BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c80580_g1_i1 len=1545 path=[1523:0-1544]

Length=1545
                                                                      Score     E

ref|XP_009621839.1|  PREDICTED: uncharacterized protein LOC104113394    268   1e-80   
ref|XP_009804663.1|  PREDICTED: two-component response regulator ...    268   1e-80   
ref|XP_011095220.1|  PREDICTED: uncharacterized protein LOC105174731    254   3e-75   
ref|XP_006429461.1|  hypothetical protein CICLE_v10011992mg             236   9e-69   
gb|KDO56741.1|  hypothetical protein CISIN_1g017464mg                   234   5e-68   
ref|XP_009767509.1|  PREDICTED: two-component response regulator ...    229   2e-66   
ref|XP_011046839.1|  PREDICTED: putative Myb family transcription...    228   1e-65   
ref|XP_002323602.2|  hypothetical protein POPTR_0016s12940g             227   5e-65   Populus trichocarpa [western balsam poplar]
ref|XP_009622809.1|  PREDICTED: uncharacterized protein LOC104114139    221   8e-64   
ref|XP_004249715.1|  PREDICTED: uncharacterized protein LOC101244920    219   3e-63   
emb|CDP06448.1|  unnamed protein product                                221   4e-63   
ref|XP_007026615.1|  Myb-like HTH transcriptional regulator famil...    221   8e-63   
ref|XP_010092813.1|  Putative Myb family transcription factor           218   5e-62   
ref|XP_002268055.1|  PREDICTED: putative Myb family transcription...    217   3e-61   Vitis vinifera
emb|CBI18131.3|  unnamed protein product                                217   5e-61   
ref|XP_002534265.1|  conserved hypothetical protein                     209   9e-61   Ricinus communis
ref|XP_004302585.1|  PREDICTED: uncharacterized protein LOC101295055    212   9e-60   
ref|XP_008363851.1|  PREDICTED: uncharacterized protein LOC103427569    210   2e-59   
ref|XP_003623331.1|  Two-component response regulator ARR10             211   3e-59   
gb|AES79549.2|  MYB-like transcription factor family protein            211   3e-59   
ref|XP_009376409.1|  PREDICTED: two-component response regulator ...    209   5e-59   
ref|XP_006363620.1|  PREDICTED: putative Myb family transcription...    208   7e-59   
ref|XP_008243158.1|  PREDICTED: transcription repressor KAN1-like       209   7e-59   
gb|EYU41938.1|  hypothetical protein MIMGU_mgv1a020265mg                209   1e-58   
emb|CDP05632.1|  unnamed protein product                                209   2e-58   
gb|KDP22851.1|  hypothetical protein JCGZ_00438                         207   6e-58   
ref|XP_004492477.1|  PREDICTED: putative Myb family transcription...    204   3e-57   
ref|XP_007207102.1|  hypothetical protein PRUPE_ppa021179mg             204   5e-57   
ref|XP_010264566.1|  PREDICTED: two-component response regulator ...    202   8e-56   
ref|XP_010529031.1|  PREDICTED: uncharacterized protein LOC104806008    197   6e-54   
ref|XP_008359800.1|  PREDICTED: uncharacterized protein LOC103423495    195   1e-53   
ref|XP_002273049.2|  PREDICTED: uncharacterized protein LOC100263821    196   2e-53   Vitis vinifera
ref|XP_010037685.1|  PREDICTED: uncharacterized protein LOC104426365    194   5e-53   
ref|XP_009337761.1|  PREDICTED: LOW QUALITY PROTEIN: putative two...    193   6e-53   
ref|XP_010257080.1|  PREDICTED: two-component response regulator ...    193   2e-52   
gb|KGN54397.1|  hypothetical protein Csa_4G312300                       191   6e-52   
ref|XP_004492478.1|  PREDICTED: putative Myb family transcription...    189   2e-51   
emb|CBI25446.3|  unnamed protein product                                192   5e-51   
ref|XP_008464217.1|  PREDICTED: probable transcription factor KAN...    186   1e-50   
gb|KHN01942.1|  Putative Myb family transcription factor                186   5e-50   
ref|XP_006573379.1|  PREDICTED: uncharacterized protein LOC102660...    186   5e-50   
ref|XP_006411030.1|  hypothetical protein EUTSA_v10016890mg             186   6e-50   
ref|XP_011035900.1|  PREDICTED: putative two-component response r...    186   7e-50   
emb|CDX74898.1|  BnaA05g06440D                                          185   8e-50   
ref|XP_006294540.1|  hypothetical protein CARUB_v10023575mg             185   8e-50   
ref|XP_009143403.1|  PREDICTED: putative Myb family transcription...    185   9e-50   
ref|XP_006378651.1|  hypothetical protein POPTR_0010s19310g             186   1e-49   
ref|XP_010031180.1|  PREDICTED: uncharacterized protein LOC104421051    186   1e-49   
ref|XP_002881577.1|  DNA binding protein                                184   1e-49   
ref|XP_007008903.1|  Myb-like HTH transcriptional regulator famil...    186   2e-49   
ref|XP_010505450.1|  PREDICTED: two-component response regulator ...    184   2e-49   
ref|XP_008464219.1|  PREDICTED: probable transcription factor KAN...    182   3e-49   
ref|NP_181364.2|  myb-like HTH transcriptional regulator-like pro...    184   3e-49   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003520352.1|  PREDICTED: uncharacterized protein LOC100801120    183   4e-49   
ref|XP_006583665.1|  PREDICTED: uncharacterized protein LOC102662...    184   4e-49   
ref|XP_006602682.1|  PREDICTED: two-component response regulator ...    183   6e-49   
emb|CDX91442.1|  BnaC04g07080D                                          183   6e-49   
ref|XP_010517118.1|  PREDICTED: two-component response regulator ...    181   3e-48   
ref|XP_010509196.1|  PREDICTED: two-component response regulator ...    181   3e-48   
ref|XP_009611230.1|  PREDICTED: putative two-component response r...    182   3e-48   
ref|XP_010693076.1|  PREDICTED: two-component response regulator ...    182   4e-48   
emb|CDP13985.1|  unnamed protein product                                181   5e-48   
ref|XP_007134813.1|  hypothetical protein PHAVU_010G078400g             179   5e-48   
ref|XP_009791664.1|  PREDICTED: uncharacterized protein LOC104238...    181   8e-48   
ref|XP_011076824.1|  PREDICTED: uncharacterized protein LOC105160975    179   1e-47   
gb|KDP44725.1|  hypothetical protein JCGZ_01225                         179   2e-47   
ref|XP_007140226.1|  hypothetical protein PHAVU_008G094800g             179   2e-47   
ref|XP_009611229.1|  PREDICTED: uncharacterized protein LOC104104...    179   3e-47   
ref|XP_004307667.1|  PREDICTED: uncharacterized protein LOC101309095    179   6e-47   
ref|XP_009791663.1|  PREDICTED: uncharacterized protein LOC104238...    178   6e-47   
ref|XP_008233790.1|  PREDICTED: uncharacterized protein LOC103332813    177   1e-46   
ref|XP_009410557.1|  PREDICTED: uncharacterized protein LOC103992543    174   2e-46   
ref|XP_002528326.1|  DNA binding protein, putative                      176   3e-46   Ricinus communis
ref|XP_010517119.1|  PREDICTED: uncharacterized protein LOC104792...    175   3e-46   
ref|XP_007220942.1|  hypothetical protein PRUPE_ppa025397mg             176   3e-46   
ref|XP_010509197.1|  PREDICTED: uncharacterized protein LOC104785...    175   3e-46   
ref|XP_010505451.1|  PREDICTED: two-component response regulator ...    175   4e-46   
ref|XP_010922593.1|  PREDICTED: uncharacterized protein LOC105045...    176   4e-46   
ref|XP_009369202.1|  PREDICTED: uncharacterized protein LOC103958635    175   6e-46   
ref|XP_004246781.1|  PREDICTED: probable transcription factor KAN2      167   1e-45   
ref|XP_010105426.1|  Putative Myb family transcription factor           176   2e-45   
ref|XP_011001163.1|  PREDICTED: uncharacterized protein LOC105108499    174   2e-45   
ref|XP_006583667.1|  PREDICTED: uncharacterized protein LOC102662...    173   2e-45   
ref|XP_010257082.1|  PREDICTED: uncharacterized protein LOC104597310    173   2e-45   
ref|XP_008369283.1|  PREDICTED: uncharacterized protein LOC103432854    173   5e-45   
ref|XP_008806053.1|  PREDICTED: putative Myb family transcription...    165   2e-44   
ref|XP_010922591.1|  PREDICTED: uncharacterized protein LOC105045...    171   2e-44   
ref|XP_004148628.1|  PREDICTED: probable transcription factor KAN...    166   2e-44   
ref|XP_006353444.1|  PREDICTED: uncharacterized protein LOC102588048    171   3e-44   
ref|XP_009345257.1|  PREDICTED: uncharacterized protein LOC103937...    167   9e-43   
ref|XP_010676796.1|  PREDICTED: uncharacterized protein LOC104892...    166   1e-42   
ref|XP_010937910.1|  PREDICTED: uncharacterized protein LOC105057131    166   1e-42   
ref|XP_011085124.1|  PREDICTED: uncharacterized protein LOC105167199    164   2e-42   
ref|XP_010322168.1|  PREDICTED: putative two-component response r...    164   6e-42   
ref|XP_008374244.1|  PREDICTED: transcription factor LUX-like iso...    164   1e-41   
ref|XP_010322167.1|  PREDICTED: putative two-component response r...    162   4e-41   
ref|XP_010676795.1|  PREDICTED: uncharacterized protein LOC104892...    162   4e-41   
ref|XP_009345244.1|  PREDICTED: uncharacterized protein LOC103937...    162   4e-41   
ref|XP_009345251.1|  PREDICTED: uncharacterized protein LOC103937...    162   5e-41   
ref|XP_010264567.1|  PREDICTED: uncharacterized protein LOC104602...    160   1e-40   
ref|XP_010907869.1|  PREDICTED: transcription activator GLK2-like...    159   2e-40   
ref|XP_008374237.1|  PREDICTED: uncharacterized protein LOC103437...    160   4e-40   
ref|XP_002278456.1|  PREDICTED: uncharacterized protein LOC100246669    159   5e-40   Vitis vinifera
emb|CBI15915.3|  unnamed protein product                                153   6e-40   
gb|KHN23034.1|  Putative Myb family transcription factor                156   7e-40   
ref|XP_008374230.1|  PREDICTED: uncharacterized protein LOC103437...    159   8e-40   
gb|KHN20340.1|  Putative Myb family transcription factor                155   2e-39   
emb|CDY18860.1|  BnaC04g04900D                                          158   2e-39   
ref|XP_010264568.1|  PREDICTED: uncharacterized protein LOC104602...    157   3e-39   
gb|KHN28868.1|  Putative transcription factor KAN2                      154   4e-39   
ref|XP_010676797.1|  PREDICTED: uncharacterized protein LOC104892...    155   1e-38   
emb|CDX74803.1|  BnaA05g05490D                                          155   1e-38   
ref|XP_009143231.1|  PREDICTED: uncharacterized protein LOC103866...    155   2e-38   
ref|XP_006411281.1|  hypothetical protein EUTSA_v10016733mg             155   2e-38   
ref|XP_007016942.1|  Myb HTH transcriptional regulator family pro...    153   4e-38   
ref|XP_010907870.1|  PREDICTED: transcription activator GLK2-like...    153   4e-38   
gb|KFK36916.1|  hypothetical protein AALP_AA4G189400                    154   4e-38   
gb|KDO66970.1|  hypothetical protein CISIN_1g041956mg                   145   1e-37   
ref|XP_010907868.1|  PREDICTED: transcription activator GLK2-like...    151   1e-37   
ref|XP_002881704.1|  hypothetical protein ARALYDRAFT_321718             152   2e-37   
ref|XP_010508888.1|  PREDICTED: putative two-component response r...    152   3e-37   
ref|XP_010505750.1|  PREDICTED: putative two-component response r...    152   3e-37   
ref|XP_010554678.1|  PREDICTED: two-component response regulator ...    151   4e-37   
ref|XP_010517442.1|  PREDICTED: uncharacterized protein LOC104792882    152   4e-37   
ref|XP_006294294.1|  hypothetical protein CARUB_v10023302mg             151   6e-37   
ref|XP_006425115.1|  hypothetical protein CICLE_v10029989mg             150   8e-37   
ref|XP_002312172.1|  myb family transcription factor family protein     147   3e-36   Populus trichocarpa [western balsam poplar]
ref|XP_006359562.1|  PREDICTED: putative Myb family transcription...    140   5e-36   
ref|XP_009143232.1|  PREDICTED: uncharacterized protein LOC103866...    148   5e-36   
emb|CBI21992.3|  unnamed protein product                                145   6e-36   
ref|XP_009143230.1|  PREDICTED: uncharacterized protein LOC103866...    148   6e-36   
gb|AAD25941.1|AF085279_14  hypothetical cytoskeletal protein            147   1e-35   Arabidopsis thaliana [mouse-ear cress]
gb|KDO77871.1|  hypothetical protein CISIN_1g035517mg                   140   1e-35   
ref|NP_181555.1|  myb family transcription factor                       147   1e-35   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002313237.2|  hypothetical protein POPTR_0009s07890g             145   1e-35   Populus trichocarpa [western balsam poplar]
ref|XP_009141878.1|  PREDICTED: serine/threonine-protein kinase p...    145   5e-35   
emb|CAN60070.1|  hypothetical protein VITISV_022944                     139   6e-35   Vitis vinifera
ref|XP_006449512.1|  hypothetical protein CICLE_v10017867mg             140   6e-35   
gb|KHN27949.1|  Putative Myb family transcription factor                144   7e-35   
ref|XP_006592875.1|  PREDICTED: uncharacterized protein LOC102668520    144   7e-35   
emb|CDY07612.1|  BnaA03g18990D                                          144   1e-34   
ref|XP_011024915.1|  PREDICTED: probable transcription factor KAN...    143   1e-34   
ref|XP_010534614.1|  PREDICTED: uncharacterized protein LOC104810118    144   1e-34   
ref|XP_007216041.1|  hypothetical protein PRUPE_ppa017500mg             140   2e-34   
ref|XP_006594818.1|  PREDICTED: probable transcription factor KAN...    143   2e-34   
gb|KHN36703.1|  Putative Myb family transcription factor                142   2e-34   
emb|CDX93206.1|  BnaC04g46900D                                          144   2e-34   
emb|CDY07070.1|  BnaA04g22450D                                          144   3e-34   
ref|XP_009141879.1|  PREDICTED: two-component response regulator ...    144   3e-34   
ref|XP_010274476.1|  PREDICTED: uncharacterized protein LOC104609785    144   3e-34   
ref|XP_002450099.1|  hypothetical protein SORBIDRAFT_05g000480          142   4e-34   Sorghum bicolor [broomcorn]
ref|XP_003532757.2|  PREDICTED: uncharacterized protein LOC100787...    143   4e-34   
ref|XP_006585172.1|  PREDICTED: uncharacterized protein LOC100787...    142   4e-34   
ref|XP_007149732.1|  hypothetical protein PHAVU_005G094600g             141   6e-34   
ref|XP_010657046.1|  PREDICTED: uncharacterized protein LOC104880828    143   6e-34   
ref|XP_006585171.1|  PREDICTED: uncharacterized protein LOC100787...    143   7e-34   
ref|XP_009133426.1|  PREDICTED: uncharacterized protein LOC103857923    141   8e-34   
ref|XP_002299997.1|  hypothetical protein POPTR_0001s28690g             141   9e-34   Populus trichocarpa [western balsam poplar]
ref|XP_011003744.1|  PREDICTED: probable transcription factor KAN4      140   1e-33   
ref|XP_006469002.1|  PREDICTED: uncharacterized protein LOC102628788    140   1e-33   
ref|XP_008794301.1|  PREDICTED: uncharacterized protein LOC103710387    140   1e-33   
gb|KDO63386.1|  hypothetical protein CISIN_1g038268mg                   137   2e-33   
ref|XP_007048707.1|  Myb-like HTH transcriptional regulator famil...    140   2e-33   
gb|KDP21103.1|  hypothetical protein JCGZ_21574                         139   3e-33   
gb|KHN06404.1|  Putative Myb family transcription factor                140   3e-33   
ref|XP_007148039.1|  hypothetical protein PHAVU_006G175300g             139   3e-33   
ref|XP_003524206.1|  PREDICTED: two-component response regulator ...    140   3e-33   
ref|XP_007159455.1|  hypothetical protein PHAVU_002G239100g             139   4e-33   
ref|XP_002442650.1|  hypothetical protein SORBIDRAFT_08g000510          139   4e-33   Sorghum bicolor [broomcorn]
ref|XP_006855946.1|  hypothetical protein AMTR_s00037p00221530          132   5e-33   
gb|EPS58795.1|  hypothetical protein M569_16018                         135   5e-33   
ref|XP_011024914.1|  PREDICTED: probable transcription factor KAN...    139   5e-33   
ref|XP_008228924.1|  PREDICTED: uncharacterized protein LOC103328...    140   6e-33   
ref|XP_010104403.1|  Putative Myb family transcription factor           140   7e-33   
ref|XP_006597478.1|  PREDICTED: uncharacterized protein LOC100787...    138   7e-33   
ref|XP_011024916.1|  PREDICTED: probable transcription factor KAN...    138   8e-33   
ref|XP_006597479.1|  PREDICTED: uncharacterized protein LOC100787...    138   8e-33   
ref|XP_004233059.1|  PREDICTED: two-component response regulator ...    137   1e-32   
ref|XP_010276999.1|  PREDICTED: uncharacterized protein LOC104611575    139   1e-32   
emb|CDY52431.1|  BnaC03g72550D                                          138   2e-32   
ref|XP_010999741.1|  PREDICTED: uncharacterized protein LOC105107499    137   2e-32   
ref|XP_004504295.1|  PREDICTED: two-component response regulator ...    138   2e-32   
ref|XP_010915504.1|  PREDICTED: two-component response regulator ...    139   2e-32   
ref|XP_010915503.1|  PREDICTED: two-component response regulator ...    139   3e-32   
ref|XP_010925633.1|  PREDICTED: uncharacterized protein LOC105048124    139   3e-32   
gb|KEH38868.1|  myb-like DNA-binding domain, shaqkyf class protein      135   3e-32   
gb|KCW52514.1|  hypothetical protein EUGRSUZ_J01904                     130   3e-32   
ref|XP_002316821.1|  myb family transcription factor family protein     130   3e-32   Populus trichocarpa [western balsam poplar]
ref|XP_006446804.1|  hypothetical protein CICLE_v10015819mg             135   4e-32   
ref|XP_006467640.1|  PREDICTED: uncharacterized protein LOC102609915    137   4e-32   
gb|KEH38867.1|  myb-like DNA-binding domain, shaqkyf class protein      136   4e-32   
ref|XP_006486285.1|  PREDICTED: uncharacterized protein LOC102620939    136   4e-32   
ref|XP_008781403.1|  PREDICTED: probable transcription factor KAN2      131   6e-32   
ref|XP_008649161.1|  PREDICTED: uncharacterized protein LOC103629847    138   6e-32   
ref|XP_003577159.1|  PREDICTED: two-component response regulator ...    134   6e-32   
ref|XP_006383901.1|  hypothetical protein POPTR_0004s01060g             128   6e-32   
ref|XP_004305446.1|  PREDICTED: uncharacterized protein LOC101299510    137   7e-32   
ref|XP_006852395.1|  hypothetical protein AMTR_s00021p00013790          137   7e-32   
gb|AFW76554.1|  putative MYB DNA-binding domain superfamily protein     137   8e-32   
ref|XP_010109885.1|  Putative Myb family transcription factor           134   1e-31   
emb|CBI30694.3|  unnamed protein product                                136   1e-31   
ref|XP_009607761.1|  PREDICTED: putative Myb family transcription...    135   1e-31   
ref|XP_010655530.1|  PREDICTED: uncharacterized protein LOC104880...    136   1e-31   
ref|XP_010655529.1|  PREDICTED: uncharacterized protein LOC104880...    135   2e-31   
ref|XP_008228923.1|  PREDICTED: uncharacterized protein LOC103328...    135   2e-31   
ref|XP_010052783.1|  PREDICTED: uncharacterized protein LOC104441352    135   2e-31   
gb|AAC28774.1|  unknown protein                                         132   3e-31   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008225297.1|  PREDICTED: transcription activator GLK1-like       134   3e-31   
ref|XP_011101395.1|  PREDICTED: two-component response regulator ...    134   3e-31   
ref|XP_008790063.1|  PREDICTED: uncharacterized protein LOC103707382    136   3e-31   
ref|XP_004487568.1|  PREDICTED: uncharacterized protein LOC101500041    134   4e-31   
ref|XP_007025361.1|  Myb-like HTH transcriptional regulator famil...    134   5e-31   
emb|CDO96808.1|  unnamed protein product                                134   5e-31   
ref|XP_006594551.1|  PREDICTED: uncharacterized protein LOC102669757    133   5e-31   
gb|EMT09351.1|  Putative Myb family transcription factor                131   6e-31   
ref|XP_011008685.1|  PREDICTED: uncharacterized protein LOC105114001    130   8e-31   
ref|XP_011047027.1|  PREDICTED: uncharacterized protein LOC105141490    130   8e-31   
ref|XP_002438524.1|  hypothetical protein SORBIDRAFT_10g021360          134   9e-31   Sorghum bicolor [broomcorn]
ref|XP_010920938.1|  PREDICTED: uncharacterized protein LOC105044662    134   9e-31   
ref|XP_010032996.1|  PREDICTED: uncharacterized protein LOC104422379    133   9e-31   
ref|XP_009409395.1|  PREDICTED: uncharacterized protein LOC103991...    134   1e-30   
ref|XP_009409396.1|  PREDICTED: uncharacterized protein LOC103991...    134   1e-30   
ref|XP_009409397.1|  PREDICTED: uncharacterized protein LOC103991...    134   1e-30   
ref|XP_003629774.1|  Myb family transcription factor APL                132   1e-30   
gb|KEH20674.1|  MYB-like transcription factor family protein            132   1e-30   
ref|XP_009759227.1|  PREDICTED: putative Myb family transcription...    130   2e-30   
ref|XP_002984784.1|  hypothetical protein SELMODRAFT_423935             130   2e-30   
gb|EMT28079.1|  Putative Myb family transcription factor                132   2e-30   
ref|XP_008448246.1|  PREDICTED: probable transcription factor KAN...    126   2e-30   
ref|XP_009613587.1|  PREDICTED: uncharacterized protein LOC104106691    131   3e-30   
ref|XP_009623365.1|  PREDICTED: putative Myb family transcription...    127   3e-30   
ref|XP_009421270.1|  PREDICTED: uncharacterized protein LOC104000...    132   3e-30   
ref|XP_009421269.1|  PREDICTED: uncharacterized protein LOC104000...    132   3e-30   
ref|XP_006663711.1|  PREDICTED: transcription activator GLK2-like       129   3e-30   
ref|XP_003577903.2|  PREDICTED: two-component response regulator ...    130   3e-30   
gb|KEH36604.1|  myb-like DNA-binding domain, shaqkyf class protein      130   4e-30   
ref|XP_003636803.1|  Myb family transcription factor APL                130   5e-30   
ref|XP_002985847.1|  hypothetical protein SELMODRAFT_424890             129   5e-30   
ref|XP_006362389.1|  PREDICTED: uncharacterized protein LOC102585011    129   6e-30   
ref|XP_004233787.1|  PREDICTED: uncharacterized protein LOC101255...    127   6e-30   
gb|KHN40881.1|  Putative Myb family transcription factor                127   6e-30   
ref|XP_009782820.1|  PREDICTED: transcription repressor KAN1-like       127   6e-30   
ref|XP_003534706.2|  PREDICTED: probable transcription factor KAN...    127   7e-30   
ref|XP_009802187.1|  PREDICTED: uncharacterized protein LOC104247786    130   9e-30   
ref|XP_007147718.1|  hypothetical protein PHAVU_006G149000g             128   1e-29   
ref|XP_008439740.1|  PREDICTED: transcription repressor KAN1-like...    127   1e-29   
ref|XP_006435783.1|  hypothetical protein CICLE_v10032941mg             124   1e-29   
ref|XP_008439738.1|  PREDICTED: myb-like protein H isoform X2           127   2e-29   
emb|CDP09227.1|  unnamed protein product                                128   2e-29   
gb|EAZ01264.1|  hypothetical protein OsI_23288                          130   2e-29   Oryza sativa Indica Group [Indian rice]
ref|XP_010316579.1|  PREDICTED: putative two-component response r...    125   2e-29   
ref|XP_009803423.1|  PREDICTED: transcription repressor KAN1-like       125   2e-29   
gb|KGN49310.1|  hypothetical protein Csa_6G519620                       127   2e-29   
gb|KDO68898.1|  hypothetical protein CISIN_1g029903mg                   124   2e-29   
ref|XP_010647532.1|  PREDICTED: putative two-component response r...    125   3e-29   
ref|XP_004293956.1|  PREDICTED: uncharacterized protein LOC101298396    128   3e-29   
ref|XP_004951340.1|  PREDICTED: uncharacterized protein LOC101755438    129   3e-29   
ref|XP_010099195.1|  Putative Myb family transcription factor           127   3e-29   
ref|XP_004965558.1|  PREDICTED: uncharacterized protein LOC101779064    129   4e-29   
ref|XP_004486311.1|  PREDICTED: probable transcription factor KAN...    124   4e-29   
ref|XP_006663145.1|  PREDICTED: transcription activator GLK2-like       126   4e-29   
ref|XP_008659607.1|  PREDICTED: uncharacterized protein LOC103638481    129   4e-29   
ref|XP_008439737.1|  PREDICTED: myb-like protein H isoform X1           127   4e-29   
ref|NP_001057810.1|  Os06g0543200                                       129   4e-29   Oryza sativa Japonica Group [Japonica rice]
ref|XP_011039440.1|  PREDICTED: uncharacterized protein LOC105136003    127   5e-29   
ref|XP_007026111.1|  Homeodomain-like superfamily protein               120   5e-29   
ref|XP_009352761.1|  PREDICTED: uncharacterized protein LOC103944086    127   6e-29   
ref|XP_010517804.1|  PREDICTED: putative two-component response r...    123   6e-29   
ref|XP_006411533.1|  hypothetical protein EUTSA_v10017090mg             124   6e-29   
ref|XP_010920993.1|  PREDICTED: uncharacterized protein LOC105044...    126   7e-29   
ref|XP_010234086.1|  PREDICTED: uncharacterized protein LOC104583488    128   7e-29   
gb|KCW76997.1|  hypothetical protein EUGRSUZ_D01346                     119   8e-29   
ref|XP_007213573.1|  hypothetical protein PRUPE_ppa015662mg             120   8e-29   
ref|XP_006389592.1|  hypothetical protein POPTR_0021s00430g             120   9e-29   
ref|XP_008645578.1|  PREDICTED: uncharacterized protein LOC103627002    129   9e-29   
ref|XP_008793164.1|  PREDICTED: uncharacterized protein LOC103709531    128   9e-29   
ref|XP_002451851.1|  hypothetical protein SORBIDRAFT_04g008670          128   1e-28   Sorghum bicolor [broomcorn]
gb|KCW89649.1|  hypothetical protein EUGRSUZ_A01921                     121   1e-28   
ref|XP_010517802.1|  PREDICTED: two-component response regulator ...    124   1e-28   
emb|CBI14787.3|  unnamed protein product                                119   1e-28   
ref|XP_008439999.1|  PREDICTED: probable transcription factor KAN...    123   1e-28   
ref|XP_008356062.1|  PREDICTED: uncharacterized protein LOC103419745    125   1e-28   
gb|KHF99142.1|  hypothetical protein F383_20210                         125   1e-28   
ref|XP_006449755.1|  hypothetical protein CICLE_v10018145mg             124   1e-28   
ref|XP_008448244.1|  PREDICTED: uncharacterized protein LOC103490...    126   1e-28   
gb|KHN33018.1|  Putative Myb family transcription factor                124   1e-28   
ref|XP_009350428.1|  PREDICTED: uncharacterized protein LOC103941921    126   2e-28   
ref|XP_008353366.1|  PREDICTED: uncharacterized protein LOC103416937    126   2e-28   
ref|XP_008341218.1|  PREDICTED: uncharacterized protein LOC103404135    126   2e-28   
gb|AAT64038.1|  putative MYB transcription factor                       125   2e-28   
ref|XP_002518461.1|  DNA binding protein, putative                      124   2e-28   
ref|XP_006597590.1|  PREDICTED: putative Myb family transcription...    124   2e-28   
ref|XP_002305066.2|  hypothetical protein POPTR_0004s05660g             124   2e-28   
gb|KGN49100.1|  hypothetical protein Csa_6G513640                       122   2e-28   
ref|XP_004234092.1|  PREDICTED: uncharacterized protein LOC101251954    124   2e-28   
gb|KEH36878.1|  myb-like DNA-binding domain, shaqkyf class protein      122   2e-28   
ref|NP_001136957.1|  putative MYB DNA-binding domain superfamily ...    125   3e-28   
gb|ACD56656.1|  putative MYB transcription factor                       124   3e-28   
ref|XP_008371480.1|  PREDICTED: uncharacterized protein LOC103434890    125   3e-28   
ref|XP_010680052.1|  PREDICTED: uncharacterized protein LOC104895284    125   3e-28   
gb|EYU20041.1|  hypothetical protein MIMGU_mgv1a0209401mg               118   3e-28   
gb|EMT11720.1|  Putative Myb family transcription factor                125   3e-28   
ref|XP_010508544.1|  PREDICTED: putative two-component response r...    123   3e-28   
gb|KEH20675.1|  MYB-like transcription factor family protein            125   3e-28   
gb|AFW86750.1|  putative MYB DNA-binding domain superfamily protein     127   4e-28   
ref|XP_008384248.1|  PREDICTED: uncharacterized protein LOC103446871    125   4e-28   
ref|XP_002881865.1|  myb family transcription factor                    122   5e-28   
gb|KEH36605.1|  myb-like DNA-binding domain, shaqkyf class protein      124   5e-28   
ref|XP_007045387.1|  Homeodomain-like superfamily protein, putati...    123   5e-28   
ref|XP_006648492.1|  PREDICTED: centrosomal and chromosomal facto...    127   6e-28   
ref|XP_004162479.1|  PREDICTED: uncharacterized LOC101205384            124   6e-28   
ref|XP_004150753.1|  PREDICTED: uncharacterized protein LOC101205384    124   6e-28   
ref|NP_181794.1|  homeodomain-like superfamily protein                  121   7e-28   
gb|EAY85155.1|  hypothetical protein OsI_06510                          125   1e-27   
ref|XP_006656146.1|  PREDICTED: uncharacterized protein LOC102715027    125   1e-27   
dbj|BAD28879.1|  myb family transcription factor-like                   125   1e-27   
ref|NP_001169950.1|  uncharacterized protein LOC100383849               123   1e-27   
ref|XP_006378423.1|  hypothetical protein POPTR_0010s10990g             119   1e-27   
ref|XP_008804408.1|  PREDICTED: putative Myb family transcription...    122   1e-27   
ref|XP_002983552.1|  hypothetical protein SELMODRAFT_422768             123   1e-27   
ref|XP_002973839.1|  hypothetical protein SELMODRAFT_414222             122   2e-27   
ref|XP_010935361.1|  PREDICTED: uncharacterized protein LOC105055282    122   2e-27   
ref|XP_008667376.1|  PREDICTED: uncharacterized protein LOC100217...    123   2e-27   
ref|XP_009605835.1|  PREDICTED: putative Myb family transcription...    122   2e-27   
ref|XP_007212374.1|  hypothetical protein PRUPE_ppa014847mg             123   2e-27   
gb|KDP38204.1|  hypothetical protein JCGZ_04847                         121   2e-27   
ref|XP_010227658.1|  PREDICTED: uncharacterized protein LOC100830272    124   2e-27   
ref|XP_011025033.1|  PREDICTED: putative Myb family transcription...    120   2e-27   
dbj|BAK04843.1|  predicted protein                                      121   3e-27   
ref|XP_010270741.1|  PREDICTED: putative Myb family transcription...    121   3e-27   
ref|XP_006295407.1|  hypothetical protein CARUB_v10024503mg             120   3e-27   
ref|XP_010506102.1|  PREDICTED: putative Myb family transcription...    120   3e-27   
ref|XP_002521884.1|  conserved hypothetical protein                     120   3e-27   
ref|XP_011070508.1|  PREDICTED: putative Myb family transcription...    120   4e-27   
ref|NP_001065933.1|  Os12g0105600                                       120   4e-27   
ref|XP_010920992.1|  PREDICTED: uncharacterized protein LOC105044...    121   4e-27   
ref|XP_003590285.1|  hypothetical protein MTR_1g051035                  115   4e-27   
ref|XP_002988200.1|  hypothetical protein SELMODRAFT_426960             122   5e-27   
gb|EAY81968.1|  hypothetical protein OsI_37145                          120   6e-27   
ref|XP_008220974.1|  PREDICTED: putative Myb family transcription...    119   7e-27   
ref|XP_009766440.1|  PREDICTED: putative Myb family transcription...    120   8e-27   
ref|XP_009766441.1|  PREDICTED: putative Myb family transcription...    120   8e-27   
ref|XP_008220975.1|  PREDICTED: putative Myb family transcription...    119   8e-27   
ref|XP_009386097.1|  PREDICTED: uncharacterized protein LOC103973299    119   8e-27   
ref|XP_002963490.1|  hypothetical protein SELMODRAFT_438636             121   9e-27   
ref|XP_011021697.1|  PREDICTED: putative Myb family transcription...    119   9e-27   
emb|CDP05400.1|  unnamed protein product                                119   1e-26   
ref|XP_010940260.1|  PREDICTED: uncharacterized protein LOC105058895    119   1e-26   
emb|CAN63286.1|  hypothetical protein VITISV_025194                     119   1e-26   
ref|XP_002281928.1|  PREDICTED: myb family transcription factor A...    119   1e-26   
ref|XP_010651000.1|  PREDICTED: putative Myb family transcription...    119   1e-26   
gb|KFK37114.1|  myb family transcription factor                         118   1e-26   
ref|XP_001762580.1|  predicted protein                                  123   1e-26   
ref|XP_009133548.1|  PREDICTED: uncharacterized protein LOC103858025    118   1e-26   
ref|XP_010524068.1|  PREDICTED: uncharacterized protein LOC104802...    119   1e-26   
ref|XP_008440000.1|  PREDICTED: probable transcription factor KAN...    117   1e-26   
ref|XP_006289552.1|  hypothetical protein CARUB_v10003097mg             113   2e-26   
emb|CEA10059.1|  putative transcription repressor KAN1-like             112   2e-26   
gb|EYU33887.1|  hypothetical protein MIMGU_mgv1a019410mg                114   2e-26   
ref|XP_006355020.1|  PREDICTED: putative Myb family transcription...    119   2e-26   
ref|XP_006355021.1|  PREDICTED: putative Myb family transcription...    119   2e-26   
ref|XP_008439998.1|  PREDICTED: probable transcription factor KAN...    117   2e-26   
ref|XP_009408891.1|  PREDICTED: two-component response regulator ...    120   2e-26   
ref|XP_009408892.1|  PREDICTED: two-component response regulator ...    120   2e-26   
ref|XP_004236899.2|  PREDICTED: putative Myb family transcription...    118   2e-26   
ref|XP_007045388.1|  Homeodomain-like superfamily protein, putati...    118   2e-26   
gb|KDO78278.1|  hypothetical protein CISIN_1g043383mg                   112   2e-26   
gb|EMT27812.1|  Putative Myb family transcription factor                121   3e-26   
emb|CDY71094.1|  BnaCnng71310D                                          112   3e-26   
emb|CDY42825.1|  BnaC03g23810D                                          118   3e-26   
emb|CDY67147.1|  BnaA03g56690D                                          118   3e-26   
gb|KHG02728.1|  hypothetical protein F383_24858                         118   3e-26   
ref|XP_006420714.1|  hypothetical protein CICLE_v100054661mg            116   3e-26   
ref|XP_004155673.1|  PREDICTED: probable transcription factor KAN...    116   3e-26   
ref|XP_004295277.1|  PREDICTED: uncharacterized protein LOC101299365    117   4e-26   
ref|XP_008812783.1|  PREDICTED: putative Myb family transcription...    117   4e-26   
ref|XP_004134975.1|  PREDICTED: probable transcription factor KAN...    115   4e-26   
ref|XP_011086192.1|  PREDICTED: uncharacterized protein LOC105167992    117   5e-26   
ref|XP_010908308.1|  PREDICTED: transcription repressor KAN1-like       117   5e-26   
ref|XP_010057109.1|  PREDICTED: uncharacterized protein LOC104445014    118   6e-26   
ref|XP_010043897.1|  PREDICTED: uncharacterized protein LOC104432988    117   6e-26   
ref|XP_006379799.1|  hypothetical protein POPTR_0008s14140g             112   6e-26   
ref|XP_007221856.1|  hypothetical protein PRUPE_ppa021540mg             117   7e-26   
ref|XP_004155628.1|  PREDICTED: two-component response regulator-...    114   7e-26   
gb|ACU23450.1|  unknown                                                 113   7e-26   
ref|XP_006470870.1|  PREDICTED: uncharacterized protein LOC102607614    117   7e-26   
gb|KDO53576.1|  hypothetical protein CISIN_1g020303mg                   117   8e-26   
ref|NP_565281.2|  putative transcription factor                         115   9e-26   
ref|XP_008460209.1|  PREDICTED: putative Myb family transcription...    116   9e-26   
ref|XP_010529836.1|  PREDICTED: putative Myb family transcription...    115   1e-25   
ref|XP_009129177.1|  PREDICTED: putative Myb family transcription...    114   1e-25   
ref|XP_009389791.1|  PREDICTED: putative two-component response r...    117   1e-25   
ref|XP_010918327.1|  PREDICTED: transcription repressor KAN1-like...    116   1e-25   
ref|XP_010918329.1|  PREDICTED: transcription repressor KAN1-like...    116   1e-25   
gb|KGN50826.1|  hypothetical protein Csa_5G276460                       115   1e-25   
ref|XP_010093351.1|  Putative Myb family transcription factor           117   1e-25   
gb|ABA91074.1|  myb-like DNA-binding domain, SHAQKYF class family...    116   1e-25   
gb|ADO79619.1|  myb-like DNA-binding domain-containing protein          116   1e-25   
gb|KHG15273.1|  hypothetical protein F383_06292                         116   2e-25   
ref|XP_008340525.1|  PREDICTED: putative Myb family transcription...    115   2e-25   
ref|XP_007142823.1|  hypothetical protein PHAVU_007G019900g             116   2e-25   
ref|XP_009383036.1|  PREDICTED: transcription repressor KAN1-like       116   2e-25   
ref|XP_008460208.1|  PREDICTED: putative Myb family transcription...    115   2e-25   
ref|XP_008789400.1|  PREDICTED: uncharacterized protein LOC103706912    118   2e-25   
ref|NP_001280888.1|  putative Myb family transcription factor At1...    115   2e-25   
ref|XP_002875110.1|  hypothetical protein ARALYDRAFT_484129             114   2e-25   
gb|KHN11480.1|  Putative Myb family transcription factor                115   3e-25   
ref|XP_009129176.1|  PREDICTED: putative Myb family transcription...    114   3e-25   
ref|XP_004297794.1|  PREDICTED: uncharacterized protein LOC101309246    115   4e-25   
ref|XP_010455748.1|  PREDICTED: uncharacterized protein LOC104737...    113   4e-25   
gb|KEH44343.1|  myb-like DNA-binding domain, shaqkyf class protein      115   5e-25   
ref|XP_006855580.1|  hypothetical protein AMTR_s00044p00042560          115   5e-25   
ref|XP_009402093.1|  PREDICTED: uncharacterized protein LOC103985966    115   5e-25   
ref|XP_008805079.1|  PREDICTED: uncharacterized protein LOC103718164    114   5e-25   
emb|CDP04416.1|  unnamed protein product                                114   6e-25   
ref|XP_008224747.1|  PREDICTED: probable transcription factor KAN4      113   6e-25   
gb|KHN37404.1|  Putative Myb family transcription factor                114   7e-25   
ref|XP_009144511.1|  PREDICTED: uncharacterized protein LOC103868161    112   8e-25   
gb|KFK33423.1|  hypothetical protein AALP_AA5G011100                    112   9e-25   
ref|XP_009398908.1|  PREDICTED: uncharacterized protein LOC103983419    114   9e-25   
ref|XP_009351623.1|  PREDICTED: LOW QUALITY PROTEIN: putative Myb...    113   1e-24   
emb|CDY70922.1|  BnaCnng70380D                                          112   1e-24   
ref|XP_004497172.1|  PREDICTED: putative Myb family transcription...    113   2e-24   
gb|EYU28094.1|  hypothetical protein MIMGU_mgv1a011823mg                112   2e-24   
ref|XP_001773705.1|  predicted protein                                  116   2e-24   
ref|XP_006838104.1|  hypothetical protein AMTR_s00106p00040830          110   2e-24   
ref|XP_004498202.1|  PREDICTED: uncharacterized protein LOC101495986    112   2e-24   
ref|XP_006605453.1|  PREDICTED: putative Myb family transcription...    112   2e-24   
ref|XP_007153120.1|  hypothetical protein PHAVU_003G008400g             112   3e-24   
ref|XP_003589673.1|  Myb family transcription factor APL                110   3e-24   
ref|XP_003530316.1|  PREDICTED: putative Myb family transcription...    112   3e-24   
gb|KEH16339.1|  myb-like DNA-binding domain, shaqkyf class protein      111   4e-24   
gb|KFK43702.1|  hypothetical protein AALP_AA1G162200                    110   4e-24   
ref|XP_010467966.1|  PREDICTED: uncharacterized protein LOC104747958    110   4e-24   
ref|XP_010455747.1|  PREDICTED: uncharacterized protein LOC104737...    110   5e-24   
gb|KCW74118.1|  hypothetical protein EUGRSUZ_E02754                     109   5e-24   
gb|KFK43703.1|  hypothetical protein AALP_AA1G162200                    110   6e-24   
ref|XP_009101280.1|  PREDICTED: putative Myb family transcription...    110   7e-24   
emb|CDY17617.1|  BnaA06g34360D                                          110   7e-24   
ref|XP_010539026.1|  PREDICTED: putative Myb family transcription...    109   8e-24   
ref|XP_009148839.1|  PREDICTED: putative Myb family transcription...    110   8e-24   
ref|XP_009148840.1|  PREDICTED: putative Myb family transcription...    110   8e-24   
ref|XP_009101279.1|  PREDICTED: putative Myb family transcription...    110   8e-24   
gb|AAD20098.1|  unknown protein                                         115   8e-24   
ref|XP_010424973.1|  PREDICTED: putative Myb family transcription...    110   8e-24   
gb|KHN28615.1|  Putative Myb family transcription factor                110   9e-24   
emb|CDY45272.1|  BnaA06g09420D                                          110   9e-24   
ref|NP_172912.3|  putative Myb family transcription factor              110   9e-24   
gb|AAF63176.1|AC010657_12  T5E21.10                                     110   9e-24   
ref|XP_006395816.1|  hypothetical protein EUTSA_v10004791mg             110   1e-23   
ref|XP_010424971.1|  PREDICTED: putative Myb family transcription...    110   1e-23   
ref|XP_002892817.1|  DNA binding protein                                110   1e-23   
ref|XP_010496263.1|  PREDICTED: putative Myb family transcription...    110   1e-23   
ref|XP_010458964.1|  PREDICTED: putative Myb family transcription...    110   1e-23   
emb|CDX81654.1|  BnaC08g39470D                                          109   1e-23   
ref|XP_010502218.1|  PREDICTED: putative Myb family transcription...    110   1e-23   
gb|AAS79548.1|  myb family transcription factor                         110   1e-23   
ref|XP_010476522.1|  PREDICTED: putative Myb family transcription...    110   1e-23   
emb|CDX82805.1|  BnaC01g12550D                                          109   1e-23   
ref|XP_010496269.1|  PREDICTED: putative Myb family transcription...    109   1e-23   
ref|XP_010476523.1|  PREDICTED: putative Myb family transcription...    109   1e-23   
ref|XP_010424972.1|  PREDICTED: putative Myb family transcription...    110   1e-23   
ref|XP_010458965.1|  PREDICTED: putative Myb family transcription...    109   1e-23   
gb|ADX60114.1|  G2-like transcription factor                            112   1e-23   
ref|XP_010502217.1|  PREDICTED: putative Myb family transcription...    110   1e-23   
ref|XP_010502216.1|  PREDICTED: putative Myb family transcription...    110   1e-23   
ref|NP_001142882.1|  uncharacterized protein LOC100275291               112   1e-23   
ref|XP_008340524.1|  PREDICTED: putative Myb family transcription...    110   1e-23   
ref|XP_006416996.1|  hypothetical protein EUTSA_v10008620mg             109   2e-23   
ref|XP_009629451.1|  PREDICTED: transcription repressor KAN1-like       108   2e-23   
ref|XP_006291400.1|  hypothetical protein CARUB_v10017538mg             110   2e-23   
ref|XP_006303284.1|  hypothetical protein CARUB_v10010057mg             109   2e-23   
ref|XP_006291399.1|  hypothetical protein CARUB_v10017538mg             110   2e-23   
ref|XP_010317313.1|  PREDICTED: uncharacterized protein LOC104646024    108   3e-23   
emb|CDY41090.1|  BnaC05g10810D                                          108   3e-23   
ref|XP_006662561.1|  PREDICTED: putative Myb family transcription...    107   4e-23   
ref|XP_010424974.1|  PREDICTED: putative Myb family transcription...    108   4e-23   
ref|XP_009114210.1|  PREDICTED: putative Myb family transcription...    108   5e-23   
ref|XP_009114209.1|  PREDICTED: putative Myb family transcription...    108   5e-23   
ref|XP_009610208.1|  PREDICTED: putative Myb family transcription...    108   5e-23   
emb|CDY17443.1|  BnaC09g20940D                                          108   5e-23   
ref|XP_001766166.1|  predicted protein                                  112   6e-23   
ref|XP_010316582.1|  PREDICTED: uncharacterized protein LOC104645...    107   7e-23   
ref|XP_003572016.2|  PREDICTED: putative Myb family transcription...    103   8e-23   
gb|KDP20732.1|  hypothetical protein JCGZ_21203                         107   8e-23   
ref|XP_009117890.1|  PREDICTED: putative Myb family transcription...    107   9e-23   
ref|XP_010686880.1|  PREDICTED: putative Myb family transcription...    106   9e-23   
ref|XP_009784028.1|  PREDICTED: uncharacterized protein LOC104232501    108   1e-22   
gb|EEE58269.1|  hypothetical protein OsJ_09275                          107   1e-22   
ref|XP_010066524.1|  PREDICTED: putative Myb family transcription...    107   1e-22   
ref|XP_011008035.1|  PREDICTED: uncharacterized protein LOC105113531    107   1e-22   
emb|CDY59419.1|  BnaA09g56920D                                          106   1e-22   
ref|XP_006651003.1|  PREDICTED: uncharacterized protein LOC102722843    109   2e-22   
ref|XP_008660542.1|  PREDICTED: uncharacterized protein LOC103639589    108   2e-22   
gb|ADQ43192.1|  unknown                                                 106   2e-22   
ref|XP_004987194.1|  PREDICTED: uncharacterized protein LOC101766248    108   2e-22   
gb|AFW89731.1|  putative MYB DNA-binding domain superfamily protein     108   3e-22   
ref|XP_001771430.1|  predicted protein                                  110   3e-22   
ref|NP_001048850.1|  Os03g0129800                                       108   3e-22   
gb|AAN17397.1|  Unknown protein                                         108   3e-22   



>ref|XP_009621839.1| PREDICTED: uncharacterized protein LOC104113394 [Nicotiana tomentosiformis]
 ref|XP_009621844.1| PREDICTED: uncharacterized protein LOC104113394 [Nicotiana tomentosiformis]
Length=375

 Score =   268 bits (685),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 174/353 (49%), Positives = 206/353 (58%), Gaps = 82/353 (23%)
 Frame = -2

Query  1292  SGETVCSKTTSDDSNKFEEDEDETNESPRNQTVKDGGSSSNSTVEESGEKKASVRPYVRS  1113
             SGE+ C+  TS +S K  EDE+E N S      KDGGSSSNSTVEES EKK SVRPYVRS
Sbjct  5     SGESGCNSKTSSNSGK-NEDEEENNSSK----FKDGGSSSNSTVEES-EKKPSVRPYVRS  58

Query  1112  KMPRLRWTPDLHLRFLHAVERLGGQERATPKLVLQLMDIKGLNIAHVKSHLQMYRSKKTE  933
             KMPRLRWTPDLHLRF+HAVERLGGQ+RATPKLVLQ+M+IKGLNIAHVKSHLQMYRSKK +
Sbjct  59    KMPRLRWTPDLHLRFIHAVERLGGQDRATPKLVLQMMNIKGLNIAHVKSHLQMYRSKKMD  118

Query  932   DPSQGFANHRAFMEGGDRNVFNLSQLPMFKIFNNQRLNPPFRYGDDSYRNCQEKWMNGTA  753
             D SQG A+H  FMEGGD N++NL+QLPMF  F +QRLN  FRY + S+ NC   W  G +
Sbjct  119   DQSQGIAHHSLFMEGGDPNIYNLNQLPMFPTF-HQRLNSTFRYENASW-NCHGNWTRGQS  176

Query  752   MAHGTADRGRP--YEALYER-FRSNY------DLSRETINPPF-TERSNRGLHELKEKLG  603
                 T DR     Y  L ER F SN+      DL +   NP F +ERS    HE+K+++G
Sbjct  177   ----TLDRSSRGFYTTLTERIFGSNHGREANEDLCKR--NPSFISERSTLQTHEIKDEMG  230

Query  602   SFLENQTWHHQFAPQNPIQHQPIQVPEPKTMARTGSSVGSWVTDCRPEPKTTVMNSLVGS  423
              FLE +    +  P                                           + S
Sbjct  231   FFLERENHSGELTP-------------------------------------------ILS  247

Query  422   WVADRGQEPKATTLENRNAAVSAKLQKQETMKRK---ADLDLNLSLGMKSMKE  273
              +A + Q            A +  LQKQ  +KRK    DLDLNLSLG+K   E
Sbjct  248   HIAAKAQ------------ARAINLQKQTPLKRKVSDCDLDLNLSLGVKPRNE  288



>ref|XP_009804663.1| PREDICTED: two-component response regulator ARR10-like [Nicotiana 
sylvestris]
Length=374

 Score =   268 bits (684),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 175/349 (50%), Positives = 206/349 (59%), Gaps = 82/349 (23%)
 Frame = -2

Query  1292  SGETVCSKTTSDDSNKFEEDEDETNESPRNQTVKDGGSSSNSTVEESGEKKASVRPYVRS  1113
             SGET C+  TS +S K+E+DE E N S      KDGGSSSNSTVEES EKK SVRPYVRS
Sbjct  5     SGETGCNSKTSSNSGKYEDDE-ENNSS----KFKDGGSSSNSTVEES-EKKPSVRPYVRS  58

