BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c80524_g1_i1 len=1763 path=[1741:0-1762]

Length=1763
                                                                      Score     E

emb|CDP19959.1|  unnamed protein product                                646   0.0      
gb|KEH44511.1|  3-ketoacyl-CoA synthase-like protein                    607   0.0      
ref|XP_007009580.1|  3-ketoacyl-CoA synthase                            605   0.0      
gb|KDO67810.1|  hypothetical protein CISIN_1g010144mg                   605   0.0      
ref|XP_006436136.1|  hypothetical protein CICLE_v10031467mg             603   0.0      
ref|XP_004497320.1|  PREDICTED: 3-ketoacyl-CoA synthase 21-like         595   0.0      
gb|EPS63248.1|  hypothetical protein M569_11539                         592   0.0      
ref|XP_004143684.1|  PREDICTED: 3-ketoacyl-CoA synthase 21-like         589   0.0      
ref|XP_010096696.1|  3-ketoacyl-CoA synthase 21                         587   0.0      
emb|CDP17293.1|  unnamed protein product                                586   0.0      
ref|XP_008461612.1|  PREDICTED: 3-ketoacyl-CoA synthase 21-like i...    587   0.0      
ref|XP_007009535.1|  3-ketoacyl-CoA synthase                            587   0.0      
ref|XP_002315256.1|  hypothetical protein POPTR_0010s21940g             581   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_007219422.1|  hypothetical protein PRUPE_ppa021980mg             582   0.0      
ref|XP_011038218.1|  PREDICTED: 3-ketoacyl-CoA synthase 21-like         579   0.0      
ref|XP_010658135.1|  PREDICTED: 3-ketoacyl-CoA synthase 21              579   0.0      
dbj|BAJ34933.1|  hypothetical protein                                   578   0.0      
ref|XP_011027090.1|  PREDICTED: 3-ketoacyl-CoA synthase 21-like         577   0.0      
ref|XP_010669795.1|  PREDICTED: 3-ketoacyl-CoA synthase 21              577   0.0      
gb|AGK30014.1|  3-ketoacyl-CoA synthase 20                              575   0.0      
ref|XP_006376363.1|  hypothetical protein POPTR_0013s12390g             575   0.0      
ref|XP_007220454.1|  hypothetical protein PRUPE_ppa004944mg             575   0.0      
ref|XP_004309416.1|  PREDICTED: 3-ketoacyl-CoA synthase 21-like         574   0.0      
ref|XP_004308834.1|  PREDICTED: 3-ketoacyl-CoA synthase 21-like         570   0.0      
gb|KDP46105.1|  hypothetical protein JCGZ_06616                         567   0.0      
ref|XP_003536780.1|  PREDICTED: 3-ketoacyl-CoA synthase 21-like         569   0.0      
ref|XP_008233539.1|  PREDICTED: 3-ketoacyl-CoA synthase 21-like         566   0.0      
ref|XP_007142697.1|  hypothetical protein PHAVU_007G009200g             565   0.0      
ref|XP_008233540.1|  PREDICTED: 3-ketoacyl-CoA synthase 21-like         563   0.0      
ref|XP_007217982.1|  hypothetical protein PRUPE_ppa005454mg             562   0.0      
ref|XP_007009579.1|  3-ketoacyl-CoA synthase                            561   0.0      
ref|XP_011002674.1|  PREDICTED: 3-ketoacyl-CoA synthase 21-like         559   0.0      
ref|XP_007142696.1|  hypothetical protein PHAVU_007G009100g             558   0.0      
ref|XP_010558768.1|  PREDICTED: 3-ketoacyl-CoA synthase 21-like         556   0.0      
gb|KHN20288.1|  3-ketoacyl-CoA synthase 21                              557   0.0      
gb|KHN37313.1|  3-ketoacyl-CoA synthase 21                              555   0.0      
ref|XP_011020158.1|  PREDICTED: 3-ketoacyl-CoA synthase 21-like         554   0.0      
gb|AGK30011.1|  3-ketoacyl-CoA synthase                                 553   0.0      
ref|XP_009335920.1|  PREDICTED: 3-ketoacyl-CoA synthase 21-like         553   0.0      
ref|XP_009344910.1|  PREDICTED: 3-ketoacyl-CoA synthase 21-like         553   0.0      
ref|XP_009357644.1|  PREDICTED: 3-ketoacyl-CoA synthase 21-like         551   0.0      
gb|AGK30010.1|  3-ketoacyl-CoA synthase 15                              550   0.0      
emb|CDX70217.1|  BnaA10g25660D                                          548   0.0      
ref|XP_010520159.1|  PREDICTED: 3-ketoacyl-CoA synthase 21-like         548   0.0      
ref|XP_009357643.1|  PREDICTED: 3-ketoacyl-CoA synthase 21-like         547   0.0      
ref|XP_010452351.1|  PREDICTED: 3-ketoacyl-CoA synthase 21-like         546   0.0      
ref|XP_009335921.1|  PREDICTED: 3-ketoacyl-CoA synthase 21-like         546   0.0      
gb|AGK30013.1|  3-ketoacyl-CoA synthase                                 545   0.0      
ref|XP_010423567.1|  PREDICTED: 3-ketoacyl-CoA synthase 21-like         545   0.0      
ref|XP_002313455.1|  beta-ketoacyl-CoA synthase family protein          545   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_008369933.1|  PREDICTED: 3-ketoacyl-CoA synthase 21-like         545   0.0      
ref|XP_006398912.1|  hypothetical protein EUTSA_v10013468mg             545   0.0      
ref|XP_010490966.1|  PREDICTED: 3-ketoacyl-CoA synthase 21              544   0.0      
ref|XP_002873154.1|  beta-ketoacyl-CoA synthase family protein          543   0.0      
ref|XP_009122587.1|  PREDICTED: 3-ketoacyl-CoA synthase 21              541   0.0      
emb|CDY04915.1|  BnaAnng00970D                                          541   0.0      
emb|CDY44863.1|  BnaC09g50630D                                          541   0.0      
ref|NP_196073.1|  3-ketoacyl-CoA synthase 19                            540   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_009344902.1|  PREDICTED: 3-ketoacyl-CoA synthase 21-like         540   0.0      
ref|XP_007221017.1|  hypothetical protein PRUPE_ppa019864mg             540   0.0      
ref|XP_002526783.1|  acyltransferase, putative                          539   0.0      Ricinus communis
emb|CDY14150.1|  BnaC02g02670D                                          539   0.0      
ref|XP_006376366.1|  hypothetical protein POPTR_0013s12410g             538   0.0      
ref|XP_008353343.1|  PREDICTED: 3-ketoacyl-CoA synthase 21-like         538   0.0      
ref|XP_009125563.1|  PREDICTED: 3-ketoacyl-CoA synthase 21              538   0.0      
ref|XP_006287689.1|  hypothetical protein CARUB_v10000897mg             537   0.0      
ref|XP_002534162.1|  acyltransferase, putative                          537   0.0      Ricinus communis
ref|XP_011005030.1|  PREDICTED: 3-ketoacyl-CoA synthase 3-like          536   0.0      
ref|XP_010043605.1|  PREDICTED: 3-ketoacyl-CoA synthase 12              535   0.0      
gb|AGK30012.1|  3-ketoacyl-CoA synthase                                 531   0.0      
gb|ABK95107.1|  unknown                                                 532   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_009794082.1|  PREDICTED: 3-ketoacyl-CoA synthase 12-like         531   0.0      
ref|XP_007219332.1|  hypothetical protein PRUPE_ppa019292mg             528   3e-180   
ref|XP_003606593.1|  3-ketoacyl-CoA synthase                            530   4e-180   
ref|XP_003606586.1|  3-ketoacyl-CoA synthase                            528   1e-179   
ref|XP_008461615.1|  PREDICTED: 3-ketoacyl-CoA synthase 21-like         528   1e-179   
ref|XP_009598249.1|  PREDICTED: 3-ketoacyl-CoA synthase 3-like          528   2e-179   
ref|XP_002298380.2|  hypothetical protein POPTR_0001s24120g             526   2e-179   Populus trichocarpa [western balsam poplar]
ref|XP_009358307.1|  PREDICTED: 3-ketoacyl-CoA synthase 12-like         526   7e-179   
ref|XP_008385185.1|  PREDICTED: 3-ketoacyl-CoA synthase 12-like         525   3e-178   
ref|XP_007150274.1|  hypothetical protein PHAVU_005G140100g             525   4e-178   
gb|KDP44173.1|  hypothetical protein JCGZ_05640                         524   4e-178   
ref|XP_009771429.1|  PREDICTED: 3-ketoacyl-CoA synthase 3-like          524   5e-178   
ref|XP_004150960.1|  PREDICTED: 3-ketoacyl-CoA synthase 21-like         524   5e-178   
ref|XP_009782321.1|  PREDICTED: 3-ketoacyl-CoA synthase 3-like          524   7e-178   
ref|XP_003547033.2|  PREDICTED: 3-ketoacyl-CoA synthase 12-like         524   7e-178   
ref|XP_002526784.1|  acyltransferase, putative                          523   1e-177   Ricinus communis
ref|XP_010112930.1|  3-ketoacyl-CoA synthase 12                         523   2e-177   
ref|XP_003539757.1|  PREDICTED: 3-ketoacyl-CoA synthase 12-like         522   3e-177   
ref|XP_003606588.1|  3-ketoacyl-CoA synthase                            522   5e-177   
ref|XP_008448355.1|  PREDICTED: 3-ketoacyl-CoA synthase 12              521   6e-177   
ref|XP_009354553.1|  PREDICTED: 3-ketoacyl-CoA synthase 12-like         521   1e-176   
ref|XP_007207633.1|  hypothetical protein PRUPE_ppa021836mg             520   2e-176   
ref|XP_008222749.1|  PREDICTED: 3-ketoacyl-CoA synthase 12              520   3e-176   
ref|XP_010651070.1|  PREDICTED: 3-ketoacyl-CoA synthase 12              520   3e-176   
gb|KHN05688.1|  3-ketoacyl-CoA synthase 12                              519   7e-176   
ref|XP_006363390.1|  PREDICTED: 3-ketoacyl-CoA synthase 3-like          518   9e-176   
ref|XP_003543495.1|  PREDICTED: 3-ketoacyl-CoA synthase 12-like         518   9e-176   
ref|XP_006363392.1|  PREDICTED: 3-ketoacyl-CoA synthase 3-like          518   1e-175   
ref|XP_011089407.1|  PREDICTED: 3-ketoacyl-CoA synthase 12              518   1e-175   
ref|XP_003539099.2|  PREDICTED: 3-ketoacyl-CoA synthase 12-like         518   4e-175   
ref|XP_010096695.1|  3-ketoacyl-CoA synthase 21                         516   5e-175   
ref|XP_004251303.1|  PREDICTED: 3-ketoacyl-CoA synthase 3-like          516   5e-175   
ref|XP_004251302.1|  PREDICTED: 3-ketoacyl-CoA synthase 3-like          516   6e-175   
ref|XP_007132127.1|  hypothetical protein PHAVU_011G068900g             515   1e-174   
gb|EYU36246.1|  hypothetical protein MIMGU_mgv1a005714mg                514   4e-174   
emb|CAN62551.1|  hypothetical protein VITISV_002308                     513   7e-174   Vitis vinifera
ref|XP_010260016.1|  PREDICTED: 3-ketoacyl-CoA synthase 12-like         514   7e-174   
ref|XP_004487041.1|  PREDICTED: 3-ketoacyl-CoA synthase 12-like         514   8e-174   
gb|AGK30015.1|  3-ketoacyl-CoA synthase 6                               513   1e-173   
ref|XP_004294622.1|  PREDICTED: 3-ketoacyl-CoA synthase 12-like         513   1e-173   
ref|XP_004157020.1|  PREDICTED: LOW QUALITY PROTEIN: 3-ketoacyl-C...    512   2e-173   
gb|ABX10441.1|  3-ketoacyl-CoA synthase 6                               513   2e-173   Gossypium hirsutum [American cotton]
emb|CDP08983.1|  unnamed protein product                                513   2e-173   
ref|XP_004148222.1|  PREDICTED: 3-ketoacyl-CoA synthase 12-like         512   2e-173   
ref|XP_008233538.1|  PREDICTED: 3-ketoacyl-CoA synthase 21-like         512   2e-173   
gb|KHN30213.1|  3-ketoacyl-CoA synthase 12                              512   3e-173   
ref|XP_010534310.1|  PREDICTED: 3-ketoacyl-CoA synthase 21-like         512   4e-173   
gb|KHN22006.1|  3-ketoacyl-CoA synthase 12                              510   7e-173   
ref|XP_008796343.1|  PREDICTED: 3-ketoacyl-CoA synthase 12-like         510   8e-173   
ref|XP_006376369.1|  hypothetical protein POPTR_0013s12440g             508   1e-172   
ref|XP_007016547.1|  3-ketoacyl-CoA synthase 12                         510   2e-172   
ref|XP_002276028.1|  PREDICTED: 3-ketoacyl-CoA synthase 12-like         509   4e-172   Vitis vinifera
ref|XP_010935997.1|  PREDICTED: 3-ketoacyl-CoA synthase 12-like         508   4e-172   
