BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c80583_g1_i1 len=2336 path=[2314:0-2335]

Length=2336
                                                                      Score     E

ref|XP_009802257.1|  PREDICTED: protein NRT1/ PTR FAMILY 7.3 isof...    895   0.0      
ref|XP_009802258.1|  PREDICTED: protein NRT1/ PTR FAMILY 7.3 isof...    894   0.0      
ref|XP_009802255.1|  PREDICTED: protein NRT1/ PTR FAMILY 7.3 isof...    891   0.0      
ref|XP_006354610.1|  PREDICTED: nitrate transporter 1.5-like            891   0.0      
ref|XP_009802256.1|  PREDICTED: protein NRT1/ PTR FAMILY 7.3 isof...    889   0.0      
ref|XP_009607049.1|  PREDICTED: protein NRT1/ PTR FAMILY 7.3-like       886   0.0      
emb|CDP09345.1|  unnamed protein product                                879   0.0      
ref|XP_006341336.1|  PREDICTED: nitrate transporter 1.5-like            879   0.0      
ref|XP_009629801.1|  PREDICTED: protein NRT1/ PTR FAMILY 7.3-like...    877   0.0      
ref|XP_009629800.1|  PREDICTED: protein NRT1/ PTR FAMILY 7.3-like...    877   0.0      
ref|XP_009629799.1|  PREDICTED: protein NRT1/ PTR FAMILY 7.3-like...    876   0.0      
ref|XP_004229506.1|  PREDICTED: protein NRT1/ PTR FAMILY 7.3-like       874   0.0      
ref|XP_009757592.1|  PREDICTED: protein NRT1/ PTR FAMILY 7.3-like       873   0.0      
ref|XP_011085074.1|  PREDICTED: protein NRT1/ PTR FAMILY 7.3-like       866   0.0      
ref|XP_010327292.1|  PREDICTED: protein NRT1/ PTR FAMILY 7.3-like       862   0.0      
ref|XP_007008714.1|  Nitrate transporter 1.5                            856   0.0      
ref|XP_008232241.1|  PREDICTED: protein NRT1/ PTR FAMILY 7.3-like       850   0.0      
ref|XP_006464342.1|  PREDICTED: nitrate transporter 1.5-like            849   0.0      
ref|XP_006445510.1|  hypothetical protein CICLE_v10023644mg             848   0.0      
ref|XP_009347591.1|  PREDICTED: protein NRT1/ PTR FAMILY 7.3-like       848   0.0      
ref|XP_007220198.1|  hypothetical protein PRUPE_ppa003058mg             848   0.0      
gb|KHG12170.1|  Nitrate transporter 1.5 -like protein                   837   0.0      
ref|XP_004307313.1|  PREDICTED: nitrate transporter 1.5-like            837   0.0      
gb|KHG17535.1|  Nitrate transporter 1.5 -like protein                   832   0.0      
ref|XP_002265725.3|  PREDICTED: protein NRT1/ PTR FAMILY 7.3-like       832   0.0      Vitis vinifera
ref|XP_004148494.1|  PREDICTED: nitrate transporter 1.5-like            828   0.0      
ref|XP_008448722.1|  PREDICTED: protein NRT1/ PTR FAMILY 7.3-like       828   0.0      
ref|XP_010275292.1|  PREDICTED: protein NRT1/ PTR FAMILY 7.3-like       828   0.0      
ref|XP_004133948.1|  PREDICTED: nitrate transporter 1.5-like            828   0.0      
ref|XP_002519847.1|  Peptide transporter, putative                      827   0.0      Ricinus communis
ref|XP_002320578.1|  hypothetical protein POPTR_0014s17750g             827   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_011011752.1|  PREDICTED: protein NRT1/ PTR FAMILY 7.2-like...    825   0.0      
ref|XP_011011755.1|  PREDICTED: protein NRT1/ PTR FAMILY 7.2-like...    825   0.0      
ref|XP_011011754.1|  PREDICTED: protein NRT1/ PTR FAMILY 7.2-like...    825   0.0      
ref|XP_004163981.1|  PREDICTED: nitrate transporter 1.5-like            824   0.0      
ref|XP_011011753.1|  PREDICTED: protein NRT1/ PTR FAMILY 7.2-like...    824   0.0      
ref|XP_006368434.1|  proton-dependent oligopeptide transport fami...    823   0.0      
ref|XP_008465942.1|  PREDICTED: protein NRT1/ PTR FAMILY 7.3-like       823   0.0      
emb|CAN83927.1|  hypothetical protein VITISV_031037                     821   0.0      Vitis vinifera
ref|XP_002526521.1|  Peptide transporter, putative                      821   0.0      Ricinus communis
ref|XP_007139566.1|  hypothetical protein PHAVU_008G040500g             821   0.0      
ref|XP_010269969.1|  PREDICTED: protein NRT1/ PTR FAMILY 7.3-like       821   0.0      
ref|XP_003550941.1|  PREDICTED: nitrate transporter 1.5-like            820   0.0      
ref|XP_011018609.1|  PREDICTED: protein NRT1/ PTR FAMILY 7.3            819   0.0      
ref|XP_006385620.1|  proton-dependent oligopeptide transport fami...    818   0.0      
ref|XP_011028220.1|  PREDICTED: protein NRT1/ PTR FAMILY 7.3-like...    818   0.0      
ref|XP_011028221.1|  PREDICTED: protein NRT1/ PTR FAMILY 7.3-like...    817   0.0      
gb|KHN01673.1|  Nitrate transporter 1.5                                 816   0.0      
ref|XP_007155757.1|  hypothetical protein PHAVU_003G229000g             815   0.0      
ref|XP_006579680.1|  PREDICTED: nitrate transporter 1.5-like isof...    814   0.0      
ref|XP_006436768.1|  hypothetical protein CICLE_v10031017mg             811   0.0      
gb|EYU40300.1|  hypothetical protein MIMGU_mgv1a025093mg                811   0.0      
ref|XP_003525604.1|  PREDICTED: nitrate transporter 1.5-like isof...    811   0.0      
gb|KHN21024.1|  Nitrate transporter 1.5                                 811   0.0      
ref|XP_010538507.1|  PREDICTED: protein NRT1/ PTR FAMILY 7.2            809   0.0      
emb|CBI16743.3|  unnamed protein product                                807   0.0      
gb|KDP39505.1|  hypothetical protein JCGZ_05071                         805   0.0      
emb|CDX93833.1|  BnaA09g24330D                                          803   0.0      
ref|XP_010097732.1|  Nitrate transporter 1.5                            800   0.0      
emb|CDY01274.1|  BnaC05g24580D                                          800   0.0      
ref|XP_009114885.1|  PREDICTED: protein NRT1/ PTR FAMILY 7.3-like       800   0.0      
ref|XP_002278374.2|  PREDICTED: protein NRT1/ PTR FAMILY 7.3            800   0.0      Vitis vinifera
ref|XP_010053584.1|  PREDICTED: protein NRT1/ PTR FAMILY 7.3            797   0.0      
ref|XP_010056493.1|  PREDICTED: protein NRT1/ PTR FAMILY 7.3-like       797   0.0      
ref|XP_010677273.1|  PREDICTED: protein NRT1/ PTR FAMILY 7.3            796   0.0      
ref|XP_007039561.1|  Nitrate transporter 1.5                            796   0.0      
gb|AES90846.2|  peptide transporter                                     794   0.0      
ref|XP_006602907.1|  PREDICTED: nitrate transporter 1.5-like            793   0.0      
emb|CAN77707.1|  hypothetical protein VITISV_026382                     793   0.0      Vitis vinifera
ref|XP_003534448.1|  PREDICTED: nitrate transporter 1.5-like            792   0.0      
gb|KEH31554.1|  peptide transporter                                     794   0.0      
ref|XP_003608649.1|  Peptide transporter PTR1                           794   0.0      
ref|XP_008238336.1|  PREDICTED: protein NRT1/ PTR FAMILY 7.3            791   0.0      
emb|CDY32284.1|  BnaC05g28620D                                          792   0.0      
emb|CDY48871.1|  BnaA05g35790D                                          791   0.0      
ref|XP_008439356.1|  PREDICTED: protein NRT1/ PTR FAMILY 7.3-like       788   0.0      
ref|XP_009151431.1|  PREDICTED: protein NRT1/ PTR FAMILY 7.3            791   0.0      
ref|XP_003516639.1|  PREDICTED: nitrate transporter 1.5-like            790   0.0      
gb|KHN13614.1|  Nitrate transporter 1.5                                 789   0.0      
ref|XP_003611453.1|  Peptide transporter PTR1                           790   0.0      
gb|KHG24156.1|  Nitrate transporter 1.5 -like protein                   789   0.0      
gb|KHN42621.1|  Nitrate transporter 1.5                                 788   0.0      
ref|XP_011081326.1|  PREDICTED: protein NRT1/ PTR FAMILY 7.3-like       788   0.0      
ref|XP_007210875.1|  hypothetical protein PRUPE_ppa003158mg             788   0.0      
ref|XP_007156651.1|  hypothetical protein PHAVU_002G005700g             787   0.0      
ref|XP_004301700.1|  PREDICTED: nitrate transporter 1.5-like            792   0.0      
ref|XP_006415196.1|  hypothetical protein EUTSA_v10007088mg             787   0.0      
gb|KHN34858.1|  Nitrate transporter 1.5                                 786   0.0      
ref|XP_004150179.1|  PREDICTED: nitrate transporter 1.5-like            784   0.0      
ref|XP_009137205.1|  PREDICTED: protein NRT1/ PTR FAMILY 7.2            783   0.0      
emb|CDX94047.1|  BnaC07g36810D                                          781   0.0      
ref|NP_174523.2|  nitrate transporter 1.5                               782   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_010518871.1|  PREDICTED: protein NRT1/ PTR FAMILY 7.3-like       781   0.0      
ref|XP_006847685.1|  hypothetical protein AMTR_s00149p00049280          781   0.0      
ref|XP_010478666.1|  PREDICTED: protein NRT1/ PTR FAMILY 7.3-like       781   0.0      
emb|CDX98697.1|  BnaA03g44820D                                          779   0.0      
ref|XP_010461068.1|  PREDICTED: protein NRT1/ PTR FAMILY 7.3            780   0.0      
gb|AAF81343.1|AC007767_23  Contains similarity to a peptide trans...    780   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_010499794.1|  PREDICTED: protein NRT1/ PTR FAMILY 7.3-like       780   0.0      
ref|XP_006307023.1|  hypothetical protein CARUB_v10008608mg             780   0.0      
emb|CDP12983.1|  unnamed protein product                                779   0.0      
emb|CDX79084.1|  BnaA01g11510D                                          778   0.0      
ref|XP_011070229.1|  PREDICTED: protein NRT1/ PTR FAMILY 7.3            778   0.0      
ref|XP_009135044.1|  PREDICTED: protein NRT1/ PTR FAMILY 7.2-like       775   0.0      
ref|XP_006587754.1|  PREDICTED: nitrate transporter 1.5-like            775   0.0      
gb|ABD32535.1|  TGF-beta receptor, type I/II extracellular region       773   0.0      Medicago truncatula
ref|XP_003551735.1|  PREDICTED: nitrate transporter 1.5-like            773   0.0      
ref|XP_008373542.1|  PREDICTED: protein NRT1/ PTR FAMILY 7.3            773   0.0      
ref|XP_009792818.1|  PREDICTED: protein NRT1/ PTR FAMILY 7.3-like...    773   0.0      
ref|XP_009395136.1|  PREDICTED: protein NRT1/ PTR FAMILY 7.3-like       774   0.0      
ref|XP_007139567.1|  hypothetical protein PHAVU_008G040600g             773   0.0      
ref|XP_010449021.1|  PREDICTED: protein NRT1/ PTR FAMILY 7.2-like       772   0.0      
ref|XP_006283396.1|  hypothetical protein CARUB_v10004438mg             771   0.0      
ref|XP_002893724.1|  proton-dependent oligopeptide transport fami...    771   0.0      
ref|XP_010919865.1|  PREDICTED: protein NRT1/ PTR FAMILY 7.3-like...    771   0.0      
ref|XP_009595682.1|  PREDICTED: protein NRT1/ PTR FAMILY 7.3-like       770   0.0      
ref|XP_010919866.1|  PREDICTED: protein NRT1/ PTR FAMILY 7.3-like...    770   0.0      
gb|KHN11611.1|  Nitrate transporter 1.5                                 769   0.0      
ref|XP_010434145.1|  PREDICTED: protein NRT1/ PTR FAMILY 7.2 isof...    768   0.0      
ref|XP_004245877.1|  PREDICTED: protein NRT1/ PTR FAMILY 7.3            768   0.0      
ref|XP_009593649.1|  PREDICTED: protein NRT1/ PTR FAMILY 7.3 isof...    768   0.0      
ref|XP_010439444.1|  PREDICTED: protein NRT1/ PTR FAMILY 7.2-like       768   0.0      
ref|XP_006413747.1|  hypothetical protein EUTSA_v10024762mg             767   0.0      
ref|XP_010104361.1|  Nitrate transporter 1.5                            766   0.0      
ref|XP_006358632.1|  PREDICTED: nitrate transporter 1.5-like            766   0.0      
ref|XP_009377057.1|  PREDICTED: protein NRT1/ PTR FAMILY 7.3-like       766   0.0      
ref|XP_009373444.1|  PREDICTED: protein NRT1/ PTR FAMILY 7.3-like       764   0.0      
ref|XP_002867832.1|  proton-dependent oligopeptide transport fami...    764   0.0      
gb|KFK28750.1|  hypothetical protein AALP_AA7G041900                    764   0.0      
ref|XP_008353085.1|  PREDICTED: protein SUPPRESSOR OF npr1-1, CON...    788   0.0      
ref|XP_009761242.1|  PREDICTED: protein NRT1/ PTR FAMILY 7.3-like       763   0.0      
ref|XP_004244546.1|  PREDICTED: protein NRT1/ PTR FAMILY 7.3            763   0.0      
ref|XP_008788684.1|  PREDICTED: protein NRT1/ PTR FAMILY 7.3-like       763   0.0      
ref|XP_009761241.1|  PREDICTED: protein NRT1/ PTR FAMILY 7.3-like       762   0.0      
ref|XP_009378974.1|  PREDICTED: protein NRT1/ PTR FAMILY 7.3-like...    761   0.0      
ref|XP_010934995.1|  PREDICTED: protein NRT1/ PTR FAMILY 7.3 isof...    758   0.0      
ref|NP_193899.2|  nitrate transporter 1.8                               756   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_009595683.1|  PREDICTED: protein NRT1/ PTR FAMILY 7.3-like       757   0.0      
dbj|BAC42767.1|  putative peptide transporter                           755   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_010934996.1|  PREDICTED: protein NRT1/ PTR FAMILY 7.3 isof...    755   0.0      
ref|XP_009378973.1|  PREDICTED: protein NRT1/ PTR FAMILY 7.3-like...    755   0.0      
ref|XP_009409940.1|  PREDICTED: protein NRT1/ PTR FAMILY 7.2-like...    754   0.0      
ref|XP_003621236.1|  Peptide transporter PTR1                           751   0.0      
ref|XP_006362495.1|  PREDICTED: nitrate transporter 1.5-like            749   0.0      
ref|XP_009409941.1|  PREDICTED: protein NRT1/ PTR FAMILY 7.2-like...    748   0.0      
ref|XP_008799424.1|  PREDICTED: protein NRT1/ PTR FAMILY 7.3-like       747   0.0      
ref|XP_010691959.1|  PREDICTED: protein NRT1/ PTR FAMILY 7.3-like       736   0.0      
ref|XP_010540767.1|  PREDICTED: protein NRT1/ PTR FAMILY 7.3-like...    734   0.0      
ref|XP_010943512.1|  PREDICTED: protein NRT1/ PTR FAMILY 7.2 isof...    734   0.0      
ref|XP_010540766.1|  PREDICTED: protein NRT1/ PTR FAMILY 7.3-like...    734   0.0      
ref|XP_010943513.1|  PREDICTED: protein NRT1/ PTR FAMILY 7.2 isof...    734   0.0      
ref|XP_010691958.1|  PREDICTED: protein NRT1/ PTR FAMILY 7.3-like       729   0.0      
ref|XP_009418231.1|  PREDICTED: protein NRT1/ PTR FAMILY 7.2-like       728   0.0      
gb|KHN13615.1|  Nitrate transporter 1.5                                 736   0.0      
ref|XP_009593650.1|  PREDICTED: protein NRT1/ PTR FAMILY 7.3 isof...    724   0.0      
ref|XP_008341111.1|  PREDICTED: protein NRT1/ PTR FAMILY 7.3-like       722   0.0      
emb|CAB36812.1|  peptide transporter-like protein                       722   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_010692434.1|  PREDICTED: protein NRT1/ PTR FAMILY 7.3-like       722   0.0      
ref|XP_008808100.1|  PREDICTED: protein NRT1/ PTR FAMILY 7.2            721   0.0      
ref|XP_009393944.1|  PREDICTED: protein NRT1/ PTR FAMILY 7.3-like...    721   0.0      
ref|XP_009409943.1|  PREDICTED: protein NRT1/ PTR FAMILY 7.3-like...    718   0.0      
ref|XP_010919867.1|  PREDICTED: protein NRT1/ PTR FAMILY 7.3-like...    716   0.0      
ref|XP_003570234.1|  PREDICTED: protein NRT1/ PTR FAMILY 7.3-like       716   0.0      
ref|XP_010943514.1|  PREDICTED: protein NRT1/ PTR FAMILY 7.2 isof...    713   0.0      
gb|KCW73263.1|  hypothetical protein EUGRSUZ_E01723                     710   0.0      
ref|XP_002452648.1|  hypothetical protein SORBIDRAFT_04g029890          712   0.0      Sorghum bicolor [broomcorn]
ref|NP_001047928.1|  Os02g0716800                                       708   0.0      Oryza sativa Japonica Group [Japonica rice]
ref|XP_006647794.1|  PREDICTED: nitrate transporter 1.5-like            707   0.0      
ref|XP_004953690.1|  PREDICTED: nitrate transporter 1.5-like isof...    706   0.0      
gb|EMT20726.1|  Peptide transporter PTR1                                705   0.0      
ref|XP_008679035.1|  PREDICTED: protein NRT1/ PTR FAMILY 7.3-like...    705   0.0      
ref|XP_008679034.1|  PREDICTED: protein NRT1/ PTR FAMILY 7.2-like...    705   0.0      
ref|XP_008679033.1|  PREDICTED: protein NRT1/ PTR FAMILY 7.2-like...    705   0.0      
gb|KHN11612.1|  Nitrate transporter 1.5                                 698   0.0      
gb|AGT17043.1|  Proton-dependent oligopeptide transporter family        695   0.0      
ref|XP_009792819.1|  PREDICTED: protein NRT1/ PTR FAMILY 7.3-like...    685   0.0      
ref|XP_008646076.1|  PREDICTED: protein NRT1/ PTR FAMILY 7.2-like       685   0.0      
ref|XP_002452718.1|  hypothetical protein SORBIDRAFT_04g031320          683   0.0      Sorghum bicolor [broomcorn]
gb|EEC73893.1|  hypothetical protein OsI_08696                          676   0.0      Oryza sativa Indica Group [Indian rice]
ref|XP_004296302.1|  PREDICTED: putative peptide/nitrate transpor...    676   0.0      
ref|XP_004953503.1|  PREDICTED: nitrate transporter 1.5-like isof...    676   0.0      
ref|XP_004953502.1|  PREDICTED: nitrate transporter 1.5-like isof...    676   0.0      
ref|XP_009384121.1|  PREDICTED: protein NRT1/ PTR FAMILY 7.3-like       674   0.0      
ref|XP_009393946.1|  PREDICTED: protein NRT1/ PTR FAMILY 7.3-like...    662   0.0      
ref|XP_010046691.1|  PREDICTED: protein NRT1/ PTR FAMILY 7.1-like       665   0.0      
gb|KCW87117.1|  hypothetical protein EUGRSUZ_B03643                     664   0.0      
ref|XP_006648949.1|  PREDICTED: nitrate transporter 1.5-like            663   0.0      
ref|XP_011037917.1|  PREDICTED: protein NRT1/ PTR FAMILY 7.1-like       660   0.0      
ref|XP_006850009.1|  hypothetical protein AMTR_s00022p00178680          660   0.0      
ref|XP_007014834.1|  Major facilitator superfamily protein              661   0.0      
gb|AFK36303.1|  unknown                                                 656   0.0      
ref|XP_006603076.1|  PREDICTED: putative peptide/nitrate transpor...    659   0.0      
ref|XP_004497406.1|  PREDICTED: putative peptide/nitrate transpor...    658   0.0      
ref|XP_011025229.1|  PREDICTED: protein NRT1/ PTR FAMILY 7.1-like       658   0.0      
gb|EEC73815.1|  hypothetical protein OsI_08532                          657   0.0      Oryza sativa Indica Group [Indian rice]
ref|NP_001047787.1|  Os02g0689900                                       657   0.0      Oryza sativa Japonica Group [Japonica rice]
ref|XP_002304892.1|  hypothetical protein POPTR_0003s21800g             657   0.0      Populus trichocarpa [western balsam poplar]
gb|KHN12584.1|  Putative peptide/nitrate transporter                    655   0.0      
ref|XP_010257465.1|  PREDICTED: protein NRT1/ PTR FAMILY 7.1-like...    653   0.0      
ref|XP_010257463.1|  PREDICTED: protein NRT1/ PTR FAMILY 7.1-like...    653   0.0      
ref|XP_010046454.1|  PREDICTED: protein NRT1/ PTR FAMILY 7.1-like       653   0.0      
ref|XP_003592858.1|  Peptide transporter PTR1                           651   0.0      
ref|XP_004497408.1|  PREDICTED: putative peptide/nitrate transpor...    649   0.0      
gb|KHN24967.1|  Putative peptide/nitrate transporter                    650   0.0      
ref|XP_010265895.1|  PREDICTED: protein NRT1/ PTR FAMILY 7.1-like       651   0.0      
ref|XP_009376620.1|  PREDICTED: protein NRT1/ PTR FAMILY 7.1-like       649   0.0      
gb|KHN27133.1|  Putative peptide/nitrate transporter                    648   0.0      
ref|XP_006606590.1|  PREDICTED: putative peptide/nitrate transpor...    648   0.0      
ref|XP_003555644.2|  PREDICTED: putative peptide/nitrate transpor...    648   0.0      
ref|XP_009791514.1|  PREDICTED: protein NRT1/ PTR FAMILY 7.1            648   0.0      
ref|XP_006586602.1|  PREDICTED: putative peptide/nitrate transpor...    648   0.0      
ref|XP_010087388.1|  Putative peptide/nitrate transporter               649   0.0      
ref|XP_010235838.1|  PREDICTED: protein NRT1/ PTR FAMILY 7.2-like       647   0.0      
ref|XP_002283281.3|  PREDICTED: protein NRT1/ PTR FAMILY 7.1 isof...    644   0.0      Vitis vinifera
ref|XP_008352266.1|  PREDICTED: protein NRT1/ PTR FAMILY 7.1-like       645   0.0      
gb|EPS61277.1|  hypothetical protein M569_13519                         645   0.0      
gb|KDP30601.1|  hypothetical protein JCGZ_16932                         644   0.0      
ref|XP_010651313.1|  PREDICTED: protein NRT1/ PTR FAMILY 7.1 isof...    644   0.0      
ref|XP_004296304.1|  PREDICTED: putative peptide/nitrate transpor...    646   0.0      
ref|XP_002871897.1|  proton-dependent oligopeptide transport fami...    643   0.0      
ref|XP_007207679.1|  hypothetical protein PRUPE_ppa023462mg             643   0.0      
ref|XP_007139109.1|  hypothetical protein PHAVU_008G002100g             641   0.0      
ref|XP_008243619.1|  PREDICTED: protein NRT1/ PTR FAMILY 7.1-like       643   0.0      
ref|XP_006589795.1|  PREDICTED: putative peptide/nitrate transpor...    642   0.0      
gb|EMS68576.1|  Nitrate transporter 1.5                                 643   0.0      
ref|XP_006589794.1|  PREDICTED: putative peptide/nitrate transpor...    641   0.0      
ref|XP_009618337.1|  PREDICTED: protein NRT1/ PTR FAMILY 7.1            640   0.0      
ref|XP_011080231.1|  PREDICTED: protein NRT1/ PTR FAMILY 7.1-like       639   0.0      
emb|CDP17506.1|  unnamed protein product                                639   0.0      
ref|NP_197465.1|  putative peptide/nitrate transporter                  636   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_007139336.1|  hypothetical protein PHAVU_008G020800g             635   0.0      
emb|CAN77230.1|  hypothetical protein VITISV_005961                     634   0.0      Vitis vinifera
ref|XP_004491684.1|  PREDICTED: putative peptide/nitrate transpor...    634   0.0      
ref|XP_007142617.1|  hypothetical protein PHAVU_007G002800g             636   0.0      
ref|XP_007207539.1|  hypothetical protein PRUPE_ppa015854mg             634   0.0      
gb|EMT17042.1|  Peptide transporter PTR1                                633   0.0      
ref|XP_008243685.1|  PREDICTED: protein NRT1/ PTR FAMILY 7.1-like       632   0.0      
gb|AES77223.2|  peptide/nitrate transporter                             630   0.0      
ref|XP_006354232.1|  PREDICTED: putative peptide/nitrate transpor...    629   0.0      
ref|XP_010673538.1|  PREDICTED: protein NRT1/ PTR FAMILY 7.1            630   0.0      
ref|XP_003621005.1|  Peptide transporter PTR1                           630   0.0      
gb|ABN09773.1|  TGF-beta receptor, type I/II extracellular region       630   0.0      Medicago truncatula
ref|XP_004228926.2|  PREDICTED: protein NRT1/ PTR FAMILY 7.1            628   0.0      
ref|XP_006492658.1|  PREDICTED: putative peptide/nitrate transpor...    629   0.0      
ref|XP_010493040.1|  PREDICTED: protein NRT1/ PTR FAMILY 7.1            628   0.0      
ref|XP_010519721.1|  PREDICTED: protein NRT1/ PTR FAMILY 7.1            628   0.0      
gb|KDO56443.1|  hypothetical protein CISIN_1g039271mg                   628   0.0      
ref|XP_006445924.1|  hypothetical protein CICLE_v10018037mg             629   0.0      
ref|XP_006400525.1|  hypothetical protein EUTSA_v10015614mg             625   0.0      
ref|XP_011083321.1|  PREDICTED: protein NRT1/ PTR FAMILY 7.1-like       623   0.0      
emb|CDX92513.1|  BnaA10g15520D                                          624   0.0      
ref|XP_010420775.1|  PREDICTED: protein NRT1/ PTR FAMILY 7.1-like       624   0.0      
ref|XP_008451167.1|  PREDICTED: protein NRT1/ PTR FAMILY 7.1            624   0.0      
ref|XP_009120868.1|  PREDICTED: protein NRT1/ PTR FAMILY 7.1            623   0.0      
gb|KGN66437.1|  hypothetical protein Csa_1G605660                       622   0.0      
emb|CDY58969.1|  BnaC09g38060D                                          621   0.0      
ref|XP_006286439.1|  hypothetical protein CARUB_v10003886mg             620   0.0      
ref|XP_004149033.1|  PREDICTED: putative peptide/nitrate transpor...    622   0.0      
ref|XP_004161579.1|  PREDICTED: LOW QUALITY PROTEIN: putative pep...    621   0.0      
ref|XP_010098931.1|  Nitrate transporter 1.5                            619   0.0      
gb|EYU46323.1|  hypothetical protein MIMGU_mgv1a022341mg                617   0.0      
gb|EPS67766.1|  hypothetical protein M569_07006                         613   0.0      
ref|XP_009792173.1|  PREDICTED: protein NRT1/ PTR FAMILY 7.2-like       614   0.0      
gb|AFW72868.1|  hypothetical protein ZEAMMB73_561824                    612   0.0      
ref|XP_003621431.1|  Peptide transporter PTR1                           614   0.0      
ref|XP_009364152.1|  PREDICTED: protein NRT1/ PTR FAMILY 7.1-like       611   0.0      
ref|XP_010454248.1|  PREDICTED: protein NRT1/ PTR FAMILY 7.1-like       610   0.0      
ref|XP_010692216.1|  PREDICTED: protein NRT1/ PTR FAMILY 7.3-like       610   0.0      
ref|XP_010919864.1|  PREDICTED: protein NRT1/ PTR FAMILY 7.3-like       609   0.0      
ref|XP_007219218.1|  hypothetical protein PRUPE_ppa017670mg             609   0.0      
ref|XP_006491456.1|  PREDICTED: nitrate transporter 1.5-like            608   0.0      
ref|XP_008232637.1|  PREDICTED: protein NRT1/ PTR FAMILY 7.3-like       608   0.0      
ref|XP_010325672.1|  PREDICTED: protein NRT1/ PTR FAMILY 7.3-like       607   0.0      
ref|XP_008338492.1|  PREDICTED: protein NRT1/ PTR FAMILY 7.1-like       607   0.0      
ref|XP_006347879.1|  PREDICTED: nitrate transporter 1.5-like            603   0.0      
ref|XP_009376599.1|  PREDICTED: protein NRT1/ PTR FAMILY 7.1-like       602   0.0      
ref|XP_008352702.1|  PREDICTED: protein NRT1/ PTR FAMILY 7.1-like       602   0.0      
emb|CDO97706.1|  unnamed protein product                                600   0.0      
ref|XP_008460105.1|  PREDICTED: protein NRT1/ PTR FAMILY 7.3-like...    594   0.0      
ref|XP_008460104.1|  PREDICTED: protein NRT1/ PTR FAMILY 7.3-like...    593   0.0      
gb|KGN46251.1|  hypothetical protein Csa_6G077970                       590   0.0      
ref|XP_004506528.1|  PREDICTED: nitrate transporter 1.5-like            589   0.0      
ref|XP_009628684.1|  PREDICTED: protein NRT1/ PTR FAMILY 7.2-like       587   0.0      
gb|EYU44105.1|  hypothetical protein MIMGU_mgv1a006704mg                576   0.0      
emb|CBI16454.3|  unnamed protein product                                580   0.0      
ref|XP_007052096.1|  Nitrate transporter 1.5                            583   0.0      
ref|XP_011094557.1|  PREDICTED: protein NRT1/ PTR FAMILY 7.3-like       578   0.0      
ref|XP_004308457.1|  PREDICTED: nitrate transporter 1.5-like            577   0.0      
ref|XP_004966956.1|  PREDICTED: nitrate transporter 1.5-like            574   0.0      
ref|XP_006445280.1|  hypothetical protein CICLE_v10024592mg             572   0.0      
gb|EYU31977.1|  hypothetical protein MIMGU_mgv1a019257mg                569   0.0      
gb|KDO85793.1|  hypothetical protein CISIN_1g035554mg                   557   0.0      
ref|XP_010096008.1|  Nitrate transporter 1.5                            557   0.0      
ref|XP_006853963.1|  hypothetical protein AMTR_s00036p00217430          546   0.0      
ref|XP_003605166.1|  Peptide transporter                                542   4e-180   
ref|XP_002528132.1|  Peptide transporter, putative                      522   3e-174   
dbj|BAK07083.1|  predicted protein                                      521   4e-172   
ref|XP_004506506.1|  PREDICTED: nitrate transporter 1.5-like            511   1e-168   
ref|XP_002436958.1|  hypothetical protein SORBIDRAFT_10g012270          510   3e-168   
ref|XP_002965429.1|  hypothetical protein SELMODRAFT_84173              509   1e-167   
ref|XP_002994164.1|  hypothetical protein SELMODRAFT_138285             508   3e-167   
dbj|BAD61865.1|  putative peptide transporter                           504   2e-165   
gb|EEC80506.1|  hypothetical protein OsI_22764                          505   3e-165   
ref|XP_002459620.1|  hypothetical protein SORBIDRAFT_02g007605          498   7e-163   
gb|EPS65056.1|  hypothetical protein M569_09720                         493   3e-162   
ref|XP_002299155.2|  hypothetical protein POPTR_0001s05090g             488   2e-161   
emb|CDY72659.1|  BnaCnng78690D                                          479   8e-159   
ref|XP_007222295.1|  hypothetical protein PRUPE_ppa003339mg             486   1e-158   
ref|XP_010246838.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.3-like       483   1e-157   
ref|XP_002521890.1|  peptide transporter, putative                      483   2e-157   
ref|XP_001774221.1|  predicted protein                                  483   2e-157   
ref|XP_008651039.1|  PREDICTED: uncharacterized protein LOC100272...    483   5e-157   
gb|ABK24723.1|  unknown                                                 481   6e-157   
ref|XP_006346628.1|  PREDICTED: peptide transporter PTR2-like           481   8e-157   
ref|XP_009779291.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.1-like       480   1e-156   
ref|XP_010923125.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.1-like       479   4e-156   
ref|NP_001131161.1|  uncharacterized protein LOC100192469               478   9e-156   
ref|XP_004252286.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.3-like...    478   1e-155   
ref|XP_009591017.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.1-like       478   1e-155   
gb|EMT26772.1|  Peptide transporter PTR1                                486   2e-155   
ref|XP_001774033.1|  predicted protein                                  477   2e-155   
ref|XP_007045395.1|  Peptide transporter 2 isoform 1                    477   2e-155   
ref|XP_002315835.1|  Peptide transporter PTR2-B family protein          477   3e-155   
ref|XP_007158832.1|  hypothetical protein PHAVU_002G185700g             476   5e-155   
gb|ABR32183.1|  peptide transporter                                     476   6e-155   
ref|XP_009405847.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.1-like       476   8e-155   
ref|XP_009419340.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.3-like       476   9e-155   
gb|EYU30228.1|  hypothetical protein MIMGU_mgv1a003438mg                475   1e-154   
ref|XP_008785424.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.1-like       474   2e-154   
ref|XP_004241180.2|  PREDICTED: protein NRT1/ PTR FAMILY 8.1-like       477   2e-154   
ref|XP_010276263.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.3-like       474   3e-154   
gb|KDP38200.1|  hypothetical protein JCGZ_04843                         474   3e-154   
ref|XP_009421313.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.1-like       474   3e-154   
ref|XP_011070505.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.3-like       474   3e-154   
ref|XP_003524837.1|  PREDICTED: peptide transporter PTR2-like           474   4e-154   
ref|XP_003531124.1|  PREDICTED: peptide transporter PTR2-like           474   4e-154   
gb|AIL30501.1|  oligopeptide transporter 1                              474   5e-154   
ref|XP_006365835.1|  PREDICTED: peptide transporter PTR2-like           473   6e-154   
ref|XP_009591011.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.3-like       473   8e-154   
ref|XP_009803584.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.3-like...    473   1e-153   
ref|XP_009351619.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.3-like       473   1e-153   
ref|XP_008389126.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.3-like       473   1e-153   
ref|XP_008798043.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.3-like       473   2e-153   
ref|XP_004297798.1|  PREDICTED: peptide transporter PTR2-like           471   5e-153   
ref|XP_001765362.1|  predicted protein                                  472   6e-153   
ref|XP_011021701.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.3-like       469   2e-152   
ref|XP_006849517.1|  hypothetical protein AMTR_s00024p00147790          469   5e-152   
ref|XP_010907628.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.1-like       469   6e-152   
ref|XP_004968169.1|  PREDICTED: peptide transporter PTR1-like iso...    468   6e-152   
ref|XP_006350821.1|  PREDICTED: peptide transporter PTR1-like           468   7e-152   
ref|XP_002992575.1|  hypothetical protein SELMODRAFT_135536             468   9e-152   
ref|XP_003599760.1|  Peptide transporter PTR2                           488   1e-151   
ref|NP_001051098.1|  Os03g0719900                                       468   1e-151   
ref|NP_190982.1|  peptide transporter PTR1                              467   2e-151   
ref|XP_010937011.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.3-like       467   2e-151   
gb|EEE59822.1|  hypothetical protein OsJ_12376                          467   2e-151   
ref|XP_010939960.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.3-like       467   2e-151   
ref|XP_003605102.1|  Peptide transporter PTR2                           488   3e-151   
ref|XP_006492274.1|  PREDICTED: peptide transporter PTR2-like           466   4e-151   
ref|XP_006448044.1|  hypothetical protein CICLE_v10014643mg             467   4e-151   
ref|XP_002966337.1|  hypothetical protein SELMODRAFT_439656             466   5e-151   
ref|XP_002972518.1|  hypothetical protein SELMODRAFT_97812              465   6e-151   
ref|NP_001041994.1|  Os01g0142800                                       465   7e-151   
dbj|BAG91734.1|  unnamed protein product                                465   7e-151   
ref|XP_008466783.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.3 isof...    465   9e-151   
dbj|BAJ85008.1|  predicted protein                                      465   1e-150   
ref|XP_008466778.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.3 isof...    465   1e-150   
ref|XP_008775060.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.1-like       464   1e-150   
ref|XP_001769410.1|  predicted protein                                  464   2e-150   
ref|NP_001233998.1|  oligopeptide transporter 1                         464   3e-150   
ref|XP_010043898.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.3            464   3e-150   
ref|XP_009624729.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.2-like       464   3e-150   
gb|KDP38199.1|  hypothetical protein JCGZ_04842                         464   3e-150   
ref|XP_002877959.1|  proton-dependent oligopeptide transport fami...    463   4e-150   
ref|XP_008787880.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.3-like       464   4e-150   
emb|CDP09151.1|  unnamed protein product                                463   5e-150   
ref|XP_002978223.1|  hypothetical protein SELMODRAFT_417946             464   6e-150   
ref|XP_003568460.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.2-like       463   7e-150   
ref|XP_004149470.1|  PREDICTED: peptide transporter PTR2-like           463   8e-150   
gb|KHG08248.1|  Peptide transporter PTR1 -like protein                  462   9e-150   
ref|XP_010427083.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.1            462   1e-149   
ref|XP_010515930.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.1-like       462   1e-149   
ref|XP_006292488.1|  hypothetical protein CARUB_v10018717mg             462   1e-149   
ref|XP_003551296.1|  PREDICTED: peptide transporter PTR1                461   2e-149   
ref|XP_006650508.1|  PREDICTED: peptide transporter PTR2-like           462   2e-149   
ref|XP_004981956.1|  PREDICTED: peptide transporter PTR2-like           462   2e-149   
ref|XP_006403613.1|  hypothetical protein EUTSA_v10010246mg             461   2e-149   
ref|XP_010504206.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.1-like       461   3e-149   
ref|XP_009139262.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.1            461   3e-149   
ref|XP_010066525.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.3-like       461   5e-149   
ref|XP_006346629.1|  PREDICTED: peptide transporter PTR2-like           461   6e-149   
ref|XP_010033028.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.1-like       460   6e-149   
emb|CDP05420.1|  unnamed protein product                                462   7e-149   
ref|XP_004504618.1|  PREDICTED: peptide transporter PTR2-like           460   7e-149   
ref|XP_007026785.1|  Peptide transporter 1 isoform 1                    459   1e-148   
ref|XP_002992551.1|  hypothetical protein SELMODRAFT_448814             460   1e-148   
ref|XP_010680056.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.3-like       460   1e-148   
ref|XP_010276258.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.3-like...    460   1e-148   
ref|XP_002285274.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.3-like       460   1e-148   
gb|AES87363.2|  peptide/nitrate transporter                             459   1e-148   
dbj|BAJ95092.1|  predicted protein                                      459   1e-148   
ref|XP_006425015.1|  hypothetical protein CICLE_v10028095mg             459   2e-148   
ref|XP_010528782.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.1            458   3e-148   
ref|XP_006848110.1|  hypothetical protein AMTR_s00029p00215100          459   3e-148   
gb|KDP46546.1|  hypothetical protein JCGZ_08518                         458   4e-148   
ref|XP_002981774.1|  hypothetical protein SELMODRAFT_115215             458   5e-148   
gb|AFN53657.1|  putative peptide transporter                            457   5e-148   
ref|XP_008665380.1|  PREDICTED: hypothetical protein isoform X1         458   5e-148   
dbj|BAJ97409.1|  predicted protein                                      458   7e-148   
ref|XP_010937012.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.3-like       457   8e-148   
gb|KHG06441.1|  Peptide transporter PTR2 -like protein                  457   9e-148   
ref|XP_002520427.1|  peptide transporter, putative                      457   1e-147   
ref|XP_010105518.1|  Peptide transporter                                473   1e-147   
ref|XP_009405229.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.1-like       457   2e-147   
gb|EMS66305.1|  Peptide transporter PTR2                                464   2e-147   
ref|XP_010680055.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.3-like       457   2e-147   
ref|XP_006591201.1|  PREDICTED: peptide transporter PTR1-like iso...    456   2e-147   
gb|KHN02576.1|  Peptide transporter PTR1                                456   2e-147   
emb|CDY13185.1|  BnaC04g26500D                                          455   3e-147   
ref|XP_004500227.1|  PREDICTED: peptide transporter PTR5-like iso...    456   3e-147   
gb|KDP46548.1|  hypothetical protein JCGZ_08520                         456   3e-147   
ref|XP_002972318.1|  hypothetical protein SELMODRAFT_441824             456   4e-147   
ref|XP_009795638.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.1-like       456   5e-147   
ref|XP_009116102.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.1            455   6e-147   
ref|XP_010105516.1|  Peptide transporter                                455   8e-147   
gb|EMS68423.1|  Peptide transporter PTR2                                455   1e-146   
ref|XP_002962950.1|  hypothetical protein SELMODRAFT_165561             454   1e-146   
gb|KEH34179.1|  proton-dependent oligopeptide transport family pr...    454   1e-146   
ref|XP_009392698.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.1-like       454   1e-146   
gb|ACG41138.1|  peptide transporter PTR2                                455   1e-146   
gb|KHG27963.1|  Peptide transporter PTR2 -like protein                  454   1e-146   
ref|XP_002992553.1|  hypothetical protein SELMODRAFT_135522             454   1e-146   
ref|XP_007016184.1|  Peptide transporter 1                              454   2e-146   
ref|XP_002972320.1|  hypothetical protein SELMODRAFT_97239              454   2e-146   
gb|ACL52627.1|  unknown                                                 454   2e-146   
ref|XP_008798073.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.3            454   2e-146   
ref|XP_006643742.1|  PREDICTED: peptide transporter PTR1-like           454   2e-146   
ref|XP_010650937.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.1-like...    453   2e-146   
ref|XP_010650936.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.1-like...    454   2e-146   
ref|NP_001146682.1|  hypothetical protein                               454   2e-146   
ref|XP_006649696.1|  PREDICTED: peptide transporter PTR2-like           454   3e-146   
gb|EPS69660.1|  hypothetical protein M569_05105                         453   4e-146   
ref|XP_007146742.1|  hypothetical protein PHAVU_006G065900g             453   4e-146   
ref|XP_002962329.1|  hypothetical protein SELMODRAFT_78769              453   4e-146   
ref|XP_010262765.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.1-like       452   5e-146   
gb|EAY89168.1|  hypothetical protein OsI_10664                          453   5e-146   
gb|ACN26865.1|  unknown                                                 451   7e-146   
ref|XP_009374278.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.2-like       452   7e-146   
ref|XP_003531411.1|  PREDICTED: peptide transporter PTR2-like           452   7e-146   
ref|XP_011003660.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.1-like...    452   1e-145   
ref|XP_010654192.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.1-like       452   1e-145   
ref|XP_002463972.1|  hypothetical protein SORBIDRAFT_01g009890          452   2e-145   
ref|XP_010228918.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.3-like...    451   2e-145   
ref|XP_006395818.1|  hypothetical protein EUTSA_v10003893mg             451   2e-145   
ref|XP_003558415.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.3-like...    451   2e-145   
dbj|BAJ95903.1|  predicted protein                                      451   2e-145   
ref|XP_002875108.1|  ATPTR2-B                                           451   3e-145   
ref|XP_010228917.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.3-like...    451   3e-145   
gb|EYU45753.1|  hypothetical protein MIMGU_mgv1a003661mg                451   3e-145   
gb|KFK33424.1|  hypothetical protein AALP_AA5G011300                    451   4e-145   
ref|XP_002463973.1|  hypothetical protein SORBIDRAFT_01g009900          451   4e-145   
ref|XP_002309120.2|  proton-dependent oligopeptide transport fami...    450   4e-145   
ref|XP_009337310.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.2-like       450   6e-145   
ref|XP_011003661.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.1-like...    449   8e-145   
ref|NP_178313.1|  peptide transporter PTR2                              450   9e-145   
ref|XP_004985075.1|  PREDICTED: peptide transporter PTR2-like iso...    450   1e-144   
ref|XP_004492413.1|  PREDICTED: peptide transporter PTR1-like iso...    449   1e-144   
ref|XP_002323559.2|  proton-dependent oligopeptide transport fami...    449   1e-144   
gb|ABF94833.1|  Peptide transporter PTR2, putative, expressed           450   1e-144   
ref|XP_010680054.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.3-like       449   1e-144   
ref|XP_002298324.1|  hypothetical protein POPTR_0001s25570g             449   1e-144   
ref|XP_008355414.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.2-like       449   2e-144   
ref|XP_010033021.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.1-like       449   2e-144   
ref|XP_011077583.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.1-like       449   2e-144   
gb|KDP24486.1|  hypothetical protein JCGZ_25050                         448   2e-144   
ref|XP_006848107.1|  hypothetical protein AMTR_s00029p00214340          448   2e-144   
ref|XP_006363053.1|  PREDICTED: peptide transporter PTR1-like           448   2e-144   
ref|XP_007208292.1|  hypothetical protein PRUPE_ppa003364mg             448   3e-144   
gb|EMS46611.1|  Peptide transporter PTR5                                449   5e-144   
ref|XP_008220400.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.2-like       447   6e-144   
ref|XP_002967570.1|  hypothetical protein SELMODRAFT_231062             446   7e-144   
ref|XP_009346886.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.2-like...    447   7e-144   
ref|XP_011019153.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.1            446   1e-143   
ref|XP_004972110.1|  PREDICTED: peptide transporter PTR1-like           447   1e-143   
gb|AAC32034.1|  peptide transporter                                     446   2e-143   
gb|EYU41841.1|  hypothetical protein MIMGU_mgv1a017650mg                446   2e-143   
ref|XP_008355088.1|  PREDICTED: LOW QUALITY PROTEIN: protein NRT1...    446   2e-143   
ref|XP_010044085.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.1            445   3e-143   
ref|XP_002991341.1|  hypothetical protein SELMODRAFT_429656             446   3e-143   
ref|XP_010554363.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.3 isof...    446   4e-143   
emb|CBI33896.3|  unnamed protein product                                439   4e-143   
ref|XP_010513957.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.3            446   4e-143   
ref|XP_010424976.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.3-like       446   4e-143   
ref|XP_009346885.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.2-like...    446   4e-143   
ref|XP_009405084.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.3-like       445   5e-143   
ref|XP_010554364.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.3 isof...    445   6e-143   
emb|CDY03084.1|  BnaC07g21430D                                          445   7e-143   
ref|XP_009148842.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.3-like       444   7e-143   
ref|XP_010230764.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.3-like       456   7e-143   
ref|XP_009114212.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.3            445   7e-143   



>ref|XP_009802257.1| PREDICTED: protein NRT1/ PTR FAMILY 7.3 isoform X3 [Nicotiana 
sylvestris]
Length=599

 Score =   895 bits (2313),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 466/596 (78%), Positives = 516/596 (87%), Gaps = 19/596 (3%)
 Frame = -3

Query  2136  FLNITKMFFIKNERDEEKA-SREECTLDGTVDHYGRPALRSATGGWFAGVLLLVNQGLAT  1960
             FLNI K+   + +R+E+   S EE TLDGTVD +GRPA+R+ TG WFAGVLLLVNQGLAT
Sbjct  3     FLNIDKL---QGQREEKLGNSEEELTLDGTVDKHGRPAVRATTGRWFAGVLLLVNQGLAT  59

Query  1959  LAFFGVGVNLVLFLTRVMGQDNADAANNVSKWTGTVYLFSLLGAFLSDSYWGRYKTCAIF  1780
             LAFFGVGVNLVLFLTRVMGQDNA+AANNVSKWTGTVY+FSLLGAFLSDSYWGRYKTCAIF
Sbjct  60    LAFFGVGVNLVLFLTRVMGQDNAEAANNVSKWTGTVYIFSLLGAFLSDSYWGRYKTCAIF  119

Query  1779  QLIYVVGLISVSIFSFIFLVKPKGCGDENTPCRSPSRIHIAVYYVSIYLVALGNGGYQPN  1600
             Q I+V GL+S+S+ S+IFL+KP GCGDE  PCRS S +HI ++Y+SIYL+ALGNGGYQP 
Sbjct  120   QAIFVAGLVSLSLTSYIFLIKPNGCGDEKMPCRSHSTVHIVLFYMSIYLIALGNGGYQPT  179

Query  1599  IATFGSDQFDGDHAHESVSKVAFFSYFYLALNLGSLFSNTVLVYFEDKGMWTLGFWastv  1420
             IATFG+DQFD DH  ES SKV+FFSYFYLALNLGSLFSNT+LVY EDKGMWTLGFWAS  
Sbjct  180   IATFGADQFDEDHPQESHSKVSFFSYFYLALNLGSLFSNTILVYVEDKGMWTLGFWASAC  239

Query  1419  savlalllflVGTPRYRHFAPKGNPLSRFSQVLVASARKWNVHLPSDGDDHRLYEIQEH-  1243
             SA+LAL+LFL+GTPRYRH  P GNP+SRF QVLVA+ RKW +  PS+G  + LYE     
Sbjct  240   SAILALVLFLIGTPRYRHRKPTGNPISRFCQVLVAAIRKWKIEQPSNG--YELYEGDGRD  297

Query  1242  --DSSTRKILHTEGFKFLDKAAVITTKESVRDLEERNINPWRLCSVTQVEEVKCILRLLP  1069
               D+ +R ILHT+ FKFL+KAA+IT+K       ER  NPWRLC VTQVEEVKCILRL P
Sbjct  298   LADNGSRNILHTKEFKFLNKAAIITSK-------ERFDNPWRLCPVTQVEEVKCILRLFP  350

Query  1068  IWLCTILYSVVFTQMASLFVEQGAAMRTNIAGFHIPPASMSSFDILSVAAFIFIYRRILD  889
             IWLCTILYSVVFTQMASLFVEQG AM+T ++ FHIPPASMSSFDILSVAAFIFIYRR+LD
Sbjct  351   IWLCTILYSVVFTQMASLFVEQGDAMKTTVSRFHIPPASMSSFDILSVAAFIFIYRRVLD  410

Query  888   PLIASLKKTRRAQGFTELQRMGVGLiiaimamvaagiVEHFRLKYASTDCPRC--PSSLS  715
             P +ASLKK+ + +G TELQRMGVGLIIAIMAMVAAGIVEHFRLKYAS DC  C   SSLS
Sbjct  411   PFVASLKKSSQ-RGLTELQRMGVGLIIAIMAMVAAGIVEHFRLKYASIDCSHCTNSSSLS  469

Query  714   IFWQVPQYVLIGASEVFMYVGQLEFFNGQAPEGLKSFASALCMTSISLGNYVSSLLVSIV  535
             I WQVPQYVLIGASEVFMYVGQLEFFNGQAP+GLKSF SALCMTSISLGNYVSSLLVSIV
Sbjct  470   ILWQVPQYVLIGASEVFMYVGQLEFFNGQAPDGLKSFGSALCMTSISLGNYVSSLLVSIV  529

Query  534   MRISTTHRMPGWIPGNLNKGHLDRFYFLLAALTTADFVVYILCAKWYKYIEFEERN  367
             MRISTT  MPGWIPGNLNKGHLDRFYFLLAALT ADF+VY+LCAKWYKYIEFEER+
Sbjct  530   MRISTTDNMPGWIPGNLNKGHLDRFYFLLAALTAADFLVYLLCAKWYKYIEFEERS  585



>ref|XP_009802258.1| PREDICTED: protein NRT1/ PTR FAMILY 7.3 isoform X4 [Nicotiana 
sylvestris]
Length=598

 Score =   894 bits (2309),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 466/596 (78%), Positives = 515/596 (86%), Gaps = 20/596 (3%)
 Frame = -3

Query  2136  FLNITKMFFIKNERDEEKA-SREECTLDGTVDHYGRPALRSATGGWFAGVLLLVNQGLAT  1960
             FLNI K+     +R+E+   S EE TLDGTVD +GRPA+R+ TG WFAGVLLLVNQGLAT
Sbjct  3     FLNIDKL----GQREEKLGNSEEELTLDGTVDKHGRPAVRATTGRWFAGVLLLVNQGLAT  58

Query  1959  LAFFGVGVNLVLFLTRVMGQDNADAANNVSKWTGTVYLFSLLGAFLSDSYWGRYKTCAIF  1780
             LAFFGVGVNLVLFLTRVMGQDNA+AANNVSKWTGTVY+FSLLGAFLSDSYWGRYKTCAIF
Sbjct  59    LAFFGVGVNLVLFLTRVMGQDNAEAANNVSKWTGTVYIFSLLGAFLSDSYWGRYKTCAIF  118

Query  1779  QLIYVVGLISVSIFSFIFLVKPKGCGDENTPCRSPSRIHIAVYYVSIYLVALGNGGYQPN  1600
             Q I+V GL+S+S+ S+IFL+KP GCGDE  PCRS S +HI ++Y+SIYL+ALGNGGYQP 
Sbjct  119   QAIFVAGLVSLSLTSYIFLIKPNGCGDEKMPCRSHSTVHIVLFYMSIYLIALGNGGYQPT  178

Query  1599  IATFGSDQFDGDHAHESVSKVAFFSYFYLALNLGSLFSNTVLVYFEDKGMWTLGFWastv  1420
             IATFG+DQFD DH  ES SKV+FFSYFYLALNLGSLFSNT+LVY EDKGMWTLGFWAS  
Sbjct  179   IATFGADQFDEDHPQESHSKVSFFSYFYLALNLGSLFSNTILVYVEDKGMWTLGFWASAC  238

Query  1419  savlalllflVGTPRYRHFAPKGNPLSRFSQVLVASARKWNVHLPSDGDDHRLYEIQEH-  1243
             SA+LAL+LFL+GTPRYRH  P GNP+SRF QVLVA+ RKW +  PS+G  + LYE     
Sbjct  239   SAILALVLFLIGTPRYRHRKPTGNPISRFCQVLVAAIRKWKIEQPSNG--YELYEGDGRD  296

Query  1242  --DSSTRKILHTEGFKFLDKAAVITTKESVRDLEERNINPWRLCSVTQVEEVKCILRLLP  1069
               D+ +R ILHT+ FKFL+KAA+IT+K       ER  NPWRLC VTQVEEVKCILRL P
Sbjct  297   LADNGSRNILHTKEFKFLNKAAIITSK-------ERFDNPWRLCPVTQVEEVKCILRLFP  349

Query  1068  IWLCTILYSVVFTQMASLFVEQGAAMRTNIAGFHIPPASMSSFDILSVAAFIFIYRRILD  889
             IWLCTILYSVVFTQMASLFVEQG AM+T ++ FHIPPASMSSFDILSVAAFIFIYRR+LD
Sbjct  350   IWLCTILYSVVFTQMASLFVEQGDAMKTTVSRFHIPPASMSSFDILSVAAFIFIYRRVLD  409

Query  888   PLIASLKKTRRAQGFTELQRMGVGLiiaimamvaagiVEHFRLKYASTDCPRC--PSSLS  715
             P +ASLKK+ + +G TELQRMGVGLIIAIMAMVAAGIVEHFRLKYAS DC  C   SSLS
Sbjct  410   PFVASLKKSSQ-RGLTELQRMGVGLIIAIMAMVAAGIVEHFRLKYASIDCSHCTNSSSLS  468

Query  714   IFWQVPQYVLIGASEVFMYVGQLEFFNGQAPEGLKSFASALCMTSISLGNYVSSLLVSIV  535
             I WQVPQYVLIGASEVFMYVGQLEFFNGQAP+GLKSF SALCMTSISLGNYVSSLLVSIV
Sbjct  469   ILWQVPQYVLIGASEVFMYVGQLEFFNGQAPDGLKSFGSALCMTSISLGNYVSSLLVSIV  528

Query  534   MRISTTHRMPGWIPGNLNKGHLDRFYFLLAALTTADFVVYILCAKWYKYIEFEERN  367
             MRISTT  MPGWIPGNLNKGHLDRFYFLLAALT ADF+VY+LCAKWYKYIEFEER+
Sbjct  529   MRISTTDNMPGWIPGNLNKGHLDRFYFLLAALTAADFLVYLLCAKWYKYIEFEERS  584



>ref|XP_009802255.1| PREDICTED: protein NRT1/ PTR FAMILY 7.3 isoform X1 [Nicotiana 
sylvestris]
Length=594

 Score =   891 bits (2302),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 462/590 (78%), Positives = 512/590 (87%), Gaps = 16/590 (3%)
 Frame = -3

Query  2118  MFFIKNERDEEKA-SREECTLDGTVDHYGRPALRSATGGWFAGVLLLVNQGLATLAFFGV  1942
             M  ++ +R+E+   S EE TLDGTVD +GRPA+R+ TG WFAGVLLLVNQGLATLAFFGV
Sbjct  1     MNILQGQREEKLGNSEEELTLDGTVDKHGRPAVRATTGRWFAGVLLLVNQGLATLAFFGV  60

Query  1941  GVNLVLFLTRVMGQDNADAANNVSKWTGTVYLFSLLGAFLSDSYWGRYKTCAIFQLIYVV  1762
             GVNLVLFLTRVMGQDNA+AANNVSKWTGTVY+FSLLGAFLSDSYWGRYKTCAIFQ I+V 
Sbjct  61    GVNLVLFLTRVMGQDNAEAANNVSKWTGTVYIFSLLGAFLSDSYWGRYKTCAIFQAIFVA  120

Query  1761  GLISVSIFSFIFLVKPKGCGDENTPCRSPSRIHIAVYYVSIYLVALGNGGYQPNIATFGS  1582
             GL+S+S+ S+IFL+KP GCGDE  PCRS S +HI ++Y+SIYL+ALGNGGYQP IATFG+
Sbjct  121   GLVSLSLTSYIFLIKPNGCGDEKMPCRSHSTVHIVLFYMSIYLIALGNGGYQPTIATFGA  180

Query  1581  DQFDGDHAHESVSKVAFFSYFYLALNLGSLFSNTVLVYFEDKGMWTLGFWastvsavlal  1402
             DQFD DH  ES SKV+FFSYFYLALNLGSLFSNT+LVY EDKGMWTLGFWAS  SA+LAL
Sbjct  181   DQFDEDHPQESHSKVSFFSYFYLALNLGSLFSNTILVYVEDKGMWTLGFWASACSAILAL  240

Query  1401  llflVGTPRYRHFAPKGNPLSRFSQVLVASARKWNVHLPSDGDDHRLYEIQEH---DSST  1231
             +LFL+GTPRYRH  P GNP+SRF QVLVA+ RKW +  PS+G  + LYE       D+ +
Sbjct  241   VLFLIGTPRYRHRKPTGNPISRFCQVLVAAIRKWKIEQPSNG--YELYEGDGRDLADNGS  298

Query  1230  RKILHTEGFKFLDKAAVITTKESVRDLEERNINPWRLCSVTQVEEVKCILRLLPIWLCTI  1051
             R ILHT+ FKFL+KAA+IT+K       ER  NPWRLC VTQVEEVKCILRL PIWLCTI
Sbjct  299   RNILHTKEFKFLNKAAIITSK-------ERFDNPWRLCPVTQVEEVKCILRLFPIWLCTI  351

Query  1050  LYSVVFTQMASLFVEQGAAMRTNIAGFHIPPASMSSFDILSVAAFIFIYRRILDPLIASL  871
             LYSVVFTQMASLFVEQG AM+T ++ FHIPPASMSSFDILSVAAFIFIYRR+LDP +ASL
Sbjct  352   LYSVVFTQMASLFVEQGDAMKTTVSRFHIPPASMSSFDILSVAAFIFIYRRVLDPFVASL  411

Query  870   KKTRRAQGFTELQRMGVGLiiaimamvaagiVEHFRLKYASTDCPRC--PSSLSIFWQVP  697
             KK+ + +G TELQRMGVGLIIAIMAMVAAGIVEHFRLKYAS DC  C   SSLSI WQVP
Sbjct  412   KKSSQ-RGLTELQRMGVGLIIAIMAMVAAGIVEHFRLKYASIDCSHCTNSSSLSILWQVP  470

Query  696   QYVLIGASEVFMYVGQLEFFNGQAPEGLKSFASALCMTSISLGNYVSSLLVSIVMRISTT  517
             QYVLIGASEVFMYVGQLEFFNGQAP+GLKSF SALCMTSISLGNYVSSLLVSIVMRISTT
Sbjct  471   QYVLIGASEVFMYVGQLEFFNGQAPDGLKSFGSALCMTSISLGNYVSSLLVSIVMRISTT  530

Query  516   HRMPGWIPGNLNKGHLDRFYFLLAALTTADFVVYILCAKWYKYIEFEERN  367
               MPGWIPGNLNKGHLDRFYFLLAALT ADF+VY+LCAKWYKYIEFEER+
Sbjct  531   DNMPGWIPGNLNKGHLDRFYFLLAALTAADFLVYLLCAKWYKYIEFEERS  580



>ref|XP_006354610.1| PREDICTED: nitrate transporter 1.5-like [Solanum tuberosum]
Length=596

 Score =   891 bits (2302),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 464/597 (78%), Positives = 518/597 (87%), Gaps = 24/597 (4%)
 Frame = -3

Query  2133  LNITKMFFIKNERDEEKAS--REECTLDGTVDHYGRPALRSATGGWFAGVLLLVNQGLAT  1960
             LNI KM       DE+  +   EE TLDGTVD +GRPA+R+ TG WFAGVLLLVNQGLAT
Sbjct  4     LNIGKM-------DEKLGNIPHEEFTLDGTVDQHGRPAVRATTGKWFAGVLLLVNQGLAT  56

Query  1959  LAFFGVGVNLVLFLTRVMGQDNADAANNVSKWTGTVYLFSLLGAFLSDSYWGRYKTCAIF  1780
             LAFFGVGVNLVLFLTRVMGQDNA+AANNVSKWTGTVY+FSLLGAFLSDSYWGRYKTCAIF
Sbjct  57    LAFFGVGVNLVLFLTRVMGQDNAEAANNVSKWTGTVYIFSLLGAFLSDSYWGRYKTCAIF  116

Query  1779  QLIYVVGLISVSIFSFIFLVKPKGCGDENTPCRSPSRIHIAVYYVSIYLVALGNGGYQPN  1600
             Q I+V GL+ +S+ S+IFL+KP GCGDE TPC SPS +H  ++YVSIYL+ALGNGGYQP 
Sbjct  117   QAIFVAGLVLLSLCSYIFLIKPNGCGDEETPCGSPSSLHTMLFYVSIYLIALGNGGYQPT  176

Query  1599  IATFGSDQFDGDHAHESVSKVAFFSYFYLALNLGSLFSNTVLVYFEDKGMWTLGFWastv  1420
             IATFGSDQFD DH  ES SK++FFSYFYLALNLGSLFSNT+LVYFEDKGMWTLGFWAS  
Sbjct  177   IATFGSDQFDEDHPQESHSKLSFFSYFYLALNLGSLFSNTILVYFEDKGMWTLGFWASAG  236

Query  1419  savlalllflVGTPRYRHFAPKGNPLSRFSQVLVASARKWNVHLPSDGDDHRLYE---IQ  1249
             SA+LAL+LFLVGTP YRHF P GNP+SRF QV+VA+ RKW +  PS+GD+  LYE    +
Sbjct  237   SAILALVLFLVGTPWYRHFKPTGNPISRFCQVVVAAIRKWKIEQPSNGDE--LYEGDGRE  294

Query  1248  EHDSSTRKILHTEGFKFLDKAAVITTKESVRDLEERNINPWRLCSVTQVEEVKCILRLLP  1069
               D+S+R ILHT+ F+FLDKAA+IT+K       ER  NPWRLC VTQVEEVKCILRL P
Sbjct  295   LADNSSRNILHTKEFRFLDKAAIITSK-------ERLDNPWRLCPVTQVEEVKCILRLFP  347

Query  1068  IWLCTILYSVVFTQMASLFVEQGAAMRTNIAGFHIPPASMSSFDILSVAAFIFIYRRILD  889
             IWLCTILYSVVFTQMASLFVEQG AM+T ++GFHIPPASMSSFDILSVAAFIFIYRR+LD
Sbjct  348   IWLCTILYSVVFTQMASLFVEQGDAMKTMVSGFHIPPASMSSFDILSVAAFIFIYRRVLD  407

Query  888   PLIASLKKTRRAQGFTELQRMGVGLiiaimamvaagiVEHFRLKYASTDCPRC--PSSLS  715
             PL+ASLKK+   +G TELQRMGVGLIIA+MAM+AAGIVEHFRLKYA+ DC +C   SSLS
Sbjct  408   PLVASLKKS-SPRGLTELQRMGVGLIIAVMAMLAAGIVEHFRLKYANKDCSQCTNSSSLS  466

Query  714   IFWQVPQYVLIGASEVFMYVGQLEFFNGQAPEGLKSFASALCMTSISLGNYVSSLLVSIV  535
             IFWQVPQYVLIGASEVFMYVGQLEFFNGQ P+GLKSF SALCMTSISLGNYVSSLLVSIV
Sbjct  467   IFWQVPQYVLIGASEVFMYVGQLEFFNGQTPDGLKSFGSALCMTSISLGNYVSSLLVSIV  526

Query  534   MRISTTHRMPGWIPGNLNKGHLDRFYFLLAALTTADFVVYILCAKWYKYIEFEERNS  364
             ++IST  +MPGWIPGNLNKGHLDRFYFLLAALT ADFVVY++CAKWYKYIEFE+R+S
Sbjct  527   IKISTNDKMPGWIPGNLNKGHLDRFYFLLAALTIADFVVYLICAKWYKYIEFEQRSS  583



>ref|XP_009802256.1| PREDICTED: protein NRT1/ PTR FAMILY 7.3 isoform X2 [Nicotiana 
sylvestris]
Length=593

 Score =   889 bits (2298),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 462/587 (79%), Positives = 510/587 (87%), Gaps = 16/587 (3%)
 Frame = -3

Query  2109  IKNERDEEKA-SREECTLDGTVDHYGRPALRSATGGWFAGVLLLVNQGLATLAFFGVGVN  1933
             I  +R+E+   S EE TLDGTVD +GRPA+R+ TG WFAGVLLLVNQGLATLAFFGVGVN
Sbjct  3     ILGQREEKLGNSEEELTLDGTVDKHGRPAVRATTGRWFAGVLLLVNQGLATLAFFGVGVN  62

Query  1932  LVLFLTRVMGQDNADAANNVSKWTGTVYLFSLLGAFLSDSYWGRYKTCAIFQLIYVVGLI  1753
             LVLFLTRVMGQDNA+AANNVSKWTGTVY+FSLLGAFLSDSYWGRYKTCAIFQ I+V GL+
Sbjct  63    LVLFLTRVMGQDNAEAANNVSKWTGTVYIFSLLGAFLSDSYWGRYKTCAIFQAIFVAGLV  122

Query  1752  SVSIFSFIFLVKPKGCGDENTPCRSPSRIHIAVYYVSIYLVALGNGGYQPNIATFGSDQF  1573
             S+S+ S+IFL+KP GCGDE  PCRS S +HI ++Y+SIYL+ALGNGGYQP IATFG+DQF
Sbjct  123   SLSLTSYIFLIKPNGCGDEKMPCRSHSTVHIVLFYMSIYLIALGNGGYQPTIATFGADQF  182

Query  1572  DGDHAHESVSKVAFFSYFYLALNLGSLFSNTVLVYFEDKGMWTLGFWastvsavlalllf  1393
             D DH  ES SKV+FFSYFYLALNLGSLFSNT+LVY EDKGMWTLGFWAS  SA+LAL+LF
Sbjct  183   DEDHPQESHSKVSFFSYFYLALNLGSLFSNTILVYVEDKGMWTLGFWASACSAILALVLF  242

Query  1392  lVGTPRYRHFAPKGNPLSRFSQVLVASARKWNVHLPSDGDDHRLYEIQEH---DSSTRKI  1222
             L+GTPRYRH  P GNP+SRF QVLVA+ RKW +  PS+G  + LYE       D+ +R I
Sbjct  243   LIGTPRYRHRKPTGNPISRFCQVLVAAIRKWKIEQPSNG--YELYEGDGRDLADNGSRNI  300

Query  1221  LHTEGFKFLDKAAVITTKESVRDLEERNINPWRLCSVTQVEEVKCILRLLPIWLCTILYS  1042
             LHT+ FKFL+KAA+IT+K       ER  NPWRLC VTQVEEVKCILRL PIWLCTILYS
Sbjct  301   LHTKEFKFLNKAAIITSK-------ERFDNPWRLCPVTQVEEVKCILRLFPIWLCTILYS  353

Query  1041  VVFTQMASLFVEQGAAMRTNIAGFHIPPASMSSFDILSVAAFIFIYRRILDPLIASLKKT  862
             VVFTQMASLFVEQG AM+T ++ FHIPPASMSSFDILSVAAFIFIYRR+LDP +ASLKK+
Sbjct  354   VVFTQMASLFVEQGDAMKTTVSRFHIPPASMSSFDILSVAAFIFIYRRVLDPFVASLKKS  413

Query  861   RRAQGFTELQRMGVGLiiaimamvaagiVEHFRLKYASTDCPRC--PSSLSIFWQVPQYV  688
              + +G TELQRMGVGLIIAIMAMVAAGIVEHFRLKYAS DC  C   SSLSI WQVPQYV
Sbjct  414   SQ-RGLTELQRMGVGLIIAIMAMVAAGIVEHFRLKYASIDCSHCTNSSSLSILWQVPQYV  472

Query  687   LIGASEVFMYVGQLEFFNGQAPEGLKSFASALCMTSISLGNYVSSLLVSIVMRISTTHRM  508
             LIGASEVFMYVGQLEFFNGQAP+GLKSF SALCMTSISLGNYVSSLLVSIVMRISTT  M
Sbjct  473   LIGASEVFMYVGQLEFFNGQAPDGLKSFGSALCMTSISLGNYVSSLLVSIVMRISTTDNM  532

Query  507   PGWIPGNLNKGHLDRFYFLLAALTTADFVVYILCAKWYKYIEFEERN  367
             PGWIPGNLNKGHLDRFYFLLAALT ADF+VY+LCAKWYKYIEFEER+
Sbjct  533   PGWIPGNLNKGHLDRFYFLLAALTAADFLVYLLCAKWYKYIEFEERS  579



>ref|XP_009607049.1| PREDICTED: protein NRT1/ PTR FAMILY 7.3-like [Nicotiana tomentosiformis]
Length=595

 Score =   886 bits (2290),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 459/594 (77%), Positives = 515/594 (87%), Gaps = 17/594 (3%)
 Frame = -3

Query  2139  AFLNITKMFFIKNERDEEKASREECTLDGTVDHYGRPALRSATGGWFAGVLLLVNQGLAT  1960
             A LNI KM        + +  ++E T DG+VD +G+PA+R+ TG WFAGVLLLVNQGLAT
Sbjct  2     ACLNIDKMC------HKPENQKDEYTFDGSVDKHGQPAVRARTGRWFAGVLLLVNQGLAT  55

Query  1959  LAFFGVGVNLVLFLTRVMGQDNADAANNVSKWTGTVYLFSLLGAFLSDSYWGRYKTCAIF  1780
             LAFFGVGVNLVLFLTRVMGQDNA+AANNVSKWTGTVY+FSLLGAFLSDSYWGRYKTCAIF
Sbjct  56    LAFFGVGVNLVLFLTRVMGQDNAEAANNVSKWTGTVYIFSLLGAFLSDSYWGRYKTCAIF  115

Query  1779  QLIYVVGLISVSIFSFIFLVKPKGCGDENTPCRSPSRIHIAVYYVSIYLVALGNGGYQPN  1600
             Q I+V G++S+S+ S+IFLVKPKGCGDE+ PC S S I +A++YVSIYL+ALGNGGYQP 
Sbjct  116   QAIFVAGVVSLSLTSYIFLVKPKGCGDESNPCGSHSTISVALFYVSIYLIALGNGGYQPT  175

Query  1599  IATFGSDQFDGDHAHESVSKVAFFSYFYLALNLGSLFSNTVLVYFEDKGMWTLGFWastv  1420
             IATFG+DQFD DH  ES SKVAFFSYFYLALNLGSLFSNT+L YFEDKGMWTLGFWAS  
Sbjct  176   IATFGADQFDEDHPQESHSKVAFFSYFYLALNLGSLFSNTILGYFEDKGMWTLGFWASAG  235

Query  1419  savlalllflVGTPRYRHFAPKGNPLSRFSQVLVASARKWNVHLPSDGDDHRLYEIQE-H  1243
             SA+LAL+LFL+GTPRYRHF P GNPLSRF QV+VA+ RKW V  P  GD+    E QE  
Sbjct  236   SAILALVLFLIGTPRYRHFKPTGNPLSRFCQVVVAATRKWKVEQPIRGDELYEGEGQEPA  295

Query  1242  DSSTRKILHTEGFKFLDKAAVITTKESVRDLEERNINPWRLCSVTQVEEVKCILRLLPIW  1063
             ++  R+ILHT+GFKFLDKAA+IT+K+          NPWRLC+V+Q+EEVKCILRLLPIW
Sbjct  296   ENGNRRILHTDGFKFLDKAAIITSKDGEN-------NPWRLCAVSQIEEVKCILRLLPIW  348

Query  1062  LCTILYSVVFTQMASLFVEQGAAMRTNIAGFHIPPASMSSFDILSVAAFIFIYRRILDPL  883
             LCTILYSVVFTQMASLFVEQGAAM+T ++GFHIPPASMSSFDILSVAAFIFIYRR+LDPL
Sbjct  349   LCTILYSVVFTQMASLFVEQGAAMKTTVSGFHIPPASMSSFDILSVAAFIFIYRRVLDPL  408

Query  882   IASLKKTRRAQGFTELQRMGVGLiiaimamvaagiVEHFRLKYASTDCPRCPS--SLSIF  709
             +A LKK+   +G TELQRMGVGLIIAIMAMVAAGIVEHFRLK A  DC  C +  SLSIF
Sbjct  409   VARLKKS-APKGLTELQRMGVGLIIAIMAMVAAGIVEHFRLKSADKDCSSCTNSRSLSIF  467

Query  708   WQVPQYVLIGASEVFMYVGQLEFFNGQAPEGLKSFASALCMTSISLGNYVSSLLVSIVMR  529
             WQVPQYVLIGASEVFMYVGQLEFFNGQAP+GLKSF SALCMTSISLGNYVSSLLVSIVM+
Sbjct  468   WQVPQYVLIGASEVFMYVGQLEFFNGQAPDGLKSFGSALCMTSISLGNYVSSLLVSIVMK  527

Query  528   ISTTHRMPGWIPGNLNKGHLDRFYFLLAALTTADFVVYILCAKWYKYIEFEERN  367
             ISTT +MPGWIPGNLNKGHLDRFYFLLAALT ADF+VY++CAKWYKYI+FEER+
Sbjct  528   ISTTDKMPGWIPGNLNKGHLDRFYFLLAALTAADFLVYLICAKWYKYIKFEERS  581



>emb|CDP09345.1| unnamed protein product [Coffea canephora]
Length=609

 Score =   879 bits (2272),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 452/584 (77%), Positives = 509/584 (87%), Gaps = 12/584 (2%)
 Frame = -3

Query  2100  ERDEEKASREECTLDGTVDHYGRPALRSATGGWFAGVLLLVNQGLATLAFFGVGVNLVLF  1921
             E++     R+ECT DG+VD +GRPA+R  TG WFAG LLLVNQGLATLAFFGVGVNLVLF
Sbjct  20    EKNNAMDQRKECTFDGSVDRHGRPAVREGTGKWFAGNLLLVNQGLATLAFFGVGVNLVLF  79

Query  1920  LTRVMGQDNADAANNVSKWTGTVYLFSLLGAFLSDSYWGRYKTCAIFQLIYVVGLISVSI  1741
             LTRVMGQ+NADAAN+VSKWTGTVY+FSLLGAFLSD+YWGRYK CA+FQ I+V+GL+S+SI
Sbjct  80    LTRVMGQNNADAANSVSKWTGTVYVFSLLGAFLSDAYWGRYKACAVFQAIFVIGLVSLSI  139

Query  1740  FSFIFLVKPKGCGDENTPCRSPSRIHIAVYYVSIYLVALGNGGYQPNIATFGSDQFDGDH  1561
              S IFLVKP GCG+E TPC S S + +A++YVSIYLVALG GGYQPNIATFG+DQFD DH
Sbjct  140   SSNIFLVKPSGCGNEQTPCASHSTLQVALFYVSIYLVALGYGGYQPNIATFGADQFDEDH  199

Query  1560  AHESVSKVAFFSYFYLALNLGSLFSNTVLVYFEDKGMWTLGFWastvsavlalllflVGT  1381
               ES SKVAFFSYFYLALNLGSLFSNTVL YFED+G W +GFWAS  SA+L LLLFLVGT
Sbjct  200   PKESHSKVAFFSYFYLALNLGSLFSNTVLGYFEDEGKWAIGFWASAGSALLGLLLFLVGT  259

Query  1380  PRYRHFAPKGNPLSRFSQVLVASARKWNVHLPSDGDDHRLYEIQ---EHDSSTRKILHTE  1210
             PRYRHF  +GNPLSR  QV+VASA+KW V +P D D+  LYE++   E D++ RK+LHTE
Sbjct  260   PRYRHFMAQGNPLSRICQVVVASAKKWKVKIPDDSDE--LYEVEGKKEADNADRKLLHTE  317

Query  1209  GFKFLDKAAVITTKESVRDLEERNI-NPWRLCSVTQVEEVKCILRLLPIWLCTILYSVVF  1033
             GF+FLD+AAVIT+K    D EE +I NPWRL +VT+VEEVKCILRLLPIWLCTILYSVVF
Sbjct  318   GFRFLDRAAVITSK----DFEEDDICNPWRLTTVTKVEEVKCILRLLPIWLCTILYSVVF  373

Query  1032  TQMASLFVEQGAAMRTNIAGFHIPPASMSSFDILSVAAFIFIYRRILDPLIASLKKTRRA  853
             TQMASLFVEQGAAMRT ++GFHIPPASMSSFDILSVAAFIFIYRR+LDPL A L+K    
Sbjct  374   TQMASLFVEQGAAMRTTVSGFHIPPASMSSFDILSVAAFIFIYRRVLDPLAARLRKKYNP  433

Query  852   QGFTELQRMGVGLiiaimamvaagiVEHFRLKYASTDCPRC--PSSLSIFWQVPQYVLIG  679
              G TELQRMG+GLIIAIMAMVAAGIVEHFRLK+  T+C  C   SSLSIFWQVPQYVLIG
Sbjct  434   GGLTELQRMGIGLIIAIMAMVAAGIVEHFRLKHKLTNCSDCDNSSSLSIFWQVPQYVLIG  493

Query  678   ASEVFMYVGQLEFFNGQAPEGLKSFASALCMTSISLGNYVSSLLVSIVMRISTTHRMPGW  499
             ASEVFMYVGQLEFFNGQAP+GLKSF SALCMTSISLGNYVSSLLV++VM+IST+  MPGW
Sbjct  494   ASEVFMYVGQLEFFNGQAPDGLKSFGSALCMTSISLGNYVSSLLVTMVMKISTSDEMPGW  553

Query  498   IPGNLNKGHLDRFYFLLAALTTADFVVYILCAKWYKYIEFEERN  367
             IPGNLNKGHLDRFYFLLAALT+ADFVVY++CAKWYKY++FE RN
Sbjct  554   IPGNLNKGHLDRFYFLLAALTSADFVVYLVCAKWYKYVQFEGRN  597



>ref|XP_006341336.1| PREDICTED: nitrate transporter 1.5-like [Solanum tuberosum]
Length=597

 Score =   879 bits (2271),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 458/597 (77%), Positives = 518/597 (87%), Gaps = 21/597 (4%)
 Frame = -3

Query  2139  AFLNITKMFFIKNERDEEKASREECTLDGTVDHYGRPALRSATGGWFAGVLLLVNQGLAT  1960
             A LNI KM     +R+ EK   +E T DG+VD +G PA+R+ TG WFAGVLLLVNQGLAT
Sbjct  2     ACLNIDKMC---EKREMEK---DEYTFDGSVDKHGEPAVRAKTGRWFAGVLLLVNQGLAT  55

Query  1959  LAFFGVGVNLVLFLTRVMGQDNADAANNVSKWTGTVYLFSLLGAFLSDSYWGRYKTCAIF  1780
             LAFFGVGVNLVLFLTRVMGQDNA+AAN+VSKWTGTVY+FSLLGAF+SDSYWGRYKTCAIF
Sbjct  56    LAFFGVGVNLVLFLTRVMGQDNAEAANSVSKWTGTVYIFSLLGAFVSDSYWGRYKTCAIF  115

Query  1779  QLIYVVGLISVSIFSFIFLVKPKGCGDENTPCRSPSRIHIAVYYVSIYLVALGNGGYQPN  1600
             Q I+V GL+S+S+ S+IFL+KP  CGDE TPC + S I +A++YVSIYL+ALGNGGYQP 
Sbjct  116   QAIFVAGLVSLSLTSYIFLIKPNDCGDEETPCGTHSTISVALFYVSIYLIALGNGGYQPT  175

Query  1599  IATFGSDQFDGDHAHESVSKVAFFSYFYLALNLGSLFSNTVLVYFEDKGMWTLGFWastv  1420
             IATFG+DQFD DH  ES SKVAFFSYFYLALNLGSLFSNT+L YFED+GMWT+GFWAS  
Sbjct  176   IATFGADQFDEDHPQESHSKVAFFSYFYLALNLGSLFSNTILGYFEDQGMWTIGFWASAG  235

Query  1419  savlalllflVGTPRYRHFAPKGNPLSRFSQVLVASARKWNVHLPSDGDDHRLYEIQEHD  1240
             SA+LAL+LFL+GTPRYRHF P GNPLSRF QV+VA+ +KWNV  PS GD+  LYE  E D
Sbjct  236   SAILALVLFLIGTPRYRHFKPTGNPLSRFCQVVVAATKKWNVEQPSRGDE--LYEGDEQD  293

Query  1239  ---SSTRKILHTEGFKFLDKAAVITTKESVRDLEERNINPWRLCSVTQVEEVKCILRLLP  1069
                +  R+ILHT+GFKFLD+AA+IT+KE   +      +PWRLC+V+QVEEVKCILRLLP
Sbjct  294   LPLNGNRRILHTQGFKFLDRAAIITSKEGGGN------SPWRLCAVSQVEEVKCILRLLP  347

Query  1068  IWLCTILYSVVFTQMASLFVEQGAAMRTNIAGFHIPPASMSSFDILSVAAFIFIYRRILD  889
             IWLCTILYSVVFTQMASLFVEQGAAM+T ++GFHIPPASMSSFDILSVA+FIFIYRR+LD
Sbjct  348   IWLCTILYSVVFTQMASLFVEQGAAMKTTLSGFHIPPASMSSFDILSVASFIFIYRRVLD  407

Query  888   PLIASLKKTRRAQGFTELQRMGVGLiiaimamvaagiVEHFRLKYASTDCPR-C--PSSL  718
             PL+A LKK+   +G TELQRMGVGLIIAIMAMVAAGIVEHFRLK A  DC   C   SSL
Sbjct  408   PLVARLKKS-SPRGLTELQRMGVGLIIAIMAMVAAGIVEHFRLKSAEKDCSHDCSNSSSL  466

Query  717   SIFWQVPQYVLIGASEVFMYVGQLEFFNGQAPEGLKSFASALCMTSISLGNYVSSLLVSI  538
             SIFWQVPQYVLIGASEVFMYVGQLEFFNGQAP+GLKSF SALCMTSISLGNYVSSLLVS+
Sbjct  467   SIFWQVPQYVLIGASEVFMYVGQLEFFNGQAPDGLKSFGSALCMTSISLGNYVSSLLVSV  526

Query  537   VMRISTTHRMPGWIPGNLNKGHLDRFYFLLAALTTADFVVYILCAKWYKYIEFEERN  367
             VM+ISTT  MPGWIPGNLNKGHLDRFYFLLAALT+ADF+VY++CAKWYKYI+FEER+
Sbjct  527   VMKISTTDNMPGWIPGNLNKGHLDRFYFLLAALTSADFLVYLICAKWYKYIKFEERS  583



>ref|XP_009629801.1| PREDICTED: protein NRT1/ PTR FAMILY 7.3-like isoform X3 [Nicotiana 
tomentosiformis]
Length=598

 Score =   877 bits (2265),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 460/594 (77%), Positives = 509/594 (86%), Gaps = 18/594 (3%)
 Frame = -3

Query  2133  LNITKMFFIKNERDEEKASREECTLDGTVDHYGRPALRSATGGWFAGVLLLVNQGLATLA  1954
             LNI KM       ++     EE TLDGTVD +G PA+R+ TG WFAGVLLLVNQGLATLA
Sbjct  4     LNIDKM---DQREEKLGNEEEEITLDGTVDKHGHPAVRATTGRWFAGVLLLVNQGLATLA  60

Query  1953  FFGVGVNLVLFLTRVMGQDNADAANNVSKWTGTVYLFSLLGAFLSDSYWGRYKTCAIFQL  1774
             FFGVGVNLVLFLTRVMGQDNA+AANNVSKWTGTVY+FSLLGAFLSDSYWGRYKTCAIFQ 
Sbjct  61    FFGVGVNLVLFLTRVMGQDNAEAANNVSKWTGTVYIFSLLGAFLSDSYWGRYKTCAIFQA  120

Query  1773  IYVVGLISVSIFSFIFLVKPKGCGDENTPCRSPSRIHIAVYYVSIYLVALGNGGYQPNIA  1594
             I+VVGL+S+S+ S+IFL+KP GCGDE  PCRS S +H  ++Y+SIYL+ALGNGGYQP IA
Sbjct  121   IFVVGLVSLSLTSYIFLIKPNGCGDEKMPCRSDSTVHTVLFYMSIYLIALGNGGYQPTIA  180

Query  1593  TFGSDQFDGDHAHESVSKVAFFSYFYLALNLGSLFSNTVLVYFEDKGMWTLGFWastvsa  1414
             TFG+DQFD DH  ES SKV+FFSYFYLALNLGSLFSNT+LVYFEDKGMWTLGFWAS  SA
Sbjct  181   TFGADQFDEDHPQESHSKVSFFSYFYLALNLGSLFSNTILVYFEDKGMWTLGFWASACSA  240

Query  1413  vlalllflVGTPRYRHFAPKGNPLSRFSQVLVASARKWNVHLPSDGDDHRLYEIQEH---  1243
             +LAL+LFL+GTPRYRH  P GNP+SRF QV+VA+ RKW +  PS+G  + LYE       
Sbjct  241   ILALVLFLIGTPRYRHCKPTGNPISRFCQVVVAAIRKWKIGQPSNG--YELYEGDGRDLA  298

Query  1242  DSSTRKILHTEGFKFLDKAAVITTKESVRDLEERNINPWRLCSVTQVEEVKCILRLLPIW  1063
             D+ +R ILHT+ FKFL+KAA+IT+K       ER  NPWRLC VTQVEEVKCILRL PIW
Sbjct  299   DNGSRNILHTKEFKFLNKAAIITSK-------ERFDNPWRLCPVTQVEEVKCILRLFPIW  351

Query  1062  LCTILYSVVFTQMASLFVEQGAAMRTNIAGFHIPPASMSSFDILSVAAFIFIYRRILDPL  883
             LCTILYSVVFTQMASLFVEQG AM+T ++ FHIPPASMSSFDILSVAAFIFIYRR+LDP 
Sbjct  352   LCTILYSVVFTQMASLFVEQGDAMKTTVSRFHIPPASMSSFDILSVAAFIFIYRRVLDPF  411

Query  882   IASLKKTRRAQGFTELQRMGVGLiiaimamvaagiVEHFRLKYASTDCPRC--PSSLSIF  709
             +ASLKK+   +G TELQRMGVGLIIAIMAMVAAGIVEHFRLKYA+ DC  C   SSLSI 
Sbjct  412   VASLKKS-SPRGLTELQRMGVGLIIAIMAMVAAGIVEHFRLKYANIDCSHCTNSSSLSIL  470

Query  708   WQVPQYVLIGASEVFMYVGQLEFFNGQAPEGLKSFASALCMTSISLGNYVSSLLVSIVMR  529
             WQVPQYVLIGASEVFMYVGQLEFFNGQAP+GLKSF SALCMTSISLGNYVSSLLVSIVMR
Sbjct  471   WQVPQYVLIGASEVFMYVGQLEFFNGQAPDGLKSFGSALCMTSISLGNYVSSLLVSIVMR  530

Query  528   ISTTHRMPGWIPGNLNKGHLDRFYFLLAALTTADFVVYILCAKWYKYIEFEERN  367
             ISTT  MPGWIPGNLNKGHLDRFYFLLAALT ADFVVY++CAKWYKYIEFE+R+
Sbjct  531   ISTTDNMPGWIPGNLNKGHLDRFYFLLAALTAADFVVYLICAKWYKYIEFEQRS  584



>ref|XP_009629800.1| PREDICTED: protein NRT1/ PTR FAMILY 7.3-like isoform X2 [Nicotiana 
tomentosiformis]
Length=605

 Score =   877 bits (2265),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 459/598 (77%), Positives = 509/598 (85%), Gaps = 19/598 (3%)
 Frame = -3

Query  2133  LNITKMFFIKNERDEEKASREE----CTLDGTVDHYGRPALRSATGGWFAGVLLLVNQGL  1966
             LNI KM    +  D+ +          TLDGTVD +G PA+R+ TG WFAGVLLLVNQGL
Sbjct  4     LNIDKMVCALSYPDQREEKLGNEEEEITLDGTVDKHGHPAVRATTGRWFAGVLLLVNQGL  63

Query  1965  ATLAFFGVGVNLVLFLTRVMGQDNADAANNVSKWTGTVYLFSLLGAFLSDSYWGRYKTCA  1786
             ATLAFFGVGVNLVLFLTRVMGQDNA+AANNVSKWTGTVY+FSLLGAFLSDSYWGRYKTCA
Sbjct  64    ATLAFFGVGVNLVLFLTRVMGQDNAEAANNVSKWTGTVYIFSLLGAFLSDSYWGRYKTCA  123

Query  1785  IFQLIYVVGLISVSIFSFIFLVKPKGCGDENTPCRSPSRIHIAVYYVSIYLVALGNGGYQ  1606
             IFQ I+VVGL+S+S+ S+IFL+KP GCGDE  PCRS S +H  ++Y+SIYL+ALGNGGYQ
Sbjct  124   IFQAIFVVGLVSLSLTSYIFLIKPNGCGDEKMPCRSDSTVHTVLFYMSIYLIALGNGGYQ  183

Query  1605  PNIATFGSDQFDGDHAHESVSKVAFFSYFYLALNLGSLFSNTVLVYFEDKGMWTLGFWas  1426
             P IATFG+DQFD DH  ES SKV+FFSYFYLALNLGSLFSNT+LVYFEDKGMWTLGFWAS
Sbjct  184   PTIATFGADQFDEDHPQESHSKVSFFSYFYLALNLGSLFSNTILVYFEDKGMWTLGFWAS  243

Query  1425  tvsavlalllflVGTPRYRHFAPKGNPLSRFSQVLVASARKWNVHLPSDGDDHRLYEIQE  1246
               SA+LAL+LFL+GTPRYRH  P GNP+SRF QV+VA+ RKW +  PS+G  + LYE   
Sbjct  244   ACSAILALVLFLIGTPRYRHCKPTGNPISRFCQVVVAAIRKWKIGQPSNG--YELYEGDG  301

Query  1245  H---DSSTRKILHTEGFKFLDKAAVITTKESVRDLEERNINPWRLCSVTQVEEVKCILRL  1075
                 D+ +R ILHT+ FKFL+KAA+IT+K       ER  NPWRLC VTQVEEVKCILRL
Sbjct  302   RDLADNGSRNILHTKEFKFLNKAAIITSK-------ERFDNPWRLCPVTQVEEVKCILRL  354

Query  1074  LPIWLCTILYSVVFTQMASLFVEQGAAMRTNIAGFHIPPASMSSFDILSVAAFIFIYRRI  895
              PIWLCTILYSVVFTQMASLFVEQG AM+T ++ FHIPPASMSSFDILSVAAFIFIYRR+
Sbjct  355   FPIWLCTILYSVVFTQMASLFVEQGDAMKTTVSRFHIPPASMSSFDILSVAAFIFIYRRV  414

Query  894   LDPLIASLKKTRRAQGFTELQRMGVGLiiaimamvaagiVEHFRLKYASTDCPRC--PSS  721
             LDP +ASLKK+   +G TELQRMGVGLIIAIMAMVAAGIVEHFRLKYA+ DC  C   SS
Sbjct  415   LDPFVASLKKS-SPRGLTELQRMGVGLIIAIMAMVAAGIVEHFRLKYANIDCSHCTNSSS  473

Query  720   LSIFWQVPQYVLIGASEVFMYVGQLEFFNGQAPEGLKSFASALCMTSISLGNYVSSLLVS  541
             LSI WQVPQYVLIGASEVFMYVGQLEFFNGQAP+GLKSF SALCMTSISLGNYVSSLLVS
Sbjct  474   LSILWQVPQYVLIGASEVFMYVGQLEFFNGQAPDGLKSFGSALCMTSISLGNYVSSLLVS  533

Query  540   IVMRISTTHRMPGWIPGNLNKGHLDRFYFLLAALTTADFVVYILCAKWYKYIEFEERN  367
             IVMRISTT  MPGWIPGNLNKGHLDRFYFLLAALT ADFVVY++CAKWYKYIEFE+R+
Sbjct  534   IVMRISTTDNMPGWIPGNLNKGHLDRFYFLLAALTAADFVVYLICAKWYKYIEFEQRS  591



>ref|XP_009629799.1| PREDICTED: protein NRT1/ PTR FAMILY 7.3-like isoform X1 [Nicotiana 
tomentosiformis]
Length=646

 Score =   876 bits (2264),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 453/571 (79%), Positives = 500/571 (88%), Gaps = 15/571 (3%)
 Frame = -3

Query  2064  TLDGTVDHYGRPALRSATGGWFAGVLLLVNQGLATLAFFGVGVNLVLFLTRVMGQDNADA  1885
             TLDGTVD +G PA+R+ TG WFAGVLLLVNQGLATLAFFGVGVNLVLFLTRVMGQDNA+A
Sbjct  72    TLDGTVDKHGHPAVRATTGRWFAGVLLLVNQGLATLAFFGVGVNLVLFLTRVMGQDNAEA  131

Query  1884  ANNVSKWTGTVYLFSLLGAFLSDSYWGRYKTCAIFQLIYVVGLISVSIFSFIFLVKPKGC  1705
             ANNVSKWTGTVY+FSLLGAFLSDSYWGRYKTCAIFQ I+VVGL+S+S+ S+IFL+KP GC
Sbjct  132   ANNVSKWTGTVYIFSLLGAFLSDSYWGRYKTCAIFQAIFVVGLVSLSLTSYIFLIKPNGC  191

Query  1704  GDENTPCRSPSRIHIAVYYVSIYLVALGNGGYQPNIATFGSDQFDGDHAHESVSKVAFFS  1525
             GDE  PCRS S +H  ++Y+SIYL+ALGNGGYQP IATFG+DQFD DH  ES SKV+FFS
Sbjct  192   GDEKMPCRSDSTVHTVLFYMSIYLIALGNGGYQPTIATFGADQFDEDHPQESHSKVSFFS  251

Query  1524  YFYLALNLGSLFSNTVLVYFEDKGMWTLGFWastvsavlalllflVGTPRYRHFAPKGNP  1345
             YFYLALNLGSLFSNT+LVYFEDKGMWTLGFWAS  SA+LAL+LFL+GTPRYRH  P GNP
Sbjct  252   YFYLALNLGSLFSNTILVYFEDKGMWTLGFWASACSAILALVLFLIGTPRYRHCKPTGNP  311

Query  1344  LSRFSQVLVASARKWNVHLPSDGDDHRLYEIQEH---DSSTRKILHTEGFKFLDKAAVIT  1174
             +SRF QV+VA+ RKW +  PS+G  + LYE       D+ +R ILHT+ FKFL+KAA+IT
Sbjct  312   ISRFCQVVVAAIRKWKIGQPSNG--YELYEGDGRDLADNGSRNILHTKEFKFLNKAAIIT  369

Query  1173  TKESVRDLEERNINPWRLCSVTQVEEVKCILRLLPIWLCTILYSVVFTQMASLFVEQGAA  994
             +K       ER  NPWRLC VTQVEEVKCILRL PIWLCTILYSVVFTQMASLFVEQG A
Sbjct  370   SK-------ERFDNPWRLCPVTQVEEVKCILRLFPIWLCTILYSVVFTQMASLFVEQGDA  422

Query  993   MRTNIAGFHIPPASMSSFDILSVAAFIFIYRRILDPLIASLKKTRRAQGFTELQRMGVGL  814
             M+T ++ FHIPPASMSSFDILSVAAFIFIYRR+LDP +ASLKK+   +G TELQRMGVGL
Sbjct  423   MKTTVSRFHIPPASMSSFDILSVAAFIFIYRRVLDPFVASLKKS-SPRGLTELQRMGVGL  481

Query  813   iiaimamvaagiVEHFRLKYASTDCPRC--PSSLSIFWQVPQYVLIGASEVFMYVGQLEF  640
             IIAIMAMVAAGIVEHFRLKYA+ DC  C   SSLSI WQVPQYVLIGASEVFMYVGQLEF
Sbjct  482   IIAIMAMVAAGIVEHFRLKYANIDCSHCTNSSSLSILWQVPQYVLIGASEVFMYVGQLEF  541

Query  639   FNGQAPEGLKSFASALCMTSISLGNYVSSLLVSIVMRISTTHRMPGWIPGNLNKGHLDRF  460
             FNGQAP+GLKSF SALCMTSISLGNYVSSLLVSIVMRISTT  MPGWIPGNLNKGHLDRF
Sbjct  542   FNGQAPDGLKSFGSALCMTSISLGNYVSSLLVSIVMRISTTDNMPGWIPGNLNKGHLDRF  601

Query  459   YFLLAALTTADFVVYILCAKWYKYIEFEERN  367
             YFLLAALT ADFVVY++CAKWYKYIEFE+R+
Sbjct  602   YFLLAALTAADFVVYLICAKWYKYIEFEQRS  632



>ref|XP_004229506.1| PREDICTED: protein NRT1/ PTR FAMILY 7.3-like [Solanum lycopersicum]
Length=663

 Score =   874 bits (2257),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 461/595 (77%), Positives = 509/595 (86%), Gaps = 20/595 (3%)
 Frame = -3

Query  2133  LNITKMFFIKNERDEEKASREECTLDGTVDHYGRPALRSATGGWFAGVLLLVNQGLATLA  1954
             LNI KM     E        EE TLDGTVD +G PA+R+ TG WFAGVLLLVNQGLATLA
Sbjct  67    LNIGKM-----EVKLGNMPHEEFTLDGTVDQHGCPAVRATTGKWFAGVLLLVNQGLATLA  121

Query  1953  FFGVGVNLVLFLTRVMGQDNADAANNVSKWTGTVYLFSLLGAFLSDSYWGRYKTCAIFQL  1774
             FFGVGVNLVLFLTRVMGQDNA+AANNVSKWTGTVY+FSLLGAFLSDSYWGRYKTCAIFQ 
Sbjct  122   FFGVGVNLVLFLTRVMGQDNAEAANNVSKWTGTVYIFSLLGAFLSDSYWGRYKTCAIFQA  181

Query  1773  IYVVGLISVSIFSFIFLVKPKGCGDENTPCRSPSRIHIAVYYVSIYLVALGNGGYQPNIA  1594
             I+V GL+ +S+ S+IFL+KP GCGDE  PC S S +H  ++ VSIYL+ALGNGGYQP IA
Sbjct  182   IFVAGLVLLSLCSYIFLIKPNGCGDEEAPCGSHSSLHTMLFNVSIYLIALGNGGYQPTIA  241

Query  1593  TFGSDQFDGDHAHESVSKVAFFSYFYLALNLGSLFSNTVLVYFEDKGMWTLGFWastvsa  1414
             TFGSDQFD DH  ES SK++FFSYFYLALNLGSLFSNT+LVYFEDKGMWTLGF AS  SA
Sbjct  242   TFGSDQFDEDHPQESHSKLSFFSYFYLALNLGSLFSNTILVYFEDKGMWTLGFSASAGSA  301

Query  1413  vlalllflVGTPRYRHFAPKGNPLSRFSQVLVASARKWNVHLPSDGDDHRLYE---IQEH  1243
             +LAL+LFL+GTP YRHF P  NP+SRF QV+VA+ RKWN+  PS+GD+  LYE    +  
Sbjct  302   ILALVLFLIGTPWYRHFRPTRNPISRFCQVVVAAIRKWNMEKPSNGDE--LYEGDGRELA  359

Query  1242  DSSTRKILHTEGFKFLDKAAVITTKESVRDLEERNINPWRLCSVTQVEEVKCILRLLPIW  1063
             D+S+R ILHTE F FLDKAA+IT+K       ER  NPWRLCSVTQVEEVKCILRL PIW
Sbjct  360   DNSSRNILHTEEFSFLDKAAIITSK-------ERLDNPWRLCSVTQVEEVKCILRLFPIW  412

Query  1062  LCTILYSVVFTQMASLFVEQGAAMRTNIAGFHIPPASMSSFDILSVAAFIFIYRRILDPL  883
             LCTILYSVVFTQMASLFVEQG AM+T ++GFHIPPASMSSFDILSVA FIFIYRR+LDPL
Sbjct  413   LCTILYSVVFTQMASLFVEQGDAMKTTVSGFHIPPASMSSFDILSVAVFIFIYRRVLDPL  472

Query  882   IASLKKTRRAQGFTELQRMGVGLiiaimamvaagiVEHFRLKYASTDCPRC--PSSLSIF  709
             +ASLKKT   +G TELQRMGVGLIIAIMAMVAAGIVEHFRLK+A+ DC  C   SSLSIF
Sbjct  473   VASLKKT-SPRGLTELQRMGVGLIIAIMAMVAAGIVEHFRLKHANKDCSHCTNSSSLSIF  531

Query  708   WQVPQYVLIGASEVFMYVGQLEFFNGQAPEGLKSFASALCMTSISLGNYVSSLLVSIVMR  529
             WQVPQYVLIGASEVFMYVGQLEFFNGQAP+GLKSF SALCMTSISLGNYVSSLLVSIV++
Sbjct  532   WQVPQYVLIGASEVFMYVGQLEFFNGQAPDGLKSFGSALCMTSISLGNYVSSLLVSIVIK  591

Query  528   ISTTHRMPGWIPGNLNKGHLDRFYFLLAALTTADFVVYILCAKWYKYIEFEERNS  364
             IST  +MPGWIPGNLNKGHLDRFYFLLAALT ADFVVY++CAKWYKYIEFE+R+S
Sbjct  592   ISTNDKMPGWIPGNLNKGHLDRFYFLLAALTIADFVVYLICAKWYKYIEFEQRSS  646



>ref|XP_009757592.1| PREDICTED: protein NRT1/ PTR FAMILY 7.3-like [Nicotiana sylvestris]
Length=595

 Score =   873 bits (2255),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 458/594 (77%), Positives = 512/594 (86%), Gaps = 17/594 (3%)
 Frame = -3

Query  2139  AFLNITKMFFIKNERDEEKASREECTLDGTVDHYGRPALRSATGGWFAGVLLLVNQGLAT  1960
             A LNI KM        + +  ++E T DG+VD +G+PA+R  TG WFAGVLLLVNQGLAT
Sbjct  2     ACLNIHKMC------QKPENEKDEYTFDGSVDKHGQPAVRERTGRWFAGVLLLVNQGLAT  55

Query  1959  LAFFGVGVNLVLFLTRVMGQDNADAANNVSKWTGTVYLFSLLGAFLSDSYWGRYKTCAIF  1780
             LAFFGVGVNLVLFLTRVMGQDNA+AANNVSKWTGTVY+FSLLGAFLSDSYWGRYKTCAIF
Sbjct  56    LAFFGVGVNLVLFLTRVMGQDNAEAANNVSKWTGTVYIFSLLGAFLSDSYWGRYKTCAIF  115

Query  1779  QLIYVVGLISVSIFSFIFLVKPKGCGDENTPCRSPSRIHIAVYYVSIYLVALGNGGYQPN  1600
             Q I+V G++S+S+ S+IFLVKPKGCGDEN PC S S I + ++YVSIYL+ALGNGGYQP 
Sbjct  116   QAIFVAGVVSLSLTSYIFLVKPKGCGDENNPCGSHSTISVVLFYVSIYLIALGNGGYQPT  175

Query  1599  IATFGSDQFDGDHAHESVSKVAFFSYFYLALNLGSLFSNTVLVYFEDKGMWTLGFWastv  1420
             IATFG+DQFD DH  ES SKVAFFSYFYLALNLGSLFSNT+L YFEDKGMWTLGFWAS  
Sbjct  176   IATFGADQFDEDHPQESHSKVAFFSYFYLALNLGSLFSNTILGYFEDKGMWTLGFWASAG  235

Query  1419  savlalllflVGTPRYRHFAPKGNPLSRFSQVLVASARKWNVHLPSDGDDHRLYEIQE-H  1243
             SA+LAL+LFL+GTPRYRHF P GNPLSRF QV+V++ RKW V   S GD+    E QE  
Sbjct  236   SAILALVLFLIGTPRYRHFKPTGNPLSRFCQVVVSATRKWKVEQSSRGDELYEGEGQEPA  295

Query  1242  DSSTRKILHTEGFKFLDKAAVITTKESVRDLEERNINPWRLCSVTQVEEVKCILRLLPIW  1063
             ++  R+ILHT+GFKFLDKAA+IT+K+          NPWRLC+V+Q+EEVKCILRLLPIW
Sbjct  296   ENGNRRILHTDGFKFLDKAAIITSKDGEN-------NPWRLCAVSQIEEVKCILRLLPIW  348

Query  1062  LCTILYSVVFTQMASLFVEQGAAMRTNIAGFHIPPASMSSFDILSVAAFIFIYRRILDPL  883
             LCTILYSVVFTQMASLFVEQGAAM+T ++GFHIPPASMSSFDILSVAAFIFIYRR+LDPL
Sbjct  349   LCTILYSVVFTQMASLFVEQGAAMKTTVSGFHIPPASMSSFDILSVAAFIFIYRRVLDPL  408

Query  882   IASLKKTRRAQGFTELQRMGVGLiiaimamvaagiVEHFRLKYASTDC--PRCPSSLSIF  709
             +A LKK+   +G TELQRMGVGLIIAIMAMVAAGIVEHFRLK A  DC      SSLSIF
Sbjct  409   VARLKKS-APRGLTELQRMGVGLIIAIMAMVAAGIVEHFRLKSADKDCSSCTNSSSLSIF  467

Query  708   WQVPQYVLIGASEVFMYVGQLEFFNGQAPEGLKSFASALCMTSISLGNYVSSLLVSIVMR  529
             WQVPQYVLIGASEVFMYVGQLEFFNGQAP+GLKSF SALCMTSISLGNYVSSLLVSIVM+
Sbjct  468   WQVPQYVLIGASEVFMYVGQLEFFNGQAPDGLKSFGSALCMTSISLGNYVSSLLVSIVMK  527

Query  528   ISTTHRMPGWIPGNLNKGHLDRFYFLLAALTTADFVVYILCAKWYKYIEFEERN  367
             ISTT +MPGWIPGNLNKGHLDRFYFLLAALT ADF+VY++CAKWYKYI+FEER+
Sbjct  528   ISTTDKMPGWIPGNLNKGHLDRFYFLLAALTAADFLVYLICAKWYKYIKFEERS  581



>ref|XP_011085074.1| PREDICTED: protein NRT1/ PTR FAMILY 7.3-like [Sesamum indicum]
Length=590

 Score =   866 bits (2237),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 433/576 (75%), Positives = 500/576 (87%), Gaps = 10/576 (2%)
 Frame = -3

Query  2076  REECTLDGTVDHYGRPALRSATGGWFAGVLLLVNQGLATLAFFGVGVNLVLFLTRVMGQD  1897
             +EECTLDG+VD +G+PA+RS +G W AG L+LVNQGLATLAFFGVGVNLVLFLTRVMGQD
Sbjct  10    QEECTLDGSVDRHGKPAIRSRSGSWSAGTLILVNQGLATLAFFGVGVNLVLFLTRVMGQD  69

Query  1896  NADAANNVSKWTGTVYLFSLLGAFLSDSYWGRYKTCAIFQLIYVVGLISVSIFSFIFLVK  1717
             NA AANNVSKWTGTVY+FSLLGAFLSDSYWGRYKTCA+FQ+I+V+GL+S+S+ S++FLVK
Sbjct  70    NASAANNVSKWTGTVYMFSLLGAFLSDSYWGRYKTCAVFQVIFVIGLVSLSLTSYLFLVK  129

Query  1716  PKGCGDENTPCRSPSRIHIAVYYVSIYLVALGNGGYQPNIATFGSDQFDGDHAHESVSKV  1537
             P GCGDE TPC S S +H++++YVSIYL+ALGNGGYQP IATFG+DQFD +H  ES SKV
Sbjct  130   PNGCGDEKTPCGSHSTLHLSLFYVSIYLIALGNGGYQPTIATFGADQFDEEHPKESHSKV  189

Query  1536  AFFSYFYLALNLGSLFSNTVLVYFEDKGMWTLGFWastvsavlalllflVGTPRYRHFAP  1357
             AFFSYFYLALNLG LFSNT+L Y+EDKG+W LGFWAS  SA +AL LFLVGTP YRHF P
Sbjct  190   AFFSYFYLALNLGCLFSNTILGYYEDKGVWALGFWASAGSATVALGLFLVGTPTYRHFKP  249

Query  1356  KGNPLSRFSQVLVASARKWNVHLPSDGDDHRLYEIQEH---DSSTRKILHTEGFKFLDKA  1186
             +GNP SRF QV+VA++RKW V +PS+ DDH LYE+      D ++RKILHT GFKFLD+A
Sbjct  250   RGNPFSRFCQVMVAASRKWKVEIPSN-DDH-LYEVDGRDLTDDASRKILHTRGFKFLDRA  307

Query  1185  AVITTKESVRDLEERNINPWRLCSVTQVEEVKCILRLLPIWLCTILYSVVFTQMASLFVE  1006
             AV+T ++   + +    NPW LCSVTQVEEVKCILRLLPIWLCTILYSVVFTQM SLFVE
Sbjct  308   AVMTQEDHNIEQKTSTHNPWLLCSVTQVEEVKCILRLLPIWLCTILYSVVFTQMQSLFVE  367

Query  1005  QGAAMRTNIAGFHIPPASMSSFDILSVAAFIFIYRRILDPLIASLKKTRRAQGFTELQRM  826
             QGAAM+T +AGFHIPPASMSSFDILSVA+FIFI RRI++P++A   K R++ G TELQRM
Sbjct  368   QGAAMKTTLAGFHIPPASMSSFDILSVASFIFINRRIIEPMVA---KIRKSGGLTELQRM  424

Query  825   GVGLiiaimamvaagiVEHFRLKYASTDCPRC--PSSLSIFWQVPQYVLIGASEVFMYVG  652
             G+GLIIA+MAM+ AG VEHFRL+YA  DCPRC   SSLSIFWQVPQYVLIGASEVFMYVG
Sbjct  425   GIGLIIAVMAMLTAGAVEHFRLRYAQKDCPRCVNSSSLSIFWQVPQYVLIGASEVFMYVG  484

Query  651   QLEFFNGQAPEGLKSFASALCMTSISLGNYVSSLLVSIVMRISTTHRMPGWIPGNLNKGH  472
             QLEFFNGQAP+GLKSF SAL M SISLGNYVSSL+V+IVM++ST+  MPGWIP NLNKGH
Sbjct  485   QLEFFNGQAPDGLKSFGSALSMMSISLGNYVSSLIVTIVMKVSTSDDMPGWIPRNLNKGH  544

Query  471   LDRFYFLLAALTTADFVVYILCAKWYKYIEFEERNS  364
             LD FY+LLAALT ADFVVY++CAKWYKY  FEER+S
Sbjct  545   LDMFYYLLAALTAADFVVYVVCAKWYKYTRFEERSS  580



>ref|XP_010327292.1| PREDICTED: protein NRT1/ PTR FAMILY 7.3-like [Solanum lycopersicum]
Length=594

 Score =   862 bits (2227),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 444/577 (77%), Positives = 505/577 (88%), Gaps = 15/577 (3%)
 Frame = -3

Query  2064  TLDGTVDHYGRPALRSATGGWFAGVLLLVNQGLATLAFFGVGVNLVLFLTRVMGQDNADA  1885
             T DG+VD +G PA+R+ TG WFAGVLLLVNQGLATLAFFGVGVNLVLFLTRVMG+DNA+A
Sbjct  18    TFDGSVDKHGEPAVRAKTGRWFAGVLLLVNQGLATLAFFGVGVNLVLFLTRVMGEDNAEA  77

Query  1884  ANNVSKWTGTVYLFSLLGAFLSDSYWGRYKTCAIFQLIYVVGLISVSIFSFIFLVKPKGC  1705
             AN+VSKWTGTVY+FSLLGAFLSDSYWGRYKTCAIFQ IYV GL+S+S+ S+IFL+KP  C
Sbjct  78    ANSVSKWTGTVYIFSLLGAFLSDSYWGRYKTCAIFQAIYVAGLVSLSLTSYIFLIKPNDC  137

Query  1704  GDENTPCRSPSRIHIAVYYVSIYLVALGNGGYQPNIATFGSDQFDGDHAHESVSKVAFFS  1525
             GDE++PC S S + +A++Y+SIYL+ALGNGGYQP IATFG+DQFD DH  ES SKVAFFS
Sbjct  138   GDEDSPCGSHSTMSVALFYLSIYLIALGNGGYQPTIATFGADQFDEDHPQESHSKVAFFS  197

Query  1524  YFYLALNLGSLFSNTVLVYFEDKGMWTLGFWastvsavlalllflVGTPRYRHFAPKGNP  1345
             YFYLALNLGSLFSNT+L YFED+GMWT+GFWAS  SA+LAL+LFL+GTPRYRHF P GNP
Sbjct  198   YFYLALNLGSLFSNTILGYFEDEGMWTIGFWASAGSAILALVLFLIGTPRYRHFKPTGNP  257

Query  1344  LSRFSQVLVASARKWNVHLPSDGDDHRLYEIQEHD---SSTRKILHTEGFKFLDKAAVIT  1174
             LSRF QV+VA+ +KWNV  PS GD+  LYE  E D   +  R+ILHT+GFKFLD+AA+IT
Sbjct  258   LSRFCQVVVAATKKWNVEQPSRGDE--LYEGDEQDLPLNGNRRILHTQGFKFLDRAAIIT  315

Query  1173  TKESVRDLEERNINPWRLCSVTQVEEVKCILRLLPIWLCTILYSVVFTQMASLFVEQGAA  994
             +K+   +      N WRLC+V+QVEEVKCILRLLPIW CTILYSVVFTQMASLFVEQGAA
Sbjct  316   SKDGGGN------NQWRLCAVSQVEEVKCILRLLPIWFCTILYSVVFTQMASLFVEQGAA  369

Query  993   MRTNIAGFHIPPASMSSFDILSVAAFIFIYRRILDPLIASLKKTRRAQGFTELQRMGVGL  814
             M+T ++GFHIPPASMSSFDIL VA+FIFIYRR+LDPL+A LKK+   +G TELQRMGVGL
Sbjct  370   MKTALSGFHIPPASMSSFDILGVASFIFIYRRLLDPLVARLKKS-SPRGLTELQRMGVGL  428

Query  813   iiaimamvaagiVEHFRLKYASTDCPR-C--PSSLSIFWQVPQYVLIGASEVFMYVGQLE  643
             +IAIMAMVAAGIVEHFRLK A  DC   C   SSLSIFWQVPQYVLIGASEVFMYVGQLE
Sbjct  429   VIAIMAMVAAGIVEHFRLKSAEKDCSHDCSNSSSLSIFWQVPQYVLIGASEVFMYVGQLE  488

Query  642   FFNGQAPEGLKSFASALCMTSISLGNYVSSLLVSIVMRISTTHRMPGWIPGNLNKGHLDR  463
             FFNGQAP+GLKSF SALCMTSISLGNYVSSLLVS+VM+ISTT  +PGWIPGNLNKGHLDR
Sbjct  489   FFNGQAPDGLKSFGSALCMTSISLGNYVSSLLVSVVMKISTTDNVPGWIPGNLNKGHLDR  548

Query  462   FYFLLAALTTADFVVYILCAKWYKYIEFEERNSCLKN  352
             FYFLLAALT+ADF+VY++CAKWYKYI+FEER+   KN
Sbjct  549   FYFLLAALTSADFLVYLICAKWYKYIKFEERSVEKKN  585



>ref|XP_007008714.1| Nitrate transporter 1.5 [Theobroma cacao]
 gb|EOY17524.1| Nitrate transporter 1.5 [Theobroma cacao]
Length=609

 Score =   856 bits (2212),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 441/601 (73%), Positives = 508/601 (85%), Gaps = 16/601 (3%)
 Frame = -3

Query  2145  MAAFLNITKMFFIKNERDEEKASREECTLDGTVDHYGRPALRSATGGWFAGVLLLVNQGL  1966
             MA   N  K   I+ +  +E+   E  TLDG VD +GRPA+R  TG W AG+LLLVNQGL
Sbjct  1     MACLNNNCKEVSIEKKMIKEE---ESYTLDGAVDRHGRPAIRGRTGTWVAGILLLVNQGL  57

Query  1965  ATLAFFGVGVNLVLFLTRVMGQDNADAANNVSKWTGTVYLFSLLGAFLSDSYWGRYKTCA  1786
             ATLAFFGVGVNLVLFLTRV+GQDNADAANNVSKWTGTVY+FSLLGAFLSDSYWGRYKTCA
Sbjct  58    ATLAFFGVGVNLVLFLTRVLGQDNADAANNVSKWTGTVYIFSLLGAFLSDSYWGRYKTCA  117

Query  1785  IFQLIYVVGLISVSIFSFIFLVKPKGCGDENTPCRSPSRIHIAVYYVSIYLVALGNGGYQ  1606
             IFQ ++VVGL+  S+ + +FL+KP GCGDE+T C S S  HI  +Y +IYLVALGNGGYQ
Sbjct  118   IFQAVFVVGLVLSSVSTSVFLLKPSGCGDEDTSCGSHSAFHIVFFYFAIYLVALGNGGYQ  177

Query  1605  PNIATFGSDQFDGDHAHESVSKVAFFSYFYLALNLGSLFSNTVLVYFEDKGMWTLGFWas  1426
             PNIATFG+DQFD +   E  SK+AFFSYFYLALNLGSLFSNT+L YFED+GMW LGFWAS
Sbjct  178   PNIATFGADQFDEEDPKEGHSKIAFFSYFYLALNLGSLFSNTILGYFEDQGMWVLGFWAS  237

Query  1425  tvsavlalllflVGTPRYRHFAPKGNPLSRFSQVLVASARKWNVHLPSDGDDHRLYEIQE  1246
               SA +AL+LFL+GTPRYRHF P GNPLSRF QVLVA++RKW V +   G++  L+E+++
Sbjct  238   AASAFVALVLFLIGTPRYRHFKPTGNPLSRFCQVLVAASRKWKVQMTPGGEN--LFEVEK  295

Query  1245  HDSST---RKILHTEGFKFLDKAAVITTKESVRDLEERNI---NPWRLCSVTQVEEVKCI  1084
              +S+T   RKILHTEGF+FLD+AA++T ++   D +E+NI   NPW LC+VTQVEEVKCI
Sbjct  296   KESATNGARKILHTEGFRFLDRAAIMTPRDYA-DGQEKNIDGRNPWSLCTVTQVEEVKCI  354

Query  1083  LRLLPIWLCTILYSVVFTQMASLFVEQGAAMRTNIAGFHIPPASMSSFDILSVAAFIFIY  904
             LRLLPIWLCTILYSVVFTQMASLFVEQGAAM+T I+ FHIP ASMSSFDILSVA FIFIY
Sbjct  355   LRLLPIWLCTILYSVVFTQMASLFVEQGAAMKTTISNFHIPAASMSSFDILSVATFIFIY  414

Query  903   RRILDPLIASLKKTRRAQGFTELQRMGVGLiiaimamvaagiVEHFRLKYASTDCPRC--  730
             RR+LDP++A +K   + +G TELQRMG+GL+IAI+AMV+AGIVE FRLKYA  DCP C  
Sbjct  415   RRVLDPIVARIKT--KPKGLTELQRMGIGLVIAILAMVSAGIVELFRLKYADKDCPSCEN  472

Query  729   PSSLSIFWQVPQYVLIGASEVFMYVGQLEFFNGQAPEGLKSFASALCMTSISLGNYVSSL  550
              SSLSIFWQVPQY+LIGASEVFMYVGQLEFFNGQAP+GLKSF SALCMTSISLGNYVSSL
Sbjct  473   ASSLSIFWQVPQYMLIGASEVFMYVGQLEFFNGQAPDGLKSFGSALCMTSISLGNYVSSL  532

Query  549   LVSIVMRISTTHRMPGWIPGNLNKGHLDRFYFLLAALTTADFVVYILCAKWYKYIEFEER  370
             LV+IVM+IST   MPGWIPGNLN+GHLDRFYFLLAALTTAD VVYI+CAKWYKYI+FE R
Sbjct  533   LVTIVMKISTRDDMPGWIPGNLNRGHLDRFYFLLAALTTADLVVYIICAKWYKYIKFEGR  592

Query  369   N  367
             +
Sbjct  593   S  593



>ref|XP_008232241.1| PREDICTED: protein NRT1/ PTR FAMILY 7.3-like [Prunus mume]
Length=607

 Score =   850 bits (2195),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 444/611 (73%), Positives = 510/611 (83%), Gaps = 18/611 (3%)
 Frame = -3

Query  2139  AFLNITKMFFIKNERDEEKASR--EECTLDGTVDHYGRPALRSATGGWFAGVLLLVNQGL  1966
             A LN+ K      E  EEK  +  E CTLDGT D YGRPA+R  TG W A  L+LVNQGL
Sbjct  4     ACLNVCK---DDQEYVEEKNQKIKEVCTLDGTTDWYGRPAVRGRTGTWVAATLILVNQGL  60

Query  1965  ATLAFFGVGVNLVLFLTRVMGQDNADAANNVSKWTGTVYLFSLLGAFLSDSYWGRYKTCA  1786
             ATLAFFGVGVNLVL LTRV+GQDNA+AANNVSKWTGTVYLFSLLGAFLSDSYWGRYKTCA
Sbjct  61    ATLAFFGVGVNLVLMLTRVLGQDNAEAANNVSKWTGTVYLFSLLGAFLSDSYWGRYKTCA  120

Query  1785  IFQLIYVVGLISVSIFSFIFLVKPKGCGDENTPCRSPSRIHIAVYYVSIYLVALGNGGYQ  1606
             +FQLI+V+GL  +S+ ++IFL+KPKGCGD+NTPC   S   I ++Y+SIYL+ALGNGGYQ
Sbjct  121   VFQLIFVIGLSMLSLSTYIFLLKPKGCGDKNTPCGDHSAFVIGLFYISIYLIALGNGGYQ  180

Query  1605  PNIATFGSDQFD--GDHAHESVSKVAFFSYFYLALNLGSLFSNTVLVYFEDKGMWTLGFW  1432
             PNIATFG+DQFD  GD   E  SK+AFFSYFYLALNLGSLFSNT+L YFEDKGMWTLGFW
Sbjct  181   PNIATFGADQFDDQGD-PKEGQSKIAFFSYFYLALNLGSLFSNTILGYFEDKGMWTLGFW  239

Query  1431  astvsavlalllflVGTPRYRHFAPKGNPLSRFSQVLVASARKWNVHLPSDGDDHRLYEI  1252
             AST SA +AL+LFL GTPRYRHF P+GNPLSRF +V+VA+ RKW V +   G+D    + 
Sbjct  240   ASTGSAAIALVLFLCGTPRYRHFKPQGNPLSRFCRVMVAATRKWKVEMMPSGEDLYEEDG  299

Query  1251  QEHDSSTRKILHTEGFKFLDKAAVITTKESVRDLEERNINPWRLCSVTQVEEVKCILRLL  1072
             +E   + R I+HT GFKFLD+AAVIT+KE + ++++   NPWRLC+VTQVEEVKC+LRLL
Sbjct  300   KECSPNDRNIVHTHGFKFLDRAAVITSKE-MNEMDKGAHNPWRLCTVTQVEEVKCLLRLL  358

Query  1071  PIWLCTILYSVVFTQMASLFVEQGAAMRTNIAGFHIPPASMSSFDILSVAAFIFIYRRIL  892
             PIWLCTILYSVVFTQMASLFVEQGA+M+T ++GFHIPPASMSSFDILSVAAFIFI RR L
Sbjct  359   PIWLCTILYSVVFTQMASLFVEQGASMKTTVSGFHIPPASMSSFDILSVAAFIFISRRFL  418

Query  891   DPLIASLKKTRRAQGFTELQRMGVGLiiaimamvaagiVEHFRLKYASTDCPRC--PSSL  718
             DPL   L+K +     TELQRMG+GL+IAIMAMV+AG+VE FRLKYA  +C  C  PSSL
Sbjct  419   DPLFGRLRKKK----LTELQRMGIGLVIAIMAMVSAGVVEVFRLKYAVKECNNCENPSSL  474

Query  717   SIFWQVPQYVLIGASEVFMYVGQLEFFNGQAPEGLKSFASALCMTSISLGNYVSSLLVSI  538
             SIFWQVPQ+VL+GASEVFMYVGQLEFFNGQAP+GLKSF SALCMTSISLGNYVSSLLV+I
Sbjct  475   SIFWQVPQFVLVGASEVFMYVGQLEFFNGQAPDGLKSFGSALCMTSISLGNYVSSLLVTI  534

Query  537   VMRISTTHRMPGWIPGNLNKGHLDRFYFLLAALTTADFVVYILCAKWYKYIEFEER---N  367
             VM++ST   MPGWIPGNLNKGHLDRFYFLLAALTTAD +VYILCAKWYKYIEFE +   +
Sbjct  535   VMKVSTRDEMPGWIPGNLNKGHLDRFYFLLAALTTADLLVYILCAKWYKYIEFEAKGGND  594

Query  366   SCLKNIGDSKL  334
             + + NIG  +L
Sbjct  595   NGVHNIGQPEL  605



>ref|XP_006464342.1| PREDICTED: nitrate transporter 1.5-like [Citrus sinensis]
 gb|KDO85368.1| hypothetical protein CISIN_1g007201mg [Citrus sinensis]
Length=613

 Score =   849 bits (2194),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 436/603 (72%), Positives = 497/603 (82%), Gaps = 18/603 (3%)
 Frame = -3

Query  2139  AFLNITKMFFIKNERDEEKASREECTLDGTVDHYGRPALRSATGGWFAGVLLLVNQGLAT  1960
             A  N+     +K +   ++   E CTLDG VD +GRPA++  TG W AG+L+LVNQGLAT
Sbjct  2     ALSNVCNEVIVKEKIKNDQ--EEACTLDGAVDRHGRPAIKRRTGTWIAGILILVNQGLAT  59

Query  1959  LAFFGVGVNLVLFLTRVMGQDNADAANNVSKWTGTVYLFSLLGAFLSDSYWGRYKTCAIF  1780
             LAFFGVGVNLVLFLTRV+GQ+NADAANNVSKWTGTVY+FSLLGAFLSDSYWGRYKTCAIF
Sbjct  60    LAFFGVGVNLVLFLTRVVGQNNADAANNVSKWTGTVYIFSLLGAFLSDSYWGRYKTCAIF  119

Query  1779  QLIYVVGLISVSIFSFIFLVKPKGCGDENTPCRSPSRIHIAVYYVSIYLVALGNGGYQPN  1600
             Q I+V+GL+S+S+ S+ FL+KP GCGDE  PC S S +H+A++Y+SIYL ALGNGGYQPN
Sbjct  120   QAIFVIGLVSLSVSSYAFLLKPSGCGDEGNPCGSHSSLHMALFYLSIYLTALGNGGYQPN  179

Query  1599  IATFGSDQFDGDHAHESVSKVAFFSYFYLALNLGSLFSNTVLVYFEDKGMWTLGFWastv  1420
             IATFG+DQFD +   E  SK+AFFSYFYLALNLGSLFSNT+L YFED+GMW LGFWAS  
Sbjct  180   IATFGADQFDEEDPKEGHSKIAFFSYFYLALNLGSLFSNTILGYFEDEGMWALGFWASAG  239

Query  1419  savlalllflVGTPRYRHFAPKGNPLSRFSQVLVASARKWNVHLPSDGDDHRLYE----I  1252
             SA +AL+LFL+GTPRYRHF P GNPLSR  QV+VA+ RKW V +  D  D   YE     
Sbjct  240   SATMALILFLIGTPRYRHFKPTGNPLSRICQVVVAATRKWKVQISDDDHDLLFYERDGIK  299

Query  1251  QEHDSSTRKILHTEGFKFLDKAAVITTK---ESVRDLEERNI---NPWRLCSVTQVEEVK  1090
             Q   +  R ILHT+GFKFLDKAAVIT K   +     +  NI   NPW LC+VTQVEEVK
Sbjct  300   QTSQNGARNILHTQGFKFLDKAAVITRKSDNDKNNGGDGENIDMRNPWVLCTVTQVEEVK  359

Query  1089  CILRLLPIWLCTILYSVVFTQMASLFVEQGAAMRTNIAGFHIPPASMSSFDILSVAAFIF  910
             CILRLLPIWLCTILYSVVFTQMASLFVEQGAAM+TNI+ FHIPPASMSSFDILSVAAFIF
Sbjct  360   CILRLLPIWLCTILYSVVFTQMASLFVEQGAAMKTNISTFHIPPASMSSFDILSVAAFIF  419

Query  909   IYRRILDPLIASLKKTRRAQGFTELQRMGVGLiiaimamvaagiVEHFRLKYASTDCPRC  730
             IYRR+LDPL+  L +    +GFTELQRMGVGL+IAIMAM++AG+VE FRLKY+  DC  C
Sbjct  420   IYRRVLDPLVERLTRKSGTRGFTELQRMGVGLVIAIMAMISAGVVEIFRLKYSIKDCNSC  479

Query  729   ---PSSLSIFWQVPQYVLIGASEVFMYVGQLEFFNGQAPEGLKSFASALCMTSISLGNYV  559
                 S+LSIFWQ+PQYVLIGASEVFMYVGQLEFFNGQAP+GLKSF SALCMTSISLGNYV
Sbjct  480   ESKASTLSIFWQIPQYVLIGASEVFMYVGQLEFFNGQAPDGLKSFGSALCMTSISLGNYV  539

Query  558   SSLLVSIVMRISTTHRMPGWIPGNLNKGHLDRFYFLLAALTTADFVVYILCAKWYKYIEF  379
             SSLLV+IVM+IST    PGWIPGNLNKGHLDRFYFLLAALTTAD  +YI+CA+WYKYI+F
Sbjct  540   SSLLVTIVMKISTR---PGWIPGNLNKGHLDRFYFLLAALTTADLFIYIICARWYKYIKF  596

Query  378   EER  370
             EER
Sbjct  597   EER  599



>ref|XP_006445510.1| hypothetical protein CICLE_v10023644mg [Citrus clementina]
 gb|ESR58750.1| hypothetical protein CICLE_v10023644mg [Citrus clementina]
Length=612

 Score =   848 bits (2192),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 436/593 (74%), Positives = 495/593 (83%), Gaps = 22/593 (4%)
 Frame = -3

Query  2109  IKNERDEEKASREECTLDGTVDHYGRPALRSATGGWFAGVLLLVNQGLATLAFFGVGVNL  1930
             IKN+++E       CTLDG VD +GRPA++  TG W AG+L+LVNQGLATLAFFGVGVNL
Sbjct  15    IKNDQEEA------CTLDGAVDRHGRPAIKRRTGTWIAGILILVNQGLATLAFFGVGVNL  68

Query  1929  VLFLTRVMGQDNADAANNVSKWTGTVYLFSLLGAFLSDSYWGRYKTCAIFQLIYVVGLIS  1750
             VLFLTRV+GQ+NADAANNVSKWTGTVY+FSLLGAFLSDSYWGRYKTCAIFQ I+V+GL+S
Sbjct  69    VLFLTRVVGQNNADAANNVSKWTGTVYIFSLLGAFLSDSYWGRYKTCAIFQAIFVIGLVS  128

Query  1749  VSIFSFIFLVKPKGCGDENTPCRSPSRIHIAVYYVSIYLVALGNGGYQPNIATFGSDQFD  1570
             +S+ S+ FL+KP GCGDE  PC S S +H+A++Y+SIYL ALGNGGYQPNIATFG+DQFD
Sbjct  129   LSVSSYAFLLKPSGCGDEGNPCGSHSSLHMALFYLSIYLTALGNGGYQPNIATFGADQFD  188

Query  1569  GDHAHESVSKVAFFSYFYLALNLGSLFSNTVLVYFEDKGMWTLGFWastvsavlalllfl  1390
              +   E  SK+AFFSYFYLALNLGSLFSNT+L YFED+GMW LGFWAS  SA +AL+LFL
Sbjct  189   EEDPKEGHSKIAFFSYFYLALNLGSLFSNTILGYFEDEGMWALGFWASAGSATMALILFL  248

Query  1389  VGTPRYRHFAPKGNPLSRFSQVLVASARKWNVHLPSDGDDHRLYE----IQEHDSSTRKI  1222
             +GTPRYRHF P GNPLSR  QV+VA+ RKW V +  D  D   YE     Q   +  R I
Sbjct  249   IGTPRYRHFKPTGNPLSRICQVVVAATRKWKVQISDDDHDLLFYERDGIKQTSQNGARNI  308

Query  1221  LHTEGFKFLDKAAVITTK---ESVRDLEERNI---NPWRLCSVTQVEEVKCILRLLPIWL  1060
             LHT+GFKFLDKAAVIT K   +     +  NI   NPW LC+VTQVEEVKCILRLLPIWL
Sbjct  309   LHTQGFKFLDKAAVITRKSDNDKNNGGDGENIDMRNPWVLCTVTQVEEVKCILRLLPIWL  368

Query  1059  CTILYSVVFTQMASLFVEQGAAMRTNIAGFHIPPASMSSFDILSVAAFIFIYRRILDPLI  880
             CTILYSVVFTQMASLFVEQGAAM+TNI+ FHIPPASMSSFDILSVAAFIFIYRR+LDPL+
Sbjct  369   CTILYSVVFTQMASLFVEQGAAMKTNISTFHIPPASMSSFDILSVAAFIFIYRRVLDPLV  428

Query  879   ASLKKTRRAQGFTELQRMGVGLiiaimamvaagiVEHFRLKYASTDCPRC---PSSLSIF  709
               L +    +GFTELQRMGVGL+IAIMAM++AG+VE FRLKY+  DC  C    S+LSIF
Sbjct  429   ERLTRKSGTRGFTELQRMGVGLVIAIMAMISAGVVEIFRLKYSIKDCNSCESKASTLSIF  488

Query  708   WQVPQYVLIGASEVFMYVGQLEFFNGQAPEGLKSFASALCMTSISLGNYVSSLLVSIVMR  529
             WQ+PQYVLIGASEVFMYVGQLEFFNGQAP+GLKSF SALCMTSISLGNYVSSLLV+IVM+
Sbjct  489   WQIPQYVLIGASEVFMYVGQLEFFNGQAPDGLKSFGSALCMTSISLGNYVSSLLVTIVMK  548

Query  528   ISTTHRMPGWIPGNLNKGHLDRFYFLLAALTTADFVVYILCAKWYKYIEFEER  370
             IST    PGWIPGNLNKGHLDRFYFLLAALTTAD  +YI+CA+WYKYI+FEER
Sbjct  549   ISTR---PGWIPGNLNKGHLDRFYFLLAALTTADLFIYIICARWYKYIKFEER  598



>ref|XP_009347591.1| PREDICTED: protein NRT1/ PTR FAMILY 7.3-like [Pyrus x bretschneideri]
Length=604

 Score =   848 bits (2190),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 437/603 (72%), Positives = 507/603 (84%), Gaps = 18/603 (3%)
 Frame = -3

Query  2106  KNERDEEKAS---REECTLDGTVDHYGRPALRSATGGWFAGVLLLVNQGLATLAFFGVGV  1936
             K++R  E+ +   +E CTLDGT D +GRPA+R  TG W AG+L+LVNQGLATLAFFGVGV
Sbjct  8     KDQRYAEEKNLKIKEVCTLDGTTDRHGRPAVRGRTGRWVAGILILVNQGLATLAFFGVGV  67

Query  1935  NLVLFLTRVMGQDNADAANNVSKWTGTVYLFSLLGAFLSDSYWGRYKTCAIFQLIYVVGL  1756
             NLVLF TRV+GQDNA+AANNVSKWTGTVYLFSLLGAFLSDSYWGRYKTCAIFQ+IYV+GL
Sbjct  68    NLVLFFTRVLGQDNAEAANNVSKWTGTVYLFSLLGAFLSDSYWGRYKTCAIFQVIYVIGL  127

Query  1755  ISVSIFSFIFLVKPKGCGDENTPCRSPSRIHIAVYYVSIYLVALGNGGYQPNIATFGSDQ  1576
               +SI ++IFL+KPKGCGDE +PC   S   I ++Y+SIYL+ALGNGGYQPNIATFG+DQ
Sbjct  128   SLLSISTYIFLLKPKGCGDEKSPCGEHSTFEIGLFYISIYLIALGNGGYQPNIATFGADQ  187

Query  1575  FDGDHAHESVSKVAFFSYFYLALNLGSLFSNTVLVYFEDKGMWTLGFWastvsavlalll  1396
             FD +  +E  SK++FFSYFYLALNLGSLFSNT+L YFEDKG+WTLGFW ST SA +AL+L
Sbjct  188   FDEEDPNEGHSKISFFSYFYLALNLGSLFSNTILGYFEDKGIWTLGFWVSTGSAAMALVL  247

Query  1395  flVGTPRYRHFAPKGNPLSRFSQVLVASARKWNVHLPSDGDDHRLYEIQEH----DSSTR  1228
             FL GTP YRHF P+GNPLSRF +V+VA+ RKW V +   G+D  LYE ++      + +R
Sbjct  248   FLCGTPMYRHFKPQGNPLSRFFRVIVAATRKWKVEMTPSGED--LYEGEDEKECSSNESR  305

Query  1227  KILHTEGFKFLDKAAVITTKESVRDLEERNINPWRLCSVTQVEEVKCILRLLPIWLCTIL  1048
             KI+HT GFKFLDKAA+IT+KE +  + +   NPWRLCSVTQVEEVKCILRLLPIWLCTIL
Sbjct  306   KIVHTHGFKFLDKAAIITSKE-MNQMGKGAQNPWRLCSVTQVEEVKCILRLLPIWLCTIL  364

Query  1047  YSVVFTQMASLFVEQGAAMRTNIAGFHIPPASMSSFDILSVAAFIFIYRRILDPLIASLK  868
             YSVVFTQMASLFVEQGAAM+T I+ FHIPPA MSSFDILSVAAFIF YRR+LDPL+A L 
Sbjct  365   YSVVFTQMASLFVEQGAAMKTTISSFHIPPAGMSSFDILSVAAFIFFYRRVLDPLVARLW  424

Query  867   KTRRAQGFTELQRMGVGLiiaimamvaagiVEHFRLKYASTDCP---RCPSSLSIFWQVP  697
             K    +G TELQRMG+G++IAIMAM++AG+VE FRLKYA  DC      PSSLSIFWQVP
Sbjct  425   K----KGLTELQRMGIGIVIAIMAMISAGVVELFRLKYAIKDCNIDCENPSSLSIFWQVP  480

Query  696   QYVLIGASEVFMYVGQLEFFNGQAPEGLKSFASALCMTSISLGNYVSSLLVSIVMRISTT  517
             QY+LIGASEVFMYVGQLEFFNGQAP+GLKSF SALCMTSISLGNYVSSLLV++VM+IS  
Sbjct  481   QYMLIGASEVFMYVGQLEFFNGQAPDGLKSFGSALCMTSISLGNYVSSLLVTVVMKISAR  540

Query  516   HRMPGWIPGNLNKGHLDRFYFLLAALTTADFVVYILCAKWYKYIEFEERNSCLK-NIGDS  340
               MPGWIPGNLNKGHLDRFYFLLAALTTAD +VY+LCAKWYKYI+FE +      NIG +
Sbjct  541   EDMPGWIPGNLNKGHLDRFYFLLAALTTADLLVYVLCAKWYKYIKFEGKGGNDSGNIGQA  600

Query  339   KLQ  331
             +L+
Sbjct  601   ELR  603



>ref|XP_007220198.1| hypothetical protein PRUPE_ppa003058mg [Prunus persica]
 gb|EMJ21397.1| hypothetical protein PRUPE_ppa003058mg [Prunus persica]
Length=607

 Score =   848 bits (2190),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 445/611 (73%), Positives = 509/611 (83%), Gaps = 18/611 (3%)
 Frame = -3

Query  2139  AFLNITKMFFIKNERDEEKASR--EECTLDGTVDHYGRPALRSATGGWFAGVLLLVNQGL  1966
             A LN+ K      E  EEK  +  E CTLDGT D YGRPA+R  TG W A  L+LVNQGL
Sbjct  4     ACLNVCK---DDQEYVEEKNQKIKEVCTLDGTTDWYGRPAVRGRTGTWVAATLILVNQGL  60

Query  1965  ATLAFFGVGVNLVLFLTRVMGQDNADAANNVSKWTGTVYLFSLLGAFLSDSYWGRYKTCA  1786
             ATLAFFGVGVNLVL LTRV+GQDNA+AANNVSKWTGTVYLFSLLGAFLSDSYWGRYKTCA
Sbjct  61    ATLAFFGVGVNLVLMLTRVLGQDNAEAANNVSKWTGTVYLFSLLGAFLSDSYWGRYKTCA  120

Query  1785  IFQLIYVVGLISVSIFSFIFLVKPKGCGDENTPCRSPSRIHIAVYYVSIYLVALGNGGYQ  1606
             IFQLI+V+GL  +S+ ++IFL+KPKGCGD+NTPC   S   I ++Y+SIYL+ALGNGGYQ
Sbjct  121   IFQLIFVIGLSLLSLSTYIFLLKPKGCGDKNTPCGDHSAFVIGLFYISIYLIALGNGGYQ  180

Query  1605  PNIATFGSDQFD--GDHAHESVSKVAFFSYFYLALNLGSLFSNTVLVYFEDKGMWTLGFW  1432
             PNIATFG+DQFD  GD   E  SK+AFFSYFYLALNLGSLFSNT+L YFEDKGMWTLGFW
Sbjct  181   PNIATFGADQFDDQGD-PKEGQSKIAFFSYFYLALNLGSLFSNTILGYFEDKGMWTLGFW  239

Query  1431  astvsavlalllflVGTPRYRHFAPKGNPLSRFSQVLVASARKWNVHLPSDGDDHRLYEI  1252
             AST SA +AL+LFL GTPRYRHF P+GNPLSRF +V+VA+ RKW V +   G++    + 
Sbjct  240   ASTGSAAMALVLFLCGTPRYRHFKPQGNPLSRFCRVMVAATRKWKVEMMPSGENLYEEDG  299

Query  1251  QEHDSSTRKILHTEGFKFLDKAAVITTKESVRDLEERNINPWRLCSVTQVEEVKCILRLL  1072
             +E   + R I+HT GFKFLD+AAVIT+KE   ++++   NPWRLC+VTQVEEVKCILRLL
Sbjct  300   KECSPNDRNIVHTHGFKFLDRAAVITSKEK-NEMDKGAHNPWRLCTVTQVEEVKCILRLL  358

Query  1071  PIWLCTILYSVVFTQMASLFVEQGAAMRTNIAGFHIPPASMSSFDILSVAAFIFIYRRIL  892
             PIWLCTILYSVVFTQMASLFVEQGA+M+T ++GFHIPPASMSSFDILSVAAFIFI RR L
Sbjct  359   PIWLCTILYSVVFTQMASLFVEQGASMKTTVSGFHIPPASMSSFDILSVAAFIFICRRFL  418

Query  891   DPLIASLKKTRRAQGFTELQRMGVGLiiaimamvaagiVEHFRLKYASTDCPRC--PSSL  718
             DPL   L+K R     TELQRMG+GL+IAIMAMV+AG+VE FRLKYA  +C  C  PSSL
Sbjct  419   DPLFGRLRKKR----LTELQRMGIGLVIAIMAMVSAGVVEVFRLKYAVKECNNCESPSSL  474

Query  717   SIFWQVPQYVLIGASEVFMYVGQLEFFNGQAPEGLKSFASALCMTSISLGNYVSSLLVSI  538
             SIFWQVPQ+VL+GASEVFMYVGQLEFFNGQAP+GLKSF SALCMTSISLGNYVSSLLV+I
Sbjct  475   SIFWQVPQFVLVGASEVFMYVGQLEFFNGQAPDGLKSFGSALCMTSISLGNYVSSLLVTI  534

Query  537   VMRISTTHRMPGWIPGNLNKGHLDRFYFLLAALTTADFVVYILCAKWYKYIEFEER---N  367
             VM++ST   MPGWIPGNLNKGHLDRFYFLLAALTTAD +VYILCAKWYKYI+FE +   +
Sbjct  535   VMKVSTRDEMPGWIPGNLNKGHLDRFYFLLAALTTADLLVYILCAKWYKYIKFEAKVGND  594

Query  366   SCLKNIGDSKL  334
             + + NIG  +L
Sbjct  595   NGVHNIGQPEL  605



>gb|KHG12170.1| Nitrate transporter 1.5 -like protein [Gossypium arboreum]
Length=616

 Score =   837 bits (2162),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 436/604 (72%), Positives = 505/604 (84%), Gaps = 20/604 (3%)
 Frame = -3

Query  2145  MAAFLNITKMFFIKNERDEEKASREE--CTLDGTVDHYGRPALRSATGGWFAGVLLLVNQ  1972
             MA   NI K        DE+  ++EE   TLDGTVD +G+PA+RS TG W +G+LLLVNQ
Sbjct  1     MACLNNICK-----EVSDEKMMTKEEEDYTLDGTVDRHGQPAIRSKTGTWVSGILLLVNQ  55

Query  1971  GLATLAFFGVGVNLVLFLTRVMGQDNADAANNVSKWTGTVYLFSLLGAFLSDSYWGRYKT  1792
             GLATLAFFGVGVNLVLFLTRV+GQDNA+AANNVSKWTGTVY+FSLLGAFLSDSYWGRYKT
Sbjct  56    GLATLAFFGVGVNLVLFLTRVLGQDNAEAANNVSKWTGTVYIFSLLGAFLSDSYWGRYKT  115

Query  1791  CAIFQLIYVVGLISVSIFSFIFLVKPKGCGDENTPCRSPSRIHIAVYYVSIYLVALGNGG  1612
             CAIFQ I+VVGL+ +SI S  FL+ PKGCGDE TPC + S  HI  +Y++IY+VALGNGG
Sbjct  116   CAIFQAIFVVGLVLLSISSSAFLLYPKGCGDEETPCGTHSTFHIVFFYLAIYMVALGNGG  175

Query  1611  YQPNIATFGSDQFDGDHAHESVSKVAFFSYFYLALNLGSLFSNTVLVYFEDKGMWTLGFW  1432
             YQP IATFG+DQFD +   E  SK+AFFS+FYLALNLGSLFSNTVL YFED+GMWTLGFW
Sbjct  176   YQPTIATFGADQFDEEDPKEGHSKIAFFSFFYLALNLGSLFSNTVLGYFEDQGMWTLGFW  235

Query  1431  astvsavlalllflVGTPRYRHFAPKGNPLSRFSQVLVASARKWNVHLPSDGDDHRLYEI  1252
             AS  SA +AL+LFL+GTPRYRHF P+GNPLSRF QVLVA+ RKW V +   GDDH L+E 
Sbjct  236   ASAGSAFVALVLFLIGTPRYRHFKPQGNPLSRFCQVLVAAIRKWKVGI-MPGDDH-LFET  293

Query  1251  QEHDSST---RKILHTEGFKFLDKAAVITTKESVRDLEERNI---NPWRLCSVTQVEEVK  1090
              +++S+    R+ILHTEGF+FLD+AA++T  +   D EE+N    NPWRLC++TQVEEVK
Sbjct  294   DKNESAIKGDRRILHTEGFRFLDRAAIMTPNDYATD-EEKNTKGRNPWRLCTITQVEEVK  352