Query  1112  KMPRLRWTPDLHLRFLHAVERLGGQERATPKLVLQLMDIKGLNIAHVKSHLQMYRSKKTE  933
             KMPRLRWTPDLHLRF+HAVERLGGQ+RATPKLVLQ+M+IKGLNIAHVKSHLQMYRSKK +
Sbjct  59    KMPRLRWTPDLHLRFIHAVERLGGQDRATPKLVLQMMNIKGLNIAHVKSHLQMYRSKKMD  118

Query  932   DPSQGFANHRAFMEGGDRNVFNLSQLPMFKIFNNQRLNPPFRYGDDSYRNCQEKWMNGTA  753
             D SQG A+HR FMEGGD N++NLSQLPMF  F +QRLN  FRY D S+ N    W     
Sbjct  119   DQSQGTAHHRLFMEGGDPNIYNLSQLPMFPTF-HQRLNSTFRYEDASW-NFHGNW----T  172

Query  752   MAHGTADRGRP--YEALYER-FRSNY------DLSRETINPPF-TERSNRGLHELKEKLG  603
             M     DR     Y  L ER F SN+      DL +   NP F +ERSN   HE+K+++G
Sbjct  173   MGQRPLDRSSRGFYTTLTERIFGSNHGREANEDLCKR--NPSFISERSNLQTHEIKDEMG  230

Query  602   SFLENQTWHHQFAPQNPIQHQPIQVPEPKTMARTGSSVGSWVTDCRPEPKTTVMNSLVGS  423
               LE+++   +  P                                           + S
Sbjct  231   LSLEHESHSGELTP-------------------------------------------ILS  247

Query  422   WVADRGQEPKATTLENRNAAVSAKLQKQETMKRK---ADLDLNLSLGMK  285
              +A + Q            A +  LQKQ  +KRK    DLDLNLSLG+K
Sbjct  248   HIAAKAQ------------ARAINLQKQTPLKRKVSDCDLDLNLSLGVK  284



>ref|XP_011095220.1| PREDICTED: uncharacterized protein LOC105174731 [Sesamum indicum]
Length=375

 Score =   254 bits (648),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 172/408 (42%), Positives = 228/408 (56%), Gaps = 52/408 (13%)
 Frame = -2

Query  1292  SGETVCSKTTSDDSNKFEEDEDETNESPRNQTVKDGGSSSNSTVEESGEKKASVRPYVRS  1113
             SGE  CSKT+  + N   +DEDE+     + TVKDGGSSSNSTVEES EKK SVRPYVRS
Sbjct  3     SGEKECSKTSPSEKN---DDEDESQGKDESCTVKDGGSSSNSTVEES-EKKPSVRPYVRS  58

Query  1112  KMPRLRWTPDLHLRFLHAVERLGGQERATPKLVLQLMDIKGLNIAHVKSHLQMYRSKKTE  933
             KMPRLRWTPDLH+RF+HAVERLGGQ+RATPKLVLQLM+IKGLNIAHVKSHLQMYRSKK +
Sbjct  59    KMPRLRWTPDLHMRFVHAVERLGGQDRATPKLVLQLMNIKGLNIAHVKSHLQMYRSKKID  118

Query  932   DPSQGFANHRAFMEGGDRNVFNLSQLPMFKIFNNQRLNPPFRYGDDSYRNCQEKWMNGTA  753
             + +QG  +HR FMEGGDRNV+NLSQLP+   FN ++     RYGD S+ +   KWM+ +A
Sbjct  119   ESNQGLMDHRLFMEGGDRNVYNLSQLPLLPSFNQRQNYSNLRYGDPSW-SPHGKWMHNSA  177

Query  752   MAHGT-ADRGRP--YEALYERFRSNYDLSRETINPPFTERSNRGLHELKEKLGSFLENQT  582
                 T + + RP  Y+ + ER   ++   R + N     R++           S  +  T
Sbjct  178   PGQNTISHKTRPGFYDTITERLIGSH-FYRPSANLDLWSRTS-----------SHTDGST  225

Query  581   WHHQFAPQNPIQHQPIQVPEPKTMARTGSSVGSWVTDCRPEPKTTVMNSLVGSWVADRGQ  402
             W      +   + +P                  W+   R  P     + L+ + V ++  
Sbjct  226   WRRNEDFKEVYRQEP------------------WLGQSRQNPIQLNSSKLIQNGVQEQRI  267

Query  401   EPKATTLENRNAAVSAKLQKQETMKRKAD-----LDLNLSLGMKSMKEKSMeglgedesg  237
                A       ++    ++    +KRKA      LDLNLSL ++S  E   +G    +  
Sbjct  268   SSDAAKSNPPISSAGQTMRDTARLKRKASGSDDKLDLNLSLALESRNESEQKGTLITDDD  327

Query  236   ltlslsssssSK------LRKLNQDDT---NNFTKSGKGGASTLDLTL  120
                   S  +S+      ++KL +DDT       ++   GASTLDLTL
Sbjct  328   DEHLSLSLFTSRPSSSNLIKKLKEDDTVVHGTDQQNAIRGASTLDLTL  375



>ref|XP_006429461.1| hypothetical protein CICLE_v10011992mg [Citrus clementina]
 ref|XP_006481085.1| PREDICTED: putative Myb family transcription factor At1g14600-like 
isoform X1 [Citrus sinensis]
 ref|XP_006481086.1| PREDICTED: putative Myb family transcription factor At1g14600-like 
isoform X2 [Citrus sinensis]
 gb|ESR42701.1| hypothetical protein CICLE_v10011992mg [Citrus clementina]
Length=371

 Score =   236 bits (603),  Expect = 9e-69, Method: Compositional matrix adjust.
 Identities = 136/287 (47%), Positives = 181/287 (63%), Gaps = 17/287 (6%)
 Frame = -2

Query  1283  TVCSKTTSDDSNKFEEDEDETNESPRNQTV-KDGGSSSNSTVEESGEKKASVRPYVRSKM  1107
             T CSKT    S++  +DE E+ E+    +  K+GGSSSNSTVEE+ +KK  VRPYVRSKM
Sbjct  7     TECSKTCPSASDEIPDDEGESEENDDESSKPKNGGSSSNSTVEEN-DKKPPVRPYVRSKM  65

Query  1106  PRLRWTPDLHLRFLHAVERLGGQERATPKLVLQLMDIKGLNIAHVKSHLQMYRSKKTEDP  927
             PRLRWTPDLHLRF+HAVE+LGGQERATPKLVLQ+MDIKGL+IAHVKSHLQMYRSKK +DP
Sbjct  66    PRLRWTPDLHLRFVHAVEKLGGQERATPKLVLQMMDIKGLSIAHVKSHLQMYRSKKIDDP  125

Query  926   SQGFANHRAFMEGGDRNVFNLSQLPMFKIFNNQRLNPPFRYGDDSYRNCQEKWMNGTAMA  747
              +  A+HR  +E GDRN++NLSQLPM + +NNQ     FRYG+ S+   +E  M    ++
Sbjct  126   GRAMADHRHLVESGDRNIYNLSQLPMLQGYNNQSQASGFRYGEASWSTAREYLMRNPYVS  185

Query  746   HGTAD--RGRPYEALYERF----------RSNYDLSRETINPPFTERSNRGLHELKEKL-  606
                 D  R R Y  + E+            +N+ +S  +    +   S   + ELKE++ 
Sbjct  186   RSLIDETRSRLYGTVAEKIFDGTNCNWPSNNNFRMSTTSSALSYGANSTWKMPELKEEIQ  245

Query  605   GSFLENQ-TWHHQFAPQNPIQHQPIQVPEPKTMARTGSSVGSWVTDC  468
              SF  N+  W  Q +   PI+  P++    K   +  +++    TDC
Sbjct  246   TSFNRNRHPWQAQ-SRLRPIELNPVRQQHTKIEEQKSATMKRKATDC  291



>gb|KDO56741.1| hypothetical protein CISIN_1g017464mg [Citrus sinensis]
Length=371

 Score =   234 bits (598),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 138/287 (48%), Positives = 182/287 (63%), Gaps = 22/287 (8%)
 Frame = -2

Query  1283  TVCSKTTSDDSNKFEEDEDETNESPRNQTV-KDGGSSSNSTVEESGEKKASVRPYVRSKM  1107
             T CSKT  + S++  +DE E+ E+    +  K+GGSSSNSTVEE+ +KK  VRPYVRSKM
Sbjct  7     TECSKTCPNSSDEIPDDEGESEENDDESSKPKNGGSSSNSTVEEN-DKKPPVRPYVRSKM  65

Query  1106  PRLRWTPDLHLRFLHAVERLGGQERATPKLVLQLMDIKGLNIAHVKSHLQMYRSKKTEDP  927
             PRLRWTPDLHLRF++AVE+LGGQERATPKLVLQ+MDIKGL+IAHVKSHLQMYRSKK +DP
Sbjct  66    PRLRWTPDLHLRFVNAVEKLGGQERATPKLVLQMMDIKGLSIAHVKSHLQMYRSKKIDDP  125

Query  926   SQGFANHRAFMEGGDRNVFNLSQLPMFKIFNNQRLNPPFRYGDDSYRNCQEKWMNGTAMA  747
              +  A+HR  +E GDRN++NLSQLPM + +NNQ     FRYG+ S+   +E  M    ++
Sbjct  126   GRAMADHRHLVESGDRNIYNLSQLPMLQGYNNQSQASGFRYGEASWSTAREYLMRNPYVS  185

Query  746   HGTAD--RGRPYEALYERF----------RSNYDLSRETINPPFTERSNRGLHELKEKL-  606
                 D  R R Y  + E+            +N+ +S  +    +   S   + ELKE++ 
Sbjct  186   RSLIDETRSRLYGTVAEKIFDGTNCNWPSNNNFRMSTTSSALSYGANSTWKMPELKEEIQ  245

Query  605   GSFLENQT-WHHQ--FAP--QNPIQHQPIQVPEPK--TMARTGSSVG  486
              SF  N+  W  Q    P   NP++ Q  ++ E K  TM R  +  G
Sbjct  246   TSFNRNRDPWQAQSRLRPIDLNPVRQQHTKIEEQKSATMKRKATDCG  292



>ref|XP_009767509.1| PREDICTED: two-component response regulator ARR18-like [Nicotiana 
sylvestris]
Length=330

 Score =   229 bits (584),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 138/254 (54%), Positives = 172/254 (68%), Gaps = 21/254 (8%)
 Frame = -2

Query  1292  SGETVCSKTTSDDSNKFEEDEDETNESPRNQTVKDGGSSSNSTVEESGEKKASVRPYVRS  1113
             S +TVCSKT+ + S K E++ D  +     +  KDGGSSSNSTVEE GEKK  VRPYVRS
Sbjct  4     SDDTVCSKTSPNYSEKNEDEGDNISI----KLPKDGGSSSNSTVEE-GEKKLHVRPYVRS  58

Query  1112  KMPRLRWTPDLHLRFLHAVERLGGQERATPKLVLQLMDIKGLNIAHVKSHLQMYRSKKTE  933
             KM RLRWT DLHLRF+ AVE+LGGQERATPKLVLQ M+IKGLNIAHVKSHLQMYRSKK +
Sbjct  59    KMVRLRWTTDLHLRFVQAVEKLGGQERATPKLVLQSMNIKGLNIAHVKSHLQMYRSKKID  118

Query  932   DPSQGFANHRAFMEGGDRNVFNLSQLPMFKIFNNQRLNPPFRYGDDSYRNCQEKWMNGTA  753
             D +QG AN+R FMEGGD N++N+S+LP+   F  QR N  FRYGD S RNC +  ++   
Sbjct  119   DLTQGIANYRPFMEGGDPNIYNMSELPVLPTF-IQRFNSTFRYGDAS-RNCPQSTIDMNV  176

Query  752   MAHGTADRGRPYEALYER-FRSNYD--LSRETIN--PPF-TERSNRGLHELKEKLGSFLE  591
                    R   Y  L ER F SN    + +++I   P F +ERS    +E+K+++G F E
Sbjct  177   -------RPEFYTKLSERIFGSNNSRAIHQDSITGIPSFISERSTWRTNEMKDEMGLFRE  229

Query  590   NQTWHHQFAPQNPI  549
              Q +      ++PI
Sbjct  230   -QKYGQGLFRKSPI  242



>ref|XP_011046839.1| PREDICTED: putative Myb family transcription factor At1g14600 
[Populus euphratica]
 ref|XP_011046840.1| PREDICTED: putative Myb family transcription factor At1g14600 
[Populus euphratica]
Length=378

 Score =   228 bits (582),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 124/207 (60%), Positives = 148/207 (71%), Gaps = 17/207 (8%)
 Frame = -2

Query  1292  SGETVCSKTTS-----DDSNKFEEDEDETNESPRNQTVKDGGSSSNSTVEESGEKKASVR  1128
             S  T CSKT++     D+S   E DE+E+         K GGSSSNSTVEES E K+SVR
Sbjct  4     SNHTGCSKTSASIQDHDESAGGENDEEESRP-------KKGGSSSNSTVEES-ENKSSVR  55

Query  1127  PYVRSKMPRLRWTPDLHLRFLHAVERLGGQERATPKLVLQLMDIKGLNIAHVKSHLQMYR  948
             PYVRSK+PRLRWTP+LHL F+ AVERLGGQERATPKLVLQLM++ GL+IAHVKSHLQMYR
Sbjct  56    PYVRSKLPRLRWTPELHLCFVKAVERLGGQERATPKLVLQLMNVNGLSIAHVKSHLQMYR  115

Query  947   SKKTEDPSQGFANHRAFMEGGDRNVFNLSQLPMFKIFNN-QRLNPPFRYGDDSYRNCQEK  771
             SKK +DPSQG A+HR  ME GDRN++NLSQLPM + +N  QR N  FRYGD S+ N +E 
Sbjct  116   SKKVDDPSQGMADHRHLMESGDRNIYNLSQLPMLQGYNQYQRQNSSFRYGDASW-NAREH  174

Query  770   WMNGTAMAHGTADRGRP--YEALYERF  696
             ++    +     DR RP  Y  + ER 
Sbjct  175   FIYNPHVGRCVIDRTRPGSYGTVAERI  201



>ref|XP_002323602.2| hypothetical protein POPTR_0016s12940g [Populus trichocarpa]
 gb|EEF05363.2| hypothetical protein POPTR_0016s12940g [Populus trichocarpa]
Length=378

 Score =   227 bits (578),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 123/207 (59%), Positives = 148/207 (71%), Gaps = 17/207 (8%)
 Frame = -2

Query  1292  SGETVCSKTTS-----DDSNKFEEDEDETNESPRNQTVKDGGSSSNSTVEESGEKKASVR  1128
             S  T CSKT++     D+S   E DE+E+         K GGSSSNSTVEES E K+SVR
Sbjct  4     SNHTGCSKTSASLQDHDESAGGENDEEESRP-------KKGGSSSNSTVEES-ENKSSVR  55

Query  1127  PYVRSKMPRLRWTPDLHLRFLHAVERLGGQERATPKLVLQLMDIKGLNIAHVKSHLQMYR  948
             PYVRSK+PRLRWTP+LHL F+ AVERLGGQERATPKLVLQLM++ GL+IAHVKSHLQMYR
Sbjct  56    PYVRSKLPRLRWTPELHLCFIKAVERLGGQERATPKLVLQLMNVNGLSIAHVKSHLQMYR  115

Query  947   SKKTEDPSQGFANHRAFMEGGDRNVFNLSQLPMFKIFNN-QRLNPPFRYGDDSYRNCQEK  771
             SKK +DPSQG A+HR  +E GDRN++NLSQLPM + +N  QR N  FRYGD S+ N +E 
Sbjct  116   SKKVDDPSQGMADHRHLVESGDRNIYNLSQLPMLQGYNQYQRQNSSFRYGDASW-NAREH  174

Query  770   WMNGTAMAHGTADRGRP--YEALYERF  696
             ++    +     DR RP  Y  + ER 
Sbjct  175   FIYNPHVGRCVIDRTRPGSYGTVAERI  201



>ref|XP_009622809.1| PREDICTED: uncharacterized protein LOC104114139 [Nicotiana tomentosiformis]
 ref|XP_009622810.1| PREDICTED: uncharacterized protein LOC104114139 [Nicotiana tomentosiformis]
 ref|XP_009622811.1| PREDICTED: uncharacterized protein LOC104114139 [Nicotiana tomentosiformis]
Length=295

 Score =   221 bits (563),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 120/172 (70%), Positives = 136/172 (79%), Gaps = 11/172 (6%)
 Frame = -2

Query  1292  SGETVCSKTTSDDSNKFEEDEDETNESPRNQTVKDGGSSSNSTVEESGEKKASVRPYVRS  1113
             S +TVCSK + + S   E++E+E N S   +  KDGGSSSNS+VE  GEK   VRPYVRS
Sbjct  5     SDDTVCSKRSPNYS---EKNEEEGNNSSI-KLPKDGGSSSNSSVE-VGEK---VRPYVRS  56

Query  1112  KMPRLRWTPDLHLRFLHAVERLGGQERATPKLVLQLMDIKGLNIAHVKSHLQMYRSKKTE  933
             KM RLRWT DLH RF+HAVERLGGQERATPKLVL+LMDIKGLNIAHVKSHLQMYRSKK +
Sbjct  57    KMVRLRWTTDLHRRFVHAVERLGGQERATPKLVLRLMDIKGLNIAHVKSHLQMYRSKKID  116

Query  932   DPSQGFAN-HRAFMEGGDRNVFNLSQLPMFKIFNNQRLNPPFRYGDDSYRNC  780
             DP+QG AN HR FMEGGD N++NL++LPM   F NQR N  FRYGD S RNC
Sbjct  117   DPTQGVANHHRLFMEGGDPNIYNLNELPMLPTF-NQRFNSTFRYGDAS-RNC  166



>ref|XP_004249715.1| PREDICTED: uncharacterized protein LOC101244920 [Solanum lycopersicum]
Length=302

 Score =   219 bits (559),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 131/207 (63%), Positives = 149/207 (72%), Gaps = 11/207 (5%)
 Frame = -2

Query  1292  SGETVCSKTTSDDSNKFEEDEDETNESPRNQTVKDGGSSSNSTVEESGEKKASVRPYVRS  1113
             SG+T  SKT+ + +   EEDE+ T+     +  KDGGSSS ST+EES EKK SVRPYVRS
Sbjct  5     SGDTEFSKTSPNSNQNEEEDENVTS----TKLHKDGGSSSISTIEES-EKKFSVRPYVRS  59

Query  1112  KMPRLRWTPDLHLRFLHAVERLGGQERATPKLVLQLMDIKGLNIAHVKSHLQMYRSKKTE  933
             KM RLRWTPDLH RF+HAVERLGG +RATPKLVLQLM+IKGLNIAHVKSHLQMYRSKK +
Sbjct  60    KMVRLRWTPDLHRRFVHAVERLGGHDRATPKLVLQLMNIKGLNIAHVKSHLQMYRSKKID  119

Query  932   DPSQGFANHRAF-MEGGDRNVFNLSQLPMFKIFNNQRLNPPFRYGDDSYRNCQEK-WMNG  759
             DPSQG  NH    MEGGD  ++NLSQLPM   F  QR NP FRYGD S  NCQ+   M+ 
Sbjct  120   DPSQGITNHHKLCMEGGDSYIYNLSQLPMLSSF-KQRFNPTFRYGDVSSMNCQDHDLMHS  178

Query  758   TAMAHGTADRGRP--YEALYER-FRSN  687
             + M   T D+ R   Y  L ER F SN
Sbjct  179   SIMGQSTIDKARIGLYTTLNERIFGSN  205



>emb|CDP06448.1| unnamed protein product [Coffea canephora]
Length=340

 Score =   221 bits (562),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 135/254 (53%), Positives = 161/254 (63%), Gaps = 19/254 (7%)
 Frame = -2

Query  1292  SGETVCSKTTSDDSNKFEEDEDETNESPRNQTVKDGGSSSNSTVEESGEKKASVRPYVRS  1113
             S +T CSK     S K E DE++ ++       KDGGSSSNSTVEE+ E K SVRPYVRS
Sbjct  4     SEDTECSKACPS-SGKDEVDENDGDKQ------KDGGSSSNSTVEEN-ENKPSVRPYVRS  55

Query  1112  KMPRLRWTPDLHLRFLHAVERLGGQERATPKLVLQLMDIKGLNIAHVKSHLQMYRSKKTE  933
             KMPRLRWTPDLHLRF+HAVERLGGQERATPKLVLQLM+IKGLNIAHVKSHLQMYRSKK +
Sbjct  56    KMPRLRWTPDLHLRFVHAVERLGGQERATPKLVLQLMNIKGLNIAHVKSHLQMYRSKKID  115

Query  932   DPSQGFANHRAFMEGGDRNVFNLSQLPMF-KIFNNQRLNPPFRYGDDSYRNCQEKWMNGT  756
             DPSQG  +H    EG DRN+FNL Q+PM   +  NQ+    FRYGD S+ N  E  M  +
Sbjct  116   DPSQGVTDHSHLWEGVDRNIFNLGQIPMLPGLHQNQK--STFRYGDASW-NGLENSMQMS  172

Query  755   AMAHGTADRGRPYEALYERFRSNYDLSRETINPPFTERSNR----GLHELKEKLGSFLEN  588
             AM   T ++ RP    Y+ +      SR          SN+      HEL+ K+ S  + 
Sbjct  173   AMRQST-NKKRP--GFYDTWPGRIVGSRNNDVYSGFRNSNQLWSWQTHELESKMQSLPQQ  229

Query  587   QTWHHQFAPQNPIQ  546
             + W  Q      +Q
Sbjct  230   EYWQDQLKSSIQVQ  243



>ref|XP_007026615.1| Myb-like HTH transcriptional regulator family protein, putative 
isoform 1 [Theobroma cacao]
 ref|XP_007026616.1| Myb-like HTH transcriptional regulator family protein, putative 
isoform 1 [Theobroma cacao]
 gb|EOY07117.1| Myb-like HTH transcriptional regulator family protein, putative 
isoform 1 [Theobroma cacao]
 gb|EOY07118.1| Myb-like HTH transcriptional regulator family protein, putative 
isoform 1 [Theobroma cacao]
Length=368

 Score =   221 bits (562),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 117/191 (61%), Positives = 136/191 (71%), Gaps = 7/191 (4%)
 Frame = -2

Query  1283  TVCSKTTSDDSNKFEEDEDETNESPRNQTVKDGGSSSNSTVEESGEKKASVRPYVRSKMP  1104
             T CSKT+    N+ E +  E N+       K+GGSSSNSTVEE+ EKK SVRPYVRSKMP
Sbjct  7     TECSKTSPSKQNQAESESTEENDG--ESRPKNGGSSSNSTVEEN-EKKPSVRPYVRSKMP  63

Query  1103  RLRWTPDLHLRFLHAVERLGGQERATPKLVLQLMDIKGLNIAHVKSHLQMYRSKKTEDPS  924
             RLRWTPDLHLRF+HAVERLGGQ+RATPKLVLQLM+IKGL+IAHVKSHLQMYRSKK +DP 
Sbjct  64    RLRWTPDLHLRFIHAVERLGGQDRATPKLVLQLMNIKGLSIAHVKSHLQMYRSKKIDDPG  123

Query  923   QGFANHRAFMEGGDRNVFNLSQLPMFKIFNNQR---LNPPFRYGDDSYRNCQEKWMNGTA  753
             Q    HR  +E GDRN++NLSQLPM + +NN      +  FRYGD S+ N QE       
Sbjct  124   QVITEHRHLVESGDRNIYNLSQLPMLQGYNNHHHGDSSSSFRYGDASW-NGQECLQRNPY  182

Query  752   MAHGTADRGRP  720
              +    D  RP
Sbjct  183   SSRSFIDEPRP  193



>ref|XP_010092813.1| Putative Myb family transcription factor [Morus notabilis]
 gb|EXB52399.1| Putative Myb family transcription factor [Morus notabilis]
Length=368

 Score =   218 bits (556),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 110/163 (67%), Positives = 128/163 (79%), Gaps = 3/163 (2%)
 Frame = -2

Query  1277  CSKTTSDDSNKFEEDEDETNESPRNQTVKDGG--SSSNSTVEESGEKKASVRPYVRSKMP  1104
             CSKTT  + N  E +  E ++   ++  K+ G  SSSNSTVEES EKK+SVRPYVRSK P
Sbjct  10    CSKTTLSNQNNGESESGENDDDQISKPNKNNGGLSSSNSTVEESSEKKSSVRPYVRSKAP  69

Query  1103  RLRWTPDLHLRFLHAVERLGGQERATPKLVLQLMDIKGLNIAHVKSHLQMYRSKKTEDPS  924
             RLRW PDLHLRF+HAVERLGGQERATPKLVLQLM+IKGL+IAHVKSHLQMYRSKK +D  
Sbjct  70    RLRWMPDLHLRFVHAVERLGGQERATPKLVLQLMNIKGLSIAHVKSHLQMYRSKKIDDAG  129

Query  923   QGFANHRAFMEGGDRNVFNLSQLPMFKIFNNQRLNPPFRYGDD  795
             Q  A+HR  +E GDRN++NLSQLPM + + NQR N  FRYG D
Sbjct  130   QVLADHRHLVEYGDRNIYNLSQLPMLQGY-NQRHNSSFRYGFD  171



>ref|XP_002268055.1| PREDICTED: putative Myb family transcription factor At1g14600 
[Vitis vinifera]
 emb|CAN73581.1| hypothetical protein VITISV_002087 [Vitis vinifera]
Length=370

 Score =   217 bits (552),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 145/315 (46%), Positives = 178/315 (57%), Gaps = 48/315 (15%)
 Frame = -2

Query  1193  KDGGSSSNSTVEESGEK--KASVRPYVRSKMPRLRWTPDLHLRFLHAVERLGGQERATPK  1020
             K+  SSSNSTVEE+ +K    +VRPYVRSKMPRLRWTPDLHLRF+HAVERLGGQERATPK
Sbjct  34    KNCRSSSNSTVEENEKKGHSGAVRPYVRSKMPRLRWTPDLHLRFVHAVERLGGQERATPK  93

Query  1019  LVLQLMDIKGLNIAHVKSHLQMYRSKKTEDPSQGFANHRAFMEGGDRNVFNLSQLPMFKI  840
             LVLQLM+IKGLNIAHVKSHLQMYRSKK EDP Q  A+HR  +E GD N++NLSQLPM + 
Sbjct  94    LVLQLMNIKGLNIAHVKSHLQMYRSKKIEDPGQVLADHRHLVESGDPNIYNLSQLPMLQG  153

Query  839   FNNQRLNPPFRYGDDSYRNCQEKWMNGTAMAHGTADR-GRP--YEALYER-FRSNYDLSR  672
               NQR    FRYGD S+ +  E WM+   +   + D+  RP  Y ++ ER F  N + S 
Sbjct  154   L-NQRPTSSFRYGDASW-SAHENWMHSPFIGRSSVDKTTRPGFYGSVTERIFGGNNNNST  211

Query  671   ET---INPPFTERSNRGLHELKEKL-GSFLENQTWHHQFAPQNPIQHQPIQVPEPKTMAR  504
                  +     E S  G H  K+    SF ++++W  Q        +Q  Q+       R
Sbjct  212   SCNFHMGTSLNEYSTWGTHVRKDSFQTSFHDHESWRGQAGSSLKELNQLTQMQAHVRERR  271

Query  503   TGSSVGSWVTDCRPEPKTTVMNSLVGSWVADRGQEPKATTLENRNAAVSAKLQKQETMKR  324
                S+ S +    P    T  N                             LQ+  T+KR
Sbjct  272   EHMSLKSRI----PSDMNTATN-----------------------------LQEWRTVKR  298

Query  323   KA---DLDLNLSLGM  288
             KA   DLDLNLSL +
Sbjct  299   KASDCDLDLNLSLKL  313



>emb|CBI18131.3| unnamed protein product [Vitis vinifera]
Length=403

 Score =   217 bits (552),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 145/315 (46%), Positives = 178/315 (57%), Gaps = 48/315 (15%)
 Frame = -2

Query  1193  KDGGSSSNSTVEESGEK--KASVRPYVRSKMPRLRWTPDLHLRFLHAVERLGGQERATPK  1020
             K+  SSSNSTVEE+ +K    +VRPYVRSKMPRLRWTPDLHLRF+HAVERLGGQERATPK
Sbjct  67    KNCRSSSNSTVEENEKKGHSGAVRPYVRSKMPRLRWTPDLHLRFVHAVERLGGQERATPK  126

Query  1019  LVLQLMDIKGLNIAHVKSHLQMYRSKKTEDPSQGFANHRAFMEGGDRNVFNLSQLPMFKI  840
             LVLQLM+IKGLNIAHVKSHLQMYRSKK EDP Q  A+HR  +E GD N++NLSQLPM + 
Sbjct  127   LVLQLMNIKGLNIAHVKSHLQMYRSKKIEDPGQVLADHRHLVESGDPNIYNLSQLPMLQG  186

Query  839   FNNQRLNPPFRYGDDSYRNCQEKWMNGTAMAHGTADR-GRP--YEALYER-FRSNYDLSR  672
               NQR    FRYGD S+ +  E WM+   +   + D+  RP  Y ++ ER F  N + S 
Sbjct  187   L-NQRPTSSFRYGDASW-SAHENWMHSPFIGRSSVDKTTRPGFYGSVTERIFGGNNNNST  244

Query  671   ET---INPPFTERSNRGLHELKEKL-GSFLENQTWHHQFAPQNPIQHQPIQVPEPKTMAR  504
                  +     E S  G H  K+    SF ++++W  Q        +Q  Q+       R
Sbjct  245   SCNFHMGTSLNEYSTWGTHVRKDSFQTSFHDHESWRGQAGSSLKELNQLTQMQAHVRERR  304

Query  503   TGSSVGSWVTDCRPEPKTTVMNSLVGSWVADRGQEPKATTLENRNAAVSAKLQKQETMKR  324
                S+ S +    P    T  N                             LQ+  T+KR
Sbjct  305   EHMSLKSRI----PSDMNTATN-----------------------------LQEWRTVKR  331

Query  323   KA---DLDLNLSLGM  288
             KA   DLDLNLSL +
Sbjct  332   KASDCDLDLNLSLKL  346



>ref|XP_002534265.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF28118.1| conserved hypothetical protein [Ricinus communis]
Length=182

 Score =   209 bits (532),  Expect = 9e-61, Method: Compositional matrix adjust.
 Identities = 109/183 (60%), Positives = 142/183 (78%), Gaps = 6/183 (3%)
 Frame = -2

Query  1292  SGETVCSKTTSDDSNKFEEDEDETNESPRNQTV-KDGGSSSNSTVEESGEKKASVRPYVR  1116
             S ++ CS+T +   N  +EDE  + E+  ++++ K+G SSSNSTVEES +KK SVRPYVR
Sbjct  4     SDQSGCSETKASRQN--QEDESGSGENDGDESMPKNGASSSNSTVEES-DKKPSVRPYVR  60

Query  1115  SKMPRLRWTPDLHLRFLHAVERLGGQERATPKLVLQLMDIKGLNIAHVKSHLQMYRSKKT  936
             SKMPRLRWTP+LHL F+ AVERLGGQ+RATPKLVLQLM++ GL+IAHVKSHLQMYRSKK 
Sbjct  61    SKMPRLRWTPELHLCFVKAVERLGGQDRATPKLVLQLMNVNGLSIAHVKSHLQMYRSKKI  120

Query  935   EDPSQGFANHRAFMEGGDRNVFNLSQLPMFKIFNNQRLNPPFRYGDDSYRNCQEKWMNGT  756
             +DPSQ  A+HR  M+ GDRN++NLSQLPM + + +QR    +RYGD S+ N +E ++  +
Sbjct  121   DDPSQVMADHRHLMKSGDRNIYNLSQLPMLQGY-HQRHASSYRYGDASW-NARENFVYNS  178

Query  755   AMA  747
              M 
Sbjct  179   HMG  181



>ref|XP_004302585.1| PREDICTED: uncharacterized protein LOC101295055 [Fragaria vesca 
subsp. vesca]
Length=352

 Score =   212 bits (540),  Expect = 9e-60, Method: Compositional matrix adjust.
 Identities = 110/170 (65%), Positives = 132/170 (78%), Gaps = 8/170 (5%)
 Frame = -2

Query  1292  SGETVCSKTT-SDDSNKFEEDEDETNESPRNQTVK---DGGSSSNSTVEESGE-KKASVR  1128
             SGE+ CSKT+ SDD N  EE   E+ E+   +  K   +GGSSSNSTVEESG+ KK SVR
Sbjct  5     SGESECSKTSPSDDRN--EEGSSESGENYDGEINKPKNNGGSSSNSTVEESGDQKKGSVR  62

Query  1127  PYVRSKMPRLRWTPDLHLRFLHAVERLGGQERATPKLVLQLMDIKGLNIAHVKSHLQMYR  948
             PYVRSKMPRLRWTPDLHLRF+HAVERLGGQ+RATPK+VLQLM+IKGL+IAHVKSHLQMYR
Sbjct  63    PYVRSKMPRLRWTPDLHLRFVHAVERLGGQDRATPKMVLQLMNIKGLSIAHVKSHLQMYR  122

Query  947   SKKTEDPSQGFANH-RAFMEGGDRNVFNLSQLPMFKIFNNQRLNPPFRYG  801
             SKK +D  Q   +     +E GD+N++NLSQLPM + +N   ++  FRYG
Sbjct  123   SKKIDDAGQVIGDQGHHLVECGDKNIYNLSQLPMLQGYNRSHMSTSFRYG  172



>ref|XP_008363851.1| PREDICTED: uncharacterized protein LOC103427569 [Malus domestica]
Length=328

 Score =   210 bits (535),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 109/168 (65%), Positives = 128/168 (76%), Gaps = 8/168 (5%)
 Frame = -2

Query  1289  GETVCSKTTSDDSNKFEEDEDETNESPRN----QTVKDGGSSSNSTVEESGEKKASVRPY  1122
             G + CSKT+  D  K  ED  E+ E+  N    +   +GGSSSNSTVEES +KK SVRPY
Sbjct  6     GGSECSKTSPSD--KQNEDGSESGENYSNGENSKPKNNGGSSSNSTVEESDQKKTSVRPY  63

Query  1121  VRSKMPRLRWTPDLHLRFLHAVERLGGQERATPKLVLQLMDIKGLNIAHVKSHLQMYRSK  942
             VRSKMPRLRWTPDLHLRF+HAVERLGGQ+RATPKLVLQLM+IKGLNIAHVKSHLQMYRSK
Sbjct  64    VRSKMPRLRWTPDLHLRFIHAVERLGGQDRATPKLVLQLMNIKGLNIAHVKSHLQMYRSK  123

Query  941   KTEDPSQGFANHRA-FMEGGDRNVFNLSQLPMFKIFNNQRLNPPFRYG  801
             K +D  Q  A+H+   +E GD+N++NLSQLPM + +N       FRYG
Sbjct  124   KIDDAGQVLADHQGHLVECGDKNIYNLSQLPMLQGYNRSHTT-SFRYG  170



>ref|XP_003623331.1| Two-component response regulator ARR10 [Medicago truncatula]
Length=350

 Score =   211 bits (536),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 132/281 (47%), Positives = 171/281 (61%), Gaps = 24/281 (9%)
 Frame = -2

Query  1277  CSKTT-SDDSNKFEEDEDETNESPRNQTVKDGG-SSSNSTVEESGEKKASVRPYVRSKMP  1104
             CSK + S + +  E  E   +E    Q + +GG SSSNST+EE+ EKK+SVRPYVRSK P
Sbjct  11    CSKASISINEDGCEISEGNEDEESNKQNINNGGISSSNSTIEENCEKKSSVRPYVRSKFP  70

Query  1103  RLRWTPDLHLRFLHAVERLGGQERATPKLVLQLMDIKGLNIAHVKSHLQMYRSKKTEDPS  924
             RLRWTPDLH RFLHAV+RLGGQERATPKLVLQLM+IKGL+IAHVKSHLQMYRSKK  D +
Sbjct  71    RLRWTPDLHFRFLHAVQRLGGQERATPKLVLQLMNIKGLSIAHVKSHLQMYRSKKVVDTN  130

Query  923   QGFANHRAFMEGGDRNVFNLSQLPMFKIFN-NQRLNPPFR---YGDDSYRNCQEKWMNGT  756
             Q  A+HR  ++ GDRNV+NL+QLPM + +  NQ     +R   YGD S       + N  
Sbjct  131   QVLADHRLLVDNGDRNVYNLTQLPMLQGYTPNQ--TSSYRCGSYGDASL----AMYENMV  184

Query  755   AMAHGTADRGRPYEALYERFRSN-YDLSRETI----NPPFTERSNRGLHELKEKLGSFLE  591
              M+  +  R   Y  + ER  +N  ++   +I    +  F E S   +HE  +   SF  
Sbjct  185   QMSSISDSRADFYGKMIERTNNNIINIQGHSIFQMDSSNFRELSTTKVHEPNDNFLSFCG  244

Query  590   NQTWHH--QFAP--QNPIQHQPI---QVPEPKTMARTGSSV  489
             +++     Q  P  Q+ I +  +   QV E KTM R  S +
Sbjct  245   HESLRDDLQVQPRAQDLISNDNLPANQVEELKTMKRKASDM  285



>gb|AES79549.2| MYB-like transcription factor family protein [Medicago truncatula]
Length=352

 Score =   211 bits (536),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 132/281 (47%), Positives = 171/281 (61%), Gaps = 24/281 (9%)
 Frame = -2

Query  1277  CSKTT-SDDSNKFEEDEDETNESPRNQTVKDGG-SSSNSTVEESGEKKASVRPYVRSKMP  1104
             CSK + S + +  E  E   +E    Q + +GG SSSNST+EE+ EKK+SVRPYVRSK P
Sbjct  13    CSKASISINEDGCEISEGNEDEESNKQNINNGGISSSNSTIEENCEKKSSVRPYVRSKFP  72

Query  1103  RLRWTPDLHLRFLHAVERLGGQERATPKLVLQLMDIKGLNIAHVKSHLQMYRSKKTEDPS  924
             RLRWTPDLH RFLHAV+RLGGQERATPKLVLQLM+IKGL+IAHVKSHLQMYRSKK  D +
Sbjct  73    RLRWTPDLHFRFLHAVQRLGGQERATPKLVLQLMNIKGLSIAHVKSHLQMYRSKKVVDTN  132

Query  923   QGFANHRAFMEGGDRNVFNLSQLPMFKIFN-NQRLNPPFR---YGDDSYRNCQEKWMNGT  756
             Q  A+HR  ++ GDRNV+NL+QLPM + +  NQ     +R   YGD S       + N  
Sbjct  133   QVLADHRLLVDNGDRNVYNLTQLPMLQGYTPNQ--TSSYRCGSYGDASL----AMYENMV  186

Query  755   AMAHGTADRGRPYEALYERFRSN-YDLSRETI----NPPFTERSNRGLHELKEKLGSFLE  591
              M+  +  R   Y  + ER  +N  ++   +I    +  F E S   +HE  +   SF  
Sbjct  187   QMSSISDSRADFYGKMIERTNNNIINIQGHSIFQMDSSNFRELSTTKVHEPNDNFLSFCG  246

Query  590   NQTWHH--QFAP--QNPIQHQPI---QVPEPKTMARTGSSV  489
             +++     Q  P  Q+ I +  +   QV E KTM R  S +
Sbjct  247   HESLRDDLQVQPRAQDLISNDNLPANQVEELKTMKRKASDM  287



>ref|XP_009376409.1| PREDICTED: two-component response regulator ARR18-like [Pyrus 
x bretschneideri]
Length=329

 Score =   209 bits (533),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 108/164 (66%), Positives = 127/164 (77%), Gaps = 8/164 (5%)
 Frame = -2

Query  1277  CSKTTSDDSNKFEEDEDETNESPRN----QTVKDGGSSSNSTVEESGEKKASVRPYVRSK  1110
             CSKT+  D  K  ED  E+ E+  N    +   +GGSSSNSTVEES +KK SVRPYVRSK
Sbjct  10    CSKTSPSD--KQNEDGSESGENYSNGENSKPKNNGGSSSNSTVEESDQKKTSVRPYVRSK  67

Query  1109  MPRLRWTPDLHLRFLHAVERLGGQERATPKLVLQLMDIKGLNIAHVKSHLQMYRSKKTED  930
             MPRLRWTPDLHLRF+HAVERLGGQ+RATPKLVLQLM+IKGLNIAHVKSHLQMYRSKK +D
Sbjct  68    MPRLRWTPDLHLRFIHAVERLGGQDRATPKLVLQLMNIKGLNIAHVKSHLQMYRSKKIDD  127

Query  929   PSQGFANHRA-FMEGGDRNVFNLSQLPMFKIFNNQRLNPPFRYG  801
               Q  A+H+   +E GD+N++NLSQLPM + +N    +  FRYG
Sbjct  128   TGQVLADHQGHLVECGDKNIYNLSQLPMLQGYNRSH-STSFRYG  170



>ref|XP_006363620.1| PREDICTED: putative Myb family transcription factor At1g14600-like 
isoform X1 [Solanum tuberosum]
 ref|XP_006363621.1| PREDICTED: putative Myb family transcription factor At1g14600-like 
isoform X2 [Solanum tuberosum]
Length=303

 Score =   208 bits (530),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 128/214 (60%), Positives = 147/214 (69%), Gaps = 11/214 (5%)
 Frame = -2

Query  1292  SGETVCSKTTSDDSNKFEEDEDETNESPRNQTVKDGGSSSNSTVEESGEKKASVRPYVRS  1113
             SG T  SKT+ +     EEDE+ T+     +  KDGGSSS ST+EES EKK SVRPYVRS
Sbjct  5     SGGTEFSKTSPNSDQNEEEDENVTS----TKLHKDGGSSSTSTIEES-EKKFSVRPYVRS  59

Query  1112  KMPRLRWTPDLHLRFLHAVERLGGQERATPKLVLQLMDIKGLNIAHVKSHLQMYRSKKTE  933
             KM RLRWTPDLH RF+H VERLGG +RATPKLVLQLM+IKGLNIAHVKSHLQMYRSKK +
Sbjct  60    KMVRLRWTPDLHRRFVHVVERLGGHDRATPKLVLQLMNIKGLNIAHVKSHLQMYRSKKID  119

Query  932   DPSQGFANHRAF-MEGGDRNV-FNLSQLPMFKIFNNQRLNPPFRYGDDSYRNCQEK-WMN  762
             DP+QG  NH    MEGGD  + +NLSQLPM   F  QR N  FRYGD S RNCQ+   M+
Sbjct  120   DPAQGITNHHKLCMEGGDPYIYYNLSQLPMLSSF-KQRFNSTFRYGDVSSRNCQDHDLMH  178

Query  761   GTAMAHGTADRGRP--YEALYERFRSNYDLSRET  666
              + M   T D+ R   Y  L ER   N  + + T
Sbjct  179   SSIMRQSTIDKARIGLYTTLNERIFGNNPIDKLT  212



>ref|XP_008243158.1| PREDICTED: transcription repressor KAN1-like [Prunus mume]
Length=339

 Score =   209 bits (532),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 104/150 (69%), Positives = 123/150 (82%), Gaps = 8/150 (5%)
 Frame = -2

Query  1238  EDEDETNES--PRNQTVKDGGSSSNSTVEESGEKKASVRPYVRSKMPRLRWTPDLHLRFL  1065
             E+ D+  ES  P+N    +GGSSSNSTVEES ++KASVRPYVRSKMPRLRWTPDLHLRF+
Sbjct  25    ENYDDIEESGKPKN----NGGSSSNSTVEESDQRKASVRPYVRSKMPRLRWTPDLHLRFI  80

Query  1064  HAVERLGGQERATPKLVLQLMDIKGLNIAHVKSHLQMYRSKKTEDPSQGFANHRA-FMEG  888
             HAVERLGGQERATPKLVLQLM+IKGL+IAHVKSHLQMYRSKK +D  Q  A+H+   +E 
Sbjct  81    HAVERLGGQERATPKLVLQLMNIKGLSIAHVKSHLQMYRSKKIDDAGQVLADHQGHLVEC  140

Query  887   GDRNVFNLSQLPMFKIFNNQRLNPPFRYGD  798
             GD+N++NLSQLPM + +N    +  FRYGD
Sbjct  141   GDKNIYNLSQLPMLQGYNRSH-STSFRYGD  169



>gb|EYU41938.1| hypothetical protein MIMGU_mgv1a020265mg [Erythranthe guttata]
Length=368

 Score =   209 bits (533),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 134/314 (43%), Positives = 174/314 (55%), Gaps = 46/314 (15%)
 Frame = -2

Query  1199  TVK--DGGSSSNSTVEESGEKKASVRPYVRSKMPRLRWTPDLHLRFLHAVERLGGQERAT  1026
             TVK  +GGSSSNSTVEES + K SVRPYVRSKMPRLRWTPDLHLRF+HAVERLGGQERAT
Sbjct  41    TVKLDNGGSSSNSTVEESEKNKPSVRPYVRSKMPRLRWTPDLHLRFMHAVERLGGQERAT  100

Query  1025  PKLVLQLMDIKGLNIAHVKSHLQMYRSKKTEDPSQGFANHRAFMEGGDRNVFNLSQLPMF  846
             PKLVLQ M IKGLNI+HVKSHLQMYRSK+ ++ +QG  + R FMEG DRN++NLSQLP+ 
Sbjct  101   PKLVLQFMGIKGLNISHVKSHLQMYRSKRIDESNQGMKDQRFFMEGVDRNIYNLSQLPLL  160

Query  845   KIFNN--QRLNPPF-RYGDDSYRNCQEKWMNGTAMAHGTADRGRPYEALYERFRSNYDLS  675
               FN   Q  N  F R GD +  +   KWM  +++A                     +++
Sbjct  161   PTFNQRPQNSNISFPRNGDAATWDGHGKWMQNSSIAQ--------------------NIN  200

Query  674   RETINPPFTERSNRGLHELKEKLGSFLENQTWHHQFAPQNPIQHQPIQVPEPKTMARTGS  495
              +TI P F    N  L     K      N      F+  +P   +               
Sbjct  201   NKTIKPGFYGTINNNLDSHYYKYNRSSANNINLDLFSKTSPFFER---------------  245

Query  494   SVGSWVTDCRPEPKTTVMNSLVGSWVADRGQEPKATTLENRNAAVSAKLQKQETMKRKA-  318
                +W T+    PK     SL        GQ  +  ++      + +++ ++  +KRKA 
Sbjct  246   --STWRTNNEGVPKQDEYRSLYKQEPL-LGQSTQNPSVNINPPIIVSQIMRETGLKRKAS  302

Query  317   --DLDLNLSLGMKS  282
               ++DLNLSL ++S
Sbjct  303   DFEVDLNLSLAVES  316



>emb|CDP05632.1| unnamed protein product [Coffea canephora]
Length=353

 Score =   209 bits (531),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 110/172 (64%), Positives = 126/172 (73%), Gaps = 6/172 (3%)
 Frame = -2

Query  1292  SGETVCSKTTSDDSNKFEEDEDETNESPR---NQTVKDGGSSSNS-TVEESGEKKASVRP  1125
             SG+  CSKT    S + E DEDE     +   +   KDGG+SSNS TVEE+   K  VRP
Sbjct  4     SGDAECSKTCPS-SGETEADEDENEHEGKIDDDHKQKDGGTSSNSSTVEENEINKPPVRP  62

Query  1124  YVRSKMPRLRWTPDLHLRFLHAVERLGGQERATPKLVLQLMDIKGLNIAHVKSHLQMYRS  945
             YVRSKMPRLRWTPDLHLRFLHAVERLGGQERATPK VLQLM+ KGLNI HVKSHLQMYRS
Sbjct  63    YVRSKMPRLRWTPDLHLRFLHAVERLGGQERATPKSVLQLMNTKGLNITHVKSHLQMYRS  122

Query  944   KKTEDPSQGFANHRAFMEGGDRNVFNLSQLPMFKIFNNQRLNPPFRYGDDSY  789
             KK +DPSQG  +HR   EG D N+FNLSQ+PMF  F++      FRYG+ ++
Sbjct  123   KKIDDPSQGITDHRQVFEGVDPNIFNLSQIPMFPGFHHNH-KSTFRYGEATW  173



>gb|KDP22851.1| hypothetical protein JCGZ_00438 [Jatropha curcas]
Length=359

 Score =   207 bits (528),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 105/168 (63%), Positives = 126/168 (75%), Gaps = 5/168 (3%)
 Frame = -2

Query  1193  KDGGSSSNSTVEESGEKKASVRPYVRSKMPRLRWTPDLHLRFLHAVERLGGQERATPKLV  1014
             K+G SSSNSTVEES EKK SVRPYVRSKMPRLRWTP+LHL F+ AVERLGGQ+RATPKLV
Sbjct  35    KNGASSSNSTVEES-EKKPSVRPYVRSKMPRLRWTPELHLCFVKAVERLGGQDRATPKLV  93

Query  1013  LQLMDIKGLNIAHVKSHLQMYRSKKTEDPSQGFANHRAFMEGGDRNVFNLSQLPMFKIFN  834
             LQLM++ GL+IAHVKSHLQMYRSKK +DPSQ  ++HR  +E GDRN++NLSQLPM + + 
Sbjct  94    LQLMNVNGLSIAHVKSHLQMYRSKKIDDPSQAMSDHRHLVESGDRNIYNLSQLPMLQGY-  152

Query  833   NQRLNPPFRYGDDSYRNCQEKWMNGTAMAHGTADRGRP--YEALYERF  696
             NQ     +RYGD S+ N +E ++    M     D  R   Y  + ER 
Sbjct  153   NQHYGSNYRYGDASW-NARESFVYNPHMGRCLVDENRQGLYGTVAERI  199



>ref|XP_004492477.1| PREDICTED: putative Myb family transcription factor At1g14600-like 
isoform X1 [Cicer arietinum]
Length=325

 Score =   204 bits (520),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 99/150 (66%), Positives = 120/150 (80%), Gaps = 4/150 (3%)
 Frame = -2

Query  1277  CSKTTSD---DSNKFEEDEDETNESPRNQTVKDGGSSSNSTVEESGEKKASVRPYVRSKM  1107
             CSKT+     D  +  E+  E  ES +N  + +G SSSNST+EE+ EKK+SVRPYVRSK 
Sbjct  14    CSKTSVSNEVDGCEISEENHEDEESKQN-NINEGLSSSNSTIEENNEKKSSVRPYVRSKF  72

Query  1106  PRLRWTPDLHLRFLHAVERLGGQERATPKLVLQLMDIKGLNIAHVKSHLQMYRSKKTEDP  927
             PRLRWTPDLHLRF+HAV+RLGGQERATPKLVLQLM+IKGL+IAHVKSHLQMYRSKK  D 
Sbjct  73    PRLRWTPDLHLRFIHAVQRLGGQERATPKLVLQLMNIKGLSIAHVKSHLQMYRSKKVVDT  132

