A + GG  + Y+A+V  KPW   S  L  F P+
Sbjct  80   RLRVTA-NDGGESKNYEAIVWEKPW-LKSMNLTSFKPA  115



>ref|NP_850570.2| cysteine proteinase inhibitor 6 [Arabidopsis thaliana]
 sp|Q8H0X6.2|CYT6_ARATH RecName: Full=Cysteine proteinase inhibitor 6; Short=AtCYS-6; 
AltName: Full=PIP-M; AltName: Full=PRLI-interacting factor 
M; Flags: Precursor [Arabidopsis thaliana]
 gb|AAG51028.1|AC069474_27 cysteine proteinase inhibitor, putative; 65918-67271 [Arabidopsis 
thaliana]
 dbj|BAB03156.1| cysteine proteinase inhibitor-like protein [Arabidopsis thaliana]
 gb|AEE75201.1| cysteine proteinase inhibitor 6 [Arabidopsis thaliana]
Length=234

 Score = 63.5 bits (153),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 38/100 (38%), Positives = 60/100 (60%), Gaps = 8/100 (8%)
 Frame = -2

Query  647  VGGRTEVKDVKNNEEVQELGRYCVREYNKVLQEKQGGGGLLSFSEVVKAETQVVSGFKYY  468
            VGG  +V   +N+ EV+ L R+ V E+NK          LL F+ VVKA+ QVV+G  ++
Sbjct  37   VGGVGDVPANQNSGEVESLARFAVDEHNK------KENALLEFARVVKAKEQVVAGTLHH  90

Query  467  LKISAASSGGARRIYDAVVVVKPWAADSRELLDFAPSPDS  348
            L +    + G +++Y+A V VKPW  + +EL +F P+ D+
Sbjct  91   LTLEILEA-GQKKLYEAKVWVKPW-LNFKELQEFKPASDA  128



>gb|AFK41117.1| unknown [Lotus japonicus]
Length=98

 Score = 60.8 bits (146),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 38/94 (40%), Positives = 58/94 (62%), Gaps = 8/94 (9%)
 Frame = -2

Query  647  VGGRTEVKDVKNNEEVQELGRYCVREYNKVLQEKQGGGGLLSFSEVVKAETQVVSGFKYY  468
            VGG +EV   +N+ E++ L R+ V E+NK    KQ    LL F +VV A  QVV+G  Y 
Sbjct  4    VGGASEVPGNQNSLEIENLARFAVEEHNK----KQ--NTLLEFGKVVSATQQVVAGTLYK  57

Query  467  LKISAASSGGARRIYDAVVVVKPWAADSRELLDF  366
            +K+  A+ GG +++Y+A +  KPW  + +EL +F
Sbjct  58   IKLE-ANDGGKKQVYEAKIWEKPW-LNFKELQEF  89



>emb|CDY08429.1| BnaA05g26650D [Brassica napus]
Length=229

 Score = 63.2 bits (152),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 37/100 (37%), Positives = 60/100 (60%), Gaps = 8/100 (8%)
 Frame = -2

Query  647  VGGRTEVKDVKNNEEVQELGRYCVREYNKVLQEKQGGGGLLSFSEVVKAETQVVSGFKYY  468
            +GG  +V   +N+ EV+ L R+ V E+NK          LL F+ VVKA+ QVV+G  ++
Sbjct  30   LGGVRDVPANQNSGEVESLARFAVDEHNK------KENSLLEFARVVKAKEQVVAGTMHH  83

Query  467  LKISAASSGGARRIYDAVVVVKPWAADSRELLDFAPSPDS  348
            L +    + G +++Y+A V VKPW  + +EL +F P+ D+
Sbjct  84   LTLEIVEA-GKKKLYEAKVWVKPW-LNFKELQEFKPASDA  121



>gb|AHZ92270.1| cystatin 4 [Malus prunifolia]
Length=247

 Score = 63.2 bits (152),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 39/111 (35%), Positives = 63/111 (57%), Gaps = 8/111 (7%)
 Frame = -2

Query  650  KVGGRTEVKDVKNNEEVQELGRYCVREYNKVLQEKQGGGGLLSFSEVVKAETQVVSGFKY  471
            +VGG  E +  +N+ EV++L R+ V+E+N           LL F  VVKA+ QVV+G  +
Sbjct  46   RVGGIQESRGAQNSAEVEDLARFAVQEHN------NKENALLEFVRVVKAKEQVVAGTLH  99

Query  470  YLKISAASSGGARRIYDAVVVVKPWAADSRELLDFAPSPDSDHPSKQFLDI  318
            +L I A  + G +++Y+A V VKPW    +E  +F  + + + PS    D+
Sbjct  100  HLTIEAIEA-GKKKLYEAKVWVKPWMG-FKEEQEFKQADEEETPSVTSSDL  148



>gb|AAC37479.1| cysteine proteinase inhibitor [Brassica rapa subsp. oleifera]
Length=199

 Score = 62.4 bits (150),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 37/97 (38%), Positives = 58/97 (60%), Gaps = 8/97 (8%)
 Frame = -2

Query  647  VGGRTEVKDVKNNEEVQELGRYCVREYNKVLQEKQGGGGLLSFSEVVKAETQVVSGFKYY  468
            +GG  +V   +N+ EV+ L R+ V E+NK          LL F+ VVKA+ QVV+G  ++
Sbjct  4    LGGVRDVPSNENSVEVESLARFAVDEHNK------KENALLEFARVVKAKEQVVAGTMHH  57

Query  467  LKISAASSGGARRIYDAVVVVKPWAADSRELLDFAPS  357
            L +    + G +++Y+A V VKPW  + +EL +F PS
Sbjct  58   LTLEIIEA-GKKKLYEAKVWVKPW-LNFKELQEFKPS  92



>emb|CAA60634.1| cysteine proteinase inhibitor [Sorghum bicolor]
Length=130

 Score = 61.2 bits (147),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 37/93 (40%), Positives = 54/93 (58%), Gaps = 11/93 (12%)
 Frame = -2

Query  629  VKDVKNNE---EVQELGRYCVREYNKVLQEKQGGGGLLSFSEVVKAETQVVSGFKYYLKI  459
            +KDV  NE    +QEL R+ V E+NK          LL + ++VKA+TQVV+G  YYL +
Sbjct  39   IKDVPANENDLHLQELARFAVDEHNK------KANALLGYEKLVKAKTQVVAGTMYYLTV  92

Query  458  SAASSGGARRIYDAVVVVKPWAADSRELLDFAP  360
                 G  +++Y+A V  KPW  + +EL +F P
Sbjct  93   E-VKDGEVKKLYEAKVWEKPW-ENFKELQEFKP  123



>dbj|BAH47556.1| cystatin [Spinacia oleracea]
Length=104

 Score = 60.8 bits (146),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 36/105 (34%), Positives = 60/105 (57%), Gaps = 8/105 (8%)
 Frame = -2

Query  647  VGGRTEVKDVKNNEEVQELGRYCVREYNKVLQEKQGGGGLLSFSEVVKAETQVVSGFKYY  468
            VGG  E +   N+ E++ L ++ + E+NK          LL F  VV  + QVV+G  YY
Sbjct  4    VGGIKEKEGSANSLEIETLAQFAIDEHNK------KENALLEFHRVVNTKEQVVAGTIYY  57

Query  467  LKISAASSGGARRIYDAVVVVKPWAADSRELLDFAPSPDSDHPSK  333
            + + A + G  ++IY+A + VKPW A+ +E+ +F    D+D P++
Sbjct  58   ITLEA-TDGDKKKIYEAKIWVKPW-ANFKEVQEFKYVGDADAPAE  100



>gb|AAY57867.1| cysteine proteinase inhibitor [Zea mays subsp. parviglumis]
Length=134

 Score = 61.2 bits (147),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 38/99 (38%), Positives = 55/99 (56%), Gaps = 8/99 (8%)
 Frame = -2

Query  656  GRKVGGRTEVKDVKNNEEVQELGRYCVREYNKVLQEKQGGGGLLSFSEVVKAETQVVSGF  477
            G  VGG  +V   +N+  +QEL R+ V E+NK          LL F ++VK +TQVV+G 
Sbjct  37   GTLVGGIQDVPGSENDLHLQELARFAVDEHNK------KANALLGFEKLVKVKTQVVAGT  90

Query  476  KYYLKISAASSGGARRIYDAVVVVKPWAADSRELLDFAP  360
             YYL I     G  +++Y+A V  KPW  + + L +F P
Sbjct  91   MYYLTIE-VKDGEVKKLYEAKVWEKPW-ENLKGLQEFKP  127



>ref|XP_002298154.1| cysteine protease inhibitor family protein [Populus trichocarpa]
 gb|EEE82959.1| cysteine protease inhibitor family protein [Populus trichocarpa]
Length=101

 Score = 60.5 bits (145),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 39/104 (38%), Positives = 59/104 (57%), Gaps = 8/104 (8%)
 Frame = -2