Query  1089  CILRLLPIWLCTILYSVVFTQMASLFVEQGAAMRTNIAGFHIPPASMSSFDILSVAAFIF  910
             CILRLLPIWLCTILYSVVFTQMASLFVEQG AM+T ++ F IP ASMSSFDILSVA FIF
Sbjct  353   CILRLLPIWLCTILYSVVFTQMASLFVEQGDAMKTTVSNFDIPAASMSSFDILSVATFIF  412

Query  909   IYRRILDPLIASLKKTRRAQGFTELQRMGVGLiiaimamvaagiVEHFRLKYASTDCPRC  730
             IYRRILDP++A +K     +G TELQRMG+GL+IAI+AMVAAG+VE FRLKYA+ DCP C
Sbjct  413   IYRRILDPIVARIKT--NPKGLTELQRMGIGLVIAILAMVAAGVVEVFRLKYANKDCPNC  470

Query  729   --PSSLSIFWQVPQYVLIGASEVFMYVGQLEFFNGQAPEGLKSFASALCMTSISLGNYVS  556
                SSLSIFWQ+PQY+LIGASEVFMYVGQLEFFNGQAP+GLKSF SALCMTSISLGNYVS
Sbjct  471   NNASSLSIFWQIPQYMLIGASEVFMYVGQLEFFNGQAPDGLKSFGSALCMTSISLGNYVS  530

Query  555   SLLVSIVMRISTTHRMPGWIPGNLNKGHLDRFYFLLAALTTADFVVYILCAKWYKYIEFE  376
             SLLV++VM+IST   MPGWIPGNLNKG LD FYFLLAALTTAD ++YI+CAKWYK I+F+
Sbjct  531   SLLVTMVMKISTRDNMPGWIPGNLNKGRLDLFYFLLAALTTADLMIYIICAKWYKCIKFD  590

Query  375   ERNS  364
              R +
Sbjct  591   GRTN  594



>ref|XP_004307313.1| PREDICTED: nitrate transporter 1.5-like [Fragaria vesca subsp. 
vesca]
Length=608

 Score =   837 bits (2161),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 434/598 (73%), Positives = 503/598 (84%), Gaps = 23/598 (4%)
 Frame = -3

Query  2103  NERDEEKASREECTLDGTVDHYGRPALRSATGGWFAGVLLLVNQGLATLAFFGVGVNLVL  1924
              E + +K   E CT+DG VD  GRPA+R  +G W A VL+LVNQGLATLAFFGVGVNLVL
Sbjct  15    EEENSQKKMTETCTMDGAVDWNGRPAIRGRSGSWVAAVLILVNQGLATLAFFGVGVNLVL  74

Query  1923  FLTRVMGQDNADAANNVSKWTGTVYLFSLLGAFLSDSYWGRYKTCAIFQLIYVVGLISVS  1744
             FLTRV+GQDNA+AANNVSKWTGTVY+FSLLGAFLSDSYWGRYKTCAIFQ+I+V+GL  +S
Sbjct  75    FLTRVLGQDNAEAANNVSKWTGTVYIFSLLGAFLSDSYWGRYKTCAIFQVIFVIGLTLLS  134

Query  1743  IFSFIFLVKPKGCGDENTPCRSPSRIHIAVYYVSIYLVALGNGGYQPNIATFGSDQFDGD  1564
             + +++FL+KPKGCGDE +PC   S    A++Y+SIYL+ALGNGGYQP IATFG+DQFD D
Sbjct  135   LTTYLFLLKPKGCGDEKSPCGEHSNFEFALFYLSIYLIALGNGGYQPTIATFGADQFDED  194

Query  1563  HAHESVSKVAFFSYFYLALNLGSLFSNTVLVYFEDKGMWTLGFWastvsavlalllflVG  1384
                E  SK+AFFSYFYLALNLGSLFSNT+L YFEDKG+WT+GFWAST SA +AL+LFL G
Sbjct  195   DPEEGHSKIAFFSYFYLALNLGSLFSNTILGYFEDKGIWTVGFWASTGSAAMALILFLCG  254

Query  1383  TPRYRHFAPKGNPLSRFSQVLVASARKWNVHLPSDGDDHRLYEIQEH-----DSSTRKIL  1219
             TPRYRHF P+GNPLSRF  VLVA+ RKW V + SDGDD  LYE  EH     ++ +RKIL
Sbjct  255   TPRYRHFKPQGNPLSRFCHVLVAATRKWKVKITSDGDD--LYE--EHLKQCPENQSRKIL  310

Query  1218  HTEGFKFLDKAAVITTKESVRDLEERNINPWRLCSVTQVEEVKCILRLLPIWLCTILYSV  1039
             HT GFKFLD+AA+IT+KES   +++   NPWRLC+VTQVEEVKC+LRLLPIWLCTILYSV
Sbjct  311   HTRGFKFLDRAAIITSKES-NHVDKYAQNPWRLCTVTQVEEVKCVLRLLPIWLCTILYSV  369

Query  1038  VFTQMASLFVEQGAAMRTNIAGFHIPPASMSSFDILSVAAFIFIYRRILDPLIASLKKTR  859
             VFTQMASLFVEQGA M+T ++ FHIPPASMSSFDILSVA FIFIYRR+LDPL+A L+K  
Sbjct  370   VFTQMASLFVEQGAVMKTTVSNFHIPPASMSSFDILSVALFIFIYRRVLDPLVAKLRK--  427

Query  858   RAQGFTELQRMGVGLiiaimamvaagiVEHFRLKYASTDCP----RCPSSLSIFWQVPQY  691
               +G TELQRMG+GL+IAIMAM++AG+VE FRLKYA TDC       PSSLSIFWQVPQY
Sbjct  428   --RGLTELQRMGIGLVIAIMAMISAGVVECFRLKYARTDCASTDCESPSSLSIFWQVPQY  485

Query  690   VLIGASEVFMYVGQLEFFNGQAPEGLKSFASALCMTSISLGNYVSSLLVSIVMRISTTHR  511
             +L+GASEVFMYVGQLEFFN QAP+GLKSF SALCMTSISLGNYVSSLLV+IVMR S+   
Sbjct  486   MLVGASEVFMYVGQLEFFNSQAPDGLKSFGSALCMTSISLGNYVSSLLVTIVMRFSSRDD  545

Query  510   MPGWIPGNLNKGHLDRFYFLLAALTTADFVVYILCAKWYKYIEFE-----ERNSCLKN  352
             M GWIPGNLN+GHLDRFYFLLAALTTAD +VYI+CAKWYKYI+FE     ++N C++ 
Sbjct  546   MSGWIPGNLNRGHLDRFYFLLAALTTADLMVYIVCAKWYKYIKFEAKGGDDQNECIRQ  603



>gb|KHG17535.1| Nitrate transporter 1.5 -like protein [Gossypium arboreum]
Length=597

 Score =   832 bits (2150),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 431/584 (74%), Positives = 493/584 (84%), Gaps = 10/584 (2%)
 Frame = -3

Query  2085  KASREECTLDGTVDHYGRPALRSATGGWFAGVLLLVNQGLATLAFFGVGVNLVLFLTRVM  1906
             + + E  TLDGTVD +G+PA+R  TG W +G+LLLVNQGLATLAFFGVGVNLVLFLTRV+
Sbjct  2     EMNEEAYTLDGTVDRHGQPAIRGRTGTWVSGILLLVNQGLATLAFFGVGVNLVLFLTRVL  61

Query  1905  GQDNADAANNVSKWTGTVYLFSLLGAFLSDSYWGRYKTCAIFQLIYVVGLISVSIFSFIF  1726
             GQD+A AANNVSKWTGTVY+FSLLGAFLSDSYWGRYKTCAIFQ ++VVGL+ +SI + +F
Sbjct  62    GQDSAAAANNVSKWTGTVYIFSLLGAFLSDSYWGRYKTCAIFQAVFVVGLVLLSISTTLF  121

Query  1725  LVKPKGCGDENTPCRSPSRIHIAVYYVSIYLVALGNGGYQPNIATFGSDQFDGDHAHESV  1546
             L+KP GCGDE TPC S S  HI  +Y++IYLVALGNGGYQPNIATFG+DQFD +   E  
Sbjct  122   LLKPSGCGDEETPCGSHSTFHIVFFYLAIYLVALGNGGYQPNIATFGADQFDEEDPKEGH  181

Query  1545  SKVAFFSYFYLALNLGSLFSNTVLVYFEDKGMWTLGFWastvsavlalllflVGTPRYRH  1366
             SK+AFFSYFYLALNLGSLFSNT+L YFED+GMW LGFWAST S V AL+LFL+GTPRYRH
Sbjct  182   SKIAFFSYFYLALNLGSLFSNTILGYFEDQGMWALGFWASTASGVGALVLFLIGTPRYRH  241

Query  1365  FAPKGNPLSRFSQVLVASARKWNVHLPSDGDDHRLYEIQEHDSST---RKILHTEGFKFL  1195
             F PKGNPLSRF QVLVAS RKW V   + G+++ L+E+   +S+    RKILHT+GF+FL
Sbjct  242   FEPKGNPLSRFCQVLVASTRKWKVE-RTQGEEN-LFEVDNKESAMNGDRKILHTDGFRFL  299

Query  1194  DKAAVITTKESVRDLEE-RNINPWRLCSVTQVEEVKCILRLLPIWLCTILYSVVFTQMAS  1018
             DKAA+IT K   +  ++    NPWRLC+VTQVEEVKCILRLLPIWLCTIL+SVVFTQMAS
Sbjct  300   DKAAIITPKNYAKQGKKFYGRNPWRLCTVTQVEEVKCILRLLPIWLCTILFSVVFTQMAS  359

Query  1017  LFVEQGAAMRTNIAGFHIPPASMSSFDILSVAAFIFIYRRILDPLIASLKKTRRAQGFTE  838
             LFVEQGAAM+T I+ F+IP A MSSFDILSVA FIF+YR +LDP++A +K   + +G TE
Sbjct  360   LFVEQGAAMKTKISNFNIPAAGMSSFDILSVATFIFLYRLVLDPVVARIKS--KPKGLTE  417

Query  837   LQRMGVGLiiaimamvaagiVEHFRLKYASTDCPRC--PSSLSIFWQVPQYVLIGASEVF  664
             LQRMGVGL+IAI+AMVAAG+VE  RLK A  DCP C   SSLSIFWQVPQY+LIGASEVF
Sbjct  418   LQRMGVGLVIAILAMVAAGVVEVLRLKDAKKDCPNCVNASSLSIFWQVPQYMLIGASEVF  477

Query  663   MYVGQLEFFNGQAPEGLKSFASALCMTSISLGNYVSSLLVSIVMRISTTHRMPGWIPGNL  484
             MYVGQLEFFNGQAP+GLKSF SALCMTSISLGNYVSSLLVSIVMRIST   MPGWIPGNL
Sbjct  478   MYVGQLEFFNGQAPDGLKSFGSALCMTSISLGNYVSSLLVSIVMRISTRDDMPGWIPGNL  537

Query  483   NKGHLDRFYFLLAALTTADFVVYILCAKWYKYIEFEERNSCLKN  352
             NKGHLDRF+F+LAALTTAD VVYI+CAKWYKYI+FE R     N
Sbjct  538   NKGHLDRFFFMLAALTTADLVVYIICAKWYKYIKFEGRKGADDN  581



>ref|XP_002265725.3| PREDICTED: protein NRT1/ PTR FAMILY 7.3-like [Vitis vinifera]
Length=604

 Score =   832 bits (2150),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 434/581 (75%), Positives = 498/581 (86%), Gaps = 9/581 (2%)
 Frame = -3

Query  2097  RDEEKASREECTLDGTVDHYGRPALRSATGGWFAGVLLLVNQGLATLAFFGVGVNLVLFL  1918
             R + +  +EECT DG+VD +G PA+R+ TG W   +L+LVNQGLATLAFFGVGVNLVLFL
Sbjct  14    RGKTRNEQEECTFDGSVDRHGHPAVRARTGNWVTAILILVNQGLATLAFFGVGVNLVLFL  73

Query  1917  TRVMGQDNADAANNVSKWTGTVYLFSLLGAFLSDSYWGRYKTCAIFQLIYVVGLISVSIF  1738
             TRV+GQDNA AANNVSKWTGTVY+FSLLGAFLSDSYWGRYKTCAIFQ+I+V+GL+ +S+ 
Sbjct  74    TRVLGQDNATAANNVSKWTGTVYIFSLLGAFLSDSYWGRYKTCAIFQVIFVIGLVLLSLS  133

Query  1737  SFIFLVKPKGCGDENTPCRSPSRIHIAVYYVSIYLVALGNGGYQPNIATFGSDQFDGDHA  1558
             S+IFL+KP GCGD+  PC S S   I+ +Y+SIYL+ALGNGGYQPNIATFG+DQFD D+ 
Sbjct  134   SYIFLLKPNGCGDKEFPCGSHSTFEISFFYLSIYLIALGNGGYQPNIATFGADQFDEDNP  193

Query  1557  HESVSKVAFFSYFYLALNLGSLFSNTVLVYFEDKGMWTLGFWastvsavlalllflVGTP  1378
              ES SKVAFFSYFYLALNLGSLFSNT+L YFED G W LGFWAS+ SA+LAL+LFL G P
Sbjct  194   KESHSKVAFFSYFYLALNLGSLFSNTILGYFEDGGRWVLGFWASSASAILALILFLFGIP  253

Query  1377  RYRHFAPKGNPLSRFSQVLVASARKWNVHLPSDGDDHRLYEIQEHDSS---TRKILHTEG  1207
             RYRHF P GNPLSRF +V+VA+ RKW V +P +G+D  LYE+   D S    RK+LHT+G
Sbjct  254   RYRHFKPSGNPLSRFCRVVVAATRKWKVEMPPEGED--LYEVDGDDCSGNCRRKMLHTQG  311

Query  1206  FKFLDKAAVITTKESVRDLEERNINPWRLCSVTQVEEVKCILRLLPIWLCTILYSVVFTQ  1027
             FKFLDKAAV+T KE  ++ +E   +PWR+C+VTQVEEVKCILRLLPIWLCTILYSVVFTQ
Sbjct  312   FKFLDKAAVLTAKEREQEDKESR-SPWRICTVTQVEEVKCILRLLPIWLCTILYSVVFTQ  370

Query  1026  MASLFVEQGAAMRTNIAGFHIPPASMSSFDILSVAAFIFIYRRILDPLIASLKKTRRAQG  847
             MASLFVEQGAAM+T + GFHIPPASMSSFDI+SVAAFIFIYRR+LDPL+A LK T +A+G
Sbjct  371   MASLFVEQGAAMKTTLLGFHIPPASMSSFDIVSVAAFIFIYRRVLDPLVARLKGT-KARG  429

Query  846   FTELQRMGVGLiiaimamvaagiVEHFRLKYASTDCPRC--PSSLSIFWQVPQYVLIGAS  673
              TELQRMG+GLIIAI+AMVAAGIVE FRLKYA  DC +C   SSLSIFWQ+PQYVLIGAS
Sbjct  430   LTELQRMGIGLIIAIIAMVAAGIVEWFRLKYAKKDCRQCESESSLSIFWQIPQYVLIGAS  489

Query  672   EVFMYVGQLEFFNGQAPEGLKSFASALCMTSISLGNYVSSLLVSIVMRISTTHRMPGWIP  493
             EVFMYVGQLEFFN QAP+GLKSF SALCMTSISLGNYVSSLLV+IVM+ ST  +MPGWIP
Sbjct  490   EVFMYVGQLEFFNDQAPDGLKSFGSALCMTSISLGNYVSSLLVTIVMKFSTRDQMPGWIP  549

Query  492   GNLNKGHLDRFYFLLAALTTADFVVYILCAKWYKYIEFEER  370
              NLNKGHLDRFYFLLAALT ADF VYI+CAKWYK I+ E +
Sbjct  550   SNLNKGHLDRFYFLLAALTMADFGVYIICAKWYKSIKLEGK  590



>ref|XP_004148494.1| PREDICTED: nitrate transporter 1.5-like [Cucumis sativus]
 ref|XP_004168597.1| PREDICTED: LOW QUALITY PROTEIN: nitrate transporter 1.5-like 
[Cucumis sativus]
 gb|KGN60418.1| hypothetical protein Csa_3G904070 [Cucumis sativus]
Length=602

 Score =   828 bits (2140),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 422/586 (72%), Positives = 495/586 (84%), Gaps = 13/586 (2%)
 Frame = -3

Query  2091  EEKASREECTLDGTVDHYGRPALRSATGGWFAGVLLLVNQGLATLAFFGVGVNLVLFLTR  1912
             E K  RE CTLDGT+D +G+PA+RS +GGW AG+++L+NQGLATLAFFGVGVNLVLFLTR
Sbjct  16    ETKEEREVCTLDGTIDWHGQPAIRSKSGGWVAGIIILLNQGLATLAFFGVGVNLVLFLTR  75

Query  1911  VMGQDNADAANNVSKWTGTVYLFSLLGAFLSDSYWGRYKTCAIFQLIYVVGLISVSIFSF  1732
             V+ Q+NADAAN+VSKWTGTVY+FSL+GAFLSDSYWGRYKTCAIFQ+I+V+GL+S+SI S 
Sbjct  76    VLQQNNADAANSVSKWTGTVYIFSLVGAFLSDSYWGRYKTCAIFQIIFVIGLVSLSITSQ  135

Query  1731  IFLVKPKGCGDENTPCRSPSRIHIAVYYVSIYLVALGNGGYQPNIATFGSDQFDGDHAHE  1552
             +FL+KPKGCGDE+TPC S SR+  A++Y+SIYL+ALGNGGYQPNIATFG+DQFD + + E
Sbjct  136   LFLIKPKGCGDEDTPCESHSRLGNALFYLSIYLIALGNGGYQPNIATFGADQFDEEDSTE  195

Query  1551  SVSKVAFFSYFYLALNLGSLFSNTVLVYFEDKGMWTLGFWastvsavlalllflVGTPRY  1372
               SKVAFFSYFYLALNLGSLFSNT+L YFED+G+W LGFW S  SA  AL+LFL G PRY
Sbjct  196   GHSKVAFFSYFYLALNLGSLFSNTILGYFEDEGVWALGFWVSAGSAFAALVLFLCGIPRY  255

Query  1371  RHFAPKGNPLSRFSQVLVASARKWNVHLPSDGDDHRLYEIQEHDSST---RKILHTEGFK  1201
             RHF P GNPLSRF QV+VA+A+K  V +P+ GD+  LY +   D S    R+ILHT GFK
Sbjct  256   RHFKPSGNPLSRFCQVIVAAAKKSTVKMPASGDE--LYSLDAKDCSMNRGRRILHTHGFK  313

Query  1200  FLDKAAVITTKESVRDLEERNI-NPWRLCSVTQVEEVKCILRLLPIWLCTILYSVVFTQM  1024
             FLD+AA I++++   D + R I NPWRLC +TQVEEVKCILRLLPIWLCTI+YSVVFTQM
Sbjct  314   FLDRAAYISSRD--LDNQGRGIGNPWRLCPITQVEEVKCILRLLPIWLCTIIYSVVFTQM  371

Query  1023  ASLFVEQGAAMRTNIAGFHIPPASMSSFDILSVAAFIFIYRRILDPLIASLKKTRRAQGF  844
             ASLFVEQGAAM+T ++ FHIPPASMSSFDILSVA FIF+YRR+LDPL   L+K+  ++G 
Sbjct  372   ASLFVEQGAAMKTVVSNFHIPPASMSSFDILSVAVFIFLYRRVLDPLAGKLRKS-DSKGL  430

Query  843   TELQRMGVGLiiaimamvaagiVEHFRLKYASTDCPRC--PSSLSIFWQVPQYVLIGASE  670
             TELQRMG+GLIIA+MAMV+AGIVE +RLKYA  DC  C   SSLSIFWQVPQY  IGASE
Sbjct  431   TELQRMGIGLIIAVMAMVSAGIVECYRLKYAKGDCTHCEGSSSLSIFWQVPQYAFIGASE  490

Query  669   VFMYVGQLEFFNGQAPEGLKSFASALCMTSISLGNYVSSLLVSIVMRISTTHRMPGWIPG  490
             VFMYVGQLEFFN Q P+GLKSF SALCMTSISLGNYVSSLLV++VM+IST   MPGWIPG
Sbjct  491   VFMYVGQLEFFNAQTPDGLKSFGSALCMTSISLGNYVSSLLVTMVMKISTEDHMPGWIPG  550

Query  489   NLNKGHLDRFYFLLAALTTADFVVYILCAKWYKYIEFEERNSCLKN  352
             NLN+GHLDRFYFLLA LT  DF VYI+CA+WYK I+ E +  C +N
Sbjct  551   NLNRGHLDRFYFLLAGLTAIDFAVYIMCARWYKCIKLEGK--CEEN  594



>ref|XP_008448722.1| PREDICTED: protein NRT1/ PTR FAMILY 7.3-like [Cucumis melo]
Length=601

 Score =   828 bits (2139),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 428/584 (73%), Positives = 500/584 (86%), Gaps = 9/584 (2%)
 Frame = -3

Query  2106  KNERDEEKASREECTLDGTVDHYGRPALRSATGGWFAGVLLLVNQGLATLAFFGVGVNLV  1927
             +++  EE A+ E  TLDGTVD +GRPA+RS +G W AG+++L+NQGLATLAFFGVGVNLV
Sbjct  10    QSKLKEEIATAEGFTLDGTVDFHGRPAIRSKSGTWVAGIIILLNQGLATLAFFGVGVNLV  69

Query  1926  LFLTRVMGQDNADAANNVSKWTGTVYLFSLLGAFLSDSYWGRYKTCAIFQLIYVVGLISV  1747
             LFLTRV+ Q+NADAANNVSKWTGTVY+FSL+GAFLSDSYWGRYKTCAIFQ+I+V+GL+S+
Sbjct  70    LFLTRVLQQNNADAANNVSKWTGTVYIFSLVGAFLSDSYWGRYKTCAIFQIIFVIGLVSL  129

Query  1746  SIFSFIFLVKPKGCGDENTPCRSPSRIHIAVYYVSIYLVALGNGGYQPNIATFGSDQFDG  1567
             S+ S +FL++PKGCGDE TPC S S+  I+++Y+SIYL ALGNGGYQPNIATFG+DQFD 
Sbjct  130   SLSSHLFLIRPKGCGDEQTPCGSHSKTEISLFYLSIYLTALGNGGYQPNIATFGADQFDE  189

Query  1566  DHAHESVSKVAFFSYFYLALNLGSLFSNTVLVYFEDKGMWTLGFWastvsavlalllflV  1387
             ++  E  SKVAFFSYFYLALNLGSLFSNT+L +FED+GMW LGFW S  SA  ALLLFL+
Sbjct  190   EYQKEGHSKVAFFSYFYLALNLGSLFSNTILGFFEDEGMWALGFWVSAGSAAAALLLFLI  249

Query  1386  GTPRYRHFAPKGNPLSRFSQVLVASARKWNVHLPSDGDDHRLYEIQEHDSST---RKILH  1216
             GTPRYRHF P GNPL+R SQV+V++A+KW V +PS G+   L++    +SS    RKILH
Sbjct  250   GTPRYRHFKPTGNPLTRVSQVVVSAAKKWRVKVPSGGEG--LFDDDGKESSNNGCRKILH  307

Query  1215  TEGFKFLDKAAVITTKESVRDLEERNINPWRLCSVTQVEEVKCILRLLPIWLCTILYSVV  1036
             T GFKFLDKAA I++++ + D E+   NPWRLC +TQVEEVKCILRLLPIWLCTI+YSVV
Sbjct  308   THGFKFLDKAAYISSRD-LSDKEQGVNNPWRLCPITQVEEVKCILRLLPIWLCTIIYSVV  366

Query  1035  FTQMASLFVEQGAAMRTNIAGFHIPPASMSSFDILSVAAFIFIYRRILDPLIASLKKTRR  856
             FTQMASLFVEQGAAM+T I+ FHIPPASMSSFDILSVA FIF+YRR+LDP +  LKK+  
Sbjct  367   FTQMASLFVEQGAAMKTTISNFHIPPASMSSFDILSVALFIFLYRRVLDPFVGKLKKS-S  425

Query  855   AQGFTELQRMGVGLiiaimamvaagiVEHFRLKYASTDCPRCP--SSLSIFWQVPQYVLI  682
             + G TELQRMGVGLIIA+MAMV+AGIVE +RLKYA  DC  C   SSLSIFWQVPQY LI
Sbjct  426   STGLTELQRMGVGLIIAVMAMVSAGIVECYRLKYAQADCTHCEGSSSLSIFWQVPQYALI  485

Query  681   GASEVFMYVGQLEFFNGQAPEGLKSFASALCMTSISLGNYVSSLLVSIVMRISTTHRMPG  502
             GASEVFMYVGQLEFFN QAP+GLKSF SALCMTSISLGNYVSSLLV++VM+IST  RMPG
Sbjct  486   GASEVFMYVGQLEFFNAQAPDGLKSFGSALCMTSISLGNYVSSLLVTMVMKISTVDRMPG  545

Query  501   WIPGNLNKGHLDRFYFLLAALTTADFVVYILCAKWYKYIEFEER  370
             WIPGNLNKGHLDRFYFLLAALT  DFV+YI+CAKWYK I+ EE+
Sbjct  546   WIPGNLNKGHLDRFYFLLAALTVVDFVIYIVCAKWYKSIKLEEK  589



>ref|XP_010275292.1| PREDICTED: protein NRT1/ PTR FAMILY 7.3-like [Nelumbo nucifera]
Length=612

 Score =   828 bits (2140),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 437/593 (74%), Positives = 504/593 (85%), Gaps = 13/593 (2%)
 Frame = -3

Query  2130  NITKMFFIKNERDEEKASREECTLDGTVDHYGRPALRSATGGWFAGVLLLVNQGLATLAF  1951
              I ++  ++  + EE+  +EE TLDGTVD +GRPA+R  TG W AG+LLLVNQGLATLAF
Sbjct  11    KINELGEVEGRKMEEE--QEEYTLDGTVDLHGRPAIREKTGQWAAGILLLVNQGLATLAF  68

Query  1950  FGVGVNLVLFLTRVMGQDNADAANNVSKWTGTVYLFSLLGAFLSDSYWGRYKTCAIFQLI  1771
             FGVGVNLVLFLTRV+ QDNADAANNVSKWTGTVY+FSL+GAFLSDSYWGRYKTCAIFQ+I
Sbjct  69    FGVGVNLVLFLTRVLQQDNADAANNVSKWTGTVYIFSLVGAFLSDSYWGRYKTCAIFQVI  128

Query  1770  YVVGLISVSIFSFIFLVKPKGCGDENTPCRSPSRIHIAVYYVSIYLVALGNGGYQPNIAT  1591
             +V+GL+S+S+ S++FLVKP GCG+E  PC S S  HI ++YVSIYL+ALGNGGYQPNIAT
Sbjct  129   FVLGLVSLSLSSYLFLVKPTGCGNEQNPCGSHSAFHIGLFYVSIYLIALGNGGYQPNIAT  188

Query  1590  FGSDQFDGDHAHESVSKVAFFSYFYLALNLGSLFSNTVLVYFEDKGMWTLGFWastvsav  1411
             FG+DQFD     E  SKVAFFSYFYLALNLGSLFSNT+L YFED+GMWTLGFW S  SA 
Sbjct  189   FGADQFDEGDPREGHSKVAFFSYFYLALNLGSLFSNTILGYFEDEGMWTLGFWVSGGSAF  248

Query  1410  lalllflVGTPRYRHFAPKGNPLSRFSQVLVASARKWNVHLPSDGDDHRLYEIQEHD---  1240
             +AL+LFL+GTPRYRHF P GNPLSRF QV++A+++KW   LP  GDD  LYE+       
Sbjct  249   VALVLFLIGTPRYRHFKPSGNPLSRFCQVIIAASKKWRAELPPSGDD--LYEVDGKQCVI  306

Query  1239  SSTRKILHTEGFKFLDKAAVITTKESVRDLEERNIN-PWRLCSVTQVEEVKCILRLLPIW  1063
             +  RK+LHTEGF+FLD+AA+IT+K++   L+ + ++ PW LC++TQVEEVKCILRLLPIW
Sbjct  307   AGGRKMLHTEGFRFLDRAAIITSKDTA--LQNQGLSTPWNLCTITQVEEVKCILRLLPIW  364

Query  1062  LCTILYSVVFTQMASLFVEQGAAMRTNIAGFHIPPASMSSFDILSVAAFIFIYRRILDPL  883
             LCTI+YSVVFTQMASLFVEQGAAM+T IA F IPPASMSSFDILSVAAFIFIYRRILDPL
Sbjct  365   LCTIIYSVVFTQMASLFVEQGAAMKTTIANFRIPPASMSSFDILSVAAFIFIYRRILDPL  424

Query  882   IASLKKTRRAQGFTELQRMGVGLiiaimamvaagiVEHFRLKYASTDCPRCP--SSLSIF  709
             +  L+KT   +G TELQRMGVGL+IAIMAM++AGIVE +RLKYA  DC  C   SSLSIF
Sbjct  425   VCRLRKT-TGKGLTELQRMGVGLVIAIMAMISAGIVECYRLKYAKKDCTHCEGSSSLSIF  483

Query  708   WQVPQYVLIGASEVFMYVGQLEFFNGQAPEGLKSFASALCMTSISLGNYVSSLLVSIVMR  529
             WQ+PQYVLIGASEVFMYVGQL FFNGQAP+GLKSF SALCMTSISLGNYVSSLLVSIVM+
Sbjct  484   WQIPQYVLIGASEVFMYVGQLVFFNGQAPDGLKSFGSALCMTSISLGNYVSSLLVSIVMK  543

Query  528   ISTTHRMPGWIPGNLNKGHLDRFYFLLAALTTADFVVYILCAKWYKYIEFEER  370
             IST   MPGWIPGNLNKGHLDRFYFLLA LTTADF+VY+ CAKWYKYI+ E +
Sbjct  544   ISTEDDMPGWIPGNLNKGHLDRFYFLLAVLTTADFIVYVACAKWYKYIKLEGK  596



>ref|XP_004133948.1| PREDICTED: nitrate transporter 1.5-like [Cucumis sativus]
 ref|XP_004164748.1| PREDICTED: nitrate transporter 1.5-like [Cucumis sativus]
 gb|KGN56654.1| hypothetical protein Csa_3G127170 [Cucumis sativus]
Length=597

 Score =   828 bits (2138),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 437/581 (75%), Positives = 492/581 (85%), Gaps = 18/581 (3%)
 Frame = -3

Query  2082  ASREECTLDGTVDHYGRPALRSATGGWFAGVLLLVNQGLATLAFFGVGVNLVLFLTRVMG  1903
             + +E  TLDG VD +G PA+R  TG W +G+L+LVNQGLATLAFFGVGVNLVLFLTRV+G
Sbjct  21    SEKEVRTLDGAVDRHGHPAIRDKTGTWVSGILILVNQGLATLAFFGVGVNLVLFLTRVVG  80

Query  1902  QDNADAANNVSKWTGTVYLFSLLGAFLSDSYWGRYKTCAIFQLIYVVGLISVSIFSFIFL  1723
             QDNA+AANNVSKWTGTVY+FSLLGAFLSDSYWGR+KTCAIFQ I+VVGL S+SI S+IFL
Sbjct  81    QDNAEAANNVSKWTGTVYIFSLLGAFLSDSYWGRFKTCAIFQAIFVVGLASLSITSYIFL  140

Query  1722  VKPKGCGDENTPCRSPSRIHIAVYYVSIYLVALGNGGYQPNIATFGSDQFDGDHAHESVS  1543
             V+PKGCGDE+TPC S S +HIA++Y+S+YLVALGNGGYQPNIATFG+DQFD +   E  S
Sbjct  141   VRPKGCGDEHTPCNSHSSLHIALFYLSVYLVALGNGGYQPNIATFGADQFDEEDPKEGQS  200

Query  1542  KVAFFSYFYLALNLGSLFSNTVLVYFEDKGMWTLGFWastvsavlalllflVGTPRYRHF  1363
             K+AFFSYFYLALNLGSLFSNT+L YFED+GMW LGFWAST SA LALLLFL G PRYRHF
Sbjct  201   KIAFFSYFYLALNLGSLFSNTILGYFEDEGMWVLGFWASTASAALALLLFLCGIPRYRHF  260

Query  1362  APKGNPLSRFSQVLVASARKWNVHL-PS-----DGDDHRLYEIQEHDSSTRKILHTEGFK  1201
              PKGNPLSR SQV++A+ RKW V + P+     D DD  L       +  R+ILHT GFK
Sbjct  261   TPKGNPLSRVSQVVIAATRKWKVQMIPNSEGLFDDDDKEL-----ASNGARRILHTNGFK  315

Query  1200  FLDKAAVITTKESVRDLEERNINPWRLCSVTQVEEVKCILRLLPIWLCTILYSVVFTQMA  1021
             FLDKAAVIT+ E    L++   NPWRLC+VTQVEEVKCILRLLPIWLCTILYSVVFTQMA
Sbjct  316   FLDKAAVITSSE-YDQLDDGARNPWRLCTVTQVEEVKCILRLLPIWLCTILYSVVFTQMA  374

Query  1020  SLFVEQGAAMRTNIAGFHIPPASMSSFDILSVAAFIFIYRRILDPLIASLKKTRRAQGFT  841
             SLFV QGAAMRTNI+ FH+PPASMSSFDILSVAAFIFIYRR++DP+ A L K+      T
Sbjct  375   SLFVVQGAAMRTNISTFHVPPASMSSFDILSVAAFIFIYRRVIDPVFARLTKS----SLT  430

Query  840   ELQRMGVGLiiaimamvaagiVEHFRLKYASTDCPRC--PSSLSIFWQVPQYVLIGASEV  667
             ELQRMG+GL+IAI AMV+AG VE FRLK+A+ DC RC   SSLSIFWQ+PQYVLIGASEV
Sbjct  431   ELQRMGIGLVIAICAMVSAGTVEIFRLKHANKDCLRCDNSSSLSIFWQIPQYVLIGASEV  490

Query  666   FMYVGQLEFFNGQAPEGLKSFASALCMTSISLGNYVSSLLVSIVMRISTTHRMPGWIPGN  487
             FMYVGQLEFFN QAP+GLKSF SALCMTSIS GNYVSSLLV+IVM+IS T  MPGWIPGN
Sbjct  491   FMYVGQLEFFNSQAPDGLKSFGSALCMTSISFGNYVSSLLVTIVMKISATDNMPGWIPGN  550

Query  486   LNKGHLDRFYFLLAALTTADFVVYILCAKWYKYIEFEERNS  364
             LN+GHLDRFYFLLAALT AD VVYILCAKWYKYI+FE R +
Sbjct  551   LNRGHLDRFYFLLAALTAADLVVYILCAKWYKYIKFESREA  591



>ref|XP_002519847.1| Peptide transporter, putative [Ricinus communis]
 gb|EEF42451.1| Peptide transporter, putative [Ricinus communis]
Length=598

 Score =   827 bits (2135),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 420/595 (71%), Positives = 502/595 (84%), Gaps = 15/595 (3%)
 Frame = -3

Query  2100  ERDEEKASREECTLDGTVDHYGRPALRSATGGWFAGVLLLVNQGLATLAFFGVGVNLVLF  1921
             + D+ K  ++ECTLDGTVD +G+PA+R  +G W AG+++L+NQGLATLAFFGVGVNLVLF
Sbjct  8     KEDKLKPDQDECTLDGTVDWHGQPAMRKKSGKWVAGIIILLNQGLATLAFFGVGVNLVLF  67

Query  1920  LTRVMGQDNADAANNVSKWTGTVYLFSLLGAFLSDSYWGRYKTCAIFQLIYVVGLISVSI  1741
             LTRV+ Q+NADAANNVSKWTGTVY+FSL+GAFLSDSYWGRYKTCAIFQ+I+V+GL+ +S+
Sbjct  68    LTRVLQQNNADAANNVSKWTGTVYIFSLVGAFLSDSYWGRYKTCAIFQVIFVIGLVFLSL  127

Query  1740  FSFIFLVKPKGCGDENTPCRSPSRIHIAVYYVSIYLVALGNGGYQPNIATFGSDQFDGDH  1561
              S++FL++PKGCGDE TPC S S + +  +Y+SIYLVALGNGGYQPNIATFG+DQFD + 
Sbjct  128   SSYLFLIRPKGCGDELTPCGSHSSMEVGFFYLSIYLVALGNGGYQPNIATFGADQFDEED  187

Query  1560  AHESVSKVAFFSYFYLALNLGSLFSNTVLVYFEDKGMWTLGFWastvsavlalllflVGT  1381
               E  SKVAFFSYFYLALNLGSLFSNT+L YFED+GMW LGFWAS  SA+ AL LFL GT
Sbjct  188   PKEGHSKVAFFSYFYLALNLGSLFSNTILGYFEDEGMWALGFWASAGSALAALALFLGGT  247

Query  1380  PRYRHFAPKGNPLSRFSQVLVASARKWNVHLPSDGDDHRLYEIQEHDSS---TRKILHTE  1210
              RYRHF P GNPLSRF QV++A+ +KW+V++PSD +D  LY++   D S    R+IL+T 
Sbjct  248   ARYRHFKPTGNPLSRFCQVIIAATKKWSVNMPSDAED--LYDVNGEDCSANGNRRILYTH  305

Query  1209  GFKFLDKAAVITTKESVRDLEER---NINPWRLCSVTQVEEVKCILRLLPIWLCTILYSV  1039
             GFKFLD+AA I++    RD++E+   + NPWRLC +TQVEEVKCILRLLPIWLCTILYSV
Sbjct  306   GFKFLDRAAFISS----RDMDEQKQGSQNPWRLCPITQVEEVKCILRLLPIWLCTILYSV  361

Query  1038  VFTQMASLFVEQGAAMRTNIAGFHIPPASMSSFDILSVAAFIFIYRRILDPLIASLKKTR  859
             VFTQMASLFVEQGAAM+T ++ F IPPASMSSFDILSVA FIF+YRR+LDPLI+ ++ + 
Sbjct  362   VFTQMASLFVEQGAAMKTTVSNFRIPPASMSSFDILSVALFIFLYRRVLDPLISRIRNS-  420

Query  858   RAQGFTELQRMGVGLiiaimamvaagiVEHFRLKYASTDCPRCP--SSLSIFWQVPQYVL  685
             +++G TELQRMG+GL+IAIMAMV+AGIVE +RLKYA+ DC RC   SSLSIFWQVPQY L
Sbjct  421   KSKGLTELQRMGIGLVIAIMAMVSAGIVECYRLKYANKDCTRCEGSSSLSIFWQVPQYAL  480

Query  684   IGASEVFMYVGQLEFFNGQAPEGLKSFASALCMTSISLGNYVSSLLVSIVMRISTTHRMP  505
             IGASEVFMYVGQLEFFN Q P+GLKSF SALCMTSISLGNYVSSLLV++VM+IST   MP
Sbjct  481   IGASEVFMYVGQLEFFNAQTPDGLKSFGSALCMTSISLGNYVSSLLVTMVMKISTEDHMP  540

Query  504   GWIPGNLNKGHLDRFYFLLAALTTADFVVYILCAKWYKYIEFEERNSCLKNIGDS  340
             GWIPGNLNKGHLDRFYFLLA LTT D VVY+ CA+WYK I+ E +     N+ D+
Sbjct  541   GWIPGNLNKGHLDRFYFLLAGLTTIDLVVYMACARWYKCIKLEGKFDRNNNVEDN  595



>ref|XP_002320578.1| hypothetical protein POPTR_0014s17750g [Populus trichocarpa]
 gb|EEE98893.1| hypothetical protein POPTR_0014s17750g [Populus trichocarpa]
Length=606

 Score =   827 bits (2135),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 431/586 (74%), Positives = 497/586 (85%), Gaps = 13/586 (2%)
 Frame = -3

Query  2085  KASREECTLDGTVDHYGRPALRSATGGWFAGVLLLVNQGLATLAFFGVGVNLVLFLTRVM  1906
             K  +E CT DG+VD +G PA+R  TG WFAG+L+LVNQGLATLAFFGVGVNLVLFLTRV+
Sbjct  19    KKEQEVCTRDGSVDRHGDPAIRGRTGTWFAGILILVNQGLATLAFFGVGVNLVLFLTRVL  78

Query  1905  GQDNADAANNVSKWTGTVYLFSLLGAFLSDSYWGRYKTCAIFQLIYVVGLISVSIFSFIF  1726
             GQDNA+AANNVSKWTGTVY+FSLLGAFLSDSYWGRYKTCAIFQ I+V GL+ +S+ S++F
Sbjct  79    GQDNAEAANNVSKWTGTVYIFSLLGAFLSDSYWGRYKTCAIFQAIFVTGLVLLSLSSYLF  138

Query  1725  LVKPKGCGDENTPCRSPSRIHIAVYYVSIYLVALGNGGYQPNIATFGSDQFDGDHAHESV  1546
             L+KP+GCGDE++PC S S      +Y SIYLVALGNGGYQPNIATFG+DQFD +   E  
Sbjct  139   LLKPRGCGDEHSPCGSHSTYQNVFFYFSIYLVALGNGGYQPNIATFGADQFDEEDPKEGH  198

Query  1545  SKVAFFSYFYLALNLGSLFSNTVLVYFEDKGMWTLGFWastvsavlalllflVGTPRYRH  1366
             SK+AFFSYFYLALNLGSLFSNT+L YFED+GMW LGFWAS  SA+LAL+LFL+GTPRYRH
Sbjct  199   SKIAFFSYFYLALNLGSLFSNTILGYFEDRGMWALGFWASAGSALLALVLFLIGTPRYRH  258

Query  1365  FAPKGNPLSRFSQVLVASARKWNVH-LPSDGDDHRLYEIQEHDSST--RKILHTEGFKFL  1195
             F PKGNPLSR  QV+VA+ RKW V  +P+ GDD    ++ +  S    RKILHT+GF+FL
Sbjct  259   FTPKGNPLSRCCQVMVAATRKWKVQRMPNQGDDQFESDVPKDGSKNGDRKILHTQGFRFL  318

Query  1194  DKAAVITTKESVRDLEERNINPWRLCSVTQVEEVKCILRLLPIWLCTILYSVVFTQMASL  1015
             D+AA+IT+K+     E R  +PWR+C+V QVEE KCILRLLPIWLCTILYSVVFTQMASL
Sbjct  319   DRAAIITSKDYT---ENRIHDPWRVCTVNQVEEFKCILRLLPIWLCTILYSVVFTQMASL  375

Query  1014  FVEQGAAMRTNIAGFHIPPASMSSFDILSVAAFIFIYRRILDPLIASLKKTRRAQGFTEL  835
             FVEQGA M+T I+ FHIPPASMSSFDILSVAAFIFIYRR+LDPL+A ++K    +G TEL
Sbjct  376   FVEQGADMKTTISKFHIPPASMSSFDILSVAAFIFIYRRVLDPLVARIRKD--PKGLTEL  433

Query  834   QRMGVGLiiaimamvaagiVEHFRLKYASTDCPRC--PSSLSIFWQVPQYVLIGASEVFM  661
             QRMG+GL+IAI+AMV+AGIVE FRLKYA  DCPRC   SSLSI WQ+PQYVLIGASEVFM
Sbjct  434   QRMGIGLVIAIIAMVSAGIVELFRLKYARKDCPRCESASSLSILWQIPQYVLIGASEVFM  493

Query  660   YVGQLEFFNGQAPEGLKSFASALCMTSISLGNYVSSLLVSIVMRISTTHRMPGWIPGNLN  481
             YVGQLEFFNGQAP+GLKSF SALCMTSISLGNYVSSLLV++VM+IST   MPGWIPGNLN
Sbjct  494   YVGQLEFFNGQAPDGLKSFGSALCMTSISLGNYVSSLLVTVVMKISTRDEMPGWIPGNLN  553

Query  480   KGHLDRFYFLLAALTTADFVVYILCAKWYKYIEFE---ERNSCLKN  352
             KGHLDRF+FLLA LTTAD V+YI+CA+WYKYI+FE   E +S L N
Sbjct  554   KGHLDRFFFLLAVLTTADLVLYIICARWYKYIKFERQQEADSILSN  599



>ref|XP_011011752.1| PREDICTED: protein NRT1/ PTR FAMILY 7.2-like isoform X1 [Populus 
euphratica]
Length=616

 Score =   825 bits (2132),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 432/586 (74%), Positives = 490/586 (84%), Gaps = 13/586 (2%)
 Frame = -3

Query  2085  KASREECTLDGTVDHYGRPALRSATGGWFAGVLLLVNQGLATLAFFGVGVNLVLFLTRVM  1906
             K  +E CT DG+VD +G PA+R  TG WFAG+L+LVNQGLATLAFFGVGVNLVLFLTRV+
Sbjct  29    KKEQEVCTRDGSVDRHGDPAIRGRTGTWFAGILILVNQGLATLAFFGVGVNLVLFLTRVL  88

Query  1905  GQDNADAANNVSKWTGTVYLFSLLGAFLSDSYWGRYKTCAIFQLIYVVGLISVSIFSFIF  1726
             GQDNADAANNVSKWTGTVY+FSLLGAFLSDSYWGRYKTCAIFQ I+V GL+ +S+ S++F
Sbjct  89    GQDNADAANNVSKWTGTVYIFSLLGAFLSDSYWGRYKTCAIFQAIFVTGLVLLSLSSYLF  148

Query  1725  LVKPKGCGDENTPCRSPSRIHIAVYYVSIYLVALGNGGYQPNIATFGSDQFDGDHAHESV  1546
             L+KP+GCGDE +PC S S      +Y SIYLVALGNGGYQPNIATFG+DQFD +   E  
Sbjct  149   LLKPRGCGDERSPCGSHSTYQNVFFYFSIYLVALGNGGYQPNIATFGADQFDEEDPKEGR  208

Query  1545  SKVAFFSYFYLALNLGSLFSNTVLVYFEDKGMWTLGFWastvsavlalllflVGTPRYRH  1366
             SK+AFFSYFYLALNLGSLFSNT+L YFED+G+W LGFWAS  SA LAL+LFL+GTPRYRH
Sbjct  209   SKIAFFSYFYLALNLGSLFSNTILGYFEDRGLWALGFWASAGSAFLALVLFLIGTPRYRH  268

Query  1365  FAPKGNPLSRFSQVLVASARKWNVHLPSDGDDHRLYEIQEHDSST---RKILHTEGFKFL  1195
             F PKGNPLSR  QV+VA+ RKW V    + DD +      +D S    RKILHT+GF+FL
Sbjct  269   FTPKGNPLSRCCQVIVAATRKWKVQRMPNQDDDQFESDVPNDRSKIRDRKILHTQGFRFL  328

Query  1194  DKAAVITTKESVRDLEERNINPWRLCSVTQVEEVKCILRLLPIWLCTILYSVVFTQMASL  1015
             D+AA+IT+K+     E R  +PWR+C+VTQVEE KCILRLLPIWLCTILYSVVFTQMASL
Sbjct  329   DRAAIITSKDYT---ENRIHDPWRVCTVTQVEEFKCILRLLPIWLCTILYSVVFTQMASL  385

Query  1014  FVEQGAAMRTNIAGFHIPPASMSSFDILSVAAFIFIYRRILDPLIASLKKTRRAQGFTEL  835
             FVEQGA M T I+ FHIPPASMSSFDILSVAAFIFIYRR+LDPL+A ++K    +G TEL
Sbjct  386   FVEQGADMETTISKFHIPPASMSSFDILSVAAFIFIYRRVLDPLVARIRKD--PKGLTEL  443

Query  834   QRMGVGLiiaimamvaagiVEHFRLKYASTDCPRC--PSSLSIFWQVPQYVLIGASEVFM  661
             QRMG+GL+IAI+AMV+AGIVE FRLKYA  DCP C   SSLSI WQ+PQYVLIGASEVFM
Sbjct  444   QRMGIGLVIAIIAMVSAGIVELFRLKYARKDCPSCESASSLSILWQIPQYVLIGASEVFM  503

Query  660   YVGQLEFFNGQAPEGLKSFASALCMTSISLGNYVSSLLVSIVMRISTTHRMPGWIPGNLN  481
             YVGQLEFFNGQAP+GLKSF SALCMTSISLGNYVSSLLV++VM+IST   MPGWIPGNLN
Sbjct  504   YVGQLEFFNGQAPDGLKSFGSALCMTSISLGNYVSSLLVTVVMKISTRDEMPGWIPGNLN  563

Query  480   KGHLDRFYFLLAALTTADFVVYILCAKWYKYIEFE---ERNSCLKN  352
             KGHLDRFYFLLA LTTAD VVYI+CA+WYKYI FE   E +S L N
Sbjct  564   KGHLDRFYFLLAVLTTADLVVYIICARWYKYIRFERQQEADSILSN  609



>ref|XP_011011755.1| PREDICTED: protein NRT1/ PTR FAMILY 7.2-like isoform X4 [Populus 
euphratica]
Length=601

 Score =   825 bits (2131),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 438/604 (73%), Positives = 496/604 (82%), Gaps = 19/604 (3%)
 Frame = -3

Query  2139  AFLNITKMFFIKNERDEEKASREECTLDGTVDHYGRPALRSATGGWFAGVLLLVNQGLAT  1960
             A LNI K      E    K  +E CT DG+VD +G PA+R  TG WFAG+L+LVNQGLAT
Sbjct  2     ACLNICK------EGKLVKKEQEVCTRDGSVDRHGDPAIRGRTGTWFAGILILVNQGLAT  55

Query  1959  LAFFGVGVNLVLFLTRVMGQDNADAANNVSKWTGTVYLFSLLGAFLSDSYWGRYKTCAIF  1780
             LAFFGVGVNLVLFLTRV+GQDNADAANNVSKWTGTVY+FSLLGAFLSDSYWGRYKTCAIF
Sbjct  56    LAFFGVGVNLVLFLTRVLGQDNADAANNVSKWTGTVYIFSLLGAFLSDSYWGRYKTCAIF  115

Query  1779  QLIYVVGLISVSIFSFIFLVKPKGCGDENTPCRSPSRIHIAVYYVSIYLVALGNGGYQPN  1600
             Q I+V GL+ +S+ S++FL+KP+GCGDE +PC S S      +Y SIYLVALGNGGYQPN
Sbjct  116   QAIFVTGLVLLSLSSYLFLLKPRGCGDERSPCGSHSTYQNVFFYFSIYLVALGNGGYQPN  175

Query  1599  IATFGSDQFDGDHAHESVSKVAFFSYFYLALNLGSLFSNTVLVYFEDKGMWTLGFWastv  1420
             IATFG+DQFD +   E  SK+AFFSYFYLALNLGSLFSNT+L YFED+G+W LGFWAS  
Sbjct  176   IATFGADQFDEEDPKEGRSKIAFFSYFYLALNLGSLFSNTILGYFEDRGLWALGFWASAG  235

Query  1419  savlalllflVGTPRYRHFAPKGNPLSRFSQVLVASARKWNVHLPSDGDDHRLYEIQEHD  1240
             SA LAL+LFL+GTPRYRHF PKGNPLSR  QV+VA+ RKW V    + DD +      +D
Sbjct  236   SAFLALVLFLIGTPRYRHFTPKGNPLSRCCQVIVAATRKWKVQRMPNQDDDQFESDVPND  295

Query  1239  SST---RKILHTEGFKFLDKAAVITTKESVRDLEERNINPWRLCSVTQVEEVKCILRLLP  1069
              S    RKILHT+GF+FLD+AA+IT+K+     E R  +PWR+C+VTQVEE KCILRLLP
Sbjct  296   RSKIRDRKILHTQGFRFLDRAAIITSKDYT---ENRIHDPWRVCTVTQVEEFKCILRLLP  352

Query  1068  IWLCTILYSVVFTQMASLFVEQGAAMRTNIAGFHIPPASMSSFDILSVAAFIFIYRRILD  889
             IWLCTILYSVVFTQMASLFVEQGA M T I+ FHIPPASMSSFDILSVAAFIFIYRR+LD
Sbjct  353   IWLCTILYSVVFTQMASLFVEQGADMETTISKFHIPPASMSSFDILSVAAFIFIYRRVLD  412

Query  888   PLIASLKKTRRAQGFTELQRMGVGLiiaimamvaagiVEHFRLKYASTDCPRC--PSSLS  715
             PL+A ++K    +G TELQRMG+GL+IAI+AMV+AGIVE FRLKYA  DCP C   SSLS
Sbjct  413   PLVARIRKD--PKGLTELQRMGIGLVIAIIAMVSAGIVELFRLKYARKDCPSCESASSLS  470

Query  714   IFWQVPQYVLIGASEVFMYVGQLEFFNGQAPEGLKSFASALCMTSISLGNYVSSLLVSIV  535
             I WQ+PQYVLIGASEVFMYVGQLEFFNGQAP+GLKSF SALCMTSISLGNYVSSLLV++V
Sbjct  471   ILWQIPQYVLIGASEVFMYVGQLEFFNGQAPDGLKSFGSALCMTSISLGNYVSSLLVTVV  530

Query  534   MRISTTHRMPGWIPGNLNKGHLDRFYFLLAALTTADFVVYILCAKWYKYIEFE---ERNS  364
             M+IST   MPGWIPGNLNKGHLDRFYFLLA LTTAD VVYI+CA+WYKYI FE   E +S
Sbjct  531   MKISTRDEMPGWIPGNLNKGHLDRFYFLLAVLTTADLVVYIICARWYKYIRFERQQEADS  590

Query  363   CLKN  352
              L N
Sbjct  591   ILSN  594



>ref|XP_011011754.1| PREDICTED: protein NRT1/ PTR FAMILY 7.2-like isoform X3 [Populus 
euphratica]
Length=606

 Score =   825 bits (2130),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 435/597 (73%), Positives = 494/597 (83%), Gaps = 17/597 (3%)
 Frame = -3

Query  2106  KNERDEE----KASREECTLDGTVDHYGRPALRSATGGWFAGVLLLVNQGLATLAFFGVG  1939
             K ER  +    K  +E CT DG+VD +G PA+R  TG WFAG+L+LVNQGLATLAFFGVG
Sbjct  8     KEERSVQGKLVKKEQEVCTRDGSVDRHGDPAIRGRTGTWFAGILILVNQGLATLAFFGVG  67

Query  1938  VNLVLFLTRVMGQDNADAANNVSKWTGTVYLFSLLGAFLSDSYWGRYKTCAIFQLIYVVG  1759
             VNLVLFLTRV+GQDNADAANNVSKWTGTVY+FSLLGAFLSDSYWGRYKTCAIFQ I+V G
Sbjct  68    VNLVLFLTRVLGQDNADAANNVSKWTGTVYIFSLLGAFLSDSYWGRYKTCAIFQAIFVTG  127

Query  1758  LISVSIFSFIFLVKPKGCGDENTPCRSPSRIHIAVYYVSIYLVALGNGGYQPNIATFGSD  1579
             L+ +S+ S++FL+KP+GCGDE +PC S S      +Y SIYLVALGNGGYQPNIATFG+D
Sbjct  128   LVLLSLSSYLFLLKPRGCGDERSPCGSHSTYQNVFFYFSIYLVALGNGGYQPNIATFGAD  187

Query  1578  QFDGDHAHESVSKVAFFSYFYLALNLGSLFSNTVLVYFEDKGMWTLGFWastvsavlall  1399
             QFD +   E  SK+AFFSYFYLALNLGSLFSNT+L YFED+G+W LGFWAS  SA LAL+
Sbjct  188   QFDEEDPKEGRSKIAFFSYFYLALNLGSLFSNTILGYFEDRGLWALGFWASAGSAFLALV  247

Query  1398  lflVGTPRYRHFAPKGNPLSRFSQVLVASARKWNVHLPSDGDDHRLYEIQEHDSST---R  1228
             LFL+GTPRYRHF PKGNPLSR  QV+VA+ RKW V    + DD +      +D S    R
Sbjct  248   LFLIGTPRYRHFTPKGNPLSRCCQVIVAATRKWKVQRMPNQDDDQFESDVPNDRSKIRDR  307

Query  1227  KILHTEGFKFLDKAAVITTKESVRDLEERNINPWRLCSVTQVEEVKCILRLLPIWLCTIL  1048
             KILHT+GF+FLD+AA+IT+K+     E R  +PWR+C+VTQVEE KCILRLLPIWLCTIL
Sbjct  308   KILHTQGFRFLDRAAIITSKDYT---ENRIHDPWRVCTVTQVEEFKCILRLLPIWLCTIL  364

Query  1047  YSVVFTQMASLFVEQGAAMRTNIAGFHIPPASMSSFDILSVAAFIFIYRRILDPLIASLK  868
             YSVVFTQMASLFVEQGA M T I+ FHIPPASMSSFDILSVAAFIFIYRR+LDPL+A ++
Sbjct  365   YSVVFTQMASLFVEQGADMETTISKFHIPPASMSSFDILSVAAFIFIYRRVLDPLVARIR  424

Query  867   KTRRAQGFTELQRMGVGLiiaimamvaagiVEHFRLKYASTDCPRC--PSSLSIFWQVPQ  694
             K    +G TELQRMG+GL+IAI+AMV+AGIVE FRLKYA  DCP C   SSLSI WQ+PQ
Sbjct  425   KD--PKGLTELQRMGIGLVIAIIAMVSAGIVELFRLKYARKDCPSCESASSLSILWQIPQ  482

Query  693   YVLIGASEVFMYVGQLEFFNGQAPEGLKSFASALCMTSISLGNYVSSLLVSIVMRISTTH  514
             YVLIGASEVFMYVGQLEFFNGQAP+GLKSF SALCMTSISLGNYVSSLLV++VM+IST  
Sbjct  483   YVLIGASEVFMYVGQLEFFNGQAPDGLKSFGSALCMTSISLGNYVSSLLVTVVMKISTRD  542

Query  513   RMPGWIPGNLNKGHLDRFYFLLAALTTADFVVYILCAKWYKYIEFE---ERNSCLKN  352
              MPGWIPGNLNKGHLDRFYFLLA LTTAD VVYI+CA+WYKYI FE   E +S L N
Sbjct  543   EMPGWIPGNLNKGHLDRFYFLLAVLTTADLVVYIICARWYKYIRFERQQEADSILSN  599



>ref|XP_004163981.1| PREDICTED: nitrate transporter 1.5-like [Cucumis sativus]
 gb|KGN55790.1| hypothetical protein Csa_3G015860 [Cucumis sativus]
Length=601

 Score =   824 bits (2128),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 426/584 (73%), Positives = 500/584 (86%), Gaps = 9/584 (2%)
 Frame = -3

Query  2106  KNERDEEKASREECTLDGTVDHYGRPALRSATGGWFAGVLLLVNQGLATLAFFGVGVNLV  1927
             +++  EE A+ E  TLDGTVD +GRPA+RS +G W AG+++L+NQGLATLAFFGVGVNLV
Sbjct  10    QSKLKEEIATAEGFTLDGTVDFHGRPAIRSKSGTWVAGIIILLNQGLATLAFFGVGVNLV  69

Query  1926  LFLTRVMGQDNADAANNVSKWTGTVYLFSLLGAFLSDSYWGRYKTCAIFQLIYVVGLISV  1747
             LFLTRV+ Q+NADAANNVSKWTGTVY+FSL+GAFLSDSYWGRYKTCAIFQ+I+V+GL+S+
Sbjct  70    LFLTRVLQQNNADAANNVSKWTGTVYIFSLVGAFLSDSYWGRYKTCAIFQIIFVIGLVSL  129

Query  1746  SIFSFIFLVKPKGCGDENTPCRSPSRIHIAVYYVSIYLVALGNGGYQPNIATFGSDQFDG  1567
             S+ S +FL++PKGCGDE TPC S S+  I+++Y+SIYL ALGNGGYQPNIATFG+DQFD 
Sbjct  130   SLSSHLFLIRPKGCGDEQTPCGSHSKTEISLFYLSIYLTALGNGGYQPNIATFGADQFDE  189

Query  1566  DHAHESVSKVAFFSYFYLALNLGSLFSNTVLVYFEDKGMWTLGFWastvsavlalllflV  1387
             ++  E  SKVAFFSYFYLALNLGSLFSNT+L +FED+GMW LGFW ST SA  ALLLFL+
Sbjct  190   EYQKEGHSKVAFFSYFYLALNLGSLFSNTILGFFEDEGMWALGFWVSTGSAAAALLLFLI  249

Query  1386  GTPRYRHFAPKGNPLSRFSQVLVASARKWNVHLPSDGDDHRLYEIQEHDSST---RKILH  1216
             GTPRYR+F P GNPL R SQV+V++A+KW + +PS G+   L++    +SS    RKILH
Sbjct  250   GTPRYRYFKPTGNPLMRVSQVVVSAAKKWRIKVPSGGEG--LFDDDGKESSNNGCRKILH  307

Query  1215  TEGFKFLDKAAVITTKESVRDLEERNINPWRLCSVTQVEEVKCILRLLPIWLCTILYSVV  1036
             T GFKFLDKAA I++++ + D E+   NPWRLC +TQVEEVKCILRLLPIWLCTI+YSVV
Sbjct  308   THGFKFLDKAAYISSRD-LSDKEQGVNNPWRLCPITQVEEVKCILRLLPIWLCTIIYSVV  366

Query  1035  FTQMASLFVEQGAAMRTNIAGFHIPPASMSSFDILSVAAFIFIYRRILDPLIASLKKTRR  856
             FTQMASLFVEQGAAM+T ++ FHIPPASMSSFDILSVA FIF+YRR+LDP +  LKK+  
Sbjct  367   FTQMASLFVEQGAAMKTTVSNFHIPPASMSSFDILSVALFIFLYRRVLDPFVGKLKKS-S  425

Query  855   AQGFTELQRMGVGLiiaimamvaagiVEHFRLKYASTDCPRCP--SSLSIFWQVPQYVLI  682
             + G TELQRMGVGLIIA+MAMV+AGIVE +RLKYA  DC  C   SSLSIFWQVPQY LI
Sbjct  426   STGLTELQRMGVGLIIAVMAMVSAGIVECYRLKYAQADCTHCEGSSSLSIFWQVPQYALI  485

Query  681   GASEVFMYVGQLEFFNGQAPEGLKSFASALCMTSISLGNYVSSLLVSIVMRISTTHRMPG  502
             GASEVFMYVGQLEFFN QAP+GLKSF SALCMTSISLGNYVSSLLV++VM+IST  RMPG
Sbjct  486   GASEVFMYVGQLEFFNAQAPDGLKSFGSALCMTSISLGNYVSSLLVTMVMKISTVDRMPG  545

Query  501   WIPGNLNKGHLDRFYFLLAALTTADFVVYILCAKWYKYIEFEER  370
             WIPGNLNKGHLDRFYFLLAALT  DFV+YI+CAKWYK I+ EE+
Sbjct  546   WIPGNLNKGHLDRFYFLLAALTVVDFVIYIVCAKWYKSIKLEEK  589



>ref|XP_011011753.1| PREDICTED: protein NRT1/ PTR FAMILY 7.2-like isoform X2 [Populus 
euphratica]
Length=611

 Score =   824 bits (2128),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 432/586 (74%), Positives = 490/586 (84%), Gaps = 13/586 (2%)
 Frame = -3

Query  2085  KASREECTLDGTVDHYGRPALRSATGGWFAGVLLLVNQGLATLAFFGVGVNLVLFLTRVM  1906
             K  +E CT DG+VD +G PA+R  TG WFAG+L+LVNQGLATLAFFGVGVNLVLFLTRV+
Sbjct  24    KKEQEVCTRDGSVDRHGDPAIRGRTGTWFAGILILVNQGLATLAFFGVGVNLVLFLTRVL  83

Query  1905  GQDNADAANNVSKWTGTVYLFSLLGAFLSDSYWGRYKTCAIFQLIYVVGLISVSIFSFIF  1726
             GQDNADAANNVSKWTGTVY+FSLLGAFLSDSYWGRYKTCAIFQ I+V GL+ +S+ S++F
Sbjct  84    GQDNADAANNVSKWTGTVYIFSLLGAFLSDSYWGRYKTCAIFQAIFVTGLVLLSLSSYLF  143

Query  1725  LVKPKGCGDENTPCRSPSRIHIAVYYVSIYLVALGNGGYQPNIATFGSDQFDGDHAHESV  1546
             L+KP+GCGDE +PC S S      +Y SIYLVALGNGGYQPNIATFG+DQFD +   E  
Sbjct  144   LLKPRGCGDERSPCGSHSTYQNVFFYFSIYLVALGNGGYQPNIATFGADQFDEEDPKEGR  203

Query  1545  SKVAFFSYFYLALNLGSLFSNTVLVYFEDKGMWTLGFWastvsavlalllflVGTPRYRH  1366
             SK+AFFSYFYLALNLGSLFSNT+L YFED+G+W LGFWAS  SA LAL+LFL+GTPRYRH
Sbjct  204   SKIAFFSYFYLALNLGSLFSNTILGYFEDRGLWALGFWASAGSAFLALVLFLIGTPRYRH  263

Query  1365  FAPKGNPLSRFSQVLVASARKWNVHLPSDGDDHRLYEIQEHDSST---RKILHTEGFKFL  1195
             F PKGNPLSR  QV+VA+ RKW V    + DD +      +D S    RKILHT+GF+FL
Sbjct  264   FTPKGNPLSRCCQVIVAATRKWKVQRMPNQDDDQFESDVPNDRSKIRDRKILHTQGFRFL  323

Query  1194  DKAAVITTKESVRDLEERNINPWRLCSVTQVEEVKCILRLLPIWLCTILYSVVFTQMASL  1015
             D+AA+IT+K+     E R  +PWR+C+VTQVEE KCILRLLPIWLCTILYSVVFTQMASL
Sbjct  324   DRAAIITSKDYT---ENRIHDPWRVCTVTQVEEFKCILRLLPIWLCTILYSVVFTQMASL  380

Query  1014  FVEQGAAMRTNIAGFHIPPASMSSFDILSVAAFIFIYRRILDPLIASLKKTRRAQGFTEL  835
             FVEQGA M T I+ FHIPPASMSSFDILSVAAFIFIYRR+LDPL+A ++K    +G TEL
Sbjct  381   FVEQGADMETTISKFHIPPASMSSFDILSVAAFIFIYRRVLDPLVARIRKD--PKGLTEL  438

Query  834   QRMGVGLiiaimamvaagiVEHFRLKYASTDCPRC--PSSLSIFWQVPQYVLIGASEVFM  661
             QRMG+GL+IAI+AMV+AGIVE FRLKYA  DCP C   SSLSI WQ+PQYVLIGASEVFM
Sbjct  439   QRMGIGLVIAIIAMVSAGIVELFRLKYARKDCPSCESASSLSILWQIPQYVLIGASEVFM  498

Query  660   YVGQLEFFNGQAPEGLKSFASALCMTSISLGNYVSSLLVSIVMRISTTHRMPGWIPGNLN  481
             YVGQLEFFNGQAP+GLKSF SALCMTSISLGNYVSSLLV++VM+IST   MPGWIPGNLN
Sbjct  499   YVGQLEFFNGQAPDGLKSFGSALCMTSISLGNYVSSLLVTVVMKISTRDEMPGWIPGNLN  558

Query  480   KGHLDRFYFLLAALTTADFVVYILCAKWYKYIEFE---ERNSCLKN  352
             KGHLDRFYFLLA LTTAD VVYI+CA+WYKYI FE   E +S L N
Sbjct  559   KGHLDRFYFLLAVLTTADLVVYIICARWYKYIRFERQQEADSILSN  604



>ref|XP_006368434.1| proton-dependent oligopeptide transport family protein [Populus 
trichocarpa]
 gb|ERP65003.1| proton-dependent oligopeptide transport family protein [Populus 
trichocarpa]
Length=598

 Score =   823 bits (2125),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 411/577 (71%), Positives = 489/577 (85%), Gaps = 8/577 (1%)
 Frame = -3

Query  2085  KASREECTLDGTVDHYGRPALRSATGGWFAGVLLLVNQGLATLAFFGVGVNLVLFLTRVM  1906
             K  REECT DGTVD +GRPA++  +G W AG+++L+NQGLATLAFFGVGVNLVLFLTRV+
Sbjct  13    KEGREECTFDGTVDWHGRPAIKDKSGQWVAGIIILLNQGLATLAFFGVGVNLVLFLTRVL  72

Query  1905  GQDNADAANNVSKWTGTVYLFSLLGAFLSDSYWGRYKTCAIFQLIYVVGLISVSIFSFIF  1726
              Q NADAANNVSKWTGTVY+FSL+GAFLSDSYWGRYKTCAIFQ+I+V+GL+ +S+ S++F
Sbjct  73    QQSNADAANNVSKWTGTVYIFSLVGAFLSDSYWGRYKTCAIFQVIFVIGLVILSLSSYLF  132

Query  1725  LVKPKGCGDENTPCRSPSRIHIAVYYVSIYLVALGNGGYQPNIATFGSDQFDGDHAHESV  1546
             L++PKGCG+E TPC S S + ++++Y+SIYLVALGNGGYQPNIATFG+DQFD +   E  
Sbjct  133   LIRPKGCGNELTPCGSHSSMEVSLFYLSIYLVALGNGGYQPNIATFGADQFDEEDPREGH  192

Query  1545  SKVAFFSYFYLALNLGSLFSNTVLVYFEDKGMWTLGFWastvsavlalllflVGTPRYRH  1366
             SKVAFFSYFYLALNLGSLFSNT+L YFED+G+W LGFWAS  SA  AL+LFL GT RYRH
Sbjct  193   SKVAFFSYFYLALNLGSLFSNTILGYFEDEGVWALGFWASAGSAFAALVLFLGGTSRYRH  252

Query  1365  FAPKGNPLSRFSQVLVASARKWNVHLPSDGDDHRLYEIQEHDSS---TRKILHTEGFKFL  1195
             F P GNPLSRF QV++A+ +KW + +P DG++  LY +   D S    RKILHT+GFKFL
Sbjct  253   FKPSGNPLSRFCQVIIAAMKKWKLEMPRDGEEE-LYNVHAKDCSMNGNRKILHTDGFKFL  311

Query  1194  DKAAVITTKESVRDLEERNINPWRLCSVTQVEEVKCILRLLPIWLCTILYSVVFTQMASL  1015
             D+AA I++++ + D +    NPWRLC +TQVEEVKCILRLLPIWLCTI+YSVVFTQMASL
Sbjct  312   DRAAFISSRD-IDDQKRGCRNPWRLCPITQVEEVKCILRLLPIWLCTIIYSVVFTQMASL  370

Query  1014  FVEQGAAMRTNIAGFHIPPASMSSFDILSVAAFIFIYRRILDPLIASLKKTRRAQGFTEL  835
             FVEQGAAM+T ++ F IPPASMSSFDILSVA FIF+YRR+LDPL++ +KKT  ++G TEL
Sbjct  371   FVEQGAAMKTTVSNFKIPPASMSSFDILSVAFFIFLYRRVLDPLVSRVKKT-GSKGLTEL  429

Query  834   QRMGVGLiiaimamvaagiVEHFRLKYASTDCPRCP--SSLSIFWQVPQYVLIGASEVFM  661
             QRMGVGL+IAI+AM++AG+VE +RL+YA  DC  C   SS+SIFWQVPQY LIGASEVFM
Sbjct  430   QRMGVGLVIAIVAMISAGLVECYRLRYARKDCTHCEGSSSMSIFWQVPQYALIGASEVFM  489

Query  660   YVGQLEFFNGQAPEGLKSFASALCMTSISLGNYVSSLLVSIVMRISTTHRMPGWIPGNLN  481
             YVGQLEFFN Q P+GLKSF SALCMTSISLGNYVSSLLV++VM+IST   MPGWIPGNLN
Sbjct  490   YVGQLEFFNAQTPDGLKSFGSALCMTSISLGNYVSSLLVTMVMKISTEDHMPGWIPGNLN  549

Query  480   KGHLDRFYFLLAALTTADFVVYILCAKWYKYIEFEER  370
             KGHLDRFYFLLA LTT D VVYI CA+WYK I+ E +
Sbjct  550   KGHLDRFYFLLATLTTIDLVVYIACARWYKSIQLEGK  586



>ref|XP_008465942.1| PREDICTED: protein NRT1/ PTR FAMILY 7.3-like [Cucumis melo]
Length=601

 Score =   823 bits (2125),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 422/586 (72%), Positives = 494/586 (84%), Gaps = 13/586 (2%)
 Frame = -3

Query  2091  EEKASREECTLDGTVDHYGRPALRSATGGWFAGVLLLVNQGLATLAFFGVGVNLVLFLTR  1912
             E K  RE CTLDGT+D +G+PA+RS +GGW AG+++L+NQGLATLAFFGVGVNLVLFLTR
Sbjct  15    ETKEEREVCTLDGTIDWHGQPAIRSKSGGWVAGIIILLNQGLATLAFFGVGVNLVLFLTR  74

Query  1911  VMGQDNADAANNVSKWTGTVYLFSLLGAFLSDSYWGRYKTCAIFQLIYVVGLISVSIFSF  1732
             V+ Q+NADAAN+VSKWTGTVY+FSL+GAFLSDSYWGRYKTCAIFQ+I+V+GL+S+SI S 
Sbjct  75    VLQQNNADAANSVSKWTGTVYIFSLVGAFLSDSYWGRYKTCAIFQIIFVIGLVSLSITSQ  134

Query  1731  IFLVKPKGCGDENTPCRSPSRIHIAVYYVSIYLVALGNGGYQPNIATFGSDQFDGDHAHE  1552
             +FL+KPKGCGDE+TPC S SR+  A++Y+SIYL+ALGNGGYQPNIAT G+DQFD + + E
Sbjct  135   LFLIKPKGCGDEDTPCESHSRLGNALFYLSIYLIALGNGGYQPNIATLGADQFDEEDSTE  194

Query  1551  SVSKVAFFSYFYLALNLGSLFSNTVLVYFEDKGMWTLGFWastvsavlalllflVGTPRY  1372
               SKVAFFSYFYLALNLGSLFSNT+L YFED+G+W LGFW ST SA  AL+LFL GTPRY
Sbjct  195   GHSKVAFFSYFYLALNLGSLFSNTILGYFEDEGVWALGFWVSTGSAFAALVLFLCGTPRY  254

Query  1371  RHFAPKGNPLSRFSQVLVASARKWNVHLPSDGDDHRLYEIQEHDSST---RKILHTEGFK  1201
             RHF   GNPLSRF QV+VA+A+K  V +P+  D+  LY +   D S    R+ILHT GFK
Sbjct  255   RHFKASGNPLSRFCQVIVAAAKKSTVKMPASEDE--LYSLDAKDCSMNRGRRILHTHGFK  312

Query  1200  FLDKAAVITTKESVRDLEERNI-NPWRLCSVTQVEEVKCILRLLPIWLCTILYSVVFTQM  1024
             FLD+AA I++++   D + R I NPWRLC +TQVEEVKCILRLLPIWLCTI+YSVVFTQM
Sbjct  313   FLDRAAYISSRD--LDNQGRGIDNPWRLCPITQVEEVKCILRLLPIWLCTIIYSVVFTQM  370

Query  1023  ASLFVEQGAAMRTNIAGFHIPPASMSSFDILSVAAFIFIYRRILDPLIASLKKTRRAQGF  844
             ASLFVEQGAAM+T I+ FHIPPASMSSFDILSVA FIF+YRR+L+PL   L+K+  ++G 
Sbjct  371   ASLFVEQGAAMKTVISNFHIPPASMSSFDILSVAVFIFLYRRVLEPLAGKLRKS-DSKGL  429

Query  843   TELQRMGVGLiiaimamvaagiVEHFRLKYASTDCPRCP--SSLSIFWQVPQYVLIGASE  670
             TELQRMG+GLIIA+MAMV+AGIVE +RLKYA  DC  C   SSLSIFWQVPQY  IGASE
Sbjct  430   TELQRMGIGLIIAVMAMVSAGIVECYRLKYAKGDCTHCEGSSSLSIFWQVPQYAFIGASE  489

Query  669   VFMYVGQLEFFNGQAPEGLKSFASALCMTSISLGNYVSSLLVSIVMRISTTHRMPGWIPG  490
             VFMYVGQLEFFN Q P+GLKSF SALCMTSISLGNYVSSLLV++VM+IST   MPGWIPG
Sbjct  490   VFMYVGQLEFFNAQTPDGLKSFGSALCMTSISLGNYVSSLLVTMVMKISTEDHMPGWIPG  549

Query  489   NLNKGHLDRFYFLLAALTTADFVVYILCAKWYKYIEFEERNSCLKN  352
             NLN+GHLDRFYFLLA LT  DF VYILCA+WYK I+ E +  C +N
Sbjct  550   NLNRGHLDRFYFLLAGLTAIDFAVYILCARWYKCIKLEGK--CEEN  593



>emb|CAN83927.1| hypothetical protein VITISV_031037 [Vitis vinifera]
Length=587

 Score =   821 bits (2120),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 429/574 (75%), Positives = 492/574 (86%), Gaps = 9/574 (2%)
 Frame = -3

Query  2106  KNERDEEKASREECTLDGTVDHYGRPALRSATGGWFAGVLLLVNQGLATLAFFGVGVNLV  1927
             +  R + +  +EECT DG+VD +G PA+R+ TG W   +L+LVNQGLATLAFFGVGVNLV
Sbjct  11    QKGRGKTRNEQEECTFDGSVDRHGHPAVRARTGNWVTAILILVNQGLATLAFFGVGVNLV  70

Query  1926  LFLTRVMGQDNADAANNVSKWTGTVYLFSLLGAFLSDSYWGRYKTCAIFQLIYVVGLISV  1747
             LFLTRV+GQDNA AANNVSKWTGTVY+FSLLGAFLSDSYWGRYKTCAIFQ+I+V+GL+ +
Sbjct  71    LFLTRVLGQDNATAANNVSKWTGTVYIFSLLGAFLSDSYWGRYKTCAIFQVIFVIGLVLL  130

Query  1746  SIFSFIFLVKPKGCGDENTPCRSPSRIHIAVYYVSIYLVALGNGGYQPNIATFGSDQFDG  1567
             S+ S+IFL+KP GCGD+  PC S S   I+ +Y+SIYL+ALGNGGYQPNIATFG+DQFD 
Sbjct  131   SLSSYIFLLKPNGCGDKEFPCGSHSTFEISFFYLSIYLIALGNGGYQPNIATFGADQFDE  190

Query  1566  DHAHESVSKVAFFSYFYLALNLGSLFSNTVLVYFEDKGMWTLGFWastvsavlalllflV  1387
             D+  ES SKVAFFSYFYLALNLGSLFSNT+L YFED G W LGFWAS+ SA+LAL+LFL 
Sbjct  191   DNPKESHSKVAFFSYFYLALNLGSLFSNTILGYFEDGGRWVLGFWASSASAILALILFLF  250

Query  1386  GTPRYRHFAPKGNPLSRFSQVLVASARKWNVHLPSDGDDHRLYEIQEHDSS---TRKILH  1216
             G PRYRHF P GNPLSRF +V+VA+ RKW V +P +G+D  LYE+   D S    RK+LH
Sbjct  251   GIPRYRHFKPSGNPLSRFCRVVVAATRKWKVEMPPEGED--LYEVDGDDCSGNCRRKMLH  308

Query  1215  TEGFKFLDKAAVITTKESVRDLEERNINPWRLCSVTQVEEVKCILRLLPIWLCTILYSVV  1036
             T+GFKFLDKAAV+T KE  ++ +E   +PWR+C+VTQVEEVKCILRLLPIWLCTILYSVV
Sbjct  309   TQGFKFLDKAAVLTAKEREQEDKESR-SPWRICTVTQVEEVKCILRLLPIWLCTILYSVV  367

Query  1035  FTQMASLFVEQGAAMRTNIAGFHIPPASMSSFDILSVAAFIFIYRRILDPLIASLKKTRR  856
             FTQMASLFVEQGAAM+T + GFHIPPASMSSFDI+SVAAFIFIYRR+LDPL+A LK T +
Sbjct  368   FTQMASLFVEQGAAMKTTLLGFHIPPASMSSFDIVSVAAFIFIYRRVLDPLVARLKGT-K  426

Query  855   AQGFTELQRMGVGLiiaimamvaagiVEHFRLKYASTDCPRC--PSSLSIFWQVPQYVLI  682
             A+G TELQRMG+GLIIAI+AMVAAGIVE FRLKYA  DC +C   SSLSIFWQ+PQYVLI
Sbjct  427   ARGLTELQRMGIGLIIAIIAMVAAGIVEWFRLKYAKKDCRQCESESSLSIFWQIPQYVLI  486

Query  681   GASEVFMYVGQLEFFNGQAPEGLKSFASALCMTSISLGNYVSSLLVSIVMRISTTHRMPG  502
             GASEVFMYVGQLEFFN QAP+GLKSF SALCMTSISLGNYVSSLLV+IVM+ ST  +MPG
Sbjct  487   GASEVFMYVGQLEFFNDQAPDGLKSFGSALCMTSISLGNYVSSLLVTIVMKFSTRDQMPG  546

Query  501   WIPGNLNKGHLDRFYFLLAALTTADFVVYILCAK  400
             WIP NLNKGHLDRFYFLLAALT ADF VYI+CAK
Sbjct  547   WIPSNLNKGHLDRFYFLLAALTMADFGVYIICAK  580



>ref|XP_002526521.1| Peptide transporter, putative [Ricinus communis]
 gb|EEF35912.1| Peptide transporter, putative [Ricinus communis]
Length=601

 Score =   821 bits (2121),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 425/575 (74%), Positives = 485/575 (84%), Gaps = 15/575 (3%)
 Frame = -3

Query  2064  TLDGTVDHYGRPALRSATGGWFAGVLLLVNQGLATLAFFGVGVNLVLFLTRVMGQDNADA  1885
             T DGTVD +G PA+R  TG W AG+L+LVNQGLATLAFFGVGVNLVLFLTRV+GQ+NADA
Sbjct  26    TQDGTVDRHGHPAIRQRTGTWIAGILILVNQGLATLAFFGVGVNLVLFLTRVLGQNNADA  85

Query  1884  ANNVSKWTGTVYLFSLLGAFLSDSYWGRYKTCAIFQLIYVVGLISVSIFSFIFLVKPKGC  1705
             ANNVSKWTGTVY+FSLLGAFLSDSYWGRYKTCAIFQ I+VVGL+S+S+ S+IFL+KP GC
Sbjct  86    ANNVSKWTGTVYIFSLLGAFLSDSYWGRYKTCAIFQAIFVVGLVSLSLSSYIFLLKPHGC  145

Query  1704  GDENTPCRSPSRIHIAVYYVSIYLVALGNGGYQPNIATFGSDQFDGDHAHESVSKVAFFS  1525
             G E  PC S S   IA++Y+S+YLVALGNGGYQPNIAT G+DQFD +   E  SK+AFFS
Sbjct  146   GSEKLPCGSHSNFEIALFYLSVYLVALGNGGYQPNIATLGADQFDEEDPKEGHSKIAFFS  205

Query  1524  YFYLALNLGSLFSNTVLVYFEDKGMWTLGFWastvsavlalllflVGTPRYRHFAPKGNP  1345
             YFYLALNLGSLFSNT+L YFED+GMW LGFW S  SA+LALLLFL GTPRYRHF  KGNP
Sbjct  206   YFYLALNLGSLFSNTILGYFEDQGMWALGFWTSAGSALLALLLFLCGTPRYRHFKSKGNP  265

Query  1344  LSRFSQVLVASARKWNVHLPSDGDDHRLYEIQ--EHDSSTRKILHTEGFKFLDKAAVITT  1171
             LSRF QVLVA+ R W  H   D ++  L+E      D   RKILHT+GF+FLD+AA+IT+
Sbjct  266   LSRFCQVLVAAFRNWK-HNKRDLNEEDLFESNFCSQDGDHRKILHTDGFRFLDRAALITS  324

Query  1170  KESVR-DLEERNINPWRLCSVTQVEEVKCILRLLPIWLCTILYSVVFTQMASLFVEQGAA  994
             +++V  D+     NPWRLC+VTQVEEVKCILRLLPIWLCTILYSVVFTQMASLFVEQGAA
Sbjct  325   EDNVNADIR----NPWRLCTVTQVEEVKCILRLLPIWLCTILYSVVFTQMASLFVEQGAA  380

Query  993   MRTNIAGFHIPPASMSSFDILSVAAFIFIYRRILDPLIASLKKTRRAQGFTELQRMGVGL  814
             M+T I+ FHIPPASMSSFDI+SVA FIF+YRRILDPL+A ++K  R  G TELQRMG+GL
Sbjct  381   MKTTISSFHIPPASMSSFDIVSVAVFIFMYRRILDPLVARIRKDPR--GLTELQRMGIGL  438

Query  813   iiaimamvaagiVEHFRLKYASTD---CPRC--PSSLSIFWQVPQYVLIGASEVFMYVGQ  649
             +IAI+AMV+AG+VE FRLKY +T    C  C   SSLSIFWQ+PQYVLIGASEVFMYVGQ
Sbjct  439   VIAILAMVSAGVVELFRLKYKNTQKAVCADCESESSLSIFWQIPQYVLIGASEVFMYVGQ  498

Query  648   LEFFNGQAPEGLKSFASALCMTSISLGNYVSSLLVSIVMRISTTHRMPGWIPGNLNKGHL  469
             LEFFN Q P+GLKSF SALCMTSISLGNYVSSLLV++VM+IST   MPGWIPGNLNKGHL
Sbjct  499   LEFFNAQTPDGLKSFGSALCMTSISLGNYVSSLLVTVVMKISTRDEMPGWIPGNLNKGHL  558

Query  468   DRFYFLLAALTTADFVVYILCAKWYKYIEFEERNS  364
             DRFYFLLAALTTAD ++YIL AKWYKYI+F+ + S
Sbjct  559   DRFYFLLAALTTADLIIYILTAKWYKYIKFQGKIS  593



>ref|XP_007139566.1| hypothetical protein PHAVU_008G040500g [Phaseolus vulgaris]
 gb|ESW11560.1| hypothetical protein PHAVU_008G040500g [Phaseolus vulgaris]
Length=599

 Score =   821 bits (2120),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 425/600 (71%), Positives = 490/600 (82%), Gaps = 13/600 (2%)
 Frame = -3

Query  2115  FFIKNERDEEKASRE--ECTLDGTVDHYGRPALRSATGGWFAGVLLLVNQGLATLAFFGV  1942
             FF+K +  EEK  +E  + T DG +D +G  A+R  TG W A +L+LVNQGLATLAFFGV
Sbjct  5     FFLKKDTVEEKVKKEHQDYTSDGAIDRHGHRAVREKTGDWVAAILILVNQGLATLAFFGV  64

Query  1941  GVNLVLFLTRVMGQDNADAANNVSKWTGTVYLFSLLGAFLSDSYWGRYKTCAIFQLIYVV  1762
             GVNLVLFLTRVMGQ+NA+AANNVSKWTGTVY+FSLLGAFLSDSYWGRY TCAIFQLI+V+
Sbjct  65    GVNLVLFLTRVMGQENAEAANNVSKWTGTVYIFSLLGAFLSDSYWGRYITCAIFQLIFVI  124

Query  1761  GLISVSIFSFIFLVKPKGCGDENTPCRSPSRIHIAVYYVSIYLVALGNGGYQPNIATFGS  1582
             GL+S+S+ S+IFL+KP GCGD+  PC S       ++YVSIYL+ALGNGGYQPNIATFG+
Sbjct  125   GLVSLSVSSYIFLLKPSGCGDKELPCGSRPSYQTVLFYVSIYLIALGNGGYQPNIATFGA  184

Query  1581  DQFDGDHAHESVSKVAFFSYFYLALNLGSLFSNTVLVYFEDKGMWTLGFWastvsavlal  1402
             DQFD     E  SK+ FFSYFYLALNLGSLFSNT+L YFED G+WTLGFWAS  SA LAL
Sbjct  185   DQFDEGDPREQHSKIVFFSYFYLALNLGSLFSNTILNYFEDDGLWTLGFWASAGSAALAL  244

Query  1401  llflVGTPRYRHFAPKGNPLSRFSQVLVASARKWNVHLPSDGDDHRLYEIQEHDS--STR  1228
              LFL GTPRYR+F P GNPL RF QV VASARKWNV +    +D +LY+  +  S    R
Sbjct  245   ALFLCGTPRYRYFKPSGNPLPRFCQVFVASARKWNVKVL---EDDKLYQADQQFSINEGR  301

Query  1227  KILHTEGFKFLDKAAVITTKESVRDLEERNINPWRLCSVTQVEEVKCILRLLPIWLCTIL  1048
             K+LHT+GF+FLDKAAVIT+K + +++EE   +PW L +VTQVEEVKCILRLLPIWLCTIL
Sbjct  302   KMLHTQGFRFLDKAAVITSK-NFKEMEESKCSPWSLSTVTQVEEVKCILRLLPIWLCTIL  360

Query  1047  YSVVFTQMASLFVEQGAAMRTNIAGFHIPPASMSSFDILSVAAFIFIYRRILDPLIASLK  868
             YSVVF QMASLFVEQG AM T I+ FHIPPASMS+FDILSVA FIFIYRR+LDPL+A   
Sbjct  361   YSVVFAQMASLFVEQGDAMDTRISRFHIPPASMSTFDILSVAVFIFIYRRVLDPLVA---  417

Query  867   KTRRAQGFTELQRMGVGLiiaimamvaagiVEHFRLKYASTDCPRCP--SSLSIFWQVPQ  694
             +T +++G TELQRMG+GL++AIMAMV+AG+VEHFRLK+A  DC  C   SSLSIFWQVPQ
Sbjct  418   RTMKSKGLTELQRMGIGLVLAIMAMVSAGLVEHFRLKHAIEDCNECEGSSSLSIFWQVPQ  477

Query  693   YVLIGASEVFMYVGQLEFFNGQAPEGLKSFASALCMTSISLGNYVSSLLVSIVMRISTTH  514
             YVL+GASEVFMYVGQLEFFNGQ P+GLKSF SALCMTSISLGNYVSSLLV+IVM+IS   
Sbjct  478   YVLVGASEVFMYVGQLEFFNGQTPDGLKSFGSALCMTSISLGNYVSSLLVAIVMKISARD  537

Query  513   RMPGWIPGNLNKGHLDRFYFLLAALTTADFVVYILCAKWYKYIEFEERNSCLKNIGDSKL  334
              MPGWIPGNLNKGHLDRFYFLLAALT AD  VYI  AKWYKY++F+  N    N  D +L
Sbjct  538   EMPGWIPGNLNKGHLDRFYFLLAALTIADLAVYIAMAKWYKYVKFQGNNENHINKQDPEL  597



>ref|XP_010269969.1| PREDICTED: protein NRT1/ PTR FAMILY 7.3-like [Nelumbo nucifera]
Length=612

 Score =   821 bits (2121),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 435/595 (73%), Positives = 502/595 (84%), Gaps = 12/595 (2%)
 Frame = -3

Query  2112  FIKNERDEEKASREECTLDGTVDHYGRPALRSATGGWFAGVLLLVNQGLATLAFFGVGVN  1933
              ++ E  E KA +E+ TLDGTVD +GRPA+R+ TG W AG+LLLVNQGLATLAFFGVGVN
Sbjct  15    LVEVEDREMKAGKEDYTLDGTVDLHGRPAIRARTGRWAAGILLLVNQGLATLAFFGVGVN  74

Query  1932  LVLFLTRVMGQDNADAANNVSKWTGTVYLFSLLGAFLSDSYWGRYKTCAIFQLIYVVGLI  1753
             LVLFLTRV+ QDNADAANNVSKWTGTVY+FSL+GAFLSDSYWGRYKTCAIFQLI+V+GL 
Sbjct  75    LVLFLTRVLQQDNADAANNVSKWTGTVYIFSLVGAFLSDSYWGRYKTCAIFQLIFVIGLA  134

Query  1752  SVSIFSFIFLVKPKGCGDENTPCRSPSRIHIAVYYVSIYLVALGNGGYQPNIATFGSDQF  1573
             S+S+ S++FLVKP GCG+E  PC S S   I ++Y+SIYL+ALGNGGYQPNIATFG+DQF
Sbjct  135   SLSLSSYLFLVKPSGCGNEQKPCGSHSNFQIGLFYLSIYLIALGNGGYQPNIATFGADQF  194

Query  1572  DGDHAHESVSKVAFFSYFYLALNLGSLFSNTVLVYFEDKGMWTLGFWastvsavlalllf  1393
             D     E  SKVAFFSYFYLALNLGSLFSNT+L YFED+GMW LGFWAST SA +AL+LF
Sbjct  195   DEGDPKEGHSKVAFFSYFYLALNLGSLFSNTILGYFEDEGMWALGFWASTGSAFVALVLF  254

Query  1392  lVGTPRYRHFAPKGNPLSRFSQVLVASARKWNVHLPSDGDDHRLYEIQEHD---SSTRKI  1222
             LVGTP YRHF P GNPLSRF  V+VA+ +K     P  GD+  LYE+   +   +  RKI
Sbjct  255   LVGTPGYRHFKPSGNPLSRFCHVVVAATKKLRAEFPPSGDN--LYEVDGKECAITGGRKI  312

Query  1221  LHTEGFKFLDKAAVITTKESVRDLEERNINPWRLCSVTQVEEVKCILRLLPIWLCTILYS  1042
             LHTEGF+FLD+AA+IT+K++    +  + +PW LC++TQVEEVKCILRLLPIWLCTILYS
Sbjct  313   LHTEGFRFLDRAAIITSKDTTPHNKGCH-SPWNLCTITQVEEVKCILRLLPIWLCTILYS  371

Query  1041  VVFTQMASLFVEQGAAMRTNIAGFHIPPASMSSFDILSVAAFIFIYRRILDPLIASLKKT  862
             VVFTQMASLFVEQGAAM+T I+ F IPPASMSSFDILSVAAFIFIYRRILDP +++LKK 
Sbjct  372   VVFTQMASLFVEQGAAMKTTISNFRIPPASMSSFDILSVAAFIFIYRRILDPFVSTLKKA  431

Query  861   RRAQGFTELQRMGVGLiiaimamvaagiVEHFRLKYASTDCPRC--PSSLSIFWQVPQYV  688
                +G TELQRMGVGLIIAI+AMV+AGIVE +RLKYA  DC  C   SSLSIFWQ+PQYV
Sbjct  432   -SGKGLTELQRMGVGLIIAIIAMVSAGIVECYRLKYAKQDCKHCEGSSSLSIFWQIPQYV  490

Query  687   LIGASEVFMYVGQLEFFNGQAPEGLKSFASALCMTSISLGNYVSSLLVSIVMRISTTHRM  508
             LIGASEVFMYVGQLEFFNGQAP+GLKSF SALCMTSISLGNYVSSLLV++VM+IST   M
Sbjct  491   LIGASEVFMYVGQLEFFNGQAPDGLKSFGSALCMTSISLGNYVSSLLVTMVMKISTEDNM  550

Query  507   PGWIPGNLNKGHLDRFYFLLAALTTADFVVYILCAKWYKYIEFEERNSCLKNIGD  343
             PGWIPGNLNKGHLDRFYFLLA LTT DF+VY+ CAKWYKY++ E++  C+ N+GD
Sbjct  551   PGWIPGNLNKGHLDRFYFLLAVLTTLDFLVYVACAKWYKYMKLEDK--CV-NMGD  602



>ref|XP_003550941.1| PREDICTED: nitrate transporter 1.5-like [Glycine max]
Length=597

 Score =   820 bits (2117),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 419/580 (72%), Positives = 494/580 (85%), Gaps = 15/580 (3%)
 Frame = -3

Query  2085  KASREECTLDGTVDHYGRPALRSATGGWFAGVLLLVNQGLATLAFFGVGVNLVLFLTRVM  1906
             K   EE TLDG+VD +GRPA+R+ +G W AG ++L+NQGLATLAFFGVGVNLVLFLTRVM
Sbjct  13    KGDTEELTLDGSVDWHGRPAIRAKSGRWVAGTIVLLNQGLATLAFFGVGVNLVLFLTRVM  72

Query  1905  GQDNADAANNVSKWTGTVYLFSLLGAFLSDSYWGRYKTCAIFQLIYVVGLISVSIFSFIF  1726
             GQDNA+AANNVSKWTGTVY+FSL+GAFLSDSYWGRYKTCAIFQ+I+V+GL+S+S+ S++ 
Sbjct  73    GQDNAEAANNVSKWTGTVYIFSLVGAFLSDSYWGRYKTCAIFQVIFVIGLVSLSLSSYLS  132

Query  1725  LVKPKGCGDENTPCRSPSRIHIAVYYVSIYLVALGNGGYQPNIATFGSDQFDGDHAHESV  1546
             L++PKGCG+E  PC   S + + ++Y+SIYL+ALGNGGYQPNIATFG+DQFD +H+ E  
Sbjct  133   LIRPKGCGNETIPCGKHSSLEMGMFYLSIYLIALGNGGYQPNIATFGADQFDEEHSKEGY  192

Query  1545  SKVAFFSYFYLALNLGSLFSNTVLVYFEDKGMWTLGFWastvsavlalllflVGTPRYRH  1366
             SKVAFFSYFYLALNLGSLFSNT+L YFED+G+W LGFW S  SA  AL+LFL+GTPRYRH
Sbjct  193   SKVAFFSYFYLALNLGSLFSNTILGYFEDEGLWALGFWVSAGSAFAALVLFLLGTPRYRH  252

Query  1365  FAPKGNPLSRFSQVLVASARKWNVHLPSDGDDHRLYEIQEHDSST---RKILHTEGFKFL  1195
             F P GNPLSRFSQVLVA++RKW   + S+G+D  LY + E++S T   RKILHTEGFKFL
Sbjct  253   FKPSGNPLSRFSQVLVAASRKWRAQMASNGED--LYVMDENESPTNGNRKILHTEGFKFL  310

Query  1194  DKAAVITTKESVRDLEERN---INPWRLCSVTQVEEVKCILRLLPIWLCTILYSVVFTQM  1024
             D+AA+I++    RDLE++     NPWRLC +TQVEEVKCILRLLPIWLCTI+YSVVFTQM
Sbjct  311   DRAAIISS----RDLEDQKSGVYNPWRLCPITQVEEVKCILRLLPIWLCTIIYSVVFTQM  366

Query  1023  ASLFVEQGAAMRTNIAGFHIPPASMSSFDILSVAAFIFIYRRILDPLIASLKKTRRAQGF  844
             ASLFVEQGAAM+T I+ F IPPASMSSFDILSVA FIF YRR++DPL+  LKK + ++G 
Sbjct  367   ASLFVEQGAAMKTTISHFRIPPASMSSFDILSVAVFIFFYRRVIDPLVGRLKK-KSSKGL  425

Query  843   TELQRMGVGLiiaimamvaagiVEHFRLKYASTDCPRCP--SSLSIFWQVPQYVLIGASE  670
             TELQRMG+GL+IA+MAMV+AGIVE +RLKYA   CP C   SSL+IFWQ+PQY LIGASE
Sbjct  426   TELQRMGIGLVIAVMAMVSAGIVECYRLKYADPVCPHCSGTSSLTIFWQIPQYTLIGASE  485

Query  669   VFMYVGQLEFFNGQAPEGLKSFASALCMTSISLGNYVSSLLVSIVMRISTTHRMPGWIPG  490
             VFMYVGQLEFFN Q P+GLKSF SALCMTSISLGNYVSSLLVSIVM+IST   MPGWIPG
Sbjct  486   VFMYVGQLEFFNAQTPDGLKSFGSALCMTSISLGNYVSSLLVSIVMKISTEDHMPGWIPG  545

Query  489   NLNKGHLDRFYFLLAALTTADFVVYILCAKWYKYIEFEER  370
             NLN+GHLDRFYFLLA LT+ D V+YI CAKW+K I+ E +
Sbjct  546   NLNRGHLDRFYFLLAILTSIDLVLYIACAKWFKSIQLEGK  585



>ref|XP_011018609.1| PREDICTED: protein NRT1/ PTR FAMILY 7.3 [Populus euphratica]
Length=598

 Score =   819 bits (2116),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 410/577 (71%), Positives = 488/577 (85%), Gaps = 8/577 (1%)
 Frame = -3

Query  2085  KASREECTLDGTVDHYGRPALRSATGGWFAGVLLLVNQGLATLAFFGVGVNLVLFLTRVM  1906
             K  REECT DGTVD +GRPA+++ +G W AG+++L+NQGLATLAFFGVGVNLVLFLTRV+
Sbjct  13    KEGREECTFDGTVDWHGRPAVKAKSGQWVAGIIILLNQGLATLAFFGVGVNLVLFLTRVL  72

Query  1905  GQDNADAANNVSKWTGTVYLFSLLGAFLSDSYWGRYKTCAIFQLIYVVGLISVSIFSFIF  1726
              Q NADAANNVSKWTGTVY+FSL+GAFLSDSYWGRYKTCAIFQ+I+V+GL+ +S+ S++F
Sbjct  73    QQSNADAANNVSKWTGTVYIFSLVGAFLSDSYWGRYKTCAIFQVIFVIGLVILSLSSYLF  132

Query  1725  LVKPKGCGDENTPCRSPSRIHIAVYYVSIYLVALGNGGYQPNIATFGSDQFDGDHAHESV  1546
             L++PKGCG+E TPC S S + ++++Y+SIYLVALGNGGYQPNIATFG+DQFD +   E  
Sbjct  133   LIRPKGCGNELTPCGSHSSMEVSLFYLSIYLVALGNGGYQPNIATFGADQFDEEDPREGH  192

Query  1545  SKVAFFSYFYLALNLGSLFSNTVLVYFEDKGMWTLGFWastvsavlalllflVGTPRYRH  1366
             SKV FFSYFYLALNLGSLFSNT+L YFED+G W LGFWAS  SA+ AL+LFL GT RYRH
Sbjct  193   SKVTFFSYFYLALNLGSLFSNTILGYFEDEGAWALGFWASAGSALAALVLFLGGTARYRH  252

Query  1365  FAPKGNPLSRFSQVLVASARKWNVHLPSDGDDHRLYEIQEHDSS---TRKILHTEGFKFL  1195
             F P GNPLSR  QV++A+ +KW + +P DG++  LY +   D S    RKILHT+GFKFL
Sbjct  253   FKPSGNPLSRLCQVIIAAMKKWKLEMPRDGEEE-LYNVHAKDCSMNGNRKILHTDGFKFL  311

Query  1194  DKAAVITTKESVRDLEERNINPWRLCSVTQVEEVKCILRLLPIWLCTILYSVVFTQMASL  1015
             D+AA I++++ + D +    NPWRLC +TQVEEVKCILRLLPIWLCTI+YSVVFTQMASL
Sbjct  312   DRAAFISSRD-IDDQKRGCRNPWRLCPITQVEEVKCILRLLPIWLCTIIYSVVFTQMASL  370

Query  1014  FVEQGAAMRTNIAGFHIPPASMSSFDILSVAAFIFIYRRILDPLIASLKKTRRAQGFTEL  835
             FVEQGAAM+T +A F IPPASMSSFDILSVA FIF+YRR+LDPL++ +KKT  ++G TEL
Sbjct  371   FVEQGAAMKTTVANFKIPPASMSSFDILSVAFFIFLYRRVLDPLVSRVKKT-GSKGLTEL  429

Query  834   QRMGVGLiiaimamvaagiVEHFRLKYASTDCPRCP--SSLSIFWQVPQYVLIGASEVFM  661
             QRMGVGL+IAI+AM++AG+VE +RL+YA  DC  C   SSLSIFWQVPQY LIGASEVFM
Sbjct  430   QRMGVGLVIAIVAMISAGLVECYRLRYARKDCTHCEGSSSLSIFWQVPQYALIGASEVFM  489

Query  660   YVGQLEFFNGQAPEGLKSFASALCMTSISLGNYVSSLLVSIVMRISTTHRMPGWIPGNLN  481
             YVGQLEFFN Q P+GLKSF SALCMTSISLGNYVSSLLV++VM+IST   MPGWIPGNLN
Sbjct  490   YVGQLEFFNAQTPDGLKSFGSALCMTSISLGNYVSSLLVTMVMKISTEDHMPGWIPGNLN  549

Query  480   KGHLDRFYFLLAALTTADFVVYILCAKWYKYIEFEER  370
             KGHLDRFYFLLA LTT D VVY+ CA+WYK I+ E +
Sbjct  550   KGHLDRFYFLLATLTTIDLVVYMACARWYKSIQLEGK  586



>ref|XP_006385620.1| proton-dependent oligopeptide transport family protein [Populus 
trichocarpa]
 gb|ERP63417.1| proton-dependent oligopeptide transport family protein [Populus 
trichocarpa]
Length=598

 Score =   818 bits (2113),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 412/588 (70%), Positives = 491/588 (84%), Gaps = 10/588 (2%)
 Frame = -3

Query  2100  ERDEEKASREECTLDGTVDHYGRPALRSATGGWFAGVLLLVNQGLATLAFFGVGVNLVLF  1921
             + D+ K    ECT DGTVD +GRPA+++ +G W AG+++L+NQGLATLAFFGVGVNLVLF
Sbjct  8     KEDKFKEGEGECTFDGTVDWHGRPAIKAKSGQWAAGIIILLNQGLATLAFFGVGVNLVLF  67

Query  1920  LTRVMGQDNADAANNVSKWTGTVYLFSLLGAFLSDSYWGRYKTCAIFQLIYVVGLISVSI  1741
             LTRV+ Q NADAANNVSKWTGTVY+FSL+GAFLSDSYWGRYKTCA+FQ+I+V+GL+ +S+
Sbjct  68    LTRVLQQSNADAANNVSKWTGTVYIFSLVGAFLSDSYWGRYKTCAVFQVIFVIGLVILSL  127

Query  1740  FSFIFLVKPKGCGDENTPCRSPSRIHIAVYYVSIYLVALGNGGYQPNIATFGSDQFDGDH  1561
              S +FL++PKGCGDE TPC S S + ++++Y+SIYL+ALGNGGYQPNIATFG+DQFD D 
Sbjct  128   ASHLFLIRPKGCGDELTPCGSHSSMEVSLFYLSIYLIALGNGGYQPNIATFGADQFDEDD  187

Query  1560  AHESVSKVAFFSYFYLALNLGSLFSNTVLVYFEDKGMWTLGFWastvsavlalllflVGT  1381
               E  SKVAFFSYFYLALNLGSLFSNT+L YFED+GMW LGFW S  SA  AL+LFL GT
Sbjct  188   PREGYSKVAFFSYFYLALNLGSLFSNTILGYFEDEGMWALGFWMSAGSAFAALVLFLGGT  247

Query  1380  PRYRHFAPKGNPLSRFSQVLVASARKWNVHLPSDGDDHRLYEIQEHDSS---TRKILHTE  1210
              RYRHF P GNPLSRF QV++A+ +K  V +P DG++  LY++   D S    RKILHT+
Sbjct  248   ARYRHFKPSGNPLSRFGQVIIAAMKKCRVEMPPDGEEE-LYDVDRKDCSMNGNRKILHTD  306

Query  1209  GFKFLDKAAVITTKESVRDLEERNINPWRLCSVTQVEEVKCILRLLPIWLCTILYSVVFT  1030
             GFKFLD+AA I++++ + D +    NPWRLC +TQVEEVKCILRLLPIWLCTI+YSVVFT
Sbjct  307   GFKFLDRAAFISSRD-IDDQKRGCRNPWRLCPITQVEEVKCILRLLPIWLCTIIYSVVFT  365

Query  1029  QMASLFVEQGAAMRTNIAGFHIPPASMSSFDILSVAAFIFIYRRILDPLIASLKKTRRAQ  850
             QMASLFVEQGAAM+T I+ F IPPASMS+FDILSVA FIF+YRR+LDPL++S K+T  ++
Sbjct  366   QMASLFVEQGAAMKTTISNFKIPPASMSTFDILSVAFFIFLYRRVLDPLVSSFKQT-SSK  424

Query  849   GFTELQRMGVGLiiaimamvaagiVEHFRLKYASTDCPRCP--SSLSIFWQVPQYVLIGA  676
             G TELQRMGVGL+IAIMAMV+AG+VE +RLKYA  DC  C   SSLSIFWQ PQY LIGA
Sbjct  425   GLTELQRMGVGLVIAIMAMVSAGLVECYRLKYARKDCKHCEGSSSLSIFWQAPQYALIGA  484

Query  675   SEVFMYVGQLEFFNGQAPEGLKSFASALCMTSISLGNYVSSLLVSIVMRISTTHRMPGWI  496
             SEVFMYVGQLEFFN Q P+GLKSF SALCMTSISLGNYVSSLLV++V++IST   MPGWI
Sbjct  485   SEVFMYVGQLEFFNAQTPDGLKSFGSALCMTSISLGNYVSSLLVTMVVKISTEDHMPGWI  544

Query  495   PGNLNKGHLDRFYFLLAALTTADFVVYILCAKWYKYIEFEERNSCLKN  352
             PGNLN GHLDRFYFLLA LTT D VVY+ CA+WYK I+ E++  C +N
Sbjct  545   PGNLNTGHLDRFYFLLAGLTTIDLVVYMACARWYKSIKLEKK--CEEN  590



>ref|XP_011028220.1| PREDICTED: protein NRT1/ PTR FAMILY 7.3-like isoform X1 [Populus 
euphratica]
Length=598

 Score =   818 bits (2112),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 411/588 (70%), Positives = 492/588 (84%), Gaps = 10/588 (2%)
 Frame = -3

Query  2100  ERDEEKASREECTLDGTVDHYGRPALRSATGGWFAGVLLLVNQGLATLAFFGVGVNLVLF  1921
             + D+ K    ECT DGTVD +GRPA+++ +G W AG+++L+NQGLATLAFFGVGVNLVLF
Sbjct  8     KEDKFKEGEGECTSDGTVDWHGRPAIKAKSGQWAAGIIILLNQGLATLAFFGVGVNLVLF  67

Query  1920  LTRVMGQDNADAANNVSKWTGTVYLFSLLGAFLSDSYWGRYKTCAIFQLIYVVGLISVSI  1741
             LTRV+ Q NADAANNVSKWTGTVY+FSL+GAFLSDSYWGRYKTCA+FQ+I+V+GL+ +S+
Sbjct  68    LTRVLQQSNADAANNVSKWTGTVYIFSLVGAFLSDSYWGRYKTCAVFQVIFVIGLVILSL  127

Query  1740  FSFIFLVKPKGCGDENTPCRSPSRIHIAVYYVSIYLVALGNGGYQPNIATFGSDQFDGDH  1561
              S++ L++PKGCGDE TPC S S + ++++Y+SIYL+ALGNGGYQPNIATFG+DQFD D 
Sbjct  128   ASYLILIRPKGCGDELTPCGSHSNMEVSLFYLSIYLIALGNGGYQPNIATFGADQFDEDD  187

Query  1560  AHESVSKVAFFSYFYLALNLGSLFSNTVLVYFEDKGMWTLGFWastvsavlalllflVGT  1381
               E  SKV+FFSYFYLALNLGSLFSNT+L YFED+GMW LGFW S  SA  AL+LFL GT
Sbjct  188   PREGYSKVSFFSYFYLALNLGSLFSNTILGYFEDEGMWALGFWMSAGSAFAALVLFLGGT  247

Query  1380  PRYRHFAPKGNPLSRFSQVLVASARKWNVHLPSDGDDHRLYEIQEHDSS---TRKILHTE  1210
              RYRHF P GNPLSRF QV++A+ +K  V +P DG++  LY++   D S    RKILHT+
Sbjct  248   ARYRHFKPSGNPLSRFGQVIIAAMKKCGVEMPPDGEEE-LYDVDTKDCSMNGNRKILHTD  306

Query  1209  GFKFLDKAAVITTKESVRDLEERNINPWRLCSVTQVEEVKCILRLLPIWLCTILYSVVFT  1030
             GFKFLD+AA I++++ + D +    NPWRLC +TQVEEVKCILRLLPIWLCTI+YSVVFT
Sbjct  307   GFKFLDRAAFISSRD-IDDQKRGCRNPWRLCPITQVEEVKCILRLLPIWLCTIIYSVVFT  365

Query  1029  QMASLFVEQGAAMRTNIAGFHIPPASMSSFDILSVAAFIFIYRRILDPLIASLKKTRRAQ  850
             QMASLFVEQGAAM+T I+ F IPPASMS+FDILSVA FIF+YRR+LDPL++S K+T  ++
Sbjct  366   QMASLFVEQGAAMKTTISNFKIPPASMSAFDILSVAFFIFLYRRVLDPLVSSFKQT-SSK  424

Query  849   GFTELQRMGVGLiiaimamvaagiVEHFRLKYASTDCPRC--PSSLSIFWQVPQYVLIGA  676
             G TELQRMGVGL+IAIMAMV+AG+VE +RLKYA  DC  C   SSLSIFWQ PQY LIGA
Sbjct  425   GLTELQRMGVGLVIAIMAMVSAGLVECYRLKYARKDCKHCEGSSSLSIFWQAPQYALIGA  484

Query  675   SEVFMYVGQLEFFNGQAPEGLKSFASALCMTSISLGNYVSSLLVSIVMRISTTHRMPGWI  496
             SEVFMYVGQLEFFN Q P+GLKSF SALCMTSISLGNYVSSLLV++V++IST   MPGWI
Sbjct  485   SEVFMYVGQLEFFNAQTPDGLKSFGSALCMTSISLGNYVSSLLVTMVVKISTEDHMPGWI  544

Query  495   PGNLNKGHLDRFYFLLAALTTADFVVYILCAKWYKYIEFEERNSCLKN  352
             PGNLN GHLDRFYFLLA LTT DFVVY+ CA+WYK I+ E++  C +N
Sbjct  545   PGNLNAGHLDRFYFLLAGLTTIDFVVYMACARWYKSIKLEKK--CEEN  590



>ref|XP_011028221.1| PREDICTED: protein NRT1/ PTR FAMILY 7.3-like isoform X2 [Populus 
euphratica]
Length=594

 Score =   817 bits (2111),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 411/587 (70%), Positives = 491/587 (84%), Gaps = 10/587 (2%)
 Frame = -3

Query  2097  RDEEKASREECTLDGTVDHYGRPALRSATGGWFAGVLLLVNQGLATLAFFGVGVNLVLFL  1918
              D+ K    ECT DGTVD +GRPA+++ +G W AG+++L+NQGLATLAFFGVGVNLVLFL
Sbjct  5     EDKFKEGEGECTSDGTVDWHGRPAIKAKSGQWAAGIIILLNQGLATLAFFGVGVNLVLFL  64

Query  1917  TRVMGQDNADAANNVSKWTGTVYLFSLLGAFLSDSYWGRYKTCAIFQLIYVVGLISVSIF  1738
             TRV+ Q NADAANNVSKWTGTVY+FSL+GAFLSDSYWGRYKTCA+FQ+I+V+GL+ +S+ 
Sbjct  65    TRVLQQSNADAANNVSKWTGTVYIFSLVGAFLSDSYWGRYKTCAVFQVIFVIGLVILSLA  124

Query  1737  SFIFLVKPKGCGDENTPCRSPSRIHIAVYYVSIYLVALGNGGYQPNIATFGSDQFDGDHA  1558
             S++ L++PKGCGDE TPC S S + ++++Y+SIYL+ALGNGGYQPNIATFG+DQFD D  
Sbjct  125   SYLILIRPKGCGDELTPCGSHSNMEVSLFYLSIYLIALGNGGYQPNIATFGADQFDEDDP  184

Query  1557  HESVSKVAFFSYFYLALNLGSLFSNTVLVYFEDKGMWTLGFWastvsavlalllflVGTP  1378
              E  SKV+FFSYFYLALNLGSLFSNT+L YFED+GMW LGFW S  SA  AL+LFL GT 
Sbjct  185   REGYSKVSFFSYFYLALNLGSLFSNTILGYFEDEGMWALGFWMSAGSAFAALVLFLGGTA  244

Query  1377  RYRHFAPKGNPLSRFSQVLVASARKWNVHLPSDGDDHRLYEIQEHDSS---TRKILHTEG  1207
             RYRHF P GNPLSRF QV++A+ +K  V +P DG++  LY++   D S    RKILHT+G
Sbjct  245   RYRHFKPSGNPLSRFGQVIIAAMKKCGVEMPPDGEEE-LYDVDTKDCSMNGNRKILHTDG  303

Query  1206  FKFLDKAAVITTKESVRDLEERNINPWRLCSVTQVEEVKCILRLLPIWLCTILYSVVFTQ  1027
             FKFLD+AA I++++ + D +    NPWRLC +TQVEEVKCILRLLPIWLCTI+YSVVFTQ
Sbjct  304   FKFLDRAAFISSRD-IDDQKRGCRNPWRLCPITQVEEVKCILRLLPIWLCTIIYSVVFTQ  362

Query  1026  MASLFVEQGAAMRTNIAGFHIPPASMSSFDILSVAAFIFIYRRILDPLIASLKKTRRAQG  847
             MASLFVEQGAAM+T I+ F IPPASMS+FDILSVA FIF+YRR+LDPL++S K+T  ++G
Sbjct  363   MASLFVEQGAAMKTTISNFKIPPASMSAFDILSVAFFIFLYRRVLDPLVSSFKQT-SSKG  421

Query  846   FTELQRMGVGLiiaimamvaagiVEHFRLKYASTDCPRCP--SSLSIFWQVPQYVLIGAS  673
              TELQRMGVGL+IAIMAMV+AG+VE +RLKYA  DC  C   SSLSIFWQ PQY LIGAS
Sbjct  422   LTELQRMGVGLVIAIMAMVSAGLVECYRLKYARKDCKHCEGSSSLSIFWQAPQYALIGAS  481

Query  672   EVFMYVGQLEFFNGQAPEGLKSFASALCMTSISLGNYVSSLLVSIVMRISTTHRMPGWIP  493
             EVFMYVGQLEFFN Q P+GLKSF SALCMTSISLGNYVSSLLV++V++IST   MPGWIP
Sbjct  482   EVFMYVGQLEFFNAQTPDGLKSFGSALCMTSISLGNYVSSLLVTMVVKISTEDHMPGWIP  541

Query  492   GNLNKGHLDRFYFLLAALTTADFVVYILCAKWYKYIEFEERNSCLKN  352
             GNLN GHLDRFYFLLA LTT DFVVY+ CA+WYK I+ E++  C +N
Sbjct  542   GNLNAGHLDRFYFLLAGLTTIDFVVYMACARWYKSIKLEKK--CEEN  586



>gb|KHN01673.1| Nitrate transporter 1.5 [Glycine soja]
Length=597

 Score =   816 bits (2109),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 418/580 (72%), Positives = 493/580 (85%), Gaps = 15/580 (3%)
 Frame = -3

Query  2085  KASREECTLDGTVDHYGRPALRSATGGWFAGVLLLVNQGLATLAFFGVGVNLVLFLTRVM  1906
             K   EE TLDG+VD +GRPA+R+ +G W AG ++L+NQGLATLAFFGVGVNLVLFLTRVM
Sbjct  13    KGDTEELTLDGSVDWHGRPAIRAKSGRWVAGTIVLLNQGLATLAFFGVGVNLVLFLTRVM  72

Query  1905  GQDNADAANNVSKWTGTVYLFSLLGAFLSDSYWGRYKTCAIFQLIYVVGLISVSIFSFIF  1726
             GQDNA+AANNVSKWTGTVY+FSL+GAFLSDSYWGRYKTCAIFQ+I+V+GL+S+S+ S++ 
Sbjct  73    GQDNAEAANNVSKWTGTVYIFSLVGAFLSDSYWGRYKTCAIFQVIFVIGLVSLSLSSYLS  132

Query  1725  LVKPKGCGDENTPCRSPSRIHIAVYYVSIYLVALGNGGYQPNIATFGSDQFDGDHAHESV  1546
             L++PKGCG+E  PC   S + + ++Y+SIYL+ALGNGGYQPNIATFG+DQFD +H+ E  
Sbjct  133   LIRPKGCGNETIPCGKHSSLEMGMFYLSIYLIALGNGGYQPNIATFGADQFDEEHSKEGY  192

Query  1545  SKVAFFSYFYLALNLGSLFSNTVLVYFEDKGMWTLGFWastvsavlalllflVGTPRYRH  1366
             SKVAFFSYFYLALNLGSLFSNT+L YFE +G+W LGFW S  SA  AL+LFL+GTPRYRH
Sbjct  193   SKVAFFSYFYLALNLGSLFSNTILGYFEGEGLWALGFWVSAGSAFAALVLFLLGTPRYRH  252

Query  1365  FAPKGNPLSRFSQVLVASARKWNVHLPSDGDDHRLYEIQEHDSST---RKILHTEGFKFL  1195
             F P GNPLSRFSQVLVA++RKW   + S+G+D  LY + E++S T   RKILHTEGFKFL
Sbjct  253   FKPSGNPLSRFSQVLVAASRKWRAQMASNGED--LYVMDENESPTNGNRKILHTEGFKFL  310

Query  1194  DKAAVITTKESVRDLEERN---INPWRLCSVTQVEEVKCILRLLPIWLCTILYSVVFTQM  1024
             D+AA+I++    RDLE++     NPWRLC +TQVEEVKCILRLLPIWLCTI+YSVVFTQM
Sbjct  311   DRAAIISS----RDLEDQKSGVYNPWRLCPITQVEEVKCILRLLPIWLCTIIYSVVFTQM  366

Query  1023  ASLFVEQGAAMRTNIAGFHIPPASMSSFDILSVAAFIFIYRRILDPLIASLKKTRRAQGF  844
             ASLFVEQGAAM+T I+ F IPPASMSSFDILSVA FIF YRR++DPL+  LKK + ++G 
Sbjct  367   ASLFVEQGAAMKTTISHFRIPPASMSSFDILSVAVFIFFYRRVIDPLVGRLKK-KSSKGL  425

Query  843   TELQRMGVGLiiaimamvaagiVEHFRLKYASTDCPRCP--SSLSIFWQVPQYVLIGASE  670
             TELQRMG+GL+IA+MAMV+AGIVE +RLKYA   CP C   SSL+IFWQ+PQY LIGASE
Sbjct  426   TELQRMGIGLVIAVMAMVSAGIVECYRLKYADPVCPHCSGTSSLTIFWQIPQYTLIGASE  485

Query  669   VFMYVGQLEFFNGQAPEGLKSFASALCMTSISLGNYVSSLLVSIVMRISTTHRMPGWIPG  490
             VFMYVGQLEFFN Q P+GLKSF SALCMTSISLGNYVSSLLVSIVM+IST   MPGWIPG
Sbjct  486   VFMYVGQLEFFNAQTPDGLKSFGSALCMTSISLGNYVSSLLVSIVMKISTEDHMPGWIPG  545

Query  489   NLNKGHLDRFYFLLAALTTADFVVYILCAKWYKYIEFEER  370
             NLN+GHLDRFYFLLA LT+ D V+YI CAKW+K I+ E +
Sbjct  546   NLNRGHLDRFYFLLAILTSIDLVLYIACAKWFKSIQLEGK  585



>ref|XP_007155757.1| hypothetical protein PHAVU_003G229000g [Phaseolus vulgaris]
 gb|ESW27751.1| hypothetical protein PHAVU_003G229000g [Phaseolus vulgaris]
Length=597

 Score =   815 bits (2106),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 421/580 (73%), Positives = 492/580 (85%), Gaps = 15/580 (3%)
 Frame = -3

Query  2085  KASREECTLDGTVDHYGRPALRSATGGWFAGVLLLVNQGLATLAFFGVGVNLVLFLTRVM  1906
             K   EE TLDG+VD +GRPA+R+ +G W AG ++L+NQGLATLAFFGVGVNLVLFLTRVM
Sbjct  13    KDDTEEVTLDGSVDWHGRPAIRAKSGRWVAGTIVLLNQGLATLAFFGVGVNLVLFLTRVM  72

Query  1905  GQDNADAANNVSKWTGTVYLFSLLGAFLSDSYWGRYKTCAIFQLIYVVGLISVSIFSFIF  1726
             GQ+NADAANNVSKWTGTVY+FSL+GAFLSDSYWGRYKTCAIFQ+I+V+GL+S+S+ S++ 
Sbjct  73    GQNNADAANNVSKWTGTVYIFSLVGAFLSDSYWGRYKTCAIFQVIFVIGLVSLSLSSYLS  132

Query  1725  LVKPKGCGDENTPCRSPSRIHIAVYYVSIYLVALGNGGYQPNIATFGSDQFDGDHAHESV  1546
             L++PKGCG+    C   S + + ++Y+SIYL+ALGNGGYQPNIATFG+DQFD +H+ E  
Sbjct  133   LIRPKGCGNGTISCGKNSSLEMGMFYLSIYLIALGNGGYQPNIATFGADQFDEEHSKEGY  192

Query  1545  SKVAFFSYFYLALNLGSLFSNTVLVYFEDKGMWTLGFWastvsavlalllflVGTPRYRH  1366
             SKVAFFSYFYLALNLGSLFSNT+L YFED+G+WTLGFW S  SA  AL+LFL+GTPRYRH
Sbjct  193   SKVAFFSYFYLALNLGSLFSNTILGYFEDEGLWTLGFWVSAGSAFAALVLFLLGTPRYRH  252

Query  1365  FAPKGNPLSRFSQVLVASARKWNVHLPSDGDDHRLYEIQEHDSST---RKILHTEGFKFL  1195
             F P GNPLSRF QVLVA+ RKW  H+ S+ +D  LY   E++S T   RKILHT+GFKFL
Sbjct  253   FKPSGNPLSRFGQVLVAALRKWGAHVTSNEED--LYVKDENESPTNGNRKILHTDGFKFL  310

Query  1194  DKAAVITTKESVRDLEERNI---NPWRLCSVTQVEEVKCILRLLPIWLCTILYSVVFTQM  1024
             D+AA I+T    RDLE++     NPWRLC +TQVEEVKCILRLLPIWLCTI+YSVVFTQM
Sbjct  311   DRAAFIST----RDLEDQKRGLHNPWRLCPITQVEEVKCILRLLPIWLCTIIYSVVFTQM  366

Query  1023  ASLFVEQGAAMRTNIAGFHIPPASMSSFDILSVAAFIFIYRRILDPLIASLKKTRRAQGF  844
             ASLFVEQGAAM+T I+ F IPPASMSSFDILSVA FIF YRR++DPL+  LKKT  ++G 
Sbjct  367   ASLFVEQGAAMKTTISHFRIPPASMSSFDILSVAVFIFFYRRVIDPLVGRLKKT-SSKGL  425

Query  843   TELQRMGVGLiiaimamvaagiVEHFRLKYASTDCPRCP--SSLSIFWQVPQYVLIGASE  670
             TELQRMG+GL+IA+MAMV+AGIVE +RLKYA   CP C   SSLSIFWQ+PQY LIGASE
Sbjct  426   TELQRMGIGLVIAVMAMVSAGIVECYRLKYAKVGCPHCSGTSSLSIFWQIPQYALIGASE  485

Query  669   VFMYVGQLEFFNGQAPEGLKSFASALCMTSISLGNYVSSLLVSIVMRISTTHRMPGWIPG  490
             VFMYVGQLEFFN Q P+GLKSF SALCMTSISLGNYVSSLLVSIVM+IST  +MPGWIPG
Sbjct  486   VFMYVGQLEFFNAQTPDGLKSFGSALCMTSISLGNYVSSLLVSIVMKISTEDQMPGWIPG  545

Query  489   NLNKGHLDRFYFLLAALTTADFVVYILCAKWYKYIEFEER  370
             NLN+GHLDRFYFLLAALT+ D +VYILCAKW+K I+ E +
Sbjct  546   NLNRGHLDRFYFLLAALTSIDLIVYILCAKWFKSIQLEGK  585



>ref|XP_006579680.1| PREDICTED: nitrate transporter 1.5-like isoform X2 [Glycine max]
Length=598

 Score =   814 bits (2103),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 418/588 (71%), Positives = 496/588 (84%), Gaps = 15/588 (3%)
 Frame = -3

Query  2109  IKNERDEEKASREECTLDGTVDHYGRPALRSATGGWFAGVLLLVNQGLATLAFFGVGVNL  1930
             +  E+ + K   EE TLDG+VD +GRPA+R+ +G W AG ++L+NQGLATLAFFGVGVNL
Sbjct  6     VSKEQGKFKGDTEELTLDGSVDWHGRPAIRAKSGRWVAGTIVLLNQGLATLAFFGVGVNL  65

Query  1929  VLFLTRVMGQDNADAANNVSKWTGTVYLFSLLGAFLSDSYWGRYKTCAIFQLIYVVGLIS  1750
             VLFLTRVMGQ+NA AAN+VSKWTGTVY+FSL+GAFLSDSYWGRYKTCAIFQ+I+V+GL+S
Sbjct  66    VLFLTRVMGQNNAAAANSVSKWTGTVYIFSLVGAFLSDSYWGRYKTCAIFQVIFVIGLVS  125

Query  1749  VSIFSFIFLVKPKGCGDENTPCRSPSRIHIAVYYVSIYLVALGNGGYQPNIATFGSDQFD  1570
             +S+ S++ L++PKGCG+E  PC   S + + ++Y+SIYL+ALGNGGYQPNIATFG+DQFD
Sbjct  126   LSLSSYLSLIRPKGCGNETIPCGKHSSLEMGMFYLSIYLIALGNGGYQPNIATFGADQFD  185

Query  1569  GDHAHESVSKVAFFSYFYLALNLGSLFSNTVLVYFEDKGMWTLGFWastvsavlalllfl  1390
              +H+ E  SKVAFFSYFYLALNLGSLFSNT+L YFED+G+W LGFW S  SA  AL+LFL
Sbjct  186   EEHSKEGYSKVAFFSYFYLALNLGSLFSNTILGYFEDEGLWALGFWVSAGSAFAALVLFL  245

Query  1389  VGTPRYRHFAPKGNPLSRFSQVLVASARKWNVHLPSDGDDHRLYEIQEHDSST---RKIL  1219
             +GTPRYRHF P GNPLSRFSQVLVA++RKW   + S+G+D  LY + E++S T   RKIL
Sbjct  246   LGTPRYRHFKPSGNPLSRFSQVLVAASRKWRAQMTSNGED--LYVMDENESPTNGNRKIL  303

Query  1218  HTEGFKFLDKAAVITTKESVRDLEERN---INPWRLCSVTQVEEVKCILRLLPIWLCTIL  1048
             HT GFKFLD+AA I    S RDLE++     NPWRLC +TQVEEVKCILRLLPIWLCTI+
Sbjct  304   HTGGFKFLDRAAFI----SPRDLEDQKSGVYNPWRLCPITQVEEVKCILRLLPIWLCTII  359

Query  1047  YSVVFTQMASLFVEQGAAMRTNIAGFHIPPASMSSFDILSVAAFIFIYRRILDPLIASLK  868
             YSVVFTQMASLFVEQGAAM+T I+ F IPPASMSSFDILSVA FIF YRR++DPL+  LK
Sbjct  360   YSVVFTQMASLFVEQGAAMKTTISNFRIPPASMSSFDILSVAVFIFFYRRVIDPLVGRLK  419

Query  867   KTRRAQGFTELQRMGVGLiiaimamvaagiVEHFRLKYASTDCPRCP--SSLSIFWQVPQ  694
             K + ++G TELQRMG+GL+IA+MAMV+AGIVE +RLKYA++ CP C   SSLSIFWQ+PQ
Sbjct  420   K-KSSRGLTELQRMGIGLVIAVMAMVSAGIVECYRLKYANSGCPHCSGTSSLSIFWQIPQ  478

Query  693   YVLIGASEVFMYVGQLEFFNGQAPEGLKSFASALCMTSISLGNYVSSLLVSIVMRISTTH  514
             Y LIGASEVFMYVGQLEFFN Q P+GLKSF SALCMTSISLGNYVSS+LVSIVM+IST  
Sbjct  479   YALIGASEVFMYVGQLEFFNAQTPDGLKSFGSALCMTSISLGNYVSSILVSIVMKISTED  538

Query  513   RMPGWIPGNLNKGHLDRFYFLLAALTTADFVVYILCAKWYKYIEFEER  370
              MPGWIPGNLN+GHLDRFYFLLA LT+ D V+YI CAKW+K I+ E +
Sbjct  539   HMPGWIPGNLNRGHLDRFYFLLAILTSIDLVLYIACAKWFKSIQLEGK  586



>ref|XP_006436768.1| hypothetical protein CICLE_v10031017mg [Citrus clementina]
 ref|XP_006485423.1| PREDICTED: nitrate transporter 1.5-like [Citrus sinensis]
 gb|ESR50008.1| hypothetical protein CICLE_v10031017mg [Citrus clementina]
 gb|KDO53845.1| hypothetical protein CISIN_1g007612mg [Citrus sinensis]
Length=596

 Score =   811 bits (2096),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 418/585 (71%), Positives = 497/585 (85%), Gaps = 15/585 (3%)
 Frame = -3

Query  2100  ERDEEKASREECTLDGTVDHYGRPALRSATGGWFAGVLLLVNQGLATLAFFGVGVNLVLF  1921
             + ++ K   EE TLDG+VD+YGRPA+R+ +GGW AG+++L+NQGLATLAFFGVGVNLVLF
Sbjct  8     KEEKFKDDGEEHTLDGSVDYYGRPAIRAKSGGWVAGIIILLNQGLATLAFFGVGVNLVLF  67

Query  1920  LTRVMGQDNADAANNVSKWTGTVYLFSLLGAFLSDSYWGRYKTCAIFQLIYVVGLISVSI  1741
             LTRV+ Q+NA+AANNVSKWTGTVY+FSL+GAFLSDSYWGR+KTCAIFQ I+V+GL+ +S+
Sbjct  68    LTRVLQQNNAEAANNVSKWTGTVYIFSLVGAFLSDSYWGRFKTCAIFQGIFVIGLVLLSL  127

Query  1740  FSFIFLVKPKGCGDENTPCRSPSRIHIAVYYVSIYLVALGNGGYQPNIATFGSDQFDGDH  1561
              S++FL++P+GCG+E TPC + S + I ++Y+SIY VALGNGGYQPNIATFG+DQ+D + 
Sbjct  128   SSYLFLIRPRGCGNELTPCGTHSSLEICLFYLSIYFVALGNGGYQPNIATFGADQYDEED  187

Query  1560  AHESVSKVAFFSYFYLALNLGSLFSNTVLVYFEDKGMWTLGFWastvsavlalllflVGT  1381
             A E  SKVAFFSYFYLALNLGSLFSNT+L YFED+GMW LGFW ST SA  AL+LFL GT
Sbjct  188   AKEGHSKVAFFSYFYLALNLGSLFSNTILGYFEDEGMWALGFWVSTGSAFAALVLFLAGT  247

Query  1380  PRYRHFAPKGNPLSRFSQVLVASARKWNVHLPSDGDDHRLYEIQEHDSST---RKILHTE  1210
              RYRHF P GNPL+RF QV+VA+ +KW VHL ++G+D  LY I  +DSST   R +LHT 
Sbjct  248   TRYRHFKPSGNPLARFCQVIVAATKKWRVHLSAEGED--LYVIDANDSSTNGNRNMLHTH  305

Query  1209  GFKFLDKAAVITTKESVRDLEERN---INPWRLCSVTQVEEVKCILRLLPIWLCTILYSV  1039
             GFKFLD+AA I++    RDL+E+     NPWRLC VTQVEEVKCILRLLPIWLCTILYSV
Sbjct  306   GFKFLDRAAYISS----RDLDEQKQGCSNPWRLCPVTQVEEVKCILRLLPIWLCTILYSV  361

Query  1038  VFTQMASLFVEQGAAMRTNIAGFHIPPASMSSFDILSVAAFIFIYRRILDPLIASLKKTR  859
             VFTQMASLFVEQGAAM+T ++ F IPPASMSSFDILSVAAFIF+YRR+++PL   ++K +
Sbjct  362   VFTQMASLFVEQGAAMKTTVSNFRIPPASMSSFDILSVAAFIFLYRRVIEPLAGGIRK-K  420

Query  858   RAQGFTELQRMGVGLiiaimamvaagiVEHFRLKYASTDCPRC--PSSLSIFWQVPQYVL  685
              ++G TELQRMG+GL+IAI+AM+AAGIVE +RLKYA T+C  C   SSLSIFWQVPQY L
Sbjct  421   NSKGLTELQRMGIGLVIAIVAMLAAGIVECYRLKYAKTECKHCEGASSLSIFWQVPQYAL  480

Query  684   IGASEVFMYVGQLEFFNGQAPEGLKSFASALCMTSISLGNYVSSLLVSIVMRISTTHRMP  505
             IGASEVFMYV QLEFFN QAP+GLKSF SALCMTSISLGNYVSSLL+++VM+IST   MP
Sbjct  481   IGASEVFMYVAQLEFFNAQAPDGLKSFGSALCMTSISLGNYVSSLLLTMVMKISTEDHMP  540

Query  504   GWIPGNLNKGHLDRFYFLLAALTTADFVVYILCAKWYKYIEFEER  370
             GW+PGNLNKGHLDRFYFLLA LTT DFVVYI CAKWYK IE E +
Sbjct  541   GWVPGNLNKGHLDRFYFLLAGLTTVDFVVYIACAKWYKCIELEAK  585



>gb|EYU40300.1| hypothetical protein MIMGU_mgv1a025093mg [Erythranthe guttata]
Length=592

 Score =   811 bits (2095),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 416/583 (71%), Positives = 485/583 (83%), Gaps = 12/583 (2%)
 Frame = -3

Query  2079  SREECTLDGTVDHYGRPALRSATGGWFAGVLLLVNQGLATLAFFGVGVNLVLFLTRVMGQ  1900
             S+EE TLDG+VD  GRPA+RS TG W AG+LLLVNQGLATLAFFGVGVNLVL+LTRVMGQ
Sbjct  8     SQEEYTLDGSVDRNGRPAIRSRTGSWGAGILLLVNQGLATLAFFGVGVNLVLYLTRVMGQ  67

Query  1899  DNADAANNVSKWTGTVYLFSLLGAFLSDSYWGRYKTCAIFQLIYVVGLISVSIFSFIFLV  1720
             DNA AANNVSKWTGTVYLFSLLGAFLSDSYWGRYKTCAIFQ I+V+GL+S+S+ S++FLV
Sbjct  68    DNASAANNVSKWTGTVYLFSLLGAFLSDSYWGRYKTCAIFQAIFVIGLVSLSLTSYLFLV  127

Query  1719  KPKGCGDENTPCRSPSRIHIAVYYVSIYLVALGNGGYQPNIATFGSDQFDGDHAHESVSK  1540
             KP GCGDE T C + S  H++++YVSIYL+ALGNGGYQP IATFG+DQFD +H  ES SK
Sbjct  128   KPSGCGDEGTQCGAHSATHLSLFYVSIYLIALGNGGYQPTIATFGADQFDEEHPKESHSK  187

Query  1539  VAFFSYFYLALNLGSLFSNTVLVYFEDKGMWTLGFWastvsavlalllflVGTPRYRHFA  1360
             VAFFSYFYLALNLGSLFSNTVL Y+EDKG+W +GFW+S  SA +AL+LFL+GTP YRH  
Sbjct  188   VAFFSYFYLALNLGSLFSNTVLGYYEDKGIWAVGFWSSAGSATVALILFLLGTPIYRHVT  247

Query  1359  PKGNPLSRFSQVLVASARKWNVHLPSDGDDHRLYEIQE-----HDSSTRKILHTEGFKFL  1195
             PKGNP SRF QV++A++RKW V +PS  +D  LYE++       D+  RKILHT GF FL
Sbjct  248   PKGNPFSRFCQVVIAASRKWKVEVPS--NDDLLYEVKGGGDNLADNGGRKILHTHGFIFL  305

Query  1194  DKAAVITTKESVRDLEERNI-NPWRLCSVTQVEEVKCILRLLPIWLCTILYSVVFTQMAS  1018
             D+AAV+T K+   +++     NPWRLCSV+QVEEVKCILRLLPIWLCTILYSVVFTQM S
Sbjct  306   DRAAVVTHKDHTVEVKTSAAHNPWRLCSVSQVEEVKCILRLLPIWLCTILYSVVFTQMTS  365

Query  1017  LFVEQGAAMRTNIA-GFHIPPASMSSFDILSVAAFIFIYRRILDPLIASLKKTRRAQGFT  841
             LFVEQGAAM+T  A GFHIPPASMSSFDILSVA FIF+ RR++ P +A ++K+  A   T
Sbjct  366   LFVEQGAAMKTTTAGGFHIPPASMSSFDILSVATFIFLSRRVIFPAVARMRKSGLAP--T  423

Query  840   ELQRMGVGLiiaimamvaagiVEHFRLKYASTDCPRCPSSLSIFWQVPQYVLIGASEVFM  661
             EL+RMG GL+IA  AM++AG+VEHFRL+ +          +SIFWQVPQYVLIGASEVFM
Sbjct  424   ELERMGAGLVIAAAAMISAGVVEHFRLR-SVDSSGDGGGGMSIFWQVPQYVLIGASEVFM  482

Query  660   YVGQLEFFNGQAPEGLKSFASALCMTSISLGNYVSSLLVSIVMRISTTHRMPGWIPGNLN  481
             YVGQLEFFNGQAP+GLKSF SAL MTSISLGNYVSSL+V+IVM++S +  MPGWIP NLN
Sbjct  483   YVGQLEFFNGQAPDGLKSFGSALSMTSISLGNYVSSLIVTIVMKVSASDEMPGWIPRNLN  542

Query  480   KGHLDRFYFLLAALTTADFVVYILCAKWYKYIEFEERNSCLKN  352
              GHLDRFY+LLAALT ADF VY+LCA+WYKY  FEER+S  KN
Sbjct  543   DGHLDRFYYLLAALTAADFGVYVLCARWYKYTRFEERSSRGKN  585



>ref|XP_003525604.1| PREDICTED: nitrate transporter 1.5-like isoform X1 [Glycine max]
Length=597

 Score =   811 bits (2094),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 417/580 (72%), Positives = 492/580 (85%), Gaps = 15/580 (3%)
 Frame = -3

Query  2085  KASREECTLDGTVDHYGRPALRSATGGWFAGVLLLVNQGLATLAFFGVGVNLVLFLTRVM  1906
             K   EE TLDG+VD +GRPA+R+ +G W AG ++L+NQGLATLAFFGVGVNLVLFLTRVM
Sbjct  13    KGDTEELTLDGSVDWHGRPAIRAKSGRWVAGTIVLLNQGLATLAFFGVGVNLVLFLTRVM  72

Query  1905  GQDNADAANNVSKWTGTVYLFSLLGAFLSDSYWGRYKTCAIFQLIYVVGLISVSIFSFIF  1726
             GQ+NA AAN+VSKWTGTVY+FSL+GAFLSDSYWGRYKTCAIFQ+I+V+GL+S+S+ S++ 
Sbjct  73    GQNNAAAANSVSKWTGTVYIFSLVGAFLSDSYWGRYKTCAIFQVIFVIGLVSLSLSSYLS  132

Query  1725  LVKPKGCGDENTPCRSPSRIHIAVYYVSIYLVALGNGGYQPNIATFGSDQFDGDHAHESV  1546
             L++PKGCG+E  PC   S + + ++Y+SIYL+ALGNGGYQPNIATFG+DQFD +H+ E  
Sbjct  133   LIRPKGCGNETIPCGKHSSLEMGMFYLSIYLIALGNGGYQPNIATFGADQFDEEHSKEGY  192

Query  1545  SKVAFFSYFYLALNLGSLFSNTVLVYFEDKGMWTLGFWastvsavlalllflVGTPRYRH  1366
             SKVAFFSYFYLALNLGSLFSNT+L YFED+G+W LGFW S  SA  AL+LFL+GTPRYRH
Sbjct  193   SKVAFFSYFYLALNLGSLFSNTILGYFEDEGLWALGFWVSAGSAFAALVLFLLGTPRYRH  252

Query  1365  FAPKGNPLSRFSQVLVASARKWNVHLPSDGDDHRLYEIQEHDSST---RKILHTEGFKFL  1195
             F P GNPLSRFSQVLVA++RKW   + S+G+D  LY + E++S T   RKILHT GFKFL
Sbjct  253   FKPSGNPLSRFSQVLVAASRKWRAQMTSNGED--LYVMDENESPTNGNRKILHTGGFKFL  310

Query  1194  DKAAVITTKESVRDLEERN---INPWRLCSVTQVEEVKCILRLLPIWLCTILYSVVFTQM  1024
             D+AA I    S RDLE++     NPWRLC +TQVEEVKCILRLLPIWLCTI+YSVVFTQM
Sbjct  311   DRAAFI----SPRDLEDQKSGVYNPWRLCPITQVEEVKCILRLLPIWLCTIIYSVVFTQM  366

Query  1023  ASLFVEQGAAMRTNIAGFHIPPASMSSFDILSVAAFIFIYRRILDPLIASLKKTRRAQGF  844
             ASLFVEQGAAM+T I+ F IPPASMSSFDILSVA FIF YRR++DPL+  LKK + ++G 
Sbjct  367   ASLFVEQGAAMKTTISNFRIPPASMSSFDILSVAVFIFFYRRVIDPLVGRLKK-KSSRGL  425

Query  843   TELQRMGVGLiiaimamvaagiVEHFRLKYASTDCPRCP--SSLSIFWQVPQYVLIGASE  670
             TELQRMG+GL+IA+MAMV+AGIVE +RLKYA++ CP C   SSLSIFWQ+PQY LIGASE
Sbjct  426   TELQRMGIGLVIAVMAMVSAGIVECYRLKYANSGCPHCSGTSSLSIFWQIPQYALIGASE  485

Query  669   VFMYVGQLEFFNGQAPEGLKSFASALCMTSISLGNYVSSLLVSIVMRISTTHRMPGWIPG  490
             VFMYVGQLEFFN Q P+GLKSF SALCMTSISLGNYVSS+LVSIVM+IST   MPGWIPG
Sbjct  486   VFMYVGQLEFFNAQTPDGLKSFGSALCMTSISLGNYVSSILVSIVMKISTEDHMPGWIPG  545

Query  489   NLNKGHLDRFYFLLAALTTADFVVYILCAKWYKYIEFEER  370
             NLN+GHLDRFYFLLA LT+ D V+YI CAKW+K I+ E +
Sbjct  546   NLNRGHLDRFYFLLAILTSIDLVLYIACAKWFKSIQLEGK  585



>gb|KHN21024.1| Nitrate transporter 1.5, partial [Glycine soja]
Length=606

 Score =   811 bits (2094),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 417/580 (72%), Positives = 492/580 (85%), Gaps = 15/580 (3%)
 Frame = -3

Query  2085  KASREECTLDGTVDHYGRPALRSATGGWFAGVLLLVNQGLATLAFFGVGVNLVLFLTRVM  1906
             K   EE TLDG+VD +GRPA+R+ +G W AG ++L+NQGLATLAFFGVGVNLVLFLTRVM
Sbjct  22    KGDTEELTLDGSVDWHGRPAIRAKSGRWVAGTIVLLNQGLATLAFFGVGVNLVLFLTRVM  81

Query  1905  GQDNADAANNVSKWTGTVYLFSLLGAFLSDSYWGRYKTCAIFQLIYVVGLISVSIFSFIF  1726
             GQ+NA AAN+VSKWTGTVY+FSL+GAFLSDSYWGRYKTCAIFQ+I+V+GL+S+S+ S++ 
Sbjct  82    GQNNAAAANSVSKWTGTVYIFSLVGAFLSDSYWGRYKTCAIFQVIFVIGLVSLSLSSYLS  141

Query  1725  LVKPKGCGDENTPCRSPSRIHIAVYYVSIYLVALGNGGYQPNIATFGSDQFDGDHAHESV  1546
             L++PKGCG+E  PC   S + + ++Y+SIYL+ALGNGGYQPNIATFG+DQFD +H+ E  
Sbjct  142   LIRPKGCGNETIPCGKHSSLEMGMFYLSIYLIALGNGGYQPNIATFGADQFDEEHSKEGY  201

Query  1545  SKVAFFSYFYLALNLGSLFSNTVLVYFEDKGMWTLGFWastvsavlalllflVGTPRYRH  1366
             SKVAFFSYFYLALNLGSLFSNT+L YFED+G+W LGFW S  SA  AL+LFL+GTPRYRH
Sbjct  202   SKVAFFSYFYLALNLGSLFSNTILGYFEDEGLWALGFWVSAGSAFAALVLFLLGTPRYRH  261

Query  1365  FAPKGNPLSRFSQVLVASARKWNVHLPSDGDDHRLYEIQEHDSST---RKILHTEGFKFL  1195
             F P GNPLSRFSQVLVA++RKW   + S+G+D  LY + E++S T   RKILHT GFKFL
Sbjct  262   FKPSGNPLSRFSQVLVAASRKWRAQMTSNGED--LYVMDENESPTNGNRKILHTGGFKFL  319

Query  1194  DKAAVITTKESVRDLEERN---INPWRLCSVTQVEEVKCILRLLPIWLCTILYSVVFTQM  1024
             D+AA I    S RDLE++     NPWRLC +TQVEEVKCILRLLPIWLCTI+YSVVFTQM
Sbjct  320   DRAAFI----SPRDLEDQKSGVYNPWRLCPITQVEEVKCILRLLPIWLCTIIYSVVFTQM  375