Query  926   SQGFANHRAFMEGGDRNVFNLSQLPMFKIF  837
             +Q  A+HR  ++ GD+NV+NLSQLPM + +
Sbjct  133   NQVLADHRLLVDNGDKNVYNLSQLPMLQGY  162



>ref|XP_007207102.1| hypothetical protein PRUPE_ppa021179mg [Prunus persica]
 gb|EMJ08301.1| hypothetical protein PRUPE_ppa021179mg [Prunus persica]
Length=333

 Score =   204 bits (520),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 103/149 (69%), Positives = 120/149 (81%), Gaps = 12/149 (8%)
 Frame = -2

Query  1238  EDEDETNES--PRNQTVKDGGSSSNSTVEESGEKKASVRPYVRSKMPRLRWTPDLHLRFL  1065
             E+ D+  ES  P+N    +GGSSSNSTVEES ++KASVRPYVRSKMPRLRWTPDLHLRF+
Sbjct  25    ENYDDIEESGKPKN----NGGSSSNSTVEESDQRKASVRPYVRSKMPRLRWTPDLHLRFI  80

Query  1064  HAVERLGGQERATPKLVLQLMDIKGLNIAHVKSHLQMYRSKKTEDPSQGFANHRAFMEGG  885
             HAVERLGGQERATPKLVLQLM+IKGL+IAHVKSHLQMYRSKK +D  QG       +E G
Sbjct  81    HAVERLGGQERATPKLVLQLMNIKGLSIAHVKSHLQMYRSKKIDDAGQGH-----LVECG  135

Query  884   DRNVFNLSQLPMFKIFNNQRLNPPFRYGD  798
             D+N++NLSQLPM + +N    +  FRYGD
Sbjct  136   DKNIYNLSQLPMLQGYNRSH-STSFRYGD  163



>ref|XP_010264566.1| PREDICTED: two-component response regulator ARR18-like [Nelumbo 
nucifera]
Length=381

 Score =   202 bits (515),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 157/405 (39%), Positives = 217/405 (54%), Gaps = 68/405 (17%)
 Frame = -2

Query  1268  TTSDDSNKFEEDEDETNESPRNQTVKDGGSSSNSTVEESGEKKA----SVRPYVRSKMPR  1101
             T   ++NK+  D++E  E       K+GGSSSNSTVE++ ++ +    SVR Y RSK+PR
Sbjct  23    TEGSETNKYPSDKNEDEEVNCESKPKNGGSSSNSTVEQNDQRSSATAGSVRQYNRSKLPR  82

Query  1100  LRWTPDLHLRFLHAVERLGGQERATPKLVLQLMDIKGLNIAHVKSHLQMYRSKKTEDPSQ  921
             LRWTPDLHL F+HAVERLGGQ+RATPKL+L LM+IKGL IAHVKSHLQMYRSKK ++  Q
Sbjct  83    LRWTPDLHLCFVHAVERLGGQDRATPKLLLNLMNIKGLTIAHVKSHLQMYRSKKIDEAGQ  142

Query  920   GFANHRAFMEGGDRNVFNLSQLPMFKIFNNQRLNPPFRYGDDSYRNCQEKWMNGTAMAHG  741
                 HR F+E GDR+++NL+QLPM + FN +  +  FRY + S+R     W++       
Sbjct  143   VIPEHRHFVEVGDRHMYNLTQLPMLQRFNQRTSSCSFRYEETSWRG-NGNWISCAPYMVE  201

Query  740   TADRGRPYEALYERFRSNYDLSRETINP---------PFTERSNRGLHELKEKLGSFLEN  588
                R   + +L    RSN+ L+   + P         PF E + +  HE + +L  F   
Sbjct  202   ATTRSGYHGSLS---RSNFSLNSGKLTPTPDFNLDISPF-EHATKITHESRARLSPF---  254

Query  587   QTWHHQFAPQNPIQHQPIQVPEPKTMARTGSSVGSWVTDCRPEPKTTVMNSLV--GSWVA  414
                HH  + Q PI   P +         T  +   W  D   E    + NS++   SW  
Sbjct  255   ---HHPKSWQTPINPNPTE---------TNPTTQLW--DNGREQMGCLNNSIIPEASW--  298

Query  413   DRGQEPKATTLENRNAAVSAKLQKQETMKRKA---DLDLNLSLGMKSMKEKSMeglgede  243
                      T+E +N           T KRKA   +LDLNLSL +   ++K      + E
Sbjct  299   -------NITVEEKN-----------TEKRKASDCNLDLNLSLELTPRRDKCTRNSEDVE  340

Query  242   sgltlslsssssSKLRKLNQ----DDTNNFTKSGKGGASTLDLTL  120
              G + SLS  SSS  ++ ++    DD+    +S    ASTLDLT+
Sbjct  341   VGSSFSLSLFSSSSSKQFSRLKGGDDSRKLARS----ASTLDLTI  381



>ref|XP_010529031.1| PREDICTED: uncharacterized protein LOC104806008 [Tarenaya hassleriana]
Length=360

 Score =   197 bits (500),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 96/135 (71%), Positives = 113/135 (84%), Gaps = 3/135 (2%)
 Frame = -2

Query  1181  SSSNSTVEESGEKKASVRPYVRSKMPRLRWTPDLHLRFLHAVERLGGQERATPKLVLQLM  1002
             +SSNSTVEES +KK  VRPYVRSK+PRLRWTPDLHLRF+HAV+RLGGQERATPKLVLQLM
Sbjct  43    ASSNSTVEES-DKKPKVRPYVRSKVPRLRWTPDLHLRFVHAVDRLGGQERATPKLVLQLM  101

Query  1001  DIKGLNIAHVKSHLQMYRSKKTEDPSQGFANHRAFMEG-GDRNVFNLSQLPMFKIFNNQR  825
             +IKGL+IAHVKSHLQMYRSKKT+D  Q  A HR  +E   DRN++NLSQLPMF+ +++  
Sbjct  102   NIKGLSIAHVKSHLQMYRSKKTDDQCQAMAEHRHLIESTTDRNIYNLSQLPMFRAYSHDH  161

Query  824   LNPPFRYGDDSYRNC  780
              + PFRYG+ S  N 
Sbjct  162   -DSPFRYGNASMWNS  175



>ref|XP_008359800.1| PREDICTED: uncharacterized protein LOC103423495 [Malus domestica]
Length=331

 Score =   195 bits (495),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 104/171 (61%), Positives = 127/171 (74%), Gaps = 11/171 (6%)
 Frame = -2

Query  1289  GETVCSKTTSDDSNKFEEDEDETNESPRN----QTVKDGGSSSNSTVEESGEKKASVRPY  1122
             G + CSKT+  D  K  ED  E+ E+  N    +   +GGSSSNSTVEE  +KK SVRPY
Sbjct  6     GGSECSKTSPSD--KQNEDGSESGENYGNGGSSKPKNNGGSSSNSTVEEGDQKKVSVRPY  63

Query  1121  VRSKMPRLRWTPDLHLRFLHAVERLGGQERATPKLVLQLMDIKGLNIAHVKSHLQMYRSK  942
             VRSKMPRLRWT +LHLRF+HA+ERLGGQ+RATPKLVLQLM+IKGL+IAHVKSHLQMYRSK
Sbjct  64    VRSKMPRLRWTXBLHLRFIHAMERLGGQDRATPKLVLQLMNIKGLSIAHVKSHLQMYRSK  123

Query  941   KTEDPSQGFANHRAFM-EGGDRNVFNLSQLPM---FKIFNNQRLNPPFRYG  801
             K  D  Q   + +  + E GD+N++NLSQLPM   +K++ N+R    FRYG
Sbjct  124   KINDAGQVLPDRQGHLGECGDKNIYNLSQLPMLQGYKLY-NRRHTTSFRYG  173



>ref|XP_002273049.2| PREDICTED: uncharacterized protein LOC100263821 [Vitis vinifera]
Length=376

 Score =   196 bits (498),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 147/372 (40%), Positives = 191/372 (51%), Gaps = 47/372 (13%)
 Frame = -2

Query  1196  VKDGGSSSNSTVEESGEKKA---SVRPYVRSKMPRLRWTPDLHLRFLHAVERLGGQERAT  1026
              K+GGSSSNSTVEES E+KA   SVR YVRSKMPRLRWTPDLHL FLHAVERLGGQ+RAT
Sbjct  39    TKNGGSSSNSTVEES-ERKAGSGSVRRYVRSKMPRLRWTPDLHLCFLHAVERLGGQDRAT  97

Query  1025  PKLVLQLMDIKGLNIAHVKSHLQMYRSKKTEDPSQGFANHRAFMEGGDRNVFNLSQLPMF  846
             PKLVLQLMDIKGL+I+HVKSHLQMYRSKK +DP+Q       F+EGGD +++ LS LPM 
Sbjct  98    PKLVLQLMDIKGLSISHVKSHLQMYRSKKIDDPNQVMMEQGLFIEGGDHHIYKLSHLPML  157

Query  845   KIFNNQRLNPPFRY--GDDSYRNCQEKWMNGTAMAHGTADRGR--PYEALYER-FRSNYD  681
             + FN +     FRY     S+R                +DR +   Y ++ ER FRSN  
Sbjct  158   QSFNRRPDTSGFRYDSASASWRASMANQTYSPYRGGDASDRSKNGGYSSVSERIFRSNKG  217

Query  680   LSRETINPPFTERSNRGLHELKEKLGSFLENQTWHHQFAPQNPIQHQPIQVPEPKTMART  501
              S   +N           +E      SF    TW++    +   Q               
Sbjct  218   SS--VLN-----------YEFHVGNSSFNGQATWNNAHHTREEFQ-------------LY  251

Query  500   GSSVGSWVTDCRPEPKTTVMNSLVGSWVADRGQEPKATTLENRNAAVSAKLQKQETMKRK  321
               S GSW +  RP       +S+  +++  +  E +   +   N     +  ++  +KRK
Sbjct  252   SQSHGSWRSQIRP-------SSIQSNYLQPQVLESRKQQVNRLNNPPPPQENQKTMLKRK  304

Query  320   A-----DLDLNLSLGMKSMKEKSMeglgedesgltlslsssssSKLRKLNQDDTNNFTKS  156
             +     DLDLNLSL              +     +    S  S    KL++    + ++ 
Sbjct  305   SSDSNFDLDLNLSLKPAPKSHDHHLEKMDSTEIDSSLSLSLFSPPPSKLSRVKEGDGSRK  364

Query  155   GKGGASTLDLTL  120
                GASTLDLTL
Sbjct  365   HAEGASTLDLTL  376



>ref|XP_010037685.1| PREDICTED: uncharacterized protein LOC104426365 [Eucalyptus grandis]
 gb|KCW49432.1| hypothetical protein EUGRSUZ_K02966 [Eucalyptus grandis]
 gb|KCW49433.1| hypothetical protein EUGRSUZ_K02966 [Eucalyptus grandis]
Length=366

 Score =   194 bits (494),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 154/372 (41%), Positives = 207/372 (56%), Gaps = 60/372 (16%)
 Frame = -2

Query  1190  DGGSSSNSTVEESG-------EKKASVRPYVRSKMPRLRWTPDLHLRFLHAVERLGGQER  1032
             +GGSSSNSTVEE         +KK SVRPYVRSKMPRLRWTPDLHLRF+HA+ERLGGQ+R
Sbjct  40    NGGSSSNSTVEEMSHDGRHHHQKKPSVRPYVRSKMPRLRWTPDLHLRFIHAIERLGGQDR  99

Query  1031  ATPKLVLQLMDIKGLNIAHVKSHLQMYRSKKTEDPSQGFANHRAFMEGGD-RNVFNLSQL  855
             ATPKLVLQLM+IKGL+IAHVKSHLQMYR+KK +D  Q  A+HR  +E G+  NV+ LSQL
Sbjct  100   ATPKLVLQLMNIKGLSIAHVKSHLQMYRNKKIDDNGQVLADHRHLVECGENNNVYKLSQL  159

Query  854   PMFKIFNNQRLNPPFRYGDDSYRNCQEKWMNGTAMAHGTADRGRPYEALYERFRSNYDLS  675
             PM + ++ Q  N  FRYGD  +R  + +  N       + +  RP   LY R       +
Sbjct  160   PMLQGYSGQTSN--FRYGDPCWRAGEYQMHNNPFSGWRSREETRP--GLYGRVAEKLFGN  215

Query  674   RETINPPFTERSNRGLHELKEKLG--SFLENQTWHHQFAPQNPIQHQPIQVPEPKTMART  501
             +  I   F              LG  SF     W +Q            +V  P   +R 
Sbjct  216   KNGIWSNFL-------------LGASSFNRQPNWTYQ-----------QEVKHPYISSR-  250

Query  500   GSSVGSWVTDCRPEPKTTVMNSLVGSWVADRGQEPKATTLENRN--AAVSAKLQKQETMK  327
               + G+W            + S +      R  + +A   EN N   +++++L+++   +
Sbjct  251   --NQGTWKN----------IESRMSQIEHQRTAQLRAEGGENGNFDKSIASELKRKVDGR  298

Query  326   RKADLDLNLSLGMKSMKEK---SMeglgedesgltlslsssssSKLRKLNQDDTNNFTKS  156
                D+DLNLSL +    ++   S E   + +S L+LSL S+ +SK RKLN D++    + 
Sbjct  299   ---DIDLNLSLQVNQDYDEGHGSSEEANDVDSSLSLSLFSAKASKHRKLN-DESKEIKEH  354

Query  155   GKGGASTLDLTL  120
             G G ASTLDLTL
Sbjct  355   GIGRASTLDLTL  366



>ref|XP_009337761.1| PREDICTED: LOW QUALITY PROTEIN: putative two-component response 
regulator ARR13 [Pyrus x bretschneideri]
Length=331

 Score =   193 bits (491),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 103/173 (60%), Positives = 123/173 (71%), Gaps = 15/173 (9%)
 Frame = -2

Query  1289  GETVCSKTTSDDSNKFEEDEDETNES------PRNQTVKDGGSSSNSTVEESGEKKASVR  1128
             G + CSKT+  D    +  E   N        P+N    +GGSSSNSTVEE  +KK SVR
Sbjct  6     GGSECSKTSPSDKQNGDRSESGENYGNGESCXPKN----NGGSSSNSTVEEGDQKKVSVR  61

Query  1127  PYVRSKMPRLRWTPDLHLRFLHAVERLGGQERATPKLVLQLMDIKGLNIAHVKSHLQMYR  948
             PYVRSKMPRLRWT DLHLRF+HA+ERLGGQ+RATPKLVLQLM+IKGL+IAHVKSHLQMYR
Sbjct  62    PYVRSKMPRLRWTTDLHLRFIHAMERLGGQDRATPKLVLQLMNIKGLSIAHVKSHLQMYR  121

Query  947   SKKTEDPSQGFANHRAFM-EGGDRNVFNLSQLPM---FKIFNNQRLNPPFRYG  801
             SKK  D  Q   + +  + E GD+N++NLSQLPM   +K++ NQ     FRYG
Sbjct  122   SKKINDAGQVLPDRQGHLGECGDKNIYNLSQLPMLQGYKLY-NQSHTTSFRYG  173



>ref|XP_010257080.1| PREDICTED: two-component response regulator ARR14-like [Nelumbo 
nucifera]
 ref|XP_010257081.1| PREDICTED: two-component response regulator ARR14-like [Nelumbo 
nucifera]
Length=370

 Score =   193 bits (490),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 142/325 (44%), Positives = 178/325 (55%), Gaps = 58/325 (18%)
 Frame = -2

Query  1205  NQTVKDGGSSSNSTVEESGEKKA---SVRPYVRSKMPRLRWTPDLHLRFLHAVERLGGQE  1035
             N   K+GGSSSNSTVEE+ EKKA   SVR YVRSKMPRLRWTPDLHL F+HAVERLGGQ+
Sbjct  31    NDKPKNGGSSSNSTVEEN-EKKAGTGSVRQYVRSKMPRLRWTPDLHLCFVHAVERLGGQD  89

Query  1034  RATPKLVLQLMDIKGLNIAHVKSHLQMYRSKKTEDPSQGFAN-HRAFMEGGDRNVFNLSQ  858
             RATPKLVL LM+IKGL IAHVKSHLQMYRSKK +D  Q   +  R ++E  DR+++NLSQ
Sbjct  90    RATPKLVLNLMNIKGLTIAHVKSHLQMYRSKKIDDAGQVITDQQRHYVEAADRHIYNLSQ  149

Query  857   LPMFKIFNNQRLNPPFRYGDDSYRNCQEKWMNGTAMAHGTADRGRPYEALYERFRSNYDL  678
             LPM + F NQR    FRY + S+ N    WM+   +   T      Y ++  R   N+ L
Sbjct  150   LPMLQGF-NQRPASSFRYEEASWNN-HGNWMSNPYIGEATNRPSGFYSSVATR---NFSL  204

Query  677   SRETI---------NPPFTERSNRGLHELKEKLGSFLENQTWHHQFAPQNP-IQHQPIQV  528
             +             + PF   S +  HE +     F ++++W      Q P  +  PI  
Sbjct  205   NSSKAPNRDDFQMGSSPFGH-SIKMTHETRGDFSLFRQHESW------QTPTFRPSPITK  257

Query  527   PEPKTMARTGSSVGSWVTDCRPEPKTTVMNSLVGSWVADRGQEPKATTLENRNAAVSAKL  348
             P P T  R GS +         E    + NS+              T   N   AV    
Sbjct  258   PNPTTQFR-GSGL---------EQAVRLNNSI--------------TPETNWRIAV----  289

Query  347   QKQETMKRKA---DLDLNLSLGMKS  282
             +++   KRKA   DLDLNLSL + S
Sbjct  290   EEKNPGKRKASDCDLDLNLSLKIAS  314



>gb|KGN54397.1| hypothetical protein Csa_4G312300 [Cucumis sativus]
Length=331

 Score =   191 bits (484),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 101/186 (54%), Positives = 125/186 (67%), Gaps = 12/186 (6%)
 Frame = -2

Query  1184  GSSSNSTVEESGE--------KKASVRPYVRSKMPRLRWTPDLHLRFLHAVERLGGQERA  1029
             GSSSNST+EE+          K  +VRPYVRSK+PRLRWTPDLHLRF+HAVERLGGQE A
Sbjct  36    GSSSNSTIEENNNNDHDQHKTKPPTVRPYVRSKLPRLRWTPDLHLRFVHAVERLGGQENA  95

Query  1028  TPKLVLQLMDIKGLNIAHVKSHLQMYRSKKTEDPSQGFANHRAFM---EGGDRNVFNLSQ  858
             TPKLVLQLM+IKGL+IAHVKSHLQMYRSKKT +P Q   + R  M     GDRN+FN+SQ
Sbjct  96    TPKLVLQLMNIKGLSIAHVKSHLQMYRSKKTNEPGQVVGDQRVLMAESNNGDRNIFNVSQ  155

Query  857   LPMFKIFNNQRLNPPFRYGDDSYRNCQEKWMNGTAMAHGTADRGRPYEALYERFRSNYDL  678
             +PMF+ +N+   +  FR+G  S++  + K +    M   +A      +A    F SN   
Sbjct  156   IPMFQRYNSSYPSNLFRFGGSSWKAIENKTIQSPFM-EKSASMTTLTQARSSLFSSNKSN  214

Query  677   SRETIN  660
             + E IN
Sbjct  215   APEMIN  220



>ref|XP_004492478.1| PREDICTED: putative Myb family transcription factor At1g14600-like 
isoform X2 [Cicer arietinum]
Length=316

 Score =   189 bits (479),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 96/150 (64%), Positives = 115/150 (77%), Gaps = 13/150 (9%)
 Frame = -2

Query  1277  CSKTTSD---DSNKFEEDEDETNESPRNQTVKDGGSSSNSTVEESGEKKASVRPYVRSKM  1107
             CSKT+     D  +  E+  E  ES +N  + +G SSSNST+EE+ EKK+SVRPYVRSK 
Sbjct  14    CSKTSVSNEVDGCEISEENHEDEESKQN-NINEGLSSSNSTIEENNEKKSSVRPYVRSKF  72

Query  1106  PRLRWTPDLHLRFLHAVERLGGQERATPKLVLQLMDIKGLNIAHVKSHLQMYRSKKTEDP  927
             PRLRWTPDLHLRF+HAV+RLGGQERATPKLVLQLM+IKGL+IAHVKSHLQMYRSKK  D 
Sbjct  73    PRLRWTPDLHLRFIHAVQRLGGQERATPKLVLQLMNIKGLSIAHVKSHLQMYRSKKVVDT  132

Query  926   SQGFANHRAFMEGGDRNVFNLSQLPMFKIF  837
             +Q         + GD+NV+NLSQLPM + +
Sbjct  133   NQ---------DNGDKNVYNLSQLPMLQGY  153



>emb|CBI25446.3| unnamed protein product [Vitis vinifera]
Length=491

 Score =   192 bits (488),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 135/313 (43%), Positives = 170/313 (54%), Gaps = 45/313 (14%)
 Frame = -2

Query  1196  VKDGGSSSNSTVEESGEKKA---SVRPYVRSKMPRLRWTPDLHLRFLHAVERLGGQERAT  1026
              K+GGSSSNSTVEES E+KA   SVR YVRSKMPRLRWTPDLHL FLHAVERLGGQ+RAT
Sbjct  132   TKNGGSSSNSTVEES-ERKAGSGSVRRYVRSKMPRLRWTPDLHLCFLHAVERLGGQDRAT  190

Query  1025  PKLVLQLMDIKGLNIAHVKSHLQMYRSKKTEDPSQGFANHRAFMEGGDRNVFNLSQLPMF  846
             PKLVLQLMDIKGL+I+HVKSHLQMYRSKK +DP+Q       F+EGGD +++ LS LPM 
Sbjct  191   PKLVLQLMDIKGLSISHVKSHLQMYRSKKIDDPNQVMMEQGLFIEGGDHHIYKLSHLPML  250

Query  845   KIFNNQRLNPPFRYGDDSYRNCQEKWMNGTAMAHGTADRGRPYEALYERFRSNYDLSRET  666
             + FN +     FRY   S       W    +MA+ T    R  +A        Y    E 
Sbjct  251   QSFNRRPDTSGFRYDSAS-----ASWR--ASMANQTYSPYRGGDASDRSKNGGYSSVSER  303

Query  665   INPPFTERSNRGLHELKEKL----GSFLENQTWHHQFAPQNPIQHQPIQVPEPKTMARTG  498
             I      RSN+G   L  +      SF    TW++    +   Q                
Sbjct  304   IF-----RSNKGSSVLNYEFHVGNSSFNGQATWNNAHHTREEFQ-------------LYS  345

Query  497   SSVGSWVTDCRPEPKTTVMNSLVGSWVADRGQEPKATTLENRNAAVSAKLQKQETMKRKA  318
              S GSW +  RP       +S+  +++  +  E +   +   N     +  ++  +KRK+
Sbjct  346   QSHGSWRSQIRP-------SSIQSNYLQPQVLESRKQQVNRLNNPPPPQENQKTMLKRKS  398

Query  317   -----DLDLNLSL  294
                  DLDLNLSL
Sbjct  399   SDSNFDLDLNLSL  411



>ref|XP_008464217.1| PREDICTED: probable transcription factor KAN3 isoform X1 [Cucumis 
melo]
 ref|XP_008464218.1| PREDICTED: probable transcription factor KAN3 isoform X1 [Cucumis 
melo]
Length=307

 Score =   186 bits (473),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 91/143 (64%), Positives = 108/143 (76%), Gaps = 11/143 (8%)
 Frame = -2

Query  1184  GSSSNSTVEESGE--------KKASVRPYVRSKMPRLRWTPDLHLRFLHAVERLGGQERA  1029
             GSSSNST+EE+          K  +VRPYVRSK+PRLRWTPDLHLRF+HAVERLGGQE A
Sbjct  36    GSSSNSTIEENNNNDHDQHKTKPPTVRPYVRSKLPRLRWTPDLHLRFVHAVERLGGQENA  95

Query  1028  TPKLVLQLMDIKGLNIAHVKSHLQMYRSKKTEDPSQGFANHRAFM---EGGDRNVFNLSQ  858
             TPKLVLQLM+IKGL+IAHVKSHLQMYRSKKT +P Q   + R  M     GDRN+FN+SQ
Sbjct  96    TPKLVLQLMNIKGLSIAHVKSHLQMYRSKKTNEPGQVVGDQRVLMAESNNGDRNIFNVSQ  155

Query  857   LPMFKIFNNQRLNPPFRYGDDSY  789
             +PMF+ +N+   +  FR G  S+
Sbjct  156   IPMFQRYNSSYTSNLFRLGGSSW  178



>gb|KHN01942.1| Putative Myb family transcription factor [Glycine soja]
Length=343

 Score =   186 bits (471),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 118/230 (51%), Positives = 155/230 (67%), Gaps = 25/230 (11%)
 Frame = -2

Query  1277  CSKTTSDDSNKFEEDEDETNESPRNQTVK--DGGSSSNSTVEESGEKKASVRPYVRSKMP  1104
             CSKT   + +  +EDE+  +E+   Q+ +  +GGSSSNSTVEE+ EKK  +RPYVRSKMP
Sbjct  9     CSKT---NPSNIDEDEECESEANEEQSTQKNNGGSSSNSTVEEN-EKK--IRPYVRSKMP  62

Query  1103  RLRWTPDLHLRFLHAVERLGGQERATPKLVLQLMDIKGLNIAHVKSHLQMYRSKKTEDPS  924
             RLRWTPDLHLRF+HAV+RLGGQERATPKLVLQLM++KGL+IAHVKSHLQM+RSKK +D +
Sbjct  63    RLRWTPDLHLRFVHAVQRLGGQERATPKLVLQLMNVKGLSIAHVKSHLQMFRSKKVDDRN  122

Query  923   QGFANHRAFMEGGDRNVFNLSQLPMFKIFNNQRLNPPFRYGDDSYRNCQEKWMNGTAMAH  744
             Q FA++   +E GD+N++N+SQL M + +N      P +    SY N      N      
Sbjct  123   QVFADYNNLVEIGDKNIYNISQLSMLQGYN------PSQSSSFSYTN------NYPCYGL  170

Query  743   GTADRGRPYEALYER-FRSNYDLSRETINPPFTERSNRGLHELKEKLGSF  597
             G A  G  YE L +R F  +  +SRE  +  F E+S   + E K++  SF
Sbjct  171   GDASFG-VYEKLLQRPFDWSNAISREG-SSIFGEQSK--IREPKDEFLSF  216



>ref|XP_006573379.1| PREDICTED: uncharacterized protein LOC102660246 isoform X1 [Glycine 
max]
 ref|XP_006573380.1| PREDICTED: uncharacterized protein LOC102660246 isoform X2 [Glycine 
max]
Length=343

 Score =   186 bits (471),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 118/230 (51%), Positives = 155/230 (67%), Gaps = 25/230 (11%)
 Frame = -2

Query  1277  CSKTTSDDSNKFEEDEDETNESPRNQTVK--DGGSSSNSTVEESGEKKASVRPYVRSKMP  1104
             CSKT   + +  +EDE+  +E+   Q+ +  +GGSSSNSTVEE+ EKK  +RPYVRSKMP
Sbjct  9     CSKT---NPSNIDEDEECESEANEEQSTQKNNGGSSSNSTVEEN-EKK--IRPYVRSKMP  62

Query  1103  RLRWTPDLHLRFLHAVERLGGQERATPKLVLQLMDIKGLNIAHVKSHLQMYRSKKTEDPS  924
             RLRWTPDLHLRF+HAV+RLGGQERATPKLVLQLM++KGL+IAHVKSHLQM+RSKK +D +
Sbjct  63    RLRWTPDLHLRFVHAVQRLGGQERATPKLVLQLMNVKGLSIAHVKSHLQMFRSKKVDDRN  122

Query  923   QGFANHRAFMEGGDRNVFNLSQLPMFKIFNNQRLNPPFRYGDDSYRNCQEKWMNGTAMAH  744
             Q FA++   +E GD+N++N+SQL M + +N      P +    SY N      N      
Sbjct  123   QVFADYNNLVEIGDKNIYNISQLSMLQGYN------PSQSSSFSYTN------NYPCYGL  170

Query  743   GTADRGRPYEALYER-FRSNYDLSRETINPPFTERSNRGLHELKEKLGSF  597
             G A  G  YE L +R F  +  +SRE  +  F E+S   + E K++  SF
Sbjct  171   GDASFG-VYEKLLQRPFDWSNAISREG-SSIFGEQSK--IREPKDEFLSF  216



>ref|XP_006411030.1| hypothetical protein EUTSA_v10016890mg [Eutrema salsugineum]
 gb|ESQ52483.1| hypothetical protein EUTSA_v10016890mg [Eutrema salsugineum]
Length=340

 Score =   186 bits (471),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 92/127 (72%), Positives = 105/127 (83%), Gaps = 3/127 (2%)
 Frame = -2

Query  1178  SSNSTVEESGEKKASVRPYVRSKMPRLRWTPDLHLRFLHAVERLGGQERATPKLVLQLMD  999
             SSNSTVEES +KKA VRPYVRSK+PRLRWTPDLHLRF+ AVERLGGQERATPKLV Q+M+
Sbjct  30    SSNSTVEES-DKKAKVRPYVRSKVPRLRWTPDLHLRFVRAVERLGGQERATPKLVRQMMN  88

Query  998   IKGLNIAHVKSHLQMYRSKKTEDPSQGFANHRAFME-GGDRNVFNLSQLPMFKIFNNQRL  822
             IKGL+IAHVKSHLQMYRSKK +D  Q  A+HR F+E   DRN++ LSQLPMF+  N    
Sbjct  89    IKGLSIAHVKSHLQMYRSKKIDDQGQAIADHRHFIETSTDRNIYKLSQLPMFR-GNTHNH  147

Query  821   NPPFRYG  801
             +  FRYG
Sbjct  148   DSQFRYG  154



>ref|XP_011035900.1| PREDICTED: putative two-component response regulator ARR21 [Populus 
euphratica]
Length=362

 Score =   186 bits (472),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 96/155 (62%), Positives = 122/155 (79%), Gaps = 11/155 (7%)
 Frame = -2

Query  1241  EEDEDETNESPRNQTVKDGGSSSNSTVEESGEKKAS---VRPYVRSKMPRLRWTPDLHLR  1071
             EE+ D+ +   RN+ V    S+SNS+VEE+ +K AS   VR Y+RSKMPRLRWTPDLHL 
Sbjct  26    EEEVDKISFKSRNEGV----STSNSSVEENEKKAASTGSVRQYIRSKMPRLRWTPDLHLC  81

Query  1070  FLHAVERLGGQERATPKLVLQLMDIKGLNIAHVKSHLQMYRSKKTEDPSQGFANHRAFME  891
             F+HAVERLGGQERATPKLVLQ+M+IKGL+IAHVKSHLQMYRSK++++P+QG      F+E
Sbjct  82    FVHAVERLGGQERATPKLVLQMMNIKGLSIAHVKSHLQMYRSKRSDEPNQGQG---LFLE  138

Query  890   GGDRNVFNLSQLPMFKIFNNQRLNPPFRYGDDSYR  786
             GGDR ++N SQLP+ + F NQR +   RYG+ S+R
Sbjct  139   GGDRLIYNHSQLPVLQNF-NQRSSCNLRYGNASWR  172



>emb|CDX74898.1| BnaA05g06440D [Brassica napus]
Length=342

 Score =   185 bits (470),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 89/128 (70%), Positives = 104/128 (81%), Gaps = 2/128 (2%)
 Frame = -2

Query  1178  SSNSTVEESGEKKASVRPYVRSKMPRLRWTPDLHLRFLHAVERLGGQERATPKLVLQLMD  999
             SSN+TVE    KK  VRPYVRSK+PRLRWTPDLHLRF+ AVERLGGQERATPKLV Q+M+
Sbjct  38    SSNTTVEAEVGKKTKVRPYVRSKVPRLRWTPDLHLRFVRAVERLGGQERATPKLVRQMMN  97

Query  998   IKGLNIAHVKSHLQMYRSKKTEDPSQGFANHRAFMEGG-DRNVFNLSQLPMFKIFN-NQR  825
             IKGL+IAHVKSHLQMYRSKK +D  Q  A++R F+E   DRN++ LSQLPMF+ +N N  
Sbjct  98    IKGLSIAHVKSHLQMYRSKKMDDQGQAIADNRHFIESSTDRNIYKLSQLPMFRGYNTNHS  157

Query  824   LNPPFRYG  801
              + PFRYG
Sbjct  158   HDSPFRYG  165



>ref|XP_006294540.1| hypothetical protein CARUB_v10023575mg [Capsella rubella]
 gb|EOA27438.1| hypothetical protein CARUB_v10023575mg [Capsella rubella]
Length=338

 Score =   185 bits (470),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 89/128 (70%), Positives = 106/128 (83%), Gaps = 3/128 (2%)
 Frame = -2

Query  1181  SSSNSTVEESGEKKASVRPYVRSKMPRLRWTPDLHLRFLHAVERLGGQERATPKLVLQLM  1002
             +SSNSTVEES +KK  VRPYVRSK+PRLRWTPDLHLRF+ AVERLGGQERATPKLV Q+M
Sbjct  29    ASSNSTVEES-DKKTKVRPYVRSKVPRLRWTPDLHLRFVRAVERLGGQERATPKLVRQMM  87

Query  1001  DIKGLNIAHVKSHLQMYRSKKTEDPSQGFANHRAFME-GGDRNVFNLSQLPMFKIFNNQR  825
             +IKGL+IAHVKSHLQMYRSKK +D  Q  ++H+   E   DRN++ LSQLPMF+ +N+  
Sbjct  88    NIKGLSIAHVKSHLQMYRSKKIDDHGQAISDHKHLFETSTDRNIYKLSQLPMFRGYNHNN  147

Query  824   LNPPFRYG  801
              + PFRYG
Sbjct  148   -DSPFRYG  154



>ref|XP_009143403.1| PREDICTED: putative Myb family transcription factor At1g14600 
[Brassica rapa]
Length=337

 Score =   185 bits (469),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 89/128 (70%), Positives = 104/128 (81%), Gaps = 2/128 (2%)
 Frame = -2

Query  1178  SSNSTVEESGEKKASVRPYVRSKMPRLRWTPDLHLRFLHAVERLGGQERATPKLVLQLMD  999
             SSN+TVE    KK  VRPYVRSK+PRLRWTPDLHLRF+ AVERLGGQERATPKLV Q+M+
Sbjct  33    SSNTTVEAEVGKKTKVRPYVRSKVPRLRWTPDLHLRFVRAVERLGGQERATPKLVRQMMN  92

Query  998   IKGLNIAHVKSHLQMYRSKKTEDPSQGFANHRAFMEGG-DRNVFNLSQLPMFKIFN-NQR  825
             IKGL+IAHVKSHLQMYRSKK +D  Q  A++R F+E   DRN++ LSQLPMF+ +N N  
Sbjct  93    IKGLSIAHVKSHLQMYRSKKMDDQGQAIADNRHFIESSTDRNIYKLSQLPMFRGYNTNHS  152

Query  824   LNPPFRYG  801
              + PFRYG
Sbjct  153   HDSPFRYG  160



>ref|XP_006378651.1| hypothetical protein POPTR_0010s19310g [Populus trichocarpa]
 gb|ERP56448.1| hypothetical protein POPTR_0010s19310g [Populus trichocarpa]
Length=366

 Score =   186 bits (471),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 114/230 (50%), Positives = 150/230 (65%), Gaps = 36/230 (16%)
 Frame = -2

Query  1241  EEDEDETNESPRNQTVKDGGSSSNSTVEESGEKKA----SVRPYVRSKMPRLRWTPDLHL  1074
             EE+ D+ +   RN+ V    S+SNS+VEE+ EK+A    SVR Y+RSKMPRLRWTPDLHL
Sbjct  26    EEEVDKISFKSRNEGV----STSNSSVEEN-EKEAVSTGSVRQYIRSKMPRLRWTPDLHL  80

Query  1073  RFLHAVERLGGQERATPKLVLQLMDIKGLNIAHVKSHLQMYRSKKTEDPSQGFANHRAFM  894
              F+HAVERLGGQ+RATPKLVLQ+M+IKGL+IAHVKSHLQMYRSK++++P+QG      F 
Sbjct  81    CFVHAVERLGGQDRATPKLVLQMMNIKGLSIAHVKSHLQMYRSKRSDEPNQGQG---LFF  137

Query  893   EGGDRNVFNLSQLPMFKIFNNQRLNPPFRYGDDSYRNCQEK----WMNGTAM---AHGTA  735
             EGGD  ++NLSQLP+ + F NQR +   RYGD S+R    +    +  GTA+    HG  
Sbjct  138   EGGDHQIYNLSQLPVLQNF-NQRSSCNLRYGDASWRGHDHQMYSPYKGGTALNRFKHGL-  195

Query  734   DRGRPYEALYERF--------RSNYDLSRE--TINPPFTERSNRGLHELK  615
                  Y ++ ER           NYD S    ++N   T R+++ L  +K
Sbjct  196   -----YSSVSERLVIGRNNHNSLNYDSSINIPSLNVQATSRTHQFLEGVK  240



>ref|XP_010031180.1| PREDICTED: uncharacterized protein LOC104421051 [Eucalyptus grandis]
 gb|KCW50444.1| hypothetical protein EUGRSUZ_J00182 [Eucalyptus grandis]
Length=404

 Score =   186 bits (473),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 101/167 (60%), Positives = 121/167 (72%), Gaps = 14/167 (8%)
 Frame = -2

Query  1250  NKFEEDEDETNESPRNQT----VKDGG-SSSNSTVEESGEKKAS-------VRPYVRSKM  1107
             N+ E+DED   E    +      KDG  SSSNSTV+ESG+   S       VR YVRSKM
Sbjct  21    NRKEQDEDSYEEEEEEEEEVGMFKDGRRSSSNSTVDESGKNDGSKVKAGGSVRKYVRSKM  80

Query  1106  PRLRWTPDLHLRFLHAVERLGGQERATPKLVLQLMDIKGLNIAHVKSHLQMYRSKKTEDP  927
             PRLRWTPDLHL FLHAVERLGG ERATPKLVLQLM++KGL+IAHVKSHLQMYRSKKT+DP
Sbjct  81    PRLRWTPDLHLCFLHAVERLGGHERATPKLVLQLMNVKGLSIAHVKSHLQMYRSKKTDDP  140

Query  926   SQGFANHRAFMEGGDRNVFNLSQLPMFKIFNNQRLNPPFRYGDDSYR  786
             +Q   +H  F +GGD +V+NLSQLP+ + FN++      R+ D S+R
Sbjct  141   NQAIKDHGFFGDGGDHHVYNLSQLPLLQTFNHR--PSSLRFMDASWR  185



>ref|XP_002881577.1| DNA binding protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH57836.1| DNA binding protein [Arabidopsis lyrata subsp. lyrata]
Length=338

 Score =   184 bits (468),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 90/127 (71%), Positives = 105/127 (83%), Gaps = 3/127 (2%)
 Frame = -2

Query  1178  SSNSTVEESGEKKASVRPYVRSKMPRLRWTPDLHLRFLHAVERLGGQERATPKLVLQLMD  999
             SSNSTVEES +KK  VRPYVRSK+PRLRWTPDLHLRF+ AVERLGGQERATPKLV Q+M+
Sbjct  27    SSNSTVEES-DKKTKVRPYVRSKVPRLRWTPDLHLRFVRAVERLGGQERATPKLVRQMMN  85

Query  998   IKGLNIAHVKSHLQMYRSKKTEDPSQGFANHRAFME-GGDRNVFNLSQLPMFKIFNNQRL  822
             IKGL+IAHVKSHLQMYRSKK +D  Q  A+H+   E   DRN++ LSQLPMF+ + N+  
Sbjct  86    IKGLSIAHVKSHLQMYRSKKIDDQGQAIADHKHLFETSTDRNIYKLSQLPMFRGY-NRNY  144

Query  821   NPPFRYG  801
             + PFRYG
Sbjct  145   DSPFRYG  151



>ref|XP_007008903.1| Myb-like HTH transcriptional regulator family protein, putative 
[Theobroma cacao]
 gb|EOY17713.1| Myb-like HTH transcriptional regulator family protein, putative 
[Theobroma cacao]
Length=382

 Score =   186 bits (471),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 98/180 (54%), Positives = 119/180 (66%), Gaps = 7/180 (4%)
 Frame = -2

Query  1151  GEKKAS--VRPYVRSKMPRLRWTPDLHLRFLHAVERLGGQERATPKLVLQLMDIKGLNIA  978
             G+K AS  VR Y RSK PRLRWTPDLHL F+HAVERLGGQ+RATPKLVLQLM+IKGL+IA
Sbjct  52    GKKHASGSVRQYNRSKTPRLRWTPDLHLCFVHAVERLGGQDRATPKLVLQLMNIKGLSIA  111

Query  977   HVKSHLQMYRSKKTEDPSQGFANHRAFMEGGDRNVFNLSQLPMFKIFNNQRLNPPFRYGD  798
             HVKSHLQMYRSKK +DP+Q         EGGD   + LS LPM   F+NQR +  FRYGD
Sbjct  112   HVKSHLQMYRSKKIDDPNQAMTEQGLLFEGGDHPTYKLSHLPMLHSFDNQRPSSSFRYGD  171

Query  797   DSYRNCQEKWM----NGTAMAHGTADRGRPYEALYERFRSNYDLSRETINPPFTERSNRG  630
              S+R   +K       G+A+A   A +G  Y ++ ER   +Y  +   I+ P  +   RG
Sbjct  172   VSWRGNDQKVYGSHRGGSALALDIATKGL-YTSVTERLFGSYHNNSLGISSPMADSCVRG  230



>ref|XP_010505450.1| PREDICTED: two-component response regulator ARR18-like isoform 
X1 [Camelina sativa]
Length=341

 Score =   184 bits (467),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 89/128 (70%), Positives = 106/128 (83%), Gaps = 3/128 (2%)
 Frame = -2

Query  1181  SSSNSTVEESGEKKASVRPYVRSKMPRLRWTPDLHLRFLHAVERLGGQERATPKLVLQLM  1002
             +SSNSTVEES +KK  VRPYVRSK+PRLRWTPDLHLRF+ AVERLGGQERATPKLV Q+M
Sbjct  27    ASSNSTVEES-DKKTKVRPYVRSKVPRLRWTPDLHLRFVRAVERLGGQERATPKLVRQMM  85

Query  1001  DIKGLNIAHVKSHLQMYRSKKTEDPSQGFANHR-AFMEGGDRNVFNLSQLPMFKIFNNQR  825
             +IKGL+IAHVKSHLQMYRSKK +D  Q  ++H+  F    DRN++ LSQLPMF+ +N+  
Sbjct  86    NIKGLSIAHVKSHLQMYRSKKIDDHGQAISDHKHLFDTSTDRNIYKLSQLPMFRGYNHNS  145

Query  824   LNPPFRYG  801
              + PFRYG
Sbjct  146   -DSPFRYG  152



>ref|XP_008464219.1| PREDICTED: probable transcription factor KAN4 isoform X2 [Cucumis 
melo]
Length=306

 Score =   182 bits (463),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 91/143 (64%), Positives = 108/143 (76%), Gaps = 12/143 (8%)
 Frame = -2

Query  1184  GSSSNSTVEESGE--------KKASVRPYVRSKMPRLRWTPDLHLRFLHAVERLGGQERA  1029
             GSSSNST+EE+          K  +VRPYVRSK+PRLRWTPDLHLRF+HAVERLGGQE A
Sbjct  36    GSSSNSTIEENNNNDHDQHKTKPPTVRPYVRSKLPRLRWTPDLHLRFVHAVERLGGQENA  95

Query  1028  TPKLVLQLMDIKGLNIAHVKSHLQMYRSKKTEDPSQGFANHRAFM---EGGDRNVFNLSQ  858
             TPKLVLQLM+IKGL+IAHVKSHLQMYRSKKT +P Q   + R  M     GDRN+FN+SQ
Sbjct  96    TPKLVLQLMNIKGLSIAHVKSHLQMYRSKKTNEPGQ-VGDQRVLMAESNNGDRNIFNVSQ  154

Query  857   LPMFKIFNNQRLNPPFRYGDDSY  789
             +PMF+ +N+   +  FR G  S+
Sbjct  155   IPMFQRYNSSYTSNLFRLGGSSW  177



>ref|NP_181364.2| myb-like HTH transcriptional regulator-like protein [Arabidopsis 
thaliana]
 dbj|BAC42341.1| unknown protein [Arabidopsis thaliana]
 gb|AAO50506.1| unknown protein [Arabidopsis thaliana]
 gb|AEC09520.1| myb-like HTH transcriptional regulator-like protein [Arabidopsis 
thaliana]
Length=340

 Score =   184 bits (466),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 90/127 (71%), Positives = 104/127 (82%), Gaps = 3/127 (2%)
 Frame = -2

Query  1178  SSNSTVEESGEKKASVRPYVRSKMPRLRWTPDLHLRFLHAVERLGGQERATPKLVLQLMD  999
             SSNSTVEES +KK  VRPYVRSK+PRLRWTPDLHLRF+ AVERLGGQERATPKLV Q+M+
Sbjct  32    SSNSTVEES-DKKTKVRPYVRSKVPRLRWTPDLHLRFVRAVERLGGQERATPKLVRQMMN  90

Query  998   IKGLNIAHVKSHLQMYRSKKTEDPSQGFANHRAFME-GGDRNVFNLSQLPMFKIFNNQRL  822
             IKGL+IAHVKSHLQMYRSKK +D  Q  A H+   E   DRN++ LSQLPMF+ +N+   
Sbjct  91    IKGLSIAHVKSHLQMYRSKKIDDQGQAIAGHKHLFETSTDRNIYKLSQLPMFRGYNHNH-  149

Query  821   NPPFRYG  801
             + PFRYG
Sbjct  150   DSPFRYG  156



>ref|XP_003520352.1| PREDICTED: uncharacterized protein LOC100801120 [Glycine max]
Length=346

 Score =   183 bits (465),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 108/199 (54%), Positives = 138/199 (69%), Gaps = 20/199 (10%)
 Frame = -2

Query  1277  CSKTTSDDSNKFEEDEDETNESPRNQTVKDGGSSSNSTVEESGEKKASVRPYVRSKMPRL  1098
             CSKT+  + ++ +E E E NE    Q    GGSSSNSTVEE+ EKK  +RPYVRSKMPRL
Sbjct  9     CSKTSPSNIDEDDEGESEANEDQSKQNNN-GGSSSNSTVEEN-EKK--IRPYVRSKMPRL  64

Query  1097  RWTPDLHLRFLHAVERLGGQERATPKLVLQLMDIKGLNIAHVKSHLQMYRSKKTEDPSQG  918
             RWTPDLHLRF+HAV+RLGGQERATPKLVLQLM+IK L+IAHVKSHLQM+RSKK +D +Q 
Sbjct  65    RWTPDLHLRFIHAVQRLGGQERATPKLVLQLMNIKSLSIAHVKSHLQMFRSKKVDDRNQV  124

Query  917   FANHRAFMEGGDRNVFNLSQLPMFKIFNNQRLN--------PPFRYGDDSYRNCQEK---  771
             FA+H + +E GD+N++NLSQL M + +N  + +        P + +GD S+    EK   
Sbjct  125   FADHNSLVETGDKNIYNLSQLSMLQGYNPSQSSSFSYTNNYPSYGFGDASF-GVYEKLLQ  183

Query  770   ----WMNGTAMAHGTADRG  726
                 W N  +   G++  G
Sbjct  184   RPFDWSNAISSREGSSIFG  202



>ref|XP_006583665.1| PREDICTED: uncharacterized protein LOC102662997 isoform X1 [Glycine 
max]
 ref|XP_006583666.1| PREDICTED: uncharacterized protein LOC102662997 isoform X2 [Glycine 
max]
Length=366

 Score =   184 bits (466),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 108/203 (53%), Positives = 136/203 (67%), Gaps = 11/203 (5%)
 Frame = -2

Query  1166  TVEESGEKKASVRPYVRSKMPRLRWTPDLHLRFLHAVERLGGQERATPKLVLQLMDIKGL  987
             TVEE+ EKK +VRPYVRSKMPRLRWTPDLHLRF+HAV+RLGGQERATPKLVLQLM+IKGL
Sbjct  48    TVEEN-EKKTTVRPYVRSKMPRLRWTPDLHLRFIHAVQRLGGQERATPKLVLQLMNIKGL  106

Query  986   NIAHVKSHLQMYRSKKTEDPSQGFANHRAFMEGGDRNVFNLSQLPMFKIFNNQRLNPPFR  807
             +IAHVKSHLQMYRSKK  D +Q  A+ R  +E GDRNV+NLSQLPM + +N  + +  +R
Sbjct  107   SIAHVKSHLQMYRSKKV-DTNQVLADPRLLVETGDRNVYNLSQLPMLQGYNPSQ-SSAYR  164

Query  806   YG-DDSYRNCQEKWMNGTAMAHGTADR-GRPY--EALYERFRSN----YDLSRETINPPF  651
             YG  D+     E  ++G  M   + D  G  +    L     SN    +++ +   +  F
Sbjct  165   YGYGDASLAIYENMVHGPFMNRSSLDESGAEFCGSRLTHGTNSNINWIHNMFQVDSSSSF  224

Query  650   TERSNRGLHELKEKLGSFLENQT  582
              E S   +HE K K  SF  N++
Sbjct  225   NEPSTSKVHEPKHKFFSFGGNES  247



>ref|XP_006602682.1| PREDICTED: two-component response regulator ARR14-like [Glycine 
max]
Length=360

 Score =   183 bits (465),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 149/351 (42%), Positives = 188/351 (54%), Gaps = 73/351 (21%)
 Frame = -2

Query  1289  GETVCSKTTSDDSNKFEEDEDETNESPRNQTVKDGGSSSNSTVEESGEKKASVRPYVRSK  1110
             G + CSKT+  +    EE E   +ES   Q   +GGSSSNSTVEE+ EKK +VRPYVRSK
Sbjct  9     GSSECSKTSPSNEEDCEESEGYEDES--KQNNNNGGSSSNSTVEEN-EKKTTVRPYVRSK  65

Query  1109  MPRLRWTPDLHLRFLHAVERLGGQERATPKLVLQLMDIKGLNIAHVKSHLQMYRSKKTED  930
             MPRLRWTPDLHLRF+HAV+RLGGQERATPKLVLQLM+IKGL+IAHVKSHLQMYRSKK  D
Sbjct  66    MPRLRWTPDLHLRFVHAVQRLGGQERATPKLVLQLMNIKGLSIAHVKSHLQMYRSKKV-D  124

Query  929   PSQGFANHRAFMEGGDRNVFNLSQLPMFKIFN-NQRLNPPFRYGDDS---YRNCQEK-WM  765
              +Q         E GDRNV+NLSQLPM + +N +Q  +  + YGD S   Y N   + +M
Sbjct  125   TNQ---------ETGDRNVYNLSQLPMLQGYNPSQSSSYRYGYGDASLAIYENMVHRPFM  175