Query  647  VGGRTEVKDVKNNEEVQELGRYCVREYNKVLQEKQGGGGLLSFSEVVKAETQVVSGFKYY  468
            VGG TEV+   N+ E+  L R+ V +YNK    KQ    +L F  V+ A+ QVV+G  YY
Sbjct  4    VGGITEVEGTANSLEIDSLARFAVDDYNK----KQ--NSVLEFKRVLNAKQQVVAGTIYY  57

Query  467  LKISAASSGGARRIYDAVVVVKPWAADSRELLDFAPSPDSDHPS  336
            +     + GG +++Y+A V VKPW  + +E+ +F    D+   S
Sbjct  58   ITFE-VTEGGHKKVYEAKVWVKPW-LNFKEVQEFKLVADAPCDS  99



>ref|NP_001242786.1| uncharacterized protein LOC100810979 [Glycine max]
 gb|ACU14306.1| unknown [Glycine max]
Length=184

 Score = 62.0 bits (149),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 39/109 (36%), Positives = 57/109 (52%), Gaps = 15/109 (14%)
 Frame = -2

Query  647  VGGRTEVKDVKNNEEVQELGRYCVREYNKVLQEKQGGGGLLSFSEVVKAETQVVSGFKYY  468
            +GG TEV+   N+ E+  L R+ V E NK          +L F  V+ A+ QVVSG  YY
Sbjct  10   LGGITEVQGAANSVEINNLARFAVEEQNK------RENSVLEFVRVISAQQQVVSGVNYY  63

Query  467  LKISAASSGGARRIYDAVVVVKPWAADSRELLDFAPSP----DSDHPSK  333
            + +  A  G  +  Y A    K W  +S+ELL+F P+     + DHP++
Sbjct  64   ITLE-AKDGEIKNEYKA----KVWERESQELLEFMPTLGAGGEIDHPAR  107



>gb|ABQ32295.1| cysteine protease inhibitor [Zea mays]
Length=134

 Score = 61.2 bits (147),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 39/99 (39%), Positives = 55/99 (56%), Gaps = 8/99 (8%)
 Frame = -2

Query  656  GRKVGGRTEVKDVKNNEEVQELGRYCVREYNKVLQEKQGGGGLLSFSEVVKAETQVVSGF  477
            G  VGG  +V   +N+  +QEL R+ V E NK          LL F ++VKA+TQVV+G 
Sbjct  37   GTLVGGIQDVPGSENDLHLQELARFAVDERNK------KANALLGFEKLVKAKTQVVAGT  90

Query  476  KYYLKISAASSGGARRIYDAVVVVKPWAADSRELLDFAP  360
             YYL I     G  +++Y+A V  KPW  + + L +F P
Sbjct  91   MYYLTIE-VKDGEVKKLYEAKVWEKPW-ENLKGLQEFKP  127



>ref|XP_002314231.1| hypothetical protein POPTR_0009s02740g [Populus trichocarpa]
 gb|EEE88186.1| hypothetical protein POPTR_0009s02740g [Populus trichocarpa]
Length=100

 Score = 60.5 bits (145),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 42/105 (40%), Positives = 57/105 (54%), Gaps = 13/105 (12%)
 Frame = -2

Query  647  VGGRTEVKDVKNNEEVQELGRYCVREYNKVLQEKQGGGGLLSFSEVVKAETQVVSGFKYY  468
             GG  EV    N+ E++ L R+ V +YNK    KQ    LL F  VVK + QVVSG  YY
Sbjct  3    TGGIKEVGGSANSLEIESLARFAVDDYNK----KQNS--LLEFKRVVKTKQQVVSGTMYY  56

Query  467  LKISAASSGGARRIYDAVVVVKPWAADSRELLDF-----APSPDS  348
            +     + GG R++Y+A V  KPW  + +E+ +F     APS  S
Sbjct  57   ITFE-VTDGGHRKVYEAKVWEKPW-MNFKEVQEFKLVGDAPSDSS  99



>sp|Q10992.1|CYTA_HELAN RecName: Full=Cysteine proteinase inhibitor A; AltName: Full=Cystatin-A; 
AltName: Full=SCA [Helianthus annuus]
Length=82

 Score = 60.1 bits (144),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 35/82 (43%), Positives = 51/82 (62%), Gaps = 8/82 (10%)
 Frame = -2

Query  605  EVQELGRYCVREYNKVLQEKQGGGGLLSFSEVVKAETQVVSGFKYYLKISAASSGGARRI  426
            E+ EL R+ V E+NK    KQ    LL F +VV  + QVV+G  YY+ +  A++GG ++ 
Sbjct  3    EIDELARFAVDEHNK----KQNA--LLEFGKVVNTKEQVVAGKMYYITLE-ATNGGVKKT  55

Query  425  YDAVVVVKPWAADSRELLDFAP  360
            Y+A V VKPW  + +EL +F P
Sbjct  56   YEAKVWVKPW-ENFKELQEFKP  76



>emb|CAD21441.1| putative cysteine proteinase inhibitor [Rumex obtusifolius]
Length=99

 Score = 60.5 bits (145),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 33/84 (39%), Positives = 53/84 (63%), Gaps = 7/84 (8%)
 Frame = -2

Query  647  VGGRTEVKDVKNNEEVQELGRYCVREYNKVLQEKQGGGGLLSFSEVVKAETQVVSGFKYY  468
            +GG  +V+   N+ EV+ L ++ V ++NK    KQ    +L FS+VV  + QVV+G  YY
Sbjct  4    IGGIKQVEGSANSLEVESLAKFAVEDHNK----KQNA--MLEFSKVVNTKEQVVAGTMYY  57

Query  467  LKISAASSGGARRIYDAVVVVKPW  396
            + +  A+ GG +++Y+A V VKPW
Sbjct  58   ITLE-ATDGGKKKVYEAKVWVKPW  80



>ref|XP_009383251.1| PREDICTED: cysteine proteinase inhibitor A-like [Musa acuminata 
subsp. malaccensis]
Length=136

 Score = 60.8 bits (146),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 39/96 (41%), Positives = 56/96 (58%), Gaps = 8/96 (8%)
 Frame = -2

Query  653  RKVGGRTEVKDVKNNEEVQELGRYCVREYNKVLQEKQGGGGLLSFSEVVKAETQVVSGFK  474
            R  GG  + +  +N+ E+Q L R+ V EYNK    KQ    LL F +++KA+ QVV+G  
Sbjct  36   RNQGGIHDCEGFQNSAEIQGLARFAVEEYNK----KQ--NALLEFIQLLKAKEQVVAGKM  89

Query  473  YYLKISAASSGGARRIYDAVVVVKPWAADSRELLDF  366
            YYL +   ++ G +  Y+A V VKPW  +  EL DF
Sbjct  90   YYLTVQ-TNNCGKKNHYEAKVWVKPW-MNFMELQDF  123



>gb|AAY57864.1| cysteine proteinase inhibitor [Zea mays subsp. parviglumis]
 gb|AAY57868.1| cysteine proteinase inhibitor [Zea mays subsp. parviglumis]
Length=134

 Score = 60.8 bits (146),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 38/99 (38%), Positives = 55/99 (56%), Gaps = 8/99 (8%)
 Frame = -2

Query  656  GRKVGGRTEVKDVKNNEEVQELGRYCVREYNKVLQEKQGGGGLLSFSEVVKAETQVVSGF  477
            G   GG  +V   +N+  +QEL R+ V E+NK          LL F ++VKA+TQVV+G 
Sbjct  37   GTLAGGIKDVPGNENDLHLQELARFAVDEHNK------KANALLGFEKLVKAKTQVVAGT  90

Query  476  KYYLKISAASSGGARRIYDAVVVVKPWAADSRELLDFAP  360
             YYL I     G  +++Y+A V  KPW  + + L +F P
Sbjct  91   MYYLTIE-VKDGEVKKLYEAKVWEKPW-ENLKGLQEFKP  127



>ref|XP_006281295.1| hypothetical protein CARUB_v10027345mg, partial [Capsella rubella]
 gb|EOA14193.1| hypothetical protein CARUB_v10027345mg, partial [Capsella rubella]
Length=137

 Score = 60.8 bits (146),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 43/98 (44%), Positives = 56/98 (57%), Gaps = 9/98 (9%)
 Frame = -2

Query  650  KVGGRTEVKDVKNNEEVQELGRYCVREYNKVLQEKQGGGGLLSFSEVVKAETQVVSGFKY  471
            +VGG + + DVK+   V E+G + V EY+K  Q K G    L F  VV  E+QVVSG  Y
Sbjct  48   RVGGWSPISDVKD-PHVVEIGEFAVTEYDK--QSKSG----LKFETVVSGESQVVSGTNY  100

Query  470  YLKISAASSGGARRIYDAVVVVKPWAADSRELLDFAPS  357
             L I A + GGA + Y+A+V  KPW    R L  F P+
Sbjct  101  RL-IVAVNEGGASKNYEALVWDKPWLK-FRILNSFKPA  136



>ref|XP_010441439.1| PREDICTED: cysteine proteinase inhibitor 5-like [Camelina sativa]
Length=124

 Score = 60.8 bits (146),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 39/85 (46%), Positives = 52/85 (61%), Gaps = 8/85 (9%)
 Frame = -2