ref|XP_010533206.1|  PREDICTED: 3-ketoacyl-CoA synthase 21-like         508   5e-172   
ref|XP_010253345.1|  PREDICTED: 3-ketoacyl-CoA synthase 12-like         508   1e-171   
ref|XP_010033177.1|  PREDICTED: 3-ketoacyl-CoA synthase 12-like         507   3e-171   
ref|XP_004170359.1|  PREDICTED: LOW QUALITY PROTEIN: 3-ketoacyl-C...    505   8e-171   
ref|XP_008457509.1|  PREDICTED: 3-ketoacyl-CoA synthase 12-like         503   8e-170   
ref|XP_010032269.1|  PREDICTED: 3-ketoacyl-CoA synthase 21              503   1e-169   
ref|XP_003597312.1|  3-ketoacyl-CoA synthase                            503   1e-169   
gb|ABX10439.1|  3-ketoacyl-CoA synthase 3                               502   2e-169   Gossypium hirsutum [American cotton]
gb|KGN47350.1|  hypothetical protein Csa_6G302180                       508   2e-169   
ref|XP_006294126.1|  hypothetical protein CARUB_v10023121mg             502   3e-169   
ref|XP_009410745.1|  PREDICTED: 3-ketoacyl-CoA synthase 3-like          501   3e-169   
gb|AGK30020.1|  3-ketoacyl-CoA synthase 3                               501   4e-169   
ref|XP_009140927.1|  PREDICTED: 3-ketoacyl-CoA synthase 12              501   6e-169   
emb|CDY31720.1|  BnaA04g16560D                                          501   7e-169   
ref|XP_010685852.1|  PREDICTED: 3-ketoacyl-CoA synthase 12              501   8e-169   
ref|XP_010260036.1|  PREDICTED: 3-ketoacyl-CoA synthase 12-like         501   9e-169   
ref|XP_010521808.1|  PREDICTED: 3-ketoacyl-CoA synthase 12-like         500   6e-168   
gb|EYU39553.1|  hypothetical protein MIMGU_mgv1a0261841mg               496   8e-168   
gb|AFK48573.1|  unknown                                                 496   1e-167   
ref|XP_004505912.1|  PREDICTED: 3-ketoacyl-CoA synthase 3-like          498   1e-167   
gb|KDO72994.1|  hypothetical protein CISIN_1g039047mg                   497   2e-167   
ref|XP_010470059.1|  PREDICTED: 3-ketoacyl-CoA synthase 12-like         496   6e-167   
ref|XP_010510599.1|  PREDICTED: 3-ketoacyl-CoA synthase 12              496   6e-167   
emb|CDX77194.1|  BnaC04g39890D                                          496   1e-166   
ref|XP_011041958.1|  PREDICTED: 3-ketoacyl-CoA synthase 12-like         493   1e-166   
ref|XP_008457508.1|  PREDICTED: 3-ketoacyl-CoA synthase 12-like         494   2e-166   
ref|NP_180431.1|  3-ketoacyl-CoA synthase 12                            494   2e-166   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008802414.1|  PREDICTED: 3-ketoacyl-CoA synthase 12-like         494   2e-166   
gb|AAM61290.1|  putative fatty acid elongase                            494   2e-166   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004152899.1|  PREDICTED: 3-ketoacyl-CoA synthase 12-like         494   2e-166   
ref|XP_006424733.1|  hypothetical protein CICLE_v10028377mg             494   3e-166   
ref|XP_006409896.1|  hypothetical protein EUTSA_v10016592mg             494   3e-166   
ref|XP_010534309.1|  PREDICTED: 3-ketoacyl-CoA synthase 21-like         493   1e-165   
gb|KGN65695.1|  hypothetical protein Csa_1G501850                       493   1e-165   
emb|CDY68412.1|  BnaCnng58900D                                          493   1e-165   
gb|KFK32277.1|  hypothetical protein AALP_AA6G221500                    492   3e-165   
ref|XP_010920343.1|  PREDICTED: LOW QUALITY PROTEIN: 3-ketoacyl-C...    490   5e-165   
ref|XP_004170358.1|  PREDICTED: LOW QUALITY PROTEIN: 3-ketoacyl-C...    489   1e-164   
ref|XP_009405939.1|  PREDICTED: 3-ketoacyl-CoA synthase 12-like         489   2e-164   
ref|XP_004152906.1|  PREDICTED: 3-ketoacyl-CoA synthase 12-like         489   2e-164   
ref|XP_002880999.1|  beta-ketoacyl-CoA synthase family protein          489   2e-164   
emb|CDY04576.1|  BnaA07g14020D                                          489   3e-164   
ref|XP_010682271.1|  PREDICTED: 3-ketoacyl-CoA synthase 12-like i...    488   1e-163   
emb|CDP19958.1|  unnamed protein product                                486   2e-163   
ref|XP_011077046.1|  PREDICTED: 3-ketoacyl-CoA synthase 12-like         486   2e-163   
ref|XP_009148023.1|  PREDICTED: 3-ketoacyl-CoA synthase 3-like          487   2e-163   
ref|XP_002892414.1|  beta-ketoacyl-CoA synthase family protein          487   3e-163   
emb|CDY58835.1|  BnaAnng15510D                                          486   5e-163   
ref|XP_010475542.1|  PREDICTED: 3-ketoacyl-CoA synthase 3-like          486   5e-163   
ref|XP_010557292.1|  PREDICTED: 3-ketoacyl-CoA synthase 12-like         486   6e-163   
emb|CDX93620.1|  BnaA06g04280D                                          486   6e-163   
emb|CDY66950.1|  BnaCnng52900D                                          485   9e-163   
gb|KFK43092.1|  hypothetical protein AALP_AA1G078700                    485   1e-162   
ref|XP_009407581.1|  PREDICTED: 3-ketoacyl-CoA synthase 3-like          484   1e-162   
ref|XP_009110921.1|  PREDICTED: 3-ketoacyl-CoA synthase 3               484   3e-162   
ref|XP_009103702.1|  PREDICTED: 3-ketoacyl-CoA synthase 12-like         484   3e-162   
ref|XP_006417769.1|  hypothetical protein EUTSA_v10009782mg             484   4e-162   
emb|CDY15765.1|  BnaC04g15590D                                          482   2e-161   
ref|XP_006304468.1|  hypothetical protein CARUB_v10011152mg             482   2e-161   
gb|EPS63851.1|  hypothetical protein M569_10932                         480   6e-161   
ref|XP_010457975.1|  PREDICTED: 3-ketoacyl-CoA synthase 3               479   3e-160   
ref|XP_011089840.1|  PREDICTED: 3-ketoacyl-CoA synthase 12-like         479   3e-160   
ref|XP_010542615.1|  PREDICTED: 3-ketoacyl-CoA synthase 12-like         479   3e-160   
ref|NP_172251.1|  3-ketoacyl-CoA synthase 3                             478   9e-160   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010487912.1|  PREDICTED: 3-ketoacyl-CoA synthase 3-like          477   2e-159   
ref|XP_006379567.1|  hypothetical protein POPTR_0008s04840g             471   1e-158   
ref|XP_010682269.1|  PREDICTED: 3-ketoacyl-CoA synthase 12-like         473   1e-157   
gb|EPS61832.1|  hypothetical protein M569_12961                         468   3e-156   
ref|XP_010558801.1|  PREDICTED: 3-ketoacyl-CoA synthase 21-like         468   7e-156   
ref|XP_002326030.2|  hypothetical protein POPTR_0019s12140g             463   1e-155   Populus trichocarpa [western balsam poplar]
gb|AGT16173.1|  acyltransferase                                         466   2e-155   
ref|XP_004984200.1|  PREDICTED: 3-ketoacyl-CoA synthase 12-like         464   1e-154   
ref|XP_008660002.1|  PREDICTED: 3-ketoacyl-CoA synthase 12-like         463   3e-154   
ref|NP_001152498.1|  acyltransferase precursor                          462   1e-153   Zea mays [maize]
ref|XP_006850575.1|  hypothetical protein AMTR_s00034p00045070          462   1e-153   
ref|XP_006848688.1|  hypothetical protein AMTR_s00178p00018030          461   2e-153   
ref|XP_002467779.1|  hypothetical protein SORBIDRAFT_01g033910          462   4e-153   Sorghum bicolor [broomcorn]
ref|XP_006661857.1|  PREDICTED: 3-ketoacyl-CoA synthase 12-like         457   8e-152   
ref|NP_001148161.1|  acyltransferase                                    457   1e-151   Zea mays [maize]
dbj|BAK06890.1|  predicted protein                                      456   2e-151   
gb|EYU18919.1|  hypothetical protein MIMGU_mgv1a006441mg                453   2e-150   
ref|XP_002454759.1|  hypothetical protein SORBIDRAFT_04g036880          453   3e-150   Sorghum bicolor [broomcorn]
ref|NP_001064831.1|  Os10g0472900                                       453   3e-150   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008461613.1|  PREDICTED: 3-ketoacyl-CoA synthase 21-like i...    450   3e-150   
gb|KGN65694.1|  Beta-ketoacyl-coa synthase family protein               451   7e-150   
ref|XP_003574048.1|  PREDICTED: 3-ketoacyl-CoA synthase 12-like         449   1e-148   
gb|EMS56142.1|  3-ketoacyl-CoA synthase 12                              448   2e-148   
ref|NP_001050243.1|  Os03g0382100                                       447   8e-148   Oryza sativa Japonica Group [Japonica rice]
gb|EAZ27140.1|  hypothetical protein OsJ_11071                          447   9e-148   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004982889.1|  PREDICTED: 3-ketoacyl-CoA synthase 12-like         445   3e-147   
gb|AFW73988.1|  hypothetical protein ZEAMMB73_394221                    445   5e-147   
gb|KCW51679.1|  hypothetical protein EUGRSUZ_J01159                     444   3e-146   
gb|EPS65202.1|  hypothetical protein M569_09577                         441   6e-146   
dbj|BAJ92417.1|  predicted protein                                      441   9e-146   
ref|XP_004954331.1|  PREDICTED: 3-ketoacyl-CoA synthase 3-like          440   4e-145   
ref|XP_003570371.1|  PREDICTED: 3-ketoacyl-CoA synthase 12-like         439   6e-145   
ref|NP_001148181.1|  acyltransferase                                    439   7e-145   Zea mays [maize]
ref|NP_001152441.1|  acyltransferase                                    439   1e-144   Zea mays [maize]
gb|EMT31337.1|  3-ketoacyl-CoA synthase 12                              443   9e-143   
ref|XP_003557811.1|  PREDICTED: 3-ketoacyl-CoA synthase 12-like         426   1e-139   
ref|XP_002467095.1|  hypothetical protein SORBIDRAFT_01g019520          425   2e-139   Sorghum bicolor [broomcorn]
ref|XP_009804844.1|  PREDICTED: 3-ketoacyl-CoA synthase 3-like          420   4e-139   
gb|EEE51123.1|  hypothetical protein OsJ_31866                          419   1e-137   Oryza sativa Japonica Group [Japonica rice]
gb|EAZ27142.1|  hypothetical protein OsJ_11076                          420   3e-137   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001050246.1|  Os03g0383600                                       420   4e-137   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001173448.1|  Os03g0383200                                       418   1e-136   
gb|EAY87986.1|  hypothetical protein OsI_09409                          418   1e-136   Oryza sativa Indica Group [Indian rice]
ref|NP_001048486.1|  Os02g0813600                                       417   2e-136   Oryza sativa Japonica Group [Japonica rice]
gb|EAY90260.1|  hypothetical protein OsI_11835                          416   7e-136   Oryza sativa Indica Group [Indian rice]
ref|XP_011069412.1|  PREDICTED: 3-ketoacyl-CoA synthase 12-like         403   6e-132   
gb|EMS48112.1|  3-ketoacyl-CoA synthase 12                              391   3e-126   
gb|EAZ27141.1|  hypothetical protein OsJ_11073                          385   6e-124   Oryza sativa Japonica Group [Japonica rice]
gb|KDO67811.1|  hypothetical protein CISIN_1g010144mg                   372   4e-120   
ref|XP_009357760.1|  PREDICTED: 3-ketoacyl-CoA synthase 21-like         372   2e-119   
ref|XP_008675478.1|  PREDICTED: acyltransferase isoform X1              369   1e-118   
ref|XP_004984199.1|  PREDICTED: 3-ketoacyl-CoA synthase 12-like         370   1e-117   
ref|XP_010418816.1|  PREDICTED: 3-ketoacyl-CoA synthase 12-like         358   6e-116   
gb|EMS49160.1|  3-ketoacyl-CoA synthase 12                              360   1e-115   
ref|XP_007219070.1|  hypothetical protein PRUPE_ppa014834mg             357   9e-115   
ref|XP_006649160.1|  PREDICTED: 3-ketoacyl-CoA synthase 12-like         347   3e-110   