Query  1023  ASLFVEQGAAMRTNIAGFHIPPASMSSFDILSVAAFIFIYRRILDPLIASLKKTRRAQGF  844
             ASLFVEQGAAM+T I+ F IPPASMSSFDILSVA FIF YRR++DPL+  LKK + ++G 
Sbjct  376   ASLFVEQGAAMKTTISNFRIPPASMSSFDILSVAVFIFFYRRVIDPLVGRLKK-KSSRGL  434

Query  843   TELQRMGVGLiiaimamvaagiVEHFRLKYASTDCPRCP--SSLSIFWQVPQYVLIGASE  670
             TELQRMG+GL+IA+MAMV+AGIVE +RLKYA++ CP C   SSLSIFWQ+PQY LIGASE
Sbjct  435   TELQRMGIGLVIAVMAMVSAGIVECYRLKYANSGCPHCSGTSSLSIFWQIPQYALIGASE  494

Query  669   VFMYVGQLEFFNGQAPEGLKSFASALCMTSISLGNYVSSLLVSIVMRISTTHRMPGWIPG  490
             VFMYVGQLEFFN Q P+GLKSF SALCMTSISLGNYVSS+LVSIVM+IST   MPGWIPG
Sbjct  495   VFMYVGQLEFFNAQTPDGLKSFGSALCMTSISLGNYVSSILVSIVMKISTEDHMPGWIPG  554

Query  489   NLNKGHLDRFYFLLAALTTADFVVYILCAKWYKYIEFEER  370
             NLN+GHLDRFYFLLA LT+ D V+YI CAKW+K I+ E +
Sbjct  555   NLNRGHLDRFYFLLAILTSIDLVLYIACAKWFKSIQLEGK  594



>ref|XP_010538507.1| PREDICTED: protein NRT1/ PTR FAMILY 7.2 [Tarenaya hassleriana]
Length=581

 Score =   809 bits (2089),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 413/576 (72%), Positives = 476/576 (83%), Gaps = 10/576 (2%)
 Frame = -3

Query  2091  EEKASR--EECTLDGTVDHYGRPALRSATGGWFAGVLLLVNQGLATLAFFGVGVNLVLFL  1918
             E+K S+  E CT DG+VD  G PA+RS TG W + VL+LVNQGLATLAFFGVGVNLVLFL
Sbjct  5     EQKISKKTEACTQDGSVDRPGNPAIRSKTGTWLSAVLILVNQGLATLAFFGVGVNLVLFL  64

Query  1917  TRVMGQDNADAANNVSKWTGTVYLFSLLGAFLSDSYWGRYKTCAIFQLIYVVGLISVSIF  1738
             TRVMGQDNA+AAN+VSKWTGTVY+FSLLGAFLSDSYWGRYKTC+IFQ   V GL+ +S+ 
Sbjct  65    TRVMGQDNAEAANSVSKWTGTVYIFSLLGAFLSDSYWGRYKTCSIFQAFLVAGLVLLSVS  124

Query  1737  SFIFLVKPKGCGDENTPCRSPSRIHIAVYYVSIYLVALGNGGYQPNIATFGSDQFDGDHA  1558
             +  FL+KP+GCG E TPC S SR   A++Y S+YL+ALG GGYQPNIATFG+DQFD +  
Sbjct  125   TQAFLLKPEGCGGEETPCGSHSRFKTALFYFSVYLIALGYGGYQPNIATFGADQFDAEDP  184

Query  1557  HESVSKVAFFSYFYLALNLGSLFSNTVLVYFEDKGMWTLGFWastvsavlalllflVGTP  1378
              E  SK+AFFSYFYLALNLGSLFSNTVL +FED+G W LGFWAS  SA   L LFL GTP
Sbjct  185   KEGYSKIAFFSYFYLALNLGSLFSNTVLGFFEDQGRWPLGFWASAASAFAGLALFLTGTP  244

Query  1377  RYRHFAPKGNPLSRFSQVLVASARKWNVHLPSDGDDH--RLYEIQEHDSSTRKILHTEGF  1204
             RYRHF PK +P SRF QVLVA+ RK  +H+P   D H   L+E +   +  RKILHT+GF
Sbjct  245   RYRHFVPKESPWSRFCQVLVAATRKARIHMPPSTDLHGVNLFETETQRTGDRKILHTQGF  304

Query  1203  KFLDKAAVITTKESVRDLEERNINPWRLCSVTQVEEVKCILRLLPIWLCTILYSVVFTQM  1024
             +FLD+AA +   + +   +E + +PW+LC+VTQVEEVKC+LRLLPIWLCTILYSVVFTQM
Sbjct  305   RFLDRAATVMPDDEID--KESSYDPWKLCTVTQVEEVKCVLRLLPIWLCTILYSVVFTQM  362

Query  1023  ASLFVEQGAAMRTNIAGFHIPPASMSSFDILSVAAFIFIYRRILDPLIASLKKTRRAQGF  844
             ASLFVEQGA M+T IA FHIPPASMSSFDILSVA FIF+YRR+LDP+ + L KT   +G 
Sbjct  363   ASLFVEQGAVMKTTIADFHIPPASMSSFDILSVAFFIFVYRRVLDPIFSRLNKTEPNKGL  422

Query  843   TELQRMGVGLiiaimamvaagiVEHFRLKYASTDCPRCPSSLSIFWQVPQYVLIGASEVF  664
             TELQRMG+GL+IA+MAM+AAG+VE FRLK+ +T      SSLSIFWQVPQYVLIGASEVF
Sbjct  423   TELQRMGIGLVIAVMAMIAAGVVEIFRLKHKNTS----ESSLSIFWQVPQYVLIGASEVF  478

Query  663   MYVGQLEFFNGQAPEGLKSFASALCMTSISLGNYVSSLLVSIVMRISTTHRMPGWIPGNL  484
             MYVGQLEFFNGQAP GLKSF SALCMTSISLGNYVSSLLVSIVM+IST   MPGWIPGNL
Sbjct  479   MYVGQLEFFNGQAPSGLKSFGSALCMTSISLGNYVSSLLVSIVMKISTRDEMPGWIPGNL  538

Query  483   NKGHLDRFYFLLAALTTADFVVYILCAKWYKYIEFE  376
             NKGHL+RF+FLLAALTTADFVVY++CAKWYKYI+ E
Sbjct  539   NKGHLERFFFLLAALTTADFVVYLICAKWYKYIKSE  574



>emb|CBI16743.3| unnamed protein product [Vitis vinifera]
Length=641

 Score =   807 bits (2085),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 412/599 (69%), Positives = 477/599 (80%), Gaps = 29/599 (5%)
 Frame = -3

Query  2097  RDEEKASREECTLDGTVDHYGRPALRSATGGWFAGVLLLVNQGLATLAFFGVGVNLVLFL  1918
             R + +  +EECT DG+VD +G PA+R+ TG W   +L+LVNQGLATLAFFGVGVNLVLFL
Sbjct  64    RGKTRNEQEECTFDGSVDRHGHPAVRARTGNWVTAILILVNQGLATLAFFGVGVNLVLFL  123

Query  1917  TRVMGQDNADAANNVSKWTGTVYLFSLLGAFLSDSYWGRYKTCAIFQLIYVVGLISVSIF  1738
             TRV+GQDNA AANNVSKWTGTVY+FSLLGAFLSDSYWGRYKTCAIFQ+I+V+GL+ +S+ 
Sbjct  124   TRVLGQDNATAANNVSKWTGTVYIFSLLGAFLSDSYWGRYKTCAIFQVIFVIGLVLLSLS  183

Query  1737  SFIFLVKPKGCGDENTPCRSPSRIHIAVYYVSIYLVALGNGGYQPNIATFGSDQFDGDHA  1558
             S+IFL+KP GCGD+  PC S S   I+ +Y+SIYL+ALGNGGYQPNIATFG+DQFD D+ 
Sbjct  184   SYIFLLKPNGCGDKEFPCGSHSTFEISFFYLSIYLIALGNGGYQPNIATFGADQFDEDNP  243

Query  1557  HESVSKVAFFSYFYLALNLGSLFSNTVLVYFEDKGMWTLGFWastvsavlalllflVGTP  1378
              ES SKVAFFSYFYLALNLGSLFSNT+L YFED G W LGFWAS+ SA+LAL+LFL G P
Sbjct  244   KESHSKVAFFSYFYLALNLGSLFSNTILGYFEDGGRWVLGFWASSASAILALILFLFGIP  303

Query  1377  RYRHFAPKGNPLSRFSQVLVASARKWNVHLPSDGDDHRLYEIQEHDSS---TRKILHTEG  1207
             RYRHF P GNPLSRF +V+VA+ RKW V +P +G+D  LYE+   D S    RK+LHT+G
Sbjct  304   RYRHFKPSGNPLSRFCRVVVAATRKWKVEMPPEGED--LYEVDGDDCSGNCRRKMLHTQG  361

Query  1206  FKFLDKAAVITTKESVRDLEERNINPWRLCSVTQVEEVKCILRLLPIWLCTILYSVVFTQ  1027
             FKFLDKAAV+T KE  ++ +E   +PWR+C+VTQVEEVKCILRLLPIWLCTILYSVVFTQ
Sbjct  362   FKFLDKAAVLTAKEREQEDKESR-SPWRICTVTQVEEVKCILRLLPIWLCTILYSVVFTQ  420

Query  1026  MASLFVEQGAAMRTNIAGFHIPPASMSSFDILSVAAFIFIYRRILDPLIASLKKTRRAQG  847
             MASLFVEQGAAM+T + GFHIPPASMSSFDI+SVAAFIFIYRR+LDPL+A LK T +A+G
Sbjct  421   MASLFVEQGAAMKTTLLGFHIPPASMSSFDIVSVAAFIFIYRRVLDPLVARLKGT-KARG  479

Query  846   FTELQRMGVGLiiaimamvaagiVEHFRLKYASTDCPRCPSSLSIFWQVPQYVLIGASEV  667
              TELQRM                                 SSLSIFWQ+PQYVLIGASEV
Sbjct  480   LTELQRM----------------------GIGLIIAIIAMSSLSIFWQIPQYVLIGASEV  517

Query  666   FMYVGQLEFFNGQAPEGLKSFASALCMTSISLGNYVSSLLVSIVMRISTTHRMPGWIPGN  487
             FMYVGQLEFFN QAP+GLKSF SALCMTSISLGNYVSSLLV+IVM+ ST  +MPGWIP N
Sbjct  518   FMYVGQLEFFNDQAPDGLKSFGSALCMTSISLGNYVSSLLVTIVMKFSTRDQMPGWIPSN  577

Query  486   LNKGHLDRFYFLLAALTTADFVVYILCAKWYKYIEFEERNSCLKNIGDSKLQEDRSTFN  310
             LNKGHLDRFYFLLAALT ADF VYI+CAKWYK I+ E +     + G   +  + + FN
Sbjct  578   LNKGHLDRFYFLLAALTMADFGVYIICAKWYKSIKLEGKYEDSNSKGSDDVMSELNIFN  636



>gb|KDP39505.1| hypothetical protein JCGZ_05071 [Jatropha curcas]
Length=599

 Score =   805 bits (2080),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 419/601 (70%), Positives = 498/601 (83%), Gaps = 20/601 (3%)
 Frame = -3

Query  2103  NERDEEKASREECTLDGTVDHYGRPALRSATGGWFAGVLLLVNQGLATLAFFGVGVNLVL  1924
             N+  + K  REECTLDGT D +GRPA++  +G W AG+++L+NQGLATLAFFGVGVNLVL
Sbjct  8     NKEGKFKKDREECTLDGTTDFHGRPAIKQKSGKWVAGIIILLNQGLATLAFFGVGVNLVL  67

Query  1923  FLTRVMGQDNADAANNVSKWTGTVYLFSLLGAFLSDSYWGRYKTCAIFQLIYVVGLISVS  1744
             FLTRV+ Q+NADAAN+VSKWTGTVY+FSL+GAFLSDSYWGRYKTCAIFQ+I+V+GL+ +S
Sbjct  68    FLTRVLQQNNADAANSVSKWTGTVYIFSLVGAFLSDSYWGRYKTCAIFQVIFVIGLMLLS  127

Query  1743  IFSFIFLVKPKGCGDENTPCRSPSRIHIAVYYVSIYLVALGNGGYQPNIATFGSDQFDGD  1564
             + S++FL++PKGCGD  TPC S S + I  +Y+SIYL+ALGNGGYQPNIATFG+DQFD  
Sbjct  128   LSSYLFLIRPKGCGDGMTPCGSHSSMEIGFFYLSIYLIALGNGGYQPNIATFGADQFDEQ  187

Query  1563  HAHESVSKVAFFSYFYLALNLGSLFSNTVLVYFEDKGMWTLGFWastvsavlalllflVG  1384
                E  SKVAFFSYFYLALNLGSLFSNTVL YFED GMW LGFW ST SA  AL+LFL G
Sbjct  188   DPKEGHSKVAFFSYFYLALNLGSLFSNTVLGYFEDGGMWALGFWVSTGSAFAALVLFLGG  247

Query  1383  TPRYRHFAPKGNPLSRFSQVLVASARKWNVHLPSDGDDHRLYEIQEHD---SSTRKILHT  1213
             T  YRHF P GNPLSRF QV++A+ +KW V +P D +D  LY++ + D   +S+RKILHT
Sbjct  248   TAWYRHFKPSGNPLSRFCQVIIAATKKWKVEMPQDSED--LYDLDDKDGSVNSSRKILHT  305

Query  1212  EGFKFLDKAAVITTKESVRDLEERNI---NPWRLCSVTQVEEVKCILRLLPIWLCTILYS  1042
              GFKFLD+AA I++    RD++++N    NPWRLC +TQVEEVKCILRLLPIWLCTILYS
Sbjct  306   HGFKFLDRAAFISS----RDMDDQNQDCRNPWRLCPITQVEEVKCILRLLPIWLCTILYS  361

Query  1041  VVFTQMASLFVEQGAAMRTNIAGFHIPPASMSSFDILSVAAFIFIYRRILDPLIASLKKT  862
             VVFTQMASLFVEQGAAM+T I+ F IP ASMSSFDILSVA FIF+YRR+LDPL+  ++ +
Sbjct  362   VVFTQMASLFVEQGAAMKTTISNFRIPAASMSSFDILSVALFIFLYRRVLDPLVGRIRNS  421

Query  861   RRAQGFTELQRMGVGLiiaimamvaagiVEHFRLKYASTDCPRC--PSSLSIFWQVPQYV  688
              +++G TELQRMG+GL+IAIMAMV+AGIVE +RLKYA  DC  C   SSLS+FWQVPQY 
Sbjct  422   -KSKGLTELQRMGIGLVIAIMAMVSAGIVECYRLKYARKDCRHCEGSSSLSVFWQVPQYA  480

Query  687   LIGASEVFMYVGQLEFFNGQAPEGLKSFASALCMTSISLGNYVSSLLVSIVMRISTTHRM  508
             LIGASEVFMYVGQLEFFN QAP+GLKSF SALCMTSISLGNYVSSLLV++VM+IST   M
Sbjct  481   LIGASEVFMYVGQLEFFNAQAPDGLKSFGSALCMTSISLGNYVSSLLVTMVMKISTEGNM  540

Query  507   PGWIPGNLNKGHLDRFYFLLAALTTADFVVYILCAKWYKYIEFEERNSCLKNIGDSKLQE  328
              GWIPGNLNKGHLDRFYFLLAALT+ D  VYI CAKWYK I+F+ R     ++ ++K ++
Sbjct  541   HGWIPGNLNKGHLDRFYFLLAALTSVDLFVYIACAKWYKSIKFQGR-----DVANNKEED  595

Query  327   D  325
             D
Sbjct  596   D  596



>emb|CDX93833.1| BnaA09g24330D [Brassica napus]
Length=620

 Score =   803 bits (2074),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 413/588 (70%), Positives = 490/588 (83%), Gaps = 8/588 (1%)
 Frame = -3

Query  2109  IKNERDEEKASREECTLDGTVDHYGRPALRSATGGWFAGVLLLVNQGLATLAFFGVGVNL  1930
             I N+   +K    E T DGTVD+YGRP++RS +G W AG+++LVNQGLATLAFFGVGVNL
Sbjct  6     IYNKDMMKKKGEGEETRDGTVDYYGRPSIRSNSGQWVAGIIILVNQGLATLAFFGVGVNL  65

Query  1929  VLFLTRVMGQDNADAANNVSKWTGTVYLFSLLGAFLSDSYWGRYKTCAIFQLIYVVGLIS  1750
             VLFLTRV+ Q+NADAANNVSKWTGTVY+FSL+GAFLSDSYWGRYKTCAIFQ+I+V+GL S
Sbjct  66    VLFLTRVLQQNNADAANNVSKWTGTVYIFSLVGAFLSDSYWGRYKTCAIFQVIFVIGLSS  125

Query  1749  VSIFSFIFLVKPKGCGDENTPCRSPSRIHIAVYYVSIYLVALGNGGYQPNIATFGSDQFD  1570
             +S+ S+IFL+KP+GCG+E TPC + S + I ++Y+SIYL+ALGNGGYQPNIATFG+DQFD
Sbjct  126   LSLSSYIFLIKPRGCGNEVTPCSTHSTMEITMFYLSIYLIALGNGGYQPNIATFGADQFD  185

Query  1569  GDHAHESVSKVAFFSYFYLALNLGSLFSNTVLVYFEDKGMWTLGFWastvsavlalllfl  1390
              +H  E  SK+AFFSYFYLALNLGSLFSNT+L YFED+GMW LGFWAST SAVLAL+LFL
Sbjct  186   EEHPKEGYSKIAFFSYFYLALNLGSLFSNTILGYFEDEGMWALGFWASTGSAVLALILFL  245

Query  1389  VGTPRYRHFAPKGNPLSRFSQVLVASARKWNVHLPSDG-----DDHRLYEIQEHDSSTRK  1225
             VGTPRYRHF P GNPLSRF QVLVA+ +K +V  PS G     D+ R  +    +++ R+
Sbjct  246   VGTPRYRHFKPTGNPLSRFCQVLVAATKKSSVEAPSRGREEMYDEDRQEKNDSVNNTGRR  305

Query  1224  ILHTEGFKFLDKAAVITTKESVRDLEERNINPWRLCSVTQVEEVKCILRLLPIWLCTILY  1045
             I+HT+ FKFLD+AA IT ++ + D ++  +NPWRLC VTQVEEVKCILRL+PIWLCTI+Y
Sbjct  306   IMHTDEFKFLDRAAYITARD-LDDKKQGGVNPWRLCPVTQVEEVKCILRLMPIWLCTIIY  364

Query  1044  SVVFTQMASLFVEQGAAMRTNIAGFHIPPASMSSFDILSVAAFIFIYRRILDPLIASLKK  865
             SVVFTQMASLFVEQGAAM+T ++ F IPPASMSSFDILSVA FIFIYRR+L+PL    KK
Sbjct  365   SVVFTQMASLFVEQGAAMKTTVSDFKIPPASMSSFDILSVALFIFIYRRVLEPLATRFKK  424

Query  864   TRRAQGFTELQRMGVGLiiaimamvaagiVEHFRLKYASTDCPRC--PSSLSIFWQVPQY  691
                 +G TEL RMG+GL+IAI+AMVAAG+VE FRLKYA   C  C   SSLSIFWQVPQY
Sbjct  425   KDGTKGITELHRMGIGLVIAILAMVAAGVVECFRLKYADKSCTHCDGSSSLSIFWQVPQY  484

Query  690   VLIGASEVFMYVGQLEFFNGQAPEGLKSFASALCMTSISLGNYVSSLLVSIVMRISTTHR  511
              LIGASEVFMYVGQLEFFN Q P+GLKSF SALCM S+S+GN+VSSLLV++V++IST   
Sbjct  485   SLIGASEVFMYVGQLEFFNAQTPDGLKSFGSALCMMSMSMGNFVSSLLVTMVVKISTVDH  544

Query  510   MPGWIPGNLNKGHLDRFYFLLAALTTADFVVYILCAKWYKYIEFEERN  367
             MPGWIP NLNKGHLDRFYFLLAALT+ D VVYI CA+WYK I+ E ++
Sbjct  545   MPGWIPRNLNKGHLDRFYFLLAALTSIDLVVYIACARWYKCIKLEAKD  592



>ref|XP_010097732.1| Nitrate transporter 1.5 [Morus notabilis]
 gb|EXB70687.1| Nitrate transporter 1.5 [Morus notabilis]
Length=618

 Score =   800 bits (2067),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 433/599 (72%), Positives = 495/599 (83%), Gaps = 18/599 (3%)
 Frame = -3

Query  2133  LNITKMFFIKNERDEEKASREECTLDGTVDHYGRPALRSATGGWFAGVLLLVNQGLATLA  1954
             LN+ +    K  + ++K   E  T DG+VD +G PA+R  TG W AG+L+LVNQGLATLA
Sbjct  11    LNLYEQVVAKERKKQKKECWEAYTQDGSVDRHGHPAVRGRTGSWVAGILILVNQGLATLA  70

Query  1953  FFGVGVNLVLFLTRVMGQDNADAANNVSKWTGTVYLFSLLGAFLSDSYWGRYKTCAIFQL  1774
             FFGVGVNLVLFL RV+GQDNA+AANNVSKWTGTVYLFSL+GAFLSDSYWGR+KTCAIFQ 
Sbjct  71    FFGVGVNLVLFLIRVLGQDNAEAANNVSKWTGTVYLFSLVGAFLSDSYWGRFKTCAIFQA  130

Query  1773  IYVVGLISVSIFSFIFLVKPKGCGDENTPCRSPSRIHIAVYYVSIYLVALGNGGYQPNIA  1594
             I+V+GL S+S+ S++ L+KP+GCGD  +PC   S    A++YVS Y++ALGNGGYQPNIA
Sbjct  131   IFVLGLASLSLSSYMLLLKPRGCGDGESPCGHHSSFANALFYVSTYMIALGNGGYQPNIA  190

Query  1593  TFGSDQFDGDHAHESVSKVAFFSYFYLALNLGSLFSNTVLVYFEDKGMWTLGFWastvsa  1414
             TFG+DQFD + + E  SK+AFFSYFYLALNLGSLFSNT+L Y+EDKGMW LGFWAS  SA
Sbjct  191   TFGADQFDEEDSKEGHSKIAFFSYFYLALNLGSLFSNTILGYYEDKGMWALGFWASAGSA  250

Query  1413  vlalllflVGTPRYRHFAPKGNPLSRFSQVLVASARKWNVHLPSDGDDHRLYEIQEHDSS  1234
              LAL+LFL GTPRYRHF+PKGNPLSRF QV+V + RKW V +   GD+  L+E  E +SS
Sbjct  251   TLALILFLCGTPRYRHFSPKGNPLSRFCQVVVTAVRKWKVEMTPGGDN--LFENCEKESS  308

Query  1233  ---TRKILHTEGFKFLDKAAVITTKESVRDLEERNINPWRLCSVTQVEEVKCILRLLPIW  1063
                 R ILHTEGFKFLD+AAVIT KE    L++   NPWRLC+VTQVEEVKCILRLLPIW
Sbjct  309   QNGARNILHTEGFKFLDRAAVITEKE----LDKTGKNPWRLCTVTQVEEVKCILRLLPIW  364

Query  1062  LCTILYSVVFTQMASLFVEQGAAMRTNIAGFHIPPASMSSFDILSVAAFIFIYRRILDPL  883
             LCTILYSVVFTQMASLFVEQGAAM+T ++GFHIPPASMSSFDILSVAAFIF+YRR+LDPL
Sbjct  365   LCTILYSVVFTQMASLFVEQGAAMKTTVSGFHIPPASMSSFDILSVAAFIFLYRRVLDPL  424

Query  882   IASLKKTRRAQGFTELQRMGVGLiiaimamvaagiVEHFRLKY-------ASTDCPRCPS  724
             +A + K  R  G TELQRMG+GL+IAIMAMV+AG+VE FRLKY          D  + PS
Sbjct  425   VARVTKNPR--GLTELQRMGMGLVIAIMAMVSAGVVECFRLKYKVVVVEEGVGDHHKSPS  482

Query  723   SLSIFWQVPQYVLIGASEVFMYVGQLEFFNGQAPEGLKSFASALCMTSISLGNYVSSLLV  544
             SLSIFWQVPQYVLIGASEVFMYVGQLEFFNGQAP+GLKSF SALCMTSISLGNYVSSLLV
Sbjct  483   SLSIFWQVPQYVLIGASEVFMYVGQLEFFNGQAPDGLKSFGSALCMTSISLGNYVSSLLV  542

Query  543   SIVMRISTTHRMPGWIPGNLNKGHLDRFYFLLAALTTADFVVYILCAKWYKYIEFEERN  367
             +IVM+IST   MPGWIPGNLNKGHL+RFYFLLAALT AD  VY LCAKWYKY +FE RN
Sbjct  543   TIVMKISTRDDMPGWIPGNLNKGHLERFYFLLAALTAADLAVYFLCAKWYKYTKFEGRN  601



>emb|CDY01274.1| BnaC05g24580D [Brassica napus]
Length=619

 Score =   800 bits (2065),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 410/588 (70%), Positives = 489/588 (83%), Gaps = 8/588 (1%)
 Frame = -3

Query  2109  IKNERDEEKASREECTLDGTVDHYGRPALRSATGGWFAGVLLLVNQGLATLAFFGVGVNL  1930
             I N+   +K    E T DGTVD+YGRP++RS +G W AG+++LVNQGLATLAFFGVGVNL
Sbjct  6     IYNKDMMKKKGEGEETRDGTVDYYGRPSIRSNSGQWVAGIIILVNQGLATLAFFGVGVNL  65

Query  1929  VLFLTRVMGQDNADAANNVSKWTGTVYLFSLLGAFLSDSYWGRYKTCAIFQLIYVVGLIS  1750
             VLFLTRV+ Q+NADAANNVSKWTGTVY+FSL+GAFLSDSYWGRYKTCAIFQ+I+V+GL S
Sbjct  66    VLFLTRVLQQNNADAANNVSKWTGTVYIFSLVGAFLSDSYWGRYKTCAIFQVIFVIGLSS  125

Query  1749  VSIFSFIFLVKPKGCGDENTPCRSPSRIHIAVYYVSIYLVALGNGGYQPNIATFGSDQFD  1570
             +S+ S++FL+KP+GCG+E TPC + S + I ++Y+SIYL+ALGNGGYQPNIATFG+DQFD
Sbjct  126   LSLSSYMFLIKPRGCGNEVTPCSTHSTMEITMFYLSIYLIALGNGGYQPNIATFGADQFD  185

Query  1569  GDHAHESVSKVAFFSYFYLALNLGSLFSNTVLVYFEDKGMWTLGFWastvsavlalllfl  1390
              +H  E  SK+AFFSYFYLALNLGSLFSNT+L YFED+GMW LGFWAST SA+LAL+LFL
Sbjct  186   EEHPKEGYSKIAFFSYFYLALNLGSLFSNTILGYFEDEGMWALGFWASTGSAILALILFL  245

Query  1389  VGTPRYRHFAPKGNPLSRFSQVLVASARKWNVHLPSDG-----DDHRLYEIQEHDSSTRK  1225
             VGTPRYRHF P GNPLSRF QVLVA+ +K +V  PS G     D+ R  +    +++ R+
Sbjct  246   VGTPRYRHFKPTGNPLSRFCQVLVAATKKSSVEAPSRGREEMYDEDRQEKNDSVNNTGRR  305

Query  1224  ILHTEGFKFLDKAAVITTKESVRDLEERNINPWRLCSVTQVEEVKCILRLLPIWLCTILY  1045
             I+HT+ FKFLD+AA IT ++ + D ++  +NPWRLC VTQVEEVKCILRL+PIWLCTI+Y
Sbjct  306   IMHTDEFKFLDRAAYITARD-LDDKKQGGVNPWRLCPVTQVEEVKCILRLMPIWLCTIIY  364

Query  1044  SVVFTQMASLFVEQGAAMRTNIAGFHIPPASMSSFDILSVAAFIFIYRRILDPLIASLKK  865
             SVVFTQMASLFVEQGAAM+T ++ F IPPASMSSFDILSVA FIFIYRR+L+PL    K 
Sbjct  365   SVVFTQMASLFVEQGAAMKTTVSDFKIPPASMSSFDILSVALFIFIYRRVLEPLATRFKN  424

Query  864   TRRAQGFTELQRMGVGLiiaimamvaagiVEHFRLKYASTDCPRC--PSSLSIFWQVPQY  691
                 +G TEL RMG+GL+IAI+AMVAAG+VE FRLKYA   C  C   SSLSIFWQVPQY
Sbjct  425   KDGTKGITELHRMGIGLVIAILAMVAAGVVECFRLKYADKSCTHCDGSSSLSIFWQVPQY  484

Query  690   VLIGASEVFMYVGQLEFFNGQAPEGLKSFASALCMTSISLGNYVSSLLVSIVMRISTTHR  511
              LIGASEVFMYVGQLEFFN Q P+GLKSF SALCM S+S+GN+VSSLLV++V++IST   
Sbjct  485   SLIGASEVFMYVGQLEFFNAQTPDGLKSFGSALCMMSMSMGNFVSSLLVTMVVKISTVDH  544

Query  510   MPGWIPGNLNKGHLDRFYFLLAALTTADFVVYILCAKWYKYIEFEERN  367
             MPGWIP NLNKGHLDRFYFLLAALT+ D VVYI CA+WYK I+ E ++
Sbjct  545   MPGWIPRNLNKGHLDRFYFLLAALTSIDLVVYIACARWYKCIKLEAKH  592



>ref|XP_009114885.1| PREDICTED: protein NRT1/ PTR FAMILY 7.3-like [Brassica rapa]
Length=620

 Score =   800 bits (2065),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 411/588 (70%), Positives = 489/588 (83%), Gaps = 8/588 (1%)
 Frame = -3

Query  2109  IKNERDEEKASREECTLDGTVDHYGRPALRSATGGWFAGVLLLVNQGLATLAFFGVGVNL  1930
             I N+   +K    E T DGTVD+YGRP++RS +G W AG+++LVNQGLATLAFFGVGVNL
Sbjct  6     IYNKDMMKKKGEGEETRDGTVDYYGRPSIRSNSGQWVAGIIILVNQGLATLAFFGVGVNL  65

Query  1929  VLFLTRVMGQDNADAANNVSKWTGTVYLFSLLGAFLSDSYWGRYKTCAIFQLIYVVGLIS  1750
             VLFLTRV+ Q+NADAANNVSKWTGTVY+ SL+GAFLSDSYWGRYKTCAIFQ+I+V+GL S
Sbjct  66    VLFLTRVLQQNNADAANNVSKWTGTVYISSLVGAFLSDSYWGRYKTCAIFQVIFVIGLSS  125

Query  1749  VSIFSFIFLVKPKGCGDENTPCRSPSRIHIAVYYVSIYLVALGNGGYQPNIATFGSDQFD  1570
             +S+ S++FL+KP+GCG+E TPC + S + I ++Y+SIYL+ALGNGGYQPNIATFG+DQFD
Sbjct  126   LSLSSYMFLIKPRGCGNEVTPCSTHSTMEITMFYLSIYLIALGNGGYQPNIATFGADQFD  185

Query  1569  GDHAHESVSKVAFFSYFYLALNLGSLFSNTVLVYFEDKGMWTLGFWastvsavlalllfl  1390
              +H  E  SK+AFFSYFYLALNLGSLFSNT+L YFED+GMW LGFWAST SAVLAL+LFL
Sbjct  186   EEHPKEGYSKIAFFSYFYLALNLGSLFSNTILGYFEDEGMWALGFWASTGSAVLALILFL  245

Query  1389  VGTPRYRHFAPKGNPLSRFSQVLVASARKWNVHLPSDG-----DDHRLYEIQEHDSSTRK  1225
             VGTPRYRHF P GNPLSRF QVLVA+ +K +V  PS G     D+ R  +    +++ R+
Sbjct  246   VGTPRYRHFKPTGNPLSRFCQVLVAATKKSSVEAPSRGREEMYDEDRQEKNDSVNNTGRR  305

Query  1224  ILHTEGFKFLDKAAVITTKESVRDLEERNINPWRLCSVTQVEEVKCILRLLPIWLCTILY  1045
             I+HT+ FKFLD+AA IT ++ + D ++  +NPWRLC VTQVEEVKCILRL+PIWLCTI+Y
Sbjct  306   IMHTDEFKFLDRAAYITARD-LDDKKQGGVNPWRLCPVTQVEEVKCILRLMPIWLCTIIY  364

Query  1044  SVVFTQMASLFVEQGAAMRTNIAGFHIPPASMSSFDILSVAAFIFIYRRILDPLIASLKK  865
             SVVFTQMASLFVEQGAAM+T ++ F IPPASMSSFDILSVA FIFIYRR+L+PL    KK
Sbjct  365   SVVFTQMASLFVEQGAAMKTTVSDFKIPPASMSSFDILSVALFIFIYRRVLEPLATRFKK  424

Query  864   TRRAQGFTELQRMGVGLiiaimamvaagiVEHFRLKYASTDCPRC--PSSLSIFWQVPQY  691
                 +G TEL RMG+GL+IAI+AMVAAG+VE FRLKYA   C  C   SSLSIFWQVPQY
Sbjct  425   KDGTKGITELHRMGIGLVIAILAMVAAGLVECFRLKYADKSCTHCDGSSSLSIFWQVPQY  484

Query  690   VLIGASEVFMYVGQLEFFNGQAPEGLKSFASALCMTSISLGNYVSSLLVSIVMRISTTHR  511
              LIGASEVFMYVGQLEFFN Q P+GLKSF SALCM S+S+GN+VSSLLV++V++IST   
Sbjct  485   SLIGASEVFMYVGQLEFFNAQTPDGLKSFGSALCMMSMSMGNFVSSLLVTMVVKISTVDH  544

Query  510   MPGWIPGNLNKGHLDRFYFLLAALTTADFVVYILCAKWYKYIEFEERN  367
             MPGWIP NLNKGHLDRFYFLLAALT+ D VVYI CA+WYK I+ E ++
Sbjct  545   MPGWIPRNLNKGHLDRFYFLLAALTSIDLVVYIACARWYKSIKLEAKD  592



>ref|XP_002278374.2| PREDICTED: protein NRT1/ PTR FAMILY 7.3 [Vitis vinifera]
Length=648

 Score =   800 bits (2066),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 419/577 (73%), Positives = 488/577 (85%), Gaps = 9/577 (2%)
 Frame = -3

Query  2085  KASREECTLDGTVDHYGRPALRSATGGWFAGVLLLVNQGLATLAFFGVGVNLVLFLTRVM  1906
             KA  E CTLDGTVD  G PA+RS +G WFAG+++L+NQGLATLAFFGVGVNLVLFLTRV+
Sbjct  70    KAGEEACTLDGTVDCRGNPAIRSRSGKWFAGIIILLNQGLATLAFFGVGVNLVLFLTRVL  129

Query  1905  GQDNADAANNVSKWTGTVYLFSLLGAFLSDSYWGRYKTCAIFQLIYVVGLISVSIFSFIF  1726
              Q+NADAANNVSKWTGTVY+FSL+GAFLSDSYWGRYKTCAIFQ+I+V+GL+S+S+ S+IF
Sbjct  130   QQNNADAANNVSKWTGTVYIFSLVGAFLSDSYWGRYKTCAIFQVIFVIGLVSLSLSSYIF  189

Query  1725  LVKPKGCGDENTPCRSPSRIHIAVYYVSIYLVALGNGGYQPNIATFGSDQFDGDHAHESV  1546
             LVKP+GCG+E++PC S S + I ++Y+SIYLVALGNGGYQPNIAT G+DQFD +   E  
Sbjct  190   LVKPEGCGNEDSPCPSHSSLEIGLFYLSIYLVALGNGGYQPNIATLGADQFDEEDPKEGH  249

Query  1545  SKVAFFSYFYLALNLGSLFSNTVLVYFEDKGMWTLGFWastvsavlalllflVGTPRYRH  1366
             SKVAFFSYFYLALNLGSLFSNT+L Y ED+GMW LGFW S  SA LAL+LFL GTPRYRH
Sbjct  250   SKVAFFSYFYLALNLGSLFSNTILSYLEDEGMWALGFWVSAGSAFLALILFLGGTPRYRH  309

Query  1365  FAPKGNPLSRFSQVLVASARKWNVHLPSDGDDHRLYE---IQEHDSSTRKILHTEGFKFL  1195
             F P GNPLSRF QV+VA+ RK+ V +P   +D  LYE    +  ++S R+ILHT+GFKFL
Sbjct  310   FKPSGNPLSRFCQVMVAAMRKFRVEMPPSAED--LYEGDGKECSNNSIRRILHTDGFKFL  367

Query  1194  DKAAVITTKESVRDLEERNINPWRLCSVTQVEEVKCILRLLPIWLCTILYSVVFTQMASL  1015
             D+AA I++K+S  + E+   N WRLC +TQVEEVKCILRL+PIWLCTI+YSVVFTQMASL
Sbjct  368   DRAAFISSKDS-DNQEQGFYNQWRLCPITQVEEVKCILRLIPIWLCTIIYSVVFTQMASL  426

Query  1014  FVEQGAAMRTNIAGFHIPPASMSSFDILSVAAFIFIYRRILDPLIASLKKTRRAQGFTEL  835
             FVEQGAAM+T ++ F IPPASMSSFDILSVAAFIF+YRR+LDPL+  ++KT   +G TEL
Sbjct  427   FVEQGAAMKTTVSNFRIPPASMSSFDILSVAAFIFLYRRVLDPLVGRIRKT-DTKGLTEL  485

Query  834   QRMGVGLiiaimamvaagiVEHFRLKYASTDCPRC--PSSLSIFWQVPQYVLIGASEVFM  661
             QRMG+GLIIAI+AM+AAGIVE +RLKYA  DC  C   SSLSIFWQVPQY  IGASEVFM
Sbjct  486   QRMGIGLIIAIIAMIAAGIVECYRLKYAQKDCTNCEGSSSLSIFWQVPQYAFIGASEVFM  545

Query  660   YVGQLEFFNGQAPEGLKSFASALCMTSISLGNYVSSLLVSIVMRISTTHRMPGWIPGNLN  481
             YVGQLEFFN Q P+GLKSF SALCMTSISLGNYVSSLLV++VM+IST   MPGWIPGNLN
Sbjct  546   YVGQLEFFNAQTPDGLKSFGSALCMTSISLGNYVSSLLVTMVMKISTEDHMPGWIPGNLN  605

Query  480   KGHLDRFYFLLAALTTADFVVYILCAKWYKYIEFEER  370
             KGHLDRFYFLLA LT  D VVY+ CAKWYK I+ E+R
Sbjct  606   KGHLDRFYFLLATLTALDLVVYVACAKWYKCIKMEDR  642



>ref|XP_010053584.1| PREDICTED: protein NRT1/ PTR FAMILY 7.3 [Eucalyptus grandis]
 gb|KCW77909.1| hypothetical protein EUGRSUZ_D02167 [Eucalyptus grandis]
Length=597

 Score =   797 bits (2059),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 413/583 (71%), Positives = 490/583 (84%), Gaps = 13/583 (2%)
 Frame = -3

Query  2103  NERDEEKASREECTLDGTVDHYGRPALRSATGGWFAGVLLLVNQGLATLAFFGVGVNLVL  1924
             N R+E    +EE TLDGTVD  GRPA+++ +G W AG ++L+NQGLATLAFFGVGVNLVL
Sbjct  11    NYREE----KEEHTLDGTVDWEGRPAIKAKSGQWCAGTIILLNQGLATLAFFGVGVNLVL  66

Query  1923  FLTRVMGQDNADAANNVSKWTGTVYLFSLLGAFLSDSYWGRYKTCAIFQLIYVVGLISVS  1744
             FLTRV+GQ+NADAAN+VSKWTGTVY+FSL+GAFLSDSYWGRYKTCA+FQ+I+V+GL S+S
Sbjct  67    FLTRVLGQNNADAANSVSKWTGTVYIFSLVGAFLSDSYWGRYKTCAVFQVIFVIGLASLS  126

Query  1743  IFSFIFLVKPKGCGDENTPCRSPSRIHIAVYYVSIYLVALGNGGYQPNIATFGSDQFDGD  1564
             + S++FLV+PKGCGD+ TPC S S + I ++Y+SIYLVALGNGGYQPNIATFG+DQFD +
Sbjct  127   LSSYLFLVRPKGCGDQQTPCGSHSSMEITLFYLSIYLVALGNGGYQPNIATFGADQFDEE  186

Query  1563  HAHESVSKVAFFSYFYLALNLGSLFSNTVLVYFEDKGMWTLGFWastvsavlalllflVG  1384
                E  SKVAFFSYFYLALNLGSLFSNT+L YFED+GMW LGFW S  SA+  LLLFL G
Sbjct  187   DPREGRSKVAFFSYFYLALNLGSLFSNTILGYFEDEGMWALGFWLSAGSALAGLLLFLGG  246

Query  1383  TPRYRHFAPKGNPLSRFSQVLVASARKWNVHLPSDGDDHRLYEIQE---HDSSTRKILHT  1213
             +P YRHF P GNP+SRF QV+VA+++KW V +   GDD  LYE +     DSS R ILHT
Sbjct  247   SPMYRHFKPTGNPISRFCQVMVAASKKWRVEMAPGGDD--LYEAEGMDCSDSSRRNILHT  304

Query  1212  EGFKFLDKAAVITTKESVRDLEERNINPWRLCSVTQVEEVKCILRLLPIWLCTILYSVVF  1033
              GFKFLD+AA IT+++ + D ++   N WRLC +TQVEEVKCILRLLPIWLCTI+YSVVF
Sbjct  305   HGFKFLDRAAYITSRD-LEDQKQGRYNKWRLCPITQVEEVKCILRLLPIWLCTIVYSVVF  363

Query  1032  TQMASLFVEQGAAMRTNIAGFHIPPASMSSFDILSVAAFIFIYRRILDPLIASLKKTRRA  853
             TQMASLFVEQGAAM+T ++ F IPPASMSSFDI+SVA FIF+YRR++DP++  ++KT  +
Sbjct  364   TQMASLFVEQGAAMKTTVSHFRIPPASMSSFDIVSVAVFIFLYRRVIDPVVGRIRKT-HS  422

Query  852   QGFTELQRMGVGLiiaimamvaagiVEHFRLKYASTDCPRCP--SSLSIFWQVPQYVLIG  679
             +G TELQRMG+GL+IA++AMV+AGIVE +RLKYA  DC RC   S+LSI WQVPQY LIG
Sbjct  423   RGLTELQRMGIGLVIAVLAMVSAGIVECYRLKYARKDCTRCEGSSTLSILWQVPQYALIG  482

Query  678   ASEVFMYVGQLEFFNGQAPEGLKSFASALCMTSISLGNYVSSLLVSIVMRISTTHRMPGW  499
             ASEVFMYVGQLEFFN QAP+GLKSF SALCMTSISLGNYVSSLLVS+VM+IST   MPGW
Sbjct  483   ASEVFMYVGQLEFFNAQAPDGLKSFGSALCMTSISLGNYVSSLLVSMVMKISTEDHMPGW  542

Query  498   IPGNLNKGHLDRFYFLLAALTTADFVVYILCAKWYKYIEFEER  370
             IPGNLNKGHLDRFYFLLAALT  D +VYI CAKWY+ I+ E +
Sbjct  543   IPGNLNKGHLDRFYFLLAALTVVDLMVYIACAKWYRNIKLEGK  585



>ref|XP_010056493.1| PREDICTED: protein NRT1/ PTR FAMILY 7.3-like [Eucalyptus grandis]
Length=619

 Score =   797 bits (2059),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 423/591 (72%), Positives = 479/591 (81%), Gaps = 19/591 (3%)
 Frame = -3

Query  2106  KNERDEE---KASREECTLDGTVDHYGRPALRSATGGWFAGVLLLVNQGLATLAFFGVGV  1936
             K  +D E   K   E  T DG VD +GRPA+R  TG W AG+L+LVNQGLATLAFFGVGV
Sbjct  8     KESKDGEGKIKKGEEVLTRDGAVDRHGRPAVRGKTGTWVAGILILVNQGLATLAFFGVGV  67

Query  1935  NLVLFLTRVMGQDNADAANNVSKWTGTVYLFSLLGAFLSDSYWGRYKTCAIFQLIYVVGL  1756
             NLVLFLTRVMGQDNA AANNVSKWTGTVY+FSLLGAFLSDSYWGRYKTCA+FQ I+V+GL
Sbjct  68    NLVLFLTRVMGQDNASAANNVSKWTGTVYIFSLLGAFLSDSYWGRYKTCAVFQAIFVIGL  127

Query  1755  ISVSIFSFIFLVKPKGCGDENTPCRSPSRIHIAVYYVSIYLVALGNGGYQPNIATFGSDQ  1576
              ++S+ S+IFL+KP+GCGDE T C   S    AV+Y+SIY+VALGNGGYQPNIATFG+DQ
Sbjct  128   AALSLSSYIFLLKPRGCGDEQTQCGRHSGFETAVFYLSIYMVALGNGGYQPNIATFGADQ  187

Query  1575  FDGDHAHESVSKVAFFSYFYLALNLGSLFSNTVLVYFEDKGMWTLGFWastvsavlalll  1396
             FD +   E  SK++FFSYFYLALNLGSLFSNT+L YFED+GMW LGFWAST SA LAL+L
Sbjct  188   FDEEDPREGHSKISFFSYFYLALNLGSLFSNTILGYFEDEGMWALGFWASTASAALALVL  247

Query  1395  flVGTPRYRHFAPKGNPLSRFSQVLVASARKWNVHLPSDGDDHRLYEIQEHDSST---RK  1225
             FL G+P YRHF P+GNPLSRF QVLV++ RKW V      +D  L+E+   D +    R+
Sbjct  248   FLCGSPWYRHFRPRGNPLSRFCQVLVSATRKWRVETEPTEED--LFEVDAGDCAAGGERR  305

Query  1224  ILHTEGFKFLDKAAVITTKESVRD-------LEERNINPWRLCSVTQVEEVKCILRLLPI  1066
             ILHT GFKFLDKAA+IT  + ++D       L+    NPWRLC+VTQVEEVKCILRLLPI
Sbjct  306   ILHTTGFKFLDKAAIITPTDFIQDCNSSSSRLQPPQNNPWRLCTVTQVEEVKCILRLLPI  365

Query  1065  WLCTILYSVVFTQMASLFVEQGAAMRTNIAGFHIPPASMSSFDILSVAAFIFIYRRILDP  886
             WLCTILYSVVFTQMASLFVEQGA MR    GFHIPPASMSSFDILSVAAFIFIYRRILDP
Sbjct  366   WLCTILYSVVFTQMASLFVEQGAGMRATFGGFHIPPASMSSFDILSVAAFIFIYRRILDP  425

Query  885   LIASLKKTRRAQGFTELQRMGVGLiiaimamvaagiVEHFRLKYAST--DCPRCPSSLSI  712
             ++A ++   +  G T+LQRMGVGLI+A++AMVAAG VEHFRLKYA          SSLSI
Sbjct  426   VVARVRT--KPHGLTQLQRMGVGLIVAVLAMVAAGTVEHFRLKYADKSCSSCEGSSSLSI  483

Query  711   FWQVPQYVLIGASEVFMYVGQLEFFNGQAPEGLKSFASALCMTSISLGNYVSSLLVSIVM  532
             FWQVPQYVLIGASEVFMYVGQLEFFN QAP+GLKSF SALCMTSISLGNYVSSLLV++VM
Sbjct  484   FWQVPQYVLIGASEVFMYVGQLEFFNAQAPDGLKSFGSALCMTSISLGNYVSSLLVTMVM  543

Query  531   RISTTHRMPGWIPGNLNKGHLDRFYFLLAALTTADFVVYILCAKWYKYIEF  379
             + S    MPGWIP NLN+GHLDRFYFLLAALT ADF VY+LCAKWY+ IEF
Sbjct  544   KFSARDDMPGWIPRNLNRGHLDRFYFLLAALTAADFFVYLLCAKWYQCIEF  594



>ref|XP_010677273.1| PREDICTED: protein NRT1/ PTR FAMILY 7.3 [Beta vulgaris subsp. 
vulgaris]
Length=599

 Score =   796 bits (2056),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 411/588 (70%), Positives = 482/588 (82%), Gaps = 12/588 (2%)
 Frame = -3

Query  2109  IKNERDEEKASREECTLDGTVDHYGRPALRSATGGWFAGVLLLVNQGLATLAFFGVGVNL  1930
             +  +RD  K   ++ T+DGTVD+ G PA R  TG WFA  ++LVNQGLATLAFFGVGVNL
Sbjct  6     VIKKRDMTKKQDDDYTMDGTVDNRGHPASRQDTGKWFASNIILVNQGLATLAFFGVGVNL  65

Query  1929  VLFLTRVMGQDNADAANNVSKWTGTVYLFSLLGAFLSDSYWGRYKTCAIFQLIYVVGLIS  1750
             VLFLTRV+G++NADAAN VSKWTGTVY+FSL+GAFLSD+YWGR+KTCAIFQ+ +V+GL S
Sbjct  66    VLFLTRVLGENNADAANTVSKWTGTVYIFSLVGAFLSDAYWGRFKTCAIFQITFVIGLAS  125

Query  1749  VSIFSFIFLVKPKGCGDENTPCRSPSRIHIAVYYVSIYLVALGNGGYQPNIATFGSDQFD  1570
             VS+ +++FL++PKGCGD  T C   S   I ++Y SIYLVALG GGYQPNIATFG+DQFD
Sbjct  126   VSLSTYLFLLRPKGCGDRTTQCGRHSSTEIGMFYFSIYLVALGYGGYQPNIATFGADQFD  185

Query  1569  GDHAHESVSKVAFFSYFYLALNLGSLFSNTVLVYFEDKGMWTLGFWastvsavlalllfl  1390
              ++  ES SKVAFFSYFYLA+NLGSLFSNT+L YFED+GMW LGFWAS  SA LAL+LFL
Sbjct  186   EEYESESHSKVAFFSYFYLAMNLGSLFSNTLLGYFEDEGMWALGFWASAASAFLALVLFL  245

Query  1389  VGTPRYRHFAPKGNPLSRFSQVLVASARKWNVHLPSDGDDHRLYEIQEHDSST---RKIL  1219
             V TP+YRHF   GNPLSR  QVLVA+ RKW   +P   D  RLYE  + + ST   RK+L
Sbjct  246   VRTPKYRHFKATGNPLSRLCQVLVAAIRKWKTEMP---DGERLYEADQKECSTDGNRKLL  302

Query  1218  HTEGFKFLDKAAVITTKESVRDLEERNINPWRLCSVTQVEEVKCILRLLPIWLCTILYSV  1039
             HTEGFKFLDKAA I + +   + E+   NPWRLC + QVEEVKCILRLLPIWLCTI+YSV
Sbjct  303   HTEGFKFLDKAAYIKSGD-FYNQEQSLHNPWRLCPIRQVEEVKCILRLLPIWLCTIIYSV  361

Query  1038  VFTQMASLFVEQGAAMRTNIAGFHIPPASMSSFDILSVAAFIFIYRRILDPLIASLKKTR  859
             VFTQMASLFVEQGAAM+T I+ F IP ASMSSFDILSV AF+FIYR++LDP+++ ++KT 
Sbjct  362   VFTQMASLFVEQGAAMKTTISNFRIPAASMSSFDILSVVAFVFIYRKVLDPIMSRVRKTE  421

Query  858   RAQGFTELQRMGVGLiiaimamvaagiVEHFRLKYASTDCPRC----PSSLSIFWQVPQY  691
                G TEL RMG+GLIIA++AMV+AGIVE +RLKYA  DCP C    PS+LSIFWQ+PQY
Sbjct  422   SG-GLTELHRMGIGLIIAVLAMVSAGIVECYRLKYAIKDCPHCRAPNPSTLSIFWQIPQY  480

Query  690   VLIGASEVFMYVGQLEFFNGQAPEGLKSFASALCMTSISLGNYVSSLLVSIVMRISTTHR  511
             V IGASEVFMYVGQLEFFN QAP+GLKSF SALCMTSISLGNYVSSL+VSIVM+IST   
Sbjct  481   VFIGASEVFMYVGQLEFFNAQAPDGLKSFGSALCMTSISLGNYVSSLIVSIVMKISTEDH  540

Query  510   MPGWIPGNLNKGHLDRFYFLLAALTTADFVVYILCAKWYKYIEFEERN  367
             MPGWIPGNLNKGHLDRF+FLLAALTT DFVVY+LCA+ YK I+ E ++
Sbjct  541   MPGWIPGNLNKGHLDRFFFLLAALTTIDFVVYLLCARSYKCIKLEGKS  588



>ref|XP_007039561.1| Nitrate transporter 1.5 [Theobroma cacao]
 gb|EOY24062.1| Nitrate transporter 1.5 [Theobroma cacao]
Length=597

 Score =   796 bits (2055),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 415/579 (72%), Positives = 487/579 (84%), Gaps = 9/579 (2%)
 Frame = -3

Query  2085  KASREECTLDGTVDHYGRPALRSATGGWFAGVLLLVNQGLATLAFFGVGVNLVLFLTRVM  1906
             K  +  CT DGT+D +GRPA+R+ +G W AG+++L+NQGLATLAFFGVGVNLVLFLTRV+
Sbjct  13    KEDQGACTQDGTIDWHGRPAIRAKSGQWTAGIIILLNQGLATLAFFGVGVNLVLFLTRVL  72

Query  1905  GQDNADAANNVSKWTGTVYLFSLLGAFLSDSYWGRYKTCAIFQLIYVVGLISVSIFSFIF  1726
             GQ+NADAANNVSKWTGTVY+FSL+GAFLSDSYWGRYKTCAIFQ+I+V+GL+S+S+ S++F
Sbjct  73    GQNNADAANNVSKWTGTVYIFSLVGAFLSDSYWGRYKTCAIFQVIFVIGLVSLSLSSYLF  132

Query  1725  LVKPKGCGDENTPCRSPSRIHIAVYYVSIYLVALGNGGYQPNIATFGSDQFDGDHAHESV  1546
             LV+P+GCG++ TPC S S + I ++Y+SIYLVALGNGGYQPNIATFG+DQFD +   E  
Sbjct  133   LVRPRGCGNQETPCGSHSGLEITLFYLSIYLVALGNGGYQPNIATFGADQFDEEDPEEGH  192

Query  1545  SKVAFFSYFYLALNLGSLFSNTVLVYFEDKGMWTLGFWastvsavlalllflVGTPRYRH  1366
             SKVAFFSYFYLALNLGSLFSNT+L YFED+GMW LGFW S  SA+ AL LFL GT RYRH
Sbjct  193   SKVAFFSYFYLALNLGSLFSNTILGYFEDEGMWALGFWVSAGSALAALGLFLAGTTRYRH  252

Query  1365  FAPKGNPLSRFSQVLVASARKWNVHLPSDGDDHRLYEIQEHDSS---TRKILHTEGFKFL  1195
             F P GNPL RF QV+VA+ +K ++ LP D DD  LY++  +DSS    RKILHT  FKFL
Sbjct  253   FKPSGNPLPRFCQVIVAATKKCSIDLPPDADD--LYDVDGNDSSMNGNRKILHTNEFKFL  310

Query  1194  DKAAVITTKESVRDLEERNINPWRLCSVTQVEEVKCILRLLPIWLCTILYSVVFTQMASL  1015
             D+AA I+T++ V D ++   +PWRLC VTQVEEVKCILRLLPIWLCTI+YSVVFTQMASL
Sbjct  311   DRAAYISTRD-VDDQKKGIYSPWRLCPVTQVEEVKCILRLLPIWLCTIIYSVVFTQMASL  369

Query  1014  FVEQGAAMRTNIAGFHIPPASMSSFDILSVAAFIFIYRRILDPLIASLKKTRRAQGFTEL  835
             FVEQGAAM T I+ F IPPASMSSFDILSVA FIF+YRR+LDPL+  ++K + ++G TEL
Sbjct  370   FVEQGAAMTTTISNFRIPPASMSSFDILSVALFIFLYRRVLDPLVGRIRK-KDSRGLTEL  428

Query  834   QRMGVGLiiaimamvaagiVEHFRLKYASTDCPRCP--SSLSIFWQVPQYVLIGASEVFM  661
             QRMG+GL+IAI+AMV+AGIVE +RLKYAS DC  C   SSLSIFWQVPQY  IGASEVFM
Sbjct  429   QRMGIGLVIAILAMVSAGIVECYRLKYASRDCTHCEGSSSLSIFWQVPQYAFIGASEVFM  488

Query  660   YVGQLEFFNGQAPEGLKSFASALCMTSISLGNYVSSLLVSIVMRISTTHRMPGWIPGNLN  481
             YVGQLEFFN Q P+GLKSF SALCMTSISLGNYVSSLLV++VM+IST   MPGWIPGNLN
Sbjct  489   YVGQLEFFNAQTPDGLKSFGSALCMTSISLGNYVSSLLVTMVMKISTEDHMPGWIPGNLN  548

Query  480   KGHLDRFYFLLAALTTADFVVYILCAKWYKYIEFEERNS  364
             KGHLDRFYFLLA LTT D VVYI CA WYK I+ E + +
Sbjct  549   KGHLDRFYFLLAGLTTIDLVVYIACATWYKCIKLEGKTA  587



>gb|AES90846.2| peptide transporter [Medicago truncatula]
Length=592

 Score =   794 bits (2050),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 414/588 (70%), Positives = 483/588 (82%), Gaps = 23/588 (4%)
 Frame = -3

Query  2085  KASREECTLDGTVDHYGRPALRSATGGWFAGVLLLVNQGLATLAFFGVGVNLVLFLTRVM  1906
             K   EE TLDG+VD +GRP++R+ +G WFAG ++L+NQGLATLAFFGVGVNLVLFLTRV+
Sbjct  13    KEETEELTLDGSVDWHGRPSIRATSGRWFAGTIILLNQGLATLAFFGVGVNLVLFLTRVL  72

Query  1905  GQDNADAANNVSKWTGTVYLFSLLGAFLSDSYWGRYKTCAIFQLIYVVGLISVSIFSFIF  1726
             GQDNA AANNVSKWTGTVY+FSL+GAFLSDSYWGRYKTCAIFQ I+V GL+S+S+ +++ 
Sbjct  73    GQDNAAAANNVSKWTGTVYIFSLVGAFLSDSYWGRYKTCAIFQGIFVTGLVSLSVTTYLA  132

Query  1725  LVKPKGCGDENTPCRSPSRIHIAVYYVSIYLVALGNGGYQPNIATFGSDQFDGDHAHESV  1546
             L++PKGCG+    C   S + + ++Y+SIYL+ALGNGGYQPNIATFG+DQFD DH+ ES 
Sbjct  133   LLRPKGCGNGKLECGEHSSLEMGMFYLSIYLIALGNGGYQPNIATFGADQFDEDHSKESY  192

Query  1545  SKVAFFSYFYLALNLGSLFSNTVLVYFEDKGMWTLGFWastvsavlalllflVGTPRYRH  1366
             SKVAFFSYFYLALNLGSLFSNT+L YFED+G+W LGFWAS  SA LAL+LFLVGTP+YRH
Sbjct  193   SKVAFFSYFYLALNLGSLFSNTILGYFEDEGLWALGFWASAGSAFLALVLFLVGTPKYRH  252

Query  1365  FAPKGNPLSRFSQVLVASARKWNVHLPSDGDDHRLYEIQEHDS---STRKILHTEGFKFL  1195
             F P GNPLSRF QV  A++RK  V + S+GDD  LY I E +S   S RKILHT GFKFL
Sbjct  253   FKPCGNPLSRFCQVFFAASRKLGVQMTSNGDD--LYVIDEKESSNNSNRKILHTHGFKFL  310

Query  1194  DKAAVITTKESVRDLEER---NINPWRLCSVTQVEEVKCILRLLPIWLCTILYSVVFTQM  1024
             D+AA IT+    RDLE +     NPW LC +TQVEEVKCILRLLPIWLCTI+YSVVFTQM
Sbjct  311   DRAAYITS----RDLEVQKGGQHNPWYLCPITQVEEVKCILRLLPIWLCTIIYSVVFTQM  366

Query  1023  ASLFVEQGAAMRTNIAGFHIPPASMSSFDILSVAAFIFIYRRILDPLIASLKKTRRAQGF  844
             ASLFVEQGAAM+T I+ F IPPASMSSFDILSVA FIF YRR+LDPL+  LKK+  ++G 
Sbjct  367   ASLFVEQGAAMKTTISSFKIPPASMSSFDILSVAIFIFFYRRVLDPLVGKLKKS-SSKGL  425

Query  843   TELQRMGVGLiiaimamvaagiVEHFRLKYASTDCPRCPSSLSIFWQVPQYVLIGASEVF  664
             TELQRMG+GL+IAI+AMV AGIVE +RLKYA        SSLSIFWQ+PQY LIGASEVF
Sbjct  426   TELQRMGIGLVIAIIAMVTAGIVECYRLKYAKQG---DTSSLSIFWQIPQYALIGASEVF  482

Query  663   MYVGQLEFFNGQAPEGLKSFASALCMTSISLGNYVSSLLVSIVMRISTTHRMPGWIPGNL  484
             MYVGQLEFFN Q P+GLKSF SALCMTSISLGNYVSSL+VSIVM+IST   MPGWIPGNL
Sbjct  483   MYVGQLEFFNAQTPDGLKSFGSALCMTSISLGNYVSSLIVSIVMKISTEDHMPGWIPGNL  542

Query  483   NKGHLDRFYFLLAALTTADFVVYILCAKWYKYIEF-------EERNSC  361
             N+GHLDRF+FLLA LT+ D + YI CAKW++ I+        +E +SC
Sbjct  543   NRGHLDRFFFLLAVLTSLDLIAYIACAKWFQNIQMACKYDNNDEPSSC  590



>ref|XP_006602907.1| PREDICTED: nitrate transporter 1.5-like [Glycine max]
Length=597

 Score =   793 bits (2049),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 415/600 (69%), Positives = 487/600 (81%), Gaps = 12/600 (2%)
 Frame = -3

Query  2118  MFFIKNERDEEKASREE--CTLDGTVDHYGRPALRSATGGWFAGVLLLVNQGLATLAFFG  1945
             ++F++ +  EEK ++E   CT DG +D  G PA+R  TG W A +L+LVNQGLATLAFFG
Sbjct  4     LYFLRKDTMEEKVNKEHQVCTSDGAIDSQGHPAVREKTGDWVAAILILVNQGLATLAFFG  63

Query  1944  VGVNLVLFLTRVMGQDNADAANNVSKWTGTVYLFSLLGAFLSDSYWGRYKTCAIFQLIYV  1765
             +GVNLVLFLTRVMGQDNA+AAN+VSKWTGTVYLFSLLGAFLSDSYWGRY TCAIFQ+I+V
Sbjct  64    IGVNLVLFLTRVMGQDNAEAANSVSKWTGTVYLFSLLGAFLSDSYWGRYMTCAIFQVIFV  123

Query  1764  VGLISVSIFSFIFLVKPKGCGDENTPCRSPSRIHIAVYYVSIYLVALGNGGYQPNIATFG  1585
             +GL+S+S+ S+IFL+KP GCG++  PC S S     ++YVSIYL+ALGNGGYQPNIATFG
Sbjct  124   IGLVSLSLSSYIFLLKPSGCGNKELPCGSHSSYQTILFYVSIYLIALGNGGYQPNIATFG  183

Query  1584  SDQFDGDHAHESVSKVAFFSYFYLALNLGSLFSNTVLVYFEDKGMWTLGFWastvsavla  1405
             +DQFD     E  SK+ FFSYFYLALN+GSLFSNT+L YFED G+WTLGFWAS  SA LA
Sbjct  184   ADQFDEGDTREQHSKIVFFSYFYLALNIGSLFSNTILNYFEDDGLWTLGFWASAGSAALA  243

Query  1404  lllflVGTPRYRHFAPKGNPLSRFSQVLVASARKWNVHLPSDGDDHRLYEIQEHDSST-R  1228
             L+LFL GT RYR+F P GNPL RF QV VA+ RKW V +     D +LYE+ E  +   R
Sbjct  244   LVLFLCGTRRYRYFKPNGNPLPRFCQVFVAATRKWKVKVL---QDDKLYEVDEFSTDEGR  300

Query  1227  KILHTEGFKFLDKAAVITTKESVRDLEERNINPWRLCSVTQVEEVKCILRLLPIWLCTIL  1048
             K+LHTEGF+FLDKAA IT+K + + +EE   +PW L +VTQVEEVKCILRLLPIWLCTIL
Sbjct  301   KMLHTEGFRFLDKAAFITSK-NFKQMEESKCSPWYLSTVTQVEEVKCILRLLPIWLCTIL  359

Query  1047  YSVVFTQMASLFVEQGAAMRTNIAGFHIPPASMSSFDILSVAAFIFIYRRILDPLIASLK  868
             YSVVF QMASLFVEQG AM T I+ FHIPPASMS+FDILSVA  IFIYRR+LDPL+A   
Sbjct  360   YSVVFAQMASLFVEQGDAMDTRISSFHIPPASMSTFDILSVAIVIFIYRRVLDPLVA---  416

Query  867   KTRRAQGFTELQRMGVGLiiaimamvaagiVEHFRLKYASTDCPRCP--SSLSIFWQVPQ  694
             +T +++G TELQRMG+GL++AIMAMV+AG+VEHFRLK A  DC  C   SSLSIFWQVPQ
Sbjct  417   RTMKSKGLTELQRMGIGLVLAIMAMVSAGLVEHFRLKNAIEDCNECKGSSSLSIFWQVPQ  476

Query  693   YVLIGASEVFMYVGQLEFFNGQAPEGLKSFASALCMTSISLGNYVSSLLVSIVMRISTTH  514
             YV +GASEVFMYVGQLEFFN Q P+GLKSF SALCMTSISLGNYVSSLLV+IVM+IS T 
Sbjct  477   YVFVGASEVFMYVGQLEFFNAQTPDGLKSFGSALCMTSISLGNYVSSLLVAIVMKISATD  536

Query  513   RMPGWIPGNLNKGHLDRFYFLLAALTTADFVVYILCAKWYKYIEFEERNSCLKNIGDSKL  334
              MPGWIPGNLNKGHLD FYFLLAALT AD V+Y+L A+WYKY++F+  N    N  D ++
Sbjct  537   EMPGWIPGNLNKGHLDMFYFLLAALTAADLVIYVLMARWYKYVKFQGNNENDTNKEDPEV  596



>emb|CAN77707.1| hypothetical protein VITISV_026382 [Vitis vinifera]
Length=592

 Score =   793 bits (2047),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 418/577 (72%), Positives = 487/577 (84%), Gaps = 9/577 (2%)
 Frame = -3

Query  2085  KASREECTLDGTVDHYGRPALRSATGGWFAGVLLLVNQGLATLAFFGVGVNLVLFLTRVM  1906
             KA  E CTLDGTVD  G PA+RS +G WFAG+++L+NQGLATLAFFGVGVNLVLFLTRV+
Sbjct  14    KAGEEACTLDGTVDCRGNPAIRSRSGKWFAGIIILLNQGLATLAFFGVGVNLVLFLTRVL  73

Query  1905  GQDNADAANNVSKWTGTVYLFSLLGAFLSDSYWGRYKTCAIFQLIYVVGLISVSIFSFIF  1726
              Q+NADAANNVSKWTGTVY+FSL+GAFLSDSYWGRYKTCAIFQ+I+V+GL+S+S+ S+IF
Sbjct  74    QQNNADAANNVSKWTGTVYIFSLVGAFLSDSYWGRYKTCAIFQVIFVIGLVSLSLSSYIF  133

Query  1725  LVKPKGCGDENTPCRSPSRIHIAVYYVSIYLVALGNGGYQPNIATFGSDQFDGDHAHESV  1546
             LVKP+GCG+E++PC S S + I ++Y+SIYLVALGNGGYQPNIAT G+DQFD +   E  
Sbjct  134   LVKPEGCGNEDSPCPSHSSLEIGLFYLSIYLVALGNGGYQPNIATLGADQFDEEDPKEGH  193

Query  1545  SKVAFFSYFYLALNLGSLFSNTVLVYFEDKGMWTLGFWastvsavlalllflVGTPRYRH  1366
             SKVAFFSYFYLALNLGSLFSNT+L Y ED+GMW LGFW S  SA LAL+LFL GTPRYRH
Sbjct  194   SKVAFFSYFYLALNLGSLFSNTILSYLEDEGMWALGFWVSAGSAFLALILFLGGTPRYRH  253

Query  1365  FAPKGNPLSRFSQVLVASARKWNVHLPSDGDDHRLYE---IQEHDSSTRKILHTEGFKFL  1195
             F P GNPLSRF QV+VA+ RK+ V +P   +D  LYE    +  ++S R+ILHT+GFKFL
Sbjct  254   FKPSGNPLSRFCQVMVAAMRKFRVEMPPSAED--LYEGDGKECSNNSIRRILHTDGFKFL  311

Query  1194  DKAAVITTKESVRDLEERNINPWRLCSVTQVEEVKCILRLLPIWLCTILYSVVFTQMASL  1015
             D+AA I++K+S  + E+   N WRLC +TQVEEVKCILRL+PIWLCTI+YSVVFTQMASL
Sbjct  312   DRAAFISSKDS-DNQEQGFYNQWRLCPITQVEEVKCILRLIPIWLCTIIYSVVFTQMASL  370

Query  1014  FVEQGAAMRTNIAGFHIPPASMSSFDILSVAAFIFIYRRILDPLIASLKKTRRAQGFTEL  835
             FVEQGAAM+T ++ F IPPASMSSFDILSVAAFIF+YRR+LDPL+  ++KT   +G TEL
Sbjct  371   FVEQGAAMKTTVSNFRIPPASMSSFDILSVAAFIFLYRRVLDPLVGRIRKT-DTKGLTEL  429

Query  834   QRMGVGLiiaimamvaagiVEHFRLKYASTDCPRCP--SSLSIFWQVPQYVLIGASEVFM  661
             QRMG+GLIIAI+AM+AAGIVE +RLKYA  DC  C   SSLSIFWQVPQY  IGASEVFM
Sbjct  430   QRMGIGLIIAIIAMIAAGIVECYRLKYAQKDCTNCEGSSSLSIFWQVPQYAFIGASEVFM  489

Query  660   YVGQLEFFNGQAPEGLKSFASALCMTSISLGNYVSSLLVSIVMRISTTHRMPGWIPGNLN  481
             YVGQLEFFN Q P+GLKSF SALCMTSISLGNYVSSLLV++VM+IST   MPGWIPGNLN
Sbjct  490   YVGQLEFFNAQTPDGLKSFGSALCMTSISLGNYVSSLLVTMVMKISTEDHMPGWIPGNLN  549

Query  480   KGHLDRFYFLLAALTTADFVVYILCAKWYKYIEFEER  370
             KGHLDRFYFLLA LT  D VVY+ CAK YK I+ E+R
Sbjct  550   KGHLDRFYFLLATLTALDLVVYVACAKXYKCIKMEBR  586



>ref|XP_003534448.1| PREDICTED: nitrate transporter 1.5-like [Glycine max]
Length=598

 Score =   792 bits (2046),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 417/600 (70%), Positives = 489/600 (82%), Gaps = 12/600 (2%)
 Frame = -3

Query  2118  MFFIKNERDEEKASREE--CTLDGTVDHYGRPALRSATGGWFAGVLLLVNQGLATLAFFG  1945
             ++F++ +  EEK ++E   CT DG +D +G PA+R  TG W A +L+LVNQGLATLAFFG
Sbjct  4     LYFLRKDTMEEKINKEHQVCTSDGAIDSHGHPAVRKKTGDWVAAILILVNQGLATLAFFG  63

Query  1944  VGVNLVLFLTRVMGQDNADAANNVSKWTGTVYLFSLLGAFLSDSYWGRYKTCAIFQLIYV  1765
             VGVNLVLFLTRVMGQDNA+AAN+VSKWTGTVYLFSLLGAFLSDSYWGRY TCAIFQ+I+V
Sbjct  64    VGVNLVLFLTRVMGQDNAEAANSVSKWTGTVYLFSLLGAFLSDSYWGRYMTCAIFQVIFV  123

Query  1764  VGLISVSIFSFIFLVKPKGCGDENTPCRSPSRIHIAVYYVSIYLVALGNGGYQPNIATFG  1585
             +GL+S+S+ S+IFL+KP GCG++  PC S S     ++YVSIYL+ALGNGGYQPNIATFG
Sbjct  124   IGLVSLSLSSYIFLLKPSGCGNKELPCGSHSSYQTILFYVSIYLIALGNGGYQPNIATFG  183

Query  1584  SDQFDGDHAHESVSKVAFFSYFYLALNLGSLFSNTVLVYFEDKGMWTLGFWastvsavla  1405
             +DQFD     E  SK+ FFSYFYLALN+GSLFSNT+L YFED G+WTLGFWAS  SA LA
Sbjct  184   ADQFDEGDPREQHSKIVFFSYFYLALNIGSLFSNTILNYFEDDGLWTLGFWASAGSAALA  243

Query  1404  lllflVGTPRYRHFAPKGNPLSRFSQVLVASARKWNVHLPSDGDDHRLYEIQEHDSST-R  1228
             L+LFL GT RYR+F P GNPL RF QV VA+ RKW   +     D +LYE+ E  ++  R
Sbjct  244   LILFLCGTRRYRYFKPNGNPLPRFCQVFVAATRKWKAKVL---QDDKLYEVDEFSTNEGR  300

Query  1227  KILHTEGFKFLDKAAVITTKESVRDLEERNINPWRLCSVTQVEEVKCILRLLPIWLCTIL  1048
             K+LHTEGF+FLDKAA IT+K + + +EE   +PW L +VTQVEEVKCILRLLPIWLCTIL
Sbjct  301   KMLHTEGFRFLDKAAFITSK-NFKQMEESKCSPWYLSTVTQVEEVKCILRLLPIWLCTIL  359

Query  1047  YSVVFTQMASLFVEQGAAMRTNIAGFHIPPASMSSFDILSVAAFIFIYRRILDPLIASLK  868
             YSVVF QMASLFVEQG AM T I+ FHIPPASMS+FDILSVA  IFIYRR+LDPL+A   
Sbjct  360   YSVVFAQMASLFVEQGDAMDTRISRFHIPPASMSTFDILSVAVVIFIYRRVLDPLVA---  416

Query  867   KTRRAQGFTELQRMGVGLiiaimamvaagiVEHFRLKYASTDCPRCP--SSLSIFWQVPQ  694
             +T +++G TELQRMG+GL++AIMAMV+AG+VEHFRLK A  DC  C   SSLSIFWQVPQ
Sbjct  417   RTMKSKGLTELQRMGIGLVLAIMAMVSAGLVEHFRLKNAIEDCNECEGSSSLSIFWQVPQ  476

Query  693   YVLIGASEVFMYVGQLEFFNGQAPEGLKSFASALCMTSISLGNYVSSLLVSIVMRISTTH  514
             YVL+GASEVFMYVGQLEFFN Q P+GLKSF SALCMTSISLGNYVSSLLV+IVM+IS T 
Sbjct  477   YVLVGASEVFMYVGQLEFFNAQTPDGLKSFGSALCMTSISLGNYVSSLLVAIVMKISATD  536

Query  513   RMPGWIPGNLNKGHLDRFYFLLAALTTADFVVYILCAKWYKYIEFEERNSCLKNIGDSKL  334
              MPGWIPGNLNKGHLD FYFLLAALT AD V+Y+L A+WYKYI+F+  N    N  D ++
Sbjct  537   EMPGWIPGNLNKGHLDMFYFLLAALTAADLVIYVLMARWYKYIKFQGNNDNGINKEDPEV  596



>gb|KEH31554.1| peptide transporter [Medicago truncatula]
Length=657

 Score =   794 bits (2050),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 416/597 (70%), Positives = 488/597 (82%), Gaps = 26/597 (4%)
 Frame = -3

Query  2112  FIKNERDEEKASREECTLDGTVDHYGRPALRSATGGWFAGVLLLVNQGLATLAFFGVGVN  1933
             F++ +  EE    EE TLDG+VD +GRP++R+ +G WFAG ++L+NQGLATLAFFGVGVN
Sbjct  72    FLQGKFKEET---EELTLDGSVDWHGRPSIRATSGRWFAGTIILLNQGLATLAFFGVGVN  128

Query  1932  LVLFLTRVMGQDNADAANNVSKWTGTVYLFSLLGAFLSDSYWGRYKTCAIFQLIYVVGLI  1753
             LVLFLTRV+GQDNA AANNVSKWTGTVY+FSL+GAFLSDSYWGRYKTCAIFQ I+V GL+
Sbjct  129   LVLFLTRVLGQDNAAAANNVSKWTGTVYIFSLVGAFLSDSYWGRYKTCAIFQGIFVTGLV  188

Query  1752  SVSIFSFIFLVKPKGCGDENTPCRSPSRIHIAVYYVSIYLVALGNGGYQPNIATFGSDQF  1573
             S+S+ +++ L++PKGCG+    C   S + + ++Y+SIYL+ALGNGGYQPNIATFG+DQF
Sbjct  189   SLSVTTYLALLRPKGCGNGKLECGEHSSLEMGMFYLSIYLIALGNGGYQPNIATFGADQF  248

Query  1572  DGDHAHESVSKVAFFSYFYLALNLGSLFSNTVLVYFEDKGMWTLGFWastvsavlalllf  1393
             D DH+ ES SKVAFFSYFYLALNLGSLFSNT+L YFED+G+W LGFWAS  SA LAL+LF
Sbjct  249   DEDHSKESYSKVAFFSYFYLALNLGSLFSNTILGYFEDEGLWALGFWASAGSAFLALVLF  308

Query  1392  lVGTPRYRHFAPKGNPLSRFSQVLVASARKWNVHLPSDGDDHRLYEIQEHDS---STRKI  1222
             LVGTP+YRHF P GNPLSRF QV  A++RK  V + S+GDD  LY I E +S   S RKI
Sbjct  309   LVGTPKYRHFKPCGNPLSRFCQVFFAASRKLGVQMTSNGDD--LYVIDEKESSNNSNRKI  366

Query  1221  LHTEGFKFLDKAAVITTKESVRDLEER---NINPWRLCSVTQVEEVKCILRLLPIWLCTI  1051
             LHT GFKFLD+AA IT+    RDLE +     NPW LC +TQVEEVKCILRLLPIWLCTI
Sbjct  367   LHTHGFKFLDRAAYITS----RDLEVQKGGQHNPWYLCPITQVEEVKCILRLLPIWLCTI  422

Query  1050  LYSVVFTQMASLFVEQGAAMRTNIAGFHIPPASMSSFDILSVAAFIFIYRRILDPLIASL  871
             +YSVVFTQMASLFVEQGAAM+T I+ F IPPASMSSFDILSVA FIF YRR+LDPL+  L
Sbjct  423   IYSVVFTQMASLFVEQGAAMKTTISSFKIPPASMSSFDILSVAIFIFFYRRVLDPLVGKL  482

Query  870   KKTRRAQGFTELQRMGVGLiiaimamvaagiVEHFRLKYASTDCPRCPSSLSIFWQVPQY  691
             KK+  ++G TELQRMG+GL+IAI+AMV AGIVE +RLKYA        SSLSIFWQ+PQY
Sbjct  483   KKS-SSKGLTELQRMGIGLVIAIIAMVTAGIVECYRLKYAKQG---DTSSLSIFWQIPQY  538

Query  690   VLIGASEVFMYVGQLEFFNGQAPEGLKSFASALCMTSISLGNYVSSLLVSIVMRISTTHR  511
              LIGASEVFMYVGQLEFFN Q P+GLKSF SALCMTSISLGNYVSSL+VSIVM+IST   
Sbjct  539   ALIGASEVFMYVGQLEFFNAQTPDGLKSFGSALCMTSISLGNYVSSLIVSIVMKISTEDH  598

Query  510   MPGWIPGNLNKGHLDRFYFLLAALTTADFVVYILCAKWYKYIEF-------EERNSC  361
             MPGWIPGNLN+GHLDRF+FLLA LT+ D + YI CAKW++ I+        +E +SC
Sbjct  599   MPGWIPGNLNRGHLDRFFFLLAVLTSLDLIAYIACAKWFQNIQMACKYDNNDEPSSC  655



>ref|XP_003608649.1| Peptide transporter PTR1 [Medicago truncatula]
Length=668

 Score =   794 bits (2051),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 414/588 (70%), Positives = 483/588 (82%), Gaps = 23/588 (4%)
 Frame = -3

Query  2085  KASREECTLDGTVDHYGRPALRSATGGWFAGVLLLVNQGLATLAFFGVGVNLVLFLTRVM  1906
             K   EE TLDG+VD +GRP++R+ +G WFAG ++L+NQGLATLAFFGVGVNLVLFLTRV+
Sbjct  89    KEETEELTLDGSVDWHGRPSIRATSGRWFAGTIILLNQGLATLAFFGVGVNLVLFLTRVL  148

Query  1905  GQDNADAANNVSKWTGTVYLFSLLGAFLSDSYWGRYKTCAIFQLIYVVGLISVSIFSFIF  1726
             GQDNA AANNVSKWTGTVY+FSL+GAFLSDSYWGRYKTCAIFQ I+V GL+S+S+ +++ 
Sbjct  149   GQDNAAAANNVSKWTGTVYIFSLVGAFLSDSYWGRYKTCAIFQGIFVTGLVSLSVTTYLA  208

Query  1725  LVKPKGCGDENTPCRSPSRIHIAVYYVSIYLVALGNGGYQPNIATFGSDQFDGDHAHESV  1546
             L++PKGCG+    C   S + + ++Y+SIYL+ALGNGGYQPNIATFG+DQFD DH+ ES 
Sbjct  209   LLRPKGCGNGKLECGEHSSLEMGMFYLSIYLIALGNGGYQPNIATFGADQFDEDHSKESY  268

Query  1545  SKVAFFSYFYLALNLGSLFSNTVLVYFEDKGMWTLGFWastvsavlalllflVGTPRYRH  1366
             SKVAFFSYFYLALNLGSLFSNT+L YFED+G+W LGFWAS  SA LAL+LFLVGTP+YRH
Sbjct  269   SKVAFFSYFYLALNLGSLFSNTILGYFEDEGLWALGFWASAGSAFLALVLFLVGTPKYRH  328

Query  1365  FAPKGNPLSRFSQVLVASARKWNVHLPSDGDDHRLYEIQEHDS---STRKILHTEGFKFL  1195
             F P GNPLSRF QV  A++RK  V + S+GDD  LY I E +S   S RKILHT GFKFL
Sbjct  329   FKPCGNPLSRFCQVFFAASRKLGVQMTSNGDD--LYVIDEKESSNNSNRKILHTHGFKFL  386

Query  1194  DKAAVITTKESVRDLEER---NINPWRLCSVTQVEEVKCILRLLPIWLCTILYSVVFTQM  1024
             D+AA IT+    RDLE +     NPW LC +TQVEEVKCILRLLPIWLCTI+YSVVFTQM
Sbjct  387   DRAAYITS----RDLEVQKGGQHNPWYLCPITQVEEVKCILRLLPIWLCTIIYSVVFTQM  442

Query  1023  ASLFVEQGAAMRTNIAGFHIPPASMSSFDILSVAAFIFIYRRILDPLIASLKKTRRAQGF  844
             ASLFVEQGAAM+T I+ F IPPASMSSFDILSVA FIF YRR+LDPL+  LKK+  ++G 
Sbjct  443   ASLFVEQGAAMKTTISSFKIPPASMSSFDILSVAIFIFFYRRVLDPLVGKLKKS-SSKGL  501

Query  843   TELQRMGVGLiiaimamvaagiVEHFRLKYASTDCPRCPSSLSIFWQVPQYVLIGASEVF  664
             TELQRMG+GL+IAI+AMV AGIVE +RLKYA        SSLSIFWQ+PQY LIGASEVF
Sbjct  502   TELQRMGIGLVIAIIAMVTAGIVECYRLKYAKQG---DTSSLSIFWQIPQYALIGASEVF  558

Query  663   MYVGQLEFFNGQAPEGLKSFASALCMTSISLGNYVSSLLVSIVMRISTTHRMPGWIPGNL  484
             MYVGQLEFFN Q P+GLKSF SALCMTSISLGNYVSSL+VSIVM+IST   MPGWIPGNL
Sbjct  559   MYVGQLEFFNAQTPDGLKSFGSALCMTSISLGNYVSSLIVSIVMKISTEDHMPGWIPGNL  618

Query  483   NKGHLDRFYFLLAALTTADFVVYILCAKWYKYIEF-------EERNSC  361
             N+GHLDRF+FLLA LT+ D + YI CAKW++ I+        +E +SC
Sbjct  619   NRGHLDRFFFLLAVLTSLDLIAYIACAKWFQNIQMACKYDNNDEPSSC  666



>ref|XP_008238336.1| PREDICTED: protein NRT1/ PTR FAMILY 7.3 [Prunus mume]
Length=597

 Score =   791 bits (2043),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 403/577 (70%), Positives = 477/577 (83%), Gaps = 10/577 (2%)
 Frame = -3

Query  2085  KASREECTLDGTVDHYGRPALRSATGGWFAGVLLLVNQGLATLAFFGVGVNLVLFLTRVM  1906
             K   + CTLDGTVD +G+PA+R+ +G W AG+++LVNQGLATLAFFGVGVNLVL+LTRV+
Sbjct  13    KEDEDACTLDGTVDMHGQPAIRAKSGRWVAGIIILVNQGLATLAFFGVGVNLVLYLTRVL  72

Query  1905  GQDNADAANNVSKWTGTVYLFSLLGAFLSDSYWGRYKTCAIFQLIYVVGLISVSIFSFIF  1726
              QDNA AANNVSKWTGTVY+FSL+GAFLSDSYWGRYKTCAIFQLI+V GLIS+S+ S +F
Sbjct  73    QQDNATAANNVSKWTGTVYIFSLVGAFLSDSYWGRYKTCAIFQLIFVTGLISLSLSSQLF  132

Query  1725  LVKPKGCGDENTPCRSPSRIHIAVYYVSIYLVALGNGGYQPNIATFGSDQFDGDHAHESV  1546
             L+KP+GCG +  PC + S++H+ ++Y+SIYL+ALGNGGYQPNIATFG+DQFD +   E  
Sbjct  133   LLKPEGCGSQEDPCGTHSKLHVWLFYLSIYLIALGNGGYQPNIATFGADQFDEEDNKEGH  192

Query  1545  SKVAFFSYFYLALNLGSLFSNTVLVYFEDKGMWTLGFWastvsavlalllflVGTPRYRH  1366
             SKVAFFSYFYLA+NLGSLFSNT+L YFED+G+W +GFWAST SA  AL+LFL GT RYRH
Sbjct  193   SKVAFFSYFYLAMNLGSLFSNTILGYFEDEGVWAIGFWASTASAFAALVLFLGGTARYRH  252

Query  1365  FAPKGNPLSRFSQVLVASARKWNVHLPSDGDDHRLYEIQEHDSSTRKILHTEGFKFLDKA  1186
             F P GNPLSRF QVLVA+ +K    +P  GDD      +E  +S RKIL+T GFKFLD+A
Sbjct  253   FKPNGNPLSRFCQVLVAAMKKCRAEMPQGGDDLYDEAKKESSNSNRKILYTHGFKFLDRA  312

Query  1185  AVITTKESVRDLEERN---INPWRLCSVTQVEEVKCILRLLPIWLCTILYSVVFTQMASL  1015
             A I++    RDL+ +    ++PWRLC ++QVEEVKCILRLLPIWLCTILYSVVFTQMASL
Sbjct  313   AYISS----RDLDHQKQGILSPWRLCPISQVEEVKCILRLLPIWLCTILYSVVFTQMASL  368

Query  1014  FVEQGAAMRTNIAGFHIPPASMSSFDILSVAAFIFIYRRILDPLIASLKKTRRAQGFTEL  835
             FVEQGAAM+T ++ F IPPASMSSFDILSVA FIF YRRILDP++A ++K+  A+G TEL
Sbjct  369   FVEQGAAMKTTVSNFKIPPASMSSFDILSVAVFIFFYRRILDPVVARIRKS-DAKGLTEL  427

Query  834   QRMGVGLiiaimamvaagiVEHFRLKYASTDCPRCP--SSLSIFWQVPQYVLIGASEVFM  661
             QRMG+GL++A++    AGIVE +RLKYA  +CP C   SSLSIFWQ+PQY  IGASEVFM
Sbjct  428   QRMGIGLVVAVLXXXXAGIVECYRLKYADKECPHCEGSSSLSIFWQIPQYACIGASEVFM  487

Query  660   YVGQLEFFNGQAPEGLKSFASALCMTSISLGNYVSSLLVSIVMRISTTHRMPGWIPGNLN  481
             YVGQLEFFN Q P+GLKSF SALCMTSISLGNY SS LVS+VM+IST   MPGWIPGNLN
Sbjct  488   YVGQLEFFNAQTPDGLKSFGSALCMTSISLGNYFSSFLVSVVMKISTADDMPGWIPGNLN  547

Query  480   KGHLDRFYFLLAALTTADFVVYILCAKWYKYIEFEER  370
             KGHLDRFYFLLA LT+ D +VYI CAKWYK I+ E R
Sbjct  548   KGHLDRFYFLLAVLTSIDLIVYIACAKWYKSIKLEGR  584



>emb|CDY32284.1| BnaC05g28620D [Brassica napus]
Length=614

 Score =   792 bits (2045),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 405/572 (71%), Positives = 484/572 (85%), Gaps = 7/572 (1%)
 Frame = -3

Query  2064  TLDGTVDHYGRPALRSATGGWFAGVLLLVNQGLATLAFFGVGVNLVLFLTRVMGQDNADA  1885
             T DGTVD+YGRP++RS +G W AG+++LVNQGLATLAFFGVGVNLVLFLTRV+ Q+NADA
Sbjct  21    TRDGTVDYYGRPSIRSNSGKWVAGIIILVNQGLATLAFFGVGVNLVLFLTRVLQQNNADA  80

Query  1884  ANNVSKWTGTVYLFSLLGAFLSDSYWGRYKTCAIFQLIYVVGLISVSIFSFIFLVKPKGC  1705
             ANNVSKWTGTVY+FSL+GAFLSDSYWGRYKTCAIFQ+I+V+GL S+S+ S++FL++PKGC
Sbjct  81    ANNVSKWTGTVYIFSLVGAFLSDSYWGRYKTCAIFQVIFVIGLSSLSLSSYMFLIRPKGC  140

Query  1704  GDENTPCRSPSRIHIAVYYVSIYLVALGNGGYQPNIATFGSDQFDGDHAHESVSKVAFFS  1525
             GDE TPC + S + I ++Y+SIYL+ALGNGGYQPNIATFG+DQFD +H  E  SK+AFFS
Sbjct  141   GDEVTPCGTHSTMEITMFYLSIYLIALGNGGYQPNIATFGADQFDEEHPKEGYSKIAFFS  200

Query  1524  YFYLALNLGSLFSNTVLVYFEDKGMWTLGFWastvsavlalllflVGTPRYRHFAPKGNP  1345
             YFYLALNLGSLFSNT+L YFED+GMW LGFWAST SA+LAL+LFLVGTPRYR+F P GNP
Sbjct  201   YFYLALNLGSLFSNTILGYFEDEGMWALGFWASTGSAILALILFLVGTPRYRNFKPTGNP  260

Query  1344  LSRFSQVLVASARKWNVHLPSDGDDHRLYEIQEHDSST----RKILHTEGFKFLDKAAVI  1177
             LSRF QVLVA+ +K ++  PS G +    E ++  +++    R+I+HT+ FKFLD+AA I
Sbjct  261   LSRFCQVLVAATKKSSMEAPSRGREEMYDEDRQGKNASGDTGRRIVHTDEFKFLDRAAYI  320

Query  1176  TTKESVRDLEERNINPWRLCSVTQVEEVKCILRLLPIWLCTILYSVVFTQMASLFVEQGA  997
             T ++ + D ++  +NPWRLC VTQVEEVKCILRL+PIWLCTI+YSVVFTQMASLFVEQGA
Sbjct  321   TARD-LDDKKQGGVNPWRLCPVTQVEEVKCILRLMPIWLCTIIYSVVFTQMASLFVEQGA  379

Query  996   AMRTNIAGFHIPPASMSSFDILSVAAFIFIYRRILDPLIASLKKTRRAQGFTELQRMGVG  817
             AM+T ++ F IPPASMSSFDILSVA FIFIYRR+L+PL    KK    +G TEL RMG+G
Sbjct  380   AMKTTVSDFKIPPASMSSFDILSVALFIFIYRRVLEPLANRFKKKDGTKGITELHRMGIG  439

Query  816   LiiaimamvaagiVEHFRLKYASTDCPRC--PSSLSIFWQVPQYVLIGASEVFMYVGQLE  643
             L+IAI+AMVAAG+VE FRLKYA   C  C   SSLSIFWQVPQY LIGASEVFMYVGQLE
Sbjct  440   LVIAILAMVAAGVVECFRLKYADKSCTHCDGSSSLSIFWQVPQYSLIGASEVFMYVGQLE  499

Query  642   FFNGQAPEGLKSFASALCMTSISLGNYVSSLLVSIVMRISTTHRMPGWIPGNLNKGHLDR  463
             FFN Q P+GLKSF SALCM S+S+GN+VSSLLV++V++IST   MPGWIP NLNKGHLDR
Sbjct  500   FFNAQTPDGLKSFGSALCMMSMSMGNFVSSLLVTMVVKISTEDHMPGWIPRNLNKGHLDR  559

Query  462   FYFLLAALTTADFVVYILCAKWYKYIEFEERN  367
             FYFLLAALT+ D VVYI CA+WYK I+ E ++
Sbjct  560   FYFLLAALTSIDLVVYIACARWYKCIKLEAKD  591



>emb|CDY48871.1| BnaA05g35790D [Brassica napus]
Length=614

 Score =   791 bits (2043),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 404/572 (71%), Positives = 484/572 (85%), Gaps = 7/572 (1%)
 Frame = -3

Query  2064  TLDGTVDHYGRPALRSATGGWFAGVLLLVNQGLATLAFFGVGVNLVLFLTRVMGQDNADA  1885
             T DGTVD+YGRP++RS +G W AG+++LVNQGLATLAFFGVGVNLVLFLTRV+ Q+NADA
Sbjct  21    TRDGTVDYYGRPSIRSNSGKWVAGIIILVNQGLATLAFFGVGVNLVLFLTRVLQQNNADA  80

Query  1884  ANNVSKWTGTVYLFSLLGAFLSDSYWGRYKTCAIFQLIYVVGLISVSIFSFIFLVKPKGC  1705
             ANNVSKWTGTVY+FSL+GAFLSDSYWGRYKTCAIFQ+I+V+GL S+S+ S++FL++PKGC
Sbjct  81    ANNVSKWTGTVYIFSLVGAFLSDSYWGRYKTCAIFQVIFVIGLSSLSLSSYMFLIRPKGC  140

Query  1704  GDENTPCRSPSRIHIAVYYVSIYLVALGNGGYQPNIATFGSDQFDGDHAHESVSKVAFFS  1525
             GDE TPC + S + I ++Y+SIYL+ALGNGGYQPNIATFG+DQFD +H  E  SK+AFFS
Sbjct  141   GDEVTPCGTHSTMEITMFYLSIYLIALGNGGYQPNIATFGADQFDEEHPKEGYSKIAFFS  200

Query  1524  YFYLALNLGSLFSNTVLVYFEDKGMWTLGFWastvsavlalllflVGTPRYRHFAPKGNP  1345
             YFYLALNLGSLFSNT+L YFED+GMW LGFWAST SA+LAL+LFL+GTPRYR+F P GNP
Sbjct  201   YFYLALNLGSLFSNTILGYFEDEGMWALGFWASTGSAILALILFLLGTPRYRNFKPTGNP  260

Query  1344  LSRFSQVLVASARKWNVHLPSDGDDHRLYEIQEHDSST----RKILHTEGFKFLDKAAVI  1177
             LSRF QVLVA+ +K ++  PS G +    E ++  +++    R+I+HT+ FKFLD+AA I
Sbjct  261   LSRFCQVLVAATKKSSMEAPSRGREEMYDEDRQGKNASGDTGRRIVHTDEFKFLDRAAYI  320

Query  1176  TTKESVRDLEERNINPWRLCSVTQVEEVKCILRLLPIWLCTILYSVVFTQMASLFVEQGA  997
             T ++ + D ++  +NPWRLC VTQVEEVKCILRL+PIWLCTI+YSVVFTQMASLFVEQGA
Sbjct  321   TARD-LDDKKQGGVNPWRLCPVTQVEEVKCILRLMPIWLCTIIYSVVFTQMASLFVEQGA  379

Query  996   AMRTNIAGFHIPPASMSSFDILSVAAFIFIYRRILDPLIASLKKTRRAQGFTELQRMGVG  817
             AM+T ++ F IPPASMSSFDILSVA FIFIYRR+L+PL    KK    +G TEL RMG+G
Sbjct  380   AMKTTVSDFKIPPASMSSFDILSVALFIFIYRRVLEPLANRFKKKDGTKGITELHRMGIG  439

Query  816   LiiaimamvaagiVEHFRLKYASTDCPRC--PSSLSIFWQVPQYVLIGASEVFMYVGQLE  643
             L+IAI+AMVAAG+VE FRLKYA   C  C   SSLSIFWQVPQY LIGASEVFMYVGQLE
Sbjct  440   LVIAILAMVAAGVVECFRLKYADKSCTHCDGSSSLSIFWQVPQYSLIGASEVFMYVGQLE  499

Query  642   FFNGQAPEGLKSFASALCMTSISLGNYVSSLLVSIVMRISTTHRMPGWIPGNLNKGHLDR  463
             FFN Q P+GLKSF SALCM S+S+GN+VSSLLV++V++IST   MPGWIP NLNKGHLDR
Sbjct  500   FFNAQTPDGLKSFGSALCMMSMSMGNFVSSLLVTMVVKISTEDHMPGWIPRNLNKGHLDR  559

Query  462   FYFLLAALTTADFVVYILCAKWYKYIEFEERN  367
             FYFLLAALT+ D VVYI CA+WYK I+ E ++
Sbjct  560   FYFLLAALTSIDLVVYIACARWYKCIKLEAKD  591



>ref|XP_008439356.1| PREDICTED: protein NRT1/ PTR FAMILY 7.3-like, partial [Cucumis 
melo]
Length=549

 Score =   788 bits (2036),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 416/547 (76%), Positives = 468/547 (86%), Gaps = 18/547 (3%)
 Frame = -3

Query  1980  VNQGLATLAFFGVGVNLVLFLTRVMGQDNADAANNVSKWTGTVYLFSLLGAFLSDSYWGR  1801
             VNQGLATLAFFGVGVNLVLFLTRV+GQDNA+AANNVSKWTGTVY+FSLLGAFLSDSYWGR
Sbjct  7     VNQGLATLAFFGVGVNLVLFLTRVLGQDNAEAANNVSKWTGTVYIFSLLGAFLSDSYWGR  66

Query  1800  YKTCAIFQLIYVVGLISVSIFSFIFLVKPKGCGDENTPCRSPSRIHIAVYYVSIYLVALG  1621
             +KTCAIFQ I+V+GL S+SI S++FLV+PKGCGDE+TPC S S +HIA++Y+S+YLVALG
Sbjct  67    FKTCAIFQAIFVIGLASLSITSYVFLVRPKGCGDEHTPCNSHSSLHIALFYLSVYLVALG  126

Query  1620  NGGYQPNIATFGSDQFDGDHAHESVSKVAFFSYFYLALNLGSLFSNTVLVYFEDKGMWTL  1441
             NGGYQPNIATFG+DQFD +   E  SK+AFFSYFYLALNLGSLFSNT+L YFED+GMW +
Sbjct  127   NGGYQPNIATFGADQFDEEDPKEGHSKIAFFSYFYLALNLGSLFSNTILGYFEDEGMWVI  186

Query  1440  GFWastvsavlalllflVGTPRYRHFAPKGNPLSRFSQVLVASARKWNVH-LPS-----D  1279
             GFWAST SA +ALLLFL G PRYRHF PKGNPLSR SQV++A+ RKW V  +P+     D
Sbjct  187   GFWASTASAAMALLLFLCGIPRYRHFTPKGNPLSRVSQVVIAATRKWKVQMMPNSEGLFD  246

Query  1278  GDDHRLYEIQEHDSSTRKILHTEGFKFLDKAAVITTKESVRDLEERNINPWRLCSVTQVE  1099
              DD  L       +  R+ILHT GF+FLDKAAVIT+ E  + L++   NPWRLC+VTQVE
Sbjct  247   DDDKEL-----ASNGARRILHTNGFRFLDKAAVITSSECDK-LDDGARNPWRLCTVTQVE  300

Query  1098  EVKCILRLLPIWLCTILYSVVFTQMASLFVEQGAAMRTNIAGFHIPPASMSSFDILSVAA  919
             EVKCILRLLPIWLCTILYSVVFTQMASLFVEQGAAMRTNI+ FHIPPASMSSFDILSVAA
Sbjct  301   EVKCILRLLPIWLCTILYSVVFTQMASLFVEQGAAMRTNISTFHIPPASMSSFDILSVAA  360

Query  918   FIFIYRRILDPLIASLKKTRRAQGFTELQRMGVGLiiaimamvaagiVEHFRLKYASTDC  739
             FIFIYRR++DP+ A L K+      TELQRMG+GL+IAI AMV+AG VE FRLK+A+ DC
Sbjct  361   FIFIYRRVIDPVFARLTKS----SLTELQRMGIGLVIAICAMVSAGTVEIFRLKHANKDC  416

Query  738   PRC--PSSLSIFWQVPQYVLIGASEVFMYVGQLEFFNGQAPEGLKSFASALCMTSISLGN  565
               C   SSLSIFWQ+PQYVLIGASEVFMYVGQLEFFN QAP+GLKSF SALCMTSIS GN
Sbjct  417   LHCDDSSSLSIFWQIPQYVLIGASEVFMYVGQLEFFNSQAPDGLKSFGSALCMTSISFGN  476

Query  564   YVSSLLVSIVMRISTTHRMPGWIPGNLNKGHLDRFYFLLAALTTADFVVYILCAKWYKYI  385
             YVSSLLV+IVM+IS T  MPGWIPGNLNKGHLDRFYFLLAALT AD  VYILCAKWYKYI
Sbjct  477   YVSSLLVTIVMKISATDNMPGWIPGNLNKGHLDRFYFLLAALTAADLAVYILCAKWYKYI  536

Query  384   EFEERNS  364
             +FE R +
Sbjct  537   KFESREA  543



>ref|XP_009151431.1| PREDICTED: protein NRT1/ PTR FAMILY 7.3 [Brassica rapa]
Length=614

 Score =   791 bits (2042),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 404/572 (71%), Positives = 484/572 (85%), Gaps = 7/572 (1%)
 Frame = -3

Query  2064  TLDGTVDHYGRPALRSATGGWFAGVLLLVNQGLATLAFFGVGVNLVLFLTRVMGQDNADA  1885
             T DGTVD+YGRP++RS +G W AG+++LVNQGLATLAFFGVGVNLVLFLTRV+ Q+NADA
Sbjct  21    TRDGTVDYYGRPSIRSNSGKWVAGIIILVNQGLATLAFFGVGVNLVLFLTRVLQQNNADA  80

Query  1884  ANNVSKWTGTVYLFSLLGAFLSDSYWGRYKTCAIFQLIYVVGLISVSIFSFIFLVKPKGC  1705
             ANNVSKWTGTVY+FSL+GAFLSDSYWGRYKTCAIFQ+I+V+GL S+S+ S++FL++PKGC
Sbjct  81    ANNVSKWTGTVYIFSLVGAFLSDSYWGRYKTCAIFQVIFVIGLSSLSLSSYMFLIRPKGC  140

Query  1704  GDENTPCRSPSRIHIAVYYVSIYLVALGNGGYQPNIATFGSDQFDGDHAHESVSKVAFFS  1525
             GDE TPC + S + I ++Y+SIYL+ALGNGGYQPNIATFG+DQFD +H  E  SK+AFFS
Sbjct  141   GDEVTPCGTHSTMEITMFYLSIYLIALGNGGYQPNIATFGADQFDEEHPKEGYSKIAFFS  200

Query  1524  YFYLALNLGSLFSNTVLVYFEDKGMWTLGFWastvsavlalllflVGTPRYRHFAPKGNP  1345
             YFYLALNLGSLFSNT+L YFED+GMW LGFWAST SA+LAL+LFL+GTPRYR+F P GNP
Sbjct  201   YFYLALNLGSLFSNTILGYFEDEGMWALGFWASTGSAILALILFLLGTPRYRNFKPTGNP  260

Query  1344  LSRFSQVLVASARKWNVHLPSDGDDHRLYEIQEHDSST----RKILHTEGFKFLDKAAVI  1177
             LSRF QVLVA+ +K ++  PS G +    E ++  +++    R+I+HT+ FKFLD+AA I
Sbjct  261   LSRFCQVLVAATKKSSMEAPSRGREEMYDEDRQGKNASGDTGRRIVHTDEFKFLDRAAYI  320

Query  1176  TTKESVRDLEERNINPWRLCSVTQVEEVKCILRLLPIWLCTILYSVVFTQMASLFVEQGA  997
             T ++ + D ++  +NPWRLC VTQVEEVKCILRL+PIWLCTI+YSVVFTQMASLFVEQGA
Sbjct  321   TARD-LDDKKQGGVNPWRLCPVTQVEEVKCILRLMPIWLCTIIYSVVFTQMASLFVEQGA  379

Query  996   AMRTNIAGFHIPPASMSSFDILSVAAFIFIYRRILDPLIASLKKTRRAQGFTELQRMGVG  817
             AM+T ++ F IPPASMSSFDILSVA FIFIYRR+L+PL    KK    +G TEL RMG+G
Sbjct  380   AMKTTVSDFKIPPASMSSFDILSVALFIFIYRRVLEPLANRFKKKDGTKGITELHRMGIG  439

Query  816   LiiaimamvaagiVEHFRLKYASTDCPRC--PSSLSIFWQVPQYVLIGASEVFMYVGQLE  643
             L+IAI+AMVAAG+VE FRLKYA   C  C   SSLSIFWQVPQY LIGASEVFMYVGQLE
Sbjct  440   LVIAILAMVAAGVVECFRLKYADRSCTHCDGSSSLSIFWQVPQYSLIGASEVFMYVGQLE  499

Query  642   FFNGQAPEGLKSFASALCMTSISLGNYVSSLLVSIVMRISTTHRMPGWIPGNLNKGHLDR  463
             FFN Q P+GLKSF SALCM S+S+GN+VSSLLV++V++IST   MPGWIP NLNKGHLDR
Sbjct  500   FFNAQTPDGLKSFGSALCMMSMSMGNFVSSLLVTMVVKISTEDHMPGWIPRNLNKGHLDR  559

Query  462   FYFLLAALTTADFVVYILCAKWYKYIEFEERN  367
             FYFLLAALT+ D VVYI CA+WYK I+ E ++
Sbjct  560   FYFLLAALTSIDLVVYIACARWYKCIKLEAKD  591



>ref|XP_003516639.1| PREDICTED: nitrate transporter 1.5-like [Glycine max]
Length=596

 Score =   790 bits (2039),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 401/566 (71%), Positives = 481/566 (85%), Gaps = 5/566 (1%)
 Frame = -3

Query  2064  TLDGTVDHYGRPALRSATGGWFAGVLLLVNQGLATLAFFGVGVNLVLFLTRVMGQDNADA  1885
             TLDG+VD +GRPA+R+ +G W A +++L+NQ LATLAFFG+GVNLVLFLTRV+GQ+NADA
Sbjct  22    TLDGSVDFHGRPAIRAKSGRWVAAIIILLNQALATLAFFGIGVNLVLFLTRVVGQNNADA  81

Query  1884  ANNVSKWTGTVYLFSLLGAFLSDSYWGRYKTCAIFQLIYVVGLISVSIFSFIFLVKPKGC  1705
             ANNVSKWTGTVY+FSL+GAFLSDSYWGRYKTCA+FQ+I+V+GL+S+S+ S++FL+KPKGC
Sbjct  82    ANNVSKWTGTVYIFSLVGAFLSDSYWGRYKTCAVFQVIFVIGLMSLSLSSYLFLLKPKGC  141

Query  1704  GDENTPCRSPSRIHIAVYYVSIYLVALGNGGYQPNIATFGSDQFDGDHAHESVSKVAFFS  1525
             G+E+  C   S++ + ++Y+SIYLVALGNGGYQPNIATFG+DQFD +H+ E  +KVAFFS
Sbjct  142   GNESVNCGKHSKLEMGMFYLSIYLVALGNGGYQPNIATFGADQFDEEHSKEGHNKVAFFS  201

Query  1524  YFYLALNLGSLFSNTVLVYFEDKGMWTLGFWastvsavlalllflVGTPRYRHFAPKGNP  1345
             YFYLA N+G LFSNT+LVYFED+GMW LGFW S  SA  AL+LFLV TPRYRHF P GNP
Sbjct  202   YFYLAFNIGQLFSNTILVYFEDEGMWALGFWLSAGSAFAALVLFLVCTPRYRHFKPSGNP  261

Query  1344  LSRFSQVLVASARKWNVHLPSDGDDHRLYEIQE-HDSSTRKILHTEGFKFLDKAAVITTK  1168
             LSRFSQVLVA++RK  V + S+G+D    + +E  +++ RKILHT GFKFLD+AA I+++
Sbjct  262   LSRFSQVLVAASRKSKVQMSSNGEDLFNMDAKEASNNANRKILHTHGFKFLDRAAFISSR  321

Query  1167  ESVRDLEERNINPWRLCSVTQVEEVKCILRLLPIWLCTILYSVVFTQMASLFVEQGAAMR  988
             + + D +    NPWRLC V+QVEEVKCILRLLPIWLCTI+YSVVFTQMASLFVEQGAAM+
Sbjct  322   D-LGDQKGLGYNPWRLCPVSQVEEVKCILRLLPIWLCTIIYSVVFTQMASLFVEQGAAMK  380

Query  987   TNIAGFHIPPASMSSFDILSVAAFIFIYRRILDPLIASLKKTRRAQGFTELQRMGVGLii  808
             T ++ F IPPASMSSFDILSVA FIF YRR+LDP +  LKKT  ++G TELQRMGVGL+I
Sbjct  381   TKVSNFRIPPASMSSFDILSVAVFIFFYRRVLDPFVGKLKKT-DSKGLTELQRMGVGLVI  439

Query  807   aimamvaagiVEHFRLKYASTDCPRC--PSSLSIFWQVPQYVLIGASEVFMYVGQLEFFN  634
             A++AMV+AG+VE +RLKYA   C  C   S+LSIFWQ+PQY  IGASEVFMYVGQLEFFN
Sbjct  440   AVLAMVSAGLVECYRLKYAKQGCIHCNDSSTLSIFWQIPQYAFIGASEVFMYVGQLEFFN  499

Query  633   GQAPEGLKSFASALCMTSISLGNYVSSLLVSIVMRISTTHRMPGWIPGNLNKGHLDRFYF  454
              Q P+GLKSF SALCMTSISLGNYVSSLLVS+VM+IST   MPGWIPGNLNKGHLDRFYF
Sbjct  500   AQTPDGLKSFGSALCMTSISLGNYVSSLLVSVVMKISTEDHMPGWIPGNLNKGHLDRFYF  559

Query  453   LLAALTTADFVVYILCAKWYKYIEFE  376
             LLAALT+ D + YI CAKWYK I+ E
Sbjct  560   LLAALTSIDLIAYIACAKWYKSIQLE  585



>gb|KHN13614.1| Nitrate transporter 1.5 [Glycine soja]
Length=586

 Score =   789 bits (2038),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 414/591 (70%), Positives = 481/591 (81%), Gaps = 12/591 (2%)
 Frame = -3

Query  2091  EEKASREE--CTLDGTVDHYGRPALRSATGGWFAGVLLLVNQGLATLAFFGVGVNLVLFL  1918
             EEK ++E   CT DG +D  G PA+R  TG W A +L+LVNQGLATLAFFG+GVNLVLFL
Sbjct  2     EEKVNKEHQVCTSDGAIDSQGHPAVREKTGDWVAAILILVNQGLATLAFFGIGVNLVLFL  61

Query  1917  TRVMGQDNADAANNVSKWTGTVYLFSLLGAFLSDSYWGRYKTCAIFQLIYVVGLISVSIF  1738
             TRVMGQDNA+AAN+VSKWTGTVYLFSLLGAFLSDSYWGRY TCAIFQ+I+V+GL+S+S+ 
Sbjct  62    TRVMGQDNAEAANSVSKWTGTVYLFSLLGAFLSDSYWGRYMTCAIFQVIFVIGLVSLSLS  121

Query  1737  SFIFLVKPKGCGDENTPCRSPSRIHIAVYYVSIYLVALGNGGYQPNIATFGSDQFDGDHA  1558
             S+IFL+KP GCG++  PC S S     ++YVSIYL+ALGNGGYQPNIATFG+DQFD    
Sbjct  122   SYIFLLKPSGCGNKELPCGSHSSYQTILFYVSIYLIALGNGGYQPNIATFGADQFDEGDT  181

Query  1557  HESVSKVAFFSYFYLALNLGSLFSNTVLVYFEDKGMWTLGFWastvsavlalllflVGTP  1378
              E  SK+ FFSYFYLALN+GSLFSNT+L YFED G+WTLGFWAS  SA LAL+LFL GT 
Sbjct  182   REQHSKIVFFSYFYLALNIGSLFSNTILNYFEDDGLWTLGFWASAGSAALALVLFLCGTR  241

Query  1377  RYRHFAPKGNPLSRFSQVLVASARKWNVHLPSDGDDHRLYEIQEHDSST-RKILHTEGFK  1201
             RYR+F P GNPL RF QV VA+ RKW V +     D +LYE+ E  +   RK+LHTEGF+
Sbjct  242   RYRYFKPNGNPLPRFCQVFVAATRKWKVKVL---QDDKLYEVDEFSTDEGRKMLHTEGFR  298

Query  1200  FLDKAAVITTKESVRDLEERNINPWRLCSVTQVEEVKCILRLLPIWLCTILYSVVFTQMA  1021
             FLDKAA IT+K + + +EE   +PW L +VTQVEEVKCILRLLPIWLCTILYSVVF QMA
Sbjct  299   FLDKAAFITSK-NFKQMEESKCSPWYLSTVTQVEEVKCILRLLPIWLCTILYSVVFAQMA  357

Query  1020  SLFVEQGAAMRTNIAGFHIPPASMSSFDILSVAAFIFIYRRILDPLIASLKKTRRAQGFT  841
             SLFVEQG AM T I+ FHIPPASMS+FDILSVA  IFIYRR+LDPL+A   +T +++G T
Sbjct  358   SLFVEQGDAMDTRISSFHIPPASMSTFDILSVAIVIFIYRRVLDPLVA---RTMKSKGLT  414

Query  840   ELQRMGVGLiiaimamvaagiVEHFRLKYASTDCPRCP--SSLSIFWQVPQYVLIGASEV  667
             ELQRMG+GL++AIMAMV+AG+VEHFRLK A  DC  C   SSLSIFWQVPQYV +GASEV
Sbjct  415   ELQRMGIGLVLAIMAMVSAGLVEHFRLKNAIEDCNECKGSSSLSIFWQVPQYVFVGASEV  474

Query  666   FMYVGQLEFFNGQAPEGLKSFASALCMTSISLGNYVSSLLVSIVMRISTTHRMPGWIPGN  487
             FMYVGQLEFFN Q P+GLKSF SALCMTSISLGNYVSSLLV+IVM+IS T  MPGWIPGN
Sbjct  475   FMYVGQLEFFNAQTPDGLKSFGSALCMTSISLGNYVSSLLVAIVMKISATDEMPGWIPGN  534

Query  486   LNKGHLDRFYFLLAALTTADFVVYILCAKWYKYIEFEERNSCLKNIGDSKL  334
             LNKGHLD FYFLLAALT AD V+Y+L A+WYKY++F+  N    N  D ++
Sbjct  535   LNKGHLDMFYFLLAALTAADLVIYVLMARWYKYVKFQGNNENDTNKEDPEV  585



>ref|XP_003611453.1| Peptide transporter PTR1 [Medicago truncatula]
 gb|AES94411.1| peptide transporter [Medicago truncatula]
Length=605

 Score =   790 bits (2039),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 408/593 (69%), Positives = 490/593 (83%), Gaps = 10/593 (2%)
 Frame = -3

Query  2133  LNITKMFFIKNERDEEKASREECTLDGTVDHYGRPALRSATGGWFAGVLLLVNQGLATLA  1954
             L ++K    K E D E  S EE TLDG+VD  GRPA+R+ +G W AG ++L+NQ LATLA
Sbjct  6     LEVSKENKFKEETDFESES-EELTLDGSVDFNGRPAIRAKSGRWSAGTIILLNQCLATLA  64

Query  1953  FFGVGVNLVLFLTRVMGQDNADAANNVSKWTGTVYLFSLLGAFLSDSYWGRYKTCAIFQL  1774
             FFG+GVNLV+FLTRV+GQ+NA+AANNVSKWTGTVY+FSL+GAFLSDSYWGRYKTCA+FQ+
Sbjct  65    FFGIGVNLVVFLTRVVGQNNAEAANNVSKWTGTVYIFSLVGAFLSDSYWGRYKTCAVFQV  124

Query  1773  IYVVGLISVSIFSFIFLVKPKGCGDENTPCRSPSRIHIAVYYVSIYLVALGNGGYQPNIA  1594
             I+V+GL+S+S+ S++FL+KPKGCG+E+  C   S   + ++Y+SIYL+ALGNGGYQPNIA
Sbjct  125   IFVIGLMSLSLSSYLFLIKPKGCGNESIQCGKHSSWEMGMFYLSIYLIALGNGGYQPNIA  184

Query  1593  TFGSDQFDGDHAHESVSKVAFFSYFYLALNLGSLFSNTVLVYFEDKGMWTLGFWastvsa  1414
             TFG+DQFD +H+ E  +KVAFFSYFYLALN G LFSNT+LVYFED+GMW LGFW S   A
Sbjct  185   TFGADQFDEEHSKEGHNKVAFFSYFYLALNFGQLFSNTILVYFEDEGMWALGFWLSAGCA  244

Query  1413  vlalllflVGTPRYRHFAPKGNPLSRFSQVLVASARKWNVHLPSDGDDHRLYEIQEHDSS  1234
              +AL+LFLVGTP+YRHF P GNPL+RF QVLVA++RK  V +PS+GDD  LY +   +SS
Sbjct  245   FIALILFLVGTPKYRHFKPSGNPLARFCQVLVAASRKVKVEMPSNGDD--LYNMDTKESS  302

Query  1233  T---RKILHTEGFKFLDKAAVITTKESVRDLEERNINPWRLCSVTQVEEVKCILRLLPIW  1063
             T   RKILHT GFKFLD+AA+I++++   + +    NPWRLC V+QVEEVKCILRLLPIW
Sbjct  303   TDVNRKILHTHGFKFLDRAAIISSRDH-DNQKGTCSNPWRLCPVSQVEEVKCILRLLPIW  361

Query  1062  LCTILYSVVFTQMASLFVEQGAAMRTNIAGFHIPPASMSSFDILSVAAFIFIYRRILDPL  883
             LCTI+YSVVFTQMASLFVEQG AM+T +  F +PPASMS FDI+SVA FIF YRRILDP 
Sbjct  362   LCTIIYSVVFTQMASLFVEQGDAMKTTVYNFRVPPASMSCFDIISVAVFIFFYRRILDPF  421

Query  882   IASLKKTRRAQGFTELQRMGVGLiiaimamvaagiVEHFRLKYASTDCPRCP--SSLSIF  709
             +  LKK+  ++G TELQRMGVGL+IA++AMV+AGIVE +RLK+A  DC  C   S+LSIF
Sbjct  422   VGKLKKS-DSKGLTELQRMGVGLVIAVIAMVSAGIVESYRLKHADQDCRHCKGSSTLSIF  480

Query  708   WQVPQYVLIGASEVFMYVGQLEFFNGQAPEGLKSFASALCMTSISLGNYVSSLLVSIVMR  529
             WQ+PQY LIGASEVFMYVGQLEFFN Q P+GLKSF SALCMTSISLGNYVSSLLVS+VM+
Sbjct  481   WQIPQYALIGASEVFMYVGQLEFFNAQTPDGLKSFGSALCMTSISLGNYVSSLLVSVVMK  540

Query  528   ISTTHRMPGWIPGNLNKGHLDRFYFLLAALTTADFVVYILCAKWYKYIEFEER  370
             IST   MPGWIP NLNKGHLDRFYFLLAALT+ D + YI CAKWYK I+  E+
Sbjct  541   ISTEDHMPGWIPVNLNKGHLDRFYFLLAALTSMDLIAYIACAKWYKSIQLGEK  593



>gb|KHG24156.1| Nitrate transporter 1.5 -like protein [Gossypium arboreum]
Length=599

 Score =   789 bits (2037),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 420/607 (69%), Positives = 499/607 (82%), Gaps = 23/607 (4%)
 Frame = -3

Query  2139  AFLNITKMFFIKNERDEEKASREECTLDGTVDHYGRPALRSATGGWFAGVLLLVNQGLAT  1960
             A L + K   +K E++E       CT DG+VD +GRPA+++ +G W AG+++L+NQGLAT
Sbjct  2     ACLEVCKEGKLKEEQEEA------CTQDGSVDWHGRPAIKAKSGQWTAGIIILLNQGLAT  55

Query  1959  LAFFGVGVNLVLFLTRVMGQDNADAANNVSKWTGTVYLFSLLGAFLSDSYWGRYKTCAIF  1780
             LAFFGVGVNLVLFLTRV+ Q+NA+AANNVSKWTGTVY+FSL+GAFLSDSYWGRYKTCAIF
Sbjct  56    LAFFGVGVNLVLFLTRVLDQNNAEAANNVSKWTGTVYIFSLVGAFLSDSYWGRYKTCAIF  115

Query  1779  QLIYVVGLISVSIFSFIFLVKPKGCGDENTPCRSPSRIHIAVYYVSIYLVALGNGGYQPN  1600
             Q+I+V+GL+S+S+ S++FL++P+GCG++  PC S S + I ++Y+SIYLVALGNGGYQPN
Sbjct  116   QVIFVIGLVSLSLSSYLFLIRPRGCGNQEMPCGSHSGLEITLFYLSIYLVALGNGGYQPN  175

Query  1599  IATFGSDQFDGDHAHESVSKVAFFSYFYLALNLGSLFSNTVLVYFEDKGMWTLGFWastv  1420
             IATFG+DQFD D   E  SKVAFFSYFYLALNLGSLFSNT+L YFED+GMW LGFW S  
Sbjct  176   IATFGADQFDEDDPKEGHSKVAFFSYFYLALNLGSLFSNTILGYFEDEGMWALGFWVSAG  235

Query  1419  savlalllflVGTPRYRHFAPKGNPLSRFSQVLVASARKWNVHLPSDGDDHRLYEIQEHD  1240
             SA+ AL+LFLVGT RYRHF P GNPLSRFSQVLVA+ RK +V +P D D+  LY+I  + 
Sbjct  236   SALAALVLFLVGTTRYRHFKPSGNPLSRFSQVLVAAIRKCSVDMPPDTDE--LYDIDGNY  293

Query  1239  SS---TRKILHTEGFKFLDKAAVITTKESVRDLEERNINP---WRLCSVTQVEEVKCILR  1078
             SS    RKILHT+ FKFLD+AA I+T    RD+EE+       WRLC VTQVEEVKC+LR
Sbjct  294   SSMNGNRKILHTDEFKFLDRAAYIST----RDVEEQKKGTHSMWRLCPVTQVEEVKCVLR  349

Query  1077  LLPIWLCTILYSVVFTQMASLFVEQGAAMRTNIAGFHIPPASMSSFDILSVAAFIFIYRR  898
             LLPIWLCTI+YSVVFTQMASLFVEQGAAM+T ++ F IPPASMSSFDILSVA FIF+YRR
Sbjct  350   LLPIWLCTIIYSVVFTQMASLFVEQGAAMKTTVSNFRIPPASMSSFDILSVALFIFLYRR  409

Query  897   ILDPLIASLKKTRRAQGFTELQRMGVGLiiaimamvaagiVEHFRLKYASTDCPRCP--S  724
             +LDPL+  +KK + ++G TELQRMG+GL+IAIMAMV+AGIVE +RLK+A  DC  C   S
Sbjct  410   VLDPLVTRIKK-KGSRGLTELQRMGIGLVIAIMAMVSAGIVECYRLKHADKDCMHCEGSS  468

Query  723   SLSIFWQVPQYVLIGASEVFMYVGQLEFFNGQAPEGLKSFASALCMTSISLGNYVSSLLV  544
             SLSIFWQVPQY  IGASEVFMYVGQLEFFN Q P+GLKSF SALCMTSISLGNYVSSLLV
Sbjct  469   SLSIFWQVPQYAFIGASEVFMYVGQLEFFNAQTPDGLKSFGSALCMTSISLGNYVSSLLV  528

Query  543   SIVMRISTTHRMPGWIPGNLNKGHLDRFYFLLAALTTADFVVYILCAKWYKYIEFEERNS  364
             ++VM+IST   MPGWIPGNLNKGHLD FYFLLA LTT D +VYI CA+WYK I+ E + +
Sbjct  529   TMVMKISTEDHMPGWIPGNLNKGHLDWFYFLLAGLTTIDLIVYIACARWYKSIKLEGKTA  588

Query  363   CLKNIGD  343
               +NI D
Sbjct  589   --ENIDD  593



>gb|KHN42621.1| Nitrate transporter 1.5 [Glycine soja]
Length=596

 Score =   788 bits (2036),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 401/566 (71%), Positives = 481/566 (85%), Gaps = 5/566 (1%)
 Frame = -3

Query  2064  TLDGTVDHYGRPALRSATGGWFAGVLLLVNQGLATLAFFGVGVNLVLFLTRVMGQDNADA  1885
             TLDG+VD +GRPA+R+ +G W A +++L+NQ LATLAFFG+GVNLVLFLTRV+GQ+NADA
Sbjct  22    TLDGSVDFHGRPAIRAKSGRWVAAIIILLNQALATLAFFGIGVNLVLFLTRVVGQNNADA  81

Query  1884  ANNVSKWTGTVYLFSLLGAFLSDSYWGRYKTCAIFQLIYVVGLISVSIFSFIFLVKPKGC  1705
             ANNVSKWTGTVY+FSL+GAFLSDSYWGRYKTCA+FQ+I+V+GL+S+S+ S++FL+KPKGC
Sbjct  82    ANNVSKWTGTVYIFSLVGAFLSDSYWGRYKTCAVFQVIFVIGLMSLSLSSYLFLLKPKGC  141

Query  1704  GDENTPCRSPSRIHIAVYYVSIYLVALGNGGYQPNIATFGSDQFDGDHAHESVSKVAFFS  1525
             G+E+  C   S++ + ++Y+SIYLVALGNGGYQPNIATFG+DQFD +H+ E  +KVAFFS
Sbjct  142   GNESVNCGKHSKLEMGMFYLSIYLVALGNGGYQPNIATFGADQFDEEHSKEGHNKVAFFS  201

Query  1524  YFYLALNLGSLFSNTVLVYFEDKGMWTLGFWastvsavlalllflVGTPRYRHFAPKGNP  1345
             YFYLA N+G LFSNT+LVYFED+GMW LGFW S  SA  AL+LFLV TPRYRHF P GNP
Sbjct  202   YFYLAFNIGQLFSNTILVYFEDEGMWALGFWLSAGSAFAALVLFLVCTPRYRHFKPSGNP  261

Query  1344  LSRFSQVLVASARKWNVHLPSDGDDHRLYEIQE-HDSSTRKILHTEGFKFLDKAAVITTK  1168
             LSRFSQVLVA++RK  V + S+G+D    + +E  +++ RKILHT GFKFLD+AA I+++
Sbjct  262   LSRFSQVLVAASRKSKVQMSSNGEDLFNMDAKEASNNANRKILHTHGFKFLDRAAFISSR  321

Query  1167  ESVRDLEERNINPWRLCSVTQVEEVKCILRLLPIWLCTILYSVVFTQMASLFVEQGAAMR  988
             + + D +    NPWRLC V+QVEEVKCILRLLPIWLCTI+YSVVFTQMASLFVEQGAAM+
Sbjct  322   D-LGDQKGLGYNPWRLCPVSQVEEVKCILRLLPIWLCTIIYSVVFTQMASLFVEQGAAMK  380

Query  987   TNIAGFHIPPASMSSFDILSVAAFIFIYRRILDPLIASLKKTRRAQGFTELQRMGVGLii  808
             T ++ F IPPASMSSFDILSVA FIF YRR+LDP +  LKKT  ++G TELQRMGVGL+I
Sbjct  381   TKLSNFRIPPASMSSFDILSVAVFIFFYRRVLDPFVGKLKKT-DSKGLTELQRMGVGLVI  439

Query  807   aimamvaagiVEHFRLKYASTDCPRC--PSSLSIFWQVPQYVLIGASEVFMYVGQLEFFN  634
             A++AMV+AG+VE +RLKYA   C  C   S+LSIFWQ+PQY  IGASEVFMYVGQLEFFN
Sbjct  440   AVLAMVSAGLVECYRLKYAKQGCIHCNDSSTLSIFWQIPQYAFIGASEVFMYVGQLEFFN  499

Query  633   GQAPEGLKSFASALCMTSISLGNYVSSLLVSIVMRISTTHRMPGWIPGNLNKGHLDRFYF  454
              Q P+GLKSF SALCMTSISLGNYVSSLLVS+VM+IST   MPGWIPGNLNKGHLDRFYF
Sbjct  500   AQTPDGLKSFGSALCMTSISLGNYVSSLLVSVVMKISTEDHMPGWIPGNLNKGHLDRFYF  559

Query  453   LLAALTTADFVVYILCAKWYKYIEFE  376
             LLAALT+ D + YI CAKWYK I+ E
Sbjct  560   LLAALTSIDLIAYIACAKWYKCIQLE  585



>ref|XP_011081326.1| PREDICTED: protein NRT1/ PTR FAMILY 7.3-like [Sesamum indicum]
Length=601

 Score =   788 bits (2036),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 408/599 (68%), Positives = 480/599 (80%), Gaps = 23/599 (4%)
 Frame = -3

Query  2097  RDEEKASREECTLDGTVDHYGRPALRSATGGWFAGVLLLVNQGLATLAFFGVGVNLVLFL  1918
             R EE+  +  CT DG+VD +GRPA+   +G WFAG+++L+NQGLATLAFFGVGVNLVLFL
Sbjct  13    RGEEEGCK--CTRDGSVDLHGRPAIPERSGKWFAGIIILLNQGLATLAFFGVGVNLVLFL  70

Query  1917  TRVMGQDNADAANNVSKWTGTVYLFSLLGAFLSDSYWGRYKTCAIFQLIYVVGLISVSIF  1738
             TRVM QDNADAAN+VSKWTGTVY+FSL+GAFLSDSYWGRYKTCAIFQLI+V+GL  +S+ 
Sbjct  71    TRVMHQDNADAANSVSKWTGTVYIFSLVGAFLSDSYWGRYKTCAIFQLIFVIGLALLSLA  130

Query  1737  SFIFLVKPKGCGDENTPCRSPSRIHIAVYYVSIYLVALGNGGYQPNIATFGSDQFDGDHA  1558
             + I L+KP GCG   +PC+  S   + ++Y+SIY+VALGNGGYQPNIATFG+DQFD +  
Sbjct  131   TQISLLKPGGCGRGTSPCKPHSSWEMGLFYISIYMVALGNGGYQPNIATFGADQFDQEDP  190

Query  1557  HESVSKVAFFSYFYLALNLGSLFSNTVLVYFEDKGMWTLGFWastvsavlalllflVGTP  1378
              E  SKV+FFSYFYLALNLGSLFSNT+L YFED+GMW LGFWAST SA  ALLLFL GT 
Sbjct  191   KEGRSKVSFFSYFYLALNLGSLFSNTILGYFEDEGMWALGFWASTASAFAALLLFLGGTK  250

Query  1377  RYRHFAPKGNPLSRFSQVLVASARKWNVHLPSDGDDHRLYEIQEHDSS-------TRKIL  1219
             RYRHF P GNPLSRF+QVLVA+  KW   +P    +H LYE  +   S        RK+L
Sbjct  251   RYRHFRPTGNPLSRFAQVLVAALNKWTEKIPP--GEHNLYEAADDRGSDHTANGGARKML  308

Query  1218  HTEGFKFLDKAAVITTKESVRDLEERNINPWRLCSVTQVEEVKCILRLLPIWLCTILYSV  1039
             HT+GFKFLD+AA +T+++S   L+++  NPWRLC ++QVEEVKCILRLLPIWLCTI+YSV
Sbjct  309   HTQGFKFLDRAAFLTSRDS-EQLKQKAYNPWRLCPISQVEEVKCILRLLPIWLCTIIYSV  367

Query  1038  VFTQMASLFVEQGAAMRTNIAGFHIPPASMSSFDILSVAAFIFIYRRILDPLIASLKKTR  859
             VFTQMASLFVEQG AM TNI+ F IPPASMSSFDILSVA FIF+YRR++DPL+   ++ R
Sbjct  368   VFTQMASLFVEQGDAMNTNISNFRIPPASMSSFDILSVAFFIFLYRRVVDPLV---RRVR  424

Query  858   RAQGFTELQRMGVGLiiaimamvaagiVEHFRLKYASTDCPRC--PSSLSIFWQVPQYVL  685
             +    TELQRMG+GLIIA+ AM++AGIVE +RLKYA  DC  C   SSLSIFWQVPQY L
Sbjct  425   KKGSLTELQRMGIGLIIAVAAMLSAGIVECYRLKYAKKDCRHCQGSSSLSIFWQVPQYAL  484

Query  684   IGASEVFMYVGQLEFFNGQAPEGLKSFASALCMTSISLGNYVSSLLVSIVMRISTTHRMP  505
             IGASEVFMYVGQLEFFN +AP+GLKSF SALCMTSISLGNYVSS LVSIVM+IST   MP
Sbjct  485   IGASEVFMYVGQLEFFNAEAPDGLKSFGSALCMTSISLGNYVSSFLVSIVMKISTVDNMP  544

Query  504   GWIPGNLNKGHLDRFYFLLAALTTADFVVYILCAKWYKYIEFEERNSCLKNIGDSKLQE  328
             GWIPGNLNKGHLDRFYFLLA LT  D V+YI CA+WY  ++ E       N G++  +E
Sbjct  545   GWIPGNLNKGHLDRFYFLLAGLTAVDLVIYIACARWYTSMKLE------GNYGENNEEE  597



>ref|XP_007210875.1| hypothetical protein PRUPE_ppa003158mg [Prunus persica]
 gb|EMJ12074.1| hypothetical protein PRUPE_ppa003158mg [Prunus persica]
Length=597

 Score =   788 bits (2035),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 406/577 (70%), Positives = 480/577 (83%), Gaps = 10/577 (2%)
 Frame = -3

Query  2085  KASREECTLDGTVDHYGRPALRSATGGWFAGVLLLVNQGLATLAFFGVGVNLVLFLTRVM  1906
             K   + CTLDGTVD +G+PA+R+ +G W AG+++LVNQGLATLAFFGVGVNLVL+LTRV+
Sbjct  13    KEDEDACTLDGTVDMHGQPAIRAKSGRWVAGIIILVNQGLATLAFFGVGVNLVLYLTRVL  72

Query  1905  GQDNADAANNVSKWTGTVYLFSLLGAFLSDSYWGRYKTCAIFQLIYVVGLISVSIFSFIF  1726
              QDNA AANNVSKWTGTVY+FSL+GAFLSDSYWGRYKTCAIFQLI+V GLIS+S+ S +F
Sbjct  73    QQDNATAANNVSKWTGTVYIFSLVGAFLSDSYWGRYKTCAIFQLIFVTGLISLSLSSQLF  132

Query  1725  LVKPKGCGDENTPCRSPSRIHIAVYYVSIYLVALGNGGYQPNIATFGSDQFDGDHAHESV  1546
             L+KP+GCG +  PC + S++H+ ++Y+SIYL+ALGNGGYQPNIATFG+DQFD +   E  
Sbjct  133   LLKPEGCGSQEDPCGTHSKLHVWLFYLSIYLIALGNGGYQPNIATFGADQFDEEDNKEGH  192

Query  1545  SKVAFFSYFYLALNLGSLFSNTVLVYFEDKGMWTLGFWastvsavlalllflVGTPRYRH  1366
             SKVAFFSYFYLA+NLGSLFSNT+L YFED+G+W +GFWAST SA  AL+LFL GT RYRH
Sbjct  193   SKVAFFSYFYLAMNLGSLFSNTILGYFEDEGVWAIGFWASTASAFAALVLFLGGTARYRH  252

Query  1365  FAPKGNPLSRFSQVLVASARKWNVHLPSDGDDHRLYEIQEHDSSTRKILHTEGFKFLDKA  1186
             F P GNPLSRF QVLVA+ +K    +P  GDD      +E  +S RKIL+T GFKFLD+A
Sbjct  253   FKPNGNPLSRFCQVLVAAMKKCRAEMPQGGDDLYDEAKKESSNSNRKILYTHGFKFLDRA  312

Query  1185  AVITTKESVRDLEERN---INPWRLCSVTQVEEVKCILRLLPIWLCTILYSVVFTQMASL  1015
             A I++    RDL+ +     +PWRLC ++QVEEVKCILRLLPIWLCTILYSVVFTQMASL
Sbjct  313   AYISS----RDLDHQKQGICSPWRLCPISQVEEVKCILRLLPIWLCTILYSVVFTQMASL  368

Query  1014  FVEQGAAMRTNIAGFHIPPASMSSFDILSVAAFIFIYRRILDPLIASLKKTRRAQGFTEL  835
             FVEQGAAM+T ++ F IPPASMSSFDILSVA FIF YRRILDP++A ++K+  A+G TEL
Sbjct  369   FVEQGAAMKTTVSNFKIPPASMSSFDILSVAVFIFFYRRILDPVVARIRKS-DAKGLTEL  427

Query  834   QRMGVGLiiaimamvaagiVEHFRLKYASTDCPRCP--SSLSIFWQVPQYVLIGASEVFM  661
             QRMG+GL+IA++AM++AGIVE +RLKYA  +CP C   SSLSIFWQ+PQY  IGASEVFM
Sbjct  428   QRMGIGLVIAVLAMLSAGIVECYRLKYADKECPHCEGSSSLSIFWQIPQYACIGASEVFM  487

Query  660   YVGQLEFFNGQAPEGLKSFASALCMTSISLGNYVSSLLVSIVMRISTTHRMPGWIPGNLN  481
             YVGQLEFFN Q P+GLKSF SALCMTSISLGNY SS LVS+VM+IST   MPGWIPGNLN
Sbjct  488   YVGQLEFFNAQTPDGLKSFGSALCMTSISLGNYFSSFLVSVVMKISTEDDMPGWIPGNLN  547

Query  480   KGHLDRFYFLLAALTTADFVVYILCAKWYKYIEFEER  370
             KGHLDRFYFLLA LT+ D +VYI  AKWYK I+FE R
Sbjct  548   KGHLDRFYFLLAVLTSIDLIVYIASAKWYKSIKFEGR  584



>ref|XP_007156651.1| hypothetical protein PHAVU_002G005700g [Phaseolus vulgaris]
 gb|ESW28645.1| hypothetical protein PHAVU_002G005700g [Phaseolus vulgaris]
Length=596

 Score =   787 bits (2033),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 402/570 (71%), Positives = 479/570 (84%), Gaps = 9/570 (2%)
 Frame = -3

Query  2064  TLDGTVDHYGRPALRSATGGWFAGVLLLVNQGLATLAFFGVGVNLVLFLTRVMGQDNADA  1885
             TLDG+VD +G PA+R+ +G W A +++L+NQ LATLAFFG+GVNLVLFLTRV+GQ+NADA
Sbjct  22    TLDGSVDLHGGPAIRAKSGRWVAAIIILLNQALATLAFFGMGVNLVLFLTRVVGQNNADA  81

Query  1884  ANNVSKWTGTVYLFSLLGAFLSDSYWGRYKTCAIFQLIYVVGLISVSIFSFIFLVKPKGC  1705
             ANNVSKWTGTVY+FSL+GAFLSDSYWGRYKTCA+FQ+I+V+GL+S+S+ S++FL+KPKGC
Sbjct  82    ANNVSKWTGTVYIFSLVGAFLSDSYWGRYKTCAVFQVIFVIGLMSLSLSSYLFLLKPKGC  141

Query  1704  GDENTPCRSPSRIHIAVYYVSIYLVALGNGGYQPNIATFGSDQFDGDHAHESVSKVAFFS  1525
             G+E   C   SR+ + ++Y+SIYLVALGNGGYQPNIATFG+DQFD +H+ E  SKVAFFS
Sbjct  142   GNETIHCGKHSRLEMGMFYLSIYLVALGNGGYQPNIATFGADQFDEEHSEEGHSKVAFFS  201

Query  1524  YFYLALNLGSLFSNTVLVYFEDKGMWTLGFWastvsavlalllflVGTPRYRHFAPKGNP  1345
             YFYLA N+G LFSNT+LVYFED+GMW LGFW S  SA  AL+LFL  T RYRHF P GNP
Sbjct  202   YFYLAFNIGQLFSNTILVYFEDEGMWALGFWLSAGSAFAALVLFLACTSRYRHFKPSGNP  261

Query  1344  LSRFSQVLVASARKWNVHLPSDGDDHRLYEIQEHDSST---RKILHTEGFKFLDKAAVIT  1174
             LSRFSQVLVA++RK  + + S+G++  L  +   +SST   RKILHT GFKFLD+AA I+
Sbjct  262   LSRFSQVLVAASRKSKIQMSSNGEN--LLHMDAKESSTNANRKILHTHGFKFLDRAAFIS  319

Query  1173  TKESVRDLEERNINPWRLCSVTQVEEVKCILRLLPIWLCTILYSVVFTQMASLFVEQGAA  994
             +++ + D +E   NPWRLC V+QVEEVKCILRLLPIWLCTI+YSVVFTQMASLFVEQGAA
Sbjct  320   SRD-LDDQKETGYNPWRLCPVSQVEEVKCILRLLPIWLCTIIYSVVFTQMASLFVEQGAA  378

Query  993   MRTNIAGFHIPPASMSSFDILSVAAFIFIYRRILDPLIASLKKTRRAQGFTELQRMGVGL  814
             M+T ++ F IPPASMSSFDILSVA FIF YRR+LDP +  LKKT  ++G TELQRMGVGL
Sbjct  379   MKTTVSNFRIPPASMSSFDILSVAVFIFFYRRVLDPFVGKLKKT-DSKGLTELQRMGVGL  437

Query  813   iiaimamvaagiVEHFRLKYASTDCPRC--PSSLSIFWQVPQYVLIGASEVFMYVGQLEF  640
             +IA++AMV+AG+VE +RLKYA   C  C   S+LSIFWQ+PQY  IGASEVFMYVGQLEF
Sbjct  438   VIAVLAMVSAGLVECYRLKYAKQGCIHCNDTSTLSIFWQIPQYAFIGASEVFMYVGQLEF  497

Query  639   FNGQAPEGLKSFASALCMTSISLGNYVSSLLVSIVMRISTTHRMPGWIPGNLNKGHLDRF  460
             FN Q P+GLKSF SALCMTSISLGNYVSSLLVS+VM+IST   MPGWIPGNLNKGHLDRF
Sbjct  498   FNAQTPDGLKSFGSALCMTSISLGNYVSSLLVSMVMKISTEDHMPGWIPGNLNKGHLDRF  557

Query  459   YFLLAALTTADFVVYILCAKWYKYIEFEER  370
             YFLLAALT+ D + YI CAKWYK I+ E +
Sbjct  558   YFLLAALTSIDLIAYIACAKWYKCIQLEGK  587



>ref|XP_004301700.1| PREDICTED: nitrate transporter 1.5-like [Fragaria vesca subsp. 
vesca]
Length=747

 Score =   792 bits (2046),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 411/575 (71%), Positives = 488/575 (85%), Gaps = 12/575 (2%)
 Frame = -3

Query  2079  SREECTLDGTVDHYGRPALRSATGGWFAGVLLLVNQGLATLAFFGVGVNLVLFLTRVMGQ  1900
             S E CTLDG+VD +GRPA+R+ +G W AG+++LVNQGLATLAFFGVGVNLVLFLTRV+ Q
Sbjct  168   SFEICTLDGSVDMHGRPAIRAKSGRWVAGIIILVNQGLATLAFFGVGVNLVLFLTRVLQQ  227

Query  1899  DNADAANNVSKWTGTVYLFSLLGAFLSDSYWGRYKTCAIFQLIYVVGLISVSIFSFIFLV  1720
             +NA AAN+VSKWTGTVY+FSL+GAFLSDSYWGRYKTCAIFQ+I+V+GL S+S+ S +FL+
Sbjct  228   NNATAANSVSKWTGTVYIFSLVGAFLSDSYWGRYKTCAIFQIIFVIGLASLSLSSQLFLL  287

Query  1719  KPKGCGDENTPCRSPSRIHIAVYYVSIYLVALGNGGYQPNIATFGSDQFDGDHAHESVSK  1540
             +PKGCG +  PC +     IA++Y+SIYL+ALGNGGYQPNIATFG+DQFD +   E  SK
Sbjct  288   RPKGCGSQENPCGTHQGYQIALFYLSIYLIALGNGGYQPNIATFGADQFDEEDHREGHSK  347

Query  1539  VAFFSYFYLALNLGSLFSNTVLVYFEDKGMWTLGFWastvsavlalllflVGTPRYRHFA  1360
             VAFFSYFYLA+NLGSLFSNT+L YFED+G+W LGFWAST SA  AL+LFL+GTPRYRHF 
Sbjct  348   VAFFSYFYLAMNLGSLFSNTILGYFEDEGIWALGFWASTASAFAALVLFLIGTPRYRHFK  407

Query  1359  PKGNPLSRFSQVLVASARKWNVHLPSDGDDHRLYEIQEHDSSTRKILHTEGFKFLDKAAV  1180
             P GNPL+RF QVLVA+ +K  V++PS G++  LY  ++ +SS RKIL+T GFKFLD+AA 
Sbjct  408   PNGNPLARFCQVLVAAVKKGKVNMPSGGEE--LYTEEKKESSNRKILYTHGFKFLDRAAY  465

Query  1179  ITTKESVRDLEERN---INPWRLCSVTQVEEVKCILRLLPIWLCTILYSVVFTQMASLFV  1009
             I++    RDL+ +     +PWRLC +TQVEEVKCILRLLPIWLCTILYSVVFTQMASLFV
Sbjct  466   ISS----RDLDNQKQGLQDPWRLCPITQVEEVKCILRLLPIWLCTILYSVVFTQMASLFV  521

Query  1008  EQGAAMRTNIAGFHIPPASMSSFDILSVAAFIFIYRRILDPLIASLKKTRRAQGFTELQR  829
             EQGAAM+T ++ F IPPASMSSFDILSVA FIF YRRILDPL++ +KK+  ++G T+LQR
Sbjct  522   EQGAAMKTTVSNFRIPPASMSSFDILSVAVFIFFYRRILDPLVSRIKKS-DSKGLTQLQR  580

Query  828   MGVGLiiaimamvaagiVEHFRLKYASTDCPRC--PSSLSIFWQVPQYVLIGASEVFMYV  655
             MG+GL+IAI+AMV+AGIVE +RLKYA  +C  C   S+LSIFWQ+PQY  IGASEVFMYV
Sbjct  581   MGIGLVIAILAMVSAGIVECYRLKYAKKECTHCDGSSTLSIFWQIPQYAFIGASEVFMYV  640

Query  654   GQLEFFNGQAPEGLKSFASALCMTSISLGNYVSSLLVSIVMRISTTHRMPGWIPGNLNKG  475
             GQLEFFN QAP+GLKSF SALCMTSISLGNYVSSLLVS+VM+IST   MPGWIPGNLNKG
Sbjct  641   GQLEFFNAQAPDGLKSFGSALCMTSISLGNYVSSLLVSMVMKISTEDHMPGWIPGNLNKG  700

Query  474   HLDRFYFLLAALTTADFVVYILCAKWYKYIEFEER  370
             HLDRFYFLLAALT+ D +VYI CAKWYK I+ E R
Sbjct  701   HLDRFYFLLAALTSIDLIVYIACAKWYKCIKLEGR  735



>ref|XP_006415196.1| hypothetical protein EUTSA_v10007088mg [Eutrema salsugineum]
 gb|ESQ33549.1| hypothetical protein EUTSA_v10007088mg [Eutrema salsugineum]
Length=618

 Score =   787 bits (2032),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 403/572 (70%), Positives = 483/572 (84%), Gaps = 7/572 (1%)
 Frame = -3

Query  2064  TLDGTVDHYGRPALRSATGGWFAGVLLLVNQGLATLAFFGVGVNLVLFLTRVMGQDNADA  1885
             T DGTVD+YGR ++RS +G W AG+++L+NQGLATLAFFGVGVNLVLFLTRV+ Q+NADA
Sbjct  22    TRDGTVDYYGRASIRSNSGQWVAGIIILLNQGLATLAFFGVGVNLVLFLTRVLQQNNADA  81