Query  764   NGTAMAHGTADRGRPYEALYERFR---SNYDLSRETI----NPPFTERSNRGLHELKEKL  606
             N +++    A+       L ER     SN + +R       +  F E S   + E K K 
Sbjct  176   NRSSLDESGAEFCGS--RLTERIHGTNSNINWTRNMFQVDSSSSFNEPSTSKVQEPKHKF  233

Query  605   GSFLENQTWHHQFAPQNPIQHQPIQVPEPKTMARTGSSVGSWVTDCRPEPKTTVMNSLVG  426
              SF  N++   Q        HQ  Q+                                  
Sbjct  234   FSFGGNESSCTQIKMSQVDLHQSTQL----------------------------------  259

Query  425   SWVADRGQEPKATTLENRNAAVSAKLQKQETMKRKA---DLDLNLSLGMKS  282
                     +P A  L   N   + +++ + T+KRKA   DLDLNLSL + S
Sbjct  260   --------QPGAQELMPNNKFATNEVELK-TLKRKASDIDLDLNLSLKLNS  301



>emb|CDX91442.1| BnaC04g07080D [Brassica napus]
Length=350

 Score =   183 bits (464),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 88/128 (69%), Positives = 103/128 (80%), Gaps = 2/128 (2%)
 Frame = -2

Query  1178  SSNSTVEESGEKKASVRPYVRSKMPRLRWTPDLHLRFLHAVERLGGQERATPKLVLQLMD  999
             SSN+TVE    KK  VRPYVRSK+PRLRWTPDLHLRF+ AVERLGGQERATPKLV Q+M+
Sbjct  45    SSNTTVEAEVGKKTKVRPYVRSKVPRLRWTPDLHLRFVRAVERLGGQERATPKLVRQMMN  104

Query  998   IKGLNIAHVKSHLQMYRSKKTEDPSQGFANHRAFMEGG-DRNVFNLSQLPMFKIFN-NQR  825
             IKGL+IAHVKSHLQMYRSKK +D  Q   ++R F+E   DRN++ LSQLPMF+ +N N  
Sbjct  105   IKGLSIAHVKSHLQMYRSKKMDDQGQAIGDNRHFIESSTDRNIYKLSQLPMFRGYNTNHS  164

Query  824   LNPPFRYG  801
              + PFRYG
Sbjct  165   HDSPFRYG  172



>ref|XP_010517118.1| PREDICTED: two-component response regulator ARR18-like isoform 
X1 [Camelina sativa]
Length=341

 Score =   181 bits (459),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 88/128 (69%), Positives = 105/128 (82%), Gaps = 3/128 (2%)
 Frame = -2

Query  1181  SSSNSTVEESGEKKASVRPYVRSKMPRLRWTPDLHLRFLHAVERLGGQERATPKLVLQLM  1002
             +SSNSTVEES +KK  VRPYVRSK+PRLRWTPDLHLRF+ AVERLGGQERATPKLV Q+M
Sbjct  27    ASSNSTVEES-DKKTKVRPYVRSKVPRLRWTPDLHLRFVRAVERLGGQERATPKLVRQMM  85

Query  1001  DIKGLNIAHVKSHLQMYRSKKTEDPSQGFANHR-AFMEGGDRNVFNLSQLPMFKIFNNQR  825
             +IKGL+IAHVKSHLQMYRSKK +D  Q  ++ +  F    DRN++ LSQLPMF+ +N+  
Sbjct  86    NIKGLSIAHVKSHLQMYRSKKIDDHGQAISDDKYLFDTSTDRNIYKLSQLPMFRGYNHNN  145

Query  824   LNPPFRYG  801
              + PFRYG
Sbjct  146   -DSPFRYG  152



>ref|XP_010509196.1| PREDICTED: two-component response regulator ARR18-like isoform 
X1 [Camelina sativa]
Length=338

 Score =   181 bits (459),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 89/129 (69%), Positives = 106/129 (82%), Gaps = 4/129 (3%)
 Frame = -2

Query  1181  SSSNSTVEESGEKKASVRPYVRSKMPRLRWTPDLHLRFLHAVERLGGQERATPKLVLQLM  1002
             +SSNSTVEES +KK  VRPYVRSK+PRLRWTPDLHLRF+ AVERLGGQERATPKLV Q+M
Sbjct  23    ASSNSTVEES-DKKTKVRPYVRSKVPRLRWTPDLHLRFVRAVERLGGQERATPKLVRQMM  81

Query  1001  DIKGLNIAHVKSHLQMYRSKKTEDPSQGF-ANHRAFME-GGDRNVFNLSQLPMFKIFNNQ  828
             +IKGL+IAHVKSHLQMYRSKK +D  Q   ++H+   E   DRN++ LSQLPMF+ +N+ 
Sbjct  82    NIKGLSIAHVKSHLQMYRSKKIDDHGQAISSDHKHLFETSTDRNIYKLSQLPMFRGYNHN  141

Query  827   RLNPPFRYG  801
               + PFRYG
Sbjct  142   N-DSPFRYG  149



>ref|XP_009611230.1| PREDICTED: putative two-component response regulator ARR20 isoform 
X2 [Nicotiana tomentosiformis]
Length=381

 Score =   182 bits (461),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 90/131 (69%), Positives = 105/131 (80%), Gaps = 3/131 (2%)
 Frame = -2

Query  1181  SSSNSTVEESGEKKAS---VRPYVRSKMPRLRWTPDLHLRFLHAVERLGGQERATPKLVL  1011
             SSSNSTVEE+G+K  +   VR YVRSK PRLRWTP+LHLRF+HAVERLGGQ+RATPKLVL
Sbjct  49    SSSNSTVEENGKKSTNSGGVRQYVRSKTPRLRWTPELHLRFIHAVERLGGQDRATPKLVL  108

Query  1010  QLMDIKGLNIAHVKSHLQMYRSKKTEDPSQGFANHRAFMEGGDRNVFNLSQLPMFKIFNN  831
             QLM+IKGL+IAHVKSHLQMYRSKKT+DP+Q   + R  +E GD N+FNLSQLP  +   N
Sbjct  109   QLMNIKGLSIAHVKSHLQMYRSKKTDDPNQISTDGRFLIENGDHNIFNLSQLPRLQGTFN  168

Query  830   QRLNPPFRYGD  798
             Q  +   RY D
Sbjct  169   QASSSSLRYED  179



>ref|XP_010693076.1| PREDICTED: two-component response regulator ARR10-like [Beta 
vulgaris subsp. vulgaris]
Length=399

 Score =   182 bits (462),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 109/201 (54%), Positives = 136/201 (68%), Gaps = 14/201 (7%)
 Frame = -2

Query  1250  NKFEEDEDETNESPRNQTVK---DGGSSSNSTVEESGEKK----ASVRPYVRSKMPRLRW  1092
             NK EE+E + N +  N  V    +G SSS+STVEE  +K+     SVRPY RSKMPRLRW
Sbjct  30    NKVEEEEVDDNSNNTNSKVVIKINGSSSSSSTVEEDEKKRTTSSGSVRPYNRSKMPRLRW  89

Query  1091  TPDLHLRFLHAVERLGGQERATPKLVLQLMDIKGLNIAHVKSHLQMYRSKKTEDPSQ-GF  915
             TPDLHL F+HAVERLGGQERATPKLVLQLM+IKGL+IAHVKSHLQMYRSKK ++ +Q   
Sbjct  90    TPDLHLCFVHAVERLGGQERATPKLVLQLMNIKGLSIAHVKSHLQMYRSKKIDESNQEAM  149

Query  914   ANHRAFMEGGDRNVFNLSQLPMFKIFNNQRLNPPFRYGDDSYRNCQEKWMNGTAMAHGTA  735
             +N++     G  N++NLSQLPM + +N+QR     RYGD S+R      + G      ++
Sbjct  150   SNNQGIFSDGRDNIYNLSQLPMLQGYNHQRSPFNLRYGDPSWRG-HSNQIYGPYNVGTSS  208

Query  734   DR---GRPYEALYER--FRSN  687
             DR   G  + +L ER  F SN
Sbjct  209   DRPRNGSNFNSLSERMIFSSN  229



>emb|CDP13985.1| unnamed protein product [Coffea canephora]
Length=386

 Score =   181 bits (460),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 93/166 (56%), Positives = 118/166 (71%), Gaps = 12/166 (7%)
 Frame = -2

Query  1190  DGGSSSNSTVEESGEKKAS--VRPYVRSKMPRLRWTPDLHLRFLHAVERLGGQERATPKL  1017
             +G SSSNSTVEE+ +K AS  VR Y+RSK PRLRWTP+LHL F+HAVERLGGQ+RATPKL
Sbjct  47    NGTSSSNSTVEENSKKPASGSVRQYIRSKTPRLRWTPELHLCFIHAVERLGGQDRATPKL  106

Query  1016  VLQLMDIKGLNIAHVKSHLQMYRSKKTEDPSQGFANHRAFMEGGDRNVFNLSQLPMFKIF  837
             VLQLM+IKGL+IAHVKSHLQMYRSKK +DP+Q  +  R   + GD N++NLS+LPM + F
Sbjct  107   VLQLMNIKGLSIAHVKSHLQMYRSKKIDDPNQVISEQRLLADSGDHNIYNLSKLPMLQAF  166

Query  836   NNQRLNPPFRYGDDSYRNCQEKWM----------NGTAMAHGTADR  729
             ++   +   RYG+  + + Q  +           N T    GTAD+
Sbjct  167   DHFSSSGSLRYGNTFWNSRQTNYHGPYNYGGAPSNFTRHGFGTADK  212



>ref|XP_007134813.1| hypothetical protein PHAVU_010G078400g [Phaseolus vulgaris]
 gb|ESW06807.1| hypothetical protein PHAVU_010G078400g [Phaseolus vulgaris]
Length=312

 Score =   179 bits (455),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 110/214 (51%), Positives = 140/214 (65%), Gaps = 26/214 (12%)
 Frame = -2

Query  1277  CSKTTSDDSNKFEEDEDETNESPRNQTVKDGGSSSNSTVEESGEKKASVRPYVRSKMPRL  1098
             CSKT+  + ++ EE E   NE    Q    G SSSNST EES EKK  +RPY+RSK+PRL
Sbjct  9     CSKTSPSNIDE-EECERHANEDQSKQNNNGG-SSSNSTAEES-EKK--IRPYIRSKLPRL  63

Query  1097  RWTPDLHLRFLHAVERLGGQERATPKLVLQLMDIKGLNIAHVKSHLQMYRSKKTEDPSQG  918
             RWTPDLHLRF+HAV+RLGGQERATPKLVLQLM++KGL+IAHVKSHLQM+RSKK +D +Q 
Sbjct  64    RWTPDLHLRFIHAVQRLGGQERATPKLVLQLMNMKGLSIAHVKSHLQMFRSKKVDDRNQV  123

Query  917   FANHRAFMEGGDRNVFNLSQLPMFKIFNNQRLN---------PPFRYGDDSYRNCQEK--  771
             F+NH + +E GD+N++NLSQL M + +N  + +         P + +GD S+    EK  
Sbjct  124   FSNHTSLVEIGDKNIYNLSQLSMLQAYNPSQSSSYSYTNNNYPSYGFGDASF-GVYEKLV  182

Query  770   -----WMNGTAMA----HGTADRGRPYEALYERF  696
                  W NG + A     G     +  E  YE F
Sbjct  183   HIPFDWSNGISQAGSSISGEQSTSKTREPKYEFF  216



>ref|XP_009791664.1| PREDICTED: uncharacterized protein LOC104238869 isoform X2 [Nicotiana 
sylvestris]
Length=381

 Score =   181 bits (458),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 89/131 (68%), Positives = 105/131 (80%), Gaps = 3/131 (2%)
 Frame = -2

Query  1181  SSSNSTVEESGEKKAS---VRPYVRSKMPRLRWTPDLHLRFLHAVERLGGQERATPKLVL  1011
             SSSNSTVEE+G+K  +   VR YVRSK PRLRWTP+LHLRF+HAVERLGGQ+RATPKLVL
Sbjct  49    SSSNSTVEENGKKSTNSGGVRQYVRSKTPRLRWTPELHLRFIHAVERLGGQDRATPKLVL  108

Query  1010  QLMDIKGLNIAHVKSHLQMYRSKKTEDPSQGFANHRAFMEGGDRNVFNLSQLPMFKIFNN  831
             QLM+IKGL+IAHVKSHLQMYRSKKT+DP+Q   + R  +E GD ++FNLSQLP  +   N
Sbjct  109   QLMNIKGLSIAHVKSHLQMYRSKKTDDPNQISTDGRFLIENGDHHIFNLSQLPRLQGTFN  168

Query  830   QRLNPPFRYGD  798
             Q  +   RY D
Sbjct  169   QTSSSSLRYED  179



>ref|XP_011076824.1| PREDICTED: uncharacterized protein LOC105160975 [Sesamum indicum]
Length=328

 Score =   179 bits (454),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 93/166 (56%), Positives = 117/166 (70%), Gaps = 9/166 (5%)
 Frame = -2

Query  1241  EEDEDETNESPRNQTVKDGGSSSNSTVEESGEKKA---SVRPYVRSKMPRLRWTPDLHLR  1071
             EE  D+ +  P N     G SSSNSTVEE+  +K    SVR Y RSK PRLRWTP+LHL 
Sbjct  16    EEKTDQDSSRPMN-----GNSSSNSTVEENNGRKVNSGSVRQYTRSKTPRLRWTPELHLC  70

Query  1070  FLHAVERLGGQERATPKLVLQLMDIKGLNIAHVKSHLQMYRSKKTEDPSQGFANHRAFME  891
             F+HAVERLGG+ERATPKLVLQLM++KGL+IAHVKSHLQMYRSKK +DP+Q  + HR  ++
Sbjct  71    FVHAVERLGGEERATPKLVLQLMNVKGLSIAHVKSHLQMYRSKKIDDPNQVLSEHRLLLD  130

Query  890   GGDRNVFNLSQLPMFKIFNNQRLNPPFRYGDDSYRNCQEKWMNGTA  753
              GDR+++NLSQLP+ +  N   ++   RY D  + + Q   M  T 
Sbjct  131   AGDRHIYNLSQLPVLQTPNQTPIS-SLRYRDAIWGSSQSNSMYRTG  175



>gb|KDP44725.1| hypothetical protein JCGZ_01225 [Jatropha curcas]
Length=367

 Score =   179 bits (455),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 97/165 (59%), Positives = 112/165 (68%), Gaps = 14/165 (8%)
 Frame = -2

Query  1247  KFEEDEDETNESPRNQTVKDGG----SSSNSTVEESGEKKA-------SVRPYVRSKMPR  1101
             K  ED+D   E  +    K       S+SNS+V+E  EKK        SVR Y+RSKMPR
Sbjct  22    KSHEDDDSDEEVNKKNCCKQRNEEIISTSNSSVDEESEKKEKDSATTRSVRQYIRSKMPR  81

Query  1100  LRWTPDLHLRFLHAVERLGGQERATPKLVLQLMDIKGLNIAHVKSHLQMYRSKKTEDPSQ  921
             LRWTPDLHL F+HAVERLGGQERATPKLVLQLM+IKGL+IAHVKSHLQMYRSKK +D +Q
Sbjct  82    LRWTPDLHLCFVHAVERLGGQERATPKLVLQLMNIKGLSIAHVKSHLQMYRSKKIDDANQ  141

Query  920   GFANHRAFMEGGDRNVFNLSQLPMFKIFNNQRLNPPFRYGDDSYR  786
             G    R   EG D N+FNLSQL M + FN +      RY D S+R
Sbjct  142   G---QRLLFEGDDHNIFNLSQLSMLQGFNQKPNFTNLRYRDVSWR  183



>ref|XP_007140226.1| hypothetical protein PHAVU_008G094800g [Phaseolus vulgaris]
 gb|ESW12220.1| hypothetical protein PHAVU_008G094800g [Phaseolus vulgaris]
Length=364

 Score =   179 bits (454),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 88/122 (72%), Positives = 104/122 (85%), Gaps = 3/122 (2%)
 Frame = -2

Query  1166  TVEESGEKKASVRPYVRSKMPRLRWTPDLHLRFLHAVERLGGQERATPKLVLQLMDIKGL  987
             TVEE+ EKKA+VRPYVRSK+PRLRWTPDLHLRF+HAV+RLGGQERATPKLVLQLM+IKGL
Sbjct  49    TVEEN-EKKATVRPYVRSKLPRLRWTPDLHLRFVHAVQRLGGQERATPKLVLQLMNIKGL  107

Query  986   NIAHVKSHLQMYRSKKTEDPSQGFANHRAFMEGGDRNVFNLSQLPMFKIFNNQRLNPPFR  807
             +IAHVKSHLQMYRSKK E  +Q   + R  +E GDRNV+NLSQ+PM + +N  + +  FR
Sbjct  108   SIAHVKSHLQMYRSKKVE-ANQVLGDPRLLVETGDRNVYNLSQIPMLQGYNPSQTS-TFR  165

Query  806   YG  801
             YG
Sbjct  166   YG  167



>ref|XP_009611229.1| PREDICTED: uncharacterized protein LOC104104777 isoform X1 [Nicotiana 
tomentosiformis]
Length=382

 Score =   179 bits (455),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 90/132 (68%), Positives = 106/132 (80%), Gaps = 4/132 (3%)
 Frame = -2

Query  1181  SSSNSTVEESGEKKAS---VRPYVRSKMPRLRWTPDLHLRFLHAVERLGGQERATPKLVL  1011
             SSSNSTVEE+G+K  +   VR YVRSK PRLRWTP+LHLRF+HAVERLGGQ+RATPKLVL
Sbjct  49    SSSNSTVEENGKKSTNSGGVRQYVRSKTPRLRWTPELHLRFIHAVERLGGQDRATPKLVL  108

Query  1010  QLMDIKGLNIAHVKSHLQMYRSKKTEDPSQGFA-NHRAFMEGGDRNVFNLSQLPMFKIFN  834
             QLM+IKGL+IAHVKSHLQMYRSKKT+DP+Q  + + R  +E GD N+FNLSQLP  +   
Sbjct  109   QLMNIKGLSIAHVKSHLQMYRSKKTDDPNQTVSTDGRFLIENGDHNIFNLSQLPRLQGTF  168

Query  833   NQRLNPPFRYGD  798
             NQ  +   RY D
Sbjct  169   NQASSSSLRYED  180



>ref|XP_004307667.1| PREDICTED: uncharacterized protein LOC101309095 [Fragaria vesca 
subsp. vesca]
Length=392

 Score =   179 bits (453),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 90/140 (64%), Positives = 109/140 (78%), Gaps = 6/140 (4%)
 Frame = -2

Query  1193  KDGG-SSSNSTVEESGEKKA-----SVRPYVRSKMPRLRWTPDLHLRFLHAVERLGGQER  1032
             K+GG SSS+ST+EE+ + K      SVR YVRSK  RLRWTPDLHLRF+HAVERLGGQER
Sbjct  69    KNGGVSSSSSTIEENEKSKGASGGGSVRQYVRSKNSRLRWTPDLHLRFIHAVERLGGQER  128

Query  1031  ATPKLVLQLMDIKGLNIAHVKSHLQMYRSKKTEDPSQGFANHRAFMEGGDRNVFNLSQLP  852
             ATPKLVLQLM+IKGL+IAHVKSHLQMYRSKK EDP+Q  +    + EGGD +++NL+QL 
Sbjct  129   ATPKLVLQLMNIKGLSIAHVKSHLQMYRSKKMEDPNQVLSEQGFYTEGGDNHIYNLTQLS  188

Query  851   MFKIFNNQRLNPPFRYGDDS  792
             M +  N+Q  +   RYG D+
Sbjct  189   MLQSLNHQWPSSGLRYGADA  208



>ref|XP_009791663.1| PREDICTED: uncharacterized protein LOC104238869 isoform X1 [Nicotiana 
sylvestris]
Length=382

 Score =   178 bits (452),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 89/132 (67%), Positives = 106/132 (80%), Gaps = 4/132 (3%)
 Frame = -2

Query  1181  SSSNSTVEESGEKKAS---VRPYVRSKMPRLRWTPDLHLRFLHAVERLGGQERATPKLVL  1011
             SSSNSTVEE+G+K  +   VR YVRSK PRLRWTP+LHLRF+HAVERLGGQ+RATPKLVL
Sbjct  49    SSSNSTVEENGKKSTNSGGVRQYVRSKTPRLRWTPELHLRFIHAVERLGGQDRATPKLVL  108

Query  1010  QLMDIKGLNIAHVKSHLQMYRSKKTEDPSQGFA-NHRAFMEGGDRNVFNLSQLPMFKIFN  834
             QLM+IKGL+IAHVKSHLQMYRSKKT+DP+Q  + + R  +E GD ++FNLSQLP  +   
Sbjct  109   QLMNIKGLSIAHVKSHLQMYRSKKTDDPNQTVSTDGRFLIENGDHHIFNLSQLPRLQGTF  168

Query  833   NQRLNPPFRYGD  798
             NQ  +   RY D
Sbjct  169   NQTSSSSLRYED  180



>ref|XP_008233790.1| PREDICTED: uncharacterized protein LOC103332813 [Prunus mume]
Length=360

 Score =   177 bits (448),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 94/149 (63%), Positives = 111/149 (74%), Gaps = 6/149 (4%)
 Frame = -2

Query  1202  QTVKDGGSSSNSTVEESGEK--KASVRPYVRSKMPRLRWTPDLHLRFLHAVERLGGQERA  1029
             Q   +G SSSNST+EE+ +K    SVR YVRSK  RLRWTPDLHL F+HAVERLGGQERA
Sbjct  43    QLRNNGVSSSNSTIEENEKKGVSGSVRQYVRSKTSRLRWTPDLHLCFVHAVERLGGQERA  102

Query  1028  TPKLVLQLMDIKGLNIAHVKSHLQMYRSKKTEDPSQGFANHRAFMEGGDRNVFNLSQLPM  849
             TPKLVLQLM++KGL+IAHVKSHLQMYRSKK EDP Q  +    FMEGGD +++NL+QL M
Sbjct  103   TPKLVLQLMNVKGLSIAHVKSHLQMYRSKKMEDPDQVMSEQGFFMEGGDNHIYNLTQLSM  162

Query  848   FKIFNNQRLNPPFRYG---DDSYRNCQEK  771
              + F NQ  +   RYG   D S+R  Q +
Sbjct  163   LQSF-NQWPSSGLRYGTATDASWRGRQHQ  190



>ref|XP_009410557.1| PREDICTED: uncharacterized protein LOC103992543 [Musa acuminata 
subsp. malaccensis]
Length=300

 Score =   174 bits (442),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 99/189 (52%), Positives = 126/189 (67%), Gaps = 14/189 (7%)
 Frame = -2

Query  1292  SGETVCSKTTSDDSNKFEEDEDETNESPRNQTVKDGGSSSNSTVEESGEKKASVRPYVRS  1113
             SG  +  +++  + +  EED ++   SPRN     GGSSSNSTVEE+ ++K +VR YVRS
Sbjct  4     SGSAISRRSSPSERDMVEEDGED---SPRN-----GGSSSNSTVEEN-DRKVAVRQYVRS  54

Query  1112  KMPRLRWTPDLHLRFLHAVERLGGQERATPKLVLQLMDIKGLNIAHVKSHLQMYRSKKTE  933
             K PRLRWTPDLHL F+HAVERLGG++RATPKLVLQLM++KGL+IAHVKSHLQMYRSK  +
Sbjct  55    KNPRLRWTPDLHLCFVHAVERLGGKDRATPKLVLQLMNVKGLSIAHVKSHLQMYRSKNED  114

Query  932   DPSQGFANHRAFMEGGDRNVFNLSQLPMFKIFNNQRLNPPFRYGDDSYRNCQEKWMNGTA  753
                 G AN R  M+GG  + ++LS LP+   F +QR N   R  D S+      WM    
Sbjct  115   ---SGHANPRNLMQGGQPHAYSLSHLPLLHAF-HQRPNSKSRPDDVSW-GSHRYWMPNQI  169

Query  752   MAHGTADRG  726
             +A   A  G
Sbjct  170   LARAMATTG  178



>ref|XP_002528326.1| DNA binding protein, putative [Ricinus communis]
 gb|EEF34084.1| DNA binding protein, putative [Ricinus communis]
Length=375

 Score =   176 bits (447),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 101/180 (56%), Positives = 123/180 (68%), Gaps = 27/180 (15%)
 Frame = -2

Query  1241  EEDEDETNES---PRNQTVKDGGSSSNSTV--EESGEKKA------SVRPYVRSKMPRLR  1095
             +ED++E   S   PRN+      SS++S+V  EE  EKK       SVR Y RSKMPRLR
Sbjct  22    DEDDEEVKRSCFKPRNRE----SSSNDSSVDHEEISEKKEGSKATRSVRQYNRSKMPRLR  77

Query  1094  WTPDLHLRFLHAVERLGGQERATPKLVLQLMDIKGLNIAHVKSHLQMYRSKKTEDPS--Q  921
             WTPDLHL F+HAVERLGG+ERATPKLVLQ+M+IKGL+IAHVKSHLQMYRSKK +D +  Q
Sbjct  78    WTPDLHLCFVHAVERLGGEERATPKLVLQMMNIKGLSIAHVKSHLQMYRSKKIDDATREQ  137

Query  920   GFANHRAFMEGGDRNVFNLSQLPMFKIFNNQRLNPPFRYGDDSYRNCQEKWMNGTAMAHG  741
             G  +     EGGDRN+FNL Q+PM + FN +     FRYGD S R+    +M G  +  G
Sbjct  138   GLIS-----EGGDRNIFNLGQIPMLQTFNQEPF-ANFRYGDASRRS----FMGGAVIHRG  187



>ref|XP_010517119.1| PREDICTED: uncharacterized protein LOC104792627 isoform X2 [Camelina 
sativa]
Length=328

 Score =   175 bits (444),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 87/127 (69%), Positives = 101/127 (80%), Gaps = 14/127 (11%)
 Frame = -2

Query  1181  SSSNSTVEESGEKKASVRPYVRSKMPRLRWTPDLHLRFLHAVERLGGQERATPKLVLQLM  1002
             +SSNSTVEES +KK  VRPYVRSK+PRLRWTPDLHLRF+ AVERLGGQERATPKLV Q+M
Sbjct  27    ASSNSTVEES-DKKTKVRPYVRSKVPRLRWTPDLHLRFVRAVERLGGQERATPKLVRQMM  85

Query  1001  DIKGLNIAHVKSHLQMYRSKKTEDPSQGFANHRAFMEGGDRNVFNLSQLPMFKIFNNQRL  822
             +IKGL+IAHVKSHLQMYRSKK +D             G DRN++ LSQLPMF+ +N+   
Sbjct  86    NIKGLSIAHVKSHLQMYRSKKIDD------------HGQDRNIYKLSQLPMFRGYNHNN-  132

Query  821   NPPFRYG  801
             + PFRYG
Sbjct  133   DSPFRYG  139



>ref|XP_007220942.1| hypothetical protein PRUPE_ppa025397mg [Prunus persica]
 gb|EMJ22141.1| hypothetical protein PRUPE_ppa025397mg [Prunus persica]
Length=351

 Score =   176 bits (445),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 93/149 (62%), Positives = 111/149 (74%), Gaps = 6/149 (4%)
 Frame = -2

Query  1202  QTVKDGGSSSNSTVEESGEK--KASVRPYVRSKMPRLRWTPDLHLRFLHAVERLGGQERA  1029
             Q   +G SSSNST+EE+ +K    SVR YVRSK  RLRWTPDLHL F+HAVERLGGQERA
Sbjct  36    QLRNNGVSSSNSTIEENEKKGVSGSVRQYVRSKTSRLRWTPDLHLCFVHAVERLGGQERA  95

Query  1028  TPKLVLQLMDIKGLNIAHVKSHLQMYRSKKTEDPSQGFANHRAFMEGGDRNVFNLSQLPM  849
             TPKLVLQLM++KGL+IAHVKSHLQMYRSKK EDP Q  +    FMEGGD +++NL+QL M
Sbjct  96    TPKLVLQLMNVKGLSIAHVKSHLQMYRSKKMEDPDQVMSEQGFFMEGGDNHIYNLTQLSM  155

Query  848   FKIFNNQRLNPPFRYG---DDSYRNCQEK  771
              + F NQ  +   RYG   D ++R  Q +
Sbjct  156   LQSF-NQWPSSGLRYGTATDAAWRGRQHQ  183



>ref|XP_010509197.1| PREDICTED: uncharacterized protein LOC104785641 isoform X2 [Camelina 
sativa]
Length=324

 Score =   175 bits (443),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 87/127 (69%), Positives = 101/127 (80%), Gaps = 14/127 (11%)
 Frame = -2

Query  1181  SSSNSTVEESGEKKASVRPYVRSKMPRLRWTPDLHLRFLHAVERLGGQERATPKLVLQLM  1002
             +SSNSTVEES +KK  VRPYVRSK+PRLRWTPDLHLRF+ AVERLGGQERATPKLV Q+M
Sbjct  23    ASSNSTVEES-DKKTKVRPYVRSKVPRLRWTPDLHLRFVRAVERLGGQERATPKLVRQMM  81

Query  1001  DIKGLNIAHVKSHLQMYRSKKTEDPSQGFANHRAFMEGGDRNVFNLSQLPMFKIFNNQRL  822
             +IKGL+IAHVKSHLQMYRSKK +D             G DRN++ LSQLPMF+ +N+   
Sbjct  82    NIKGLSIAHVKSHLQMYRSKKIDD------------HGQDRNIYKLSQLPMFRGYNHNN-  128

Query  821   NPPFRYG  801
             + PFRYG
Sbjct  129   DSPFRYG  135



>ref|XP_010505451.1| PREDICTED: two-component response regulator ARR18-like isoform 
X2 [Camelina sativa]
Length=328

 Score =   175 bits (443),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 87/127 (69%), Positives = 101/127 (80%), Gaps = 14/127 (11%)
 Frame = -2

Query  1181  SSSNSTVEESGEKKASVRPYVRSKMPRLRWTPDLHLRFLHAVERLGGQERATPKLVLQLM  1002
             +SSNSTVEES +KK  VRPYVRSK+PRLRWTPDLHLRF+ AVERLGGQERATPKLV Q+M
Sbjct  27    ASSNSTVEES-DKKTKVRPYVRSKVPRLRWTPDLHLRFVRAVERLGGQERATPKLVRQMM  85

Query  1001  DIKGLNIAHVKSHLQMYRSKKTEDPSQGFANHRAFMEGGDRNVFNLSQLPMFKIFNNQRL  822
             +IKGL+IAHVKSHLQMYRSKK +D             G DRN++ LSQLPMF+ +N+   
Sbjct  86    NIKGLSIAHVKSHLQMYRSKKIDD------------HGQDRNIYKLSQLPMFRGYNHNS-  132

Query  821   NPPFRYG  801
             + PFRYG
Sbjct  133   DSPFRYG  139



>ref|XP_010922593.1| PREDICTED: uncharacterized protein LOC105045864 isoform X2 [Elaeis 
guineensis]
Length=359

 Score =   176 bits (445),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 105/223 (47%), Positives = 137/223 (61%), Gaps = 24/223 (11%)
 Frame = -2

Query  1229  DETNESPRNQTVKDGGSSSNSTVEESGEKKAS--VRPYVRSKMPRLRWTPDLHLRFLHAV  1056
             DE  E   N  ++ GGSSSNSTVEESG K +S  VR YVRSK PRLRWTP+LHL F+HA+
Sbjct  17    DEVEEDGVN-NLRHGGSSSNSTVEESGRKASSGTVRQYVRSKNPRLRWTPELHLCFVHAI  75

Query  1055  ERLGGQERATPKLVLQLMDIKGLNIAHVKSHLQMYRSKKTEDPSQGFANHRAFMEGGDRN  876
             E LGGQ+RATPK+VLQLM++KGL+IAHVKSHLQMYRSKK +D  Q  A+ R+ M+G +++
Sbjct  76    ETLGGQDRATPKMVLQLMNVKGLSIAHVKSHLQMYRSKKIDDSGQVIADPRSVMQGREQH  135

Query  875   VFNLSQLPMFKIFNNQRL-NPPFRYGDDSYRNCQEKWMNGTAMAHGTADRGRP--YEALY  705
             + NLS LPM   F+   + N  F   DD +      WM+   +       G P  Y ++ 
Sbjct  136   INNLSHLPMLHSFHQWPISNSRF---DDYFWASPRNWMHNQVLGRAMNSTGEPRSYGSIT  192

Query  704   E-------RFRSNYDLSRETINPPFTERSNR------GLHELK  615
             E       R +SN D    T +     R++R      GLH+ +
Sbjct  193   EMVFRGGDRLKSNQDF--HTKDSSLDHRASRELCEASGLHDYR  233



>ref|XP_009369202.1| PREDICTED: uncharacterized protein LOC103958635 [Pyrus x bretschneideri]
Length=373

 Score =   175 bits (444),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 91/142 (64%), Positives = 107/142 (75%), Gaps = 5/142 (4%)
 Frame = -2

Query  1202  QTVKDGGSSSNSTVEESGEKKA---SVRPYVRSKMPRLRWTPDLHLRFLHAVERLGGQER  1032
             Q   +G SSSNST+EE+ EKK    SVR YVRSK  RLRWTPDLHL F+ AVERLGGQER
Sbjct  41    QLKNNGDSSSNSTIEENHEKKGASGSVRHYVRSKTSRLRWTPDLHLCFVRAVERLGGQER  100

Query  1031  ATPKLVLQLMDIKGLNIAHVKSHLQMYRSKKTEDPSQGFANHRA-FMEGGDRNVFNLSQL  855
             ATPKLVLQLM++KGL+IAHVKSHLQMYRSKKTEDP+Q   +    FMEGGD  ++NL+QL
Sbjct  101   ATPKLVLQLMNVKGLSIAHVKSHLQMYRSKKTEDPNQVLTDQAGFFMEGGDNQLYNLTQL  160

Query  854   PMFKIFNNQRLNPPFRYGDDSY  789
              M + FN    +   RYG + +
Sbjct  161   SMLQSFNRWS-SSGLRYGANDH  181



>ref|XP_004246781.1| PREDICTED: probable transcription factor KAN2 [Solanum lycopersicum]
Length=146

 Score =   167 bits (423),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 94/142 (66%), Positives = 114/142 (80%), Gaps = 8/142 (6%)
 Frame = -2

Query  1292  SGETVC-SKTTSDDSNKFEEDEDETNESPRNQTVKDGGSSSNSTVEESGEKKASVRPYVR  1116
             SGET C SKT+ +  N+  E+ D +++       KDGGSSS ST+EES + K  VRPYVR
Sbjct  5     SGETGCNSKTSCNFENEVLEENDASSK------FKDGGSSSESTLEESEKIKPCVRPYVR  58

Query  1115  SKMPRLRWTPDLHLRFLHAVERLGGQERATPKLVLQLMDIKGLNIAHVKSHLQMYRSKKT  936
             SKM RLRWTP+LHLRF+HAVERLGGQ+RATPKLVLQ+M+IKGL+IAHVKSHLQM+RSKKT
Sbjct  59    SKMARLRWTPELHLRFVHAVERLGGQDRATPKLVLQMMNIKGLSIAHVKSHLQMFRSKKT  118

Query  935   EDPSQGFA-NHRAFMEGGDRNV  873
             +D SQG   +H+ FMEGGD N+
Sbjct  119   DDQSQGIGHHHKLFMEGGDPNI  140



>ref|XP_010105426.1| Putative Myb family transcription factor [Morus notabilis]
 gb|EXC04701.1| Putative Myb family transcription factor [Morus notabilis]
Length=422

 Score =   176 bits (445),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 101/199 (51%), Positives = 123/199 (62%), Gaps = 30/199 (15%)
 Frame = -2

Query  1190  DGGSSSNSTVEES--GEKK------ASVRPYVRSKMPRLRWTPDLHLRFLHAVERLGGQE  1035
             +G SSSNSTVEE+  G  K       SVR Y+RSK PRLRWTPDLHL F+ AVERLGGQE
Sbjct  54    NGRSSSNSTVEENNNGSSKKGSASGGSVRQYIRSKTPRLRWTPDLHLCFVRAVERLGGQE  113

Query  1034  RATPKLVLQLMDIKGLNIAHVKSHLQMYRSKKTEDPSQG-------FANHRAFMEGGDRN  876
             RATPKLVLQ+M+IKGL+IAHVKSHLQMYRSKK EDP+Q         +    F+EGGD  
Sbjct  114   RATPKLVLQMMNIKGLSIAHVKSHLQMYRSKKIEDPNQDPHSFKTVLSEQGFFLEGGDHQ  173

Query  875   VFNLSQLPMFKIFNNQRLNPPF-RYGDDSYRNCQEKWMNGTAMAHGTADRGRPYEALYER  699
             ++NLSQLPM + FN    +    RY D S+R+              T D  + Y   Y  
Sbjct  174   IYNLSQLPMLQGFNQWPTSSGLIRYADSSWRSS-------------TRDH-QIYSPQYSS  219

Query  698   FRSNYDLSRETINPPFTER  642
             FR+ +D ++  +     ER
Sbjct  220   FRTAFDSAKNGVYGSVAER  238



>ref|XP_011001163.1| PREDICTED: uncharacterized protein LOC105108499 [Populus euphratica]
 ref|XP_011001232.1| PREDICTED: uncharacterized protein LOC105108499 [Populus euphratica]
Length=367

 Score =   174 bits (440),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 98/171 (57%), Positives = 118/171 (69%), Gaps = 16/171 (9%)
 Frame = -2

Query  1241  EEDEDETNESPRNQTVKDGGSSSNSTVEESGEKKA--SVRPYVRSKMPRLRWTPDLHLRF  1068
             EE+ D  N   +N+    G S+SNS++EE+ +K A  S R Y+RSKMPRLRWTPDLHL F
Sbjct  26    EEEVDGINFKSKNE----GQSTSNSSIEENKKKAANGSFRQYIRSKMPRLRWTPDLHLCF  81

Query  1067  LHAVERLGGQERATPKLVLQLMDIKGLNIAHVKSHLQMYRSKKTEDPSQGFANHRAFMEG  888
             +HAVERLGGQ+RATPKLVLQ+M+IK LNIAHVKSHLQMYRSK++EDP QG        EG
Sbjct  82    VHAVERLGGQDRATPKLVLQMMNIKDLNIAHVKSHLQMYRSKRSEDPGQG---QGLLFEG  138

Query  887   GDRNVFNLSQLPMFKIFNNQRLNPPFRYGDDSYRN-----CQEKWMNGTAM  750
             GD  + NL QL M + F NQR     RYGD S+       C   +M GTA+
Sbjct  139   GDNPICNLRQLAMPQDF-NQRSPFNLRYGDASWIGHDHMMC-SAYMGGTAL  187



>ref|XP_006583667.1| PREDICTED: uncharacterized protein LOC102662997 isoform X3 [Glycine 
max]
Length=357

 Score =   173 bits (439),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 106/203 (52%), Positives = 132/203 (65%), Gaps = 20/203 (10%)
 Frame = -2

Query  1166  TVEESGEKKASVRPYVRSKMPRLRWTPDLHLRFLHAVERLGGQERATPKLVLQLMDIKGL  987
             TVEE+ EKK +VRPYVRSKMPRLRWTPDLHLRF+HAV+RLGGQERATPKLVLQLM+IKGL
Sbjct  48    TVEEN-EKKTTVRPYVRSKMPRLRWTPDLHLRFIHAVQRLGGQERATPKLVLQLMNIKGL  106

Query  986   NIAHVKSHLQMYRSKKTEDPSQGFANHRAFMEGGDRNVFNLSQLPMFKIFNNQRLNPPFR  807
             +IAHVKSHLQMYRSKK  D +Q         E GDRNV+NLSQLPM + +N  + +  +R
Sbjct  107   SIAHVKSHLQMYRSKKV-DTNQ---------ETGDRNVYNLSQLPMLQGYNPSQ-SSAYR  155

Query  806   YG-DDSYRNCQEKWMNGTAMAHGTADR-GRPY--EALYERFRSN----YDLSRETINPPF  651
             YG  D+     E  ++G  M   + D  G  +    L     SN    +++ +   +  F
Sbjct  156   YGYGDASLAIYENMVHGPFMNRSSLDESGAEFCGSRLTHGTNSNINWIHNMFQVDSSSSF  215

Query  650   TERSNRGLHELKEKLGSFLENQT  582
              E S   +HE K K  SF  N++
Sbjct  216   NEPSTSKVHEPKHKFFSFGGNES  238



>ref|XP_010257082.1| PREDICTED: uncharacterized protein LOC104597310 [Nelumbo nucifera]
Length=350

 Score =   173 bits (439),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 109/245 (44%), Positives = 143/245 (58%), Gaps = 22/245 (9%)
 Frame = -2

Query  1253  SNKFEEDEDETNESPRNQTVKDGGSSSNSTVEESGEKKAS----VRPYVRSKMPRLRWTP  1086
             SNK E++E +    P     K   SSSNSTVEES +K +S    +R Y+RSKMPRLRWTP
Sbjct  17    SNKSEDEEGDDEVMP-----KTSASSSNSTVEESEKKPSSGEGKMRQYIRSKMPRLRWTP  71

Query  1085  DLHLRFLHAVERLGGQERATPKLVLQLMDIKGLNIAHVKSHLQMYRSKKTEDPSQGFANH  906
             +LHL F+ AVERLGGQ+RATPKLVLQLM+IKGL+I+HVKSHLQMYRSKKT+DP Q   ++
Sbjct  72    ELHLCFVQAVERLGGQDRATPKLVLQLMNIKGLSISHVKSHLQMYRSKKTDDPGQVLNDN  131

Query  905   RAFMEGGDRNVF-NLSQLPMFKIFNNQRLNPPFRYGDDSYRNCQEKWMNGTAMAHGTADR  729
                +E  + +++ N  +LPM     N R +   RY D         W   + M      R
Sbjct  132   EYLLENWNHHIYNNPCRLPMLPSL-NPRFSSNIRYPDVLRTTGHGNWFPSSYMGGEAIAR  190

Query  728   GRP--YEALYERF-------RSNYDLSRETINPPFTERSNRGLHELKEKLGSFLENQTWH  576
             GRP  Y ++ ER         SN D   + +N  FTE+S R  HE  +      + +++ 
Sbjct  191   GRPGFYGSVTERVFGGSGCKTSNSDFYMDKVN--FTEQSRRRAHEYPDDYKIPYDRESYQ  248

Query  575   HQFAP  561
              Q  P
Sbjct  249   TQTRP  253



>ref|XP_008369283.1| PREDICTED: uncharacterized protein LOC103432854 [Malus domestica]
Length=372

 Score =   173 bits (438),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 88/127 (69%), Positives = 101/127 (80%), Gaps = 4/127 (3%)
 Frame = -2

Query  1202  QTVKDGGSSSNSTVEESGEKKA---SVRPYVRSKMPRLRWTPDLHLRFLHAVERLGGQER  1032
             Q   +GGSSSNST+EE+ EKK    SVR YVRSK  RLRWTPDLHL F+ AVERLGGQER
Sbjct  41    QLRNNGGSSSNSTIEENHEKKGASGSVRQYVRSKTSRLRWTPDLHLCFIRAVERLGGQER  100

Query  1031  ATPKLVLQLMDIKGLNIAHVKSHLQMYRSKKTEDPSQGFANHRA-FMEGGDRNVFNLSQL  855
             ATPKLVLQLM++KGL+IAHVKSHLQMYRSKKTED +Q   +    FMEGGD  ++NL+QL
Sbjct  101   ATPKLVLQLMNVKGLSIAHVKSHLQMYRSKKTEDHNQVVTDQAGFFMEGGDNQLYNLTQL  160

Query  854   PMFKIFN  834
              M + FN
Sbjct  161   SMLQSFN  167



>ref|XP_008806053.1| PREDICTED: putative Myb family transcription factor At1g14600 
[Phoenix dactylifera]
Length=159

 Score =   165 bits (417),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 86/135 (64%), Positives = 108/135 (80%), Gaps = 5/135 (4%)
 Frame = -2

Query  1229  DETNESPRNQTVKDGGSSSNSTVEESGEKKAS---VRPYVRSKMPRLRWTPDLHLRFLHA  1059
             DE  E   N +++ GGSSSNSTVEES E+KAS   VR YVRSK PRLRWTP+LHL F+HA
Sbjct  17    DEVEEDGGN-SLRYGGSSSNSTVEES-ERKASSGAVRQYVRSKNPRLRWTPELHLCFVHA  74

Query  1058  VERLGGQERATPKLVLQLMDIKGLNIAHVKSHLQMYRSKKTEDPSQGFANHRAFMEGGDR  879
             VERLGGQ+RATPK+VLQLM++KGL+IAHVKSHLQMYRSKK ++  Q  A+ ++ M+G ++
Sbjct  75    VERLGGQDRATPKMVLQLMNVKGLSIAHVKSHLQMYRSKKIDESGQVIADPKSAMQGREQ  134

Query  878   NVFNLSQLPMFKIFN  834
             ++ NLS LPM   F+
Sbjct  135   HINNLSHLPMLHSFH  149



>ref|XP_010922591.1| PREDICTED: uncharacterized protein LOC105045864 isoform X1 [Elaeis 
guineensis]
Length=361

 Score =   171 bits (433),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 105/225 (47%), Positives = 137/225 (61%), Gaps = 26/225 (12%)
 Frame = -2

Query  1229  DETNESPRNQTVKDGGSSSNSTVEESGEKKAS--VRPYVRSKMPRLRWTPDLHLRFLHAV  1056
             DE  E   N  ++ GGSSSNSTVEESG K +S  VR YVRSK PRLRWTP+LHL F+HA+
Sbjct  17    DEVEEDGVN-NLRHGGSSSNSTVEESGRKASSGTVRQYVRSKNPRLRWTPELHLCFVHAI  75

Query  1055  ERLGGQERA--TPKLVLQLMDIKGLNIAHVKSHLQMYRSKKTEDPSQGFANHRAFMEGGD  882
             E LGGQ+RA  TPK+VLQLM++KGL+IAHVKSHLQMYRSKK +D  Q  A+ R+ M+G +
Sbjct  76    ETLGGQDRAGATPKMVLQLMNVKGLSIAHVKSHLQMYRSKKIDDSGQVIADPRSVMQGRE  135

Query  881   RNVFNLSQLPMFKIFNNQRL-NPPFRYGDDSYRNCQEKWMNGTAMAHGTADRGRP--YEA  711
             +++ NLS LPM   F+   + N  F   DD +      WM+   +       G P  Y +
Sbjct  136   QHINNLSHLPMLHSFHQWPISNSRF---DDYFWASPRNWMHNQVLGRAMNSTGEPRSYGS  192

Query  710   LYE-------RFRSNYDLSRETINPPFTERSNR------GLHELK  615
             + E       R +SN D    T +     R++R      GLH+ +
Sbjct  193   ITEMVFRGGDRLKSNQDF--HTKDSSLDHRASRELCEASGLHDYR  235



>ref|XP_004148628.1| PREDICTED: probable transcription factor KAN2-like [Cucumis sativus]
Length=201

 Score =   166 bits (420),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 81/121 (67%), Positives = 94/121 (78%), Gaps = 11/121 (9%)
 Frame = -2

Query  1184  GSSSNSTVEESGE--------KKASVRPYVRSKMPRLRWTPDLHLRFLHAVERLGGQERA  1029
             GSSSNST+EE+          K  +VRPYVRSK+PRLRWTPDLHLRF+HAVERLGGQE A
Sbjct  36    GSSSNSTIEENNNNDHDQHKTKPPTVRPYVRSKLPRLRWTPDLHLRFVHAVERLGGQENA  95

Query  1028  TPKLVLQLMDIKGLNIAHVKSHLQMYRSKKTEDPSQGFANHRAFM---EGGDRNVFNLSQ  858
             TPKLVLQLM+IKGL+IAHVKSHLQMYRSKKT +P Q   + R  M     GDRN+FN+ +
Sbjct  96    TPKLVLQLMNIKGLSIAHVKSHLQMYRSKKTNEPGQVVGDQRVLMAESNNGDRNIFNIRR  155

Query  857   L  855
             +
Sbjct  156   V  156



>ref|XP_006353444.1| PREDICTED: uncharacterized protein LOC102588048 [Solanum tuberosum]
Length=381

 Score =   171 bits (433),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 86/131 (66%), Positives = 104/131 (79%), Gaps = 4/131 (3%)
 Frame = -2

Query  1163  VEESGEK--KASVRPYVRSKMPRLRWTPDLHLRFLHAVERLGGQERATPKLVLQLMDIKG  990
             VEE+G+K   ASVR YVRSK PRLRWTP+LHLRF+HAVERLGGQ+RATPKLVLQ M+IKG
Sbjct  56    VEENGKKTNSASVRQYVRSKTPRLRWTPELHLRFVHAVERLGGQDRATPKLVLQFMNIKG  115

Query  989   LNIAHVKSHLQMYRSKKTEDPSQGFANHRAFMEGGDRNVFNLSQLPMFKIFNNQRLNPPF  810
             L+IAHVKSHLQMYRSKKT+DP+Q   + R  +E GD ++FNL+QLP  + F NQ  +   
Sbjct  116   LSIAHVKSHLQMYRSKKTDDPNQISTDGRFLLENGDHHIFNLTQLPRLQGF-NQTSSSSL  174

Query  809   RYGDDSYRNCQ  777
             RY D++  N Q
Sbjct  175   RY-DNALWNRQ  184



>ref|XP_009345257.1| PREDICTED: uncharacterized protein LOC103937055 isoform X3 [Pyrus 
x bretschneideri]
Length=373

 Score =   167 bits (422),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 85/132 (64%), Positives = 101/132 (77%), Gaps = 9/132 (7%)
 Frame = -2

Query  1163  VEESGEKKA---SVRPYVRSKMPRLRWTPDLHLRFLHAVERLGGQERATPKLVLQLMDIK  993
             ++E+ EKK    SVR YVRSK  RLRWTPDLHLRF+HAVERLGGQERATPKLVLQLM++K
Sbjct  54    IDENHEKKGASGSVRQYVRSKTSRLRWTPDLHLRFVHAVERLGGQERATPKLVLQLMNVK  113

Query  992   GLNIAHVKSHLQMYRSKKTEDPSQGFANHRAFMEGGDRNVFNLSQLPMFKIFNNQRLNPP  813
             GL+IAHVKSHLQM+RSKK EDP+QGF     FMEGGD  ++NL+QL M + F  Q  +  
Sbjct  114   GLSIAHVKSHLQMHRSKKMEDPNQGF-----FMEGGDNQLYNLTQLSMLQSF-KQWPSSG  167

Query  812   FRYGDDSYRNCQ  777
              RYG   + + Q
Sbjct  168   LRYGATDHSSWQ  179



>ref|XP_010676796.1| PREDICTED: uncharacterized protein LOC104892532 isoform X2 [Beta 
vulgaris subsp. vulgaris]
Length=360

 Score =   166 bits (421),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 91/164 (55%), Positives = 111/164 (68%), Gaps = 12/164 (7%)
 Frame = -2