ref|XP_009798489.1|  PREDICTED: 3-ketoacyl-CoA synthase 3-like          345   5e-110   
ref|XP_004309415.1|  PREDICTED: 3-ketoacyl-CoA synthase 21-like         340   4e-109   
gb|EAY90259.1|  hypothetical protein OsI_11832                          335   3e-105   Oryza sativa Indica Group [Indian rice]
ref|XP_011100666.1|  PREDICTED: 3-ketoacyl-CoA synthase 1               336   6e-104   
ref|XP_004507452.1|  PREDICTED: 3-ketoacyl-CoA synthase 4-like          334   2e-103   
emb|CCW28736.1|  putative 3-Oxoacyl-[acyl-carrier-protein (ACP)] ...    333   4e-103   
gb|AGK30001.1|  3-ketoacyl-CoA synthase                                 332   7e-103   
emb|CDP02779.1|  unnamed protein product                                332   1e-102   
ref|XP_009758872.1|  PREDICTED: 3-ketoacyl-CoA synthase 1               332   2e-102   
ref|XP_003626601.1|  3-ketoacyl-CoA synthase                            332   2e-102   
gb|AAC99312.1|  fatty acid elongase 3-ketoacyl-CoA synthase 1           331   3e-102   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006361008.1|  PREDICTED: 3-ketoacyl-CoA synthase 1-like          332   3e-102   
ref|NP_171620.2|  3-ketoacyl-CoA synthase 1                             331   4e-102   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009606335.1|  PREDICTED: 3-ketoacyl-CoA synthase 1               331   4e-102   
ref|XP_002889383.1|  3-ketoacyl-CoA synthase 1                          331   5e-102   
ref|XP_010548058.1|  PREDICTED: 3-ketoacyl-CoA synthase 18-like         329   7e-102   
ref|XP_003614634.1|  3-ketoacyl-CoA synthase                            327   8e-101   
gb|KFK42502.1|  hypothetical protein AALP_AA1G001800                    327   9e-101   
dbj|BAE98925.1|  putative fatty acid elongase 3-ketoacyl-CoA synt...    327   1e-100   Arabidopsis thaliana [mouse-ear cress]
gb|EYU32293.1|  hypothetical protein MIMGU_mgv1a004078mg                328   1e-100   
ref|XP_011088406.1|  PREDICTED: 3-ketoacyl-CoA synthase 4-like          326   2e-100   
ref|XP_004248096.1|  PREDICTED: 3-ketoacyl-CoA synthase 1               327   2e-100   
ref|XP_009762000.1|  PREDICTED: 3-ketoacyl-CoA synthase 6-like          325   3e-100   
gb|AGK29998.1|  3-ketoacyl-CoA synthase 9                               325   3e-100   
ref|XP_003606927.1|  3-ketoacyl-CoA synthase                            325   3e-100   
ref|XP_010049293.1|  PREDICTED: 3-ketoacyl-CoA synthase 10              326   3e-100   
ref|XP_006306361.1|  hypothetical protein CARUB_v10012263mg             326   4e-100   
ref|XP_006444749.1|  hypothetical protein CICLE_v10019672mg             326   5e-100   
ref|XP_009336207.1|  PREDICTED: 3-ketoacyl-CoA synthase 4               323   5e-100   
gb|AHX25585.1|  3-ketoacyl-CoA synthase 6                               324   6e-100   
ref|XP_009784659.1|  PREDICTED: 3-ketoacyl-CoA synthase 5-like          324   7e-100   
ref|XP_002264721.1|  PREDICTED: 3-ketoacyl-CoA synthase 1               325   8e-100   Vitis vinifera
ref|XP_007218983.1|  hypothetical protein PRUPE_ppa003977mg             325   8e-100   
ref|XP_004135091.1|  PREDICTED: 3-ketoacyl-CoA synthase 6-like is...    322   8e-100   
ref|XP_010480647.1|  PREDICTED: 3-ketoacyl-CoA synthase 1-like          325   8e-100   
ref|XP_009142612.1|  PREDICTED: 3-ketoacyl-CoA synthase 13              323   8e-100   
ref|XP_010474700.1|  PREDICTED: 3-ketoacyl-CoA synthase 1               325   8e-100   
ref|XP_011099559.1|  PREDICTED: 3-ketoacyl-CoA synthase 6               324   9e-100   
ref|XP_010100669.1|  3-ketoacyl-CoA synthase 1                          325   1e-99    
ref|XP_004135090.1|  PREDICTED: 3-ketoacyl-CoA synthase 6-like is...    323   2e-99    
ref|XP_002301436.2|  fatty acid elongase 3-ketoacyl-CoA synthase ...    324   2e-99    
ref|XP_003567862.1|  PREDICTED: 3-ketoacyl-CoA synthase 4               324   2e-99    
ref|XP_006344142.1|  PREDICTED: 3-ketoacyl-CoA synthase 6-like          323   2e-99    
ref|XP_009399728.1|  PREDICTED: 3-ketoacyl-CoA synthase 6-like          323   2e-99    
ref|XP_010925903.1|  PREDICTED: 3-ketoacyl-CoA synthase 4-like          322   3e-99    
ref|XP_007200967.1|  hypothetical protein PRUPE_ppa004500mg             323   3e-99    
ref|XP_004133789.1|  PREDICTED: 3-ketoacyl-CoA synthase 1-like          323   3e-99    
gb|KFK41268.1|  hypothetical protein AALP_AA2G107900                    323   4e-99    
gb|ABK24632.1|  unknown                                                 323   4e-99    
gb|KFK39995.1|  hypothetical protein AALP_AA3G316500                    322   4e-99    
ref|XP_002529975.1|  acyltransferase, putative                          323   5e-99    
ref|XP_009597817.1|  PREDICTED: 3-ketoacyl-CoA synthase 5-like          322   5e-99    
ref|XP_004494857.1|  PREDICTED: 3-ketoacyl-CoA synthase 1-like          323   5e-99    
ref|XP_002441534.1|  hypothetical protein SORBIDRAFT_09g028860          323   5e-99    
ref|XP_009786212.1|  PREDICTED: 3-ketoacyl-CoA synthase 6               322   6e-99    
ref|XP_011025387.1|  PREDICTED: 3-ketoacyl-CoA synthase 1               322   6e-99    
gb|EPS61116.1|  hypothetical protein M569_13682                         322   7e-99    
ref|XP_010527059.1|  PREDICTED: 3-ketoacyl-CoA synthase 10              323   8e-99    
ref|XP_009782317.1|  PREDICTED: 3-ketoacyl-CoA synthase 4-like          322   9e-99    
gb|AGK30000.1|  3-ketoacyl-CoA synthase 5                               321   1e-98    
gb|AAC34858.1|  senescence-associated protein 15                        322   1e-98    
ref|XP_011076851.1|  PREDICTED: 3-ketoacyl-CoA synthase 6-like          321   1e-98    
ref|XP_006299425.1|  hypothetical protein CARUB_v10015586mg             321   1e-98    
ref|XP_006581119.1|  PREDICTED: 3-ketoacyl-CoA synthase 4-like          319   1e-98    
gb|AGK29997.1|  3-ketoacyl-CoA synthase                                 322   1e-98    
ref|XP_004306622.1|  PREDICTED: 3-ketoacyl-CoA synthase 1-like          322   1e-98    
ref|XP_002282234.1|  PREDICTED: 3-ketoacyl-CoA synthase 10              322   1e-98    
ref|XP_006655600.1|  PREDICTED: 3-ketoacyl-CoA synthase 4-like          321   1e-98    
ref|XP_008236905.1|  PREDICTED: 3-ketoacyl-CoA synthase 4-like          321   2e-98    
gb|KDO49072.1|  hypothetical protein CISIN_1g010687mg                   321   2e-98    
gb|ADE77445.1|  unknown                                                 320   2e-98    
ref|XP_010506688.1|  PREDICTED: 3-ketoacyl-CoA synthase 13 isofor...    320   2e-98    
ref|XP_002969546.1|  hypothetical protein SELMODRAFT_91671              321   2e-98    
ref|XP_006418385.1|  hypothetical protein EUTSA_v10007351mg             321   2e-98    
ref|XP_011086329.1|  PREDICTED: 3-ketoacyl-CoA synthase 11-like         320   2e-98    
ref|XP_008357196.1|  PREDICTED: 3-ketoacyl-CoA synthase 4-like          321   2e-98    
gb|EYU44641.1|  hypothetical protein MIMGU_mgv1a005164mg                320   2e-98    
gb|KDP28427.1|  hypothetical protein JCGZ_14198                         321   3e-98    
ref|XP_009760261.1|  PREDICTED: 3-ketoacyl-CoA synthase 4               321   3e-98    
ref|XP_010265151.1|  PREDICTED: 3-ketoacyl-CoA synthase 6-like          320   3e-98    
gb|ADN10815.1|  fatty acid elongase 1                                   320   3e-98    
ref|XP_007160751.1|  hypothetical protein PHAVU_001G014100g             320   3e-98    
ref|XP_008388058.1|  PREDICTED: 3-ketoacyl-CoA synthase 4-like          320   3e-98    
gb|EYU26763.1|  hypothetical protein MIMGU_mgv1a027040mg                321   3e-98    
ref|XP_002869142.1|  hypothetical protein ARALYDRAFT_912937             320   3e-98    
ref|XP_010263663.1|  PREDICTED: 3-ketoacyl-CoA synthase 6-like          320   4e-98    
ref|XP_008363965.1|  PREDICTED: 3-ketoacyl-CoA synthase 1-like          321   4e-98    
ref|XP_009605061.1|  PREDICTED: 3-ketoacyl-CoA synthase 6-like          321   4e-98    
ref|XP_008446598.1|  PREDICTED: 3-ketoacyl-CoA synthase 6               320   4e-98    
ref|XP_004233492.1|  PREDICTED: 3-ketoacyl-CoA synthase 6-like          320   4e-98    
ref|NP_001267518.1|  uncharacterized protein LOC100797855               320   4e-98    
ref|XP_009351389.1|  PREDICTED: 3-ketoacyl-CoA synthase 1-like          321   5e-98    
ref|XP_009364915.1|  PREDICTED: 3-ketoacyl-CoA synthase 4-like          320   5e-98    
ref|XP_007136167.1|  hypothetical protein PHAVU_009G023600g             320   5e-98    
ref|XP_011097190.1|  PREDICTED: 3-ketoacyl-CoA synthase 6-like          319   5e-98    
emb|CDP17887.1|  unnamed protein product                                320   5e-98    
ref|XP_007044356.1|  3-ketoacyl-CoA synthase 6                          319   5e-98    
ref|XP_010683160.1|  PREDICTED: 3-ketoacyl-CoA synthase 11-like         320   5e-98    
ref|XP_009366618.1|  PREDICTED: 3-ketoacyl-CoA synthase 1               321   5e-98    
ref|XP_007204837.1|  hypothetical protein PRUPE_ppa004269mg             320   5e-98    
ref|XP_003631663.1|  PREDICTED: 3-ketoacyl-CoA synthase 4               320   5e-98    
emb|CDP00616.1|  unnamed protein product                                319   5e-98    
ref|XP_003577407.1|  PREDICTED: 3-ketoacyl-CoA synthase 19-like         320   6e-98    
ref|XP_010432405.1|  PREDICTED: probable 3-ketoacyl-CoA synthase 2      318   6e-98    
ref|XP_008650048.1|  PREDICTED: 3-ketoacyl-CoA synthase 11-like         319   6e-98    
ref|XP_010548059.1|  PREDICTED: 3-ketoacyl-CoA synthase 18-like i...    319   6e-98    
ref|XP_002970815.1|  hypothetical protein SELMODRAFT_94459              320   6e-98    
ref|XP_006450506.1|  hypothetical protein CICLE_v10008045mg             319   7e-98    
ref|XP_006423278.1|  hypothetical protein CICLE_v10028243mg             319   7e-98    
gb|KDO73681.1|  hypothetical protein CISIN_1g009313mg                   320   9e-98    
ref|XP_010507981.1|  PREDICTED: 3-ketoacyl-CoA synthase 13-like         318   9e-98    
ref|XP_009136297.1|  PREDICTED: 3-ketoacyl-CoA synthase 18-like         318   9e-98    
ref|XP_010681548.1|  PREDICTED: 3-ketoacyl-CoA synthase 6-like          318   9e-98    
ref|XP_006483306.1|  PREDICTED: 3-ketoacyl-CoA synthase 11-like         319   9e-98    
ref|XP_004289669.1|  PREDICTED: 3-ketoacyl-CoA synthase 4-like          319   1e-97    
emb|CDY41551.1|  BnaC04g00710D                                          323   1e-97    
ref|XP_004141352.1|  PREDICTED: 3-ketoacyl-CoA synthase 10-like         320   1e-97    
ref|XP_002510394.1|  acyltransferase, putative                          318   1e-97    
ref|XP_010932594.1|  PREDICTED: 3-ketoacyl-CoA synthase 5-like          318   1e-97    
gb|ACZ51240.1|  3-ketoacyl-CoA synthase                                 318   1e-97    
ref|XP_010518010.1|  PREDICTED: 3-ketoacyl-CoA synthase 8-like          318   1e-97    
gb|KHN11421.1|  3-ketoacyl-CoA synthase 6                               317   1e-97    
ref|XP_009627040.1|  PREDICTED: 3-ketoacyl-CoA synthase 4               319   1e-97    
gb|KHN05569.1|  3-ketoacyl-CoA synthase 6                               317   1e-97    
ref|XP_004232364.1|  PREDICTED: 3-ketoacyl-CoA synthase 6               318   1e-97    
gb|AAX58618.1|  beta-ketoacyl-CoA synthase                              318   1e-97    
gb|AAD03366.1|  putative fatty acid elongase                            318   1e-97    