Query  650  KVGGRTEVKDVKNNEEVQELGRYCVREYNKVLQEKQGGGGLLSFSEVVKAETQVVSGFKY  471
            +VGG + + DVK+   V E+G + V EY+K  + K G    L F  VV  ETQVVSG  Y
Sbjct  27   RVGGWSPISDVKD-PHVVEIGEFAVSEYDK--RSKLG----LKFETVVSGETQVVSGTNY  79

Query  470  YLKISAASSGGARRIYDAVVVVKPW  396
             L + AA+ GGA + Y+A+V  KPW
Sbjct  80   RLTV-AANDGGASKNYEAMVWEKPW  103



>ref|XP_006432368.1| hypothetical protein CICLE_v10002346mg [Citrus clementina]
 gb|ESR45608.1| hypothetical protein CICLE_v10002346mg [Citrus clementina]
Length=235

 Score = 62.8 bits (151),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 36/102 (35%), Positives = 57/102 (56%), Gaps = 9/102 (9%)
 Frame = -2

Query  647  VGGRTEVKDVKNNEEVQELGRYCVREYNKVLQEKQGGGGLLSFSEVVKAETQVVSGFKYY  468
            +GG  E +  +N+ E++ L R+ + E+NK          LL F +VVKA+ QVV+G  ++
Sbjct  38   LGGVQESRGAENSNEIESLARFAIEEHNK------KENALLEFVKVVKAQEQVVAGTMHH  91

Query  467  LKISAASSGGARRIYDAVVVVKPWA--ADSRELLDFAPSPDS  348
            L + A  + G +++Y+A V VKPW    D +E      SP S
Sbjct  92   LTVEAIDA-GTKKLYEAKVWVKPWLNFKDLQEFKHVGDSPAS  132



>gb|KHN37731.1| Cysteine proteinase inhibitor 12 [Glycine soja]
Length=245

 Score = 62.8 bits (151),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 37/100 (37%), Positives = 62/100 (62%), Gaps = 8/100 (8%)
 Frame = -2

Query  647  VGGRTEVKDVKNNEEVQELGRYCVREYNKVLQEKQGGGGLLSFSEVVKAETQVVSGFKYY  468
            +GG  + +  +N+ E + L R+ V E+NK    KQ    LL F+ VV+A+ QVV+G  ++
Sbjct  48   IGGLHDSQGSQNSVETEALARFAVDEHNK----KQ--NSLLEFARVVRAQEQVVAGTLHH  101

Query  467  LKISAASSGGARRIYDAVVVVKPWAADSRELLDFAPSPDS  348
            L + A  + G +++Y+A V VKPW  + +EL +F P+ D+
Sbjct  102  LTLEAIEA-GEKKLYEAKVWVKPW-LNFKELQEFKPAGDA  139



>ref|XP_010094696.1| Cysteine proteinase inhibitor 5 [Morus notabilis]
 gb|EXB56668.1| Cysteine proteinase inhibitor 5 [Morus notabilis]
Length=114

 Score = 60.5 bits (145),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 41/100 (41%), Positives = 55/100 (55%), Gaps = 9/100 (9%)
 Frame = -2

Query  656  GRKVGGRTEVKDVKNNEEVQELGRYCVREYNKVLQEKQGGGGLLSFSEVVKAETQVVSGF  477
            G  VGG T +KD+ ++  V+E+  + V EYNK  Q K      L    +VK ETQVV+G 
Sbjct  23   GPLVGGWTPIKDL-SDPHVKEIANFAVSEYNK--QSKAS----LKLKSIVKGETQVVAGT  75

Query  476  KYYLKISAASSGGARRIYDAVVVVKPWAADSRELLDFAPS  357
             Y L + A ++G A   Y+AVV  KPW    R L  F P+
Sbjct  76   NYRL-VVAVTNGAAAERYEAVVWEKPW-QHFRNLTSFKPA  113



>gb|ABW03251.1| cysteine proteinase inhibitor [Sonneratia caseolaris]
 gb|ABW03252.1| cysteine proteinase inhibitor [Sonneratia caseolaris]
 gb|ABW03253.1| cysteine proteinase inhibitor [Sonneratia caseolaris]
 gb|ABW03254.1| cysteine proteinase inhibitor [Sonneratia caseolaris]
 gb|ABW03255.1| cysteine proteinase inhibitor [Sonneratia caseolaris]
 gb|ABW03256.1| cysteine proteinase inhibitor [Sonneratia caseolaris]
 gb|ABW03257.1| cysteine proteinase inhibitor [Sonneratia caseolaris]
 gb|ABW03258.1| cysteine proteinase inhibitor [Sonneratia caseolaris]
Length=74

 Score = 59.7 bits (143),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 34/80 (43%), Positives = 50/80 (63%), Gaps = 8/80 (10%)
 Frame = -2

Query  614  NNEEVQELGRYCVREYNKVLQEKQGGGGLLSFSEVVKAETQVVSGFKYYLKISAASSGGA  435
            N+ E++ L R+ V E+NK          LL F +VVKA+ QVV+G  YY+ +  A+ GG 
Sbjct  2    NSLEIEALARFAVDEHNK------KENSLLQFGKVVKAKQQVVAGTVYYITVE-ATDGGV  54

Query  434  RRIYDAVVVVKPWAADSREL  375
            +++Y+A V VKPW  D +EL
Sbjct  55   KKLYEAKVWVKPW-MDFKEL  73



>ref|XP_010481310.1| PREDICTED: cysteine proteinase inhibitor 5-like [Camelina sativa]
Length=124

 Score = 60.5 bits (145),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 38/85 (45%), Positives = 52/85 (61%), Gaps = 8/85 (9%)
 Frame = -2

Query  650  KVGGRTEVKDVKNNEEVQELGRYCVREYNKVLQEKQGGGGLLSFSEVVKAETQVVSGFKY  471
            ++GG + + DVK+   V E+G + V EY+K  + K G    L F  VV  ETQVVSG  Y
Sbjct  27   RIGGWSPISDVKD-PHVVEIGEFAVSEYDK--RSKLG----LKFETVVSGETQVVSGTNY  79

Query  470  YLKISAASSGGARRIYDAVVVVKPW  396
             L + AA+ GGA + Y+A+V  KPW
Sbjct  80   RLTV-AANDGGASKNYEAMVWEKPW  103



>gb|AAF72202.1|AF265551_1 cysteine protease inhibitor [Manihot esculenta]
Length=101

 Score = 60.1 bits (144),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 37/96 (39%), Positives = 55/96 (57%), Gaps = 8/96 (8%)
 Frame = -2

Query  647  VGGRTEVKDVKNNEEVQELGRYCVREYNKVLQEKQGGGGLLSFSEVVKAETQVVSGFKYY  468
            +GG  EV++  N+ E+  L R+ V +YNK    KQ    LL F  VV  + QVV+G  YY
Sbjct  4    LGGIKEVEESANSVEIDNLARFAVDDYNK----KQNA--LLEFKRVVSTKQQVVAGTMYY  57

Query  467  LKISAASSGGARRIYDAVVVVKPWAADSRELLDFAP  360
            + +  A  GG  ++Y+A V  KPW  + +E+ +F P
Sbjct  58   ITLEVA-DGGQTKVYEAKVWEKPW-LNFKEVQEFKP  91



>ref|XP_002267841.1| PREDICTED: cysteine proteinase inhibitor 12 [Vitis vinifera]
Length=201

 Score = 61.6 bits (148),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 36/99 (36%), Positives = 57/99 (58%), Gaps = 8/99 (8%)
 Frame = -2

Query  647  VGGRTEVKDVKNNEEVQELGRYCVREYNKVLQEKQGGGGLLSFSEVVKAETQVVSGFKYY  468
            +GG  E +  +N+ E+  L R+ V E+NK          LL F+ VVKAE QVV+G  ++
Sbjct  4    LGGVQESQGTQNSAEIDSLARFAVEEHNK------KENALLEFARVVKAEEQVVAGTLHH  57

Query  467  LKISAASSGGARRIYDAVVVVKPWAADSRELLDFAPSPD  351
            L +    + G +++Y+A V VKPW  + +EL +F  + D
Sbjct  58   LTLEVIDA-GRKKLYEAKVWVKPW-MNFKELQEFKHAGD  94



>ref|XP_006836222.1| hypothetical protein AMTR_s00101p00100170 [Amborella trichopoda]
 gb|ERM99075.1| hypothetical protein AMTR_s00101p00100170 [Amborella trichopoda]
Length=206

 Score = 61.6 bits (148),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 38/98 (39%), Positives = 59/98 (60%), Gaps = 12/98 (12%)
 Frame = -2

Query  629  VKDV----KNNEEVQELGRYCVREYNKVLQEKQGGGGLLSFSEVVKAETQVVSGFKYYLK  462
            +KDV    +N+ E++EL R+ V+E+NK          LL F+ VVKA+ QVV+G  Y+L 
Sbjct  7    LKDVTGSNQNSAEIEELARFAVQEHNK------KSNSLLEFARVVKAKEQVVAGTLYHLT  60

Query  461  ISAASSGGARRIYDAVVVVKPWAADSRELLDFAPSPDS  348
            + A  + G  ++Y+A V +KPW  + +EL +F    DS
Sbjct  61   LEAIDA-GKNKLYEAKVWLKPW-ENFKELKEFNHVGDS  96