Query  1166  TVEE--SGEKKAS----VRPYVRSKMPRLRWTPDLHLRFLHAVERLGGQERATPKLVLQL  1005
             TVEE   G K++S    VRPY+RSK PRLRWTPDLHLRF+HAVERLGGQ++ATPKLVLQL
Sbjct  51    TVEEMSDGMKRSSSSTAVRPYIRSKTPRLRWTPDLHLRFIHAVERLGGQDKATPKLVLQL  110

Query  1004  MDIKGLNIAHVKSHLQMYRSKKTEDPSQGFANHRAFMEGGDRNVFNLSQLPMFKIFNNQR  825
             M+IKGL+IAHVKSHLQMYRSKK ED SQ   + +   E  D N+FNLSQLP+ + +  Q 
Sbjct  111   MNIKGLSIAHVKSHLQMYRSKKAEDQSQATCDQKHIFEVRDCNIFNLSQLPLLQGY-CQA  169

Query  824   LNPPFRYGDDSYRNCQEKWMNGTAMAHGTAD-RGRPYEALYERF  696
              +  +R  D  +      W  G      TAD   R  E +++RF
Sbjct  170   PSSNYRSIDPMWTTTNPSWTRGLY----TADMESRVNENVWQRF  209



>ref|XP_010937910.1| PREDICTED: uncharacterized protein LOC105057131 [Elaeis guineensis]
Length=360

 Score =   166 bits (420),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 98/186 (53%), Positives = 124/186 (67%), Gaps = 14/186 (8%)
 Frame = -2

Query  1280  VCSKTTSDDSNKFEEDEDETNESPRNQTVKDGGSSSNSTVEESGEKKA----SVRPYVRS  1113
             + +K  S+ S   E DE++ +E+PR+     G SSSNST+EES  KKA    SVR YVRS
Sbjct  1     MMAKNFSEKSADKEGDEEDGDENPRH-----GRSSSNSTIEES--KKATGSGSVRQYVRS  53

Query  1112  KMPRLRWTPDLHLRFLHAVERLGGQERATPKLVLQLMDIKGLNIAHVKSHLQMYRSKKTE  933
             K PRLRWTPDLHL F+HAVERLGGQ+RATPKLVLQLM++KGL+I HVKSHLQMYRSKK +
Sbjct  54    KNPRLRWTPDLHLCFVHAVERLGGQDRATPKLVLQLMNVKGLSIGHVKSHLQMYRSKKID  113

Query  932   DPSQGFANHRAFMEGGDRNVFNLSQLPMFKIFNNQRLNPPFRYGDDSYRNCQEKWMNGTA  753
                +  A+ R  +EG +R  ++ + L M   F +QR +   RY  DS  N  E W   + 
Sbjct  114   ASGRVIADSRNMIEGRERFAYSFNHLSMLHDF-HQRPHTYSRY--DSSLNGHEYWNTMSL  170

Query  752   MAHGTA  735
               H +A
Sbjct  171   GLHSSA  176



>ref|XP_011085124.1| PREDICTED: uncharacterized protein LOC105167199 [Sesamum indicum]
Length=316

 Score =   164 bits (415),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 87/149 (58%), Positives = 105/149 (70%), Gaps = 14/149 (9%)
 Frame = -2

Query  1232  EDETNESPRNQTVKDGGSSSNSTVEESGEK---KASVRPYVRSKMPRLRWTPDLHLRFLH  1062
             + E NES  N TV          VEESG+K     SVR Y RSK PRLRWTPDLHL FLH
Sbjct  11    QSEENESKPNSTVD---------VEESGKKVVSSGSVRHYTRSKTPRLRWTPDLHLCFLH  61

Query  1061  AVERLGGQERATPKLVLQLMDIKGLNIAHVKSHLQMYRSKKTEDPS-QGFANHRAFMEGG  885
             AVERLGGQERATPKLVLQLM++KGL+IAHVKSHLQMYRSKK +DP+ Q  +     ++ G
Sbjct  62    AVERLGGQERATPKLVLQLMNVKGLSIAHVKSHLQMYRSKKIDDPNHQVISEQELLLDAG  121

Query  884   DRNVFNLSQLPMFKIFNNQRLNPPFRYGD  798
             DR+++ L QLP+ + +N   ++  FRY D
Sbjct  122   DRHIYKLGQLPLLQGYNQAPIS-SFRYRD  149



>ref|XP_010322168.1| PREDICTED: putative two-component response regulator ARR21 isoform 
X2 [Solanum lycopersicum]
Length=374

 Score =   164 bits (416),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 81/122 (66%), Positives = 96/122 (79%), Gaps = 3/122 (2%)
 Frame = -2

Query  1163  VEESGEK--KASVRPYVRSKMPRLRWTPDLHLRFLHAVERLGGQERATPKLVLQLMDIKG  990
             VEE+G+K   ASVR YVRSK PRLRWTP+LHLRF+HAVERLGGQ+RATPKLVLQ M+IKG
Sbjct  49    VEENGKKPNSASVRQYVRSKTPRLRWTPELHLRFVHAVERLGGQDRATPKLVLQFMNIKG  108

Query  989   LNIAHVKSHLQMYRSKKTEDPSQGFANHRAFMEGGDRNVFNLSQLPMFKIFNNQRLNPPF  810
             L+IAHVKSHLQMYRSKKT+DP+Q   + R  +E GD ++FNL+QL     F  Q  +   
Sbjct  109   LSIAHVKSHLQMYRSKKTDDPNQISTDGRFLLENGDHHIFNLTQLSRLHGF-KQTSSSSL  167

Query  809   RY  804
             RY
Sbjct  168   RY  169



>ref|XP_008374244.1| PREDICTED: transcription factor LUX-like isoform X3 [Malus domestica]
 ref|XP_008362732.1| PREDICTED: transcription factor LUX-like isoform X3 [Malus domestica]
Length=404

 Score =   164 bits (416),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 80/111 (72%), Positives = 93/111 (84%), Gaps = 8/111 (7%)
 Frame = -2

Query  1166  TVEESGEKKA---SVRPYVRSKMPRLRWTPDLHLRFLHAVERLGGQERATPKLVLQLMDI  996
             T++E+ EKK    SVR YVRSK  RLRWTPDLHLRF+HAVERLGGQERATPKLVLQLM++
Sbjct  84    TIDENHEKKGASGSVRQYVRSKTSRLRWTPDLHLRFVHAVERLGGQERATPKLVLQLMNV  143

Query  995   KGLNIAHVKSHLQMYRSKKTEDPSQGFANHRAFMEGGDRNVFNLSQLPMFK  843
             KGL+IAHVKSHLQM+RSKK EDP+QGF     FMEGGD  ++NL+QL M +
Sbjct  144   KGLSIAHVKSHLQMHRSKKMEDPNQGF-----FMEGGDNQLYNLTQLSMLQ  189



>ref|XP_010322167.1| PREDICTED: putative two-component response regulator ARR21 isoform 
X1 [Solanum lycopersicum]
Length=375

 Score =   162 bits (410),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 81/123 (66%), Positives = 97/123 (79%), Gaps = 4/123 (3%)
 Frame = -2

Query  1163  VEESGEK--KASVRPYVRSKMPRLRWTPDLHLRFLHAVERLGGQERATPKLVLQLMDIKG  990
             VEE+G+K   ASVR YVRSK PRLRWTP+LHLRF+HAVERLGGQ+RATPKLVLQ M+IKG
Sbjct  49    VEENGKKPNSASVRQYVRSKTPRLRWTPELHLRFVHAVERLGGQDRATPKLVLQFMNIKG  108

Query  989   LNIAHVKSHLQMYRSKKTEDPSQGFA-NHRAFMEGGDRNVFNLSQLPMFKIFNNQRLNPP  813
             L+IAHVKSHLQMYRSKKT+DP+Q  + + R  +E GD ++FNL+QL     F  Q  +  
Sbjct  109   LSIAHVKSHLQMYRSKKTDDPNQTVSTDGRFLLENGDHHIFNLTQLSRLHGF-KQTSSSS  167

Query  812   FRY  804
              RY
Sbjct  168   LRY  170



>ref|XP_010676795.1| PREDICTED: uncharacterized protein LOC104892532 isoform X1 [Beta 
vulgaris subsp. vulgaris]
Length=361

 Score =   162 bits (409),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 91/165 (55%), Positives = 111/165 (67%), Gaps = 13/165 (8%)
 Frame = -2

Query  1166  TVEE--SGEKKAS----VRPYVRSKMPRLRWTPDLHLRFLHAVERLGGQERATPKLVLQL  1005
             TVEE   G K++S    VRPY+RSK PRLRWTPDLHLRF+HAVERLGGQ++ATPKLVLQL
Sbjct  51    TVEEMSDGMKRSSSSTAVRPYIRSKTPRLRWTPDLHLRFIHAVERLGGQDKATPKLVLQL  110

Query  1004  MDIKGLNIAHVKSHLQMYRSKKTEDPSQGF-ANHRAFMEGGDRNVFNLSQLPMFKIFNNQ  828
             M+IKGL+IAHVKSHLQMYRSKK ED SQ    + +   E  D N+FNLSQLP+ + +  Q
Sbjct  111   MNIKGLSIAHVKSHLQMYRSKKAEDQSQAATCDQKHIFEVRDCNIFNLSQLPLLQGY-CQ  169

Query  827   RLNPPFRYGDDSYRNCQEKWMNGTAMAHGTAD-RGRPYEALYERF  696
               +  +R  D  +      W  G      TAD   R  E +++RF
Sbjct  170   APSSNYRSIDPMWTTTNPSWTRGLY----TADMESRVNENVWQRF  210



>ref|XP_009345244.1| PREDICTED: uncharacterized protein LOC103937055 isoform X1 [Pyrus 
x bretschneideri]
Length=379

 Score =   162 bits (410),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 83/133 (62%), Positives = 100/133 (75%), Gaps = 5/133 (4%)
 Frame = -2

Query  1163  VEESGEKKA---SVRPYVRSKMPRLRWTPDLHLRFLHAVERLGGQERATPKLVLQLMDIK  993
             ++E+ EKK    SVR YVRSK  RLRWTPDLHLRF+HAVERLGGQERATPKLVLQLM++K
Sbjct  54    IDENHEKKGASGSVRQYVRSKTSRLRWTPDLHLRFVHAVERLGGQERATPKLVLQLMNVK  113

Query  992   GLNIAHVKSHLQMYRSKKTEDPSQGFANHRA-FMEGGDRNVFNLSQLPMFKIFNNQRLNP  816
             GL+IAHVKSHLQM+RSKK EDP+Q   +    FMEGGD  ++NL+QL M + F  Q  + 
Sbjct  114   GLSIAHVKSHLQMHRSKKMEDPNQVLTDQAGFFMEGGDNQLYNLTQLSMLQSF-KQWPSS  172

Query  815   PFRYGDDSYRNCQ  777
               RYG   + + Q
Sbjct  173   GLRYGATDHSSWQ  185



>ref|XP_009345251.1| PREDICTED: uncharacterized protein LOC103937055 isoform X2 [Pyrus 
x bretschneideri]
Length=376

 Score =   162 bits (409),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 84/132 (64%), Positives = 100/132 (76%), Gaps = 6/132 (5%)
 Frame = -2

Query  1163  VEESGEKKA---SVRPYVRSKMPRLRWTPDLHLRFLHAVERLGGQERATPKLVLQLMDIK  993
             ++E+ EKK    SVR YVRSK  RLRWTPDLHLRF+HAVERLGGQERATPKLVLQLM++K
Sbjct  54    IDENHEKKGASGSVRQYVRSKTSRLRWTPDLHLRFVHAVERLGGQERATPKLVLQLMNVK  113

Query  992   GLNIAHVKSHLQMYRSKKTEDPSQGFANHRAFMEGGDRNVFNLSQLPMFKIFNNQRLNPP  813
             GL+IAHVKSHLQM+RSKK EDP+Q  A    FMEGGD  ++NL+QL M + F  Q  +  
Sbjct  114   GLSIAHVKSHLQMHRSKKMEDPNQDQAG--FFMEGGDNQLYNLTQLSMLQSF-KQWPSSG  170

Query  812   FRYGDDSYRNCQ  777
              RYG   + + Q
Sbjct  171   LRYGATDHSSWQ  182



>ref|XP_010264567.1| PREDICTED: uncharacterized protein LOC104602538 isoform X1 [Nelumbo 
nucifera]
Length=358

 Score =   160 bits (406),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 85/157 (54%), Positives = 106/157 (68%), Gaps = 10/157 (6%)
 Frame = -2

Query  1253  SNKFEEDEDETNESPRNQTVKDGGSSSNSTVEESGEKKAS----VRPYVRSKMPRLRWTP  1086
             S K E++E +   +PR        SSSN +VEES  K +S    VR Y+RSKMPRLRWTP
Sbjct  19    SEKNEDEEGDDESTPRTSV-----SSSNCSVEESEMKASSGGGKVRQYIRSKMPRLRWTP  73

Query  1085  DLHLRFLHAVERLGGQERATPKLVLQLMDIKGLNIAHVKSHLQMYRSKKTEDPSQGFANH  906
             +LHL F+ AVERLGGQE+ATPKLVLQLM+IKGL+IAHVKSHLQMYRSKK +D  Q   + 
Sbjct  74    ELHLCFVQAVERLGGQEKATPKLVLQLMNIKGLSIAHVKSHLQMYRSKKVDDQGQVITDK  133

Query  905   RAFMEGGDRNVFNLSQLPMFKIFNNQRLNP-PFRYGD  798
               F++  D  ++N  Q+PM     +QR+     RY D
Sbjct  134   GFFLQTWDHRIYNPCQVPMLHSLLDQRIRSNIIRYTD  170



>ref|XP_010907869.1| PREDICTED: transcription activator GLK2-like isoform X2 [Elaeis 
guineensis]
Length=336

 Score =   159 bits (402),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 96/211 (45%), Positives = 132/211 (63%), Gaps = 21/211 (10%)
 Frame = -2

Query  1196  VKDGGSSSNSTVEESGEKKAS--VRPYVRSKMPRLRWTPDLHLRFLHAVERLGGQERATP  1023
             +++GGSSSNSTVEES  K +S  VR YVRSK PRLRWTP+LHL F+ AVERLGGQ+RATP
Sbjct  27    LRNGGSSSNSTVEESERKPSSGTVRQYVRSKNPRLRWTPELHLCFVQAVERLGGQDRATP  86

Query  1022  KLVLQLMDIKGLNIAHVKSHLQMYRSKKTEDPSQGFANHRAFMEGGDRNVFNLSQLPMFK  843
             K+VL+LM +KGL+IAHVKSHLQMYRSKK ++  Q  A+  + M+G  ++++NL  LPM  
Sbjct  87    KMVLELMKVKGLSIAHVKSHLQMYRSKKIDESGQVIADPWSVMKGTKQHIYNLGHLPMLH  146

Query  842   IFNNQRLNPPFRYGDDSY---RNCQE-----KWMNGTAMAHGTADRGRPYEALY---ERF  696
               + +   P  R    S+   RN  +     + MN T    G+   G   E ++   +R 
Sbjct  147   GCHQRPTIPNLRSDGSSWFGHRNWTQNPVLSRAMNSTV---GSRSHGSINEMIFRGSDRL  203

Query  695   RSNYDLSRETINPPFTERSNRGLHELKEKLG  603
             +SN D    T     +  +++ + EL+E  G
Sbjct  204   KSNQDFHINT-----SSSNHQAICELREATG  229



>ref|XP_008374237.1| PREDICTED: uncharacterized protein LOC103437524 isoform X2 [Malus 
domestica]
 ref|XP_008362731.1| PREDICTED: uncharacterized protein LOC103426420 isoform X2 [Malus 
domestica]
Length=407

 Score =   160 bits (405),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 79/111 (71%), Positives = 92/111 (83%), Gaps = 5/111 (5%)
 Frame = -2

Query  1166  TVEESGEKKA---SVRPYVRSKMPRLRWTPDLHLRFLHAVERLGGQERATPKLVLQLMDI  996
             T++E+ EKK    SVR YVRSK  RLRWTPDLHLRF+HAVERLGGQERATPKLVLQLM++
Sbjct  84    TIDENHEKKGASGSVRQYVRSKTSRLRWTPDLHLRFVHAVERLGGQERATPKLVLQLMNV  143

Query  995   KGLNIAHVKSHLQMYRSKKTEDPSQGFANHRAFMEGGDRNVFNLSQLPMFK  843
             KGL+IAHVKSHLQM+RSKK EDP+Q  A    FMEGGD  ++NL+QL M +
Sbjct  144   KGLSIAHVKSHLQMHRSKKMEDPNQDXAG--FFMEGGDNQLYNLTQLSMLQ  192



>ref|XP_002278456.1| PREDICTED: uncharacterized protein LOC100246669 [Vitis vinifera]
Length=356

 Score =   159 bits (401),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 136/359 (38%), Positives = 178/359 (50%), Gaps = 70/359 (19%)
 Frame = -2

Query  1292  SGETVCSKTTSDDSNKFEEDEDETNESPRNQTVKDGGSSSNSTVEESGEKKAS---VRPY  1122
             SG+   SKT      K +E ED+ N++      K   SS NS V++  EKK +   VR Y
Sbjct  8     SGKDDGSKTIDPFDGKDDEQEDDGNKT------KTSVSSGNSVVDQESEKKTTSNGVRQY  61

Query  1121  VRSKMPRLRWTPDLHLRFLHAVERLGGQERATPKLVLQLMDIKGLNIAHVKSHLQMYRSK  942
             VRSK+PRLRWTP+LHL F+ AVERLGGQERATPKLV QLM+IKGL+IAHVKSHLQMYRSK
Sbjct  62    VRSKVPRLRWTPNLHLCFVRAVERLGGQERATPKLVQQLMNIKGLSIAHVKSHLQMYRSK  121

Query  941   KTEDPSQGFANHRAFMEGGDRNVFNLSQLPMFKIFNNQRLNPPFRYGDDSYRNCQEKWM-  765
             K +D  Q   N R  +      V NL QLP F+   +QR+   FRY + S+      W+ 
Sbjct  122   KIDDKGQ-VINSRGQLHPNGSAVHNLWQLPTFESI-DQRVGFNFRYSNISW-GGHGDWIS  178

Query  764   --NGTAMAHGTADR--GRPYEAL-------YERFRSNYDLSRETINPPFTERSNRGLHEL  618
               +  AM  G  D   GR  + +        E F  N D +        TE+ ++  HE 
Sbjct  179   RPSMPAMGAGFHDSVAGRISKGIGTSLNRRNEVFYMNNDCT------LITEQYSKRPHEF  232

Query  617   KEKLGSFLENQTWHHQFAPQNPIQHQPIQVPEPKTMARTGSSVGSWVTDCRPEP-KTTVM  441
             +E+   F + +                         A T          CR  P +TT  
Sbjct  233   REEFQMFHDRE----------------------HIRALT----------CRSIPTETTCT  260

Query  440   NSLVGSWVADRGQEPKATTLENRNAAVSAKLQKQETMKRKA---DLDLNLSLGMKSMKE  273
               L    V D+G     +     +   S+  + Q ++KRKA   D+DLNLSL  +S KE
Sbjct  261   IQLHRRGVQDKGFNNSISL----DGNWSSNREDQNSLKRKAPDSDIDLNLSLNTRSRKE  315



>emb|CBI15915.3| unnamed protein product [Vitis vinifera]
Length=177

 Score =   153 bits (387),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 91/166 (55%), Positives = 109/166 (66%), Gaps = 11/166 (7%)
 Frame = -2

Query  1292  SGETVCSKTTSDDSNKFEEDEDETNESPRNQTVKDGGSSSNSTVEESGEKKAS---VRPY  1122
             SG+   SKT      K +E ED+ N++      K   SS NS V++  EKK +   VR Y
Sbjct  8     SGKDDGSKTIDPFDGKDDEQEDDGNKT------KTSVSSGNSVVDQESEKKTTSNGVRQY  61

Query  1121  VRSKMPRLRWTPDLHLRFLHAVERLGGQERATPKLVLQLMDIKGLNIAHVKSHLQMYRSK  942
             VRSK+PRLRWTP+LHL F+ AVERLGGQERATPKLV QLM+IKGL+IAHVKSHLQMYRSK
Sbjct  62    VRSKVPRLRWTPNLHLCFVRAVERLGGQERATPKLVQQLMNIKGLSIAHVKSHLQMYRSK  121

Query  941   KTEDPSQGFANHRAFMEGGDRNVFNLSQLPMFKIFNNQRLNPPFRY  804
             K +D  Q   N R  +      V NL QLP F+   +QR+   FRY
Sbjct  122   KIDDKGQ-VINSRGQLHPNGSAVHNLWQLPTFESI-DQRVGFNFRY  165



>gb|KHN23034.1| Putative Myb family transcription factor [Glycine soja]
Length=288

 Score =   156 bits (395),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 95/194 (49%), Positives = 120/194 (62%), Gaps = 29/194 (15%)
 Frame = -2

Query  1109  MPRLRWTPDLHLRFLHAVERLGGQERATPKLVLQLMDIKGLNIAHVKSHLQMYRSKKTED  930
             MPRLRWTPDLHLRF+HAV+RLGGQERATPKLVLQLM+IKGL+IAHVKSHLQMYRSKK  D
Sbjct  1     MPRLRWTPDLHLRFIHAVQRLGGQERATPKLVLQLMNIKGLSIAHVKSHLQMYRSKKV-D  59

Query  929   PSQGFANHRAFMEGGDRNVFNLSQLPMFKIFNNQRLNP--PFRYGDDS---YRN-CQEKW  768
              +Q  A+ R  +E GDRNV+NLSQLPM + +N  + +    + YGD S   Y N     +
Sbjct  60    TNQVLADPRLLVETGDRNVYNLSQLPMLQGYNPSQSSAYRQYGYGDASLAIYENMVHGPF  119

Query  767   MN------------GTAMAHGTADRGRPYEALYERFRSNYDLSRETINPPFTERSNRGLH  624
             MN            G+ + HGT         ++  F+ +   S  + N P T +    +H
Sbjct  120   MNRSSLDESGAEFCGSRLTHGTNSN---INWIHNMFQVD---SSSSFNEPSTSK----VH  169

Query  623   ELKEKLGSFLENQT  582
             E K K  SF  N++
Sbjct  170   EPKHKFFSFGGNES  183



>ref|XP_008374230.1| PREDICTED: uncharacterized protein LOC103437524 isoform X1 [Malus 
domestica]
 ref|XP_008362730.1| PREDICTED: uncharacterized protein LOC103426420 isoform X1 [Malus 
domestica]
Length=410

 Score =   159 bits (403),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 78/112 (70%), Positives = 92/112 (82%), Gaps = 4/112 (4%)
 Frame = -2

Query  1166  TVEESGEKKA---SVRPYVRSKMPRLRWTPDLHLRFLHAVERLGGQERATPKLVLQLMDI  996
             T++E+ EKK    SVR YVRSK  RLRWTPDLHLRF+HAVERLGGQERATPKLVLQLM++
Sbjct  84    TIDENHEKKGASGSVRQYVRSKTSRLRWTPDLHLRFVHAVERLGGQERATPKLVLQLMNV  143

Query  995   KGLNIAHVKSHLQMYRSKKTEDPSQGFANHRA-FMEGGDRNVFNLSQLPMFK  843
             KGL+IAHVKSHLQM+RSKK EDP+Q   +    FMEGGD  ++NL+QL M +
Sbjct  144   KGLSIAHVKSHLQMHRSKKMEDPNQVLTDXAGFFMEGGDNQLYNLTQLSMLQ  195



>gb|KHN20340.1| Putative Myb family transcription factor [Glycine soja]
Length=305

 Score =   155 bits (393),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 117/292 (40%), Positives = 151/292 (52%), Gaps = 62/292 (21%)
 Frame = -2

Query  1109  MPRLRWTPDLHLRFLHAVERLGGQERATPKLVLQLMDIKGLNIAHVKSHLQMYRSKKTED  930
             MPRLRWTPDLHLRF+HAV+RLGGQERATPKLVLQLM+IKGL+IAHVKSHLQMYRSKK  D
Sbjct  1     MPRLRWTPDLHLRFVHAVQRLGGQERATPKLVLQLMNIKGLSIAHVKSHLQMYRSKKV-D  59

Query  929   PSQGFANHRAFMEGGDRNVFNLSQLPMFKIFNNQRLNP--PFRYGDDS---YRNCQEK-W  768
              +Q  A+ R  +E GDRNV+NLSQLPM + +N  + +    + YGD S   Y N   + +
Sbjct  60    TNQVLADPRFLVETGDRNVYNLSQLPMLQGYNPSQSSSYRQYGYGDASLAIYENMVHRPF  119

Query  767   MNGTAMAHGTADRGRPYEALYERFR---SNYDLSRETI----NPPFTERSNRGLHELKEK  609
             MN +++    A+       L ER     SN + +R       +  F E S   + E K K
Sbjct  120   MNRSSLDESGAEFCG--SRLTERIHGTNSNINWTRNMFQADSSSSFNEPSTSKVQEPKHK  177

Query  608   LGSFLENQTWHHQFAPQNPIQHQPIQVPEPKTMARTGSSVGSWVTDCRPEPKTTVMNSLV  429
               SF  N++   Q        HQ  Q+                                 
Sbjct  178   FFSFGGNESSCTQIKMSQVDLHQSTQL---------------------------------  204

Query  428   GSWVADRGQEPKATTLENRNAAVSAKLQKQETMKRKA---DLDLNLSLGMKS  282
                      +P A  L   N   + +++ + T+KRKA   DLDLNLSL + S
Sbjct  205   ---------QPGAQELMPNNKFATNEVELK-TLKRKASDIDLDLNLSLKLNS  246



>emb|CDY18860.1| BnaC04g04900D [Brassica napus]
Length=407

 Score =   158 bits (400),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 90/174 (52%), Positives = 113/174 (65%), Gaps = 14/174 (8%)
 Frame = -2

Query  1280  VCSKTTSDDSNKFEEDEDETNESPRNQTVKDGGSSSNSTVEESG----------EKKASV  1131
              C      ++ K E+++D+ N+    ++V D   S+NS VEESG          +   SV
Sbjct  13    TCPSNNFKETTKKEDNKDDENKDEEARSV-DQIPSNNSYVEESGSHHHNNDQIKKNGGSV  71

Query  1130  RPYVRSKMPRLRWTPDLHLRFLHAVERLGGQERATPKLVLQLMDIKGLNIAHVKSHLQMY  951
             RPY RSK PRLRWTP+LHLRFL AVE+ GG +RATPKLVLQLM++KGL IAHVKSHLQMY
Sbjct  72    RPYNRSKTPRLRWTPELHLRFLQAVEKFGGPDRATPKLVLQLMNVKGLCIAHVKSHLQMY  131

Query  950   RSKKTEDPSQGFANHRAFMEGGDRNVFNLSQLPMFKIFNNQRLNPPFRYGDDSY  789
             RSKKT+DP+QG  N     E G    +NL QLPM + F +QR +    YG  S+
Sbjct  132   RSKKTDDPNQG--NQGFSFEHGAGYTYNLGQLPMLQSF-DQRPSTSLGYGGGSW  182



>ref|XP_010264568.1| PREDICTED: uncharacterized protein LOC104602538 isoform X2 [Nelumbo 
nucifera]
Length=355

 Score =   157 bits (396),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 87/159 (55%), Positives = 107/159 (67%), Gaps = 17/159 (11%)
 Frame = -2

Query  1253  SNKFEEDEDETNESPRNQTVKDGGSSSNSTVEESGEKKAS----VRPYVRSKMPRLRWTP  1086
             S K E++E +   +PR        SSSN +VEES  K +S    VR Y+RSKMPRLRWTP
Sbjct  19    SEKNEDEEGDDESTPRTSV-----SSSNCSVEESEMKASSGGGKVRQYIRSKMPRLRWTP  73

Query  1085  DLHLRFLHAVERLGGQERATPKLVLQLMDIKGLNIAHVKSHLQMYRSKKTEDPSQ--GFA  912
             +LHL F+ AVERLGGQE+ATPKLVLQLM+IKGL+IAHVKSHLQMYRSKK +D  Q  GF 
Sbjct  74    ELHLCFVQAVERLGGQEKATPKLVLQLMNIKGLSIAHVKSHLQMYRSKKVDDQGQDKGF-  132

Query  911   NHRAFMEGGDRNVFNLSQLPMFKIFNNQRLNP-PFRYGD  798
                 F++  D  ++N  Q+PM     +QR+     RY D
Sbjct  133   ----FLQTWDHRIYNPCQVPMLHSLLDQRIRSNIIRYTD  167



>gb|KHN28868.1| Putative transcription factor KAN2 [Glycine soja]
Length=286

 Score =   154 bits (390),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 77/143 (54%), Positives = 100/143 (70%), Gaps = 16/143 (11%)
 Frame = -2

Query  1109  MPRLRWTPDLHLRFLHAVERLGGQERATPKLVLQLMDIKGLNIAHVKSHLQMYRSKKTED  930
             MPRLRWTPDLHLRF+HAV+RLGGQERATPKLVLQLM+IK L+IAHVKSHLQM+RSKK +D
Sbjct  1     MPRLRWTPDLHLRFIHAVQRLGGQERATPKLVLQLMNIKSLSIAHVKSHLQMFRSKKVDD  60

Query  929   PSQGFANHRAFMEGGDRNVFNLSQLPMFKIFNNQRLN--------PPFRYGDDSYRNCQE  774
              +Q FA+H + +E GD+N++NLSQL M + +N  + +        P + +GD S+    E
Sbjct  61    RNQVFADHNSLVETGDKNIYNLSQLSMLQGYNPSQSSSFSYTNNYPSYGFGDASF-GVYE  119

Query  773   K-------WMNGTAMAHGTADRG  726
             K       W N  +   G++  G
Sbjct  120   KLLQRPFDWSNAISSREGSSIFG  142



>ref|XP_010676797.1| PREDICTED: uncharacterized protein LOC104892532 isoform X3 [Beta 
vulgaris subsp. vulgaris]
Length=360

 Score =   155 bits (391),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 90/165 (55%), Positives = 109/165 (66%), Gaps = 14/165 (8%)
 Frame = -2

Query  1166  TVEE--SGEKKAS----VRPYVRSKMPRLRWTPDLHLRFLHAVERLGGQERATPKLVLQL  1005
             TVEE   G K++S    VRPY+RSK PRLRWTPDLHLRF+HAVERLGGQ+  TPKLVLQL
Sbjct  51    TVEEMSDGMKRSSSSTAVRPYIRSKTPRLRWTPDLHLRFIHAVERLGGQD-TTPKLVLQL  109

Query  1004  MDIKGLNIAHVKSHLQMYRSKKTEDPSQGF-ANHRAFMEGGDRNVFNLSQLPMFKIFNNQ  828
             M+IKGL+IAHVKSHLQMYRSKK ED SQ    + +   E  D N+FNLSQLP+ + +  Q
Sbjct  110   MNIKGLSIAHVKSHLQMYRSKKAEDQSQAATCDQKHIFEVRDCNIFNLSQLPLLQGY-CQ  168

Query  827   RLNPPFRYGDDSYRNCQEKWMNGTAMAHGTAD-RGRPYEALYERF  696
               +  +R  D  +      W  G      TAD   R  E +++RF
Sbjct  169   APSSNYRSIDPMWTTTNPSWTRGLY----TADMESRVNENVWQRF  209



>emb|CDX74803.1| BnaA05g05490D [Brassica napus]
Length=384

 Score =   155 bits (392),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 89/174 (51%), Positives = 112/174 (64%), Gaps = 14/174 (8%)
 Frame = -2

Query  1280  VCSKTTSDDSNKFEEDEDETNESPRNQTVKDGGSSSNSTVEESG----------EKKASV  1131
              C      ++ K E+++D+ N+    ++V D   S+NS VEESG          +   SV
Sbjct  13    TCPSNNFKETTKKEDNKDDENKDEEARSV-DQIPSNNSYVEESGSHHHNNDQIKKNGGSV  71

Query  1130  RPYVRSKMPRLRWTPDLHLRFLHAVERLGGQERATPKLVLQLMDIKGLNIAHVKSHLQMY  951
             RPY RSK PRLRWTP+LHLRFL AVE+ GG +RATPKLVLQLM++KGL IAHVKSHLQMY
Sbjct  72    RPYNRSKTPRLRWTPELHLRFLQAVEKFGGPDRATPKLVLQLMNVKGLCIAHVKSHLQMY  131

Query  950   RSKKTEDPSQGFANHRAFMEGGDRNVFNLSQLPMFKIFNNQRLNPPFRYGDDSY  789
             RSKKT+DP+QG  N     E G    +NL QLPM + F +QR +    Y   S+
Sbjct  132   RSKKTDDPNQG--NQGFSFEHGAGYTYNLGQLPMLQSF-DQRPSTSLGYDGGSW  182



>ref|XP_009143231.1| PREDICTED: uncharacterized protein LOC103866965 isoform X2 [Brassica 
rapa]
Length=407

 Score =   155 bits (393),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 89/174 (51%), Positives = 112/174 (64%), Gaps = 14/174 (8%)
 Frame = -2

Query  1280  VCSKTTSDDSNKFEEDEDETNESPRNQTVKDGGSSSNSTVEESG----------EKKASV  1131
              C      ++ K E+++D+ N+    ++V D   S+NS VEESG          +   SV
Sbjct  13    TCPSNNFKETTKKEDNKDDENKDEEARSV-DQIPSNNSYVEESGSHHHNNDQIKKNGGSV  71

Query  1130  RPYVRSKMPRLRWTPDLHLRFLHAVERLGGQERATPKLVLQLMDIKGLNIAHVKSHLQMY  951
             RPY RSK PRLRWTP+LHLRFL AVE+ GG +RATPKLVLQLM++KGL IAHVKSHLQMY
Sbjct  72    RPYNRSKTPRLRWTPELHLRFLQAVEKFGGPDRATPKLVLQLMNVKGLCIAHVKSHLQMY  131

Query  950   RSKKTEDPSQGFANHRAFMEGGDRNVFNLSQLPMFKIFNNQRLNPPFRYGDDSY  789
             RSKKT+DP+QG  N     E G    +NL QLPM + F +QR +    Y   S+
Sbjct  132   RSKKTDDPNQG--NQGFSFEHGAGYTYNLGQLPMLQSF-DQRPSTSLGYDGGSW  182



>ref|XP_006411281.1| hypothetical protein EUTSA_v10016733mg [Eutrema salsugineum]
 gb|ESQ52734.1| hypothetical protein EUTSA_v10016733mg [Eutrema salsugineum]
Length=409

 Score =   155 bits (393),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 87/146 (60%), Positives = 100/146 (68%), Gaps = 15/146 (10%)
 Frame = -2

Query  1190  DGGSSSNSTVEESGEKK------------ASVRPYVRSKMPRLRWTPDLHLRFLHAVERL  1047
             D   SSNS VEESG                SVRPY RSK PRLRWTP+LHL FL AVERL
Sbjct  47    DQSPSSNSYVEESGSHHHHNHHDQIKKNGGSVRPYNRSKTPRLRWTPELHLCFLQAVERL  106

Query  1046  GGQERATPKLVLQLMDIKGLNIAHVKSHLQMYRSKKTEDPSQGFANHRAFMEGGDRNVFN  867
             GG +RATPKLVLQLM++KGL+IAHVKSHLQMYRSKKT+DP+QG     +F EG     +N
Sbjct  107   GGPDRATPKLVLQLMNVKGLSIAHVKSHLQMYRSKKTDDPNQGDQGF-SFGEGAGY-TYN  164

Query  866   LSQLPMFKIFNNQRLNPPFRYGDDSY  789
             LSQLPM + F +QR +    YG  S+
Sbjct  165   LSQLPMLQSF-DQRPSTSLGYGSGSW  189



>ref|XP_007016942.1| Myb HTH transcriptional regulator family protein, putative [Theobroma 
cacao]
 gb|EOY34561.1| Myb HTH transcriptional regulator family protein, putative [Theobroma 
cacao]
Length=332

 Score =   153 bits (386),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 86/144 (60%), Positives = 103/144 (72%), Gaps = 10/144 (7%)
 Frame = -2

Query  1229  DETNESPRNQTVKDGGSSSNSTVEESGEKKAS---VRPYVRSKMPRLRWTPDLHLRFLHA  1059
             DE  E    +  ++  SSSNS VEE GEKKA+   VRPYVRSKMPRLRWTP+LHL F+ A
Sbjct  2     DEEEEGDDKRKTRNSASSSNSIVEE-GEKKATSSGVRPYVRSKMPRLRWTPELHLCFVRA  60

Query  1058  VERLGGQERATPKLVLQLMDIKGLNIAHVKSHLQMYRSKKTEDPSQGFANHRAFMEGGDR  879
             VERLGGQE+ATPKLVLQLM+IKGL+IAHVKSHLQMYRSKK +D  Q   N +        
Sbjct  61    VERLGGQEKATPKLVLQLMNIKGLSIAHVKSHLQMYRSKKIDDQGQVLNNKQLL-----G  115

Query  878   NVFNLSQ-LPMFKIFNNQRLNPPF  810
             +V NLSQ L    + ++QR++  F
Sbjct  116   SVDNLSQNLWHQSMLHDQRVSSDF  139



>ref|XP_010907870.1| PREDICTED: transcription activator GLK2-like isoform X3 [Elaeis 
guineensis]
Length=334

 Score =   153 bits (386),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 95/211 (45%), Positives = 131/211 (62%), Gaps = 23/211 (11%)
 Frame = -2

Query  1196  VKDGGSSSNSTVEESGEKKAS--VRPYVRSKMPRLRWTPDLHLRFLHAVERLGGQERATP  1023
             +++GGSSSNSTVEES  K +S  VR YVRSK PRLRWTP+LHL F+ AVERLGGQ+RATP
Sbjct  27    LRNGGSSSNSTVEESERKPSSGTVRQYVRSKNPRLRWTPELHLCFVQAVERLGGQDRATP  86

Query  1022  KLVLQLMDIKGLNIAHVKSHLQMYRSKKTEDPSQGFANHRAFMEGGDRNVFNLSQLPMFK  843
             K+VL+LM +KGL+IAHVKSHLQMYRSKK ++     A+  + M+G  ++++NL  LPM  
Sbjct  87    KMVLELMKVKGLSIAHVKSHLQMYRSKKIDESV--IADPWSVMKGTKQHIYNLGHLPMLH  144

Query  842   IFNNQRLNPPFRYGDDSY---RNCQE-----KWMNGTAMAHGTADRGRPYEALY---ERF  696
               + +   P  R    S+   RN  +     + MN T    G+   G   E ++   +R 
Sbjct  145   GCHQRPTIPNLRSDGSSWFGHRNWTQNPVLSRAMNSTV---GSRSHGSINEMIFRGSDRL  201

Query  695   RSNYDLSRETINPPFTERSNRGLHELKEKLG  603
             +SN D    T     +  +++ + EL+E  G
Sbjct  202   KSNQDFHINT-----SSSNHQAICELREATG  227



>gb|KFK36916.1| hypothetical protein AALP_AA4G189400 [Arabis alpina]
Length=403

 Score =   154 bits (389),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 85/144 (59%), Positives = 100/144 (69%), Gaps = 13/144 (9%)
 Frame = -2

Query  1190  DGGSSSNSTVEESG----------EKKASVRPYVRSKMPRLRWTPDLHLRFLHAVERLGG  1041
             D   SSNS VEESG          +   SVRPY RSK PRLRWTP+LHL FL AVERLGG
Sbjct  46    DQSPSSNSYVEESGSHNNHNDQIKKNGGSVRPYNRSKTPRLRWTPELHLCFLQAVERLGG  105

Query  1040  QERATPKLVLQLMDIKGLNIAHVKSHLQMYRSKKTEDPSQGFANHRAFMEGGDRNVFNLS  861
              +RATPKLVLQ+M++KGL+IAHVKSHLQM+RSKKT+DPSQG  +     E G    +NLS
Sbjct  106   PDRATPKLVLQMMNVKGLSIAHVKSHLQMFRSKKTDDPSQG--DQGFSFEHGTGYTYNLS  163

Query  860   QLPMFKIFNNQRLNPPFRYGDDSY  789
             QLPM + F +QR +    YG  S+
Sbjct  164   QLPMLQSF-DQRPSTSLGYGGGSW  186



>gb|KDO66970.1| hypothetical protein CISIN_1g041956mg, partial [Citrus sinensis]
Length=119

 Score =   145 bits (365),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 72/93 (77%), Positives = 79/93 (85%), Gaps = 4/93 (4%)
 Frame = -2

Query  1184  GSSSNSTVEESGEKKAS----VRPYVRSKMPRLRWTPDLHLRFLHAVERLGGQERATPKL  1017
              SSSNS VEE  ++KAS    VRPYVRSK+PRLRWTPDLH  F+ AVERLGGQERATPKL
Sbjct  17    ASSSNSVVEEGDQRKASSSSGVRPYVRSKVPRLRWTPDLHRCFVQAVERLGGQERATPKL  76

Query  1016  VLQLMDIKGLNIAHVKSHLQMYRSKKTEDPSQG  918
             VLQLM+IKGL+IAHVKSHLQMYRSKK +D  QG
Sbjct  77    VLQLMNIKGLSIAHVKSHLQMYRSKKIDDHGQG  109



>ref|XP_010907868.1| PREDICTED: transcription activator GLK2-like isoform X1 [Elaeis 
guineensis]
Length=338

 Score =   151 bits (382),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 95/213 (45%), Positives = 131/213 (62%), Gaps = 23/213 (11%)
 Frame = -2

Query  1196  VKDGGSSSNSTVEESGEKKAS--VRPYVRSKMPRLRWTPDLHLRFLHAVERLGGQERA--  1029
             +++GGSSSNSTVEES  K +S  VR YVRSK PRLRWTP+LHL F+ AVERLGGQ+ A  
Sbjct  27    LRNGGSSSNSTVEESERKPSSGTVRQYVRSKNPRLRWTPELHLCFVQAVERLGGQDHAGA  86

Query  1028  TPKLVLQLMDIKGLNIAHVKSHLQMYRSKKTEDPSQGFANHRAFMEGGDRNVFNLSQLPM  849
             TPK+VL+LM +KGL+IAHVKSHLQMYRSKK ++  Q  A+  + M+G  ++++NL  LPM
Sbjct  87    TPKMVLELMKVKGLSIAHVKSHLQMYRSKKIDESGQVIADPWSVMKGTKQHIYNLGHLPM  146

Query  848   FKIFNNQRLNPPFRYGDDSY---RNCQE-----KWMNGTAMAHGTADRGRPYEALY---E  702
                 + +   P  R    S+   RN  +     + MN T    G+   G   E ++   +
Sbjct  147   LHGCHQRPTIPNLRSDGSSWFGHRNWTQNPVLSRAMNSTV---GSRSHGSINEMIFRGSD  203

Query  701   RFRSNYDLSRETINPPFTERSNRGLHELKEKLG  603
             R +SN D    T     +  +++ + EL+E  G
Sbjct  204   RLKSNQDFHINT-----SSSNHQAICELREATG  231



>ref|XP_002881704.1| hypothetical protein ARALYDRAFT_321718 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH57963.1| hypothetical protein ARALYDRAFT_321718 [Arabidopsis lyrata subsp. 
lyrata]
Length=411

 Score =   152 bits (385),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 127/327 (39%), Positives = 161/327 (49%), Gaps = 60/327 (18%)
 Frame = -2

Query  1190  DGGSSSNSTVEESG---------EKKASVRPYVRSKMPRLRWTPDLHLRFLHAVERLGGQ  1038
             D   SSNS VEESG         +   SVRPY RSK PRLRWTP+LH+ FL AVERLGG 
Sbjct  47    DQSPSSNSYVEESGSHHHHDQNKKNGGSVRPYNRSKTPRLRWTPELHICFLQAVERLGGP  106

Query  1037  ERATPKLVLQLMDIKGLNIAHVKSHLQMYRSKKTEDPSQGFANHRAFMEGGDRNVFNLSQ  858
             +RATPKLVLQLM++KGL+IAHVKSHLQMYRSKKT+DP+QG  +     E G    +NLSQ
Sbjct  107   DRATPKLVLQLMNVKGLSIAHVKSHLQMYRSKKTDDPNQG--DQGFSFEHGAGYTYNLSQ  164

Query  857   LPMFKIFNNQRLNPPFRYGDDSYRNCQEKWMNGTAMAHGTADRGRPYEALY-----ERFR  693
             LPM + F +QR +    YG  S+ + + +          T D  R  + L+     ERF 
Sbjct  165   LPMLQSF-DQRPSSSLGYGGGSWTDHRRQIYRSPWRGLTTRDSTRTRQTLFSSQPGERFH  223

Query  692   --SNYDLSRETINPPFTERSNRGLHELKEKLG-------SFLE-----NQTWHHQFAPQN  555
               SN  L  +     F   S+ G+HE     G       SFLE     N++W    +  N
Sbjct  224   GVSNSILDDKNKTISFRINSHEGVHENNGVAGAVPRIHRSFLEGMKTFNKSWGQSLS-SN  282

Query  554   PIQHQPIQVPEPKTMARTGSSVGSWVTDCRPEPKTTVMNSLVGSWVADRGQEPKATTLEN  375
             P    P  +P+                        T +NS    W   R  E     L+ 
Sbjct  283   PKSSTPT-IPQDHI--------------------ATTLNSY--QWENARVAEGSENILKR  319

Query  374   RNAAVSAKLQKQETMKRKADLDLNLSL  294
             +   +S    K +      DLDL+LSL
Sbjct  320   KRLLLSDDCNKSD-----QDLDLSLSL  341



>ref|XP_010508888.1| PREDICTED: putative two-component response regulator-like APRR6 
[Camelina sativa]
Length=412

 Score =   152 bits (384),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 80/130 (62%), Positives = 93/130 (72%), Gaps = 13/130 (10%)
 Frame = -2

Query  1190  DGGSSSNSTVEESGEKK-----------ASVRPYVRSKMPRLRWTPDLHLRFLHAVERLG  1044
             D   SSNS VEESG  +            SVRPY RSK PRLRWTP+LH+ FL AVERLG
Sbjct  47    DQSPSSNSYVEESGSHQNHDHDQIKKNGGSVRPYNRSKTPRLRWTPELHICFLQAVERLG  106

Query  1043  GQERATPKLVLQLMDIKGLNIAHVKSHLQMYRSKKTEDPSQGFANHRAFMEGGDRNVFNL  864
             G +RATPKLVLQLM++KGL+IAHVKSHLQMYRSKKT+DP+QG  +     E G    +NL
Sbjct  107   GPDRATPKLVLQLMNVKGLSIAHVKSHLQMYRSKKTDDPNQG--DQGFSFEHGAGYTYNL  164

Query  863   SQLPMFKIFN  834
             SQLPM + F+
Sbjct  165   SQLPMLQSFD  174



>ref|XP_010505750.1| PREDICTED: putative two-component response regulator-like APRR6 
[Camelina sativa]
Length=405

 Score =   152 bits (383),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 80/130 (62%), Positives = 93/130 (72%), Gaps = 13/130 (10%)
 Frame = -2

Query  1190  DGGSSSNSTVEESGEKK-----------ASVRPYVRSKMPRLRWTPDLHLRFLHAVERLG  1044
             D   SSNS VEESG  +            SVRPY RSK PRLRWTP+LH+ FL AVERLG
Sbjct  47    DQSPSSNSYVEESGSHQNHHHDQIKKNGGSVRPYNRSKTPRLRWTPELHICFLQAVERLG  106

Query  1043  GQERATPKLVLQLMDIKGLNIAHVKSHLQMYRSKKTEDPSQGFANHRAFMEGGDRNVFNL  864
             G +RATPKLVLQLM++KGL+IAHVKSHLQMYRSKKT+DP+QG  +     E G    +NL
Sbjct  107   GPDRATPKLVLQLMNVKGLSIAHVKSHLQMYRSKKTDDPNQG--DQGFSFEHGAGYTYNL  164

Query  863   SQLPMFKIFN  834
             SQLPM + F+
Sbjct  165   SQLPMLQSFD  174



>ref|XP_010554678.1| PREDICTED: two-component response regulator ARR14-like [Tarenaya 
hassleriana]
Length=386

 Score =   151 bits (381),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 81/139 (58%), Positives = 99/139 (71%), Gaps = 12/139 (9%)
 Frame = -2

Query  1181  SSSNSTVEESGEKK-------ASVRPYVRSKMPRLRWTPDLHLRFLHAVERLGGQERATP  1023
             SS+NS VEE    +        SVRPY RSK PRLRWTP+LHL F+HAVERLGGQ+RATP
Sbjct  48    SSNNSYVEECSSHRLKIKKFGGSVRPYNRSKTPRLRWTPELHLSFVHAVERLGGQDRATP  107

Query  1022  KLVLQLMDIKGLNIAHVKSHLQMYRSKKTEDPSQGFANHRAF-MEGGDRNVFNLSQLPMF  846
             KLVLQLM+IKGL+IA VKSHLQMYRSKK+++ +QG    + F  E G     NL+Q+PM 
Sbjct  108   KLVLQLMNIKGLSIAQVKSHLQMYRSKKSDEHNQG---QQGFSFETGTGYTCNLTQVPML  164

Query  845   KIFNNQRLNPPFRYGDDSY  789
             + F +QR +    YGD S+
Sbjct  165   QSF-DQRTSTSLGYGDTSW  182



>ref|XP_010517442.1| PREDICTED: uncharacterized protein LOC104792882 [Camelina sativa]
Length=411

 Score =   152 bits (383),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 80/130 (62%), Positives = 93/130 (72%), Gaps = 13/130 (10%)
 Frame = -2

Query  1190  DGGSSSNSTVEESGEKK-----------ASVRPYVRSKMPRLRWTPDLHLRFLHAVERLG  1044
             D   SSNS VEESG  +            SVRPY RSK PRLRWTP+LH+ FL AVERLG
Sbjct  47    DQSPSSNSYVEESGSHQNHDHDQIKKNGGSVRPYNRSKTPRLRWTPELHICFLQAVERLG  106

Query  1043  GQERATPKLVLQLMDIKGLNIAHVKSHLQMYRSKKTEDPSQGFANHRAFMEGGDRNVFNL  864
             G +RATPKLVLQLM++KGL+IAHVKSHLQMYRSKKT+DP+QG  +     E G    +NL
Sbjct  107   GPDRATPKLVLQLMNVKGLSIAHVKSHLQMYRSKKTDDPNQG--DQGFSFEHGAGYTYNL  164

Query  863   SQLPMFKIFN  834
             SQLPM + F+
Sbjct  165   SQLPMLQSFD  174



>ref|XP_006294294.1| hypothetical protein CARUB_v10023302mg [Capsella rubella]
 gb|EOA27192.1| hypothetical protein CARUB_v10023302mg [Capsella rubella]
Length=415

 Score =   151 bits (382),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 80/130 (62%), Positives = 93/130 (72%), Gaps = 13/130 (10%)
 Frame = -2

Query  1190  DGGSSSNSTVEESGEKK-----------ASVRPYVRSKMPRLRWTPDLHLRFLHAVERLG  1044
             D   SSNS VEESG  +            SVRPY RSK PRLRWTP+LH+ FL AVERLG
Sbjct  47    DQSPSSNSYVEESGSHQHHHHDQIKKNGGSVRPYNRSKTPRLRWTPELHICFLQAVERLG  106