ref|XP_010243778.1|  PREDICTED: 3-ketoacyl-CoA synthase 4               319   1e-97    
ref|XP_003555901.1|  PREDICTED: 3-ketoacyl-CoA synthase 6-like          318   1e-97    
ref|XP_007139008.1|  hypothetical protein PHAVU_009G257100g             319   1e-97    
dbj|BAJ98276.1|  predicted protein                                      319   1e-97    
ref|XP_006363119.1|  PREDICTED: 3-ketoacyl-CoA synthase 6-like          318   1e-97    
emb|CDX90012.1|  BnaA10g00700D                                          319   1e-97    
ref|XP_009365554.1|  PREDICTED: 3-ketoacyl-CoA synthase 4-like          319   1e-97    
gb|EMT26171.1|  3-ketoacyl-CoA synthase 1                               319   2e-97    
emb|CDX80041.1|  BnaA05g01150D                                          322   2e-97    
ref|NP_179113.2|  3-ketoacyl-CoA synthase 8                             317   2e-97    
ref|XP_009119672.1|  PREDICTED: 3-ketoacyl-CoA synthase 1               319   2e-97    
ref|XP_002880261.1|  hypothetical protein ARALYDRAFT_346483             317   2e-97    
ref|XP_007136914.1|  hypothetical protein PHAVU_009G084500g             319   2e-97    
ref|XP_009779121.1|  PREDICTED: 3-ketoacyl-CoA synthase 4-like          318   2e-97    
ref|XP_006346917.1|  PREDICTED: 3-ketoacyl-CoA synthase 6-like          318   2e-97    
ref|XP_006452943.1|  hypothetical protein CICLE_v10007953mg             319   2e-97    
ref|XP_009348198.1|  PREDICTED: 3-ketoacyl-CoA synthase 11-like         318   2e-97    
ref|XP_010104374.1|  3-ketoacyl-CoA synthase 4                          318   2e-97    
ref|XP_008452803.1|  PREDICTED: LOW QUALITY PROTEIN: 3-ketoacyl-C...    318   2e-97    
ref|NP_001056354.1|  Os05g0568000                                       318   2e-97    
gb|AGK29999.1|  3-ketoacyl-CoA synthase 13                              317   2e-97    
ref|XP_010542792.1|  PREDICTED: 3-ketoacyl-CoA synthase 1-like          318   3e-97    
ref|XP_002883879.1|  hypothetical protein ARALYDRAFT_480389             317   3e-97    
ref|XP_003536684.1|  PREDICTED: 3-ketoacyl-CoA synthase 6               317   3e-97    
ref|NP_182195.1|  3-ketoacyl-CoA synthase 13                            317   3e-97    
gb|AFW81175.1|  acyltransferase                                         318   3e-97    
ref|XP_009777704.1|  PREDICTED: 3-ketoacyl-CoA synthase 6-like          317   3e-97    
gb|AAT65207.1|  fatty acid elongase 3-ketoacyl-CoA synthase             318   3e-97    
ref|XP_010248169.1|  PREDICTED: 3-ketoacyl-CoA synthase 4-like          318   3e-97    
ref|XP_010530833.1|  PREDICTED: 3-ketoacyl-CoA synthase 9-like          317   3e-97    
ref|XP_011007926.1|  PREDICTED: 3-ketoacyl-CoA synthase 6               317   3e-97    
ref|XP_002315942.1|  ECERIFERUM 6 family protein                        317   3e-97    
ref|XP_010028602.1|  PREDICTED: 3-ketoacyl-CoA synthase 4-like          318   3e-97    
ref|XP_006474532.1|  PREDICTED: 3-ketoacyl-CoA synthase 10-like         318   3e-97    
ref|XP_004499254.1|  PREDICTED: 3-ketoacyl-CoA synthase 4-like          318   3e-97    
ref|XP_010102812.1|  3-ketoacyl-CoA synthase 11                         318   3e-97    
ref|XP_003549437.1|  PREDICTED: 3-ketoacyl-CoA synthase 4-like          318   3e-97    
ref|XP_008243224.1|  PREDICTED: 3-ketoacyl-CoA synthase 6               317   3e-97    
ref|XP_009598968.1|  PREDICTED: 3-ketoacyl-CoA synthase 6               317   4e-97    
gb|ACR15953.1|  fatty acid elongase 1                                   317   4e-97    
ref|NP_001130522.1|  uncharacterized protein LOC100191621               317   4e-97    
ref|XP_006286187.1|  hypothetical protein CARUB_v10007752mg             317   4e-97    
gb|KDP46259.1|  hypothetical protein JCGZ_10099                         317   4e-97    
gb|KDP38510.1|  hypothetical protein JCGZ_04435                         317   4e-97    
ref|XP_008242707.1|  PREDICTED: 3-ketoacyl-CoA synthase 11              318   4e-97    
ref|XP_010488941.1|  PREDICTED: 3-ketoacyl-CoA synthase 8               316   4e-97    
ref|XP_007142908.1|  hypothetical protein PHAVU_007G027100g             317   4e-97    
ref|XP_010447067.1|  PREDICTED: probable 3-ketoacyl-CoA synthase 2      316   4e-97    
ref|XP_003603250.1|  3-ketoacyl-CoA synthase                            318   4e-97    
ref|XP_004291247.1|  PREDICTED: 3-ketoacyl-CoA synthase 10-like         318   5e-97    
ref|NP_179223.1|  3-ketoacyl-CoA synthase 9                             317   5e-97    
ref|XP_008385932.1|  PREDICTED: 3-ketoacyl-CoA synthase 11              317   5e-97    
ref|XP_002284986.1|  PREDICTED: 3-ketoacyl-CoA synthase 11              317   5e-97    
ref|XP_009356269.1|  PREDICTED: 3-ketoacyl-CoA synthase 6-like          317   6e-97    
ref|XP_004238922.1|  PREDICTED: 3-ketoacyl-CoA synthase 6               317   6e-97    
ref|XP_006299088.1|  hypothetical protein CARUB_v10015226mg             317   6e-97    
ref|XP_006397863.1|  hypothetical protein EUTSA_v10001434mg             315   6e-97    
ref|XP_009356268.1|  PREDICTED: 3-ketoacyl-CoA synthase 6               317   6e-97    
ref|XP_010516847.1|  PREDICTED: 3-ketoacyl-CoA synthase 18-like         316   6e-97    
ref|XP_011048431.1|  PREDICTED: 3-ketoacyl-CoA synthase 4-like          317   6e-97    
ref|XP_002869162.1|  hypothetical protein ARALYDRAFT_491244             316   6e-97    
gb|AFW79234.1|  hypothetical protein ZEAMMB73_025891                    317   7e-97    
ref|XP_011083903.1|  PREDICTED: 3-ketoacyl-CoA synthase 4               317   7e-97    
ref|XP_008339680.1|  PREDICTED: 3-ketoacyl-CoA synthase 6               316   7e-97    
ref|XP_009594431.1|  PREDICTED: LOW QUALITY PROTEIN: 3-ketoacyl-C...    317   7e-97    
ref|XP_003637444.1|  3-ketoacyl-CoA synthase                            316   8e-97    
emb|CDX71202.1|  BnaC07g04810D                                          315   8e-97    
ref|XP_010254302.1|  PREDICTED: 3-ketoacyl-CoA synthase 11-like         317   8e-97    
ref|XP_010066726.1|  PREDICTED: 3-ketoacyl-CoA synthase 6               316   9e-97    
ref|XP_009118793.1|  PREDICTED: LOW QUALITY PROTEIN: 3-ketoacyl-C...    317   9e-97    
ref|XP_002313793.1|  hypothetical protein POPTR_0009s11940g             317   9e-97    
ref|XP_008233066.1|  PREDICTED: 3-ketoacyl-CoA synthase 1-like          317   1e-96    
ref|NP_001068184.1|  Os11g0591200                                       314   1e-96    
ref|XP_004168381.1|  PREDICTED: 3-ketoacyl-CoA synthase 10-like         317   1e-96    
gb|AAU05611.1|  3-ketoacyl-CoA synthase                                 315   1e-96    
ref|XP_008653424.1|  PREDICTED: 3-ketoacyl-CoA synthase 1-like          317   1e-96    
dbj|BAJ85769.1|  predicted protein                                      317   1e-96    
ref|XP_010249963.1|  PREDICTED: 3-ketoacyl-CoA synthase 11-like         316   1e-96    
ref|XP_006415873.1|  hypothetical protein EUTSA_v10007453mg             315   1e-96    
ref|XP_010670713.1|  PREDICTED: 3-ketoacyl-CoA synthase 11-like         316   1e-96    
ref|XP_002890689.1|  hypothetical protein ARALYDRAFT_472828             315   1e-96    
gb|KDP29403.1|  hypothetical protein JCGZ_18324                         315   2e-96    
ref|XP_010477925.1|  PREDICTED: 3-ketoacyl-CoA synthase 5-like          315   2e-96    
ref|XP_004238271.1|  PREDICTED: 3-ketoacyl-CoA synthase 4               316   2e-96    
ref|XP_008377297.1|  PREDICTED: 3-ketoacyl-CoA synthase 4-like          316   2e-96    
ref|XP_010499108.1|  PREDICTED: 3-ketoacyl-CoA synthase 5               315   2e-96    
gb|AIE57499.1|  KCS6                                                    315   2e-96    
ref|XP_006409460.1|  hypothetical protein EUTSA_v10022654mg             316   2e-96    
ref|XP_006307339.1|  hypothetical protein CARUB_v10008957mg             315   2e-96    
gb|AFW88999.1|  senescence-associated protein 15                        317   2e-96    
ref|XP_008220603.1|  PREDICTED: 3-ketoacyl-CoA synthase 10              317   2e-96    
ref|NP_195177.1|  3-ketoacyl-CoA synthase 17                            315   2e-96    
ref|XP_002884160.1|  hypothetical protein ARALYDRAFT_900287             316   2e-96    
ref|XP_008376209.1|  PREDICTED: LOW QUALITY PROTEIN: 3-ketoacyl-C...    317   2e-96    
ref|XP_007222372.1|  hypothetical protein PRUPE_ppa004011mg             316   2e-96    
ref|XP_010688098.1|  PREDICTED: 3-ketoacyl-CoA synthase 11              316   2e-96    
ref|XP_006841272.1|  hypothetical protein AMTR_s00135p00117490          315   2e-96    
ref|XP_010437603.1|  PREDICTED: 3-ketoacyl-CoA synthase 18-like         315   2e-96    
gb|ADN10818.1|  fatty acid elongase 1                                   315   2e-96    
gb|ADN10820.1|  fatty acid elongase 1                                   315   2e-96    
gb|ADN10812.1|  fatty acid elongase 1                                   315   2e-96    
ref|XP_007222865.1|  hypothetical protein PRUPE_ppa004284mg             315   2e-96    
ref|XP_002869143.1|  3-ketoacyl-CoA synthase 2                          315   3e-96    
ref|XP_003526086.1|  PREDICTED: 3-ketoacyl-CoA synthase 10-like         316   3e-96    
ref|XP_008811879.1|  PREDICTED: 3-ketoacyl-CoA synthase 1               316   3e-96    
gb|ADN10816.1|  fatty acid elongase 1                                   315   3e-96    
ref|XP_010467354.1|  PREDICTED: 3-ketoacyl-CoA synthase 9-like          315   3e-96    
ref|XP_004299082.1|  PREDICTED: 3-ketoacyl-CoA synthase 6-like          315   3e-96    
ref|XP_009400361.1|  PREDICTED: 3-ketoacyl-CoA synthase 1-like          316   3e-96    
gb|AAP74371.1|  FAE1                                                    315   3e-96    
ref|XP_009378513.1|  PREDICTED: 3-ketoacyl-CoA synthase 4-like          315   3e-96    
gb|EAZ18954.1|  hypothetical protein OsJ_34491                          314   3e-96    
ref|XP_006295989.1|  hypothetical protein CARUB_v10025132mg             313   3e-96    
gb|KDP34003.1|  hypothetical protein JCGZ_07574                         316   3e-96    
ref|XP_001756180.1|  predicted protein                                  315   3e-96    
ref|XP_009347466.1|  PREDICTED: 3-ketoacyl-CoA synthase 11-like         315   3e-96    
ref|XP_010548057.1|  PREDICTED: 3-ketoacyl-CoA synthase 9-like          314   4e-96    
ref|XP_011037520.1|  PREDICTED: 3-ketoacyl-CoA synthase 4-like          315   4e-96    
ref|XP_010467283.1|  PREDICTED: 3-ketoacyl-CoA synthase 8-like          314   4e-96    
emb|CAZ68133.1|  3-ketoacyl-coA synthase 13 KCS13                       313   4e-96    
gb|AAL67993.1|  fiddlehead-like protein                                 315   4e-96    
gb|AAT65206.1|  fatty acid elongase 3-ketoacyl-CoA synthase             315   4e-96    
ref|XP_006375382.1|  hypothetical protein POPTR_0014s10010g             315   4e-96    
ref|XP_010489202.1|  PREDICTED: 3-ketoacyl-CoA synthase 18-like         314   4e-96    
ref|XP_010255306.1|  PREDICTED: 3-ketoacyl-CoA synthase 4-like          315   4e-96    
dbj|BAJ85000.1|  predicted protein                                      315   5e-96    
ref|XP_010916172.1|  PREDICTED: 3-ketoacyl-CoA synthase 6-like          314   5e-96    
ref|XP_010530834.1|  PREDICTED: 3-ketoacyl-CoA synthase 9 isoform X1    315   5e-96    
gb|ABA94525.1|  Beta-ketoacyl-CoA synthase, putative, expressed         314   5e-96    