>gb|ADK13078.1| phytocystatin 5-3 [Brassica rapa subsp. pekinensis]
Length=120

 Score = 60.1 bits (144),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 40/101 (40%), Positives = 54/101 (53%), Gaps = 13/101 (13%)
 Frame = -2

Query  644  GGRTEVKDVKNNEEVQELGRYCVREYNKVLQEKQGGGGLLSFSEVVKAETQVVSGFKYYL  465
            GG + + DVKN   + E+G + V EYNK  Q K G    L F EVV  E+Q+V+G  Y L
Sbjct  27   GGWSPISDVKN-AHIVEIGEFAVSEYNK--QSKSG----LKFVEVVSGESQIVAGMNYRL  79

Query  464  KIS-----AASSGGARRIYDAVVVVKPWAADSRELLDFAPS  357
             ++     A +  G  + Y+AVV  KPW   S  L  F P+
Sbjct  80   ILAANEGVAIAGNGESKKYEAVVWEKPW-LKSMNLTSFKPA  119



>ref|NP_199566.1| cysteine proteinase inhibitor 5 [Arabidopsis thaliana]
 sp|Q41916.2|CYT5_ARATH RecName: Full=Cysteine proteinase inhibitor 5; Short=AtCYS-5; 
Flags: Precursor [Arabidopsis thaliana]
 dbj|BAB09081.1| unnamed protein product [Arabidopsis thaliana]
 gb|AAL62346.1| putative protein [Arabidopsis thaliana]
 gb|AAP21343.1| At5g47550 [Arabidopsis thaliana]
 gb|AED95531.1| cysteine proteinase inhibitor 5 [Arabidopsis thaliana]
Length=122

 Score = 60.1 bits (144),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 39/98 (40%), Positives = 54/98 (55%), Gaps = 8/98 (8%)
 Frame = -2

Query  650  KVGGRTEVKDVKNNEEVQELGRYCVREYNKVLQEKQGGGGLLSFSEVVKAETQVVSGFKY  471
            +VGG + + +V +  +V E+G + V EYNK  + + G    L F  VV  ETQVVSG  Y
Sbjct  27   RVGGWSPISNVTD-PQVVEIGEFAVSEYNK--RSESG----LKFETVVSGETQVVSGTNY  79

Query  470  YLKISAASSGGARRIYDAVVVVKPWAADSRELLDFAPS  357
             LK++A    G  + Y A+V  KPW    R L  F P+
Sbjct  80   RLKVAANDGDGVSKNYLAIVWDKPW-MKFRNLTSFEPA  116



>gb|AAM64661.1| cystatin-like protein [Arabidopsis thaliana]
Length=122

 Score = 60.1 bits (144),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 39/98 (40%), Positives = 54/98 (55%), Gaps = 8/98 (8%)
 Frame = -2

Query  650  KVGGRTEVKDVKNNEEVQELGRYCVREYNKVLQEKQGGGGLLSFSEVVKAETQVVSGFKY  471
            +VGG + + +V +  +V E+G + V EYNK  + + G    L F  VV  ETQVVSG  Y
Sbjct  27   RVGGWSPISNVTD-PQVVEIGEFAVSEYNK--RSESG----LKFETVVSGETQVVSGTNY  79

Query  470  YLKISAASSGGARRIYDAVVVVKPWAADSRELLDFAPS  357
             LK++A    G  + Y A+V  KPW    R L  F P+
Sbjct  80   RLKVAANDGDGVSKNYLAIVWDKPW-MKFRNLTSFEPA  116



>ref|XP_008364741.1| PREDICTED: cysteine proteinase inhibitor 6-like isoform X2 [Malus 
domestica]
Length=247

 Score = 62.4 bits (150),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 39/110 (35%), Positives = 62/110 (56%), Gaps = 8/110 (7%)
 Frame = -2

Query  647  VGGRTEVKDVKNNEEVQELGRYCVREYNKVLQEKQGGGGLLSFSEVVKAETQVVSGFKYY  468
            VGG  E +  +N+ EV++L R+ V+E+N           LL F  VVKA+ QVV+G  ++
Sbjct  48   VGGIQESRGXQNSAEVEDLARFAVQEHN------NKENALLEFVRVVKAKEQVVAGTLHH  101

Query  467  LKISAASSGGARRIYDAVVVVKPWAADSRELLDFAPSPDSDHPSKQFLDI  318
            L I A  + G +++Y+A V VKPW    +E  +F  + + + PS    D+
Sbjct  102  LTIEAIEA-GKKKLYEAKVWVKPWMG-FKEEQEFKQADEEETPSVTSSDL  149



>ref|XP_008364740.1| PREDICTED: cysteine proteinase inhibitor 6-like isoform X1 [Malus 
domestica]
Length=248

 Score = 62.4 bits (150),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 39/110 (35%), Positives = 62/110 (56%), Gaps = 8/110 (7%)
 Frame = -2

Query  647  VGGRTEVKDVKNNEEVQELGRYCVREYNKVLQEKQGGGGLLSFSEVVKAETQVVSGFKYY  468
            VGG  E +  +N+ EV++L R+ V+E+N           LL F  VVKA+ QVV+G  ++
Sbjct  48   VGGIQESRGXQNSAEVEDLARFAVQEHN------NKENALLEFVRVVKAKEQVVAGTLHH  101

Query  467  LKISAASSGGARRIYDAVVVVKPWAADSRELLDFAPSPDSDHPSKQFLDI  318
            L I A  + G +++Y+A V VKPW    +E  +F  + + + PS    D+
Sbjct  102  LTIEAIEA-GKKKLYEAKVWVKPWMG-FKEEQEFKQADEEETPSVTSSDL  149



>ref|XP_006398453.1| hypothetical protein EUTSA_v10001076mg [Eutrema salsugineum]
 gb|ESQ39906.1| hypothetical protein EUTSA_v10001076mg [Eutrema salsugineum]
Length=121

 Score = 60.1 bits (144),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 43/103 (42%), Positives = 55/103 (53%), Gaps = 13/103 (13%)
 Frame = -2

Query  650  KVGGRTEVKDVKNNEEVQELGRYCVREYNKVLQEKQGGGGLLSFSEVVKAETQVVSGFKY  471
            +VGG + + DVK+   V E+G + V EYNK  Q K G    L F EVV+ E+QVVSG  Y
Sbjct  26   RVGGWSPISDVKD-PHVVEVGEFAVSEYNK--QSKSG----LKFVEVVRGESQVVSGMNY  78

Query  470  YLKISAASSGG-----ARRIYDAVVVVKPWAADSRELLDFAPS  357
             L ++     G     A   Y+AVV  KPW   S  L  F P+
Sbjct  79   RLVVAVNDGKGIAGSDASENYEAVVWEKPW-LKSMNLTSFKPA  120



>ref|XP_001771745.1| predicted protein [Physcomitrella patens]
 gb|EDQ63353.1| predicted protein [Physcomitrella patens]
Length=139

 Score = 60.5 bits (145),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 37/104 (36%), Positives = 56/104 (54%), Gaps = 6/104 (6%)
 Frame = -2

Query  647  VGGRTEVKDVKNNEEVQELGRYCVREYNKVLQEKQGGGGLLSFSEVVKAETQVVSGFKYY  468
            VGG  ++ +  N+ E+ EL  + V +Y    + +Q    +++FS+V+ A+ QVV G  YY
Sbjct  3    VGGPKDISNFPNSVEIDELANFAVDQY----KSRQNSIAVITFSKVLSAKEQVVQGKMYY  58

Query  467  LKISAASSGGARRIYDAVVVVKPWAADSRELLDFAPSPDSDHPS  336
              I    +G  +  YDA V VKPW    +EL  F PS  S + S
Sbjct  59   FTIEVMENGVPKN-YDAKVWVKPWEG-YKELESFLPSAPSHYDS  100



>gb|ACN85343.1| cystatin [Camellia sinensis]
 gb|ACN85344.1| cystatin [Camellia sinensis]
Length=101

 Score = 59.7 bits (143),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 44/106 (42%), Positives = 61/106 (58%), Gaps = 9/106 (8%)
 Frame = -2

Query  650  KVGGRTEVKDVKNNEEVQELGRYCVREYNKVLQEKQGGGGLLSFSEVVKAETQVVSGFKY  471
            KVGG TE     N+ E+  L R+ V E+NK           L FS+VV  + QVVSG  Y
Sbjct  3    KVGGITESAGSANSSEIDSLARFAVDEHNKKEN------ACLEFSKVVNVKQQVVSGTVY  56

Query  470  YLKISAASSGGARRIYDAVVVVKPWAADSRELLDFAPSPDS-DHPS  336
            Y+ +  A++GG ++ Y+A V VKPW  + +EL +F P  D+  HPS
Sbjct  57   YITLE-ATNGGQKKAYEAKVWVKPW-MNFKELQEFKPIGDTPSHPS  100