Query  1884  ANNVSKWTGTVYLFSLLGAFLSDSYWGRYKTCAIFQLIYVVGLISVSIFSFIFLVKPKGC  1705
             ANNVSKWTGTVY+FSL+GAFLSDSYWGRYKTCAIFQ+I+V+GL S+S+ S++FL++P+GC
Sbjct  82    ANNVSKWTGTVYIFSLVGAFLSDSYWGRYKTCAIFQVIFVIGLSSLSLSSYMFLIRPRGC  141

Query  1704  GDENTPCRSPSRIHIAVYYVSIYLVALGNGGYQPNIATFGSDQFDGDHAHESVSKVAFFS  1525
             GDE TPC + S + I ++Y+SIYL+A GNGGYQPNIATFG+DQFD +H  E  SKVAFFS
Sbjct  142   GDEVTPCGTHSTMEITMFYLSIYLIAFGNGGYQPNIATFGADQFDEEHPKECYSKVAFFS  201

Query  1524  YFYLALNLGSLFSNTVLVYFEDKGMWTLGFWastvsavlalllflVGTPRYRHFAPKGNP  1345
             YFYLALNLGSLFSNT+L YFED+GMW LGFWAST SA+LAL+LFLVGTPRYR+F P GNP
Sbjct  202   YFYLALNLGSLFSNTILGYFEDEGMWALGFWASTGSAILALILFLVGTPRYRYFKPTGNP  261

Query  1344  LSRFSQVLVASARKWNVHLPSDGDDHRLYEIQEHDSST----RKILHTEGFKFLDKAAVI  1177
             LSRF QVLVA+ +K +V +PS G +    E +E  +++    R+I+HT+ FKFLD+AA I
Sbjct  262   LSRFCQVLVAATKKSSVEVPSRGREEMYDEDKEGKNASGNTGRRIVHTDEFKFLDRAAYI  321

Query  1176  TTKESVRDLEERNINPWRLCSVTQVEEVKCILRLLPIWLCTILYSVVFTQMASLFVEQGA  997
             T ++ + D ++  +NPWRLC VTQVEEVKCILRL+PIWLCTI+YSVVFTQMASLFVEQGA
Sbjct  322   TARD-LDDKKQGGVNPWRLCPVTQVEEVKCILRLMPIWLCTIIYSVVFTQMASLFVEQGA  380

Query  996   AMRTNIAGFHIPPASMSSFDILSVAAFIFIYRRILDPLIASLKKTRRAQGFTELQRMGVG  817
             AM+T ++ F IPPASMSSFDILSVA FIFIYRR+L+PL    KK    +G TEL RMG+G
Sbjct  381   AMKTTVSDFKIPPASMSSFDILSVALFIFIYRRVLEPLANRFKKKDGTKGITELHRMGIG  440

Query  816   LiiaimamvaagiVEHFRLKYASTDCPRC--PSSLSIFWQVPQYVLIGASEVFMYVGQLE  643
             L+IAI+AMVAAG+VE FRLK+A   C  C   SSLSIFWQVPQY LIGASEVFMYVGQLE
Sbjct  441   LVIAILAMVAAGVVECFRLKFADKSCTHCDGSSSLSIFWQVPQYSLIGASEVFMYVGQLE  500

Query  642   FFNGQAPEGLKSFASALCMTSISLGNYVSSLLVSIVMRISTTHRMPGWIPGNLNKGHLDR  463
             FFN Q P+GLKSF SALCM S+S+GN+VSSLLV++V++IST   MPGWIP NLNKGHLDR
Sbjct  501   FFNAQTPDGLKSFGSALCMMSMSMGNFVSSLLVTMVVKISTEDHMPGWIPRNLNKGHLDR  560

Query  462   FYFLLAALTTADFVVYILCAKWYKYIEFEERN  367
             FYFLLAALT+ D VVYI CA+WYK I+ E ++
Sbjct  561   FYFLLAALTSIDLVVYIACARWYKCIKLEGKD  592



>gb|KHN34858.1| Nitrate transporter 1.5 [Glycine soja]
Length=596

 Score =   786 bits (2029),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 397/569 (70%), Positives = 480/569 (84%), Gaps = 5/569 (1%)
 Frame = -3

Query  2064  TLDGTVDHYGRPALRSATGGWFAGVLLLVNQGLATLAFFGVGVNLVLFLTRVMGQDNADA  1885
             TLDG+VD +GRPA+R+ +G W A +++L+NQ LATLAFFG+GVNLVLFLTRV+GQ+NADA
Sbjct  22    TLDGSVDFHGRPAIRAKSGRWVAAIIILLNQALATLAFFGIGVNLVLFLTRVVGQNNADA  81

Query  1884  ANNVSKWTGTVYLFSLLGAFLSDSYWGRYKTCAIFQLIYVVGLISVSIFSFIFLVKPKGC  1705
             ANNVSKWTGTVY+FSL+GAFLSDSYWGRYKTCA+FQ+I+V+GL+S+S+ S++FL+KPKGC
Sbjct  82    ANNVSKWTGTVYIFSLVGAFLSDSYWGRYKTCAVFQVIFVIGLMSLSLSSYLFLLKPKGC  141

Query  1704  GDENTPCRSPSRIHIAVYYVSIYLVALGNGGYQPNIATFGSDQFDGDHAHESVSKVAFFS  1525
             G+E   C   S++ + ++Y+SIYLVALGNGGYQPNIATFG+DQFD +H+ E  +KVAFFS
Sbjct  142   GNETVSCGKHSKLEMGMFYLSIYLVALGNGGYQPNIATFGADQFDEEHSKEGHNKVAFFS  201

Query  1524  YFYLALNLGSLFSNTVLVYFEDKGMWTLGFWastvsavlalllflVGTPRYRHFAPKGNP  1345
             YFYLA N+G LFSNT+LVYFED+GMW LGFW S  SA  AL+LFL+ TPRYRHF P GNP
Sbjct  202   YFYLAFNIGQLFSNTILVYFEDEGMWALGFWLSAGSAFAALVLFLICTPRYRHFKPSGNP  261

Query  1344  LSRFSQVLVASARKWNVHLPSDGDDHRLYEIQE-HDSSTRKILHTEGFKFLDKAAVITTK  1168
             +SRFSQVLVA++RK  + + S+G+D    + +E  + + RKILHT GFKFLD+AA I+++
Sbjct  262   ISRFSQVLVAASRKSKLQMSSNGEDLFNMDAKEASNDANRKILHTHGFKFLDRAAFISSR  321

Query  1167  ESVRDLEERNINPWRLCSVTQVEEVKCILRLLPIWLCTILYSVVFTQMASLFVEQGAAMR  988
             + + D +    NPWRLC V+QVEEVKCILRLLPIWLCTI+YSVVFTQMASLFVEQGAAM+
Sbjct  322   D-LGDQKGLGYNPWRLCPVSQVEEVKCILRLLPIWLCTIIYSVVFTQMASLFVEQGAAMK  380

Query  987   TNIAGFHIPPASMSSFDILSVAAFIFIYRRILDPLIASLKKTRRAQGFTELQRMGVGLii  808
             T ++ F IPPASMSSFDILSVA FIF YRR+LDP +  LKKT  ++G TELQRMGVGL+I
Sbjct  381   TKVSNFRIPPASMSSFDILSVAVFIFFYRRVLDPFVGKLKKT-DSKGLTELQRMGVGLVI  439

Query  807   aimamvaagiVEHFRLKYASTDCPRC--PSSLSIFWQVPQYVLIGASEVFMYVGQLEFFN  634
             A++AMV+AG+VE +RLKYA   C  C   S+LSIFWQ+PQY  IGASEVFMYVGQLEFFN
Sbjct  440   AVLAMVSAGLVECYRLKYAKQGCLHCNDSSTLSIFWQIPQYAFIGASEVFMYVGQLEFFN  499

Query  633   GQAPEGLKSFASALCMTSISLGNYVSSLLVSIVMRISTTHRMPGWIPGNLNKGHLDRFYF  454
              Q P+GLKSF SALCMTSISLGNYVSSLLVS+VM+IST   MPGWIPG+LNKGHLDRFYF
Sbjct  500   AQTPDGLKSFGSALCMTSISLGNYVSSLLVSVVMKISTEDHMPGWIPGHLNKGHLDRFYF  559

Query  453   LLAALTTADFVVYILCAKWYKYIEFEERN  367
             LLAALT+ D + YI CAKWYK I+ E + 
Sbjct  560   LLAALTSIDLIAYIACAKWYKSIQLEAKT  588



>ref|XP_004150179.1| PREDICTED: nitrate transporter 1.5-like [Cucumis sativus]
Length=587

 Score =   784 bits (2025),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 412/584 (71%), Positives = 486/584 (83%), Gaps = 23/584 (4%)
 Frame = -3

Query  2106  KNERDEEKASREECTLDGTVDHYGRPALRSATGGWFAGVLLLVNQGLATLAFFGVGVNLV  1927
             +++  EE A+ E  TLDGTVD +GRPA+RS +G W AG+++L+NQGLATLAFFGVGVNLV
Sbjct  10    QSKLKEEIATAEGFTLDGTVDFHGRPAIRSKSGTWVAGIIILLNQGLATLAFFGVGVNLV  69

Query  1926  LFLTRVMGQDNADAANNVSKWTGTVYLFSLLGAFLSDSYWGRYKTCAIFQLIYVVGLISV  1747
             LFLTRV+ Q+NADAANNVSKWTGTVY+FSL+GA              IFQ+I+V+GL+S+
Sbjct  70    LFLTRVLQQNNADAANNVSKWTGTVYIFSLVGA--------------IFQIIFVIGLVSL  115

Query  1746  SIFSFIFLVKPKGCGDENTPCRSPSRIHIAVYYVSIYLVALGNGGYQPNIATFGSDQFDG  1567
             S+ S +FL++PKGCGDE TPC S S+  I+++Y+SIYL ALGNGGYQPNIATFG+DQFD 
Sbjct  116   SLSSHLFLIRPKGCGDEQTPCGSHSKTEISLFYLSIYLTALGNGGYQPNIATFGADQFDE  175

Query  1566  DHAHESVSKVAFFSYFYLALNLGSLFSNTVLVYFEDKGMWTLGFWastvsavlalllflV  1387
             ++  E  SKVAFFSYFYLALNLGSLFSNT+L +FED+GMW LGFW ST SA  ALLLFL+
Sbjct  176   EYQKEGHSKVAFFSYFYLALNLGSLFSNTILGFFEDEGMWALGFWVSTGSAAAALLLFLI  235

Query  1386  GTPRYRHFAPKGNPLSRFSQVLVASARKWNVHLPSDGDDHRLYEIQEHDSST---RKILH  1216
             GTPRYR+F P GNPL R SQV+V++A+KW + +PS G+   L++    +SS    RKILH
Sbjct  236   GTPRYRYFKPTGNPLMRVSQVVVSAAKKWRIKVPSGGEG--LFDDDGKESSNNGCRKILH  293

Query  1215  TEGFKFLDKAAVITTKESVRDLEERNINPWRLCSVTQVEEVKCILRLLPIWLCTILYSVV  1036
             T GFKFLDKAA I++++ + D E+   NPWRLC +TQVEEVKCILRLLPIWLCTI+YSVV
Sbjct  294   THGFKFLDKAAYISSRD-LSDKEQGVNNPWRLCPITQVEEVKCILRLLPIWLCTIIYSVV  352

Query  1035  FTQMASLFVEQGAAMRTNIAGFHIPPASMSSFDILSVAAFIFIYRRILDPLIASLKKTRR  856
             FTQMASLFVEQGAAM+T ++ FHIPPASMSSFDILSVA FIF+YRR+LDP +  LKK+  
Sbjct  353   FTQMASLFVEQGAAMKTTVSNFHIPPASMSSFDILSVALFIFLYRRVLDPFVGKLKKS-S  411

Query  855   AQGFTELQRMGVGLiiaimamvaagiVEHFRLKYASTDCPRCP--SSLSIFWQVPQYVLI  682
             + G TELQRMGVGLIIA+MAMV+AGIVE +RLKYA  DC  C   SSLSIFWQVPQY LI
Sbjct  412   STGLTELQRMGVGLIIAVMAMVSAGIVECYRLKYAQADCTHCEGSSSLSIFWQVPQYALI  471

Query  681   GASEVFMYVGQLEFFNGQAPEGLKSFASALCMTSISLGNYVSSLLVSIVMRISTTHRMPG  502
             GASEVFMYVGQLEFFN QAP+GLKSF SALCMTSISLGNYVSSLLV++VM+IST  RMPG
Sbjct  472   GASEVFMYVGQLEFFNAQAPDGLKSFGSALCMTSISLGNYVSSLLVTMVMKISTVDRMPG  531

Query  501   WIPGNLNKGHLDRFYFLLAALTTADFVVYILCAKWYKYIEFEER  370
             WIPGNLNKGHLDRFYFLLAALT  DFV+YI+CAKWYK I+ EE+
Sbjct  532   WIPGNLNKGHLDRFYFLLAALTVVDFVIYIVCAKWYKSIKLEEK  575



>ref|XP_009137205.1| PREDICTED: protein NRT1/ PTR FAMILY 7.2 [Brassica rapa]
Length=583

 Score =   783 bits (2023),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 398/574 (69%), Positives = 465/574 (81%), Gaps = 5/574 (1%)
 Frame = -3

Query  2094  DEEKASREECTLDGTVDHYGRPALRSATGGWFAGVLLLVNQGLATLAFFGVGVNLVLFLT  1915
             D++    E CT DG+VD +G PA+R+ TG W   +L+LVNQGLATLAFFGVGVNLVLFLT
Sbjct  2     DQKVRHTEVCTQDGSVDRHGNPAIRAKTGKWLTAILILVNQGLATLAFFGVGVNLVLFLT  61

Query  1914  RVMGQDNADAANNVSKWTGTVYLFSLLGAFLSDSYWGRYKTCAIFQLIYVVGLISVSIFS  1735
             RVMGQDNA+AANNVS+WTGT Y+FSLLGAFLSDSYWGRYKTCAIFQ  +V GL+ +S+ +
Sbjct  62    RVMGQDNAEAANNVSRWTGTAYIFSLLGAFLSDSYWGRYKTCAIFQASFVAGLVMLSLST  121

Query  1734  FIFLVKPKGCGDENTPCRSPSRIHIAVYYVSIYLVALGNGGYQPNIATFGSDQFDGDHAH  1555
                L++P GCG E +PC+  S +   ++Y+S+YL+ALG GGYQPNIATFGSDQFD D + 
Sbjct  122   GALLLEPSGCGVEESPCKPHSTVKTVIFYLSVYLIALGYGGYQPNIATFGSDQFDADDSV  181

Query  1554  ESVSKVAFFSYFYLALNLGSLFSNTVLVYFEDKGMWTLGFWastvsavlalllflVGTPR  1375
             E  SK+AFFSYFYLALNLGSL SNTVL YFED+G W LGFWAS  SA   L+LFL GTP+
Sbjct  182   EGHSKIAFFSYFYLALNLGSLLSNTVLGYFEDQGAWPLGFWASAGSAFAGLVLFLAGTPK  241

Query  1374  YRHFAPKGNPLSRFSQVLVASARKWNVHLPSDGDDHRLYEIQEHDSSTRKILHTEGFKFL  1195
             YRHF P+ +P SRF QVLVAS RK  + +  + DD  LY+ +   +  +KILHT+GF+FL
Sbjct  242   YRHFKPRESPWSRFCQVLVASTRKAKIDV--NYDDMNLYDSETQRTGDKKILHTKGFRFL  299

Query  1194  DKAAVITTKESVRDLEERNI-NPWRLCSVTQVEEVKCILRLLPIWLCTILYSVVFTQMAS  1018
             D+AA++T  +    +E  +  +PWRLCSVTQVEEVKC+LRLLPIWLCTILYSVVFTQMAS
Sbjct  300   DRAAIVTPDDEAEKVESGSAYDPWRLCSVTQVEEVKCVLRLLPIWLCTILYSVVFTQMAS  359

Query  1017  LFVEQGAAMRTNIAGFHIPPASMSSFDILSVAAFIFIYRRILDPLIASLKKTRRAQGFTE  838
             LFV QGAAM+TNI  F IP +SMS+FDILSVA FIF YRR LDPL A L KT   +G TE
Sbjct  360   LFVVQGAAMKTNIKDFRIPASSMSTFDILSVAFFIFAYRRFLDPLFARLNKTEPNKGLTE  419

Query  837   LQRMGVGLiiaimamvaagiVEHFRLKYASTDCPRCPSSLSIFWQVPQYVLIGASEVFMY  658
             LQRMG+GL+IAI AM++AGIVE +RLK+  T      SSLSIFWQVPQY++IGASEVFMY
Sbjct  420   LQRMGIGLVIAITAMISAGIVEIYRLKHKET--ASNSSSLSIFWQVPQYMMIGASEVFMY  477

Query  657   VGQLEFFNGQAPEGLKSFASALCMTSISLGNYVSSLLVSIVMRISTTHRMPGWIPGNLNK  478
             VGQLEFFN QAP GLKSFASALCM SISLGNYVSSLLVSIVM+IST   +PGWIPGNLNK
Sbjct  478   VGQLEFFNSQAPTGLKSFASALCMASISLGNYVSSLLVSIVMKISTRDDLPGWIPGNLNK  537

Query  477   GHLDRFYFLLAALTTADFVVYILCAKWYKYIEFE  376
             GHLDRFYFLLAALT ADFVVY++CAKWYKYI+ E
Sbjct  538   GHLDRFYFLLAALTAADFVVYLVCAKWYKYIKSE  571



>emb|CDX94047.1| BnaC07g36810D [Brassica napus]
Length=583

 Score =   781 bits (2017),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 397/574 (69%), Positives = 464/574 (81%), Gaps = 5/574 (1%)
 Frame = -3

Query  2094  DEEKASREECTLDGTVDHYGRPALRSATGGWFAGVLLLVNQGLATLAFFGVGVNLVLFLT  1915
             D++    E CT DG+VD +G PA+R+ TG W   +L+LVNQGLATLAFFGVGVNLVLFLT
Sbjct  2     DQKVRHTEVCTQDGSVDRHGNPAIRAKTGKWLTAILILVNQGLATLAFFGVGVNLVLFLT  61

Query  1914  RVMGQDNADAANNVSKWTGTVYLFSLLGAFLSDSYWGRYKTCAIFQLIYVVGLISVSIFS  1735
             RVMGQDNA+AANNVSKWTGTVY+FSLLGAFLSDSYWGRYKTCAIFQ  +V GL+ +S+ +
Sbjct  62    RVMGQDNAEAANNVSKWTGTVYIFSLLGAFLSDSYWGRYKTCAIFQASFVAGLVMLSLST  121

Query  1734  FIFLVKPKGCGDENTPCRSPSRIHIAVYYVSIYLVALGNGGYQPNIATFGSDQFDGDHAH  1555
                L++P GCG E +PCR  S +   ++Y+S+YL+ALG GGYQPNIATFG+DQFD D + 
Sbjct  122   GALLLEPSGCGVEESPCRPHSTVKTVIFYLSVYLIALGYGGYQPNIATFGADQFDADDSV  181

Query  1554  ESVSKVAFFSYFYLALNLGSLFSNTVLVYFEDKGMWTLGFWastvsavlalllflVGTPR  1375
             E  SK+AFFSYFYLALNLGSL SNTVL YFED+G W LGFWAS  SA   L+LFL GTP+
Sbjct  182   EGHSKIAFFSYFYLALNLGSLLSNTVLGYFEDQGAWPLGFWASAGSAFAGLVLFLTGTPK  241

Query  1374  YRHFAPKGNPLSRFSQVLVASARKWNVHLPSDGDDHRLYEIQEHDSSTRKILHTEGFKFL  1195
             YRHF P+ +P SRF QVLVAS RK  + +  + DD  LY+ +   +  +KILHT+GF+FL
Sbjct  242   YRHFKPRKSPWSRFCQVLVASTRKAKIDV--NYDDMNLYDSETQRTGDKKILHTKGFRFL  299

Query  1194  DKAAVITTKESVRDLEERNI-NPWRLCSVTQVEEVKCILRLLPIWLCTILYSVVFTQMAS  1018
             D+AA++T  +    +E  +  +PWRLCSVTQVEEVKC+LRLLPIWLCTILYSVVFTQMAS
Sbjct  300   DRAAIVTPDDEAEKVESGSTYDPWRLCSVTQVEEVKCVLRLLPIWLCTILYSVVFTQMAS  359

Query  1017  LFVEQGAAMRTNIAGFHIPPASMSSFDILSVAAFIFIYRRILDPLIASLKKTRRAQGFTE  838
             LFV QGAAM+TNI  F IP +SMS+FDILSVA FIF YRR LDPL A L K    +G TE
Sbjct  360   LFVVQGAAMKTNIKDFRIPASSMSTFDILSVAFFIFAYRRFLDPLFARLNKREPNKGLTE  419

Query  837   LQRMGVGLiiaimamvaagiVEHFRLKYASTDCPRCPSSLSIFWQVPQYVLIGASEVFMY  658
             LQRMG+GL+IAI AM++AGIVE +RLK+  T      SSLSIFWQVPQY++IGASEVFMY
Sbjct  420   LQRMGIGLVIAITAMISAGIVEIYRLKHKET--ASNSSSLSIFWQVPQYMMIGASEVFMY  477

Query  657   VGQLEFFNGQAPEGLKSFASALCMTSISLGNYVSSLLVSIVMRISTTHRMPGWIPGNLNK  478
             VGQLEFFN QAP GLKSFASALCM SISLGNYVSSLLVSIVM+IST   +PGWIPGNLNK
Sbjct  478   VGQLEFFNSQAPTGLKSFASALCMASISLGNYVSSLLVSIVMKISTRDDLPGWIPGNLNK  537

Query  477   GHLDRFYFLLAALTTADFVVYILCAKWYKYIEFE  376
             GHLDRFYFLLA LT ADF+VY++CAKWYKYI+ E
Sbjct  538   GHLDRFYFLLAGLTAADFLVYLVCAKWYKYIKSE  571



>ref|NP_174523.2| nitrate transporter 1.5 [Arabidopsis thaliana]
 sp|Q9LQL2.2|PTR14_ARATH RecName: Full=Protein NRT1/ PTR FAMILY 7.3; Short=AtNPF7.3; AltName: 
Full=Nitrate transporter 1.5 [Arabidopsis thaliana]
 gb|AEE31488.1| nitrate transporter 1.5 [Arabidopsis thaliana]
Length=614

 Score =   782 bits (2019),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 405/606 (67%), Positives = 496/606 (82%), Gaps = 13/606 (2%)
 Frame = -3

Query  2109  IKNERDEEKASREECTLDGTVDHYGRPALRSATGGWFAGVLLLVNQGLATLAFFGVGVNL  1930
             I N+   +K   EE T DGTVD+YGRP++RS +G W AG+++L+NQGLATLAFFGVGVNL
Sbjct  6     IYNKDTMKKKEGEEETRDGTVDYYGRPSIRSNSGQWVAGIVILLNQGLATLAFFGVGVNL  65

Query  1929  VLFLTRVMGQDNADAANNVSKWTGTVYLFSLLGAFLSDSYWGRYKTCAIFQLIYVVGLIS  1750
             VLFLTRV+ Q+NADAANNVSKWTGTVY+FSL+GAFLSDSYWGRYKTCAIFQ+I+V+GL S
Sbjct  66    VLFLTRVLQQNNADAANNVSKWTGTVYIFSLVGAFLSDSYWGRYKTCAIFQVIFVIGLSS  125

Query  1749  VSIFSFIFLVKPKGCGDENTPCRSPSRIHIAVYYVSIYLVALGNGGYQPNIATFGSDQFD  1570
             +S+ S++FL++P+GCGDE TPC S S + I ++Y SIYL+ALG GGYQPNIAT G+DQFD
Sbjct  126   LSLSSYMFLIRPRGCGDEVTPCGSHSMMEITMFYFSIYLIALGYGGYQPNIATLGADQFD  185

Query  1569  GDHAHESVSKVAFFSYFYLALNLGSLFSNTVLVYFEDKGMWTLGFWastvsavlalllfl  1390
              +H  E  SK+AFFSYFYLALNLGSLFSNT+L YFED+GMW LGFWAST SA++ L+LFL
Sbjct  186   EEHPKEGYSKIAFFSYFYLALNLGSLFSNTILGYFEDEGMWALGFWASTGSAIIGLILFL  245

Query  1389  VGTPRYRHFAPKGNPLSRFSQVLVASARKWNVHLPSDGDDHRLYEIQEHDSST----RKI  1222
             VGTPRYR+F P GNPLSRF QVLVA+ +K +V  P  G +       E  +++    R+I
Sbjct  246   VGTPRYRYFKPTGNPLSRFCQVLVAATKKSSVEAPLRGREEMYDGDSEGKNASVNTGRRI  305

Query  1221  LHTEGFKFLDKAAVITTKESVRDLEERNINPWRLCSVTQVEEVKCILRLLPIWLCTILYS  1042
             +HT+ FKFLDKAA IT ++ + D ++ ++NPWRLC VTQVEEVKCILRL+PIWLCTI+YS
Sbjct  306   VHTDEFKFLDKAAYITARD-LDDKKQDSVNPWRLCPVTQVEEVKCILRLMPIWLCTIIYS  364

Query  1041  VVFTQMASLFVEQGAAMRTNIAGFHIPPASMSSFDILSVAAFIFIYRRILDPLIASLKKT  862
             VVFTQMASLFVEQGAAM T+++ F IPPASMSSFDILSVA FIF+YRR+L+P+    KK 
Sbjct  365   VVFTQMASLFVEQGAAMNTSVSDFKIPPASMSSFDILSVALFIFLYRRVLEPVANRFKKN  424

Query  861   RRAQGFTELQRMGVGLiiaimamvaagiVEHFRLKYASTDCPRC--PSSLSIFWQVPQYV  688
               ++G TEL RMG+GL+IA++AM+AAGIVE +RLKYA   C  C   SSLSIFWQ PQY 
Sbjct  425   -GSKGITELHRMGIGLVIAVIAMIAAGIVECYRLKYADKSCTHCDGSSSLSIFWQAPQYS  483

Query  687   LIGASEVFMYVGQLEFFNGQAPEGLKSFASALCMTSISLGNYVSSLLVSIVMRISTTHRM  508
             LIGASEVFMYVGQLEFFN Q P+GLKSF SALCM S+S+GN+VSSLLV++V++IST   M
Sbjct  484   LIGASEVFMYVGQLEFFNAQTPDGLKSFGSALCMMSMSMGNFVSSLLVTMVVKISTEDHM  543

Query  507   PGWIPGNLNKGHLDRFYFLLAALTTADFVVYILCAKWYKYIEFEERNSCLKNIG----DS  340
             PGWIP NLNKGHLDRFYFLLAALT+ D VVYI CAKWYK I+ E ++  ++++     D+
Sbjct  544   PGWIPRNLNKGHLDRFYFLLAALTSIDLVVYIACAKWYKPIQLEGKDE-MQDMSDDDYDT  602

Query  339   KLQEDR  322
             + +E+R
Sbjct  603   ESEEER  608



>ref|XP_010518871.1| PREDICTED: protein NRT1/ PTR FAMILY 7.3-like [Tarenaya hassleriana]
Length=620

 Score =   781 bits (2018),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 401/573 (70%), Positives = 480/573 (84%), Gaps = 8/573 (1%)
 Frame = -3

Query  2064  TLDGTVDHYGRPALRSATGGWFAGVLLLVNQGLATLAFFGVGVNLVLFLTRVMGQDNADA  1885
             T DGTVD  GRPALRS +G W AG ++L+NQGLATLAFFGVGVNLVLFLTRV+ Q+NADA
Sbjct  24    TRDGTVDWDGRPALRSKSGQWVAGSVILLNQGLATLAFFGVGVNLVLFLTRVLQQNNADA  83

Query  1884  ANNVSKWTGTVYLFSLLGAFLSDSYWGRYKTCAIFQLIYVVGLISVSIFSFIFLVKPKGC  1705
             ANNVSKWTGTVY+FSL+GAFLSDSYWGR+KTCAIFQ+I+VVGL+S+S+ S++FL++PKGC
Sbjct  84    ANNVSKWTGTVYIFSLVGAFLSDSYWGRFKTCAIFQVIFVVGLMSLSLSSYLFLIRPKGC  143

Query  1704  GDENTPCRSPSRIHIAVYYVSIYLVALGNGGYQPNIATFGSDQFDGDHAHESVSKVAFFS  1525
             GDE TPC S + + I+++Y SIYLVALGNGGYQPNIATFG+DQFD ++  E  SK+AFFS
Sbjct  144   GDELTPCGSHTTMEISLFYFSIYLVALGNGGYQPNIATFGADQFDEENPKEGYSKIAFFS  203

Query  1524  YFYLALNLGSLFSNTVLVYFEDKGMWTLGFWastvsavlalllflVGTPRYRHFAPKGNP  1345
             YFYLALNLGSLFSNT+L YFED+G+W LGFWAST SA++AL+LF++GTPRYRHF P GNP
Sbjct  204   YFYLALNLGSLFSNTILGYFEDEGLWALGFWASTGSALVALILFMMGTPRYRHFKPSGNP  263

Query  1344  LSRFSQVLVASARKWNVHLPSDGDDHRLYEIQEHDSST----RKILHTEGFKFLDKAAVI  1177
             LSRF QVL+A+ +KW V + S      LY+    D  T    R+I+HT+ FKFLDKAA I
Sbjct  264   LSRFCQVLIAAVKKWTVEIDSGHGREDLYDGNRDDKKTSNGARRIMHTDEFKFLDKAAYI  323

Query  1176  TTKESVRDLEERNINPWRLCSVTQVEEVKCILRLLPIWLCTILYSVVFTQMASLFVEQGA  997
             T K+ + D ++  ++PWRLC V QVEEVKCILRL+PIWLCTI+YSVVFTQMASLFVEQGA
Sbjct  324   TAKD-LEDQKQGRVDPWRLCPVNQVEEVKCILRLMPIWLCTIIYSVVFTQMASLFVEQGA  382

Query  996   AMRTNIA-GFHIPPASMSSFDILSVAAFIFIYRRILDPLIASLKKTRRAQGFTELQRMGV  820
             AM+T +   F +PPASMSSFDILSVA FIF+YRR+LDPL +  +K   ++G TELQRMG+
Sbjct  383   AMKTTVGNNFKVPPASMSSFDILSVAVFIFLYRRVLDPLASRFRKKDGSRGLTELQRMGI  442

Query  819   GLiiaimamvaagiVEHFRLKYASTDCPRC--PSSLSIFWQVPQYVLIGASEVFMYVGQL  646
             GL+IA++AM++AGIVE +RLKYA   C  C   SSLSIFWQVPQY LIGASEVFMYVGQL
Sbjct  443   GLVIAVVAMLSAGIVECYRLKYADKACTHCDGSSSLSIFWQVPQYALIGASEVFMYVGQL  502

Query  645   EFFNGQAPEGLKSFASALCMTSISLGNYVSSLLVSIVMRISTTHRMPGWIPGNLNKGHLD  466
             EFFN QAP+GLKSF SALCM S+S+GN+VSSLLV++VM+IST   MPGWIP NLNKGHLD
Sbjct  503   EFFNAQAPDGLKSFGSALCMMSMSMGNFVSSLLVTMVMKISTEDHMPGWIPRNLNKGHLD  562

Query  465   RFYFLLAALTTADFVVYILCAKWYKYIEFEERN  367
             RFYFLLA LT+ D VVY+ CAKWYK I+ E ++
Sbjct  563   RFYFLLAVLTSVDLVVYVACAKWYKCIKLEGKD  595



>ref|XP_006847685.1| hypothetical protein AMTR_s00149p00049280 [Amborella trichopoda]
 gb|ERN09266.1| hypothetical protein AMTR_s00149p00049280 [Amborella trichopoda]
Length=607

 Score =   781 bits (2016),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 406/589 (69%), Positives = 478/589 (81%), Gaps = 16/589 (3%)
 Frame = -3

Query  2106  KNERDEEKASREECTLDGTVDHYGRPALRSATGGWFAGVLLLVNQGLATLAFFGVGVNLV  1927
             K ER+ E  +R     DG+VD +GRPA+++ TGGW A +L+LVNQGLATLAFFGVGVNLV
Sbjct  26    KKERESEMYTR-----DGSVDRHGRPAIKATTGGWNAAILILVNQGLATLAFFGVGVNLV  80

Query  1926  LFLTRVMGQDNADAANNVSKWTGTVYLFSLLGAFLSDSYWGRYKTCAIFQLIYVVGLISV  1747
             LFLTRV+ Q NA+AANNVSKWTGTVY+FSL+GAFLSDSYWGRYKTCA+FQLI+V+GL+ +
Sbjct  81    LFLTRVLKQSNAEAANNVSKWTGTVYIFSLVGAFLSDSYWGRYKTCAVFQLIFVLGLVML  140

Query  1746  SIFSFIFLVKPKGCGDENTPCRSPSRIHIAVYYVSIYLVALGNGGYQPNIATFGSDQFDG  1567
             SI S++FL+ P GCG   +PC++PS I I V+Y+SIYL+ALGNGGYQP+IATFG+DQFD 
Sbjct  141   SIISYLFLLHPSGCGHVGSPCKTPSSIIIGVFYLSIYLIALGNGGYQPSIATFGADQFDE  200

Query  1566  DHAHESVSKVAFFSYFYLALNLGSLFSNTVLVYFEDKGMWTLGFWastvsavlalllflV  1387
             +   E  +KVAFFSYFYLALNLGSLFSNT+L YFED+G W LGFW S+ SA +AL+LF+ 
Sbjct  201   EDPQEGHAKVAFFSYFYLALNLGSLFSNTILGYFEDEGKWALGFWMSSGSAFIALVLFIG  260

Query  1386  GTPRYRHFAPKGNPLSRFSQVLVASARKWNVHLPSDGDDHRLYEIQEHDSS---TRKILH  1216
             GTP YRHFAP GNPLSRFSQV++AS +KW V  PS   D  L+E+   +S+   +RKILH
Sbjct  261   GTPWYRHFAPGGNPLSRFSQVMIASFKKWRVEAPS--RDSELFEVNGKESTISGSRKILH  318

Query  1215  TEGFKFLDKAAVITTKESVRDLEERNINPWRLCSVTQVEEVKCILRLLPIWLCTILYSVV  1036
             T  FKFLDKAA +T K+   D   R  +PW LC+VTQVEEVKCILRLLPIWLCTI+YSVV
Sbjct  319   THEFKFLDKAATVTKKDFTEDRSTR--DPWFLCTVTQVEEVKCILRLLPIWLCTIIYSVV  376

Query  1035  FTQMASLFVEQGAAMRTNIAGFHIPPASMSSFDILSVAAFIFIYRRILDPLIASLKKTRR  856
             FTQMASLFVEQGAAM+T+I GFHIPPASMS FDILSVAAFI  YRR L P +   K  + 
Sbjct  377   FTQMASLFVEQGAAMKTDIIGFHIPPASMSMFDILSVAAFILFYRRFLIPCLH--KIIKN  434

Query  855   AQGFTELQRMGVGLiiaimamvaagiVEHFRLKYASTDCPRCPSSLSIFWQVPQYVLIGA  676
             ++G TELQRMGVGLIIAI+AM++AG VE  RLKYA T+  + PSSLSI WQ+PQYVLIGA
Sbjct  435   SKGITELQRMGVGLIIAIIAMISAGTVEVMRLKYA-TEVDK-PSSLSILWQIPQYVLIGA  492

Query  675   SEVFMYVGQLEFFNGQAPEGLKSFASALCMTSISLGNYVSSLLVSIVMRISTTHRMPGWI  496
             SEVFMYVGQLEFFNGQ P+GLKSF SALCMTSIS GNYVSSLLVSIVM I+      GWI
Sbjct  493   SEVFMYVGQLEFFNGQTPDGLKSFGSALCMTSISFGNYVSSLLVSIVMDITRKDHEAGWI  552

Query  495   PGNLNKGHLDRFYFLLAALTTADFVVYILCAKWYKYIEFEERNSCLKNI  349
             PGNLNKGH+DRFYFLLA LT  DFV+Y++CAK Y+ I  E R+   ++I
Sbjct  553   PGNLNKGHMDRFYFLLAILTAVDFVLYVICAKGYRPISLEIRDEDEEDI  601



>ref|XP_010478666.1| PREDICTED: protein NRT1/ PTR FAMILY 7.3-like [Camelina sativa]
Length=615

 Score =   781 bits (2016),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 405/588 (69%), Positives = 484/588 (82%), Gaps = 10/588 (2%)
 Frame = -3

Query  2109  IKNERDEEKASREECTLDGTVDHYGRPALRSATGGWFAGVLLLVNQGLATLAFFGVGVNL  1930
             I N+   +K   +E T DGTVD YGRP++RS +G W A +++L+NQGLATLAFFGVGVNL
Sbjct  6     IYNKDTMKKKEGDEETRDGTVDFYGRPSIRSNSGQWVAAIVILLNQGLATLAFFGVGVNL  65

Query  1929  VLFLTRVMGQDNADAANNVSKWTGTVYLFSLLGAFLSDSYWGRYKTCAIFQLIYVVGLIS  1750
             VLFLTRV+ Q+NADAANNVSKWTGTVY+FSL+GAFLSDSYWGRYKTCAIFQ+I+V+GL S
Sbjct  66    VLFLTRVLQQNNADAANNVSKWTGTVYIFSLVGAFLSDSYWGRYKTCAIFQVIFVIGLSS  125

Query  1749  VSIFSFIFLVKPKGCGDENTPCRSPSRIHIAVYYVSIYLVALGNGGYQPNIATFGSDQFD  1570
             +S+ S++FL++P GCGDE TPC S S + I ++Y SIYL+ALG GGYQPNIAT G+DQFD
Sbjct  126   LSLSSYMFLIRPIGCGDEVTPCGSHSMMEITMFYFSIYLIALGYGGYQPNIATLGADQFD  185

Query  1569  GDHAHESVSKVAFFSYFYLALNLGSLFSNTVLVYFEDKGMWTLGFWastvsavlalllfl  1390
              +H  E  SK+AFFSYFYLALNLGSLFSNT+L YFED+GMW LGFWAST SAV+AL+LFL
Sbjct  186   EEHPKEGYSKIAFFSYFYLALNLGSLFSNTILGYFEDEGMWALGFWASTGSAVIALILFL  245

Query  1389  VGTPRYRHFAPKGNPLSRFSQVLVASARKWNVHLPSDGDDHRLYEIQEH-----DSSTRK  1225
             VGTPRYR+F P GNPLSRF QVLVA+ +K +V  P  G +  +Y+         +++ R+
Sbjct  246   VGTPRYRYFKPTGNPLSRFCQVLVAATKKSSVEAPLRGREE-MYDGDSQGKNASENTGRR  304

Query  1224  ILHTEGFKFLDKAAVITTKESVRDLEERNINPWRLCSVTQVEEVKCILRLLPIWLCTILY  1045
             I+HT+ FKFLDKAA IT ++ + D ++  +NPWRLC VTQVEEVKCILRL+PIWLCTI+Y
Sbjct  305   IMHTDEFKFLDKAAYITARD-LDDKKQDAVNPWRLCPVTQVEEVKCILRLMPIWLCTIIY  363

Query  1044  SVVFTQMASLFVEQGAAMRTNIAGFHIPPASMSSFDILSVAAFIFIYRRILDPLIASLKK  865
             SVVFTQMASLFVEQGAAM TNI+ F IPPASMSSFDILSVA FIF+YRR+L+P+    KK
Sbjct  364   SVVFTQMASLFVEQGAAMNTNISDFKIPPASMSSFDILSVALFIFLYRRVLEPVANRFKK  423

Query  864   TRRAQGFTELQRMGVGLiiaimamvaagiVEHFRLKYASTDCPRC--PSSLSIFWQVPQY  691
                ++G TEL RMG+GL+IA++AMVAAG+VE +RLKYA   C  C   SSLSIFWQ PQY
Sbjct  424   N-GSKGITELHRMGIGLVIAVIAMVAAGVVECYRLKYADKSCTHCDGSSSLSIFWQAPQY  482

Query  690   VLIGASEVFMYVGQLEFFNGQAPEGLKSFASALCMTSISLGNYVSSLLVSIVMRISTTHR  511
              LIGASEVFMYVGQLEFFN Q P+GLKSF SALCM S+S+GN+VSSLLV++V++IST   
Sbjct  483   SLIGASEVFMYVGQLEFFNAQTPDGLKSFGSALCMMSMSMGNFVSSLLVTMVVKISTEDH  542

Query  510   MPGWIPGNLNKGHLDRFYFLLAALTTADFVVYILCAKWYKYIEFEERN  367
             MPGWIP NLNKGHLDRFYFLLAALT+ D VVYI CAKWYK I+ E +N
Sbjct  543   MPGWIPRNLNKGHLDRFYFLLAALTSIDLVVYIACAKWYKSIQLEGKN  590



>emb|CDX98697.1| BnaA03g44820D [Brassica napus]
Length=583

 Score =   779 bits (2011),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 395/574 (69%), Positives = 464/574 (81%), Gaps = 5/574 (1%)
 Frame = -3

Query  2094  DEEKASREECTLDGTVDHYGRPALRSATGGWFAGVLLLVNQGLATLAFFGVGVNLVLFLT  1915
             D++    E CT DG+VD +G PA+R+ TG W   +L+LVNQGLATLAFFGVGVNLVLFLT
Sbjct  2     DQKVRHTEVCTQDGSVDRHGNPAIRAKTGKWLTAILILVNQGLATLAFFGVGVNLVLFLT  61

Query  1914  RVMGQDNADAANNVSKWTGTVYLFSLLGAFLSDSYWGRYKTCAIFQLIYVVGLISVSIFS  1735
             RVMGQDNA+AANNVSKWTGTVY+FSLLGAFLSDSYWGRYKTCAIFQ  +V GL+ +S+ +
Sbjct  62    RVMGQDNAEAANNVSKWTGTVYIFSLLGAFLSDSYWGRYKTCAIFQASFVAGLVMLSLST  121

Query  1734  FIFLVKPKGCGDENTPCRSPSRIHIAVYYVSIYLVALGNGGYQPNIATFGSDQFDGDHAH  1555
                L++P GCG E +PC+  S +   ++Y+S+YL+ALG GGYQPNIATFG+DQFD D + 
Sbjct  122   GALLLEPSGCGVEESPCKPHSTVKTVIFYLSVYLIALGYGGYQPNIATFGADQFDADDSA  181

Query  1554  ESVSKVAFFSYFYLALNLGSLFSNTVLVYFEDKGMWTLGFWastvsavlalllflVGTPR  1375
             E  SK+AFFSYFYLALNLGSL SNTVL YFED+G W LGFWAS  SA   L+LFL GTP+
Sbjct  182   EGHSKIAFFSYFYLALNLGSLLSNTVLGYFEDQGAWPLGFWASAGSAFAGLVLFLAGTPK  241

Query  1374  YRHFAPKGNPLSRFSQVLVASARKWNVHLPSDGDDHRLYEIQEHDSSTRKILHTEGFKFL  1195
             YRHF P+ +P SRF QVLVAS RK  + +  + +D  LY+ +   +  +KILHT+GF+FL
Sbjct  242   YRHFKPRESPWSRFCQVLVASTRKAKIDV--NYEDMNLYDSETQRTGDKKILHTKGFRFL  299

Query  1194  DKAAVITTKESVRDLEERNI-NPWRLCSVTQVEEVKCILRLLPIWLCTILYSVVFTQMAS  1018
             D+AA++T  +    +E  +  +PWRLCSVTQVEEVKC+LRLLPIWLCTILYSVVFTQMAS
Sbjct  300   DRAAIVTPDDEAEKVESGSTYDPWRLCSVTQVEEVKCVLRLLPIWLCTILYSVVFTQMAS  359

Query  1017  LFVEQGAAMRTNIAGFHIPPASMSSFDILSVAAFIFIYRRILDPLIASLKKTRRAQGFTE  838
             LFV QGAAM+TNI  F IP +SMS+FDILSVA FIF YRR LDPL A L K    +G TE
Sbjct  360   LFVVQGAAMKTNIKDFRIPASSMSTFDILSVAFFIFAYRRFLDPLFARLNKREPNKGLTE  419

Query  837   LQRMGVGLiiaimamvaagiVEHFRLKYASTDCPRCPSSLSIFWQVPQYVLIGASEVFMY  658
             LQRMG+GL+IAI AM++AGIVE +RLK+  T      SSLSIFWQVPQY++IGASEVFMY
Sbjct  420   LQRMGIGLVIAITAMISAGIVEIYRLKHKET--ASNSSSLSIFWQVPQYMMIGASEVFMY  477

Query  657   VGQLEFFNGQAPEGLKSFASALCMTSISLGNYVSSLLVSIVMRISTTHRMPGWIPGNLNK  478
             VGQLEFFN QAP GLKSFASALCM SISLGNYVSSLLVSIVM+IST   +PGWIPGNLNK
Sbjct  478   VGQLEFFNSQAPTGLKSFASALCMASISLGNYVSSLLVSIVMKISTRDDLPGWIPGNLNK  537

Query  477   GHLDRFYFLLAALTTADFVVYILCAKWYKYIEFE  376
             GHLDRFYFLLA LT ADF+VY++CAKWYKYI+ E
Sbjct  538   GHLDRFYFLLAGLTAADFLVYLVCAKWYKYIKSE  571



>ref|XP_010461068.1| PREDICTED: protein NRT1/ PTR FAMILY 7.3 [Camelina sativa]
Length=615

 Score =   780 bits (2014),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 406/588 (69%), Positives = 484/588 (82%), Gaps = 10/588 (2%)
 Frame = -3

Query  2109  IKNERDEEKASREECTLDGTVDHYGRPALRSATGGWFAGVLLLVNQGLATLAFFGVGVNL  1930
             I N+   +K   +E T DGTVD YGRP++RS +G W A +++L+NQGLATLAFFGVGVNL
Sbjct  6     IYNKDTMKKKEGDEETRDGTVDFYGRPSIRSNSGQWVAAIVILLNQGLATLAFFGVGVNL  65

Query  1929  VLFLTRVMGQDNADAANNVSKWTGTVYLFSLLGAFLSDSYWGRYKTCAIFQLIYVVGLIS  1750
             VLFLTRV+ Q+NADAANNVSKWTGTVY+FSL+GAFLSDSYWGRYKTCAIFQ+I+V+GL S
Sbjct  66    VLFLTRVLQQNNADAANNVSKWTGTVYIFSLVGAFLSDSYWGRYKTCAIFQVIFVIGLSS  125

Query  1749  VSIFSFIFLVKPKGCGDENTPCRSPSRIHIAVYYVSIYLVALGNGGYQPNIATFGSDQFD  1570
             +S+ S++FL++P GCGDE TPC S S + I ++Y SIYL+ALG GGYQPNIAT G+DQFD
Sbjct  126   LSLSSYMFLIRPIGCGDEVTPCGSHSMMEITMFYFSIYLIALGYGGYQPNIATLGADQFD  185

Query  1569  GDHAHESVSKVAFFSYFYLALNLGSLFSNTVLVYFEDKGMWTLGFWastvsavlalllfl  1390
              +H  E  SK+AFFSYFYLALNLGSLFSNT+L YFED+GMW LGFWAST SAV+AL+LFL
Sbjct  186   EEHPKEGYSKIAFFSYFYLALNLGSLFSNTILGYFEDEGMWALGFWASTGSAVIALILFL  245

Query  1389  VGTPRYRHFAPKGNPLSRFSQVLVASARKWNVHLPSDGDDHRLYEIQEH-----DSSTRK  1225
             VGTPRYR+F P GNPLSRF QVLVA+ +K +V  P  G +  +Y+         +++ R+
Sbjct  246   VGTPRYRYFKPTGNPLSRFCQVLVAATKKSSVEAPLRGREE-MYDGDSQGKNASENTGRR  304

Query  1224  ILHTEGFKFLDKAAVITTKESVRDLEERNINPWRLCSVTQVEEVKCILRLLPIWLCTILY  1045
             I+HT+ FKFLDKAA IT ++ + D ++  +NPWRLC VTQVEEVKCILRL+PIWLCTI+Y
Sbjct  305   IMHTDEFKFLDKAAYITARD-LDDKKQDAVNPWRLCPVTQVEEVKCILRLMPIWLCTIIY  363

Query  1044  SVVFTQMASLFVEQGAAMRTNIAGFHIPPASMSSFDILSVAAFIFIYRRILDPLIASLKK  865
             SVVFTQMASLFVEQGAAM TNI+ F IPPASMSSFDILSVA FIF+YRR+L+P+    KK
Sbjct  364   SVVFTQMASLFVEQGAAMNTNISDFKIPPASMSSFDILSVALFIFLYRRVLEPVANRFKK  423

Query  864   TRRAQGFTELQRMGVGLiiaimamvaagiVEHFRLKYASTDCPRC--PSSLSIFWQVPQY  691
                ++G TEL RMG+GL+IAI+AMVAAG+VE +RLKYA   C  C   SSLSIFWQ PQY
Sbjct  424   N-GSKGITELHRMGIGLVIAIIAMVAAGVVECYRLKYADKSCTHCDGSSSLSIFWQAPQY  482

Query  690   VLIGASEVFMYVGQLEFFNGQAPEGLKSFASALCMTSISLGNYVSSLLVSIVMRISTTHR  511
              LIGASEVFMYVGQLEFFN Q P+GLKSF SALCM S+S+GN+VSSLLV++V++IST   
Sbjct  483   SLIGASEVFMYVGQLEFFNAQTPDGLKSFGSALCMMSMSMGNFVSSLLVTMVVKISTEDH  542

Query  510   MPGWIPGNLNKGHLDRFYFLLAALTTADFVVYILCAKWYKYIEFEERN  367
             MPGWIP NLNKGHLDRFYFLLAALT+ D VVYI CAKWYK I+ E +N
Sbjct  543   MPGWIPRNLNKGHLDRFYFLLAALTSIDLVVYIACAKWYKSIQLEGKN  590



>gb|AAF81343.1|AC007767_23 Contains similarity to a peptide transport protein homolog F17L22.140 
gi|7488004 from Arabidopsis thaliana BAC F17L22 gb|AL035527. 
It contains a POT family domain PF|00854. ESTs gb|BE038248, 
gb|T22680, gb|T04498, gb|R89961, gb|R30626, gb|R30389, 
gb|AA713063 and gb|AA585801 come from this gene [Arabidopsis 
thaliana]
Length=606

 Score =   780 bits (2013),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 404/598 (68%), Positives = 489/598 (82%), Gaps = 11/598 (2%)
 Frame = -3

Query  2088  EKASREECTLDGTVDHYGRPALRSATGGWFAGVLLLVNQGLATLAFFGVGVNLVLFLTRV  1909
             +K   EE T DGTVD+YGRP++RS +G W AG+++L+NQGLATLAFFGVGVNLVLFLTRV
Sbjct  5     KKKEGEEETRDGTVDYYGRPSIRSNSGQWVAGIVILLNQGLATLAFFGVGVNLVLFLTRV  64

Query  1908  MGQDNADAANNVSKWTGTVYLFSLLGAFLSDSYWGRYKTCAIFQLIYVVGLISVSIFSFI  1729
             + Q+NADAANNVSKWTGTVY+FSL+GAFLSDSYWGRYKTCAIFQ+I+V+GL S+S+ S++
Sbjct  65    LQQNNADAANNVSKWTGTVYIFSLVGAFLSDSYWGRYKTCAIFQVIFVIGLSSLSLSSYM  124

Query  1728  FLVKPKGCGDENTPCRSPSRIHIAVYYVSIYLVALGNGGYQPNIATFGSDQFDGDHAHES  1549
             FL++P+GCGDE TPC S S + I ++Y SIYL+ALG GGYQPNIAT G+DQFD +H  E 
Sbjct  125   FLIRPRGCGDEVTPCGSHSMMEITMFYFSIYLIALGYGGYQPNIATLGADQFDEEHPKEG  184

Query  1548  VSKVAFFSYFYLALNLGSLFSNTVLVYFEDKGMWTLGFWastvsavlalllflVGTPRYR  1369
              SK+AFFSYFYLALNLGSLFSNT+L YFED+GMW LGFWAST SA++ L+LFLVGTPRYR
Sbjct  185   YSKIAFFSYFYLALNLGSLFSNTILGYFEDEGMWALGFWASTGSAIIGLILFLVGTPRYR  244

Query  1368  HFAPKGNPLSRFSQVLVASARKWNVHLPSDGDDHRLYEIQEHDSST----RKILHTEGFK  1201
             +F P GNPLSRF QVLVA+ +K +V  P  G +       E  +++    R+I+HT+ FK
Sbjct  245   YFKPTGNPLSRFCQVLVAATKKSSVEAPLRGREEMYDGDSEGKNASVNTGRRIVHTDEFK  304

Query  1200  FLDKAAVITTKESVRDLEERNINPWRLCSVTQVEEVKCILRLLPIWLCTILYSVVFTQMA  1021
             FLDKAA IT ++ + D ++ ++NPWRLC VTQVEEVKCILRL+PIWLCTI+YSVVFTQMA
Sbjct  305   FLDKAAYITARD-LDDKKQDSVNPWRLCPVTQVEEVKCILRLMPIWLCTIIYSVVFTQMA  363

Query  1020  SLFVEQGAAMRTNIAGFHIPPASMSSFDILSVAAFIFIYRRILDPLIASLKKTRRAQGFT  841
             SLFVEQGAAM T+++ F IPPASMSSFDILSVA FIF+YRR+L+P+    KK   ++G T
Sbjct  364   SLFVEQGAAMNTSVSDFKIPPASMSSFDILSVALFIFLYRRVLEPVANRFKKN-GSKGIT  422

Query  840   ELQRMGVGLiiaimamvaagiVEHFRLKYASTDCPRC--PSSLSIFWQVPQYVLIGASEV  667
             EL RMG+GL+IA++AM+AAGIVE +RLKYA   C  C   SSLSIFWQ PQY LIGASEV
Sbjct  423   ELHRMGIGLVIAVIAMIAAGIVECYRLKYADKSCTHCDGSSSLSIFWQAPQYSLIGASEV  482

Query  666   FMYVGQLEFFNGQAPEGLKSFASALCMTSISLGNYVSSLLVSIVMRISTTHRMPGWIPGN  487
             FMYVGQLEFFN Q P+GLKSF SALCM S+S+GN+VSSLLV++V++IST   MPGWIP N
Sbjct  483   FMYVGQLEFFNAQTPDGLKSFGSALCMMSMSMGNFVSSLLVTMVVKISTEDHMPGWIPRN  542

Query  486   LNKGHLDRFYFLLAALTTADFVVYILCAKWYKYIEFE---ERNSCLKNIGDSKLQEDR  322
             LNKGHLDRFYFLLAALT+ D VVYI CAKWYK I+ E   E      +  D++ +E+R
Sbjct  543   LNKGHLDRFYFLLAALTSIDLVVYIACAKWYKPIQLEGKDEMQDMSDDDYDTESEEER  600



>ref|XP_010499794.1| PREDICTED: protein NRT1/ PTR FAMILY 7.3-like [Camelina sativa]
Length=615

 Score =   780 bits (2014),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 404/587 (69%), Positives = 482/587 (82%), Gaps = 8/587 (1%)
 Frame = -3

Query  2109  IKNERDEEKASREECTLDGTVDHYGRPALRSATGGWFAGVLLLVNQGLATLAFFGVGVNL  1930
             I N+   +K    E T DGTVD YGRP++RS +G W A +++L+NQGLATLAFFGVGVNL
Sbjct  6     IYNKDTMKKKEGNEETRDGTVDFYGRPSIRSNSGQWVAAIVILLNQGLATLAFFGVGVNL  65

Query  1929  VLFLTRVMGQDNADAANNVSKWTGTVYLFSLLGAFLSDSYWGRYKTCAIFQLIYVVGLIS  1750
             VLFLTRV+ Q+NADAANNVSKWTGTVY+FSL+GAFLSDSYWGRYKTCAIFQ+I+V+GL S
Sbjct  66    VLFLTRVLQQNNADAANNVSKWTGTVYIFSLVGAFLSDSYWGRYKTCAIFQVIFVIGLSS  125

Query  1749  VSIFSFIFLVKPKGCGDENTPCRSPSRIHIAVYYVSIYLVALGNGGYQPNIATFGSDQFD  1570
             +S+ S++FL++P GCGDE TPC S S + I ++Y SIYL+ALG GGYQPNIAT G+DQFD
Sbjct  126   LSLSSYMFLIRPIGCGDEVTPCGSHSMMEITMFYFSIYLIALGYGGYQPNIATLGADQFD  185

Query  1569  GDHAHESVSKVAFFSYFYLALNLGSLFSNTVLVYFEDKGMWTLGFWastvsavlalllfl  1390
              +H  E  SK+AFFSYFYLALNLGSLFSNT+L YFED+GMW LGFWAST SAV+AL+LFL
Sbjct  186   EEHPKEGYSKIAFFSYFYLALNLGSLFSNTILGYFEDEGMWALGFWASTGSAVIALILFL  245

Query  1389  VGTPRYRHFAPKGNPLSRFSQVLVASARKWNVHLPSDGDDHRLYEIQE----HDSSTRKI  1222
             VGTPRYR+F P GNPLSRF QVLVA+ +K +V  P  G +    E  +     +++ R+I
Sbjct  246   VGTPRYRYFKPTGNPLSRFCQVLVAATKKSSVEAPLRGREEMYDEDSQGKNASENTGRRI  305

Query  1221  LHTEGFKFLDKAAVITTKESVRDLEERNINPWRLCSVTQVEEVKCILRLLPIWLCTILYS  1042
             +H++ FKFLDKAA IT ++ + D ++  +NPWRLC VTQVEEVKCILRL+PIWLCTI+YS
Sbjct  306   MHSDEFKFLDKAAYITARD-LDDKKQDAVNPWRLCPVTQVEEVKCILRLMPIWLCTIIYS  364

Query  1041  VVFTQMASLFVEQGAAMRTNIAGFHIPPASMSSFDILSVAAFIFIYRRILDPLIASLKKT  862
             VVFTQMASLFVEQGAAM TNI+ F IPPASMSSFDILSVA FIF+YRR+L+P+    KK 
Sbjct  365   VVFTQMASLFVEQGAAMNTNISDFKIPPASMSSFDILSVALFIFLYRRVLEPVANRFKKN  424

Query  861   RRAQGFTELQRMGVGLiiaimamvaagiVEHFRLKYASTDCPRC--PSSLSIFWQVPQYV  688
               ++G TEL RMG+GL+IA++AMVAAG+VE +RLKYA   C  C   SSLSIFWQ PQY 
Sbjct  425   -GSKGITELHRMGIGLVIAVIAMVAAGVVECYRLKYADKSCTHCDGSSSLSIFWQAPQYS  483

Query  687   LIGASEVFMYVGQLEFFNGQAPEGLKSFASALCMTSISLGNYVSSLLVSIVMRISTTHRM  508
             LIGASEVFMYVGQLEFFN Q P+GLKSF SALCM S+S+GN+VSSLLV++V++IST   M
Sbjct  484   LIGASEVFMYVGQLEFFNAQTPDGLKSFGSALCMMSMSMGNFVSSLLVTMVVKISTEDHM  543

Query  507   PGWIPGNLNKGHLDRFYFLLAALTTADFVVYILCAKWYKYIEFEERN  367
             PGWIP NLNKGHLDRFYFLLAALT+ D VVYI CAKWYK I+ E +N
Sbjct  544   PGWIPRNLNKGHLDRFYFLLAALTSIDLVVYIACAKWYKSIQLEGKN  590



>ref|XP_006307023.1| hypothetical protein CARUB_v10008608mg [Capsella rubella]
 gb|EOA39921.1| hypothetical protein CARUB_v10008608mg [Capsella rubella]
Length=615

 Score =   780 bits (2013),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 405/588 (69%), Positives = 486/588 (83%), Gaps = 10/588 (2%)
 Frame = -3

Query  2109  IKNERDEEKASREECTLDGTVDHYGRPALRSATGGWFAGVLLLVNQGLATLAFFGVGVNL  1930
             I N+   +K   +E T DGTVD+YGRP++RS +G W AG++LL+NQGLATLAFFGVGVNL
Sbjct  6     IYNKDTMKKKEGDEETRDGTVDYYGRPSIRSNSGQWVAGIILLLNQGLATLAFFGVGVNL  65

Query  1929  VLFLTRVMGQDNADAANNVSKWTGTVYLFSLLGAFLSDSYWGRYKTCAIFQLIYVVGLIS  1750
             VLFLTRV+ Q+NADAANNVSKWTGTVY+FSL+GAFLSDSYWGRYKTCAIFQ+I+V+GL S
Sbjct  66    VLFLTRVLQQNNADAANNVSKWTGTVYIFSLVGAFLSDSYWGRYKTCAIFQVIFVIGLSS  125

Query  1749  VSIFSFIFLVKPKGCGDENTPCRSPSRIHIAVYYVSIYLVALGNGGYQPNIATFGSDQFD  1570
             +S+ S++FL++P GCGDE TPC + S + I ++Y SIYL+ALG GGYQPNIAT G+DQFD
Sbjct  126   LSLSSYMFLIRPIGCGDEVTPCGTHSMMEITMFYFSIYLIALGYGGYQPNIATLGADQFD  185

Query  1569  GDHAHESVSKVAFFSYFYLALNLGSLFSNTVLVYFEDKGMWTLGFWastvsavlalllfl  1390
              +H  E  SK+AFFSYFYLALNLGSLFSNT+L YFED+GMW LGFWAST SAV+AL+LFL
Sbjct  186   EEHPKEGYSKIAFFSYFYLALNLGSLFSNTILGYFEDEGMWALGFWASTGSAVIALILFL  245

Query  1389  VGTPRYRHFAPKGNPLSRFSQVLVASARKWNVHLPSDGDDHRLYEIQEH-----DSSTRK  1225
             VGTPRYR+F P GNPLSRF QVLVA+ +K +V  P  G +  +Y+         +++ R+
Sbjct  246   VGTPRYRYFQPTGNPLSRFCQVLVAATKKSSVEAPLRGREE-MYDGDSQGKNASENTGRR  304

Query  1224  ILHTEGFKFLDKAAVITTKESVRDLEERNINPWRLCSVTQVEEVKCILRLLPIWLCTILY  1045
             I+HT+ FKFLDKAA IT ++ + D ++  +NPWRLC VTQVEEVKCILRL+PIWLCTI+Y
Sbjct  305   IMHTDEFKFLDKAAYITARD-LDDKKQDAVNPWRLCPVTQVEEVKCILRLMPIWLCTIIY  363

Query  1044  SVVFTQMASLFVEQGAAMRTNIAGFHIPPASMSSFDILSVAAFIFIYRRILDPLIASLKK  865
             SVVFTQMASLFVEQGAAM T+I+ F IPPASMSSFDILSVA FIF+YRR+L+P+    KK
Sbjct  364   SVVFTQMASLFVEQGAAMNTSISNFKIPPASMSSFDILSVALFIFLYRRVLEPVANRFKK  423

Query  864   TRRAQGFTELQRMGVGLiiaimamvaagiVEHFRLKYASTDCPRC--PSSLSIFWQVPQY  691
                ++G TEL RMG+GL+IA++AMVAAGIVE +RLKYA   C  C   SSLSIFWQ PQY
Sbjct  424   N-GSKGITELHRMGIGLVIAVIAMVAAGIVECYRLKYADKSCTHCDGSSSLSIFWQAPQY  482

Query  690   VLIGASEVFMYVGQLEFFNGQAPEGLKSFASALCMTSISLGNYVSSLLVSIVMRISTTHR  511
              LIGASEVFMYVGQLEFFN Q P+GLKSF SALCM S+S+GN+VSSLLV++V++IST   
Sbjct  483   SLIGASEVFMYVGQLEFFNAQTPDGLKSFGSALCMMSMSMGNFVSSLLVTMVVKISTEDN  542

Query  510   MPGWIPGNLNKGHLDRFYFLLAALTTADFVVYILCAKWYKYIEFEERN  367
             MPGWIP NLNKGHLDRFYFLLAALT+ D VVYI CAKWYK I+ E ++
Sbjct  543   MPGWIPRNLNKGHLDRFYFLLAALTSIDLVVYIACAKWYKDIKLEGKD  590



>emb|CDP12983.1| unnamed protein product [Coffea canephora]
Length=606

 Score =   779 bits (2011),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 403/607 (66%), Positives = 480/607 (79%), Gaps = 28/607 (5%)
 Frame = -3

Query  2115  FFIKNERDEEKASREECTLDGTVDHYGRPALRSATGGWFAGVLLLVNQGLATLAFFGVGV  1936
             F +  E   ++   E  TLDGTVD +GRPA+R  TG WFAG+++L+NQGLATLAFFGVGV
Sbjct  4     FQVSKEEKLKENQEERYTLDGTVDMHGRPAIRGKTGRWFAGIIILLNQGLATLAFFGVGV  63

Query  1935  NLVLFLTRVMGQDNADAANNVSKWTGTVYLFSLLGAFLSDSYWGRYKTCAIFQLIYVVGL  1756
             NLVLFLTRV+ Q+NADAAN+VSKWTGTVY+FSL+GAFLSDSYWGRY+TCAIFQ+I+V+GL
Sbjct  64    NLVLFLTRVLQQNNADAANSVSKWTGTVYIFSLVGAFLSDSYWGRYRTCAIFQVIFVIGL  123

Query  1755  ISVSIFSFIFLVKPKGCGDENTPCRSPSRIHIAVYYVSIYLVALGNGGYQPNIATFGSDQ  1576
              ++S+ S +FL+KPKGCG+E T C   S   I ++Y+SIYLVALGNGGYQPNIATFG+DQ
Sbjct  124   AALSLSSHLFLMKPKGCGNETTACAQHSSWEIGLFYISIYLVALGNGGYQPNIATFGADQ  183

Query  1575  FDGDHAHESVSKVAFFSYFYLALNLGSLFSNTVLVYFEDKGMWTLGFWastvsavlalll  1396
             FD +   E  SKVAFFSYFYLALNLGSLFSNT+L Y+E+ GMW +GFWAST SA+ AL+L
Sbjct  184   FDEEDPKEGHSKVAFFSYFYLALNLGSLFSNTILGYYENSGMWAIGFWASTASALAALVL  243

Query  1395  flVGTPRYRHFAPKGNPLSRFSQVLVASARKWNVHLPSDGDDHRLYEIQEHDSS---TRK  1225
             FL GT RYRHF P GNP+SRF+QV+VA+ R W V  P    D+ L+E++  +SS   +RK
Sbjct  244   FLAGTTRYRHFRPCGNPISRFTQVIVAAIRNWRVEGPQ--SDYELFEVEGKESSVTGSRK  301

Query  1224  ILHTEGFKFLDKAAVITTKESVRDLEERN--INPWRLCSVTQVEEVKCILRLLPIWLCTI  1051
             +LHT GFKFLD+AA I +    RD  E+    N W LC ++QVEEVKCILRLLPIWLCTI
Sbjct  302   MLHTHGFKFLDRAAFIAS----RDFNEKQGYYNRWHLCPISQVEEVKCILRLLPIWLCTI  357

Query  1050  LYSVVFTQMASLFVEQGAAMRTNIAGFHIPPASMSSFDILSVAAFIFIYRRILDPLIASL  871
             +YSVVFTQMAS+FVEQGAAM+T +  F IPPASMSSFDILSVA  IF YRR+LDP+++ +
Sbjct  358   IYSVVFTQMASIFVEQGAAMKTKVWNFEIPPASMSSFDILSVAVVIFFYRRVLDPIVSRI  417

Query  870   KK--------TRRAQGFTELQRMGVGLiiaimamvaagiVEHFRLKYASTDCPRCP--SS  721
             KK        T+ ++G TELQRMG+G +IA+MAM++AGIVE++R KYA  DC  C   SS
Sbjct  418   KKSGAKDLTETKDSKGLTELQRMGIGFVIAVMAMLSAGIVENYRRKYARIDCTNCEGSSS  477

Query  720   LSIFWQVPQYVLIGASEVFMYVGQLEFFNGQAPEGLKSFASALCMTSISLGNYVSSLLVS  541
             LSI WQVPQY LIGASEVFMYVGQLEFFN QAP+GLKSF SALCMTSISLGNYVSSL+VS
Sbjct  478   LSIVWQVPQYALIGASEVFMYVGQLEFFNDQAPDGLKSFGSALCMTSISLGNYVSSLIVS  537

Query  540   IVMRISTTHRMPGWIPGNLNKGHLDRFYFLLAALTTADFVVYILCAKWY-------KYIE  382
             +VMRIS    MPGWIP NLN GHLDRFYFLLA LT  D  VY+ CAKWY       KY+E
Sbjct  538   MVMRISARDDMPGWIPINLNNGHLDRFYFLLAGLTIIDLAVYMACAKWYKSAKIEGKYVE  597

Query  381   FEERNSC  361
               E+ +C
Sbjct  598   DTEKEAC  604



>emb|CDX79084.1| BnaA01g11510D [Brassica napus]
Length=583

 Score =   778 bits (2008),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 397/572 (69%), Positives = 464/572 (81%), Gaps = 5/572 (1%)
 Frame = -3

Query  2094  DEEKASREECTLDGTVDHYGRPALRSATGGWFAGVLLLVNQGLATLAFFGVGVNLVLFLT  1915
             D++    E CT DG+VD +G PA+R+ TG W + +L+LVNQGLATLAFFGVGVNLVLFLT
Sbjct  2     DQKVRQFEVCTQDGSVDRHGNPAIRAKTGKWLSAILILVNQGLATLAFFGVGVNLVLFLT  61

Query  1914  RVMGQDNADAANNVSKWTGTVYLFSLLGAFLSDSYWGRYKTCAIFQLIYVVGLISVSIFS  1735
             RVMGQDNA+AAN+VSKWTGTVY+FSLLGAFLSDSYWGRYKTCAIFQ  +VVGL+ +S  +
Sbjct  62    RVMGQDNAEAANSVSKWTGTVYIFSLLGAFLSDSYWGRYKTCAIFQGSFVVGLVMLSFST  121

Query  1734  FIFLVKPKGCGDENTPCRSPSRIHIAVYYVSIYLVALGNGGYQPNIATFGSDQFDGDHAH  1555
                L++P GCG E +PC+  S     ++Y+S+YL+ALG GGYQPNIATFG+DQFD D + 
Sbjct  122   AALLLEPSGCGVEESPCKPHSTFKTVIFYLSVYLIALGYGGYQPNIATFGADQFDADDSV  181

Query  1554  ESVSKVAFFSYFYLALNLGSLFSNTVLVYFEDKGMWTLGFWastvsavlalllflVGTPR  1375
             E  SK+AFFSYFYLALNLGSL SNTVL YFED+G W LGFWAST SA   L+LFL GTP+
Sbjct  182   EGHSKIAFFSYFYLALNLGSLLSNTVLSYFEDQGDWPLGFWASTGSAFAGLVLFLTGTPK  241

Query  1374  YRHFAPKGNPLSRFSQVLVASARKWNVHLPSDGDDHRLYEIQEHDSSTRKILHTEGFKFL  1195
             YRHF P+ +P SRF QVLVA+ RK    + ++ +D  LY+ +   +  +KILHT GF+FL
Sbjct  242   YRHFTPRESPWSRFCQVLVAATRK--AKIDANYEDMNLYDSETQRTGDKKILHTSGFRFL  299

Query  1194  DKAAVITTKESVRDLEERNI-NPWRLCSVTQVEEVKCILRLLPIWLCTILYSVVFTQMAS  1018
             D+AA++T  +    +E  +  NPWRLCSVTQVEEVKC+ RL+PIWLCTILYSVVFTQMAS
Sbjct  300   DRAAIVTPDDDAEKVESGSTYNPWRLCSVTQVEEVKCVFRLIPIWLCTILYSVVFTQMAS  359

Query  1017  LFVEQGAAMRTNIAGFHIPPASMSSFDILSVAAFIFIYRRILDPLIASLKKTRRAQGFTE  838
             LFVEQGAAM+TNI  F IP +SMSSFDILSVA FIF YRR LDPL A L KT   +G TE
Sbjct  360   LFVEQGAAMKTNIKDFKIPASSMSSFDILSVAFFIFAYRRFLDPLFARLNKTEPNKGLTE  419

Query  837   LQRMGVGLiiaimamvaagiVEHFRLKYASTDCPRCPSSLSIFWQVPQYVLIGASEVFMY  658
             LQRMG+GL+IA+MAM++AGIVE +RLK+  T      SSLSIFWQVPQY++IGASEVFMY
Sbjct  420   LQRMGIGLVIAVMAMISAGIVEIYRLKHKGT--ASNSSSLSIFWQVPQYMMIGASEVFMY  477

Query  657   VGQLEFFNGQAPEGLKSFASALCMTSISLGNYVSSLLVSIVMRISTTHRMPGWIPGNLNK  478
             VGQLEFFN QAP GLKSFASALCM SISLGNYVSSLLVSIVM IST   +PGWIPGNLNK
Sbjct  478   VGQLEFFNSQAPTGLKSFASALCMASISLGNYVSSLLVSIVMSISTRDDLPGWIPGNLNK  537

Query  477   GHLDRFYFLLAALTTADFVVYILCAKWYKYIE  382
             GHLDRFYFLLA LT ADFVVY++CAKWYKYI+
Sbjct  538   GHLDRFYFLLAGLTAADFVVYLVCAKWYKYIK  569



>ref|XP_011070229.1| PREDICTED: protein NRT1/ PTR FAMILY 7.3 [Sesamum indicum]
Length=597

 Score =   778 bits (2008),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 405/579 (70%), Positives = 472/579 (82%), Gaps = 14/579 (2%)
 Frame = -3

Query  2064  TLDGTVDHYGRPALRSATGGWFAGVLLLVNQGLATLAFFGVGVNLVLFLTRVMGQDNADA  1885
             T DGTVD +GRPA+R  TG   AG+++LVNQGLATLAFFGVGVNLVLFLTRV+ Q+NA A
Sbjct  23    TGDGTVDFHGRPAIRDQTGKGVAGIIILVNQGLATLAFFGVGVNLVLFLTRVLQQNNAYA  82

Query  1884  ANNVSKWTGTVYLFSLLGAFLSDSYWGRYKTCAIFQLIYVVGLISVSIFSFIFLVKPKGC  1705
             AN+VSKWTGTVY+FSL+GAFLSDSYWGRYKTCAIFQ I+V+GL+ +S+ + IFL+KP+GC
Sbjct  83    ANSVSKWTGTVYIFSLVGAFLSDSYWGRYKTCAIFQAIFVIGLVLLSLTTQIFLLKPRGC  142

Query  1704  GDENTPCRSPSRIHIAVYYVSIYLVALGNGGYQPNIATFGSDQFDGDHAHESVSKVAFFS  1525
             GDE TPC S S   I ++Y+SIY+VALGNGGYQPNIATFG+DQFD +   E  SKVAFFS
Sbjct  143   GDEITPCESHSSWVIGLFYISIYMVALGNGGYQPNIATFGADQFDEEDPKEGYSKVAFFS  202

Query  1524  YFYLALNLGSLFSNTVLVYFEDKGMWTLGFWastvsavlalllflVGTPRYRHFAPKGNP  1345
             YFYLALNLGSLFSNT+L YFED+GMW LGFWAST SA  AL+LFL GT RYRHF P GNP
Sbjct  203   YFYLALNLGSLFSNTILGYFEDEGMWALGFWASTASAFAALVLFLGGTKRYRHFKPSGNP  262

Query  1344  LSRFSQVLVASARKWNVHLPSDGDDHRLYEIQEHDSST---RKILHTEGFKFLDKAAVIT  1174
             LSR  QV+VA+++K  + +P    +  LYE +  + ST   RK+LHT GFKFLD+AA +T
Sbjct  263   LSRVCQVIVAASKKCRLKIPP--GEEILYEAEGTEKSTVAARKMLHTHGFKFLDRAAFVT  320

Query  1173  TKESVRDLEERNINPWRLCSVTQVEEVKCILRLLPIWLCTILYSVVFTQMASLFVEQGAA  994
             ++E +  L++   NPWRLC ++QVEEVKCILRLLPIWLCTI+YSVVFTQMASLFVEQG A
Sbjct  321   SRE-LDQLKQNEYNPWRLCPISQVEEVKCILRLLPIWLCTIIYSVVFTQMASLFVEQGDA  379

Query  993   MRTNIAGFHIPPASMSSFDILSVAAFIFIYRRILDPLIASLKKTRRAQGFTELQRMGVGL  814
             M T I+ F IP ASMSSFDI+SVA  IF+YRR+LDPL+  ++K    +G TELQRMG+GL
Sbjct  380   MNTKISNFRIPAASMSSFDIVSVAIVIFLYRRVLDPLVHRIRK----KGLTELQRMGIGL  435

Query  813   iiaimamvaagiVEHFRLKYASTDCPRC--PSSLSIFWQVPQYVLIGASEVFMYVGQLEF  640
             +IAIMAM++AGIVE +RLKYA  DC  C   SSLSIFWQVPQY LIGASEVFMYVGQLEF
Sbjct  436   VIAIMAMLSAGIVECYRLKYAQKDCKHCQGSSSLSIFWQVPQYALIGASEVFMYVGQLEF  495

Query  639   FNGQAPEGLKSFASALCMTSISLGNYVSSLLVSIVMRISTTHRMPGWIPGNLNKGHLDRF  460
             FN QAP+GLKSF SALCMTSISLGNYVSSLLVSIVM+IST   MPGWIP NLNKGHLDRF
Sbjct  496   FNAQAPDGLKSFGSALCMTSISLGNYVSSLLVSIVMKISTIDNMPGWIPRNLNKGHLDRF  555

Query  459   YFLLAALTTADFVVYILCAKWYKYIEFEERNSCLKNIGD  343
             YFLLA LT  D ++YI CA WYK ++   R  C +N  D
Sbjct  556   YFLLAGLTAIDLILYIACAMWYKSMKL--RGKCSENKED  592



>ref|XP_009135044.1| PREDICTED: protein NRT1/ PTR FAMILY 7.2-like [Brassica rapa]
Length=583

 Score =   775 bits (2000),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 396/572 (69%), Positives = 463/572 (81%), Gaps = 5/572 (1%)
 Frame = -3

Query  2094  DEEKASREECTLDGTVDHYGRPALRSATGGWFAGVLLLVNQGLATLAFFGVGVNLVLFLT  1915
             D++    E CT DG+VD +G PA+R+ TG W + +L+LVNQGLATLAFFGVGVNLVLFLT
Sbjct  2     DQKVRQFEVCTQDGSVDRHGNPAIRAKTGKWLSAILILVNQGLATLAFFGVGVNLVLFLT  61

Query  1914  RVMGQDNADAANNVSKWTGTVYLFSLLGAFLSDSYWGRYKTCAIFQLIYVVGLISVSIFS  1735
             RVMGQDNA+AAN+VSKWTGTVY+FSLLGAFLSDSYWGRYKTCAIFQ  +VVGL+ +S  +
Sbjct  62    RVMGQDNAEAANSVSKWTGTVYIFSLLGAFLSDSYWGRYKTCAIFQGSFVVGLVMLSFST  121

Query  1734  FIFLVKPKGCGDENTPCRSPSRIHIAVYYVSIYLVALGNGGYQPNIATFGSDQFDGDHAH  1555
                L++P GCG E +PC+  S     ++Y+S+YL+ALG GGYQPNIATFG+DQFD D + 
Sbjct  122   AALLLEPSGCGVEESPCKPHSTFKTVIFYLSVYLIALGYGGYQPNIATFGADQFDADDSV  181

Query  1554  ESVSKVAFFSYFYLALNLGSLFSNTVLVYFEDKGMWTLGFWastvsavlalllflVGTPR  1375
             E  SK+AFFSYFYLALNLGSL SNTVL YFED+G W LGFWAST SA   L+LFL GTP+
Sbjct  182   EGHSKIAFFSYFYLALNLGSLLSNTVLSYFEDQGDWPLGFWASTGSAFAGLVLFLTGTPK  241

Query  1374  YRHFAPKGNPLSRFSQVLVASARKWNVHLPSDGDDHRLYEIQEHDSSTRKILHTEGFKFL  1195
             YRHF P+ +P SRF QVLVA+ RK    + ++ +D  LY+ +   +  +KILHT GF+FL
Sbjct  242   YRHFTPRESPWSRFCQVLVAATRK--AKIDANYEDMNLYDSETQRTGDKKILHTSGFRFL  299

Query  1194  DKAAVITTKESVRDLEERNI-NPWRLCSVTQVEEVKCILRLLPIWLCTILYSVVFTQMAS  1018
             D+AA++T  +    +E  +  NPWRLCSVTQVEEVKC+ RL+PIWLCTILYSVVFTQMAS
Sbjct  300   DRAAIVTPDDDAEKVESGSTYNPWRLCSVTQVEEVKCVFRLIPIWLCTILYSVVFTQMAS  359

Query  1017  LFVEQGAAMRTNIAGFHIPPASMSSFDILSVAAFIFIYRRILDPLIASLKKTRRAQGFTE  838
             LFVEQGAAM+TNI  F IP +SMSSFDILSVA FIF YRR LDPL A L KT   +G T+
Sbjct  360   LFVEQGAAMKTNIKDFKIPASSMSSFDILSVAFFIFAYRRFLDPLFARLNKTEPNKGLTQ  419

Query  837   LQRMGVGLiiaimamvaagiVEHFRLKYASTDCPRCPSSLSIFWQVPQYVLIGASEVFMY  658
             LQRMG+GL+IAIMAM++AGIVE +RLK+  T      SSLSIFWQVPQY++IGASEVFMY
Sbjct  420   LQRMGIGLVIAIMAMISAGIVELYRLKHKET--ASNSSSLSIFWQVPQYMMIGASEVFMY  477

Query  657   VGQLEFFNGQAPEGLKSFASALCMTSISLGNYVSSLLVSIVMRISTTHRMPGWIPGNLNK  478
             VGQLEFFN QAP GLKSFASALCM SISLGNYVSSLLVSIVM IST   +PGWIPGNLNK
Sbjct  478   VGQLEFFNSQAPTGLKSFASALCMASISLGNYVSSLLVSIVMSISTRDDLPGWIPGNLNK  537

Query  477   GHLDRFYFLLAALTTADFVVYILCAKWYKYIE  382
             GHLDRFYFLLA LT  DFVVY++CAKWYKYI+
Sbjct  538   GHLDRFYFLLAGLTAVDFVVYLVCAKWYKYIK  569



>ref|XP_006587754.1| PREDICTED: nitrate transporter 1.5-like [Glycine max]
Length=597

 Score =   775 bits (2001),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 416/589 (71%), Positives = 474/589 (80%), Gaps = 13/589 (2%)
 Frame = -3

Query  2118  MFFIKNERDEEKASR--EECTLDGTVDHYGRPALRSATGGWFAGVLLLVNQGLATLAFFG  1945
             ++FIK ++ + K +R  E CT DG +D +G PA+R  TG W  G+L+LVNQGLATLAFFG
Sbjct  4     LYFIKKDKIKGKVNRGNEVCTSDGAIDSHGHPAVRKRTGTWTTGILILVNQGLATLAFFG  63

Query  1944  VGVNLVLFLTRVMGQDNADAANNVSKWTGTVYLFSLLGAFLSDSYWGRYKTCAIFQLIYV  1765
             VGVNLVLFLTRVMGQDNA+AANNVSKWTGTVYLFSLLGAFLSDSYWGRY TCAIFQ+I+V
Sbjct  64    VGVNLVLFLTRVMGQDNAEAANNVSKWTGTVYLFSLLGAFLSDSYWGRYMTCAIFQVIFV  123

Query  1764  VGLISVSIFSFIFLVKPKGCGDENTPCRSPSRIHIAVYYVSIYLVALGNGGYQPNIATFG  1585
             +GLIS+S+ S I L+KP GCGD+   C S S    A +Y+SIYLVALGNGGYQPNIATFG
Sbjct  124   IGLISLSLSSHISLLKPSGCGDKELQCGSHSSYQTAFFYLSIYLVALGNGGYQPNIATFG  183

Query  1584  SDQFDGDHAHESVSKVAFFSYFYLALNLGSLFSNTVLVYFEDKGMWTLGFWastvsavla  1405
             +DQFD     E +SKVAFFSYFYLALNLGSLFSNT+L YFEDKG WTLGFWAS  SA +A
Sbjct  184   ADQFDEGDPKERLSKVAFFSYFYLALNLGSLFSNTILDYFEDKGQWTLGFWASAGSAAIA  243

Query  1404  lllflVGTPRYRHFAPKGNPLSRFSQVLVASARKWNVHLPSDGDDHRLYEIQE-HDSSTR  1228
             L+LFL GT RYR+F P GNPL R  QV VA+A+KW V +PS   +  LYE ++   S  R
Sbjct  244   LILFLCGTRRYRYFKPVGNPLPRVGQVFVAAAKKWKVKVPS---EENLYEDKKCSPSGRR  300

Query  1227  KILHTEGFKFLDKAAVITTKESVRDLEERNINPWRLCSVTQVEEVKCILRLLPIWLCTIL  1048
             K+LHT+GF++LDKAA IT+K+ +  LEE   NPW L +VTQVEEVKCILRLLPIWLCTI+
Sbjct  301   KMLHTKGFRYLDKAAFITSKD-LEQLEENKRNPWCLSTVTQVEEVKCILRLLPIWLCTIM  359

Query  1047  YSVVFTQMASLFVEQGAAMRTNIAGFHIPPASMSSFDILSVAAFIFIYRRILDPLIASLK  868
             YSVVF QMASLFV QG AM T I+ F IPPASMSSFDIL VA FIFIYR  LDP +A + 
Sbjct  360   YSVVFAQMASLFVVQGDAMATGISSFKIPPASMSSFDILGVAFFIFIYRHALDPFVAKVM  419

Query  867   KTRRAQGFTELQRMGVGLiiaimamvaagiVEHFRLKYASTDCPRC--PSSLSIFWQVPQ  694
             K++     TELQRMG+GL++AIMAMV+AG+VE FRLK+A  DC  C   SSLSIFWQVPQ
Sbjct  420   KSK----LTELQRMGIGLVLAIMAMVSAGLVEKFRLKFAIKDCSNCDGSSSLSIFWQVPQ  475

Query  693   YVLIGASEVFMYVGQLEFFNGQAPEGLKSFASALCMTSISLGNYVSSLLVSIVMRISTTH  514
             YVL GASEVFMYV QLEFFN Q P+GLKSF SALCMTSISLGNYVSSLLV+IVM+IST  
Sbjct  476   YVLTGASEVFMYVPQLEFFNAQTPDGLKSFGSALCMTSISLGNYVSSLLVAIVMKISTKG  535

Query  513   RMPGWIPGNLNKGHLDRFYFLLAALTTADFVVYILCAKWYKYIEFEERN  367
              +PGWIPGNLN GHLDRFYFLLAALTT D VVY+  AKWYKYI FE  N
Sbjct  536   DIPGWIPGNLNLGHLDRFYFLLAALTTVDLVVYVALAKWYKYINFEGNN  584



>gb|ABD32535.1| TGF-beta receptor, type I/II extracellular region [Medicago truncatula]
 gb|AES77454.2| peptide/nitrate transporter [Medicago truncatula]
Length=589

 Score =   773 bits (1996),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 412/576 (72%), Positives = 482/576 (84%), Gaps = 12/576 (2%)
 Frame = -3

Query  2073  EECTLDGTVDHYGRPALRSATGGWFAGVLLLVNQGLATLAFFGVGVNLVLFLTRVMGQDN  1894
             E CTLDG++D +G PA+R  TG WFAG+L+LVNQGLATLAFFGVGVNLVLFLTRVMGQDN
Sbjct  7     EVCTLDGSIDSHGHPAVRERTGTWFAGILILVNQGLATLAFFGVGVNLVLFLTRVMGQDN  66

Query  1893  ADAANNVSKWTGTVYLFSLLGAFLSDSYWGRYKTCAIFQLIYVVGLISVSIFSFIFLVKP  1714
             ADAANNVSKWTGTVY+FSLLGAFLSDSYWGRY TCAIFQ+I+VVGL+++S+ S+IFL+KP
Sbjct  67    ADAANNVSKWTGTVYIFSLLGAFLSDSYWGRYITCAIFQVIFVVGLVALSLTSYIFLLKP  126

Query  1713  KGCGDENTPCRSPSRIHIAVYYVSIYLVALGNGGYQPNIATFGSDQFDGDHAHESVSKVA  1534
              GCG +  PC + S     ++YVSIYLVALGNGGYQP IATFG+DQFD     E  SK+A
Sbjct  127   NGCGSKELPCGTHSSYETTLFYVSIYLVALGNGGYQPTIATFGADQFDESDPSEQHSKIA  186

Query  1533  FFSYFYLALNLGSLFSNTVLVYFEDKGMWTLGFWastvsavlalllflVGTPRYRHFAPK  1354
             FFSYFYLALN+GSLFSNT+L YFED G+WTLGF  S  SA LAL+LFL GT +YR+F P 
Sbjct  187   FFSYFYLALNIGSLFSNTILDYFEDDGLWTLGFCVSAGSAALALVLFLCGTSKYRYFKPV  246

Query  1353  GNPLSRFSQVLVASARKWNVHLPSDGDDHRLYEIQEHDSS-TRKILHTEGFKFLDKAAVI  1177
             GNPL RF QV VA+ RKW V +  DG+D +L+E+++  S+  RK+ HT+GF+FLDKAA I
Sbjct  247   GNPLPRFCQVFVAAIRKWKVQM-FDGED-KLHEVEDCLSNGGRKMYHTQGFRFLDKAAFI  304

Query  1176  TTKESVRDLEERNINPWRLCSVTQVEEVKCILRLLPIWLCTILYSVVFTQMASLFVEQGA  997
             T K+ ++ +EE   +PW L +VTQVEEVKCILRLLPIWLCTIL+SVVF+QMASLFVEQGA
Sbjct  305   TPKD-LKQMEENKCSPWFLSTVTQVEEVKCILRLLPIWLCTILFSVVFSQMASLFVEQGA  363

Query  996   AMRTNIAGFHIPPASMSSFDILSVAAFIFIYRRILDPLIASLKKTRRAQGFTELQRMGVG  817
             AM T I+ FHIPPASMSSFDILSV +FIFIYRRILDPL+A  + T++++G TELQRMG+G
Sbjct  364   AMETKISTFHIPPASMSSFDILSVVSFIFIYRRILDPLVA--RFTKKSKGITELQRMGIG  421

Query  816   LiiaimamvaagiVEHFRLKYA---STDCPRCP--SSLSIFWQVPQYVLIGASEVFMYVG  652
             L++AI+AMV+AG+VE FRLKYA     +C  C   SSLSIFWQVPQYVLIGASEVFMYVG
Sbjct  422   LVLAIIAMVSAGLVEIFRLKYAIKEEKNCSHCEGTSSLSIFWQVPQYVLIGASEVFMYVG  481

Query  651   QLEFFNGQAPEGLKSFASALCMTSISLGNYVSSLLVSIVMRISTTHR-MPGWIPGNLNKG  475
             QLEFFN QAP+GLKSF SALCMTSISLGNYVSSLLV+IVM+IST +  M GWIPGNLN G
Sbjct  482   QLEFFNSQAPDGLKSFGSALCMTSISLGNYVSSLLVAIVMKISTRNEGMLGWIPGNLNMG  541

Query  474   HLDRFYFLLAALTTADFVVYILCAKWYKYIEFEERN  367
             HLDRFYFLLAALT AD +VYI  A+WYKY++F   N
Sbjct  542   HLDRFYFLLAALTAADLLVYIAMARWYKYVKFHGNN  577



>ref|XP_003551735.1| PREDICTED: nitrate transporter 1.5-like [Glycine max]
Length=597

 Score =   773 bits (1997),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 417/586 (71%), Positives = 472/586 (81%), Gaps = 13/586 (2%)
 Frame = -3

Query  2112  FIKNERDEEKASR--EECTLDGTVDHYGRPALRSATGGWFAGVLLLVNQGLATLAFFGVG  1939
             FIK ++ + K +R  E CT DG +D +G PA+   TG W  G+L+LVNQGLATLAFFGVG
Sbjct  6     FIKKDKIKGKVNRDNEVCTSDGAIDSHGHPAVLKRTGTWTTGILILVNQGLATLAFFGVG  65

Query  1938  VNLVLFLTRVMGQDNADAANNVSKWTGTVYLFSLLGAFLSDSYWGRYKTCAIFQLIYVVG  1759
             VNLVLFLTRVMGQDNA+AANNVSKWTGTVYLFSLLGAFLSDSYWGRY TCAIFQ+I+V+G
Sbjct  66    VNLVLFLTRVMGQDNAEAANNVSKWTGTVYLFSLLGAFLSDSYWGRYMTCAIFQVIFVIG  125

Query  1758  LISVSIFSFIFLVKPKGCGDENTPCRSPSRIHIAVYYVSIYLVALGNGGYQPNIATFGSD  1579
             L+S+S+ S I L+KP GCGD+   C S S    A++Y+SIYLVALGNGGYQPNIATFGSD
Sbjct  126   LVSLSLSSHISLLKPSGCGDKELQCGSHSSSQTALFYLSIYLVALGNGGYQPNIATFGSD  185

Query  1578  QFDGDHAHESVSKVAFFSYFYLALNLGSLFSNTVLVYFEDKGMWTLGFWastvsavlall  1399
             QFD     E +SKVAFFSYFYLALNLGSLFSNT+L YFEDKG WTLGFWAS  SA +AL+
Sbjct  186   QFDEGDPKERLSKVAFFSYFYLALNLGSLFSNTILDYFEDKGQWTLGFWASAGSAAIALI  245

Query  1398  lflVGTPRYRHFAPKGNPLSRFSQVLVASARKWNVHLPSDGDDHRLYEIQEHD-SSTRKI  1222
             LFL GT RYR+F P GNPL R  QV VA+ +KW V + S   +  LYE +E   S  RK+
Sbjct  246   LFLCGTRRYRYFKPVGNPLPRVGQVFVAAGKKWKVKVLS---EENLYEDEESSPSGRRKM  302

Query  1221  LHTEGFKFLDKAAVITTKESVRDLEERNINPWRLCSVTQVEEVKCILRLLPIWLCTILYS  1042
             LHTEGF+FLDKAA IT+K+ +  LEE   NPW L +VTQVEEVKCILRLLPIWLCTI+YS
Sbjct  303   LHTEGFRFLDKAAFITSKD-LEQLEENKRNPWCLSTVTQVEEVKCILRLLPIWLCTIMYS  361

Query  1041  VVFTQMASLFVEQGAAMRTNIAGFHIPPASMSSFDILSVAAFIFIYRRILDPLIASLKKT  862
             VVF QMASLFV QG AM T I+ F IPPASMSSFDIL VA FIFIYR  LDP +A + K+
Sbjct  362   VVFAQMASLFVVQGDAMATGISSFKIPPASMSSFDILGVAFFIFIYRHALDPFVAKVMKS  421

Query  861   RRAQGFTELQRMGVGLiiaimamvaagiVEHFRLKYASTDCPRC--PSSLSIFWQVPQYV  688
             +     TELQRMG+GL++AIMAMV+AG+VE FRLKYA  DC +C   SSLSIFWQVPQYV
Sbjct  422   K----LTELQRMGIGLVLAIMAMVSAGLVEKFRLKYAIKDCNQCDGSSSLSIFWQVPQYV  477

Query  687   LIGASEVFMYVGQLEFFNGQAPEGLKSFASALCMTSISLGNYVSSLLVSIVMRISTTHRM  508
             L GASEVFMYV QLEFFN Q P+GLKSF SALCMTSISLGNYVSSLLV+IVM+IST   +
Sbjct  478   LTGASEVFMYVPQLEFFNAQTPDGLKSFGSALCMTSISLGNYVSSLLVAIVMKISTKGDI  537

Query  507   PGWIPGNLNKGHLDRFYFLLAALTTADFVVYILCAKWYKYIEFEER  370
             PGWIPGNLN GHLDRFYFLLAALTTAD VVY+  AKWYK I+FEE 
Sbjct  538   PGWIPGNLNLGHLDRFYFLLAALTTADLVVYVALAKWYKSIQFEEN  583



>ref|XP_008373542.1| PREDICTED: protein NRT1/ PTR FAMILY 7.3 [Malus domestica]
Length=596

 Score =   773 bits (1997),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 400/589 (68%), Positives = 484/589 (82%), Gaps = 10/589 (2%)
 Frame = -3

Query  2085  KASREECTLDGTVDHYGRPALRSATGGWFAGVLLLVNQGLATLAFFGVGVNLVLFLTRVM  1906
             K  ++ CTLDGTVD +GRPA+R+ +G W AG+++L+NQGLATLAFFGVGVNLVL+LTRV+
Sbjct  13    KEDQDACTLDGTVDMHGRPAIRAKSGKWVAGIIILLNQGLATLAFFGVGVNLVLYLTRVL  72

Query  1905  GQDNADAANNVSKWTGTVYLFSLLGAFLSDSYWGRYKTCAIFQLIYVVGLISVSIFSFIF  1726
              QDNA AANNVSKWTGTVY+FSL+GAFLSDSYWGRYKTC+IFQLI+V+GL+S+S+ S +F
Sbjct  73    QQDNATAANNVSKWTGTVYIFSLVGAFLSDSYWGRYKTCSIFQLIFVIGLVSLSLSSQLF  132

Query  1725  LVKPKGCGDENTPCRSPSRIHIAVYYVSIYLVALGNGGYQPNIATFGSDQFDGDHAHESV  1546
             L+ PKGCG +  PC S S   I ++Y+SIYL+ALG GGYQPNIATFG+DQ+D +H+ E +
Sbjct  133   LLNPKGCGSKANPCGSHSSWKIWLFYLSIYLIALGYGGYQPNIATFGADQYDEEHSKEGL  192

Query  1545  SKVAFFSYFYLALNLGSLFSNTVLVYFEDKGMWTLGFWastvsavlalllflVGTPRYRH  1366
             +KVAFFSYFYLA+NLGSLFSNT+L +FED+G+W +GFWAS  SA  AL+LFL GT RYRH
Sbjct  193   AKVAFFSYFYLAMNLGSLFSNTILGFFEDEGVWAIGFWASAASAFAALVLFLGGTARYRH  252

Query  1365  FAPKGNPLSRFSQVLVASARKWNVHLPSDGDDHRLYEIQEHDSST--RKILHTEGFKFLD  1192
             F P GNPL RF QVLVA+ +K   H+P  G+D  LY+   ++SST  RKI +T GFKFLD
Sbjct  253   FKPNGNPLXRFCQVLVAAVKKCRAHMPQGGED--LYDESNNESSTSNRKIXYTHGFKFLD  310

Query  1191  KAAVITTKESVRDLEERNI-NPWRLCSVTQVEEVKCILRLLPIWLCTILYSVVFTQMASL  1015
             +AA I++++   D +++ I +PWRLC ++QVEEVKCILRLLPIWLCTI+YSVVFTQMASL
Sbjct  311   RAAYISSRD--LDYQKQGIRSPWRLCPISQVEEVKCILRLLPIWLCTIIYSVVFTQMASL  368

Query  1014  FVEQGAAMRTNIAGFHIPPASMSSFDILSVAAFIFIYRRILDPLIASLKKTRRAQGFTEL  835
             FVEQGAAM+T I  F IPPASMSSFDI+SVA FIFIYRRI+DP +  +KK+  A+G TEL
Sbjct  369   FVEQGAAMKTTIPNFSIPPASMSSFDIISVAVFIFIYRRIIDPFVGRIKKS-DAKGLTEL  427

Query  834   QRMGVGLiiaimamvaagiVEHFRLKYASTDCPRC--PSSLSIFWQVPQYVLIGASEVFM  661
             QRMGVGL+IA  AM++AGIVE +RLKYA  +CP C   SSLSIFWQ+PQY  IGASEVFM
Sbjct  428   QRMGVGLVIAXXAMLSAGIVECYRLKYADKECPHCDGSSSLSIFWQIPQYACIGASEVFM  487

Query  660   YVGQLEFFNGQAPEGLKSFASALCMTSISLGNYVSSLLVSIVMRISTTHRMPGWIPGNLN  481
             YVGQLEFFN Q P+GLKSF SALCMTSISLGNY S+ LVS+VM+ ST   MPGWIPGNLN
Sbjct  488   YVGQLEFFNAQTPDGLKSFGSALCMTSISLGNYFSTFLVSVVMKFSTEDHMPGWIPGNLN  547

Query  480   KGHLDRFYFLLAALTTADFVVYILCAKWYKYIEFEERNSCLKNIGDSKL  334
             +GHLDRFYFLLA LT+ D +VYI CAKWYK I+ E R     + G+ K+
Sbjct  548   RGHLDRFYFLLAGLTSIDXIVYIACAKWYKNIKLEGRFEVDDDQGNLKV  596



>ref|XP_009792818.1| PREDICTED: protein NRT1/ PTR FAMILY 7.3-like isoform X1 [Nicotiana 
sylvestris]
Length=595

 Score =   773 bits (1996),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 399/605 (66%), Positives = 484/605 (80%), Gaps = 14/605 (2%)
 Frame = -3

Query  2139  AFLNITKMFFIKNERDEEKASREECTLDGTVDHYGRPALRSATGGWFAGVLLLVNQGLAT  1960
             A L ++K   +K E ++E      CT DGT+D +G PA+R  TG W AG++LL+NQGLAT
Sbjct  2     ACLELSKEVKLKGEEEQE------CTNDGTIDFHGMPAIRGKTGTWKAGIVLLLNQGLAT  55

Query  1959  LAFFGVGVNLVLFLTRVMGQDNADAANNVSKWTGTVYLFSLLGAFLSDSYWGRYKTCAIF  1780
             LAFFGVGVNLVLFLTRVM ++NA+AAN+VSKWTGTVY+FSL+GAFLSDSYWGR+K+CAIF
Sbjct  56    LAFFGVGVNLVLFLTRVMQENNAEAANSVSKWTGTVYIFSLVGAFLSDSYWGRFKSCAIF  115

Query  1779  QLIYVVGLISVSIFSFIFLVKPKGCGDENTPCRSPSRIHIAVYYVSIYLVALGNGGYQPN  1600
             Q+IYV+GL+ +S+ + ++L+KPKGCGD  T C   S + I+++Y+S+Y++ALG GGYQPN
Sbjct  116   QVIYVIGLVLLSLATQLYLLKPKGCGDRTTLCGPHSTMEISLFYISVYMIALGYGGYQPN  175

Query  1599  IATFGSDQFDGDHAHESVSKVAFFSYFYLALNLGSLFSNTVLVYFEDKGMWTLGFWastv  1420
             IATFG+DQFD     E  SK AFFSYFYLALNLGSLFSNT+L YFED GMW LGFWAS  
Sbjct  176   IATFGADQFDEHDPREKQSKQAFFSYFYLALNLGSLFSNTILDYFEDDGMWALGFWASAA  235

Query  1419  savlalllflVGTPRYRHFAPKGNPLSRFSQVLVASARKWNVHLPSDGDDHRLYEIQEHD  1240
             SA  AL+LFL GT +YRHF   GNP++RFSQV++A++ KW V +P + D   LYE  +  
Sbjct  236   SAFAALVLFLGGTVKYRHFRSSGNPITRFSQVIIAASNKWRVAIPENED--ALYEGDDES  293

Query  1239  SST--RKILHTEGFKFLDKAAVITTKESVRDLEERNINPWRLCSVTQVEEVKCILRLLPI  1066
             S T  RK+LHT+GFKFLDKAA+IT+KE + + ++ N NPWRLC ++QVEEVKCILRL+PI
Sbjct  294   SRTAGRKMLHTQGFKFLDKAALITSKE-LGNEKQSNRNPWRLCPISQVEEVKCILRLMPI  352

Query  1065  WLCTILYSVVFTQMASLFVEQGAAMRTNIAGFHIPPASMSSFDILSVAAFIFIYRRILDP  886
             WLCTI+YSVVFTQMAS+FVEQG AM+T I  F IP ASMSSFDI+SVA  IF+YRR+LDP
Sbjct  353   WLCTIIYSVVFTQMASIFVEQGDAMKTTIGKFRIPAASMSSFDIMSVAVVIFLYRRVLDP  412

Query  885   LIASLKKTR-RAQGFTELQRMGVGLiiaimamvaagiVEHFRLKYASTDCPRCPSSLSIF  709
              +  +KK +  A G T+LQRMG+GLIIA+MAM++AGIVE +RLKYAS D  +  SSL+I 
Sbjct  413   FVKKIKKHKGEALGITQLQRMGIGLIIAVMAMLSAGIVECYRLKYASKD--QGSSSLTIL  470

Query  708   WQVPQYVLIGASEVFMYVGQLEFFNGQAPEGLKSFASALCMTSISLGNYVSSLLVSIVMR  529
             WQ+PQY L+GASEVFMYVGQLEFFN QAP+GLKSF SALCMTSISLGNYVS+LLVS+VM+
Sbjct  471   WQIPQYSLVGASEVFMYVGQLEFFNEQAPDGLKSFGSALCMTSISLGNYVSNLLVSVVMK  530

Query  528   ISTTHRMPGWIPGNLNKGHLDRFYFLLAALTTADFVVYILCAKWYKYIEFEERNSCLKNI  349
             ISTT  M GWIPGNLNKGHLDRFYFLLA LT  D V YI CAKWYK I+  E    LK  
Sbjct  531   ISTTDNMSGWIPGNLNKGHLDRFYFLLAGLTILDLVAYIACAKWYKGIKHGEITQQLKEE  590

Query  348   GDSKL  334
                K+
Sbjct  591   DKCKV  595



>ref|XP_009395136.1| PREDICTED: protein NRT1/ PTR FAMILY 7.3-like [Musa acuminata 
subsp. malaccensis]
Length=619

 Score =   774 bits (1998),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 395/587 (67%), Positives = 475/587 (81%), Gaps = 11/587 (2%)
 Frame = -3

Query  2109  IKNERDEEKASREECTLDGTVDHYGRPALRSATGGWFAGVLLLVNQGLATLAFFGVGVNL  1930
             +  + + EK  R E TLDG+VD  GRPA +  TGGW AG LLLVNQGLATLAFFGVGVNL
Sbjct  28    LNKDVNGEKDERYEYTLDGSVDARGRPAAKGKTGGWVAGALLLVNQGLATLAFFGVGVNL  87

Query  1929  VLFLTRVMGQDNADAANNVSKWTGTVYLFSLLGAFLSDSYWGRYKTCAIFQLIYVVGLIS  1750
             VLFLTRV+ Q+NADAANNVSKWTGTVY+FSL+GAFLSDSYWGRYKTCAIFQ+I+V+GL  
Sbjct  88    VLFLTRVLQQNNADAANNVSKWTGTVYIFSLVGAFLSDSYWGRYKTCAIFQVIFVIGLGL  147

Query  1749  VSIFSFIFLVKPKGCGDENTPCRSPSRIHIAVYYVSIYLVALGNGGYQPNIATFGSDQFD  1570
             +S+ +++FL+KP GCG E+  C   S + + V+Y+S+YL+ALGNGGYQPNIATFG+DQFD
Sbjct  148   LSLSTYLFLLKPSGCGQEHLLCGPHSSMELGVFYLSVYLIALGNGGYQPNIATFGADQFD  207

Query  1569  GDHAHESVSKVAFFSYFYLALNLGSLFSNTVLVYFEDKGMWTLGFWastvsavlalllfl  1390
              +   E+ SKV+FFSYFYLALNLGSLFSNT L YFEDKGMW LGFWAS  SA++AL+LFL
Sbjct  208   EEDRSEAHSKVSFFSYFYLALNLGSLFSNTFLGYFEDKGMWALGFWASAGSALVALVLFL  267

Query  1389  VGTPRYRHFAPKGNPLSRFSQVLVASARKWNVHLPSDGDDHRLYEIQEHDSS----TRKI  1222
              GTPRYRHF P GNPLSR  QV++A++RKW +H+P  G D  LYE++  + S    +RKI
Sbjct  268   CGTPRYRHFRPVGNPLSRVCQVVIAASRKWRLHIPLGGYD--LYEVEAKEVSAVAGSRKI  325

Query  1221  LHTEGFKFLDKAAVITTKES--VRDLEERNINPWRLCSVTQVEEVKCILRLLPIWLCTIL  1048
             LHT GFKFLD+AA++       +R+      +PWRLC +TQVEE+KC+LRLLPIWL TI+
Sbjct  326   LHTHGFKFLDRAAIVDPGNDFVIREDMSSARDPWRLCPITQVEELKCVLRLLPIWLTTII  385

Query  1047  YSVVFTQMASLFVEQGAAMRTNIAGFHIPPASMSSFDILSVAAFIFIYRRILDPLIASLK  868
             YSVVFTQMASLFVEQGAAM T +AGF IPPASMS+FDI+SVA FIF YRR+L PL++ L+
Sbjct  386   YSVVFTQMASLFVEQGAAMNTTVAGFRIPPASMSAFDIVSVALFIFFYRRLLSPLVSRLR  445

Query  867   KTRRAQGFTELQRMGVGLiiaimamvaagiVEHFRLKYASTDCPRCPSSLSIFWQVPQYV  688
             +  R  G TELQRMGVGL+IA++AM++AG VE +RLK+  + C    SSLSI WQ+PQY+
Sbjct  446   RNPR--GLTELQRMGVGLVIAVLAMISAGTVEVYRLKHVCSGCDD-DSSLSILWQIPQYM  502

Query  687   LIGASEVFMYVGQLEFFNGQAPEGLKSFASALCMTSISLGNYVSSLLVSIVMRISTTHRM  508
             LIGASEVFMYVGQLEFFN QAP+GLKSF SALCMTSIS GNYVSSLLV+IVM I+     
Sbjct  503   LIGASEVFMYVGQLEFFNSQAPDGLKSFGSALCMTSISFGNYVSSLLVTIVMEITARGER  562

Query  507   PGWIPGNLNKGHLDRFYFLLAALTTADFVVYILCAKWYKYIEFEERN  367
             PGWIP NLNKGH+DRFYFLLA+LT AD V ++ CA+WYK I+ E R+
Sbjct  563   PGWIPVNLNKGHMDRFYFLLASLTAADLVAFVACARWYKCIKLEGRH  609



>ref|XP_007139567.1| hypothetical protein PHAVU_008G040600g [Phaseolus vulgaris]
 gb|ESW11561.1| hypothetical protein PHAVU_008G040600g [Phaseolus vulgaris]
Length=598

 Score =   773 bits (1995),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 414/586 (71%), Positives = 480/586 (82%), Gaps = 13/586 (2%)
 Frame = -3

Query  2118  MFFIKNERDEEKASR--EECTLDGTVDHYGRPALRSATGGWFAGVLLLVNQGLATLAFFG  1945
             ++F K ++ + K +R  E CT DG +D +G PA+R+ TG W  G+L+LVNQGLATLAFFG
Sbjct  4     LYFNKKDKMKGKMNRDNEVCTSDGAIDSHGNPAVRTRTGTWVTGILILVNQGLATLAFFG  63

Query  1944  VGVNLVLFLTRVMGQDNADAANNVSKWTGTVYLFSLLGAFLSDSYWGRYKTCAIFQLIYV  1765
             VGVNLVLFLTRVMGQ+NA+AANNVSKWTGTVY+FSLLGAFLSDSYWGRY TCAIFQLI+V
Sbjct  64    VGVNLVLFLTRVMGQENAEAANNVSKWTGTVYIFSLLGAFLSDSYWGRYITCAIFQLIFV  123

Query  1764  VGLISVSIFSFIFLVKPKGCGDENTPCRSPSRIHIAVYYVSIYLVALGNGGYQPNIATFG  1585
             +GLI++S+ S IFL+ P GCGD+   C S S   +A +Y+SIYL+ALGNGGYQPNIATFG
Sbjct  124   IGLIALSLSSHIFLLNPSGCGDKELQCGSHSSYQMAFFYISIYLIALGNGGYQPNIATFG  183

Query  1584  SDQFDGDHAHESVSKVAFFSYFYLALNLGSLFSNTVLVYFEDKGMWTLGFWastvsavla  1405
             +DQFD     E +SKVAFFSYFYLALNLGSLFSNTVL YFEDKG WTLGFWAST SA +A
Sbjct  184   ADQFDEGDPKEQLSKVAFFSYFYLALNLGSLFSNTVLDYFEDKGQWTLGFWASTASAAIA  243

Query  1404  lllflVGTPRYRHFAPKGNPLSRFSQVLVASARKWNVHLPSDGDDHRLYEIQEHD-SSTR  1228
             L+LFL GT RYR+F   GNPL R  QV VA+A+KW   + +   + +LYE+QE   +  R
Sbjct  244   LVLFLCGTRRYRYFKSVGNPLPRVGQVFVAAAKKWKFKVSA---EDKLYEVQESSHNGRR  300

Query  1227  KILHTEGFKFLDKAAVITTKESVRDLEERNINPWRLCSVTQVEEVKCILRLLPIWLCTIL  1048
             K+L TEGF+FLDKAA+IT+K+ +  +EE   NPWRL +VTQVEEVKC+LRLLPIWLCTI+
Sbjct  301   KMLQTEGFRFLDKAALITSKD-LEQIEENKRNPWRLSTVTQVEEVKCVLRLLPIWLCTIM  359

Query  1047  YSVVFTQMASLFVEQGAAMRTNIAGFHIPPASMSSFDILSVAAFIFIYRRILDPLIASLK  868
             YSVVF QMASLFV QG AM T ++ F+IPPASMSSFDIL VA FIFIYR  LDPL+A   
Sbjct  360   YSVVFAQMASLFVVQGDAMDTRVSSFNIPPASMSSFDILGVAFFIFIYRHALDPLVAKTM  419

Query  867   KTRRAQGFTELQRMGVGLiiaimamvaagiVEHFRLKYASTDCPRC--PSSLSIFWQVPQ  694
             K++     TELQRMGVGL++AIMAMV+AG VE FRL+YA  DC +C   SSLSIFWQVPQ
Sbjct  420   KSK----LTELQRMGVGLVLAIMAMVSAGTVEKFRLRYAIKDCDKCDGSSSLSIFWQVPQ  475

Query  693   YVLIGASEVFMYVGQLEFFNGQAPEGLKSFASALCMTSISLGNYVSSLLVSIVMRISTTH  514
             YVL GASEVFMYV QLEFFNGQAPEGLKSF SALCMTSISLGNYVSSLLV+IVM+IST H
Sbjct  476   YVLTGASEVFMYVPQLEFFNGQAPEGLKSFGSALCMTSISLGNYVSSLLVAIVMKISTKH  535

Query  513   RMPGWIPGNLNKGHLDRFYFLLAALTTADFVVYILCAKWYKYIEFE  376
              +PGWIPGNLN GHLDRF+FLLAALT AD VVYI  AKWYKY++FE
Sbjct  536   DIPGWIPGNLNLGHLDRFFFLLAALTLADLVVYIALAKWYKYVKFE  581



>ref|XP_010449021.1| PREDICTED: protein NRT1/ PTR FAMILY 7.2-like [Camelina sativa]
 ref|XP_010449022.1| PREDICTED: protein NRT1/ PTR FAMILY 7.2-like [Camelina sativa]
Length=586

 Score =   772 bits (1993),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 395/574 (69%), Positives = 463/574 (81%), Gaps = 3/574 (1%)
 Frame = -3

Query  2094  DEEKASREECTLDGTVDHYGRPALRSATGGWFAGVLLLVNQGLATLAFFGVGVNLVLFLT  1915
             D++    E CT DG+VD +G PA+R+ TG W   +L+LVNQGLATLAFFGVGVNLVLFLT
Sbjct  2     DQKVRQFEVCTQDGSVDRHGNPAIRANTGKWLTAILILVNQGLATLAFFGVGVNLVLFLT  61

Query  1914  RVMGQDNADAANNVSKWTGTVYLFSLLGAFLSDSYWGRYKTCAIFQLIYVVGLISVSIFS  1735
             RVMGQDNA+AANNVSKWTGTVY+FSLLGAFLSDSYWGRYKTCAIFQ  +V GL+ +S+ +
Sbjct  62    RVMGQDNAEAANNVSKWTGTVYIFSLLGAFLSDSYWGRYKTCAIFQASFVAGLVMLSLST  121

Query  1734  FIFLVKPKGCGDENTPCRSPSRIHIAVYYVSIYLVALGNGGYQPNIATFGSDQFDGDHAH  1555
                L++P GCG E +PC+  S     ++Y+S+YL+ALG GGYQPNIATFG+DQFD + + 
Sbjct  122   GALLLEPSGCGVEESPCKPHSTFKTVIFYLSVYLIALGYGGYQPNIATFGADQFDAEDSA  181

Query  1554  ESVSKVAFFSYFYLALNLGSLFSNTVLVYFEDKGMWTLGFWastvsavlalllflVGTPR  1375
             E  SK+AFFSYFYLALNLGSLFSNTVL YFED+GMW LGFWAS  SA   L+LFL GTP+
Sbjct  182   EGHSKIAFFSYFYLALNLGSLFSNTVLGYFEDQGMWPLGFWASAGSAFAGLVLFLTGTPK  241

Query  1374  YRHFAPKGNPLSRFSQVLVASARKWNVHLPSDGDDHRLYEIQEHDSSTRKILHTEGFKFL  1195
             YRHF P+ +P SRF QVLVA+ RK  + +  + +D  LY+ +   +  +KILHT+GF+FL
Sbjct  242   YRHFTPRESPWSRFCQVLVAATRKAKIGV--NYEDLNLYDSETQRTGDKKILHTKGFRFL  299

Query  1194  DKAAVITTKESVRDLEE-RNINPWRLCSVTQVEEVKCILRLLPIWLCTILYSVVFTQMAS  1018
             D+AA++T  +    +E     +PWRLCSVTQVEEVKC+LRL+PIWLCTILYSVVFTQMAS
Sbjct  300   DRAAIVTPDDEAEKVESGSKYDPWRLCSVTQVEEVKCVLRLIPIWLCTILYSVVFTQMAS  359

Query  1017  LFVEQGAAMRTNIAGFHIPPASMSSFDILSVAAFIFIYRRILDPLIASLKKTRRAQGFTE  838
             LFV QGAAM+TNI  F IP +SMSSFDILSVA FIF YRR LDPL A L KT   +G TE
Sbjct  360   LFVVQGAAMKTNIKSFRIPASSMSSFDILSVAFFIFAYRRFLDPLFARLNKTEPNKGLTE  419

Query  837   LQRMGVGLiiaimamvaagiVEHFRLKYASTDCPRCPSSLSIFWQVPQYVLIGASEVFMY  658
             LQRMG+GL+IAIMAM++AG VE +RLK    +     SSLSIFWQVPQY+LIGASEVFMY
Sbjct  420   LQRMGIGLVIAIMAMISAGTVEIYRLKNKEPESTSDSSSLSIFWQVPQYMLIGASEVFMY  479

Query  657   VGQLEFFNGQAPEGLKSFASALCMTSISLGNYVSSLLVSIVMRISTTHRMPGWIPGNLNK  478
             VGQLEFFN QAP GLKSFASALCM SISLGNYVSSLLVSIVM+ STT  +PGWIP NLNK
Sbjct  480   VGQLEFFNSQAPTGLKSFASALCMASISLGNYVSSLLVSIVMKFSTTAEVPGWIPENLNK  539

Query  477   GHLDRFYFLLAALTTADFVVYILCAKWYKYIEFE  376
             GHL+RFYFLLA LT ADFVVY++CAKWYKYI+ E
Sbjct  540   GHLERFYFLLAGLTAADFVVYLICAKWYKYIKSE  573



>ref|XP_006283396.1| hypothetical protein CARUB_v10004438mg [Capsella rubella]
 gb|EOA16294.1| hypothetical protein CARUB_v10004438mg [Capsella rubella]
Length=586

 Score =   771 bits (1990),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 396/574 (69%), Positives = 464/574 (81%), Gaps = 3/574 (1%)
 Frame = -3

Query  2094  DEEKASREECTLDGTVDHYGRPALRSATGGWFAGVLLLVNQGLATLAFFGVGVNLVLFLT  1915
             D++    E CT DG+VD +G PA+R+ TG W   +L+LVNQGLATLAFFGVGVNLVLFLT
Sbjct  2     DQKVRQFEVCTQDGSVDRHGNPAIRANTGKWLTAILILVNQGLATLAFFGVGVNLVLFLT  61

Query  1914  RVMGQDNADAANNVSKWTGTVYLFSLLGAFLSDSYWGRYKTCAIFQLIYVVGLISVSIFS  1735
             RVMGQDNA+AANNVSKWTGTVY+FSLLGAFLSDSYWGRYKTCAIFQ  +V GL+ +S+ +
Sbjct  62    RVMGQDNAEAANNVSKWTGTVYIFSLLGAFLSDSYWGRYKTCAIFQASFVAGLVMLSLST  121

Query  1734  FIFLVKPKGCGDENTPCRSPSRIHIAVYYVSIYLVALGNGGYQPNIATFGSDQFDGDHAH  1555
                L++P GCG E++PC+  S +   ++Y+S+YL+ALG GGYQPNIATFG+DQFD + + 
Sbjct  122   GALLLEPSGCGVEDSPCKPHSTVKTVIFYLSVYLIALGYGGYQPNIATFGADQFDAEDSV  181

Query  1554  ESVSKVAFFSYFYLALNLGSLFSNTVLVYFEDKGMWTLGFWastvsavlalllflVGTPR  1375
             E  +KVAFFSYFYLALNLGSL SNTVL YFED+G W LGFWAS  SA   L+LFL GTP+
Sbjct  182   EGYAKVAFFSYFYLALNLGSLLSNTVLGYFEDQGEWPLGFWASAGSAFAGLVLFLTGTPK  241

Query  1374  YRHFAPKGNPLSRFSQVLVASARKWNVHLPSDGDDHRLYEIQEHDSSTRKILHTEGFKFL  1195
             YRHF P+ +P SRF QVLVA+ RK  + +  + +D  LY+ +   +  +KILHT+GF+FL
Sbjct  242   YRHFTPRESPWSRFCQVLVAATRKAKIGV--NYEDLNLYDSETQRTGDKKILHTKGFRFL  299

Query  1194  DKAAVITTKESVRDLEE-RNINPWRLCSVTQVEEVKCILRLLPIWLCTILYSVVFTQMAS  1018
             D+AA++T  +    +E     +PWRLCSVTQVEEVKC+LRLLPIWLCTILYSVVFTQMAS
Sbjct  300   DRAAIVTPDDEAEKVESGSKYDPWRLCSVTQVEEVKCVLRLLPIWLCTILYSVVFTQMAS  359

Query  1017  LFVEQGAAMRTNIAGFHIPPASMSSFDILSVAAFIFIYRRILDPLIASLKKTRRAQGFTE  838
             LFV QGAAM+TNI  F IP +SMSSFDILSVA FIF YRR LDPL A L KT   +G TE
Sbjct  360   LFVVQGAAMKTNIKNFRIPASSMSSFDILSVAFFIFAYRRFLDPLFARLNKTEPNKGLTE  419

Query  837   LQRMGVGLiiaimamvaagiVEHFRLKYASTDCPRCPSSLSIFWQVPQYVLIGASEVFMY  658
             LQRMG+GL+IAIMAM++AGIVE +RLK          SSLSIFWQVPQY+LIGASEVFMY
Sbjct  420   LQRMGIGLVIAIMAMISAGIVEIYRLKNKEQGSSSGSSSLSIFWQVPQYMLIGASEVFMY  479

Query  657   VGQLEFFNGQAPEGLKSFASALCMTSISLGNYVSSLLVSIVMRISTTHRMPGWIPGNLNK  478
             VGQLEFFN QAP GLKSFASALCM SISLGNYVSSLLVSIVM+ISTT + PGWIP NLNK
Sbjct  480   VGQLEFFNSQAPTGLKSFASALCMASISLGNYVSSLLVSIVMKISTTDKFPGWIPENLNK  539

Query  477   GHLDRFYFLLAALTTADFVVYILCAKWYKYIEFE  376
             GHL+RFYFLLA LT ADFVVY++CAKWYKYI+ E
Sbjct  540   GHLERFYFLLAGLTAADFVVYLICAKWYKYIKSE  573



>ref|XP_002893724.1| proton-dependent oligopeptide transport family protein [Arabidopsis 
lyrata subsp. lyrata]
 gb|EFH69983.1| proton-dependent oligopeptide transport family protein [Arabidopsis 
lyrata subsp. lyrata]
Length=615

 Score =   771 bits (1992),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 397/572 (69%), Positives = 478/572 (84%), Gaps = 10/572 (2%)
 Frame = -3

Query  2064  TLDGTVDHYGRPALRSATGGWFAGVLLLVNQGLATLAFFGVGVNLVLFLTRVMGQDNADA  1885
             T DGTVD+YGRP++RS +G W AG+++L+NQGLATLAFFGVGVNLVLFLTRV+ Q+NADA
Sbjct  22    TRDGTVDYYGRPSIRSNSGQWVAGIVILLNQGLATLAFFGVGVNLVLFLTRVLQQNNADA  81

Query  1884  ANNVSKWTGTVYLFSLLGAFLSDSYWGRYKTCAIFQLIYVVGLISVSIFSFIFLVKPKGC  1705
             ANNVSKWTGTVY+FSL+GAFLSDSYWGRYKTCAIFQ+I+V+GL S+S+ S++FL++P+GC
Sbjct  82    ANNVSKWTGTVYIFSLVGAFLSDSYWGRYKTCAIFQVIFVIGLSSLSLSSYMFLIRPRGC  141

Query  1704  GDENTPCRSPSRIHIAVYYVSIYLVALGNGGYQPNIATFGSDQFDGDHAHESVSKVAFFS  1525
             GDE TPC S S + I ++Y SIYL+ALG GGYQPNIAT G+DQFD +H  E  SK+AFFS
Sbjct  142   GDEVTPCGSHSMMEITMFYFSIYLIALGYGGYQPNIATLGADQFDEEHPKEGYSKIAFFS  201

Query  1524  YFYLALNLGSLFSNTVLVYFEDKGMWTLGFWastvsavlalllflVGTPRYRHFAPKGNP  1345
             YFYLALNLGSLFSNT+L YFED+GMW LGFWAST SA++ L+LFLVGTPRYR+F P GNP
Sbjct  202   YFYLALNLGSLFSNTILGYFEDEGMWALGFWASTGSAIIGLILFLVGTPRYRYFMPTGNP  261

Query  1344  LSRFSQVLVASARKWNVHLPSDGDDHRLYEIQEH-----DSSTRKILHTEGFKFLDKAAV  1180
             LSRF QVLVA+ +K +V  P  G +  +Y+         +++ R+I+HT+ FKFLDKAA 
Sbjct  262   LSRFCQVLVAATKKSSVEAPLRGREE-MYDGDSQGKNASENTGRRIVHTDEFKFLDKAAY  320

Query  1179  ITTKESVRDLEERNINPWRLCSVTQVEEVKCILRLLPIWLCTILYSVVFTQMASLFVEQG  1000
             IT ++ + D ++  +NPWRLC VTQVEEVKCILRL+PIWLCTI+YSVVFTQMASLFVEQG
Sbjct  321   ITARD-LDDKKQDAVNPWRLCPVTQVEEVKCILRLMPIWLCTIIYSVVFTQMASLFVEQG  379

Query  999   AAMRTNIAGFHIPPASMSSFDILSVAAFIFIYRRILDPLIASLKKTRRAQGFTELQRMGV  820
             AAM T+++ F IPPASMSSFDILSVA FIF+YRR+L+P+    KK   ++G TEL RMG+
Sbjct  380   AAMNTSVSDFKIPPASMSSFDILSVALFIFLYRRVLEPVANRFKKN-GSKGITELHRMGI  438

Query  819   GLiiaimamvaagiVEHFRLKYASTDCPRC--PSSLSIFWQVPQYVLIGASEVFMYVGQL  646
             GL+IA++AM+AAGIVE +RLKYA   C  C   SSLSIFWQ PQY LIGASEVFMYVGQL
Sbjct  439   GLVIAVIAMIAAGIVECYRLKYADKSCTHCDGSSSLSIFWQAPQYSLIGASEVFMYVGQL  498

Query  645   EFFNGQAPEGLKSFASALCMTSISLGNYVSSLLVSIVMRISTTHRMPGWIPGNLNKGHLD  466
             EFFN Q P+GLKSF SALCM S+S+GN+VSSLLV++V++IST   MPGWIP NLNKGHLD
Sbjct  499   EFFNAQTPDGLKSFGSALCMMSMSMGNFVSSLLVTMVVKISTEDHMPGWIPRNLNKGHLD  558

Query  465   RFYFLLAALTTADFVVYILCAKWYKYIEFEER  370
             RFYFLLAALT+ D VVYI CAKWYK I+ E +
Sbjct  559   RFYFLLAALTSIDLVVYIACAKWYKPIKLEGK  590



>ref|XP_010919865.1| PREDICTED: protein NRT1/ PTR FAMILY 7.3-like isoform X1 [Elaeis 
guineensis]
Length=619

 Score =   771 bits (1991),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 402/585 (69%), Positives = 473/585 (81%), Gaps = 10/585 (2%)
 Frame = -3

Query  2109  IKNERDEEKASREEC--TLDGTVDHYGRPALRSATGGWFAGVLLLVNQGLATLAFFGVGV  1936
             ++ +   E   +E C  TLDG+VD  GRPA++ ++GGW  G+LLLVNQGLATLAFFGVGV
Sbjct  32    MEGDGGTEARGKECCDYTLDGSVDLRGRPAVKGSSGGWVTGILLLVNQGLATLAFFGVGV  91

Query  1935  NLVLFLTRVMGQDNADAANNVSKWTGTVYLFSLLGAFLSDSYWGRYKTCAIFQLIYVVGL  1756
             NLVLFLTRV+ Q+NADAANNVSKWTGTVY+FSL GAFLSDSYWGRYKTCAIFQ+I+VVGL
Sbjct  92    NLVLFLTRVLQQNNADAANNVSKWTGTVYIFSLFGAFLSDSYWGRYKTCAIFQVIFVVGL  151

Query  1755  ISVSIFSFIFLVKPKGCGDENTPCRSPSRIHIAVYYVSIYLVALGNGGYQPNIATFGSDQ  1576
             + +S+ + +FL++P GCGD + PC S S I + V+YVSIYLVA G GGYQPNIATFG+DQ
Sbjct  152   VLLSLCAHLFLLRPSGCGDGHAPCGSHSSIEVGVFYVSIYLVAFGYGGYQPNIATFGADQ  211

Query  1575  FDGDHAHESVSKVAFFSYFYLALNLGSLFSNTVLVYFEDKGMWTLGFWastvsavlalll  1396
             FD +   E+ SKV+FFSYFYLALNLGSLFSNT L Y +D+GMW LGFWAS  SA+LAL+L
Sbjct  212   FDEEDPGEAHSKVSFFSYFYLALNLGSLFSNTFLSYLQDQGMWALGFWASGASALLALVL  271

Query  1395  flVGTPRYRHFAPKGNPLSRFSQVLVASARKWNVHLPSDGDDHRLYEIQEHDSSTRKILH  1216
             FLV T RYRHF P GNPLSR  QV++A++RK  V +P  G+D  +       S TRKILH
Sbjct  272   FLVWTLRYRHFKPGGNPLSRICQVVIAASRKSRVRMPPGGEDLYVGGECAEVSGTRKILH  331

Query  1215  TEGFKFLDKAAVITTKESVRDLEERNI--NPWRLCSVTQVEEVKCILRLLPIWLCTILYS  1042
             TEGF FLD+AA + + +      ER+I  +PWRLC++TQVEEVKC+LRLLPIWLCTILYS
Sbjct  332   TEGFNFLDRAAYVDSNDFTIQ-GERSILRDPWRLCTITQVEEVKCVLRLLPIWLCTILYS  390

Query  1041  VVFTQMASLFVEQGAAMRTNIAGFHIPPASMSSFDILSVAAFIFIYRRILDPLIASLKKT  862
             VVFTQMASLFVEQGAAM TN+ GF IPPASMS+FDILSVA  IF  RR+L+P+I  LKK+
Sbjct  391   VVFTQMASLFVEQGAAMNTNVHGFRIPPASMSAFDILSVATVIFFNRRLLNPVICRLKKS  450

Query  861   RRAQGFTELQRMGVGLiiaimamvaagiVEHFRLKYASTDCPRCPSSLSIFWQVPQYVLI  682
              R  G TELQRMGVGL+IA+MAMV+A  VEHFRLK+A  +     SSLSI WQVPQYVLI
Sbjct  451   PR--GLTELQRMGVGLVIAVMAMVSACAVEHFRLKHAGGN---AGSSLSILWQVPQYVLI  505

Query  681   GASEVFMYVGQLEFFNGQAPEGLKSFASALCMTSISLGNYVSSLLVSIVMRISTTHRMPG  502
             GASEVFMYVGQLEFFNGQAP+GLKSF SALCMTS+SLGNYVS +LV+IVM I+     PG
Sbjct  506   GASEVFMYVGQLEFFNGQAPDGLKSFGSALCMTSMSLGNYVSDVLVTIVMEITAKGGRPG  565

Query  501   WIPGNLNKGHLDRFYFLLAALTTADFVVYILCAKWYKYIEFEERN  367
             WIPGNLN GH+DRFYFLLA LT+ DFVVY+ CAKWYK I+ E ++
Sbjct  566   WIPGNLNNGHMDRFYFLLAVLTSVDFVVYVACAKWYKCIKLEGKS  610



>ref|XP_009595682.1| PREDICTED: protein NRT1/ PTR FAMILY 7.3-like [Nicotiana tomentosiformis]
Length=599

 Score =   770 bits (1988),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 397/577 (69%), Positives = 472/577 (82%), Gaps = 8/577 (1%)
 Frame = -3

Query  2085  KASREECTLDGTVDHYGRPALRSATGGWFAGVLLLVNQGLATLAFFGVGVNLVLFLTRVM  1906
             K    ECT DGTVD  G+PA+R A+G W AG+++L+NQ LATLAFFGVGVNLVLFLTRV+
Sbjct  14    KGEEIECTKDGTVDLDGKPAIREASGKWVAGIMILLNQALATLAFFGVGVNLVLFLTRVL  73

Query  1905  GQDNADAANNVSKWTGTVYLFSLLGAFLSDSYWGRYKTCAIFQLIYVVGLISVSIFSFIF  1726
              ++NADAAN+VSKWTGTVY+ SL+GAFLSDSYWGR+KTCAIFQ+IYV GL  +++ S ++
Sbjct  74    KENNADAANSVSKWTGTVYICSLVGAFLSDSYWGRFKTCAIFQVIYVTGLALLALASQLY  133

Query  1725  LVKPKGCGDENTPCRSPSRIHIAVYYVSIYLVALGNGGYQPNIATFGSDQFDGDHAHESV  1546
             L+KPKGCGD  T C   S + I ++Y+S+Y++ALG GGYQPNIATFG+DQFD  H  ES 
Sbjct  134   LLKPKGCGDRMTLCGEHSTMGIGLFYISVYMIALGYGGYQPNIATFGADQFDEQHPRESQ  193

Query  1545  SKVAFFSYFYLALNLGSLFSNTVLVYFEDKGMWTLGFWastvsavlalllflVGTPRYRH  1366
             SKVAFFSYFYL +NLGSLFSNT+L YFED+GMW LGFWAS  SA  AL+LFL GT RYRH
Sbjct  194   SKVAFFSYFYLFMNLGSLFSNTILDYFEDEGMWALGFWASAASAFAALMLFLGGTARYRH  253

Query  1365  FAPKGNPLSRFSQVLVASARKWNVHLPSDGDDHRLYEIQEHDSST--RKILHTEGFKFLD  1192
             F   GNPL+RF+QVLVA+ +K  V  P + DD   Y+ ++ D++T  RK+LHT GFKFLD
Sbjct  254   FKSSGNPLARFAQVLVAATKKSRVETPENEDD--FYQGEDDDNTTGGRKMLHTHGFKFLD  311

Query  1191  KAAVITTKESVRDLEERNINPWRLCSVTQVEEVKCILRLLPIWLCTILYSVVFTQMASLF  1012
             +AAV+T++E + D ++ + NPWRLC ++QVEEVKCILRLLPIWLCTI+YSVVFTQMASLF
Sbjct  312   RAAVVTSRE-LDDQKQSDHNPWRLCPISQVEEVKCILRLLPIWLCTIIYSVVFTQMASLF  370

Query  1011  VEQGAAMRTNIAGFHIPPASMSSFDILSVAAFIFIYRRILDPLIASLKKTRRAQ-GFTEL  835
             VEQG AM+T IA F IP ASMS+FDILSVA  IF+ RR+L+PL++  KK +    G TEL
Sbjct  371   VEQGDAMQTTIANFRIPAASMSTFDILSVAGVIFLNRRVLNPLVSRFKKCKGDHTGLTEL  430

Query  834   QRMGVGLiiaimamvaagiVEHFRLKYASTDCPRCP--SSLSIFWQVPQYVLIGASEVFM  661
             QRMG+GL+IA+MAM++AGIVE +RLKYAS DC  C   SSL+IFWQVPQY  IGASEVFM
Sbjct  431   QRMGIGLVIAVMAMLSAGIVECYRLKYASNDCKNCEGSSSLNIFWQVPQYAFIGASEVFM  490

Query  660   YVGQLEFFNGQAPEGLKSFASALCMTSISLGNYVSSLLVSIVMRISTTHRMPGWIPGNLN  481
             YVGQLEFFN QAP+GLKSF SALCMTSISLGNYVSSLLVS+VM+IS T  MPGWIPGNLN
Sbjct  491   YVGQLEFFNAQAPDGLKSFGSALCMTSISLGNYVSSLLVSVVMKISATDNMPGWIPGNLN  550

Query  480   KGHLDRFYFLLAALTTADFVVYILCAKWYKYIEFEER  370
             KGHLDRFYFLLA LT  D V YI CAKWYK I+  E+
Sbjct  551   KGHLDRFYFLLAGLTLIDLVAYIACAKWYKNIKHSEK  587



>ref|XP_010919866.1| PREDICTED: protein NRT1/ PTR FAMILY 7.3-like isoform X2 [Elaeis 
guineensis]
Length=615

 Score =   770 bits (1989),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 402/585 (69%), Positives = 473/585 (81%), Gaps = 10/585 (2%)
 Frame = -3

Query  2109  IKNERDEEKASREEC--TLDGTVDHYGRPALRSATGGWFAGVLLLVNQGLATLAFFGVGV  1936
             ++ +   E   +E C  TLDG+VD  GRPA++ ++GGW  G+LLLVNQGLATLAFFGVGV
Sbjct  28    MEGDGGTEARGKECCDYTLDGSVDLRGRPAVKGSSGGWVTGILLLVNQGLATLAFFGVGV  87

Query  1935  NLVLFLTRVMGQDNADAANNVSKWTGTVYLFSLLGAFLSDSYWGRYKTCAIFQLIYVVGL  1756
             NLVLFLTRV+ Q+NADAANNVSKWTGTVY+FSL GAFLSDSYWGRYKTCAIFQ+I+VVGL
Sbjct  88    NLVLFLTRVLQQNNADAANNVSKWTGTVYIFSLFGAFLSDSYWGRYKTCAIFQVIFVVGL  147

Query  1755  ISVSIFSFIFLVKPKGCGDENTPCRSPSRIHIAVYYVSIYLVALGNGGYQPNIATFGSDQ  1576
             + +S+ + +FL++P GCGD + PC S S I + V+YVSIYLVA G GGYQPNIATFG+DQ
Sbjct  148   VLLSLCAHLFLLRPSGCGDGHAPCGSHSSIEVGVFYVSIYLVAFGYGGYQPNIATFGADQ  207

Query  1575  FDGDHAHESVSKVAFFSYFYLALNLGSLFSNTVLVYFEDKGMWTLGFWastvsavlalll  1396
             FD +   E+ SKV+FFSYFYLALNLGSLFSNT L Y +D+GMW LGFWAS  SA+LAL+L
Sbjct  208   FDEEDPGEAHSKVSFFSYFYLALNLGSLFSNTFLSYLQDQGMWALGFWASGASALLALVL  267

Query  1395  flVGTPRYRHFAPKGNPLSRFSQVLVASARKWNVHLPSDGDDHRLYEIQEHDSSTRKILH  1216
             FLV T RYRHF P GNPLSR  QV++A++RK  V +P  G+D  +       S TRKILH
Sbjct  268   FLVWTLRYRHFKPGGNPLSRICQVVIAASRKSRVRMPPGGEDLYVGGECAEVSGTRKILH  327

Query  1215  TEGFKFLDKAAVITTKESVRDLEERNI--NPWRLCSVTQVEEVKCILRLLPIWLCTILYS  1042
             TEGF FLD+AA + + +      ER+I  +PWRLC++TQVEEVKC+LRLLPIWLCTILYS
Sbjct  328   TEGFNFLDRAAYVDSNDFTIQ-GERSILRDPWRLCTITQVEEVKCVLRLLPIWLCTILYS  386

Query  1041  VVFTQMASLFVEQGAAMRTNIAGFHIPPASMSSFDILSVAAFIFIYRRILDPLIASLKKT  862
             VVFTQMASLFVEQGAAM TN+ GF IPPASMS+FDILSVA  IF  RR+L+P+I  LKK+
Sbjct  387   VVFTQMASLFVEQGAAMNTNVHGFRIPPASMSAFDILSVATVIFFNRRLLNPVICRLKKS  446

Query  861   RRAQGFTELQRMGVGLiiaimamvaagiVEHFRLKYASTDCPRCPSSLSIFWQVPQYVLI  682
              R  G TELQRMGVGL+IA+MAMV+A  VEHFRLK+A  +     SSLSI WQVPQYVLI
Sbjct  447   PR--GLTELQRMGVGLVIAVMAMVSACAVEHFRLKHAGGN---AGSSLSILWQVPQYVLI  501

Query  681   GASEVFMYVGQLEFFNGQAPEGLKSFASALCMTSISLGNYVSSLLVSIVMRISTTHRMPG  502
             GASEVFMYVGQLEFFNGQAP+GLKSF SALCMTS+SLGNYVS +LV+IVM I+     PG
Sbjct  502   GASEVFMYVGQLEFFNGQAPDGLKSFGSALCMTSMSLGNYVSDVLVTIVMEITAKGGRPG  561

Query  501   WIPGNLNKGHLDRFYFLLAALTTADFVVYILCAKWYKYIEFEERN  367
             WIPGNLN GH+DRFYFLLA LT+ DFVVY+ CAKWYK I+ E ++
Sbjct  562   WIPGNLNNGHMDRFYFLLAVLTSVDFVVYVACAKWYKCIKLEGKS  606



>gb|KHN11611.1| Nitrate transporter 1.5 [Glycine soja]
Length=604

 Score =   769 bits (1986),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 414/591 (70%), Positives = 473/591 (80%), Gaps = 13/591 (2%)
 Frame = -3

Query  2124  TKMFFIKNERDEEKASR--EECTLDGTVDHYGRPALRSATGGWFAGVLLLVNQGLATLAF  1951
             ++ F   +++ + K +R  E CT DG +D +G PA+R  TG W  G+L+LVNQGLATLAF
Sbjct  9     SRNFSSPSDKIKGKVNRGNEVCTSDGAIDSHGHPAVRKRTGTWTTGILILVNQGLATLAF  68

Query  1950  FGVGVNLVLFLTRVMGQDNADAANNVSKWTGTVYLFSLLGAFLSDSYWGRYKTCAIFQLI  1771
             FGVGVNLVLFLTRVMGQDNA+AANNVSKWTGTVYLFSLLGAFLSDSYWGRY TCAIFQ+I
Sbjct  69    FGVGVNLVLFLTRVMGQDNAEAANNVSKWTGTVYLFSLLGAFLSDSYWGRYMTCAIFQVI  128

Query  1770  YVVGLISVSIFSFIFLVKPKGCGDENTPCRSPSRIHIAVYYVSIYLVALGNGGYQPNIAT  1591
             +V+GLIS+S+ S I L+KP GCGD+   C S S    A +Y+SIYLVALGNGGYQPNIAT
Sbjct  129   FVIGLISLSLSSHISLLKPSGCGDKELQCGSHSSYQTAFFYLSIYLVALGNGGYQPNIAT  188

Query  1590  FGSDQFDGDHAHESVSKVAFFSYFYLALNLGSLFSNTVLVYFEDKGMWTLGFWastvsav  1411
             FG+DQFD     E +SKVAFFSYFYLALNLGSLFSNT+L YFEDKG WTLGFWAS  SA 
Sbjct  189   FGADQFDEGDPKERLSKVAFFSYFYLALNLGSLFSNTILDYFEDKGQWTLGFWASAGSAA  248

Query  1410  lalllflVGTPRYRHFAPKGNPLSRFSQVLVASARKWNVHLPSDGDDHRLYEIQE-HDSS  1234
             +AL+LFL GT RYR+F P GNPL R  QV VA+A+KW V +PS   +  LYE ++   S 
Sbjct  249   IALILFLCGTRRYRYFKPVGNPLPRVGQVFVAAAKKWKVKVPS---EENLYEDKKCSPSG  305

Query  1233  TRKILHTEGFKFLDKAAVITTKESVRDLEERNINPWRLCSVTQVEEVKCILRLLPIWLCT  1054
              RK+LHT+GF++LDKAA IT+K+ +  LEE   NPW L +VTQVEEVKCILRLLPIWLCT
Sbjct  306   RRKMLHTKGFRYLDKAAFITSKD-LEQLEENKRNPWCLSTVTQVEEVKCILRLLPIWLCT  364

Query  1053  ILYSVVFTQMASLFVEQGAAMRTNIAGFHIPPASMSSFDILSVAAFIFIYRRILDPLIAS  874
             I+YSVVF QMASLFV QG AM T I+ F IPPASMSSFDIL VA FIFIYR  LDP +A 
Sbjct  365   IMYSVVFAQMASLFVVQGDAMATGISSFKIPPASMSSFDILGVAFFIFIYRHALDPFVAK  424

Query  873   LKKTRRAQGFTELQRMGVGLiiaimamvaagiVEHFRLKYASTDCPRC--PSSLSIFWQV  700
             + K++     TELQRMG+GL++AIMAMV+AG+VE FRLK+A  DC  C   SSLSIFWQV
Sbjct  425   VMKSK----LTELQRMGIGLVLAIMAMVSAGLVEKFRLKFAIKDCSNCDGSSSLSIFWQV  480

Query  699   PQYVLIGASEVFMYVGQLEFFNGQAPEGLKSFASALCMTSISLGNYVSSLLVSIVMRIST  520
             PQYVL GASEVFMYV QLEFFN Q P+GLKSF SALCMTSISLGNYVSSLLV+IVM+IST
Sbjct  481   PQYVLTGASEVFMYVPQLEFFNAQTPDGLKSFGSALCMTSISLGNYVSSLLVAIVMKIST  540

Query  519   THRMPGWIPGNLNKGHLDRFYFLLAALTTADFVVYILCAKWYKYIEFEERN  367
                +PGWIPGNLN GHLDRFYFLLAALTT D VVY+  AKWYKYI FE  N
Sbjct  541   KGDIPGWIPGNLNLGHLDRFYFLLAALTTVDLVVYVALAKWYKYINFEGNN  591



>ref|XP_010434145.1| PREDICTED: protein NRT1/ PTR FAMILY 7.2 isoform X1 [Camelina 
sativa]
 ref|XP_010434147.1| PREDICTED: protein NRT1/ PTR FAMILY 7.2 isoform X2 [Camelina 
sativa]
Length=586

 Score =   768 bits (1983),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 394/574 (69%), Positives = 464/574 (81%), Gaps = 3/574 (1%)
 Frame = -3

Query  2094  DEEKASREECTLDGTVDHYGRPALRSATGGWFAGVLLLVNQGLATLAFFGVGVNLVLFLT  1915
             D++    E CT DG+VD +G PA+R+ TG W   +L+LVNQGLATLAFFGVGVNLVLFLT
Sbjct  2     DQKVRQFEVCTQDGSVDRHGNPAIRANTGKWLTAILILVNQGLATLAFFGVGVNLVLFLT  61

Query  1914  RVMGQDNADAANNVSKWTGTVYLFSLLGAFLSDSYWGRYKTCAIFQLIYVVGLISVSIFS  1735
             RVMGQDNA+AANNVSKWTGTVY+FSLLGAFLSDSYWGRYKTCAIFQ  +V GL+ +S+ +
Sbjct  62    RVMGQDNAEAANNVSKWTGTVYIFSLLGAFLSDSYWGRYKTCAIFQASFVAGLVMLSLST  121

Query  1734  FIFLVKPKGCGDENTPCRSPSRIHIAVYYVSIYLVALGNGGYQPNIATFGSDQFDGDHAH  1555
                L++P GCG E +PC+  S     ++Y+S+YL+ALG GGYQPNIATFG+DQFD + + 
Sbjct  122   GALLLEPSGCGVEESPCKPHSTFKTVIFYLSVYLIALGYGGYQPNIATFGADQFDAEDSA  181