>emb|CDP19959.1| unnamed protein product [Coffea canephora]
Length=467

 Score =   646 bits (1666),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 314/460 (68%), Positives = 379/460 (82%), Gaps = 4/460 (1%)
 Frame = -1

Query  1703  METLVAIYSLLFLYTVVYILRSYLRRRHQCCYMLNYECYKPTDVARRLSTDKSALVVYRN  1524
             ME L A+Y L FLY   Y+ +  L+R +QCCYML YECYK T+  R+L T+  A ++ RN
Sbjct  1     MELLTALYLLCFLYLTYYLYKIALQRTNQCCYMLGYECYKATE-DRKLDTELCASIILRN  59

Query  1523  RNLGIDEFRFLLQTMVNSGVGEQTYIPINVLEGREDSPTLEDSFTEVDDIMFQTLDNLFA  1344
             + LG++E+RFLLQT+VNSG+GE TY P NV++G+E+ P L DS TE+D I F TLD+LFA
Sbjct  60    KTLGLEEYRFLLQTIVNSGIGENTYAPDNVIQGKEERPELIDSLTEMDQIFFNTLDSLFA  119

Query  1343  KSKVSPREIDvlvvnvsllasapsLTSRVVNRYKMREDVKTFNLSGMGCSASVVAIDIVH  1164
             KS +SP+EID+LVVNVSLL+  PSL +RV+NRYKMR DVK FNLSGMGCSAS+VAID+V 
Sbjct  120   KSGISPQEIDILVVNVSLLSCVPSLAARVINRYKMRCDVKAFNLSGMGCSASLVAIDLVQ  179

Query  1163  HLFKVYKNSYAIVVSTESLGANWYSGKERSMMLSNCLFRSGGCSMLFTNNPALKPRAILK  984
             HLFK YKN+YAIVVSTE+LGANWY G+E+SMMLSNCLFRSGGCSMLFTNN ALK RAILK
Sbjct  180   HLFKSYKNAYAIVVSTEALGANWYCGREKSMMLSNCLFRSGGCSMLFTNNKALKHRAILK  239

Query  983   LKHMVRTHIAAIDEAYECCKQVEDPQGFRGFHLSKRLPKVATKALVTNFKVLVPKAIPLW  804
             LK+MVRTH  + DEAYECC QVED QG+RGF L+K+L K A ++ + N +VL PK +PLW
Sbjct  240   LKYMVRTHYGSNDEAYECCIQVEDGQGYRGFRLTKKLVKAAAQSFIINLRVLGPKMLPLW  299

Query  803   ETLRFLAVSSLERRKFKLPSL---LGKPILNMKTGIEHFCLHPGGRAVIDGVGVSLGLSE  633
             E +R++ VS  +RRK K  SL   L   I N+KTG +HFC+HPGG+AVIDGVG SLGL++
Sbjct  300   EIIRYIVVSFQQRRKSKSASLDQGLMAAIPNLKTGADHFCIHPGGKAVIDGVGKSLGLTD  359

Query  632   YDLEPARMSLHRWGNTSAGGLWYVLGYMEAKKRLKKGDRILMLSLGAGFKCNNCVWEVMK  453
             YDLEPARM+LHR+GNTSAGGLWYVLGYMEAKKRLKKGDRI+M+S GAGFKCNNCVWEVMK
Sbjct  360   YDLEPARMTLHRYGNTSAGGLWYVLGYMEAKKRLKKGDRIIMISFGAGFKCNNCVWEVMK  419

Query  452   DLGDPNVWEDCIDRYPPETLVNPFTEKFDWIHDPCLNFLR  333
             D+ D NVWEDCID YPP++L NPF EK+ WI+D  L+F+R
Sbjct  420   DMTDRNVWEDCIDEYPPDSLGNPFMEKYGWINDAALSFIR  459



>gb|KEH44511.1| 3-ketoacyl-CoA synthase-like protein [Medicago truncatula]
Length=484

 Score =   607 bits (1564),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 304/476 (64%), Positives = 366/476 (77%), Gaps = 20/476 (4%)
 Frame = -1

Query  1703  METLVAIYSLLFL-YTVVYILRSYLRRRHQCCYMLNYECYKPTDVARRLSTDKSALVVYR  1527
             ME  + I+ L  L Y+++ +    L+RR Q CYML YEC++P +   +L+TD +A +V R
Sbjct  1     MEYFLKIFCLFSLFYSILKLFNLILKRRSQSCYMLAYECFRPKE-DTKLNTDSAAKIVMR  59

Query  1526  NRNLGIDEFRFLLQTMVNSGVGEQTYIPINVLEGREDSPTLEDSFTEVDDIMFQTLDNLF  1347
             N+NLG++EFRFLL+TMV+SG+GE TY P NVLEGRE  PTL+D++ E+D+IMF TLDNLF
Sbjct  60    NKNLGLEEFRFLLKTMVSSGIGENTYCPRNVLEGRETCPTLKDTYEEIDEIMFDTLDNLF  119

Query  1346  AKSKVSPREIDvlvvnvsllasapsLTSRVVNRYKMREDVKTFNLSGMGCSASVVAIDIV  1167
              K+  SP EID+LVVNVSL + APSLT+R++NRYKMREDVK FNL+GMGCSASVVAID+V
Sbjct  120   KKTCFSPSEIDILVVNVSLFSPAPSLTARIINRYKMREDVKVFNLAGMGCSASVVAIDLV  179