>gb|AGX28141.1| cysteine protease inhibitor, partial [Populus euphratica]
 gb|AGX28143.1| cysteine protease inhibitor, partial [Populus euphratica]
 gb|AGX28144.1| cysteine protease inhibitor, partial [Populus pruinosa]
 gb|AGX28145.1| cysteine protease inhibitor, partial [Populus pruinosa]
 gb|AGX28146.1| cysteine protease inhibitor, partial [Populus pruinosa]
 gb|AGX28147.1| cysteine protease inhibitor, partial [Populus pruinosa]
 gb|AGX28148.1| cysteine protease inhibitor, partial [Populus pruinosa]
 gb|AGX28149.1| cysteine protease inhibitor, partial [Populus pruinosa]
 gb|AGX28150.1| cysteine protease inhibitor, partial [Populus pruinosa]
 gb|AGX28151.1| cysteine protease inhibitor, partial [Populus pruinosa]
 gb|AGX28152.1| cysteine protease inhibitor, partial [Populus pruinosa]
Length=107

 Score = 59.7 bits (143),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 35/99 (35%), Positives = 58/99 (59%), Gaps = 8/99 (8%)
 Frame = -2

Query  647  VGGRTEVKDVKNNEEVQELGRYCVREYNKVLQEKQGGGGLLSFSEVVKAETQVVSGFKYY  468
            +GG  + +  +N+ E+  L R+ V E+NK          +L F+ VVKA+ QVV+G  ++
Sbjct  4    LGGVHDSQSSQNSAEIDSLARFAVDEHNK------KENAILEFARVVKAKEQVVAGTMHH  57

Query  467  LKISAASSGGARRIYDAVVVVKPWAADSRELLDFAPSPD  351
            L I A  + G +++Y+A V VKPW  + +EL +F  + D
Sbjct  58   LTIEAIEA-GKKKLYEAKVWVKPW-LNFKELHEFKDAGD  94



>ref|XP_006471323.1| PREDICTED: cysteine proteinase inhibitor 12-like [Citrus sinensis]
Length=235

 Score = 61.6 bits (148),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 36/102 (35%), Positives = 57/102 (56%), Gaps = 9/102 (9%)
 Frame = -2

Query  647  VGGRTEVKDVKNNEEVQELGRYCVREYNKVLQEKQGGGGLLSFSEVVKAETQVVSGFKYY  468
            +GG  E +  +N+ E++ L R+ + E+NK          LL F +VVKA+ QVV+G  ++
Sbjct  38   LGGVQESRGAENSNEIESLARFAIEEHNK------KENALLEFVKVVKAQEQVVAGTMHH  91

Query  467  LKISAASSGGARRIYDAVVVVKPWA--ADSRELLDFAPSPDS  348
            L + A  + G +++Y+A V VKPW    D +E      SP S
Sbjct  92   LTVEAIDA-GRKKLYEAKVWVKPWLNFKDLQEFKHVGDSPAS  132



>gb|ABN42208.1| proteinase inhibitor [Cakile maritima]
Length=202

 Score = 61.2 bits (147),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 36/98 (37%), Positives = 58/98 (59%), Gaps = 8/98 (8%)
 Frame = -2

Query  644  GGRTEVKDVKNNEEVQELGRYCVREYNKVLQEKQGGGGLLSFSEVVKAETQVVSGFKYYL  465
            GG  +V   +N+++V+ L R+ V E+NK          LL F  VVKA+ QVV+G  ++L
Sbjct  5    GGVRDVPANQNSDDVESLARFAVDEHNK------KENALLEFGRVVKAKEQVVAGTLHHL  58

Query  464  KISAASSGGARRIYDAVVVVKPWAADSRELLDFAPSPD  351
             +    + G +++Y+A V VKPW  + +EL +F P+ D
Sbjct  59   TLEIIEA-GKKKLYEAKVWVKPW-LNFKELQEFKPATD  94



>gb|ACZ02398.1| latex cystatin [Hevea brasiliensis]
Length=101

 Score = 59.3 bits (142),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 39/106 (37%), Positives = 58/106 (55%), Gaps = 13/106 (12%)
 Frame = -2

Query  650  KVGGRTEVKDVKNNEEVQELGRYCVREYNKVLQEKQGGGGLLSFSEVVKAETQVVSGFKY  471
            K+GG  EV+   N+ E+  L RY V +YN      Q    LL F +VV A+ QVV+G  Y
Sbjct  3    KLGGVKEVEGSANSVEINSLARYAVDDYN------QKQNALLEFKKVVNAKQQVVAGTIY  56

Query  470  YLKISAASSGGARRIYDAVVVVKPWAADSRELLDF-----APSPDS  348
            Y+ +     GG +++Y+A V  KPW  + +E+ +F     APS  +
Sbjct  57   YITLEVI-DGGQKKVYEAKVWEKPW-LNFKEVQEFKLIGDAPSDST  100



>emb|CAN78115.1| hypothetical protein VITISV_031522 [Vitis vinifera]
 emb|CBI24312.3| unnamed protein product [Vitis vinifera]
Length=101

 Score = 59.3 bits (142),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 39/99 (39%), Positives = 56/99 (57%), Gaps = 8/99 (8%)
 Frame = -2

Query  647  VGGRTEVKDVKNNEEVQELGRYCVREYNKVLQEKQGGGGLLSFSEVVKAETQVVSGFKYY  468
            VGG  +    +N  E++ L R+ V E+NK    KQ    LL F+ VVK   QVV+G  YY
Sbjct  4    VGGIHDSDGSQNALEIENLARFAVDEHNK----KQNT--LLEFNGVVKVRQQVVAGTIYY  57

Query  467  LKISAASSGGARRIYDAVVVVKPWAADSRELLDFAPSPD  351
            + +  A+ GG +  Y+A + VKPW  + +EL +F P  D
Sbjct  58   ITLD-ATDGGKKNKYEAKIWVKPW-LNFKELQEFKPIGD  94



>ref|XP_009759630.1| PREDICTED: cysteine proteinase inhibitor A-like [Nicotiana sylvestris]
 gb|AHX74042.1| cystein protease inhibitor 1 [Nicotiana tabacum]
 gb|AIE76378.1| cysteine protease inhibitor [Nicotiana tabacum]
Length=98

 Score = 59.3 bits (142),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 38/100 (38%), Positives = 58/100 (58%), Gaps = 8/100 (8%)
 Frame = -2

Query  647  VGGRTEVKDVKNNEEVQELGRYCVREYNKVLQEKQGGGGLLSFSEVVKAETQVVSGFKYY  468
            +GG  E    +N+ E+ +L R+ V E+NK    KQ    LL F +VV  + QVV+G  YY
Sbjct  4    LGGIREAGGSENSLEINDLARFAVDEHNK----KQNA--LLEFGKVVNVKEQVVAGTMYY  57

Query  467  LKISAASSGGARRIYDAVVVVKPWAADSRELLDFAPSPDS  348
            + +  A+ GG ++ Y+A V VKPW  + ++L DF    D+
Sbjct  58   ITLE-ATEGGKKKAYEAKVWVKPW-QNFKQLEDFKLIGDA  95



>gb|AHA85335.1| cysteine protease inhibitor [Curcuma longa]
Length=228

 Score = 61.2 bits (147),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 39/100 (39%), Positives = 57/100 (57%), Gaps = 8/100 (8%)
 Frame = -2

Query  647  VGGRTEVKDVKNNEEVQELGRYCVREYNKVLQEKQGGGGLLSFSEVVKAETQVVSGFKYY  468
            VG   E    +N+ E++EL R+ V E+NK          LL F+ VVKA+ QVV+G  +Y
Sbjct  32   VGDVRESDGAQNSAELEELARFAVEEHNK------KENRLLEFTRVVKAKEQVVAGTLHY  85

Query  467  LKISAASSGGARRIYDAVVVVKPWAADSRELLDFAPSPDS  348
            L + A  +G  +++Y+A V VKPW    +EL +F    DS
Sbjct  86   LTLEAIDAGK-KKLYEAKVWVKPW-LHFKELQEFEHIGDS  123



>ref|NP_001105851.1| cystatin8 precursor [Zea mays]
 tpe|CAG29030.1| TPA: putative cystatin [Zea mays]
 gb|ACG48205.1| cystatin [Zea mays]
 gb|ACR38134.1| unknown [Zea mays]
 tpg|DAA45943.1| TPA: hypothetical protein ZEAMMB73_121214 [Zea mays]
Length=127

 Score = 59.7 bits (143),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 37/97 (38%), Positives = 54/97 (56%), Gaps = 9/97 (9%)
 Frame = -2

Query  647  VGGRTEVKDVKNNEEVQELGRYCVREYNKVLQEKQGGGGLLSFSEVVKAETQVVSGFKYY  468
            VGG   +K+V N+  VQE+GR+ V E+ K   +       L F  VV  E Q+V+G  Y 
Sbjct  39   VGGWKPIKNV-NDPHVQEIGRWAVSEHIKTANDG------LGFGRVVSGEEQIVAGKNYR  91

Query  467  LKISAASSGGARRIYDAVVVVKPWAADSRELLDFAPS  357
            L+I A   GG + +Y AVV  +    ++R+LL F P+
Sbjct  92   LRIQATKVGGQKAMYRAVVYEQ--LTNTRQLLSFDPA  126