Query  1554  ESVSKVAFFSYFYLALNLGSLFSNTVLVYFEDKGMWTLGFWastvsavlalllflVGTPR  1375
             E  SK+AFFSYFYLALNLGSLFSNTVL YFED+G W LGFWAS  SA   L+LFL GTP+
Sbjct  182   EGHSKIAFFSYFYLALNLGSLFSNTVLGYFEDQGNWPLGFWASAGSAFAGLVLFLTGTPK  241

Query  1374  YRHFAPKGNPLSRFSQVLVASARKWNVHLPSDGDDHRLYEIQEHDSSTRKILHTEGFKFL  1195
             YRHF P+ +P SRF QVLVA+ RK  + +  + +D  LY+ +   +  +KILHT+GF+FL
Sbjct  242   YRHFTPRESPWSRFCQVLVAATRKAKIGV--NYEDLNLYDSETQRTGDKKILHTKGFRFL  299

Query  1194  DKAAVITTKESVRDLEE-RNINPWRLCSVTQVEEVKCILRLLPIWLCTILYSVVFTQMAS  1018
             D+AA++T  +    +E     +PWRLCSVTQVEEVKC+LRL+PIWLCTILYSVVFTQMAS
Sbjct  300   DRAAIVTPDDEAEKVESGSKYDPWRLCSVTQVEEVKCVLRLIPIWLCTILYSVVFTQMAS  359

Query  1017  LFVEQGAAMRTNIAGFHIPPASMSSFDILSVAAFIFIYRRILDPLIASLKKTRRAQGFTE  838
             LFV QGAAM+TNI  F IP +SMSSFDILSVA FIF YRR LDPL A L KT   +G +E
Sbjct  360   LFVVQGAAMKTNIKSFRIPASSMSSFDILSVAFFIFAYRRFLDPLFARLNKTEPNKGLSE  419

Query  837   LQRMGVGLiiaimamvaagiVEHFRLKYASTDCPRCPSSLSIFWQVPQYVLIGASEVFMY  658
             LQRMG+GL+IAIMAM++AGIVE +RLK+   +     SSLSIFWQVPQY+LIGASEVFMY
Sbjct  420   LQRMGIGLVIAIMAMISAGIVEIYRLKHKEPESTSDSSSLSIFWQVPQYMLIGASEVFMY  479

Query  657   VGQLEFFNGQAPEGLKSFASALCMTSISLGNYVSSLLVSIVMRISTTHRMPGWIPGNLNK  478
             VGQLEFFN QAP GLKSFASALCM SISLGNYVSSLLVSIVM+ STT  +PGWIP NLNK
Sbjct  480   VGQLEFFNSQAPTGLKSFASALCMASISLGNYVSSLLVSIVMKFSTTDEVPGWIPENLNK  539

Query  477   GHLDRFYFLLAALTTADFVVYILCAKWYKYIEFE  376
             GHL+RFYFLLA LT ADFVVY++CAKWYKYI+ E
Sbjct  540   GHLERFYFLLAGLTAADFVVYLICAKWYKYIKSE  573



>ref|XP_004245877.1| PREDICTED: protein NRT1/ PTR FAMILY 7.3 [Solanum lycopersicum]
Length=591

 Score =   768 bits (1983),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 393/573 (69%), Positives = 468/573 (82%), Gaps = 10/573 (2%)
 Frame = -3

Query  2091  EEKASREECTLDGTVDHYGRPALRSATGGWFAGVLLLVNQGLATLAFFGVGVNLVLFLTR  1912
             E K   E+CT DGTVD YG PA ++ TG W AG++LL+NQGLATLAFFGVGVNLVLFLTR
Sbjct  9     EVKGKEEDCTNDGTVDFYGMPANKAKTGKWLAGIMLLLNQGLATLAFFGVGVNLVLFLTR  68

Query  1911  VMGQDNADAANNVSKWTGTVYLFSLLGAFLSDSYWGRYKTCAIFQLIYVVGLISVSIFSF  1732
             V+ Q+NA+AANNVS WTGTVY+FSLLGAFLSDSYWGR+K+CAIFQ+IYV GL+ +S+ + 
Sbjct  69    VLQQNNAEAANNVSIWTGTVYIFSLLGAFLSDSYWGRFKSCAIFQVIYVTGLVLLSLTTQ  128

Query  1731  IFLVKPKGCGDENTPCRSPSRIHIAVYYVSIYLVALGNGGYQPNIATFGSDQFDGDHAHE  1552
              +L+KP+GCG+    C   S + I+++YVS+Y++ALG GGYQPNIATFG+DQFD     E
Sbjct  129   RYLLKPEGCGEREILCGEHSSMEISLFYVSVYMIALGYGGYQPNIATFGADQFDARDPRE  188

Query  1551  SVSKVAFFSYFYLALNLGSLFSNTVLVYFEDKGMWTLGFWastvsavlalllflVGTPRY  1372
               SK+AFFSYFYLALNLGSLFSNTVL YFED+G W LGFWAS  SA   L+LFL GT +Y
Sbjct  189   KQSKLAFFSYFYLALNLGSLFSNTVLDYFEDEGKWALGFWASAASAFAGLVLFLGGTAKY  248

Query  1371  RHFAPKGNPLSRFSQVLVASARKWNVHLPSDGDDHRLYEIQEHDSSTRKILHTEGFKFLD  1192
             RHF   GNP+ RFSQV+VA+++KW+V  P + D+  LYE   +D S RK+LHT GF+FLD
Sbjct  249   RHFRSSGNPIIRFSQVIVAASKKWSVETPENEDE--LYE--GNDESDRKMLHTHGFRFLD  304

Query  1191  KAAVITTKESVRDLEERNINPWRLCSVTQVEEVKCILRLLPIWLCTILYSVVFTQMASLF  1012
             +AA+IT+KE      E+N N W LC V+QVEEVKCILRLLPIWLCTI+YSVVFTQMAS+F
Sbjct  305   RAALITSKEQDH---EKNRNQWLLCPVSQVEEVKCILRLLPIWLCTIVYSVVFTQMASIF  361

Query  1011  VEQGAAMRTNIAGFHIPPASMSSFDILSVAAFIFIYRRILDPLIASLKKTR-RAQGFTEL  835
             VEQG AM+T+I  F IP ASMS+FDI+SVA FIF+YRR+LDP++ ++KK +   QG T+L
Sbjct  362   VEQGDAMKTSIGNFRIPAASMSTFDIMSVAVFIFLYRRVLDPIVKNIKKIKGEGQGITQL  421

Query  834   QRMGVGLiiaimamvaagiVEHFRLKYASTDCPRCP--SSLSIFWQVPQYVLIGASEVFM  661
             QRMG+GL+IA+MAM++A IVE +RLKYA  +C  C   SSLSIFWQVPQY LIGASEVFM
Sbjct  422   QRMGIGLVIAVMAMLSAAIVECYRLKYAKKECRHCEGSSSLSIFWQVPQYSLIGASEVFM  481

Query  660   YVGQLEFFNGQAPEGLKSFASALCMTSISLGNYVSSLLVSIVMRISTTHRMPGWIPGNLN  481
             YVGQLEFFN QAPEGLKSF SALCMTSISLGNYVSSLLVS+VM+ISTT  M GWIPGNLN
Sbjct  482   YVGQLEFFNEQAPEGLKSFGSALCMTSISLGNYVSSLLVSVVMKISTTDNMSGWIPGNLN  541

Query  480   KGHLDRFYFLLAALTTADFVVYILCAKWYKYIE  382
             +GHLDRFYFLLA LT  D V +I CAKWYK I+
Sbjct  542   EGHLDRFYFLLAGLTILDLVAFIACAKWYKGIK  574



>ref|XP_009593649.1| PREDICTED: protein NRT1/ PTR FAMILY 7.3 isoform X1 [Nicotiana 
tomentosiformis]
Length=588

 Score =   768 bits (1982),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 393/585 (67%), Positives = 471/585 (81%), Gaps = 10/585 (2%)
 Frame = -3

Query  2085  KASREECTLDGTVDHYGRPALRSATGGWFAGVLLLVNQGLATLAFFGVGVNLVLFLTRVM  1906
             K   EECT DGTVD +G PA+R  TG W AG++LL+NQGLATLAFFGVGVNLVLFLTRVM
Sbjct  13    KGEEEECTNDGTVDFHGMPAIRGKTGTWKAGIILLLNQGLATLAFFGVGVNLVLFLTRVM  72

Query  1905  GQDNADAANNVSKWTGTVYLFSLLGAFLSDSYWGRYKTCAIFQLIYVVGLISVSIFSFIF  1726
              ++NA+AAN+VSKWTGTVY+FSL+GAFLSDSYWGR+K+CAIFQ+IYV+GL+ +S+ S ++
Sbjct  73    QENNAEAANSVSKWTGTVYIFSLVGAFLSDSYWGRFKSCAIFQVIYVIGLVLLSLASQLY  132

Query  1725  LVKPKGCGDENTPCRSPSRIHIAVYYVSIYLVALGNGGYQPNIATFGSDQFDGDHAHESV  1546
             L+KPKGCGD  T C + S + I+++Y+S+Y++ LG GGYQPNIATFG+DQFD     E  
Sbjct  133   LLKPKGCGDRTTLCGAHSTVEISLFYISVYMIGLGYGGYQPNIATFGADQFDEHDPREKQ  192

Query  1545  SKVAFFSYFYLALNLGSLFSNTVLVYFEDKGMWTLGFWastvsavlalllflVGTPRYRH  1366
             SK AFFSYFYLALNLGSLFSNT+L YFED GMW LGFWAS  SA  ALLLFL GT +YR 
Sbjct  193   SKQAFFSYFYLALNLGSLFSNTILDYFEDDGMWALGFWASAASAFAALLLFLGGTLKYRQ  252

Query  1365  FAPKGNPLSRFSQVLVASARKWNVHLPSDGDDHRLYEIQEHDSSTRKILHTEGFKFLDKA  1186
             F   GNP++RFSQV++A++ KW V +P + +D  LY+ +   ++ RK+LHT+GFKFLDKA
Sbjct  253   FRSSGNPITRFSQVIIAASNKWGVEIP-ENEDAALYD-ESSTTAARKMLHTQGFKFLDKA  310

Query  1185  AVITTKESVRDLEERNINPWRLCSVTQVEEVKCILRLLPIWLCTILYSVVFTQMASLFVE  1006
             A+IT+ E     ++ N NPWRLC ++QVEEVKCILRLLPIWLCTI+YSVVFTQMAS+FVE
Sbjct  311   ALITSNE-----KQSNRNPWRLCPISQVEEVKCILRLLPIWLCTIIYSVVFTQMASIFVE  365

Query  1005  QGAAMRTNIAGFHIPPASMSSFDILSVAAFIFIYRRILDPLIASLKKTR-RAQGFTELQR  829
             QG AM++ I  F IP ASMSSFDI+SVA  IF+YRR+LDP +  +KK +  A G T+ QR
Sbjct  366   QGDAMKSTIGKFRIPAASMSSFDIVSVAVVIFLYRRVLDPFVKKIKKHKGEAVGITQRQR  425

Query  828   MGVGLiiaimamvaagiVEHFRLKYASTDCPRCPSSLSIFWQVPQYVLIGASEVFMYVGQ  649
             MG+GL+IA+MAM++AGIVE +RLKYA  D  +  SSLSI WQ+PQY LIGASEVFMYVGQ
Sbjct  426   MGIGLVIAVMAMLSAGIVECYRLKYARKD--QGSSSLSILWQIPQYSLIGASEVFMYVGQ  483

Query  648   LEFFNGQAPEGLKSFASALCMTSISLGNYVSSLLVSIVMRISTTHRMPGWIPGNLNKGHL  469
             LEFFN QAP+GLKSF SALCMTSISLGNYVSSLLVS+VM+ISTT  M GWIP NLNKGHL
Sbjct  484   LEFFNEQAPDGLKSFGSALCMTSISLGNYVSSLLVSVVMKISTTDNMSGWIPANLNKGHL  543

Query  468   DRFYFLLAALTTADFVVYILCAKWYKYIEFEERNSCLKNIGDSKL  334
             DRFYFLLAALT  D V YI CAKWYK I+  E    LK     K+
Sbjct  544   DRFYFLLAALTILDLVAYIACAKWYKAIKHGEMIQQLKEEDKCKV  588



>ref|XP_010439444.1| PREDICTED: protein NRT1/ PTR FAMILY 7.2-like [Camelina sativa]
Length=586

 Score =   768 bits (1982),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 395/574 (69%), Positives = 462/574 (80%), Gaps = 3/574 (1%)
 Frame = -3

Query  2094  DEEKASREECTLDGTVDHYGRPALRSATGGWFAGVLLLVNQGLATLAFFGVGVNLVLFLT  1915
             D++    E CT DG+VD +G PA+R+ TG W   +L+LVNQGLATLAFFGVGVNLVLFLT
Sbjct  2     DQKVRQFEVCTQDGSVDRHGNPAIRANTGKWLTAILILVNQGLATLAFFGVGVNLVLFLT  61

Query  1914  RVMGQDNADAANNVSKWTGTVYLFSLLGAFLSDSYWGRYKTCAIFQLIYVVGLISVSIFS  1735
             RVMGQDNA+AANNVSKWTGTVY+FSLLGAFLSDSYWGRYKTCAIFQ  +V GL+ +S+ +
Sbjct  62    RVMGQDNAEAANNVSKWTGTVYIFSLLGAFLSDSYWGRYKTCAIFQASFVAGLVMLSLST  121

Query  1734  FIFLVKPKGCGDENTPCRSPSRIHIAVYYVSIYLVALGNGGYQPNIATFGSDQFDGDHAH  1555
                L++P GCG E  PC+  S     ++Y+S+YL+ALG GGYQPNIATFG+DQFD + + 
Sbjct  122   GALLLEPSGCGVEELPCKPHSTFKTVIFYLSVYLIALGYGGYQPNIATFGADQFDAEDSA  181

Query  1554  ESVSKVAFFSYFYLALNLGSLFSNTVLVYFEDKGMWTLGFWastvsavlalllflVGTPR  1375
             E  SK+AFFSYFYLALNLGSLFSNTVL YFED+G W LGFWAS  SA   L+LFL GTP+
Sbjct  182   EGHSKIAFFSYFYLALNLGSLFSNTVLGYFEDQGKWPLGFWASAGSAFAGLVLFLTGTPK  241

Query  1374  YRHFAPKGNPLSRFSQVLVASARKWNVHLPSDGDDHRLYEIQEHDSSTRKILHTEGFKFL  1195
             YRHF P+ +P SRF QVLVA+ RK  + +  + +D  LY+ +   +  +KILHT+GF+FL
Sbjct  242   YRHFTPRESPWSRFCQVLVAATRKAKIGV--NYEDLNLYDSETQRTGDKKILHTKGFRFL  299

Query  1194  DKAAVITTKESVRDLEE-RNINPWRLCSVTQVEEVKCILRLLPIWLCTILYSVVFTQMAS  1018
             D+AA++T  +    +E     +PWRLCSVTQVEEVKC+LRL+PIWLCTILYSVVFTQMAS
Sbjct  300   DRAAIVTPDDEAEKVESGSKYDPWRLCSVTQVEEVKCVLRLIPIWLCTILYSVVFTQMAS  359

Query  1017  LFVEQGAAMRTNIAGFHIPPASMSSFDILSVAAFIFIYRRILDPLIASLKKTRRAQGFTE  838
             LFV QGAAM+TNI  F IP +SMSSFDILSVA FIF YRR LDPL A L KT   +G +E
Sbjct  360   LFVVQGAAMKTNIKSFRIPASSMSSFDILSVAFFIFAYRRFLDPLFARLNKTEPNKGLSE  419

Query  837   LQRMGVGLiiaimamvaagiVEHFRLKYASTDCPRCPSSLSIFWQVPQYVLIGASEVFMY  658
             LQRMGVGL+IAIMAM++AGIVE +RLK    +     SSLSIFWQVPQY+LIGASEVFMY
Sbjct  420   LQRMGVGLVIAIMAMISAGIVEIYRLKNKEPESTSDSSSLSIFWQVPQYMLIGASEVFMY  479

Query  657   VGQLEFFNGQAPEGLKSFASALCMTSISLGNYVSSLLVSIVMRISTTHRMPGWIPGNLNK  478
             VGQLEFFN QAP GLKSFASALCM SISLGNYVSSLLVSIVM+ STT  +PGWIP NLNK
Sbjct  480   VGQLEFFNSQAPTGLKSFASALCMASISLGNYVSSLLVSIVMKFSTTDEVPGWIPENLNK  539

Query  477   GHLDRFYFLLAALTTADFVVYILCAKWYKYIEFE  376
             GHL+RFYFLLA LT ADFVVY++CAKWYKYI+ E
Sbjct  540   GHLERFYFLLAGLTAADFVVYLICAKWYKYIKSE  573



>ref|XP_006413747.1| hypothetical protein EUTSA_v10024762mg [Eutrema salsugineum]
 gb|ESQ55200.1| hypothetical protein EUTSA_v10024762mg [Eutrema salsugineum]
Length=583

 Score =   767 bits (1980),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 400/574 (70%), Positives = 465/574 (81%), Gaps = 5/574 (1%)
 Frame = -3

Query  2094  DEEKASREECTLDGTVDHYGRPALRSATGGWFAGVLLLVNQGLATLAFFGVGVNLVLFLT  1915
             D++    E  T DG+VD +G PA+R+ TG W   +L+LVNQGLATLAFFGVGVNLVLFLT
Sbjct  2     DQKVRQFEVYTQDGSVDRHGNPAIRAKTGKWLTAILILVNQGLATLAFFGVGVNLVLFLT  61

Query  1914  RVMGQDNADAANNVSKWTGTVYLFSLLGAFLSDSYWGRYKTCAIFQLIYVVGLISVSIFS  1735
             RVMGQDNA+AANNVSKWTGTVY+FSLLGAFLSDSYWGRYKTCAIFQ  +V GL+ +S+ +
Sbjct  62    RVMGQDNAEAANNVSKWTGTVYIFSLLGAFLSDSYWGRYKTCAIFQASFVAGLVMLSLCT  121

Query  1734  FIFLVKPKGCGDENTPCRSPSRIHIAVYYVSIYLVALGNGGYQPNIATFGSDQFDGDHAH  1555
               FL+ P GCG E   C+  S +   ++Y+S+YL+ALG GGYQPNIATFG+DQFD D + 
Sbjct  122   GAFLLDPSGCGIEEISCKPHSTVKTVLFYLSVYLIALGYGGYQPNIATFGADQFDADDSV  181

Query  1554  ESVSKVAFFSYFYLALNLGSLFSNTVLVYFEDKGMWTLGFWastvsavlalllflVGTPR  1375
             E  SK+AFFSYFYLALNLGSLFSNTVL YFED+G W LGFWAS  SA   L+LFL GTP+
Sbjct  182   EGHSKMAFFSYFYLALNLGSLFSNTVLGYFEDQGKWPLGFWASAGSAFAGLVLFLAGTPK  241

Query  1374  YRHFAPKGNPLSRFSQVLVASARKWNVHLPSDGDDHRLYEIQEHDSSTRKILHTEGFKFL  1195
             YRHF P+ +P SRF QVLVA+ RK  + +  D +D  LY+ +   +  +KILHT+GF+FL
Sbjct  242   YRHFTPRESPWSRFCQVLVAATRKAKIDV--DYEDMNLYDSETQRTGDKKILHTKGFRFL  299

Query  1194  DKAAVIT-TKESVRDLEERNINPWRLCSVTQVEEVKCILRLLPIWLCTILYSVVFTQMAS  1018
             D+AA++T   E+V+       +PWRLCSVTQVEEVKC+LRLLPIWLCTILYSVVFTQMAS
Sbjct  300   DRAAIVTPDDEAVKVETGSTYDPWRLCSVTQVEEVKCVLRLLPIWLCTILYSVVFTQMAS  359

Query  1017  LFVEQGAAMRTNIAGFHIPPASMSSFDILSVAAFIFIYRRILDPLIASLKKTRRAQGFTE  838
             LFVEQGAAM+TNI  F IP +SMSSFDILSVA FIF YRR LDPL A L KT   +G TE
Sbjct  360   LFVEQGAAMKTNIKSFRIPASSMSSFDILSVAFFIFAYRRFLDPLFARLNKTEPNKGLTE  419

Query  837   LQRMGVGLiiaimamvaagiVEHFRLKYASTDCPRCPSSLSIFWQVPQYVLIGASEVFMY  658
             LQRMG+GL+IAIMAM++AGIVE +RLK+ S+      SSLSIFWQVPQY++IGASEVFMY
Sbjct  420   LQRMGIGLVIAIMAMISAGIVEIYRLKHKSSV--SNSSSLSIFWQVPQYMMIGASEVFMY  477

Query  657   VGQLEFFNGQAPEGLKSFASALCMTSISLGNYVSSLLVSIVMRISTTHRMPGWIPGNLNK  478
             VGQLEFFN QAP GLKSFASALCM SISLGNYVSSLLVSIVM+IS    +PGWIPGNLNK
Sbjct  478   VGQLEFFNSQAPTGLKSFASALCMASISLGNYVSSLLVSIVMKISARDELPGWIPGNLNK  537

Query  477   GHLDRFYFLLAALTTADFVVYILCAKWYKYIEFE  376
             GHLDRFYFLLA LT ADFVVY++CAKWYKYI+ E
Sbjct  538   GHLDRFYFLLAGLTAADFVVYLVCAKWYKYIKSE  571



>ref|XP_010104361.1| Nitrate transporter 1.5 [Morus notabilis]
 gb|EXB99781.1| Nitrate transporter 1.5 [Morus notabilis]
Length=562

 Score =   766 bits (1977),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 401/559 (72%), Positives = 464/559 (83%), Gaps = 13/559 (2%)
 Frame = -3

Query  1980  VNQGLATLAFFGVGVNLVLFLTRVMGQDNADAANNVSKWTGTVYLFSLLGAFLSDSYWGR  1801
             VNQGL TLAFFGVGVNLVLFLTRV+ Q+NA AANNVSKWTGTVY+FSL GAFLSDSYWGR
Sbjct  5     VNQGLVTLAFFGVGVNLVLFLTRVLQQNNASAANNVSKWTGTVYIFSLFGAFLSDSYWGR  64

Query  1800  YKTCAIFQLIYVVGLISVSIFSFIFLVKPKGCGDENTPCRSPSRIHIAVYYVSIYLVALG  1621
             +KTCA+FQ I+VVGL+S+S+ + +FL+KPKGCGD+ T C   S +++A++Y++IYLVALG
Sbjct  65    FKTCAVFQAIFVVGLVSLSLSTNLFLLKPKGCGDQETKCGKHSNLNMALFYLAIYLVALG  124

Query  1620  NGGYQPNIATFGSDQFDGDHAHESVSKVAFFSYFYLALNLGSLFSNTVLVYFEDKGMWTL  1441
              GGYQP+I TFG+DQFD     E  SKVAFFSYFYLALNLGSLFSNT+LVYFED+GMW L
Sbjct  125   YGGYQPSICTFGADQFDEVDLKEGRSKVAFFSYFYLALNLGSLFSNTILVYFEDEGMWAL  184

Query  1440  GFWastvsavlalllflVGTPRYRHFAPKGNPLSRFSQVLVASARKWNVHLPSDGDDHRL  1261
             GFW S  SA  AL+LFLVGT RYRHF P GNPLSRF QV+ A+ +KW V +P  GDD  L
Sbjct  185   GFWVSAASAFAALVLFLVGTLRYRHFKPSGNPLSRFCQVIAAATKKWRVEMPPSGDD--L  242

Query  1260  YEIQEHDSS---TRKILHTEGFKFLDKAAVITTKESVRDLEERNINPWRLCSVTQVEEVK  1090
             YE    +SS   +RKILHT GFKFLD+AA I+++E +   ++ + NPWRLCSVTQVEEVK
Sbjct  243   YEEDGKESSINGSRKILHTHGFKFLDRAAYISSRE-MEVQQQGHRNPWRLCSVTQVEEVK  301

Query  1089  CILRLLPIWLCTILYSVVFTQMASLFVEQGAAMRTNIAGFHIPPASMSSFDILSVAAFIF  910
             CILRLLPIWLCTI+YSVVFTQMASLFVEQG+AM+T ++ F IPPASMSSFDILSVA FIF
Sbjct  302   CILRLLPIWLCTIIYSVVFTQMASLFVEQGSAMKTTVSNFRIPPASMSSFDILSVALFIF  361

Query  909   IYRRILDPLIASLKKTRRAQGFTELQRMGVGLiiaimamvaagiVEHFRLKYASTDCPRC  730
             I RRILDPL+  L+KT   +G +ELQRMGVGL+IA+MAMV+AGIVE +RL+YA  DC  C
Sbjct  362   INRRILDPLVGRLRKT-SPRGLSELQRMGVGLVIAVMAMVSAGIVECYRLEYARKDCTHC  420

Query  729   --PSSLSIFWQVPQYVLIGASEVFMYVGQLEFFNGQAPEGLKSFASALCMTSISLGNYVS  556
                SSLSIFWQVPQY  IGASEVFMYVGQLEFFN QAP+GLKSF SALCMTSISLGNYVS
Sbjct  421   EGSSSLSIFWQVPQYAFIGASEVFMYVGQLEFFNAQAPDGLKSFGSALCMTSISLGNYVS  480

Query  555   SLLVSIVMRISTTHRMPGWIPGNLNKGHLDRFYFLLAALTTADFVVYILCAKWYKYIEFE  376
             SLLVS+VM+IST   MPGWIPGNLNKGHLDRFYFLLAALT+ D VVYI CAKWYK I+ E
Sbjct  481   SLLVSMVMKISTEDHMPGWIPGNLNKGHLDRFYFLLAALTSIDLVVYIACAKWYKCIKLE  540

Query  375   ERNSCLKNIGDSKLQEDRS  319
              +  C +N  D+  ++D S
Sbjct  541   GK--CGEN--DNGDEDDES  555



>ref|XP_006358632.1| PREDICTED: nitrate transporter 1.5-like [Solanum tuberosum]
Length=594

 Score =   766 bits (1978),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 397/589 (67%), Positives = 474/589 (80%), Gaps = 16/589 (3%)
 Frame = -3

Query  2139  AFLNITKMFFIKNERDEEKASREECTLDGTVDHYGRPALRSATGGWFAGVLLLVNQGLAT  1960
             A L ++K   +K E        EECT DGTVD  G PA R+ TG W AG++LL+NQGLAT
Sbjct  2     ACLELSKEVKVKGE--------EECTNDGTVDFNGMPANRAKTGKWLAGIMLLLNQGLAT  53

Query  1959  LAFFGVGVNLVLFLTRVMGQDNADAANNVSKWTGTVYLFSLLGAFLSDSYWGRYKTCAIF  1780
             LAFFGVGVNLVLFLTRV+ Q+NA+AANNVS WTGTVY+FSLLGAFLSDSYWGR+K+CAIF
Sbjct  54    LAFFGVGVNLVLFLTRVLQQNNAEAANNVSIWTGTVYIFSLLGAFLSDSYWGRFKSCAIF  113

Query  1779  QLIYVVGLISVSIFSFIFLVKPKGCGDENTPCRSPSRIHIAVYYVSIYLVALGNGGYQPN  1600
             Q+IYV GL+ +S+ +  +L+KP+GCG+  T C   S + I+++YVS+Y++ALG GGYQPN
Sbjct  114   QVIYVTGLVLLSLTTQRYLLKPEGCGERETLCGVHSNMEISLFYVSVYMIALGYGGYQPN  173

Query  1599  IATFGSDQFDGDHAHESVSKVAFFSYFYLALNLGSLFSNTVLVYFEDKGMWTLGFWastv  1420
             IATFG+DQFD     E  SK+AFFSYFYLALNLGSLFSNTVL YFED+G W LGFWAS  
Sbjct  174   IATFGADQFDARDPREKQSKLAFFSYFYLALNLGSLFSNTVLDYFEDEGKWALGFWASAA  233

Query  1419  savlalllflVGTPRYRHFAPKGNPLSRFSQVLVASARKWNVHLPSDGDDHRLYEIQEHD  1240
             SA   L+LFL GT +YRHF   GNP+ RFSQV+VA+++KW+V    + D+  LYE    D
Sbjct  234   SAFAGLVLFLGGTAKYRHFRSSGNPIIRFSQVIVAASKKWSVETRENEDE--LYE--GDD  289

Query  1239  SSTRKILHTEGFKFLDKAAVITTKESVRDLEERNINPWRLCSVTQVEEVKCILRLLPIWL  1060
              S+RK+LHT GF+FLD+AA+IT+KE   + ++ N N WRLC V+QVEEVKCILRLLPIWL
Sbjct  290   ESSRKMLHTHGFRFLDRAALITSKEQDNE-KQSNRNQWRLCPVSQVEEVKCILRLLPIWL  348

Query  1059  CTILYSVVFTQMASLFVEQGAAMRTNIAGFHIPPASMSSFDILSVAAFIFIYRRILDPLI  880
             CTI+YSVVFTQMAS+FVEQG AM+T I  F IP ASMS+FDI+SVA FIF+YRRILDP++
Sbjct  349   CTIVYSVVFTQMASIFVEQGDAMKTTIGNFRIPAASMSTFDIMSVAVFIFLYRRILDPIV  408

Query  879   ASLKKTR-RAQGFTELQRMGVGLiiaimamvaagiVEHFRLKYASTDCPRCP--SSLSIF  709
              ++KK +   QG T+LQRMG+GL+IA+MAM++A IVE +RLKYA  +C  C   SSLSIF
Sbjct  409   KNIKKIKGEGQGITQLQRMGIGLVIAVMAMLSAAIVECYRLKYAKKECTHCEGSSSLSIF  468

Query  708   WQVPQYVLIGASEVFMYVGQLEFFNGQAPEGLKSFASALCMTSISLGNYVSSLLVSIVMR  529
             WQVPQY LIGASEVFMYVGQLEFFN QAP+GLKSF SALCMTSISLGNYVSSLLVS+VM+
Sbjct  469   WQVPQYSLIGASEVFMYVGQLEFFNEQAPDGLKSFGSALCMTSISLGNYVSSLLVSVVMK  528

Query  528   ISTTHRMPGWIPGNLNKGHLDRFYFLLAALTTADFVVYILCAKWYKYIE  382
             ISTT  M GWIPGNLN+GHLDRFYFLLA LT  D V +I CAKWYK I+
Sbjct  529   ISTTDNMSGWIPGNLNEGHLDRFYFLLAGLTILDLVAFIACAKWYKGIK  577



>ref|XP_009377057.1| PREDICTED: protein NRT1/ PTR FAMILY 7.3-like [Pyrus x bretschneideri]
Length=595

 Score =   766 bits (1978),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 396/575 (69%), Positives = 477/575 (83%), Gaps = 6/575 (1%)
 Frame = -3

Query  2085  KASREECTLDGTVDHYGRPALRSATGGWFAGVLLLVNQGLATLAFFGVGVNLVLFLTRVM  1906
             +  ++ECTLDGTVD +GRPA+RS +G W AG+++L+NQGLATLAFFGVGVNLVL+LTRV+
Sbjct  13    EEDQDECTLDGTVDMHGRPAVRSKSGRWVAGIIILLNQGLATLAFFGVGVNLVLYLTRVL  72

Query  1905  GQDNADAANNVSKWTGTVYLFSLLGAFLSDSYWGRYKTCAIFQLIYVVGLISVSIFSFIF  1726
              QDNA AANNVSKWTGTVY+FSL+GAFLSDSYWGRYKTC+IFQLI+V+GL+S+S+ S +F
Sbjct  73    QQDNATAANNVSKWTGTVYIFSLVGAFLSDSYWGRYKTCSIFQLIFVIGLVSLSLSSQLF  132

Query  1725  LVKPKGCGDENTPCRSPSRIHIAVYYVSIYLVALGNGGYQPNIATFGSDQFDGDHAHESV  1546
             L+ PKGCG +  PC S S   I ++Y+S YL+ALG GGYQPNIATFG+DQ+D + + E +
Sbjct  133   LLNPKGCGSKENPCGSHSSWKIWLFYLSTYLIALGYGGYQPNIATFGADQYDEEDSKEGL  192

Query  1545  SKVAFFSYFYLALNLGSLFSNTVLVYFEDKGMWTLGFWastvsavlalllflVGTPRYRH  1366
             SKVAFFSYFYLA+NLGSLFSNT+L +FED+G+W +GFWAS  SA   L+LFL GT RYRH
Sbjct  193   SKVAFFSYFYLAMNLGSLFSNTILGFFEDEGIWAIGFWASAASAFAGLVLFLGGTARYRH  252

Query  1365  FAPKGNPLSRFSQVLVASARKWNVHLPSDGDDHRLYEIQEHDSSTRKILHTEGFKFLDKA  1186
             F P GNPLSRF QVLVA+ +K  VH+P  G+D      +E  +S RKIL+T GFKFLD+A
Sbjct  253   FKPNGNPLSRFCQVLVAAMKKCRVHMPQGGEDLYDESNKESSNSNRKILYTHGFKFLDRA  312

Query  1185  AVITTKESVRDLEERNI-NPWRLCSVTQVEEVKCILRLLPIWLCTILYSVVFTQMASLFV  1009
             A I++++   D +++ I +PW LC ++QVEEVKCILRLLPIWLCTI+YSVVFTQMASLFV
Sbjct  313   AYISSRD--LDYQKQGIRSPWHLCPISQVEEVKCILRLLPIWLCTIIYSVVFTQMASLFV  370

Query  1008  EQGAAMRTNIAGFHIPPASMSSFDILSVAAFIFIYRRILDPLIASLKKTRRAQGFTELQR  829
             EQGAAM+T I  F IPPASMSSFDI+SVA FIFIYRRI+DP +  +KK+  A+G TELQR
Sbjct  371   EQGAAMKTTIPNFSIPPASMSSFDIISVAVFIFIYRRIIDPFVGRIKKS-DAKGLTELQR  429

Query  828   MGVGLiiaimamvaagiVEHFRLKYASTDCPRC--PSSLSIFWQVPQYVLIGASEVFMYV  655
             MG+GL+IA+MAM++AGIVE +RLKYA  +CP C   SSLSIFWQ+PQY  IGASEVFMYV
Sbjct  430   MGIGLVIAVMAMLSAGIVECYRLKYADKECPHCDGSSSLSIFWQIPQYACIGASEVFMYV  489

Query  654   GQLEFFNGQAPEGLKSFASALCMTSISLGNYVSSLLVSIVMRISTTHRMPGWIPGNLNKG  475
             GQLEFFN Q P+GLKSF SALCMTSISLGNY S+ LVS+VM+ ST   MPGWIPGNLN+G
Sbjct  490   GQLEFFNAQTPDGLKSFGSALCMTSISLGNYFSTFLVSVVMKFSTVDHMPGWIPGNLNRG  549

Query  474   HLDRFYFLLAALTTADFVVYILCAKWYKYIEFEER  370
             HLDRFYFLLA LT+ D +VYI CAKWYK I+ E R
Sbjct  550   HLDRFYFLLAVLTSIDLIVYIACAKWYKNIKLEGR  584



>ref|XP_009373444.1| PREDICTED: protein NRT1/ PTR FAMILY 7.3-like [Pyrus x bretschneideri]
Length=596

 Score =   764 bits (1974),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 397/587 (68%), Positives = 480/587 (82%), Gaps = 6/587 (1%)
 Frame = -3

Query  2085  KASREECTLDGTVDHYGRPALRSATGGWFAGVLLLVNQGLATLAFFGVGVNLVLFLTRVM  1906
             K  ++ CTLDGTVD +GRPA+R+ +G W AG+++L+NQGLATLAFFGVGVNLVL+LTRV+
Sbjct  13    KEDQDACTLDGTVDMHGRPAIRAKSGRWVAGIIILLNQGLATLAFFGVGVNLVLYLTRVL  72

Query  1905  GQDNADAANNVSKWTGTVYLFSLLGAFLSDSYWGRYKTCAIFQLIYVVGLISVSIFSFIF  1726
              QDNA AANNVSKWTGTVY+FSL+GAFLSDSYWGRYKTC+IFQLI+V+GL+S+S+ S +F
Sbjct  73    QQDNATAANNVSKWTGTVYIFSLVGAFLSDSYWGRYKTCSIFQLIFVIGLVSLSLSSQLF  132

Query  1725  LVKPKGCGDENTPCRSPSRIHIAVYYVSIYLVALGNGGYQPNIATFGSDQFDGDHAHESV  1546
             L+ PKGCG +  PC S S   I ++Y+SIYL+ALG GGYQPNIATFG+DQ+D +H+ E +
Sbjct  133   LLNPKGCGSKANPCGSHSSWKIWLFYLSIYLIALGYGGYQPNIATFGADQYDEEHSKEGL  192

Query  1545  SKVAFFSYFYLALNLGSLFSNTVLVYFEDKGMWTLGFWastvsavlalllflVGTPRYRH  1366
             +KVAFFSYFYLA+NLG LFSNT+L +FED+G+W +GFWAS  SA  AL+LFL GT RYRH
Sbjct  193   AKVAFFSYFYLAMNLGPLFSNTILGFFEDEGVWAIGFWASAASAFAALVLFLGGTARYRH  252

Query  1365  FAPKGNPLSRFSQVLVASARKWNVHLPSDGDDHRLYEIQEHDSSTRKILHTEGFKFLDKA  1186
             F P GNPLSRF QVLVA+ +K   H+P   +D       E  +S RKIL+T GFKFLD+A
Sbjct  253   FNPNGNPLSRFCQVLVAAMKKCRAHMPQGEEDLYDESNNESSNSNRKILYTHGFKFLDRA  312

Query  1185  AVITTKESVRDLEERNI-NPWRLCSVTQVEEVKCILRLLPIWLCTILYSVVFTQMASLFV  1009
             A I++++   D +++ I +PWRLC ++QVEEVKCILRLLPIWLCTI+YSVVFTQMASLFV
Sbjct  313   AYISSRD--LDYQKQGIRSPWRLCPISQVEEVKCILRLLPIWLCTIIYSVVFTQMASLFV  370

Query  1008  EQGAAMRTNIAGFHIPPASMSSFDILSVAAFIFIYRRILDPLIASLKKTRRAQGFTELQR  829
             EQGAAM+T I  F IPPASMSSFDI+SVA FIFIYRRI+DP +  +KK+  A+G TELQR
Sbjct  371   EQGAAMKTTIPNFSIPPASMSSFDIISVAVFIFIYRRIIDPFVGRIKKS-DAKGLTELQR  429

Query  828   MGVGLiiaimamvaagiVEHFRLKYASTDCPRC--PSSLSIFWQVPQYVLIGASEVFMYV  655
             MGVGL+IA++AM++AGIVE +RLKYA  +CP C   SSLSIFWQ+PQY  IGASEVFMYV
Sbjct  430   MGVGLVIAVLAMLSAGIVECYRLKYADKECPHCDGSSSLSIFWQIPQYACIGASEVFMYV  489

Query  654   GQLEFFNGQAPEGLKSFASALCMTSISLGNYVSSLLVSIVMRISTTHRMPGWIPGNLNKG  475
             GQLEFFN Q P+GLKSF SALCMTSISLGNY S+ LVS+VM+ ST   MPGWIPGNLN+G
Sbjct  490   GQLEFFNAQTPDGLKSFGSALCMTSISLGNYFSTFLVSVVMKFSTEDHMPGWIPGNLNRG  549

Query  474   HLDRFYFLLAALTTADFVVYILCAKWYKYIEFEERNSCLKNIGDSKL  334
             HLDRFYFLLA LT  D +VYI CAKWYK I+ E R     + G+ K+
Sbjct  550   HLDRFYFLLAGLTLIDLIVYIACAKWYKNIKLEGRFEVDDDQGNLKV  596



>ref|XP_002867832.1| proton-dependent oligopeptide transport family protein [Arabidopsis 
lyrata subsp. lyrata]
 gb|EFH44091.1| proton-dependent oligopeptide transport family protein [Arabidopsis 
lyrata subsp. lyrata]
Length=589

 Score =   764 bits (1972),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 396/577 (69%), Positives = 462/577 (80%), Gaps = 6/577 (1%)
 Frame = -3

Query  2094  DEEKASREECTLDGTVDHYGRPALRSATGGWFAGVLLLVNQGLATLAFFGVGVNLVLFLT  1915
             D++    E CT DG+VD +G PA+R+ TG W   +L+LVNQGLATLAFFGVGVNLVLFLT
Sbjct  2     DQKVRQFEVCTQDGSVDRHGNPAIRANTGKWLTAILILVNQGLATLAFFGVGVNLVLFLT  61

Query  1914  RVMGQDNADAANNVSKWTGTVYLFSLLGAFLSDSYWGRYKTCAIFQLIYVVGLISVSIFS  1735
             RVMGQDNA+AANNVSKWTGTVY+FSLLGAFLSDSYWGRYKTCAIFQ  +V GL+ +S+ +
Sbjct  62    RVMGQDNAEAANNVSKWTGTVYIFSLLGAFLSDSYWGRYKTCAIFQASFVAGLVMLSLST  121

Query  1734  FIFLVKPKGCGDENTPCRSPSRIHIAVYYVSIYLVALGNGGYQPNIATFGSDQFDGDHAH  1555
                L++P GCG E +PC+  S     ++Y+S+YL+ALG GGYQPNIATFG+DQFD + + 
Sbjct  122   GALLLEPSGCGVEESPCKPHSTFKTVLFYLSVYLIALGYGGYQPNIATFGADQFDAEDSV  181

Query  1554  ESVSKVAFFSYFYLALNLGSLFSNTVLVYFEDKGMWTLGFWastvsavlalllflVGTPR  1375
             E  SK+AFFSYFYLALNLGSLFSNTVL YFED+G W LGFWAS  SA   L+LFL GTP+
Sbjct  182   EGHSKIAFFSYFYLALNLGSLFSNTVLGYFEDQGEWPLGFWASAGSAFAGLVLFLTGTPK  241

Query  1374  YRHFAPKGNPLSRFSQVLVASARKWNVHLPSDGDDHRLYEIQEHDSSTRKILHTEGFKFL  1195
             YRHF P+ +P SRF QVLVA+ RK  + +  D +D  LY+ +   +  +KILHT+GF+FL
Sbjct  242   YRHFTPRESPWSRFCQVLVAATRKAKIDV--DHEDLNLYDSETQRTGDKKILHTKGFRFL  299

Query  1194  DKAAVITTKESVRDLEE-RNINPWRLCSVTQVEEVKCILRLLPIWLCTILYSVVFTQMAS  1018
             D+AA++T  +    +E     + WRLCSVTQVEEVKC+LRLLPIWLCTILYSVVFTQMAS
Sbjct  300   DRAAIVTPDDEAEKVESGSKYDSWRLCSVTQVEEVKCVLRLLPIWLCTILYSVVFTQMAS  359

Query  1017  LFVEQGAAMRTNIAGFHIPPASMSSFDILSVAAFIFIYRRILDPLIASLKKTRRAQGFTE  838
             LFV QGAAM+TNI  F IP +SMSSFDILSVA FIF YRR LDPL A L KT   +G TE
Sbjct  360   LFVVQGAAMKTNIKNFRIPASSMSSFDILSVAFFIFAYRRFLDPLFARLNKTEPNKGLTE  419

Query  837   LQRMGVGLiiaimamvaagiVEHFRLKYASTD---CPRCPSSLSIFWQVPQYVLIGASEV  667
             LQRMG+GL+IAIMAM++AG VE +RLK    +        SSLSIFWQVPQY+LIGASEV
Sbjct  420   LQRMGIGLVIAIMAMISAGTVEIYRLKNKEPESSTSVSSSSSLSIFWQVPQYMLIGASEV  479

Query  666   FMYVGQLEFFNGQAPEGLKSFASALCMTSISLGNYVSSLLVSIVMRISTTHRMPGWIPGN  487
             FMYVGQLEFFN QAP GLKSFASALCM SISLGNYVSSLLVSIVM+ISTT  +PGWIP N
Sbjct  480   FMYVGQLEFFNSQAPTGLKSFASALCMASISLGNYVSSLLVSIVMKISTTDDVPGWIPEN  539

Query  486   LNKGHLDRFYFLLAALTTADFVVYILCAKWYKYIEFE  376
             LNKGHL+RFYFLLA LT ADFVVY++CAKWYKYI+ E
Sbjct  540   LNKGHLERFYFLLAGLTAADFVVYLICAKWYKYIKSE  576



>gb|KFK28750.1| hypothetical protein AALP_AA7G041900 [Arabis alpina]
Length=588

 Score =   764 bits (1972),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 393/575 (68%), Positives = 466/575 (81%), Gaps = 6/575 (1%)
 Frame = -3

Query  2094  DEEKASREECTLDGTVDHYGRPALRSATGGWFAGVLLLVNQGLATLAFFGVGVNLVLFLT  1915
             D++    + CT DG+VD +G PA+++ TG W   +L+LVNQGLATLAFFGVGVNLVLFLT
Sbjct  2     DQKVRQLDLCTQDGSVDCHGNPAIKAKTGKWLTAILILVNQGLATLAFFGVGVNLVLFLT  61

Query  1914  RVMGQDNADAANNVSKWTGTVYLFSLLGAFLSDSYWGRYKTCAIFQLIYVVGLISVSIFS  1735
             RVMGQ+NA+AANNVSKWTGTVY+FSLLGAFLSDSYWGRYKTCAIFQ  +V GL+ +S+ +
Sbjct  62    RVMGQNNAEAANNVSKWTGTVYIFSLLGAFLSDSYWGRYKTCAIFQASFVAGLVLLSLST  121

Query  1734  FIFLVKPKGCGDENTPCRSPSRIHIAVYYVSIYLVALGNGGYQPNIATFGSDQFDGDHAH  1555
               FL++PKGCG E +PC+  S      +Y+S+YL+ALG GGYQPNIATFG+DQFD +   
Sbjct  122   GAFLLEPKGCGIEESPCKPHSMFKTVFFYLSVYLIALGYGGYQPNIATFGADQFDAEDTV  181

Query  1554  ESVSKVAFFSYFYLALNLGSLFSNTVLVYFEDKGMWTLGFWastvsavlalllflVGTPR  1375
             E  SK+AFFSYFYLALNLGSLFSNTVL YFED+G W LGFWAS  SA   L+LFL GTP+
Sbjct  182   EGHSKIAFFSYFYLALNLGSLFSNTVLGYFEDQGKWPLGFWASAGSAFAGLVLFLTGTPK  241

Query  1374  YRHFAPKGNPLSRFSQVLVASARKWNVHLPSDGDDHRLYEIQEHDSSTRKILHTEGFKFL  1195
             YRHF P+ +P SRF QVLVA+ RK  V +  D DD  LY+ +   +  +KILHT+GF+FL
Sbjct  242   YRHFTPRESPWSRFCQVLVAATRK--VKIDVDYDDLNLYDSETQRTGDKKILHTKGFRFL  299

Query  1194  DKAAVITTKESVRDLEERNI-NPWRLCSVTQVEEVKCILRLLPIWLCTILYSVVFTQMAS  1018
             D+AA++T  + V+ ++  +  +PWRLCSVTQVEEVKC+LRLLPIWLCTILYSVVFTQMAS
Sbjct  300   DRAAIVTPDDEVKKVQSGSTYDPWRLCSVTQVEEVKCVLRLLPIWLCTILYSVVFTQMAS  359

Query  1017  LFVEQGAAMRTNIAGFHIPPASMSSFDILSVAAFIFIYRRILDPLIASLKKTRRAQGFTE  838
             LFVEQGA+M+TNI  F IP +SMSSFDILSVA FIF YRR LDPL A L K    +G TE
Sbjct  360   LFVEQGASMKTNINNFRIPASSMSSFDILSVAFFIFAYRRFLDPLFARLNKKEPNKGLTE  419

Query  837   LQRMGVGLiiaimamvaagiVEHFRLKYASTD---CPRCPSSLSIFWQVPQYVLIGASEV  667
             LQRMG+GL+IAIMAM++AG+VE +RL++   +        SSLSIFWQVPQY++IGASEV
Sbjct  420   LQRMGIGLVIAIMAMISAGVVEIYRLRHKDPESSNSVSSSSSLSIFWQVPQYMMIGASEV  479

Query  666   FMYVGQLEFFNGQAPEGLKSFASALCMTSISLGNYVSSLLVSIVMRISTTHRMPGWIPGN  487
             FMYVGQLEFFN QAP GLKSFASALCM SISLGNYVSSLLV+IVM+IST   +PGWIP N
Sbjct  480   FMYVGQLEFFNSQAPTGLKSFASALCMASISLGNYVSSLLVTIVMKISTRDDLPGWIPSN  539

Query  486   LNKGHLDRFYFLLAALTTADFVVYILCAKWYKYIE  382
             LNKGHLDRFYFLLA LT ADFVVY++CAKWYKYI+
Sbjct  540   LNKGHLDRFYFLLAGLTAADFVVYLICAKWYKYIK  574



>ref|XP_008353085.1| PREDICTED: protein SUPPRESSOR OF npr1-1, CONSTITUTIVE 1-like 
[Malus domestica]
Length=1293

 Score =   788 bits (2036),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 405/558 (73%), Positives = 476/558 (85%), Gaps = 15/558 (3%)
 Frame = -3

Query  1980  VNQGLATLAFFGVGVNLVLFLTRVMGQDNADAANNVSKWTGTVYLFSLLGAFLSDSYWGR  1801
             +NQGLATLAFFGVGVNLVLFLTRV+GQDNA+AANNVSKWTGTVY+FSLLGA LSDSYWGR
Sbjct  742   INQGLATLAFFGVGVNLVLFLTRVLGQDNAEAANNVSKWTGTVYIFSLLGALLSDSYWGR  801

Query  1800  YKTCAIFQLIYVVGLISVSIFSFIFLVKPKGCGDENTPCRSPSRIHIAVYYVSIYLVALG  1621
             YKTCA+FQ+I+V+GL  +S+ +++FL+KPKGCGDE +PC   S   I ++Y+SIYL+ALG
Sbjct  802   YKTCAVFQVIFVLGLSLLSLSTYVFLLKPKGCGDEKSPCGDHSTFEIGLFYISIYLIALG  861

Query  1620  NGGYQPNIATFGSDQFDGDHAHESVSKVAFFSYFYLALNLGSLFSNTVLVYFEDKGMWTL  1441
             NGGYQP IATFG+DQFD +  +E  SK++FFS+FYLALNLGSLFSNT+L YFEDKG+WTL
Sbjct  862   NGGYQPTIATFGADQFDEEDPNEGHSKISFFSFFYLALNLGSLFSNTILGYFEDKGIWTL  921

Query  1440  GFWastvsavlalllflVGTPRYRHFAPKGNPLSRFSQVLVASARKWNVHLPSDGDDHRL  1261
             GFW ST SA +AL+LFL GTP YRHF P+GNPLSRF +V+VA+ RKW   +   G+D  L
Sbjct  922   GFWVSTGSAAMALVLFLCGTPMYRHFKPQGNPLSRFCRVVVAATRKWKDEMTPSGED--L  979

Query  1260  YEIQEHD----SSTRKILHTEGFKFLDKAAVITTKESVRDLEERNINPWRLCSVTQVEEV  1093
             YE ++ +    + +RKI+HT GFKFLDKAA+IT KE +  + +   NPWRLC+VTQVEEV
Sbjct  980   YEGEDQNKXSQNESRKIVHTHGFKFLDKAAIITPKE-MNQMGKGAQNPWRLCTVTQVEEV  1038

Query  1092  KCILRLLPIWLCTILYSVVFTQMASLFVEQGAAMRTNIAGFHIPPASMSSFDILSVAAFI  913
             KCILRLLPIWLCTILYSVVFTQMASLFVEQGAAM+T I+ FHIPPASMSSFDILSVAAFI
Sbjct  1039  KCILRLLPIWLCTILYSVVFTQMASLFVEQGAAMKTTISSFHIPPASMSSFDILSVAAFI  1098

Query  912   FIYRRILDPLIASLKKTRRAQGFTELQRMGVGLiiaimamvaagiVEHFRLKYASTDCP-  736
             FIYRR+LDPL++ L K    +G TELQRMG+GL+IAI+AM++AG+VE FRLKYA  DC  
Sbjct  1099  FIYRRVLDPLVSRLMK----KGLTELQRMGIGLVIAILAMISAGVVELFRLKYAVKDCNT  1154

Query  735   --RCPSSLSIFWQVPQYVLIGASEVFMYVGQLEFFNGQAPEGLKSFASALCMTSISLGNY  562
                 PSSLSIFWQVPQYVL+GASEVFMYVGQLEFFNGQAP+GLKSF SALCMTSISLGNY
Sbjct  1155  DCETPSSLSIFWQVPQYVLVGASEVFMYVGQLEFFNGQAPDGLKSFGSALCMTSISLGNY  1214

Query  561   VSSLLVSIVMRISTTHRMPGWIPGNLNKGHLDRFYFLLAALTTADFVVYILCAKWYKYIE  382
             VSSLLV++VM+IST   MPGWIPGNLNKGHL+RFYFLLAALTTAD +VY+LCAKWYKYI+
Sbjct  1215  VSSLLVTVVMKISTRDDMPGWIPGNLNKGHLERFYFLLAALTTADLLVYVLCAKWYKYIK  1274

Query  381   FEERNSCLK-NIGDSKLQ  331
             FE +      NIG ++L+
Sbjct  1275  FEGKGGNDSGNIGQAELR  1292



>ref|XP_009761242.1| PREDICTED: protein NRT1/ PTR FAMILY 7.3-like [Nicotiana sylvestris]
Length=598

 Score =   763 bits (1971),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 399/597 (67%), Positives = 478/597 (80%), Gaps = 14/597 (2%)
 Frame = -3

Query  2145  MAAFLNITKMFFIKNERDEEKASREECTLDGTVDHYGRPALRSATGGWFAGVLLLVNQGL  1966
             M A L ++K      E    K    ECT DGTVD  G+PA+R A+G W AG+++L+NQ L
Sbjct  1     MMACLELSK------EVKMMKGEEIECTKDGTVDLDGKPAIREASGKWVAGIMILLNQAL  54

Query  1965  ATLAFFGVGVNLVLFLTRVMGQDNADAANNVSKWTGTVYLFSLLGAFLSDSYWGRYKTCA  1786
             ATLAFFGVGVNLVLFLTRV+ ++NADAAN+VSKWTGTVY+ SL+GAFLSDSYWGR+KTCA
Sbjct  55    ATLAFFGVGVNLVLFLTRVLKENNADAANSVSKWTGTVYICSLVGAFLSDSYWGRFKTCA  114

Query  1785  IFQLIYVVGLISVSIFSFIFLVKPKGCGDENTPCRSPSRIHIAVYYVSIYLVALGNGGYQ  1606
             IFQ+IYV GL  +++ S ++L+KPKGCG+  T C   S + I ++Y+++Y++ALG GGYQ
Sbjct  115   IFQVIYVTGLALLALASQLYLLKPKGCGNRTTLCGEHSTMGIGLFYIAVYMIALGYGGYQ  174

Query  1605  PNIATFGSDQFDGDHAHESVSKVAFFSYFYLALNLGSLFSNTVLVYFEDKGMWTLGFWas  1426
             PNIATFG+DQFD  H  ES SKVAFFSYFYL +NLGSLFSNT+L YFED+GMW LGFWAS
Sbjct  175   PNIATFGADQFDEQHPGESHSKVAFFSYFYLFMNLGSLFSNTILDYFEDEGMWALGFWAS  234

Query  1425  tvsavlalllflVGTPRYRHFAPKGNPLSRFSQVLVASARKWNVHLPSDGDDHRLYEIQE  1246
               SA  ALLLFL GT RYRHF   GNPL+RF+QVLVA+ +K  V  P   DD   Y+ ++
Sbjct  235   AASAFAALLLFLGGTARYRHFKSSGNPLARFAQVLVAATKKNRVETPETEDD--FYQGED  292

Query  1245  HDSST--RKILHTEGFKFLDKAAVITTKESVRDLEERNINPWRLCSVTQVEEVKCILRLL  1072
              D++T  RK+LHT GFKFLD+AAV+T++E + + ++ + NPW LC ++QVEEVKCILRLL
Sbjct  293   DDNTTGGRKMLHTHGFKFLDRAAVVTSRE-LDNQKQSDHNPWHLCPISQVEEVKCILRLL  351

Query  1071  PIWLCTILYSVVFTQMASLFVEQGAAMRTNIAGFHIPPASMSSFDILSVAAFIFIYRRIL  892
             PIWLCTI+YSVVFTQMASLFVEQG AM+T IA F IP ASMS+FDILSVA  IF+ RR+L
Sbjct  352   PIWLCTIIYSVVFTQMASLFVEQGDAMKTTIANFRIPAASMSTFDILSVAGVIFLNRRVL  411

Query  891   DPLIASLKKTRRAQ-GFTELQRMGVGLiiaimamvaagiVEHFRLKYASTDCPRC--PSS  721
             +PL++  KK +    G TELQRMG+GL+IA+MAM++AGIVE +RLKYAS DC  C   SS
Sbjct  412   NPLVSRFKKCKGDHIGLTELQRMGIGLVIAVMAMLSAGIVECYRLKYASNDCKNCGGSSS  471

Query  720   LSIFWQVPQYVLIGASEVFMYVGQLEFFNGQAPEGLKSFASALCMTSISLGNYVSSLLVS  541
             L+IFWQVPQY  IGASEVFMYVGQLEFFN QAP+GLKSF SALCMTSISLGNYVSSLLVS
Sbjct  472   LNIFWQVPQYAFIGASEVFMYVGQLEFFNAQAPDGLKSFGSALCMTSISLGNYVSSLLVS  531

Query  540   IVMRISTTHRMPGWIPGNLNKGHLDRFYFLLAALTTADFVVYILCAKWYKYIEFEER  370
             +VM+IS T +MPGWIPGNLNKGHLDRFYFLLA LT  D V YI CAKWYK I+  E+
Sbjct  532   VVMKISATDKMPGWIPGNLNKGHLDRFYFLLAGLTLIDLVAYIACAKWYKNIKHSEK  588



>ref|XP_004244546.1| PREDICTED: protein NRT1/ PTR FAMILY 7.3 [Solanum lycopersicum]
Length=600

 Score =   763 bits (1971),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 395/587 (67%), Positives = 465/587 (79%), Gaps = 15/587 (3%)
 Frame = -3

Query  2085  KASREECTLDGTVDHYGRPALRSATGGWFAGVLLLVNQGLATLAFFGVGVNLVLFLTRVM  1906
             K    ECT DG+VD  G PA+R  +G W AG+++L+NQ LATLAFFGVGVNLVLFLTRV+
Sbjct  15    KGEDVECTKDGSVDLKGNPAIRERSGKWVAGIMILLNQALATLAFFGVGVNLVLFLTRVL  74

Query  1905  GQDNADAANNVSKWTGTVYLFSLLGAFLSDSYWGRYKTCAIFQLIYVVGLISVSIFSFIF  1726
              ++NADAAN+VSKWTGTVY+ SL+GAFLSDSYWGR+KTCAIFQ+IYV GL  +++ S ++
Sbjct  75    KENNADAANSVSKWTGTVYICSLVGAFLSDSYWGRFKTCAIFQVIYVTGLSLLALASQLY  134

Query  1725  LVKPKGCGDENTPCRSPSRIHIAVYYVSIYLVALGNGGYQPNIATFGSDQFDGDHAHESV  1546
             L+KPKGCG+  T C   S + + ++YVS+Y++ALG GGYQPNIATFG+DQFD  H  E  
Sbjct  135   LLKPKGCGNRTTLCGEHSTMEVGLFYVSVYMIALGYGGYQPNIATFGADQFDEQHPGECS  194

Query  1545  SKVAFFSYFYLALNLGSLFSNTVLVYFEDKGMWTLGFWastvsavlalllflVGTPRYRH  1366
             SKVAFFSYFYL +NLGSLFSNT+L YFED+GMW LGFWAS  SA  AL+LFL GT RYRH
Sbjct  195   SKVAFFSYFYLFMNLGSLFSNTILDYFEDEGMWALGFWASAASAFAALMLFLGGTARYRH  254

Query  1365  FAPKGNPLSRFSQVLVASARKWNVHLPSDGDDHRLYEIQEHDSST--RKILHTEGFKFLD  1192
             F   GNPLSRF QVLVA+ +K  V  P + DD   Y+ ++ D +T  RK+LHT GFKFLD
Sbjct  255   FKSSGNPLSRFGQVLVAATKKGKVETPENEDD--FYQGEDDDDTTGGRKMLHTHGFKFLD  312

Query  1191  KAAVITTKESVRDLEERNINPWRLCSVTQVEEVKCILRLLPIWLCTILYSVVFTQMASLF  1012
             +AAV+T+KE +   ++ + NPWRLC ++QVEEVKCILRLLPIWLCTI+YSVVFTQMASLF
Sbjct  313   RAAVVTSKE-LESQKQGDHNPWRLCPISQVEEVKCILRLLPIWLCTIIYSVVFTQMASLF  371

Query  1011  VEQGAAMRTNIAGFHIPPASMSSFDILSVAAFIFIYRRILDPLIASLKKTRRAQ-GFTEL  835
             VEQG AM+T IA F IP ASMS+FDILSVA  IF+ RR+L+PL+   KK +    G TEL
Sbjct  372   VEQGDAMKTTIANFRIPAASMSTFDILSVAGVIFLNRRVLNPLVKRFKKCKDDDAGLTEL  431

Query  834   QRMGVGLiiaimamvaagiVEHFRLKYASTDCPRCP--SSLSIFWQVPQYVLIGASEVFM  661
             QRMG+GL+IA+MAM+++GIVE +RLKYAS DC  C   SSL+IFWQVPQY  IGASEVFM
Sbjct  432   QRMGIGLVIAVMAMLSSGIVECYRLKYASNDCKHCEGSSSLNIFWQVPQYAFIGASEVFM  491

Query  660   YVGQLEFFNGQAPEGLKSFASALCMTSISLGNYVSSLLVSIVMRISTTHRMPGWIPGNLN  481
             YV QLEFFN QAP+GLKSF SALCMTSISLGNYVSS LVSIVM+IS T  MPGWIPGNLN
Sbjct  492   YVAQLEFFNAQAPDGLKSFGSALCMTSISLGNYVSSFLVSIVMKISATDNMPGWIPGNLN  551

Query  480   KGHLDRFYFLLAALTTADFVVYILCAKWYKYI-------EFEERNSC  361
             KGHLDRFYFLLA LT  D V YI CAKWYK I       E EE + C
Sbjct  552   KGHLDRFYFLLAGLTLIDLVAYIACAKWYKNIKHSEKIQEHEEEDKC  598



>ref|XP_008788684.1| PREDICTED: protein NRT1/ PTR FAMILY 7.3-like [Phoenix dactylifera]
Length=619

 Score =   763 bits (1971),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 407/579 (70%), Positives = 472/579 (82%), Gaps = 15/579 (3%)
 Frame = -3

Query  2076  REEC---TLDGTVDHYGRPALRSATGGWFAGVLLLVNQGLATLAFFGVGVNLVLFLTRVM  1906
              EEC   TLDG+VD  GRPA+R  TGGW AG LLLVNQGLATLAFFGVGVNLVLFLTRV+
Sbjct  37    EEECCEYTLDGSVDIKGRPAIRGKTGGWVAGALLLVNQGLATLAFFGVGVNLVLFLTRVL  96

Query  1905  GQDNADAANNVSKWTGTVYLFSLLGAFLSDSYWGRYKTCAIFQLIYVVGLISVSIFSFIF  1726
              Q+NADAANNVSKWTGTVY+FSL+GAFLSDSYWGRYKTCAIFQ+I+V GL+ +S+ S++F
Sbjct  97    QQNNADAANNVSKWTGTVYIFSLVGAFLSDSYWGRYKTCAIFQVIFVFGLVLLSLSSYLF  156

Query  1725  LVKPKGCGDENTPCRSPSRIHIAVYYVSIYLVALGNGGYQPNIATFGSDQFDGDHAHESV  1546
             L+KP GCGDE+T C S S + + V+Y+S YL+ALGNGGYQP IATFG+DQFD +   E+ 
Sbjct  157   LLKPSGCGDEDTLCGSHSGLEVGVFYLSTYLIALGNGGYQPTIATFGADQFDEEDRAEAH  216

Query  1545  SKVAFFSYFYLALNLGSLFSNTVLVYFEDKGMWTLGFWastvsavlalllflVGTPRYRH  1366
             SKV+FFS+FYLALNLGSLFSNT L YFEDKGMW LGFWAS  SA +AL LFL GTPRYRH
Sbjct  217   SKVSFFSFFYLALNLGSLFSNTFLSYFEDKGMWALGFWASAGSAFVALALFLGGTPRYRH  276

Query  1365  FAPKGNPLSRFSQVLVASARKWNVHLPSDGDDHRLYEIQEHD----SSTRKILHTEGFKF  1198
             F P GNPL+R  QV+VA+ RKW V +P  G +  LYE+   +    +  RKILHT+GFKF
Sbjct  277   FKPGGNPLTRVCQVIVAAVRKWRVRMPPGGGN--LYEVDGKELAAANGGRKILHTKGFKF  334

Query  1197  LDKAAVITTKESVRDLEERNI--NPWRLCSVTQVEEVKCILRLLPIWLCTILYSVVFTQM  1024
             LD+AA I   + V  L++R+I  NPWR C++ QVEEVKCILRL+PIWL TILYSVVFTQM
Sbjct  335   LDRAAFIEFDDKVM-LQDRSIPRNPWRFCTINQVEEVKCILRLIPIWLTTILYSVVFTQM  393

Query  1023  ASLFVEQGAAMRTNIAGFHIPPASMSSFDILSVAAFIFIYRRILDPLIASLKKTRRAQGF  844
             ASLFVEQG AM T IAGF IPPASMS+FDILSVA FI  YRR+L PL++ L K    +G 
Sbjct  394   ASLFVEQGDAMSTTIAGFEIPPASMSAFDILSVAVFILFYRRLLTPLVSKLVKD--PKGL  451

Query  843   TELQRMGVGLiiaimamvaagiVEHFRLKYASTDCPRCPSSLSIFWQVPQYVLIGASEVF  664
             T+LQRMG+GLIIAIMAM+AAG VE FRLK+    C +  SSLSI WQ+PQY+LIGASEVF
Sbjct  452   TQLQRMGIGLIIAIMAMIAAGTVEVFRLKHVCEGC-KDESSLSILWQIPQYMLIGASEVF  510

Query  663   MYVGQLEFFNGQAPEGLKSFASALCMTSISLGNYVSSLLVSIVMRISTTHRMPGWIPGNL  484
             MYVGQLEFFN Q P+GLKSF SALCMTSISLGNYVSSLLV+IVM+I+     PGWIPGNL
Sbjct  511   MYVGQLEFFNDQVPDGLKSFGSALCMTSISLGNYVSSLLVTIVMKITVEDNRPGWIPGNL  570

Query  483   NKGHLDRFYFLLAALTTADFVVYILCAKWYKYIEFEERN  367
             NKGH+DRFYFLLAALT+ADFVVY+ CA+WY  I+ E R+
Sbjct  571   NKGHMDRFYFLLAALTSADFVVYLACARWYSCIKLEGRS  609



>ref|XP_009761241.1| PREDICTED: protein NRT1/ PTR FAMILY 7.3-like [Nicotiana sylvestris]
Length=595

 Score =   762 bits (1967),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 393/576 (68%), Positives = 467/576 (81%), Gaps = 7/576 (1%)
 Frame = -3

Query  2085  KASREECTLDGTVDHYGRPALRSATGGWFAGVLLLVNQGLATLAFFGVGVNLVLFLTRVM  1906
             K    +CT DGT+D  G+PA+R  +G W AG+++L+NQ LATLAFFGVGVNLVLFLTRV+
Sbjct  13    KGEEMDCTKDGTIDLNGKPAIRETSGKWVAGIMILLNQALATLAFFGVGVNLVLFLTRVL  72

Query  1905  GQDNADAANNVSKWTGTVYLFSLLGAFLSDSYWGRYKTCAIFQLIYVVGLISVSIFSFIF  1726
              ++NADAAN+VSKWTGTVY+ SL+GAFLSDSYWGR+KTCAIFQ+IYV GL  +++ S ++
Sbjct  73    KENNADAANSVSKWTGTVYICSLVGAFLSDSYWGRFKTCAIFQVIYVTGLALLALASQLY  132

Query  1725  LVKPKGCGDENTPCRSPSRIHIAVYYVSIYLVALGNGGYQPNIATFGSDQFDGDHAHESV  1546
             L+KPKGCGD  T C   S + + ++Y+S+Y++ALG GGYQPNIATFG+DQFD  H  ES 
Sbjct  133   LLKPKGCGDRTTLCGEHSTMGVGLFYISVYMIALGYGGYQPNIATFGADQFDEHHPRESQ  192

Query  1545  SKVAFFSYFYLALNLGSLFSNTVLVYFEDKGMWTLGFWastvsavlalllflVGTPRYRH  1366
             SKVAFFSYFYL +NLGSLFSNT+L YFED+GMW LGFWAS  SA  ALLLFL GT RYRH
Sbjct  193   SKVAFFSYFYLFMNLGSLFSNTILDYFEDEGMWALGFWASAASAFAALLLFLGGTARYRH  252

Query  1365  FAPKGNPLSRFSQVLVASARKWNVHLPSDGDDHRLYEIQEHD-SSTRKILHTEGFKFLDK  1189
             F   GNPL+RF+QVLVA+ +K  V  P + DD   Y+ ++ D +  RK+LHT GFKFLD+
Sbjct  253   FKSSGNPLARFAQVLVAATKKNRVETPENEDD--FYQGEDDDVTGGRKMLHTHGFKFLDR  310

Query  1188  AAVITTKESVRDLEERNINPWRLCSVTQVEEVKCILRLLPIWLCTILYSVVFTQMASLFV  1009
             AAV+T++E + D +  + NPWRLC ++QVEEVKCILRLLPIWLCTI+YSVVFTQMASLFV
Sbjct  311   AAVVTSRE-LDDQKLSDHNPWRLCPISQVEEVKCILRLLPIWLCTIIYSVVFTQMASLFV  369

Query  1008  EQGAAMRTNIAGFHIPPASMSSFDILSVAAFIFIYRRILDPLIASLKKTR-RAQGFTELQ  832
             EQG AM+T IA F IP ASMS+FDILSVA  IF+ RR+L+PL++  KK +    G TELQ
Sbjct  370   EQGDAMKTTIANFRIPAASMSTFDILSVAGVIFLNRRVLNPLVSRFKKCKGDNTGLTELQ  429

Query  831   RMGVGLiiaimamvaagiVEHFRLKYASTDCPRCP--SSLSIFWQVPQYVLIGASEVFMY  658
             RMG+GL+IA+MAM++AGIVE +RLKYAS DC  C   SSL+IFWQVPQY  IGASEVFMY
Sbjct  430   RMGIGLVIAVMAMLSAGIVECYRLKYASNDCKHCEGSSSLNIFWQVPQYAFIGASEVFMY  489

Query  657   VGQLEFFNGQAPEGLKSFASALCMTSISLGNYVSSLLVSIVMRISTTHRMPGWIPGNLNK  478
             VGQLEFFN QAP+GLKSF SALCMTSISLGNYVSS LVSIVM+IS T  MPGWIPGNLNK
Sbjct  490   VGQLEFFNAQAPDGLKSFGSALCMTSISLGNYVSSFLVSIVMKISATDNMPGWIPGNLNK  549

Query  477   GHLDRFYFLLAALTTADFVVYILCAKWYKYIEFEER  370
             GHLDRFYFLLA LT  D V YI CAKWYK I+  E+
Sbjct  550   GHLDRFYFLLAGLTLIDLVAYIACAKWYKNIKHSEK  585



>ref|XP_009378974.1| PREDICTED: protein NRT1/ PTR FAMILY 7.3-like isoform X2 [Pyrus 
x bretschneideri]
Length=595

 Score =   761 bits (1966),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 397/577 (69%), Positives = 474/577 (82%), Gaps = 10/577 (2%)
 Frame = -3

Query  2085  KASREECTLDGTVDHYGRPALRSATGGWFAGVLLLVNQGLATLAFFGVGVNLVLFLTRVM  1906
             +  ++ECTLDGTVD +GRPA+RS +G W AG+++L+NQGLATLAFFGVGVNLVL+LTRV+
Sbjct  13    EEDQDECTLDGTVDMHGRPAVRSKSGRWVAGIIILLNQGLATLAFFGVGVNLVLYLTRVL  72

Query  1905  GQDNADAANNVSKWTGTVYLFSLLGAFLSDSYWGRYKTCAIFQLIYVVGLISVSIFSFIF  1726
              QDNA AANNVSKWTGTVY+FSL+GAFLSDSYWGRYKTC+IFQLI+V+GL+S+S+ S +F
Sbjct  73    QQDNATAANNVSKWTGTVYIFSLVGAFLSDSYWGRYKTCSIFQLIFVIGLVSLSLSSQLF  132

Query  1725  LVKPKGCGDENTPCRSPSRIHIAVYYVSIYLVALGNGGYQPNIATFGSDQFDGDHAHESV  1546
             L+ PKGCG +  PC S S   I ++Y+S YL+ALG GGYQPNIATFG+DQ+D + + E +
Sbjct  133   LLNPKGCGSKENPCGSHSSWKIWLFYLSTYLIALGYGGYQPNIATFGADQYDEEDSKEGL  192

Query  1545  SKVAFFSYFYLALNLGSLFSNTVLVYFEDKGMWTLGFWastvsavlalllflVGTPRYRH  1366
             SKVAFFSYFYLA+NLGSLFSNT+L +FED+G+W +GFWAS  SA   L+LFL GT RYRH
Sbjct  193   SKVAFFSYFYLAMNLGSLFSNTILGFFEDEGIWAIGFWASAASAFAGLVLFLGGTARYRH  252

Query  1365  FAPKGNPLSRFSQVLVASARKWNVHLPSDGDDHRLYEIQEHDSSTRKILHTEGFKFLDKA  1186
             F P GNPLSRF QVLVA+ +K  VH+P  G+D      +E  +S RKIL+T GFKFLD+A
Sbjct  253   FKPNGNPLSRFCQVLVAAMKKCRVHMPQGGEDLYDESNKESSNSNRKILYTHGFKFLDRA  312

Query  1185  AVITTKESVRDLEERNI---NPWRLCSVTQVEEVKCILRLLPIWLCTILYSVVFTQMASL  1015
             A I++    RDL+ R     +PW LC ++QVEEVKCILRLLPIWLCTI+YSVVFTQMASL
Sbjct  313   AYISS----RDLDYRKQGIRSPWHLCPISQVEEVKCILRLLPIWLCTIIYSVVFTQMASL  368

Query  1014  FVEQGAAMRTNIAGFHIPPASMSSFDILSVAAFIFIYRRILDPLIASLKKTRRAQGFTEL  835
             FVEQGAAM+T I  F IPPASMSSFDI+SVA FIFIYRRI+DP +  +KK+  A+G TEL
Sbjct  369   FVEQGAAMKTTIPNFSIPPASMSSFDIISVAVFIFIYRRIIDPFVGRIKKS-DAKGLTEL  427

Query  834   QRMGVGLiiaimamvaagiVEHFRLKYASTDCPRC--PSSLSIFWQVPQYVLIGASEVFM  661
             QRMG+GL+IA+MAM++AGIVE +RLKYA  +CP C   SSLSIFWQ+PQY  IGASEVFM
Sbjct  428   QRMGIGLVIAVMAMLSAGIVECYRLKYADKECPHCDGSSSLSIFWQIPQYACIGASEVFM  487

Query  660   YVGQLEFFNGQAPEGLKSFASALCMTSISLGNYVSSLLVSIVMRISTTHRMPGWIPGNLN  481
             YVGQLEFFN Q P+GLKSF SALCMTSISLGNY S+ LVS+VM+ ST   MPGWIPGNLN
Sbjct  488   YVGQLEFFNAQTPDGLKSFGSALCMTSISLGNYFSTFLVSVVMKFSTEDHMPGWIPGNLN  547

Query  480   KGHLDRFYFLLAALTTADFVVYILCAKWYKYIEFEER  370
             +GHLD FYFLLA LT+ D +VYI CAKWYK I+ E R
Sbjct  548   RGHLDWFYFLLAVLTSIDLIVYIACAKWYKNIKLEGR  584



>ref|XP_010934995.1| PREDICTED: protein NRT1/ PTR FAMILY 7.3 isoform X1 [Elaeis guineensis]
Length=618

 Score =   758 bits (1956),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 402/579 (69%), Positives = 474/579 (82%), Gaps = 15/579 (3%)
 Frame = -3

Query  2076  REEC---TLDGTVDHYGRPALRSATGGWFAGVLLLVNQGLATLAFFGVGVNLVLFLTRVM  1906
              EEC   TLDG+VD  GR A++  TGGW AG L+LVNQGLATLAFFGVGVNLVLFLTRV+
Sbjct  37    EEECCEYTLDGSVDIKGRLAIKGKTGGWVAGTLILVNQGLATLAFFGVGVNLVLFLTRVL  96

Query  1905  GQDNADAANNVSKWTGTVYLFSLLGAFLSDSYWGRYKTCAIFQLIYVVGLISVSIFSFIF  1726
              Q+NADAANNVSKWTGTVY+FSL+GAFLSDSYWGRYKTCAIFQ+I+V GL+ +S+ S++F
Sbjct  97    QQNNADAANNVSKWTGTVYIFSLVGAFLSDSYWGRYKTCAIFQVIFVFGLVLLSLSSYLF  156

Query  1725  LVKPKGCGDENTPCRSPSRIHIAVYYVSIYLVALGNGGYQPNIATFGSDQFDGDHAHESV  1546
             L+KP GCGDE+T C   SR+ + V+Y+S YL+ALGNGGYQPNIAT G+DQFD +   E+ 
Sbjct  157   LLKPSGCGDEDTLCGPHSRLEVGVFYLSTYLIALGNGGYQPNIATLGADQFDEEDPVEAH  216

Query  1545  SKVAFFSYFYLALNLGSLFSNTVLVYFEDKGMWTLGFWastvsavlalllflVGTPRYRH  1366
             SKV+FFS+FYLALNLGSLFSNT L YFEDKGMW LGFWAS  SA +AL LFL GTPRYRH
Sbjct  217   SKVSFFSFFYLALNLGSLFSNTFLGYFEDKGMWALGFWASAGSAFVALALFLGGTPRYRH  276

Query  1365  FAPKGNPLSRFSQVLVASARKWNVHLPSDGDDHRLYEIQEHD----SSTRKILHTEGFKF  1198
             F P GNP SR  +V+VA+ RKW V +P  G +  LYE+   +    +  RK+LHT+GFKF
Sbjct  277   FKPSGNPFSRVCRVIVAALRKWRVKIPPGGGN--LYEVDSKELAAANGGRKMLHTKGFKF  334

Query  1197  LDKAAVITTKESVRDLEERNI--NPWRLCSVTQVEEVKCILRLLPIWLCTILYSVVFTQM  1024
             LD+AA I +  ++  L++R+I  + W LC++TQVEEVKC+LRL+PIWL TILYSVVFTQM
Sbjct  335   LDRAAFIDSDNNII-LQDRSIPRDTWSLCTITQVEEVKCVLRLIPIWLTTILYSVVFTQM  393

Query  1023  ASLFVEQGAAMRTNIAGFHIPPASMSSFDILSVAAFIFIYRRILDPLIASLKKTRRAQGF  844
             ASLFVEQG AM T IAGF IPPASMS+FDILSVA FI  YRR+L PL++ LKK    +G 
Sbjct  394   ASLFVEQGDAMNTTIAGFRIPPASMSAFDILSVAVFILFYRRLLTPLVSKLKK--EPKGL  451

Query  843   TELQRMGVGLiiaimamvaagiVEHFRLKYASTDCPRCPSSLSIFWQVPQYVLIGASEVF  664
             TELQRMG+GLIIAIMAM+AAG+VE FRLK+    C +  SSLSI WQ+PQY LIGASEVF
Sbjct  452   TELQRMGIGLIIAIMAMIAAGMVEIFRLKHVCKGC-KDKSSLSILWQIPQYTLIGASEVF  510

Query  663   MYVGQLEFFNGQAPEGLKSFASALCMTSISLGNYVSSLLVSIVMRISTTHRMPGWIPGNL  484
             MYVGQLEFFN QAP+GLKSF SALCMTSISLGNYVSSLLV+IVM+I+     PGWIPGNL
Sbjct  511   MYVGQLEFFNDQAPDGLKSFGSALCMTSISLGNYVSSLLVTIVMKITAEDNRPGWIPGNL  570

Query  483   NKGHLDRFYFLLAALTTADFVVYILCAKWYKYIEFEERN  367
             NKGH+DRFYFLLAALT+ADF+VY+ CA+WYK I+ E R+
Sbjct  571   NKGHMDRFYFLLAALTSADFLVYVACARWYKCIKLEGRS  609



>ref|NP_193899.2| nitrate transporter 1.8 [Arabidopsis thaliana]
 sp|Q8GXN2.2|PTR47_ARATH RecName: Full=Protein NRT1/ PTR FAMILY 7.2; Short=AtNPF7.2; AltName: 
Full=Nitrate transporter 1.8 [Arabidopsis thaliana]
 gb|AEE84489.1| nitrate transporter 1.8 [Arabidopsis thaliana]
Length=589

 Score =   756 bits (1953),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 395/577 (68%), Positives = 464/577 (80%), Gaps = 6/577 (1%)
 Frame = -3

Query  2094  DEEKASREECTLDGTVDHYGRPALRSATGGWFAGVLLLVNQGLATLAFFGVGVNLVLFLT  1915
             D++    E CT DG+VD +G PA+R+ TG W   +L+LVNQGLATLAFFGVGVNLVLFLT
Sbjct  2     DQKVRQFEVCTQDGSVDRHGNPAIRANTGKWLTAILILVNQGLATLAFFGVGVNLVLFLT  61

Query  1914  RVMGQDNADAANNVSKWTGTVYLFSLLGAFLSDSYWGRYKTCAIFQLIYVVGLISVSIFS  1735
             RVMGQDNA+AANNVSKWTGTVY+FSLLGAFLSDSYWGRYKTCAIFQ  +V GL+ +S+ +
Sbjct  62    RVMGQDNAEAANNVSKWTGTVYIFSLLGAFLSDSYWGRYKTCAIFQASFVAGLMMLSLST  121

Query  1734  FIFLVKPKGCGDENTPCRSPSRIHIAVYYVSIYLVALGNGGYQPNIATFGSDQFDGDHAH  1555
                L++P GCG E++PC+  S     ++Y+S+YL+ALG GGYQPNIATFG+DQFD + + 
Sbjct  122   GALLLEPSGCGVEDSPCKPHSTFKTVLFYLSVYLIALGYGGYQPNIATFGADQFDAEDSV  181

Query  1554  ESVSKVAFFSYFYLALNLGSLFSNTVLVYFEDKGMWTLGFWastvsavlalllflVGTPR  1375
             E  SK+AFFSYFYLALNLGSLFSNTVL YFED+G W LGFWAS  SA   L+LFL+GTP+
Sbjct  182   EGHSKIAFFSYFYLALNLGSLFSNTVLGYFEDQGEWPLGFWASAGSAFAGLVLFLIGTPK  241

Query  1374  YRHFAPKGNPLSRFSQVLVASARKWNVHLPSDGDDHRLYEIQEHDSSTRKILHTEGFKFL  1195
             YRHF P+ +P SRF QVLVA+ RK  + +    ++  LY+ +   +  +KILHT+GF+FL
Sbjct  242   YRHFTPRESPWSRFCQVLVAATRKAKIDV--HHEELNLYDSETQYTGDKKILHTKGFRFL  299

Query  1194  DKAAVITTKESVRDLEE-RNINPWRLCSVTQVEEVKCILRLLPIWLCTILYSVVFTQMAS  1018
             D+AA++T  +    +E     +PWRLCSVTQVEEVKC+LRLLPIWLCTILYSVVFTQMAS
Sbjct  300   DRAAIVTPDDEAEKVESGSKYDPWRLCSVTQVEEVKCVLRLLPIWLCTILYSVVFTQMAS  359

Query  1017  LFVEQGAAMRTNIAGFHIPPASMSSFDILSVAAFIFIYRRILDPLIASLKKTRRAQGFTE  838
             LFV QGAAM+TNI  F IP +SMSSFDILSVA FIF YRR LDPL A L KT R +G TE
Sbjct  360   LFVVQGAAMKTNIKNFRIPASSMSSFDILSVAFFIFAYRRFLDPLFARLNKTERNKGLTE  419

Query  837   LQRMGVGLiiaimamvaagiVEHFRLKYASTD---CPRCPSSLSIFWQVPQYVLIGASEV  667
             LQRMG+GL+IAIMAM++AGIVE  RLK    +        S+LSIFWQVPQY+LIGASEV
Sbjct  420   LQRMGIGLVIAIMAMISAGIVEIHRLKNKEPESATSISSSSTLSIFWQVPQYMLIGASEV  479

Query  666   FMYVGQLEFFNGQAPEGLKSFASALCMTSISLGNYVSSLLVSIVMRISTTHRMPGWIPGN  487
             FMYVGQLEFFN QAP GLKSFASALCM SISLGNYVSSLLVSIVM+ISTT  + GWIP N
Sbjct  480   FMYVGQLEFFNSQAPTGLKSFASALCMASISLGNYVSSLLVSIVMKISTTDDVHGWIPEN  539

Query  486   LNKGHLDRFYFLLAALTTADFVVYILCAKWYKYIEFE  376
             LNKGHL+RFYFLLA LT ADFVVY++CAKWYKYI+ E
Sbjct  540   LNKGHLERFYFLLAGLTAADFVVYLICAKWYKYIKSE  576



>ref|XP_009595683.1| PREDICTED: protein NRT1/ PTR FAMILY 7.3-like [Nicotiana tomentosiformis]
Length=601

 Score =   757 bits (1954),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 391/578 (68%), Positives = 466/578 (81%), Gaps = 7/578 (1%)
 Frame = -3

Query  2085  KASREECTLDGTVDHYGRPALRSATGGWFAGVLLLVNQGLATLAFFGVGVNLVLFLTRVM  1906
             K    +CT DGT+D  G+PA+R  +G W AG+++L+NQ LATLAFFGVGVNLVLFLTRV+
Sbjct  13    KGEEMDCTKDGTIDLNGKPAIRETSGKWVAGIMILLNQALATLAFFGVGVNLVLFLTRVL  72

Query  1905  GQDNADAANNVSKWTGTVYLFSLLGAFLSDSYWGRYKTCAIFQLIYVVGLISVSIFSFIF  1726
              ++NADAAN+VSKWTGTVY+ SL+GAFLSDSYWGR+KTCAIFQ+IYV GL  +++ S ++
Sbjct  73    KENNADAANSVSKWTGTVYICSLVGAFLSDSYWGRFKTCAIFQVIYVTGLALLALASQLY  132

Query  1725  LVKPKGCGDENTPCRSPSRIHIAVYYVSIYLVALGNGGYQPNIATFGSDQFDGDHAHESV  1546
             L+KPKGCGD  T C   S + + ++Y+S+Y++ALG GGYQPNIATFG+DQFD  H  ES 
Sbjct  133   LLKPKGCGDRTTLCGEHSTMGVGLFYISVYMIALGYGGYQPNIATFGADQFDEQHPRESQ  192

Query  1545  SKVAFFSYFYLALNLGSLFSNTVLVYFEDKGMWTLGFWastvsavlalllflVGTPRYRH  1366
             SKVAFFSYFYL +NLGSLFSNT+L YFED+GMW LGFWAS  SA  AL+LFL GT RYRH
Sbjct  193   SKVAFFSYFYLFMNLGSLFSNTILDYFEDEGMWALGFWASAASAFAALMLFLGGTARYRH  252

Query  1365  FAPKGNPLSRFSQVLVASARKWNVHLPSDGDDHRLYEIQEHDSST---RKILHTEGFKFL  1195
             F   GNPL+RF+QVLVA+ +K  +  P + DD    E  + D +T   RK+LHT GFKFL
Sbjct  253   FKSSGNPLARFAQVLVAATKKSRLETPENEDDFYQGEDDDDDDNTTGGRKMLHTHGFKFL  312

Query  1194  DKAAVITTKESVRDLEERNINPWRLCSVTQVEEVKCILRLLPIWLCTILYSVVFTQMASL  1015
             D+AAV+T++E + + ++ + NPW LC ++QVEEVKCILRLLPIWLCTI+YSVVFTQMASL
Sbjct  313   DRAAVVTSRE-LDNQKQGDHNPWHLCPISQVEEVKCILRLLPIWLCTIIYSVVFTQMASL  371

Query  1014  FVEQGAAMRTNIAGFHIPPASMSSFDILSVAAFIFIYRRILDPLIASLKKTR-RAQGFTE  838
             FVEQG AM+T IA F IP ASMS+FDILSVA  IF+ RR+L+PL++  KK +    G TE
Sbjct  372   FVEQGDAMKTTIANFRIPAASMSTFDILSVAGVIFLNRRVLNPLVSRFKKCKGDNTGLTE  431

Query  837   LQRMGVGLiiaimamvaagiVEHFRLKYASTDCPRCP--SSLSIFWQVPQYVLIGASEVF  664
             LQRMG+GL+IA+MAM++AGIVE FRLKYAS DC  C   SSL+IFWQVPQY  IGASEVF
Sbjct  432   LQRMGIGLVIAVMAMLSAGIVECFRLKYASNDCKHCEGSSSLNIFWQVPQYAFIGASEVF  491

Query  663   MYVGQLEFFNGQAPEGLKSFASALCMTSISLGNYVSSLLVSIVMRISTTHRMPGWIPGNL  484
             MYVGQLEFFN QAP+GLKSF SALCMTSISLGNYVSS LVSIVM+IS T  MPGWIPGNL
Sbjct  492   MYVGQLEFFNAQAPDGLKSFGSALCMTSISLGNYVSSFLVSIVMKISATDNMPGWIPGNL  551

Query  483   NKGHLDRFYFLLAALTTADFVVYILCAKWYKYIEFEER  370
             NKGHLDRFYFLLA LT  D V YI CAKWYK I+  E+
Sbjct  552   NKGHLDRFYFLLAGLTLIDLVAYIACAKWYKNIKHSEK  589



>dbj|BAC42767.1| putative peptide transporter [Arabidopsis thaliana]
Length=589

 Score =   755 bits (1949),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 394/577 (68%), Positives = 464/577 (80%), Gaps = 6/577 (1%)
 Frame = -3

Query  2094  DEEKASREECTLDGTVDHYGRPALRSATGGWFAGVLLLVNQGLATLAFFGVGVNLVLFLT  1915
             D++    E CT DG+VD +G PA+R+ TG W   +L+LVNQGLATLAFFGVGVNLVLFLT
Sbjct  2     DQKVRQFEVCTQDGSVDRHGNPAIRANTGKWLTAILILVNQGLATLAFFGVGVNLVLFLT  61

Query  1914  RVMGQDNADAANNVSKWTGTVYLFSLLGAFLSDSYWGRYKTCAIFQLIYVVGLISVSIFS  1735
             RVMGQDNA+AANNVSKWTGTVY+FSLLGAFLSDSYWGRYKTCAIFQ  +V GL+ +S+ +
Sbjct  62    RVMGQDNAEAANNVSKWTGTVYIFSLLGAFLSDSYWGRYKTCAIFQASFVAGLMMLSLST  121

Query  1734  FIFLVKPKGCGDENTPCRSPSRIHIAVYYVSIYLVALGNGGYQPNIATFGSDQFDGDHAH  1555
                L++P GCG E++PC+  S     ++Y+S+YL+ALG GGYQPNIATFG+DQFD + + 
Sbjct  122   GALLLEPSGCGVEDSPCKPHSTFKTVLFYLSVYLIALGYGGYQPNIATFGADQFDAEDSV  181

Query  1554  ESVSKVAFFSYFYLALNLGSLFSNTVLVYFEDKGMWTLGFWastvsavlalllflVGTPR  1375
             E  SK+AFFSYFYLALNLGSLFSNTVL YFED+G W LGFWAS  SA   L+LFL+GTP+
Sbjct  182   EGHSKIAFFSYFYLALNLGSLFSNTVLGYFEDQGEWPLGFWASAGSAFAGLVLFLIGTPK  241

Query  1374  YRHFAPKGNPLSRFSQVLVASARKWNVHLPSDGDDHRLYEIQEHDSSTRKILHTEGFKFL  1195
             YRHF P+ +P SRF QVLVA+ RK  + +    ++  LY+ +   +  +KILHT+GF+FL
Sbjct  242   YRHFTPRESPWSRFCQVLVAATRKAKIDV--HHEELNLYDSETQYTGDKKILHTKGFRFL  299

Query  1194  DKAAVITTKESVRDLEE-RNINPWRLCSVTQVEEVKCILRLLPIWLCTILYSVVFTQMAS  1018
             D+AA++T  +    +E     +PWRLCSVTQVEEVKC+LRLLPIWLCTILYSVVFTQMAS
Sbjct  300   DRAAIVTPDDEAEKVESGSKYDPWRLCSVTQVEEVKCVLRLLPIWLCTILYSVVFTQMAS  359

Query  1017  LFVEQGAAMRTNIAGFHIPPASMSSFDILSVAAFIFIYRRILDPLIASLKKTRRAQGFTE  838
             LFV QGAAM+TNI  F IP +SMSSFDIL+VA FIF YRR LDPL A L KT R +G TE
Sbjct  360   LFVVQGAAMKTNIKNFRIPASSMSSFDILNVAFFIFAYRRFLDPLFARLNKTERNKGLTE  419

Query  837   LQRMGVGLiiaimamvaagiVEHFRLKYASTD---CPRCPSSLSIFWQVPQYVLIGASEV  667
             LQRMG+GL+IAIMAM++AGIVE  RLK    +        S+LSIFWQVPQY+LIGASEV
Sbjct  420   LQRMGIGLVIAIMAMISAGIVEIHRLKNKEPESATSISSSSTLSIFWQVPQYMLIGASEV  479

Query  666   FMYVGQLEFFNGQAPEGLKSFASALCMTSISLGNYVSSLLVSIVMRISTTHRMPGWIPGN  487
             FMYVGQLEFFN QAP GLKSFASALCM SISLGNYVSSLLVSIVM+ISTT  + GWIP N
Sbjct  480   FMYVGQLEFFNSQAPTGLKSFASALCMASISLGNYVSSLLVSIVMKISTTDDVHGWIPEN  539

Query  486   LNKGHLDRFYFLLAALTTADFVVYILCAKWYKYIEFE  376
             LNKGHL+RFYFLLA LT ADFVVY++CAKWYKYI+ E
Sbjct  540   LNKGHLERFYFLLAGLTAADFVVYLICAKWYKYIKSE  576



>ref|XP_010934996.1| PREDICTED: protein NRT1/ PTR FAMILY 7.3 isoform X2 [Elaeis guineensis]
Length=585

 Score =   755 bits (1949),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 402/579 (69%), Positives = 474/579 (82%), Gaps = 15/579 (3%)
 Frame = -3

Query  2076  REEC---TLDGTVDHYGRPALRSATGGWFAGVLLLVNQGLATLAFFGVGVNLVLFLTRVM  1906
              EEC   TLDG+VD  GR A++  TGGW AG L+LVNQGLATLAFFGVGVNLVLFLTRV+
Sbjct  4     EEECCEYTLDGSVDIKGRLAIKGKTGGWVAGTLILVNQGLATLAFFGVGVNLVLFLTRVL  63

Query  1905  GQDNADAANNVSKWTGTVYLFSLLGAFLSDSYWGRYKTCAIFQLIYVVGLISVSIFSFIF  1726
              Q+NADAANNVSKWTGTVY+FSL+GAFLSDSYWGRYKTCAIFQ+I+V GL+ +S+ S++F
Sbjct  64    QQNNADAANNVSKWTGTVYIFSLVGAFLSDSYWGRYKTCAIFQVIFVFGLVLLSLSSYLF  123

Query  1725  LVKPKGCGDENTPCRSPSRIHIAVYYVSIYLVALGNGGYQPNIATFGSDQFDGDHAHESV  1546
             L+KP GCGDE+T C   SR+ + V+Y+S YL+ALGNGGYQPNIAT G+DQFD +   E+ 
Sbjct  124   LLKPSGCGDEDTLCGPHSRLEVGVFYLSTYLIALGNGGYQPNIATLGADQFDEEDPVEAH  183

Query  1545  SKVAFFSYFYLALNLGSLFSNTVLVYFEDKGMWTLGFWastvsavlalllflVGTPRYRH  1366
             SKV+FFS+FYLALNLGSLFSNT L YFEDKGMW LGFWAS  SA +AL LFL GTPRYRH
Sbjct  184   SKVSFFSFFYLALNLGSLFSNTFLGYFEDKGMWALGFWASAGSAFVALALFLGGTPRYRH  243

Query  1365  FAPKGNPLSRFSQVLVASARKWNVHLPSDGDDHRLYEIQEHD----SSTRKILHTEGFKF  1198
             F P GNP SR  +V+VA+ RKW V +P  G +  LYE+   +    +  RK+LHT+GFKF
Sbjct  244   FKPSGNPFSRVCRVIVAALRKWRVKIPPGGGN--LYEVDSKELAAANGGRKMLHTKGFKF  301

Query  1197  LDKAAVITTKESVRDLEERNI--NPWRLCSVTQVEEVKCILRLLPIWLCTILYSVVFTQM  1024
             LD+AA I +  ++  L++R+I  + W LC++TQVEEVKC+LRL+PIWL TILYSVVFTQM
Sbjct  302   LDRAAFIDSDNNII-LQDRSIPRDTWSLCTITQVEEVKCVLRLIPIWLTTILYSVVFTQM  360

Query  1023  ASLFVEQGAAMRTNIAGFHIPPASMSSFDILSVAAFIFIYRRILDPLIASLKKTRRAQGF  844
             ASLFVEQG AM T IAGF IPPASMS+FDILSVA FI  YRR+L PL++ LKK    +G 
Sbjct  361   ASLFVEQGDAMNTTIAGFRIPPASMSAFDILSVAVFILFYRRLLTPLVSKLKK--EPKGL  418

Query  843   TELQRMGVGLiiaimamvaagiVEHFRLKYASTDCPRCPSSLSIFWQVPQYVLIGASEVF  664
             TELQRMG+GLIIAIMAM+AAG+VE FRLK+    C +  SSLSI WQ+PQY LIGASEVF
Sbjct  419   TELQRMGIGLIIAIMAMIAAGMVEIFRLKHVCKGC-KDKSSLSILWQIPQYTLIGASEVF  477

Query  663   MYVGQLEFFNGQAPEGLKSFASALCMTSISLGNYVSSLLVSIVMRISTTHRMPGWIPGNL  484
             MYVGQLEFFN QAP+GLKSF SALCMTSISLGNYVSSLLV+IVM+I+     PGWIPGNL
Sbjct  478   MYVGQLEFFNDQAPDGLKSFGSALCMTSISLGNYVSSLLVTIVMKITAEDNRPGWIPGNL  537

Query  483   NKGHLDRFYFLLAALTTADFVVYILCAKWYKYIEFEERN  367
             NKGH+DRFYFLLAALT+ADF+VY+ CA+WYK I+ E R+
Sbjct  538   NKGHMDRFYFLLAALTSADFLVYVACARWYKCIKLEGRS  576



>ref|XP_009378973.1| PREDICTED: protein NRT1/ PTR FAMILY 7.3-like isoform X1 [Pyrus 
x bretschneideri]
Length=605

 Score =   755 bits (1950),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 396/587 (67%), Positives = 473/587 (81%), Gaps = 20/587 (3%)
 Frame = -3

Query  2085  KASREECTLDGTVDHYGRPALRSATGGWFAGVLLLVNQGLATLAFFGVGVNLVLFLTRVM  1906
             +  ++ECTLDGTVD +GRPA+RS +G W AG+++L+NQGLATLAFFGVGVNLVL+LTRV+
Sbjct  13    EEDQDECTLDGTVDMHGRPAVRSKSGRWVAGIIILLNQGLATLAFFGVGVNLVLYLTRVL  72

Query  1905  GQDNADAANNVSKWTGTVYLFSLLGAFLSDSYWGRYKTCAIFQLIYVVGLISVSIFSFIF  1726
              QDNA AANNVSKWTGTVY+FSL+GAFLSDSYWGRYKTC+IFQLI+V+GL+S+S+ S +F
Sbjct  73    QQDNATAANNVSKWTGTVYIFSLVGAFLSDSYWGRYKTCSIFQLIFVIGLVSLSLSSQLF  132

Query  1725  LVKPKGCGDENTPCRSPSRIHIAVYYVSIYLVALGNGGYQPNIATFGSDQFDGDHAHESV  1546
             L+ PKGCG +  PC S S   I ++Y+S YL+ALG GGYQPNIATFG+DQ+D + + E +
Sbjct  133   LLNPKGCGSKENPCGSHSSWKIWLFYLSTYLIALGYGGYQPNIATFGADQYDEEDSKEGL  192

Query  1545  SKVAFFSYFYLALNLGSLFSNTVLVYFEDKGMWTLGFWastvsavlalllflVGTPRYRH  1366
             SKVAFFSYFYLA+NLGSLFSNT+L +FED+G+W +GFWAS  SA   L+LFL GT RYRH
Sbjct  193   SKVAFFSYFYLAMNLGSLFSNTILGFFEDEGIWAIGFWASAASAFAGLVLFLGGTARYRH  252

Query  1365  FAPKGNPLSRFSQVLVASARKWNVHLPSDGDDHRLYEIQEHDSSTRKILHTEGFKFLDKA  1186
             F P GNPLSRF QVLVA+ +K  VH+P  G+D      +E  +S RKIL+T GFKFLD+A
Sbjct  253   FKPNGNPLSRFCQVLVAAMKKCRVHMPQGGEDLYDESNKESSNSNRKILYTHGFKFLDRA  312

Query  1185  AVITTKESVRDLEERNI---NPWRLCSVTQVEEVKCILRLLPIWLCTILYSVVFTQMASL  1015
             A I++    RDL+ R     +PW LC ++QVEEVKCILRLLPIWLCTI+YSVVFTQMASL
Sbjct  313   AYISS----RDLDYRKQGIRSPWHLCPISQVEEVKCILRLLPIWLCTIIYSVVFTQMASL  368

Query  1014  FVEQGAAMRTNIAGFHIPPASMSSFDILSVAAFIFIYRRILDPLIASLKKTRRAQGFTEL  835
             FVEQGAAM+T I  F IPPASMSSFDI+SVA FIFIYRRI+DP +  +KK+  A+G TEL
Sbjct  369   FVEQGAAMKTTIPNFSIPPASMSSFDIISVAVFIFIYRRIIDPFVGRIKKS-DAKGLTEL  427

Query  834   QRMGVGLiiaimamvaagiV----------EHFRLKYASTDCPRC--PSSLSIFWQVPQY  691
             QRMG+GL+IA+MAM++AGI           E +RLKYA  +CP C   SSLSIFWQ+PQY
Sbjct  428   QRMGIGLVIAVMAMLSAGIAVMAMLSAGIVECYRLKYADKECPHCDGSSSLSIFWQIPQY  487

Query  690   VLIGASEVFMYVGQLEFFNGQAPEGLKSFASALCMTSISLGNYVSSLLVSIVMRISTTHR  511
               IGASEVFMYVGQLEFFN Q P+GLKSF SALCMTSISLGNY S+ LVS+VM+ ST   
Sbjct  488   ACIGASEVFMYVGQLEFFNAQTPDGLKSFGSALCMTSISLGNYFSTFLVSVVMKFSTEDH  547

Query  510   MPGWIPGNLNKGHLDRFYFLLAALTTADFVVYILCAKWYKYIEFEER  370
             MPGWIPGNLN+GHLD FYFLLA LT+ D +VYI CAKWYK I+ E R
Sbjct  548   MPGWIPGNLNRGHLDWFYFLLAVLTSIDLIVYIACAKWYKNIKLEGR  594



>ref|XP_009409940.1| PREDICTED: protein NRT1/ PTR FAMILY 7.2-like isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=620

 Score =   754 bits (1948),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 394/578 (68%), Positives = 460/578 (80%), Gaps = 11/578 (2%)
 Frame = -3

Query  2106  KNERDEEKASREECTLDGTVDHYGRPALRSATGGWFAGVLLLVNQGLATLAFFGVGVNLV  1927
               E +E K  + E TLDG+VD  GRPA +  TGGW  GVL+LVNQGLATLAFFGVGVNLV
Sbjct  29    NKEMNEGKDEQYEYTLDGSVDIRGRPAAKGKTGGWVGGVLVLVNQGLATLAFFGVGVNLV  88

Query  1926  LFLTRVMGQDNADAANNVSKWTGTVYLFSLLGAFLSDSYWGRYKTCAIFQLIYVVGLISV  1747
             LFLTRV+ Q+NADAANNVSKWTGTVY+FSLLGAFLSDSYWGRYKTCAIFQ+I+V GL+ +
Sbjct  89    LFLTRVLQQNNADAANNVSKWTGTVYIFSLLGAFLSDSYWGRYKTCAIFQVIFVFGLVLL  148

Query  1746  SIFSFIFLVKPKGCGDENTPCRSPSRIHIAVYYVSIYLVALGNGGYQPNIATFGSDQFDG  1567
             S+ +++FL+KP GCG+E+  C   S +   V+Y+SIYL+ALGNGGYQPNIATFG+DQFD 
Sbjct  149   SLSTYLFLLKPSGCGEEHFICGPHSSMDTGVFYLSIYLIALGNGGYQPNIATFGADQFDA  208

Query  1566  DHAHESVSKVAFFSYFYLALNLGSLFSNTVLVYFEDKGMWTLGFWastvsavlalllflV  1387
                 ES SKV+FFSYFYLALNLGSLFSNT L YFEDKGMW LGFW S  SAV+ALLLFL 
Sbjct  209   KDPDESHSKVSFFSYFYLALNLGSLFSNTFLNYFEDKGMWALGFWVSAGSAVVALLLFLC  268

Query  1386  GTPRYRHFAPKGNPLSRFSQVLVASARKWNVHLPSDGDDHRLYEIQEHDSS----TRKIL  1219
             GT RYRHF P GNPLSR  QV+VA++RKW + +P++G D  LYE +E   S    +R+IL
Sbjct  269   GTSRYRHFKPIGNPLSRVCQVVVAASRKWRMKMPTNGGDD-LYEAEEKQVSAAHGSRRIL  327

Query  1218  HTEGFKFLDKAAVITTKESVRDLEER---NINPWRLCSVTQVEEVKCILRLLPIWLCTIL  1048
             HTEGF+FLD+AAVI  +      + +   + +PWRLC +TQVEE+KC+LRL+PIWL TIL
Sbjct  328   HTEGFRFLDRAAVIDPENDFTIQQGKSGCSRDPWRLCPITQVEELKCVLRLIPIWLTTIL  387

Query  1047  YSVVFTQMASLFVEQGAAMRTNIAGFHIPPASMSSFDILSVAAFIFIYRRILDPLIASLK  868
             YSVVFTQMASLFVEQGAAM   +AGF IPPASMS+FDI+SVAAFI  YRR L+PL++ L+
Sbjct  388   YSVVFTQMASLFVEQGAAMDGTVAGFRIPPASMSAFDIVSVAAFILFYRRFLNPLVSRLR  447

Query  867   KTRRAQGFTELQRMGVGLiiaimamvaagiVEHFRLKYASTDCPRCPSSLSIFWQVPQYV  688
             K   A+G TELQRMG GLI+AIMAM +AG VE  RL+     C    SSLSI WQ+PQY 
Sbjct  448   KD--ARGLTELQRMGAGLILAIMAMASAGTVEVQRLRSVCRGCDD-DSSLSILWQIPQYA  504

Query  687   LIGASEVFMYVGQLEFFNGQAPEGLKSFASALCMTSISLGNYVSSLLVSIVMRISTTHRM  508
             LIGASEVFMYVGQLEFFNGQAP GLKSF SALCMTSISLGNYVSSLLV+ VM I+     
Sbjct  505   LIGASEVFMYVGQLEFFNGQAPHGLKSFGSALCMTSISLGNYVSSLLVTAVMEITGKGDR  564

Query  507   PGWIPGNLNKGHLDRFYFLLAALTTADFVVYILCAKWY  394
              GWIP NLN+GH+DRFYFLLA+LT ADF V++ CA WY
Sbjct  565   AGWIPANLNRGHMDRFYFLLASLTAADFAVFVTCAIWY  602



>ref|XP_003621236.1| Peptide transporter PTR1 [Medicago truncatula]
Length=580

 Score =   751 bits (1939),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 405/576 (70%), Positives = 473/576 (82%), Gaps = 21/576 (4%)
 Frame = -3

Query  2073  EECTLDGTVDHYGRPALRSATGGWFAGVLLLVNQGLATLAFFGVGVNLVLFLTRVMGQDN  1894
             E CTLDG++D +G PA+R  TG WFAG+L+LVNQGLATLAFFGVGVNLVLFLTRVMGQDN
Sbjct  7     EVCTLDGSIDSHGHPAVRERTGTWFAGILILVNQGLATLAFFGVGVNLVLFLTRVMGQDN  66

Query  1893  ADAANNVSKWTGTVYLFSLLGAFLSDSYWGRYKTCAIFQLIYVVGLISVSIFSFIFLVKP  1714
             ADAANNVSKWTGTVY+FSLLGAFLSDSYWGRY TC         GL+++S+ S+IFL+KP
Sbjct  67    ADAANNVSKWTGTVYIFSLLGAFLSDSYWGRYITC---------GLVALSLTSYIFLLKP  117

Query  1713  KGCGDENTPCRSPSRIHIAVYYVSIYLVALGNGGYQPNIATFGSDQFDGDHAHESVSKVA  1534
              GCG +  PC + S     ++YVSIYLVALGNGGYQP IATFG+DQFD     E  SK+A
Sbjct  118   NGCGSKELPCGTHSSYETTLFYVSIYLVALGNGGYQPTIATFGADQFDESDPSEQHSKIA  177

Query  1533  FFSYFYLALNLGSLFSNTVLVYFEDKGMWTLGFWastvsavlalllflVGTPRYRHFAPK  1354
             FFSYFYLALN+GSLFSNT+L YFED G+WTLGF  S  SA LAL+LFL GT +YR+F P 
Sbjct  178   FFSYFYLALNIGSLFSNTILDYFEDDGLWTLGFCVSAGSAALALVLFLCGTSKYRYFKPV  237

Query  1353  GNPLSRFSQVLVASARKWNVHLPSDGDDHRLYEIQEHDSS-TRKILHTEGFKFLDKAAVI  1177
             GNPL RF QV VA+ RKW V +  DG+D +L+E+++  S+  RK+ HT+GF+FLDKAA I
Sbjct  238   GNPLPRFCQVFVAAIRKWKVQM-FDGED-KLHEVEDCLSNGGRKMYHTQGFRFLDKAAFI  295

Query  1176  TTKESVRDLEERNINPWRLCSVTQVEEVKCILRLLPIWLCTILYSVVFTQMASLFVEQGA  997
             T K+ ++ +EE   +PW L +VTQVEEVKCILRLLPIWLCTIL+SVVF+QMASLFVEQGA
Sbjct  296   TPKD-LKQMEENKCSPWFLSTVTQVEEVKCILRLLPIWLCTILFSVVFSQMASLFVEQGA  354

Query  996   AMRTNIAGFHIPPASMSSFDILSVAAFIFIYRRILDPLIASLKKTRRAQGFTELQRMGVG  817
             AM T I+ FHIPPASMSSFDILSV +FIFIYRRILDPL+A  + T++++G TELQRMG+G
Sbjct  355   AMETKISTFHIPPASMSSFDILSVVSFIFIYRRILDPLVA--RFTKKSKGITELQRMGIG  412

Query  816   LiiaimamvaagiVEHFRLKYA---STDCPRCP--SSLSIFWQVPQYVLIGASEVFMYVG  652
             L++AI+AMV+AG+VE FRLKYA     +C  C   SSLSIFWQVPQYVLIGASEVFMYVG
Sbjct  413   LVLAIIAMVSAGLVEIFRLKYAIKEEKNCSHCEGTSSLSIFWQVPQYVLIGASEVFMYVG  472

Query  651   QLEFFNGQAPEGLKSFASALCMTSISLGNYVSSLLVSIVMRISTTHR-MPGWIPGNLNKG  475
             QLEFFN QAP+GLKSF SALCMTSISLGNYVSSLLV+IVM+IST +  M GWIPGNLN G
Sbjct  473   QLEFFNSQAPDGLKSFGSALCMTSISLGNYVSSLLVAIVMKISTRNEGMLGWIPGNLNMG  532

Query  474   HLDRFYFLLAALTTADFVVYILCAKWYKYIEFEERN  367
             HLDRFYFLLAALT AD +VYI  A+WYKY++F   N
Sbjct  533   HLDRFYFLLAALTAADLLVYIAMARWYKYVKFHGNN  568



>ref|XP_006362495.1| PREDICTED: nitrate transporter 1.5-like [Solanum tuberosum]
Length=600

 Score =   749 bits (1935),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 393/587 (67%), Positives = 465/587 (79%), Gaps = 15/587 (3%)
 Frame = -3

Query  2085  KASREECTLDGTVDHYGRPALRSATGGWFAGVLLLVNQGLATLAFFGVGVNLVLFLTRVM  1906
             K    ECT DG++D  G PA+R  +G W AG+++L+NQ LATLAFFGVGVN+VLFLTRV+
Sbjct  15    KGEDVECTKDGSIDLKGNPAIRETSGKWVAGIMILLNQALATLAFFGVGVNMVLFLTRVL  74

Query  1905  GQDNADAANNVSKWTGTVYLFSLLGAFLSDSYWGRYKTCAIFQLIYVVGLISVSIFSFIF  1726
              ++NADAAN+VSKWTGTVY+ SL+GAFLSDSYWGR+KTCAIFQ+IYV GL  +++ S ++
Sbjct  75    KENNADAANSVSKWTGTVYICSLVGAFLSDSYWGRFKTCAIFQVIYVTGLSLLALASQLY  134

Query  1725  LVKPKGCGDENTPCRSPSRIHIAVYYVSIYLVALGNGGYQPNIATFGSDQFDGDHAHESV  1546
             L+KPKGCG+  T C   S + + ++YVS+Y++ALG GGYQPNIATFG+DQFD  H  E  
Sbjct  135   LLKPKGCGNRTTLCGEHSTMEVGLFYVSVYMIALGYGGYQPNIATFGADQFDEQHPGECS  194

Query  1545  SKVAFFSYFYLALNLGSLFSNTVLVYFEDKGMWTLGFWastvsavlalllflVGTPRYRH  1366
             SKVAFFSYFYL +NLGSLFSNT+L YFED+GMW LGFWAS  SA  AL+LFL GT RYRH
Sbjct  195   SKVAFFSYFYLFMNLGSLFSNTILDYFEDEGMWALGFWASAASAFAALILFLGGTARYRH  254

Query  1365  FAPKGNPLSRFSQVLVASARKWNVHLPSDGDDHRLYEIQEHDSST--RKILHTEGFKFLD  1192
             F   GNPLSRF QVLVA+ +K  V  P + DD   Y+ ++ D +T  RK+LHT GFKFLD
Sbjct  255   FKSSGNPLSRFGQVLVAATKKGKVEAPENEDD--FYKGEDDDDTTGGRKMLHTHGFKFLD  312

Query  1191  KAAVITTKESVRDLEERNINPWRLCSVTQVEEVKCILRLLPIWLCTILYSVVFTQMASLF  1012
             +AAV+T+KE +   ++ + NPWRLC ++QVEEVKCILRLLPIWLCTI+YSVVFTQMASLF
Sbjct  313   RAAVVTSKE-LESQKQGDHNPWRLCPISQVEEVKCILRLLPIWLCTIIYSVVFTQMASLF  371

Query  1011  VEQGAAMRTNIAGFHIPPASMSSFDILSVAAFIFIYRRILDPLIASLKKTRRAQ-GFTEL  835
             VEQG AM+T IA F IP ASMS+FDILSVA  IF+ RR+L+PL+   KK +    G TEL
Sbjct  372   VEQGDAMKTTIANFRIPAASMSTFDILSVAGVIFLNRRVLNPLVKRFKKCKDDDAGLTEL  431

Query  834   QRMGVGLiiaimamvaagiVEHFRLKYASTDCPRCP--SSLSIFWQVPQYVLIGASEVFM  661
             QRMG+GL+IA+MAM+++GIVE +RLKYAS DC  C   SSL+IFWQVPQY  IGASEVFM
Sbjct  432   QRMGIGLVIAVMAMLSSGIVECYRLKYASNDCKHCEGSSSLNIFWQVPQYAFIGASEVFM  491

Query  660   YVGQLEFFNGQAPEGLKSFASALCMTSISLGNYVSSLLVSIVMRISTTHRMPGWIPGNLN  481
             YV QLEFFN QAP+GLKSF SALCMTSISLGNYVSS LVSIVM+IS T  MPGWIPGNLN
Sbjct  492   YVAQLEFFNAQAPDGLKSFGSALCMTSISLGNYVSSFLVSIVMKISATDNMPGWIPGNLN  551

Query  480   KGHLDRFYFLLAALTTADFVVYILCAKWYKYI-------EFEERNSC  361
             KGHLDRFYFLLA LT  D V YI CAKWYK I       E EE + C
Sbjct  552   KGHLDRFYFLLAGLTLLDLVAYIACAKWYKNIKHSEKIQEHEEEDKC  598



>ref|XP_009409941.1| PREDICTED: protein NRT1/ PTR FAMILY 7.2-like isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=618

 Score =   748 bits (1932),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 394/584 (67%), Positives = 461/584 (79%), Gaps = 13/584 (2%)
 Frame = -3

Query  2124  TKMFFIKNERDEEKASREECTLDGTVDHYGRPALRSATGGWFAGVLLLVNQGLATLAFFG  1945
             T+      E +E K  + E TLDG+VD  GRPA +  TGGW  GVL+LVNQGLATLAFFG
Sbjct  23    TRSASFNKEMNEGKDEQYEYTLDGSVDIRGRPAAKGKTGGWVGGVLVLVNQGLATLAFFG  82

Query  1944  VGVNLVLFLTRVMGQDNADAANNVSKWTGTVYLFSLLGAFLSDSYWGRYKTCAIFQLIYV  1765
             VGVNLVLFLTRV+ Q+NADAANNVSKWTGTVY+FSLLGAFLSDSYWGRYKTCAIFQ+I+ 
Sbjct  83    VGVNLVLFLTRVLQQNNADAANNVSKWTGTVYIFSLLGAFLSDSYWGRYKTCAIFQVIF-  141

Query  1764  VGLISVSIFSFIFLVKPKGCGDENTPCRSPSRIHIAVYYVSIYLVALGNGGYQPNIATFG  1585
              GL+ +S+ +++FL+KP GCG+E+  C   S +   V+Y+SIYL+ALGNGGYQPNIATFG
Sbjct  142   -GLVLLSLSTYLFLLKPSGCGEEHFICGPHSSMDTGVFYLSIYLIALGNGGYQPNIATFG  200

Query  1584  SDQFDGDHAHESVSKVAFFSYFYLALNLGSLFSNTVLVYFEDKGMWTLGFWastvsavla  1405
             +DQFD     ES SKV+FFSYFYLALNLGSLFSNT L YFEDKGMW LGFW S  SAV+A
Sbjct  201   ADQFDAKDPDESHSKVSFFSYFYLALNLGSLFSNTFLNYFEDKGMWALGFWVSAGSAVVA  260

Query  1404  lllflVGTPRYRHFAPKGNPLSRFSQVLVASARKWNVHLPSDGDDHRLYEIQEHDSS---  1234
             LLLFL GT RYRHF P GNPLSR  QV+VA++RKW + +P++G D  LYE +E   S   
Sbjct  261   LLLFLCGTSRYRHFKPIGNPLSRVCQVVVAASRKWRMKMPTNGGDD-LYEAEEKQVSAAH  319

Query  1233  -TRKILHTEGFKFLDKAAVITTKESVRDLEER---NINPWRLCSVTQVEEVKCILRLLPI  1066
              +R+ILHTEGF+FLD+AAVI  +      + +   + +PWRLC +TQVEE+KC+LRL+PI
Sbjct  320   GSRRILHTEGFRFLDRAAVIDPENDFTIQQGKSGCSRDPWRLCPITQVEELKCVLRLIPI  379

Query  1065  WLCTILYSVVFTQMASLFVEQGAAMRTNIAGFHIPPASMSSFDILSVAAFIFIYRRILDP  886
             WL TILYSVVFTQMASLFVEQGAAM   +AGF IPPASMS+FDI+SVAAFI  YRR L+P
Sbjct  380   WLTTILYSVVFTQMASLFVEQGAAMDGTVAGFRIPPASMSAFDIVSVAAFILFYRRFLNP  439

Query  885   LIASLKKTRRAQGFTELQRMGVGLiiaimamvaagiVEHFRLKYASTDCPRCPSSLSIFW  706
             L++ L+K   A+G TELQRMG GLI+AIMAM +AG VE  RL+     C    SSLSI W
Sbjct  440   LVSRLRKD--ARGLTELQRMGAGLILAIMAMASAGTVEVQRLRSVCRGCDD-DSSLSILW  496

Query  705   QVPQYVLIGASEVFMYVGQLEFFNGQAPEGLKSFASALCMTSISLGNYVSSLLVSIVMRI  526
             Q+PQY LIGASEVFMYVGQLEFFNGQAP GLKSF SALCMTSISLGNYVSSLLV+ VM I
Sbjct  497   QIPQYALIGASEVFMYVGQLEFFNGQAPHGLKSFGSALCMTSISLGNYVSSLLVTAVMEI  556

Query  525   STTHRMPGWIPGNLNKGHLDRFYFLLAALTTADFVVYILCAKWY  394
             +      GWIP NLN+GH+DRFYFLLA+LT ADF V++ CA WY
Sbjct  557   TGKGDRAGWIPANLNRGHMDRFYFLLASLTAADFAVFVTCAIWY  600



>ref|XP_008799424.1| PREDICTED: protein NRT1/ PTR FAMILY 7.3-like [Phoenix dactylifera]
Length=604

 Score =   747 bits (1928),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 402/594 (68%), Positives = 475/594 (80%), Gaps = 21/594 (4%)
 Frame = -3

Query  2085  KASREEC---TLDGTVDHYGRPALRSATGGWFAGVLLLVNQGLATLAFFGVGVNLVLFLT  1915
              +S+EEC   TLDG+VD  GRPA++  TGGW AG+LLLVNQGLATLAFFG+GVNLVLFLT
Sbjct  22    NSSQEECCEYTLDGSVDIKGRPAIKGKTGGWIAGILLLVNQGLATLAFFGIGVNLVLFLT  81

Query  1914  RVMGQDNADAANNVSKWTGTVYLFSLLGAFLSDSYWGRYKTCAIFQLIYVVGLISVSIFS  1735
             RV+ Q+NADAAN VSKWTGTVY+FSL+GAFLSDSYWGRYKTCAIFQ+I+V+GL+ +S+ S
Sbjct  82    RVLQQNNADAANAVSKWTGTVYIFSLIGAFLSDSYWGRYKTCAIFQIIFVLGLVLLSLSS  141

Query  1734  FIFLVKPKGCGDENTPCRSPSRIHIAVYYVSIYLVALGNGGYQPNIATFGSDQFDGDHAH  1555
              +FL+KP GCGDE T C   S   + V+Y+S YLVALGNGGYQPNIAT G+DQFD +   
Sbjct  142   HLFLLKPSGCGDEETFCGPHSGPEVDVFYLSTYLVALGNGGYQPNIATLGADQFDREDPV  201

Query  1554  ESVSKVAFFSYFYLALNLGSLFSNTVLVYFEDKGMWTLGFWastvsavlalllflVGTPR  1375
             E+ SKV+FFS+FYLALNLGSLFSNT L YFED GMW LGFWAST SA +AL+LFL GTPR
Sbjct  202   EARSKVSFFSHFYLALNLGSLFSNTFLGYFEDNGMWALGFWASTGSAFVALVLFLCGTPR  261

Query  1374  YRHFAPKGNPLSRFSQVLVASARKWNVHLPSDGDDHRLYEIQEHD-----SSTRKILHTE  1210
             YRHF P GNP SR  QV+VA++RKW V +P  G  + LYE+   +     +  R++LHTE
Sbjct  262   YRHFKPGGNPFSRLCQVIVAASRKWRVRIPPGG--YNLYEVDFKEELAVSNGHRRLLHTE  319

Query  1209  GFKFLDKAAVITTKESVRDLEERNI--NPWRLCSVTQVEEVKCILRLLPIWLCTILYSVV  1036
             GF+FLD+AA I +     DL+++ I  +PWR C++TQVEEVKC+LRL+PIWL TILYSV 
Sbjct  320   GFEFLDRAAFIDS-----DLQDQLIPRDPWRCCTITQVEEVKCVLRLIPIWLTTILYSVA  374

Query  1035  FTQMASLFVEQGAAMRTNIAGFHIPPASMSSFDILSVAAFIFIYRRILDPLIASLKKTRR  856
             FTQMASLFVEQG AM T IAGF IPPASMS+FDILSVA FI + RR+L PL++ L+K   
Sbjct  375   FTQMASLFVEQGDAMNTTIAGFEIPPASMSAFDILSVAVFILLNRRLLTPLVSRLRK--E  432

Query  855   AQGFTELQRMGVGLiiaimamvaagiVEHFRLKYASTDCPRCPSSLSIFWQVPQYVLIGA  676
              +G TELQRMG+GLI+AI+AMVAAG VE  RLK+    C    SSLSI WQ+PQY+LIGA
Sbjct  433   PKGLTELQRMGIGLIVAIIAMVAAGTVEIVRLKHGCKGCKDDESSLSILWQIPQYMLIGA  492

Query  675   SEVFMYVGQLEFFNGQAPEGLKSFASALCMTSISLGNYVSSLLVSIVMRISTTHRMPGWI  496
             SEVFMYVGQLEFFN QAP GLKSF SALCM SISLGNYVSSLLV+IVM+I+T    PGWI
Sbjct  493   SEVFMYVGQLEFFNDQAPNGLKSFGSALCMASISLGNYVSSLLVTIVMKITTEDNRPGWI  552

Query  495   PGNLNKGHLDRFYFLLAALTTADFVVYILCAKWYKYIEFEERNSCLKNIGDSKL  334
             PGNLNKGH+DRFYFLLAALT  DFV+Y+ CA+WYK I+ E R  C  + GDS +
Sbjct  553   PGNLNKGHMDRFYFLLAALTGVDFVLYVACARWYKCIKLEGR--CGGDEGDSSV  604



>ref|XP_010691959.1| PREDICTED: protein NRT1/ PTR FAMILY 7.3-like [Beta vulgaris subsp. 
vulgaris]
Length=600

 Score =   736 bits (1901),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 388/611 (64%), Positives = 474/611 (78%), Gaps = 19/611 (3%)
 Frame = -3

Query  2139  AFLNITKMFFIKNERDEEKASREECTLDGTVDHYGRPALRSATGGWFAGVLLLVNQGLAT  1960
             A+LN     F K E+  +++   E TLDGTVD +G  A+R+ TG W  G+L+LVNQGLAT
Sbjct  2     AYLN-----FFKKEKIVDESEEVEYTLDGTVDRHGNRAIRTKTGRWGPGILILVNQGLAT  56

Query  1959  LAFFGVGVNLVLFLTRVMGQDNADAANNVSKWTGTVYLFSLLGAFLSDSYWGRYKTCAIF  1780
             LAFFGVGVNLVLFLTRV+G +NADAANNVSKWTGTVYLFSL+GAFLSDSYWGRYKTCAIF
Sbjct  57    LAFFGVGVNLVLFLTRVVGLNNADAANNVSKWTGTVYLFSLVGAFLSDSYWGRYKTCAIF  116

Query  1779  QLIYVVGLISVSIFSFIFLVKPKGCGDENTPCRSPSRIHIAVYYVSIYLVALGNGGYQPN  1600
             Q I+V+GL  +S+ S++FL+ PKGCGDE  PC S S  H+ ++Y+S+Y+VALGNGGYQPN
Sbjct  117   QAIFVLGLALLSLSSYLFLLNPKGCGDEQIPCTSHSGFHVVLFYISLYMVALGNGGYQPN  176

Query  1599  IATFGSDQFDGDHAHESVSKVAFFSYFYLALNLGSLFSNTVLVYFEDKGMWTLGFWastv  1420
             IATFG+DQFD +H  E  SK++FFSYFYLA NLGSLFSNT+L Y+E+ G W +GF AS  
Sbjct  177   IATFGADQFDEEHPKEGRSKISFFSYFYLAFNLGSLFSNTLLAYYENAGKWAIGFCASAT  236

Query  1419  savlalllflVGTPRYRHFAPKGNPLSRFSQVLVASARKWNVHLPSDGDDHRLYEIQEHD  1240
             +A++AL LF  GTP YRHF  +GNP++RF +V VA+  KW  H+P +G+   LYE+    
Sbjct  237   TALMALALFFGGTPHYRHFKSQGNPVARFCKVFVAAINKWKAHVPFEGEG--LYELDAKT  294

Query  1239  SST---RKILHTEGFKFLDKAAVIT-TKESVRDLEERNINPWRLCSVTQVEEVKCILRLL  1072
              S    R+I HTEG   LDKAAV+  T E +        N   LC+VTQVEEVKCILRLL
Sbjct  295   YSKNGRRQISHTEGLTILDKAAVMKYTPERISTNNHTKYNERNLCTVTQVEEVKCILRLL  354

Query  1071  PIWLCTILYSVVFTQMASLFVEQGAAMRTNIAGFHIPPASMSSFDILSVAAFIFIYRRIL  892
             PIW+CTI+YSVVFTQMASLFVEQGAAM+  I  F+IPPASMS FDILSV +FIFIYRR+L
Sbjct  355   PIWICTIMYSVVFTQMASLFVEQGAAMKATIGNFYIPPASMSIFDILSVVSFIFIYRRVL  414

Query  891   DPLIASLKKTRRAQGFTELQRMGVGLiiaimamvaagiVEHFRLKYASTDCPRC--PSSL  718
             +P +  L+K    +G TELQRMG+GLI AI+AM+AAG VE FRLK+A  DC  C   SSL
Sbjct  415   NPFVTRLRK----RGLTELQRMGIGLIFAILAMIAAGTVEIFRLKFAINDCKNCKNASSL  470

Query  717   SIFWQVPQYVLIGASEVFMYVGQLEFFNGQAPEGLKSFASALCMTSISLGNYVSSLLVSI  538
             SIFWQ+PQY+LIGASEVFMYVGQLEFFNGQAPEGLK+F SALCM S+S GNY+SS++V+I
Sbjct  471   SIFWQIPQYMLIGASEVFMYVGQLEFFNGQAPEGLKTFGSALCMLSMSFGNYLSSIIVTI  530

Query  537   VMRISTTHRMPGWIPGNLNKGHLDRFYFLLAALTTADFVVYILCAKWYKYIEFEERNSCL  358
             +M+I+T + MPGWIP +LNKGHL+RF+FLLA LT  DF+VY+  A  YKYI+ EE     
Sbjct  531   LMKITTQNNMPGWIPEDLNKGHLERFFFLLAGLTAVDFMVYLFYASSYKYIQAEEPKG--  588

Query  357   KNIGDSKLQED  325
             ++ G+S +  D
Sbjct  589   ESDGESNINID  599



>ref|XP_010540767.1| PREDICTED: protein NRT1/ PTR FAMILY 7.3-like isoform X2 [Tarenaya 
hassleriana]
Length=599

 Score =   734 bits (1895),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 400/588 (68%), Positives = 480/588 (82%), Gaps = 12/588 (2%)
 Frame = -3

Query  2064  TLDGTVDHYGRPALRSATGGWFAGVLLLVNQGLATLAFFGVGVNLVLFLTRVMGQDNADA  1885
             T DG+VD  GRPALR  +G W AG ++L+NQGLATLAFFGVGVNLVLFLTRV+ Q+NADA
Sbjct  13    TRDGSVDWEGRPALRHKSGRWVAGSVILLNQGLATLAFFGVGVNLVLFLTRVLQQNNADA  72

Query  1884  ANNVSKWTGTVYLFSLLGAFLSDSYWGRYKTCAIFQLIYVVGLISVSIFSFIFLVKPKGC  1705
             ANNVSKWTGTVY+FSL+GAFLSDSYWGR+KTCAIFQ+I+V+GL+S+S+ S++FL++PKGC
Sbjct  73    ANNVSKWTGTVYIFSLVGAFLSDSYWGRFKTCAIFQVIFVLGLMSLSLSSYLFLIRPKGC  132

Query  1704  GDENTPCRSPSRIHIAVYYVSIYLVALGNGGYQPNIATFGSDQFDGDHAHESVSKVAFFS  1525
             G+EN PC S S + I ++Y+SIYLVALGNGGYQPNIATFG+DQFD +H  E  SK+AFFS
Sbjct  133   GNENIPCGSHSTMEITLFYLSIYLVALGNGGYQPNIATFGADQFDEEHPREGYSKIAFFS  192

Query  1524  YFYLALNLGSLFSNTVLVYFEDKGMWTLGFWastvsavlalllflVGTPRYRHFAPKGNP  1345
             YFYLALNLGSLFSNT+L YFED+G+W LGFW ST SA+  L+LFL+GTPRYRHF P GNP
Sbjct  193   YFYLALNLGSLFSNTILGYFEDEGLWALGFWVSTGSALAGLILFLMGTPRYRHFKPSGNP  252

Query  1344  LSRFSQVLVASARKWNVHL-PSDGDDHRLYEIQEHDSSTRKILHTEGFKFLDKAAVITTK  1168
             L RF QV+VA+ +KW V + P  G    LY++       R+I+HT+ FKFLDKAAVIT  
Sbjct  253   LPRFCQVIVAAVKKWTVEISPGRGGGDELYDL-PGSGGGRRIMHTDEFKFLDKAAVITA-  310

Query  1167  ESVRDLEERNINPWRLCSVTQVEEVKCILRLLPIWLCTILYSVVFTQMASLFVEQGAAMR  988
             E + D E   +NPWRLC VTQVEEVKCILRL+PIWLCTI+YSVVFTQMASLFVEQGAAM+
Sbjct  311   EDMEDEENGRVNPWRLCPVTQVEEVKCILRLMPIWLCTIIYSVVFTQMASLFVEQGAAMK  370

Query  987   TNIA----GFHIPPASMSSFDILSVAAFIFIYRRILDPLIASLK-KTRRAQGFTELQRMG  823
             T +A     F +PPASMSSFDILSVA FIF+YRR+++P  + L+ K   ++G TEL+RMG
Sbjct  371   TAMAAAENSFRVPPASMSSFDILSVAVFIFLYRRVIEPTASRLRQKENGSKGMTELERMG  430

Query  822   VGLiiaimamvaagiVEHFRLKYASTDCPRC--PSSLSIFWQVPQYVLIGASEVFMYVGQ  649
             +GL+IA++AM++AGIVE +RLKYA   C  C   SSLSIFWQVPQY LIGASEVFMYVGQ
Sbjct  431   IGLVIAVLAMLSAGIVESYRLKYADKSCTHCDGSSSLSIFWQVPQYALIGASEVFMYVGQ  490

Query  648   LEFFNGQAPEGLKSFASALCMTSISLGNYVSSLLVSIVMRISTTHRMPGWIPGNLNKGHL  469
             LEFFN QAP+GLKSF S+LCM S+S+GN+VSSLLV++VM+IST   +PGWIP NLNKGHL
Sbjct  491   LEFFNAQAPDGLKSFGSSLCMMSMSMGNFVSSLLVTMVMKISTEDHVPGWIPRNLNKGHL  550

Query  468   DRFYFLLAALTTADFVVYILCAKWYKYIEFEERNSCLKNIGDSKLQED  325
             DRFYFLLA LT+ D VVYI CAKWYK I+ + +    K  GD +   D
Sbjct  551   DRFYFLLAVLTSVDLVVYIACAKWYKCIKLQGKGD--KPDGDDEKDGD  596



>ref|XP_010943512.1| PREDICTED: protein NRT1/ PTR FAMILY 7.2 isoform X1 [Elaeis guineensis]
Length=604

 Score =   734 bits (1895),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 376/583 (64%), Positives = 459/583 (79%), Gaps = 11/583 (2%)
 Frame = -3

Query  2106  KNERDEEKASREECTLDGTVDHYGRPALRSATGGWFAGVLLLVNQGLATLAFFGVGVNLV  1927
              N +  E       T DG+VD  G PA+++ TG W + +LLLVN GLATLAFFGVGVNLV
Sbjct  21    NNSKKNEDKMISPITEDGSVDRRGNPAVKARTGRWKSAILLLVNYGLATLAFFGVGVNLV  80

Query  1926  LFLTRVMGQDNADAANNVSKWTGTVYLFSLLGAFLSDSYWGRYKTCAIFQLIYVVGLISV  1747
             LFLTRV+ Q+NADAANNVSKWTGTVY+FSL+GAFLSDSYWGRY TCAIFQLIYVVGL+ +
Sbjct  81    LFLTRVLKQENADAANNVSKWTGTVYIFSLIGAFLSDSYWGRYLTCAIFQLIYVVGLMLL  140

Query  1746  SIFSFIFLVKPKGCGDENTPCRSPSRIHIAVYYVSIYLVALGNGGYQPNIATFGSDQFDG  1567
             S  S+  LVKP GCGD    C+ P+ I  A++Y+SIYL+A GNGGYQP+IATFGSDQFD 
Sbjct  141   SFTSWFLLVKPSGCGDGELECKPPTTIGTAIFYLSIYLIAFGNGGYQPSIATFGSDQFDE  200

Query  1566  DHAHESVSKVAFFSYFYLALNLGSLFSNTVLVYFEDKGMWTLGFWastvsavlalllflV  1387
                +E  SK+AFFSYFYLALN+GSLFSNTVLVY+ED G W +GFW S  SA LALLLFL+
Sbjct  201   MDPYERHSKIAFFSYFYLALNVGSLFSNTVLVYYEDSGKWVIGFWTSAGSAALALLLFLL  260

Query  1386  GTPRYRHFAPKGNPLSRFSQVLVASARKWNVHLPSDGDDHRLYEIQEHDSS---TRKILH  1216
             GTP YRHF P GNPL+R +QV  A+ RKW V +P  G++  LYE++  +S+   +RKI H
Sbjct  261   GTPSYRHFKPSGNPLTRIAQVFFAAFRKWEVEVP--GNEVMLYEVEGKESTIAGSRKICH  318

Query  1215  TEGFKFLDKAAVITTKESVRDLEERNINPWRLCSVTQVEEVKCILRLLPIWLCTILYSVV  1036
             +  F+FLDKAA +T  +    ++ +  NPW+LC+VTQVEEVKC+L++LPIWLCTI+YSVV
Sbjct  319   SNEFRFLDKAATLTADDYC--MQAKTKNPWKLCTVTQVEEVKCVLKMLPIWLCTIIYSVV  376

Query  1035  FTQMASLFVEQGAAMRTNIAGFHIPPASMSSFDILSVAAFIFIYRRILDPLIASLKKTRR  856
             FTQMASLFVEQGA+M TNI  FHIPPASMS FDILSV  FI IYRR+L P+++ L  ++ 
Sbjct  377   FTQMASLFVEQGASMNTNIGTFHIPPASMSVFDILSVLFFIVIYRRVLIPVMSRL--SQN  434

Query  855   AQGFTELQRMGVGLiiaimamvaagiVEHFRLKYASTDCPRCPSSLSIFWQVPQYVLIGA  676
              +G TELQRMGVGL+I ++AMVAAG+VE  RLK    + P  PSSLSI  Q+PQY  IGA
Sbjct  435   PKGLTELQRMGVGLVIGMLAMVAAGVVEVERLK--RVEVPDEPSSLSILCQIPQYAFIGA  492

Query  675   SEVFMYVGQLEFFNGQAPEGLKSFASALCMTSISLGNYVSSLLVSIVMRISTTHRMPGWI  496
             SEVFMYVGQLEFFNGQAP+G+KSF S+LCM SISLGNYVS ++V+IV  +++  + PGWI
Sbjct  493   SEVFMYVGQLEFFNGQAPDGIKSFGSSLCMASISLGNYVSIMIVNIVTAVTSRDKNPGWI  552

Query  495   PGNLNKGHLDRFYFLLAALTTADFVVYILCAKWYKYIEFEERN  367
             PGNLN+GHL+RFYFLLA LT  DF+VY++CA+WYK I+ E  +
Sbjct  553   PGNLNRGHLERFYFLLATLTVVDFIVYLVCARWYKCIKLETND  595



>ref|XP_010540766.1| PREDICTED: protein NRT1/ PTR FAMILY 7.3-like isoform X1 [Tarenaya 
hassleriana]
Length=609

 Score =   734 bits (1895),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 400/588 (68%), Positives = 480/588 (82%), Gaps = 12/588 (2%)
 Frame = -3

Query  2064  TLDGTVDHYGRPALRSATGGWFAGVLLLVNQGLATLAFFGVGVNLVLFLTRVMGQDNADA  1885
             T DG+VD  GRPALR  +G W AG ++L+NQGLATLAFFGVGVNLVLFLTRV+ Q+NADA
Sbjct  23    TRDGSVDWEGRPALRHKSGRWVAGSVILLNQGLATLAFFGVGVNLVLFLTRVLQQNNADA  82

Query  1884  ANNVSKWTGTVYLFSLLGAFLSDSYWGRYKTCAIFQLIYVVGLISVSIFSFIFLVKPKGC  1705
             ANNVSKWTGTVY+FSL+GAFLSDSYWGR+KTCAIFQ+I+V+GL+S+S+ S++FL++PKGC
Sbjct  83    ANNVSKWTGTVYIFSLVGAFLSDSYWGRFKTCAIFQVIFVLGLMSLSLSSYLFLIRPKGC  142

Query  1704  GDENTPCRSPSRIHIAVYYVSIYLVALGNGGYQPNIATFGSDQFDGDHAHESVSKVAFFS  1525
             G+EN PC S S + I ++Y+SIYLVALGNGGYQPNIATFG+DQFD +H  E  SK+AFFS
Sbjct  143   GNENIPCGSHSTMEITLFYLSIYLVALGNGGYQPNIATFGADQFDEEHPREGYSKIAFFS  202

Query  1524  YFYLALNLGSLFSNTVLVYFEDKGMWTLGFWastvsavlalllflVGTPRYRHFAPKGNP  1345
             YFYLALNLGSLFSNT+L YFED+G+W LGFW ST SA+  L+LFL+GTPRYRHF P GNP
Sbjct  203   YFYLALNLGSLFSNTILGYFEDEGLWALGFWVSTGSALAGLILFLMGTPRYRHFKPSGNP  262

Query  1344  LSRFSQVLVASARKWNVHL-PSDGDDHRLYEIQEHDSSTRKILHTEGFKFLDKAAVITTK  1168
             L RF QV+VA+ +KW V + P  G    LY++       R+I+HT+ FKFLDKAAVIT  
Sbjct  263   LPRFCQVIVAAVKKWTVEISPGRGGGDELYDL-PGSGGGRRIMHTDEFKFLDKAAVITA-  320

Query  1167  ESVRDLEERNINPWRLCSVTQVEEVKCILRLLPIWLCTILYSVVFTQMASLFVEQGAAMR  988
             E + D E   +NPWRLC VTQVEEVKCILRL+PIWLCTI+YSVVFTQMASLFVEQGAAM+
Sbjct  321   EDMEDEENGRVNPWRLCPVTQVEEVKCILRLMPIWLCTIIYSVVFTQMASLFVEQGAAMK  380

Query  987   TNIA----GFHIPPASMSSFDILSVAAFIFIYRRILDPLIASLK-KTRRAQGFTELQRMG  823
             T +A     F +PPASMSSFDILSVA FIF+YRR+++P  + L+ K   ++G TEL+RMG
Sbjct  381   TAMAAAENSFRVPPASMSSFDILSVAVFIFLYRRVIEPTASRLRQKENGSKGMTELERMG  440

Query  822   VGLiiaimamvaagiVEHFRLKYASTDCPRC--PSSLSIFWQVPQYVLIGASEVFMYVGQ  649
             +GL+IA++AM++AGIVE +RLKYA   C  C   SSLSIFWQVPQY LIGASEVFMYVGQ
Sbjct  441   IGLVIAVLAMLSAGIVESYRLKYADKSCTHCDGSSSLSIFWQVPQYALIGASEVFMYVGQ  500

Query  648   LEFFNGQAPEGLKSFASALCMTSISLGNYVSSLLVSIVMRISTTHRMPGWIPGNLNKGHL  469
             LEFFN QAP+GLKSF S+LCM S+S+GN+VSSLLV++VM+IST   +PGWIP NLNKGHL
Sbjct  501   LEFFNAQAPDGLKSFGSSLCMMSMSMGNFVSSLLVTMVMKISTEDHVPGWIPRNLNKGHL  560

Query  468   DRFYFLLAALTTADFVVYILCAKWYKYIEFEERNSCLKNIGDSKLQED  325
             DRFYFLLA LT+ D VVYI CAKWYK I+ + +    K  GD +   D
Sbjct  561   DRFYFLLAVLTSVDLVVYIACAKWYKCIKLQGKGD--KPDGDDEKDGD  606



>ref|XP_010943513.1| PREDICTED: protein NRT1/ PTR FAMILY 7.2 isoform X2 [Elaeis guineensis]
Length=601

 Score =   734 bits (1894),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 376/583 (64%), Positives = 459/583 (79%), Gaps = 11/583 (2%)
 Frame = -3

Query  2106  KNERDEEKASREECTLDGTVDHYGRPALRSATGGWFAGVLLLVNQGLATLAFFGVGVNLV  1927
              N +  E       T DG+VD  G PA+++ TG W + +LLLVN GLATLAFFGVGVNLV
Sbjct  18    NNSKKNEDKMISPITEDGSVDRRGNPAVKARTGRWKSAILLLVNYGLATLAFFGVGVNLV  77

Query  1926  LFLTRVMGQDNADAANNVSKWTGTVYLFSLLGAFLSDSYWGRYKTCAIFQLIYVVGLISV  1747
             LFLTRV+ Q+NADAANNVSKWTGTVY+FSL+GAFLSDSYWGRY TCAIFQLIYVVGL+ +
Sbjct  78    LFLTRVLKQENADAANNVSKWTGTVYIFSLIGAFLSDSYWGRYLTCAIFQLIYVVGLMLL  137

Query  1746  SIFSFIFLVKPKGCGDENTPCRSPSRIHIAVYYVSIYLVALGNGGYQPNIATFGSDQFDG  1567
             S  S+  LVKP GCGD    C+ P+ I  A++Y+SIYL+A GNGGYQP+IATFGSDQFD 
Sbjct  138   SFTSWFLLVKPSGCGDGELECKPPTTIGTAIFYLSIYLIAFGNGGYQPSIATFGSDQFDE  197

Query  1566  DHAHESVSKVAFFSYFYLALNLGSLFSNTVLVYFEDKGMWTLGFWastvsavlalllflV  1387
                +E  SK+AFFSYFYLALN+GSLFSNTVLVY+ED G W +GFW S  SA LALLLFL+
Sbjct  198   MDPYERHSKIAFFSYFYLALNVGSLFSNTVLVYYEDSGKWVIGFWTSAGSAALALLLFLL  257

Query  1386  GTPRYRHFAPKGNPLSRFSQVLVASARKWNVHLPSDGDDHRLYEIQEHDSS---TRKILH  1216
             GTP YRHF P GNPL+R +QV  A+ RKW V +P  G++  LYE++  +S+   +RKI H
Sbjct  258   GTPSYRHFKPSGNPLTRIAQVFFAAFRKWEVEVP--GNEVMLYEVEGKESTIAGSRKICH  315

Query  1215  TEGFKFLDKAAVITTKESVRDLEERNINPWRLCSVTQVEEVKCILRLLPIWLCTILYSVV  1036
             +  F+FLDKAA +T  +    ++ +  NPW+LC+VTQVEEVKC+L++LPIWLCTI+YSVV
Sbjct  316   SNEFRFLDKAATLTADDYC--MQAKTKNPWKLCTVTQVEEVKCVLKMLPIWLCTIIYSVV  373

Query  1035  FTQMASLFVEQGAAMRTNIAGFHIPPASMSSFDILSVAAFIFIYRRILDPLIASLKKTRR  856
             FTQMASLFVEQGA+M TNI  FHIPPASMS FDILSV  FI IYRR+L P+++ L  ++ 
Sbjct  374   FTQMASLFVEQGASMNTNIGTFHIPPASMSVFDILSVLFFIVIYRRVLIPVMSRL--SQN  431

Query  855   AQGFTELQRMGVGLiiaimamvaagiVEHFRLKYASTDCPRCPSSLSIFWQVPQYVLIGA  676
              +G TELQRMGVGL+I ++AMVAAG+VE  RLK    + P  PSSLSI  Q+PQY  IGA
Sbjct  432   PKGLTELQRMGVGLVIGMLAMVAAGVVEVERLK--RVEVPDEPSSLSILCQIPQYAFIGA  489