Query  1166  HHLFKVYKNSYAIVVSTESLGANWYSGKERSMMLSNCLFRSGGCSMLFTNNPALKPRAIL  987
               LFK Y+NS  IVVSTE LG++WY GK++ MMLSNCLFR+GGCSMLFTN   LK RAIL
Sbjct  180   QQLFKTYENSLGIVVSTEDLGSHWYCGKDKKMMLSNCLFRAGGCSMLFTNKTELKDRAIL  239

Query  986   KLKHMVRTHIAAIDEAYECCKQVEDPQGFRGFHLSKRLPKVATKALVTNFKVLVPKAIPL  807
             KLKHM RT   + DEAY CC Q+ED +GF GF L+K L K A KAL  N + +VPK +PL
Sbjct  240   KLKHMERTQYGSDDEAYNCCIQMEDEEGFAGFRLTKSLVKSAAKALTVNLQSMVPKILPL  299

Query  806   WETLRFLAVSSLERRK-----------FKLPSLLGKPILNM-------KTGIEHFCLHPG  681
             WE +RF  +S     K           F L  ++ KP  NM       K+GIEHFC+HPG
Sbjct  300   WELVRFFIISLRNSMKKVEFGNIFILFFNLGKMVIKPKFNMLGGGLNLKSGIEHFCVHPG  359

Query  680   GRAVIDGVGVSLGLSEYDLEPARMSLHRWGNTSAGGLWYVLGYMEAKKRLKKGDRILMLS  501
             GRAVIDGVG  L L+EYDLEPARM+LHRWGNTSAGGLWYVLGYMEAKKRLKKGDRILM+S
Sbjct  360   GRAVIDGVGKGLKLNEYDLEPARMALHRWGNTSAGGLWYVLGYMEAKKRLKKGDRILMIS  419

Query  500   LGAGFKCNNCVWEVMKDLGDPNVWEDCIDRYPPETLVNPFTEKFDWIHDPCLNFLR  333
             LGAGFKCNNCVWEVMKDL D NVW+DCI  YPP+TL NPF EK++WI+D  L+F+R
Sbjct  420   LGAGFKCNNCVWEVMKDLSDTNVWKDCIQSYPPDTLNNPFKEKYNWINDEYLSFVR  475



>ref|XP_007009580.1| 3-ketoacyl-CoA synthase [Theobroma cacao]
 gb|EOY18390.1| 3-ketoacyl-CoA synthase [Theobroma cacao]
Length=460

 Score =   605 bits (1561),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 297/459 (65%), Positives = 366/459 (80%), Gaps = 3/459 (1%)
 Frame = -1

Query  1703  METLVAIYSLLFLYTVVYILRSYLRRRHQCCYMLNYECYKPTDVARRLSTDKSALVVYRN  1524
             ME  + I   LF   + Y  +   + R+QCCYML YECYK +   R+L T+    VV RN
Sbjct  1     MELFITICFSLFFCIISYFYKRVFQMRNQCCYMLAYECYKASG-DRKLDTEACVRVVMRN  59

Query  1523  RNLGIDEFRFLLQTMVNSGVGEQTYIPINVLEGREDSPTLEDSFTEVDDIMFQTLDNLFA  1344
             +NLG+D++RFLLQTMVNSG+GE+TY P NVL GRE++PTLED+  E+D+IMF TLD LFA
Sbjct  60    KNLGLDQYRFLLQTMVNSGLGEETYGPRNVLAGREETPTLEDAHLEMDEIMFDTLDKLFA  119

Query  1343  KSKVSPREIDvlvvnvsllasapsLTSRVVNRYKMREDVKTFNLSGMGCSASVVAIDIVH  1164
             K+ VSP EID+LVV+VSL + APSLT+R+VNRYKMR+++K F+LSGMGCSAS+VA+D+V 
Sbjct  120   KTGVSPSEIDILVVDVSLFSPAPSLTARIVNRYKMRDNIKAFSLSGMGCSASMVAVDLVQ  179

Query  1163  HLFKVYKNSYAIVVSTESLGANWYSGKERSMMLSNCLFRSGGCSMLFTNNPALKPRAILK  984
             HLFK +KN++AIVVSTE++G +WY GKE+SMMLSNCLFRSGGCS+L TN  +LK +A++K
Sbjct  180   HLFKTHKNAFAIVVSTETIGPHWYCGKEKSMMLSNCLFRSGGCSVLLTNKRSLKRQALMK  239

Query  983   LKHMVRTHIAAIDEAYECCKQVEDPQGFRGFHLSKRLPKVATKALVTNFKVLVPKAIPLW  804
             L H VRT++ A DEAY CC Q+ED QG++GF L++ L K A KA   N KVLVPK +P+ 
Sbjct  240   LSHSVRTNMGANDEAYGCCMQIEDEQGYQGFLLTRSLTKAAAKAFTLNLKVLVPKILPIS  299

Query  803   ETLRFLAVSSLERRKFKLPSLLGKPILNMKTGIEHFCLHPGGRAVIDGVGVSLGLSEYDL  624
             E LRF  VS  + ++        +  LN+KTGIEHFC+HPGGRAVIDG+G+SLGLSEYDL
Sbjct  300   ELLRFAIVSLCKSKRKSSTPESARAGLNLKTGIEHFCIHPGGRAVIDGLGMSLGLSEYDL  359

Query  623   EPARMSLHRWGNTSAGGLWYVLGYMEAKKRLKKGDRILMLSLGAGFKCNNCVWEVMKDLG  444
             EP+RM+LHR+GNTSAGGLWYVLGYMEAKKRLKKGDRILM+SLGAGF CNNCVWEV KDL 
Sbjct  360   EPSRMALHRFGNTSAGGLWYVLGYMEAKKRLKKGDRILMISLGAGFMCNNCVWEVTKDLE  419

Query  443   DPNVWEDCIDRYP--PETLVNPFTEKFDWIHDPCLNFLR  333
             D NVWED +DRYP   E LVNPF EK+ WI+D CLNF+R
Sbjct  420   DSNVWEDSLDRYPVSRENLVNPFAEKYSWINDECLNFVR  458



>gb|KDO67810.1| hypothetical protein CISIN_1g010144mg [Citrus sinensis]
Length=517

 Score =   605 bits (1561),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 299/466 (64%), Positives = 365/466 (78%), Gaps = 7/466 (2%)
 Frame = -1

Query  1712  FYHMETLVAIYSLLFLYTVVYILRSYLRRRHQCCYMLNYECYKPTDVARRLSTDKSALVV  1533
             F+    +  +Y L   Y + ++ +  L++R QCCYML YECYKP D  RRL T+  A VV
Sbjct  52    FFFSFIMALLYLLPLFYIIFHLYKWVLQKRGQCCYMLAYECYKPCDETRRLDTESCARVV  111

Query  1532  YRNRNLGIDEFRFLLQTMVNSGVGEQTYIPINVLEGREDSPTLEDSFTEVDDIMFQTLDN  1353
             +RN+ LG++E+RFLL+ MV+SG+GE+TY P NV+EGRE+SP+L ++F+E+D+I+F TLD 
Sbjct  112   WRNKKLGLEEYRFLLKNMVSSGIGEETYGPRNVVEGREESPSLAEAFSEMDEIIFDTLDK  171

Query  1352  LFAKSKVSPREIDvlvvnvsllasapsLTSRVVNRYKMREDVKTFNLSGMGCSASVVAID  1173
             LFA++ +SP EIDVLVVNVSL + APSLTSR++NRY +R D+K FNLSGMGCSASVVA+D
Sbjct  172   LFARTDISPSEIDVLVVNVSLFSPAPSLTSRIINRYNLRNDIKAFNLSGMGCSASVVAVD  231

Query  1172  IVHHLFKVYKNSYAIVVSTESLGANWYSGKERSMMLSNCLFRSGGCSMLFTNNPALKPRA  993
             +V  LF+ YKN  AIVVSTES+G NWY G+E+SMMLSN LFRSGGCSML TNN ALK +A
Sbjct  232   LVQQLFRTYKNKLAIVVSTESMGPNWYCGREKSMMLSNILFRSGGCSMLLTNNRALKHKA  291

Query  992   ILKLKHMVRTHIAAIDEAYECCKQVEDPQGFRGFHLSKRLPKVATKALVTNFKVLVPKAI  813
             ILKL  +VRTH  + DEAYECC QVED QG  GF L+K+L K A  A   N +VLVPK +
Sbjct  292   ILKLNCLVRTHFGSNDEAYECCMQVEDQQGHPGFRLTKQLTKAAALAFTMNLQVLVPKIL  351

Query  812   PLWETLRFLAVSSLERR------KFKLPSLLGKPILNMKTGIEHFCLHPGGRAVIDGVGV  651
             PL E  R++  S  E R        K  ++LG   LN+K GIEHFCLHPGGRAVIDG G 
Sbjct  352   PLREQFRYVIQSYYENRIRKSTSSTKPEAVLGAG-LNLKAGIEHFCLHPGGRAVIDGTGK  410

Query  650   SLGLSEYDLEPARMSLHRWGNTSAGGLWYVLGYMEAKKRLKKGDRILMLSLGAGFKCNNC  471
              L L EYDLEPARM+LHR+GNTSAGGLWYVLGYMEAKKRLKKGDRILM+SLGAGFKCNNC
Sbjct  411   GLELDEYDLEPARMALHRFGNTSAGGLWYVLGYMEAKKRLKKGDRILMISLGAGFKCNNC  470

Query  470   VWEVMKDLGDPNVWEDCIDRYPPETLVNPFTEKFDWIHDPCLNFLR  333
             VWEVMKDL DPNVW+DCIDRYPP++L NPF E++ W++D  L+F+R
Sbjct  471   VWEVMKDLEDPNVWKDCIDRYPPKSLANPFQERYSWLNDEYLSFVR  516



>ref|XP_006436136.1| hypothetical protein CICLE_v10031467mg [Citrus clementina]
 ref|XP_006486002.1| PREDICTED: 3-ketoacyl-CoA synthase 21-like [Citrus sinensis]
 gb|ESR49376.1| hypothetical protein CICLE_v10031467mg [Citrus clementina]
Length=460

 Score =   603 bits (1555),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 298/460 (65%), Positives = 363/460 (79%), Gaps = 7/460 (2%)
 Frame = -1

Query  1694  LVAIYSLLFLYTVVYILRSYLRRRHQCCYMLNYECYKPTDVARRLSTDKSALVVYRNRNL  1515
             +  +Y L   Y + ++ +  L++R QCCYML YECYKP D  RRL T+  A VV+RN+ L
Sbjct  1     MALLYLLPLFYIIFHLYKWVLQKRGQCCYMLAYECYKPCDETRRLDTESCARVVWRNKKL  60

Query  1514  GIDEFRFLLQTMVNSGVGEQTYIPINVLEGREDSPTLEDSFTEVDDIMFQTLDNLFAKSK  1335
             G++E+RFLL+ MV+SG+GE+TY P NV+EGRE+SP+L ++F+E+D+I+F TLD LFA++ 
Sbjct  61    GLEEYRFLLKNMVSSGIGEETYGPRNVVEGREESPSLAEAFSEMDEIIFDTLDKLFARTD  120

Query  1334  VSPREIDvlvvnvsllasapsLTSRVVNRYKMREDVKTFNLSGMGCSASVVAIDIVHHLF  1155
             +SP EIDVLVVNVSL + APSLTSR++NRY +R D+K FNLSGMGCSASVVA+D+V  LF
Sbjct  121   ISPSEIDVLVVNVSLFSPAPSLTSRIINRYNLRNDIKAFNLSGMGCSASVVAVDLVQQLF  180

Query  1154  KVYKNSYAIVVSTESLGANWYSGKERSMMLSNCLFRSGGCSMLFTNNPALKPRAILKLKH  975
             + YKN  AIVVSTES+G NWY G+E+SMMLSN LFRSGGCSML TNN ALK +AILKL  
Sbjct  181   RTYKNKLAIVVSTESMGPNWYCGREKSMMLSNILFRSGGCSMLLTNNIALKHKAILKLNC  240