>emb|CDP06249.1| unnamed protein product [Coffea canephora]
Length=150

 Score = 60.1 bits (144),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 37/102 (36%), Positives = 60/102 (59%), Gaps = 8/102 (8%)
 Frame = -2

Query  656  GRKVGGRTEVKDVKNNEEVQELGRYCVREYNKVLQEKQGGGGLLSFSEVVKAETQVVSGF  477
            G  +GG    +  +NN E++ +GR+ V+E+NK          LL F  V+KA+ QVV+G 
Sbjct  38   GSVLGGSHGYRGDQNNGEIESIGRFAVQEHNK------KENALLEFGRVIKAKEQVVAGK  91

Query  476  KYYLKISAASSGGARRIYDAVVVVKPWAADSRELLDFAPSPD  351
             Y+L + A  + G ++IY+A V VKPW  + ++L +F  + D
Sbjct  92   VYHLTLEAIDA-GKKQIYEAKVWVKPW-MNFKKLEEFRHTRD  131



>gb|KGN65048.1| Cystatin-like protein [Cucumis sativus]
Length=115

 Score = 59.3 bits (142),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 38/99 (38%), Positives = 56/99 (57%), Gaps = 8/99 (8%)
 Frame = -2

Query  656  GRKVGGRTEVKDVKNNEEVQELGRYCVREYNKVLQEKQGGGGLLSFSEVVKAETQVVSGF  477
            G  +GG +++ D+K+   V+E+G++ V EYN     KQ  G  + F  VV  ETQVV+G 
Sbjct  23   GSMLGGWSKIPDLKD-PHVEEIGKFAVAEYN-----KQSKGVAIEFKSVVSGETQVVAGT  76

Query  476  KYYLKISAASSGGARRIYDAVVVVKPWAADSRELLDFAP  360
             Y L I  A  G +   Y+A+V  KPW  + ++L  F P
Sbjct  77   NYRLLID-AKRGESMSKYEAIVWEKPW-ENFKKLTSFKP  113



>gb|ACO39782.1| cysteine inhibitor 1 [Populus balsamifera]
 gb|ACO39783.1| cysteine inhibitor 1 [Populus balsamifera]
 gb|ACO39803.1| cysteine inhibitor 1 [Populus balsamifera]
Length=127

 Score = 59.3 bits (142),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 35/99 (35%), Positives = 58/99 (59%), Gaps = 8/99 (8%)
 Frame = -2

Query  647  VGGRTEVKDVKNNEEVQELGRYCVREYNKVLQEKQGGGGLLSFSEVVKAETQVVSGFKYY  468
            +GG  + +  +N+ E+  L R+ V E+NK          +L F+ VVKA+ QVV+G  ++
Sbjct  23   LGGVHDSQSSQNSAEIDSLARFAVDEHNK------KENAILEFARVVKAKEQVVAGTMHH  76

Query  467  LKISAASSGGARRIYDAVVVVKPWAADSRELLDFAPSPD  351
            L I A  + G +++Y+A V VKPW  + +EL +F  + D
Sbjct  77   LTIEAVEA-GKKKLYEAKVWVKPW-LNFKELHEFKDAGD  113



>ref|XP_010055538.1| PREDICTED: cysteine proteinase inhibitor-like [Eucalyptus grandis]
 gb|KCW89989.1| hypothetical protein EUGRSUZ_A02187 [Eucalyptus grandis]
Length=141

 Score = 59.7 bits (143),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 36/100 (36%), Positives = 58/100 (58%), Gaps = 8/100 (8%)
 Frame = -2

Query  650  KVGGRTEVKDVKNNEEVQELGRYCVREYNKVLQEKQGGGGLLSFSEVVKAETQVVSGFKY  471
            K GG    K  +N+ +++ L R+ V E+NK          LL F+ V+KA+ QVV+G  Y
Sbjct  35   KPGGVHNCKGSQNSAQIEGLARFAVEEHNK------NENALLEFARVLKAKEQVVAGTLY  88

Query  470  YLKISAASSGGARRIYDAVVVVKPWAADSRELLDFAPSPD  351
            +L + A  + G ++IY+A V VKPW  + ++L +F  + D
Sbjct  89   HLTLEAVDA-GKKKIYEAKVWVKPW-MNFKQLQEFKYAED  126



>ref|XP_004170582.1| PREDICTED: cysteine proteinase inhibitor 5-like [Cucumis sativus]
Length=118

 Score = 59.3 bits (142),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 38/99 (38%), Positives = 56/99 (57%), Gaps = 8/99 (8%)
 Frame = -2

Query  656  GRKVGGRTEVKDVKNNEEVQELGRYCVREYNKVLQEKQGGGGLLSFSEVVKAETQVVSGF  477
            G  +GG +++ D+K+   V+E+G++ V EYN     KQ  G  + F  VV  ETQVV+G 
Sbjct  26   GSMLGGWSKIPDLKD-PHVEEIGKFAVAEYN-----KQSKGVAIEFKSVVSGETQVVAGT  79

Query  476  KYYLKISAASSGGARRIYDAVVVVKPWAADSRELLDFAP  360
             Y L I  A  G +   Y+A+V  KPW  + ++L  F P
Sbjct  80   NYRLLID-AKRGESMSKYEAIVWEKPW-ENFKKLTSFKP  116



>ref|XP_008354847.1| PREDICTED: cysteine proteinase inhibitor 12-like [Malus domestica]
Length=244

 Score = 61.6 bits (148),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 39/112 (35%), Positives = 62/112 (55%), Gaps = 8/112 (7%)
 Frame = -2

Query  647  VGGRTEVKDVKNNEEVQELGRYCVREYNKVLQEKQGGGGLLSFSEVVKAETQVVSGFKYY  468
            +GG  E    +N+ EV++L R+ V+E+N           LL F  VVKA+ QVV+G  ++
Sbjct  45   LGGXHESHGAQNSAEVEDLARFAVQEHNX------KENALLEFVXVVKAKEQVVAGTLHH  98

Query  467  LKISAASSGGARRIYDAVVVVKPWAADSRELLDFAPSPDSDHPSKQFLDILV  312
            L I A  + G +++Y A V VKPW    +E+ +F  + + + PS    D+ V
Sbjct  99   LTIEAIEA-GKKKLYQAKVWVKPWMG-FKEVQEFKHADEEETPSVTSSDLGV  148



>ref|XP_010055569.1| PREDICTED: cysteine proteinase inhibitor-like [Eucalyptus grandis]
Length=141

 Score = 59.7 bits (143),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 36/100 (36%), Positives = 58/100 (58%), Gaps = 8/100 (8%)
 Frame = -2

Query  650  KVGGRTEVKDVKNNEEVQELGRYCVREYNKVLQEKQGGGGLLSFSEVVKAETQVVSGFKY  471
            K GG    K  +N+ +++ L R+ V E+NK          LL F+ V+KA+ QVV+G  Y
Sbjct  35   KPGGVHNCKGSQNSAQIEGLARFAVEEHNK------NENALLEFARVLKAKEQVVAGTLY  88

Query  470  YLKISAASSGGARRIYDAVVVVKPWAADSRELLDFAPSPD  351
            +L + A  + G ++IY+A V VKPW  + ++L +F  + D
Sbjct  89   HLTLEAVDA-GKKKIYEAKVWVKPW-MNFKQLQEFKYAED  126



>emb|CDY33126.1| BnaC09g22220D [Brassica napus]
Length=140

 Score = 59.7 bits (143),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 40/103 (39%), Positives = 55/103 (53%), Gaps = 13/103 (13%)
 Frame = -2

Query  650  KVGGRTEVKDVKNNEEVQELGRYCVREYNKVLQEKQGGGGLLSFSEVVKAETQVVSGFKY  471
            + GG + + DVKN+  V E+G + V EYNK  Q K G    L F EVV  E+Q+V+G  Y
Sbjct  45   RTGGWSPISDVKNSHIV-EIGEFAVSEYNK--QSKSG----LKFVEVVSGESQIVAGINY  97

Query  470  YLKIS-----AASSGGARRIYDAVVVVKPWAADSRELLDFAPS  357
             L ++     A +  G  + Y+AVV   PW   S  L  F P+
Sbjct  98   RLIVAANEGVAITGNGESKKYEAVVWETPW-LKSMNLTSFKPA  139