Query  1043  GQERATPKLVLQLMDIKGLNIAHVKSHLQMYRSKKTEDPSQGFANHRAFMEGGDRNVFNL  864
             G +RATPKLVLQLM++KGL+IAHVKSHLQMYRSKKT+DP+QG  +     E G    +NL
Sbjct  107   GPDRATPKLVLQLMNVKGLSIAHVKSHLQMYRSKKTDDPNQG--DQGFSFEHGAGYTYNL  164

Query  863   SQLPMFKIFN  834
             SQLPM + F+
Sbjct  165   SQLPMLQSFD  174



>ref|XP_006425115.1| hypothetical protein CICLE_v10029989mg [Citrus clementina]
 gb|ESR38355.1| hypothetical protein CICLE_v10029989mg [Citrus clementina]
Length=365

 Score =   150 bits (378),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 80/129 (62%), Positives = 90/129 (70%), Gaps = 4/129 (3%)
 Frame = -2

Query  1184  GSSSNSTVEESGEKKAS----VRPYVRSKMPRLRWTPDLHLRFLHAVERLGGQERATPKL  1017
              SSSNS VEE  ++KAS    VRPYVRSK+PRLRWTPDLH  F+ AVERLGGQERATPKL
Sbjct  41    ASSSNSVVEEGDQRKASSSSGVRPYVRSKVPRLRWTPDLHRCFVQAVERLGGQERATPKL  100

Query  1016  VLQLMDIKGLNIAHVKSHLQMYRSKKTEDPSQGFANHRAFMEGGDRNVFNLSQLPMFKIF  837
             VLQLM+IKGL+IAHVKSHLQMYRSKK +D  Q F +    M   D    NL     F+  
Sbjct  101   VLQLMNIKGLSIAHVKSHLQMYRSKKIDDHGQVFNSRGHLMGTSDHFSHNLWHHSTFQSI  160

Query  836   NNQRLNPPF  810
             N +   P F
Sbjct  161   NKRIGRPNF  169



>ref|XP_002312172.1| myb family transcription factor family protein [Populus trichocarpa]
 gb|EEE89539.1| myb family transcription factor family protein [Populus trichocarpa]
Length=329

 Score =   147 bits (371),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 75/127 (59%), Positives = 98/127 (77%), Gaps = 9/127 (7%)
 Frame = -2

Query  1241  EEDEDETNESPRNQTVKDGGSSSNSTVEESGEKKA--SVRPYVRSKMPRLRWTPDLHLRF  1068
             +E ++E  +    ++  +G S+SNS++EE+ +K A  S R Y+RSKMPRLRWTPDLHL F
Sbjct  22    DEGDEEEVDGISFKSKNEGQSTSNSSIEENKKKAADGSFRQYIRSKMPRLRWTPDLHLCF  81

Query  1067  LHAVERLGGQERATPKLVLQLMDIKGLNIAHVKSHLQMYRSKKTEDPSQGFA----NH--  906
             +HAVERLGGQ+RATPKLVLQ+M+IK LNIAHVKSHLQMYRSK+++DP Q  +    +H  
Sbjct  82    VHAVERLGGQDRATPKLVLQMMNIKDLNIAHVKSHLQMYRSKRSDDPGQDASWRGHDHMM  141

Query  905   -RAFMEG  888
              RA+M G
Sbjct  142   CRAYMGG  148



>ref|XP_006359562.1| PREDICTED: putative Myb family transcription factor At1g14600-like 
[Solanum tuberosum]
Length=115

 Score =   140 bits (353),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 78/113 (69%), Positives = 92/113 (81%), Gaps = 3/113 (3%)
 Frame = -2

Query  1292  SGETVCSKTTSDDSNKFEEDEDETNESPRNQTVKDGGSSSNSTVEESGEKKASVRPYVRS  1113
             SGET C+  TS +   FE++EDE  E   +   KDGGSSS ST+EES + K  VRPYVRS
Sbjct  5     SGETGCNSKTSSN---FEKNEDEVLEENASSKFKDGGSSSESTLEESEKIKPCVRPYVRS  61

Query  1112  KMPRLRWTPDLHLRFLHAVERLGGQERATPKLVLQLMDIKGLNIAHVKSHLQM  954
             KM RLRWTP+LHLRF+HAVERLGGQ+RATPKLVLQ+M+IKGL+IAHVKSHLQ+
Sbjct  62    KMARLRWTPELHLRFVHAVERLGGQDRATPKLVLQMMNIKGLSIAHVKSHLQV  114



>ref|XP_009143232.1| PREDICTED: uncharacterized protein LOC103866965 isoform X3 [Brassica 
rapa]
Length=385

 Score =   148 bits (373),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 88/175 (50%), Positives = 111/175 (63%), Gaps = 15/175 (9%)
 Frame = -2

Query  1280  VCSKTTSDDSNKFEEDEDETNESPRNQTVKDGGSSSNSTVEESG----------EKKASV  1131
              C      ++ K E+++D+ N+    ++V D   S+NS VEESG          +   SV
Sbjct  13    TCPSNNFKETTKKEDNKDDENKDEEARSV-DQIPSNNSYVEESGSHHHNNDQIKKNGGSV  71

Query  1130  RPYVRSKMPRLRWTPDLHLRFLHAVERLGGQER-ATPKLVLQLMDIKGLNIAHVKSHLQM  954
             RPY RSK PRLRWTP+LHLRFL AVE+ GG +  ATPKLVLQLM++KGL IAHVKSHLQM
Sbjct  72    RPYNRSKTPRLRWTPELHLRFLQAVEKFGGPDTGATPKLVLQLMNVKGLCIAHVKSHLQM  131

Query  953   YRSKKTEDPSQGFANHRAFMEGGDRNVFNLSQLPMFKIFNNQRLNPPFRYGDDSY  789
             YRSKKT+DP+QG  N     E G    +NL QLPM + F +QR +    Y   S+
Sbjct  132   YRSKKTDDPNQG--NQGFSFEHGAGYTYNLGQLPMLQSF-DQRPSTSLGYDGGSW  183



>emb|CBI21992.3| unnamed protein product [Vitis vinifera]
Length=277

 Score =   145 bits (366),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 74/122 (61%), Positives = 94/122 (77%), Gaps = 9/122 (7%)
 Frame = -2

Query  1274  SKTTSDDSNKFEEDEDETNESPRNQTVKDGGSSSNSTVEESGEKKASVRPYVRSKMPRLR  1095
             S TT    N+ +EDE  T+ +  N       SS+N+TVE  G+++ +VR Y+RSKMPRLR
Sbjct  46    SSTTGVPENEVKEDETSTDANYSN-------SSNNTTVE--GKERTTVRQYIRSKMPRLR  96

Query  1094  WTPDLHLRFLHAVERLGGQERATPKLVLQLMDIKGLNIAHVKSHLQMYRSKKTEDPSQGF  915
             WTPDLHL F++AVERLGGQERATPKLVLQLM+++GL+IAHVKSHLQMYRSKK +D  Q  
Sbjct  97    WTPDLHLAFVNAVERLGGQERATPKLVLQLMNVRGLSIAHVKSHLQMYRSKKLDDSGQVL  156

Query  914   AN  909
             ++
Sbjct  157   SH  158



>ref|XP_009143230.1| PREDICTED: uncharacterized protein LOC103866965 isoform X1 [Brassica 
rapa]
Length=408

 Score =   148 bits (374),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 88/175 (50%), Positives = 111/175 (63%), Gaps = 15/175 (9%)
 Frame = -2

Query  1280  VCSKTTSDDSNKFEEDEDETNESPRNQTVKDGGSSSNSTVEESG----------EKKASV  1131
              C      ++ K E+++D+ N+    ++V D   S+NS VEESG          +   SV
Sbjct  13    TCPSNNFKETTKKEDNKDDENKDEEARSV-DQIPSNNSYVEESGSHHHNNDQIKKNGGSV  71

Query  1130  RPYVRSKMPRLRWTPDLHLRFLHAVERLGGQER-ATPKLVLQLMDIKGLNIAHVKSHLQM  954
             RPY RSK PRLRWTP+LHLRFL AVE+ GG +  ATPKLVLQLM++KGL IAHVKSHLQM
Sbjct  72    RPYNRSKTPRLRWTPELHLRFLQAVEKFGGPDTGATPKLVLQLMNVKGLCIAHVKSHLQM  131

Query  953   YRSKKTEDPSQGFANHRAFMEGGDRNVFNLSQLPMFKIFNNQRLNPPFRYGDDSY  789
             YRSKKT+DP+QG  N     E G    +NL QLPM + F +QR +    Y   S+
Sbjct  132   YRSKKTDDPNQG--NQGFSFEHGAGYTYNLGQLPMLQSF-DQRPSTSLGYDGGSW  183



>gb|AAD25941.1|AF085279_14 hypothetical cytoskeletal protein [Arabidopsis thaliana]
Length=401

 Score =   147 bits (371),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 79/130 (61%), Positives = 93/130 (72%), Gaps = 16/130 (12%)
 Frame = -2

Query  1190  DGGSSSNSTVEESG--------EKKASVRPYVRSKMPRLRWTPDLHLRFLHAVERLGGQE  1035
             D   SSNS  EESG        +   SVRPY RSK PRLRWTP+LH+ FL AVERLGG +
Sbjct  47    DQSPSSNSYEEESGSHHHDQNKKNGGSVRPYNRSKTPRLRWTPELHICFLQAVERLGGPD  106

Query  1034  RATPKLVLQLMDIKGLNIAHVKSHLQMYRSKKTEDPS---QGFANHRAFMEGGDRNVFNL  864
             RATPKLVLQLM++KGL+IAHVKSHLQMYRSKKT++P+   QGF+      E G    +NL
Sbjct  107   RATPKLVLQLMNVKGLSIAHVKSHLQMYRSKKTDEPNEGDQGFS-----FEHGAGYTYNL  161

Query  863   SQLPMFKIFN  834
             SQLPM + F+
Sbjct  162   SQLPMLQSFD  171



>gb|KDO77871.1| hypothetical protein CISIN_1g035517mg [Citrus sinensis]
Length=161

 Score =   140 bits (354),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 65/89 (73%), Positives = 79/89 (89%), Gaps = 2/89 (2%)
 Frame = -2

Query  1184  GSSSNSTVEESGEKKASVRPYVRSKMPRLRWTPDLHLRFLHAVERLGGQERATPKLVLQL  1005
             GS+S ST   + E++++VR YVRSKMPRLRWTPDLHL F+HAVERLGGQE+ATPKLVLQL
Sbjct  68    GSTSCST--NNNERRSTVRQYVRSKMPRLRWTPDLHLSFVHAVERLGGQEKATPKLVLQL  125

Query  1004  MDIKGLNIAHVKSHLQMYRSKKTEDPSQG  918
             M+++GL+IAHVKSHLQMYRSKK ++  QG
Sbjct  126   MNVRGLSIAHVKSHLQMYRSKKLDEAGQG  154



>ref|NP_181555.1| myb family transcription factor [Arabidopsis thaliana]
 gb|AAD25661.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEC09803.1| myb family transcription factor [Arabidopsis thaliana]
Length=410

 Score =   147 bits (371),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 79/130 (61%), Positives = 93/130 (72%), Gaps = 16/130 (12%)
 Frame = -2

Query  1190  DGGSSSNSTVEESG--------EKKASVRPYVRSKMPRLRWTPDLHLRFLHAVERLGGQE  1035
             D   SSNS  EESG        +   SVRPY RSK PRLRWTP+LH+ FL AVERLGG +
Sbjct  47    DQSPSSNSYEEESGSHHHDQNKKNGGSVRPYNRSKTPRLRWTPELHICFLQAVERLGGPD  106

Query  1034  RATPKLVLQLMDIKGLNIAHVKSHLQMYRSKKTEDPS---QGFANHRAFMEGGDRNVFNL  864
             RATPKLVLQLM++KGL+IAHVKSHLQMYRSKKT++P+   QGF+      E G    +NL
Sbjct  107   RATPKLVLQLMNVKGLSIAHVKSHLQMYRSKKTDEPNEGDQGFS-----FEHGAGYTYNL  161

Query  863   SQLPMFKIFN  834
             SQLPM + F+
Sbjct  162   SQLPMLQSFD  171



>ref|XP_002313237.2| hypothetical protein POPTR_0009s07890g, partial [Populus trichocarpa]
 gb|EEE87192.2| hypothetical protein POPTR_0009s07890g, partial [Populus trichocarpa]
Length=324

 Score =   145 bits (366),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 80/149 (54%), Positives = 96/149 (64%), Gaps = 9/149 (6%)
 Frame = -2

Query  1241  EEDEDETNESPRNQTVKDGGSSSNSTVEESGEKKAS-VRPYVRSKMPRLRWTPDLHLRFL  1065
             EE +DE+         K+ GSSSNS VEE  +  +S VRPY RSK+PRLRWTPDLHL F+
Sbjct  19    EEGDDESK-------TKNSGSSSNSIVEECEKASSSGVRPYARSKVPRLRWTPDLHLCFV  71

Query  1064  HAVERLGGQERATPKLVLQLMDIKGLNIAHVKSHLQMYRSKKTEDPSQGFANHRAFMEGG  885
              AVERLGG ERATPKLVLQLM+ KGL+IAHVKSHLQMYRSKK +D  Q        +   
Sbjct  72    QAVERLGGHERATPKLVLQLMNFKGLSIAHVKSHLQMYRSKKIDDQGQVINGTGDLIGSS  131

Query  884   DRNVFNLSQLPMFKIFNNQRLNPPFRYGD  798
             D+      Q  +    ++   N  FRYG+
Sbjct  132   DKFSHEFWQHSLLPNIDHNH-NSNFRYGN  159



>ref|XP_009141878.1| PREDICTED: serine/threonine-protein kinase pakF-like isoform 
X1 [Brassica rapa]
Length=418

 Score =   145 bits (367),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 104/244 (43%), Positives = 126/244 (52%), Gaps = 34/244 (14%)
 Frame = -2

Query  1190  DGGSSSNSTVEESGEKK------------ASVRPYVRSKMPRLRWTPDLHLRFLHAVERL  1047
             D   SSNS VEESG +              SVRPY RSK PRLRWTP+LHL FL AVERL
Sbjct  53    DQSPSSNSYVEESGSQHHHNNNDQIKKNGGSVRPYNRSKTPRLRWTPELHLCFLQAVERL  112

Query  1046  GGQERATPKLVLQLMDIKGLNIAHVKSHLQMYRSKKTEDPSQGFANHRAFMEGGDRNVFN  867
             GG +RATPKLVLQLM++KGL+IAHVKSHLQMYRSKK +D +QG  +     E G    +N
Sbjct  113   GGPDRATPKLVLQLMNVKGLSIAHVKSHLQMYRSKKIDDLNQG--DQGFSFEHGAGYTYN  170

Query  866   LSQLPMFKIFNNQRLNPPFRYGDDSYRNCQEKWMNGTAMAHGTADRGRPYEALY-----E  702
             LSQ PM + F+        RYG  S+ + + +            D  R  + L+     E
Sbjct  171   LSQPPMLQSFDQGPSTSLGRYGGGSWIDHRRQVYRSPWRGLTARDNTRTRQTLFSSQLGE  230

Query  701   RFR--SNYDLSRETINPPFTERSNRGLH-------ELKEKLGSFLE-----NQTWHHQFA  564
             RF   SN  L  +     F   S    H        +     SFLE     N++W   F 
Sbjct  231   RFHGVSNSILDDKNKTISFRTNSREAAHASNGIGEAVPRSHRSFLEGMKTFNKSWGQSF-  289

Query  563   PQNP  552
             P NP
Sbjct  290   PSNP  293



>emb|CAN60070.1| hypothetical protein VITISV_022944 [Vitis vinifera]
Length=175

 Score =   139 bits (350),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 67/92 (73%), Positives = 78/92 (85%), Gaps = 3/92 (3%)
 Frame = -2

Query  1184  GSSSNSTVEESGEK---KASVRPYVRSKMPRLRWTPDLHLRFLHAVERLGGQERATPKLV  1014
             GSS+N+    +GEK   K SVR YVRSKMPRLRWTPDLHL F+HAVERLGGQ RATPKLV
Sbjct  55    GSSANNNNVSAGEKRRGKNSVRQYVRSKMPRLRWTPDLHLSFVHAVERLGGQARATPKLV  114

Query  1013  LQLMDIKGLNIAHVKSHLQMYRSKKTEDPSQG  918
             L+LM++KGL+IAHVKSHLQMYRSK+ ++  QG
Sbjct  115   LELMNVKGLSIAHVKSHLQMYRSKRLDESGQG  146



>ref|XP_006449512.1| hypothetical protein CICLE_v10017867mg [Citrus clementina]
 gb|ESR62752.1| hypothetical protein CICLE_v10017867mg [Citrus clementina]
Length=225

 Score =   140 bits (354),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 73/135 (54%), Positives = 95/135 (70%), Gaps = 10/135 (7%)
 Frame = -2

Query  1286  ETVCSKTTSDDSNKFEEDEDETNESPRNQTVKDGGSSSNSTVEESGEKKASVRPYVRSKM  1107
             E  CS+     +N  E+D+  T+           GS+S ST   + E++++VR YVRSKM
Sbjct  42    EASCSEEDDVLANAAEDDDKRTDHLE--------GSTSCST--NNNERRSTVRQYVRSKM  91

Query  1106  PRLRWTPDLHLRFLHAVERLGGQERATPKLVLQLMDIKGLNIAHVKSHLQMYRSKKTEDP  927
             PRLRWTPDLHL F+HAVERLGGQE+ATPKLVLQLM+++GL+IAHVKSHLQMYRSKK ++ 
Sbjct  92    PRLRWTPDLHLSFVHAVERLGGQEKATPKLVLQLMNVRGLSIAHVKSHLQMYRSKKLDEA  151

Query  926   SQGFANHRAFMEGGD  882
              Q  ++    + G D
Sbjct  152   GQVLSHAYRSIHGRD  166



>gb|KHN27949.1| Putative Myb family transcription factor [Glycine soja]
Length=368

 Score =   144 bits (364),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 72/123 (59%), Positives = 94/123 (76%), Gaps = 12/123 (10%)
 Frame = -2

Query  1160  EESGEKKASVRPYVRSKMPRLRWTPDLHLRFLHAVERLGGQERATPKLVLQLMDIKGLNI  981
             EE  E+ ++VR YVRSKMPRLRWTPDLHL F+HAVERLGGQERATPKLVLQLM+++GL+I
Sbjct  72    EEGKERASTVRQYVRSKMPRLRWTPDLHLAFVHAVERLGGQERATPKLVLQLMNVRGLSI  131

Query  980   AHVKSHLQMYRSKKTEDPSQGFANHRAFMEGGDRNVFNLSQLPMFKIFNNQRLNPPFRYG  801
             AHVKSHLQMYRSKK ++  Q  +++R+ M+G         +  +F ++   RLN P  +G
Sbjct  132   AHVKSHLQMYRSKKLDESGQVLSHNRS-MQG---------RHSIFYMYG--RLNAPRHFG  179

Query  800   DDS  792
             +D+
Sbjct  180   NDN  182



>ref|XP_006592875.1| PREDICTED: uncharacterized protein LOC102668520 [Glycine max]
Length=368

 Score =   144 bits (363),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 72/123 (59%), Positives = 94/123 (76%), Gaps = 12/123 (10%)
 Frame = -2

Query  1160  EESGEKKASVRPYVRSKMPRLRWTPDLHLRFLHAVERLGGQERATPKLVLQLMDIKGLNI  981
             EE  E+ ++VR YVRSKMPRLRWTPDLHL F+HAVERLGGQERATPKLVLQLM+++GL+I
Sbjct  72    EEGKERASTVRQYVRSKMPRLRWTPDLHLAFVHAVERLGGQERATPKLVLQLMNVRGLSI  131

Query  980   AHVKSHLQMYRSKKTEDPSQGFANHRAFMEGGDRNVFNLSQLPMFKIFNNQRLNPPFRYG  801
             AHVKSHLQMYRSKK ++  Q  +++R+ M+G         +  +F ++   RLN P  +G
Sbjct  132   AHVKSHLQMYRSKKLDESGQVLSHNRS-MQG---------RHSIFYMYG--RLNAPRHFG  179

Query  800   DDS  792
             +D+
Sbjct  180   NDN  182



>emb|CDY07612.1| BnaA03g18990D [Brassica napus]
Length=392

 Score =   144 bits (363),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 76/134 (57%), Positives = 98/134 (73%), Gaps = 7/134 (5%)
 Frame = -2

Query  1223  TNESP-RNQTVKDGGSS--SNSTVEESGEKKASVRPYVRSKMPRLRWTPDLHLRFLHAVE  1053
              ++SP +N  +++ GS   +N  +++SG    SVRPY RSK PRLRWTP+LH+ FL AVE
Sbjct  28    ADQSPSKNSYLEENGSHHHNNDQIKKSG---GSVRPYNRSKTPRLRWTPELHICFLQAVE  84

Query  1052  RLGGQERATPKLVLQLMDIKGLNIAHVKSHLQMYRSKKTEDPSQG-FANHRAFMEGGDRN  876
             RLGG +RATPKLVLQLM++KGL+I HVKSHLQMYRSKK +D +QG F + R   E G   
Sbjct  85    RLGGPDRATPKLVLQLMNVKGLSIGHVKSHLQMYRSKKIDDTNQGWFRDQRFSFEHGAGY  144

Query  875   VFNLSQLPMFKIFN  834
              +NL QLPM + F+
Sbjct  145   TYNLRQLPMLQSFD  158



>ref|XP_011024915.1| PREDICTED: probable transcription factor KAN2 isoform X2 [Populus 
euphratica]
Length=365

 Score =   143 bits (361),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 99/243 (41%), Positives = 130/243 (53%), Gaps = 10/243 (4%)
 Frame = -2

Query  1256  DSNKFEEDEDETNESPRNQTVKDGGSSSNSTVEESGEKKAS-VRPYVRSKMPRLRWTPDL  1080
             D++   +D +  NES      K+  SSSNS V+ES +  +S VRPYVRSK+PRLRWTPDL
Sbjct  15    DASGKSKDGEGDNESK----TKNSASSSNSIVDESEKASSSGVRPYVRSKVPRLRWTPDL  70

Query  1079  HLRFLHAVERLGGQERATPKLVLQLMDIKGLNIAHVKSHLQMYRSKKTEDPSQGFANHRA  900
             HL F+ AVERLGG ERATPKLVLQLM+IKGL+IAHVKSHLQMYRSKK +D  Q   +   
Sbjct  71    HLCFVQAVERLGGYERATPKLVLQLMNIKGLSIAHVKSHLQMYRSKKIDDQGQVIDSRGD  130

Query  899   FMEGGDRNVFNLSQLPMFKIFNNQRLNPPFRYGDDSYRNCQEKWMNGTAMAHGTADRGRP  720
              +        N  Q  +    ++ R +  FR    S       W+   ++    +   R 
Sbjct  131   LIGCSGYYSHNFWQHSLLPNIDHNR-SSDFRSRSVSRSTGHGNWITSPSVLGPDSMNIRS  189

Query  719   YEALYERF--RSNYDLSRETINPPFTERSNRGLHELKEKLG-SFLENQTWHHQFAPQNPI  549
                 Y     R N ++   T    F   +N    + + KL   FL+N++ H      N I
Sbjct  190   GAGFYNSISERINGEIGSSTRRGSFHTCNNSTFTDQRRKLKQEFLDNES-HQPMYNGNSI  248

Query  548   QHQ  540
             Q Q
Sbjct  249   QGQ  251



>ref|XP_010534614.1| PREDICTED: uncharacterized protein LOC104810118 [Tarenaya hassleriana]
Length=409

 Score =   144 bits (363),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 92/176 (52%), Positives = 111/176 (63%), Gaps = 21/176 (12%)
 Frame = -2

Query  1181  SSSNSTVEES------GEKKASVRPYVRSKMPRLRWTPDLHLRFLHAVERLGGQERATPK  1020
             SSSNS VEE        +   SVRPY RSK PRLRWTP+LH  FL AVERLGGQ+RATPK
Sbjct  49    SSSNSYVEECPGHHQIKKNGGSVRPYNRSKTPRLRWTPELHRCFLQAVERLGGQDRATPK  108

Query  1019  LVLQLMDIKGLNIAHVKSHLQMYRSKKTEDPSQGFANHRAF-MEGGDRNVFNLSQLPMFK  843
             LVLQ M++KGL+IAHVKSHLQMYRSKK ++P+QG    + F  E G     +LSQ+PM +
Sbjct  109   LVLQTMNVKGLSIAHVKSHLQMYRSKKADEPNQG---QQGFSFETGTGYTCSLSQVPMLQ  165

Query  842   IFNNQRLNPPFRYGDDSYR------NCQEKWMNGTAMAHGTADRGRP-YEALYERF  696
              F +QR +    Y D S+       NC   W  G     G A  G+P + +L ERF
Sbjct  166   SF-DQRPSTSLGYDDPSWSDHGPLINCN-PW-RGLTTRDG-ARSGQPLFISLNERF  217



>ref|XP_007216041.1| hypothetical protein PRUPE_ppa017500mg, partial [Prunus persica]
 gb|EMJ17240.1| hypothetical protein PRUPE_ppa017500mg, partial [Prunus persica]
Length=234

 Score =   140 bits (352),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 69/112 (62%), Positives = 85/112 (76%), Gaps = 5/112 (4%)
 Frame = -2

Query  1241  EEDEDETNESPRNQTVKD-----GGSSSNSTVEESGEKKASVRPYVRSKMPRLRWTPDLH  1077
             ++D+D ++ +   Q V       G  S N+T  E  E+  +VR YVRSKMPRLRWTPDLH
Sbjct  48    DDDQDVSSSNEGTQAVGSRISPVGNLSCNNTSVEGKERTIAVRQYVRSKMPRLRWTPDLH  107

Query  1076  LRFLHAVERLGGQERATPKLVLQLMDIKGLNIAHVKSHLQMYRSKKTEDPSQ  921
             L F+HAVERLGGQERATPKLVLQLM+++GL+IAHVKSHLQMYRSKK ++  Q
Sbjct  108   LAFIHAVERLGGQERATPKLVLQLMNVRGLSIAHVKSHLQMYRSKKLDESGQ  159



>ref|XP_006594818.1| PREDICTED: probable transcription factor KAN2-like isoform X1 
[Glycine max]
 ref|XP_006594819.1| PREDICTED: probable transcription factor KAN2-like isoform X2 
[Glycine max]
Length=369

 Score =   143 bits (361),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 71/119 (60%), Positives = 89/119 (75%), Gaps = 12/119 (10%)
 Frame = -2

Query  1148  EKKASVRPYVRSKMPRLRWTPDLHLRFLHAVERLGGQERATPKLVLQLMDIKGLNIAHVK  969
             E+ ++VR YVRSKMPRLRWTPDLHL F+HAVERLGGQERATPKLVLQLM++KGL+IAHVK
Sbjct  79    ERASTVRQYVRSKMPRLRWTPDLHLAFVHAVERLGGQERATPKLVLQLMNVKGLSIAHVK  138

Query  968   SHLQMYRSKKTEDPSQGFANHRAFMEGGDRNVFNLSQLPMFKIFNNQRLNPPFRYGDDS  792
             SHLQMYRSKK ++  Q   ++RA    G  ++F++            RLN P  +G+D+
Sbjct  139   SHLQMYRSKKLDESGQVLPHNRAMQ--GRHSIFDMY----------GRLNAPRHFGNDN  185



>gb|KHN36703.1| Putative Myb family transcription factor [Glycine soja]
Length=369

 Score =   142 bits (359),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 71/119 (60%), Positives = 89/119 (75%), Gaps = 12/119 (10%)
 Frame = -2

Query  1148  EKKASVRPYVRSKMPRLRWTPDLHLRFLHAVERLGGQERATPKLVLQLMDIKGLNIAHVK  969
             E+ ++VR YVRSKMPRLRWTPDLHL F+HAVERLGGQERATPKLVLQLM++KGL+IAHVK
Sbjct  79    ERASTVRQYVRSKMPRLRWTPDLHLAFVHAVERLGGQERATPKLVLQLMNVKGLSIAHVK  138

Query  968   SHLQMYRSKKTEDPSQGFANHRAFMEGGDRNVFNLSQLPMFKIFNNQRLNPPFRYGDDS  792
             SHLQMYRSKK ++  Q   ++RA    G  ++F++            RLN P  +G+D+
Sbjct  139   SHLQMYRSKKLDESGQVLPHNRAMQ--GRHSIFDMY----------GRLNAPRHFGNDN  185



>emb|CDX93206.1| BnaC04g46900D [Brassica napus]
Length=418

 Score =   144 bits (362),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 81/140 (58%), Positives = 93/140 (66%), Gaps = 26/140 (19%)
 Frame = -2

Query  1190  DGGSSSNSTVEES------------GEKKASVRPYVRSKMPRLRWTPDLHLRFLHAVERL  1047
             D   SSNS VEES             +K  SVRPY RSK PRLRWTP+LHL FL AVERL
Sbjct  48    DQSPSSNSYVEESRSQHHHNNNDQIKKKGGSVRPYNRSKTPRLRWTPELHLCFLQAVERL  107

Query  1046  GGQERATPKLVLQLMDIKGLNIAHVKSHLQMYRSKKTEDPS---------QGFANHRAFM  894
             GG +RATPKLVLQLM++KGL+IAHVKSHLQMYRSKKT+D +         QGF+      
Sbjct  108   GGPDRATPKLVLQLMNVKGLSIAHVKSHLQMYRSKKTDDLNQGNLLLLGDQGFS-----F  162

Query  893   EGGDRNVFNLSQLPMFKIFN  834
             E G    +NLSQLPM + F+
Sbjct  163   EHGAGYTYNLSQLPMLQSFD  182



>emb|CDY07070.1| BnaA04g22450D [Brassica napus]
Length=416

 Score =   144 bits (362),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 104/244 (43%), Positives = 127/244 (52%), Gaps = 35/244 (14%)
 Frame = -2

Query  1190  DGGSSSNSTVEESGEKK------------ASVRPYVRSKMPRLRWTPDLHLRFLHAVERL  1047
             D   SSNS VEESG +              SVRPY RSK PRLRWTP+LHL FL AVERL
Sbjct  52    DQSPSSNSYVEESGSQHHHNNNDQIKKNGGSVRPYNRSKTPRLRWTPELHLCFLQAVERL  111

Query  1046  GGQERATPKLVLQLMDIKGLNIAHVKSHLQMYRSKKTEDPSQGFANHRAFMEGGDRNVFN  867
             GG +RATPKLVLQLM++KGL+IAHVKSHLQMYRSKK +D +QG  +     E G    +N
Sbjct  112   GGPDRATPKLVLQLMNVKGLSIAHVKSHLQMYRSKKIDDLNQG--DQGFSFEHGAGYTYN  169

Query  866   LSQLPMFKIFNNQRLNPPFRYGDDSYRNCQEKWMNGTAMAHGTADRGRPYEALY-----E  702
             LSQ PM + F +Q  +    YG  S+ + + +            D  R  + L+     E
Sbjct  170   LSQPPMLQSF-DQGPSTSLGYGGGSWIDHRRQVYRSPWRGLTARDNTRTRQTLFSSQLGE  228

Query  701   RFR--SNYDLSRETINPPFTERSNRGLH-------ELKEKLGSFLE-----NQTWHHQFA  564
             RF   SN  L  +     F   S    H        +     SFLE     N++W   F 
Sbjct  229   RFHGVSNSILDDKNKTISFRTNSREAAHASNGIGEAVPRSHRSFLEGMKTFNKSWGQSF-  287

Query  563   PQNP  552
             P NP
Sbjct  288   PSNP  291



>ref|XP_009141879.1| PREDICTED: two-component response regulator ARR1-like isoform 
X2 [Brassica rapa]
Length=417

 Score =   144 bits (362),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 104/244 (43%), Positives = 127/244 (52%), Gaps = 35/244 (14%)
 Frame = -2

Query  1190  DGGSSSNSTVEESGEKK------------ASVRPYVRSKMPRLRWTPDLHLRFLHAVERL  1047
             D   SSNS VEESG +              SVRPY RSK PRLRWTP+LHL FL AVERL
Sbjct  53    DQSPSSNSYVEESGSQHHHNNNDQIKKNGGSVRPYNRSKTPRLRWTPELHLCFLQAVERL  112

Query  1046  GGQERATPKLVLQLMDIKGLNIAHVKSHLQMYRSKKTEDPSQGFANHRAFMEGGDRNVFN  867
             GG +RATPKLVLQLM++KGL+IAHVKSHLQMYRSKK +D +QG  +     E G    +N
Sbjct  113   GGPDRATPKLVLQLMNVKGLSIAHVKSHLQMYRSKKIDDLNQG--DQGFSFEHGAGYTYN  170

Query  866   LSQLPMFKIFNNQRLNPPFRYGDDSYRNCQEKWMNGTAMAHGTADRGRPYEALY-----E  702
             LSQ PM + F +Q  +    YG  S+ + + +            D  R  + L+     E
Sbjct  171   LSQPPMLQSF-DQGPSTSLGYGGGSWIDHRRQVYRSPWRGLTARDNTRTRQTLFSSQLGE  229

Query  701   RFR--SNYDLSRETINPPFTERSNRGLH-------ELKEKLGSFLE-----NQTWHHQFA  564
             RF   SN  L  +     F   S    H        +     SFLE     N++W   F 
Sbjct  230   RFHGVSNSILDDKNKTISFRTNSREAAHASNGIGEAVPRSHRSFLEGMKTFNKSWGQSF-  288

Query  563   PQNP  552
             P NP
Sbjct  289   PSNP  292



>ref|XP_010274476.1| PREDICTED: uncharacterized protein LOC104609785 [Nelumbo nucifera]
 ref|XP_010274477.1| PREDICTED: uncharacterized protein LOC104609785 [Nelumbo nucifera]
Length=462

 Score =   144 bits (363),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 73/115 (63%), Positives = 86/115 (75%), Gaps = 10/115 (9%)
 Frame = -2

Query  1232  EDETNESPRNQTVKDGGSSSNSTVEESGEKKASVRPYVRSKMPRLRWTPDLHLRFLHAVE  1053
             EDET E+ RN   KDG         E GE+  +VR YVRSKMPRLRWTPDLHL FLHAVE
Sbjct  57    EDETGENSRN---KDGTG-------EGGERTTTVRQYVRSKMPRLRWTPDLHLSFLHAVE  106

Query  1052  RLGGQERATPKLVLQLMDIKGLNIAHVKSHLQMYRSKKTEDPSQGFANHRAFMEG  888
             +LGGQERATPKLVLQLM+++GL+I+HVKSHLQMYRSKK ++  Q  +     M+G
Sbjct  107   KLGGQERATPKLVLQLMNVRGLSISHVKSHLQMYRSKKLDESGQVLSLSIRLMQG  161



>ref|XP_002450099.1| hypothetical protein SORBIDRAFT_05g000480 [Sorghum bicolor]
 gb|EES09087.1| hypothetical protein SORBIDRAFT_05g000480 [Sorghum bicolor]
Length=363

 Score =   142 bits (357),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 78/128 (61%), Positives = 89/128 (70%), Gaps = 18/128 (14%)
 Frame = -2

Query  1190  DGGSSSNSTVE------ESGEKKA-----SVRPYVRSKMPRLRWTPDLHLRFLHAVERLG  1044
             DG SS++STVE      +SG K A     SVRPYVRSK PRLRWTP+LHL FL AV+RLG
Sbjct  45    DGSSSNSSTVELDEAGGDSGRKVAGASPSSVRPYVRSKNPRLRWTPELHLCFLRAVDRLG  104

Query  1043  GQERATPKLVLQLMDIKGLNIAHVKSHLQMYRSKKTEDPSQGFAN-----HRAFMEGGDR  879
             GQ+RATPKLVLQLMD+KGL+I HVKSHLQMYRSKK +D  QG        H    +GG  
Sbjct  105   GQDRATPKLVLQLMDVKGLSIGHVKSHLQMYRSKKIDDSDQGATGSWRDLHHQLQDGG--  162

Query  878   NVFNLSQL  855
               +NL  L
Sbjct  163   QAYNLGHL  170



>ref|XP_003532757.2| PREDICTED: uncharacterized protein LOC100787138 isoform X1 [Glycine 
max]
Length=429

 Score =   143 bits (360),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 74/123 (60%), Positives = 91/123 (74%), Gaps = 5/123 (4%)
 Frame = -2

Query  1271  KTTSDDSNKFEEDEDET-NESPRNQTVKDGGSSSNS----TVEESGEKKASVRPYVRSKM  1107
             K +S D N+    ED   N+   ++  KD G+S+N     T E S E++  VR YVRSKM
Sbjct  68    KCSSFDLNEEASSEDNNDNDEGYDEEAKDEGTSTNKSSSITKEGSNERRGGVRQYVRSKM  127

Query  1106  PRLRWTPDLHLRFLHAVERLGGQERATPKLVLQLMDIKGLNIAHVKSHLQMYRSKKTEDP  927
             PRLRWTP+LHL F+HAVERLGGQERATPKLVLQLM+++GL+IAHVKSHLQMYRSKK ++ 
Sbjct  128   PRLRWTPELHLSFVHAVERLGGQERATPKLVLQLMNVRGLSIAHVKSHLQMYRSKKLDEA  187

Query  926   SQG  918
              Q 
Sbjct  188   GQA  190



>ref|XP_006585172.1| PREDICTED: uncharacterized protein LOC100787138 isoform X3 [Glycine 
max]
 gb|KHN48000.1| Putative Myb family transcription factor [Glycine soja]
Length=402

 Score =   142 bits (359),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 74/122 (61%), Positives = 91/122 (75%), Gaps = 5/122 (4%)
 Frame = -2

Query  1271  KTTSDDSNKFEEDEDET-NESPRNQTVKDGGSSSNS----TVEESGEKKASVRPYVRSKM  1107
             K +S D N+    ED   N+   ++  KD G+S+N     T E S E++  VR YVRSKM
Sbjct  23    KCSSFDLNEEASSEDNNDNDEGYDEEAKDEGTSTNKSSSITKEGSNERRGGVRQYVRSKM  82

Query  1106  PRLRWTPDLHLRFLHAVERLGGQERATPKLVLQLMDIKGLNIAHVKSHLQMYRSKKTEDP  927
             PRLRWTP+LHL F+HAVERLGGQERATPKLVLQLM+++GL+IAHVKSHLQMYRSKK ++ 
Sbjct  83    PRLRWTPELHLSFVHAVERLGGQERATPKLVLQLMNVRGLSIAHVKSHLQMYRSKKLDEA  142

Query  926   SQ  921
              Q
Sbjct  143   GQ  144



>ref|XP_007149732.1| hypothetical protein PHAVU_005G094600g [Phaseolus vulgaris]
 gb|ESW21726.1| hypothetical protein PHAVU_005G094600g [Phaseolus vulgaris]
Length=364

 Score =   141 bits (356),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 83/209 (40%), Positives = 123/209 (59%), Gaps = 25/209 (12%)
 Frame = -2

Query  1160  EESGEKKASVRPYVRSKMPRLRWTPDLHLRFLHAVERLGGQERATPKLVLQLMDIKGLNI  981
             EE  E+  +VR YVRSKMPRLRWTPDLHL F+HAVERLGGQERATPKLVLQLM+++GL+I
Sbjct  69    EEGKERATAVRQYVRSKMPRLRWTPDLHLAFVHAVERLGGQERATPKLVLQLMNVRGLSI  128

Query  980   AHVKSHLQMYRSKKTEDPSQGFANHRAFMEGGDRNVFNLS---QLPMFKIFNNQRLNP--  816
             AHVKSHLQMYRSKK ++  Q  + ++A    G  ++F++      P   + +N+   P  
Sbjct  129   AHVKSHLQMYRSKKLDESGQVLSQNKAMQ--GRHSIFDMYGRLNAPRHFVVDNRNYIPSS  186

Query  815   ------PFRY-GDDSYRNCQEKWMNGTAMAHGTADRGRPYEALYERFRSNYDLSRETINP  657
                   P++     S R+    + NG  M   +        +++++   +Y   R + +P
Sbjct  187   LLIQQSPYQISAHGSSRSHPTGFFNGHMMIRSS--------SMWDKDLCSYQYQRSSCSP  238

Query  656   PFT--ERSNRGLHELKEKLGSFL-ENQTW  579
              F    + +  + ++K ++  FL + Q W
Sbjct  239   NFAGHAKFDAEVRDVKNRMPEFLNQVQVW  267



>ref|XP_010657046.1| PREDICTED: uncharacterized protein LOC104880828 [Vitis vinifera]
Length=464

 Score =   143 bits (361),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 74/122 (61%), Positives = 94/122 (77%), Gaps = 9/122 (7%)
 Frame = -2

Query  1274  SKTTSDDSNKFEEDEDETNESPRNQTVKDGGSSSNSTVEESGEKKASVRPYVRSKMPRLR  1095
             S TT    N+ +EDE  T+ +  N       SS+N+TVE  G+++ +VR Y+RSKMPRLR
Sbjct  46    SSTTGVPENEVKEDETSTDANYSN-------SSNNTTVE--GKERTTVRQYIRSKMPRLR  96

Query  1094  WTPDLHLRFLHAVERLGGQERATPKLVLQLMDIKGLNIAHVKSHLQMYRSKKTEDPSQGF  915
             WTPDLHL F++AVERLGGQERATPKLVLQLM+++GL+IAHVKSHLQMYRSKK +D  Q  
Sbjct  97    WTPDLHLAFVNAVERLGGQERATPKLVLQLMNVRGLSIAHVKSHLQMYRSKKLDDSGQVL  156

Query  914   AN  909
             ++
Sbjct  157   SH  158



>ref|XP_006585171.1| PREDICTED: uncharacterized protein LOC100787138 isoform X2 [Glycine 
max]
Length=447

 Score =   143 bits (360),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 74/122 (61%), Positives = 91/122 (75%), Gaps = 5/122 (4%)
 Frame = -2

Query  1271  KTTSDDSNKFEEDEDET-NESPRNQTVKDGGSSSNS----TVEESGEKKASVRPYVRSKM  1107
             K +S D N+    ED   N+   ++  KD G+S+N     T E S E++  VR YVRSKM
Sbjct  68    KCSSFDLNEEASSEDNNDNDEGYDEEAKDEGTSTNKSSSITKEGSNERRGGVRQYVRSKM  127

Query  1106  PRLRWTPDLHLRFLHAVERLGGQERATPKLVLQLMDIKGLNIAHVKSHLQMYRSKKTEDP  927
             PRLRWTP+LHL F+HAVERLGGQERATPKLVLQLM+++GL+IAHVKSHLQMYRSKK ++ 
Sbjct  128   PRLRWTPELHLSFVHAVERLGGQERATPKLVLQLMNVRGLSIAHVKSHLQMYRSKKLDEA  187

Query  926   SQ  921
              Q
Sbjct  188   GQ  189



>ref|XP_009133426.1| PREDICTED: uncharacterized protein LOC103857923 [Brassica rapa]
Length=389

 Score =   141 bits (356),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 75/133 (56%), Positives = 97/133 (73%), Gaps = 8/133 (6%)
 Frame = -2

Query  1223  TNESP-RNQTVKDGGSS--SNSTVEESGEKKASVRPYVRSKMPRLRWTPDLHLRFLHAVE  1053
              ++SP +N  +++ GS   +N  +++SG    SVRPY RSK PRLRWTP+LH+ FL AVE
Sbjct  28    ADQSPSKNSYLEENGSHHHNNDQIKKSG---GSVRPYNRSKTPRLRWTPELHICFLQAVE  84

Query  1052  RLGGQERATPKLVLQLMDIKGLNIAHVKSHLQMYRSKKTEDPSQGFANHRAFMEGGDRNV  873
             RLGG +RATPKLVLQLM++KGL+I HVKSHLQMYRSKK +D +QG  + R   E G    
Sbjct  85    RLGGPDRATPKLVLQLMNVKGLSIGHVKSHLQMYRSKKIDDTNQG--DQRFSFEHGAGYT  142

Query  872   FNLSQLPMFKIFN  834
             +NL QLPM + F+
Sbjct  143   YNLRQLPMLQSFD  155



>ref|XP_002299997.1| hypothetical protein POPTR_0001s28690g [Populus trichocarpa]
 gb|EEE84802.1| hypothetical protein POPTR_0001s28690g [Populus trichocarpa]
Length=364

 Score =   141 bits (355),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 74/113 (65%), Positives = 87/113 (77%), Gaps = 5/113 (4%)
 Frame = -2

Query  1256  DSNKFEEDEDETNESPRNQTVKDGGSSSNSTVEESGEKKAS-VRPYVRSKMPRLRWTPDL  1080
             D++   +D +  NES      K+  SSSNS V+ES +  +S VRPYVRSK+PRLRW PDL
Sbjct  15    DASGKSKDGEGDNESK----TKNSASSSNSIVDESEKASSSGVRPYVRSKVPRLRWIPDL  70

Query  1079  HLRFLHAVERLGGQERATPKLVLQLMDIKGLNIAHVKSHLQMYRSKKTEDPSQ  921
             HL F+ AVERLGG ERATPKLVLQLM+IKGL+IAHVKSHLQMYRSKK +D  Q
Sbjct  71    HLCFVQAVERLGGYERATPKLVLQLMNIKGLSIAHVKSHLQMYRSKKIDDQGQ  123



>ref|XP_011003744.1| PREDICTED: probable transcription factor KAN4 [Populus euphratica]
Length=337

 Score =   140 bits (352),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 78/154 (51%), Positives = 93/154 (60%), Gaps = 2/154 (1%)
 Frame = -2

Query  1256  DSNKFEEDEDETNESPRNQTVKDGGSSSNSTVEESGEKKAS-VRPYVRSKMPRLRWTPDL  1080
             D  KF+       E       K+ GSSSNS VEE  +  +S VRPY RSK+PRLRWTPDL
Sbjct  10    DGLKFDPSGKNNEEGDDESKTKNSGSSSNSIVEECEKASSSGVRPYARSKVPRLRWTPDL  69

Query  1079  HLRFLHAVERLGGQERATPKLVLQLMDIKGLNIAHVKSHLQMYRSKKTEDPSQGFANHRA  900
             HL F+ AVERLGG ERATPKLVLQLM+ KGL IA VKSHLQMYRSKK +D  Q       
Sbjct  70    HLCFVQAVERLGGHERATPKLVLQLMNFKGLRIADVKSHLQMYRSKKIDDQGQVINGMGD  129

Query  899   FMEGGDRNVFNLSQLPMFKIFNNQRLNPPFRYGD  798
              +   D+   +  Q  +    ++   N  FR G+
Sbjct  130   LIRSSDKFSHDFWQHSLLPNIDHNH-NSNFRCGN  162



>ref|XP_006469002.1| PREDICTED: uncharacterized protein LOC102628788 [Citrus sinensis]
Length=340

 Score =   140 bits (352),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 82/155 (53%), Positives = 99/155 (64%), Gaps = 11/155 (7%)
 Frame = -2

Query  1292  SGETVCSKTTSDDSNKFEEDEDETNESPRNQTVKDGGSS--SNSTVEESGEKKASVRPYV  1119
             SG     K +S D N+    +D+ N++  N    +GG+S  S +T  E  E     R YV
Sbjct  20    SGTQAFQKCSSFDLNEEAAMDDDENDNITN-VPYNGGTSIISTNTTMEGKEIITMARQYV  78

Query  1118  RSKMPRLRWTPDLHLRFLHAVERLGGQERATPKLVLQLMDIKGLNIAHVKSHLQMYRSKK  939
             RSKMPRLRWT DLHL F+HAVERLGGQERATPK VLQLM++KGL+IAHVKSHLQMYRSKK
Sbjct  79    RSKMPRLRWTQDLHLAFVHAVERLGGQERATPKSVLQLMNVKGLSIAHVKSHLQMYRSKK  138

Query  938   TEDPSQGFANHRAFMEGGDRNVFNLSQLPMFKIFN  834
              +   Q  +N R   EG D        L M++ FN
Sbjct  139   LDASGQVLSN-RIMQEGHDI-------LEMYRKFN  165



>ref|XP_008794301.1| PREDICTED: uncharacterized protein LOC103710387 [Phoenix dactylifera]
Length=351

 Score =   140 bits (353),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 73/122 (60%), Positives = 92/122 (75%), Gaps = 4/122 (3%)
 Frame = -2

Query  1196  VKDGGSSSNSTVEESGEKKAS--VRPYVRSKMPRLRWTPDLHLRFLHAVERLGGQERATP  1023
              ++G SSSNST +ES +K  S  VR Y+RS  PRLRWTPDLHL F+ AVERLGGQ+RATP
Sbjct  23    ARNGRSSSNSTTDESKKKLNSGFVRQYIRSNNPRLRWTPDLHLCFVRAVERLGGQDRATP  82

Query  1022  KLVLQLMDIKGLNIAHVKSHLQMYRSKKTEDPSQGFANHRAFMEGGDRNVFNLSQLPMFK  843
             KLVLQLM++KGL+I+HVKSHLQMYRSKK ++  +   + R  +EG  R+ + LS LP  +
Sbjct  83    KLVLQLMNVKGLSISHVKSHLQMYRSKKIDESDRD--DSRNTIEGRARHAYILSHLPALQ  140

Query  842   IF  837
              F
Sbjct  141   GF  142



>gb|KDO63386.1| hypothetical protein CISIN_1g038268mg, partial [Citrus sinensis]
Length=260

 Score =   137 bits (345),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 81/154 (53%), Positives = 95/154 (62%), Gaps = 9/154 (6%)
 Frame = -2

Query  1292  SGETVCSKTTSDDSNKFEEDEDETNESPRNQTVKDGGSS-SNSTVEESGEKKASVRPYVR  1116
             SG     K +S D N+    +D  N++  N     G S  S +T  E  E     R YVR
Sbjct  20    SGTQAFQKCSSFDLNEEAAMDDAENDNITNVPYSGGTSIISTNTTMEGKEIITMARQYVR  79

Query  1115  SKMPRLRWTPDLHLRFLHAVERLGGQERATPKLVLQLMDIKGLNIAHVKSHLQMYRSKKT  936
             SKMPRLRWT DLHL F+HAVERLGGQERATPK VLQLM++KGL+IAHVKSHLQMYRSKK 
Sbjct  80    SKMPRLRWTQDLHLAFVHAVERLGGQERATPKSVLQLMNVKGLSIAHVKSHLQMYRSKKL  139

Query  935   EDPSQGFANHRAFMEGGDRNVFNLSQLPMFKIFN  834
             +   Q  +N R   EG D        L M++ FN
Sbjct  140   DASGQVLSN-RIMQEGHD-------ILEMYRKFN  165



>ref|XP_007048707.1| Myb-like HTH transcriptional regulator family protein [Theobroma 
cacao]
 gb|EOX92864.1| Myb-like HTH transcriptional regulator family protein [Theobroma 
cacao]
Length=381

 Score =   140 bits (353),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 75/149 (50%), Positives = 90/149 (60%), Gaps = 20/149 (13%)
 Frame = -2