Query  974   MVRTHIAAIDEAYECCKQVEDPQGFRGFHLSKRLPKVATKALVTNFKVLVPKAIPLWETL  795
             +VRTH  + DEAYECC QVED QG  GF L+K+L K A  A   N +VLVPK +PL E  
Sbjct  241   LVRTHFGSNDEAYECCMQVEDQQGHPGFRLTKQLTKAAALAFTMNLQVLVPKILPLREQF  300

Query  794   RFLAVSSLERR------KFKLPSLLGKPILNMKTGIEHFCLHPGGRAVIDGVGVSLGLSE  633
             R++  S  E R        K  ++LG   LN+K GIEHFCLHPGGRAVIDG G  L L E
Sbjct  301   RYVIQSYYENRIRKSTSSTKPEAVLGAG-LNLKAGIEHFCLHPGGRAVIDGTGKGLELDE  359

Query  632   YDLEPARMSLHRWGNTSAGGLWYVLGYMEAKKRLKKGDRILMLSLGAGFKCNNCVWEVMK  453
             YDLEPARM+LHR+GNTSAGGLWYVLGYMEAKKRLKKGDRILM+SLGAGFKCNNCVWEVMK
Sbjct  360   YDLEPARMALHRFGNTSAGGLWYVLGYMEAKKRLKKGDRILMISLGAGFKCNNCVWEVMK  419

Query  452   DLGDPNVWEDCIDRYPPETLVNPFTEKFDWIHDPCLNFLR  333
             DL DPNVW+DCIDRYPP++L NPF E++ W++D  L+F+R
Sbjct  420   DLEDPNVWKDCIDRYPPKSLANPFQERYSWLNDEYLSFVR  459



>ref|XP_004497320.1| PREDICTED: 3-ketoacyl-CoA synthase 21-like [Cicer arietinum]
Length=482

 Score =   595 bits (1535),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 300/464 (65%), Positives = 362/464 (78%), Gaps = 18/464 (4%)
 Frame = -1

Query  1673  LFLYTVVYILRSYLRRRHQCCYMLNYECYKPTDVARRLSTDKSALVVYRNRNLGIDEFRF  1494
             L LY++  + +   +RR Q CYML YEC+KP +   +L+TD  A +V RN+NLGI+EFRF
Sbjct  12    LLLYSIFCVSKLIHKRRGQSCYMLAYECFKPHE-ETKLNTDSCAKIVMRNKNLGIEEFRF  70

Query  1493  LLQTMVNSGVGEQTYIPINVLEGREDSPTLEDSFTEVDDIMFQTLDNLFAKSKVSPREID  1314
             LL+TMV+SG+GE TY P NVLEGRE  PTL+D+  E+D+IMF+TLDNLF K+  SP EID
Sbjct  71    LLKTMVSSGIGENTYCPRNVLEGRESCPTLKDTNEEIDEIMFETLDNLFKKTCFSPSEID  130

Query  1313  vlvvnvsllasapsLTSRVVNRYKMREDVKTFNLSGMGCSASVVAIDIVHHLFKVYKNSY  1134
             +LVVNVSL + APSLT+R++NRYKMR D+K FNL+GMGCSASVVAID+V  LFK YKNS 
Sbjct  131   ILVVNVSLFSPAPSLTARIINRYKMRHDIKVFNLAGMGCSASVVAIDLVQQLFKTYKNSV  190

Query  1133  AIVVSTESLGANWYSGKERSMMLSNCLFRSGGCSMLFTNNPALKPRAILKLKHMVRTHIA  954
              IVVSTE+LG++WY GK++ MMLSNCLFRSGGCSMLFTN   LK  AILKLKHM RT   
Sbjct  191   GIVVSTENLGSHWYCGKDKKMMLSNCLFRSGGCSMLFTNKTELKKSAILKLKHMERTQFG  250

Query  953   AIDEAYECCKQVEDPQGFRGFHLSKRLPKVATKALVTNFKVLVPKAIPLWETLRFLAVSS  774
             A DEAY CC QVED +G+ GF L+K L K A KAL  N + + PK +PLWE +RF  +S 
Sbjct  251   ADDEAYNCCIQVEDEEGYAGFRLTKSLVKSAGKALTLNLQSMAPKILPLWELVRFFGLSL  310

Query  773   LE-RRKFKLP---------------SLLGKPI-LNMKTGIEHFCLHPGGRAVIDGVGVSL  645
              +  +KF+L                ++LG  I LN+K+GIEHFC+HPGGRAVIDGVG  L
Sbjct  311   RKGMKKFELVNFFTVFFNMVKNSGLNVLGGGINLNLKSGIEHFCVHPGGRAVIDGVGKGL  370

Query  644   GLSEYDLEPARMSLHRWGNTSAGGLWYVLGYMEAKKRLKKGDRILMLSLGAGFKCNNCVW  465
              L++YDLEP+RM+LHRWGNTSAGGLWYVLGYMEAKKRLKKGDRILM+SLGAGFKCNNCVW
Sbjct  371   RLNDYDLEPSRMALHRWGNTSAGGLWYVLGYMEAKKRLKKGDRILMISLGAGFKCNNCVW  430

Query  464   EVMKDLGDPNVWEDCIDRYPPETLVNPFTEKFDWIHDPCLNFLR  333
             EVMKDL D NVW+DCID YPP +L NPF EK++WI+D  L+F+R
Sbjct  431   EVMKDLDDTNVWKDCIDSYPPSSLSNPFKEKYNWINDEDLSFVR  474



>gb|EPS63248.1| hypothetical protein M569_11539, partial [Genlisea aurea]
Length=435

 Score =   592 bits (1526),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 289/436 (66%), Positives = 350/436 (80%), Gaps = 13/436 (3%)
 Frame = -1

Query  1631  RRRHQCCYMLNYECYKPT---DVARRLSTDKSALVVYRNRNLGIDEFRFLLQTMVNSGVG  1461
             R+++ CCYMLNYECY P+   +  R+L+T+ SA +V RNRNLG++++RFLLQTMVNSG+G
Sbjct  8     RKKNPCCYMLNYECYVPSGDDETGRKLTTESSARIVLRNRNLGLEQYRFLLQTMVNSGIG  67

Query  1460  EQTYIPINVLEGREDSPTLEDSFTEVDDIMFQTLDNLFAKSKVSPREIDvlvvnvsllas  1281
             E+TY P NV+ GRE   +L D+  E+DDIMF+TLD +F++S VSP EID+LVVNVSLL+ 
Sbjct  68    EETYCPKNVIAGREQISSLADALEEIDDIMFRTLDGVFSRSGVSPSEIDILVVNVSLLSP  127

Query  1280  apsLTSRVVNRYKMREDVKTFNLSGMGCSASVVAIDIVHHLFKVYKNSYAIVVSTESLGA  1101
             APSLT+R+VNRY+MR+DVK FNLSGMGCSAS+VA+D+VH LFK+Y    A+VVSTESLG 
Sbjct  128   APSLTARIVNRYRMRDDVKAFNLSGMGCSASLVAVDLVHQLFKIYPRRLAVVVSTESLGP  187

Query  1100  NWYSGKERSMMLSNCLFRSGGCSMLFTNNPALKPRAILKLKHMVRTHIAAIDEAYECCKQ  921
             NWYSGK +S MLSNCLFRSGGCSML +N+P     AILKLKH VRTHI A DEAYECC Q
Sbjct  188   NWYSGKNKSFMLSNCLFRSGGCSMLLSNDPGRAAGAILKLKHSVRTHIGANDEAYECCIQ  247

Query  920   VEDPQGFRGFHLSKRLPKVATKALVTNFKVLVPKAIPLWETLRFLAVSSLERRKFKLPSL  741
             VED +G+RGF L+K+L K A  A   N KVL PK +P+WE LR+L   SL R        
Sbjct  248   VEDGEGYRGFCLTKKLTKAAAYAFAKNLKVLAPKILPVWEILRYLL--SLRRG-------  298

Query  740   LGKPILNMKTGIEHFCLHPGGRAVIDGVGVSLGLSEYDLEPARMSLHRWGNTSAGGLWYV  561
              G   +N+KTG++HFC+HPGGRAVID VG +LGL+EYDLEPARM+LHR+GNTSAGGLWYV
Sbjct  299   -GAAAINLKTGVKHFCIHPGGRAVIDEVGKNLGLTEYDLEPARMALHRFGNTSAGGLWYV  357

Query  560   LGYMEAKKRLKKGDRILMLSLGAGFKCNNCVWEVMKDLGDPNVWEDCIDRYPPETLVNPF  381
             LGYMEAK+RLKKGD ILM+SLGAGFKCNNC WEVM+DL DPNVW  CIDRYPP  + NPF
Sbjct  358   LGYMEAKERLKKGDIILMISLGAGFKCNNCTWEVMRDLSDPNVWRRCIDRYPPADIANPF  417

Query  380   TEKFDWIHDPCLNFLR  333
              E + WI+D  L+F+R
Sbjct  418   AENYGWINDERLSFVR  433



>ref|XP_004143684.1| PREDICTED: 3-ketoacyl-CoA synthase 21-like [Cucumis sativus]
 ref|XP_004168565.1| PREDICTED: 3-ketoacyl-CoA synthase 21-like [Cucumis sativus]
 gb|KGN50502.1| hypothetical protein Csa_5G177700 [Cucumis sativus]
Length=481

 Score =   589 bits (1519),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 287/468 (61%), Positives = 368/468 (79%), Gaps = 14/468 (3%)
 Frame = -1

Query  1694  LVAIYSLLFLYTVVYILRSYLRRRHQC-CYMLNYECYKPTDVARRLSTDKSALVVYRNRN  1518
             ++A+  +  L+T+  + + +L+ ++Q  CYML Y+CYKPTD  R L+TD    +V RN+N
Sbjct  6     MMALCLITILFTIFTLFKLFLQWKNQSSCYMLAYQCYKPTDPTRTLNTDSCVKIVLRNKN  65

Query  1517  LGIDEFRFLLQTMVNSGVGEQTYIPINVLEGREDSPTLEDSFTEVDDIMFQTLDNLFAKS  1338
             LG++E+RFLL+T+V+SG+GE TY P NVLEG E++PTL ++  E+DDI+F TLD LFAK+
Sbjct  66    LGLEEYRFLLKTIVSSGIGEHTYAPKNVLEGHEENPTLSEAVAEMDDIIFDTLDKLFAKT  125

Query  1337  KVSPREIDvlvvnvsllasapsLTSRVVNRYKMREDVKTFNLSGMGCSASVVAIDIVHHL  1158
              VSP +I +LVV+VSL + +P LTSR+VNRYKMRED+K FNLSGMGCSAS+VAID+V++L
Sbjct  126   LVSPSDIKILVVSVSLFSPSPCLTSRIVNRYKMREDIKAFNLSGMGCSASIVAIDLVNNL  185

Query  1157  FKVYKNSYAIVVSTESLGANWYSGKERSMMLSNCLFRSGGCSMLFTNNPALKPRAILKLK  978
             FK Y NSYAIVV+TES+G NWY GKE+ M+LSNCLFRSGGCSMLFTN   LK +A+LKLK
Sbjct  186   FKCYDNSYAIVVATESMGPNWYVGKEKQMVLSNCLFRSGGCSMLFTNKRELKHQAMLKLK  245

Query  977   HMVRTHIAAIDEAYECCKQVEDPQGFRGFHLSKRLPKVATKALVTNFKVLVPKAIPLWET  798
              +VR+H+ A DEAY+CC QVED +G+RGF L+K LPK A+K    N +VLVPK +PL E 
Sbjct  246   CLVRSHLGANDEAYQCCIQVEDDRGYRGFRLTKNLPKAASKIFAMNLRVLVPKILPLREL  305