>gb|ACO39758.1| cysteine inhibitor 1 [Populus balsamifera]
 gb|ACO39759.1| cysteine inhibitor 1 [Populus balsamifera]
 gb|ACO39760.1| cysteine inhibitor 1 [Populus balsamifera]
 gb|ACO39761.1| cysteine inhibitor 1 [Populus balsamifera]
 gb|ACO39762.1| cysteine inhibitor 1 [Populus balsamifera]
 gb|ACO39763.1| cysteine inhibitor 1 [Populus balsamifera]
 gb|ACO39764.1| cysteine inhibitor 1 [Populus balsamifera]
 gb|ACO39765.1| cysteine inhibitor 1 [Populus balsamifera]
 gb|ACO39766.1| cysteine inhibitor 1 [Populus balsamifera]
 gb|ACO39767.1| cysteine inhibitor 1 [Populus balsamifera]
 gb|ACO39768.1| cysteine inhibitor 1 [Populus balsamifera]
 gb|ACO39769.1| cysteine inhibitor 1 [Populus balsamifera]
 gb|ACO39770.1| cysteine inhibitor 1 [Populus balsamifera]
 gb|ACO39771.1| cysteine inhibitor 1 [Populus balsamifera]
 gb|ACO39772.1| cysteine inhibitor 1 [Populus balsamifera]
 gb|ACO39773.1| cysteine inhibitor 1 [Populus balsamifera]
 gb|ACO39774.1| cysteine inhibitor 1 [Populus balsamifera]
 gb|ACO39775.1| cysteine inhibitor 1 [Populus balsamifera]
 gb|ACO39776.1| cysteine inhibitor 1 [Populus balsamifera]
 gb|ACO39777.1| cysteine inhibitor 1 [Populus balsamifera]
 gb|ACO39778.1| cysteine inhibitor 1 [Populus balsamifera]
 gb|ACO39779.1| cysteine inhibitor 1 [Populus balsamifera]
 gb|ACO39780.1| cysteine inhibitor 1 [Populus balsamifera]
 gb|ACO39781.1| cysteine inhibitor 1 [Populus balsamifera]
 gb|ACO39784.1| cysteine inhibitor 1 [Populus balsamifera]
 gb|ACO39785.1| cysteine inhibitor 1 [Populus balsamifera]
 gb|ACO39786.1| cysteine inhibitor 1 [Populus balsamifera]
 gb|ACO39787.1| cysteine inhibitor 1 [Populus balsamifera]
 gb|ACO39788.1| cysteine inhibitor 1 [Populus balsamifera]
 gb|ACO39789.1| cysteine inhibitor 1 [Populus balsamifera]
 gb|ACO39790.1| cysteine inhibitor 1 [Populus balsamifera]
 gb|ACO39791.1| cysteine inhibitor 1 [Populus balsamifera]
 gb|ACO39792.1| cysteine inhibitor 1 [Populus balsamifera]
 gb|ACO39794.1| cysteine inhibitor 1 [Populus balsamifera]
 gb|ACO39795.1| cysteine inhibitor 1 [Populus balsamifera]
 gb|ACO39796.1| cysteine inhibitor 1 [Populus balsamifera]
 gb|ACO39797.1| cysteine inhibitor 1 [Populus balsamifera]
 gb|ACO39798.1| cysteine inhibitor 1 [Populus balsamifera]
 gb|ACO39799.1| cysteine inhibitor 1 [Populus balsamifera]
 gb|ACO39800.1| cysteine inhibitor 1 [Populus balsamifera]
 gb|ACO39801.1| cysteine inhibitor 1 [Populus balsamifera]
 gb|ACO39802.1| cysteine inhibitor 1 [Populus balsamifera]
 gb|ACO39804.1| cysteine inhibitor 1 [Populus balsamifera]
 gb|ACO39805.1| cysteine inhibitor 1 [Populus balsamifera]
 gb|ACO39806.1| cysteine inhibitor 1 [Populus balsamifera]
 gb|ACO39807.1| cysteine inhibitor 1 [Populus balsamifera]
 gb|ACO39808.1| cysteine inhibitor 1 [Populus balsamifera]
 gb|ACO39809.1| cysteine inhibitor 1 [Populus balsamifera]
 gb|ACO39810.1| cysteine inhibitor 1 [Populus balsamifera]
 gb|ACO39811.1| cysteine inhibitor 1 [Populus balsamifera]
 gb|ACO39812.1| cysteine inhibitor 1 [Populus balsamifera]
 gb|ACO39813.1| cysteine inhibitor 1 [Populus balsamifera]
 gb|ACO39814.1| cysteine inhibitor 1 [Populus balsamifera]
 gb|ACO39815.1| cysteine inhibitor 1 [Populus balsamifera]
 gb|ACO39816.1| cysteine inhibitor 1 [Populus balsamifera]
 gb|ACO39817.1| cysteine inhibitor 1 [Populus balsamifera]
 gb|ACO39818.1| cysteine inhibitor 1 [Populus balsamifera]
 gb|ACO39819.1| cysteine inhibitor 1 [Populus balsamifera]
 gb|ACO39820.1| cysteine inhibitor 1 [Populus balsamifera]
 gb|ACO39821.1| cysteine inhibitor 1 [Populus balsamifera]
 gb|ACO39822.1| cysteine inhibitor 1 [Populus balsamifera]
 gb|ACO39823.1| cysteine inhibitor 1 [Populus balsamifera]
 gb|ACO39824.1| cysteine inhibitor 1 [Populus balsamifera]
 gb|ACO39825.1| cysteine inhibitor 1 [Populus balsamifera]
 gb|ACO39826.1| cysteine inhibitor 1 [Populus balsamifera]
 gb|ACO39827.1| cysteine inhibitor 1 [Populus balsamifera]
 gb|ACO39828.1| cysteine inhibitor 1 [Populus balsamifera]
 gb|ACO39829.1| cysteine inhibitor 1 [Populus balsamifera]
 gb|ACO39830.1| cysteine inhibitor 1 [Populus balsamifera]
 gb|ACO39831.1| cysteine inhibitor 1 [Populus balsamifera]
 gb|ACO39832.1| cysteine inhibitor 1 [Populus balsamifera]
 gb|ACO39833.1| cysteine inhibitor 1 [Populus balsamifera]
 gb|ACO39834.1| cysteine inhibitor 1 [Populus balsamifera]
 gb|ACO39835.1| cysteine inhibitor 1 [Populus balsamifera]
 gb|ACO39836.1| cysteine inhibitor 1 [Populus balsamifera]
 gb|ACO39837.1| cysteine inhibitor 1 [Populus balsamifera]
 gb|ACO39838.1| cysteine inhibitor 1 [Populus balsamifera]
 gb|ACO39839.1| cysteine inhibitor 1 [Populus balsamifera]
 gb|ACO39840.1| cysteine inhibitor 1 [Populus balsamifera]
 gb|ACO39841.1| cysteine inhibitor 1 [Populus balsamifera]
Length=127

 Score = 59.3 bits (142),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 35/99 (35%), Positives = 58/99 (59%), Gaps = 8/99 (8%)
 Frame = -2

Query  647  VGGRTEVKDVKNNEEVQELGRYCVREYNKVLQEKQGGGGLLSFSEVVKAETQVVSGFKYY  468
            +GG  + +  +N+ E+  L R+ V E+NK          +L F+ VVKA+ QVV+G  ++
Sbjct  23   LGGVHDSQSSQNSAEIDSLARFAVDEHNK------KENAILEFARVVKAKEQVVAGTMHH  76

Query  467  LKISAASSGGARRIYDAVVVVKPWAADSRELLDFAPSPD  351
            L I A  + G +++Y+A V VKPW  + +EL +F  + D
Sbjct  77   LTIEAVEA-GKKKLYEAKVWVKPW-LNFKELHEFKDAGD  113



>ref|XP_011080491.1| PREDICTED: cysteine proteinase inhibitor A-like [Sesamum indicum]
Length=94

 Score = 58.5 bits (140),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 36/99 (36%), Positives = 59/99 (60%), Gaps = 8/99 (8%)
 Frame = -2

Query  644  GGRTEVKDVKNNEEVQELGRYCVREYNKVLQEKQGGGGLLSFSEVVKAETQVVSGFKYYL  465
            GG  + +  +N+ E+++L R+ V +YNK    KQ G  LL   +V   + QVV+G  YY+
Sbjct  4    GGVRQSEGFQNSLEIEDLARFAVDDYNK----KQNG--LLELKKVTNVKEQVVAGTMYYI  57

Query  464  KISAASSGGARRIYDAVVVVKPWAADSRELLDFAPSPDS  348
             + AA  GG +++Y+A V VKPW  + +E+ +F    D+
Sbjct  58   TLEAA-EGGQKKVYEAKVWVKPW-MNFKEVQEFKLLGDA  94



>ref|XP_010465015.1| PREDICTED: cysteine proteinase inhibitor 6 [Camelina sativa]
Length=230

 Score = 60.8 bits (146),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 36/99 (36%), Positives = 59/99 (60%), Gaps = 8/99 (8%)
 Frame = -2

Query  647  VGGRTEVKDVKNNEEVQELGRYCVREYNKVLQEKQGGGGLLSFSEVVKAETQVVSGFKYY  468
            +GG  +V   +N+ EV+ L R+ V E+NK          LL F+ VVKA+ QVV+G  ++
Sbjct  36   LGGVRDVPSNQNSGEVESLARFAVDEHNK------KENALLEFARVVKAKEQVVAGTLHH  89

Query  467  LKISAASSGGARRIYDAVVVVKPWAADSRELLDFAPSPD  351
            L +    + G +++Y+A V VKPW  + +EL +F P+ +
Sbjct  90   LTLEILEA-GEKKLYEAKVWVKPW-LNFKELQEFKPASN  126



>ref|NP_001237443.1| uncharacterized protein LOC100499887 precursor [Glycine max]
 gb|ACU14063.1| unknown [Glycine max]
Length=245