Query  1241  EEDEDETNESPRNQTVKDGGSSSNSTVEESGEKKASVRPYVRSKMPRLRWTPDLHLRFLH  1062
             E D DE N             + N T  +  E+   VR YVRSKMPRLRWTPDLHL F+H
Sbjct  37    ENDSDEIN-------------ADNQTTSKGKERTCRVRQYVRSKMPRLRWTPDLHLSFVH  83

Query  1061  AVERLGGQERATPKLVLQLMDIKGLNIAHVKSHLQMYRSKKTEDPSQGFA-------NHR  903
             AVERLGGQERATPKLVLQ+M+++GL+IAHVKSHLQMYRSKK  +  Q  +        ++
Sbjct  84    AVERLGGQERATPKLVLQMMNVRGLSIAHVKSHLQMYRSKKLNESGQVISQTSRFLGTYK  143

Query  902   AFMEGGDRNVFNLSQLPMFKIFNNQRLNP  816
              F  GG   + N S LP   +   Q   P
Sbjct  144   RFSPGGHFRIDNASPLPSSPVLLKQLYRP  172



>gb|KDP21103.1| hypothetical protein JCGZ_21574 [Jatropha curcas]
Length=366

 Score =   139 bits (351),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 81/154 (53%), Positives = 106/154 (69%), Gaps = 11/154 (7%)
 Frame = -2

Query  1292  SGETVCSKTTSDDSNKFEEDEDETNESPRNQTVKDGGSSSNSTVE--ESGEKKASVRPYV  1119
             S +   S   +++++  EEDEDE       +  ++G SS+N+     E  E+K++VR YV
Sbjct  30    SSQKCSSFDLNEEASCSEEDEDE-------KITEEGSSSANNNNSSSERNERKSTVRQYV  82

Query  1118  RSKMPRLRWTPDLHLRFLHAVERLGGQERATPKLVLQLMDIKGLNIAHVKSHLQMYRSKK  939
             RSKMPRLRWTPDLHL F+HAVERLGGQERATPKLVLQLM+++GL+IAHVKSHLQMYRSKK
Sbjct  83    RSKMPRLRWTPDLHLSFVHAVERLGGQERATPKLVLQLMNVRGLSIAHVKSHLQMYRSKK  142

Query  938   TEDPSQGFANHRAFMEGGDRNVFNLSQLPMFKIF  837
              ++  Q  +  +A+     R+  N   LP  K F
Sbjct  143   LDEAGQVLS--QAYRSMQRRDNTNTGMLPPQKQF  174



>gb|KHN06404.1| Putative Myb family transcription factor [Glycine soja]
Length=401

 Score =   140 bits (353),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 73/123 (59%), Positives = 90/123 (73%), Gaps = 10/123 (8%)
 Frame = -2

Query  1286  ETVCSKTTSDDSNK-FEEDEDETNESPRNQTVKDGGSSSNSTVEESGEKKASVRPYVRSK  1110
             E   SK  +D+ +K FEE  +E   + +         SS+ T E S E++  VR YVRSK
Sbjct  30    EEASSKDNNDNDDKGFEEAREEGTSTNK---------SSSMTKEGSNERRGGVRQYVRSK  80

Query  1109  MPRLRWTPDLHLRFLHAVERLGGQERATPKLVLQLMDIKGLNIAHVKSHLQMYRSKKTED  930
             MPRLRWTP+LHL F+HAVERLGGQERATPKLVLQLM+++GL+IAHVKSHLQMYRSKK ++
Sbjct  81    MPRLRWTPELHLSFVHAVERLGGQERATPKLVLQLMNVRGLSIAHVKSHLQMYRSKKLDE  140

Query  929   PSQ  921
               Q
Sbjct  141   AGQ  143



>ref|XP_007148039.1| hypothetical protein PHAVU_006G175300g [Phaseolus vulgaris]
 ref|XP_007148040.1| hypothetical protein PHAVU_006G175300g [Phaseolus vulgaris]
 gb|ESW20033.1| hypothetical protein PHAVU_006G175300g [Phaseolus vulgaris]
 gb|ESW20034.1| hypothetical protein PHAVU_006G175300g [Phaseolus vulgaris]
Length=364

 Score =   139 bits (351),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 72/126 (57%), Positives = 91/126 (72%), Gaps = 5/126 (4%)
 Frame = -2

Query  1280  VCSKTTSDDSNKFEEDEDETNESPRNQTVKDGGSSSN---STVEESGEKKASVRPYVRSK  1110
              CS   ++ S   EE  + T +    + VKD G+S+N   S   E  E++ +VR YVRSK
Sbjct  30    ACSDDNTNGST--EEGYELTTDENNIEKVKDEGTSANNGSSISREGNERRGTVRQYVRSK  87

Query  1109  MPRLRWTPDLHLRFLHAVERLGGQERATPKLVLQLMDIKGLNIAHVKSHLQMYRSKKTED  930
             MPRLRWTP+LH  F+HAVERLGGQERATPKLVLQLM+++GL+IAHVKSHLQMYRSKK ++
Sbjct  88    MPRLRWTPELHHSFMHAVERLGGQERATPKLVLQLMNVEGLSIAHVKSHLQMYRSKKLDE  147

Query  929   PSQGFA  912
               Q  +
Sbjct  148   VGQVLS  153



>ref|XP_003524206.1| PREDICTED: two-component response regulator ARR14-like [Glycine 
max]
Length=401

 Score =   140 bits (352),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 73/123 (59%), Positives = 90/123 (73%), Gaps = 10/123 (8%)
 Frame = -2

Query  1286  ETVCSKTTSDDSNK-FEEDEDETNESPRNQTVKDGGSSSNSTVEESGEKKASVRPYVRSK  1110
             E   SK  +D+ +K FEE  +E   + +         SS+ T E S E++  VR YVRSK
Sbjct  30    EEASSKDNNDNDDKGFEEAREEGTSTNK---------SSSMTKEGSNERRGGVRQYVRSK  80

Query  1109  MPRLRWTPDLHLRFLHAVERLGGQERATPKLVLQLMDIKGLNIAHVKSHLQMYRSKKTED  930
             MPRLRWTP+LHL F+HAVERLGGQERATPKLVLQLM+++GL+IAHVKSHLQMYRSKK ++
Sbjct  81    MPRLRWTPELHLSFVHAVERLGGQERATPKLVLQLMNVRGLSIAHVKSHLQMYRSKKLDE  140

Query  929   PSQ  921
               Q
Sbjct  141   AGQ  143



>ref|XP_007159455.1| hypothetical protein PHAVU_002G239100g [Phaseolus vulgaris]
 ref|XP_007159456.1| hypothetical protein PHAVU_002G239100g [Phaseolus vulgaris]
 gb|ESW31449.1| hypothetical protein PHAVU_002G239100g [Phaseolus vulgaris]
 gb|ESW31450.1| hypothetical protein PHAVU_002G239100g [Phaseolus vulgaris]
Length=390

 Score =   139 bits (351),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 72/125 (58%), Positives = 93/125 (74%), Gaps = 5/125 (4%)
 Frame = -2

Query  1271  KTTSDDSNKFEEDEDETNESPR-NQTVKDGGSSSNS----TVEESGEKKASVRPYVRSKM  1107
             K +S D N+    E+ +N + +  +  KD G+S+N     T E + E++  VR YVRSKM
Sbjct  22    KCSSFDLNEEASSENNSNANDKIYEEAKDEGTSTNKSSSITREGNNERRGGVRQYVRSKM  81

Query  1106  PRLRWTPDLHLRFLHAVERLGGQERATPKLVLQLMDIKGLNIAHVKSHLQMYRSKKTEDP  927
             PRLRWTP+LHL F+HAVERLGGQERATPKLVLQLM+++GL+IAHVKSHLQMYRSKK ++ 
Sbjct  82    PRLRWTPELHLSFVHAVERLGGQERATPKLVLQLMNVRGLSIAHVKSHLQMYRSKKLDEA  141

Query  926   SQGFA  912
              Q  +
Sbjct  142   GQVLS  146



>ref|XP_002442650.1| hypothetical protein SORBIDRAFT_08g000510 [Sorghum bicolor]
 gb|EES16488.1| hypothetical protein SORBIDRAFT_08g000510 [Sorghum bicolor]
Length=364

 Score =   139 bits (350),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 76/130 (58%), Positives = 89/130 (68%), Gaps = 18/130 (14%)
 Frame = -2

Query  1190  DGGSSSNSTVE------ESGEKKA-----SVRPYVRSKMPRLRWTPDLHLRFLHAVERLG  1044
             DG SS++STVE      +SG K A     SVRPYVRSK PRLRWTP+LHL FL AV+RLG
Sbjct  43    DGSSSNSSTVELDEAGGDSGRKAAGASPSSVRPYVRSKNPRLRWTPELHLCFLRAVDRLG  102

Query  1043  GQERATPKLVLQLMDIKGLNIAHVKSHLQMYRSKKTEDPSQGFAN-----HRAFMEGGDR  879
             GQ+RATPKLVLQLM++KGL+I HVKSHLQMYRSKK +D  QG        H    +GG  
Sbjct  103   GQDRATPKLVLQLMNVKGLSIGHVKSHLQMYRSKKIDDSGQGNTGSWRDLHHQLHDGG--  160

Query  878   NVFNLSQLPM  849
               +N   L +
Sbjct  161   QAYNFGHLSL  170



>ref|XP_006855946.1| hypothetical protein AMTR_s00037p00221530 [Amborella trichopoda]
 gb|ERN17413.1| hypothetical protein AMTR_s00037p00221530 [Amborella trichopoda]
Length=120

 Score =   132 bits (331),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 65/103 (63%), Positives = 77/103 (75%), Gaps = 5/103 (5%)
 Frame = -2

Query  1238  EDEDETNESPRNQTVKDGGSSSNSTVEESGEKKASVRPYVRSKMPRLRWTPDLHLRFLHA  1059
             E+E ET      QT+K   S +NS  E+S     SVR Y+RSKMPRLRWT +LH  F++A
Sbjct  13    EEEMETQ-----QTIKSSSSENNSVGEDSSRPSGSVRQYIRSKMPRLRWTAELHHSFVNA  67

Query  1058  VERLGGQERATPKLVLQLMDIKGLNIAHVKSHLQMYRSKKTED  930
             VERLGGQ +ATPKLVLQ+MD+KGL IAHVKSHLQMYRS K +D
Sbjct  68    VERLGGQSKATPKLVLQIMDVKGLTIAHVKSHLQMYRSMKNDD  110



>gb|EPS58795.1| hypothetical protein M569_16018 [Genlisea aurea]
Length=230

 Score =   135 bits (340),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 61/92 (66%), Positives = 76/92 (83%), Gaps = 0/92 (0%)
 Frame = -2

Query  1205  NQTVKDGGSSSNSTVEESGEKKASVRPYVRSKMPRLRWTPDLHLRFLHAVERLGGQERAT  1026
             N+TV +     +S   E  E+K +VR Y+RSKMPRLRWTPDLHL F+HA+ERLGGQERAT
Sbjct  47    NETVGEKSCDVSSKSGEGNERKTNVRQYIRSKMPRLRWTPDLHLSFVHAIERLGGQERAT  106

Query  1025  PKLVLQLMDIKGLNIAHVKSHLQMYRSKKTED  930
             PK VLQLM+++GL+I+HVKSHLQMYRSKK ++
Sbjct  107   PKAVLQLMNVRGLSISHVKSHLQMYRSKKLDE  138



>ref|XP_011024914.1| PREDICTED: probable transcription factor KAN2 isoform X1 [Populus 
euphratica]
Length=366

 Score =   139 bits (349),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 99/244 (41%), Positives = 130/244 (53%), Gaps = 11/244 (5%)
 Frame = -2

Query  1256  DSNKFEEDEDETNESPRNQTVKDGGSSSNSTVEESGEKKAS-VRPYVRSKMPRLRWTPDL  1080
             D++   +D +  NES      K+  SSSNS V+ES +  +S VRPYVRSK+PRLRWTPDL
Sbjct  15    DASGKSKDGEGDNESK----TKNSASSSNSIVDESEKASSSGVRPYVRSKVPRLRWTPDL  70

Query  1079  HLRFLHAVERLGGQERATPKLVLQLMDIKGLNIAHVKSHL-QMYRSKKTEDPSQGFANHR  903
             HL F+ AVERLGG ERATPKLVLQLM+IKGL+IAHVKSHL QMYRSKK +D  Q   +  
Sbjct  71    HLCFVQAVERLGGYERATPKLVLQLMNIKGLSIAHVKSHLQQMYRSKKIDDQGQVIDSRG  130

Query  902   AFMEGGDRNVFNLSQLPMFKIFNNQRLNPPFRYGDDSYRNCQEKWMNGTAMAHGTADRGR  723
               +        N  Q  +    ++ R +  FR    S       W+   ++    +   R
Sbjct  131   DLIGCSGYYSHNFWQHSLLPNIDHNR-SSDFRSRSVSRSTGHGNWITSPSVLGPDSMNIR  189

Query  722   PYEALYERF--RSNYDLSRETINPPFTERSNRGLHELKEKLG-SFLENQTWHHQFAPQNP  552
                  Y     R N ++   T    F   +N    + + KL   FL+N++ H      N 
Sbjct  190   SGAGFYNSISERINGEIGSSTRRGSFHTCNNSTFTDQRRKLKQEFLDNES-HQPMYNGNS  248

Query  551   IQHQ  540
             IQ Q
Sbjct  249   IQGQ  252



>ref|XP_008228924.1| PREDICTED: uncharacterized protein LOC103328312 isoform X2 [Prunus 
mume]
Length=431

 Score =   140 bits (352),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 79/159 (50%), Positives = 101/159 (64%), Gaps = 11/159 (7%)
 Frame = -2

Query  1268  TTSDDSNKFEEDEDETNESPRNQTVKDGGSSSNSTVEESGEKKASVRPYVRSKMPRLRWT  1089
             +T DD      +E    ++  ++T  +G  S N+T  E  E+  +VR YVRSKMPRLRWT
Sbjct  58    STGDDDQDVSSNE--GTQAVGSRTSPEGNLSCNNTSVEGKERTIAVRQYVRSKMPRLRWT  115

Query  1088  PDLHLRFLHAVERLGGQERATPKLVLQLMDIKGLNIAHVKSHLQMYRSKKTEDPSQGFAN  909
             PDLHL F+HAV+RLGGQERATPKLVLQLM+++GL+IAHVKSHLQMYRSKK ++  Q  + 
Sbjct  116   PDLHLAFVHAVDRLGGQERATPKLVLQLMNVRGLSIAHVKSHLQMYRSKKLDESGQVISQ  175

Query  908   HRAFMEGGDRNVFNLSQLPMFKIFNNQRLNPPFRYGDDS  792
                 M   D        L  ++ FN  R     R+ DDS
Sbjct  176   SSRGMRVKDH------ILEAYRKFNPYR---HLRHVDDS  205



>ref|XP_010104403.1| Putative Myb family transcription factor [Morus notabilis]
 gb|EXC00248.1| Putative Myb family transcription factor [Morus notabilis]
Length=468

 Score =   140 bits (352),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 71/121 (59%), Positives = 88/121 (73%), Gaps = 9/121 (7%)
 Frame = -2

Query  1256  DSNKFEEDEDETNESPRNQTVKDGGSSSNSTVEESGEKK---------ASVRPYVRSKMP  1104
             +S KF+ +E+ T     + ++ +G        E++ E+K         +SVRPYVRSKMP
Sbjct  30    NSRKFDLNEEATGTEEADSSINNGVLHDEDLKEKNVEEKVLYSGTKSTSSVRPYVRSKMP  89

Query  1103  RLRWTPDLHLRFLHAVERLGGQERATPKLVLQLMDIKGLNIAHVKSHLQMYRSKKTEDPS  924
             RLRWTPDLHL F+HAVERLGGQERATPKLV QLMD+KGL+IAHVKSHLQMYRSKK ++  
Sbjct  90    RLRWTPDLHLAFVHAVERLGGQERATPKLVQQLMDVKGLSIAHVKSHLQMYRSKKLDESG  149

Query  923   Q  921
             Q
Sbjct  150   Q  150



>ref|XP_006597478.1| PREDICTED: uncharacterized protein LOC100787474 isoform X1 [Glycine 
max]
Length=372

 Score =   138 bits (348),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 74/147 (50%), Positives = 98/147 (67%), Gaps = 4/147 (3%)
 Frame = -2

Query  1286  ETVCSKTTSDDSNKFEEDEDETNESPRNQTVKDGGSSSNSTVEESGEKKASVRPYVRSKM  1107
             E  CS+  SD     E     TNE  +++     GSS +S   E  E++ +VR YVRSKM
Sbjct  26    ELACSEDNSDTEECCELTT--TNEKAKDEGTSANGSSISS--REGNERRGTVRQYVRSKM  81

Query  1106  PRLRWTPDLHLRFLHAVERLGGQERATPKLVLQLMDIKGLNIAHVKSHLQMYRSKKTEDP  927
             PRLRWTP+LH  F+HAVERLGGQERATPKLVLQLM+++GL+IAHVKSHLQMYRSKK ++ 
Sbjct  82    PRLRWTPELHHSFVHAVERLGGQERATPKLVLQLMNVRGLSIAHVKSHLQMYRSKKLDEV  141

Query  926   SQGFANHRAFMEGGDRNVFNLSQLPMF  846
              Q    + A +    ++   +++ P+ 
Sbjct  142   GQVHIIYCAVLSQTSKSNQEVARRPLI  168



>ref|XP_011024916.1| PREDICTED: probable transcription factor KAN2 isoform X3 [Populus 
euphratica]
Length=364

 Score =   138 bits (348),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 75/114 (66%), Positives = 88/114 (77%), Gaps = 6/114 (5%)
 Frame = -2

Query  1256  DSNKFEEDEDETNESPRNQTVKDGGSSSNSTVEESGEKKAS-VRPYVRSKMPRLRWTPDL  1080
             D++   +D +  NES      K+  SSSNS V+ES +  +S VRPYVRSK+PRLRWTPDL
Sbjct  15    DASGKSKDGEGDNESK----TKNSASSSNSIVDESEKASSSGVRPYVRSKVPRLRWTPDL  70

Query  1079  HLRFLHAVERLGGQERATPKLVLQLMDIKGLNIAHVKSHL-QMYRSKKTEDPSQ  921
             HL F+ AVERLGG ERATPKLVLQLM+IKGL+IAHVKSHL QMYRSKK +D  Q
Sbjct  71    HLCFVQAVERLGGYERATPKLVLQLMNIKGLSIAHVKSHLQQMYRSKKIDDQGQ  124



>ref|XP_006597479.1| PREDICTED: uncharacterized protein LOC100787474 isoform X2 [Glycine 
max]
Length=365

 Score =   138 bits (348),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 72/125 (58%), Positives = 89/125 (71%), Gaps = 4/125 (3%)
 Frame = -2

Query  1286  ETVCSKTTSDDSNKFEEDEDETNESPRNQTVKDGGSSSNSTVEESGEKKASVRPYVRSKM  1107
             E  CS+  SD     E     TNE  +++     GSS +S   E  E++ +VR YVRSKM
Sbjct  26    ELACSEDNSDTEECCELTT--TNEKAKDEGTSANGSSISS--REGNERRGTVRQYVRSKM  81

Query  1106  PRLRWTPDLHLRFLHAVERLGGQERATPKLVLQLMDIKGLNIAHVKSHLQMYRSKKTEDP  927
             PRLRWTP+LH  F+HAVERLGGQERATPKLVLQLM+++GL+IAHVKSHLQMYRSKK ++ 
Sbjct  82    PRLRWTPELHHSFVHAVERLGGQERATPKLVLQLMNVRGLSIAHVKSHLQMYRSKKLDEV  141

Query  926   SQGFA  912
              Q  +
Sbjct  142   GQVLS  146



>ref|XP_004233059.1| PREDICTED: two-component response regulator ARR18-like [Solanum 
lycopersicum]
Length=348

 Score =   137 bits (346),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 74/132 (56%), Positives = 94/132 (71%), Gaps = 15/132 (11%)
 Frame = -2

Query  1205  NQTVKDGGSSSNSTVEESGEKKASVRPYVRSKMPRLRWTPDLHLRFLHAVERLGGQERAT  1026
             N+   +G  +++S VE     K +VR YVRSK+PRLRWTPDLH  F+HA+ERLGGQERAT
Sbjct  42    NEKEIEGNYNTSSDVE-----KKNVRQYVRSKLPRLRWTPDLHRSFVHAIERLGGQERAT  96

Query  1025  PKLVLQLMDIKGLNIAHVKSHLQMYRSKKTEDPSQ--GFANHRAFMEGGDRNVFNLSQLP  852
             PKLVLQ+M+++GL+IAHVKSHLQMYRSKK ++  Q  G  N+R+ M+G  R+ F  S L 
Sbjct  97    PKLVLQMMNVRGLSIAHVKSHLQMYRSKKLDESGQVLGHGNNRSIMQG--RSYFFRSHL-  153

Query  851   MFKIFNNQRLNP  816
                    QR NP
Sbjct  154   -----GGQRYNP  160



>ref|XP_010276999.1| PREDICTED: uncharacterized protein LOC104611575 [Nelumbo nucifera]
 ref|XP_010277000.1| PREDICTED: uncharacterized protein LOC104611575 [Nelumbo nucifera]
Length=467

 Score =   139 bits (350),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 65/93 (70%), Positives = 78/93 (84%), Gaps = 1/93 (1%)
 Frame = -2

Query  1190  DGGSSSNSTVEESGEKKASVRPYVRSKMPRLRWTPDLHLRFLHAVERLGGQERATPKLVL  1011
             D  +  NST E+ GE+  +VR YVRSKMPRLRWTPDLHL F+HAVE+LGGQERATPKLVL
Sbjct  59    DDSTDKNSTTED-GERTTTVRQYVRSKMPRLRWTPDLHLSFVHAVEKLGGQERATPKLVL  117

Query  1010  QLMDIKGLNIAHVKSHLQMYRSKKTEDPSQGFA  912
             QLM+++GL+IAHVKSHLQMYRSKK ++  Q  +
Sbjct  118   QLMNVRGLSIAHVKSHLQMYRSKKLDESGQVLS  150



>emb|CDY52431.1| BnaC03g72550D [Brassica napus]
Length=389

 Score =   138 bits (347),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 76/144 (53%), Positives = 93/144 (65%), Gaps = 14/144 (10%)
 Frame = -2

Query  1190  DGGSSSNSTVEESGEK----------KASVRPYVRSKMPRLRWTPDLHLRFLHAVERLGG  1041
             D   S NS +EE+G              SVRPY RSK PRLRWTP+LH+ FL AVERLGG
Sbjct  29    DQSPSKNSYLEENGSHHHNNDQIKKISGSVRPYNRSKTPRLRWTPELHICFLQAVERLGG  88

Query  1040  QERATPKLVLQLMDIKGLNIAHVKSHLQMYRSKKTEDPSQGFANHRAFMEGGDRNVFNLS  861
              +RATPKLVLQLM++KGL+I HVKSHLQMYRSKK +D +QG  + R   E      ++L 
Sbjct  89    PDRATPKLVLQLMNVKGLSIGHVKSHLQMYRSKKIDDTNQG--DQRFSFEHRAGYTYDLR  146

Query  860   QLPMFKIFNNQRLNPPFRYGDDSY  789
             QLPM + F+  R +    YG  S+
Sbjct  147   QLPMLQSFDQSRTS--LGYGGGSW  168



>ref|XP_010999741.1| PREDICTED: uncharacterized protein LOC105107499 [Populus euphratica]
Length=393

 Score =   137 bits (346),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 65/110 (59%), Positives = 83/110 (75%), Gaps = 0/110 (0%)
 Frame = -2

Query  1178  SSNSTVEESGEKKASVRPYVRSKMPRLRWTPDLHLRFLHAVERLGGQERATPKLVLQLMD  999
             ++N+T     E+K++VR YVRS+MPRLRWTPDLHL F+HAVERLGGQE+ATPKLVLQLM+
Sbjct  60    ANNATSAGRNERKSTVRQYVRSRMPRLRWTPDLHLSFVHAVERLGGQEKATPKLVLQLMN  119

Query  998   IKGLNIAHVKSHLQMYRSKKTEDPSQGFANHRAFMEGGDRNVFNLSQLPM  849
             ++GL+IAHVKSHLQMYRSKK ++  Q        M+G         Q+P+
Sbjct  120   VRGLSIAHVKSHLQMYRSKKLDEAGQVLCQTYRSMQGRGCIQSKFHQMPV  169



>ref|XP_004504295.1| PREDICTED: two-component response regulator ARR14-like [Cicer 
arietinum]
Length=426

 Score =   138 bits (347),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 67/99 (68%), Positives = 80/99 (81%), Gaps = 1/99 (1%)
 Frame = -2

Query  1178  SSNSTVEESGEKKASVRPYVRSKMPRLRWTPDLHLRFLHAVERLGGQERATPKLVLQLMD  999
             +S+ST   S E++  VR YVRSKMPRLRWTPDLH  F+HAVERLGGQERATPKLVLQLM+
Sbjct  80    TSSSTKNRSSERRNGVRQYVRSKMPRLRWTPDLHHSFVHAVERLGGQERATPKLVLQLMN  139

Query  998   IKGLNIAHVKSHLQMYRSKKTEDPSQGFA-NHRAFMEGG  885
             ++GL+IAHVKSHLQMYRSKK ++  Q  +  HR+  E G
Sbjct  140   VRGLSIAHVKSHLQMYRSKKLDESGQVLSPTHRSTYELG  178



>ref|XP_010915504.1| PREDICTED: two-component response regulator ARR18-like isoform 
X2 [Elaeis guineensis]
Length=529

 Score =   139 bits (350),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 62/81 (77%), Positives = 72/81 (89%), Gaps = 0/81 (0%)
 Frame = -2

Query  1163  VEESGEKKASVRPYVRSKMPRLRWTPDLHLRFLHAVERLGGQERATPKLVLQLMDIKGLN  984
              E SGE+   VRPY+RSKMPRLRWTPDLHL F+HA+ERLGGQERATPKLVLQ+M+++GL+
Sbjct  100   AEGSGERVPRVRPYIRSKMPRLRWTPDLHLSFVHAIERLGGQERATPKLVLQMMNVRGLS  159

Query  983   IAHVKSHLQMYRSKKTEDPSQ  921
             IAHVKSHLQMYRSKK +D  Q
Sbjct  160   IAHVKSHLQMYRSKKLDDSGQ  180



>ref|XP_010915503.1| PREDICTED: two-component response regulator ARR18-like isoform 
X1 [Elaeis guineensis]
Length=530

 Score =   139 bits (350),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 62/81 (77%), Positives = 72/81 (89%), Gaps = 0/81 (0%)
 Frame = -2

Query  1163  VEESGEKKASVRPYVRSKMPRLRWTPDLHLRFLHAVERLGGQERATPKLVLQLMDIKGLN  984
              E SGE+   VRPY+RSKMPRLRWTPDLHL F+HA+ERLGGQERATPKLVLQ+M+++GL+
Sbjct  100   AEGSGERVPRVRPYIRSKMPRLRWTPDLHLSFVHAIERLGGQERATPKLVLQMMNVRGLS  159

Query  983   IAHVKSHLQMYRSKKTEDPSQ  921
             IAHVKSHLQMYRSKK +D  Q
Sbjct  160   IAHVKSHLQMYRSKKLDDSGQ  180



>ref|XP_010925633.1| PREDICTED: uncharacterized protein LOC105048124 [Elaeis guineensis]
Length=530

 Score =   139 bits (349),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 63/84 (75%), Positives = 73/84 (87%), Gaps = 0/84 (0%)
 Frame = -2

Query  1172  NSTVEESGEKKASVRPYVRSKMPRLRWTPDLHLRFLHAVERLGGQERATPKLVLQLMDIK  993
             +   E SGE+  +VR Y+RSKMPRLRWTPDLHL F+HAVERLGGQERATPKLVLQ+M++K
Sbjct  93    SGAAEGSGERVPTVRQYIRSKMPRLRWTPDLHLSFIHAVERLGGQERATPKLVLQMMNVK  152

Query  992   GLNIAHVKSHLQMYRSKKTEDPSQ  921
             GL+IAHVKSHLQMYRSKK +D  Q
Sbjct  153   GLSIAHVKSHLQMYRSKKLDDSGQ  176



>gb|KEH38868.1| myb-like DNA-binding domain, shaqkyf class protein [Medicago 
truncatula]
Length=310

 Score =   135 bits (341),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 63/91 (69%), Positives = 74/91 (81%), Gaps = 0/91 (0%)
 Frame = -2

Query  1160  EESGEKKASVRPYVRSKMPRLRWTPDLHLRFLHAVERLGGQERATPKLVLQLMDIKGLNI  981
             EE   + ++VR YVRSKMPRLRWTPDLHL F+HAVERLGGQERATPKLVLQLM+++GL I
Sbjct  80    EEGKGRGSTVRQYVRSKMPRLRWTPDLHLSFVHAVERLGGQERATPKLVLQLMNVRGLRI  139

Query  980   AHVKSHLQMYRSKKTEDPSQGFANHRAFMEG  888
             AHVKSHLQMYRSKK ++  Q  +     M+G
Sbjct  140   AHVKSHLQMYRSKKLDESGQVLSQKNRAMQG  170



>gb|KCW52514.1| hypothetical protein EUGRSUZ_J01904 [Eucalyptus grandis]
Length=136

 Score =   130 bits (327),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 67/104 (64%), Positives = 80/104 (77%), Gaps = 9/104 (9%)
 Frame = -2

Query  1229  DETNESPRNQTVKDGGSSSNSTVEESGEKKASVRPYVRSKMPRLRWTPDLHLRFLHAVER  1050
             +E +E+  N   K+G SS  ST          +RPYVR+++PRLRWTP+LHLRF+ AVER
Sbjct  34    EEFSENNNNNNKKNGISSGTST---------GLRPYVRTQVPRLRWTPELHLRFIQAVER  84

Query  1049  LGGQERATPKLVLQLMDIKGLNIAHVKSHLQMYRSKKTEDPSQG  918
             LGGQERATPKLVLQLM+IKGL+IAHVKSHLQMYRSKK  D  +G
Sbjct  85    LGGQERATPKLVLQLMNIKGLSIAHVKSHLQMYRSKKINDRGEG  128



>ref|XP_002316821.1| myb family transcription factor family protein [Populus trichocarpa]
 gb|EEE97433.1| myb family transcription factor family protein [Populus trichocarpa]
Length=155

 Score =   130 bits (328),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 60/90 (67%), Positives = 74/90 (82%), Gaps = 0/90 (0%)
 Frame = -2

Query  1190  DGGSSSNSTVEESGEKKASVRPYVRSKMPRLRWTPDLHLRFLHAVERLGGQERATPKLVL  1011
             +G S++N+T  E    + +VR YVRSKMPRLRWTPDLHL F+HAVERLGGQE+ATPKLV 
Sbjct  61    EGNSANNATSAERNGLRPTVRQYVRSKMPRLRWTPDLHLSFVHAVERLGGQEKATPKLVF  120

Query  1010  QLMDIKGLNIAHVKSHLQMYRSKKTEDPSQ  921
             QLM+++ L+IAHVKSHLQ YRSKK ++  Q
Sbjct  121   QLMNVRELSIAHVKSHLQRYRSKKLDEAGQ  150



>ref|XP_006446804.1| hypothetical protein CICLE_v10015819mg [Citrus clementina]
 gb|ESR60044.1| hypothetical protein CICLE_v10015819mg [Citrus clementina]
Length=344

 Score =   135 bits (341),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 78/154 (51%), Positives = 98/154 (64%), Gaps = 9/154 (6%)
 Frame = -2

Query  1292  SGETVCSKTTSDDSNKFEEDEDETNESPRNQTVKDGGSSSNSTVEESGEKKASV-RPYVR  1116
             SG     K +S D N+    +D+ N++  N     G S  ++     G++  ++ R YVR
Sbjct  20    SGTQAFQKCSSFDLNEKAAMDDDENDNITNVPYNGGTSIISTNTTTEGKEIITMARQYVR  79

Query  1115  SKMPRLRWTPDLHLRFLHAVERLGGQERATPKLVLQLMDIKGLNIAHVKSHLQMYRSKKT  936
             SKMPRLRWT DLHL F+HAVERLGGQERATPK VLQLM++KGL+IAHVKSHLQMYRSKK 
Sbjct  80    SKMPRLRWTQDLHLAFVHAVERLGGQERATPKSVLQLMNVKGLSIAHVKSHLQMYRSKKL  139

Query  935   EDPSQGFANHRAFMEGGDRNVFNLSQLPMFKIFN  834
             +   Q  +N R   EG D        L M++ FN
Sbjct  140   DASGQVLSN-RTMQEGHDI-------LEMYRKFN  165



>ref|XP_006467640.1| PREDICTED: uncharacterized protein LOC102609915 [Citrus sinensis]
Length=428

 Score =   137 bits (345),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 75/135 (56%), Positives = 96/135 (71%), Gaps = 10/135 (7%)
 Frame = -2

Query  1286  ETVCSKTTSDDSNKFEEDEDETNESPRNQTVKDGGSSSNSTVEESGEKKASVRPYVRSKM  1107
             E  CS+   D   K  ED+D+       +T    GS+S ST   + E++++VR YVRSKM
Sbjct  42    EASCSEE-DDVLAKAAEDDDK-------RTDHLEGSTSCST--NNNERRSTVRQYVRSKM  91

Query  1106  PRLRWTPDLHLRFLHAVERLGGQERATPKLVLQLMDIKGLNIAHVKSHLQMYRSKKTEDP  927
             PRLRWTPDLHL F+HAVERLGGQE+ATPKLVLQLM+++GL+IAHVKSHLQMYRSKK ++ 
Sbjct  92    PRLRWTPDLHLSFVHAVERLGGQEKATPKLVLQLMNVRGLSIAHVKSHLQMYRSKKLDEA  151

Query  926   SQGFANHRAFMEGGD  882
              Q  ++    + G D
Sbjct  152   GQVLSHAYRSIHGRD  166



>gb|KEH38867.1| myb-like DNA-binding domain, shaqkyf class protein [Medicago 
truncatula]
Length=377

 Score =   136 bits (343),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 63/91 (69%), Positives = 74/91 (81%), Gaps = 0/91 (0%)
 Frame = -2

Query  1160  EESGEKKASVRPYVRSKMPRLRWTPDLHLRFLHAVERLGGQERATPKLVLQLMDIKGLNI  981
             EE   + ++VR YVRSKMPRLRWTPDLHL F+HAVERLGGQERATPKLVLQLM+++GL I
Sbjct  80    EEGKGRGSTVRQYVRSKMPRLRWTPDLHLSFVHAVERLGGQERATPKLVLQLMNVRGLRI  139

Query  980   AHVKSHLQMYRSKKTEDPSQGFANHRAFMEG  888
             AHVKSHLQMYRSKK ++  Q  +     M+G
Sbjct  140   AHVKSHLQMYRSKKLDESGQVLSQKNRAMQG  170



>ref|XP_006486285.1| PREDICTED: uncharacterized protein LOC102620939 [Citrus sinensis]
Length=387

 Score =   136 bits (343),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 111/302 (37%), Positives = 145/302 (48%), Gaps = 60/302 (20%)
 Frame = -2

Query  1139  ASVRPYVRSKMPRLRWTPDLHLRFLHAVERLGGQERATPKLVLQLMDIKGLNIAHVKSHL  960
              S R Y RSK PRLRWTP+LHL F+ AVERLGGQ+RATPKLVLQ M+IKGL+I+HVKSHL
Sbjct  81    GSTRQYNRSKTPRLRWTPELHLCFVQAVERLGGQDRATPKLVLQFMNIKGLSISHVKSHL  140

Query  959   QMYRSKKTEDPSQ--GFANHRAFMEGGDRNVFNLSQLPMFKIFNNQRLNPPFRYGDD-SY  789
             QMYR+KK +DP+Q  G         GGD  + N SQLPM   F NQR     R+ D  S+
Sbjct  141   QMYRNKKIDDPNQEPGLLLGGGGGGGGDHRICNFSQLPMIPHF-NQRNFSTLRFDDKASW  199

Query  788   RNCQEKWMNGTAMAHGTADRGRP--YEALYERFRSNYD---LSRETINPPFTERSNRGLH  624
             R  +++        +   DR +   Y A+ +R  S+ D   L R++I             
Sbjct  200   RGQRDRSYGLNTGENAMFDRAKHGLYAAVAKRLLSSQDKKSLKRDSI------------E  247

Query  623   ELKEKLGSFLENQTWHHQFAPQNPIQ--------HQPIQVPEPKTMARTGSSVGSWVTDC  468
             +   K     E   +  +F P  PI         H      + K     GSS G     C
Sbjct  248   QDTSKTYQTFEESEFFQRFKPSRPISSIEPNLKTHVQENAKDEKKPVNDGSSCG-----C  302

Query  467   RPEPKTTVMNSLVGSWVADRGQEPKATTLENRNAAVSAKLQKQETMKRKA-DLDLNLSLG  291
                P   +M+   G                      S KL++++    +  DLDLNLSL 
Sbjct  303   NSWP---LMDQKFG----------------------SNKLKRKKNWDSECDDLDLNLSLK  337

Query  290   MK  285
             +K
Sbjct  338   IK  339



>ref|XP_008781403.1| PREDICTED: probable transcription factor KAN2 [Phoenix dactylifera]
Length=199

 Score =   131 bits (330),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 59/75 (79%), Positives = 69/75 (92%), Gaps = 0/75 (0%)
 Frame = -2

Query  1154  SGEKKASVRPYVRSKMPRLRWTPDLHLRFLHAVERLGGQERATPKLVLQLMDIKGLNIAH  975
             SGE+  +VR Y+RSKMPRLRWTPDLHL F+ AVERLGGQERATPKLVLQ+M+++GL+IAH
Sbjct  46    SGERVPAVRQYIRSKMPRLRWTPDLHLSFIRAVERLGGQERATPKLVLQMMNVRGLSIAH  105

Query  974   VKSHLQMYRSKKTED  930
             VKSHLQMYRSKK +D
Sbjct  106   VKSHLQMYRSKKLDD  120



>ref|XP_008649161.1| PREDICTED: uncharacterized protein LOC103629847 [Zea mays]
Length=538

 Score =   138 bits (347),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 71/129 (55%), Positives = 88/129 (68%), Gaps = 4/129 (3%)
 Frame = -2

Query  1190  DGGSSSNSTVEESGEKKASVRPYVRSKMPRLRWTPDLHLRFLHAVERLGGQERATPKLVL  1011
             D  +SS+   E SGE   +VR Y RSK+PRLRWTPDLH+ F+HAVERLGGQERATPKLVL
Sbjct  96    DTNNSSSCKGEGSGETAQTVRQYNRSKLPRLRWTPDLHMAFVHAVERLGGQERATPKLVL  155

Query  1010  QLMDIKGLNIAHVKSHLQMYRSKKTEDPSQGFANHRAFMEGGDRNVFNLSQLPMFKIFNN  831
             Q M+++GL+IAHVKSHLQMYRSKK +  S G  + RA +     +VF    L M     +
Sbjct  156   QTMNVRGLSIAHVKSHLQMYRSKKLDHESAGAGHDRAAI----YSVFKPMDLHMMMRRGD  211

Query  830   QRLNPPFRY  804
              R +  F +
Sbjct  212   HRFHDMFLH  220



>ref|XP_003577159.1| PREDICTED: two-component response regulator ARR18-like [Brachypodium 
distachyon]
Length=298

 Score =   134 bits (337),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 83/185 (45%), Positives = 105/185 (57%), Gaps = 25/185 (14%)
 Frame = -2

Query  1205  NQTVKDGGSSSNSTVEESGEKKASVRPYVRSKMPRLRWTPDLHLRFLHAVERLGGQERAT  1026
             +Q  K G  S++ST         SVRPYVRSK PRLRWTP+LHL FL AV+RLGGQ+RAT
Sbjct  35    DQDTKAGDLSTSST---------SVRPYVRSKNPRLRWTPELHLCFLRAVQRLGGQDRAT  85

Query  1025  PKLVLQLMDIKGLNIAHVKSHLQMYRSKKTEDPSQGFANH----RAFMEGGDRNVFNLSQ  858
             PKLVLQLM+++GL+I HVKSHLQMYRSK+ +D  Q    H    RAF  G    V  LS+
Sbjct  86    PKLVLQLMNVRGLSIGHVKSHLQMYRSKRIDDSGQIIGGHISFPRAFHHGQSGAVTMLSR  145

Query  857   L---PMFKIFNNQRLNPPFRYGDDS------YRNCQEKWMNGTAMAHGTADRGRPYEALY  705
                 P    F+ Q   PP+ +G         Y +       G  +A G A    P + + 
Sbjct  146   FGTTPWRSSFHEQ---PPWLHGHQHFPGSKPYYSFSSAAQAGQHLARGAASSSNPDQLMM  202

Query  704   ERFRS  690
             +  R+
Sbjct  203   QLGRT  207



>ref|XP_006383901.1| hypothetical protein POPTR_0004s01060g [Populus trichocarpa]
 gb|ERP61698.1| hypothetical protein POPTR_0004s01060g [Populus trichocarpa]
Length=114

 Score =   128 bits (322),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 58/84 (69%), Positives = 70/84 (83%), Gaps = 0/84 (0%)
 Frame = -2

Query  1166  TVEESGEKKASVRPYVRSKMPRLRWTPDLHLRFLHAVERLGGQERATPKLVLQLMDIKGL  987
             +++E   K A+VRPYVRSKMPRLRW PDLH  F+HAVE LGG++RATPK+VLQ+MD+KGL
Sbjct  31    SLQEKNMKSATVRPYVRSKMPRLRWAPDLHHCFVHAVEWLGGEDRATPKMVLQIMDVKGL  90

Query  986   NIAHVKSHLQMYRSKKTEDPSQGF  915
              I+HVKSHLQMYRS K E  +QG 
Sbjct  91    TISHVKSHLQMYRSMKHEQMTQGM  114



>ref|XP_004305446.1| PREDICTED: uncharacterized protein LOC101299510 [Fragaria vesca 
subsp. vesca]
Length=431

 Score =   137 bits (344),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 75/134 (56%), Positives = 91/134 (68%), Gaps = 9/134 (7%)
 Frame = -2

Query  1256  DSNKFEEDEDETNESPRNQTVKDGGS--SSNSTVEESGEKKASVRPYVRSKMPRLRWTPD  1083
             D N     +D  N S     VK GGS  S+    + +     +VR YVRSKMPRLRWTPD
Sbjct  41    DLNAEASSDDHENAS---NNVKAGGSRISTEGKEQTATSNSGAVRQYVRSKMPRLRWTPD  97

Query  1082  LHLRFLHAVERLGGQERATPKLVLQLMDIKGLNIAHVKSHLQMYRSKKTEDPSQGFAN-H  906
             LHL F+HAVERLGGQERATPKLVLQLM+++GL+IAHVKSHLQMYRSKK ++  Q     H
Sbjct  98    LHLAFIHAVERLGGQERATPKLVLQLMNVRGLSIAHVKSHLQMYRSKKLDESGQVLPQFH  157

Query  905   RA---FMEGGDRNV  873
             R+    ++G D+ V
Sbjct  158   RSRGILLQGRDQVV  171



>ref|XP_006852395.1| hypothetical protein AMTR_s00021p00013790 [Amborella trichopoda]
 gb|ERN13862.1| hypothetical protein AMTR_s00021p00013790 [Amborella trichopoda]
Length=471

 Score =   137 bits (345),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 74/128 (58%), Positives = 89/128 (70%), Gaps = 3/128 (2%)
 Frame = -2

Query  1208  RNQTVKDGGSSSNSTVEESGEKKAS---VRPYVRSKMPRLRWTPDLHLRFLHAVERLGGQ  1038
             R ++V     +S S V+E   K A+   VR YVRSKMPRLRWTPDLHL F+HAVERLGGQ
Sbjct  25    RKRSVDSCDQNSESWVKERDMKPATTGGVRQYVRSKMPRLRWTPDLHLCFVHAVERLGGQ  84

Query  1037  ERATPKLVLQLMDIKGLNIAHVKSHLQMYRSKKTEDPSQGFANHRAFMEGGDRNVFNLSQ  858
             +RATPKLVLQLM++KGL+IAHVKSHLQMYRSKK +D  Q  +     + G D      S 
Sbjct  85    DRATPKLVLQLMNVKGLSIAHVKSHLQMYRSKKVDDSGQVISQPDRLIPGEDHYYARGSS  144

Query  857   LPMFKIFN  834
             L M + F+
Sbjct  145   LQMQQQFS  152



>gb|AFW76554.1| putative MYB DNA-binding domain superfamily protein [Zea mays]
Length=554

 Score =   137 bits (346),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 71/129 (55%), Positives = 88/129 (68%), Gaps = 4/129 (3%)
 Frame = -2

Query  1190  DGGSSSNSTVEESGEKKASVRPYVRSKMPRLRWTPDLHLRFLHAVERLGGQERATPKLVL  1011
             D  +SS+   E SGE   +VR Y RSK+PRLRWTPDLH+ F+HAVERLGGQERATPKLVL
Sbjct  96    DTNNSSSCKGEGSGETAQTVRQYNRSKLPRLRWTPDLHMAFVHAVERLGGQERATPKLVL  155

Query  1010  QLMDIKGLNIAHVKSHLQMYRSKKTEDPSQGFANHRAFMEGGDRNVFNLSQLPMFKIFNN  831
             Q M+++GL+IAHVKSHLQMYRSKK +  S G  + RA +     +VF    L M     +
Sbjct  156   QTMNVRGLSIAHVKSHLQMYRSKKLDHESAGAGHDRAAI----YSVFKPMDLHMMMRRGD  211

Query  830   QRLNPPFRY  804
              R +  F +
Sbjct  212   HRFHDMFLH  220



>ref|XP_010109885.1| Putative Myb family transcription factor [Morus notabilis]
 gb|EXC24838.1| Putative Myb family transcription factor [Morus notabilis]
Length=347

 Score =   134 bits (338),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 62/84 (74%), Positives = 70/84 (83%), Gaps = 0/84 (0%)
 Frame = -2

Query  1172  NSTVEESGEKKASVRPYVRSKMPRLRWTPDLHLRFLHAVERLGGQERATPKLVLQLMDIK  993
             NS+     E K  VR YVRSKMPRLRWTPDLHL F+HAVERLGGQE+ATPKLVLQLM+++
Sbjct  70    NSSSANRKEGKGRVRQYVRSKMPRLRWTPDLHLSFVHAVERLGGQEKATPKLVLQLMNVR  129

Query  992   GLNIAHVKSHLQMYRSKKTEDPSQ  921
             GL+I HVKSHLQMYRSKK +D  Q
Sbjct  130   GLSIGHVKSHLQMYRSKKLDDAGQ  153



>emb|CBI30694.3| unnamed protein product [Vitis vinifera]
Length=428

 Score =   136 bits (342),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 66/91 (73%), Positives = 77/91 (85%), Gaps = 3/91 (3%)
 Frame = -2

Query  1184  GSSSNSTVEESGEK---KASVRPYVRSKMPRLRWTPDLHLRFLHAVERLGGQERATPKLV  1014
             GSS+N+    +GEK   K SVR YVRSKMPRLRWTPDLHL F+HAVERLGGQ RATPKLV
Sbjct  55    GSSANNNNVSAGEKRRGKNSVRQYVRSKMPRLRWTPDLHLSFVHAVERLGGQARATPKLV  114

Query  1013  LQLMDIKGLNIAHVKSHLQMYRSKKTEDPSQ  921
             L+LM++KGL+IAHVKSHLQMYRSK+ ++  Q
Sbjct  115   LELMNVKGLSIAHVKSHLQMYRSKRLDESGQ  145



>ref|XP_009607761.1| PREDICTED: putative Myb family transcription factor At1g14600 
[Nicotiana tomentosiformis]
Length=373

 Score =   135 bits (339),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 91/215 (42%), Positives = 114/215 (53%), Gaps = 41/215 (19%)
 Frame = -2

Query  1229  DETNESPRNQTVKDG-GSSSNSTVEESGEKKASVRPYVRSKMPRLRWTPDLHLRFLHAVE  1053
             DET E   +   K   G+SS+  +     K + VR YVRSK+PRLRWTPDLHL F+ A+E
Sbjct  43    DETIELSDDMIEKTAEGNSSSEDIGNYENKSSRVRQYVRSKLPRLRWTPDLHLSFVRAIE  102

Query  1052  RLGGQERATPKLVLQLMDIKGLNIAHVKSHLQMYRSKKTEDPSQGFAN-HRAFMEGGDRN  876
             RLGGQERATPKLVLQ+M+++GL+IAHVKSHLQMYRSKK  +  Q   + HRA M+G    
Sbjct  103   RLGGQERATPKLVLQMMNVRGLSIAHVKSHLQMYRSKKLGEFGQVLGHAHRA-MQGKSYF  161

Query  875   VFNLSQLPMFKIFNNQRLNPPFRYGDDSYRNCQEKWMNGTAMAHGTADRGRPYEALYERF  696
               NLS          QR NP                +    M +G     R +       
Sbjct  162   CGNLS----------QRFNP----------------LQDFKMKNGAIVLARNF-------  188

Query  695   RSNYDLSRETINPPFTERSNRGLHELKEKLGSFLE  591
               N D   + +N  F    +R  HE KEK   +LE
Sbjct  189   --NND---DNVNHHFQNSLSRHRHETKEKFSRYLE  218



>ref|XP_010655530.1| PREDICTED: uncharacterized protein LOC104880489 isoform X2 [Vitis 
vinifera]
Length=457

 Score =   136 bits (342),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 66/91 (73%), Positives = 77/91 (85%), Gaps = 3/91 (3%)
 Frame = -2

Query  1184  GSSSNSTVEESGEK---KASVRPYVRSKMPRLRWTPDLHLRFLHAVERLGGQERATPKLV  1014
             GSS+N+    +GEK   K SVR YVRSKMPRLRWTPDLHL F+HAVERLGGQ RATPKLV
Sbjct  55    GSSANNNNVSAGEKRRGKNSVRQYVRSKMPRLRWTPDLHLSFVHAVERLGGQARATPKLV  114

Query  1013  LQLMDIKGLNIAHVKSHLQMYRSKKTEDPSQ  921
             L+LM++KGL+IAHVKSHLQMYRSK+ ++  Q
Sbjct  115   LELMNVKGLSIAHVKSHLQMYRSKRLDESGQ  145



>ref|XP_010655529.1| PREDICTED: uncharacterized protein LOC104880489 isoform X1 [Vitis 
vinifera]
Length=470

 Score =   135 bits (341),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 66/91 (73%), Positives = 77/91 (85%), Gaps = 3/91 (3%)
 Frame = -2

Query  1184  GSSSNSTVEESGEK---KASVRPYVRSKMPRLRWTPDLHLRFLHAVERLGGQERATPKLV  1014
             GSS+N+    +GEK   K SVR YVRSKMPRLRWTPDLHL F+HAVERLGGQ RATPKLV
Sbjct  87    GSSANNNNVSAGEKRRGKNSVRQYVRSKMPRLRWTPDLHLSFVHAVERLGGQARATPKLV  146