Query  675   SEVFMYVGQLEFFNGQAPEGLKSFASALCMTSISLGNYVSSLLVSIVMRISTTHRMPGWI  496
             SEVFMYVGQLEFFNGQAP+G+KSF S+LCM SISLGNYVS ++V+IV  +++  + PGWI
Sbjct  490   SEVFMYVGQLEFFNGQAPDGIKSFGSSLCMASISLGNYVSIMIVNIVTAVTSRDKNPGWI  549

Query  495   PGNLNKGHLDRFYFLLAALTTADFVVYILCAKWYKYIEFEERN  367
             PGNLN+GHL+RFYFLLA LT  DF+VY++CA+WYK I+ E  +
Sbjct  550   PGNLNRGHLERFYFLLATLTVVDFIVYLVCARWYKCIKLETND  592



>ref|XP_010691958.1| PREDICTED: protein NRT1/ PTR FAMILY 7.3-like [Beta vulgaris subsp. 
vulgaris]
Length=600

 Score =   729 bits (1883),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 385/604 (64%), Positives = 471/604 (78%), Gaps = 18/604 (3%)
 Frame = -3

Query  2112  FIKNERDEEKASREECTLDGTVDHYGRPALRSATGGWFAGVLLLVNQGLATLAFFGVGVN  1933
             F + E+  +++   E TLDGTVD +G  A+R+ TG W  G+L+LVNQGLATLAFFGVGVN
Sbjct  6     FFQKEKIVDESEEVEYTLDGTVDRHGNRAIRTKTGRWGPGILILVNQGLATLAFFGVGVN  65

Query  1932  LVLFLTRVMGQDNADAANNVSKWTGTVYLFSLLGAFLSDSYWGRYKTCAIFQLIYVVGLI  1753
             LVLFLTRV+GQ+NADAANNVSKWTGTVYLFSL+GAFLSDSYWGRYKTCAIFQ I+V+GL 
Sbjct  66    LVLFLTRVVGQNNADAANNVSKWTGTVYLFSLVGAFLSDSYWGRYKTCAIFQAIFVLGLA  125

Query  1752  SVSIFSFIFLVKPKGCGDENTPCRSPSRIHIAVYYVSIYLVALGNGGYQPNIATFGSDQF  1573
              +S+ S++FL+KPKGCGDE T C S S   +A++Y+S+Y+VALGNGGYQPNIATFG+DQF
Sbjct  126   LLSLSSYLFLLKPKGCGDEETLCTSHSGFRVALFYISLYMVALGNGGYQPNIATFGADQF  185

Query  1572  DGDHAHESVSKVAFFSYFYLALNLGSLFSNTVLVYFEDKGMWTLGFWastvsavlalllf  1393
             D +H  E  SK++FFSYFYLA NLGSLFSNT+L Y+E+ G W +GF AST +A++AL LF
Sbjct  186   DEEHPKEGRSKISFFSYFYLAFNLGSLFSNTLLAYYENDGKWAIGFCASTSTALVALALF  245

Query  1392  lVGTPRYRHFAPKGNPLSRFSQVLVASARKWNVHLPSDGDDHRLYEIQEHDSST---RKI  1222
               GTPRYRHF  +GNP++RF +V VA   KW  H+PS+G+   LYE+     S    RKI
Sbjct  246   FGGTPRYRHFKSQGNPVARFCKVFVAVINKWKAHVPSEGEG--LYELDAKTYSKMGRRKI  303

Query  1221  LHTEGFKFLDKAAVITTKESVRDLEERNINPWR---LCSVTQVEEVKCILRLLPIWLCTI  1051
              HTEG   LD+AAV+  K S   +   N   ++   LC++TQVEEVKCILRLLPIW+CTI
Sbjct  304   SHTEGLTILDRAAVV--KYSTERISTNNHTKYKERNLCTITQVEEVKCILRLLPIWVCTI  361

Query  1050  LYSVVFTQMASLFVEQGAAMRTNIAGFHIPPASMSSFDILSVAAFIFIYRRILDPLIASL  871
             +YSVVFTQMAS FVEQGAAM+  I  FHIPPAS+S F+ILSV +FIFIYRR+L+P +  L
Sbjct  362   MYSVVFTQMASFFVEQGAAMKATIGHFHIPPASISVFNILSVVSFIFIYRRVLNPFVTLL  421

Query  870   KKTRRAQGFTELQRMGVGLiiaimamvaagiVEHFRLKYASTDCPRC--PSSLSIFWQVP  697
              K    +G TELQRMG+GLIIA +AM+AAG VE FRLK+A  DC  C   SSLSIFWQ+P
Sbjct  422   TK----RGLTELQRMGIGLIIATLAMIAAGTVEIFRLKFAINDCKNCRDASSLSIFWQIP  477

Query  696   QYVLIGASEVFMYVGQLEFFNGQAPEGLKSFASALCMTSISLGNYVSSLLVSIVMRISTT  517
             QY+LIGASEVFMYVGQLEFFNGQAPEGLK+F SALCM S+S GNY+SS++V+I+M+I+T 
Sbjct  478   QYMLIGASEVFMYVGQLEFFNGQAPEGLKTFGSALCMLSMSFGNYMSSIIVTILMKITTK  537

Query  516   HRMPGWIPGNLNKGHLDRFYFLLAALTTADFVVYILCAKWYKYIEFEERNSCLKNIGDSK  337
             + MPGWIP +LNKGHL+RF+FLLA LT  DF+ Y+  A  YKYI+ EE        G+S 
Sbjct  538   NNMPGWIPEDLNKGHLERFFFLLAGLTAIDFMAYLFYAGSYKYIQSEEPKG--GGDGESN  595

Query  336   LQED  325
             +  D
Sbjct  596   INTD  599



>ref|XP_009418231.1| PREDICTED: protein NRT1/ PTR FAMILY 7.2-like [Musa acuminata 
subsp. malaccensis]
Length=600

 Score =   728 bits (1878),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 370/582 (64%), Positives = 454/582 (78%), Gaps = 11/582 (2%)
 Frame = -3

Query  2103  NERDEEKASREECTLDGTVDHYGRPALRSATGGWFAGVLLLVNQGLATLAFFGVGVNLVL  1924
             N  D +       T DG+VD  G+PA+++ TG W + VLLLVN GL T AFFGVGVNLVL
Sbjct  18    NYSDHKDRMISPVTEDGSVDRMGKPAVKARTGNWTSAVLLLVNYGLVTFAFFGVGVNLVL  77

Query  1923  FLTRVMGQDNADAANNVSKWTGTVYLFSLLGAFLSDSYWGRYKTCAIFQLIYVVGLISVS  1744
             FLTRV+ QDNADAANNVSKWTGTVY+FSL+GAF+SDSYWGRY TC++FQ+IYV+GL+ +S
Sbjct  78    FLTRVLQQDNADAANNVSKWTGTVYIFSLIGAFMSDSYWGRYLTCSVFQMIYVMGLMLLS  137

Query  1743  IFSFIFLVKPKGCGDENTPCRSPSRIHIAVYYVSIYLVALGNGGYQPNIATFGSDQFDGD  1564
             + S++FLVKP GCGD    C +PS +   ++Y+SIY +A GNGGYQP+IATFGSDQFD  
Sbjct  138   LASWLFLVKPSGCGDGQLKCNTPSTLGTVLFYISIYFIAFGNGGYQPSIATFGSDQFDEM  197

Query  1563  HAHESVSKVAFFSYFYLALNLGSLFSNTVLVYFEDKGMWTLGFWastvsavlalllflVG  1384
                E  SK+AFFSYFYLALN+GSLFSN++LVY+ED G W LGFW S  +A  ALLLFLVG
Sbjct  198   DPVERHSKIAFFSYFYLALNVGSLFSNSILVYYEDSGKWVLGFWISAGAAAAALLLFLVG  257

Query  1383  TPRYRHFAPKGNPLSRFSQVLVASARKWNVHLPSDGDDHRLYEIQEHDSS---TRKILHT  1213
             T RYRHF P GNPL+R  QV VA+ RKW V +PS+ D   LYE+Q  +S+   +RKILH+
Sbjct  258   TRRYRHFNPSGNPLTRIIQVFVAATRKWTVDVPSNSD--MLYEVQGKESAIVGSRKILHS  315

Query  1212  EGFKFLDKAAVITTKESVRDLEERNINPWRLCSVTQVEEVKCILRLLPIWLCTILYSVVF  1033
             E F+FLDKAAV T ++    ++    +PW+LC+VTQVEEVKC+L++LPIWLCTI+YSVVF
Sbjct  316   EDFRFLDKAAVPTGED--MHVQAIKNDPWQLCTVTQVEEVKCVLKMLPIWLCTIIYSVVF  373

Query  1032  TQMASLFVEQGAAMRTNIAGFHIPPASMSSFDILSVAAFIFIYRRILDPLIASLKKTRRA  853
             TQMAS+FVEQGA M TN+A F IP ASMS FDILSV  FIFIYR +L P++A + K    
Sbjct  374   TQMASIFVEQGATMNTNVAAFRIPAASMSVFDILSVIIFIFIYRNLLVPVMARISK--EP  431

Query  852   QGFTELQRMGVGLiiaimamvaagiVEHFRLKYASTDCPRCPSSLSIFWQVPQYVLIGAS  673
             +G +ELQRMGVGL+I ++AM+ AG+VE  RLK      P  PSSLSIFWQ+PQY LIGAS
Sbjct  432   KGISELQRMGVGLVIGMLAMIVAGVVEVERLKRVVV--PDEPSSLSIFWQIPQYALIGAS  489

Query  672   EVFMYVGQLEFFNGQAPEGLKSFASALCMTSISLGNYVSSLLVSIVMRISTTHRMPGWIP  493
             EVFMYVGQLEFFNGQAP+G+KSF S+LCM SISLGNYVS +LV+IV  +++    PGWIP
Sbjct  490   EVFMYVGQLEFFNGQAPDGIKSFGSSLCMASISLGNYVSIMLVNIVTSVTSKKNSPGWIP  549

Query  492   GNLNKGHLDRFYFLLAALTTADFVVYILCAKWYKYIEFEERN  367
              NLN GHLDRF+FLLAALT  DF+ Y++CAKWY+ I+ +  +
Sbjct  550   RNLNSGHLDRFFFLLAALTLIDFMAYLVCAKWYRCIKLDNDD  591



>gb|KHN13615.1| Nitrate transporter 1.5 [Glycine soja]
Length=855

 Score =   736 bits (1899),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 396/540 (73%), Positives = 443/540 (82%), Gaps = 11/540 (2%)
 Frame = -3

Query  1980  VNQGLATLAFFGVGVNLVLFLTRVMGQDNADAANNVSKWTGTVYLFSLLGAFLSDSYWGR  1801
             +NQGLATLAFFGVGVNLVLFLTRVMGQDNA+AANNVSKWTGTVYLFSLLGAFLSDSYWGR
Sbjct  310   LNQGLATLAFFGVGVNLVLFLTRVMGQDNAEAANNVSKWTGTVYLFSLLGAFLSDSYWGR  369

Query  1800  YKTCAIFQLIYVVGLISVSIFSFIFLVKPKGCGDENTPCRSPSRIHIAVYYVSIYLVALG  1621
             Y TCAIFQ+I+V+GL+S+S+ S I L+KP GCGD+   C S S    A++Y+SIYLVALG
Sbjct  370   YMTCAIFQVIFVIGLVSLSLSSHISLLKPSGCGDKELQCGSHSSSQTALFYLSIYLVALG  429

Query  1620  NGGYQPNIATFGSDQFDGDHAHESVSKVAFFSYFYLALNLGSLFSNTVLVYFEDKGMWTL  1441
             NGGYQPNIATFGSDQFD     E +SKVAFFSYFYLALNLGSLFSNT+L YFEDKG WTL
Sbjct  430   NGGYQPNIATFGSDQFDEGDPKERLSKVAFFSYFYLALNLGSLFSNTILDYFEDKGQWTL  489

Query  1440  GFWastvsavlalllflVGTPRYRHFAPKGNPLSRFSQVLVASARKWNVHLPSDGDDHRL  1261
             GFWAS  SA +AL+LFL GT RYR+F P GNPL R  QV VA+ +KW V + S   +  L
Sbjct  490   GFWASAGSAAIALILFLCGTRRYRYFKPVGNPLPRVGQVFVAAGKKWKVKVLS---EENL  546

Query  1260  YEIQEHD-SSTRKILHTEGFKFLDKAAVITTKESVRDLEERNINPWRLCSVTQVEEVKCI  1084
             YE +E   S  RK+LHTEGF+FLDKAA IT+K+ +  LEE   NPW L +VTQVEEVKCI
Sbjct  547   YEDEESSPSGRRKMLHTEGFRFLDKAAFITSKD-LEQLEENKRNPWCLSTVTQVEEVKCI  605

Query  1083  LRLLPIWLCTILYSVVFTQMASLFVEQGAAMRTNIAGFHIPPASMSSFDILSVAAFIFIY  904
             LRLLPIWLCTI+YSVVF QMASLFV QG AM T I+ F IPPASMSSFDIL VA FIFIY
Sbjct  606   LRLLPIWLCTIMYSVVFAQMASLFVVQGDAMATGISSFKIPPASMSSFDILGVAFFIFIY  665

Query  903   RRILDPLIASLKKTRRAQGFTELQRMGVGLiiaimamvaagiVEHFRLKYASTDCPRC--  730
             R  LDP +A + K++     TELQRMG+GL++AIMAMV+AG+VE FRLKYA  DC +C  
Sbjct  666   RHALDPFVAKVMKSK----LTELQRMGIGLVLAIMAMVSAGLVEKFRLKYAIKDCNQCDG  721

Query  729   PSSLSIFWQVPQYVLIGASEVFMYVGQLEFFNGQAPEGLKSFASALCMTSISLGNYVSSL  550
              SSLSIFWQVPQYVL GASEVFMYV QLEFFN Q P+GLKSF SALCMTSISLGNYVSSL
Sbjct  722   SSSLSIFWQVPQYVLTGASEVFMYVPQLEFFNAQTPDGLKSFGSALCMTSISLGNYVSSL  781

Query  549   LVSIVMRISTTHRMPGWIPGNLNKGHLDRFYFLLAALTTADFVVYILCAKWYKYIEFEER  370
             LV+IVM+IST   +PGWIPGNLN GHLDRFYFLLAALTTAD VVY+  AKWYK I+FEE 
Sbjct  782   LVAIVMKISTKGDIPGWIPGNLNLGHLDRFYFLLAALTTADLVVYVALAKWYKSIQFEEN  841



>ref|XP_009593650.1| PREDICTED: protein NRT1/ PTR FAMILY 7.3 isoform X2 [Nicotiana 
tomentosiformis]
Length=556

 Score =   724 bits (1868),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 372/550 (68%), Positives = 446/550 (81%), Gaps = 10/550 (2%)
 Frame = -3

Query  1980  VNQGLATLAFFGVGVNLVLFLTRVMGQDNADAANNVSKWTGTVYLFSLLGAFLSDSYWGR  1801
             +NQGLATLAFFGVGVNLVLFLTRVM ++NA+AAN+VSKWTGTVY+FSL+GAFLSDSYWGR
Sbjct  16    INQGLATLAFFGVGVNLVLFLTRVMQENNAEAANSVSKWTGTVYIFSLVGAFLSDSYWGR  75

Query  1800  YKTCAIFQLIYVVGLISVSIFSFIFLVKPKGCGDENTPCRSPSRIHIAVYYVSIYLVALG  1621
             +K+CAIFQ+IYV+GL+ +S+ S ++L+KPKGCGD  T C + S + I+++Y+S+Y++ LG
Sbjct  76    FKSCAIFQVIYVIGLVLLSLASQLYLLKPKGCGDRTTLCGAHSTVEISLFYISVYMIGLG  135

Query  1620  NGGYQPNIATFGSDQFDGDHAHESVSKVAFFSYFYLALNLGSLFSNTVLVYFEDKGMWTL  1441
              GGYQPNIATFG+DQFD     E  SK AFFSYFYLALNLGSLFSNT+L YFED GMW L
Sbjct  136   YGGYQPNIATFGADQFDEHDPREKQSKQAFFSYFYLALNLGSLFSNTILDYFEDDGMWAL  195

Query  1440  GFWastvsavlalllflVGTPRYRHFAPKGNPLSRFSQVLVASARKWNVHLPSDGDDHRL  1261
             GFWAS  SA  ALLLFL GT +YR F   GNP++RFSQV++A++ KW V +P + +D  L
Sbjct  196   GFWASAASAFAALLLFLGGTLKYRQFRSSGNPITRFSQVIIAASNKWGVEIP-ENEDAAL  254

Query  1260  YEIQEHDSSTRKILHTEGFKFLDKAAVITTKESVRDLEERNINPWRLCSVTQVEEVKCIL  1081
             Y+ +   ++ RK+LHT+GFKFLDKAA+IT+ E     ++ N NPWRLC ++QVEEVKCIL
Sbjct  255   YD-ESSTTAARKMLHTQGFKFLDKAALITSNE-----KQSNRNPWRLCPISQVEEVKCIL  308

Query  1080  RLLPIWLCTILYSVVFTQMASLFVEQGAAMRTNIAGFHIPPASMSSFDILSVAAFIFIYR  901
             RLLPIWLCTI+YSVVFTQMAS+FVEQG AM++ I  F IP ASMSSFDI+SVA  IF+YR
Sbjct  309   RLLPIWLCTIIYSVVFTQMASIFVEQGDAMKSTIGKFRIPAASMSSFDIVSVAVVIFLYR  368

Query  900   RILDPLIASLKKTR-RAQGFTELQRMGVGLiiaimamvaagiVEHFRLKYASTDCPRCPS  724
             R+LDP +  +KK +  A G T+ QRMG+GL+IA+MAM++AGIVE +RLKYA  D  +  S
Sbjct  369   RVLDPFVKKIKKHKGEAVGITQRQRMGIGLVIAVMAMLSAGIVECYRLKYARKD--QGSS  426

Query  723   SLSIFWQVPQYVLIGASEVFMYVGQLEFFNGQAPEGLKSFASALCMTSISLGNYVSSLLV  544
             SLSI WQ+PQY LIGASEVFMYVGQLEFFN QAP+GLKSF SALCMTSISLGNYVSSLLV
Sbjct  427   SLSILWQIPQYSLIGASEVFMYVGQLEFFNEQAPDGLKSFGSALCMTSISLGNYVSSLLV  486

Query  543   SIVMRISTTHRMPGWIPGNLNKGHLDRFYFLLAALTTADFVVYILCAKWYKYIEFEERNS  364
             S+VM+ISTT  M GWIP NLNKGHLDRFYFLLAALT  D V YI CAKWYK I+  E   
Sbjct  487   SVVMKISTTDNMSGWIPANLNKGHLDRFYFLLAALTILDLVAYIACAKWYKAIKHGEMIQ  546

Query  363   CLKNIGDSKL  334
              LK     K+
Sbjct  547   QLKEEDKCKV  556



>ref|XP_008341111.1| PREDICTED: protein NRT1/ PTR FAMILY 7.3-like [Malus domestica]
Length=563

 Score =   722 bits (1863),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 377/541 (70%), Positives = 448/541 (83%), Gaps = 6/541 (1%)
 Frame = -3

Query  1983  LVNQGLATLAFFGVGVNLVLFLTRVMGQDNADAANNVSKWTGTVYLFSLLGAFLSDSYWG  1804
              VNQGLATLAFFGVGVNLVL+LTRV+ QDNA AANNVSKWTGTVY+FSL+GAFLSDSYWG
Sbjct  15    FVNQGLATLAFFGVGVNLVLYLTRVLQQDNATAANNVSKWTGTVYIFSLVGAFLSDSYWG  74

Query  1803  RYKTCAIFQLIYVVGLISVSIFSFIFLVKPKGCGDENTPCRSPSRIHIAVYYVSIYLVAL  1624
             RYKTC+IFQLI+V+GL+S+S+ S +FL+ PKGCG +  PC S S   I ++Y+S YL+AL
Sbjct  75    RYKTCSIFQLIFVIGLVSLSLSSQLFLLNPKGCGSKENPCGSHSSWKIWLFYLSTYLIAL  134

Query  1623  GNGGYQPNIATFGSDQFDGDHAHESVSKVAFFSYFYLALNLGSLFSNTVLVYFEDKGMWT  1444
             G GGYQPNIATFG+DQ+D + + E +SKVAFFSYFYLA+NLGSLFSNT+L +FED+G+W 
Sbjct  135   GYGGYQPNIATFGADQYDEEDSKEGLSKVAFFSYFYLAMNLGSLFSNTILGFFEDEGIWA  194

Query  1443  LGFWastvsavlalllflVGTPRYRHFAPKGNPLSRFSQVLVASARKWNVHLPSDGDDHR  1264
             +GFWAS  SA   L+LFL GT RYRHF P GNPLSRF QVLVA+ +K   H+P  G+D  
Sbjct  195   IGFWASAASAFAGLVLFLGGTARYRHFKPNGNPLSRFCQVLVAAMKKCRAHMPQGGEDLY  254

Query  1263  LYEIQEHDSSTRKILHTEGFKFLDKAAVITTKESVRDLEERNI-NPWRLCSVTQVEEVKC  1087
                 +E  +S RKIL+T GFKFLD+AA I++++   D +++ I +PWRLC ++QVEEVKC
Sbjct  255   DESNKESSNSNRKILYTHGFKFLDRAAYISSRD--LDYQKQGIRSPWRLCPISQVEEVKC  312

Query  1086  ILRLLPIWLCTILYSVVFTQMASLFVEQGAAMRTNIAGFHIPPASMSSFDILSVAAFIFI  907
             ILRLLPIWLCTI+YSVVFTQMASLFVEQGAAM+T I  F IPPASMSSFDI+SVA FIFI
Sbjct  313   ILRLLPIWLCTIIYSVVFTQMASLFVEQGAAMKTTIPNFSIPPASMSSFDIISVAVFIFI  372

Query  906   YRRILDPLIASLKKTRRAQGFTELQRMGVGLiiaimamvaagiVEHFRLKYASTDCPRC-  730
             YRRI+DP +  +KK+  A+G TELQRMG+GL+IA+MAM++AGIVE +RLKYA  +CP C 
Sbjct  373   YRRIIDPFVGRIKKS-DAKGLTELQRMGIGLVIAVMAMLSAGIVECYRLKYADKECPHCD  431

Query  729   -PSSLSIFWQVPQYVLIGASEVFMYVGQLEFFNGQAPEGLKSFASALCMTSISLGNYVSS  553
               SSLSIFWQ+PQY  IGASEVFMYVGQLEFFN Q P+GLKSF SALCMTSISLGNY S+
Sbjct  432   GSSSLSIFWQIPQYACIGASEVFMYVGQLEFFNAQTPDGLKSFGSALCMTSISLGNYFST  491

Query  552   LLVSIVMRISTTHRMPGWIPGNLNKGHLDRFYFLLAALTTADFVVYILCAKWYKYIEFEE  373
              LVS+VM+ ST   MPGWIPGNLN+GHLDRFYFLLA LT+ D +VYI CAKWYK I+ E 
Sbjct  492   FLVSVVMKFSTVDHMPGWIPGNLNRGHLDRFYFLLAVLTSIDLIVYIACAKWYKNIKLEG  551

Query  372   R  370
             R
Sbjct  552   R  552



>emb|CAB36812.1| peptide transporter-like protein [Arabidopsis thaliana]
 emb|CAB81275.1| peptide transporter-like protein [Arabidopsis thaliana]
Length=576

 Score =   722 bits (1863),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 382/577 (66%), Positives = 451/577 (78%), Gaps = 19/577 (3%)
 Frame = -3

Query  2094  DEEKASREECTLDGTVDHYGRPALRSATGGWFAGVLLLVNQGLATLAFFGVGVNLVLFLT  1915
             D++    E CT DG+VD +G PA+R+ TG W   +L+L             GVNLVLFLT
Sbjct  2     DQKVRQFEVCTQDGSVDRHGNPAIRANTGKWLTAILIL-------------GVNLVLFLT  48

Query  1914  RVMGQDNADAANNVSKWTGTVYLFSLLGAFLSDSYWGRYKTCAIFQLIYVVGLISVSIFS  1735
             RVMGQDNA+AANNVSKWTGTVY+FSLLGAFLSDSYWGRYKTCAIFQ  +V GL+ +S+ +
Sbjct  49    RVMGQDNAEAANNVSKWTGTVYIFSLLGAFLSDSYWGRYKTCAIFQASFVAGLMMLSLST  108

Query  1734  FIFLVKPKGCGDENTPCRSPSRIHIAVYYVSIYLVALGNGGYQPNIATFGSDQFDGDHAH  1555
                L++P GCG E++PC+  S     ++Y+S+YL+ALG GGYQPNIATFG+DQFD + + 
Sbjct  109   GALLLEPSGCGVEDSPCKPHSTFKTVLFYLSVYLIALGYGGYQPNIATFGADQFDAEDSV  168

Query  1554  ESVSKVAFFSYFYLALNLGSLFSNTVLVYFEDKGMWTLGFWastvsavlalllflVGTPR  1375
             E  SK+AFFSYFYLALNLGSLFSNTVL YFED+G W LGFWAS  SA   L+LFL+GTP+
Sbjct  169   EGHSKIAFFSYFYLALNLGSLFSNTVLGYFEDQGEWPLGFWASAGSAFAGLVLFLIGTPK  228

Query  1374  YRHFAPKGNPLSRFSQVLVASARKWNVHLPSDGDDHRLYEIQEHDSSTRKILHTEGFKFL  1195
             YRHF P+ +P SRF QVLVA+ RK  + +    ++  LY+ +   +  +KILHT+GF+FL
Sbjct  229   YRHFTPRESPWSRFCQVLVAATRKAKIDV--HHEELNLYDSETQYTGDKKILHTKGFRFL  286

Query  1194  DKAAVITTKESVRDLEE-RNINPWRLCSVTQVEEVKCILRLLPIWLCTILYSVVFTQMAS  1018
             D+AA++T  +    +E     +PWRLCSVTQVEEVKC+LRLLPIWLCTILYSVVFTQMAS
Sbjct  287   DRAAIVTPDDEAEKVESGSKYDPWRLCSVTQVEEVKCVLRLLPIWLCTILYSVVFTQMAS  346

Query  1017  LFVEQGAAMRTNIAGFHIPPASMSSFDILSVAAFIFIYRRILDPLIASLKKTRRAQGFTE  838
             LFV QGAAM+TNI  F IP +SMSSFDILSVA FIF YRR LDPL A L KT R +G TE
Sbjct  347   LFVVQGAAMKTNIKNFRIPASSMSSFDILSVAFFIFAYRRFLDPLFARLNKTERNKGLTE  406

Query  837   LQRMGVGLiiaimamvaagiVEHFRLKYASTD---CPRCPSSLSIFWQVPQYVLIGASEV  667
             LQRMG+GL+IAIMAM++AGIVE  RLK    +        S+LSIFWQVPQY+LIGASEV
Sbjct  407   LQRMGIGLVIAIMAMISAGIVEIHRLKNKEPESATSISSSSTLSIFWQVPQYMLIGASEV  466

Query  666   FMYVGQLEFFNGQAPEGLKSFASALCMTSISLGNYVSSLLVSIVMRISTTHRMPGWIPGN  487
             FMYVGQLEFFN QAP GLKSFASALCM SISLGNYVSSLLVSIVM+ISTT  + GWIP N
Sbjct  467   FMYVGQLEFFNSQAPTGLKSFASALCMASISLGNYVSSLLVSIVMKISTTDDVHGWIPEN  526

Query  486   LNKGHLDRFYFLLAALTTADFVVYILCAKWYKYIEFE  376
             LNKGHL+RFYFLLA LT ADFVVY++CAKWYKYI+ E
Sbjct  527   LNKGHLERFYFLLAGLTAADFVVYLICAKWYKYIKSE  563



>ref|XP_010692434.1| PREDICTED: protein NRT1/ PTR FAMILY 7.3-like [Beta vulgaris subsp. 
vulgaris]
Length=587

 Score =   722 bits (1863),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 378/581 (65%), Positives = 462/581 (80%), Gaps = 12/581 (2%)
 Frame = -3

Query  2109  IKNERDEEKASREECTLDGTVDHYGRPALRSATGGWFAGVLLLVNQGLATLAFFGVGVNL  1930
             ++ +  E +    E TLDG+VD  G PA+R+ +G W  G L+LVNQG+ATLAF+GVGVNL
Sbjct  2     LQKDNHESETQVVEHTLDGSVDQRGNPAIRTKSGRWGPGTLILVNQGMATLAFYGVGVNL  61

Query  1929  VLFLTRVMGQDNADAANNVSKWTGTVYLFSLLGAFLSDSYWGRYKTCAIFQLIYVVGLIS  1750
             VLFLTRV+GQ NADAANNVSKW GTVYLFSL+GAFLSDSYWGR++TCAIFQ I+V+GL  
Sbjct  62    VLFLTRVVGQHNADAANNVSKWFGTVYLFSLIGAFLSDSYWGRFRTCAIFQAIFVLGLAL  121

Query  1749  VSIFSFIFLVKPKGCGDENTPCRSPSRIHIAVYYVSIYLVALGNGGYQPNIATFGSDQFD  1570
             +S+ S++FL+ P+GCGD+ TPC S S +H+A++Y ++Y+VALGNGGYQP IATFG+DQFD
Sbjct  122   LSLSSYLFLLNPRGCGDKQTPCNSHSSLHVAIFYFALYMVALGNGGYQPIIATFGADQFD  181

Query  1569  GDHAHESVSKVAFFSYFYLALNLGSLFSNTVLVYFEDKGMWTLGFWastvsavlalllfl  1390
              +H  E  SK+A+FSYFYLA NLG L SNT+L Y+ED G W +GF AS  +A++A++LFL
Sbjct  182   VEHPKERSSKIAYFSYFYLAFNLGPLISNTILAYYEDYGKWEIGFSASAATALMAMVLFL  241

Query  1389  VGTPRYRHFAPKGNPLSRFSQVLVASARKWNVHLPSDGDDHRLYEIQEHDSST---RKIL  1219
              GTP YRHF P+GNP+ RFS+V VA+ +K  V +P DGD   LYEI   D S    R+IL
Sbjct  242   GGTPCYRHFKPQGNPVLRFSRVFVAAIKKCKVVVPQDGD--ALYEIDAKDYSKNRCRRIL  299

Query  1218  HTEGFKFLDKAAVITTKESVRDLEERNINPWRLCSVTQVEEVKCILRLLPIWLCTILYSV  1039
             HT+GFKFLDKAAVIT+K+     +    +   LC+VTQVEEVKCILRLLPIWLCTI++SV
Sbjct  300   HTQGFKFLDKAAVITSKDCASQTKHL-YDQRHLCTVTQVEEVKCILRLLPIWLCTIMHSV  358

Query  1038  VFTQMASLFVEQGAAMRTNIAGFHIPPASMSSFDILSVAAFIFIYRRILDPLIASLKKTR  859
             V+TQMASLFV QGA MRTNI   HIPPASMSSFDILSVA FIF+YRR+L+PL+  L+K  
Sbjct  359   VYTQMASLFVVQGAEMRTNIGHLHIPPASMSSFDILSVAVFIFLYRRVLNPLVLRLRK--  416

Query  858   RAQGFTELQRMGVGLiiaimamvaagiVEHFRLKYASTDCPRCP--SSLSIFWQVPQYVL  685
               +G  EL+RMG GLI AI+AM+ +GIVE FRLKYA  DC  C   SSLSI WQ+PQ+VL
Sbjct  417   --RGLIELERMGFGLIFAILAMIVSGIVEIFRLKYAIKDCKDCKYASSLSILWQIPQFVL  474

Query  684   IGASEVFMYVGQLEFFNGQAPEGLKSFASALCMTSISLGNYVSSLLVSIVMRISTTHRMP  505
             IGASEVFMYV QLEFFNGQAPEGLKSF SAL  TS++LGNY+S ++V+IVM+I+T   M 
Sbjct  475   IGASEVFMYVPQLEFFNGQAPEGLKSFGSALYTTSMALGNYLSIVIVTIVMKITTRDNMH  534

Query  504   GWIPGNLNKGHLDRFYFLLAALTTADFVVYILCAKWYKYIE  382
             GWIP  LNKGHL++FYFLLAALTT DF VY+LCA+ YKY+ 
Sbjct  535   GWIPAKLNKGHLEKFYFLLAALTTVDFAVYLLCARSYKYVR  575



>ref|XP_008808100.1| PREDICTED: protein NRT1/ PTR FAMILY 7.2 [Phoenix dactylifera]
 ref|XP_008808101.1| PREDICTED: protein NRT1/ PTR FAMILY 7.2 [Phoenix dactylifera]
Length=601

 Score =   721 bits (1861),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 374/583 (64%), Positives = 456/583 (78%), Gaps = 11/583 (2%)
 Frame = -3

Query  2106  KNERDEEKASREECTLDGTVDHYGRPALRSATGGWFAGVLLLVNQGLATLAFFGVGVNLV  1927
              + ++ E       T DG+VD  G PA+++ TG W + VLLLVN GLATLAFFGVGVNLV
Sbjct  18    NDSKNTEDKVISPITEDGSVDRSGNPAVKARTGRWKSAVLLLVNYGLATLAFFGVGVNLV  77

Query  1926  LFLTRVMGQDNADAANNVSKWTGTVYLFSLLGAFLSDSYWGRYKTCAIFQLIYVVGLISV  1747
             LFLTRV+ Q+NADAANNVSKWTGTVY+FSL+GAFLSDSYWGRY TCAIFQLIYVVGL+ +
Sbjct  78    LFLTRVLEQENADAANNVSKWTGTVYIFSLIGAFLSDSYWGRYLTCAIFQLIYVVGLMLL  137

Query  1746  SIFSFIFLVKPKGCGDENTPCRSPSRIHIAVYYVSIYLVALGNGGYQPNIATFGSDQFDG  1567
             S  S+  LVKP GCGD    C  P+    A++Y+SIYL+A G GGYQP+IATFGSDQFD 
Sbjct  138   SSASWFLLVKPSGCGDGELECNPPTTTGTAIFYLSIYLIAFGYGGYQPSIATFGSDQFDV  197

Query  1566  DHAHESVSKVAFFSYFYLALNLGSLFSNTVLVYFEDKGMWTLGFWastvsavlalllflV  1387
                +E  SK+AFFSYFYLALN+GSLFSNTVLVY+ED G W +GFW S+ SAVLALLLFL+
Sbjct  198   MDPYERNSKIAFFSYFYLALNVGSLFSNTVLVYYEDLGKWAIGFWTSSGSAVLALLLFLL  257

Query  1386  GTPRYRHFAPKGNPLSRFSQVLVASARKWNVHLPSDGDDHRLYEIQEHDSS---TRKILH  1216
             GTP YRHF P GNPL+R +QV+ A+  KW V +PS  ++  LYE++  +S+   +RKILH
Sbjct  258   GTPSYRHFKPSGNPLTRIAQVIFAAFSKWEVEVPS--NEIMLYEVEGKESAVAGSRKILH  315

Query  1215  TEGFKFLDKAAVITTKESVRDLEERNINPWRLCSVTQVEEVKCILRLLPIWLCTILYSVV  1036
             +  F+FLDKAA +T  +    +  +  NPW+LC+VTQVEEVKC+L++LPIWLCTI+YSVV
Sbjct  316   SNEFRFLDKAATLTADDYC--MRAKMNNPWKLCTVTQVEEVKCVLKVLPIWLCTIIYSVV  373

Query  1035  FTQMASLFVEQGAAMRTNIAGFHIPPASMSSFDILSVAAFIFIYRRILDPLIASLKKTRR  856
             FTQMASLFVEQGA+M T I  FHIPPASMS FDILSV  FI IYRR+L P+++ L  +  
Sbjct  374   FTQMASLFVEQGASMNTKIGTFHIPPASMSVFDILSVLVFIVIYRRVLTPVLSRL--SNN  431

Query  855   AQGFTELQRMGVGLiiaimamvaagiVEHFRLKYASTDCPRCPSSLSIFWQVPQYVLIGA  676
              +G TELQRMG+GL+I ++AMVAAG+VE  RLK  S   P  PSSLSIF Q+PQY LIGA
Sbjct  432   PKGLTELQRMGLGLVIGMLAMVAAGLVEVERLKGVSV--PDEPSSLSIFCQIPQYALIGA  489

Query  675   SEVFMYVGQLEFFNGQAPEGLKSFASALCMTSISLGNYVSSLLVSIVMRISTTHRMPGWI  496
             SEVFMYVGQLEFFNGQAP+G+KSF S+L M SISLGNYVS ++V++V  +++  + PGWI
Sbjct  490   SEVFMYVGQLEFFNGQAPDGIKSFGSSLSMASISLGNYVSIMIVNLVTTVTSGDKNPGWI  549

Query  495   PGNLNKGHLDRFYFLLAALTTADFVVYILCAKWYKYIEFEERN  367
             PGNLN GHLDRFYFLL  LT  DF++Y++CAKWYK I+ E  +
Sbjct  550   PGNLNHGHLDRFYFLLVILTAVDFILYVVCAKWYKCIKLESND  592



>ref|XP_009393944.1| PREDICTED: protein NRT1/ PTR FAMILY 7.3-like isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=601

 Score =   721 bits (1861),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 375/575 (65%), Positives = 455/575 (79%), Gaps = 11/575 (2%)
 Frame = -3

Query  2079  SREECTLDGTVDHYGRPALRSATGGWFAGVLLLVNQGLATLAFFGVGVNLVLFLTRVMGQ  1900
             ++ E T+DG+VD  G PA ++ +GGW AG  +LVNQGLATLAFFG+ VNLVLFLTRV+ +
Sbjct  30    AKSEYTMDGSVDFGGNPAAKAKSGGWVAGAFVLVNQGLATLAFFGMNVNLVLFLTRVLQR  89

Query  1899  DNADAANNVSKWTGTVYLFSLLGAFLSDSYWGRYKTCAIFQLIYVVGLISVSIFSFIFLV  1720
             +NADAAN+VSKWTGTVY+FSL+GAFLSDSYWGRYKTCA+FQ+I+V+GL+ +S+ S +FL+
Sbjct  90    NNADAANDVSKWTGTVYIFSLVGAFLSDSYWGRYKTCAVFQVIFVLGLVLLSLSSHLFLI  149

Query  1719  KPKGCGDENTPCRSPSRIHIAVYYVSIYLVALGNGGYQPNIATFGSDQFDGDHAHESVSK  1540
             KP GCGD +TPC + S   + ++Y++IY++ALGNGGYQPNIATFG DQFD +   E+ SK
Sbjct  150   KPSGCGDSHTPCGTHSSFEVKMFYLAIYMIALGNGGYQPNIATFGPDQFDEEDPREAHSK  209

Query  1539  VAFFSYFYLALNLGSLFSNTVLVYFEDKGMWTLGFWastvsavlalllflVGTPRYRHFA  1360
             V+FFSYFYLALNLGSLFSNT L Y ED GMWTLGFWAS+ SA +AL+LFL GTPRYRHF 
Sbjct  210   VSFFSYFYLALNLGSLFSNTFLSYLEDHGMWTLGFWASSASACVALVLFLSGTPRYRHFK  269

Query  1359  PKGNPLSRFSQVLVASARKWNVHLPSDGDDHRLYEIQEHD----SSTRKILHTEGFKFLD  1192
             P GNPLSR  Q +VA++RKW V +   G D  LY+  E +    + ++KILHTEGFKFLD
Sbjct  270   PCGNPLSRICQAVVAASRKWRVKMQPGGVD--LYDTDEEEFQETNGSKKILHTEGFKFLD  327

Query  1191  KAAVITTKESVRDLEERNINPWRLCSVTQVEEVKCILRLLPIWLCTILYSVVFTQMASLF  1012
             +AA +T  +     +    NPWRLC++TQVEEVKC+LRL+PIWLCTILYSVVFTQMASLF
Sbjct  328   RAAFVTAGDFTLQDQSLRRNPWRLCTITQVEEVKCVLRLIPIWLCTILYSVVFTQMASLF  387

Query  1011  VEQGAAMRTNIAGFHIPPASMSSFDILSVAAFIFIYRRILDPLIASLKKTRRAQGFTELQ  832
             V QGAAMRT +  F IPP+SMS+FDIL V  FIF+  R+L PL+  +KK+R   G TELQ
Sbjct  388   VVQGAAMRTTVGAFSIPPSSMSAFDILGVVIFIFLRDRLLHPLVCRIKKSR--VGLTELQ  445

Query  831   RMGVGLiiaimamvaagiVEHFRLKYASTDCPRC---PSSLSIFWQVPQYVLIGASEVFM  661
             RMGVGL+IA+MAM+AAG  EHFRLK A   C  C    SSL I WQVPQY LIGASEVFM
Sbjct  446   RMGVGLVIAVMAMIAAGTAEHFRLKQARAPCSGCSGAASSLHILWQVPQYALIGASEVFM  505

Query  660   YVGQLEFFNGQAPEGLKSFASALCMTSISLGNYVSSLLVSIVMRISTTHRMPGWIPGNLN  481
             YVGQLEF+NGQAP GLKSF SAL +TS+S GN+ S L+V+ VM+++      GWIP NLN
Sbjct  506   YVGQLEFYNGQAPYGLKSFGSALYLTSMSFGNFFSDLIVTAVMKLTARGGRAGWIPENLN  565

Query  480   KGHLDRFYFLLAALTTADFVVYILCAKWYKYIEFE  376
              GHLDRFYFLLAALT+ADFVV++ CAKWYK  + E
Sbjct  566   HGHLDRFYFLLAALTSADFVVFVACAKWYKSTKLE  600



>ref|XP_009409943.1| PREDICTED: protein NRT1/ PTR FAMILY 7.3-like isoform X3 [Musa 
acuminata subsp. malaccensis]
Length=601

 Score =   718 bits (1853),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 382/578 (66%), Positives = 447/578 (77%), Gaps = 30/578 (5%)
 Frame = -3

Query  2106  KNERDEEKASREECTLDGTVDHYGRPALRSATGGWFAGVLLLVNQGLATLAFFGVGVNLV  1927
               E +E K  + E TLDG+VD                   + VNQGLATLAFFGVGVNLV
Sbjct  29    NKEMNEGKDEQYEYTLDGSVD-------------------IRVNQGLATLAFFGVGVNLV  69

Query  1926  LFLTRVMGQDNADAANNVSKWTGTVYLFSLLGAFLSDSYWGRYKTCAIFQLIYVVGLISV  1747
             LFLTRV+ Q+NADAANNVSKWTGTVY+FSLLGAFLSDSYWGRYKTCAIFQ+I+V GL+ +
Sbjct  70    LFLTRVLQQNNADAANNVSKWTGTVYIFSLLGAFLSDSYWGRYKTCAIFQVIFVFGLVLL  129

Query  1746  SIFSFIFLVKPKGCGDENTPCRSPSRIHIAVYYVSIYLVALGNGGYQPNIATFGSDQFDG  1567
             S+ +++FL+KP GCG+E+  C   S +   V+Y+SIYL+ALGNGGYQPNIATFG+DQFD 
Sbjct  130   SLSTYLFLLKPSGCGEEHFICGPHSSMDTGVFYLSIYLIALGNGGYQPNIATFGADQFDA  189

Query  1566  DHAHESVSKVAFFSYFYLALNLGSLFSNTVLVYFEDKGMWTLGFWastvsavlalllflV  1387
                 ES SKV+FFSYFYLALNLGSLFSNT L YFEDKGMW LGFW S  SAV+ALLLFL 
Sbjct  190   KDPDESHSKVSFFSYFYLALNLGSLFSNTFLNYFEDKGMWALGFWVSAGSAVVALLLFLC  249

Query  1386  GTPRYRHFAPKGNPLSRFSQVLVASARKWNVHLPSDGDDHRLYEIQEHDSS----TRKIL  1219
             GT RYRHF P GNPLSR  QV+VA++RKW + +P++G D  LYE +E   S    +R+IL
Sbjct  250   GTSRYRHFKPIGNPLSRVCQVVVAASRKWRMKMPTNGGDD-LYEAEEKQVSAAHGSRRIL  308

Query  1218  HTEGFKFLDKAAVITTKESVRDLEER---NINPWRLCSVTQVEEVKCILRLLPIWLCTIL  1048
             HTEGF+FLD+AAVI  +      + +   + +PWRLC +TQVEE+KC+LRL+PIWL TIL
Sbjct  309   HTEGFRFLDRAAVIDPENDFTIQQGKSGCSRDPWRLCPITQVEELKCVLRLIPIWLTTIL  368

Query  1047  YSVVFTQMASLFVEQGAAMRTNIAGFHIPPASMSSFDILSVAAFIFIYRRILDPLIASLK  868
             YSVVFTQMASLFVEQGAAM   +AGF IPPASMS+FDI+SVAAFI  YRR L+PL++ L+
Sbjct  369   YSVVFTQMASLFVEQGAAMDGTVAGFRIPPASMSAFDIVSVAAFILFYRRFLNPLVSRLR  428

Query  867   KTRRAQGFTELQRMGVGLiiaimamvaagiVEHFRLKYASTDCPRCPSSLSIFWQVPQYV  688
             K   A+G TELQRMG GLI+AIMAM +AG VE  RL+     C    SSLSI WQ+PQY 
Sbjct  429   KD--ARGLTELQRMGAGLILAIMAMASAGTVEVQRLRSVCRGCDD-DSSLSILWQIPQYA  485

Query  687   LIGASEVFMYVGQLEFFNGQAPEGLKSFASALCMTSISLGNYVSSLLVSIVMRISTTHRM  508
             LIGASEVFMYVGQLEFFNGQAP GLKSF SALCMTSISLGNYVSSLLV+ VM I+     
Sbjct  486   LIGASEVFMYVGQLEFFNGQAPHGLKSFGSALCMTSISLGNYVSSLLVTAVMEITGKGDR  545

Query  507   PGWIPGNLNKGHLDRFYFLLAALTTADFVVYILCAKWY  394
              GWIP NLN+GH+DRFYFLLA+LT ADF V++ CA WY
Sbjct  546   AGWIPANLNRGHMDRFYFLLASLTAADFAVFVTCAIWY  583



>ref|XP_010919867.1| PREDICTED: protein NRT1/ PTR FAMILY 7.3-like isoform X3 [Elaeis 
guineensis]
Length=593

 Score =   716 bits (1848),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 381/586 (65%), Positives = 450/586 (77%), Gaps = 36/586 (6%)
 Frame = -3

Query  2109  IKNERDEEKASREEC--TLDGTVDHYGRPALRSATGGWFAGVLLLVNQGLATLAFFGVGV  1936
             ++ +   E   +E C  TLDG+VD  GRPA++ ++GGW  G+LLLVNQGLATLAFFGVGV
Sbjct  32    MEGDGGTEARGKECCDYTLDGSVDLRGRPAVKGSSGGWVTGILLLVNQGLATLAFFGVGV  91

Query  1935  NLVLFLTRVMGQDNADAANNVSKWTGTVYLFSLLGAFLSDSYWGRYKTCAIFQLIYVVGL  1756
             NLVLFLTRV+ Q+NADAANNVSKWTGTVY+FSL GAFLSDSYWGRYKTCAIFQ+I+VVGL
Sbjct  92    NLVLFLTRVLQQNNADAANNVSKWTGTVYIFSLFGAFLSDSYWGRYKTCAIFQVIFVVGL  151

Query  1755  ISVSIFSFIFLVKPKGCGDENTPCRSPSRIHIAVYYVSIYLVALGNGGYQPNIATFGSDQ  1576
             + +S+ + +FL++P GCGD + PC S S I + V+YVSIYLVA G GGYQPNIATFG+DQ
Sbjct  152   VLLSLCAHLFLLRPSGCGDGHAPCGSHSSIEVGVFYVSIYLVAFGYGGYQPNIATFGADQ  211

Query  1575  FDGDHAHESVSKVAFFSYFYLALNLGSLFSNTVLVYFEDKGMWTLGFWastvsavlalll  1396
             FD +   E+ SK                          D+GMW LGFWAS  SA+LAL+L
Sbjct  212   FDEEDPGEAHSK--------------------------DQGMWALGFWASGASALLALVL  245

Query  1395  flVGTPRYRHFAPKGNPLSRFSQVLVASARKWNVHLPSDGDDHRLYEIQEHDSSTRKILH  1216
             FLV T RYRHF P GNPLSR  QV++A++RK  V +P  G+D  +       S TRKILH
Sbjct  246   FLVWTLRYRHFKPGGNPLSRICQVVIAASRKSRVRMPPGGEDLYVGGECAEVSGTRKILH  305

Query  1215  TEGFKFLDKAAVITTKESVRDLEERNI--NPWRLCSVTQVEEVKCILRLLPIWLCTILYS  1042
             TEGF FLD+AA + + +      ER+I  +PWRLC++TQVEEVKC+LRLLPIWLCTILYS
Sbjct  306   TEGFNFLDRAAYVDSNDFTIQ-GERSILRDPWRLCTITQVEEVKCVLRLLPIWLCTILYS  364

Query  1041  VVFTQMASLFVEQGAAMRTNIAGFHIPPASMSSFDILSVAAFIFIYRRILDPLIASLKKT  862
             VVFTQMASLFVEQGAAM TN+ GF IPPASMS+FDILSVA  IF  RR+L+P+I  LKK+
Sbjct  365   VVFTQMASLFVEQGAAMNTNVHGFRIPPASMSAFDILSVATVIFFNRRLLNPVICRLKKS  424

Query  861   RRAQGFTELQRMGVGLiiaimamvaagiVEHFRLKYASTDCPRCPSSLSIFWQVPQYVLI  682
              R  G TELQRMGVGL+IA+MAMV+A  VEHFRLK+A  +     SSLSI WQVPQYVLI
Sbjct  425   PR--GLTELQRMGVGLVIAVMAMVSACAVEHFRLKHAGGN---AGSSLSILWQVPQYVLI  479

Query  681   GASEVFMYVGQLEFFNGQAPEGLKSFASALCMTSISLGNYVSSLLVSIVMRISTTHRMPG  502
             GASEVFMYVGQLEFFNGQAP+GLKSF SALCMTS+SLGNYVS +LV+IVM I+     PG
Sbjct  480   GASEVFMYVGQLEFFNGQAPDGLKSFGSALCMTSMSLGNYVSDVLVTIVMEITAKGGRPG  539

Query  501   WIPGNLNKGHLDRFYFLLAALTTADFVVYILCAKWYKYIEFEERNS  364
             WIPGNLN GH+DRFYFLLA LT+ DFVVY+ CAKWYK I+ E ++ 
Sbjct  540   WIPGNLNNGHMDRFYFLLAVLTSVDFVVYVACAKWYKCIKLEGKSG  585



>ref|XP_003570234.1| PREDICTED: protein NRT1/ PTR FAMILY 7.3-like [Brachypodium distachyon]
Length=585

 Score =   716 bits (1847),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 365/567 (64%), Positives = 439/567 (77%), Gaps = 7/567 (1%)
 Frame = -3

Query  2064  TLDGTVDHYGRPALRSATGGWFAGVLLLVNQGLATLAFFGVGVNLVLFLTRVMGQDNADA  1885
             T DG++D  G PA+++ TG W + +LLLVN GL T AFFGVGVNLV+FL RV+ QDNA+A
Sbjct  15    TEDGSMDRRGNPAVKANTGKWKSSILLLVNYGLVTCAFFGVGVNLVVFLRRVLHQDNAEA  74

Query  1884  ANNVSKWTGTVYLFSLLGAFLSDSYWGRYKTCAIFQLIYVVGLISVSIFSFIFLVKPKGC  1705
             AN++SKWTGTVY+FSL+GAF+SDSYWGRY TCAIFQ+IYV GL+ +S+ S+  LVKP GC
Sbjct  75    ANSISKWTGTVYIFSLIGAFMSDSYWGRYITCAIFQMIYVTGLVILSLTSWFLLVKPSGC  134

Query  1704  GDENTPCRSPSRIHIAVYYVSIYLVALGNGGYQPNIATFGSDQFDGDHAHESVSKVAFFS  1525
             GD  T C  PS   +A++Y+S Y++A GNGGYQP+IAT GSDQFD     E+ SKVAFFS
Sbjct  135   GDGETHCDKPSTAGVALFYLSTYMIAFGNGGYQPSIATLGSDQFDETDPDEARSKVAFFS  194

Query  1524  YFYLALNLGSLFSNTVLVYFEDKGMWTLGFWastvsavlalllflVGTPRYRHFAPKGNP  1345
             YFYLALN+GSLFSNTVLVY+ED G W +GFW S  +A LAL+LFL+GTP YR+F P GNP
Sbjct  195   YFYLALNVGSLFSNTVLVYYEDSGQWVMGFWVSAAAAALALVLFLLGTPNYRYFKPSGNP  254

Query  1344  LSRFSQVLVASARKWNVHLPSDGDDHRLYEIQEHDSSTRKILHTEGFKFLDKAAVITTKE  1165
             L+R +QVLVA++RKW  H P     H +   +   S  RKILH++  ++LDKAA +T +E
Sbjct  255   LTRIAQVLVAASRKWRTHAPRGELLHEVDGDESKVSGIRKILHSDQLRYLDKAATVTEEE  314

Query  1164  SVRDLEERNINPWRLCSVTQVEEVKCILRLLPIWLCTILYSVVFTQMASLFVEQGAAMRT  985
                   ER  +PWRLC+VTQVEEVKCIL++LPIW+CTI+YSVVFTQMASLFVEQG  M T
Sbjct  315   YFD--PERMKDPWRLCTVTQVEEVKCILKMLPIWMCTIVYSVVFTQMASLFVEQGTTMDT  372

Query  984   NIAG-FHIPPASMSSFDILSVAAFIFIYRRILDPLIASLKKTRRAQGFTELQRMGVGLii  808
             NI G FH+P ASMS FDILSV AFI IYRR+L P++A L  +   QG TELQRMGVGL+I
Sbjct  373   NIVGSFHVPAASMSVFDILSVLAFIAIYRRVLVPVMARL--SGNPQGLTELQRMGVGLVI  430

Query  807   aimamvaagiVEHFRLKYASTDCPRCPSSLSIFWQVPQYVLIGASEVFMYVGQLEFFNGQ  628
              + AMV AG+VE  RLK  +   P  PSSLS+ WQVPQY LIGASEVFMYVGQLEFFNGQ
Sbjct  431   GMGAMVVAGVVEVERLKRVA--APDQPSSLSVLWQVPQYALIGASEVFMYVGQLEFFNGQ  488

Query  627   APEGLKSFASALCMTSISLGNYVSSLLVSIVMRISTTHRMPGWIPGNLNKGHLDRFYFLL  448
             AP+G+KSF S+LCM SISLGNYVS +LVS+V  ++   R PGWIPGNLN GHLDRFYFLL
Sbjct  489   APDGVKSFGSSLCMASISLGNYVSIMLVSVVTSLTAGERRPGWIPGNLNSGHLDRFYFLL  548

Query  447   AALTTADFVVYILCAKWYKYIEFEERN  367
             AAL+  D  VY+ CA WYK I+ +  N
Sbjct  549   AALSLVDLAVYVACAMWYKGIKLDNSN  575



>ref|XP_010943514.1| PREDICTED: protein NRT1/ PTR FAMILY 7.2 isoform X3 [Elaeis guineensis]
Length=589

 Score =   713 bits (1841),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 369/583 (63%), Positives = 449/583 (77%), Gaps = 26/583 (4%)
 Frame = -3

Query  2106  KNERDEEKASREECTLDGTVDHYGRPALRSATGGWFAGVLLLVNQGLATLAFFGVGVNLV  1927
              N +  E       T DG+VD  G PA+++ TG W + +LLLVN GLATLAFFGVGVNLV
Sbjct  21    NNSKKNEDKMISPITEDGSVDRRGNPAVKARTGRWKSAILLLVNYGLATLAFFGVGVNLV  80

Query  1926  LFLTRVMGQDNADAANNVSKWTGTVYLFSLLGAFLSDSYWGRYKTCAIFQLIYVVGLISV  1747
             LFLTRV+ Q+NADAANNVSKWTGTVY+FSL+GAFLSDSYWGRY TCAIFQLIYVV     
Sbjct  81    LFLTRVLKQENADAANNVSKWTGTVYIFSLIGAFLSDSYWGRYLTCAIFQLIYVV-----  135

Query  1746  SIFSFIFLVKPKGCGDENTPCRSPSRIHIAVYYVSIYLVALGNGGYQPNIATFGSDQFDG  1567
                       P GCGD    C+ P+ I  A++Y+SIYL+A GNGGYQP+IATFGSDQFD 
Sbjct  136   ----------PSGCGDGELECKPPTTIGTAIFYLSIYLIAFGNGGYQPSIATFGSDQFDE  185

Query  1566  DHAHESVSKVAFFSYFYLALNLGSLFSNTVLVYFEDKGMWTLGFWastvsavlalllflV  1387
                +E  SK+AFFSYFYLALN+GSLFSNTVLVY+ED G W +GFW S  SA LALLLFL+
Sbjct  186   MDPYERHSKIAFFSYFYLALNVGSLFSNTVLVYYEDSGKWVIGFWTSAGSAALALLLFLL  245

Query  1386  GTPRYRHFAPKGNPLSRFSQVLVASARKWNVHLPSDGDDHRLYEIQEHDSS---TRKILH  1216
             GTP YRHF P GNPL+R +QV  A+ RKW V +P  G++  LYE++  +S+   +RKI H
Sbjct  246   GTPSYRHFKPSGNPLTRIAQVFFAAFRKWEVEVP--GNEVMLYEVEGKESTIAGSRKICH  303

Query  1215  TEGFKFLDKAAVITTKESVRDLEERNINPWRLCSVTQVEEVKCILRLLPIWLCTILYSVV  1036
             +  F+FLDKAA +T  +    ++ +  NPW+LC+VTQVEEVKC+L++LPIWLCTI+YSVV
Sbjct  304   SNEFRFLDKAATLTADDYC--MQAKTKNPWKLCTVTQVEEVKCVLKMLPIWLCTIIYSVV  361

Query  1035  FTQMASLFVEQGAAMRTNIAGFHIPPASMSSFDILSVAAFIFIYRRILDPLIASLKKTRR  856
             FTQMASLFVEQGA+M TNI  FHIPPASMS FDILSV  FI IYRR+L P+++ L  ++ 
Sbjct  362   FTQMASLFVEQGASMNTNIGTFHIPPASMSVFDILSVLFFIVIYRRVLIPVMSRL--SQN  419

Query  855   AQGFTELQRMGVGLiiaimamvaagiVEHFRLKYASTDCPRCPSSLSIFWQVPQYVLIGA  676
              +G TELQRMGVGL+I ++AMVAAG+VE  RLK    + P  PSSLSI  Q+PQY  IGA
Sbjct  420   PKGLTELQRMGVGLVIGMLAMVAAGVVEVERLK--RVEVPDEPSSLSILCQIPQYAFIGA  477

Query  675   SEVFMYVGQLEFFNGQAPEGLKSFASALCMTSISLGNYVSSLLVSIVMRISTTHRMPGWI  496
             SEVFMYVGQLEFFNGQAP+G+KSF S+LCM SISLGNYVS ++V+IV  +++  + PGWI
Sbjct  478   SEVFMYVGQLEFFNGQAPDGIKSFGSSLCMASISLGNYVSIMIVNIVTAVTSRDKNPGWI  537

Query  495   PGNLNKGHLDRFYFLLAALTTADFVVYILCAKWYKYIEFEERN  367
             PGNLN+GHL+RFYFLLA LT  DF+VY++CA+WYK I+ E  +
Sbjct  538   PGNLNRGHLERFYFLLATLTVVDFIVYLVCARWYKCIKLETND  580



>gb|KCW73263.1| hypothetical protein EUGRSUZ_E01723 [Eucalyptus grandis]
Length=543

 Score =   710 bits (1833),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 377/522 (72%), Positives = 428/522 (82%), Gaps = 16/522 (3%)
 Frame = -3

Query  1908  MGQDNADAANNVSKWTGTVYLFSLLGAFLSDSYWGRYKTCAIFQLIYVVGLISVSIFSFI  1729
             MGQDNA AANNVSKWTGTVY+FSLLGAFLSDSYWGRYKTCA+FQ I+V+GL ++S+ S+I
Sbjct  1     MGQDNASAANNVSKWTGTVYIFSLLGAFLSDSYWGRYKTCAVFQAIFVIGLAALSLSSYI  60

Query  1728  FLVKPKGCGDENTPCRSPSRIHIAVYYVSIYLVALGNGGYQPNIATFGSDQFDGDHAHES  1549
             FL+KP+GCGDE T C   S    AV+Y+SIY+VALGNGGYQPNIATFG+DQFD +   E 
Sbjct  61    FLLKPRGCGDEQTQCGRHSGFETAVFYLSIYMVALGNGGYQPNIATFGADQFDEEDPREG  120

Query  1548  VSKVAFFSYFYLALNLGSLFSNTVLVYFEDKGMWTLGFWastvsavlalllflVGTPRYR  1369
              SK++FFSYFYLALNLGSLFSNT+L YFED+GMW LGFWAST SA LAL+LFL G+P YR
Sbjct  121   HSKISFFSYFYLALNLGSLFSNTILGYFEDEGMWALGFWASTASAALALVLFLCGSPWYR  180

Query  1368  HFAPKGNPLSRFSQVLVASARKWNVHLPSDGDDHRLYEIQEHDSST---RKILHTEGFKF  1198
             HF P+GNPLSRF QVLV++ RKW V      +D  L+E+   D +    R+ILHT GFKF
Sbjct  181   HFRPRGNPLSRFCQVLVSATRKWRVETEPTEED--LFEVDAGDCAAGGERRILHTTGFKF  238

Query  1197  LDKAAVITTKESVRD-------LEERNINPWRLCSVTQVEEVKCILRLLPIWLCTILYSV  1039
             LDKAA+IT  + ++D       L+    NPWRLC+VTQVEEVKCILRLLPIWLCTILYSV
Sbjct  239   LDKAAIITPTDFIQDCNSSSSRLQPPQNNPWRLCTVTQVEEVKCILRLLPIWLCTILYSV  298

Query  1038  VFTQMASLFVEQGAAMRTNIAGFHIPPASMSSFDILSVAAFIFIYRRILDPLIASLKKTR  859
             VFTQMASLFVEQGA MR    GFHIPPASMSSFDILSVAAFIFIYRRILDP++A ++   
Sbjct  299   VFTQMASLFVEQGAGMRATFGGFHIPPASMSSFDILSVAAFIFIYRRILDPVVARVRT--  356

Query  858   RAQGFTELQRMGVGLiiaimamvaagiVEHFRLKYAST--DCPRCPSSLSIFWQVPQYVL  685
             +  G T+LQRMGVGLI+A++AMVAAG VEHFRLKYA          SSLSIFWQVPQYVL
Sbjct  357   KPHGLTQLQRMGVGLIVAVLAMVAAGTVEHFRLKYADKSCSSCEGSSSLSIFWQVPQYVL  416

Query  684   IGASEVFMYVGQLEFFNGQAPEGLKSFASALCMTSISLGNYVSSLLVSIVMRISTTHRMP  505
             IGASEVFMYVGQLEFFN QAP+GLKSF SALCMTSISLGNYVSSLLV++VM+ S    MP
Sbjct  417   IGASEVFMYVGQLEFFNAQAPDGLKSFGSALCMTSISLGNYVSSLLVTMVMKFSARDDMP  476

Query  504   GWIPGNLNKGHLDRFYFLLAALTTADFVVYILCAKWYKYIEF  379
             GWIP NLN+GHLDRFYFLLAALT ADF VY+LCAKWY+ IEF
Sbjct  477   GWIPRNLNRGHLDRFYFLLAALTAADFFVYLLCAKWYQCIEF  518



>ref|XP_002452648.1| hypothetical protein SORBIDRAFT_04g029890 [Sorghum bicolor]
 gb|EES05624.1| hypothetical protein SORBIDRAFT_04g029890 [Sorghum bicolor]
Length=580

 Score =   712 bits (1837),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 368/566 (65%), Positives = 435/566 (77%), Gaps = 17/566 (3%)
 Frame = -3

Query  2064  TLDGTVDHYGRPALRSATGGWFAGVLLLVNQGLATLAFFGVGVNLVLFLTRVMGQDNADA  1885
             T DG++D  G PA+++ TGGW + +LLL N GLAT AFFGVGVNLV+FL RV+ Q NA+A
Sbjct  15    TEDGSMDRRGNPAVKTTTGGWRSAILLLANYGLATCAFFGVGVNLVVFLRRVLHQGNAEA  74

Query  1884  ANNVSKWTGTVYLFSLLGAFLSDSYWGRYKTCAIFQLIYVVGLISVSIFSFIFLVKPKGC  1705
             ANN+SKWTGTVY+FSL+GAFLSDSYWGRY TCAIFQ+IYV GL+ +S+ S+  LVKP GC
Sbjct  75    ANNISKWTGTVYIFSLIGAFLSDSYWGRYVTCAIFQIIYVTGLVILSLASWFLLVKPSGC  134

Query  1704  GDENTPCRSPSRIHIAVYYVSIYLVALGNGGYQPNIATFGSDQFDGDHAHESVSKVAFFS  1525
             G     C  PS   +A++Y+S Y++A GNGGYQP+IATFGSDQFD     E  SKVAFFS
Sbjct  135   GGVKVHCDEPSAPGVALFYLSTYMIAFGNGGYQPSIATFGSDQFDETDPKEGRSKVAFFS  194

Query  1524  YFYLALNLGSLFSNTVLVYFEDKGMWTLGFWastvsavlalllflVGTPRYRHFAPKGNP  1345
             YFYLALN+GSLFSNTVLVY+ED G W +GFW S  +A LAL+LFL+GTP YRHF P GNP
Sbjct  195   YFYLALNVGSLFSNTVLVYYEDSGRWVMGFWVSAAAAALALVLFLLGTPNYRHFKPSGNP  254

Query  1344  LSRFSQVLVASARKWNVHLPSDGDDHRLYEIQEHD---SSTRKILHTEGFKFLDKAAVIT  1174
             L+R +QV VA+ RKW+  +P       L+E++  D   S  RKILH++  +FLDKAA IT
Sbjct  255   LTRVAQVFVAAFRKWHAEVPR---GELLHEVEGEDPKISGIRKILHSDELRFLDKAATIT  311

Query  1173  TKESVRDLEERNINPWRLCSVTQVEEVKCILRLLPIWLCTILYSVVFTQMASLFVEQGAA  994
               E +        NPWRLC+VTQVEEVKCIL++LPIWLCTI+YSVVFTQMASLFVEQGA 
Sbjct  312   EGEKME-------NPWRLCTVTQVEEVKCILKMLPIWLCTIVYSVVFTQMASLFVEQGAT  364

Query  993   MRTNIAGFHIPPASMSSFDILSVAAFIFIYRRILDPLIASLKKTRRAQGFTELQRMGVGL  814
             M TNI  FH P ASMS FD+LSV AFI IYRR+L P++A L  +   QG TELQRMGVGL
Sbjct  365   MDTNIGSFHFPAASMSLFDVLSVLAFIAIYRRVLVPVMARL--SGNPQGLTELQRMGVGL  422

Query  813   iiaimamvaagiVEHFRLKYASTDCPRCPSSLSIFWQVPQYVLIGASEVFMYVGQLEFFN  634
             +I + AMV AG+VE  RLK  +   P  PSSLS+ WQVPQY LIGASEVFMYVGQLEFFN
Sbjct  423   VIGMAAMVVAGVVEVERLKRVA--APDQPSSLSVLWQVPQYALIGASEVFMYVGQLEFFN  480

Query  633   GQAPEGLKSFASALCMTSISLGNYVSSLLVSIVMRISTTHRMPGWIPGNLNKGHLDRFYF  454
             GQAP+G+KSF SALCM SISLGNYVS +LVS+V  ++   + PGWIPGNLN GHLDRFYF
Sbjct  481   GQAPDGVKSFGSALCMASISLGNYVSIMLVSVVTSLTAGEKRPGWIPGNLNSGHLDRFYF  540

Query  453   LLAALTTADFVVYILCAKWYKYIEFE  376
             LLAAL+  D  VYI CA WYK I+ +
Sbjct  541   LLAALSLVDLAVYIACAMWYKGIKLD  566



>ref|NP_001047928.1| Os02g0716800 [Oryza sativa Japonica Group]
 dbj|BAD09179.1| peptide transporter-like [Oryza sativa Japonica Group]
 dbj|BAD12890.1| peptide transporter-like [Oryza sativa Japonica Group]
 dbj|BAF09842.1| Os02g0716800 [Oryza sativa Japonica Group]
 gb|EAZ24393.1| hypothetical protein OsJ_08148 [Oryza sativa Japonica Group]
Length=584

 Score =   708 bits (1827),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 358/574 (62%), Positives = 436/574 (76%), Gaps = 6/574 (1%)
 Frame = -3

Query  2070  ECTLDGTVDHYGRPALRSATGGWFAGVLLLVNQGLATLAFFGVGVNLVLFLTRVMGQDNA  1891
             + T DG++D  G PA+++ TG W + +LLLVN GL T AFFGVGVNLV+FL RV+ QDNA
Sbjct  13    DITEDGSMDRRGNPAVKAKTGNWRSSILLLVNYGLVTCAFFGVGVNLVVFLRRVLHQDNA  72

Query  1890  DAANNVSKWTGTVYLFSLLGAFLSDSYWGRYKTCAIFQLIYVVGLISVSIFSFIFLVKPK  1711
             +AAN++SKWTGTVY+FSL+GAF+SDSYWGRY TCAIFQ+IYV GL+ +S+ S+  LVKP 
Sbjct  73    EAANSISKWTGTVYIFSLIGAFMSDSYWGRYITCAIFQMIYVTGLVILSLASWFLLVKPT  132

Query  1710  GCGDENTPCRSPSRIHIAVYYVSIYLVALGNGGYQPNIATFGSDQFDGDHAHESVSKVAF  1531
             GCG     C +PS   +A++Y+S Y++A GNGGYQP+IATFGSDQFD     E+ SKVAF
Sbjct  133   GCGAAGEHCDAPSSAGVALFYLSTYMIAFGNGGYQPSIATFGSDQFDETDPREARSKVAF  192

Query  1530  FSYFYLALNLGSLFSNTVLVYFEDKGMWTLGFWastvsavlalllflVGTPRYRHFAPKG  1351
             FSYFYLALN+GSLFSNTVLVY+ED+G W +GFW S  +A +AL+LFL+GTP YRHF P G
Sbjct  193   FSYFYLALNVGSLFSNTVLVYYEDEGRWVMGFWVSAAAAAMALVLFLLGTPNYRHFKPTG  252

Query  1350  NPLSRFSQVLVASARKWNVHLPSDGDDHRLYEIQEHDSSTRKILHTEGFKFLDKAAVITT  1171
             NPL+R +QV VA+ RKW   +P     H +   +   +  RKILH++  +FLDKAA +T 
Sbjct  253   NPLTRIAQVFVAAFRKWRAEVPRSELLHEVDGDESQIAGIRKILHSDQIRFLDKAATVTE  312

Query  1170  KESVRDLEERNINPWRLCSVTQVEEVKCILRLLPIWLCTILYSVVFTQMASLFVEQGAAM  991
             ++      E   +PWRLC+VTQVEEVKCIL++LPIWLCTI+YSVVFTQMASLFVEQG  M
Sbjct  313   EDYCT--PENMQDPWRLCTVTQVEEVKCILKMLPIWLCTIVYSVVFTQMASLFVEQGTTM  370

Query  990   RTNIAGFHIPPASMSSFDILSVAAFIFIYRRILDPLIASLKKTRRAQGFTELQRMGVGLi  811
              TNI  FH+P ASMS FDILSV AFI IYRR+L P+++ L  +   QG TELQRMGVGL+
Sbjct  371   NTNIGSFHVPAASMSVFDILSVLAFIAIYRRVLVPVMSRL--SGNPQGLTELQRMGVGLV  428

Query  810   iaimamvaagiVEHFRLKYASTDCPRCPSSLSIFWQVPQYVLIGASEVFMYVGQLEFFNG  631
             + + AMV AG+VE  RLK      P  PSSLS+ WQVPQY LIGASEVFMYVGQLEFFNG
Sbjct  429   VGMAAMVVAGVVEVERLK--RVGAPDQPSSLSVLWQVPQYALIGASEVFMYVGQLEFFNG  486

Query  630   QAPEGLKSFASALCMTSISLGNYVSSLLVSIVMRISTTHRMPGWIPGNLNKGHLDRFYFL  451
             QAP+G+KSF S+LCM SISLGNYVS +LVS+V  ++   R PGWIPGNLN GHLDRFYFL
Sbjct  487   QAPDGVKSFGSSLCMASISLGNYVSIMLVSVVTSLTAGDRRPGWIPGNLNSGHLDRFYFL  546

Query  450   LAALTTADFVVYILCAKWYKYIEFEERNSCLKNI  349
             LAAL+  D  VY+ CA WYK I+ +        I
Sbjct  547   LAALSLVDLAVYVACAVWYKGIKLDSNEEKANKI  580



>ref|XP_006647794.1| PREDICTED: nitrate transporter 1.5-like [Oryza brachyantha]
Length=586

 Score =   707 bits (1825),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 365/590 (62%), Positives = 442/590 (75%), Gaps = 21/590 (4%)
 Frame = -3

Query  2094  DEEKASREECTLDGTVDHYGRPALRSATGGWFAGVLLLVNQGLATLAFFGVGVNLVLFLT  1915
             D +     + T DG++D  G PA+++ TG W + +LLLVN GL T AFFGVGVNLV+FL 
Sbjct  5     DIDSKRMSDTTEDGSMDRRGNPAVKANTGKWRSSILLLVNYGLVTCAFFGVGVNLVVFLR  64

Query  1914  RVMGQDNADAANNVSKWTGTVYLFSLLGAFLSDSYWGRYKTCAIFQLIYVVGLISVSIFS  1735
             RV+ QDNA+AAN++SKWTGTVY+FSL+GAF+SDSYWGRY TCAIFQ+IYV GL+ +S+ S
Sbjct  65    RVLHQDNAEAANSISKWTGTVYIFSLIGAFMSDSYWGRYITCAIFQMIYVTGLVILSLAS  124

Query  1734  FIFLVKPKG-CGDENTPCRSPSRIHIAVYYVSIYLVALGNGGYQPNIATFGSDQFDGDHA  1558
             +  LVKP G CG     C +PS   +AV+Y+S Y++A GNGGYQP+IATFGSDQFD    
Sbjct  125   WFLLVKPSGRCGAAGEHCDAPSTAGVAVFYLSTYMIAFGNGGYQPSIATFGSDQFDETDP  184

Query  1557  HESVSKVAFFSYFYLALNLGSLFSNTVLVYFEDKGMWTLGFWastvsavlalllflVGTP  1378
             +E+ SKVAFFSYFYLALN+GSLFSNTVLVY+ED+G W +GFW S  +A +AL+LFL+GTP
Sbjct  185   NEARSKVAFFSYFYLALNVGSLFSNTVLVYYEDEGKWVMGFWVSAAAAAMALVLFLLGTP  244

Query  1377  RYRHFAPKGNPLSRFSQVLVASARKWNVHLPS-------DGDDHRLYEIQEHDSSTRKIL  1219
              YRHF P GNPL+R +QV VA+ RKW   +P        DGD+ R+  I       RKIL
Sbjct  245   SYRHFKPTGNPLTRIAQVFVAAFRKWRTDVPRSELLHEVDGDESRIAGI-------RKIL  297

Query  1218  HTEGFKFLDKAAVITTKESVRDLEERNINPWRLCSVTQVEEVKCILRLLPIWLCTILYSV  1039
             H++  +FLDKAA +T ++      E   NPWRLC+VTQVEEVKCIL++LPIWLCTI+YSV
Sbjct  298   HSDQIRFLDKAATVTEEDYCT--PENMQNPWRLCTVTQVEEVKCILKMLPIWLCTIVYSV  355

Query  1038  VFTQMASLFVEQGAAMRTNIAGFHIPPASMSSFDILSVAAFIFIYRRILDPLIASLKKTR  859
             VFTQMASLFVEQG  M TNI  FH+P ASMS FDILSV AFI IYRR+L P+++ L  + 
Sbjct  356   VFTQMASLFVEQGTTMNTNIGSFHVPAASMSVFDILSVLAFIAIYRRVLVPVMSRL--SG  413

Query  858   RAQGFTELQRMGVGLiiaimamvaagiVEHFRLKYASTDCPRCPSSLSIFWQVPQYVLIG  679
               QG TELQRMGVGL++ + AMV AG+VE  RLK      P  PSSLS+ WQVPQY LIG
Sbjct  414   NPQGLTELQRMGVGLVVGMAAMVVAGVVEVERLKRVV--APDQPSSLSVLWQVPQYALIG  471

Query  678   ASEVFMYVGQLEFFNGQAPEGLKSFASALCMTSISLGNYVSSLLVSIVMRISTTHRMPGW  499
             ASEVFMYVGQLEFFNGQAP+G+KSF S+LCM SISLGNYVS +LVS+V  ++   R PGW
Sbjct  472   ASEVFMYVGQLEFFNGQAPDGVKSFGSSLCMASISLGNYVSIMLVSVVTSLTAGDRRPGW  531

Query  498   IPGNLNKGHLDRFYFLLAALTTADFVVYILCAKWYKYIEFEERNSCLKNI  349
             IPGNLN GHLDRFYFLLAAL+  D  VY+ CA WYK I+ +        I
Sbjct  532   IPGNLNSGHLDRFYFLLAALSLVDLAVYVACAVWYKGIKLDSNEEKANKI  581



>ref|XP_004953690.1| PREDICTED: nitrate transporter 1.5-like isoform X1 [Setaria italica]
 ref|XP_004953691.1| PREDICTED: nitrate transporter 1.5-like isoform X2 [Setaria italica]
Length=583

 Score =   706 bits (1822),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 363/573 (63%), Positives = 435/573 (76%), Gaps = 12/573 (2%)
 Frame = -3

Query  2064  TLDGTVDHYGRPALRSATGGWFAGVLLLVNQGLATLAFFGVGVNLVLFLTRVMGQDNADA  1885
             T DG++D  G+PA+++ TG W + +LLL N GL T AFFGVGVNLV+FL RV+ QDNA+A
Sbjct  15    TEDGSMDRRGKPAVKATTGRWRSAILLLANYGLVTCAFFGVGVNLVVFLRRVLHQDNAEA  74

Query  1884  ANNVSKWTGTVYLFSLLGAFLSDSYWGRYKTCAIFQLIYVVGLISVSIFSFIFLVKPKGC  1705
             ANN+SKWTGTVY+FSL+GAFLSDSYWGRY TCAIFQ+IYV GL+ +S+ S+  LV P GC
Sbjct  75    ANNISKWTGTVYIFSLIGAFLSDSYWGRYITCAIFQIIYVTGLVILSLASWFLLVNPTGC  134

Query  1704  GDENTPCRSPSRIHIAVYYVSIYLVALGNGGYQPNIATFGSDQFDGDHAHESVSKVAFFS  1525
             G  N+ C  PS   +A++Y+S Y++A GNGGYQP+IATFGSDQFD     E+ SKVAFF+
Sbjct  135   GGVNSRCDEPSAPGVALFYLSTYMIAFGNGGYQPSIATFGSDQFDETDPEEARSKVAFFT  194

Query  1524  YFYLALNLGSLFSNTVLVYFEDKGMWTLGFWastvsavlalllflVGTPRYRHFAPKGNP  1345
             YFYLALN+GSLFSNTVLVY+ED G W +GFW S  +A LAL+LFL+GTP YRHF P GNP
Sbjct  195   YFYLALNVGSLFSNTVLVYYEDSGRWVMGFWVSAAAAALALVLFLLGTPNYRHFKPSGNP  254

Query  1344  LSRFSQVLVASARKWNVHLPSDGDDHRLYEIQEHD---SSTRKILHTEGFKFLDKAAVIT  1174
             L+R +QVLVA++RKW   +P       L+E++  D   S  R+ILH++  +F D+AA +T
Sbjct  255   LTRIAQVLVAASRKWRAEVPR---GELLHEVEGEDPKVSGIRRILHSDELRFFDRAATVT  311

Query  1173  TKESVRDLEERNINPWRLCSVTQVEEVKCILRLLPIWLCTILYSVVFTQMASLFVEQGAA  994
              +E  R   ER  +PWRLC+VTQVEEVKCILR+LPIWLCTI+YSVVFTQMASLFVEQGA 
Sbjct  312   EEE--RSTPERMEDPWRLCTVTQVEEVKCILRMLPIWLCTIVYSVVFTQMASLFVEQGAT  369

Query  993   MRTNIAGFHIPPASMSSFDILSVAAFIFIYRRILDPLIASLKKTRRAQGFTELQRMGVGL  814
             M T I  F IP ASMS FDILSV  FI +YRR L P +A +    R  G TELQRMGVGL
Sbjct  370   MNTTIGSFRIPAASMSLFDILSVLVFIAVYRRALVPAMARVSGNPR--GLTELQRMGVGL  427

Query  813   iiaimamvaagiVEHFRLKYASTDCPRCPSSLSIFWQVPQYVLIGASEVFMYVGQLEFFN  634
             +I + AMV AG+VE  RL+  +   P  PSSLS+ WQVPQY LIGASEVFMYVGQLEFFN
Sbjct  428   VIGMAAMVVAGVVEVERLRRVA--APDQPSSLSVLWQVPQYALIGASEVFMYVGQLEFFN  485

Query  633   GQAPEGLKSFASALCMTSISLGNYVSSLLVSIVMRISTTHRMPGWIPGNLNKGHLDRFYF  454
             GQAP+G+KSF SALCM SISLGNYVS +LVS+V  ++   R PGWIPGNLN GHLDRFYF
Sbjct  486   GQAPDGVKSFGSALCMASISLGNYVSIMLVSVVTSLTAGERRPGWIPGNLNSGHLDRFYF  545

Query  453   LLAALTTADFVVYILCAKWYKYIEFEERNSCLK  355
             LLA L+  D  VYI CA WYK I  +  +   K
Sbjct  546   LLAVLSLVDLAVYIPCAVWYKGIRLDGGDEVRK  578



>gb|EMT20726.1| Peptide transporter PTR1 [Aegilops tauschii]
Length=585

 Score =   705 bits (1820),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 360/570 (63%), Positives = 440/570 (77%), Gaps = 12/570 (2%)
 Frame = -3

Query  2064  TLDGTVDHYGRPALRSATGGWFAGVLLLVNQGLATLAFFGVGVNLVLFLTRVMGQDNADA  1885
             T DG++D  G PA+++ TG W + +LLLVN  L T AFFGVGVNLV+FL RV+ QDNA+A
Sbjct  15    TEDGSMDRRGNPAVKAKTGKWKSSILLLVNYALVTCAFFGVGVNLVVFLRRVLHQDNAEA  74

Query  1884  ANNVSKWTGTVYLFSLLGAFLSDSYWGRYKTCAIFQLIYVVGLISVSIFSFIFLVKPKGC  1705
             AN++SKWTGTVY+FSL+GAF+SDSYWGRY TCAIFQ+IYV GL+ +S+ S+  LVKP GC
Sbjct  75    ANSISKWTGTVYIFSLIGAFMSDSYWGRYITCAIFQMIYVTGLVILSLASWFLLVKPTGC  134

Query  1704  GDENTPCRSPSRIHIAVYYVSIYLVALGNGGYQPNIATFGSDQFDGDHAHESVSKVAFFS  1525
             GD  T C  PS    A++Y+S Y++A GNGGYQP+IAT GSDQFD     E+ SKVAFFS
Sbjct  135   GDVETHCDPPSAAGGALFYLSTYMIAFGNGGYQPSIATLGSDQFDETDPDEARSKVAFFS  194

Query  1524  YFYLALNLGSLFSNTVLVYFEDKGMWTLGFWastvsavlalllflVGTPRYRHFAPKGNP  1345
             YFYLALN+GS+FSNTVLVY+ED G W +GFW S  +A LAL+LFL+GTP YR+F P GNP
Sbjct  195   YFYLALNVGSIFSNTVLVYYEDAGQWVMGFWVSAGAAALALVLFLLGTPNYRYFKPTGNP  254

Query  1344  LSRFSQVLVASARKWNVHLPSDGDDHRLYEIQEH----DSSTRKILHTEGFKFLDKAAVI  1177
             L+R +QVLVA+ RKW  H P+ G+   L+E+  +    +S  RKI+H++  ++LDKAA +
Sbjct  255   LTRIAQVLVAACRKWRDHAPTRGE--LLHELDGNESYKESGIRKIMHSDQLRYLDKAATV  312

Query  1176  TTKESVRDLEERNINPWRLCSVTQVEEVKCILRLLPIWLCTILYSVVFTQMASLFVEQGA  997
             T ++      ER  +PWRLC+VTQVEEVKCIL++LPIW+CTI+YSVVFTQMASLFVEQG 
Sbjct  313   TEEDYCE--PERMKDPWRLCTVTQVEEVKCILKMLPIWMCTIVYSVVFTQMASLFVEQGT  370

Query  996   AMRTNIAGFHIPPASMSSFDILSVAAFIFIYRRILDPLIASLKKTRRAQGFTELQRMGVG  817
              M TNI  FH+P ASMS FDILSV AFI IYRR+L P++A L  +   QG TELQRMGVG
Sbjct  371   TMDTNIGSFHVPAASMSVFDILSVLAFIAIYRRVLVPVMARL--SGNPQGLTELQRMGVG  428

Query  816   LiiaimamvaagiVEHFRLKYASTDCPRCPSSLSIFWQVPQYVLIGASEVFMYVGQLEFF  637
             L+I + AMV AG+VE  RLK  +   P  PSSLS+ WQVPQY LIGASEVFMYVGQLEFF
Sbjct  429   LVIGMGAMVVAGVVEGERLKRVAA--PDQPSSLSVLWQVPQYALIGASEVFMYVGQLEFF  486

Query  636   NGQAPEGLKSFASALCMTSISLGNYVSSLLVSIVMRISTTHRMPGWIPGNLNKGHLDRFY  457
             NGQAP+G+KSF S+LCM SISLGNYVS +LVS+V  ++   + PGWIPGNLN GHLDRFY
Sbjct  487   NGQAPDGVKSFGSSLCMASISLGNYVSIMLVSVVTSLTAGDKRPGWIPGNLNSGHLDRFY  546

Query  456   FLLAALTTADFVVYILCAKWYKYIEFEERN  367
             FLLAAL+  D  VY+ CA WYK I+ +   
Sbjct  547   FLLAALSLVDLAVYVACAMWYKGIKLDSNE  576



>ref|XP_008679035.1| PREDICTED: protein NRT1/ PTR FAMILY 7.3-like isoform X3 [Zea 
mays]
 ref|XP_008679036.1| PREDICTED: protein NRT1/ PTR FAMILY 7.3-like isoform X3 [Zea 
mays]
 ref|XP_008679037.1| PREDICTED: protein NRT1/ PTR FAMILY 7.3-like isoform X3 [Zea 
mays]
 ref|XP_008679038.1| PREDICTED: protein NRT1/ PTR FAMILY 7.3-like isoform X3 [Zea 
mays]
 ref|XP_008679039.1| PREDICTED: protein NRT1/ PTR FAMILY 7.3-like isoform X3 [Zea 
mays]
 gb|AFW63622.1| hypothetical protein ZEAMMB73_688553 [Zea mays]
Length=582

 Score =   705 bits (1820),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 364/566 (64%), Positives = 433/566 (77%), Gaps = 13/566 (2%)
 Frame = -3

Query  2067  CTLDGTVDHYGRPALRSATGGWFAGVLLLVNQGLATLAFFGVGVNLVLFLTRVMGQDNAD  1888
              T DG++D  G PA+++ TG W + +LLL N GLAT AFFGVGVNLV+FL RV+ Q NA+
Sbjct  14    ATEDGSMDRRGNPAVKTTTGRWRSAILLLANYGLATCAFFGVGVNLVVFLRRVLHQGNAE  73

Query  1887  AANNVSKWTGTVYLFSLLGAFLSDSYWGRYKTCAIFQLIYVVGLISVSIFSFIFLVKPKG  1708
             AAN++SKWTGTVY+FSL+GAFLSDSYWGRY TCA+FQ+IYV+GL+ +S+ S++ LVKP G
Sbjct  74    AANSISKWTGTVYIFSLIGAFLSDSYWGRYVTCAVFQIIYVMGLVVLSLASWLLLVKPSG  133

Query  1707  CGDENTPCRSPSRIHIAVYYVSIYLVALGNGGYQPNIATFGSDQFDGDHAHESVSKVAFF  1528
             CG     C  PS   +A++Y+S Y++A GNGGYQP+IATFGSDQFD     E+ SKVAFF
Sbjct  134   CGGVKAHCDGPSAPGVALFYLSTYMIAFGNGGYQPSIATFGSDQFDETDPEEARSKVAFF  193

Query  1527  SYFYLALNLGSLFSNTVLVYFEDKGMWTLGFWastvsavlalllflVGTPRYRHFAPKGN  1348
             SYFYLALN+GSL SNTVLVY+ED G W +GFW S  +A LAL+LFL+GTP YRHF P GN
Sbjct  194   SYFYLALNVGSLLSNTVLVYYEDSGRWVMGFWVSAAAAALALVLFLLGTPGYRHFKPSGN  253

Query  1347  PLSRFSQVLVASARKWNVHLPSDGDDHRLYEIQEHD--SSTRKILHTEGFKFLDKAAVIT  1174
             PL+R +QV VA+ RKW   +P     H + E  E    S  RKILH++G +FLDKAA IT
Sbjct  254   PLTRVAQVFVAALRKWRAEVPRGELLHEVVEAGEDPKVSGIRKILHSDGLRFLDKAATIT  313

Query  1173  TKESVRDLEERNINPWRLCSVTQVEEVKCILRLLPIWLCTILYSVVFTQMASLFVEQGAA  994
              +E           PWRLC+VTQVEEVKCILR+LPIWLCTI+YSVVFTQMASLFVEQGA 
Sbjct  314   EEEE-------EEGPWRLCTVTQVEEVKCILRMLPIWLCTIVYSVVFTQMASLFVEQGAT  366

Query  993   MRTNIAGFHIPPASMSSFDILSVAAFIFIYRRILDPLIASLKKTRRAQGFTELQRMGVGL  814
             M TNI  FH P ASMS FD+LSV AFI IYRR+L P++A L  +   QG TELQRMGVGL
Sbjct  367   MDTNIGSFHFPAASMSLFDVLSVLAFIAIYRRVLVPVMARL--SGNPQGLTELQRMGVGL  424

Query  813   iiaimamvaagiVEHFRLKYASTDCPRCPSSLSIFWQVPQYVLIGASEVFMYVGQLEFFN  634
             +I + AMV AG+VE  RLK  +   P  PSSLS+ WQVPQY LIGASEVFMYVGQLEFFN
Sbjct  425   VIGMAAMVVAGVVEVERLKRVA--APDQPSSLSVLWQVPQYALIGASEVFMYVGQLEFFN  482

Query  633   GQAPEGLKSFASALCMTSISLGNYVSSLLVSIVMRISTTHRMPGWIPGNLNKGHLDRFYF  454
             GQAP+G+KSF SALCM SISLGNYVS +LVS+V  ++   + PGWIPGNLN GHLDRFYF
Sbjct  483   GQAPDGVKSFGSALCMASISLGNYVSIMLVSVVTSLTAGEKRPGWIPGNLNSGHLDRFYF  542

Query  453   LLAALTTADFVVYILCAKWYKYIEFE  376
             LLAAL+  D  VY+ CA WYK I+ +
Sbjct  543   LLAALSLVDLAVYVACAMWYKGIKLD  568



>ref|XP_008679034.1| PREDICTED: protein NRT1/ PTR FAMILY 7.2-like isoform X2 [Zea 
mays]
Length=625

 Score =   705 bits (1820),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 364/566 (64%), Positives = 432/566 (76%), Gaps = 13/566 (2%)
 Frame = -3

Query  2067  CTLDGTVDHYGRPALRSATGGWFAGVLLLVNQGLATLAFFGVGVNLVLFLTRVMGQDNAD  1888
              T DG++D  G PA+++ TG W + +LLL N GLAT AFFGVGVNLV+FL RV+ Q NA+
Sbjct  57    ATEDGSMDRRGNPAVKTTTGRWRSAILLLANYGLATCAFFGVGVNLVVFLRRVLHQGNAE  116

Query  1887  AANNVSKWTGTVYLFSLLGAFLSDSYWGRYKTCAIFQLIYVVGLISVSIFSFIFLVKPKG  1708
             AAN++SKWTGTVY+FSL+GAFLSDSYWGRY TCA+FQ+IYV+GL+ +S+ S++ LVKP G
Sbjct  117   AANSISKWTGTVYIFSLIGAFLSDSYWGRYVTCAVFQIIYVMGLVVLSLASWLLLVKPSG  176

Query  1707  CGDENTPCRSPSRIHIAVYYVSIYLVALGNGGYQPNIATFGSDQFDGDHAHESVSKVAFF  1528
             CG     C  PS   +A++Y+S Y++A GNGGYQP+IATFGSDQFD     E+ SKVAFF
Sbjct  177   CGGVKAHCDGPSAPGVALFYLSTYMIAFGNGGYQPSIATFGSDQFDETDPEEARSKVAFF  236

Query  1527  SYFYLALNLGSLFSNTVLVYFEDKGMWTLGFWastvsavlalllflVGTPRYRHFAPKGN  1348
             SYFYLALN+GSL SNTVLVY+ED G W +GFW S  +A LAL+LFL+GTP YRHF P GN
Sbjct  237   SYFYLALNVGSLLSNTVLVYYEDSGRWVMGFWVSAAAAALALVLFLLGTPGYRHFKPSGN  296

Query  1347  PLSRFSQVLVASARKWNVHLPSDGDDHRLYEIQEHD--SSTRKILHTEGFKFLDKAAVIT  1174
             PL+R +QV VA+ RKW   +P     H + E  E    S  RKILH++G +FLDKAA IT
Sbjct  297   PLTRVAQVFVAALRKWRAEVPRGELLHEVVEAGEDPKVSGIRKILHSDGLRFLDKAATIT  356

Query  1173  TKESVRDLEERNINPWRLCSVTQVEEVKCILRLLPIWLCTILYSVVFTQMASLFVEQGAA  994
              +E           PWRLC+VTQVEEVKCILR+LPIWLCTI+YSVVFTQMASLFVEQGA 
Sbjct  357   EEEE-------EEGPWRLCTVTQVEEVKCILRMLPIWLCTIVYSVVFTQMASLFVEQGAT  409

Query  993   MRTNIAGFHIPPASMSSFDILSVAAFIFIYRRILDPLIASLKKTRRAQGFTELQRMGVGL  814
             M TNI  FH P ASMS FD+LSV AFI IYRR+L P++A L      QG TELQRMGVGL
Sbjct  410   MDTNIGSFHFPAASMSLFDVLSVLAFIAIYRRVLVPVMARLSGN--PQGLTELQRMGVGL  467

Query  813   iiaimamvaagiVEHFRLKYASTDCPRCPSSLSIFWQVPQYVLIGASEVFMYVGQLEFFN  634
             +I + AMV AG+VE  RLK  +   P  PSSLS+ WQVPQY LIGASEVFMYVGQLEFFN
Sbjct  468   VIGMAAMVVAGVVEVERLKRVA--APDQPSSLSVLWQVPQYALIGASEVFMYVGQLEFFN  525

Query  633   GQAPEGLKSFASALCMTSISLGNYVSSLLVSIVMRISTTHRMPGWIPGNLNKGHLDRFYF  454
             GQAP+G+KSF SALCM SISLGNYVS +LVS+V  ++   + PGWIPGNLN GHLDRFYF
Sbjct  526   GQAPDGVKSFGSALCMASISLGNYVSIMLVSVVTSLTAGEKRPGWIPGNLNSGHLDRFYF  585

Query  453   LLAALTTADFVVYILCAKWYKYIEFE  376
             LLAAL+  D  VY+ CA WYK I+ +
Sbjct  586   LLAALSLVDLAVYVACAMWYKGIKLD  611



>ref|XP_008679033.1| PREDICTED: protein NRT1/ PTR FAMILY 7.2-like isoform X1 [Zea 
mays]
Length=628

 Score =   705 bits (1819),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 364/566 (64%), Positives = 433/566 (77%), Gaps = 13/566 (2%)
 Frame = -3

Query  2067  CTLDGTVDHYGRPALRSATGGWFAGVLLLVNQGLATLAFFGVGVNLVLFLTRVMGQDNAD  1888
              T DG++D  G PA+++ TG W + +LLL N GLAT AFFGVGVNLV+FL RV+ Q NA+
Sbjct  60    ATEDGSMDRRGNPAVKTTTGRWRSAILLLANYGLATCAFFGVGVNLVVFLRRVLHQGNAE  119

Query  1887  AANNVSKWTGTVYLFSLLGAFLSDSYWGRYKTCAIFQLIYVVGLISVSIFSFIFLVKPKG  1708
             AAN++SKWTGTVY+FSL+GAFLSDSYWGRY TCA+FQ+IYV+GL+ +S+ S++ LVKP G
Sbjct  120   AANSISKWTGTVYIFSLIGAFLSDSYWGRYVTCAVFQIIYVMGLVVLSLASWLLLVKPSG  179

Query  1707  CGDENTPCRSPSRIHIAVYYVSIYLVALGNGGYQPNIATFGSDQFDGDHAHESVSKVAFF  1528
             CG     C  PS   +A++Y+S Y++A GNGGYQP+IATFGSDQFD     E+ SKVAFF
Sbjct  180   CGGVKAHCDGPSAPGVALFYLSTYMIAFGNGGYQPSIATFGSDQFDETDPEEARSKVAFF  239

Query  1527  SYFYLALNLGSLFSNTVLVYFEDKGMWTLGFWastvsavlalllflVGTPRYRHFAPKGN  1348
             SYFYLALN+GSL SNTVLVY+ED G W +GFW S  +A LAL+LFL+GTP YRHF P GN
Sbjct  240   SYFYLALNVGSLLSNTVLVYYEDSGRWVMGFWVSAAAAALALVLFLLGTPGYRHFKPSGN  299

Query  1347  PLSRFSQVLVASARKWNVHLPSDGDDHRLYEIQEHD--SSTRKILHTEGFKFLDKAAVIT  1174
             PL+R +QV VA+ RKW   +P     H + E  E    S  RKILH++G +FLDKAA IT
Sbjct  300   PLTRVAQVFVAALRKWRAEVPRGELLHEVVEAGEDPKVSGIRKILHSDGLRFLDKAATIT  359

Query  1173  TKESVRDLEERNINPWRLCSVTQVEEVKCILRLLPIWLCTILYSVVFTQMASLFVEQGAA  994
              +E           PWRLC+VTQVEEVKCILR+LPIWLCTI+YSVVFTQMASLFVEQGA 
Sbjct  360   EEEE-------EEGPWRLCTVTQVEEVKCILRMLPIWLCTIVYSVVFTQMASLFVEQGAT  412

Query  993   MRTNIAGFHIPPASMSSFDILSVAAFIFIYRRILDPLIASLKKTRRAQGFTELQRMGVGL  814
             M TNI  FH P ASMS FD+LSV AFI IYRR+L P++A L  +   QG TELQRMGVGL
Sbjct  413   MDTNIGSFHFPAASMSLFDVLSVLAFIAIYRRVLVPVMARL--SGNPQGLTELQRMGVGL  470

Query  813   iiaimamvaagiVEHFRLKYASTDCPRCPSSLSIFWQVPQYVLIGASEVFMYVGQLEFFN  634
             +I + AMV AG+VE  RLK  +   P  PSSLS+ WQVPQY LIGASEVFMYVGQLEFFN
Sbjct  471   VIGMAAMVVAGVVEVERLKRVA--APDQPSSLSVLWQVPQYALIGASEVFMYVGQLEFFN  528

Query  633   GQAPEGLKSFASALCMTSISLGNYVSSLLVSIVMRISTTHRMPGWIPGNLNKGHLDRFYF  454
             GQAP+G+KSF SALCM SISLGNYVS +LVS+V  ++   + PGWIPGNLN GHLDRFYF
Sbjct  529   GQAPDGVKSFGSALCMASISLGNYVSIMLVSVVTSLTAGEKRPGWIPGNLNSGHLDRFYF  588

Query  453   LLAALTTADFVVYILCAKWYKYIEFE  376
             LLAAL+  D  VY+ CA WYK I+ +
Sbjct  589   LLAALSLVDLAVYVACAMWYKGIKLD  614



>gb|KHN11612.1| Nitrate transporter 1.5 [Glycine soja]
Length=549

 Score =   698 bits (1802),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 382/591 (65%), Positives = 445/591 (75%), Gaps = 50/591 (8%)
 Frame = -3

Query  2091  EEKASREE--CTLDGTVDHYGRPALRSATGGWFAGVLLLVNQGLATLAFFGVGVNLVLFL  1918
             EEK ++E   CT DG +D +G PA+R  TG W A +L+LVNQGLATLAFFGVGVNLVLFL
Sbjct  2     EEKINKEHQVCTSDGAIDSHGHPAVRKKTGDWVAAILILVNQGLATLAFFGVGVNLVLFL  61

Query  1917  TRVMGQDNADAANNVSKWTGTVYLFSLLGAFLSDSYWGRYKTCAIFQLIYVVGLISVSIF  1738
             TRVMGQDNA+AANN                                      GL+S+S+ 
Sbjct  62    TRVMGQDNAEAANN--------------------------------------GLVSLSLS  83

Query  1737  SFIFLVKPKGCGDENTPCRSPSRIHIAVYYVSIYLVALGNGGYQPNIATFGSDQFDGDHA  1558
             S+IFL+KP GCG++  PC S S     ++YVSIYL+ALGNGGYQPNIATFG+DQFD    
Sbjct  84    SYIFLLKPSGCGNKELPCGSHSSYQTILFYVSIYLIALGNGGYQPNIATFGADQFDEGDP  143

Query  1557  HESVSKVAFFSYFYLALNLGSLFSNTVLVYFEDKGMWTLGFWastvsavlalllflVGTP  1378
              E  SK+ FFSYFYLALN+GSLFSNT+L YFED G+WTLGFWAS  SA LAL+LFL GT 
Sbjct  144   REQHSKIVFFSYFYLALNIGSLFSNTILNYFEDDGLWTLGFWASAGSAALALVLFLCGTR  203

Query  1377  RYRHFAPKGNPLSRFSQVLVASARKWNVHLPSDGDDHRLYEIQEHDSST-RKILHTEGFK  1201
             RYR+F P GNPL RF QV VA+ RKW   +  D    +LYE+ E  ++  RK+ HTEGF+
Sbjct  204   RYRYFKPNGNPLPRFCQVFVAATRKWKAKVLQD---DKLYEVDEFSTNEGRKMFHTEGFR  260

Query  1200  FLDKAAVITTKESVRDLEERNINPWRLCSVTQVEEVKCILRLLPIWLCTILYSVVFTQMA  1021
             FLDKAA IT+K + + +EE   +PW L +VTQVEEVKCILRLLPIWLCTILYSVVF QMA
Sbjct  261   FLDKAAFITSK-NFKQMEESKCSPWYLSTVTQVEEVKCILRLLPIWLCTILYSVVFAQMA  319

Query  1020  SLFVEQGAAMRTNIAGFHIPPASMSSFDILSVAAFIFIYRRILDPLIASLKKTRRAQGFT  841
             SLFVEQG AM T I+ FHIPPASMS+FDILSVA  IFIYRR+LDPL+A   +T +++G T
Sbjct  320   SLFVEQGDAMDTRISRFHIPPASMSTFDILSVAVVIFIYRRVLDPLVA---RTMKSKGLT  376

Query  840   ELQRMGVGLiiaimamvaagiVEHFRLKYASTDCPRCP--SSLSIFWQVPQYVLIGASEV  667
             ELQRMG+GL++AIMAMV+AG+VEHFRLK A  DC  C   SSLSIFWQVPQYVL+GASEV
Sbjct  377   ELQRMGIGLVLAIMAMVSAGLVEHFRLKNAIEDCNECEGSSSLSIFWQVPQYVLVGASEV  436

Query  666   FMYVGQLEFFNGQAPEGLKSFASALCMTSISLGNYVSSLLVSIVMRISTTHRMPGWIPGN  487
             FMYVGQLEFFN Q P+GLKSF SALCMTSISLGNYVSSLLV+IVM+IS T  MPGWIPGN
Sbjct  437   FMYVGQLEFFNAQTPDGLKSFGSALCMTSISLGNYVSSLLVAIVMKISATDEMPGWIPGN  496

Query  486   LNKGHLDRFYFLLAALTTADFVVYILCAKWYKYIEFEERNSCLKNIGDSKL  334
             LNKGHLD FYFLLAALT AD V+Y+L A+WYKYI+F+  N    N  D ++
Sbjct  497   LNKGHLDMFYFLLAALTAADLVIYVLMARWYKYIKFQGNNDNGINKEDPEV  547



>gb|AGT17043.1| Proton-dependent oligopeptide transporter family [Saccharum hybrid 
cultivar R570]
Length=606

 Score =   695 bits (1794),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 364/577 (63%), Positives = 435/577 (75%), Gaps = 23/577 (4%)
 Frame = -3

Query  2058  DGTVDHYGRPALRSATGGWFAGVLLLVNQGLATLAFFGVGVNLVLFLTRVMGQDNADAAN  1879
             DG++D  G PA+++ TG W + +LLL N GLAT AFFGVGVNLV+FL RV+ Q NA+AAN
Sbjct  43    DGSMDRRGNPAVKTTTGRWRSAILLLANYGLATCAFFGVGVNLVVFLRRVLHQGNAEAAN  102

Query  1878  NVSKWTGTVYLFSLLGAFLSDSYWGRYKTCAIFQLIYVVGLISVSIFSFIFLVKPKGCGD  1699
             N+SKWTGTVY+FSL+GAFLSDSYWGRY TCAIFQ++YV GL+ +S+ S+  LVKP GCG 
Sbjct  103   NISKWTGTVYIFSLIGAFLSDSYWGRYVTCAIFQIVYVTGLVILSLASWFLLVKPSGCGG  162

Query  1698  ENTPCRSPSRIHIAVYYVSIYLVALGNGGYQPNIATFGSDQFDGDHAHESVSKVAFFSYF  1519
                 C  PS   +A++Y+S Y++A GNGGYQP+IATFGSDQFD     E+ SKVAFFSYF
Sbjct  163   VKAHCDEPSAPGVALFYLSTYMIAFGNGGYQPSIATFGSDQFDETDPKEARSKVAFFSYF  222

Query  1518  YLALNLGSLFSNTVLVYFEDKGMWTLGFWastvsavlalllflVGTPRYRHFAPKGNPLS  1339
             YLALN+GSLFSNTVLVY+ED G W +GFW S  +A LAL+LFL+GTP YRHF P GNPL+
Sbjct  223   YLALNVGSLFSNTVLVYYEDSGRWVMGFWVSAAAAALALVLFLLGTPNYRHFKPSGNPLT  282

Query  1338  RFSQVLVASARKWNVHLPSDGDDHRLYEIQEHD---SSTRKILHTEGFKFLDKAAVITTK  1168
             R +QV VA+ RKW+  +P       L+E++  D   S  RKILH++  +FLDKAA IT  
Sbjct  283   RVAQVFVAAFRKWHAEVPR---GELLHEVEGEDPKISGIRKILHSDELRFLDKAATITEG  339

Query  1167  ESVRDLEERNINPWRLCSVTQVEEVKCILRLLPIWLCTILYSVVFTQMASLFVEQGAAMR  988
             E +        N WRLC+VTQVEEVKCIL++LPIWL TI+YSVVFTQMASLFVEQGA M 
Sbjct  340   EKME-------NQWRLCTVTQVEEVKCILKMLPIWLSTIVYSVVFTQMASLFVEQGATMN  392

Query  987   TNIAGFHIPPASMSSFDILSVAAFIFIYRRILDPLIASLKKTRRAQGFTELQRMGVGLii  808
             TNI  FH P ASMS FD+LSV  FI IYRR+L P++A L  +   QG TELQRMGVGL+I
Sbjct  393   TNIGSFHFPAASMSLFDVLSVLVFIAIYRRVLVPVMARL--SGNPQGLTELQRMGVGLVI  450

Query  807   aimamvaagiVEHFRLKYASTDCPRCPSSLSIFWQVPQYVLIGASEVFMYVGQLEFFNGQ  628
              + AMV AG+VE  RLK  +   P  PSSLS+ WQVPQY LIGASEVFMYVGQLEFFNGQ
Sbjct  451   GMAAMVVAGVVEVERLKRVA--APDRPSSLSVLWQVPQYALIGASEVFMYVGQLEFFNGQ  508

Query  627   APEGLKSFASALCMTSISLGNYVSSLLVSIVMRISTTHRMPGWIPGNLNKGHLDRFYFLL  448
             AP+G+KSF SALCM SISLGNYVS +LVS+V  ++   + PGWIPGNLN GHLDRFYFLL
Sbjct  509   APDGVKSFGSALCMASISLGNYVSIMLVSVVTSLTAGEKRPGWIPGNLNSGHLDRFYFLL  568

Query  447   AALTTADFVVYILCAKWYKYIEFEERNSCLKNIGDSK  337
             AAL+  D  VYI CA  YK I+ +  +      GDS+
Sbjct  569   AALSLVDLAVYIACAMCYKGIKLDGGD------GDSR  599



>ref|XP_009792819.1| PREDICTED: protein NRT1/ PTR FAMILY 7.3-like isoform X2 [Nicotiana 
sylvestris]
Length=523

 Score =   685 bits (1768),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 353/528 (67%), Positives = 427/528 (81%), Gaps = 8/528 (2%)
 Frame = -3

Query  1908  MGQDNADAANNVSKWTGTVYLFSLLGAFLSDSYWGRYKTCAIFQLIYVVGLISVSIFSFI  1729
             M ++NA+AAN+VSKWTGTVY+FSL+GAFLSDSYWGR+K+CAIFQ+IYV+GL+ +S+ + +
Sbjct  1     MQENNAEAANSVSKWTGTVYIFSLVGAFLSDSYWGRFKSCAIFQVIYVIGLVLLSLATQL  60

Query  1728  FLVKPKGCGDENTPCRSPSRIHIAVYYVSIYLVALGNGGYQPNIATFGSDQFDGDHAHES  1549
             +L+KPKGCGD  T C   S + I+++Y+S+Y++ALG GGYQPNIATFG+DQFD     E 
Sbjct  61    YLLKPKGCGDRTTLCGPHSTMEISLFYISVYMIALGYGGYQPNIATFGADQFDEHDPREK  120

Query  1548  VSKVAFFSYFYLALNLGSLFSNTVLVYFEDKGMWTLGFWastvsavlalllflVGTPRYR  1369
              SK AFFSYFYLALNLGSLFSNT+L YFED GMW LGFWAS  SA  AL+LFL GT +YR
Sbjct  121   QSKQAFFSYFYLALNLGSLFSNTILDYFEDDGMWALGFWASAASAFAALVLFLGGTVKYR  180

Query  1368  HFAPKGNPLSRFSQVLVASARKWNVHLPSDGDDHRLYEIQEHDSST--RKILHTEGFKFL  1195
             HF   GNP++RFSQV++A++ KW V +P + D   LYE  +  S T  RK+LHT+GFKFL
Sbjct  181   HFRSSGNPITRFSQVIIAASNKWRVAIPENED--ALYEGDDESSRTAGRKMLHTQGFKFL  238

Query  1194  DKAAVITTKESVRDLEERNINPWRLCSVTQVEEVKCILRLLPIWLCTILYSVVFTQMASL  1015
             DKAA+IT+KE + + ++ N NPWRLC ++QVEEVKCILRL+PIWLCTI+YSVVFTQMAS+
Sbjct  239   DKAALITSKE-LGNEKQSNRNPWRLCPISQVEEVKCILRLMPIWLCTIIYSVVFTQMASI  297

Query  1014  FVEQGAAMRTNIAGFHIPPASMSSFDILSVAAFIFIYRRILDPLIASLKKTR-RAQGFTE  838
             FVEQG AM+T I  F IP ASMSSFDI+SVA  IF+YRR+LDP +  +KK +  A G T+
Sbjct  298   FVEQGDAMKTTIGKFRIPAASMSSFDIMSVAVVIFLYRRVLDPFVKKIKKHKGEALGITQ  357

Query  837   LQRMGVGLiiaimamvaagiVEHFRLKYASTDCPRCPSSLSIFWQVPQYVLIGASEVFMY  658
             LQRMG+GLIIA+MAM++AGIVE +RLKYAS D  +  SSL+I WQ+PQY L+GASEVFMY
Sbjct  358   LQRMGIGLIIAVMAMLSAGIVECYRLKYASKD--QGSSSLTILWQIPQYSLVGASEVFMY  415

Query  657   VGQLEFFNGQAPEGLKSFASALCMTSISLGNYVSSLLVSIVMRISTTHRMPGWIPGNLNK  478
             VGQLEFFN QAP+GLKSF SALCMTSISLGNYVS+LLVS+VM+ISTT  M GWIPGNLNK
Sbjct  416   VGQLEFFNEQAPDGLKSFGSALCMTSISLGNYVSNLLVSVVMKISTTDNMSGWIPGNLNK  475

Query  477   GHLDRFYFLLAALTTADFVVYILCAKWYKYIEFEERNSCLKNIGDSKL  334
             GHLDRFYFLLA LT  D V YI CAKWYK I+  E    LK     K+
Sbjct  476   GHLDRFYFLLAGLTILDLVAYIACAKWYKGIKHGEITQQLKEEDKCKV  523



>ref|XP_008646076.1| PREDICTED: protein NRT1/ PTR FAMILY 7.2-like [Zea mays]
 gb|AFW72867.1| hypothetical protein ZEAMMB73_561824 [Zea mays]
Length=613

 Score =   685 bits (1768),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 361/574 (63%), Positives = 431/574 (75%), Gaps = 19/574 (3%)
 Frame = -3

Query  2070  ECTLDGTVDHYGRPALRSATGGWFAGVLLLVNQGLATLAFFGVGVNLVLFLTRVMGQDNA  1891
             E TLDG+VD  GRPA++  +GGW AG L+LVNQGLATLAFFGV VNLVLFLTRV+GQ N 
Sbjct  37    EYTLDGSVDMKGRPAVKGKSGGWLAGALILVNQGLATLAFFGVNVNLVLFLTRVLGQSNG  96

Query  1890  DAANNVSKWTGTVYLFSLLGAFLSDSYWGRYKTCAIFQLIYVVGLISVSIFSFIFLVKPK  1711
             DAANNVSKWTGTVY+FSL+GAFLSDSYWGRYKTCAIFQ I+V+GL  +S+ S ++L++P 
Sbjct  97    DAANNVSKWTGTVYMFSLIGAFLSDSYWGRYKTCAIFQAIFVLGLALLSVSSHLYLIRPD  156

Query  1710  GCGDENTPCRSPSRIHIAVYYVSIYLVALGNGGYQPNIATFGSDQFDGDHAHESVSKVAF  1531
             GCG E+ PC   S   + ++Y+++Y++A GNGGYQPNIAT G+DQFD +   E+ SKV+F
Sbjct  157   GCGMEHAPCGPHSGKELGIFYIALYMIAFGNGGYQPNIATLGADQFDEEDPAEAHSKVSF  216

Query  1530  FSYFYLALNLGSLFSNTVLVYFEDKGMWTLGFWastvsavlalllflVGTPRYRHFAPKG  1351
             FSYFYLALNLGSLFSNT L Y EDKG W LGFWAST +A  ALLLFL GT RYR+F P G
Sbjct  217   FSYFYLALNLGSLFSNTFLSYLEDKGSWALGFWASTAAAATALLLFLSGTLRYRYFQPGG  276

Query  1350  NPLSRFSQVLVASARKWNVHLPSDGDDHRLYEIQEH-DSSTRKILHTEGFKFLDKAAVIT  1174
             NP+ R  QV +A+ R W   + +  +   LYE  E  D+  RK+LHT+GF FLD+AA   
Sbjct  277   NPIGRIGQVAIAACRNWKAGVST--EVVSLYEGDEKADAGGRKLLHTQGFSFLDRAAHAD  334

Query  1173  T--KESVRDLEERNINPWRLCSVTQVEEVKCILRLLPIWLCTILYSVVFTQMASLFVEQG  1000
             T  K   RD       PW+LCSVTQVEEVK ILRLLPIWLCTILYSVVFTQMASLFV QG
Sbjct  335   TDSKLGARD-------PWKLCSVTQVEEVKSILRLLPIWLCTILYSVVFTQMASLFVVQG  387

Query  999   AAMR--TNIAGFHIPPASMSSFDILSVAAFIFIYRRILDPLIASLKKTRRAQGFTELQRM  826
             AAMR  T  +GF +PP+SMS+FDIL+VAA IF+YRR + P +A L  + R  G TELQRM
Sbjct  388   AAMRRTTPFSGFSVPPSSMSAFDILTVAATIFLYRRTICPFLARL--SGRPAGPTELQRM  445

Query  825   GVGLiiaimamvaagiVEHFRLKYASTDCPRCPSSLSIFWQVPQYVLIGASEVFMYVGQL  646
             G+GL++  +AM  AG VEHFR   A+       S L I WQVPQY LIG SEV MYVGQL
Sbjct  446   GLGLVVGALAMTTAGTVEHFRKARATA---AMSSDLHIMWQVPQYALIGVSEVMMYVGQL  502

Query  645   EFFNGQAPEGLKSFASALCMTSISLGNYVSSLLVSIVMRISTTHRMPGWIPGNLNKGHLD  466
             EFFNGQ P+GLKSF SALCM S+SLGNY S ++VS V R++TT    GWIP +LN+GHLD
Sbjct  503   EFFNGQMPDGLKSFGSALCMMSMSLGNYFSDIIVSAVTRLTTTRGRSGWIPADLNEGHLD  562

Query  465   RFYFLLAALTTADFVVYILCAKWYKYIEFEERNS  364
             +FYFLLA L  ADF VY++CA  Y   + + R+S
Sbjct  563   KFYFLLAVLAVADFAVYLVCASRYGSGKVDGRSS  596



>ref|XP_002452718.1| hypothetical protein SORBIDRAFT_04g031320 [Sorghum bicolor]
 gb|EES05694.1| hypothetical protein SORBIDRAFT_04g031320 [Sorghum bicolor]
Length=606

 Score =   683 bits (1762),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 362/575 (63%), Positives = 430/575 (75%), Gaps = 19/575 (3%)
 Frame = -3

Query  2070  ECTLDGTVDHYGRPALRSATGGWFAGVLLLVNQGLATLAFFGVGVNLVLFLTRVMGQDNA  1891
             E TLDG+VD  GRPA++  +GGW AG L+LVNQGLATLAFFGV VNLVLFLTRV+GQ N 
Sbjct  27    EYTLDGSVDIKGRPAVKGKSGGWLAGALILVNQGLATLAFFGVNVNLVLFLTRVLGQSNE  86

Query  1890  DAANNVSKWTGTVYLFSLLGAFLSDSYWGRYKTCAIFQLIYVVGLISVSIFSFIFLVKPK  1711
             DAANNVSKWTGTVY+FSL+GAFLSDSYWGRYKTCAIFQ I+V+GL  +S+ S ++L++P 
Sbjct  87    DAANNVSKWTGTVYMFSLIGAFLSDSYWGRYKTCAIFQAIFVLGLALLSVSSHLYLIRPD  146

Query  1710  GCGDENTPCRSPSRIHIAVYYVSIYLVALGNGGYQPNIATFGSDQFDGDHAHESVSKVAF  1531
             GCG E+ PC   S   + ++Y+++Y++A GNGGYQPNIAT G+DQFD D   E+ SKV+F
Sbjct  147   GCGMEHAPCGPHSGKELGIFYIALYMIAFGNGGYQPNIATLGADQFDEDDPAEAHSKVSF  206

Query  1530  FSYFYLALNLGSLFSNTVLVYFEDKGMWTLGFWastvsavlalllflVGTPRYRHFAPKG  1351
             FSYFYLALNLGSLFSNT L Y EDKG W LGFWAST +A  ALLLFL GT RYR+F P G
Sbjct  207   FSYFYLALNLGSLFSNTFLSYLEDKGSWALGFWASTAAAATALLLFLSGTLRYRYFQPGG  266

Query  1350  NPLSRFSQVLVASARKWNVHLPSDGDDHRLYEIQEHDSST--RKILHTEGFKFLDKAAVI  1177
             NP+ R  QV +A++RKW     + G    LYE  E   +   RK+LHT+GF FLD+AA  
Sbjct  267   NPIGRICQVAIAASRKWKAGASTTG-VVSLYEGDEKADAAGGRKLLHTQGFSFLDRAAHA  325

Query  1176  TT--KESVRDLEERNINPWRLCSVTQVEEVKCILRLLPIWLCTILYSVVFTQMASLFVEQ  1003
              T  K   RD       PW+LC+VTQVEEVK ILRLLPIWLCTILYSVVFTQMASLFV Q
Sbjct  326   DTDSKLGARD-------PWKLCTVTQVEEVKSILRLLPIWLCTILYSVVFTQMASLFVVQ  378

Query  1002  GAAMR--TNIAGFHIPPASMSSFDILSVAAFIFIYRRILDPLIASLKKTRRAQGFTELQR  829
             GAAMR  T  +GF +PP+SMS+FDIL+VA  IF+YRR + P +A L  T R  G TELQR
Sbjct  379   GAAMRRTTPFSGFSVPPSSMSAFDILAVATTIFLYRRAICPFLARL--TGRPAGPTELQR  436

Query  828   MGVGLiiaimamvaagiVEHFRLKYASTDCPRCPSSLSIFWQVPQYVLIGASEVFMYVGQ  649
             MG+GL++  +AM  AG VEHFR   A+       S L I WQVPQY LIG SEV MYVGQ
Sbjct  437   MGLGLVVGALAMATAGTVEHFRKARATA---AMSSDLHIMWQVPQYALIGVSEVMMYVGQ  493

Query  648   LEFFNGQAPEGLKSFASALCMTSISLGNYVSSLLVSIVMRISTTHRMPGWIPGNLNKGHL  469
             LEFFNGQ P+GLKSF SALCM S+SLGNY S ++VS V R++TT    GWIP +LN+GHL
Sbjct  494   LEFFNGQMPDGLKSFGSALCMMSMSLGNYFSDVIVSAVTRLTTTRGRSGWIPADLNEGHL  553

Query  468   DRFYFLLAALTTADFVVYILCAKWYKYIEFEERNS  364
             D+FYFLLA L  ADF VY++CA  Y   + + R+S
Sbjct  554   DKFYFLLAVLAVADFAVYLVCASRYGSGKVDGRSS  588



>gb|EEC73893.1| hypothetical protein OsI_08696 [Oryza sativa Indica Group]
Length=560

 Score =   676 bits (1745),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 346/574 (60%), Positives = 419/574 (73%), Gaps = 30/574 (5%)
 Frame = -3

Query  2070  ECTLDGTVDHYGRPALRSATGGWFAGVLLLVNQGLATLAFFGVGVNLVLFLTRVMGQDNA  1891
             + T DG++D  G PA+++ TG W + +LLLVN GL T AFFGVGVNLV+FL RV+ QDNA
Sbjct  13    DITEDGSMDRRGNPAVKAKTGNWRSSILLLVNYGLVTCAFFGVGVNLVVFLRRVLHQDNA  72

Query  1890  DAANNVSKWTGTVYLFSLLGAFLSDSYWGRYKTCAIFQLIYVVGLISVSIFSFIFLVKPK  1711
             +AAN++SKWTGTVY+FSL+GAF+SDSYWGRY TCAIFQ+IYV GL+ +S+ S+  LVKP 
Sbjct  73    EAANSISKWTGTVYIFSLIGAFMSDSYWGRYITCAIFQMIYVTGLVILSLASWFLLVKPT  132

Query  1710  GCGDENTPCRSPSRIHIAVYYVSIYLVALGNGGYQPNIATFGSDQFDGDHAHESVSKVAF  1531
             GCG     C +PS   +A++Y+S Y++A GNGGYQP+IATFGSDQFD     E+ SKVAF
Sbjct  133   GCGAAGEHCDAPSSAGVALFYLSTYMIAFGNGGYQPSIATFGSDQFDETDPREARSKVAF  192

Query  1530  FSYFYLALNLGSLFSNTVLVYFEDKGMWTLGFWastvsavlalllflVGTPRYRHFAPKG  1351
             FSYFYLALN+GSLFSNTVLVY+ED+G W +GFW S  +A +AL+LFL+GTP YRHF P G
Sbjct  193   FSYFYLALNVGSLFSNTVLVYYEDEGRWVMGFWVSAAAAAMALVLFLLGTPNYRHFKPTG  252

Query  1350  NPLSRFSQVLVASARKWNVHLPSDGDDHRLYEIQEHDSSTRKILHTEGFKFLDKAAVITT  1171
             NPL+R +QV VA+ RKW   +P     H +   +   +  RKILH++  +FLDKAA +T 
Sbjct  253   NPLTRIAQVFVAAFRKWRAEVPRSELLHEVDGDESQIAGIRKILHSDQIRFLDKAATVTE  312

Query  1170  KESVRDLEERNINPWRLCSVTQVEEVKCILRLLPIWLCTILYSVVFTQMASLFVEQGAAM  991
             ++      E   +PWRLC+VTQVEEVKCIL++LPIWLCTI+YSVVFTQMASLFVEQG  M
Sbjct  313   EDYCT--PENMQDPWRLCTVTQVEEVKCILKMLPIWLCTIVYSVVFTQMASLFVEQGTTM  370

Query  990   RTNIAGFHIPPASMSSFDILSVAAFIFIYRRILDPLIASLKKTRRAQGFTELQRMGVGLi  811
              TNI  FH+P ASMS FDILS                          G TELQRMGVGL+
Sbjct  371   NTNIGSFHVPAASMSVFDILS--------------------------GLTELQRMGVGLV  404

Query  810   iaimamvaagiVEHFRLKYASTDCPRCPSSLSIFWQVPQYVLIGASEVFMYVGQLEFFNG  631
             + + AMV AG+VE  RLK      P  PSSLS+ WQVPQY LIGASEVFMYVGQLEFFNG
Sbjct  405   VGMAAMVVAGVVEVERLK--RVGAPDQPSSLSVLWQVPQYALIGASEVFMYVGQLEFFNG  462

Query  630   QAPEGLKSFASALCMTSISLGNYVSSLLVSIVMRISTTHRMPGWIPGNLNKGHLDRFYFL  451
             QAP+G+KSF S+LCM SISLGNYVS +LVS+V  ++   R PGWIPGNLN GHLDRFYFL
Sbjct  463   QAPDGVKSFGSSLCMASISLGNYVSIMLVSVVTSLTAGDRRPGWIPGNLNSGHLDRFYFL  522

Query  450   LAALTTADFVVYILCAKWYKYIEFEERNSCLKNI  349
             LAAL+  D  VY+ CA WYK I+ +        I
Sbjct  523   LAALSLVDLAVYVACAVWYKGIKLDSNEEKANKI  556



>ref|XP_004296302.1| PREDICTED: putative peptide/nitrate transporter At5g19640-like 
[Fragaria vesca subsp. vesca]
Length=606

 Score =   676 bits (1745),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 372/609 (61%), Positives = 450/609 (74%), Gaps = 21/609 (3%)
 Frame = -3

Query  2133  LNITKMFFIKNERDEEKASREECTLDGTVDHYGRP---ALRSATGGWFAGVLLLVNQGLA  1963
             LN T    +K   D++  ++EE   +       +P   A+R + GGW    LLLVNQGLA
Sbjct  7     LNCTNEPVVK-VTDQDNRTKEESEANELKVTTAKPKASAIRKSRGGWTYASLLLVNQGLA  65

Query  1962  TLAFFGVGVNLVLFLTRVMGQDNADAANNVSKWTGTVYLFSLLGAFLSDSYWGRYKTCAI  1783
             TLAFFGVGVNLVLFLTRV+ Q+NADAAN+VSKWTGTVYL SL+GAFLSDSYWGRY TCA+
Sbjct  66    TLAFFGVGVNLVLFLTRVLDQENADAANSVSKWTGTVYLCSLIGAFLSDSYWGRYLTCAV  125

Query  1782  FQLIYVVGLISVSIFSFIFLVKPKGCGDENTPCRSPSRIHIAVYYVSIYLVALGNGGYQP  1603
             FQLI+V+GL+ +S+ S++FL  P GCGDE   C   S I +A++Y+SIYLVALG GGYQP
Sbjct  126   FQLIFVLGLVLLSLTSWLFLFHPSGCGDEELVCSPTSSIGVAIFYLSIYLVALGYGGYQP  185

Query  1602  NIATFGSDQFDGDHAHESVSKVAFFSYFYLALNLGSLFSNTVLVYFEDKGMWTLGFWast  1423
              IATFGSDQFD     E+ SK AFFSYFY ALNLGSLFSNT+LV++ED G WTLGF  S 
Sbjct  186   TIATFGSDQFDEADHKEAASKAAFFSYFYFALNLGSLFSNTILVFYEDTGRWTLGFVVSL  245

Query  1422  vsavlalllflVGTPRYRHFAPKGNPLSRFSQVLVASARKWNVHLPSDGDDHRLYEIQEH  1243
              SAVLALLLFL+GTP YR+  P GNPL R +QV VA+ARKW+V +PS   D  LYE++  
Sbjct  246   GSAVLALLLFLLGTPGYRYLKPCGNPLPRVAQVFVATARKWDV-VPSISGD--LYEVEGP  302

Query  1242  DSS---TRKILHTEGFKFLDKAAVITTKESVRDLEERNINPWRLCSVTQVEEVKCILRLL  1072
             +S+   +RKI H+    FLDKAA IT      DL   N +PW+LC+VTQVEE KC+L++L
Sbjct  303   ESAIKGSRKIFHSNEIAFLDKAATITN----HDLCGPN-DPWKLCTVTQVEEAKCVLKML  357

Query  1071  PIWLCTILYSVVFTQMASLFVEQGAAMRTNIAGFHIPPASMSSFDILSVAAFIFIYRRIL  892
             PIWLCTI+YSV+FTQMASLFVEQG  M+++I  FH+P ASMS+FDI SV     IYR++L
Sbjct  358   PIWLCTIIYSVIFTQMASLFVEQGDVMKSHIGSFHLPAASMSAFDICSVLICTGIYRQVL  417

Query  891   DPLIASLKKTRRAQGFTELQRMGVGLiiaimamvaagiVEHFRLKYASTDCPRCPSSLSI  712
              PL   L  T   +G TELQRMG+GL+I +++MVAAG  E  RLKY         SSLSI
Sbjct  418   VPLAGKL--TGNPKGLTELQRMGIGLLIGMLSMVAAGATEIARLKYVVRG--EKISSLSI  473

Query  711   FWQVPQYVLIGASEVFMYVGQLEFFNGQAPEGLKSFASALCMTSISLGNYVSSLLVSIVM  532
             FWQVPQYVL+GASEVFMYVGQLEFFNGQAP+G+KSF S+LCM SISLGNYVSSLLV +VM
Sbjct  474   FWQVPQYVLVGASEVFMYVGQLEFFNGQAPDGIKSFGSSLCMASISLGNYVSSLLVIMVM  533

Query  531   RISTTHRMPGWIPGNLNKGHLDRFYFLLAALTTADFVVYILCAKWYKYIEFEERNSCLKN  352
              I+   + PGWIP +LN GH+DRFYFLLA L   DFV+Y+  AKWYK I  ++ +   K 
Sbjct  534   GITARGKNPGWIPDDLNTGHMDRFYFLLAVLAAFDFVIYVYLAKWYKCINLQDSDD--KE  591

Query  351   IGDSKLQED  325
             +   + QED
Sbjct  592   VQIIESQED  600



>ref|XP_004953503.1| PREDICTED: nitrate transporter 1.5-like isoform X2 [Setaria italica]
Length=607

 Score =   676 bits (1745),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 363/591 (61%), Positives = 438/591 (74%), Gaps = 25/591 (4%)
 Frame = -3

Query  2097  RDEEKAS-------REEC---TLDGTVDHYGRPALRSATGGWFAGVLLLVNQGLATLAFF  1948
              DEE A+       +++C   TLDG+VD  GRPA++  +GGW AG L+LVNQGLATLAFF
Sbjct  9     EDEEMAAPTPLPPKQDKCCEYTLDGSVDIKGRPAVKGKSGGWLAGGLILVNQGLATLAFF  68

Query  1947  GVGVNLVLFLTRVMGQDNADAANNVSKWTGTVYLFSLLGAFLSDSYWGRYKTCAIFQLIY  1768
             GV VNLVLFLTRV+GQ N DAANNVSKWTGTVY+FSL+GAFLSDSYWGRYKTCAIFQ I+
Sbjct  69    GVNVNLVLFLTRVLGQSNGDAANNVSKWTGTVYMFSLIGAFLSDSYWGRYKTCAIFQAIF  128

Query  1767  VVGLISVSIFSFIFLVKPKGCGDENTPCRSPSRIHIAVYYVSIYLVALGNGGYQPNIATF  1588
             V+GL  +S+ S ++L++P+GCG E+ PC   S   + ++Y+++Y++A GNGGYQPN+ATF
Sbjct  129   VLGLALLSVSSHLYLIRPEGCGMEHAPCGPHSGKELGIFYIALYMIAFGNGGYQPNVATF  188

Query  1587  GSDQFDGDHAHESVSKVAFFSYFYLALNLGSLFSNTVLVYFEDKGMWTLGFWastvsavl  1408
             GSDQFD +   E+ SKV+FFSYFYLALNLGSLFSNT L Y ED+G W LGFWAST +A  
Sbjct  189   GSDQFDEEDPAEAHSKVSFFSYFYLALNLGSLFSNTFLSYLEDEGRWALGFWASTAAAAA  248

Query  1407  alllflVGTPRYRHFAPKGNPLSRFSQVLVASARKWNVHLPSDGDDHRLYEIQEH-DSST  1231
             ALLLFL GT RYR+F P GNP+ R  QV  A+ R W     +      LYE  E  D+  
Sbjct  249   ALLLFLSGTLRYRYFNPGGNPIGRVCQVAFAACRNWKAG--ASPGVVTLYEGDEKTDAGG  306

Query  1230  RKILHTEGFKFLDKAAVITTKESVRDLEERNINPWRLCSVTQVEEVKCILRLLPIWLCTI  1051
             R++LHT+GF FLD+AA   T      L +R  +PW+LC+VTQVEEVK ILRLLPIWLCTI
Sbjct  307   RRLLHTQGFSFLDRAARADTDSK---LGKR--DPWKLCTVTQVEEVKSILRLLPIWLCTI  361

Query  1050  LYSVVFTQMASLFVEQGAAMR--TNIAGFHIPPASMSSFDILSVAAFIFIYRRILDPLIA  877
             LYSVVFTQMASLFV QGAAMR  T  AGF +PP+SMS+FDIL+VAA IF+YRR + P +A
Sbjct  362   LYSVVFTQMASLFVVQGAAMRRTTPFAGFSVPPSSMSAFDILTVAATIFLYRRAICPFLA  421

Query  876   SLKKTRRAQGFTELQRMGVGLiiaimamvaagiVEHFRLKYASTDCPRCPSSLSIFWQVP  697
              L  T R  G TELQRMG+GL++  +AM  AG VEHFR   A+       S L I WQVP
Sbjct  422   RL--TGRPAGPTELQRMGLGLVVGALAMATAGTVEHFRKAGATA---AMSSDLHIMWQVP  476

Query  696   QYVLIGASEVFMYVGQLEFFNGQAPEGLKSFASALCMTSISLGNYVSSLLVSIVMRISTT  517
             QY LIG SEV MYVGQLEFFN Q P+GLKSF SALCM S+SLGNY S ++VS V R++TT
Sbjct  477   QYSLIGVSEVMMYVGQLEFFNDQMPDGLKSFGSALCMMSMSLGNYFSDVIVSAVTRVTTT  536

Query  516   HRMPGWIPGNLNKGHLDRFYFLLAALTTADFVVYILCAKWYKYIEFEERNS  364
                 GWIP +LN+GHLDRFYFLLA +  ADF VY++CA  Y   + + R+S
Sbjct  537   RGRAGWIPADLNEGHLDRFYFLLAIIAVADFAVYLVCASRYGSGKVDGRSS  587



>ref|XP_004953502.1| PREDICTED: nitrate transporter 1.5-like isoform X1 [Setaria italica]
Length=614

 Score =   676 bits (1745),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 369/607 (61%), Positives = 445/607 (73%), Gaps = 26/607 (4%)
 Frame = -3

Query  2145  MAAFLNITKMFFIKNERDEEKAS-------REEC---TLDGTVDHYGRPALRSATGGWFA  1996
             M+A     KM  I  E DEE A+       +++C   TLDG+VD  GRPA++  +GGW A
Sbjct  1     MSANDGDMKMRVILVE-DEEMAAPTPLPPKQDKCCEYTLDGSVDIKGRPAVKGKSGGWLA  59

Query  1995  GVLLLVNQGLATLAFFGVGVNLVLFLTRVMGQDNADAANNVSKWTGTVYLFSLLGAFLSD  1816
             G L+LVNQGLATLAFFGV VNLVLFLTRV+GQ N DAANNVSKWTGTVY+FSL+GAFLSD
Sbjct  60    GGLILVNQGLATLAFFGVNVNLVLFLTRVLGQSNGDAANNVSKWTGTVYMFSLIGAFLSD  119

Query  1815  SYWGRYKTCAIFQLIYVVGLISVSIFSFIFLVKPKGCGDENTPCRSPSRIHIAVYYVSIY  1636
             SYWGRYKTCAIFQ I+V+GL  +S+ S ++L++P+GCG E+ PC   S   + ++Y+++Y
Sbjct  120   SYWGRYKTCAIFQAIFVLGLALLSVSSHLYLIRPEGCGMEHAPCGPHSGKELGIFYIALY  179

Query  1635  LVALGNGGYQPNIATFGSDQFDGDHAHESVSKVAFFSYFYLALNLGSLFSNTVLVYFEDK  1456
             ++A GNGGYQPN+ATFGSDQFD +   E+ SKV+FFSYFYLALNLGSLFSNT L Y ED+
Sbjct  180   MIAFGNGGYQPNVATFGSDQFDEEDPAEAHSKVSFFSYFYLALNLGSLFSNTFLSYLEDE  239

Query  1455  GMWTLGFWastvsavlalllflVGTPRYRHFAPKGNPLSRFSQVLVASARKWNVHLPSDG  1276
             G W LGFWAST +A  ALLLFL GT RYR+F P GNP+ R  QV  A+ R W     +  
Sbjct  240   GRWALGFWASTAAAAAALLLFLSGTLRYRYFNPGGNPIGRVCQVAFAACRNWKAG--ASP  297

Query  1275  DDHRLYEIQEH-DSSTRKILHTEGFKFLDKAAVITTKESVRDLEERNINPWRLCSVTQVE  1099
                 LYE  E  D+  R++LHT+GF FLD+AA   T      L +R  +PW+LC+VTQVE
Sbjct  298   GVVTLYEGDEKTDAGGRRLLHTQGFSFLDRAARADTDSK---LGKR--DPWKLCTVTQVE  352

Query  1098  EVKCILRLLPIWLCTILYSVVFTQMASLFVEQGAAMR--TNIAGFHIPPASMSSFDILSV  925
             EVK ILRLLPIWLCTILYSVVFTQMASLFV QGAAMR  T  AGF +PP+SMS+FDIL+V
Sbjct  353   EVKSILRLLPIWLCTILYSVVFTQMASLFVVQGAAMRRTTPFAGFSVPPSSMSAFDILTV  412

Query  924   AAFIFIYRRILDPLIASLKKTRRAQGFTELQRMGVGLiiaimamvaagiVEHFRLKYAST  745
             AA IF+YRR + P +A L  T R  G TELQRMG+GL++  +AM  AG VEHFR   A+ 
Sbjct  413   AATIFLYRRAICPFLARL--TGRPAGPTELQRMGLGLVVGALAMATAGTVEHFRKAGATA  470

Query  744   DCPRCPSSLSIFWQVPQYVLIGASEVFMYVGQLEFFNGQAPEGLKSFASALCMTSISLGN  565
                   S L I WQVPQY LIG SEV MYVGQLEFFN Q P+GLKSF SALCM S+SLGN
Sbjct  471   ---AMSSDLHIMWQVPQYSLIGVSEVMMYVGQLEFFNDQMPDGLKSFGSALCMMSMSLGN  527

Query  564   YVSSLLVSIVMRISTTHRMPGWIPGNLNKGHLDRFYFLLAALTTADFVVYILCAKWYKYI  385
             Y S ++VS V R++TT    GWIP +LN+GHLDRFYFLLA +  ADF VY++CA  Y   
Sbjct  528   YFSDVIVSAVTRVTTTRGRAGWIPADLNEGHLDRFYFLLAIIAVADFAVYLVCASRYGSG  587

Query  384   EFEERNS  364
             + + R+S
Sbjct  588   KVDGRSS  594



>ref|XP_009384121.1| PREDICTED: protein NRT1/ PTR FAMILY 7.3-like [Musa acuminata 
subsp. malaccensis]
Length=594

 Score =   674 bits (1740),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 356/589 (60%), Positives = 435/589 (74%), Gaps = 11/589 (2%)
 Frame = -3

Query  2118  MFFIKNERDEEKA--SREECTLDGTVDHYGRPALRSATGGWFAGVLLLVNQGLATLAFFG  1945
             M +++ +    K   ++++  L+ +V+  G+ A    +GGW AG  LLVNQGLATLAFFG
Sbjct  1     MVYLQTDSKVSKMEDAQDKDILESSVEFTGQHAAEGRSGGWLAGNFLLVNQGLATLAFFG  60

Query  1944  VGVNLVLFLTRVMGQDNADAANNVSKWTGTVYLFSLLGAFLSDSYWGRYKTCAIFQLIYV  1765
             V VNLVLFLTRV+ Q NA AANNVSKWTG + +FSL+GAFLSDSYWG YKTC +FQ ++V
Sbjct  61    VNVNLVLFLTRVLQQSNAVAANNVSKWTGALNIFSLVGAFLSDSYWGGYKTCVVFQAVFV  120

Query  1764  VGLISVSIFSFIFLVKPKGCGDENTPCRSPSRIHIAVYYVSIYLVALGNGGYQPNIATFG  1585
              GL  +S+ S +FL+KP GCGD+ TPC S + + + ++Y  IY+VALGNGGYQP +A+FG
Sbjct  121   FGLTVLSLTSHLFLIKPSGCGDQWTPCGSHTNLEVRLFYFVIYMVALGNGGYQPTVASFG  180

Query  1584  SDQFDGDHAHESVSKVAFFSYFYLALNLGSLFSNTVLVYFEDKGMWTLGFWastvsavla  1405
             +DQFD D   E+ SK  FF YFYLALNLGSL SNT L YFED+GMW  GFWASTVSA +A
Sbjct  181   ADQFDEDDPKEAHSKDTFFLYFYLALNLGSLLSNTCLSYFEDRGMWAWGFWASTVSAFVA  240

Query  1404  lllflVGTPRYRHFAPKGNPLSRFSQVLVASARKWNVHLPSDGDDHRLYEIQEHD----S  1237
             LL+F+  TP YRH  P GN LSRF QV+VA++RKW V +P    D  LYE    +     
Sbjct  241   LLIFVGATPTYRHRKPGGNTLSRFCQVVVAASRKWRVGMPPGAAD--LYEEDGKELQVAG  298

Query  1236  STRKILHTEGFKFLDKAAVITTKESVRDLEERNINPWRLCSVTQVEEVKCILRLLPIWLC  1057
               R+ILHTEG  FLD+AAV+ + +     +  +   WRLC++TQVEEVKC+LRLLPIWLC
Sbjct  299   GRRRILHTEGLGFLDRAAVVDSDDFTFQAQSTHRKLWRLCTITQVEEVKCVLRLLPIWLC  358

Query  1056  TILYSVVFTQMASLFVEQGAAMRTNIAGFHIPPASMSSFDILSVAAFIFIYRRILDPLIA  877
             TILYSVVFTQMASLFV QGAAMR  + G  IPP+ MS+FDILSV AFIF Y+R+L PL+ 
Sbjct  359   TILYSVVFTQMASLFVVQGAAMRRTVGGVTIPPSIMSAFDILSVVAFIFFYKRLLQPLVC  418

Query  876   SLKKTRRAQGFTELQRMGVGLiiaimamvaagiVEHFRLKYASTDCPRCPSSLSIFWQVP  697
              ++K     G TELQRMG+GLIIA +AMV+AG+VEHFRLK     C    SSL I WQVP
Sbjct  419   RVRKN--TTGLTELQRMGIGLIIAALAMVSAGVVEHFRLKLRCRGCTD-ASSLHIMWQVP  475

Query  696   QYVLIGASEVFMYVGQLEFFNGQAPEGLKSFASALCMTSISLGNYVSSLLVSIVMRISTT  517
             QYVL+GASEVFMYV QL+FFNGQ P+GLKSF SAL MTSI+ GN+ S  +V+IVM+I+  
Sbjct  476   QYVLVGASEVFMYVSQLQFFNGQTPDGLKSFGSALYMTSIAFGNFFSDFIVTIVMKITGK  535

Query  516   HRMPGWIPGNLNKGHLDRFYFLLAALTTADFVVYILCAKWYKYIEFEER  370
                PGWIP NLN GHLDRFYFLLAAL+ AD V Y++CA  YK I+ E R
Sbjct  536   GGRPGWIPANLNDGHLDRFYFLLAALSCADLVAYVVCAMSYKCIKMEGR  584



>ref|XP_009393946.1| PREDICTED: protein NRT1/ PTR FAMILY 7.3-like isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=527

 Score =   662 bits (1709),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 348/530 (66%), Positives = 420/530 (79%), Gaps = 11/530 (2%)
 Frame = -3

Query  1944  VGVNLVLFLTRVMGQDNADAANNVSKWTGTVYLFSLLGAFLSDSYWGRYKTCAIFQLIYV  1765
             + VNLVLFLTRV+ ++NADAAN+VSKWTGTVY+FSL+GAFLSDSYWGRYKTCA+FQ+I+V
Sbjct  1     MNVNLVLFLTRVLQRNNADAANDVSKWTGTVYIFSLVGAFLSDSYWGRYKTCAVFQVIFV  60

Query  1764  VGLISVSIFSFIFLVKPKGCGDENTPCRSPSRIHIAVYYVSIYLVALGNGGYQPNIATFG  1585
             +GL+ +S+ S +FL+KP GCGD +TPC + S   + ++Y++IY++ALGNGGYQPNIATFG
Sbjct  61    LGLVLLSLSSHLFLIKPSGCGDSHTPCGTHSSFEVKMFYLAIYMIALGNGGYQPNIATFG  120

Query  1584  SDQFDGDHAHESVSKVAFFSYFYLALNLGSLFSNTVLVYFEDKGMWTLGFWastvsavla  1405
              DQFD +   E+ SKV+FFSYFYLALNLGSLFSNT L Y ED GMWTLGFWAS+ SA +A
Sbjct  121   PDQFDEEDPREAHSKVSFFSYFYLALNLGSLFSNTFLSYLEDHGMWTLGFWASSASACVA  180

Query  1404  lllflVGTPRYRHFAPKGNPLSRFSQVLVASARKWNVHLPSDGDDHRLYEIQEHD----S  1237
             L+LFL GTPRYRHF P GNPLSR  Q +VA++RKW V +   G D  LY+  E +    +
Sbjct  181   LVLFLSGTPRYRHFKPCGNPLSRICQAVVAASRKWRVKMQPGGVD--LYDTDEEEFQETN  238

Query  1236  STRKILHTEGFKFLDKAAVITTKESVRDLEERNINPWRLCSVTQVEEVKCILRLLPIWLC  1057
              ++KILHTEGFKFLD+AA +T  +     +    NPWRLC++TQVEEVKC+LRL+PIWLC
Sbjct  239   GSKKILHTEGFKFLDRAAFVTAGDFTLQDQSLRRNPWRLCTITQVEEVKCVLRLIPIWLC  298

Query  1056  TILYSVVFTQMASLFVEQGAAMRTNIAGFHIPPASMSSFDILSVAAFIFIYRRILDPLIA  877
             TILYSVVFTQMASLFV QGAAMRT +  F IPP+SMS+FDIL V  FIF+  R+L PL+ 
Sbjct  299   TILYSVVFTQMASLFVVQGAAMRTTVGAFSIPPSSMSAFDILGVVIFIFLRDRLLHPLVC  358

Query  876   SLKKTRRAQGFTELQRMGVGLiiaimamvaagiVEHFRLKYASTDCPRC---PSSLSIFW  706
              +KK+R   G TELQRMGVGL+IA+MAM+AAG  EHFRLK A   C  C    SSL I W
Sbjct  359   RIKKSR--VGLTELQRMGVGLVIAVMAMIAAGTAEHFRLKQARAPCSGCSGAASSLHILW  416

Query  705   QVPQYVLIGASEVFMYVGQLEFFNGQAPEGLKSFASALCMTSISLGNYVSSLLVSIVMRI  526
             QVPQY LIGASEVFMYVGQLEF+NGQAP GLKSF SAL +TS+S GN+ S L+V+ VM++
Sbjct  417   QVPQYALIGASEVFMYVGQLEFYNGQAPYGLKSFGSALYLTSMSFGNFFSDLIVTAVMKL  476