 Score = 61.2 bits (147),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 36/100 (36%), Positives = 61/100 (61%), Gaps = 8/100 (8%)
 Frame = -2

Query  647  VGGRTEVKDVKNNEEVQELGRYCVREYNKVLQEKQGGGGLLSFSEVVKAETQVVSGFKYY  468
            +GG  + +  +N+ E + L R+ V E+NK    KQ    LL F+ VV+A+ QVV+G  ++
Sbjct  48   IGGLHDSQGSQNSVETEALARFAVDEHNK----KQ--NSLLEFARVVRAQEQVVAGTLHH  101

Query  467  LKISAASSGGARRIYDAVVVVKPWAADSRELLDFAPSPDS  348
            L + A  + G +++Y+A   VKPW  + +EL +F P+ D+
Sbjct  102  LTLEAIEA-GEKKLYEAKAWVKPW-LNFKELQEFKPAGDA  139



>gb|AGX28139.1| cysteine protease inhibitor, partial [Populus euphratica]
 gb|AGX28140.1| cysteine protease inhibitor, partial [Populus euphratica]
Length=107

 Score = 58.9 bits (141),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 35/99 (35%), Positives = 58/99 (59%), Gaps = 8/99 (8%)
 Frame = -2

Query  647  VGGRTEVKDVKNNEEVQELGRYCVREYNKVLQEKQGGGGLLSFSEVVKAETQVVSGFKYY  468
            +GG  + +  +N+ E+  L R+ V E+NK          +L F+ VVKA+ QVV+G  ++
Sbjct  4    LGGVHDSQSSQNSVEIDSLARFAVDEHNK------KENAILEFARVVKAKEQVVAGTMHH  57

Query  467  LKISAASSGGARRIYDAVVVVKPWAADSRELLDFAPSPD  351
            L I A  + G +++Y+A V VKPW  + +EL +F  + D
Sbjct  58   LTIEAIEA-GKKKLYEAKVWVKPW-LNFKELHEFKDAGD  94



>ref|XP_002863337.1| hypothetical protein ARALYDRAFT_494218 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH39596.1| hypothetical protein ARALYDRAFT_494218 [Arabidopsis lyrata subsp. 
lyrata]
Length=122

 Score = 58.9 bits (141),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 38/98 (39%), Positives = 54/98 (55%), Gaps = 8/98 (8%)
 Frame = -2

Query  650  KVGGRTEVKDVKNNEEVQELGRYCVREYNKVLQEKQGGGGLLSFSEVVKAETQVVSGFKY  471
            +VGG + + +V  +  V E+G + V EYNK  + + G    L F  VV+ ETQVV+G  Y
Sbjct  27   RVGGWSPISNV-TDPHVVEIGEFAVSEYNK--RSESG----LKFETVVRGETQVVAGTNY  79

Query  470  YLKISAASSGGARRIYDAVVVVKPWAADSRELLDFAPS  357
             L ++A    GA + Y A+V  KPW    R L  F P+
Sbjct  80   RLTVAANDGEGASKNYLAIVWEKPW-MKFRNLTSFEPA  116



>ref|XP_010486966.1| PREDICTED: cysteine proteinase inhibitor 6-like [Camelina sativa]
Length=232

 Score = 60.8 bits (146),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 36/99 (36%), Positives = 59/99 (60%), Gaps = 8/99 (8%)
 Frame = -2

Query  647  VGGRTEVKDVKNNEEVQELGRYCVREYNKVLQEKQGGGGLLSFSEVVKAETQVVSGFKYY  468
            +GG  +V   +N+ EV+ L R+ V E+NK          LL F+ VVKA+ QVV+G  ++
Sbjct  38   LGGVRDVPSNQNSGEVESLARFAVDEHNK------KENALLEFARVVKAKEQVVAGTLHH  91

Query  467  LKISAASSGGARRIYDAVVVVKPWAADSRELLDFAPSPD  351
            L +    + G +++Y+A V VKPW  + +EL +F P+ +
Sbjct  92   LTLEILEA-GEKKLYEAKVWVKPW-LNFKELQEFKPASN  128



>ref|XP_010499025.1| PREDICTED: cysteine proteinase inhibitor 6-like [Camelina sativa]
Length=232

 Score = 60.8 bits (146),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 36/99 (36%), Positives = 59/99 (60%), Gaps = 8/99 (8%)
 Frame = -2

Query  647  VGGRTEVKDVKNNEEVQELGRYCVREYNKVLQEKQGGGGLLSFSEVVKAETQVVSGFKYY  468
            +GG  +V   +N+ EV+ L R+ V E+NK          LL F+ VVKA+ QVV+G  ++
Sbjct  38   LGGVRDVPSNQNSGEVESLARFAVDEHNK------KENALLEFARVVKAKEQVVAGTLHH  91

Query  467  LKISAASSGGARRIYDAVVVVKPWAADSRELLDFAPSPD  351
            L +    + G +++Y+A V VKPW  + +EL +F P+ +
Sbjct  92   LTLEILEA-GEKKLYEAKVWVKPW-LNFKELQEFKPASN  128



>ref|XP_008346634.1| PREDICTED: cysteine proteinase inhibitor 6-like [Malus domestica]
Length=245

 Score = 60.8 bits (146),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 39/112 (35%), Positives = 62/112 (55%), Gaps = 8/112 (7%)
 Frame = -2

Query  647  VGGRTEVKDVKNNEEVQELGRYCVREYNKVLQEKQGGGGLLSFSEVVKAETQVVSGFKYY  468
            +GG  E    +N+ EV++L R+ V+E+N           LL F  VVKA+ QVV+G  ++
Sbjct  46   LGGVHESHGAQNSAEVEDLARFAVQEHNN------KENALLEFVSVVKAKEQVVAGTLHH  99

Query  467  LKISAASSGGARRIYDAVVVVKPWAADSRELLDFAPSPDSDHPSKQFLDILV  312
            L I A  + G +++Y A V VKPW    +E+ +F  + + + PS    D+ V
Sbjct  100  LTIEAIEA-GKKKLYQAKVWVKPWMG-FKEVQEFKHADEEETPSVTSSDLGV  149



>gb|AHZ92269.1| cystatin 3 [Malus prunifolia]
Length=245

 Score = 60.8 bits (146),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 39/112 (35%), Positives = 62/112 (55%), Gaps = 8/112 (7%)
 Frame = -2

Query  647  VGGRTEVKDVKNNEEVQELGRYCVREYNKVLQEKQGGGGLLSFSEVVKAETQVVSGFKYY  468
            +GG  E    +N+ EV++L R+ V+E+N           LL F  VVKA+ QVV+G  ++
Sbjct  46   LGGVHESHGAQNSAEVEDLARFAVQEHNN------KENALLEFVSVVKAKEQVVAGTLHH  99

Query  467  LKISAASSGGARRIYDAVVVVKPWAADSRELLDFAPSPDSDHPSKQFLDILV  312
            L I A  + G +++Y A V VKPW    +E+ +F  + + + PS    D+ V
Sbjct  100  LTIEAIEA-GKKKLYQAKVWVKPWMG-FKEVQEFKHADEEETPSVTSSDLGV  149



>gb|EMT09480.1| Cysteine proteinase inhibitor 1 [Aegilops tauschii]
Length=142

 Score = 59.3 bits (142),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 33/96 (34%), Positives = 55/96 (57%), Gaps = 8/96 (8%)
 Frame = -2

Query  644  GGRTEVKDVKNNEEVQELGRYCVREYNKVLQEKQGGGGLLSFSEVVKAETQVVSGFKYYL  465
            GG  +    +N+  + +L R+ V E+      K     LL F +VVK + QVV+G  YY+
Sbjct  48   GGIVDTPGAENDLRIVDLARFAVSEH------KNRTNALLEFEKVVKLKQQVVAGMMYYI  101

Query  464  KISAASSGGARRIYDAVVVVKPWAADSRELLDFAPS  357
             I   + GGA+++Y+A V  +PW  D ++L++F P+
Sbjct  102  TIQ-VNEGGAKKMYEAKVWEQPW-MDFKKLMEFRPA  135



>ref|XP_006470502.1| PREDICTED: cysteine proteinase inhibitor-like [Citrus sinensis]
Length=100

 Score = 58.5 bits (140),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 40/104 (38%), Positives = 57/104 (55%), Gaps = 9/104 (9%)
 Frame = -2

Query  647  VGGRTEVKDVKNNEEVQELGRYCVREYNKVLQEKQGGGGLLSFSEVVKAETQVVSGFKYY  468
            +GG   V+   NN+E+  L R+ V E+NK    KQ     L F +VV A+ QVVSG  Y 
Sbjct  4    LGGVRNVEATANNQEIVNLARFAVDEHNK----KQNSN--LQFVKVVSAKQQVVSGTLYD  57

Query  467  LKISAASSGGARRIYDAVVVVKPWAADSRELLDFAPSPDSDHPS  336
            + + A   GG +++++A V  KPW    +EL +F P   S H S
Sbjct  58   ITLEAV-EGGQKKLFEAKVWEKPW-MQFKELKEFNPVAQS-HSS  98



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1497539801044