Query  1013  LQLMDIKGLNIAHVKSHLQMYRSKKTEDPSQ  921
             L+LM++KGL+IAHVKSHLQMYRSK+ ++  Q
Sbjct  147   LELMNVKGLSIAHVKSHLQMYRSKRLDESGQ  177



>ref|XP_008228923.1| PREDICTED: uncharacterized protein LOC103328312 isoform X1 [Prunus 
mume]
Length=432

 Score =   135 bits (340),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 79/160 (49%), Positives = 101/160 (63%), Gaps = 12/160 (8%)
 Frame = -2

Query  1268  TTSDDSNKFEEDEDETNESPRNQTVKDGGSSSNSTVEESGEKKASVRPYVRSKMPRLRWT  1089
             +T DD      +E    ++  ++T  +G  S N+T  E  E+  +VR YVRSKMPRLRWT
Sbjct  58    STGDDDQDVSSNE--GTQAVGSRTSPEGNLSCNNTSVEGKERTIAVRQYVRSKMPRLRWT  115

Query  1088  PDLHLRFLHAVERLGGQERATPKLVLQLMDIKGLNIAHVKSHL-QMYRSKKTEDPSQGFA  912
             PDLHL F+HAV+RLGGQERATPKLVLQLM+++GL+IAHVKSHL QMYRSKK ++  Q  +
Sbjct  116   PDLHLAFVHAVDRLGGQERATPKLVLQLMNVRGLSIAHVKSHLQQMYRSKKLDESGQVIS  175

Query  911   NHRAFMEGGDRNVFNLSQLPMFKIFNNQRLNPPFRYGDDS  792
                  M   D        L  ++ FN  R     R+ DDS
Sbjct  176   QSSRGMRVKDH------ILEAYRKFNPYR---HLRHVDDS  206



>ref|XP_010052783.1| PREDICTED: uncharacterized protein LOC104441352 [Eucalyptus grandis]
Length=430

 Score =   135 bits (339),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 68/124 (55%), Positives = 87/124 (70%), Gaps = 8/124 (6%)
 Frame = -2

Query  1259  DDSNKFEEDEDETNESPRNQTVKDGGSS--------SNSTVEESGEKKASVRPYVRSKMP  1104
             +D N    DED  + S     + +  SS        +N + +E  E+  +VR Y+RSKMP
Sbjct  48    NDENGLSADEDADSLSNNEYNLDEAASSKVDSSSGNNNCSSDEGKERTTTVRQYMRSKMP  107

Query  1103  RLRWTPDLHLRFLHAVERLGGQERATPKLVLQLMDIKGLNIAHVKSHLQMYRSKKTEDPS  924
             RLRWTP+LHL F+HAVERLGGQE+ATPKLVLQLM+++GL+IAHVKSHLQMYRSKK +D  
Sbjct  108   RLRWTPELHLAFVHAVERLGGQEKATPKLVLQLMNVRGLSIAHVKSHLQMYRSKKLDDSG  167

Query  923   QGFA  912
             Q  +
Sbjct  168   QVLS  171



>gb|AAC28774.1| unknown protein [Arabidopsis thaliana]
 gb|AAM14858.1| unknown protein [Arabidopsis thaliana]
Length=299

 Score =   132 bits (332),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 63/76 (83%), Positives = 71/76 (93%), Gaps = 1/76 (1%)
 Frame = -2

Query  1178  SSNSTVEESGEKKASVRPYVRSKMPRLRWTPDLHLRFLHAVERLGGQERATPKLVLQLMD  999
             SSNSTVEES +KK  VRPYVRSK+PRLRWTPDLHLRF+ AVERLGGQERATPKLV Q+M+
Sbjct  32    SSNSTVEES-DKKTKVRPYVRSKVPRLRWTPDLHLRFVRAVERLGGQERATPKLVRQMMN  90

Query  998   IKGLNIAHVKSHLQMY  951
             IKGL+IAHVKSHLQ++
Sbjct  91    IKGLSIAHVKSHLQVF  106



>ref|XP_008225297.1| PREDICTED: transcription activator GLK1-like [Prunus mume]
 ref|XP_008225298.1| PREDICTED: transcription activator GLK1-like [Prunus mume]
Length=417

 Score =   134 bits (338),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 68/125 (54%), Positives = 86/125 (69%), Gaps = 0/125 (0%)
 Frame = -2

Query  1256  DSNKFEEDEDETNESPRNQTVKDGGSSSNSTVEESGEKKASVRPYVRSKMPRLRWTPDLH  1077
             D  K EE E   +E    +   +  SS+ ++ E +  ++  VR YVRSKMPRLRWTP LH
Sbjct  38    DDTKVEEFELSVDEEDEKRGQGNINSSTATSAEGNEGRRGKVRQYVRSKMPRLRWTPQLH  97

Query  1076  LRFLHAVERLGGQERATPKLVLQLMDIKGLNIAHVKSHLQMYRSKKTEDPSQGFANHRAF  897
             L F+HA+ERLGGQ+RATPKLVLQLM++KGL+I+HVKSHLQMYRSKK +   Q  +  R  
Sbjct  98    LSFVHAIERLGGQDRATPKLVLQLMNVKGLSISHVKSHLQMYRSKKLDGDGQVVSEKRQS  157

Query  896   MEGGD  882
               G D
Sbjct  158   THGRD  162



>ref|XP_011101395.1| PREDICTED: two-component response regulator ARR1-like [Sesamum 
indicum]
Length=408

 Score =   134 bits (338),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 66/104 (63%), Positives = 81/104 (78%), Gaps = 3/104 (3%)
 Frame = -2

Query  1193  KDGGSSSNSTVEESGEKKASVRPYVRSKMPRLRWTPDLHLRFLHAVERLGGQERATPKLV  1014
             + G SS +     + EKK SVR Y+RSKMPRLRWTPDLHL F+HA+ERLGGQERATPK V
Sbjct  67    RSGDSSKSGQGGNNNEKKTSVRQYIRSKMPRLRWTPDLHLSFVHAIERLGGQERATPKAV  126

Query  1013  LQLMDIKGLNIAHVKSHLQMYRSKKTEDPSQ--GFANHRAFMEG  888
             LQLM+++GL+I+HVKSHLQMYRSKK ++  +  G AN R +  G
Sbjct  127   LQLMNVRGLSISHVKSHLQMYRSKKLDESGKVIGQAN-RLYFHG  169



>ref|XP_008790063.1| PREDICTED: uncharacterized protein LOC103707382 [Phoenix dactylifera]
Length=555

 Score =   136 bits (342),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 63/91 (69%), Positives = 75/91 (82%), Gaps = 0/91 (0%)
 Frame = -2

Query  1166  TVEESGEKKASVRPYVRSKMPRLRWTPDLHLRFLHAVERLGGQERATPKLVLQLMDIKGL  987
               E +GE+   VR Y+RSKMPRLRWTPDLHL F+HAVERLGGQERATPKLVLQ+M+++GL
Sbjct  128   VAEGNGEQVPRVRQYIRSKMPRLRWTPDLHLSFVHAVERLGGQERATPKLVLQMMNVRGL  187

Query  986   NIAHVKSHLQMYRSKKTEDPSQGFANHRAFM  894
             +IAHVKSHLQMYRSKK +D  Q  A+  + M
Sbjct  188   SIAHVKSHLQMYRSKKLDDSGQEKASMSSVM  218



>ref|XP_004487568.1| PREDICTED: uncharacterized protein LOC101500041 [Cicer arietinum]
Length=401

 Score =   134 bits (337),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 69/116 (59%), Positives = 83/116 (72%), Gaps = 14/116 (12%)
 Frame = -2

Query  1139  ASVRPYVRSKMPRLRWTPDLHLRFLHAVERLGGQERATPKLVLQLMDIKGLNIAHVKSHL  960
             ++VR YVRSKMPRLRWTPDLHL F+HAVERLGGQERATPKLVLQLM+++GL+IAHVKSHL
Sbjct  91    STVRQYVRSKMPRLRWTPDLHLAFVHAVERLGGQERATPKLVLQLMNVRGLSIAHVKSHL  150

Query  959   QMYRSKKTEDPSQGFANHRAFMEGGDRNVFNLSQLPMFKIFN--------NQRLNP  816
             QMYRSKK +   Q  +  R  ++G   ++     L M+  FN        N  LNP
Sbjct  151   QMYRSKKLDASGQVLSQKRT-IQGRHHHI-----LDMYGRFNVEGQFGVDNNYLNP  200



>ref|XP_007025361.1| Myb-like HTH transcriptional regulator family protein, putative 
[Theobroma cacao]
 gb|EOY27983.1| Myb-like HTH transcriptional regulator family protein, putative 
[Theobroma cacao]
Length=406

 Score =   134 bits (336),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 73/137 (53%), Positives = 90/137 (66%), Gaps = 11/137 (8%)
 Frame = -2

Query  1277  CSKTTSDDSNKFEEDED-----ETNESPRNQTVKDGGSSSNSTVEESGEKKASVRPYVRS  1113
             CS    ++    EED D     E   S      +  GSSSN+       ++ +VR YVRS
Sbjct  31    CSSFDLNEEASSEEDYDIDIAKENEVSVEEDEKRTEGSSSNNN------ERRTVRQYVRS  84

Query  1112  KMPRLRWTPDLHLRFLHAVERLGGQERATPKLVLQLMDIKGLNIAHVKSHLQMYRSKKTE  933
             K+PRLRWTPDLHL F+HAVERLGGQERATPKLVLQLM+++GL+IAHVKSHLQMYRSKK +
Sbjct  85    KLPRLRWTPDLHLSFVHAVERLGGQERATPKLVLQLMNVRGLSIAHVKSHLQMYRSKKLD  144

Query  932   DPSQGFANHRAFMEGGD  882
             +  Q        ++G D
Sbjct  145   EAGQVLRQANRQIQGRD  161



>emb|CDO96808.1| unnamed protein product [Coffea canephora]
Length=399

 Score =   134 bits (336),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 70/121 (58%), Positives = 86/121 (71%), Gaps = 7/121 (6%)
 Frame = -2

Query  1235  DEDETNESPRNQTV-----KDGGSSSNSTVEESGEKKASVRPYVRSKMPRLRWTPDLHLR  1071
             DE+ ++E P    V      +G S +  T  E  EKK  VR Y RSK+PRLRWTPDLHL 
Sbjct  45    DEETSSEVPDLSLVDCEKSSEGNSENYCTSVERNEKK--VRQYNRSKLPRLRWTPDLHLS  102

Query  1070  FLHAVERLGGQERATPKLVLQLMDIKGLNIAHVKSHLQMYRSKKTEDPSQGFANHRAFME  891
             F+HA+ERLGGQERATPKLVLQLM+++GL+IAHVKSHLQMYRSKK ++  Q     +  M+
Sbjct  103   FVHAIERLGGQERATPKLVLQLMNVRGLSIAHVKSHLQMYRSKKLDESGQVIGLAKRGMQ  162

Query  890   G  888
             G
Sbjct  163   G  163



>ref|XP_006594551.1| PREDICTED: uncharacterized protein LOC102669757 [Glycine max]
 gb|KHN08429.1| Putative Myb family transcription factor [Glycine soja]
Length=373

 Score =   133 bits (334),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 73/129 (57%), Positives = 90/129 (70%), Gaps = 10/129 (8%)
 Frame = -2

Query  1286  ETVCSKTTSDDSNKFEEDEDETNESPRNQTVKDGGSSSNSTVEESGE----KKASVRPYV  1119
             E  CS  T D+++  E  E  T     N+  KD G+S+N +   S E    +  +VR YV
Sbjct  29    ELACS--TEDNTDTKECYELTTT----NEKAKDEGTSANGSSISSREGNERRGTTVRQYV  82

Query  1118  RSKMPRLRWTPDLHLRFLHAVERLGGQERATPKLVLQLMDIKGLNIAHVKSHLQMYRSKK  939
             RSKMPRLRWTP+LH  F HAVERLGGQERATPKLVLQLM+++GL+IAHVKSHLQMYRSKK
Sbjct  83    RSKMPRLRWTPELHHSFAHAVERLGGQERATPKLVLQLMNVRGLSIAHVKSHLQMYRSKK  142

Query  938   TEDPSQGFA  912
              ++  Q  +
Sbjct  143   LDEAGQVLS  151



>gb|EMT09351.1| Putative Myb family transcription factor [Aegilops tauschii]
Length=284

 Score =   131 bits (329),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 68/119 (57%), Positives = 84/119 (71%), Gaps = 12/119 (10%)
 Frame = -2

Query  1181  SSSNSTVEE--------SGEKKASVRPYVRSKMPRLRWTPDLHLRFLHAVERLGGQERAT  1026
             S+ +STVEE        +G+  +SVRPYVRSK PRLRWTP+LH  F+ AVERLGGQ+ AT
Sbjct  15    SNDDSTVEEEGGQDMTRAGDSSSSVRPYVRSKNPRLRWTPELHHCFVRAVERLGGQDCAT  74

Query  1025  PKLVLQLMDIKGLNIAHVKSHLQMYRSKKTEDPSQGFANHRAFMEGGDRNVFNLSQLPM  849
             PKLVLQLM+++GL+I HVKSHLQMYRSKK +   Q    H    +GG   V+N + LP 
Sbjct  75    PKLVLQLMNVRGLSIGHVKSHLQMYRSKKIDHSGQVIIGH--LQQGG--QVYNYAHLPF  129



>ref|XP_011008685.1| PREDICTED: uncharacterized protein LOC105114001 [Populus euphratica]
Length=296

 Score =   130 bits (328),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 59/85 (69%), Positives = 71/85 (84%), Gaps = 0/85 (0%)
 Frame = -2

Query  1166  TVEESGEKKASVRPYVRSKMPRLRWTPDLHLRFLHAVERLGGQERATPKLVLQLMDIKGL  987
             +++E   K A+VRPYVRSKMPRLRW PDLH  F+HAVERLGG++RATPK+VLQ+MD+KGL
Sbjct  31    SLQEKNMKSATVRPYVRSKMPRLRWAPDLHHCFVHAVERLGGEDRATPKMVLQIMDVKGL  90

Query  986   NIAHVKSHLQMYRSKKTEDPSQGFA  912
              I+HVKSHLQMYRS K E  +Q  A
Sbjct  91    TISHVKSHLQMYRSMKHEQMTQEAA  115



>ref|XP_011047027.1| PREDICTED: uncharacterized protein LOC105141490 [Populus euphratica]
Length=296

 Score =   130 bits (328),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 59/85 (69%), Positives = 71/85 (84%), Gaps = 0/85 (0%)
 Frame = -2

Query  1166  TVEESGEKKASVRPYVRSKMPRLRWTPDLHLRFLHAVERLGGQERATPKLVLQLMDIKGL  987
             +++E   K A+VRPYVRSKMPRLRW PDLH  F+HAVERLGG++RATPK+VLQ+MD+KGL
Sbjct  31    SLQEKNMKSATVRPYVRSKMPRLRWAPDLHHCFVHAVERLGGEDRATPKMVLQIMDVKGL  90

Query  986   NIAHVKSHLQMYRSKKTEDPSQGFA  912
              I+HVKSHLQMYRS K E  +Q  A
Sbjct  91    TISHVKSHLQMYRSMKHEQMTQEAA  115



>ref|XP_002438524.1| hypothetical protein SORBIDRAFT_10g021360 [Sorghum bicolor]
 gb|EER89891.1| hypothetical protein SORBIDRAFT_10g021360 [Sorghum bicolor]
Length=504

 Score =   134 bits (337),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 62/84 (74%), Positives = 73/84 (87%), Gaps = 0/84 (0%)
 Frame = -2

Query  1175  SNSTVEESGEKKASVRPYVRSKMPRLRWTPDLHLRFLHAVERLGGQERATPKLVLQLMDI  996
             SNS  E SGE+  +VR Y RSK+PRLRWTPDLH+ F+HAVERLGGQERATPKLVLQ+M++
Sbjct  95    SNSKGEGSGERALTVRQYNRSKLPRLRWTPDLHMAFVHAVERLGGQERATPKLVLQMMNV  154

Query  995   KGLNIAHVKSHLQMYRSKKTEDPS  924
             +GL+IAHVKSHLQMYRSKK +  S
Sbjct  155   RGLSIAHVKSHLQMYRSKKLDHES  178



>ref|XP_010920938.1| PREDICTED: uncharacterized protein LOC105044662 [Elaeis guineensis]
Length=487

 Score =   134 bits (336),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 67/124 (54%), Positives = 91/124 (73%), Gaps = 2/124 (2%)
 Frame = -2

Query  1286  ETVCSKTTSDDSNKFEEDEDETNESPRNQTVKDGGSSSNS--TVEESGEKKASVRPYVRS  1113
             E V      +  +K  E+ + T E+   ++  D  S+ N+  T+E S E+ ++VR Y RS
Sbjct  39    EEVAENGIEEREDKGYENGERTAETEGERSSTDSRSTDNNIDTIEGSEEQASAVRQYHRS  98

Query  1112  KMPRLRWTPDLHLRFLHAVERLGGQERATPKLVLQLMDIKGLNIAHVKSHLQMYRSKKTE  933
             KMPRLRWTPDLHL F++AVE+LGGQERATPKLVLQ+M+++GL+IAH+KSHLQMYR+KK +
Sbjct  99    KMPRLRWTPDLHLAFVNAVEKLGGQERATPKLVLQMMNVRGLSIAHIKSHLQMYRNKKLD  158

Query  932   DPSQ  921
             D  Q
Sbjct  159   DSDQ  162



>ref|XP_010032996.1| PREDICTED: uncharacterized protein LOC104422379 [Eucalyptus grandis]
Length=404

 Score =   133 bits (334),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 74/140 (53%), Positives = 94/140 (67%), Gaps = 10/140 (7%)
 Frame = -2

Query  1133  VRPYVRSKMPRLRWTPDLHLRFLHAVERLGGQERATPKLVLQLMDIKGLNIAHVKSHLQM  954
             +RPYVR+++PRLRWTP+LHLRF+ AVERLGGQERATPKLVLQLM+IKGL+IAHVKSHLQM
Sbjct  69    LRPYVRTQVPRLRWTPELHLRFIQAVERLGGQERATPKLVLQLMNIKGLSIAHVKSHLQM  128

Query  953   YRSKKTEDPSQGFANHRAFMEGGDRNVFNLSQLPMFKIFNNQRLNP-PFRYGDDSYRNCQ  777
             YRSKK  D  +   + + FM   D+      +  + +  + +  N   FR+  D  RN  
Sbjct  129   YRSKKINDRGEVINSRQDFMGSADQLPHAFWRHSILQNLDRKISNIRDFRWSSD--RN--  184

Query  776   EKWMNG---TAMAHGTADRG  726
               WM+G   T +A G A  G
Sbjct  185   --WMSGPYLTDVAMGNARNG  202



>ref|XP_009409395.1| PREDICTED: uncharacterized protein LOC103991616 isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=518

 Score =   134 bits (337),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 64/92 (70%), Positives = 76/92 (83%), Gaps = 4/92 (4%)
 Frame = -2

Query  1205  NQTVKDGGSSSNSTVEESGEKKASVRPYVRSKMPRLRWTPDLHLRFLHAVERLGGQERAT  1026
             N  + +GG+    T E S E+ ASVR Y RSK PRLRWTPDLHL F+HAVERLGGQ+RAT
Sbjct  86    NSNINEGGN----TAEGSSERVASVRQYNRSKTPRLRWTPDLHLSFVHAVERLGGQDRAT  141

Query  1025  PKLVLQLMDIKGLNIAHVKSHLQMYRSKKTED  930
             PKLVLQ+M+++GL+IAHVKSHLQMYRSKK +D
Sbjct  142   PKLVLQMMNVRGLSIAHVKSHLQMYRSKKLDD  173



>ref|XP_009409396.1| PREDICTED: uncharacterized protein LOC103991616 isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=516

 Score =   134 bits (337),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 64/92 (70%), Positives = 76/92 (83%), Gaps = 4/92 (4%)
 Frame = -2

Query  1205  NQTVKDGGSSSNSTVEESGEKKASVRPYVRSKMPRLRWTPDLHLRFLHAVERLGGQERAT  1026
             N  + +GG+    T E S E+ ASVR Y RSK PRLRWTPDLHL F+HAVERLGGQ+RAT
Sbjct  86    NSNINEGGN----TAEGSSERVASVRQYNRSKTPRLRWTPDLHLSFVHAVERLGGQDRAT  141

Query  1025  PKLVLQLMDIKGLNIAHVKSHLQMYRSKKTED  930
             PKLVLQ+M+++GL+IAHVKSHLQMYRSKK +D
Sbjct  142   PKLVLQMMNVRGLSIAHVKSHLQMYRSKKLDD  173



>ref|XP_009409397.1| PREDICTED: uncharacterized protein LOC103991616 isoform X3 [Musa 
acuminata subsp. malaccensis]
Length=514

 Score =   134 bits (337),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 64/92 (70%), Positives = 76/92 (83%), Gaps = 4/92 (4%)
 Frame = -2

Query  1205  NQTVKDGGSSSNSTVEESGEKKASVRPYVRSKMPRLRWTPDLHLRFLHAVERLGGQERAT  1026
             N  + +GG+    T E S E+ ASVR Y RSK PRLRWTPDLHL F+HAVERLGGQ+RAT
Sbjct  86    NSNINEGGN----TAEGSSERVASVRQYNRSKTPRLRWTPDLHLSFVHAVERLGGQDRAT  141

Query  1025  PKLVLQLMDIKGLNIAHVKSHLQMYRSKKTED  930
             PKLVLQ+M+++GL+IAHVKSHLQMYRSKK +D
Sbjct  142   PKLVLQMMNVRGLSIAHVKSHLQMYRSKKLDD  173



>ref|XP_003629774.1| Myb family transcription factor APL [Medicago truncatula]
 gb|AET04250.1| MYB-like transcription factor family protein [Medicago truncatula]
Length=426

 Score =   132 bits (333),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 68/109 (62%), Positives = 83/109 (76%), Gaps = 5/109 (5%)
 Frame = -2

Query  1145  KKASVRPYVRSKMPRLRWTPDLHLRFLHAVERLGGQERATPKLVLQLMDIKGLNIAHVKS  966
             ++  VR YVRSKMPRLRWTPDLH  F+HAVERLGGQERATPKLVLQLM+++GL+IAHVKS
Sbjct  97    RRNGVRQYVRSKMPRLRWTPDLHHSFMHAVERLGGQERATPKLVLQLMNVRGLSIAHVKS  156

Query  965   HLQMYRSKKTEDPSQGFA-NHRAFMEGG--DRNVFNLSQLP--MFKIFN  834
             HLQMYRSKK ++  Q  +  HR+  E G    +V + S +P   FK+ N
Sbjct  157   HLQMYRSKKLDEAGQVLSPTHRSTHELGSISHHVAHQSMIPHQHFKMAN  205



>gb|KEH20674.1| MYB-like transcription factor family protein [Medicago truncatula]
Length=428

 Score =   132 bits (333),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 68/109 (62%), Positives = 83/109 (76%), Gaps = 5/109 (5%)
 Frame = -2

Query  1145  KKASVRPYVRSKMPRLRWTPDLHLRFLHAVERLGGQERATPKLVLQLMDIKGLNIAHVKS  966
             ++  VR YVRSKMPRLRWTPDLH  F+HAVERLGGQERATPKLVLQLM+++GL+IAHVKS
Sbjct  99    RRNGVRQYVRSKMPRLRWTPDLHHSFMHAVERLGGQERATPKLVLQLMNVRGLSIAHVKS  158

Query  965   HLQMYRSKKTEDPSQGFA-NHRAFMEGG--DRNVFNLSQLP--MFKIFN  834
             HLQMYRSKK ++  Q  +  HR+  E G    +V + S +P   FK+ N
Sbjct  159   HLQMYRSKKLDEAGQVLSPTHRSTHELGSISHHVAHQSMIPHQHFKMAN  207



>ref|XP_009759227.1| PREDICTED: putative Myb family transcription factor At1g14600 
[Nicotiana sylvestris]
 ref|XP_009759228.1| PREDICTED: putative Myb family transcription factor At1g14600 
[Nicotiana sylvestris]
Length=350

 Score =   130 bits (328),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 74/136 (54%), Positives = 93/136 (68%), Gaps = 10/136 (7%)
 Frame = -2

Query  1253  SNKFEEDED-ETNESPRNQTVKDGGSSSNSTVEESGEKKASVRPYVRSKMPRLRWTPDLH  1077
             +NK E DE  E ++    +T +  GSS +   E+   K + VR YVRSK+PRLRWTPDLH
Sbjct  15    NNKRETDEAIELSDDMIEKTAEGNGSSEDIGNED---KCSRVRQYVRSKLPRLRWTPDLH  71

Query  1076  LRFLHAVERLGGQERATPKLVLQLMDIKGLNIAHVKSHLQMYRSKKTEDPSQGFAN-HRA  900
             L F+ A+ERLGGQERATPKLVLQ M+++GL+IAHVKSHLQMYRSKK  +  Q   + HRA
Sbjct  72    LSFVRAIERLGGQERATPKLVLQTMNVRGLSIAHVKSHLQMYRSKKLGEFGQVLGHAHRA  131

Query  899   -----FMEGGDRNVFN  867
                  +  G  R +FN
Sbjct  132   MQGKSYFYGNPRQIFN  147



>ref|XP_002984784.1| hypothetical protein SELMODRAFT_423935 [Selaginella moellendorffii]
 gb|EFJ14034.1| hypothetical protein SELMODRAFT_423935 [Selaginella moellendorffii]
Length=340

 Score =   130 bits (328),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 67/108 (62%), Positives = 78/108 (72%), Gaps = 4/108 (4%)
 Frame = -2

Query  1241  EEDEDETNESPRNQTVKDGGSSSNSTVEE----SGEKKASVRPYVRSKMPRLRWTPDLHL  1074
             E+D D    S  N TV   GSS  +TV      S   ++SVR Y+RSKMPRLRWTPDLH 
Sbjct  28    EDDLDAPGSSDSNNTVSGDGSSDGATVLGGPFGSSSARSSVRQYIRSKMPRLRWTPDLHE  87

Query  1073  RFLHAVERLGGQERATPKLVLQLMDIKGLNIAHVKSHLQMYRSKKTED  930
              F+ AV+RLGGQ+RATPKLVLQLM +KGL IAHVKSHLQMYRS K ++
Sbjct  88    CFVRAVDRLGGQDRATPKLVLQLMGVKGLTIAHVKSHLQMYRSMKNDE  135



>gb|EMT28079.1| Putative Myb family transcription factor [Aegilops tauschii]
Length=479

 Score =   132 bits (333),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 72/118 (61%), Positives = 87/118 (74%), Gaps = 13/118 (11%)
 Frame = -2

Query  1163  VEESGEKKASVRPYVRSKMPRLRWTPDLHLRFLHAVERLGGQERATPKLVLQLMDIKGLN  984
              E SGE+  +VR Y RSK PRLRWTPDLH+ FLHAVERLGGQERATPKLVLQ+M+++GL+
Sbjct  89    AEGSGERVPTVRQYNRSKHPRLRWTPDLHMAFLHAVERLGGQERATPKLVLQMMNVRGLS  148

Query  983   IAHVKSHLQMYRSKKTEDPSQGFANHRAFMEGGDRNVFNLSQLPMFKIFNNQRLNPPF  810
             IAHVKSHLQMYRSKK E  S   ++ RA M     +VF+    PM   F+ +R + PF
Sbjct  149   IAHVKSHLQMYRSKKIEHES---SHERAAMS----SVFS----PMN--FHMRRGDHPF  193



>ref|XP_008448246.1| PREDICTED: probable transcription factor KAN2 isoform X2 [Cucumis 
melo]
Length=180

 Score =   126 bits (317),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 58/73 (79%), Positives = 66/73 (90%), Gaps = 0/73 (0%)
 Frame = -2

Query  1139  ASVRPYVRSKMPRLRWTPDLHLRFLHAVERLGGQERATPKLVLQLMDIKGLNIAHVKSHL  960
              SVR Y RSKMPRLRWTPDLHL F++AVERLGGQERATPKLVLQLM+++GL+IAHVKSHL
Sbjct  54    GSVRKYSRSKMPRLRWTPDLHLAFVNAVERLGGQERATPKLVLQLMNVRGLSIAHVKSHL  113

Query  959   QMYRSKKTEDPSQ  921
             QMYRSKK ++  Q
Sbjct  114   QMYRSKKLDESGQ  126



>ref|XP_009613587.1| PREDICTED: uncharacterized protein LOC104106691 [Nicotiana tomentosiformis]
Length=400

 Score =   131 bits (330),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 70/122 (57%), Positives = 85/122 (70%), Gaps = 12/122 (10%)
 Frame = -2

Query  1250  NKFEEDEDETNESPRNQTVKDGGSSSNSTVEESGE-KKASVRPYVRSKMPRLRWTPDLHL  1074
             N  E+  DE N    N +  DG          SG  +K +VR YVRSKMPRLRWTP+LH 
Sbjct  63    NSSEKTTDEGNSENYNNSCGDG----------SGRVEKKNVRHYVRSKMPRLRWTPELHR  112

Query  1073  RFLHAVERLGGQERATPKLVLQLMDIKGLNIAHVKSHLQMYRSKKTEDPSQGFANHRAFM  894
              F+HA+E LGGQERATPKLVLQLM+++GL+IAHVKSHLQMYRSKK ++  Q    +RA M
Sbjct  113   SFVHAIETLGGQERATPKLVLQLMNVRGLSIAHVKSHLQMYRSKKLDESGQVLGRNRA-M  171

Query  893   EG  888
             +G
Sbjct  172   QG  173



>ref|XP_009623365.1| PREDICTED: putative Myb family transcription factor At1g14600 
[Nicotiana tomentosiformis]
Length=236

 Score =   127 bits (320),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 66/124 (53%), Positives = 82/124 (66%), Gaps = 5/124 (4%)
 Frame = -2

Query  1145  KKASVRPYVRSKMPRLRWTPDLHLRFLHAVERLGGQERATPKLVLQLMDIKGLNIAHVKS  966
             K   VRPYVRS+MPRLRWT DLH  F+HAVERLGG++RATPK+VLQLMD+KGL I+HVKS
Sbjct  31    KSGGVRPYVRSQMPRLRWTQDLHRSFVHAVERLGGEDRATPKMVLQLMDVKGLTISHVKS  90

Query  965   HLQMYRSKKTEDPSQGFANHRAFMEGGDRNVFNLSQLPMFKIFNNQRLNPPFRYGDDSYR  786
             HLQMYRS K E   Q  A       GG RN  + +    +  + N  +N    +G   ++
Sbjct  91    HLQMYRSMKHEQMMQAEAE---VANGGKRNRMDGAANGNYHYYYN--INDKAFFGAHPWK  145

Query  785   NCQE  774
             + QE
Sbjct  146   HMQE  149



>ref|XP_009421270.1| PREDICTED: uncharacterized protein LOC104000854 isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=518

 Score =   132 bits (333),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 62/85 (73%), Positives = 71/85 (84%), Gaps = 0/85 (0%)
 Frame = -2

Query  1175  SNSTVEESGEKKASVRPYVRSKMPRLRWTPDLHLRFLHAVERLGGQERATPKLVLQLMDI  996
             S  T E S  +  +VR YVRSK+PRLRWTPDLHL F+HAVERLGGQERATPKLVLQLM++
Sbjct  92    SGDTTEGSSGRAPTVRQYVRSKLPRLRWTPDLHLAFVHAVERLGGQERATPKLVLQLMNV  151

Query  995   KGLNIAHVKSHLQMYRSKKTEDPSQ  921
             +GL+IAHVKSHLQMYRSKK +   Q
Sbjct  152   RGLSIAHVKSHLQMYRSKKLDGSGQ  176



>ref|XP_009421269.1| PREDICTED: uncharacterized protein LOC104000854 isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=519

 Score =   132 bits (333),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 62/85 (73%), Positives = 71/85 (84%), Gaps = 0/85 (0%)
 Frame = -2

Query  1175  SNSTVEESGEKKASVRPYVRSKMPRLRWTPDLHLRFLHAVERLGGQERATPKLVLQLMDI  996
             S  T E S  +  +VR YVRSK+PRLRWTPDLHL F+HAVERLGGQERATPKLVLQLM++
Sbjct  92    SGDTTEGSSGRAPTVRQYVRSKLPRLRWTPDLHLAFVHAVERLGGQERATPKLVLQLMNV  151

Query  995   KGLNIAHVKSHLQMYRSKKTEDPSQ  921
             +GL+IAHVKSHLQMYRSKK +   Q
Sbjct  152   RGLSIAHVKSHLQMYRSKKLDGSGQ  176



>ref|XP_006663711.1| PREDICTED: transcription activator GLK2-like [Oryza brachyantha]
Length=300

 Score =   129 bits (324),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 71/133 (53%), Positives = 95/133 (71%), Gaps = 12/133 (9%)
 Frame = -2

Query  1190  DGGSSSNSTVEESGEKKAS----VRPYVRSKMPRLRWTPDLHLRFLHAVERLGGQERATP  1023
             DG S+S+STVEE GE++ S    VRPYVRSK PRLRWTP+LHL F+ AV+RLGGQ+RATP
Sbjct  23    DGSSTSSSTVEEEGERRTSSSSSVRPYVRSKNPRLRWTPELHLCFVRAVDRLGGQDRATP  82

Query  1022  KLVLQLMDIKGLNIAHVKSHLQMYRSKKTEDPSQGFAN------HRAFMEGGDRNVFNLS  861
             KLVLQLM+++GL+IAHVKSHLQMYRSKK ++  Q          H+    GG    +++ 
Sbjct  83    KLVLQLMNVRGLSIAHVKSHLQMYRSKKIDESGQVIGGGSWREEHQYIHHGG--QAYSVG  140

Query  860   QLPMFKIFNNQRL  822
              L +  + +++ +
Sbjct  141   HLSLPALLHHRHI  153



>ref|XP_003577903.2| PREDICTED: two-component response regulator ARR14-like [Brachypodium 
distachyon]
Length=371

 Score =   130 bits (328),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 64/95 (67%), Positives = 76/95 (80%), Gaps = 4/95 (4%)
 Frame = -2

Query  1193  KDGGSSSNSTVEESGEKK----ASVRPYVRSKMPRLRWTPDLHLRFLHAVERLGGQERAT  1026
             ++G +  +STVEE   +K    +SVRPYVRSK PRLRWTP+LH  FL AVERLGGQ+ AT
Sbjct  44    EEGSNDDDSTVEEEDHRKTNGDSSVRPYVRSKNPRLRWTPELHHCFLRAVERLGGQDHAT  103

Query  1025  PKLVLQLMDIKGLNIAHVKSHLQMYRSKKTEDPSQ  921
             PKLVLQLM+++GL+I HVKSHLQMYRSKK ED  Q
Sbjct  104   PKLVLQLMNVRGLSIGHVKSHLQMYRSKKIEDSGQ  138



>gb|KEH36604.1| myb-like DNA-binding domain, shaqkyf class protein [Medicago 
truncatula]
Length=374

 Score =   130 bits (327),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 69/126 (55%), Positives = 83/126 (66%), Gaps = 9/126 (7%)
 Frame = -2

Query  1160  EESGEKKASVRPYVRSKMPRLRWTPDLHLRFLHAVERLGGQERATPKLVLQLMDIKGLNI  981
             E + E++  VR YVRSKMPRLRWTP+LH  FLHAVERLGG ERATPKLVLQLM ++GLNI
Sbjct  72    EGNNERRGKVRHYVRSKMPRLRWTPELHHSFLHAVERLGGLERATPKLVLQLMSVRGLNI  131

Query  980   AHVKSHLQMYRSKKTEDPSQGFA-NHRAFMEGGDRNVFNLSQ--------LPMFKIFNNQ  828
              HVKSHLQMYRSKK ++  Q      R+  E G     +LSQ        + +   +N Q
Sbjct  132   GHVKSHLQMYRSKKLDEFGQVLCQTQRSTQEVGRSQKLDLSQHFKMGNGGIILSSSYNEQ  191

Query  827   RLNPPF  810
               NP +
Sbjct  192   HHNPQY  197



>ref|XP_003636803.1| Myb family transcription factor APL [Medicago truncatula]
 gb|KEH36603.1| myb-like DNA-binding domain, shaqkyf class protein [Medicago 
truncatula]
Length=377

 Score =   130 bits (327),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 69/126 (55%), Positives = 83/126 (66%), Gaps = 9/126 (7%)
 Frame = -2

Query  1160  EESGEKKASVRPYVRSKMPRLRWTPDLHLRFLHAVERLGGQERATPKLVLQLMDIKGLNI  981
             E + E++  VR YVRSKMPRLRWTP+LH  FLHAVERLGG ERATPKLVLQLM ++GLNI
Sbjct  72    EGNNERRGKVRHYVRSKMPRLRWTPELHHSFLHAVERLGGLERATPKLVLQLMSVRGLNI  131

Query  980   AHVKSHLQMYRSKKTEDPSQGFA-NHRAFMEGGDRNVFNLSQ--------LPMFKIFNNQ  828
              HVKSHLQMYRSKK ++  Q      R+  E G     +LSQ        + +   +N Q
Sbjct  132   GHVKSHLQMYRSKKLDEFGQVLCQTQRSTQEVGRSQKLDLSQHFKMGNGGIILSSSYNEQ  191

Query  827   RLNPPF  810
               NP +
Sbjct  192   HHNPQY  197



>ref|XP_002985847.1| hypothetical protein SELMODRAFT_424890 [Selaginella moellendorffii]
 gb|EFJ13024.1| hypothetical protein SELMODRAFT_424890 [Selaginella moellendorffii]
Length=336

 Score =   129 bits (325),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 66/108 (61%), Positives = 78/108 (72%), Gaps = 4/108 (4%)
 Frame = -2

Query  1241  EEDEDETNESPRNQTVKDGGSSSNSTVEE----SGEKKASVRPYVRSKMPRLRWTPDLHL  1074
             ++D D    S  N TV   GSS  +TV      S   ++SVR Y+RSKMPRLRWTPDLH 
Sbjct  28    DDDLDAPGSSDSNNTVSGDGSSDGATVLGGPFGSSSARSSVRQYIRSKMPRLRWTPDLHE  87

Query  1073  RFLHAVERLGGQERATPKLVLQLMDIKGLNIAHVKSHLQMYRSKKTED  930
              F+ AV+RLGGQ+RATPKLVLQLM +KGL IAHVKSHLQMYRS K ++
Sbjct  88    CFVRAVDRLGGQDRATPKLVLQLMGVKGLTIAHVKSHLQMYRSMKNDE  135



>ref|XP_006362389.1| PREDICTED: uncharacterized protein LOC102585011 [Solanum tuberosum]
Length=348

 Score =   129 bits (325),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 72/127 (57%), Positives = 91/127 (72%), Gaps = 16/127 (13%)
 Frame = -2

Query  1190  DGGSSSNSTVEESGEKKASVRPYVRSKMPRLRWTPDLHLRFLHAVERLGGQERATPKLVL  1011
             +G  +++S VE     K +VR YVRSK PRLRWTPDLH  F+HA+ERLGGQERATPKLVL
Sbjct  47    EGNYNTSSDVE-----KKNVRQYVRSKFPRLRWTPDLHRSFVHAIERLGGQERATPKLVL  101

Query  1010  QLMDIKGLNIAHVKSHLQMYRSKKTEDPSQ--GFANHRAFMEGGDRNVFNLSQLPMFKIF  837
             Q+M+++GL+IAHVKSHLQMYRSKK ++  Q  G  N+R+ M+G  R+ F  + L      
Sbjct  102   QMMNVRGLSIAHVKSHLQMYRSKKLDESGQVLGRGNNRS-MQG--RSYFFRNHL------  152

Query  836   NNQRLNP  816
               QR NP
Sbjct  153   GGQRYNP  159



>ref|XP_004233787.1| PREDICTED: uncharacterized protein LOC101255761 isoform X1 [Solanum 
lycopersicum]
Length=253

 Score =   127 bits (319),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 63/104 (61%), Positives = 76/104 (73%), Gaps = 5/104 (5%)
 Frame = -2

Query  1223  TNESPRNQTVKDGGSSSNSTVEESGEKKASVRPYVRSKMPRLRWTPDLHLRFLHAVERLG  1044
             ++ SP N ++K         +E +   K+ VRPYVRSKMPRLRWT DLH  F+HAVERLG
Sbjct  9     SDNSPSNLSMKQP-----IMLENTNNNKSGVRPYVRSKMPRLRWTHDLHRCFVHAVERLG  63

Query  1043  GQERATPKLVLQLMDIKGLNIAHVKSHLQMYRSKKTEDPSQGFA  912
             G++RATPK+VLQLMD+KGL I+HVKSHLQMYRS K E   Q  A
Sbjct  64    GEDRATPKMVLQLMDVKGLTISHVKSHLQMYRSMKHEQLMQAVA  107



>gb|KHN40881.1| Putative Myb family transcription factor [Glycine soja]
Length=265

 Score =   127 bits (320),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 60/87 (69%), Positives = 71/87 (82%), Gaps = 0/87 (0%)
 Frame = -2

Query  1178  SSNSTVEESGEKKASVRPYVRSKMPRLRWTPDLHLRFLHAVERLGGQERATPKLVLQLMD  999
             +S+  + E   K   VRPYVRSKMPRLRWTPDLH  F+HAV+RLGG++RATPKLVLQLM+
Sbjct  32    TSDHHLPEISLKTPMVRPYVRSKMPRLRWTPDLHRCFVHAVQRLGGEDRATPKLVLQLMN  91

Query  998   IKGLNIAHVKSHLQMYRSKKTEDPSQG  918
             +KGL I+HVKSHLQMYRS + E  SQG
Sbjct  92    VKGLTISHVKSHLQMYRSMRHEQMSQG  118



>ref|XP_009782820.1| PREDICTED: transcription repressor KAN1-like [Nicotiana sylvestris]
Length=251

 Score =   127 bits (319),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 59/87 (68%), Positives = 69/87 (79%), Gaps = 0/87 (0%)
 Frame = -2

Query  1172  NSTVEESGEKKASVRPYVRSKMPRLRWTPDLHLRFLHAVERLGGQERATPKLVLQLMDIK  993
             N+ +++   K   VRPYVRSKMPRLRWT DLH RF+HAVE LGG++RATPK+VLQLMD+K
Sbjct  24    NTPMKDHSNKSGGVRPYVRSKMPRLRWTQDLHRRFVHAVETLGGEDRATPKMVLQLMDVK  83

Query  992   GLNIAHVKSHLQMYRSKKTEDPSQGFA  912
             GL I+HVKSHLQMYRS K E   Q  A
Sbjct  84    GLTISHVKSHLQMYRSMKHEQMIQAEA  110



>ref|XP_003534706.2| PREDICTED: probable transcription factor KAN2-like [Glycine max]
Length=283

 Score =   127 bits (320),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 60/87 (69%), Positives = 71/87 (82%), Gaps = 0/87 (0%)
 Frame = -2

Query  1178  SSNSTVEESGEKKASVRPYVRSKMPRLRWTPDLHLRFLHAVERLGGQERATPKLVLQLMD  999
             +S+  + E   K   VRPYVRSKMPRLRWTPDLH  F+HAV+RLGG++RATPKLVLQLM+
Sbjct  50    TSDHHLPEISLKTPMVRPYVRSKMPRLRWTPDLHRCFVHAVQRLGGEDRATPKLVLQLMN  109

Query  998   IKGLNIAHVKSHLQMYRSKKTEDPSQG  918
             +KGL I+HVKSHLQMYRS + E  SQG
Sbjct  110   VKGLTISHVKSHLQMYRSMRHEQMSQG  136



>ref|XP_009802187.1| PREDICTED: uncharacterized protein LOC104247786 [Nicotiana sylvestris]
 ref|XP_009802188.1| PREDICTED: uncharacterized protein LOC104247786 [Nicotiana sylvestris]
 ref|XP_009802189.1| PREDICTED: uncharacterized protein LOC104247786 [Nicotiana sylvestris]
 ref|XP_009802190.1| PREDICTED: uncharacterized protein LOC104247786 [Nicotiana sylvestris]
 ref|XP_009802191.1| PREDICTED: uncharacterized protein LOC104247786 [Nicotiana sylvestris]
Length=398

 Score =   130 bits (326),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 62/87 (71%), Positives = 75/87 (86%), Gaps = 2/87 (2%)
 Frame = -2

Query  1145  KKASVRPYVRSKMPRLRWTPDLHLRFLHAVERLGGQERATPKLVLQLMDIKGLNIAHVKS  966
             +K +VR YVRSKMPRLRWTP+LH  F+HA+ERLGGQERATPKLVLQLM+++GL+IAHVKS
Sbjct  86    EKKNVRHYVRSKMPRLRWTPELHRSFVHAIERLGGQERATPKLVLQLMNVRGLSIAHVKS  145

Query  965   HLQMYRSKKTEDPSQGFA-NHRAFMEG  888
             HLQMYRSKK ++  Q    N+RA M+G
Sbjct  146   HLQMYRSKKLDESGQVLGRNYRA-MQG  171



>ref|XP_007147718.1| hypothetical protein PHAVU_006G149000g [Phaseolus vulgaris]
 gb|ESW19712.1| hypothetical protein PHAVU_006G149000g [Phaseolus vulgaris]
Length=300

 Score =   128 bits (321),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 59/76 (78%), Positives = 66/76 (87%), Gaps = 0/76 (0%)
 Frame = -2

Query  1145  KKASVRPYVRSKMPRLRWTPDLHLRFLHAVERLGGQERATPKLVLQLMDIKGLNIAHVKS  966
             K   VRPYVRSKMPRLRWTPDLH  F+HAV+RLGG++RATPKLVLQLM++KGL I+HVKS
Sbjct  60    KTPMVRPYVRSKMPRLRWTPDLHRCFVHAVQRLGGEDRATPKLVLQLMNVKGLTISHVKS  119

Query  965   HLQMYRSKKTEDPSQG  918
             HLQMYRS K E  SQG
Sbjct  120   HLQMYRSMKHEQMSQG  135



>ref|XP_008439740.1| PREDICTED: transcription repressor KAN1-like isoform X3 [Cucumis 
melo]
Length=261

 Score =   127 bits (318),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 61/94 (65%), Positives = 72/94 (77%), Gaps = 5/94 (5%)
 Frame = -2

Query  1145  KKASVRPYVRSKMPRLRWTPDLHLRFLHAVERLGGQERATPKLVLQLMDIKGLNIAHVKS  966
             ++ +VR YVRSK+PRLRWTP+LHL F+HAV+RLGGQERATPKLVLQLM++KGL+IAHVKS
Sbjct  100   RRTAVRQYVRSKVPRLRWTPELHLNFVHAVQRLGGQERATPKLVLQLMNVKGLSIAHVKS  159

Query  965   HLQMYRSKKTEDPSQGF-----ANHRAFMEGGDR  879
             HLQMYRSKK +   Q             M GG R
Sbjct  160   HLQMYRSKKLDQSGQVIREACDGMRMGLMHGGGR  193



>ref|XP_006435783.1| hypothetical protein CICLE_v10032941mg [Citrus clementina]
 gb|ESR49023.1| hypothetical protein CICLE_v10032941mg [Citrus clementina]
Length=162

 Score =   124 bits (310),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 58/87 (67%), Positives = 70/87 (80%), Gaps = 4/87 (5%)
 Frame = -2

Query  1139  ASVRPYVRSKMPRLRWTPDLHLRFLHAVERLGGQERATPKLVLQLMDIKGLNIAHVKSHL  960
              S R Y RSK PRLRWTP+LHL F+ AVERLGGQ+RATPKLVLQ M+IKGL+I+HVKSHL
Sbjct  58    GSTRQYNRSKTPRLRWTPELHLCFVQAVERLGGQDRATPKLVLQFMNIKGLSISHVKSHL  117

Query  959   QMYRSKKTEDPSQG----FANHRAFME  891
             QMYR+KK +DP+QG    F  H + ++
Sbjct  118   QMYRNKKIDDPNQGIFIYFLCHPSLLQ  144



>ref|XP_008439738.1| PREDICTED: myb-like protein H isoform X2 [Cucumis melo]
Length=304

 Score =   127 bits (319),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 61/94 (65%), Positives = 72/94 (77%), Gaps = 5/94 (5%)
 Frame = -2

Query  1145  KKASVRPYVRSKMPRLRWTPDLHLRFLHAVERLGGQERATPKLVLQLMDIKGLNIAHVKS  966
             ++ +VR YVRSK+PRLRWTP+LHL F+HAV+RLGGQERATPKLVLQLM++KGL+IAHVKS
Sbjct  59    RRTAVRQYVRSKVPRLRWTPELHLNFVHAVQRLGGQERATPKLVLQLMNVKGLSIAHVKS  118

Query  965   HLQMYRSKKTEDPSQGF-----ANHRAFMEGGDR  879
             HLQMYRSKK +   Q             M GG R
Sbjct  119   HLQMYRSKKLDQSGQVIREACDGMRMGLMHGGGR  152



>emb|CDP09227.1| unnamed protein product [Coffea canephora]
Length=372

 Score =   128 bits (322),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 76/131 (58%), Positives = 87/131 (66%), Gaps = 18/131 (14%)
 Frame = -2

Query  1244  FEEDEDETNESPRNQTVKDGGSS----------SNSTVEESGEKKAS-----VRPYVRSK  1110
             F +   E N S  +  +KDGG S          SNS  EES  KK S     VR YVRSK
Sbjct  7     FSDGLPEVNSS--DHGMKDGGGSDEPKTSGSSSSNSMAEESTGKKLSSSATGVRQYVRSK  64

Query  1109  MPRLRWTPDLHLRFLHAVERLGGQERATPKLVLQLMDIKGLNIAHVKSHLQMYRSKKTED  930
             MPRLRWTPDLH  F+ AVE+LGGQERATPKLVLQLM++KGL+IAHVKSHLQMYRS+  +D
Sbjct  65    MPRLRWTPDLHRCFVQAVEKLGGQERATPKLVLQLMNVKGLSIAHVKSHLQMYRSRNIDD  124

Query  929   PSQGFANHRAF  897
               Q   N R +
Sbjct  125   HGQ-VINERGY  134



>gb|EAZ01264.1| hypothetical protein OsI_23288 [Oryza sativa Indica Group]
Length=513

 Score =   130 bits (327),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 59/85 (69%), Positives = 73/85 (86%), Gaps = 0/85 (0%)
 Frame = -2

Query  1178  SSNSTVEESGEKKASVRPYVRSKMPRLRWTPDLHLRFLHAVERLGGQERATPKLVLQLMD  999
             SS+S  +  G++  +VR Y RSK+PRLRWTPDLH+ F+HAVERLGGQERATPKLVLQ+M+
Sbjct  72    SSSSKADGGGDRVPTVRQYNRSKLPRLRWTPDLHMAFVHAVERLGGQERATPKLVLQMMN  131

Query  998   IKGLNIAHVKSHLQMYRSKKTEDPS  924
             ++GL+IAHVKSHLQMYRSKK +  S
Sbjct  132   VRGLSIAHVKSHLQMYRSKKLDHES  156



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 4270971428024