Query  525   STTHRMPGWIPGNLNKGHLDRFYFLLAALTTADFVVYILCAKWYKYIEFE  376
             +      GWIP NLN GHLDRFYFLLAALT+ADFVV++ CAKWYK  + E
Sbjct  477   TARGGRAGWIPENLNHGHLDRFYFLLAALTSADFVVFVACAKWYKSTKLE  526



>ref|XP_010046691.1| PREDICTED: protein NRT1/ PTR FAMILY 7.1-like [Eucalyptus grandis]
Length=596

 Score =   665 bits (1715),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 360/597 (60%), Positives = 433/597 (73%), Gaps = 21/597 (4%)
 Frame = -3

Query  2103  NERDEEKASREECTLDGTVDHYGRPALRSATGGWFAGVLLLVNQGLATLAFFGVGVNLVL  1924
             N R+     R+E   + + +    P    +TGGW     LLVNQGLATLAFFGVGVNLVL
Sbjct  17    NFRNGAVKGRDE---NASTEQAKAP---KSTGGWKWASFLLVNQGLATLAFFGVGVNLVL  70

Query  1923  FLTRVMGQDNADAANNVSKWTGTVYLFSLLGAFLSDSYWGRYKTCAIFQLIYVVGLISVS  1744
             FLTRV+G DNA AAN+VSKWTGTVYL SL+GAFLSDSYWGRY TCA+FQLI+V+GL  +S
Sbjct  71    FLTRVLGHDNATAANSVSKWTGTVYLCSLIGAFLSDSYWGRYLTCAVFQLIFVLGLTLLS  130

Query  1743  IFSFIFLVKPKGCGDENTPCRSPSRIHIAVYYVSIYLVALGNGGYQPNIATFGSDQFDGD  1564
             + S ++L+KP+GCG+E+  C +PS   +A++Y+SIYL+A G GGYQP IATFG+DQFD  
Sbjct  131   MTSSVYLIKPEGCGNEDMMCMAPSSAGVALFYLSIYLIAFGYGGYQPTIATFGADQFDEK  190

Query  1563  HAHESVSKVAFFSYFYLALNLGSLFSNTVLVYFEDKGMWTLGFWastvsavlalllflVG  1384
             +  E  SK+AFFSYFY ALN GSL SNT+LV +ED G WTLGF  ST SAV+AL+LF +G
Sbjct  191   NPKEIKSKLAFFSYFYFALNAGSLLSNTILVCYEDSGQWTLGFLVSTASAVIALVLFFIG  250

Query  1383  TPRYRHFAPKGNPLSRFSQVLVASARKWNVHLPSDGDDHRLYEIQEHDSS---TRKILHT  1213
             T  YR   P GNPL R +QV +A+ RK NV    +GD   LYE++  +S+   +RKILH+
Sbjct  251   TRGYRQVKPCGNPLPRVAQVFLAATRKMNVLPTKEGD---LYELEGSESAIKGSRKILHS  307

Query  1212  EGFKFLDKAAVITTKESVRDLEERNINPWRLCSVTQVEEVKCILRLLPIWLCTILYSVVF  1033
               F FLDKAA IT      D    + NPWRLC+VTQVEE KC+L++LP+WLCTI+YSVVF
Sbjct  308   CEFAFLDKAATIT-----EDDLCHSRNPWRLCTVTQVEEAKCVLKMLPVWLCTIMYSVVF  362

Query  1032  TQMASLFVEQGAAMRTNIAGFHIPPASMSSFDILSVAAFIFIYRRILDPLIASLKKTRRA  853
             TQMASLFVEQG  MR+N   FH+P ASMS+FDI SV     IYRRI+ PL   L  +   
Sbjct  363   TQMASLFVEQGDVMRSNFGKFHVPAASMSAFDICSVLICTGIYRRIIVPLAGRL--SSNP  420

Query  852   QGFTELQRMGVGLiiaimamvaagiVEHFRLKYASTDCPRCPSSLSIFWQVPQYVLIGAS  673
             QG TELQRMGVGLI  ++AMVAAG  E  RLKY      +  SSLSIFWQ PQYVL+G S
Sbjct  421   QGLTELQRMGVGLIFGMLAMVAAGATEIQRLKYVEPG--KKSSSLSIFWQTPQYVLVGVS  478

Query  672   EVFMYVGQLEFFNGQAPEGLKSFASALCMTSISLGNYVSSLLVSIVMRISTTHRMPGWIP  493
             EVFMYVGQLEFFNGQAP+G+KSF S+LCM SISLGN+VSSLLV +V  I+T     GWIP
Sbjct  479   EVFMYVGQLEFFNGQAPDGIKSFGSSLCMASISLGNFVSSLLVIMVTAITTRGNEQGWIP  538

Query  492   GNLNKGHLDRFYFLLAALTTADFVVYILCAKWYKYIEFEERNSCLKNIGDSKLQEDR  322
              +LNKGH+DRFYFLLA LT  DF++Y+ CAKWYK I  E  N     IG  +   D+
Sbjct  539   QDLNKGHIDRFYFLLAVLTAFDFMIYLFCAKWYKCINLEADNKTAVKIGPEEQVVDQ  595



>gb|KCW87117.1| hypothetical protein EUGRSUZ_B03643 [Eucalyptus grandis]
Length=584

 Score =   664 bits (1712),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 359/597 (60%), Positives = 432/597 (72%), Gaps = 21/597 (4%)
 Frame = -3

Query  2103  NERDEEKASREECTLDGTVDHYGRPALRSATGGWFAGVLLLVNQGLATLAFFGVGVNLVL  1924
             N R+     R+E   + + +    P    +TGGW     LLVNQGLATLAFFGVGVNLVL
Sbjct  5     NFRNGAVKGRDE---NASTEQAKAP---KSTGGWKWASFLLVNQGLATLAFFGVGVNLVL  58

Query  1923  FLTRVMGQDNADAANNVSKWTGTVYLFSLLGAFLSDSYWGRYKTCAIFQLIYVVGLISVS  1744
             FLTRV+G DNA AAN+VSKWTGTVYL SL+GAFLSDSYWGRY TCA+FQLI+V+GL  +S
Sbjct  59    FLTRVLGHDNATAANSVSKWTGTVYLCSLIGAFLSDSYWGRYLTCAVFQLIFVLGLTLLS  118

Query  1743  IFSFIFLVKPKGCGDENTPCRSPSRIHIAVYYVSIYLVALGNGGYQPNIATFGSDQFDGD  1564
             + S ++L+KP+GCG+E+  C +PS   +A++Y+SIYL+A G GGYQP IATFG+DQFD  
Sbjct  119   MTSSVYLIKPEGCGNEDMMCMAPSSAGVALFYLSIYLIAFGYGGYQPTIATFGADQFDEK  178

Query  1563  HAHESVSKVAFFSYFYLALNLGSLFSNTVLVYFEDKGMWTLGFWastvsavlalllflVG  1384
             +  E  SK+AFFSYFY ALN GSL SNT+LV +ED G WTLGF  ST SAV+AL+LF +G
Sbjct  179   NPKEIKSKLAFFSYFYFALNAGSLLSNTILVCYEDSGQWTLGFLVSTASAVIALVLFFIG  238

Query  1383  TPRYRHFAPKGNPLSRFSQVLVASARKWNVHLPSDGDDHRLYEIQEHDSS---TRKILHT  1213
             T  YR   P GNPL R +QV +A+ RK NV    +GD   LYE++  +S+   +RKILH+
Sbjct  239   TRGYRQVKPCGNPLPRVAQVFLAATRKMNVLPTKEGD---LYELEGSESAIKGSRKILHS  295

Query  1212  EGFKFLDKAAVITTKESVRDLEERNINPWRLCSVTQVEEVKCILRLLPIWLCTILYSVVF  1033
               F FLDKAA IT  +          NPWRLC+VTQVEE KC+L++LP+WLCTI+YSVVF
Sbjct  296   CEFAFLDKAATITEDDLCHSR-----NPWRLCTVTQVEEAKCVLKMLPVWLCTIMYSVVF  350

Query  1032  TQMASLFVEQGAAMRTNIAGFHIPPASMSSFDILSVAAFIFIYRRILDPLIASLKKTRRA  853
             TQMASLFVEQG  MR+N   FH+P ASMS+FDI SV     IYRRI+ PL   L  +   
Sbjct  351   TQMASLFVEQGDVMRSNFGKFHVPAASMSAFDICSVLICTGIYRRIIVPLAGRL--SSNP  408

Query  852   QGFTELQRMGVGLiiaimamvaagiVEHFRLKYASTDCPRCPSSLSIFWQVPQYVLIGAS  673
             QG TELQRMGVGLI  ++AMVAAG  E  RLKY      +  SSLSIFWQ PQYVL+G S
Sbjct  409   QGLTELQRMGVGLIFGMLAMVAAGATEIQRLKYVEPG--KKSSSLSIFWQTPQYVLVGVS  466

Query  672   EVFMYVGQLEFFNGQAPEGLKSFASALCMTSISLGNYVSSLLVSIVMRISTTHRMPGWIP  493
             EVFMYVGQLEFFNGQAP+G+KSF S+LCM SISLGN+VSSLLV +V  I+T     GWIP
Sbjct  467   EVFMYVGQLEFFNGQAPDGIKSFGSSLCMASISLGNFVSSLLVIMVTAITTRGNEQGWIP  526

Query  492   GNLNKGHLDRFYFLLAALTTADFVVYILCAKWYKYIEFEERNSCLKNIGDSKLQEDR  322
              +LNKGH+DRFYFLLA LT  DF++Y+ CAKWYK I  E  N     IG  +   D+
Sbjct  527   QDLNKGHIDRFYFLLAVLTAFDFMIYLFCAKWYKCINLEADNKTAVKIGPEEQVVDQ  583



>ref|XP_006648949.1| PREDICTED: nitrate transporter 1.5-like [Oryza brachyantha]
Length=635

 Score =   663 bits (1711),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 353/586 (60%), Positives = 433/586 (74%), Gaps = 14/586 (2%)
 Frame = -3

Query  2133  LNITKMFFIKNERDEEKASREEC---TLDGTVDHYGRPALRSATGGWFAGVLLLVNQGLA  1963
             +N   +    +E +   A ++EC   TLDG+VD  G PA++  +GGW AG L+LVNQGLA
Sbjct  34    VNTRVIVMEGDESETSNAPKDECCDYTLDGSVDIKGSPAVKGKSGGWLAGGLILVNQGLA  93

Query  1962  TLAFFGVGVNLVLFLTRVMGQDNADAANNVSKWTGTVYLFSLLGAFLSDSYWGRYKTCAI  1783
             TLAFFGV VNLVLFLTRV+ Q N DAANNVSKWTGTVY+FSL+GAFLSDSYWGRYKTCAI
Sbjct  94    TLAFFGVNVNLVLFLTRVLKQSNGDAANNVSKWTGTVYMFSLIGAFLSDSYWGRYKTCAI  153

Query  1782  FQLIYVVGLISVSIFSFIFLVKPKGCGDENTPCRSPSRIHIAVYYVSIYLVALGNGGYQP  1603
             FQ I+V+GL  +S+ S ++L++P GCG E+ PC   S   + ++Y+++Y++A GNGGYQP
Sbjct  154   FQAIFVLGLALLSLSSRLYLIRPVGCGTEHAPCEPHSGAELGIFYIALYMIAFGNGGYQP  213

Query  1602  NIATFGSDQFDGDHAHESVSKVAFFSYFYLALNLGSLFSNTVLVYFEDKGMWTLGFWast  1423
             N+ATFG+DQFDG+   E+ SKV+FFSYFYLALNLGSLFSNT L + ED+G W LGFW ST
Sbjct  214   NVATFGADQFDGEDPAEAHSKVSFFSYFYLALNLGSLFSNTFLSFLEDEGNWALGFWLST  273

Query  1422  vsavlalllflVGTPRYRHFAPKGNPLSRFSQVLVASARKWNVHLPSDGDDHRLYEIQEH  1243
              +A  ALLLFL GT RYR+  P GNP+ R  QV  A+ R     +   G+   LYE  E 
Sbjct  274   AAAATALLLFLSGTLRYRYIRPSGNPVGRICQVAFAACRNRKAGVSPGGES--LYESDEK  331

Query  1242  -DSSTRKILHTEGFKFLDKAAVITTKESVRDLEERNINPWRLCSVTQVEEVKCILRLLPI  1066
              DS  RK++HTEG++FLD+AA++     +    +   +PWRLC+VTQVEEVK ILRLLPI
Sbjct  332   ADSGGRKLMHTEGYRFLDRAALVGANPKLATCTQPR-DPWRLCTVTQVEEVKSILRLLPI  390

Query  1065  WLCTILYSVVFTQMASLFVEQGAAMR--TNIAGFHIPPASMSSFDILSVAAFIFIYRRIL  892
             WLCTILYSVVFTQMASLFV QGAAMR  T   GF +PP+SMS+FDIL+VA  IF+YRR +
Sbjct  391   WLCTILYSVVFTQMASLFVVQGAAMRRTTRFPGFSVPPSSMSAFDILTVATTIFLYRRAV  450

Query  891   DPLIASLKKTRRAQGFTELQRMGVGLiiaimamvaagiVEHFRLKYASTDCPRCPSSLSI  712
              PL + L  T R  G TELQRMG+GL++  MAM  AG VEHFR   A+T      S L I
Sbjct  451   CPLASRL--TGRRTGPTELQRMGLGLVLGAMAMATAGTVEHFRKASATT---AMSSDLHI  505

Query  711   FWQVPQYVLIGASEVFMYVGQLEFFNGQAPEGLKSFASALCMTSISLGNYVSSLLVSIVM  532
              WQVPQY LIG SEV MYVGQLEFFNG+ P+GLKSFASALCM S+SLGNY S ++VS V 
Sbjct  506   MWQVPQYALIGVSEVMMYVGQLEFFNGEMPDGLKSFASALCMMSMSLGNYFSDVIVSAVT  565

Query  531   RISTTHRMPGWIPGNLNKGHLDRFYFLLAALTTADFVVYILCAKWY  394
             + +     PGWIP +LN+GHLD+F+FLLA L  ADF VY++CA+ Y
Sbjct  566   KATAVRGRPGWIPTDLNEGHLDKFFFLLAVLAVADFAVYLVCARRY  611



>ref|XP_011037917.1| PREDICTED: protein NRT1/ PTR FAMILY 7.1-like [Populus euphratica]
 ref|XP_011037918.1| PREDICTED: protein NRT1/ PTR FAMILY 7.1-like [Populus euphratica]
Length=606

 Score =   660 bits (1704),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 355/583 (61%), Positives = 431/583 (74%), Gaps = 29/583 (5%)
 Frame = -3

Query  2109  IKNERDEEKASREECTLDGTVDHYGRPALR-SATGGWFAGVLLLVNQGLATLAFFGVGVN  1933
             I+ E ++E A+R             +P+L    TGGW A  +LL NQ LATLAFFGVGVN
Sbjct  32    IRTEEEQEIANR-------------KPSLIWKRTGGWTAASILLANQCLATLAFFGVGVN  78

Query  1932  LVLFLTRVMGQDNADAANNVSKWTGTVYLFSLLGAFLSDSYWGRYKTCAIFQLIYVVGLI  1753
             LVLFLTRV+GQ NADAAN+VSKWTGTVYL SL+GAFLSDSYWGRY TCAIFQLI+V GL+
Sbjct  79    LVLFLTRVLGQSNADAANSVSKWTGTVYLCSLVGAFLSDSYWGRYLTCAIFQLIFVSGLV  138

Query  1752  SVSIFSFIFLVKPKGCGDENTPCRSPSRIHIAVYYVSIYLVALGNGGYQPNIATFGSDQF  1573
              VSI S+ FL+KP GCGD    C   + +   V+Y++IYLVA G GG+QP+IATFG+DQF
Sbjct  139   LVSISSWFFLIKPDGCGDGKLTCVPATSMGQVVFYLAIYLVAFGYGGHQPSIATFGADQF  198

Query  1572  DGDHAHESVSKVAFFSYFYLALNLGSLFSNTVLVYFEDKGMWTLGFWastvsavlalllf  1393
             D     E  SK AFF YFY ALN GSLFSNT+LVYFED G WTLGF  S  SAV+AL+ F
Sbjct  199   DESKPKERNSKAAFFCYFYFALNFGSLFSNTLLVYFEDHGRWTLGFLLSLGSAVIALVSF  258

Query  1392  lVGTPRYRHFAPKGNPLSRFSQVLVASARKWNVHLPSDGDDHRLYEIQEHDSS---TRKI  1222
             L GTP Y++  P GNPL R +QV VA+ARKW+V +P   D+  LYE++  +S+   +RKI
Sbjct  259   LFGTPGYKYVKPCGNPLPRVAQVFVAAARKWDV-IPVKADE--LYELEGPESAIKGSRKI  315

Query  1221  LHTEGFKFLDKAAVITTKESVRDLEERNINPWRLCSVTQVEEVKCILRLLPIWLCTILYS  1042
              H+E F+FLDKAA +T      DL  +  NPWRLC++TQVEE KC+L++LPIWLCTI+YS
Sbjct  316   FHSEEFEFLDKAATMTED----DLSHQK-NPWRLCTITQVEEAKCVLKMLPIWLCTIIYS  370

Query  1041  VVFTQMASLFVEQGAAMRTNIAGFHIPPASMSSFDILSVAAFIFIYRRILDPLIASLKKT  862
             VVFTQMASLFVEQG  M + I  FH+P ASMS+FDI SV     IYR+IL PL   L  +
Sbjct  371   VVFTQMASLFVEQGDVMNSYIGKFHLPAASMSAFDICSVLVCTGIYRQILVPLAGRL--S  428

Query  861   RRAQGFTELQRMGVGLiiaimamvaagiVEHFRLKYASTDCPRCPSSLSIFWQVPQYVLI  682
                +G TELQRMG+GL+I ++AM+AAG  E  RLK          SSLSIFWQ+PQYVL+
Sbjct  429   GNPKGLTELQRMGIGLVIGMLAMLAAGATEIERLKNVIEG--HKVSSLSIFWQIPQYVLV  486

Query  681   GASEVFMYVGQLEFFNGQAPEGLKSFASALCMTSISLGNYVSSLLVSIVMRISTTHRMPG  502
             GASEVFMY+GQLEFFNGQAP+G+KSF S+LCM SISLGNY SS+LV++VM+I+T    PG
Sbjct  487   GASEVFMYIGQLEFFNGQAPDGIKSFGSSLCMASISLGNYASSMLVNMVMKITTKGDKPG  546

Query  501   WIPGNLNKGHLDRFYFLLAALTTADFVVYILCAKWYKYIEFEE  373
             WIP +LN GH+DRFYFL+A LT  DFV+Y+ CAKWY  I  ++
Sbjct  547   WIPDDLNTGHMDRFYFLIAVLTAFDFVIYLFCAKWYTPINIDD  589



>ref|XP_006850009.1| hypothetical protein AMTR_s00022p00178680 [Amborella trichopoda]
 gb|ERN11590.1| hypothetical protein AMTR_s00022p00178680 [Amborella trichopoda]
Length=597

 Score =   660 bits (1702),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 357/572 (62%), Positives = 437/572 (76%), Gaps = 17/572 (3%)
 Frame = -3

Query  2094  DEEKASREECTLDGTVDHYGRPALRSATGGWFAGVLLLVNQGLATLAFFGVGVNLVLFLT  1915
             +E      E T DG+VD  GR A +  TGG  +G+L+L NQGLATLAFFGVGVNLVLFLT
Sbjct  21    NEGNIMEVEYTKDGSVDRSGRSATKRYTGGLVSGILILFNQGLATLAFFGVGVNLVLFLT  80

Query  1914  RVMGQDNADAANNVSKWTGTVYLFSLLGAFLSDSYWGRYKTCAIFQLIYVVGLISVSIFS  1735
             RV+ Q NA+AANNVSKWTGTVYLFSL+GAFLSDSYWGRYKTC IFQ+I+V GL+ +S+ S
Sbjct  81    RVLQQSNAEAANNVSKWTGTVYLFSLVGAFLSDSYWGRYKTCTIFQIIFVAGLVLLSLTS  140

Query  1734  FIFLVKPKGCGDENTPCRSPSRIHIAVYYVSIYLVALGNGGYQPNIATFGSDQFDGDHAH  1555
              + L+ P GCGD  TPCR+PS +  A++Y+SIYL+ALGNGGYQP IATFG+DQFDG+ + 
Sbjct  141   SMLLITPAGCGDHFTPCRTPSTLGEALFYLSIYLIALGNGGYQPTIATFGADQFDGEDSR  200

Query  1554  ESVSKVAFFSYFYLALNLGSLFSNTVLVYFEDKGMWTLGFWastvsavlalllflVGTPR  1375
             E  SK AFFSYFYLALNLGSLFSNT+LVYFED GMW +GFW S+ SA+LAL+LFL GT R
Sbjct  201   ERHSKKAFFSYFYLALNLGSLFSNTILVYFEDMGMWNMGFWVSSSSALLALVLFLAGTKR  260

Query  1374  YRHFAPKGNPLSRFSQVLVASARKWNVHLPSDGDDHRLYEIQEHDS--STRKILHTEGFK  1201
             YRHF P GNPL R +QVLVA+ RKW V  P++G+D  LYE+   +S   ++KILH++ ++
Sbjct  261   YRHFKPSGNPLPRVAQVLVAAVRKWEVAAPTNGED--LYELDGKESIIGSKKILHSDQYR  318

Query  1200  FLDKAAVITTKESVRDLEERNINPWRLCSVTQVEEVKCILRLLPIWLCTILYSVVFTQMA  1021
             FLDKAA IT  +       ++ +PW LC+VTQVEEVK +LRLLPIWLCTI+YSV FTQMA
Sbjct  319   FLDKAATITEADG-HFHSAKHPDPWHLCTVTQVEEVKSVLRLLPIWLCTIMYSVAFTQMA  377

Query  1020  SLFVEQGAAMRTNIAGFHIPPASMSSFDILSVAAFIFIYRRILDPLIASLKKTRRAQGFT  841
             SLFVEQG  M T    F IP ASMS+FDI+SVA  I +YRR+L PL +        +G +
Sbjct  378   SLFVEQGDKMSTG-THFRIPAASMSAFDIISVAFHILLYRRVLTPLFSR----ENYRGLS  432

Query  840   ELQRMGVGLiiaimamvaagiVEHFRLKYASTDCPRCPSSLSIFWQVPQYVLIGASEVFM  661
             EL RMG+GL +A +AM+AAG+VE  RL        R P S SIFWQVPQY ++GASEVFM
Sbjct  433   ELVRMGIGLALAALAMIAAGLVEWCRLT-------RVPQSTSIFWQVPQYCIVGASEVFM  485

Query  660   YVGQLEFFNGQAPEGLKSFASALCMTSISLGNYVSSLLVSIVMRISTTHRMPGWIPGNLN  481
             YVGQLEFF+ QAP GLKSF SALCM SIS GNY+SS+LV++V +I+     PGWI   L+
Sbjct  486   YVGQLEFFSRQAPAGLKSFGSALCMASISFGNYMSSILVAVVAKITGGRNRPGWIAEELD  545

Query  480   KGHLDRFYFLLAALTTADFVVYILCAKWYKYI  385
              G LDRF+FL+AA+ TAD V+Y++ A+ YKY+
Sbjct  546   DGRLDRFFFLVAAMVTADLVLYVVLARRYKYM  577



>ref|XP_007014834.1| Major facilitator superfamily protein [Theobroma cacao]
 gb|EOY32453.1| Major facilitator superfamily protein [Theobroma cacao]
Length=654

 Score =   661 bits (1706),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 363/611 (59%), Positives = 449/611 (73%), Gaps = 25/611 (4%)
 Frame = -3

Query  2178  RFSLLSR*HTTMAAFLNITKMFFIKNERDEEKASREECTLDGTVDHYGRP-------ALR  2020
             R SLL     +MA+F +  ++    NE  E  +SR+   ++G+ +  G+          +
Sbjct  40    RSSLLPN-KLSMASFDSSNEIELKANE--EVISSRQVEAVNGSENTDGKKLNTKSSLIKK  96

Query  2019  SATGGWFAGVLLLVNQGLATLAFFGVGVNLVLFLTRVMGQDNADAANNVSKWTGTVYLFS  1840
               +GGW    LLLVNQGLATLAFFGVGVNLVLFLTRV+ QDNADAANNVSKWTGTVYLFS
Sbjct  97    QPSGGWTYASLLLVNQGLATLAFFGVGVNLVLFLTRVLEQDNADAANNVSKWTGTVYLFS  156

Query  1839  LLGAFLSDSYWGRYKTCAIFQLIYVVGLISVSIFSFIFLVKPKGCGDENTPCRSPSRIHI  1660
             L+GAFLSDSYWGRY TCA+FQL+ V+GL  +SI S++FL+ P GCGD    C   S + I
Sbjct  157   LIGAFLSDSYWGRYLTCAVFQLVLVLGLGLLSIASWLFLINPAGCGDGVKVCMPSSSVGI  216

Query  1659  AVYYVSIYLVALGNGGYQPNIATFGSDQFDGDHAHESVSKVAFFSYFYLALNLGSLFSNT  1480
             A++Y+SIYL+A G GG+QP IATFG+DQFD  H     SK AFF YFY ALN GSLFSNT
Sbjct  217   AIFYLSIYLIAFGYGGHQPTIATFGADQFDDSHPKAVESKAAFFCYFYFALNTGSLFSNT  276

Query  1479  VLVYFEDKGMWTLGFWastvsavlalllflVGTPRYRHFAPKGNPLSRFSQVLVASARKW  1300
             +LVY+ED G WTLGF  S  SA+LALLL+++GTPRYR+    GNPL R  QV +A+ RKW
Sbjct  277   ILVYYEDSGKWTLGFLVSLGSAILALLLYMLGTPRYRYLKAYGNPLPRVGQVFIAAYRKW  336

Query  1299  NVHLPSDGDDHRLYEIQEHDSS---TRKILHTEGFKFLDKAAVITTKESVRDLEERNINP  1129
             +V +P+D +   LYE++  +S+   +RKILH++ F+FLDKAA +T      DL   N NP
Sbjct  337   DV-VPADAN--ALYEVEGTESAIKGSRKILHSDDFRFLDKAATVTQ----NDLWGPN-NP  388

Query  1128  WRLCSVTQVEEVKCILRLLPIWLCTILYSVVFTQMASLFVEQGAAMRTNIAGFHIPPASM  949
             WRLC+VTQVEE KC+L+LLPIWLCTI+YSV+FTQMASLFVEQG  M      FH+P ASM
Sbjct  389   WRLCTVTQVEEAKCVLKLLPIWLCTIIYSVIFTQMASLFVEQGDVMTAKFGNFHLPAASM  448

Query  948   SSFDILSVAAFIFIYRRILDPLIASLKKTRRAQGFTELQRMGVGLiiaimamvaagiVEH  769
             S+FDI SV     IYR IL PL   L  +   +G +ELQRMG+GLII ++AM+AAG+ E 
Sbjct  449   SAFDICSVLICTGIYRHILVPLAGKL--SGNPKGLSELQRMGIGLIIGMLAMIAAGVTEI  506

Query  768   FRLKYASTDCPRCPSSLSIFWQVPQYVLIGASEVFMYVGQLEFFNGQAPEGLKSFASALC  589
              RLK+ +    R  SSL+IFWQ+PQYVL+G+SEVFMY+GQLEFFNGQAP+G+KSF S+LC
Sbjct  507   QRLKFVTPGEKR--SSLNIFWQIPQYVLVGSSEVFMYIGQLEFFNGQAPDGIKSFGSSLC  564

Query  588   MTSISLGNYVSSLLVSIVMRISTTHRMPGWIPGNLNKGHLDRFYFLLAALTTADFVVYIL  409
             M SISLGNYVSSLLV++VM I+     PGWIP +LN GH+DRFYFL+A LT  DFV+Y+ 
Sbjct  565   MASISLGNYVSSLLVNMVMGITARGDSPGWIPADLNAGHMDRFYFLIAGLTAIDFVIYVF  624

Query  408   CAKWYKYIEFE  376
             CAKWYK I  +
Sbjct  625   CAKWYKCINLD  635



>gb|AFK36303.1| unknown [Lotus japonicus]
Length=519

 Score =   656 bits (1692),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 351/502 (70%), Positives = 412/502 (82%), Gaps = 19/502 (4%)
 Frame = -3

Query  2085  KASREECTLDGTVDHYGRPALRSATGGWFAGVLLLVNQGLATLAFFGVGVNLVLFLTRVM  1906
             K   EE TLDG+VD +GRPA+R+ +G W AG ++L+NQGLATLAFFGVGVNLVLFLTRV+
Sbjct  13    KEEAEEVTLDGSVDWHGRPAIRAKSGRWVAGTIILLNQGLATLAFFGVGVNLVLFLTRVL  72

Query  1905  GQDNADAANNVSKWTGTVYLFSLLGAFLSDSYWGRYKTCAIFQLIYVVGLISVSIFSFIF  1726
             GQDNADAANNVSKWTGTVYLFSL+GAFLSDSYWGRYKTCAIFQ I+V+GL+ +S+ S++ 
Sbjct  73    GQDNADAANNVSKWTGTVYLFSLVGAFLSDSYWGRYKTCAIFQGIFVLGLVFLSLSSYLS  132

Query  1725  LVKPKGCGDENTPCRSPSRIHIAVYYVSIYLVALGNGGYQPNIATFGSDQFDGDHAHESV  1546
             L++PKGCG E   C   S + + ++Y+SIYL+ALGNGGYQPNIATFG+DQFD +H+ E  
Sbjct  133   LLRPKGCGSELLHCGKHSSLEMGMFYLSIYLIALGNGGYQPNIATFGADQFDEEHSKEGY  192

Query  1545  SKVAFFSYFYLALNLGSLFSNTVLVYFEDKGMWTLGFWastvsavlalllflVGTPRYRH  1366
             SKVAFFSYFYLALNLGSLFSNT+L YFED+G+W LGFW S  SA  AL+LFLVGTPRYRH
Sbjct  193   SKVAFFSYFYLALNLGSLFSNTILGYFEDEGIWALGFWVSAGSAFAALVLFLVGTPRYRH  252

Query  1365  FAPKGNPLSRFSQVLVASARKWNVHLPSDGDDHRLYEIQEHDSST-----RKILHTEGFK  1201
             F P GNPLSRF QVLVA+ RK  V + S+G+D  LY + E +SST     + ILHT GFK
Sbjct  253   FKPCGNPLSRFCQVLVAAWRKLGVQMTSNGED--LYVVDEEESSTNSNNRKIILHTHGFK  310

Query  1200  FLDKAAVITTKESVRDLEERN---INPWRLCSVTQVEEVKCILRLLPIWLCTILYSVVFT  1030
             FLD+AA I++    RDL+++     NPWRLC +TQVEEVKCILRLLPIWLCTI+YSVVFT
Sbjct  311   FLDRAAYISS----RDLDDKKGGFYNPWRLCPITQVEEVKCILRLLPIWLCTIIYSVVFT  366

Query  1029  QMASLFVEQGAAMRTNIAGFHIPPASMSSFDILSVAAFIFIYRRILDPLIASLKKTRRAQ  850
             QMASLFVEQGAAM+T I  F IPPASMSSFDILSVA FIF YRR++DPL+  LKKT +++
Sbjct  367   QMASLFVEQGAAMKTTIYHFRIPPASMSSFDILSVAVFIFFYRRVIDPLVGKLKKT-KSK  425

Query  849   GFTELQRMGVGLiiaimamvaagiVEHFRLKYASTDCPRCPSSLSIFWQVPQYVLIGASE  670
             G TELQRMG+GL+IA+MAMV+AGIVE +RLKYA        SSLSIFWQVPQY L+GASE
Sbjct  426   GLTELQRMGIGLVIAVMAMVSAGIVECYRLKYAK----HGTSSLSIFWQVPQYALVGASE  481

Query  669   VFMYVGQLEFFNGQAPEGLKSF  604
             VFMYVGQLEFFN Q PE +K  
Sbjct  482   VFMYVGQLEFFNAQTPERVKEL  503



>ref|XP_006603076.1| PREDICTED: putative peptide/nitrate transporter At5g19640-like 
[Glycine max]
Length=592

 Score =   659 bits (1699),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 348/601 (58%), Positives = 432/601 (72%), Gaps = 23/601 (4%)
 Frame = -3

Query  2103  NERDEEKASREECTLDGTVDHYGRPALRSATGGWFAGVLLLVNQGLATLAFFGVGVNLVL  1924
             N  + E   ++    +G+       + +   GGW   ++LL NQ LATLAFFGVGVNLVL
Sbjct  10    NSVNVEATEKKVTGGNGSYTEQSDTSYKKIKGGWKTAIILLANQALATLAFFGVGVNLVL  69

Query  1923  FLTRVMGQDNADAANNVSKWTGTVYLFSLLGAFLSDSYWGRYKTCAIFQLIYVVGLISVS  1744
             FLTRV+ QD+A+AANNVSKWTGTVY+FSL+GAFLSDSYWGRY TCAIFQ I+VVGL  +S
Sbjct  70    FLTRVLRQDSAEAANNVSKWTGTVYIFSLIGAFLSDSYWGRYLTCAIFQFIFVVGLGMLS  129

Query  1743  IFSFIFLVKPKGCGDENTPCRSPSRIHIAVYYVSIYLVALGNGGYQPNIATFGSDQFDGD  1564
             + S+ FL+KP GCG+E T C  PS + + ++Y+SIYLVA G GG+QP +ATFG+DQFD  
Sbjct  130   LSSWRFLIKPVGCGNEETTCLEPSSVGVGIFYLSIYLVAFGYGGHQPTLATFGADQFDEK  189

Query  1563  HAHESVSKVAFFSYFYLALNLGSLFSNTVLVYFEDKGMWTLGFWastvsavlalllflVG  1384
             +  +  ++ AFFSYFY ALN+GSLFSNT+LVY+ED GMWT+GF  S  SAV+AL+ +L G
Sbjct  190   NEKQKNAREAFFSYFYFALNVGSLFSNTILVYYEDSGMWTMGFLVSLASAVIALVSYLAG  249

Query  1383  TPRYRHFAPKGNPLSRFSQVLVASARKWNVHLPSDGDDHRLYEIQEHDSS---TRKILHT  1213
               +YR+    GNP+ R  QV VA+ RKW V       +H+LYE+   +S+   +RKI H+
Sbjct  250   YRKYRYVKGYGNPVIRVVQVFVATVRKWKV---GPAKEHQLYEVDGPESAIKGSRKIHHS  306

Query  1212  EGFKFLDKAAVITTKESVRDLEERNINPWRLCSVTQVEEVKCILRLLPIWLCTILYSVVF  1033
               F+F+DKAA IT K++V +L+    N WRLC+VTQVEE KC+LR+LP+WLCTI+YSVVF
Sbjct  307   NDFRFMDKAATITEKDAV-NLK----NHWRLCTVTQVEEAKCVLRMLPVWLCTIIYSVVF  361

Query  1032  TQMASLFVEQGAAMRTNIAGFHIPPASMSSFDILSVAAFIFIYRRILDPLIASLKKTRRA  853
             TQMASLFVEQG  M   I  FH+P ASMS FDI SV     IYR+IL PL        R 
Sbjct  362   TQMASLFVEQGDVMNNKIGNFHLPAASMSVFDICSVLLCTGIYRQILVPLAGRFSGNPR-  420

Query  852   QGFTELQRMGVGLiiaimamvaagiVEHFRLKYASTDCPRCPSSLSIFWQVPQYVLIGAS  673
              G TELQRMGVGLII ++A++AAG  E  RLK+ +       SSLSIFWQ+PQYVL+GAS
Sbjct  421   -GLTELQRMGVGLIIGMLAILAAGATEFERLKHITPG--EKASSLSIFWQIPQYVLVGAS  477

Query  672   EVFMYVGQLEFFNGQAPEGLKSFASALCMTSISLGNYVSSLLVSIVMRISTTHRMPGWIP  493
             EVFMYVGQLEFFNGQAP+G+KSF S+LCM SISLGNYVSSLLV +VM I+     PGWIP
Sbjct  478   EVFMYVGQLEFFNGQAPDGIKSFGSSLCMASISLGNYVSSLLVYMVMGITARGENPGWIP  537

Query  492   GNLNKGHLDRFYFLLAALTTADFVVYILCAKWYKYIEFEERNSCLKNIGDSKLQEDRSTF  313
              NLN GH+DRF+FL+A LT  DFV+Y+LCA+WYK I   +        GD   QED    
Sbjct  538   NNLNVGHMDRFFFLVAVLTALDFVLYLLCARWYKSINLGD--------GDMGSQEDEEVI  589

Query  312   N  310
             +
Sbjct  590   S  590



>ref|XP_004497406.1| PREDICTED: putative peptide/nitrate transporter At5g19640-like 
isoform X1 [Cicer arietinum]
 ref|XP_004497407.1| PREDICTED: putative peptide/nitrate transporter At5g19640-like 
isoform X2 [Cicer arietinum]
Length=581

 Score =   658 bits (1697),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 340/548 (62%), Positives = 423/548 (77%), Gaps = 14/548 (3%)
 Frame = -3

Query  2010  GGWFAGVLLLVNQGLATLAFFGVGVNLVLFLTRVMGQDNADAANNVSKWTGTVYLFSLLG  1831
             GG  A  LLLVNQ LATLAF+GVGVNLVLFLTRV+GQDNA+AANNVSKWTGTVY+FSL+G
Sbjct  31    GGTKAATLLLVNQALATLAFYGVGVNLVLFLTRVLGQDNAEAANNVSKWTGTVYMFSLIG  90

Query  1830  AFLSDSYWGRYKTCAIFQLIYVVGLISVSIFSFIFLVKPKGCGDENTPCRSPSRIHIAVY  1651
             AFLSDSYWGRY TC IFQL +V+GL   ++ S+ FL+ P GCGDE+TPC+  S I + ++
Sbjct  91    AFLSDSYWGRYLTCTIFQLFFVLGLALSTLSSWRFLINPSGCGDEHTPCKPTSSIGVYIF  150

Query  1650  YVSIYLVALGNGGYQPNIATFGSDQFDGDHAHESVSKVAFFSYFYLALNLGSLFSNTVLV  1471
             Y+SIYLVA G GG+QP +ATFG+DQ+D  +  E   KVAFF YFY +LNLGSLFSNTVLV
Sbjct  151   YLSIYLVAFGYGGHQPTLATFGADQYDEKNPKERGLKVAFFCYFYFSLNLGSLFSNTVLV  210

Query  1470  YFEDKGMWTLGFWastvsavlalllflVGTPRYRHFAPKGNPLSRFSQVLVASARKWNVH  1291
             Y+ED G WT+GF+ S +SAV+ALL FL G+PRYR+F P GNP++R +QV     RKWNV 
Sbjct  211   YYEDTGKWTMGFFVSLISAVVALLCFLSGSPRYRYFKPSGNPVARIAQVFTIVVRKWNV-  269

Query  1290  LPSDGDDHRLYEIQEHDSS---TRKILHTEGFKFLDKAAVITTKESVRDLEERNINPWRL  1120
             +P+  D  +L+E+    S+    RKILH++  KF+DKAA IT  +   D   RN NPWRL
Sbjct  270   VPAKPD--KLFEVNGSKSAIKGCRKILHSDDLKFMDKAATITEND---DENSRN-NPWRL  323

Query  1119  CSVTQVEEVKCILRLLPIWLCTILYSVVFTQMASLFVEQGAAMRTNIAGFHIPPASMSSF  940
             C+VTQVEE KCILR+LP+WLCTI YS+VFTQMASLFVEQG AM + I  F +P ASMS+F
Sbjct  324   CTVTQVEETKCILRMLPVWLCTITYSIVFTQMASLFVEQGDAMNSRIGEFRLPAASMSAF  383

Query  939   DILSVAAFIFIYRRILDPLIASLKKTRRAQGFTELQRMGVGLiiaimamvaagiVEHFRL  760
             DI SV  F  +YR+IL P++  L  +   +G TELQRMG+GLI  +++MVA+G+ E  RL
Sbjct  384   DICSVLVFTGVYRQILVPVVGRL--SGNPKGLTELQRMGIGLIFGMLSMVASGMTEIARL  441

Query  759   KYASTDCPRCPSSLSIFWQVPQYVLIGASEVFMYVGQLEFFNGQAPEGLKSFASALCMTS  580
             ++      +  SS+SIF+Q+PQYVL+GASEVFMYVGQLEFFNGQAP+GLKSF S+LCM S
Sbjct  442   RHIIPG--QKSSSMSIFYQIPQYVLVGASEVFMYVGQLEFFNGQAPDGLKSFGSSLCMAS  499

Query  579   ISLGNYVSSLLVSIVMRISTTHRMPGWIPGNLNKGHLDRFYFLLAALTTADFVVYILCAK  400
             +SLGNY+SS+LV+++MRI+      GWIP NLN GH+DRF+FLLA +   DFV+Y+ CAK
Sbjct  500   MSLGNYMSSMLVNVIMRITARGHDKGWIPDNLNTGHMDRFFFLLAGIVAFDFVLYLFCAK  559

Query  399   WYKYIEFE  376
             WYK I  E
Sbjct  560   WYKSISVE  567



>ref|XP_011025229.1| PREDICTED: protein NRT1/ PTR FAMILY 7.1-like [Populus euphratica]
Length=601

 Score =   658 bits (1697),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 351/598 (59%), Positives = 438/598 (73%), Gaps = 30/598 (5%)
 Frame = -3

Query  2109  IKNERDEEKASREECTLDGTVDHYGRPALRSATGGWFAGVLLLVNQGLATLAFFGVGVNL  1930
             I+ E ++E  S +            R  +  ++GGW A  +LL NQ LATLAFFGVGVNL
Sbjct  26    IRTEEEQEIGSNK------------RSIIWKSSGGWKAASILLANQCLATLAFFGVGVNL  73

Query  1929  VLFLTRVMGQDNADAANNVSKWTGTVYLFSLLGAFLSDSYWGRYKTCAIFQLIYVVGLIS  1750
             VLF+TRV+GQ NADAAN+VSKWTGTVYL SL+GAFLSDSYWGRY TCA+FQLI+V GL  
Sbjct  74    VLFVTRVLGQSNADAANSVSKWTGTVYLCSLIGAFLSDSYWGRYLTCAVFQLIFVSGLAL  133

Query  1749  VSIFSFIFLVKPKGCGDENTPCRSPSRIHIAVYYVSIYLVALGNGGYQPNIATFGSDQFD  1570
             VS+ S  FL+KP GCGD    C   S + +A++Y++IYLVA G GG+QP++ATFG+DQFD
Sbjct  134   VSVSSCYFLIKPDGCGDGELACEPTSSMGVAIFYLAIYLVAFGYGGHQPSLATFGADQFD  193

Query  1569  GDHAHESVSKVAFFSYFYLALNLGSLFSNTVLVYFEDKGMWTLGFWastvsavlalllfl  1390
                  E   K A+F YFY ALN GSLFSNT+LVYFED G WTLGF  S  SAVLAL+LFL
Sbjct  194   ESKPKEKNYKAAYFCYFYFALNFGSLFSNTILVYFEDHGKWTLGFLVSLGSAVLALVLFL  253

Query  1389  VGTPRYRHFAPKGNPLSRFSQVLVASARKWNVHLPSDGDDHRLYEIQEHDSS---TRKIL  1219
              GTP Y++  P GNPL R +QV VA+ +KW+V +P+  D+  LYE++  +S+   +RKIL
Sbjct  254   FGTPGYQYVKPCGNPLPRVAQVFVAAVKKWDV-IPAKADE--LYEVEGPESTIKGSRKIL  310

Query  1218  HTEGFKFLDKAAVITTKESVRDLEERNINPWRLCSVTQVEEVKCILRLLPIWLCTILYSV  1039
             H++ F+FLDKAA +T      DL ++  NPWRLC+++QVEE KC+L++LPIWLCTI+YSV
Sbjct  311   HSDDFEFLDKAATVTED----DLSQQK-NPWRLCTISQVEEAKCVLKMLPIWLCTIIYSV  365

Query  1038  VFTQMASLFVEQGAAMRTNIAGFHIPPASMSSFDILSVAAFIFIYRRILDPLIASLKKTR  859
             VFTQMASLFVEQG  M +    FH+P ASMS+FDI SV     IYR+IL PL   L  + 
Sbjct  366   VFTQMASLFVEQGDVMNSYAGKFHLPAASMSAFDICSVLVCTGIYRQILVPLAGRL--SG  423

Query  858   RAQGFTELQRMGVGLiiaimamvaagiVEHFRLKYASTDCPRCPSSLSIFWQVPQYVLIG  679
               +G TELQRMG+GLII ++AM AAG  E  RLK+      +  SSLSIFWQ+PQYVL+G
Sbjct  424   NTKGLTELQRMGIGLIIGMLAMFAAGATEIERLKHVPEG--KKVSSLSIFWQIPQYVLVG  481

Query  678   ASEVFMYVGQLEFFNGQAPEGLKSFASALCMTSISLGNYVSSLLVSIVMRISTTHRMPGW  499
             ASEVFMYVGQLEFFNGQAP+G+KSF S+LCM SISLGNYVSS+LVS+VM+I+     PGW
Sbjct  482   ASEVFMYVGQLEFFNGQAPDGIKSFGSSLCMASISLGNYVSSMLVSMVMKITAKGDKPGW  541

Query  498   IPGNLNKGHLDRFYFLLAALTTADFVVYILCAKWYKYIEFEERNSCLKNIGDSKLQED  325
             IP +LN GH+DRFYFL+A LT  DFV+Y+ CA WY  I  ++ +   + IG  K ++D
Sbjct  542   IPDDLNTGHMDRFYFLIAVLTAFDFVIYLFCANWYTPINIDDSH---EGIGMEKQEDD  596



>gb|EEC73815.1| hypothetical protein OsI_08532 [Oryza sativa Indica Group]
Length=610

 Score =   657 bits (1696),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 358/584 (61%), Positives = 431/584 (74%), Gaps = 15/584 (3%)
 Frame = -3

Query  2121  KMFFIKNERDE-EKASREEC---TLDGTVDHYGRPALRSATGGWFAGVLLLVNQGLATLA  1954
             KM  I  E DE   A ++ C   TLDG+VD  G PA++  +GGW AG L+L+NQGLATLA
Sbjct  9     KMRVIVVEGDETSNAPKDVCCEYTLDGSVDIKGSPAVKGKSGGWLAGGLILLNQGLATLA  68

Query  1953  FFGVGVNLVLFLTRVMGQDNADAANNVSKWTGTVYLFSLLGAFLSDSYWGRYKTCAIFQL  1774
             FFGV VNLVLFLTRV+ Q N DAANNVSKWTGTVY+FSL+GAFLSDSYWGRYKTCAIFQ 
Sbjct  69    FFGVNVNLVLFLTRVLQQSNGDAANNVSKWTGTVYMFSLIGAFLSDSYWGRYKTCAIFQA  128

Query  1773  IYVVGLISVSIFSFIFLVKPKGCGDENTPCRSPSRIHIAVYYVSIYLVALGNGGYQPNIA  1594
             I+V+GL  +S+ S ++L++P GCG E+ PC   S   + ++Y+++Y++A GNGGYQPN+A
Sbjct  129   IFVLGLALLSLSSRLYLIRPVGCGTEHVPCEPHSGAELGIFYIALYMIAFGNGGYQPNVA  188

Query  1593  TFGSDQFDGDHAHESVSKVAFFSYFYLALNLGSLFSNTVLVYFEDKGMWTLGFWastvsa  1414
             TFG+DQFDG+   ES SKV+FFSYFYLALNLGSLFSNT L + ED+G W LGFW ST +A
Sbjct  189   TFGADQFDGEDPAESHSKVSFFSYFYLALNLGSLFSNTFLSFLEDEGNWALGFWVSTAAA  248

Query  1413  vlalllflVGTPRYRHFAPKGNPLSRFSQVLVASARKWNVHLPSDGDDHRLYEIQEH-DS  1237
               ALLLFL GT RYR+  P GNP+ R  QV  A+ R W     S G    LYE  E  DS
Sbjct  249   ATALLLFLGGTLRYRYIRPSGNPVGRIFQVAFAACRNWKAG-ESPG-AVTLYESDEKADS  306

Query  1236  STRKILHTEGFKFLDKAAVITTKESVRDLEERNINPWRLCSVTQVEEVKCILRLLPIWLC  1057
               RK+LHTEGF+FLD+AAV+     +    +   +PW+LC+VTQVEEVK ILRLLPIWLC
Sbjct  307   GGRKLLHTEGFRFLDRAAVVGANPKLGTCTQPR-DPWKLCTVTQVEEVKSILRLLPIWLC  365

Query  1056  TILYSVVFTQMASLFVEQGAAMR--TNIAGFHIPPASMSSFDILSVAAFIFIYRRILDPL  883
             TILYSVVFTQMASLFV QGAAMR  T   GF +PP+SMS+FDIL+VA  IF+YRR + PL
Sbjct  366   TILYSVVFTQMASLFVVQGAAMRRTTRFPGFSVPPSSMSAFDILTVATTIFLYRRAVCPL  425

Query  882   IASLKKTRRAQGFTELQRMGVGLiiaimamvaagiVEHFRLKYASTDCPRCPSSLSIFWQ  703
             ++ L  T R  G TELQRMG+GL++  MAM  AG VEHFR   A+T      S L I WQ
Sbjct  426   VSRL--TGRRTGPTELQRMGLGLVLGAMAMATAGTVEHFRKAGATT---AMSSDLHIMWQ  480

Query  702   VPQYVLIGASEVFMYVGQLEFFNGQAPEGLKSFASALCMTSISLGNYVSSLLVSIVMRIS  523
             VPQY LIG SEV MYVGQLEFFNG+ P+ LKSF SALCM S+SLGNY S ++VS V + +
Sbjct  481   VPQYALIGVSEVMMYVGQLEFFNGEMPDALKSFGSALCMMSMSLGNYFSDVIVSAVTKAT  540

Query  522   TTHRMPGWIPGNLNKGHLDRFYFLLAALTTADFVVYILCAKWYK  391
                  PGWIP +LN+GHLD+F+FLLA L  ADF VY++CA  Y+
Sbjct  541   AVRGRPGWIPADLNEGHLDKFFFLLAVLAVADFAVYLVCASRYR  584



>ref|NP_001047787.1| Os02g0689900 [Oryza sativa Japonica Group]
 dbj|BAD07678.1| putative peptide transporter [Oryza sativa Japonica Group]
 dbj|BAF09701.1| Os02g0689900 [Oryza sativa Japonica Group]
 gb|EEE57608.1| hypothetical protein OsJ_07990 [Oryza sativa Japonica Group]
Length=610

 Score =   657 bits (1696),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 358/584 (61%), Positives = 431/584 (74%), Gaps = 15/584 (3%)
 Frame = -3

Query  2121  KMFFIKNERDE-EKASREEC---TLDGTVDHYGRPALRSATGGWFAGVLLLVNQGLATLA  1954
             KM  I  E DE   A ++ C   TLDG+VD  G PA++  +GGW AG L+L+NQGLATLA
Sbjct  9     KMRVIVVEGDETSNAPKDVCCEYTLDGSVDIKGSPAVKGKSGGWLAGGLILLNQGLATLA  68

Query  1953  FFGVGVNLVLFLTRVMGQDNADAANNVSKWTGTVYLFSLLGAFLSDSYWGRYKTCAIFQL  1774
             FFGV VNLVLFLTRV+ Q N DAANNVSKWTGTVY+FSL+GAFLSDSYWGRYKTCAIFQ 
Sbjct  69    FFGVNVNLVLFLTRVLQQSNGDAANNVSKWTGTVYMFSLIGAFLSDSYWGRYKTCAIFQA  128

Query  1773  IYVVGLISVSIFSFIFLVKPKGCGDENTPCRSPSRIHIAVYYVSIYLVALGNGGYQPNIA  1594
             I+V+GL  +S+ S ++L++P GCG E+ PC   S   + ++Y+++Y++A GNGGYQPN+A
Sbjct  129   IFVLGLALLSLSSRLYLIRPVGCGTEHVPCEPHSGAELGIFYIALYMIAFGNGGYQPNVA  188

Query  1593  TFGSDQFDGDHAHESVSKVAFFSYFYLALNLGSLFSNTVLVYFEDKGMWTLGFWastvsa  1414
             TFG+DQFDG+   ES SKV+FFSYFYLALNLGSLFSNT L + ED+G W LGFW ST +A
Sbjct  189   TFGADQFDGEDPAESHSKVSFFSYFYLALNLGSLFSNTFLSFLEDEGNWALGFWVSTAAA  248

Query  1413  vlalllflVGTPRYRHFAPKGNPLSRFSQVLVASARKWNVHLPSDGDDHRLYEIQEH-DS  1237
               ALLLFL GT RYR+  P GNP+ R  QV  A+ R W     S G    LYE  E  DS
Sbjct  249   ATALLLFLGGTLRYRYIRPSGNPVGRIFQVAFAACRNWKAG-ESPG-AVTLYESDEKADS  306

Query  1236  STRKILHTEGFKFLDKAAVITTKESVRDLEERNINPWRLCSVTQVEEVKCILRLLPIWLC  1057
               RK+LHTEGF+FLD+AAV+     +    +   +PW+LC+VTQVEEVK ILRLLPIWLC
Sbjct  307   GGRKLLHTEGFRFLDRAAVVGANPKLGTCTQPR-DPWKLCTVTQVEEVKSILRLLPIWLC  365

Query  1056  TILYSVVFTQMASLFVEQGAAMR--TNIAGFHIPPASMSSFDILSVAAFIFIYRRILDPL  883
             TILYSVVFTQMASLFV QGAAMR  T   GF +PP+SMS+FDIL+VA  IF+YRR + PL
Sbjct  366   TILYSVVFTQMASLFVVQGAAMRRTTRFPGFSVPPSSMSAFDILTVATTIFLYRRAVCPL  425

Query  882   IASLKKTRRAQGFTELQRMGVGLiiaimamvaagiVEHFRLKYASTDCPRCPSSLSIFWQ  703
             ++ L  T R  G TELQRMG+GL++  MAM  AG VEHFR   A+T      S L I WQ
Sbjct  426   VSRL--TGRHTGPTELQRMGLGLVLGAMAMATAGTVEHFRKAGATT---AMSSDLHIMWQ  480

Query  702   VPQYVLIGASEVFMYVGQLEFFNGQAPEGLKSFASALCMTSISLGNYVSSLLVSIVMRIS  523
             VPQY LIG SEV MYVGQLEFFNG+ P+ LKSF SALCM S+SLGNY S ++VS V + +
Sbjct  481   VPQYALIGVSEVMMYVGQLEFFNGEMPDALKSFGSALCMMSMSLGNYFSDVIVSAVTKAT  540

Query  522   TTHRMPGWIPGNLNKGHLDRFYFLLAALTTADFVVYILCAKWYK  391
                  PGWIP +LN+GHLD+F+FLLA L  ADF VY++CA  Y+
Sbjct  541   AVRGRPGWIPADLNEGHLDKFFFLLAVLAVADFAVYLVCASRYR  584



>ref|XP_002304892.1| hypothetical protein POPTR_0003s21800g [Populus trichocarpa]
 gb|EEE79871.1| hypothetical protein POPTR_0003s21800g [Populus trichocarpa]
Length=611

 Score =   657 bits (1694),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 351/598 (59%), Positives = 435/598 (73%), Gaps = 30/598 (5%)
 Frame = -3

Query  2109  IKNERDEEKASREECTLDGTVDHYGRPALRSATGGWFAGVLLLVNQGLATLAFFGVGVNL  1930
             I+ E + + AS +            R     ++GGW A  +LL NQ LATLAFFGVGVNL
Sbjct  36    IRTEEEHDIASNK------------RSITWKSSGGWKAASILLANQCLATLAFFGVGVNL  83

Query  1929  VLFLTRVMGQDNADAANNVSKWTGTVYLFSLLGAFLSDSYWGRYKTCAIFQLIYVVGLIS  1750
             VLFLTRV+GQ NADAAN+VSKWTGTVYL SL+GAFLSDSYWGRY TCA+FQLI+V GL  
Sbjct  84    VLFLTRVLGQSNADAANSVSKWTGTVYLCSLIGAFLSDSYWGRYLTCAVFQLIFVSGLAL  143

Query  1749  VSIFSFIFLVKPKGCGDENTPCRSPSRIHIAVYYVSIYLVALGNGGYQPNIATFGSDQFD  1570
             VS+ S  FL+KP GCGD    C   S + +A++Y++IYLVA G GG+QP++ATFG+DQFD
Sbjct  144   VSVSSCYFLIKPDGCGDGELACEPTSSVGVAIFYLAIYLVAFGYGGHQPSLATFGADQFD  203

Query  1569  GDHAHESVSKVAFFSYFYLALNLGSLFSNTVLVYFEDKGMWTLGFWastvsavlalllfl  1390
                  E   K A+F YFY ALN GSLFSNT+LVYFED G WTLGF  S  SAVLAL+ FL
Sbjct  204   ESKPKEKNYKAAYFCYFYFALNFGSLFSNTILVYFEDHGKWTLGFLVSLGSAVLALVSFL  263

Query  1389  VGTPRYRHFAPKGNPLSRFSQVLVASARKWNVHLPSDGDDHRLYEIQEHDSS---TRKIL  1219
              GTP Y++  P GNPL R +QV VA+ +KW+V +P+  D+  LYE++  +S+   +RKIL
Sbjct  264   FGTPGYQYVKPCGNPLPRVAQVFVAAVKKWDV-IPAKADE--LYEVEGPESAIKGSRKIL  320

Query  1218  HTEGFKFLDKAAVITTKESVRDLEERNINPWRLCSVTQVEEVKCILRLLPIWLCTILYSV  1039
             H++ F+FLDKAA +T      DL  +  NPWRLC+++QVEE KC+L++LPIWLCTI+YSV
Sbjct  321   HSDDFEFLDKAATVTED----DLSHQK-NPWRLCTISQVEEAKCVLKMLPIWLCTIIYSV  375

Query  1038  VFTQMASLFVEQGAAMRTNIAGFHIPPASMSSFDILSVAAFIFIYRRILDPLIASLKKTR  859
             VFTQMASLFVEQG  M +    FH+P ASMS+FDI SV     IYR+IL PL   L  + 
Sbjct  376   VFTQMASLFVEQGDVMNSYAGKFHLPAASMSAFDICSVLVCTGIYRQILVPLAGRL--SG  433

Query  858   RAQGFTELQRMGVGLiiaimamvaagiVEHFRLKYASTDCPRCPSSLSIFWQVPQYVLIG  679
               +G TELQRMG+GLII ++AM AAG  E  RLK+ +    +  SSLSIFWQ+PQYVL+G
Sbjct  434   NTKGLTELQRMGIGLIIGMLAMFAAGATEIERLKHVTEG--KKVSSLSIFWQIPQYVLVG  491

Query  678   ASEVFMYVGQLEFFNGQAPEGLKSFASALCMTSISLGNYVSSLLVSIVMRISTTHRMPGW  499
             ASEVFMYVGQLEFFNGQAP+G+KSF S+LCM SISLGNYVSS+LVS+VM+I+     PGW
Sbjct  492   ASEVFMYVGQLEFFNGQAPDGIKSFGSSLCMASISLGNYVSSMLVSMVMKITAKGDKPGW  551

Query  498   IPGNLNKGHLDRFYFLLAALTTADFVVYILCAKWYKYIEFEERNSCLKNIGDSKLQED  325
             IP +LN GH+DRFYFL+A LT  DFV+Y+ CA WY  I  ++ +     IG  K ++D
Sbjct  552   IPDDLNTGHMDRFYFLIAVLTAFDFVIYLFCANWYTPINIDDSHG---GIGMEKQEDD  606



>gb|KHN12584.1| Putative peptide/nitrate transporter [Glycine soja]
Length=595

 Score =   655 bits (1690),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 347/601 (58%), Positives = 431/601 (72%), Gaps = 23/601 (4%)
 Frame = -3

Query  2103  NERDEEKASREECTLDGTVDHYGRPALRSATGGWFAGVLLLVNQGLATLAFFGVGVNLVL  1924
             N  + E   ++    +G+       + +   GGW   ++LL NQ LATLAFFGVGVNLVL
Sbjct  13    NSVNVEATEKKVTGGNGSYTEQSDTSYKKIKGGWKTAIILLANQALATLAFFGVGVNLVL  72

Query  1923  FLTRVMGQDNADAANNVSKWTGTVYLFSLLGAFLSDSYWGRYKTCAIFQLIYVVGLISVS  1744
             FLTRV+ QD+A+AANNVSKWTGTVY+FSL+GAFLSDSYWGRY TCAIFQ I+VVGL  +S
Sbjct  73    FLTRVLRQDSAEAANNVSKWTGTVYIFSLIGAFLSDSYWGRYLTCAIFQFIFVVGLGMLS  132

Query  1743  IFSFIFLVKPKGCGDENTPCRSPSRIHIAVYYVSIYLVALGNGGYQPNIATFGSDQFDGD  1564
             + S+ FL+KP GCG+E T C  PS + + ++Y+SIYLVA G GG+QP +ATFG+DQFD  
Sbjct  133   LSSWRFLIKPVGCGNEETTCLEPSSVGVGIFYLSIYLVAFGYGGHQPTLATFGADQFDEK  192

Query  1563  HAHESVSKVAFFSYFYLALNLGSLFSNTVLVYFEDKGMWTLGFWastvsavlalllflVG  1384
             +  +  ++ AFFSYFY ALN+GSLFSNT+LVY+ED GMWT+GF  S  SAV+AL+ +L G
Sbjct  193   NEKQKNAREAFFSYFYFALNVGSLFSNTILVYYEDSGMWTMGFLVSLASAVIALVSYLAG  252

Query  1383  TPRYRHFAPKGNPLSRFSQVLVASARKWNVHLPSDGDDHRLYEIQEHDSS---TRKILHT  1213
               +YR+    GNP+ R  QV VA+ RKW V       + +LYE+   +S+   +RKI H+
Sbjct  253   YRKYRYVKGYGNPVIRVVQVFVATVRKWKV---GPAKELQLYEVDGPESAIKGSRKIHHS  309

Query  1212  EGFKFLDKAAVITTKESVRDLEERNINPWRLCSVTQVEEVKCILRLLPIWLCTILYSVVF  1033
               F+F+DKAA IT K++V +L+    N WRLC+VTQVEE KC+LR+LP+WLCTI+YSVVF
Sbjct  310   NDFRFMDKAATITEKDAV-NLK----NHWRLCTVTQVEEAKCVLRMLPVWLCTIIYSVVF  364

Query  1032  TQMASLFVEQGAAMRTNIAGFHIPPASMSSFDILSVAAFIFIYRRILDPLIASLKKTRRA  853
             TQMASLFVEQG  M   I  FH+P ASMS FDI SV     IYR+IL PL        R 
Sbjct  365   TQMASLFVEQGDVMNNKIGNFHLPAASMSVFDICSVLLCTGIYRQILVPLAGRFSGNPR-  423

Query  852   QGFTELQRMGVGLiiaimamvaagiVEHFRLKYASTDCPRCPSSLSIFWQVPQYVLIGAS  673
              G TELQRMGVGLII ++A++AAG  E  RLK+ +       SSLSIFWQ+PQYVL+GAS
Sbjct  424   -GLTELQRMGVGLIIGMLAILAAGATEFERLKHITPG--EKASSLSIFWQIPQYVLVGAS  480

Query  672   EVFMYVGQLEFFNGQAPEGLKSFASALCMTSISLGNYVSSLLVSIVMRISTTHRMPGWIP  493
             EVFMYVGQLEFFNGQAP+G+KSF S+LCM SISLGNYVSSLLV +VM I+     PGWIP
Sbjct  481   EVFMYVGQLEFFNGQAPDGIKSFGSSLCMASISLGNYVSSLLVYMVMGITARGENPGWIP  540

Query  492   GNLNKGHLDRFYFLLAALTTADFVVYILCAKWYKYIEFEERNSCLKNIGDSKLQEDRSTF  313
              NLN GH+DRF+FL+A LT  DFV+Y+LCA+WYK I   +        GD   QED    
Sbjct  541   NNLNVGHMDRFFFLVAVLTALDFVLYLLCARWYKSINLGD--------GDMGSQEDEEVI  592

Query  312   N  310
             +
Sbjct  593   S  593



>ref|XP_010257465.1| PREDICTED: protein NRT1/ PTR FAMILY 7.1-like isoform X2 [Nelumbo 
nucifera]
Length=602

 Score =   653 bits (1684),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 361/563 (64%), Positives = 432/563 (77%), Gaps = 20/563 (4%)
 Frame = -3

Query  2055  GTVDHYGRPALRSATGGWFAGVLLLVNQGLATLAFFGVGVNLVLFLTRVMGQDNADAANN  1876
             G VD  G   ++S +GGW    LLL NQGLATLAFFGVGVNLVLFLTRV+ QDNA+AANN
Sbjct  38    GPVDENGSLVIKSNSGGWKPAFLLLANQGLATLAFFGVGVNLVLFLTRVLQQDNANAANN  97

Query  1875  VSKWTGTVYLFSLLGAFLSDSYWGRYKTCAIFQLIYVVGLISVSIFSFIFLVKPKGCGDE  1696
             VSKWTGTVY+ SL+GAFLSDSYWGRY TCAIFQLI+V+GL+ +S+ S++FL+KP GCGD 
Sbjct  98    VSKWTGTVYMCSLIGAFLSDSYWGRYLTCAIFQLIFVLGLVLLSLSSWLFLIKPDGCGDG  157

Query  1695  NTPCRSPSRIHIAVYYVSIYLVALGNGGYQPNIATFGSDQFDGDHAHESVSKVAFFSYFY  1516
                CR  S   +A++Y+SIYLVA G GG+QP IAT GSDQ D +HA     K AFF YFY
Sbjct  158   VIDCRPASSAGVAIFYLSIYLVAFGYGGHQPTIATLGSDQID-EHA-----KAAFFCYFY  211

Query  1515  LALNLGSLFSNTVLVYFEDKGMWTLGFWastvsavlalllflVGTPRYRHFAPKGNPLSR  1336
              ALN+GSLFSNT+LVYFED G WTLGF AS  SAVLAL+LFL+GTP+YR F P GNPL R
Sbjct  212   FALNVGSLFSNTILVYFEDSGKWTLGFLASAGSAVLALILFLIGTPKYRFFKPCGNPLPR  271

Query  1335  FSQVLVASARKWNVHLPSDGDDHRLYEIQEHDSS---TRKILHTEGFKFLDKAAVITTKE  1165
              +QV VA+ RKW+V +P+D +  +LYE++  +S+   +RKI+H+  F FLDKAA  T   
Sbjct  272   VAQVFVATFRKWDVTVPADSE--KLYELEGSESAIKGSRKIMHSNEFGFLDKAATKTQ--  327

Query  1164  SVRDLEERNINPWRLCSVTQVEEVKCILRLLPIWLCTILYSVVFTQMASLFVEQGAAMRT  985
                DL   N +PWRLC+VTQVEE KC+L++LPIWLCTI+YSVVFTQMASLFVEQG  M +
Sbjct  328   --NDLHGTN-DPWRLCTVTQVEEAKCVLKMLPIWLCTIIYSVVFTQMASLFVEQGVVMNS  384

Query  984   NIAGFHIPPASMSSFDILSVAAFIFIYRRILDPLIASLKKTRRAQGFTELQRMGVGLiia  805
             +   F +P ASMS+FDI SV  F  IYR+IL P+   L  T   +G +ELQRMGVGLII 
Sbjct  385   STGDFRLPAASMSAFDICSVLVFTGIYRQILVPVAGRL--TGNPKGLSELQRMGVGLIIG  442

Query  804   imamvaagiVEHFRLKYASTDCPRCPSSLSIFWQVPQYVLIGASEVFMYVGQLEFFNGQA  625
             ++AMVAAGI E  RL+  +       SSL IFWQ+PQY L+GASEVFMYVGQLEFFNGQA
Sbjct  443   MLAMVAAGITEIERLRRVTPGYES--SSLIIFWQIPQYTLVGASEVFMYVGQLEFFNGQA  500

Query  624   PEGLKSFASALCMTSISLGNYVSSLLVSIVMRISTTHRMPGWIPGNLNKGHLDRFYFLLA  445
             P+G+KSF S+LCM SISLGNYVSSLLV++VM I+  +  PGWIPGNLN GH+DRFYFLLA
Sbjct  501   PDGIKSFGSSLCMASISLGNYVSSLLVNMVMGITARNNKPGWIPGNLNSGHMDRFYFLLA  560

Query  444   ALTTADFVVYILCAKWYKYIEFE  376
              LT  DF +Y+ CAKWYK I+ E
Sbjct  561   GLTVIDFGIYLYCAKWYKCIKLE  583



>ref|XP_010257463.1| PREDICTED: protein NRT1/ PTR FAMILY 7.1-like isoform X1 [Nelumbo 
nucifera]
 ref|XP_010257464.1| PREDICTED: protein NRT1/ PTR FAMILY 7.1-like isoform X1 [Nelumbo 
nucifera]
Length=604

 Score =   653 bits (1684),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 361/563 (64%), Positives = 432/563 (77%), Gaps = 20/563 (4%)
 Frame = -3

Query  2055  GTVDHYGRPALRSATGGWFAGVLLLVNQGLATLAFFGVGVNLVLFLTRVMGQDNADAANN  1876
             G VD  G   ++S +GGW    LLL NQGLATLAFFGVGVNLVLFLTRV+ QDNA+AANN
Sbjct  40    GPVDENGSLVIKSNSGGWKPAFLLLANQGLATLAFFGVGVNLVLFLTRVLQQDNANAANN  99

Query  1875  VSKWTGTVYLFSLLGAFLSDSYWGRYKTCAIFQLIYVVGLISVSIFSFIFLVKPKGCGDE  1696
             VSKWTGTVY+ SL+GAFLSDSYWGRY TCAIFQLI+V+GL+ +S+ S++FL+KP GCGD 
Sbjct  100   VSKWTGTVYMCSLIGAFLSDSYWGRYLTCAIFQLIFVLGLVLLSLSSWLFLIKPDGCGDG  159

Query  1695  NTPCRSPSRIHIAVYYVSIYLVALGNGGYQPNIATFGSDQFDGDHAHESVSKVAFFSYFY  1516
                CR  S   +A++Y+SIYLVA G GG+QP IAT GSDQ D +HA     K AFF YFY
Sbjct  160   VIDCRPASSAGVAIFYLSIYLVAFGYGGHQPTIATLGSDQID-EHA-----KAAFFCYFY  213

Query  1515  LALNLGSLFSNTVLVYFEDKGMWTLGFWastvsavlalllflVGTPRYRHFAPKGNPLSR  1336
              ALN+GSLFSNT+LVYFED G WTLGF AS  SAVLAL+LFL+GTP+YR F P GNPL R
Sbjct  214   FALNVGSLFSNTILVYFEDSGKWTLGFLASAGSAVLALILFLIGTPKYRFFKPCGNPLPR  273

Query  1335  FSQVLVASARKWNVHLPSDGDDHRLYEIQEHDSS---TRKILHTEGFKFLDKAAVITTKE  1165
              +QV VA+ RKW+V +P+D +  +LYE++  +S+   +RKI+H+  F FLDKAA  T   
Sbjct  274   VAQVFVATFRKWDVTVPADSE--KLYELEGSESAIKGSRKIMHSNEFGFLDKAATKTQ--  329

Query  1164  SVRDLEERNINPWRLCSVTQVEEVKCILRLLPIWLCTILYSVVFTQMASLFVEQGAAMRT  985
                DL   N +PWRLC+VTQVEE KC+L++LPIWLCTI+YSVVFTQMASLFVEQG  M +
Sbjct  330   --NDLHGTN-DPWRLCTVTQVEEAKCVLKMLPIWLCTIIYSVVFTQMASLFVEQGVVMNS  386

Query  984   NIAGFHIPPASMSSFDILSVAAFIFIYRRILDPLIASLKKTRRAQGFTELQRMGVGLiia  805
             +   F +P ASMS+FDI SV  F  IYR+IL P+   L  T   +G +ELQRMGVGLII 
Sbjct  387   STGDFRLPAASMSAFDICSVLVFTGIYRQILVPVAGRL--TGNPKGLSELQRMGVGLIIG  444

Query  804   imamvaagiVEHFRLKYASTDCPRCPSSLSIFWQVPQYVLIGASEVFMYVGQLEFFNGQA  625
             ++AMVAAGI E  RL+  +       SSL IFWQ+PQY L+GASEVFMYVGQLEFFNGQA
Sbjct  445   MLAMVAAGITEIERLRRVTPGYES--SSLIIFWQIPQYTLVGASEVFMYVGQLEFFNGQA  502

Query  624   PEGLKSFASALCMTSISLGNYVSSLLVSIVMRISTTHRMPGWIPGNLNKGHLDRFYFLLA  445
             P+G+KSF S+LCM SISLGNYVSSLLV++VM I+  +  PGWIPGNLN GH+DRFYFLLA
Sbjct  503   PDGIKSFGSSLCMASISLGNYVSSLLVNMVMGITARNNKPGWIPGNLNSGHMDRFYFLLA  562

Query  444   ALTTADFVVYILCAKWYKYIEFE  376
              LT  DF +Y+ CAKWYK I+ E
Sbjct  563   GLTVIDFGIYLYCAKWYKCIKLE  585



>ref|XP_010046454.1| PREDICTED: protein NRT1/ PTR FAMILY 7.1-like [Eucalyptus grandis]
 gb|KCW85858.1| hypothetical protein EUGRSUZ_B02590 [Eucalyptus grandis]
Length=637

 Score =   653 bits (1685),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 349/572 (61%), Positives = 429/572 (75%), Gaps = 21/572 (4%)
 Frame = -3

Query  2022  RSATGGWFAGVLLLVNQGLATLAFFGVGVNLVLFLTRVMGQDNADAANNVSKWTGTVYLF  1843
             +++ GGW    LLL NQGLATLAFFGVGVNLVLFLTRV+ Q NA AANNVSKWTGTVYL 
Sbjct  77    KASIGGWKWTSLLLANQGLATLAFFGVGVNLVLFLTRVLEQGNASAANNVSKWTGTVYLC  136

Query  1842  SLLGAFLSDSYWGRYKTCAIFQLIYVVGLISVSIFSFIFLVKPKGCGDENTPCRSPSRIH  1663
             SL+GAFLSDSYWGRY TC IFQLI+V+GL+ +S+ S +FL+ P GCGD   PC   S   
Sbjct  137   SLIGAFLSDSYWGRYLTCTIFQLIFVLGLVLLSVTSGVFLITPDGCGDGKLPCMPASPTG  196

Query  1662  IAVYYVSIYLVALGNGGYQPNIATFGSDQFDGDHAHESVSKVAFFSYFYLALNLGSLFSN  1483
             IA++Y+SIY++A G GG+QP IATFG+DQFD  +  +  SK AFF YFY ALN+GSLFSN
Sbjct  197   IAIFYLSIYMIAFGYGGHQPTIATFGADQFDEANPKQKNSKAAFFCYFYFALNVGSLFSN  256

Query  1482  TVLVYFEDKGMWTLGFWastvsavlalllflVGTPRYRHFAPKGNPLSRFSQVLVASARK  1303
             T+LVY+ED G WTLGF  ST SA++ALLLFLVGT +YR+  P GNPL R +QV VA+ARK
Sbjct  257   TILVYYEDSGKWTLGFLVSTGSAIVALLLFLVGTKKYRYVKPSGNPLPRLAQVFVAAARK  316

Query  1302  WNVHLPSDGDDHRLYEIQEHDSS---TRKILHTEGFKFLDKAAVITTKESVRDLEERNIN  1132
             W++    +GD   LYE++  +S+   TRKILH+  F +LDKAA IT      DL     N
Sbjct  317   WDIVPAKEGD---LYELEGSESAIKGTRKILHSNEFVYLDKAATITES----DLSSPK-N  368

Query  1131  PWRLCSVTQVEEVKCILRLLPIWLCTILYSVVFTQMASLFVEQGAAMRTNIAGFHIPPAS  952
             PWRLC+V+QVEE KC+L+++P+WLCTI+YSVVFTQMASLFVEQG  M + I  FH+P AS
Sbjct  369   PWRLCTVSQVEEAKCVLKMIPVWLCTIIYSVVFTQMASLFVEQGNVMNSMIGQFHLPAAS  428

Query  951   MSSFDILSVAAFIFIYRRILDPLIASLKKTRRAQGFTELQRMGVGLiiaimamvaagiVE  772
             MS+FDI SV     IYR+IL PL   L  +   +G T+LQRMG+GLII + AM+AAG  E
Sbjct  429   MSAFDICSVLICTGIYRQILVPLAGRL--SGNPKGLTQLQRMGIGLIIGMSAMLAAGATE  486

Query  771   HFRLKYASTDCPRCPSSLSIFWQVPQYVLIGASEVFMYVGQLEFFNGQAPEGLKSFASAL  592
               RL++         S+LSIFWQVPQY+L+GASEVFMYVGQLEFFN QAP+G+KSF S+L
Sbjct  487   VARLRHVVPG--EKSSALSIFWQVPQYMLVGASEVFMYVGQLEFFNEQAPDGIKSFGSSL  544

Query  591   CMTSISLGNYVSSLLVSIVMRISTTHRMPGWIPGNLNKGHLDRFYFLLAALTTADFVVYI  412
             CM S+SLGNYVSS+LV++V RI+T    PGWIP +LN GH++RFYFL+AALT  DFV+Y+
Sbjct  545   CMASMSLGNYVSSMLVNMVTRITTEGDKPGWIPEDLNTGHMERFYFLIAALTAFDFVIYL  604

Query  411   LCAKWYKY--IEFEERNSCLKNIGDSKLQEDR  322
              CAKWYK   +E EE N  +    D + QE+ 
Sbjct  605   FCAKWYKINNLESEEDNEGV----DKEDQEEE  632



>ref|XP_003592858.1| Peptide transporter PTR1 [Medicago truncatula]
 gb|AES63109.1| peptide/nitrate transporter [Medicago truncatula]
Length=589

 Score =   651 bits (1679),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 346/570 (61%), Positives = 427/570 (75%), Gaps = 20/570 (4%)
 Frame = -3

Query  2076  REECTLDGTVDHYGRPALRSATGGWFAGVLLLVNQGLATLAFFGVGVNLVLFLTRVMGQD  1897
             REE  ++ +    GR A  +  GG     LLLVNQ LATLAFFGVGVNLVLFLTRV+GQD
Sbjct  8     REEVVMEES----GR-ANENKKGGTKVATLLLVNQALATLAFFGVGVNLVLFLTRVLGQD  62

Query  1896  NADAANNVSKWTGTVYLFSLLGAFLSDSYWGRYKTCAIFQLIYVVGLISVSIFSFIFLVK  1717
             NA+AANNVSKWTGTVY+FSL+GAFLSDSYWGRY TC IFQL +V+GL    + S+ FL+ 
Sbjct  63    NAEAANNVSKWTGTVYMFSLVGAFLSDSYWGRYLTCTIFQLFFVLGLALSCLSSWRFLIN  122

Query  1716  PKGCGDENTPCRSPSRIHIAVYYVSIYLVALGNGGYQPNIATFGSDQFDGDHAHESVSKV  1537
             P GCG+ + PC+ PS I ++++Y SIYLVA G GG+QP +ATFG+DQ+D  +  E   KV
Sbjct  123   PSGCGNGHIPCK-PSSIGVSIFYFSIYLVAFGYGGHQPTLATFGADQYDERNPKERSLKV  181

Query  1536  AFFSYFYLALNLGSLFSNTVLVYFEDKGMWTLGFWastvsavlalllflVGTPRYRHFAP  1357
             AFF YFY +LN+GSLFSNTVLVY+ED G WT+GF+ S +SA++ALL FL G+P+YR+  P
Sbjct  182   AFFCYFYFSLNVGSLFSNTVLVYYEDTGKWTMGFFISLISAIIALLTFLSGSPKYRYLKP  241

Query  1356  KGNPLSRFSQVLVASARKWNVHLPSDGDDHRLYEIQEHDSS---TRKILHTEGFKFLDKA  1186
              GNP+ R +QV  A+ARKW+V  P+  D  +L+E+    S+    RKILH++ F+ +DKA
Sbjct  242   SGNPVVRVAQVFTAAARKWDVA-PAKAD--KLFEVLGSRSAIKGCRKILHSDDFRLMDKA  298

Query  1185  AVITTKESVRDLEERNINPWRLCSVTQVEEVKCILRLLPIWLCTILYSVVFTQMASLFVE  1006
             A IT      D E+   NPW+LC+VTQVEE KC+LR+LPIWLCTI YSVVFTQMASLFVE
Sbjct  299   ATITKN----DDEQIGNNPWKLCTVTQVEETKCVLRMLPIWLCTICYSVVFTQMASLFVE  354

Query  1005  QGAAMRTNIAGFHIPPASMSSFDILSVAAFIFIYRRILDPLIASLKKTRRAQGFTELQRM  826
             QG  M +NI  FH+P ASMS FDI SV     IYR IL PL+  L    R  G +EL+RM
Sbjct  355   QGDVMNSNIGEFHLPAASMSVFDICSVLVCTVIYRTILVPLVGRLIGNTR--GISELERM  412

Query  825   GVGLiiaimamvaagiVEHFRLKYASTDCPRCPSSLSIFWQVPQYVLIGASEVFMYVGQL  646
             G+GLIIA+++MVA+G+ E  RL+       R  SS+SIF+Q+PQYVLIGASEVFMYVGQL
Sbjct  413   GIGLIIAMLSMVASGMTEMVRLRNIIPGQKR--SSMSIFYQIPQYVLIGASEVFMYVGQL  470

Query  645   EFFNGQAPEGLKSFASALCMTSISLGNYVSSLLVSIVMRISTTHRMPGWIPGNLNKGHLD  466
             EFFNGQAP+G+KSF S+LCM SISLGNYVSS+LV +VM+I+      GWIP NLNKGH+D
Sbjct  471   EFFNGQAPDGIKSFGSSLCMASISLGNYVSSMLVHVVMKITARGNDKGWIPENLNKGHMD  530

Query  465   RFYFLLAALTTADFVVYILCAKWYKYIEFE  376
             RF+FLLA L   DFV+Y+ CAKWYK I  +
Sbjct  531   RFFFLLAGLVVFDFVIYLFCAKWYKSINVQ  560



>ref|XP_004497408.1| PREDICTED: putative peptide/nitrate transporter At5g19640-like 
isoform X3 [Cicer arietinum]
Length=544

 Score =   649 bits (1673),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 334/538 (62%), Positives = 417/538 (78%), Gaps = 14/538 (3%)
 Frame = -3

Query  1980  VNQGLATLAFFGVGVNLVLFLTRVMGQDNADAANNVSKWTGTVYLFSLLGAFLSDSYWGR  1801
             VNQ LATLAF+GVGVNLVLFLTRV+GQDNA+AANNVSKWTGTVY+FSL+GAFLSDSYWGR
Sbjct  4     VNQALATLAFYGVGVNLVLFLTRVLGQDNAEAANNVSKWTGTVYMFSLIGAFLSDSYWGR  63

Query  1800  YKTCAIFQLIYVVGLISVSIFSFIFLVKPKGCGDENTPCRSPSRIHIAVYYVSIYLVALG  1621
             Y TC IFQL +V+GL   ++ S+ FL+ P GCGDE+TPC+  S I + ++Y+SIYLVA G
Sbjct  64    YLTCTIFQLFFVLGLALSTLSSWRFLINPSGCGDEHTPCKPTSSIGVYIFYLSIYLVAFG  123

Query  1620  NGGYQPNIATFGSDQFDGDHAHESVSKVAFFSYFYLALNLGSLFSNTVLVYFEDKGMWTL  1441
              GG+QP +ATFG+DQ+D  +  E   KVAFF YFY +LNLGSLFSNTVLVY+ED G WT+
Sbjct  124   YGGHQPTLATFGADQYDEKNPKERGLKVAFFCYFYFSLNLGSLFSNTVLVYYEDTGKWTM  183

Query  1440  GFWastvsavlalllflVGTPRYRHFAPKGNPLSRFSQVLVASARKWNVHLPSDGDDHRL  1261
             GF+ S +SAV+ALL FL G+PRYR+F P GNP++R +QV     RKWNV +P+  D  +L
Sbjct  184   GFFVSLISAVVALLCFLSGSPRYRYFKPSGNPVARIAQVFTIVVRKWNV-VPAKPD--KL  240

Query  1260  YEIQEHDSS---TRKILHTEGFKFLDKAAVITTKESVRDLEERNINPWRLCSVTQVEEVK  1090
             +E+    S+    RKILH++  KF+DKAA IT  +   D   RN NPWRLC+VTQVEE K
Sbjct  241   FEVNGSKSAIKGCRKILHSDDLKFMDKAATITEND---DENSRN-NPWRLCTVTQVEETK  296

Query  1089  CILRLLPIWLCTILYSVVFTQMASLFVEQGAAMRTNIAGFHIPPASMSSFDILSVAAFIF  910
             CILR+LP+WLCTI YS+VFTQMASLFVEQG AM + I  F +P ASMS+FDI SV  F  
Sbjct  297   CILRMLPVWLCTITYSIVFTQMASLFVEQGDAMNSRIGEFRLPAASMSAFDICSVLVFTG  356

Query  909   IYRRILDPLIASLKKTRRAQGFTELQRMGVGLiiaimamvaagiVEHFRLKYASTDCPRC  730
             +YR+IL P++  L  +   +G TELQRMG+GLI  +++MVA+G+ E  RL++      + 
Sbjct  357   VYRQILVPVVGRL--SGNPKGLTELQRMGIGLIFGMLSMVASGMTEIARLRHIIPG--QK  412

Query  729   PSSLSIFWQVPQYVLIGASEVFMYVGQLEFFNGQAPEGLKSFASALCMTSISLGNYVSSL  550
              SS+SIF+Q+PQYVL+GASEVFMYVGQLEFFNGQAP+GLKSF S+LCM S+SLGNY+SS+
Sbjct  413   SSSMSIFYQIPQYVLVGASEVFMYVGQLEFFNGQAPDGLKSFGSSLCMASMSLGNYMSSM  472

Query  549   LVSIVMRISTTHRMPGWIPGNLNKGHLDRFYFLLAALTTADFVVYILCAKWYKYIEFE  376
             LV+++MRI+      GWIP NLN GH+DRF+FLLA +   DFV+Y+ CAKWYK I  E
Sbjct  473   LVNVIMRITARGHDKGWIPDNLNTGHMDRFFFLLAGIVAFDFVLYLFCAKWYKSISVE  530



>gb|KHN24967.1| Putative peptide/nitrate transporter [Glycine soja]
Length=593

 Score =   650 bits (1677),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 348/600 (58%), Positives = 428/600 (71%), Gaps = 28/600 (5%)
 Frame = -3

Query  2100  ERDEEKASREECTLDGTVDHYGRPALRS---ATGGWFAGVLLLVNQGLATLAFFGVGVNL  1930
             E      + E   + G   HY   +  S     GGW    +LL NQ LATLAFFGVGVNL
Sbjct  9     ENSVNSVNIEAIEVTGGNGHYTEQSGTSHEKIKGGWKTANILLANQALATLAFFGVGVNL  68

Query  1929  VLFLTRVMGQDNADAANNVSKWTGTVYLFSLLGAFLSDSYWGRYKTCAIFQLIYVVGLIS  1750
             VLFLTRV+ Q++A+AANNVSKWTGTVY+FSL+GAFLSDSYWGRY TC IFQLI+VVGL  
Sbjct  69    VLFLTRVLHQESAEAANNVSKWTGTVYIFSLIGAFLSDSYWGRYLTCTIFQLIFVVGLGM  128

Query  1749  VSIFSFIFLVKPKGCGDENTPCRSPSRIHIAVYYVSIYLVALGNGGYQPNIATFGSDQFD  1570
             +S  S+ FL+KP GCG+E T C  PS + + ++Y+SIYLVA G GG+QP +ATFG+DQFD
Sbjct  129   LSFTSWRFLIKPAGCGNEETTCLEPSSLGVGIFYLSIYLVAFGYGGHQPTLATFGADQFD  188

Query  1569  GDHAHESVSKVAFFSYFYLALNLGSLFSNTVLVYFEDKGMWTLGFWastvsavlalllfl  1390
               +     ++  FF YFY ALN+GSLFSNTVLVY+E+ GMWT GF  S  SAV+AL+ +L
Sbjct  189   EKNEKHRDARETFFCYFYFALNVGSLFSNTVLVYYENSGMWTRGFLVSLASAVIALVSYL  248

Query  1389  VGTPRYRHFAPKGNPLSRFSQVLVASARKWNVHLPSDGDDHRLYEIQEHDSS---TRKIL  1219
              G  +Y++    GNP+ R  QV VA+ARKW V       + +LYE+   +S+   +RKIL
Sbjct  249   AGYQKYKYVKAHGNPVIRVVQVFVATARKWKV---GSAKEDQLYEVDGPESAIKGSRKIL  305

Query  1218  HTEGFKFLDKAAVITTKESVRDLEERNINPWRLCSVTQVEEVKCILRLLPIWLCTILYSV  1039
             H+  F+F+DKAA IT K++V        N WRLC+VTQVEE KC+LR+LP+WLCTI+YSV
Sbjct  306   HSNDFRFMDKAATITEKDAVHLK-----NHWRLCTVTQVEEAKCVLRMLPVWLCTIIYSV  360

Query  1038  VFTQMASLFVEQGAAMRTNIAGFHIPPASMSSFDILSVAAFIFIYRRILDPLIASLKKTR  859
             VFTQMASLFVEQG  M   I  FH+P ASMS FDI SV     IYR+IL PL   L    
Sbjct  361   VFTQMASLFVEQGNVMNNEIGKFHLPAASMSVFDICSVLLCTGIYRQILVPLAGRLSGNP  420

Query  858   RAQGFTELQRMGVGLiiaimamvaagiVEHFRLKYASTDCPR-CPSSLSIFWQVPQYVLI  682
             R  G TELQRMGVGL+I ++AM+AAG+ E  RLK+ +   PR   SSLSIFWQ+PQYVL+
Sbjct  421   R--GLTELQRMGVGLVIGMLAMLAAGVTEFERLKHVT---PREKASSLSIFWQIPQYVLV  475

Query  681   GASEVFMYVGQLEFFNGQAPEGLKSFASALCMTSISLGNYVSSLLVSIVMRISTTHRMPG  502
             GASEVFMYVGQLEFFNGQAP+G+KSF S+LCM S+SLGNYVSS+LV +VMRI+     PG
Sbjct  476   GASEVFMYVGQLEFFNGQAPDGIKSFGSSLCMASMSLGNYVSSMLVYMVMRITARGENPG  535

Query  501   WIPGNLNKGHLDRFYFLLAALTTADFVVYILCAKWYKYIEFEERNSCLKNIGDSKLQEDR  322
             WIP NLN GH+DRF+FL+A L   DFV+Y+LCA+WYK I   +        GD + QED+
Sbjct  536   WIPNNLNVGHMDRFFFLVAVLNALDFVLYLLCARWYKSINLGD--------GDMESQEDK  587



>ref|XP_010265895.1| PREDICTED: protein NRT1/ PTR FAMILY 7.1-like [Nelumbo nucifera]
 ref|XP_010265896.1| PREDICTED: protein NRT1/ PTR FAMILY 7.1-like [Nelumbo nucifera]
 ref|XP_010265897.1| PREDICTED: protein NRT1/ PTR FAMILY 7.1-like [Nelumbo nucifera]
 ref|XP_010265898.1| PREDICTED: protein NRT1/ PTR FAMILY 7.1-like [Nelumbo nucifera]
Length=612

 Score =   651 bits (1679),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 368/620 (59%), Positives = 452/620 (73%), Gaps = 39/620 (6%)
 Frame = -3

Query  2226  NKHLLRSLSGLVIKAGRFSLLSR*HTTMAAFLNITKMFFIKNERDEEKASREECTLDGTV  2047
             NK ++ ++   V+++G    L+R  T              +NE  E  ++RE      ++
Sbjct  8     NKDVVLNVGTSVVESGHGEELNRDST--------------ENEHVEVSSTRES-----SI  48

Query  2046  DHYGRPALRSATGGWFAGVLLLVNQGLATLAFFGVGVNLVLFLTRVMGQDNADAANNVSK  1867
             +      +R  +GGW    LLL NQGLATLAFFG GVNLVLFLTRV+ Q+NADAAN VSK
Sbjct  49    NGRQNSVIRGNSGGWKPAFLLLANQGLATLAFFGAGVNLVLFLTRVLEQENADAANXVSK  108

Query  1866  WTGTVYLFSLLGAFLSDSYWGRYKTCAIFQLIYVVGLISVSIFSFIFLVKPKGCGDENTP  1687
             WTGTVY+ SL+GAFLSDSYWGRY TCAIFQL++V+GL+ +S+ S++FL+KP+GCG+    
Sbjct  109   WTGTVYMCSLIGAFLSDSYWGRYLTCAIFQLVFVLGLVLLSLSSWLFLIKPEGCGNGVID  168

Query  1686  CRSPSRIHIAVYYVSIYLVALGNGGYQPNIATFGSDQFDGDHAHESVSKVAFFSYFYLAL  1507
             CR  S + IA++Y+SIYLVA G GG+QP IAT GSDQ D        SK AFF YFY AL
Sbjct  169   CRPASSVGIAIFYLSIYLVAFGYGGHQPTIATLGSDQVD------EPSKPAFFCYFYFAL  222

Query  1506  NLGSLFSNTVLVYFEDKGMWTLGFWastvsavlalllflVGTPRYRHFAPKGNPLSRFSQ  1327
             N+GSLFSNT+LVYFED G WTLGF  ST SAV+AL+LFLVGTPRYRHF P GNPL R +Q
Sbjct  223   NVGSLFSNTILVYFEDSGKWTLGFLTSTASAVIALILFLVGTPRYRHFKPCGNPLPRVAQ  282

Query  1326  VLVASARKWNVHLPSDGDDHRLYEIQEHDSS---TRKILHTEGFKFLDKAAVITTKESVR  1156
             V  A+ RKW V  P D +  +LYE++  +S+   +RKILH++ F FLDKAA +T      
Sbjct  283   VFNAAFRKWKVTAPKDAE--KLYELEGPESAIKGSRKILHSDEFGFLDKAATMTES----  336

Query  1155  DLEERNINPWRLCSVTQVEEVKCILRLLPIWLCTILYSVVFTQMASLFVEQGAAMRTNIA  976
             DL    ++PWRLC+VTQVEE KC+L++LPIWLCTI+YSVVFTQMASLFVEQGA M ++  
Sbjct  337   DLHGP-MDPWRLCTVTQVEEAKCVLKMLPIWLCTIIYSVVFTQMASLFVEQGAVMNSDAG  395

Query  975   GFHIPPASMSSFDILSVAAFIFIYRRILDPLIASLKKTRRAQGFTELQRMGVGLiiaima  796
              FH+P ASMS+FDI SV  F  IYR+IL P++  L  T   +G +ELQRMGVGL+I ++A
Sbjct  396   NFHLPAASMSAFDICSVLVFTGIYRQILVPVVGRL--TGNPKGLSELQRMGVGLVIGMLA  453

Query  795   mvaagiVEHFRLKYASTDCPRCPSSLSIFWQVPQYVLIGASEVFMYVGQLEFFNGQAPEG  616
             MVAAGI E  RL+  +       SSLSIFWQ+PQY L+GASEVFMYVGQLEFFNGQAP+G
Sbjct  454   MVAAGITELQRLEKVTPGNEI--SSLSIFWQIPQYTLVGASEVFMYVGQLEFFNGQAPDG  511

Query  615   LKSFASALCMTSISLGNYVSSLLVSIVMRISTTHRMPGWIPGNLNKGHLDRFYFLLAALT  436
             +KSF S+LCM SISLGNYVSSLLV +VM I+  +  PGWIPG+LN GH+DRFYFLLA LT
Sbjct  512   IKSFGSSLCMASISLGNYVSSLLVHMVMGITAKNNKPGWIPGDLNSGHMDRFYFLLAGLT  571

Query  435   TADFVVYILCAKWYKYIEFE  376
               DF VY+ CAKWYK I  E
Sbjct  572   AIDFGVYLFCAKWYKCINLE  591



>ref|XP_009376620.1| PREDICTED: protein NRT1/ PTR FAMILY 7.1-like, partial [Pyrus 
x bretschneideri]
Length=610

 Score =   649 bits (1673),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 348/553 (63%), Positives = 424/553 (77%), Gaps = 15/553 (3%)
 Frame = -3

Query  2025  LRSATGGWFAGVLLLVNQGLATLAFFGVGVNLVLFLTRVMGQDNADAANNVSKWTGTVYL  1846
             +R +TGGW    LLL NQ LATLAFFGVGVNLVLFLTRV+ Q+NADAAN+VSKWTGTVYL
Sbjct  53    IRKSTGGWKFASLLLANQALATLAFFGVGVNLVLFLTRVLDQENADAANSVSKWTGTVYL  112

Query  1845  FSLLGAFLSDSYWGRYKTCAIFQLIYVVGLISVSIFSFIFLVKPKGCGDENTPCRSPSRI  1666
              SL+GAFLSDSYWGRY TC IFQLI+++GL  +S+ S++FL  P GCGD  T C   S  
Sbjct  113   CSLVGAFLSDSYWGRYLTCTIFQLIFILGLALLSLSSWLFLFHPSGCGDGETMCMPESSD  172

Query  1665  HIAVYYVSIYLVALGNGGYQPNIATFGSDQFDGDHAHESVSKVAFFSYFYLALNLGSLFS  1486
              + ++Y+SIYLVA G GGYQP IATFGSDQFD  +  E  SK  FF YFY ALN+GSLFS
Sbjct  173   GVVIFYLSIYLVAFGYGGYQPTIATFGSDQFDEANPEERASKAVFFCYFYFALNVGSLFS  232

Query  1485  NTVLVYFEDKGMWTLGFWastvsavlalllflVGTPRYRHFAPKGNPLSRFSQVLVASAR  1306
             NT+LVY+ED G WTLGF  S  SAV+ALL FL+GTPRYR+  P GNPL R +QV VA+AR
Sbjct  233   NTILVYYEDTGKWTLGFVVSLGSAVIALLSFLLGTPRYRYIKPCGNPLPRVAQVFVAAAR  292

Query  1305  KWNVHLPSDGDDHRLYEIQEHDSS---TRKILHTEGFKFLDKAAVITTKESVRDLEERNI  1135
             KWN+   + GD   LYE++  +S+   +RKI H++  +FLDKAA IT      DL     
Sbjct  293   KWNIVPANSGD---LYEVEGPESAIKGSRKIYHSDEIEFLDKAATITED----DLSGPK-  344

Query  1134  NPWRLCSVTQVEEVKCILRLLPIWLCTILYSVVFTQMASLFVEQGAAMRTNIAGFHIPPA  955
             NPW+LC+VTQVEE KC+L++LPIWLCTI+YSVVFTQMASLFVEQG  M++N   FH+P A
Sbjct  345   NPWKLCTVTQVEEAKCVLKMLPIWLCTIIYSVVFTQMASLFVEQGDVMKSNFGDFHLPAA  404

Query  954   SMSSFDILSVAAFIFIYRRILDPLIASLKKTRRAQGFTELQRMGVGLiiaimamvaagiV  775
             SMS+FDI SV     IYR++L PL  + K +   +G +EL+RMG+GLII +++M+AAG+ 
Sbjct  405   SMSAFDICSVLICTGIYRQLLVPL--ARKISGNPKGLSELKRMGIGLIIGMLSMIAAGVT  462

Query  774   EHFRLKYASTDCPRCPSSLSIFWQVPQYVLIGASEVFMYVGQLEFFNGQAPEGLKSFASA  595
             E  RLK+         S+LSIFWQ+PQYVL+GASEVFMYVGQLEFFNGQAP+G+KSF S+
Sbjct  463   EIARLKHVQPH--EKISTLSIFWQIPQYVLVGASEVFMYVGQLEFFNGQAPDGIKSFGSS  520

Query  594   LCMTSISLGNYVSSLLVSIVMRISTTHRMPGWIPGNLNKGHLDRFYFLLAALTTADFVVY  415
             LCM SISLGNYVSS+LV +VM I+   + PGWIP +LN GH+DRFYFL+AALT  DFV+Y
Sbjct  521   LCMASISLGNYVSSMLVYMVMGITAKGKSPGWIPDDLNTGHMDRFYFLIAALTAFDFVIY  580

Query  414   ILCAKWYKYIEFE  376
             + CAKWYK I+FE
Sbjct  581   VFCAKWYKGIDFE  593



>gb|KHN27133.1| Putative peptide/nitrate transporter [Glycine soja]
Length=596

 Score =   648 bits (1671),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 354/598 (59%), Positives = 431/598 (72%), Gaps = 25/598 (4%)
 Frame = -3

Query  2094  DEEKASREECTLDGTVDHYGRPALRSATGGWFAGVLLLVNQGLATLAFFGVGVNLVLFLT  1915
             + + ++REE  L       G       TGG     LLLVNQ LATLAFFGVGVNLVLFLT
Sbjct  19    EGDSSNREESVLMERTSRAGE----KKTGGAKVASLLLVNQALATLAFFGVGVNLVLFLT  74

Query  1914  RVMGQDNADAANNVSKWTGTVYLFSLLGAFLSDSYWGRYKTCAIFQLIYVVGLISVSIFS  1735
             RV+GQDN +AANNVSKW GTVY+FSL+GAFLSDSYWGRY TC +FQL++V+GL   S+ S
Sbjct  75    RVLGQDNVNAANNVSKWIGTVYMFSLIGAFLSDSYWGRYLTCTVFQLVFVLGLALSSLSS  134

Query  1734  FIFLVKPKGCGDENTPCRSPSRIHIAVYYVSIYLVALGNGGYQPNIATFGSDQFDGDHAH  1555
             + FL+ P GCGD +TPC+ PS I   ++Y+SIYLVA G GG+QP +ATFG+DQ+D  +  
Sbjct  135   WRFLINPVGCGDGHTPCK-PSSIGDEIFYLSIYLVAFGYGGHQPTLATFGADQYDEKNPK  193

Query  1554  ESVSKVAFFSYFYLALNLGSLFSNTVLVYFEDKGMWTLGFWastvsavlalllflVGTPR  1375
             E  SKVAFF YFY ALN+GSLFSNTVLVY+ED GMWT+GF  S VSAV+A L FL+GTPR
Sbjct  194   EKSSKVAFFCYFYFALNVGSLFSNTVLVYYEDTGMWTMGFLVSLVSAVIAFLAFLLGTPR  253

Query  1374  YRHFAPKGNPLSRFSQVLVASARKWNVHLPSDGDDHRLYEIQEHDSS---TRKILHTEGF  1204
             YR+  P GNP+ R +QV  A  RKW V   S      LYE+    S+   +RKI HT+ F
Sbjct  254   YRYVKPCGNPVMRVAQVFSAVFRKWKV---SPAKAEELYEVDGPQSAIKGSRKIRHTDDF  310

Query  1203  KFLDKAAVITTKESVRDLEERNINPWRLCSVTQVEEVKCILRLLPIWLCTILYSVVFTQM  1024
             +F+DKAA I   E     E    NPWRLC+VTQVEE KC+LR+LP+WLCTI+YSVVFTQM
Sbjct  311   EFMDKAATIKETE-----EHSPKNPWRLCTVTQVEEAKCVLRMLPVWLCTIIYSVVFTQM  365

Query  1023  ASLFVEQGAAMRTNIAGFHIPPASMSSFDILSVAAFIFIYRRILDPLIASLKKTRRAQGF  844
             ASLFVEQG  M + I  FH+P ASMS+FDI SV     IYR+IL PL   L  +   +G 
Sbjct  366   ASLFVEQGDVMNSYIGSFHLPAASMSAFDICSVLVCTGIYRQILVPLAGRL--SGNPKGL  423

Query  843   TELQRMGVGLiiaimamvaagiVEHFRLKYASTDCPRCPSSLSIFWQVPQYVLIGASEVF  664
             +ELQRMG+GLII ++AMVA+G  E  RL+  S    +  SSLSIFWQ+PQYVL+GASEVF
Sbjct  424   SELQRMGIGLIIGMLAMVASGATEIARLRRISHG--QKTSSLSIFWQIPQYVLVGASEVF  481

Query  663   MYVGQLEFFNGQAPEGLKSFASALCMTSISLGNYVSSLLVSIVMRISTTHRMPGWIPGNL  484
             MYVGQLEFFNGQAP+G+KSF S+LCM SISLGNYVSS+LV++VM I+   +  GWIP NL
Sbjct  482   MYVGQLEFFNGQAPDGIKSFGSSLCMASISLGNYVSSMLVNMVMIITARGQNKGWIPENL  541

Query  483   NKGHLDRFYFLLAALTTADFVVYILCAKWYKYIEFEERNSCLKNIGDSKLQEDRSTFN  310
             N GH+DRF+FLLA L   DFV+Y+ CAKWYK I  E+      ++GD   +++    N
Sbjct  542   NTGHMDRFFFLLAGLAAFDFVLYLFCAKWYKSINIED-----SDMGDQGQEKEEDVNN  594



>ref|XP_006606590.1| PREDICTED: putative peptide/nitrate transporter At5g19640-like 
isoform X2 [Glycine max]
Length=596

 Score =   648 bits (1671),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 354/598 (59%), Positives = 431/598 (72%), Gaps = 25/598 (4%)
 Frame = -3

Query  2094  DEEKASREECTLDGTVDHYGRPALRSATGGWFAGVLLLVNQGLATLAFFGVGVNLVLFLT  1915
             + + ++REE  L       G       TGG     LLLVNQ LATLAFFGVGVNLVLFLT
Sbjct  19    EGDSSNREESVLMERTSRAGE----KKTGGAKVASLLLVNQALATLAFFGVGVNLVLFLT  74

Query  1914  RVMGQDNADAANNVSKWTGTVYLFSLLGAFLSDSYWGRYKTCAIFQLIYVVGLISVSIFS  1735
             RV+GQDN +AANNVSKW GTVY+FSL+GAFLSDSYWGRY TC +FQL++V+GL   S+ S
Sbjct  75    RVLGQDNVNAANNVSKWIGTVYMFSLIGAFLSDSYWGRYLTCTVFQLVFVLGLALSSLSS  134

Query  1734  FIFLVKPKGCGDENTPCRSPSRIHIAVYYVSIYLVALGNGGYQPNIATFGSDQFDGDHAH  1555
             + FL+ P GCGD +TPC+ PS I   ++Y+SIYLVA G GG+QP +ATFG+DQ+D  +  
Sbjct  135   WRFLINPVGCGDGHTPCK-PSSIGDEIFYLSIYLVAFGYGGHQPTLATFGADQYDEKNPK  193

Query  1554  ESVSKVAFFSYFYLALNLGSLFSNTVLVYFEDKGMWTLGFWastvsavlalllflVGTPR  1375
             E  SKVAFF YFY ALN+GSLFSNTVLVY+ED GMWT+GF  S VSAV+A L FL+GTPR
Sbjct  194   EKSSKVAFFCYFYFALNVGSLFSNTVLVYYEDTGMWTMGFLVSLVSAVIAFLAFLLGTPR  253

Query  1374  YRHFAPKGNPLSRFSQVLVASARKWNVHLPSDGDDHRLYEIQEHDSS---TRKILHTEGF  1204
             YR+  P GNP+ R +QV  A  RKW V   S      LYE+    S+   +RKI HT+ F
Sbjct  254   YRYVKPCGNPVMRVAQVFSAVFRKWKV---SPAKAEELYEVDGPQSAIKGSRKIRHTDDF  310

Query  1203  KFLDKAAVITTKESVRDLEERNINPWRLCSVTQVEEVKCILRLLPIWLCTILYSVVFTQM  1024
             +F+DKAA I   E     E    NPWRLC+VTQVEE KC+LR+LP+WLCTI+YSVVFTQM
Sbjct  311   EFMDKAATIKETE-----EHSPKNPWRLCTVTQVEEAKCVLRMLPVWLCTIIYSVVFTQM  365

Query  1023  ASLFVEQGAAMRTNIAGFHIPPASMSSFDILSVAAFIFIYRRILDPLIASLKKTRRAQGF  844
             ASLFVEQG  M + I  FH+P ASMS+FDI SV     IYR+IL PL   L  +   +G 
Sbjct  366   ASLFVEQGDVMNSYIGSFHLPAASMSAFDICSVLVCTGIYRQILVPLAGRL--SGNPKGL  423

Query  843   TELQRMGVGLiiaimamvaagiVEHFRLKYASTDCPRCPSSLSIFWQVPQYVLIGASEVF  664
             +ELQRMG+GLII ++AMVA+G  E  RL+  S    +  SSLSIFWQ+PQYVL+GASEVF
Sbjct  424   SELQRMGIGLIIGMLAMVASGATEIARLRRISHG--QKTSSLSIFWQIPQYVLVGASEVF  481

Query  663   MYVGQLEFFNGQAPEGLKSFASALCMTSISLGNYVSSLLVSIVMRISTTHRMPGWIPGNL  484
             MYVGQLEFFNGQAP+G+KSF S+LCM SISLGNYVSS+LV++VM I+   +  GWIP NL
Sbjct  482   MYVGQLEFFNGQAPDGIKSFGSSLCMASISLGNYVSSMLVNMVMIITARGQSKGWIPENL  541

Query  483   NKGHLDRFYFLLAALTTADFVVYILCAKWYKYIEFEERNSCLKNIGDSKLQEDRSTFN  310
             N GH+DRF+FLLA L   DFV+Y+ CAKWYK I  E+      ++GD   +++    N
Sbjct  542   NTGHMDRFFFLLAGLAAFDFVLYLFCAKWYKSINIED-----SDMGDQGQEKEEDVNN  594



>ref|XP_003555644.2| PREDICTED: putative peptide/nitrate transporter At5g19640-like 
isoform X1 [Glycine max]
Length=603

 Score =   648 bits (1672),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 354/598 (59%), Positives = 431/598 (72%), Gaps = 25/598 (4%)
 Frame = -3

Query  2094  DEEKASREECTLDGTVDHYGRPALRSATGGWFAGVLLLVNQGLATLAFFGVGVNLVLFLT  1915
             + + ++REE  L       G       TGG     LLLVNQ LATLAFFGVGVNLVLFLT
Sbjct  26    EGDSSNREESVLMERTSRAGE----KKTGGAKVASLLLVNQALATLAFFGVGVNLVLFLT  81

Query  1914  RVMGQDNADAANNVSKWTGTVYLFSLLGAFLSDSYWGRYKTCAIFQLIYVVGLISVSIFS  1735
             RV+GQDN +AANNVSKW GTVY+FSL+GAFLSDSYWGRY TC +FQL++V+GL   S+ S
Sbjct  82    RVLGQDNVNAANNVSKWIGTVYMFSLIGAFLSDSYWGRYLTCTVFQLVFVLGLALSSLSS  141

Query  1734  FIFLVKPKGCGDENTPCRSPSRIHIAVYYVSIYLVALGNGGYQPNIATFGSDQFDGDHAH  1555
             + FL+ P GCGD +TPC+ PS I   ++Y+SIYLVA G GG+QP +ATFG+DQ+D  +  
Sbjct  142   WRFLINPVGCGDGHTPCK-PSSIGDEIFYLSIYLVAFGYGGHQPTLATFGADQYDEKNPK  200

Query  1554  ESVSKVAFFSYFYLALNLGSLFSNTVLVYFEDKGMWTLGFWastvsavlalllflVGTPR  1375
             E  SKVAFF YFY ALN+GSLFSNTVLVY+ED GMWT+GF  S VSAV+A L FL+GTPR
Sbjct  201   EKSSKVAFFCYFYFALNVGSLFSNTVLVYYEDTGMWTMGFLVSLVSAVIAFLAFLLGTPR  260

Query  1374  YRHFAPKGNPLSRFSQVLVASARKWNVHLPSDGDDHRLYEIQEHDSS---TRKILHTEGF  1204
             YR+  P GNP+ R +QV  A  RKW V   S      LYE+    S+   +RKI HT+ F
Sbjct  261   YRYVKPCGNPVMRVAQVFSAVFRKWKV---SPAKAEELYEVDGPQSAIKGSRKIRHTDDF  317

Query  1203  KFLDKAAVITTKESVRDLEERNINPWRLCSVTQVEEVKCILRLLPIWLCTILYSVVFTQM  1024
             +F+DKAA I   E     E    NPWRLC+VTQVEE KC+LR+LP+WLCTI+YSVVFTQM
Sbjct  318   EFMDKAATIKETE-----EHSPKNPWRLCTVTQVEEAKCVLRMLPVWLCTIIYSVVFTQM  372

Query  1023  ASLFVEQGAAMRTNIAGFHIPPASMSSFDILSVAAFIFIYRRILDPLIASLKKTRRAQGF  844
             ASLFVEQG  M + I  FH+P ASMS+FDI SV     IYR+IL PL   L  +   +G 
Sbjct  373   ASLFVEQGDVMNSYIGSFHLPAASMSAFDICSVLVCTGIYRQILVPLAGRL--SGNPKGL  430

Query  843   TELQRMGVGLiiaimamvaagiVEHFRLKYASTDCPRCPSSLSIFWQVPQYVLIGASEVF  664
             +ELQRMG+GLII ++AMVA+G  E  RL+  S    +  SSLSIFWQ+PQYVL+GASEVF
Sbjct  431   SELQRMGIGLIIGMLAMVASGATEIARLRRISHG--QKTSSLSIFWQIPQYVLVGASEVF  488

Query  663   MYVGQLEFFNGQAPEGLKSFASALCMTSISLGNYVSSLLVSIVMRISTTHRMPGWIPGNL  484
             MYVGQLEFFNGQAP+G+KSF S+LCM SISLGNYVSS+LV++VM I+   +  GWIP NL
Sbjct  489   MYVGQLEFFNGQAPDGIKSFGSSLCMASISLGNYVSSMLVNMVMIITARGQSKGWIPENL  548

Query  483   NKGHLDRFYFLLAALTTADFVVYILCAKWYKYIEFEERNSCLKNIGDSKLQEDRSTFN  310
             N GH+DRF+FLLA L   DFV+Y+ CAKWYK I  E+      ++GD   +++    N
Sbjct  549   NTGHMDRFFFLLAGLAAFDFVLYLFCAKWYKSINIED-----SDMGDQGQEKEEDVNN  601



>ref|XP_009791514.1| PREDICTED: protein NRT1/ PTR FAMILY 7.1 [Nicotiana sylvestris]
 ref|XP_009791515.1| PREDICTED: protein NRT1/ PTR FAMILY 7.1 [Nicotiana sylvestris]
Length=599

 Score =   648 bits (1671),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 344/563 (61%), Positives = 423/563 (75%), Gaps = 16/563 (3%)
 Frame = -3

Query  2025  LRSA-TGGWFAGVLLLVNQGLATLAFFGVGVNLVLFLTRVMGQDNADAANNVSKWTGTVY  1849
             LRS  TGGW++  L LVNQGLATLAFFGVGVNLVLFL RV+GQDNA AANNVSKWTGTVY
Sbjct  37    LRSKKTGGWYSAFLCLVNQGLATLAFFGVGVNLVLFLVRVLGQDNATAANNVSKWTGTVY  96

Query  1848  LFSLLGAFLSDSYWGRYKTCAIFQLIYVVGLISVSIFSFIFLVKPKGCGDENTPCRSPSR  1669
             L SLLGAF+SDSYWGR+ TCAIFQLI ++GL+ +SI S+IFL+KP GCGD    C  PS 
Sbjct  97    LCSLLGAFISDSYWGRFLTCAIFQLILLLGLVIMSITSWIFLIKPNGCGDGILNCVPPSP  156

Query  1668  IHIAVYYVSIYLVALGNGGYQPNIATFGSDQFDGDHAHESVSKVAFFSYFYLALNLGSLF  1489
             +  A++Y++IYLVALG GG+QP IATFGSDQFD  +  E +S+ A+F YFY ALN GSL 
Sbjct  157   LGTALFYLAIYLVALGYGGHQPTIATFGSDQFDEANPKEKISRAAYFGYFYFALNAGSLI  216

Query  1488  SNTVLVYFEDKGMWTLGFWastvsavlalllflVGTPRYRHFAPKGNPLSRFSQVLVASA  1309
             SNT+LVY+ED G WTLGFWAST +A+L L +FL+GTP Y++    GNPL R +QV VA+ 
Sbjct  217   SNTILVYYEDGGKWTLGFWASTAAALLGLFIFLLGTPGYKYVKSFGNPLPRVAQVFVAAV  276

Query  1308  RKWNVHLPSDGDDHRLYEIQEHDSS---TRKILHTEGFKFLDKAAVITTKESVRDLEERN  1138
             RKW V   ++ +   LYE+   +SS   TRKILH+  FK LDKAA++T +    D +   
Sbjct  277   RKWRV---ANVEGEELYEVDGSESSIKGTRKILHSNDFKKLDKAAIVTEE----DRQRPA  329

Query  1137  INPWRLCSVTQVEEVKCILRLLPIWLCTILYSVVFTQMASLFVEQGAAMRTNIAGFHIPP  958
              NPWRLC++TQVEE KCI+R+ PIWLCTI+YSV+FTQMASLFVEQG  M   I  F +P 
Sbjct  330   FNPWRLCTITQVEEAKCIIRMCPIWLCTIMYSVIFTQMASLFVEQGEVMDATIGHFRLPA  389

Query  957   ASMSSFDILSVAAFIFIYRRILDPLIASLKKTRRAQGFTELQRMGVGLiiaimamvaagi  778
             ASMS+FDI SV A  F+YR ++ PL    K +   +G TELQRMGVGL+I +++MVAAG+
Sbjct  390   ASMSAFDICSVLACTFLYRFMVVPLAG--KISGNPKGLTELQRMGVGLVIGMLSMVAAGV  447

Query  777   VEHFRLKYASTDCPRCPSSLSIFWQVPQYVLIGASEVFMYVGQLEFFNGQAPEGLKSFAS  598
              E +RLK+      +  SSLSIFWQ+PQY+L+GASEVFMYVGQLEFFNGQAP+G+KS  S
Sbjct  448   TEIYRLKHVIPG--KEASSLSIFWQIPQYILVGASEVFMYVGQLEFFNGQAPDGIKSLGS  505

Query  597   ALCMTSISLGNYVSSLLVSIVMRISTTHRMPGWIPGNLNKGHLDRFYFLLAALTTADFVV  418
             +LCM S+SLGNYVSS+LV++VM I+      GWIP NLN GH+DRFYFLL  L   D   
Sbjct  506   SLCMASMSLGNYVSSMLVNMVMTITARGERHGWIPENLNNGHIDRFYFLLFGLALVDLFA  565

Query  417   YILCAKWYKYIEFEERN-SCLKN  352
             +++ AKWYK I+ E  + SC K 
Sbjct  566   FVVFAKWYKGIQHEGSDESCTKE  588



>ref|XP_006586602.1| PREDICTED: putative peptide/nitrate transporter At5g19640-like 
[Glycine max]
Length=629

 Score =   648 bits (1671),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 352/616 (57%), Positives = 433/616 (70%), Gaps = 32/616 (5%)
 Frame = -3

Query  2136  FLNITKMFFIKNERDEEKASR----EECTLDGTVDHYGRPALRS---ATGGWFAGVLLLV  1978
             F  I + F I  E   E +      E   + G   HY   +  S     GGW    +LL 
Sbjct  29    FDTIPEQFIISMEPGIENSVNSVNIEAIEVTGGNGHYTEQSGTSHEKIKGGWKTANILLA  88

Query  1977  NQGLATLAFFGVGVNLVLFLTRVMGQDNADAANNVSKWTGTVYLFSLLGAFLSDSYWGRY  1798
             NQ LATLAFFGVGVNLVLFLTRV+ Q++A+AANNVSKWTGTVY+FSL+GAFLSDSYWGRY
Sbjct  89    NQALATLAFFGVGVNLVLFLTRVLHQESAEAANNVSKWTGTVYIFSLIGAFLSDSYWGRY  148

Query  1797  KTCAIFQLIYVVGLISVSIFSFIFLVKPKGCGDENTPCRSPSRIHIAVYYVSIYLVALGN  1618
              TC IFQLI+VVGL  +S  S+ FL+KP GCG+E T C  PS + + ++Y+SIYLVA G 
Sbjct  149   LTCTIFQLIFVVGLGMLSFTSWRFLIKPAGCGNEETTCLEPSSLGVGIFYLSIYLVAFGY  208

Query  1617  GGYQPNIATFGSDQFDGDHAHESVSKVAFFSYFYLALNLGSLFSNTVLVYFEDKGMWTLG  1438
             GG+QP +ATFG+DQFD  +     ++  FF YFY ALN+GSLFSNTVLVY+E+ GMWT G
Sbjct  209   GGHQPTLATFGADQFDEKNEKHRDARETFFCYFYFALNVGSLFSNTVLVYYENSGMWTRG  268

Query  1437  FWastvsavlalllflVGTPRYRHFAPKGNPLSRFSQVLVASARKWNVHLPSDGDDHRLY  1258
             F  S  SAV+AL+ +L G  +Y++    GNP+ R  QV VA+ARKW V       + +LY
Sbjct  269   FLVSLASAVIALVSYLAGYQKYKYVKAHGNPVIRVVQVFVATARKWKV---GSAKEDQLY  325

Query  1257  EIQEHDSS---TRKILHTEGFKFLDKAAVITTKESVRDLEERNINPWRLCSVTQVEEVKC  1087
             E+   +S+   +RKILH+  F+F+DKAA IT K++V        N WRLC+VTQVEE KC
Sbjct  326   EVDGPESAIKGSRKILHSNDFRFMDKAATITEKDAVHLK-----NHWRLCTVTQVEEAKC  380

Query  1086  ILRLLPIWLCTILYSVVFTQMASLFVEQGAAMRTNIAGFHIPPASMSSFDILSVAAFIFI  907
             +LR+LP+WLCTI+YSVVFTQMASLFVEQG  M   I  FH+P ASMS  DI SV     I
Sbjct  381   VLRMLPVWLCTIIYSVVFTQMASLFVEQGNVMNNEIGKFHLPAASMSVLDICSVLLCTGI  440

Query  906   YRRILDPLIASLKKTRRAQGFTELQRMGVGLiiaimamvaagiVEHFRLKYASTDCPR-C  730
             YR+IL PL   L    R  G TELQRMGVGL+I ++AM+AAG+ E  RLK+ +   PR  
Sbjct  441   YRQILVPLAGRLSGNPR--GLTELQRMGVGLVIGMLAMLAAGVTEFERLKHVT---PREK  495

Query  729   PSSLSIFWQVPQYVLIGASEVFMYVGQLEFFNGQAPEGLKSFASALCMTSISLGNYVSSL  550
              SSLSIFWQ+PQYVL+GASEVFMYVGQLEFFNGQAP+G+KSF S+LCM S+SLGNYVSS+
Sbjct  496   ASSLSIFWQIPQYVLVGASEVFMYVGQLEFFNGQAPDGIKSFGSSLCMASMSLGNYVSSM  555

Query  549   LVSIVMRISTTHRMPGWIPGNLNKGHLDRFYFLLAALTTADFVVYILCAKWYKYIEFEER  370
             LV +VMRI+     PGWIP NLN GH+DRF+FL+A L   DFV+Y+LCA+WYK I   + 
Sbjct  556   LVYMVMRITARGENPGWIPNNLNVGHMDRFFFLVAVLNALDFVLYLLCARWYKSINLGD-  614

Query  369   NSCLKNIGDSKLQEDR  322
                    GD + QED+
Sbjct  615   -------GDMESQEDK  623



>ref|XP_010087388.1| Putative peptide/nitrate transporter [Morus notabilis]
 gb|EXB28998.1| Putative peptide/nitrate transporter [Morus notabilis]
Length=668

 Score =   649 bits (1673),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 342/577 (59%), Positives = 422/577 (73%), Gaps = 17/577 (3%)
 Frame = -3

Query  2037  GRPALRSATGGWFAGVLLLVNQGLATLAFFGVGVNLVLFLTRVMGQDNADAANNVSKWTG  1858
             G   +R  TGGW    LLL NQ LATL FFGVGVNLVLFLTRV+ QD ADAAN+VSKWTG
Sbjct  99    GSSLIRKRTGGWRYANLLLANQALATLCFFGVGVNLVLFLTRVLDQDTADAANSVSKWTG  158

Query  1857  TVYLFSLLGAFLSDSYWGRYKTCAIFQLIYVVGLISVSIFSFIFLVKPKGCGDENTPCRS  1678
             TVYL SL+GAFLSDSYWGRY TCA+FQ I V+G   +SI S+ FL+KP+GCGD    C  
Sbjct  159   TVYLCSLIGAFLSDSYWGRYLTCALFQGILVLGCALLSISSWFFLIKPEGCGDGELECMP  218

Query  1677  PSRIHIAVYYVSIYLVALGNGGYQPNIATFGSDQFDGDHAHESVSKVAFFSYFYLALNLG  1498
              S + +A++Y SIYLVA G GG+QP +ATFGSDQFD  +  E  SK AFF +FY ALN+G
Sbjct  219   SSTLGVAIFYTSIYLVAFGYGGHQPTLATFGSDQFDESNPKEKDSKTAFFCFFYFALNVG  278

Query  1497  SLFSNTVLVYFEDKGMWTLGFWastvsavlalllflVGTPRYRHFAPKGNPLSRFSQVLV  1318
             SLFSNTVLVY+E+ G WTLGF  S  SAV+AL+ FL G+P YRH  P GNP+ R +QV  
Sbjct  279   SLFSNTVLVYYENTGRWTLGFLVSLGSAVVALVSFLFGSPGYRHVEPSGNPIPRVAQVFT  338

Query  1317  ASARKWNVHLPSDGDDHRLYEIQEHDSS---TRKILHTEGFKFLDKAAVITTKESVRDLE  1147
             A+++KW +      +   LYE++  +S+   +RKILH+ GF FLDKAA +T K+    + 
Sbjct  339   AASKKWKI---VAANPEELYEVEGSESAIKGSRKILHSNGFSFLDKAATLTEKDLAGPM-  394

Query  1146  ERNINPWRLCSVTQVEEVKCILRLLPIWLCTILYSVVFTQMASLFVEQGAAMRTNIAGFH  967
                 NPWR+C+VTQVEE KC+L++ PIWLCTI+YSVVFTQMASLFVEQG  M +++  F 
Sbjct  395   ----NPWRICTVTQVEEAKCVLKMFPIWLCTIIYSVVFTQMASLFVEQGDLMDSHVGNFR  450

Query  966   IPPASMSSFDILSVAAFIFIYRRILDPLIASLKKTRRAQGFTELQRMGVGLiiaimamva  787
             +P ASMS+FDI SV     IYR+IL P+   L  +   +G TEL RMG+GLII ++AM+A
Sbjct  451   LPAASMSAFDIFSVLICTGIYRQILVPIAGRL--SGNPKGLTELHRMGIGLIIGMLAMLA  508

Query  786   agiVEHFRLKYASTDCPRCPSSLSIFWQVPQYVLIGASEVFMYVGQLEFFNGQAPEGLKS  607
             AGI E  RLK    +     SSLSIFWQVPQYVL+GASEVFMY+GQLEFFNGQAP+G+KS
Sbjct  509   AGITEVERLKRVIPE--EKTSSLSIFWQVPQYVLVGASEVFMYIGQLEFFNGQAPDGIKS  566

Query  606   FASALCMTSISLGNYVSSLLVSIVMRISTTHRMPGWIPGNLNKGHLDRFYFLLAALTTAD  427
             F S+LCM SISLGNYVSSLLV++VM I+     PGWI  +LN GH+DRFYFL+AALT  D
Sbjct  567   FGSSLCMASISLGNYVSSLLVNMVMGITAKGEQPGWISDDLNAGHMDRFYFLIAALTAFD  626

Query  426   FVVYILCAKWYKYIEFEERNSCLKNIGDSKL--QEDR  322
             FVVY+ CAKWYK I  ++    ++++ +  +  QED 
Sbjct  627   FVVYVFCAKWYKCINIDDNGKEIQSVEEESVIEQEDE  663



>ref|XP_010235838.1| PREDICTED: protein NRT1/ PTR FAMILY 7.2-like [Brachypodium distachyon]
Length=619

 Score =   647 bits (1668),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 350/581 (60%), Positives = 423/581 (73%), Gaps = 19/581 (3%)
 Frame = -3

Query  2100  ERDEEKASREECTLDGTVDHYGRPALRSATGGWFAGVLLLVNQGLATLAFFGVGVNLVLF  1921
             ER   K    E TLDG+VD  GRPA++  +GGW AG L+LVNQGLAT+AFFGV VNLVLF
Sbjct  20    ERSAAKEKLCEYTLDGSVDIKGRPAVKGKSGGWLAGGLILVNQGLATMAFFGVNVNLVLF  79

Query  1920  LTRVMGQDNADAANNVSKWTGTVYLFSLLGAFLSDSYWGRYKTCAIFQLIYVVGLISVSI  1741
             LTRV+ Q N DAANNVSKWTGTVY+FSL+GAFLSDSYWGRYKTCAIFQ I+V+GL  +S+
Sbjct  80    LTRVVQQSNGDAANNVSKWTGTVYMFSLIGAFLSDSYWGRYKTCAIFQAIFVLGLALLSL  139

Query  1740  FSFIFLVKPKGCGDENTPCRSPSRIHIAVYYVSIYLVALGNGGYQPNIATFGSDQFDGDH  1561
              S ++L++P GCG + TPC   S   + ++Y+++Y++A GNGGYQPNIATFG+DQFD + 
Sbjct  140   SSRLYLIRPFGCGTQGTPCAPHSGAEMGIFYIALYMIAFGNGGYQPNIATFGADQFDEED  199

Query  1560  AHESVSKVAFFSYFYLALNLGSLFSNTVLVYFEDKGMWTLGFWastvsavlalllflVGT  1381
               E+ SKV+FFSYFYLALNLGSLFSNT L Y +DKG W LGFWAST +A  ALLLFL GT
Sbjct  200   PAEAHSKVSFFSYFYLALNLGSLFSNTFLSYIQDKGNWVLGFWASTAAAATALLLFLSGT  259

Query  1380  PRYRHFAPKGNPLSRFSQVLVASARKWNVHLPSD------GDDHRLYEIQEHDSSTRKIL  1219
             P+YRH  P GNP+    QV  A+ R W   +  D      GDD       + DS  RK+L
Sbjct  260   PQYRHAQPCGNPIGSICQVASAACRNWKSGVSPDHEVLYEGDDG-----SKADSGGRKLL  314

Query  1218  HTEGFKFLDKAAVITTKESVRDLEERNINP---WRLCSVTQVEEVKCILRLLPIWLCTIL  1048
             HTEGF+FLD+AA+    +S   L      P   W+LC+VTQVE+VK ILRLLPIWLCTIL
Sbjct  315   HTEGFRFLDRAALTKASDSNTKLGGACPGPRDQWKLCTVTQVEQVKSILRLLPIWLCTIL  374

Query  1047  YSVVFTQMASLFVEQGAAMR--TNIAGFHIPPASMSSFDILSVAAFIFIYRRILDPLIAS  874
             YSVVFTQMASLFV QGAAMR  T   GF++P +SMS+FDIL+VA  IF+YRR + P +A 
Sbjct  375   YSVVFTQMASLFVVQGAAMRRTTMFPGFYVPASSMSAFDILTVATTIFLYRRAICPFLAR  434

Query  873   LKKTRRAQGFTELQRMGVGLiiaimamvaagiVEHFRLKYASTDCPRCPSSLSIFWQVPQ  694
             L  T R  G TELQRMG+GL++  MAM  AG VEHFR K  +T      S L I WQVPQ
Sbjct  435   L--TGRPTGPTELQRMGLGLVLGAMAMATAGTVEHFR-KAGATGTAANSSDLHIIWQVPQ  491

Query  693   YVLIGASEVFMYVGQLEFFNGQAPEGLKSFASALCMTSISLGNYVSSLLVSIVMRISTTH  514
             Y LIG SEV MYVGQLEFFNG+ P+G KSF SALCM S+SLGNY S ++++ V R +   
Sbjct  492   YALIGVSEVMMYVGQLEFFNGEMPDGFKSFGSALCMMSMSLGNYFSDVILTAVTRATAVD  551

Query  513   RMPGWIPGNLNKGHLDRFYFLLAALTTADFVVYILCAKWYK  391
               PGW+P +LN+GHL++FYFLLA L  ADF VY++ A  Y+
Sbjct  552   GRPGWVPDDLNEGHLNKFYFLLAILAVADFAVYLVFASRYR  592



>ref|XP_002283281.3| PREDICTED: protein NRT1/ PTR FAMILY 7.1 isoform X2 [Vitis vinifera]
Length=570

 Score =   644 bits (1662),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 351/551 (64%), Positives = 422/551 (77%), Gaps = 15/551 (3%)
 Frame = -3

Query  2019  SATGGWFAGVLLLVNQGLATLAFFGVGVNLVLFLTRVMGQDNADAANNVSKWTGTVYLFS  1840
             +ATGGW +  LLL NQGLATLAFFGVGVNLVLFLTRV+ QDNA+AAN+VSKWTGTVYL S
Sbjct  14    NATGGWKSASLLLANQGLATLAFFGVGVNLVLFLTRVLSQDNANAANSVSKWTGTVYLCS  73

Query  1839  LLGAFLSDSYWGRYKTCAIFQLIYVVGLISVSIFSFIFLVKPKGCGDENTPCRSPSRIHI  1660
             L+GAFLSDSYWGRY TCAIFQ+I V+GL+ +S+ S++FL++PKGCGD  T C   S + +
Sbjct  74    LIGAFLSDSYWGRYLTCAIFQVILVLGLLLLSLSSWLFLIEPKGCGDRTTLCSPSSSVGL  133

Query  1659  AVYYVSIYLVALGNGGYQPNIATFGSDQFDGDHAHESVSKVAFFSYFYLALNLGSLFSNT  1480
              V+Y SIYLVA G GG+QP +AT G+DQFD  +  E  SK  FFSYFY ALNLGSLFSNT
Sbjct  134   GVFYSSIYLVAFGYGGHQPTLATLGADQFDETNPREMNSKTVFFSYFYFALNLGSLFSNT  193

Query  1479  VLVYFEDKGMWTLGFWastvsavlalllflVGTPRYRHFAPKGNPLSRFSQVLVASARKW  1300
             +LVYFED G WTLGF  ST SA++AL++FL G+  YRH  P GNPL R +QV VA+ RKW
Sbjct  194   ILVYFEDSGKWTLGFLVSTGSAIIALVIFLCGSSGYRHIKPCGNPLPRVAQVFVAAFRKW  253

Query  1299  NVHLPSDGDDHRLYEIQEHDSS---TRKILHTEGFKFLDKAAVITTKESVRDLEERNINP  1129
             +V +P +GD   LYE++  +S+   +RKILH+   +FLDKAA +   + V      + NP
Sbjct  254   DVVVPENGDG--LYELEGSESAIKGSRKILHSNEIEFLDKAATMIEADMV------DPNP  305

Query  1128  WRLCSVTQVEEVKCILRLLPIWLCTILYSVVFTQMASLFVEQGAAMRTNIAGFHIPPASM  949
             WRLC+VTQVEE KC++++LPIWLCTI+YSV+FTQMASLFVEQG  M   I  F IP ASM
Sbjct  306   WRLCTVTQVEEAKCVIKMLPIWLCTIIYSVIFTQMASLFVEQGDVMNRKIGNFEIPAASM  365

Query  948   SSFDILSVAAFIFIYRRILDPLIASLKKTRRAQGFTELQRMGVGLiiaimamvaagiVEH  769
             S+FDI SV     IYR+IL P+  S K T   +G +ELQRMG+GLII I AM+AAG+ E 
Sbjct  366   SAFDIFSVLLCTGIYRQILVPI--SGKLTGNPKGMSELQRMGIGLIIGIAAMIAAGLTEL  423

Query  768   FRLKYASTDCPRCPSSLSIFWQVPQYVLIGASEVFMYVGQLEFFNGQAPEGLKSFASALC  589
              RL+  S +     SSLSIFWQ PQYVL+GASEVFMYVGQLEFFNGQAP+G+KS  S+LC
Sbjct  424   GRLRRVSPN--EEASSLSIFWQTPQYVLVGASEVFMYVGQLEFFNGQAPDGIKSLGSSLC  481

Query  588   MTSISLGNYVSSLLVSIVMRISTTHRMPGWIPGNLNKGHLDRFYFLLAALTTADFVVYIL  409
             M SISLGNYVSSLLV+IVM ++T    PGWIP +LN GHLDRFYFL+A LT  DFV+Y+ 
Sbjct  482   MASISLGNYVSSLLVNIVMGVTTRGDNPGWIPEDLNTGHLDRFYFLIAVLTVIDFVIYVF  541

Query  408   CAKWYKYIEFE  376
             CAKWYK I  E
Sbjct  542   CAKWYKSINLE  552



>ref|XP_008352266.1| PREDICTED: protein NRT1/ PTR FAMILY 7.1-like [Malus domestica]
Length=610

 Score =   645 bits (1664),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 347/556 (62%), Positives = 423/556 (76%), Gaps = 15/556 (3%)
 Frame = -3

Query  2025  LRSATGGWFAGVLLLVNQGLATLAFFGVGVNLVLFLTRVMGQDNADAANNVSKWTGTVYL  1846
             +R +TGGW    LLL NQ LATLAFFGVGVNLVLFLTRV+ Q+NADAAN+VSKWTGTVYL
Sbjct  52    IRKSTGGWKFASLLLANQALATLAFFGVGVNLVLFLTRVLDQENADAANSVSKWTGTVYL  111

Query  1845  FSLLGAFLSDSYWGRYKTCAIFQLIYVVGLISVSIFSFIFLVKPKGCGDENTPCRSPSRI  1666
              SL+GAFLSDSYWGRY TC IFQLI+V+GL  +S+ S++FL  P GCG+  T C   S +
Sbjct  112   CSLVGAFLSDSYWGRYLTCTIFQLIFVLGLALLSLSSWLFLFHPSGCGBGETMCMPESSV  171

Query  1665  HIAVYYVSIYLVALGNGGYQPNIATFGSDQFDGDHAHESVSKVAFFSYFYLALNLGSLFS  1486
              +A++Y+SIYLVA G GGYQP IATFGSDQFD  +  E  SK  FF YFY ALN+GSLFS
Sbjct  172   GVAIFYLSIYLVAFGYGGYQPTIATFGSDQFDEANPKERASKAVFFCYFYFALNVGSLFS  231

Query  1485  NTVLVYFEDKGMWTLGFWastvsavlalllflVGTPRYRHFAPKGNPLSRFSQVLVASAR  1306
             NT+LVY+ED G WTLGF  S  SAV+ALL FL+GTPRYR+  P GNPL R +QV VA+AR
Sbjct  232   NTILVYYEDTGKWTLGFVVSLGSAVIALLSFLLGTPRYRYIIPCGNPLPRIAQVFVAAAR  291

Query  1305  KWNVHLPSDGDDHRLYEIQEHDSS---TRKILHTEGFKFLDKAAVITTKESVRDLEERNI  1135
             KWN+   + GD   LYE++  +S+   +RKI H++  +FLDKAA IT      DL     
Sbjct  292   KWNIVPANSGD---LYEVEGPESAIKGSRKIYHSDEIEFLDKAATITED----DLSGPK-  343

Query  1134  NPWRLCSVTQVEEVKCILRLLPIWLCTILYSVVFTQMASLFVEQGAAMRTNIAGFHIPPA  955
             NPWRLC+VTQVEE KC+L++LPIWLCTI+YSVVFTQMASLFVEQG  M++N   FH+P A
Sbjct  344   NPWRLCTVTQVEEAKCVLKMLPIWLCTIIYSVVFTQMASLFVEQGDVMKSNFGDFHLPAA  403

Query  954   SMSSFDILSVAAFIFIYRRILDPLIASLKKTRRAQGFTELQRMGVGLiiaimamvaagiV  775
             SMS+FDI SV     IYR++L PL    K +   +G +EL+RMG+GLII +++M+AAG+ 
Sbjct  404   SMSAFDICSVLICTGIYRQLLVPLAG--KISGNPKGLSELKRMGIGLIIGMLSMIAAGVT  461

Query  774   EHFRLKYASTDCPRCPSSLSIFWQVPQYVLIGASEVFMYVGQLEFFNGQAPEGLKSFASA  595
             E  RLK+         S+LSIFWQ+PQYVL+GASEVFMYVGQLEFFNGQAP+G+KSF S+
Sbjct  462   EIARLKHVQPH--EKISTLSIFWQIPQYVLVGASEVFMYVGQLEFFNGQAPDGIKSFGSS  519

Query  594   LCMTSISLGNYVSSLLVSIVMRISTTHRMPGWIPGNLNKGHLDRFYFLLAALTTADFVVY  415
             LCM SISLGNYVSS+LV +VM I+   + PGWIP +LN G +D FYFL+AALT  DFV+Y
Sbjct  520   LCMASISLGNYVSSMLVYMVMGITAKGKSPGWIPDDLNTGRMDXFYFLIAALTAFDFVIY  579

Query  414   ILCAKWYKYIEFEERN  367
             + CAKWYK IE  ++ 
Sbjct  580   VFCAKWYKGIEVTKKE  595



>gb|EPS61277.1| hypothetical protein M569_13519 [Genlisea aurea]
Length=632

 Score =   645 bits (1664),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 334/565 (59%), Positives = 422/565 (75%), Gaps = 17/565 (3%)
 Frame = -3

Query  2022  RSATGGWFAGVLLLVNQGLATLAFFGVGVNLVLFLTRVMGQDNADAANNVSKWTGTVYLF  1843
             + A GGW   ++LL NQGLATLAFFG+GVNLVLFLTRV+GQDNA AANNVS WTGTVYL 
Sbjct  75    KVAVGGWNPALVLLANQGLATLAFFGIGVNLVLFLTRVLGQDNAAAANNVSMWTGTVYLC  134

Query  1842  SLLGAFLSDSYWGRYKTCAIFQLIYVVGLISVSIFSFIFLVKPKGCGDENTPCRSPSRIH  1663
             SL+GAFLSDSYWGRY TCA+FQ+I+++GL+ +S+ S++ L+KP GCGD    C  PS + 
Sbjct  135   SLVGAFLSDSYWGRYLTCALFQVIFIMGLVVISLSSWLILLKPSGCGDGKKTCEPPSSLG  194

Query  1662  IAVYYVSIYLVALGNGGYQPNIATFGSDQFDGDHAHESVSKVAFFSYFYLALNLGSLFSN  1483
               ++Y++IY+VA G GG+QP +ATFG+DQF      E  SK AFF YFY ALN GSLFSN
Sbjct  195   TGLFYLAIYMVAFGYGGHQPTLATFGADQFTDSTEKERDSKSAFFCYFYFALNTGSLFSN  254

Query  1482  TVLVYFEDKGMWTLGFWastvsavlalllflVGTPRYRHFAPKGNPLSRFSQVLVASARK  1303
             T+LVY+ED G WT+GFW +T SAV+ALL +L G+  YR+  P GNP+ R +QV VA+ +K
Sbjct  255   TLLVYYEDTGKWTMGFWIATASAVVALLAYLRGSSSYRYVKPCGNPIPRVAQVFVAAIKK  314

Query  1302  WNVHLPSDGDDHRLYEIQEHDSS---TRKILHTEGFKFLDKAAVITTKESVRDLEERNIN  1132
             WNV L  DG +  LYE++  +S+    RKILHT+ F+FLDKAA++T +E       R   
Sbjct  315   WNVRL--DGGEE-LYEVEGSESAIKGCRKILHTQEFRFLDKAAIVTEEERREAARSR---  368

Query  1131  PWRLCSVTQVEEVKCILRLLPIWLCTILYSVVFTQMASLFVEQGAAMRTNIAGFHIPPAS  952
              WRLCSVTQVEE KCILR+LPIWLCTI+YSV+FTQMASLFVEQG  M T I  FH+P AS
Sbjct  369   -WRLCSVTQVEEAKCILRMLPIWLCTIIYSVIFTQMASLFVEQGDVMDTTIGSFHLPAAS  427

Query  951   MSSFDILSVAAFIFIYRRILDPLIASLKKTRRAQGFTELQRMGVGLiiaimamvaagiVE  772
             MS FDI +V     +YR I  P+  S K +   +G TELQRMG+GL++ ++AMVAAG+ E
Sbjct  428   MSVFDIFAVLLCTGMYRHIFVPV--SRKLSGNPKGLTELQRMGIGLVVGLLAMVAAGLTE  485

Query  771   HFRLKYASTDCPRCPSSLSIFWQVPQYVLIGASEVFMYVGQLEFFNGQAPEGLKSFASAL  592
               RL+          S +S+FWQ+PQY+L+G SEVFMYVGQLEFFNGQAP+G+KSF S+L
Sbjct  486   LERLRNVMPG--ERVSRMSVFWQIPQYLLVGGSEVFMYVGQLEFFNGQAPDGIKSFGSSL  543

Query  591   CMTSISLGNYVSSLLVSIVMRISTTHRMPGWIPGNLNKGHLDRFYFLLAALTTADFVVYI  412
             CM SISLGN+VSS++V+IVM I+  +   GWIP +LN GH+DRFYFL+AA+T  DFV+Y+
Sbjct  544   CMASISLGNFVSSMMVNIVMGITARNESHGWIPKDLNMGHMDRFYFLIAAMTGIDFVIYL  603

Query  411   LCAKWYKYIEFEERNSCLKNIGDSK  337
              CAKWYK +E  E   C K + D++
Sbjct  604   FCAKWYKTVENPE---CAKLMVDNE  625



>gb|KDP30601.1| hypothetical protein JCGZ_16932 [Jatropha curcas]
Length=598

 Score =   644 bits (1660),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 344/552 (62%), Positives = 423/552 (77%), Gaps = 15/552 (3%)
 Frame = -3

Query  2013  TGGWFAGVLLLVNQGLATLAFFGVGVNLVLFLTRVMGQDNADAANNVSKWTGTVYLFSLL  1834
             +GGW A  +LL NQGLATLAFFGVGVNLVLFLTRV+GQ+NA AANNVSKWTGTVY+ SL+
Sbjct  51    SGGWKAATILLANQGLATLAFFGVGVNLVLFLTRVLGQENAAAANNVSKWTGTVYMCSLI  110

Query  1833  GAFLSDSYWGRYKTCAIFQLIYVVGLISVSIFSFIFLVKPKGCGDENTPCRSPSRIHIAV  1654
             GAFLSDSYWGRY TCA+FQL++ +GL  +S+ S+ FL+KP GCGD    C   S + +A+
Sbjct  111   GAFLSDSYWGRYLTCALFQLVFALGLGLLSLCSWFFLIKPSGCGDGKLDCEPASTVGVAI  170

Query  1653  YYVSIYLVALGNGGYQPNIATFGSDQFDGDHAHESVSKVAFFSYFYLALNLGSLFSNTVL  1474
             +Y+SIYLVA G GGYQP+IATFG+DQFD +   E  SK AFF YFY ALN GSLFSNT+L
Sbjct  171   FYLSIYLVAFGYGGYQPSIATFGADQFDEEKPKEKKSKAAFFCYFYFALNFGSLFSNTIL  230

Query  1473  VYFEDKGMWTLGFWastvsavlalllflVGTPRYRHFAPKGNPLSRFSQVLVASARKWNV  1294
             VY+E+ G WT GF+AS  SA++ L+ F +GTP YR+  P GNPL R +QV VA+ARKW V
Sbjct  231   VYYENSGKWTFGFFASLGSAIIGLVSFFLGTPGYRYIKPCGNPLPRVAQVFVAAARKWGV  290

Query  1293  HLPSDGDDHRLYEIQEHDSS---TRKILHTEGFKFLDKAAVITTKESVRDLEERNINPWR  1123
              +PS+ +  +LYE++  +S+   +RKILH+  F+FLDKAA IT      D+  +N +PWR
Sbjct  291   -VPSNAN--QLYEVEGPESAIKGSRKILHSSEFEFLDKAATITED----DMMHQN-DPWR  342

Query  1122  LCSVTQVEEVKCILRLLPIWLCTILYSVVFTQMASLFVEQGAAMRTNIAGFHIPPASMSS  943
             +C+VTQVEE KC+L+L+PIWLCTI+YSVVFTQMASLFVEQG  M + I  F +P ASMS+
Sbjct  343   ICTVTQVEEAKCVLKLIPIWLCTIIYSVVFTQMASLFVEQGDVMNSKIGNFQLPAASMSA  402

Query  942   FDILSVAAFIFIYRRILDPLIASLKKTRRAQGFTELQRMGVGLiiaimamvaagiVEHFR  763
             FDI SV     IYR+IL PL   L  +   +G TELQRMG+GLII ++AM AAG+ E  R
Sbjct  403   FDICSVLICTGIYRKILVPLAGKL--SGNPKGLTELQRMGIGLIIGMLAMFAAGVTEIER  460

Query  762   LKYASTDCPRCPSSLSIFWQVPQYVLIGASEVFMYVGQLEFFNGQAPEGLKSFASALCMT  583
             LK+      +  SSLSIFWQ+PQYVL+GASEVFMYVGQLEFFNGQAP+G+KSF S+LCM 
Sbjct  461   LKHVIPG--QKVSSLSIFWQIPQYVLVGASEVFMYVGQLEFFNGQAPDGIKSFGSSLCMA  518

Query  582   SISLGNYVSSLLVSIVMRISTTHRMPGWIPGNLNKGHLDRFYFLLAALTTADFVVYILCA  403
             SISLGNYVSSLLV++VM I+     PGWIP +LN GHLDRFYFL+A LT  DFV+Y+  A
Sbjct  519   SISLGNYVSSLLVNVVMGITARGEKPGWIPDDLNTGHLDRFYFLIAVLTALDFVLYLFSA  578

Query  402   KWYKYIEFEERN  367
              WYK I  +E +
Sbjct  579   NWYKTISLQESD  590



>ref|XP_010651313.1| PREDICTED: protein NRT1/ PTR FAMILY 7.1 isoform X1 [Vitis vinifera]
 ref|XP_010651314.1| PREDICTED: protein NRT1/ PTR FAMILY 7.1 isoform X1 [Vitis vinifera]
Length=611

 Score =   644 bits (1661),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 351/551 (64%), Positives = 422/551 (77%), Gaps = 15/551 (3%)
 Frame = -3

Query  2019  SATGGWFAGVLLLVNQGLATLAFFGVGVNLVLFLTRVMGQDNADAANNVSKWTGTVYLFS  1840
             +ATGGW +  LLL NQGLATLAFFGVGVNLVLFLTRV+ QDNA+AAN+VSKWTGTVYL S
Sbjct  55    NATGGWKSASLLLANQGLATLAFFGVGVNLVLFLTRVLSQDNANAANSVSKWTGTVYLCS  114

Query  1839  LLGAFLSDSYWGRYKTCAIFQLIYVVGLISVSIFSFIFLVKPKGCGDENTPCRSPSRIHI  1660
             L+GAFLSDSYWGRY TCAIFQ+I V+GL+ +S+ S++FL++PKGCGD  T C   S + +
Sbjct  115   LIGAFLSDSYWGRYLTCAIFQVILVLGLLLLSLSSWLFLIEPKGCGDRTTLCSPSSSVGL  174

Query  1659  AVYYVSIYLVALGNGGYQPNIATFGSDQFDGDHAHESVSKVAFFSYFYLALNLGSLFSNT  1480
              V+Y SIYLVA G GG+QP +AT G+DQFD  +  E  SK  FFSYFY ALNLGSLFSNT
Sbjct  175   GVFYSSIYLVAFGYGGHQPTLATLGADQFDETNPREMNSKTVFFSYFYFALNLGSLFSNT  234

Query  1479  VLVYFEDKGMWTLGFWastvsavlalllflVGTPRYRHFAPKGNPLSRFSQVLVASARKW  1300
             +LVYFED G WTLGF  ST SA++AL++FL G+  YRH  P GNPL R +QV VA+ RKW
Sbjct  235   ILVYFEDSGKWTLGFLVSTGSAIIALVIFLCGSSGYRHIKPCGNPLPRVAQVFVAAFRKW  294

Query  1299  NVHLPSDGDDHRLYEIQEHDSS---TRKILHTEGFKFLDKAAVITTKESVRDLEERNINP  1129
             +V +P +GD   LYE++  +S+   +RKILH+   +FLDKAA +   + V      + NP
Sbjct  295   DVVVPENGDG--LYELEGSESAIKGSRKILHSNEIEFLDKAATMIEADMV------DPNP  346

Query  1128  WRLCSVTQVEEVKCILRLLPIWLCTILYSVVFTQMASLFVEQGAAMRTNIAGFHIPPASM  949
             WRLC+VTQVEE KC++++LPIWLCTI+YSV+FTQMASLFVEQG  M   I  F IP ASM
Sbjct  347   WRLCTVTQVEEAKCVIKMLPIWLCTIIYSVIFTQMASLFVEQGDVMNRKIGNFEIPAASM  406

Query  948   SSFDILSVAAFIFIYRRILDPLIASLKKTRRAQGFTELQRMGVGLiiaimamvaagiVEH  769
             S+FDI SV     IYR+IL P+  S K T   +G +ELQRMG+GLII I AM+AAG+ E 
Sbjct  407   SAFDIFSVLLCTGIYRQILVPI--SGKLTGNPKGMSELQRMGIGLIIGIAAMIAAGLTEL  464

Query  768   FRLKYASTDCPRCPSSLSIFWQVPQYVLIGASEVFMYVGQLEFFNGQAPEGLKSFASALC  589
              RL+  S +     SSLSIFWQ PQYVL+GASEVFMYVGQLEFFNGQAP+G+KS  S+LC
Sbjct  465   GRLRRVSPN--EEASSLSIFWQTPQYVLVGASEVFMYVGQLEFFNGQAPDGIKSLGSSLC  522

Query  588   MTSISLGNYVSSLLVSIVMRISTTHRMPGWIPGNLNKGHLDRFYFLLAALTTADFVVYIL  409
             M SISLGNYVSSLLV+IVM ++T    PGWIP +LN GHLDRFYFL+A LT  DFV+Y+ 
Sbjct  523   MASISLGNYVSSLLVNIVMGVTTRGDNPGWIPEDLNTGHLDRFYFLIAVLTVIDFVIYVF  582

Query  408   CAKWYKYIEFE  376
             CAKWYK I  E
Sbjct  583   CAKWYKSINLE  593



>ref|XP_004296304.1| PREDICTED: putative peptide/nitrate transporter At5g19640-like 
[Fragaria vesca subsp. vesca]
Length=677

 Score =   646 bits (1666),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 339/555 (61%), Positives = 418/555 (75%), Gaps = 16/555 (3%)
 Frame = -3

Query  2031  PALRSATGGWFAGVLLLVNQGLATLAFFGVGVNLVLFLTRVMGQDNADAANNVSKWTGTV  1852
             P ++   GGW   +LLL NQGLATLAFFGVGVNLVLFL RV+ Q N+ AANNVSKWTGTV
Sbjct  116   PIIKKKRGGWKLAILLLANQGLATLAFFGVGVNLVLFLVRVLEQSNSVAANNVSKWTGTV  175

Query  1851  YLFSLLGAFLSDSYWGRYKTCAIFQLIYVVGLISVSIFSFIFLVKPKGCGDENTPCRSPS  1672
             YLFSL+GAFLSDSYWGRY TCA+FQ+ +V+GL  +++ S+IFL+ P GCG+    C  PS
Sbjct  176   YLFSLVGAFLSDSYWGRYLTCAVFQVFFVMGLGLMTLTSWIFLIHPSGCGNGEKLCNPPS  235

Query  1671  RIHIAVYYVSIYLVALGNGGYQPNIATFGSDQFDGDHAHESVSKVAFFSYFYLALNLGSL  1492
                + ++Y+SIYLVA G GG+QP IATFG+DQFD     +  S+  FFSYFY ALN+G L
Sbjct  236   ETGVGLFYLSIYLVAFGYGGHQPTIATFGADQFDEADPEQQKSRAIFFSYFYFALNVGCL  295

Query  1491  FSNTVLVYFEDKGMWTLGFWastvsavlalllflVGTPRYRHFAPKGNPLSRFSQVLVAS  1312
             FSNT+LVY+ED+G W +GF AS  SAV+ALL +L+G+ RYR+  P GNPL R +QV VA+
Sbjct  296   FSNTILVYYEDQGYWNIGFVASLGSAVVALLSYLMGSSRYRYIKPCGNPLPRVAQVFVAA  355

Query  1311  ARKWNVHLPSDGDDHRLYEIQEHDSS---TRKILHTEGFKFLDKAAVITTKESVRDLEER  1141
             A+KW+V +P+D DD  LYE++  +S+   +RKILH+   +FLDKAA IT K    D  E+
Sbjct  356   AKKWHV-VPADADD--LYEMEGKESAIKGSRKILHSNEIEFLDKAATITDK----DQNEK  408

Query  1140  NINPWRLCSVTQVEEVKCILRLLPIWLCTILYSVVFTQMASLFVEQGAAMRTNIAGFHIP  961
               NPWRLC+VTQVEE KC+L+LLPIWLCTI+YSV+FTQMASLFVEQG  M   I  FHIP
Sbjct  409   --NPWRLCTVTQVEEAKCVLKLLPIWLCTIIYSVIFTQMASLFVEQGDVMHAKIGNFHIP  466

Query  960   PASMSSFDILSVAAFIFIYRRILDPLIASLKKTRRAQGFTELQRMGVGLiiaimamvaag  781
              ASMS+FDI SV     IYR++L PL   L  +   +G +ELQRMG+GLII + AMVAAG
Sbjct  467   AASMSAFDICSVLIATGIYRQVLVPLAGRL--SGNPKGLSELQRMGIGLIIGLFAMVAAG  524

Query  780   iVEHFRLKYASTDCPRCPSSLSIFWQVPQYVLIGASEVFMYVGQLEFFNGQAPEGLKSFA  601
             + E  R KY      +  SSLSIFWQ+PQYV +G SEVFMYVGQLEFFNG+AP+G+KSF 
Sbjct  525   VTEIARRKYVEPG--KRISSLSIFWQIPQYVCVGVSEVFMYVGQLEFFNGEAPDGIKSFG  582

Query  600   SALCMTSISLGNYVSSLLVSIVMRISTTHRMPGWIPGNLNKGHLDRFYFLLAALTTADFV  421
             S+LCM SISLGNYVSS+LV++VM I+     PGWIP NLN+GH+DRFYFL+A L   DFV
Sbjct  583   SSLCMASISLGNYVSSMLVAVVMGITARGSDPGWIPNNLNEGHMDRFYFLIAGLAVIDFV  642

Query  420   VYILCAKWYKYIEFE  376
             +Y+  +K YKYI  E
Sbjct  643   IYVYLSKRYKYINLE  657



>ref|XP_002871897.1| proton-dependent oligopeptide transport family protein [Arabidopsis 
lyrata subsp. lyrata]
 gb|EFH48156.1| proton-dependent oligopeptide transport family protein [Arabidopsis 
lyrata subsp. lyrata]
Length=609

 Score =   643 bits (1659),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 341/550 (62%), Positives = 415/550 (75%), Gaps = 26/550 (5%)
 Frame = -3

Query  2010  GGWFAGVLLLVNQGLATLAFFGVGVNLVLFLTRVMGQDNADAANNVSKWTGTVYLFSLLG  1831
             GGW   ++LLVNQGLATLAFFGVGVNLVLFLTRVMGQ NA+AANNVSKWTGTVY+FSL+G
Sbjct  61    GGWTNAIILLVNQGLATLAFFGVGVNLVLFLTRVMGQGNAEAANNVSKWTGTVYMFSLVG  120

Query  1830  AFLSDSYWGRYKTCAIFQLIYVVGLISVSIFSFIFLVKPKGCGDENTPCRSPSRIHIAVY  1651
             AFLSDSYWGRY TC IFQ+I+V+G+  +S  S+ FL+KP+GCGD N  C +PS + +A++
Sbjct  121   AFLSDSYWGRYLTCTIFQVIFVIGVGLLSFVSWFFLIKPRGCGDGNLECNTPSSLGVAIF  180

Query  1650  YVSIYLVALGNGGYQPNIATFGSDQFDGDHAHESVSKVAFFSYFYLALNLGSLFSNTVLV  1471
             Y+S+YLVA G GG+QP +ATFG+DQ D D      SK AFFSYFY ALN+G+LFSNT+LV
Sbjct  181   YLSVYLVAFGYGGHQPTLATFGADQLDDDKN----SKAAFFSYFYFALNVGALFSNTILV  236

Query  1470  YFEDKGMWTLGFWastvsavlalllflVGTPRYRHFAPKGNPLSRFSQVLVASARKWNVH  1291
             YFEDKG+WT GF  S  SA++AL+ FL  T +YR+  P GNPL R +QV VA+ARKW+V 
Sbjct  237   YFEDKGLWTEGFLVSLGSAIVALVAFLAPTKQYRYVKPCGNPLPRVAQVFVATARKWSVD  296

Query  1290  LPSDGDDHRLYEIQEHDSS---TRKILHTEGFKFLDKAAVITTKESVRDLEERNINPWRL  1120
              P  GD H LYE++  +S+   +RKI H+  F FLD+AAVIT      D +E   N WRL
Sbjct  297   RP--GDPHELYELEGPESAIKGSRKIFHSTKFVFLDRAAVITEN----DRDETRTNAWRL  350

Query  1119  CSVTQVEEVKCILRLLPIWLCTILYSVVFTQMASLFVEQGAAMRTNIAGFHIPPASMSSF  940
             CSVTQVEE KC+++LLPIWLCTI+YSV+FTQMASLFVEQG  M   +  FHIP ASMS F
Sbjct  351   CSVTQVEEAKCVMKLLPIWLCTIIYSVIFTQMASLFVEQGDVMNAYVGKFHIPAASMSVF  410

Query  939   DILSVAAFIFIYRRILDPLIASLKKTRRAQGFTELQRMGVGLiiaimamvaagiVEHFRL  760
             DI+SV     IYR I+ P +            TEL RMG+GLII IMAMVAAG+ E  RL
Sbjct  411   DIISVFVSTGIYRHIIFPYVRP----------TELMRMGIGLIIGIMAMVAAGLTEIQRL  460

Query  759   KYASTDCPRCPSSLSIFWQVPQYVLIGASEVFMYVGQLEFFNGQAPEGLKSFASALCMTS  580
             +       +  S L+I WQ+PQYVL+GASEVFMYVGQLEFFNGQAP+GLK+  S+LCM S
Sbjct  461   RRVVPG--QKESELTILWQIPQYVLVGASEVFMYVGQLEFFNGQAPDGLKNLGSSLCMAS  518

Query  579   ISLGNYVSSLLVSIVMRISTT-HRMPGWIPGNLNKGHLDRFYFLLAALTTADFVVYILCA  403
             ++LGNYVSSL+V+IVM I+      PGWIP NLN+GH+DRFYFL+AAL   DFVVY++ A
Sbjct  519   MALGNYVSSLMVNIVMAITKRGENNPGWIPENLNEGHMDRFYFLIAALAAIDFVVYLVFA  578

Query  402   KWYKYIEFEE  373
             KWY+ I  +E
Sbjct  579   KWYQPISHDE  588



>ref|XP_007207679.1| hypothetical protein PRUPE_ppa023462mg [Prunus persica]
 gb|EMJ08878.1| hypothetical protein PRUPE_ppa023462mg [Prunus persica]
Length=612

 Score =   643 bits (1659),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 352/570 (62%), Positives = 429/570 (75%), Gaps = 18/570 (3%)
 Frame = -3

Query  2025  LRSATGGWFAGVLLLVNQGLATLAFFGVGVNLVLFLTRVMGQDNADAANNVSKWTGTVYL  1846
             +R +TGGW    LLLVNQGLATLAFFGVGVNLVLFLTRV+ Q+NA AAN+VSKWTGTVYL
Sbjct  52    IRKSTGGWKFASLLLVNQGLATLAFFGVGVNLVLFLTRVLDQENAVAANSVSKWTGTVYL  111

Query  1845  FSLLGAFLSDSYWGRYKTCAIFQLIYVVGLISVSIFSFIFLVKPKGCGDENTPCRSPSRI  1666
              SL+GAFLSDSYWGRY TCAIFQLI+VVGL+ +S+ S++FL  P GCGD    C   S +
Sbjct  112   CSLIGAFLSDSYWGRYLTCAIFQLIFVVGLVLLSLSSWLFLFHPSGCGDGEIVCMPASPV  171

Query  1665  HIAVYYVSIYLVALGNGGYQPNIATFGSDQFDGDHAHESVSKVAFFSYFYLALNLGSLFS  1486
              +A++Y+SIYLVA G GGYQP IATFG+DQFD  +  E  SK  FF YFY ALN+GSLFS
Sbjct  172   GVAIFYLSIYLVAFGYGGYQPTIATFGADQFDEANPKEGASKAVFFCYFYFALNVGSLFS  231

Query  1485  NTVLVYFEDKGMWTLGFWastvsavlalllflVGTPRYRHFAPKGNPLSRFSQVLVASAR  1306
             NT+LVY+ED G WTLGF  S  SA++ALL FL+GTP YR+  P GNPL R +QV VA+AR
Sbjct  232   NTILVYYEDTGKWTLGFVVSLGSAIIALLSFLLGTPGYRYLKPCGNPLPRVAQVFVAAAR  291

Query  1305  KWNVHLPSDGDDHRLYEIQEHDSS---TRKILHTEGFKFLDKAAVITTKESVRDLEERNI  1135
             KW++ +P + DD  LYE++  DS+   +RKI H+   +FLDKAA IT  +          
Sbjct  292   KWDI-VPVNSDD--LYEVEGPDSAIKGSRKIYHSNEIEFLDKAATITEDDLCGPK-----  343

Query  1134  NPWRLCSVTQVEEVKCILRLLPIWLCTILYSVVFTQMASLFVEQGAAMRTNIAGFHIPPA  955
             NPWRLC+VTQVEE KC+L++LPIWLCTI+YSVVFTQMASLFVEQG  M++N   FH+P A
Sbjct  344   NPWRLCTVTQVEEAKCVLKMLPIWLCTIIYSVVFTQMASLFVEQGDVMKSNFGNFHLPAA  403

Query  954   SMSSFDILSVAAFIFIYRRILDPLIASLKKTRRAQGFTELQRMGVGLiiaimamvaagiV  775
             SMS+FDI SV     IYR++L PL   L  +   +G +EL+RMG+GL+I ++AMVAAG  
Sbjct  404   SMSAFDICSVLICTGIYRQVLVPLAGKL--SGNTKGISELKRMGIGLVIGMLAMVAAGAT  461

Query  774   EHFRLKYASTDCPRCPSSLSIFWQVPQYVLIGASEVFMYVGQLEFFNGQAPEGLKSFASA  595
             E  RLK+         SSL+IFWQ+PQYVL+GASEVFMYVGQLEFFNGQAP+G+KSF S+
Sbjct  462   EIARLKHVLPG--EKISSLNIFWQIPQYVLVGASEVFMYVGQLEFFNGQAPDGIKSFGSS  519

Query  594   LCMTSISLGNYVSSLLVSIVMRISTTHRMPGWIPGNLNKGHLDRFYFLLAALTTADFVVY  415
             LCM S+SLGNY SS LV++VM I+   + PGWIP +LN GHLDRFYFL+AALT  DFV+Y
Sbjct  520   LCMASMSLGNYASSFLVNMVMGITARGKDPGWIPDDLNTGHLDRFYFLIAALTAFDFVIY  579

Query  414   ILCAKWYKYIEFEERNSCLKNIGDSKLQED  325
             + CAKWYK I  E      K I   ++Q+D
Sbjct  580   VFCAKWYKSINLEGSE---KEIQIIEIQQD  606



>ref|XP_007139109.1| hypothetical protein PHAVU_008G002100g [Phaseolus vulgaris]
 gb|ESW11103.1| hypothetical protein PHAVU_008G002100g [Phaseolus vulgaris]
Length=555

 Score =   641 bits (1653),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 341/559 (61%), Positives = 414/559 (74%), Gaps = 23/559 (4%)
 Frame = -3

Query  1977  NQGLATLAFFGVGVNLVLFLTRVMGQDNADAANNVSKWTGTVYLFSLLGAFLSDSYWGRY  1798
             NQ LATLAFFGVGVNLVLFLTRV+ QD+A+AANNVSKWTGTVY+FSL GAFLSDSYWGRY
Sbjct  15    NQALATLAFFGVGVNLVLFLTRVLRQDSAEAANNVSKWTGTVYIFSLFGAFLSDSYWGRY  74

Query  1797  KTCAIFQLIYVVGLISVSIFSFIFLVKPKGCGDENTPCRSPSRIHIAVYYVSIYLVALGN  1618
              TC+IFQLI++VGL  +S+ S+ FL+ P GCG+E T CR P+ + + V+Y+SIYLVA G 
Sbjct  75    LTCSIFQLIFIVGLGLLSLTSWKFLINPSGCGNEETKCREPTSVGVGVFYLSIYLVAFGY  134

Query  1617  GGYQPNIATFGSDQFDGDHAHESVSKVAFFSYFYLALNLGSLFSNTVLVYFEDKGMWTLG  1438
             GG+QP +ATFG+DQFD    +   ++ AFFSYFY ALN+GSLFSNTVLVY+ED GMWTLG
Sbjct  135   GGHQPTLATFGADQFDEKSENHKSNREAFFSYFYFALNVGSLFSNTVLVYYEDTGMWTLG  194

Query  1437  FWastvsavlalllflVGTPRYRHFAPKGNPLSRFSQVLVASARKWNVHLPSDGDDHRLY  1258
             F  S  SA++AL  +L G  +YR+    GNP+ R SQV VA+ RK  V L S   + +LY
Sbjct  195   FLVSMASAIIALASYLAGYKKYRYVKAYGNPVIRISQVFVAAFRKSKVQLSS---EDQLY  251

Query  1257  EIQEHDSS---TRKILHTEGFKFLDKAAVITTKESVRDLEERNINPWRLCSVTQVEEVKC  1087
             E++  +S+   +RKI+H+  F+F+DKAA IT K+   DL++ N   WRLC+VTQVEE KC
Sbjct  252   EVEGSESAIKGSRKIMHSNDFRFMDKAATITEKDG-DDLKKNN---WRLCTVTQVEEAKC  307

Query  1086  ILRLLPIWLCTILYSVVFTQMASLFVEQGAAMRTNIAGFHIPPASMSSFDILSVAAFIFI  907
             ++R+LP+WLCTI+YSVVFTQMASLFVEQG  M   I  FH P ASMS FDILSV      
Sbjct  308   VMRMLPVWLCTIIYSVVFTQMASLFVEQGDVMDNRIGNFHFPAASMSVFDILSVFLSTIS  367

Query  906   YRRILDPLIASLKKTRRAQGFTELQRMGVGLiiaimamvaagiVEHFRLKYASTDCPRCP  727
             Y  ++ PL   L  T   +G TELQRMGVGLII I++M+AAG+ E  RLK+         
Sbjct  368   YIHVVVPLTKYL--TGNPRGLTELQRMGVGLIIGILSMIAAGVTEMERLKHIVPG--EKA  423

Query  726   SSLSIFWQVPQYVLIGASEVFMYVGQLEFFNGQAPEGLKSFASALCMTSISLGNYVSSLL  547
             SSL+IFWQVPQYVL+GASE+F+YVGQL+FFNGQAP+G+KSF S+LCM SISLGNYVSS+L
Sbjct  424   SSLTIFWQVPQYVLVGASEIFVYVGQLDFFNGQAPDGIKSFGSSLCMASISLGNYVSSIL  483

Query  546   VSIVMRISTTHRMPGWIPGNLNKGHLDRFYFLLAALTTADFVVYILCAKWYKYIEFEERN  367
             V IVM I+     PGWIP NLN GHLDRFYFL+A LT  DFV Y  CA+WYKYI  EE  
Sbjct  484   VYIVMAITERGDNPGWIPNNLNLGHLDRFYFLIAILTAVDFVFYYFCARWYKYINIEE--  541

Query  366   SCLKNIGDSKLQEDRSTFN  310
                   GD K  +DR   N
Sbjct  542   ------GDKK-NQDREVVN  553



>ref|XP_008243619.1| PREDICTED: protein NRT1/ PTR FAMILY 7.1-like [Prunus mume]
Length=613

 Score =   643 bits (1658),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 355/599 (59%), Positives = 438/599 (73%), Gaps = 24/599 (4%)
 Frame = -3

Query  2136  FLNITKMFFIKNERDEEKASREECTLDGTVDHYGRPAL---------RSATGGWFAGVLL  1984
              LN T     K  R++ + + E  T +  +    + A+         R +TGGW    LL
Sbjct  7     LLNFTNEAAQKQVREDNRCTGESETANRNLYEVEQKAIAGKSKASLIRKSTGGWKFASLL  66

Query  1983  LVNQGLATLAFFGVGVNLVLFLTRVMGQDNADAANNVSKWTGTVYLFSLLGAFLSDSYWG  1804
             LVNQGLATLAFFGVGVNLVLFLTRV+ Q+NA AAN+VSKWTGTVYL SL+GAFLSDSYWG
Sbjct  67    LVNQGLATLAFFGVGVNLVLFLTRVLDQENAVAANSVSKWTGTVYLCSLIGAFLSDSYWG  126

Query  1803  RYKTCAIFQLIYVVGLISVSIFSFIFLVKPKGCGDENTPCRSPSRIHIAVYYVSIYLVAL  1624
             RY TCAIFQLI+VVGL+ +S+ S++FL  P GCG+    C   S + +A++Y+SIYLVA 
Sbjct  127   RYLTCAIFQLIFVVGLVLLSLSSWLFLFHPSGCGNGEIVCMPASPVGVAIFYLSIYLVAF  186

Query  1623  GNGGYQPNIATFGSDQFDGDHAHESVSKVAFFSYFYLALNLGSLFSNTVLVYFEDKGMWT  1444
             G GGYQP IATFG+DQFD  +  E  SK  FF YFY ALN+GSLFSNT+LVY+ED G WT
Sbjct  187   GYGGYQPTIATFGADQFDEANPKEGASKAVFFCYFYFALNVGSLFSNTILVYYEDTGKWT  246

Query  1443  LGFWastvsavlalllflVGTPRYRHFAPKGNPLSRFSQVLVASARKWNVHLPSDGDDHR  1264
             LGF  S  SA++ALL FL+GTP YR+  P GNPL R +QV VA+ARKW++ +P + DD  
Sbjct  247   LGFVVSLGSAIIALLSFLLGTPGYRYLKPCGNPLPRVAQVFVAAARKWDI-VPVNSDD--  303

Query  1263  LYEIQEHDSS---TRKILHTEGFKFLDKAAVITTKESVRDLEERNINPWRLCSVTQVEEV  1093
             LYE++  DS+   +RKI H+   +FLDKAA IT  +          NPWRLC+VTQVEE 
Sbjct  304   LYEVEGPDSAIKGSRKIYHSNEIEFLDKAATITEDDLCGPK-----NPWRLCTVTQVEEA  358

Query  1092  KCILRLLPIWLCTILYSVVFTQMASLFVEQGAAMRTNIAGFHIPPASMSSFDILSVAAFI  913
             KC+L++LPIWLCTI+YSVVFTQMASLFVEQG  M++N   FH+P ASMS+FDI SV    
Sbjct  359   KCVLKMLPIWLCTIIYSVVFTQMASLFVEQGDVMKSNFGNFHLPAASMSAFDICSVLICT  418

Query  912   FIYRRILDPLIASLKKTRRAQGFTELQRMGVGLiiaimamvaagiVEHFRLKYASTDCPR  733
              IYR++L PL   L  +   +G +EL+RMG+GL+I ++AMVAAG  E  RLK+       
Sbjct  419   GIYRQVLVPLAGKL--SGNTKGISELKRMGIGLVIGMLAMVAAGATEIARLKHVLPG--E  474

Query  732   CPSSLSIFWQVPQYVLIGASEVFMYVGQLEFFNGQAPEGLKSFASALCMTSISLGNYVSS  553
               SSL+IFWQ+PQYVL+GASEVFMYVGQLEFFNGQAP+G+KSF S+LCM S+SLGNY SS
Sbjct  475   KISSLNIFWQIPQYVLVGASEVFMYVGQLEFFNGQAPDGIKSFGSSLCMASMSLGNYASS  534

Query  552   LLVSIVMRISTTHRMPGWIPGNLNKGHLDRFYFLLAALTTADFVVYILCAKWYKYIEFE  376
              LV++VM I+   + PGWIP +LN+GHLDRFYFL+AALT  DFV+Y+ CAKWYK I  E
Sbjct  535   FLVNMVMGITARGKDPGWIPDDLNRGHLDRFYFLIAALTAFDFVIYVFCAKWYKSINLE  593



>ref|XP_006589795.1| PREDICTED: putative peptide/nitrate transporter At5g19640-like 
isoform X3 [Glycine max]
 gb|KHN37268.1| Putative peptide/nitrate transporter [Glycine soja]
Length=595

 Score =   642 bits (1656),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 349/579 (60%), Positives = 423/579 (73%), Gaps = 20/579 (3%)
 Frame = -3

Query  2094  DEEKASREECTLDGTVDHYGRPALRSATGGWFAGVLLLVNQGLATLAFFGVGVNLVLFLT  1915
             + + ++REE  +       G       TGG     LLLVNQ LATLAFFGVGVNLVLFLT
Sbjct  19    EGDSSNREESVIMKRSSRAGE----KKTGGAKVARLLLVNQALATLAFFGVGVNLVLFLT  74

Query  1914  RVMGQDNADAANNVSKWTGTVYLFSLLGAFLSDSYWGRYKTCAIFQLIYVVGLISVSIFS  1735
             RV+GQDN +AANNVSKW GTVY+FSL+GAFLSDSYWGRY TC +FQL++V+GL   S+ S
Sbjct  75    RVLGQDNVNAANNVSKWIGTVYMFSLIGAFLSDSYWGRYLTCTVFQLVFVLGLALSSLSS  134

Query  1734  FIFLVKPKGCGDENTPCRSPSRIHIAVYYVSIYLVALGNGGYQPNIATFGSDQFDGDHAH  1555
             + FL+ P GCGD +T C+ PS I   ++Y+SIYLVA G GG+QP +ATFG+DQ+D  +  
Sbjct  135   WRFLINPVGCGDGHTLCK-PSSIGDEIFYLSIYLVAFGYGGHQPTLATFGADQYDEKNPK  193

Query  1554  ESVSKVAFFSYFYLALNLGSLFSNTVLVYFEDKGMWTLGFWastvsavlalllflVGTPR  1375
             E  SKVAFF YFY ALN+GSLFSNTVLVY+ED GMWT+GF  S VSAV+A L FL+GTPR
Sbjct  194   EKSSKVAFFCYFYFALNVGSLFSNTVLVYYEDTGMWTMGFLVSLVSAVIAFLAFLLGTPR  253

Query  1374  YRHFAPKGNPLSRFSQVLVASARKWNVHLPSDGDDHRLYEIQEHDSS---TRKILHTEGF  1204
             YR+  P GNP+ R +QV  A  RKW V   S      LYE+    S+   +RKI HT+ F
Sbjct  254   YRYVKPCGNPVVRVAQVFTAVFRKWKV---SPAKAEELYEVDGPQSAIKGSRKIRHTDDF  310

Query  1203  KFLDKAAVITTKESVRDLEERNINPWRLCSVTQVEEVKCILRLLPIWLCTILYSVVFTQM  1024
             +F+DKAA I   E     E    NPWRLC+VTQVEE KC+LR+LP+WLCTI+YSVVFTQM
Sbjct  311   EFMDKAATIKETE-----EHSPKNPWRLCTVTQVEEAKCVLRMLPVWLCTIIYSVVFTQM  365

Query  1023  ASLFVEQGAAMRTNIAGFHIPPASMSSFDILSVAAFIFIYRRILDPLIASLKKTRRAQGF  844
             ASLFVEQG  M + I  FH+P ASMS+FDI SV     IYR+IL PL   L  +   +G 
Sbjct  366   ASLFVEQGDVMNSYIGSFHLPAASMSAFDIFSVLVCTGIYRQILVPLAGRL--SGNPKGL  423

Query  843   TELQRMGVGLiiaimamvaagiVEHFRLKYASTDCPRCPSSLSIFWQVPQYVLIGASEVF  664
             +ELQRMG+GLII ++AMVA+G  E  RL+  S    +  SSLSIFWQ+PQYVL+GASEVF
Sbjct  424   SELQRMGIGLIIGMLAMVASGATEIARLRRISHG--QKTSSLSIFWQIPQYVLVGASEVF  481

Query  663   MYVGQLEFFNGQAPEGLKSFASALCMTSISLGNYVSSLLVSIVMRISTTHRMPGWIPGNL  484
             MYVGQLEFFNGQAP+G+KSF S+LCM SISLGNYVSS+LV++VM I+   +  GWIP NL
Sbjct  482   MYVGQLEFFNGQAPDGIKSFGSSLCMASISLGNYVSSMLVNMVMIITARGQNKGWIPENL  541

Query  483   NKGHLDRFYFLLAALTTADFVVYILCAKWYKYIEFEERN  367
             N GH+DRF+FLLA L   DFV+Y+ CAKWYK I  E+ +
Sbjct  542   NTGHMDRFFFLLAGLAAFDFVLYLFCAKWYKNINIEDSD  580



>gb|EMS68576.1| Nitrate transporter 1.5 [Triticum urartu]
Length=630

 Score =   643 bits (1659),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 353/589 (60%), Positives = 436/589 (74%), Gaps = 20/589 (3%)
 Frame = -3

Query  2070  ECTLDGTVDHYGRPALRSATGGWFAGVLLLVNQGLATLAFFGVGVNLVLFLTRVMGQDNA  1891
             E TLDG+VD  GRPA++  +GGW AG L+LVNQGLAT+AFFGV VNLVLFLTRV+ Q N 
Sbjct  48    EYTLDGSVDIKGRPAVKGKSGGWLAGGLILVNQGLATMAFFGVNVNLVLFLTRVVQQSNG  107

Query  1890  DAANNVSKWTGTVYLFSLLGAFLSDSYWGRYKTCAIFQLIYVVGLISVSIFSFIFLVKPK  1711
             DAANNVSKWTGTVY+FSL+GAFLSDSYWGRYKTCAIFQ I+V+GL  +S+ S ++L++P 
Sbjct  108   DAANNVSKWTGTVYMFSLIGAFLSDSYWGRYKTCAIFQAIFVLGLGLLSLSSRLYLIRPV  167

Query  1710  GCGDENTPCRSPSRIHIAVYYVSIYLVALGNGGYQPNIATFGSDQFDGDHAHESVSKVAF  1531
             GCG E+TPC S S   + ++Y+++Y++A GNGGYQPNIATFG+DQFD +   E+ SKV+F
Sbjct  168   GCGTEHTPCASHSGTEMGIFYIALYMIAFGNGGYQPNIATFGADQFDEEDPAEAHSKVSF  227

Query  1530  FSYFYLALNLGSLFSNTVLVYFEDKGMWTLGFWastvsavlalllflVGTPRYRHFAPKG  1351
             FSYFYLALNLGSLFSNT L Y +D G W +GFWAST +A  ALLLFL GTP+YRH  P G
Sbjct  228   FSYFYLALNLGSLFSNTFLSYLQDHGKWVIGFWASTAAAATALLLFLSGTPQYRHAQPCG  287

Query  1350  NPLSRFSQVLVASARKWNVHLPSDGDDHRLYEIQEH-DSSTRKILHTEGFKFLDKAAVIT  1174
             NP++   QV  A+ R W     S  D   LYE  +  D+ +RK+LHT+GF+FLD+AA +T
Sbjct  288   NPMASICQVASAACRNWKSGGVSQ-DVEILYEGDDKTDAGSRKLLHTKGFRFLDRAA-LT  345

Query  1173  TKESVRDLE--ERNINPWRLCSVTQVEEVKCILRLLPIWLCTILYSVVFTQMASLFVEQG  1000
             T+++   L    +  + W+LC+VTQVE+VK ILR+LPIW+CTILYSVVFTQMASLFV QG
Sbjct  346   TEDTSSKLATCSKTRDQWKLCTVTQVEQVKSILRILPIWVCTILYSVVFTQMASLFVVQG  405

Query  999   AAMR--TNIAGFHIPPASMSSFDILSVAAFIFIYRRILDPLIASLKKTRRAQGFTELQRM  826
             AAMR  T +  F IP +SMS+FDIL+VA  IF+YRR + P +A    T R+ G TELQRM
Sbjct  406   AAMRRSTPLGSFSIPASSMSAFDILTVATTIFLYRRAICPFLARF--TGRSTGPTELQRM  463

Query  825   GVGLiiaimamvaagiVEHFRLKYASTDCPRCPSSLSIFWQVPQYVLIGASEVFMYVGQL  646
             G+GL++  MAM  AG VEHFR   A+T      S L I WQVPQY LIG SEV MYVGQL
Sbjct  464   GLGLVLGAMAMATAGTVEHFRKASATT---ANSSELHILWQVPQYALIGVSEVMMYVGQL  520

Query  645   EFFNGQAPEGLKSFASALCMTSISLGNYVSSLLVSIVMRISTTHRMPGWIPGNLNKGHLD  466
             EFFNG+ P+G KSF SALCM S+SLGNY S ++VS V + +     PGWIP +LN+GHL+
Sbjct  521   EFFNGEMPDGFKSFGSALCMMSMSLGNYFSDIIVSAVTKATAVDGRPGWIPADLNEGHLN  580

Query  465   RFYFLLAALTTADFVVYILCAKWYKYIEFEERNSCLKNIGDSKLQEDRS  319
             +FYFLLA L+ ADF VY++ A  Y       R SC K  G S  +E+ S
Sbjct  581   KFYFLLAILSVADFAVYLVFAGRY-------RKSC-KVDGRSDDEEEGS  621



>ref|XP_006589794.1| PREDICTED: putative peptide/nitrate transporter At5g19640-like 
isoform X2 [Glycine max]
 ref|XP_003535794.2| PREDICTED: putative peptide/nitrate transporter At5g19640-like 
isoform X1 [Glycine max]
Length=602

 Score =   641 bits (1654),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 349/579 (60%), Positives = 423/579 (73%), Gaps = 20/579 (3%)
 Frame = -3

Query  2094  DEEKASREECTLDGTVDHYGRPALRSATGGWFAGVLLLVNQGLATLAFFGVGVNLVLFLT  1915
             + + ++REE  +       G       TGG     LLLVNQ LATLAFFGVGVNLVLFLT
Sbjct  26    EGDSSNREESVIMKRSSRAGE----KKTGGAKVARLLLVNQALATLAFFGVGVNLVLFLT  81

Query  1914  RVMGQDNADAANNVSKWTGTVYLFSLLGAFLSDSYWGRYKTCAIFQLIYVVGLISVSIFS  1735
             RV+GQDN +AANNVSKW GTVY+FSL+GAFLSDSYWGRY TC +FQL++V+GL   S+ S
Sbjct  82    RVLGQDNVNAANNVSKWIGTVYMFSLIGAFLSDSYWGRYLTCTVFQLVFVLGLALSSLSS  141

Query  1734  FIFLVKPKGCGDENTPCRSPSRIHIAVYYVSIYLVALGNGGYQPNIATFGSDQFDGDHAH  1555
             + FL+ P GCGD +T C+ PS I   ++Y+SIYLVA G GG+QP +ATFG+DQ+D  +  
Sbjct  142   WRFLINPVGCGDGHTLCK-PSSIGDEIFYLSIYLVAFGYGGHQPTLATFGADQYDEKNPK  200

Query  1554  ESVSKVAFFSYFYLALNLGSLFSNTVLVYFEDKGMWTLGFWastvsavlalllflVGTPR  1375
             E  SKVAFF YFY ALN+GSLFSNTVLVY+ED GMWT+GF  S VSAV+A L FL+GTPR
Sbjct  201   EKSSKVAFFCYFYFALNVGSLFSNTVLVYYEDTGMWTMGFLVSLVSAVIAFLAFLLGTPR  260

Query  1374  YRHFAPKGNPLSRFSQVLVASARKWNVHLPSDGDDHRLYEIQEHDSS---TRKILHTEGF  1204
             YR+  P GNP+ R +QV  A  RKW V   S      LYE+    S+   +RKI HT+ F
Sbjct  261   YRYVKPCGNPVVRVAQVFTAVFRKWKV---SPAKAEELYEVDGPQSAIKGSRKIRHTDDF  317

Query  1203  KFLDKAAVITTKESVRDLEERNINPWRLCSVTQVEEVKCILRLLPIWLCTILYSVVFTQM  1024
             +F+DKAA I   E     E    NPWRLC+VTQVEE KC+LR+LP+WLCTI+YSVVFTQM
Sbjct  318   EFMDKAATIKETE-----EHSPKNPWRLCTVTQVEEAKCVLRMLPVWLCTIIYSVVFTQM  372

Query  1023  ASLFVEQGAAMRTNIAGFHIPPASMSSFDILSVAAFIFIYRRILDPLIASLKKTRRAQGF  844
             ASLFVEQG  M + I  FH+P ASMS+FDI SV     IYR+IL PL   L  +   +G 
Sbjct  373   ASLFVEQGDVMNSYIGSFHLPAASMSAFDIFSVLVCTGIYRQILVPLAGRL--SGNPKGL  430

Query  843   TELQRMGVGLiiaimamvaagiVEHFRLKYASTDCPRCPSSLSIFWQVPQYVLIGASEVF  664
             +ELQRMG+GLII ++AMVA+G  E  RL+  S    +  SSLSIFWQ+PQYVL+GASEVF
Sbjct  431   SELQRMGIGLIIGMLAMVASGATEIARLRRISHG--QKTSSLSIFWQIPQYVLVGASEVF  488

Query  663   MYVGQLEFFNGQAPEGLKSFASALCMTSISLGNYVSSLLVSIVMRISTTHRMPGWIPGNL  484
             MYVGQLEFFNGQAP+G+KSF S+LCM SISLGNYVSS+LV++VM I+   +  GWIP NL
Sbjct  489   MYVGQLEFFNGQAPDGIKSFGSSLCMASISLGNYVSSMLVNMVMIITARGQNKGWIPENL  548

Query  483   NKGHLDRFYFLLAALTTADFVVYILCAKWYKYIEFEERN  367
             N GH+DRF+FLLA L   DFV+Y+ CAKWYK I  E+ +
Sbjct  549   NTGHMDRFFFLLAGLAAFDFVLYLFCAKWYKNINIEDSD  587



>ref|XP_009618337.1| PREDICTED: protein NRT1/ PTR FAMILY 7.1 [Nicotiana tomentosiformis]
 ref|XP_009618338.1| PREDICTED: protein NRT1/ PTR FAMILY 7.1 [Nicotiana tomentosiformis]
Length=599

 Score =   640 bits (1651),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 339/565 (60%), Positives = 422/565 (75%), Gaps = 16/565 (3%)
 Frame = -3

Query  2013  TGGWFAGVLLLVNQGLATLAFFGVGVNLVLFLTRVMGQDNADAANNVSKWTGTVYLFSLL  1834
             TGGW++  L LVNQGLATLAFFGVGVNLVLFL RV+GQDNA AANNVSKWTGTVYL SLL
Sbjct  42    TGGWYSAFLCLVNQGLATLAFFGVGVNLVLFLVRVLGQDNATAANNVSKWTGTVYLCSLL  101

Query  1833  GAFLSDSYWGRYKTCAIFQLIYVVGLISVSIFSFIFLVKPKGCGDENTPCRSPSRIHIAV  1654
             GAF+SDSYWGR+ T AIFQLI ++GL+ +S+ S+IFL+KP+GCGD    C  PS +  A+
Sbjct  102   GAFISDSYWGRFLTSAIFQLILLLGLVIMSVTSWIFLIKPEGCGDGILNCVPPSPLGTAL  161

Query  1653  YYVSIYLVALGNGGYQPNIATFGSDQFDGDHAHESVSKVAFFSYFYLALNLGSLFSNTVL  1474
             +Y++IYLVALG GG+QP IATFGSDQFD  +  E +S+ A+F YFY ALN GSL SNT+L
Sbjct  162   FYLAIYLVALGYGGHQPTIATFGSDQFDEANPKEKISRAAYFGYFYFALNAGSLISNTIL  221

Query  1473  VYFEDKGMWTLGFWastvsavlalllflVGTPRYRHFAPKGNPLSRFSQVLVASARKWNV  1294
             VY+ED G WTLGFWAST +A+L L +FL+GTP Y++    GNPL R +QV VA+ RKW V
Sbjct  222   VYYEDGGKWTLGFWASTAAALLGLFIFLLGTPGYKYVKSFGNPLPRVAQVFVAAVRKWRV  281

Query  1293  HLPSDGDDHRLYEIQEHDSS---TRKILHTEGFKFLDKAAVITTKESVRDLEERNINPWR  1123
                ++ +   LYE+   +SS   TRKILH+  FK LD AA++T +    D +    NPWR
Sbjct  282   ---ANVEGEELYEVDGSESSIKGTRKILHSNDFKKLDNAAIVTEE----DRQRPAFNPWR  334

Query  1122  LCSVTQVEEVKCILRLLPIWLCTILYSVVFTQMASLFVEQGAAMRTNIAGFHIPPASMSS  943
             LC++TQVEE KCI+R+ PIWLCTI+YSV+FTQMASLFVEQG  M   I  F +P ASMS+
Sbjct  335   LCTITQVEEAKCIIRMCPIWLCTIMYSVIFTQMASLFVEQGEVMDATIGHFRLPAASMSA  394

Query  942   FDILSVAAFIFIYRRILDPLIASLKKTRRAQGFTELQRMGVGLiiaimamvaagiVEHFR  763
             FDI SV    F+YR ++ PL   L    +  G TELQRMGVGLII +++M+AAG+ E +R
Sbjct  395   FDICSVLTCTFLYRFMVVPLAGKLNGNPK--GLTELQRMGVGLIIGMLSMIAAGVTEIYR  452

Query  762   LKYASTDCPRCPSSLSIFWQVPQYVLIGASEVFMYVGQLEFFNGQAPEGLKSFASALCMT  583
             LK+      +  SSLSIFWQ+PQY+L+GASEVFMYVGQLEFFNGQAP+G+KS  S+LCM 
Sbjct  453   LKHVIPG--KEASSLSIFWQIPQYILVGASEVFMYVGQLEFFNGQAPDGIKSLGSSLCMA  510

Query  582   SISLGNYVSSLLVSIVMRISTTHRMPGWIPGNLNKGHLDRFYFLLAALTTADFVVYILCA  403
             S+SLGNYVSS+LV++VM I+      GWIP NLN GH+DRFYFLL  L   D   +++ A
Sbjct  511   SMSLGNYVSSMLVNMVMTITARGERHGWIPENLNNGHIDRFYFLLFGLALVDLFAFVVFA  570

Query  402   KWYKYIEFEERN-SCLKNIGDSKLQ  331
             KWYK I+ E  + SC K+ G+ + Q
Sbjct  571   KWYKGIQHEGSDESCTKD-GEKESQ  594



>ref|XP_011080231.1| PREDICTED: protein NRT1/ PTR FAMILY 7.1-like [Sesamum indicum]
Length=600

 Score =   639 bits (1647),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 339/555 (61%), Positives = 422/555 (76%), Gaps = 15/555 (3%)
 Frame = -3

Query  2022  RSATGGWFAGVLLLVNQGLATLAFFGVGVNLVLFLTRVMGQDNADAANNVSKWTGTVYLF  1843
              + TGGW +  LLLVNQGLATLAFFGVGVNLVLFLTRV+GQDNA AANNVSKWTGTVYL 
Sbjct  36    NNGTGGWSSAFLLLVNQGLATLAFFGVGVNLVLFLTRVLGQDNASAANNVSKWTGTVYLC  95

Query  1842  SLLGAFLSDSYWGRYKTCAIFQLIYVVGLISVSIFSFIFLVKPKGCGDENTPCRSPSRIH  1663
             SL+GAFLSDSYWGRY TCA+FQ+I+V+GL+ +S+ S++ L+KP GCGD    C   +   
Sbjct  96    SLVGAFLSDSYWGRYLTCAVFQVIFVLGLVLLSLSSWLLLLKPVGCGDGKQICVPATSFG  155

Query  1662  IAVYYVSIYLVALGNGGYQPNIATFGSDQFDGDHAHESVSKVAFFSYFYLALNLGSLFSN  1483
              A++Y+++YLVA G GG+QP IATFG+DQFD     +  SK +FF YFY ALN GSLFSN
Sbjct  156   SALFYLAVYLVAFGYGGHQPTIATFGADQFDESIPRQRNSKSSFFCYFYFALNTGSLFSN  215

Query  1482  TVLVYFEDKGMWTLGFWastvsavlalllflVGTPRYRHFAPKGNPLSRFSQVLVASARK  1303
             T+LVY+ED G WTLGFWA+T SAVLAL+ +L+G+  YR+  P GNP+ R  QV  A+A+K
Sbjct  216   TILVYYEDSGEWTLGFWAATASAVLALVAYLLGSRAYRYINPSGNPVRRVMQVFTAAAKK  275

Query  1302  WNVHLPSDGDDHRLYEIQEHDSS---TRKILHTEGFKFLDKAAVITTKESVRDLEERNIN  1132
             WNV +    +   L+E++  +S+   +RKI HT+GF+ LDKAA+IT ++      +   +
Sbjct  276   WNVKMQ---EGEALHEVEGSESAIKGSRKIFHTDGFECLDKAAIITEQD-----RQGPAD  327

Query  1131  PWRLCSVTQVEEVKCILRLLPIWLCTILYSVVFTQMASLFVEQGAAMRTNIAGFHIPPAS  952
             PWRLC+VTQVEE KCILR+LPIWLCTI+YSVVFTQMASLFVEQG  M + +  FH+PPAS
Sbjct  328   PWRLCTVTQVEEAKCILRMLPIWLCTIIYSVVFTQMASLFVEQGNVMNSTVGNFHLPPAS  387

Query  951   MSSFDILSVAAFIFIYRRILDPLIASLKKTRRAQGFTELQRMGVGLiiaimamvaagiVE  772
             MS+FDI SV     IYR+IL P+   L  +   +G TELQRMG+GLII ++AMVAAG+ E
Sbjct  388   MSAFDICSVLLCTGIYRQILVPIAGRL--SGNPKGLTELQRMGIGLIIGMLAMVAAGVTE  445

Query  771   HFRLKYASTDCPRCPSSLSIFWQVPQYVLIGASEVFMYVGQLEFFNGQAPEGLKSFASAL  592
               RLK          S +SIFWQ+PQYVL+GASEVFMYVGQLEFFNGQAP+G+KS  S+L
Sbjct  446   MERLKRVIPG--EHDSQMSIFWQIPQYVLVGASEVFMYVGQLEFFNGQAPDGVKSLGSSL  503

Query  591   CMTSISLGNYVSSLLVSIVMRISTTHRMPGWIPGNLNKGHLDRFYFLLAALTTADFVVYI  412
             CM S+SLGN+VSSLLV++VM I+  +  PGWIP +LN GH+D FYFL+A LT AD VVY+
Sbjct  504   CMASMSLGNFVSSLLVNMVMGITARNNKPGWIPADLNTGHMDMFYFLIAGLTAADLVVYV  563

Query  411   LCAKWYKYIEFEERN  367
              CAKWYK I  E+ +
Sbjct  564   ACAKWYKCINLEDTD  578



>emb|CDP17506.1| unnamed protein product [Coffea canephora]
Length=615

 Score =   639 bits (1648),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 345/575 (60%), Positives = 427/575 (74%), Gaps = 19/575 (3%)
 Frame = -3

Query  2037  GRPALRSATGGWFAGVLLLVNQGLATLAFFGVGVNLVLFLTRVMGQDNADAANNVSKWTG  1858
             G   +R+  GGW +  LLL NQGLATLAFFGV VNLVLFLTRV+GQDNA AANNVSKWTG
Sbjct  48    GVLPIRNHLGGWSSAFLLLANQGLATLAFFGVSVNLVLFLTRVLGQDNASAANNVSKWTG  107

Query  1857  TVYLFSLLGAFLSDSYWGRYKTCAIFQLIYVVGLISVSIFSFIFLVKPKGCGDENTPCRS  1678
             TVYL SL+GAFLSDSYWGRY TCAIFQ+I V+GL+ VS+ S++ LVKP GCGD    C  
Sbjct  108   TVYLCSLVGAFLSDSYWGRYLTCAIFQVILVLGLVIVSLSSWLMLVKPVGCGDGILDCNP  167

Query  1677  PSRIHIAVYYVSIYLVALGNGGYQPNIATFGSDQFDGDHAHESVSKVAFFSYFYLALNLG  1498
              + I  A++Y  IYLVALG GG+QP +ATFGSDQFD ++  +  SK AFF YFY ALN+G
Sbjct  168   TTPIGNAIFYSGIYLVALGYGGHQPTLATFGSDQFDENNPKQKSSKAAFFCYFYFALNVG  227

Query  1497  SLFSNTVLVYFEDKGMWTLGFWastvsavlalllflVGTPRYRHFAPKGNPLSRFSQVLV  1318
             SLFSNT+LVY+ED G WTLGFW S  +AV+AL  FL+G+  YR+  P GNPL R +QV V
Sbjct  228   SLFSNTILVYYEDTGRWTLGFWVSAGAAVVALASFLLGSSCYRYIKPFGNPLPRVAQVFV  287

Query  1317  ASARKWNVHLPSDGDDHRLYEIQEHDS---STRKILHTEGFKFLDKAAVITTKESVRDLE  1147
             A+ +K    LP   D  +LYE++  +S    +RKILHT+ F FLDKAA++T +E   +  
Sbjct  288   AAIKK--CKLPQV-DSAKLYEVEGSESVIKGSRKILHTDEFGFLDKAAIMTEEE---NFG  341

Query  1146  ERNINPWRLCSVTQVEEVKCILRLLPIWLCTILYSVVFTQMASLFVEQGAAMRTNIAGFH  967
             +R  + W LC++TQVEE KCI+R+ PIWLCTI+YSVVFTQMASLFVEQGA M  ++  F+
Sbjct  342   KR--SAWNLCTITQVEEAKCIIRMFPIWLCTIIYSVVFTQMASLFVEQGAVMNKSLGKFN  399

Query  966   IPPASMSSFDILSVAAFIFIYRRILDPLIASLKKTRRAQGFTELQRMGVGLiiaimamva  787
             +P ASMS+FDI SV     IY+RIL PL   L  +   +G TELQRMG G+II ++AM+A
Sbjct  400   LPAASMSAFDICSVLLCTGIYQRILVPLAGRL--SGNPKGITELQRMGAGIIIGMLAMIA  457

Query  786   agiVEHFRLKYASTDCPRCPSSLSIFWQVPQYVLIGASEVFMYVGQLEFFNGQAPEGLKS  607
             AG+ E  RLK       +  SSLSIF QVPQYVL+GASEVFMYVGQLEFFN QAP+G+KS
Sbjct  458   AGVTEIERLKRVIPG--QQSSSLSIFCQVPQYVLVGASEVFMYVGQLEFFNSQAPDGIKS  515

Query  606   FASALCMTSISLGNYVSSLLVSIVMRISTTHRMPGWIPGNLNKGHLDRFYFLLAALTTAD  427
             F S+LCM SIS+GN+VSS+LV++VM+I+     PGWIP +LN+GH+D+FYFL+A L+  D
Sbjct  516   FGSSLCMASISIGNFVSSMLVNMVMQITAKGDKPGWIPEDLNEGHMDKFYFLIACLSAID  575

Query  426   FVVYILCAKWYKYIEFEERNSCLKNIGDSKLQEDR  322
             FV+YI CAKWYK    +E NS    I  S  +ED+
Sbjct  576   FVIYIFCAKWYKCGNPDEDNS----ITQSNKEEDQ  606



>ref|NP_197465.1| putative peptide/nitrate transporter [Arabidopsis thaliana]
 sp|Q3E9B5.1|PTR51_ARATH RecName: Full=Protein NRT1/ PTR FAMILY 7.1; Short=AtNPF7.1 [Arabidopsis 
thaliana]
 gb|AED92733.1| putative peptide/nitrate transporter [Arabidopsis thaliana]
Length=609

 Score =   636 bits (1641),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 340/551 (62%), Positives = 411/551 (75%), Gaps = 26/551 (5%)
 Frame = -3

Query  2013  TGGWFAGVLLLVNQGLATLAFFGVGVNLVLFLTRVMGQDNADAANNVSKWTGTVYLFSLL  1834
              GGW   ++LLVNQGLATLAFFGVGVNLVLFLTRVMGQ NA+AANNVSKWTGTVY+FSL+
Sbjct  60    NGGWTNAIILLVNQGLATLAFFGVGVNLVLFLTRVMGQGNAEAANNVSKWTGTVYMFSLV  119

Query  1833  GAFLSDSYWGRYKTCAIFQLIYVVGLISVSIFSFIFLVKPKGCGDENTPCRSPSRIHIAV  1654
             GAFLSDSYWGRY TC IFQ+I+V+G+  +S  S+ FL+KP+GCGD +  C  PS + +A+
Sbjct  120   GAFLSDSYWGRYLTCTIFQVIFVIGVGLLSFVSWFFLIKPRGCGDGDLECNPPSSLGVAI  179

Query  1653  YYVSIYLVALGNGGYQPNIATFGSDQFDGDHAHESVSKVAFFSYFYLALNLGSLFSNTVL  1474
             +Y+S+YLVA G GG+QP +ATFG+DQ D D      SK AFFSYFY ALN+G+LFSNT+L
Sbjct  180   FYLSVYLVAFGYGGHQPTLATFGADQLDDDKN----SKAAFFSYFYFALNVGALFSNTIL  235

Query  1473  VYFEDKGMWTLGFWastvsavlalllflVGTPRYRHFAPKGNPLSRFSQVLVASARKWNV  1294
             VYFEDKG+WT GF  S  SA++AL+ FL  T +YR+  P GNPL R +QV VA+ARKW+V
Sbjct  236   VYFEDKGLWTEGFLVSLGSAIVALVAFLAPTRQYRYVKPCGNPLPRVAQVFVATARKWSV  295

Query  1293  HLPSDGDDHRLYEIQEHDSS---TRKILHTEGFKFLDKAAVITTKESVRDLEERNINPWR  1123
               P  GD H LYE++  +S+   +RKI H+  F FLD+AAVIT      D      N WR
Sbjct  296   VRP--GDPHELYELEGPESAIKGSRKIFHSTKFLFLDRAAVITEN----DRNGTRSNAWR  349

Query  1122  LCSVTQVEEVKCILRLLPIWLCTILYSVVFTQMASLFVEQGAAMRTNIAGFHIPPASMSS  943
             LCSVTQVEE KC+++LLPIWLCTI+YSV+FTQMASLFVEQG  M   +  FHIP ASMS 
Sbjct  350   LCSVTQVEEAKCVMKLLPIWLCTIIYSVIFTQMASLFVEQGDVMNAYVGKFHIPAASMSV  409

Query  942   FDILSVAAFIFIYRRILDPLIASLKKTRRAQGFTELQRMGVGLiiaimamvaagiVEHFR  763
             FDI SV     IYR I+ P +            TEL RMG+GLII IMAMVAAG+ E  R
Sbjct  410   FDIFSVFVSTGIYRHIIFPYVRP----------TELMRMGIGLIIGIMAMVAAGLTEIQR  459

Query  762   LKYASTDCPRCPSSLSIFWQVPQYVLIGASEVFMYVGQLEFFNGQAPEGLKSFASALCMT  583
             LK       +  S L+I WQ+PQYVL+GASEVFMYVGQLEFFNGQAP+GLK+  S+LCM 
Sbjct  460   LKRVVPG--QKESELTILWQIPQYVLVGASEVFMYVGQLEFFNGQAPDGLKNLGSSLCMA  517

Query  582   SISLGNYVSSLLVSIVMRISTT-HRMPGWIPGNLNKGHLDRFYFLLAALTTADFVVYILC  406
             S++LGNYVSSL+V+IVM I+      PGWIP NLN+GH+DRFYFL+AAL   DFVVY++ 
Sbjct  518   SMALGNYVSSLMVNIVMAITKRGENSPGWIPENLNEGHMDRFYFLIAALAAIDFVVYLIF  577

Query  405   AKWYKYIEFEE  373
             AKWY+ I  +E
Sbjct  578   AKWYQPISHDE  588



>ref|XP_007139336.1| hypothetical protein PHAVU_008G020800g [Phaseolus vulgaris]
 gb|ESW11330.1| hypothetical protein PHAVU_008G020800g [Phaseolus vulgaris]
Length=587

 Score =   635 bits (1639),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 331/556 (60%), Positives = 416/556 (75%), Gaps = 14/556 (3%)
 Frame = -3

Query  2022  RSATGGWFAGVLLLVNQGLATLAFFGVGVNLVLFLTRVMGQDNADAANNVSKWTGTVYLF  1843
             +   GGW   ++LLVNQ LATLAFFGVGVNLVLFLTRV+ QD+A+AANNVSKWTGTVY+F
Sbjct  32    KKCKGGWKTTIILLVNQALATLAFFGVGVNLVLFLTRVLHQDSAEAANNVSKWTGTVYIF  91

Query  1842  SLLGAFLSDSYWGRYKTCAIFQLIYVVGLISVSIFSFIFLVKPKGCGDENTPCRSPSRIH  1663
             SL+GAFLSDSYWGRY TC+IFQ+I+VVGL  +S+ S+ FL+ P GCG+E T CR PS + 
Sbjct  92    SLVGAFLSDSYWGRYLTCSIFQIIFVVGLGLLSLTSWRFLINPAGCGNEETKCREPSSVG  151

Query  1662  IAVYYVSIYLVALGNGGYQPNIATFGSDQFDGDHAHESVSKVAFFSYFYLALNLGSLFSN  1483
             + V+Y+SIYLVA G GG+QP +ATFG+DQFD  +     S+ AFFSYFY ALN+GSLFSN
Sbjct  152   VGVFYLSIYLVAFGYGGHQPTLATFGADQFDEKNEKHKDSREAFFSYFYFALNVGSLFSN  211

Query  1482  TVLVYFEDKGMWTLGFWastvsavlalllflVGTPRYRHFAPKGNPLSRFSQVLVASARK  1303
             T+LVY+ED GMWT+GF  S  SA++AL+ +L G  +YR+    GNP+ R +QV VA+ RK
Sbjct  212   TILVYYEDSGMWTMGFLVSLASAIIALVSYLAGYKKYRYVKAYGNPVIRVAQVFVAAFRK  271

Query  1302  WNVHLPSDGDDHRLYEIQEHDSS---TRKILHTEGFKFLDKAAVITTKESVRDLEERNIN  1132
               V   +   + +LYE+   +S+   +RKI+H+   +F+DKAA IT K    D ++   N
Sbjct  272   CKVQYST---EDQLYEVDGPESAIKGSRKIMHSNDLRFMDKAATITEK----DGDDLKNN  324

Query  1131  PWRLCSVTQVEEVKCILRLLPIWLCTILYSVVFTQMASLFVEQGAAMRTNIAGFHIPPAS  952
              WRLC+VTQVEE KC+LR+LP+WLCTI+YSVVFTQMASLFVEQG  M   I  FH+P AS
Sbjct  325   QWRLCTVTQVEEAKCVLRMLPVWLCTIIYSVVFTQMASLFVEQGDVMDNRIGNFHLPAAS  384

Query  951   MSSFDILSVAAFIFIYRRILDPLIASLKKTRRAQGFTELQRMGVGLiiaimamvaagiVE  772
             MS FDI SV     IYR I+ P+  + + T   +G TELQRMGVGLII +++M+AAG+ E
Sbjct  385   MSVFDICSVLLNTGIYRYIIVPV--ARRFTGNPRGLTELQRMGVGLIIGMLSMIAAGVTE  442

Query  771   HFRLKYASTDCPRCPSSLSIFWQVPQYVLIGASEVFMYVGQLEFFNGQAPEGLKSFASAL  592
               RLK+      +  SSL+IFWQ+PQYVL+GASEV +YVGQLEFFNGQAP+G+KSF S+L
Sbjct  443   IERLKHVIPG--KKASSLTIFWQIPQYVLVGASEVLVYVGQLEFFNGQAPDGIKSFGSSL  500

Query  591   CMTSISLGNYVSSLLVSIVMRISTTHRMPGWIPGNLNKGHLDRFYFLLAALTTADFVVYI  412
             CM SISLGNYVSS LV +V  I+     PGWIP NLN GHLDRF+FL+A LT  DFV+Y 
Sbjct  501   CMASISLGNYVSSTLVYMVAGITERGDNPGWIPNNLNVGHLDRFFFLIAILTALDFVLYF  560

Query  411   LCAKWYKYIEFEERNS  364
              CA+WYK +  EE ++
Sbjct  561   FCARWYKSMNIEEGDT  576



>emb|CAN77230.1| hypothetical protein VITISV_005961 [Vitis vinifera]
Length=594

 Score =   634 bits (1636),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 343/551 (62%), Positives = 407/551 (74%), Gaps = 32/551 (6%)
 Frame = -3

Query  2019  SATGGWFAGVLLLVNQGLATLAFFGVGVNLVLFLTRVMGQDNADAANNVSKWTGTVYLFS  1840
             +ATGGW +  LLL NQGLATLAFFGVGVNLVLFLTRV+ QDNA+AAN+VSKWTGTVYL S
Sbjct  55    NATGGWKSASLLLANQGLATLAFFGVGVNLVLFLTRVLSQDNANAANSVSKWTGTVYLCS  114

Query  1839  LLGAFLSDSYWGRYKTCAIFQLIYVVGLISVSIFSFIFLVKPKGCGDENTPCRSPSRIHI  1660
             L+GAFLSDSYWGRY TCAIFQ+I V+G                 CGD  T C   S + +
Sbjct  115   LIGAFLSDSYWGRYLTCAIFQVILVLG-----------------CGDRTTLCSPSSSVGL  157

Query  1659  AVYYVSIYLVALGNGGYQPNIATFGSDQFDGDHAHESVSKVAFFSYFYLALNLGSLFSNT  1480
              V+Y SIYLVA G GG+QP +AT G+DQFD  +  E  SK  FFSYFY ALNLGSLFSNT
Sbjct  158   GVFYSSIYLVAFGYGGHQPTLATLGADQFDETNPREMNSKTVFFSYFYFALNLGSLFSNT  217

Query  1479  VLVYFEDKGMWTLGFWastvsavlalllflVGTPRYRHFAPKGNPLSRFSQVLVASARKW  1300
             +LVYFED G WTLGF  ST SA++AL++FL G+  YRH  P GNPL R +QV VA+ RKW
Sbjct  218   ILVYFEDSGKWTLGFLVSTGSAIIALVIFLCGSSGYRHIKPCGNPLPRVAQVFVAAFRKW  277

Query  1299  NVHLPSDGDDHRLYEIQEHDSS---TRKILHTEGFKFLDKAAVITTKESVRDLEERNINP  1129
             +V +P +GD   LYE++  +S+   +RKILH+   +FLDKAA +   + V      + NP
Sbjct  278   DVVVPENGDG--LYELEGSESAIKGSRKILHSNEIEFLDKAATMIEADMV------DPNP  329

Query  1128  WRLCSVTQVEEVKCILRLLPIWLCTILYSVVFTQMASLFVEQGAAMRTNIAGFHIPPASM  949
             WRLC+VTQVEE KC++++LPIWLCTI+YSV+FTQMASLFVEQG  M   I  F IP ASM
Sbjct  330   WRLCTVTQVEEAKCVIKMLPIWLCTIIYSVIFTQMASLFVEQGDVMNRKIGNFEIPAASM  389

Query  948   SSFDILSVAAFIFIYRRILDPLIASLKKTRRAQGFTELQRMGVGLiiaimamvaagiVEH  769
             S+FDI SV     IYR+IL P+  S K T   +G +ELQRMG+GLII I AM+AAG+ E 
Sbjct  390   SAFDIFSVLLCTGIYRQILVPI--SGKLTGNPKGMSELQRMGIGLIIGIAAMIAAGLTEL  447

Query  768   FRLKYASTDCPRCPSSLSIFWQVPQYVLIGASEVFMYVGQLEFFNGQAPEGLKSFASALC  589
              RL+  S +     SSLSIFWQ PQYVL+GASEVFMYVGQLEFFNGQAP+G+KS  S+LC
Sbjct  448   GRLRRVSPN--EEASSLSIFWQTPQYVLVGASEVFMYVGQLEFFNGQAPDGIKSLGSSLC  505

Query  588   MTSISLGNYVSSLLVSIVMRISTTHRMPGWIPGNLNKGHLDRFYFLLAALTTADFVVYIL  409
             M SISLGNYVSSLLV+IVM ++T    PGWIP +LN GHLDRFYFL+A LT  DFV+Y+ 
Sbjct  506   MASISLGNYVSSLLVNIVMGVTTRGDNPGWIPEDLNTGHLDRFYFLIAVLTVIDFVIYVF  565

Query  408   CAKWYKYIEFE  376
             CAKWYK I  E
Sbjct  566   CAKWYKSINLE  576



>ref|XP_004491684.1| PREDICTED: putative peptide/nitrate transporter At5g19640-like 
[Cicer arietinum]
Length=591

 Score =   634 bits (1634),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 335/570 (59%), Positives = 413/570 (72%), Gaps = 20/570 (4%)
 Frame = -3

Query  2010  GGWFAGVLLLVNQGLATLAFFGVGVNLVLFLTRVMGQDNADAANNVSKWTGTVYLFSLLG  1831
             GGW    +LL NQ LATLAFFGVGVNLVLFLTRV+ QD+A+AANNVS WTGTVY+FSLLG
Sbjct  37    GGWKMAYILLANQALATLAFFGVGVNLVLFLTRVLRQDSAEAANNVSVWTGTVYIFSLLG  96

Query  1830  AFLSDSYWGRYKTCAIFQLIYVVGLISVSIFSFIFLVKPKGCGDENTPCRSPSRIHIAVY  1651
             AFLSDSYWGRY TC IFQL +V+GL  +S+ S++ L+KP+GCG+E   CR  + + + ++
Sbjct  97    AFLSDSYWGRYLTCTIFQLFFVLGLGVLSLTSWLLLIKPEGCGNEEIKCREATSLGVNIF  156

Query  1650  YVSIYLVALGNGGYQPNIATFGSDQFDGDHAHESVSKVAFFSYFYLALNLGSLFSNTVLV  1471
             Y+SIY+VA G GG+QP +ATFG+DQFD    HES S+ AFF YFY ALN+GSLFSNT+LV
Sbjct  157   YLSIYMVAFGYGGHQPTLATFGADQFDDKTIHESNSREAFFCYFYFALNVGSLFSNTILV  216

Query  1470  YFEDKGMWTLGFWastvsavlalllflVGTPRYRHFAPKGNPLSRFSQVLVASARKWNVH  1291
             Y ED G WTLGF  S  SA++AL+ FL G+ +YR+    GNP+ R  QV VAS RKW V 
Sbjct  217   YVEDSGRWTLGFGVSLASAIVALISFLAGSKKYRYVQAYGNPVIRVIQVFVASVRKWKVQ  276

Query  1290  LPSDGDDHRLYEIQEHDSS---TRKILHTEGFKFLDKAAVITTKESVRDLEERNINPWRL  1120
                DG   +LYE++  +S+   +RKI+HT+    LDKAA +T K+   D E    N WRL
Sbjct  277   PVKDG---QLYEVEGLESAIKGSRKIMHTQKLSCLDKAATLTAKDG-NDPE----NHWRL  328

Query  1119  CSVTQVEEVKCILRLLPIWLCTILYSVVFTQMASLFVEQGAAMRTNIAGFHIPPASMSSF  940
             C+VTQVEE KC++R+ P+WLCTI+YSVVFTQMASLFVEQG  M   +  +H+P A+MS F
Sbjct  329   CTVTQVEEAKCVVRMFPVWLCTIIYSVVFTQMASLFVEQGDVMNNKVGKYHLPAATMSVF  388

Query  939   DILSVAAFIFIYRRILDPLIASLKKTRRAQGFTELQRMGVGLiiaimamvaagiVEHFRL  760
             DI SV     IYRRIL PL   L  +   +G TELQRMGVGL+I ++AMVAAG+ E  RL
Sbjct  389   DICSVLLCTGIYRRILVPLAGKL--SGNPKGLTELQRMGVGLVIGMLAMVAAGVTELARL  446

Query  759   KYASTDCPRCPSSLSIFWQVPQYVLIGASEVFMYVGQLEFFNGQAPEGLKSFASALCMTS  580
             ++ S       SSLSIF+Q+PQYVL+GASEVFMYVGQLEFFNGQAP+G+KSF S+LCM S
Sbjct  447   QHLSPG--EKASSLSIFYQIPQYVLVGASEVFMYVGQLEFFNGQAPDGIKSFGSSLCMAS  504

Query  579   ISLGNYVSSLLVSIVMRISTTHRMPGWIPGNLNKGHLDRFYFLLAALTTADFVVYILCAK  400
             ISLGNYVSS +V +V  I+ T   PGWIP NLN GH+DRF+FL+A LT  D VVY+ CA+
Sbjct  505   ISLGNYVSSFMVKMVTIITATGEKPGWIPNNLNMGHMDRFFFLIAILTALDLVVYVFCAR  564

Query  399   WYKYIEFEERNSCLKNIGDSKLQEDRSTFN  310
             WY  +      S      D + QED    N
Sbjct  565   WYTSVNINVNGS-----EDIENQEDDDAIN  589



>ref|XP_007142617.1| hypothetical protein PHAVU_007G002800g, partial [Phaseolus vulgaris]
 gb|ESW14611.1| hypothetical protein PHAVU_007G002800g, partial [Phaseolus vulgaris]
Length=658

 Score =   636 bits (1641),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 346/579 (60%), Positives = 425/579 (73%), Gaps = 21/579 (4%)
 Frame = -3

Query  2094  DEEKASREECTLDGTVDHYGRPALRSATGGWFAGVLLLVNQGLATLAFFGVGVNLVLFLT  1915
             + + + REE  ++ +       A     GG     LLLVNQ LATLAFFGVGVNLVLFLT
Sbjct  83    EGDSSYREESAMERS-----SRADEKKIGGAKVASLLLVNQALATLAFFGVGVNLVLFLT  137

Query  1914  RVMGQDNADAANNVSKWTGTVYLFSLLGAFLSDSYWGRYKTCAIFQLIYVVGLISVSIFS  1735
             RV+GQDN  AANNVSKW GTVY+FSL+GAFLSDSYWGRY TC +FQLI+V+GL   S+ S
Sbjct  138   RVLGQDNVSAANNVSKWIGTVYMFSLIGAFLSDSYWGRYLTCMVFQLIFVLGLALSSLSS  197

Query  1734  FIFLVKPKGCGDENTPCRSPSRIHIAVYYVSIYLVALGNGGYQPNIATFGSDQFDGDHAH  1555
             + FL+ P GCGD NTPC+ PS I   ++Y+SIYLVA G GG+QP +ATFG+DQ++  + +
Sbjct  198   WRFLINPAGCGDGNTPCK-PSSIGDDIFYLSIYLVAFGYGGHQPTLATFGADQYNEKNPN  256

Query  1554  ESVSKVAFFSYFYLALNLGSLFSNTVLVYFEDKGMWTLGFWastvsavlalllflVGTPR  1375
             E  +KVAFF YFY ALN+GSLFSNTVLVY+ED G WT+GF  S VSAV+A L FL+GTPR
Sbjct  257   EKNAKVAFFCYFYFALNVGSLFSNTVLVYYEDTGKWTMGFLVSLVSAVIAFLAFLLGTPR  316

Query  1374  YRHFAPKGNPLSRFSQVLVASARKWNVHLPSDGDDHRLYEIQEHDSS---TRKILHTEGF  1204
             YR+  P GNP+ R +QV  A  RKW    P+  ++  L+E+    S+   +RKI HT+ F
Sbjct  317   YRYVKPCGNPVVRIAQVFAAVFRKWKAA-PAKAEE--LFEVDGAKSAIKGSRKIRHTDDF  373

Query  1203  KFLDKAAVITTKESVRDLEERNINPWRLCSVTQVEEVKCILRLLPIWLCTILYSVVFTQM  1024
             KF+DKAA I   E     E  + NPWRLC+VTQVEE KC+LR+LP+WLCTI+YSVVFTQM
Sbjct  374   KFMDKAATIKENE-----ELSSKNPWRLCTVTQVEEAKCLLRMLPVWLCTIIYSVVFTQM  428

Query  1023  ASLFVEQGAAMRTNIAGFHIPPASMSSFDILSVAAFIFIYRRILDPLIASLKKTRRAQGF  844
             ASLFVEQG  M + I  FH+P ASMS+FDI SV     IYR+IL P    L  +   +G 
Sbjct  429   ASLFVEQGDVMNSYIGSFHLPAASMSAFDICSVLVCTGIYRQILVPFAGKL--SGNPKGL  486

Query  843   TELQRMGVGLiiaimamvaagiVEHFRLKYASTDCPRCPSSLSIFWQVPQYVLIGASEVF  664
             +ELQRMG+GL+I ++AMVA+G  E  RLK       +  SSLSIFWQ+PQYVL+GASEVF
Sbjct  487   SELQRMGIGLVIGMLAMVASGATEIARLKRIIHG--QKTSSLSIFWQIPQYVLVGASEVF  544

Query  663   MYVGQLEFFNGQAPEGLKSFASALCMTSISLGNYVSSLLVSIVMRISTTHRMPGWIPGNL  484
             MYVGQLEFFNGQAP+G+KSF S+LCM SISLGNYVSS+LV++VM I+   +  GWIP NL
Sbjct  545   MYVGQLEFFNGQAPDGIKSFGSSLCMASISLGNYVSSMLVNMVMIITARGQNKGWIPENL  604

Query  483   NKGHLDRFYFLLAALTTADFVVYILCAKWYKYIEFEERN  367
             N GH+DRF+FLLA L   DFV+Y+LCAKWYK I  E+ +
Sbjct  605   NTGHMDRFFFLLAGLAAFDFVLYLLCAKWYKNINVEDSD  643



>ref|XP_007207539.1| hypothetical protein PRUPE_ppa015854mg [Prunus persica]
 gb|EMJ08738.1| hypothetical protein PRUPE_ppa015854mg [Prunus persica]
Length=602

 Score =   634 bits (1634),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 342/588 (58%), Positives = 432/588 (73%), Gaps = 24/588 (4%)
 Frame = -3

Query  2103  NERDEEKA---------SREECTLDGTVDHYGRPALRSATGGWFAGVLLLVNQGLATLAF  1951
             N RD E +         + ++ T + T     +  ++ + GGW    +LL NQGLATLAF
Sbjct  6     NNRDAEVSGAVDTNIPENEQQVTTEITESKETKSPVQKSRGGWTLATILLANQGLATLAF  65

Query  1950  FGVGVNLVLFLTRVMGQDNADAANNVSKWTGTVYLFSLLGAFLSDSYWGRYKTCAIFQLI  1771
             FGVGVNLVLFL RV+ Q NA AANNVSKWTGTVYLFSL+GAFLSDSYWGR+ TCAIFQLI
Sbjct  66    FGVGVNLVLFLIRVLDQQNAAAANNVSKWTGTVYLFSLVGAFLSDSYWGRFLTCAIFQLI  125

Query  1770  YVVGLISVSIFSFIFLVKPKGCGDENTPCRSPSRIHIAVYYVSIYLVALGNGGYQPNIAT  1591
              V+GL  +S+ S+++L+ P GCGD  TPC+  S + + ++Y+SIYL+ALG GG+QP IAT
Sbjct  126   LVLGLGLLSLSSWLYLIHPSGCGDGVTPCKPKSTVGVVMFYLSIYLIALGYGGHQPTIAT  185

Query  1590  FGSDQFDGDHAHESVSKVAFFSYFYLALNLGSLFSNTVLVYFEDKGMWTLGFWastvsav  1411
             FG+DQFD  +  +  SK AFF YFY ALN+GSLFSN++LVY+EDKG WT+GF  S  SA+
Sbjct  186   FGADQFDETNPKQQSSKAAFFCYFYFALNVGSLFSNSILVYYEDKGFWTMGFLVSLGSAI  245

Query  1410  lalllflVGTPRYRHFAPKGNPLSRFSQVLVASARKWNVHLPSDGDDHRLYEIQEHDSS-  1234
             + L+ +L+  PRYR+  P GNPL R +QV VA+ RKW V +P+  ++  LYE++  +S+ 
Sbjct  246   VGLVSYLLAAPRYRYIKPSGNPLPRVAQVFVAAFRKWKV-VPASPEN--LYEVEGSESAI  302

Query  1233  --TRKILHTEGFKFLDKAAVITTKESVRDLEERNINPWRLCSVTQVEEVKCILRLLPIWL  1060
               +RKILH++  +FLDKAA IT  +     +  + NPWR+C+VTQVEE KC+L++LPIWL
Sbjct  303   KGSRKILHSKEIEFLDKAATITEMD-----QSGHNNPWRVCTVTQVEEAKCVLKMLPIWL  357

Query  1059  CTILYSVVFTQMASLFVEQGAAMRTNIAGFHIPPASMSSFDILSVAAFIFIYRRILDPLI  880
             CTI+YSVVFTQMASLFVEQG  M ++I  FH P ASMS FDI SV     IYR I+ P+ 
Sbjct  358   CTIIYSVVFTQMASLFVEQGDVMESHIGNFHFPAASMSLFDIFSVLICTGIYRHIVVPVS  417

Query  879   ASLKKTRRAQGFTELQRMGVGLiiaimamvaagiVEHFRLKYASTDCPRCPSSLSIFWQV  700
               L  +   +G +ELQRMG+GLII +++MVAAG  E  RLK+      +  SSLSIFWQ+
Sbjct  418   GRL--SGNPKGLSELQRMGIGLIIGLLSMVAAGATEVARLKHVQPG--QKVSSLSIFWQI  473

Query  699   PQYVLIGASEVFMYVGQLEFFNGQAPEGLKSFASALCMTSISLGNYVSSLLVSIVMRIST  520
             PQYVL+GASE+FMYVGQLEFFNGQAP+G+KS  S+LCM SISLGNYVSSLLV+IVM I+ 
Sbjct  474   PQYVLVGASEIFMYVGQLEFFNGQAPDGIKSLGSSLCMASISLGNYVSSLLVTIVMMITA  533

Query  519   THRMPGWIPGNLNKGHLDRFYFLLAALTTADFVVYILCAKWYKYIEFE  376
                 PGWIP NLN+GHLDRFYFL+A LT  DFVVY+ CAK YK I  +
Sbjct  534   RGENPGWIPNNLNEGHLDRFYFLIAILTALDFVVYVFCAKRYKGINLQ  581



>gb|EMT17042.1| Peptide transporter PTR1 [Aegilops tauschii]
Length=602

 Score =   633 bits (1633),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 348/590 (59%), Positives = 432/590 (73%), Gaps = 20/590 (3%)
 Frame = -3

Query  2070  ECTLDGTVDHYGRPALRSATGGWFAGVLLLVNQGLATLAFFGVGVNLVLFLTRVMGQDNA  1891
             E TLDG+VD  GRPA++  +GGW AG L+LVNQGLAT+AFFGV VNLVLFLTRV+ Q N 
Sbjct  18    EYTLDGSVDIKGRPAVKGKSGGWLAGGLILVNQGLATMAFFGVNVNLVLFLTRVVQQSNG  77

Query  1890  DAANNVSKWTGTVYLFSLLGAFLSDSYWGRYKTCAIFQLIYVVGLISVSIFSFIFLVKPK  1711
             DAANNVSKWTGTVY+FSL+GAFLSDSYWGRYKTCAIFQ I+V+GL  +S+ S ++L++P 
Sbjct  78    DAANNVSKWTGTVYMFSLIGAFLSDSYWGRYKTCAIFQAIFVLGLGLLSLSSRLYLIRPV  137

Query  1710  GCGDENTPCRSPSRIHIAVYYVSIYLVALGNGGYQPNIATFGSDQFDGDHAHESVSKVAF  1531
             GCG E+TPC S S   + ++ +++Y++  GNGGYQPNIATFG+ QFD +   E+ SKV+F
Sbjct  138   GCGTEHTPCASRSGTEMGIFSIALYMIPFGNGGYQPNIATFGAAQFDEEDPAEAHSKVSF  197

Query  1530  FSYFYLALNLGSLFSNTVLVYFEDKGMWTLGFWastvsavlalllflVGTPRYRHFAPKG  1351
             FSYFYLALNLGSLFSNT L Y +D G W LGFWAST +A  ALLLFL GTP+YRH  P G
Sbjct  198   FSYFYLALNLGSLFSNTFLSYLQDHGKWVLGFWASTAAAATALLLFLSGTPQYRHAQPCG  257

Query  1350  NPLSRFSQVLVASARKWNV-HLPSDGDDHRLYEIQEH-DSSTRKILHTEGFKFLDKAAVI  1177
             NP++   QV  A+ R W    +    D   LYE  +  D+ +RK+LHT+GF+FLD+AA +
Sbjct  258   NPMASICQVASAACRNWKAGGVSCSSDVEILYEGDDKTDAGSRKLLHTKGFRFLDRAA-L  316

Query  1176  TTKESVRDLE--ERNINPWRLCSVTQVEEVKCILRLLPIWLCTILYSVVFTQMASLFVEQ  1003
             TT+++   L    +  + W+LC+VTQVE+VK ILR+LPIW+CTILYSVVFTQMASLFV Q
Sbjct  317   TTEDTSSKLATCSKTRDQWKLCTVTQVEQVKSILRILPIWVCTILYSVVFTQMASLFVVQ  376

Query  1002  GAAMR--TNIAGFHIPPASMSSFDILSVAAFIFIYRRILDPLIASLKKTRRAQGFTELQR  829
             GAAMR  T +  F IP +SMS+FDIL+VA  IF+YRR + P +A    T R+ G TELQR
Sbjct  377   GAAMRRTTPLGAFSIPASSMSAFDILTVATTIFLYRRAICPFLARF--TGRSTGPTELQR  434

Query  828   MGVGLiiaimamvaagiVEHFRLKYASTDCPRCPSSLSIFWQVPQYVLIGASEVFMYVGQ  649
             MG+GL++  MAM  AG VEHFR   A+T      S L I WQ PQY LIG SEV MYVGQ
Sbjct  435   MGLGLVLGAMAMATAGTVEHFRKASATT---ANSSELHILWQGPQYALIGVSEVMMYVGQ  491

Query  648   LEFFNGQAPEGLKSFASALCMTSISLGNYVSSLLVSIVMRISTTHRMPGWIPGNLNKGHL  469
             LEFFNG+ P+G KSF SALCM S+SLGNY S ++VS V + +     PGWIP +LN+GHL
Sbjct  492   LEFFNGEMPDGFKSFGSALCMMSMSLGNYFSDIIVSAVTKATAVDGRPGWIPADLNEGHL  551

Query  468   DRFYFLLAALTTADFVVYILCAKWYKYIEFEERNSCLKNIGDSKLQEDRS  319
             ++FYFLLA L+ ADF VY++ A  Y       R +C K  G S  +E+ S
Sbjct  552   NKFYFLLAILSVADFAVYLVFAGRY-------RKTC-KVDGRSDEEEEGS  593



>ref|XP_008243685.1| PREDICTED: protein NRT1/ PTR FAMILY 7.1-like [Prunus mume]
Length=602

 Score =   632 bits (1630),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 344/597 (58%), Positives = 433/597 (73%), Gaps = 24/597 (4%)
 Frame = -3

Query  2103  NERDEEKA---------SREECTLDGTVDHYGRPALRSATGGWFAGVLLLVNQGLATLAF  1951
             N RD E +         + ++ T + T     +  ++ + GGW    +LL NQGLATLAF
Sbjct  6     NNRDAEVSGAVDTNIPENEQQVTTEITESKETKSPVQKSRGGWTLATILLANQGLATLAF  65

Query  1950  FGVGVNLVLFLTRVMGQDNADAANNVSKWTGTVYLFSLLGAFLSDSYWGRYKTCAIFQLI  1771
             FGVGVNLVLFL RV+ Q NA AANNVSKWTGTVYLFSL+GAFLSDSYWGR+ TCAIFQLI
Sbjct  66    FGVGVNLVLFLIRVLDQQNAAAANNVSKWTGTVYLFSLVGAFLSDSYWGRFLTCAIFQLI  125

Query  1770  YVVGLISVSIFSFIFLVKPKGCGDENTPCRSPSRIHIAVYYVSIYLVALGNGGYQPNIAT  1591
              V+GL  +S+ S+++L+ P GCGD  TPC+  S   + ++Y+SIYL+ALG GG+QP IAT
Sbjct  126   LVLGLGLLSLSSWLYLIHPSGCGDGVTPCKPKSTAGVVIFYLSIYLIALGYGGHQPTIAT  185

Query  1590  FGSDQFDGDHAHESVSKVAFFSYFYLALNLGSLFSNTVLVYFEDKGMWTLGFWastvsav  1411
             FG+DQFD  +  +  SK AFF YFY ALN+GSLFSN++LVY+EDKG WT+GF  S  SA+
Sbjct  186   FGADQFDETNPKQQSSKAAFFCYFYFALNVGSLFSNSILVYYEDKGFWTMGFLVSLGSAI  245

Query  1410  lalllflVGTPRYRHFAPKGNPLSRFSQVLVASARKWNVHLPSDGDDHRLYEIQEHDSS-  1234
             + L+ +L+  PRYR+  P GNPL R +QV VA+ RKW V +P+  ++  LYE++  +S+ 
Sbjct  246   VGLVSYLLAAPRYRYIKPSGNPLPRVAQVFVAAFRKWKV-VPASPEN--LYEVEGSESAI  302

Query  1233  --TRKILHTEGFKFLDKAAVITTKESVRDLEERNINPWRLCSVTQVEEVKCILRLLPIWL  1060
               +RKILH++   FLDKAA IT      D    N NPWR+C++TQVEE KC+L++LPIWL
Sbjct  303   KGSRKILHSKEIMFLDKAATITE----MDRSGPN-NPWRVCTITQVEEAKCVLKMLPIWL  357

Query  1059  CTILYSVVFTQMASLFVEQGAAMRTNIAGFHIPPASMSSFDILSVAAFIFIYRRILDPLI  880
             CTI+YSVVFTQMASLFVEQG  M ++I  FH P ASMS FDI SV     IYR I+ P+ 
Sbjct  358   CTIIYSVVFTQMASLFVEQGDVMESHIGNFHFPAASMSLFDIFSVLICTGIYRHIIVPVS  417

Query  879   ASLKKTRRAQGFTELQRMGVGLiiaimamvaagiVEHFRLKYASTDCPRCPSSLSIFWQV  700
               L  +   +G +ELQRMG+GLII +++MVAAG  E  RLK+      +  SSLSIFWQ+
Sbjct  418   GRL--SGNPKGLSELQRMGIGLIIGLLSMVAAGATEVARLKHVQPG--QKVSSLSIFWQI  473

Query  699   PQYVLIGASEVFMYVGQLEFFNGQAPEGLKSFASALCMTSISLGNYVSSLLVSIVMRIST  520
             PQYVL+G SE+FMYVGQLEFFNGQAP+G+KS  S+LCM SISLGNYVSSLLV+IVM I+ 
Sbjct  474   PQYVLVGTSEIFMYVGQLEFFNGQAPDGIKSLGSSLCMASISLGNYVSSLLVTIVMMITA  533

Query  519   THRMPGWIPGNLNKGHLDRFYFLLAALTTADFVVYILCAKWYKYIEFEERNSCLKNI  349
                 PGWIP NLN+GHLDRFYFL+A LT  DFVVY+ CAK YK I  +E    +++I
Sbjct  534   RGENPGWIPNNLNEGHLDRFYFLIAILTALDFVVYVFCAKRYKGINLQEPEQEMESI  590



>gb|AES77223.2| peptide/nitrate transporter [Medicago truncatula]
Length=585

 Score =   630 bits (1625),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 333/575 (58%), Positives = 424/575 (74%), Gaps = 21/575 (4%)
 Frame = -3

Query  2037  GRPALRSATGGWFAGVLLLVNQGLATLAFFGVGVNLVLFLTRVMGQDNADAANNVSKWTG  1858
             G  A   + GGW    +LL NQ LATLAFFGVGVNLVLFLTRV+ QD+A+AANNVS WTG
Sbjct  28    GEVADGKSKGGWTTAYILLANQALATLAFFGVGVNLVLFLTRVLRQDSAEAANNVSLWTG  87

Query  1857  TVYLFSLLGAFLSDSYWGRYKTCAIFQLIYVVGLISVSIFSFIFLVKPKGCGDENTPCRS  1678
             TVY+FSLLGAFLSDSYWGRY TCAIFQL +V+GL  +S+ S++FL+KP GCG+E++ C  
Sbjct  88    TVYIFSLLGAFLSDSYWGRYLTCAIFQLFFVLGLGLMSLTSWLFLIKPLGCGNEHSVCNE  147

Query  1677  PSRIHIAVYYVSIYLVALGNGGYQPNIATFGSDQFDGDHAHESVSKVAFFSYFYLALNLG  1498
             P+ + I ++Y+SIYLVA G GG+QP +ATFG+DQFD     ++ S+ AFFSYFY ALN+G
Sbjct  148   PTPLGIGLFYLSIYLVAFGYGGHQPTLATFGADQFDDKSIQQTNSREAFFSYFYFALNVG  207

Query  1497  SLFSNTVLVYFEDKGMWTLGFWastvsavlalllflVGTPRYRHFAPKGNPLSRFSQVLV  1318
             SLFSNT+LVY+ED GMWTLGF  S  SA++AL+ FL G+ +YR+    GNP+ R  QV V
Sbjct  208   SLFSNTILVYYEDTGMWTLGFGVSLASAIIALISFLAGSRKYRYVKAYGNPVIRVIQVFV  267

Query  1317  ASARKWNVHLPSDGDDHRLYEIQEHDSS---TRKILHTEGFKFLDKAAVITTKESVRDLE  1147
             A+ RKWNV  P+  D  +LYE+  + S+   +RKILH++  +F+DKAA  T K+      
Sbjct  268   AATRKWNVE-PAKED--QLYEVDGNVSAIKGSRKILHSQDIRFMDKAATRTVKDG-----  319

Query  1146  ERNINPWRLCSVTQVEEVKCILRLLPIWLCTILYSVVFTQMASLFVEQGAAMRTNIAGFH  967
               + N WRLC+VTQVEE KC+LR++P+WLCTI+YSVVFTQMASLFVEQG  M   +  FH
Sbjct  320   NESGNQWRLCTVTQVEEAKCVLRMIPVWLCTIIYSVVFTQMASLFVEQGDVMNNKVGKFH  379

Query  966   IPPASMSSFDILSVAAFIFIYRRILDPLIASLKKTRRAQGFTELQRMGVGLiiaimamva  787
             +P A+MS FDI SV     +YR++L PL   L  +   +G +ELQRMGVGL+I ++AMVA
Sbjct  380   LPAATMSVFDICSVLVCTGLYRQVLVPLAGKL--SGNPKGLSELQRMGVGLVIGMLAMVA  437

Query  786   agiVEHFRLKYASTDCPRCPSSLSIFWQVPQYVLIGASEVFMYVGQLEFFNGQAPEGLKS  607
             AG+ E  RLK       +  S+LSIF Q+PQYVL+GASEVFMYVGQLEFFNGQAP+G+KS
Sbjct  438   AGVTEFERLKQVQPGQKQ--SNLSIFCQIPQYVLVGASEVFMYVGQLEFFNGQAPDGIKS  495

Query  606   FASALCMTSISLGNYVSSLLVSIVMRISTTHRMPGWIPGNLNKGHLDRFYFLLAALTTAD  427
             F S+LCM SISLGNYVSS++V +VM  +     PGWIP NLN GH+DRF++L+AAL+  D
Sbjct  496   FGSSLCMASISLGNYVSSMMVKLVMIFTARGEEPGWIPNNLNVGHMDRFFYLIAALSALD  555

Query  426   FVVYILCAKWYKYIEFEERNSCLKNIGDSKLQEDR  322
              V+Y+ CA+WYK +   E +    N+G    QED 
Sbjct  556   LVIYVFCARWYKGVTNIEGSD---NVGS---QEDN  584



>ref|XP_006354232.1| PREDICTED: putative peptide/nitrate transporter At5g19640-like 
[Solanum tuberosum]
Length=576

 Score =   629 bits (1622),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 339/558 (61%), Positives = 413/558 (74%), Gaps = 14/558 (3%)
 Frame = -3

Query  2013  TGGWFAGVLLLVNQGLATLAFFGVGVNLVLFLTRVMGQDNADAANNVSKWTGTVYLFSLL  1834
             TGGW++  L LVNQGL TL+FFGVGVNLVLFLTRV+GQDNA AANNVSKWTGTVYL SLL
Sbjct  23    TGGWYSAFLCLVNQGLVTLSFFGVGVNLVLFLTRVLGQDNATAANNVSKWTGTVYLCSLL  82

Query  1833  GAFLSDSYWGRYKTCAIFQLIYVVGLISVSIFSFIFLVKPKGCGDENTPCRSPSRIHIAV  1654
             GAF+SDSYWGR+ TCAIFQLI ++GL+ +S+ S++FL+KP GCGD    C  PS I  ++
Sbjct  83    GAFISDSYWGRFITCAIFQLILILGLVIISLTSWLFLIKPNGCGDGLQNCVPPSPIGTSL  142

Query  1653  YYVSIYLVALGNGGYQPNIATFGSDQFDGDHAHESVSKVAFFSYFYLALNLGSLFSNTVL  1474
             +Y++IYLVALG GG+QP IATFGSDQFD  +    +SK A+F YFY ALN GSL SNT+L
Sbjct  143   FYLAIYLVALGYGGHQPTIATFGSDQFDEANPKGKISKAAYFGYFYFALNAGSLISNTIL  202

Query  1473  VYFEDKGMWTLGFWastvsavlalllflVGTPRYRHFAPKGNPLSRFSQVLVASARKWNV  1294
             VY+ED G WTLGFWAST + +  L +FL+GTP YR+    GNPL R  QV VA+ RKW V
Sbjct  203   VYYEDGGKWTLGFWASTAAGLFGLFVFLLGTPGYRYVKSFGNPLPRVGQVFVAAFRKWRV  262

Query  1293  HLPSDGDDHRLYEIQEHDSS---TRKILHTEGFKFLDKAAVITTKESVRDLEERNINPWR  1123
                 + D+  LYE+   +SS   TRKILH+  FK LDKAA++T ++  R +    INPWR
Sbjct  263   ---PNVDETELYELNGLESSIKGTRKILHSNDFKKLDKAAIVTDEDRQRPV----INPWR  315

Query  1122  LCSVTQVEEVKCILRLLPIWLCTILYSVVFTQMASLFVEQGAAMRTNIAGFHIPPASMSS  943
             LC++TQVEE KCI+R+ PIWLCTI+YSV+FTQMASLFVEQG  M   I  FH+P ASMS+
Sbjct  316   LCTITQVEEAKCIIRMFPIWLCTIMYSVIFTQMASLFVEQGEVMDATIGNFHLPAASMSA  375

Query  942   FDILSVAAFIFIYRRILDPLIASLKKTRRAQGFTELQRMGVGLiiaimamvaagiVEHFR  763
             FDI SV    F+YR ++ PL   +    R  G +ELQRMGVGLII +++MVAAG+ E FR
Sbjct  376   FDICSVLTCTFLYRFMVVPLAGKISGNPR--GLSELQRMGVGLIIGMLSMVAAGVTEIFR  433

Query  762   LKYASTDCPRCPSSLSIFWQVPQYVLIGASEVFMYVGQLEFFNGQAPEGLKSFASALCMT  583
             L+          SSLSIFWQ+PQY+L+GASEVFMYVGQLEFFNGQAP+G+KS  S+LCM 
Sbjct  434   LRRVIPGNET--SSLSIFWQIPQYILVGASEVFMYVGQLEFFNGQAPDGIKSLGSSLCMA  491

Query  582   SISLGNYVSSLLVSIVMRISTTHRMPGWIPGNLNKGHLDRFYFLLAALTTADFVVYILCA  403
             S+SLGNYVSS+LV++VM  +      GWIP NLN GH+DRFYFLL  L   D V ++  A
Sbjct  492   SMSLGNYVSSMLVNMVMHFTAKGTRHGWIPENLNNGHIDRFYFLLFGLALVDMVAFVFFA  551

Query  402   KWYKYIEFEERNSCLKNI  349
             KWYK I  E+ N   K I
Sbjct  552   KWYKGINIEDSNHGEKEI  569



>ref|XP_010673538.1| PREDICTED: protein NRT1/ PTR FAMILY 7.1 [Beta vulgaris subsp. 
vulgaris]
Length=626

 Score =   630 bits (1626),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 337/575 (59%), Positives = 420/575 (73%), Gaps = 17/575 (3%)
 Frame = -3

Query  2031  PALRSATGGWFAGVLLLVNQGLATLAFFGVGVNLVLFLTRVMGQDNADAANNVSKWTGTV  1852
             P+++   GGW    ++L NQ LATLAFFGVGVNLVLFLTRV+ QDNA AANNVS WTGTV
Sbjct  58    PSIKKRKGGWLCAFIILANQALATLAFFGVGVNLVLFLTRVLRQDNASAANNVSIWTGTV  117

Query  1851  YLFSLLGAFLSDSYWGRYKTCAIFQLIYVVGLISVSIFSFIFLVKPKGCGDENTPCRSPS  1672
             YLFSL+GAFLSDSYWGR+ TC +FQLI ++GL+ +SI S+IFL+KP+GCGD    C   S
Sbjct  118   YLFSLVGAFLSDSYWGRFLTCTVFQLILLMGLVLLSISSWIFLLKPRGCGDGKLECHETS  177

Query  1671  RIHIAVYYVSIYLVALGNGGYQPNIATFGSDQFDGDHAHESVSKVAFFSYFYLALNLGSL  1492
              +   ++Y+SIY+VALG GG+QP  ATFG+DQFD        SK AFF YFY ALN GSL
Sbjct  178   IVGEIIFYISIYMVALGYGGHQPTCATFGADQFDDSDTKGESSKAAFFCYFYFALNCGSL  237

Query  1491  FSNTVLVYFEDKGMWTLGFWastvsavlalllflVGTPRYRHFAPKGNPLSRFSQVLVAS  1312
             FSNTVLVYFED G WT GFW ST SAVL ++LF+ G+PRYR     GNPL R +QV VA+
Sbjct  238   FSNTVLVYFEDNGSWTFGFWVSTASAVLGVVLFVAGSPRYRFIKAHGNPLPRVAQVFVAA  297

Query  1311  ARKWNVHLPSDGDDHRLYEIQEHDSS---TRKILHTEGFKFLDKAAVITTKESVRDLEER  1141
              RKWNV        + LYE++  +S+   +RKI+H++ F+FLDKAA +T ++++  +   
Sbjct  298   YRKWNVQ---RARPNELYEVEGSESAIKGSRKIVHSDHFRFLDKAATLTQQDNLGPM---  351

Query  1140  NINPWRLCSVTQVEEVKCILRLLPIWLCTILYSVVFTQMASLFVEQGAAMRTNIAGFHIP  961
               NPWR+C+VTQVEE KC+L+LLP+WLCTI+YSV+FTQMASLFVEQG  M T I  FHIP
Sbjct  352   --NPWRICTVTQVEEAKCVLKLLPLWLCTIIYSVIFTQMASLFVEQGDVMNTKIGKFHIP  409

Query  960   PASMSSFDILSVAAFIFIYRRILDPLIASLKKTRRAQGFTELQRMGVGLiiaimamvaag  781
              ASMS FDI+SV     +YR IL P++  L K  +  G +ELQRMGVGL+I ++AM+AAG
Sbjct  410   AASMSIFDIVSVLICTGVYRHILVPVLGRLLKNPK--GLSELQRMGVGLLIGMLAMLAAG  467

Query  780   iVEHFRLKYASTDCPRCPSSLSIFWQVPQYVLIGASEVFMYVGQLEFFNGQAPEGLKSFA  601
             I E  RLK    +     S+LS+ WQ+PQYVL+GASEVFMYVGQLEFFNGQAP+G+KSF 
Sbjct  468   ITEIARLKSVVPN--ERSSTLSVLWQIPQYVLVGASEVFMYVGQLEFFNGQAPDGIKSFG  525

Query  600   SALCMTSISLGNYVSSLLVSIVMRISTTHRMPGWIPGNLNKGHLDRFYFLLAALTTADFV  421
             S+LCM S+S GNYVSSLLV +VM  +     PGWIP NLN GH++ FYFL+A LT  DF+
Sbjct  526   SSLCMASMSFGNYVSSLLVHMVMIFTARGDNPGWIPENLNHGHIENFYFLIAGLTIIDFI  585

Query  420   VYILCAKWYKYIEFEE--RNSCLKNIGDSKLQEDR  322
             +Y L A+WYK + F E    S ++   D  + ED 
Sbjct  586   IYSLFAQWYKPVNFLETSHKSEVETKFDGDVVEDE  620



>ref|XP_003621005.1| Peptide transporter PTR1 [Medicago truncatula]
Length=650

 Score =   630 bits (1626),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 333/575 (58%), Positives = 424/575 (74%), Gaps = 21/575 (4%)
 Frame = -3

Query  2037  GRPALRSATGGWFAGVLLLVNQGLATLAFFGVGVNLVLFLTRVMGQDNADAANNVSKWTG  1858
             G  A   + GGW    +LL NQ LATLAFFGVGVNLVLFLTRV+ QD+A+AANNVS WTG
Sbjct  93    GEVADGKSKGGWTTAYILLANQALATLAFFGVGVNLVLFLTRVLRQDSAEAANNVSLWTG  152

Query  1857  TVYLFSLLGAFLSDSYWGRYKTCAIFQLIYVVGLISVSIFSFIFLVKPKGCGDENTPCRS  1678
             TVY+FSLLGAFLSDSYWGRY TCAIFQL +V+GL  +S+ S++FL+KP GCG+E++ C  
Sbjct  153   TVYIFSLLGAFLSDSYWGRYLTCAIFQLFFVLGLGLMSLTSWLFLIKPLGCGNEHSVCNE  212

Query  1677  PSRIHIAVYYVSIYLVALGNGGYQPNIATFGSDQFDGDHAHESVSKVAFFSYFYLALNLG  1498
             P+ + I ++Y+SIYLVA G GG+QP +ATFG+DQFD     ++ S+ AFFSYFY ALN+G
Sbjct  213   PTPLGIGLFYLSIYLVAFGYGGHQPTLATFGADQFDDKSIQQTNSREAFFSYFYFALNVG  272

Query  1497  SLFSNTVLVYFEDKGMWTLGFWastvsavlalllflVGTPRYRHFAPKGNPLSRFSQVLV  1318
             SLFSNT+LVY+ED GMWTLGF  S  SA++AL+ FL G+ +YR+    GNP+ R  QV V
Sbjct  273   SLFSNTILVYYEDTGMWTLGFGVSLASAIIALISFLAGSRKYRYVKAYGNPVIRVIQVFV  332

Query  1317  ASARKWNVHLPSDGDDHRLYEIQEHDSS---TRKILHTEGFKFLDKAAVITTKESVRDLE  1147
             A+ RKWNV  P+  D  +LYE+  + S+   +RKILH++  +F+DKAA  T K+      
Sbjct  333   AATRKWNVE-PAKED--QLYEVDGNVSAIKGSRKILHSQDIRFMDKAATRTVKDG-----  384

Query  1146  ERNINPWRLCSVTQVEEVKCILRLLPIWLCTILYSVVFTQMASLFVEQGAAMRTNIAGFH  967
               + N WRLC+VTQVEE KC+LR++P+WLCTI+YSVVFTQMASLFVEQG  M   +  FH
Sbjct  385   NESGNQWRLCTVTQVEEAKCVLRMIPVWLCTIIYSVVFTQMASLFVEQGDVMNNKVGKFH  444

Query  966   IPPASMSSFDILSVAAFIFIYRRILDPLIASLKKTRRAQGFTELQRMGVGLiiaimamva  787
             +P A+MS FDI SV     +YR++L PL   L  +   +G +ELQRMGVGL+I ++AMVA
Sbjct  445   LPAATMSVFDICSVLVCTGLYRQVLVPLAGKL--SGNPKGLSELQRMGVGLVIGMLAMVA  502

Query  786   agiVEHFRLKYASTDCPRCPSSLSIFWQVPQYVLIGASEVFMYVGQLEFFNGQAPEGLKS  607
             AG+ E  RLK       +  S+LSIF Q+PQYVL+GASEVFMYVGQLEFFNGQAP+G+KS
Sbjct  503   AGVTEFERLKQVQPGQKQ--SNLSIFCQIPQYVLVGASEVFMYVGQLEFFNGQAPDGIKS  560

Query  606   FASALCMTSISLGNYVSSLLVSIVMRISTTHRMPGWIPGNLNKGHLDRFYFLLAALTTAD  427
             F S+LCM SISLGNYVSS++V +VM  +     PGWIP NLN GH+DRF++L+AAL+  D
Sbjct  561   FGSSLCMASISLGNYVSSMMVKLVMIFTARGEEPGWIPNNLNVGHMDRFFYLIAALSALD  620

Query  426   FVVYILCAKWYKYIEFEERNSCLKNIGDSKLQEDR  322
              V+Y+ CA+WYK +   E +    N+G    QED 
Sbjct  621   LVIYVFCARWYKGVTNIEGSD---NVGS---QEDN  649



>gb|ABN09773.1| TGF-beta receptor, type I/II extracellular region [Medicago truncatula]
Length=648

 Score =   630 bits (1626),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 333/575 (58%), Positives = 424/575 (74%), Gaps = 21/575 (4%)
 Frame = -3

Query  2037  GRPALRSATGGWFAGVLLLVNQGLATLAFFGVGVNLVLFLTRVMGQDNADAANNVSKWTG  1858
             G  A   + GGW    +LL NQ LATLAFFGVGVNLVLFLTRV+ QD+A+AANNVS WTG
Sbjct  91    GEVADGKSKGGWTTAYILLANQALATLAFFGVGVNLVLFLTRVLRQDSAEAANNVSLWTG  150

Query  1857  TVYLFSLLGAFLSDSYWGRYKTCAIFQLIYVVGLISVSIFSFIFLVKPKGCGDENTPCRS  1678
             TVY+FSLLGAFLSDSYWGRY TCAIFQL +V+GL  +S+ S++FL+KP GCG+E++ C  
Sbjct  151   TVYIFSLLGAFLSDSYWGRYLTCAIFQLFFVLGLGLMSLTSWLFLIKPLGCGNEHSVCNE  210

Query  1677  PSRIHIAVYYVSIYLVALGNGGYQPNIATFGSDQFDGDHAHESVSKVAFFSYFYLALNLG  1498
             P+ + I ++Y+SIYLVA G GG+QP +ATFG+DQFD     ++ S+ AFFSYFY ALN+G
Sbjct  211   PTPLGIGLFYLSIYLVAFGYGGHQPTLATFGADQFDDKSIQQTNSREAFFSYFYFALNVG  270

Query  1497  SLFSNTVLVYFEDKGMWTLGFWastvsavlalllflVGTPRYRHFAPKGNPLSRFSQVLV  1318
             SLFSNT+LVY+ED GMWTLGF  S  SA++AL+ FL G+ +YR+    GNP+ R  QV V
Sbjct  271   SLFSNTILVYYEDTGMWTLGFGVSLASAIIALISFLAGSRKYRYVKAYGNPVIRVIQVFV  330

Query  1317  ASARKWNVHLPSDGDDHRLYEIQEHDSS---TRKILHTEGFKFLDKAAVITTKESVRDLE  1147
             A+ RKWNV  P+  D  +LYE+  + S+   +RKILH++  +F+DKAA  T K+      
Sbjct  331   AATRKWNVE-PAKED--QLYEVDGNVSAIKGSRKILHSQDIRFMDKAATRTVKDG-----  382

Query  1146  ERNINPWRLCSVTQVEEVKCILRLLPIWLCTILYSVVFTQMASLFVEQGAAMRTNIAGFH  967
               + N WRLC+VTQVEE KC+LR++P+WLCTI+YSVVFTQMASLFVEQG  M   +  FH
Sbjct  383   NESGNQWRLCTVTQVEEAKCVLRMIPVWLCTIIYSVVFTQMASLFVEQGDVMNNKVGKFH  442

Query  966   IPPASMSSFDILSVAAFIFIYRRILDPLIASLKKTRRAQGFTELQRMGVGLiiaimamva  787
             +P A+MS FDI SV     +YR++L PL   L  +   +G +ELQRMGVGL+I ++AMVA
Sbjct  443   LPAATMSVFDICSVLVCTGLYRQVLVPLAGKL--SGNPKGLSELQRMGVGLVIGMLAMVA  500

Query  786   agiVEHFRLKYASTDCPRCPSSLSIFWQVPQYVLIGASEVFMYVGQLEFFNGQAPEGLKS  607
             AG+ E  RLK       +  S+LSIF Q+PQYVL+GASEVFMYVGQLEFFNGQAP+G+KS
Sbjct  501   AGVTEFERLKQVQPGQKQ--SNLSIFCQIPQYVLVGASEVFMYVGQLEFFNGQAPDGIKS  558

Query  606   FASALCMTSISLGNYVSSLLVSIVMRISTTHRMPGWIPGNLNKGHLDRFYFLLAALTTAD  427
             F S+LCM SISLGNYVSS++V +VM  +     PGWIP NLN GH+DRF++L+AAL+  D
Sbjct  559   FGSSLCMASISLGNYVSSMMVKLVMIFTARGEEPGWIPNNLNVGHMDRFFYLIAALSALD  618

Query  426   FVVYILCAKWYKYIEFEERNSCLKNIGDSKLQEDR  322
              V+Y+ CA+WYK +   E +    N+G    QED 
Sbjct  619   LVIYVFCARWYKGVTNIEGSD---NVGS---QEDN  647



>ref|XP_004228926.2| PREDICTED: protein NRT1/ PTR FAMILY 7.1 [Solanum lycopersicum]
Length=598

 Score =   628 bits (1620),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 342/558 (61%), Positives = 414/558 (74%), Gaps = 14/558 (3%)
 Frame = -3

Query  2013  TGGWFAGVLLLVNQGLATLAFFGVGVNLVLFLTRVMGQDNADAANNVSKWTGTVYLFSLL  1834
             TGGW++    LVNQGL TL+FFGVGVNLVLFLTRV+GQDNA AANNVSKWTGTVYL SLL
Sbjct  45    TGGWYSAFHCLVNQGLVTLSFFGVGVNLVLFLTRVLGQDNATAANNVSKWTGTVYLCSLL  104

Query  1833  GAFLSDSYWGRYKTCAIFQLIYVVGLISVSIFSFIFLVKPKGCGDENTPCRSPSRIHIAV  1654
             GAF+SDSYWGR+ TCAIFQLI ++GL+ +S+ S++FL+KP GCGD    C  PS I  ++
Sbjct  105   GAFISDSYWGRFITCAIFQLILILGLVIISLTSWLFLIKPNGCGDGIQNCVPPSSIGTSL  164

Query  1653  YYVSIYLVALGNGGYQPNIATFGSDQFDGDHAHESVSKVAFFSYFYLALNLGSLFSNTVL  1474
             +Y++IYLVALG GG+QP IATFGSDQFD  +    +SK A+F YFY ALN GSL SNTVL
Sbjct  165   FYLAIYLVALGYGGHQPTIATFGSDQFDEANPKGKISKAAYFGYFYFALNAGSLISNTVL  224

Query  1473  VYFEDKGMWTLGFWastvsavlalllflVGTPRYRHFAPKGNPLSRFSQVLVASARKWNV  1294
             VY+ED G WTLGFWAST S +L L +FL+GTP YR+    GNPL R  QV VA+ RKW V
Sbjct  225   VYYEDGGKWTLGFWASTASGLLGLFVFLLGTPGYRYVKSFGNPLPRVGQVFVAAFRKWGV  284

Query  1293  HLPSDGDDHRLYEIQEHDSS---TRKILHTEGFKFLDKAAVITTKESVRDLEERNINPWR  1123
                 + D+  LYE+   +SS   TRKILH+  FK LDKAA++T ++  R +    INPWR
Sbjct  285   ---PNVDETELYELNGTESSIKGTRKILHSNDFKKLDKAAIVTDEDRQRPV----INPWR  337

Query  1122  LCSVTQVEEVKCILRLLPIWLCTILYSVVFTQMASLFVEQGAAMRTNIAGFHIPPASMSS  943
             LC++TQVEE KCILR+ PIWLCTI+YSV+FTQMASLFVEQG  M   I  FH+P ASMS+
Sbjct  338   LCTITQVEEAKCILRMFPIWLCTIMYSVIFTQMASLFVEQGEVMDATIGNFHLPAASMSA  397

Query  942   FDILSVAAFIFIYRRILDPLIASLKKTRRAQGFTELQRMGVGLiiaimamvaagiVEHFR  763
             FDI SV    F+YR ++ PL    K +   +G +ELQRMGVGLII +++MVAAG+ E FR
Sbjct  398   FDICSVLTCTFLYRFMVVPLAG--KISGNPKGLSELQRMGVGLIIGMLSMVAAGVTEIFR  455

Query  762   LKYASTDCPRCPSSLSIFWQVPQYVLIGASEVFMYVGQLEFFNGQAPEGLKSFASALCMT  583
             L+          SSLSIFWQ+PQY+L+GASEVFMYVGQLEFFNGQAP+G+KS  S+LCM 
Sbjct  456   LRRVIPGNET--SSLSIFWQIPQYILVGASEVFMYVGQLEFFNGQAPDGIKSLGSSLCMA  513

Query  582   SISLGNYVSSLLVSIVMRISTTHRMPGWIPGNLNKGHLDRFYFLLAALTTADFVVYILCA  403
             S+SLGNYVSS+LV++VM  +      GWIP NLN GH+DRFYFLL  L   D V ++  A
Sbjct  514   SMSLGNYVSSMLVNMVMHFTAKGTRHGWIPENLNNGHIDRFYFLLFGLALVDLVAFVFFA  573

Query  402   KWYKYIEFEERNSCLKNI  349
             KWYK I  E+ N   K I
Sbjct  574   KWYKGINIEDSNHGEKEI  591



>ref|XP_006492658.1| PREDICTED: putative peptide/nitrate transporter At5g19640-like 
[Citrus sinensis]
Length=612

 Score =   629 bits (1621),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 353/599 (59%), Positives = 431/599 (72%), Gaps = 30/599 (5%)
 Frame = -3

Query  2106  KNERDEEKASREECTLDGTVDHYGRPAL--RSATGGWFAGVLLLVNQGLATLAFFGVGVN  1933
             KN +DE+K           +  + R  L      GGW    +LL NQGLATLAFFGVGVN
Sbjct  33    KNNKDEKK-----------LTSFIRKNLIHEKNKGGWKYASILLANQGLATLAFFGVGVN  81

Query  1932  LVLFLTRVMGQDNADAANNVSKWTGTVYLFSLLGAFLSDSYWGRYKTCAIFQLIYVVGLI  1753
             LVLFLTRV+ Q+NA+AANNVSKWTGTVY+ SL+GAFLSDSYWGRY TCA+FQLI+VV  +
Sbjct  82    LVLFLTRVLQQENANAANNVSKWTGTVYMCSLIGAFLSDSYWGRYLTCAVFQLIFVV-GL  140

Query  1752  SVSIFSFIFLVKPKGCGDENTPCRSPSRIHIAVYYVSIYLVALGNGGYQPNIATFGSDQF  1573
              +       ++KP GCGD    C+  S I  A++Y+SIYL+A G GG+QP +ATFG+DQF
Sbjct  141   VLLSVLSFLMIKPTGCGDGFISCKPLSSIFAAIFYLSIYLIAFGYGGHQPTLATFGADQF  200

Query  1572  DGDHAHESVSKVAFFSYFYLALNLGSLFSNTVLVYFEDKGMWTLGFWastvsavlalllf  1393
             D     E  SK  FF YFY  LN+GSLFSNT+LVY+ED G WTLGF  S  SAV+ALL +
Sbjct  201   DESKPKERQSKTLFFCYFYFFLNVGSLFSNTILVYYEDSGKWTLGFLVSLASAVIALLSY  260

Query  1392  lVGTPRYRHFAPKGNPLSRFSQVLVASARKWNVHLPSDGDDHRLYEIQEHDSS---TRKI  1222
             L+GTP YR+  P GNPL R +QV +A+ARKWNV +P++ D+  LYE+   +S+   +RKI
Sbjct  261   LMGTPGYRYVKPCGNPLPRVAQVFIAAARKWNVVVPANSDE--LYEVAGPESAIKGSRKI  318

Query  1221  LHTEGFKFLDKAAVITTKESVRDLEERNINPWRLCSVTQVEEVKCILRLLPIWLCTILYS  1042
             LH+   +FLDKAA IT      DL     NPW+LC+VTQVEE KC+L++LPIWLCTI+YS
Sbjct  319   LHSNEIEFLDKAATITD----NDLAGPK-NPWKLCTVTQVEEAKCVLKMLPIWLCTIIYS  373

Query  1041  VVFTQMASLFVEQGAAMRTNIAGFHIPPASMSSFDILSVAAFIFIYRRILDPLIASLKKT  862
             VVFTQMASLFVEQG  M ++I  F +P ASMS+FDI SV     IYR+IL P+   L   
Sbjct  374   VVFTQMASLFVEQGDVMNSHIGEFRLPAASMSAFDICSVLICTGIYRKILVPVAGKLNGN  433

Query  861   RRAQGFTELQRMGVGLiiaimamvaagiVEHFRLKYASTDCPRCPSSLSIFWQVPQYVLI  682
              +  G +ELQRMG+GLII ++AM+AAG  E  RLKY S       SSLSIFWQ+PQYVL+
Sbjct  434   PK--GLSELQRMGIGLIIGMLAMIAAGATEIQRLKYISPG--EKASSLSIFWQIPQYVLV  489

Query  681   GASEVFMYVGQLEFFNGQAPEGLKSFASALCMTSISLGNYVSSLLVSIVMRISTTHRMPG  502
             GASEVFMYVGQLEFFNGQAP+G+KSF S+LCM SIS GNYVSSLLV +VM I+     PG
Sbjct  490   GASEVFMYVGQLEFFNGQAPDGIKSFGSSLCMASISFGNYVSSLLVVMVMGITAKGDKPG  549

Query  501   WIPGNLNKGHLDRFYFLLAALTTADFVVYILCAKWYKYIEFEERNSCLKNIGDSKLQED  325
             WIP +LN GH+DRFYFLLA LT  DFV+Y++CA WYK I  +E +SC K + + KL ED
Sbjct  550   WIPDDLNTGHMDRFYFLLAVLTAFDFVIYLICANWYKGINLDE-DSCEKEM-EMKLDED  606



>ref|XP_010493040.1| PREDICTED: protein NRT1/ PTR FAMILY 7.1 [Camelina sativa]
Length=608

 Score =   628 bits (1620),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 337/550 (61%), Positives = 409/550 (74%), Gaps = 26/550 (5%)
 Frame = -3

Query  2010  GGWFAGVLLLVNQGLATLAFFGVGVNLVLFLTRVMGQDNADAANNVSKWTGTVYLFSLLG  1831
             GGW   ++LL NQGLATLAFFGVGVNLVLFLTRVMGQ NA+AANNVSKWTGTVY+FSL+G
Sbjct  61    GGWTNAIILLANQGLATLAFFGVGVNLVLFLTRVMGQGNAEAANNVSKWTGTVYMFSLVG  120

Query  1830  AFLSDSYWGRYKTCAIFQLIYVVGLISVSIFSFIFLVKPKGCGDENTPCRSPSRIHIAVY  1651
             AFLSDSYWGRY TC IFQ+I+V+G+  +S  S+ FL+KP+GCGD N  C   S + +A++
Sbjct  121   AFLSDSYWGRYLTCTIFQVIFVIGVGLLSFVSWFFLIKPRGCGDGNLVCNPTSSLGVAIF  180

Query  1650  YVSIYLVALGNGGYQPNIATFGSDQFDGDHAHESVSKVAFFSYFYLALNLGSLFSNTVLV  1471
             Y+S+YLVA G GG+QP +ATFG+DQ D D      SK AFFSYFY ALN+G+LFSNT+LV
Sbjct  181   YLSVYLVAFGYGGHQPTLATFGADQLDDDQN----SKAAFFSYFYFALNVGALFSNTILV  236

Query  1470  YFEDKGMWTLGFWastvsavlalllflVGTPRYRHFAPKGNPLSRFSQVLVASARKWNVH  1291
             YFEDKG+WT GF  S  SA++AL+ FL  T +YR+  P GNPL R +QV VA+ARKW+V 
Sbjct  237   YFEDKGLWTEGFLVSLGSAIVALVAFLAPTKQYRYVKPCGNPLPRVAQVFVATARKWSVV  296

Query  1290  LPSDGDDHRLYEIQEHDSS---TRKILHTEGFKFLDKAAVITTKESVRDLEERNINPWRL  1120
              P  G+   LYE++  +S+   +RKI H+  F FLD+AAVIT      D  E   N WRL
Sbjct  297   RP--GNPQELYELEGPESAIKGSRKIFHSSKFVFLDRAAVITES----DRNETRSNAWRL  350

Query  1119  CSVTQVEEVKCILRLLPIWLCTILYSVVFTQMASLFVEQGAAMRTNIAGFHIPPASMSSF  940
             CSVTQVEE KC+++LLPIWLCTI+YSV+FTQMASLFVEQG  M   I  FHIP ASMS F
Sbjct  351   CSVTQVEEAKCVMKLLPIWLCTIIYSVIFTQMASLFVEQGDVMDAFIGKFHIPAASMSVF  410

Query  939   DILSVAAFIFIYRRILDPLIASLKKTRRAQGFTELQRMGVGLiiaimamvaagiVEHFRL  760
             DILSV     +YR ++ P +            TEL RMG+GLII IMAMVAAG+ E  RL
Sbjct  411   DILSVFLSTGLYRHVIFPYVRP----------TELMRMGIGLIIGIMAMVAAGLTEIQRL  460

Query  759   KYASTDCPRCPSSLSIFWQVPQYVLIGASEVFMYVGQLEFFNGQAPEGLKSFASALCMTS  580
             K       +  S LSI WQ+PQYVL+GASEVFMYVGQLEFF+GQAP+GLK+  S+LCM S
Sbjct  461   KQIVPG--QKESELSILWQIPQYVLVGASEVFMYVGQLEFFSGQAPDGLKNLGSSLCMAS  518

Query  579   ISLGNYVSSLLVSIVMRISTT-HRMPGWIPGNLNKGHLDRFYFLLAALTTADFVVYILCA  403
             ++LGNYVSSL+V+IVM I+      PGWIP NLN+GH+DRFYFL+A L   DFVVY++ A
Sbjct  519   MALGNYVSSLMVNIVMAITKRGEHSPGWIPENLNEGHMDRFYFLIATLAAIDFVVYLIFA  578

Query  402   KWYKYIEFEE  373
             KWY+ I  +E
Sbjct  579   KWYQPISHDE  588



>ref|XP_010519721.1| PREDICTED: protein NRT1/ PTR FAMILY 7.1 [Tarenaya hassleriana]
Length=609

 Score =   628 bits (1620),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 339/549 (62%), Positives = 408/549 (74%), Gaps = 21/549 (4%)
 Frame = -3

Query  2010  GGWFAGVLLLVNQGLATLAFFGVGVNLVLFLTRVMGQDNADAANNVSKWTGTVYLFSLLG  1831
             GGW   ++LL NQGLATLAFFGVGVNLVLFLTRV+GQ NA+AANNVSKWTGTVY+ SL+G
Sbjct  57    GGWKYAIILLANQGLATLAFFGVGVNLVLFLTRVLGQGNAEAANNVSKWTGTVYICSLIG  116

Query  1830  AFLSDSYWGRYKTCAIFQLIYVVGLISVSIFSFIFLVKPKGCGDENTPCRSPSRIHIAVY  1651
             AFLSDSYWGRY TCAIFQ+I+V+G+  +S  S+ FL+KPKGCGD    C   S + IA++
Sbjct  117   AFLSDSYWGRYLTCAIFQVIFVLGIGLLSFSSWFFLIKPKGCGDGTLVCIPSSSLGIALF  176

Query  1650  YVSIYLVALGNGGYQPNIATFGSDQFDGDHAHESVSKVAFFSYFYLALNLGSLFSNTVLV  1471
             Y+S+YL+A G GG+QP +ATFGSDQFD        S+ AFFSYFY ALN+GSLFSNT+LV
Sbjct  177   YLSVYLIAFGYGGHQPTLATFGSDQFDDSLESGMSSRAAFFSYFYFALNVGSLFSNTILV  236

Query  1470  YFEDKGMWTLGFWastvsavlalllflVGTPRYRHFAPKGNPLSRFSQVLVASARKWNVH  1291
             YFED G WT GF  S  SAVLAL  FL  T RYR   P GNPL R +QV VA+ RKWNV 
Sbjct  237   YFEDSGWWTEGFLVSLGSAVLALAAFLAPTKRYRFVKPYGNPLPRVAQVFVATMRKWNVV  296

Query  1290  LPSDGDDHRLYEIQEHDSS---TRKILHTEGFKFLDKAAVITTKESVRDLEERNINPWRL  1120
              P++ ++  LYE++  +S+   +RKILH+  F FLDKAAV+T      D     INPWRL
Sbjct  297   RPTNPEE--LYEVEGPESAIKGSRKILHSTKFVFLDKAAVVTEN----DRHGTEINPWRL  350

Query  1119  CSVTQVEEVKCILRLLPIWLCTILYSVVFTQMASLFVEQGAAMRTNIAGFHIPPASMSSF  940
             C++TQVEE KC++++LPIW CTI+YSV+FTQMASLFVEQG  M  +I  F IP ASMS F
Sbjct  351   CTITQVEEAKCVMKMLPIWACTIIYSVIFTQMASLFVEQGDVMNAHIGQFRIPAASMSVF  410

Query  939   DILSVAAFIFIYRRILDPLIASLKKTRRAQGFTELQRMGVGLiiaimamvaagiVEHFRL  760
             DI SV     IYR I+ P       T R    TELQRMGVGL+I IMAMVAAG+ E  RL
Sbjct  411   DIFSVLISTGIYRHIIIP-------TMR---LTELQRMGVGLVIGIMAMVAAGLTEIQRL  460

Query  759   KYASTDCPRCPSSLSIFWQVPQYVLIGASEVFMYVGQLEFFNGQAPEGLKSFASALCMTS  580
             +       +  S L+IFWQVPQYVLIGASE+FMYVGQLEFFNGQAP+G+KS  S+LCM S
Sbjct  461   RRVIPG--QKESELTIFWQVPQYVLIGASEIFMYVGQLEFFNGQAPDGIKSLGSSLCMAS  518

Query  579   ISLGNYVSSLLVSIVMRISTTHRMPGWIPGNLNKGHLDRFYFLLAALTTADFVVYILCAK  400
             I+LGNYVSSL+V++VM I+T     GWIP NLN+GH+DRFYFL+AAL   DFV Y++ AK
Sbjct  519   IALGNYVSSLMVNVVMMITTRGGNDGWIPENLNEGHMDRFYFLIAALAAVDFVFYLVLAK  578

Query  399   WYKYIEFEE  373
             WY+ I  ++
Sbjct  579   WYRPINVDQ  587



>gb|KDO56443.1| hypothetical protein CISIN_1g039271mg [Citrus sinensis]
Length=609

 Score =   628 bits (1620),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 353/599 (59%), Positives = 431/599 (72%), Gaps = 30/599 (5%)
 Frame = -3

Query  2106  KNERDEEKASREECTLDGTVDHYGRPAL--RSATGGWFAGVLLLVNQGLATLAFFGVGVN  1933
             KN +DE+K           +  + R  L      GGW    +LL NQGLATLAFFGVGVN
Sbjct  30    KNNKDEKK-----------LTSFIRKNLIHEKNKGGWKYASILLANQGLATLAFFGVGVN  78

Query  1932  LVLFLTRVMGQDNADAANNVSKWTGTVYLFSLLGAFLSDSYWGRYKTCAIFQLIYVVGLI  1753
             LVLFLTRV+ Q+NA+AANNVSKWTGTVY+ SL+GAFLSDSYWGRY TCA+FQLI+VV  +
Sbjct  79    LVLFLTRVLQQENANAANNVSKWTGTVYMCSLIGAFLSDSYWGRYLTCAVFQLIFVV-GL  137

Query  1752  SVSIFSFIFLVKPKGCGDENTPCRSPSRIHIAVYYVSIYLVALGNGGYQPNIATFGSDQF  1573
              +       ++KP GCGD    C+  S I  A++Y+SIYL+A G GG+QP +ATFG+DQF
Sbjct  138   VLLSVLSFLMIKPTGCGDGFISCKPLSSIFAAIFYLSIYLIAFGYGGHQPTLATFGADQF  197

Query  1572  DGDHAHESVSKVAFFSYFYLALNLGSLFSNTVLVYFEDKGMWTLGFWastvsavlalllf  1393
             D     E  SK  FF YFY  LN+GSLFSNT+LVY+ED G WTLGF  S  SAV+ALL +
Sbjct  198   DESKPKERQSKTLFFCYFYFFLNVGSLFSNTILVYYEDSGKWTLGFLVSLASAVIALLSY  257

Query  1392  lVGTPRYRHFAPKGNPLSRFSQVLVASARKWNVHLPSDGDDHRLYEIQEHDSS---TRKI  1222
             L+GTP YR+  P GNPL R +QV +A+ARKWNV +P++ D+  LYE+   +S+   +RKI
Sbjct  258   LMGTPGYRYVKPCGNPLPRVAQVFIAAARKWNVVVPANSDE--LYEVAGPESAIKGSRKI  315

Query  1221  LHTEGFKFLDKAAVITTKESVRDLEERNINPWRLCSVTQVEEVKCILRLLPIWLCTILYS  1042
             LH+   +FLDKAA IT      DL     NPW+LC+VTQVEE KC+L++LPIWLCTI+YS
Sbjct  316   LHSNEIEFLDKAATITD----NDLAGPK-NPWKLCTVTQVEEAKCVLKMLPIWLCTIIYS  370

Query  1041  VVFTQMASLFVEQGAAMRTNIAGFHIPPASMSSFDILSVAAFIFIYRRILDPLIASLKKT  862
             VVFTQMASLFVEQG  M ++I  F +P ASMS+FDI SV     IYR+IL P+   L   
Sbjct  371   VVFTQMASLFVEQGDVMNSHIGEFRLPAASMSAFDICSVLICTGIYRKILVPVAGKLNGN  430

Query  861   RRAQGFTELQRMGVGLiiaimamvaagiVEHFRLKYASTDCPRCPSSLSIFWQVPQYVLI  682
              +  G +ELQRMG+GLII ++AM+AAG  E  RLKY S       SSLSIFWQ+PQYVL+
Sbjct  431   PK--GLSELQRMGIGLIIGMLAMIAAGATEIQRLKYISPG--EKASSLSIFWQIPQYVLV  486

Query  681   GASEVFMYVGQLEFFNGQAPEGLKSFASALCMTSISLGNYVSSLLVSIVMRISTTHRMPG  502
             GASEVFMYVGQLEFFNGQAP+G+KSF S+LCM SIS GNYVSSLLV +VM I+     PG
Sbjct  487   GASEVFMYVGQLEFFNGQAPDGIKSFGSSLCMASISFGNYVSSLLVVMVMGITAKGDKPG  546

Query  501   WIPGNLNKGHLDRFYFLLAALTTADFVVYILCAKWYKYIEFEERNSCLKNIGDSKLQED  325
             WIP +LN GH+DRFYFLLA LT  DFV+Y++CA WYK I  +E +SC K + + KL ED
Sbjct  547   WIPDDLNTGHMDRFYFLLAVLTAFDFVIYLICANWYKGINLDE-DSCEKEM-EMKLDED  603



>ref|XP_006445924.1| hypothetical protein CICLE_v10018037mg, partial [Citrus clementina]
 gb|ESR59164.1| hypothetical protein CICLE_v10018037mg, partial [Citrus clementina]
Length=664

 Score =   629 bits (1621),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 360/648 (56%), Positives = 449/648 (69%), Gaps = 29/648 (4%)
 Frame = -3

Query  2238  HTSLNKHLLRSLSGLVIKAGRFSLLSR*HTTMAAFLNITKMFFIKNERD-----EEKASR  2074
             HTS  + L    SG +    + S+       M + LN T    +K   +     + +A+ 
Sbjct  30    HTSSRRLLYSITSGQIYSKNQPSM-----AAMDSVLNSTNQITLKVTDENISTGQAQAAN  84

Query  2073  EECTLDGTVDHYGRPAL--RSATGGWFAGVLLLVNQGLATLAFFGVGVNLVLFLTRVMGQ  1900
             +    +  +  + R  L      GGW    +LL NQGLATLAFFGVGVNLVLFLTRV+ Q
Sbjct  85    KNNKDEKKLTSFIRKNLIHEKNKGGWKYASILLANQGLATLAFFGVGVNLVLFLTRVLQQ  144

Query  1899  DNADAANNVSKWTGTVYLFSLLGAFLSDSYWGRYKTCAIFQLIYVVGLISVSIFSFIFLV  1720
             +NA+AANNVSKWTGTVY+ SL+GAFLSDSYWGRY TCA+FQLI+V+  + +       ++
Sbjct  145   ENANAANNVSKWTGTVYMCSLIGAFLSDSYWGRYLTCAVFQLIFVL-GLVLLSVLSFLMI  203

Query  1719  KPKGCGDENTPCRSPSRIHIAVYYVSIYLVALGNGGYQPNIATFGSDQFDGDHAHESVSK  1540
             KP GCGD    C+  S I  A++Y+SIYL+A G GG+QP +ATFG+DQFD     E  SK
Sbjct  204   KPTGCGDGFISCKPLSSIFAAIFYLSIYLIAFGYGGHQPTLATFGADQFDESKPKERQSK  263

Query  1539  VAFFSYFYLALNLGSLFSNTVLVYFEDKGMWTLGFWastvsavlalllflVGTPRYRHFA  1360
               FF YFY  LN+GSLFSNT+LVY+ED G WTLGF  S  SAV+ALL +L+GTP YR+  
Sbjct  264   TLFFCYFYFFLNVGSLFSNTILVYYEDSGKWTLGFLVSLASAVIALLSYLMGTPGYRYVK  323

Query  1359  PKGNPLSRFSQVLVASARKWNVHLPSDGDDHRLYEIQEHDSS---TRKILHTEGFKFLDK  1189
             P GNPL R +QV +A+ARKWNV +P++ D+  LYE+   +S+   +RKILH+   +FLDK
Sbjct  324   PCGNPLPRVAQVFIAAARKWNVVVPANSDE--LYEVAGPESAIKGSRKILHSNEIEFLDK  381

Query  1188  AAVITTKESVRDLEERNINPWRLCSVTQVEEVKCILRLLPIWLCTILYSVVFTQMASLFV  1009
             AA IT      DL     NPW+LC+VTQVEE KC+L++LPIWLCTI+YSVVFTQMASLFV
Sbjct  382   AATITD----NDLAGPK-NPWKLCTVTQVEEAKCVLKMLPIWLCTIIYSVVFTQMASLFV  436

Query  1008  EQGAAMRTNIAGFHIPPASMSSFDILSVAAFIFIYRRILDPLIASLKKTRRAQGFTELQR  829
             EQG  M ++I  F +P ASMS+FDI SV     IYR+IL P+   L    +  G +ELQR
Sbjct  437   EQGDVMNSHIGEFRLPAASMSAFDICSVLICTGIYRKILVPVAGKLNGNPK--GLSELQR  494

Query  828   MGVGLiiaimamvaagiVEHFRLKYASTDCPRCPSSLSIFWQVPQYVLIGASEVFMYVGQ  649
             MG+GLII ++AM+AAG  E  RLKY S       SSLSIFWQ+PQYVL+GASEVFMYVGQ
Sbjct  495   MGIGLIIGMLAMIAAGATEIQRLKYISPG--EKASSLSIFWQIPQYVLVGASEVFMYVGQ  552

Query  648   LEFFNGQAPEGLKSFASALCMTSISLGNYVSSLLVSIVMRISTTHRMPGWIPGNLNKGHL  469
             LEFFNGQAP+G+KSF S+LCM SIS GNYVSSLLV +VM I+     PGWIP +LN GH+
Sbjct  553   LEFFNGQAPDGIKSFGSSLCMASISFGNYVSSLLVVMVMGITAKGDKPGWIPDDLNTGHM  612

Query  468   DRFYFLLAALTTADFVVYILCAKWYKYIEFEERNSCLKNIGDSKLQED  325
             DRFYFLLA LT  DFV+Y++CA WYK I  +E +SC K + + KL ED
Sbjct  613   DRFYFLLAVLTAFDFVIYLICANWYKGINLDE-DSCEKEM-EMKLDED  658



>ref|XP_006400525.1| hypothetical protein EUTSA_v10015614mg [Eutrema salsugineum]
 gb|ESQ41978.1| hypothetical protein EUTSA_v10015614mg [Eutrema salsugineum]
Length=602

 Score =   625 bits (1611),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 337/580 (58%), Positives = 418/580 (72%), Gaps = 38/580 (7%)
 Frame = -3

Query  2103  NERDEEKASREECTLDGTVDHYGRPALRSATGGWFAGVLLLVNQGLATLAFFGVGVNLVL  1924
             N+ +  K + EE T D               GGW   ++LL NQGLATLAFFGVGVNLVL
Sbjct  34    NDSELTKKTNEEETRD--------------KGGWTNAIILLGNQGLATLAFFGVGVNLVL  79

Query  1923  FLTRVMGQDNADAANNVSKWTGTVYLFSLLGAFLSDSYWGRYKTCAIFQLIYVVGLISVS  1744
             FLTRVMGQ NA+AANNVSKWTGTVY+FSL+GAFLSDSYWGRY TC IFQ+I+V+G+  +S
Sbjct  80    FLTRVMGQGNAEAANNVSKWTGTVYMFSLVGAFLSDSYWGRYLTCTIFQVIFVLGVGLLS  139

Query  1743  IFSFIFLVKPKGCGDENTPCRSPSRIHIAVYYVSIYLVALGNGGYQPNIATFGSDQFDGD  1564
               S+ FL+KP+GCGD N  C +PS + +A++Y+S+YLVA G GG+QP +ATFG+DQF+ +
Sbjct  140   FTSWFFLIKPRGCGDGNLICNTPSSLGVAIFYLSVYLVAFGYGGHQPTLATFGADQFNDN  199

Query  1563  HAHESVSKVAFFSYFYLALNLGSLFSNTVLVYFEDKGMWTLGFWastvsavlalllflVG  1384
                +  SK AFFSYFY ALN+GSLFSNT+LVYFED+G+WT GF  S  SA++AL+ FL  
Sbjct  200   ---DKTSKAAFFSYFYFALNVGSLFSNTILVYFEDRGLWTEGFLVSLGSAIIALMAFLGP  256

Query  1383  TPRYRHFAPKGNPLSRFSQVLVASARKWNVHLPSDGDDHRLYEIQEHDSS---TRKILHT  1213
             T RYR+  P GNPL R +QV VA+ARKW+V  P   +   LYE++  +S+   +RKI H+
Sbjct  257   TKRYRYVKPCGNPLPRVAQVFVATARKWSVDRPE--NHQELYEVEGPESAIKGSRKIFHS  314

Query  1212  EGFKFLDKAAVITTKESVRDLEERNINPWRLCSVTQVEEVKCILRLLPIWLCTILYSVVF  1033
               F FLD+AAVIT      D      + WRLCSVTQVEE KC++++LPIWLCTI+YSV+F
Sbjct  315   TKFVFLDRAAVITED----DRNGTRSSAWRLCSVTQVEEAKCVMKMLPIWLCTIIYSVIF  370

Query  1032  TQMASLFVEQGAAMRTNIAGFHIPPASMSSFDILSVAAFIFIYRRILDPLIASLKKTRRA  853
             TQMASLFVEQG  M   I  FH+P ASMS FDI SV     IYR ++ P +         
Sbjct  371   TQMASLFVEQGDVMDAYIGKFHVPAASMSVFDICSVLISTGIYRHVIFPYVRP-------  423

Query  852   QGFTELQRMGVGLiiaimamvaagiVEHFRLKYASTDCPRCPSSLSIFWQVPQYVLIGAS  673
                TEL RMG+GLII IMAMVAAG+ E  RL+       +  S LSI WQ+PQYVL+GAS
Sbjct  424   ---TELMRMGIGLIIGIMAMVAAGLTEIQRLRRVVPG--QKESELSILWQIPQYVLVGAS  478

Query  672   EVFMYVGQLEFFNGQAPEGLKSFASALCMTSISLGNYVSSLLVSIVMRISTTHRMPGWIP  493
             EVFMYVGQLEFFNGQAP+GLK+  S+LCM S++LGNYVSSL+V+IVM I+   +  GWIP
Sbjct  479   EVFMYVGQLEFFNGQAPDGLKNLGSSLCMASMALGNYVSSLMVNIVMAITARGQSHGWIP  538

Query  492   GNLNKGHLDRFYFLLAALTTADFVVYILCAKWYKYIEFEE  373
              NLN+GH+DRFYFL+A L   DFV Y++ AKWY+ I  +E
Sbjct  539   ENLNEGHMDRFYFLIAVLAAIDFVFYLVFAKWYQPISHDE  578



>ref|XP_011083321.1| PREDICTED: protein NRT1/ PTR FAMILY 7.1-like [Sesamum indicum]
Length=586

 Score =   623 bits (1607),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 336/574 (59%), Positives = 420/574 (73%), Gaps = 13/574 (2%)
 Frame = -3

Query  2100  ERDEEKASREECTLDGTVDHYGRPALRSATGGWFAGVLLLVNQGLATLAFFGVGVNLVLF  1921
             E   +++          VD       +   GGW    LLL NQGLATLAFFGVG+NLVLF
Sbjct  5     ESTRKRSESSNAPESQPVDKPESENEKKQKGGWSYAYLLLSNQGLATLAFFGVGMNLVLF  64

Query  1920  LTRVMGQDNADAANNVSKWTGTVYLFSLLGAFLSDSYWGRYKTCAIFQLIYVVGLISVSI  1741
             LTRV+GQ+NA  ANNVS WTGTVYL SL+GAFLSDSYWGRY TCAIFQ+I V+GL  +S+
Sbjct  65    LTRVLGQNNAIGANNVSIWTGTVYLCSLVGAFLSDSYWGRYLTCAIFQVILVLGLTLLSV  124

Query  1740  FSFIFLVKPKGCGDENTPCRSPSRIHIAVYYVSIYLVALGNGGYQPNIATFGSDQFDGDH  1561
              S++FLVKPKGCG+    C+ P+ +  +V+Y++IYL A G GG+QP IATFGSDQF  D 
Sbjct  125   SSWLFLVKPKGCGNGKLRCQPPTSVGTSVFYLAIYLTAFGYGGHQPTIATFGSDQF--DD  182

Query  1560  AHESVSKVAFFSYFYLALNLGSLFSNTVLVYFEDKGMWTLGFWastvsavlalllflVGT  1381
             + ES SK AFFSYFY +L  G+LFSNTVLVYFED G WT GF AST SAVLAL++FL+G+
Sbjct  183   SQES-SKAAFFSYFYFSLKTGTLFSNTVLVYFEDNGKWTAGFCASTASAVLALVIFLLGS  241

Query  1380  PRYRHFAPKGNPLSRFSQVLVASARKWNVHLPSDGDD-HRLYEIQEHDSSTRKILHTEGF  1204
               YR+  P GNP+ R  QV VA+++KW    P  G++ H +   Q     +RKI HT+  
Sbjct  242   HGYRYMKPCGNPIPRLIQVFVAASKKWRAT-PKQGEELHEVEGSQSAIKGSRKIGHTDDL  300

Query  1203  KFLDKAAVITTKESVRDLEERNINPWRLCSVTQVEEVKCILRLLPIWLCTILYSVVFTQM  1024
             +FLDKAA++T +    D   +  +PWRLC++TQVEE KCI+R++PIWLCTI YSVVFTQM
Sbjct  301   RFLDKAAIVTEE----DRRCQRSSPWRLCTITQVEEAKCIVRMMPIWLCTITYSVVFTQM  356

Query  1023  ASLFVEQGAAMRTNIAGFHIPPASMSSFDILSVAAFIFIYRRILDPLIASLKKTRRAQGF  844
             ASLFVEQG  M T I  F +P ASMS+FDI SV  F  +YR IL P+  + K T   QG 
Sbjct  357   ASLFVEQGDVMDTKIGKFRLPAASMSAFDICSVLFFTTLYRLILVPV--TRKFTGNPQGL  414

Query  843   TELQRMGVGLiiaimamvaagiVEHFRLKYASTDCPRCPSSLSIFWQVPQYVLIGASEVF  664
             TELQRMGVGL++A++AM+AAGI E +RLK  S    +  SS+S+FWQ+PQYVLIG SEVF
Sbjct  415   TELQRMGVGLVVAMLAMIAAGITELWRLK--SVVPGKHESSMSVFWQIPQYVLIGLSEVF  472

Query  663   MYVGQLEFFNGQAPEGLKSFASALCMTSISLGNYVSSLLVSIVMRISTTHRMPGWIPGNL  484
             MYVGQLEFFNGQAP+G+KSF S+LCM SIS+GN+ SS LV+IV  +++++  PGWIP +L
Sbjct  473   MYVGQLEFFNGQAPDGIKSFGSSLCMASISVGNFASSFLVNIVTSVTSSNNNPGWIPEDL  532

Query  483   NKGHLDRFYFLLAALTTADFVVYILCAKWYKYIE  382
             N GH+DRFYFLLA L   DF++Y+ CA WYK ++
Sbjct  533   NNGHMDRFYFLLAVLAAVDFLIYLACANWYKCVD  566



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 7239240825714