Query  797   LRFLAVSSLERRKFKLPS----------LLGKPI--LNMKTGIEHFCLHPGGRAVIDGVG  654
             LR++  +S  ++  K P           L   PI  LN+KTG++HFC+HPGGRAVID VG
Sbjct  306   LRYVIANSFVQKN-KPPKGAAMGSGGGGLRQGPITGLNLKTGVDHFCIHPGGRAVIDSVG  364

Query  653   VSLGLSEYDLEPARMSLHRWGNTSAGGLWYVLGYMEAKKRLKKGDRILMLSLGAGFKCNN  474
              SLGL+ YDLEPARM+LHR+GNTS+ G WYV GYMEAKKRLKKG+R+LM+S GAGFKCNN
Sbjct  365   KSLGLNAYDLEPARMALHRFGNTSSAGFWYVFGYMEAKKRLKKGERLLMISFGAGFKCNN  424

Query  473   CVWEVMKDLGDPNVWEDCIDRYPPETLVNPFTEKFDWIHDPCLNFLRS  330
             C WEVM+DL D NVW+DCID YPP++L NPF EK+ WI+D  LNF+R+
Sbjct  425   CAWEVMRDLEDENVWKDCIDSYPPQSLTNPFMEKYSWIYDESLNFIRN  472



>ref|XP_010096696.1| 3-ketoacyl-CoA synthase 21 [Morus notabilis]
 gb|EXB65364.1| 3-ketoacyl-CoA synthase 21 [Morus notabilis]
Length=463

 Score =   587 bits (1514),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 300/461 (65%), Positives = 370/461 (80%), Gaps = 5/461 (1%)
 Frame = -1

Query  1703  METLVAIYSLLFL-YTVVYILRSYLRRRHQCCYMLNYECYKPTDVARRLSTDKSALVVYR  1527
             ME L+ I   L + Y   Y+ +S LR+RHQCCYML +ECYKP +   +LSTD  A +V R
Sbjct  1     MELLMEISLFLAISYAFFYLTKSLLRKRHQCCYMLAFECYKPPE-ETKLSTDACAKIVLR  59

Query  1526  NRNLGIDEFRFLLQTMVNSGVGEQTYIPINVLEGREDSPTLEDSFTEVDDIMFQTLDNLF  1347
             N NLG+DEFRFLL+T+V+SG+GE+TY P NVLEGRE+SPTL D+ +E+D+++F TLD+LF
Sbjct  60    NGNLGLDEFRFLLKTIVSSGIGEETYCPKNVLEGREESPTLTDAISEMDEVIFTTLDSLF  119

Query  1346  AKSKVSPREIDvlvvnvsllasapsLTSRVVNRYKMREDVKTFNLSGMGCSASVVAIDIV  1167
             AK+ VSP +ID+LVVNVSL + APSLTSR+VNRYKMRE++ ++NLSGMGCSAS++ ID+V
Sbjct  120   AKTGVSPAQIDILVVNVSLFSPAPSLTSRIVNRYKMRENIMSYNLSGMGCSASIIGIDLV  179

Query  1166  HHLFKVYKNSYAIVVSTESLGANWYSGKERSMMLSNCLFRSGGCSMLFTNNPALKPRAIL  987
              HLFK ++NSYAIVVSTES G NWY GKE+SMMLSNCLFRSGGCSMLFTN   LK +AIL
Sbjct  180   QHLFKTHENSYAIVVSTESFGPNWYCGKEKSMMLSNCLFRSGGCSMLFTNKNELKKKAIL  239

Query  986   KLKHMVRTHIAAIDEAYECCKQVEDPQGFRGFHLSKRLPKVATKALVTNFKVLVPKAIPL  807
             +LK +VRTH+ A DEAYECC Q+ED +G+ GF L+K+L K A KAL  N ++LVPK +P+
Sbjct  240   QLKCLVRTHLGADDEAYECCIQLEDEKGYEGFRLTKKLTKAAAKALRLNLRILVPKILPV  299

Query  806   WETLRFLAVSSLERRKFKLPSLL---GKPILNMKTGIEHFCLHPGGRAVIDGVGVSLGLS  636
              E LR+  V+ +  +  K    L   G   L+ KTG EHFC+HPGGRAVIDGVG+SLGLS
Sbjct  300   REILRYWIVNLIRNKSNKGDPQLTSSGANNLDFKTGAEHFCIHPGGRAVIDGVGMSLGLS  359

Query  635   EYDLEPARMSLHRWGNTSAGGLWYVLGYMEAKKRLKKGDRILMLSLGAGFKCNNCVWEVM  456
             EYDLEP+RM+LHR+GNTSAGG WYVLGYMEAKKRLKKGDRILM+S GAGFKCNNC+WEVM
Sbjct  360   EYDLEPSRMALHRFGNTSAGGFWYVLGYMEAKKRLKKGDRILMMSFGAGFKCNNCLWEVM  419

Query  455   KDLGDPNVWEDCIDRYPPETLVNPFTEKFDWIHDPCLNFLR  333
             +DL D NVW+  I+ YPP +L NPF EK+ WI+D  L F+R
Sbjct  420   RDLDDVNVWKGIIESYPPSSLANPFMEKYSWINDDYLGFVR  460



>emb|CDP17293.1| unnamed protein product [Coffea canephora]
Length=452

 Score =   586 bits (1511),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 291/451 (65%), Positives = 361/451 (80%), Gaps = 4/451 (1%)
 Frame = -1

Query  1703  METLVAIYSLLFLYTVVYILRSYLRRRHQCCYMLNYECYKPTDVARRLSTDKSALVVYRN  1524
             ME L A+  L FLY   Y+ +  L+R + CCYML YECYK T+  RRL T+  A +V+RN
Sbjct  1     MELLTALCLLCFLYLTYYLYKLVLQRTNHCCYMLGYECYKATE-DRRLDTELCASIVFRN  59

Query  1523  RNLGIDEFRFLLQTMVNSGVGEQTYIPINVLEGREDSPTLEDSFTEVDDIMFQTLDNLFA  1344
             +NLG++E+RFLL+T+V +G+GE +Y P NV+ G+E+ P L DS TE+D I F+TLDNLFA
Sbjct  60    KNLGLEEYRFLLRTIVKAGIGENSYAPENVIRGKEERPELIDSLTEMDQIFFETLDNLFA  119

Query  1343  KSKVSPREIDvlvvnvsllasapsLTSRVVNRYKMREDVKTFNLSGMGCSASVVAIDIVH  1164
             K+++SP+EID+LVVNVSLL+  PSLT+RV+NRYKM+ +VK FNLSGMGCSAS+VAID+V 
Sbjct  120   KTRISPQEIDILVVNVSLLSCVPSLTARVINRYKMKSNVKAFNLSGMGCSASLVAIDLVQ  179

Query  1163  HLFKVYKNSYAIVVSTESLGANWYSGKERSMMLSNCLFRSGGCSMLFTNNPALKPRAILK  984
              LFK Y N++AIVVSTESL ANWY G E+SM+LSNCLFRSGGCSMLFTNN ALK RAILK
Sbjct  180   QLFKTYNNAFAIVVSTESLSANWYCGNEKSMILSNCLFRSGGCSMLFTNNKALKHRAILK  239

Query  983   LKHMVRTHIAAIDEAYECCKQVEDPQGFRGFHLSKRLPKVATKALVTNFKVLVPKAIPLW  804
             LK MVRTH  + DEAY+CC Q+ED  G RGF L+K+L   A ++   N +VL PK +PLW
Sbjct  240   LKCMVRTHYGSNDEAYDCCIQMEDGHGNRGFRLTKKLVNAAAQSFTINLRVLGPKMLPLW  299

Query  803   ETLRFLAVSSLERRKFKLPSL---LGKPILNMKTGIEHFCLHPGGRAVIDGVGVSLGLSE  633
             E +R++ +S  +RRK K  SL   L   I N+KTG+EHFC+HPGG+AVIDGVG SLGL++
Sbjct  300   EIIRYIILSFAQRRKSKRASLDEELTAAIPNLKTGVEHFCIHPGGKAVIDGVGKSLGLTD  359

Query  632   YDLEPARMSLHRWGNTSAGGLWYVLGYMEAKKRLKKGDRILMLSLGAGFKCNNCVWEVMK  453
             YDLEP RM+LHR+GNTSAG LWYVLGYMEAKKRLKKGDRI+M+S G+GFKCN C+WEVMK
Sbjct  360   YDLEPTRMTLHRFGNTSAGSLWYVLGYMEAKKRLKKGDRIIMISFGSGFKCNTCIWEVMK  419

Query  452   DLGDPNVWEDCIDRYPPETLVNPFTEKFDWI  360
             D+ D NVW+DCID YPP  +VNPF EK+ W+
Sbjct  420   DMKDGNVWKDCIDEYPPNAVVNPFMEKYGWL  450



>ref|XP_008461612.1| PREDICTED: 3-ketoacyl-CoA synthase 21-like isoform X1 [Cucumis 
melo]
Length=479

 Score =   587 bits (1512),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 287/465 (62%), Positives = 362/465 (78%), Gaps = 12/465 (3%)
 Frame = -1

Query  1691  VAIYSLLFLYTVVYILRSYLRRRHQ-CCYMLNYECYKPTDVARRLSTDKSALVVYRNRNL  1515
             +A+  +  L+T+  + +  L+ ++Q CCYML Y+CYKP D  R+L+TD    +V RN+NL
Sbjct  7     MALCLITLLFTIFTLFKLLLQWKNQSCCYMLAYQCYKPIDPTRKLNTDSCVKIVLRNKNL  66

Query  1514  GIDEFRFLLQTMVNSGVGEQTYIPINVLEGREDSPTLEDSFTEVDDIMFQTLDNLFAKSK  1335
             G+DE+RFLL+T+V+SG+ E TY P NVLEG E++PTL ++  E+DDI+F TLD LFAK+ 
Sbjct  67    GLDEYRFLLKTIVSSGISEHTYAPKNVLEGHEENPTLNEAVAEMDDIIFDTLDKLFAKTL  126

Query  1334  VSPREIDvlvvnvsllasapsLTSRVVNRYKMREDVKTFNLSGMGCSASVVAIDIVHHLF  1155
             VSP +I +LVV+VSL + +P LTSR+VNRYKMRED+K FNLSGMGCSAS+VAID+V++LF
Sbjct  127   VSPSDIKILVVSVSLFSPSPCLTSRIVNRYKMREDIKAFNLSGMGCSASIVAIDLVNNLF  186

Query  1154  KVYKNSYAIVVSTESLGANWYSGKERSMMLSNCLFRSGGCSMLFTNNPALKPRAILKLKH  975
             K Y NSYAIVV+TES+G NWY GKE+ M+LSNCLFRSGGCSMLFTN   LK +A+LKL  
Sbjct  187   KCYDNSYAIVVATESMGPNWYVGKEKQMVLSNCLFRSGGCSMLFTNKRELKHQAMLKLNC  246

Query  974   MVRTHIAAIDEAYECCKQVEDPQGFRGFHLSKRLPKVATKALVTNFKVLVPKAIPLWETL  795
             +VRTH+ A DEAY+CC QVED  G+RGF L+K LPK A+K    N +VLVPK +P  E  
Sbjct  247   LVRTHLGANDEAYQCCIQVEDDSGYRGFRLTKNLPKAASKIFAMNLRVLVPKILPWRELS  306

Query  794   RFLAVSSLERRKFKLP--------SLLGKPI--LNMKTGIEHFCLHPGGRAVIDGVGVSL  645
             R++  +S  R+  KLP         L   PI  LN+KTG++HFC+HPGGRAVID VG SL
Sbjct  307   RYVIANSFIRKN-KLPKGAMGAKGGLRQGPIIGLNLKTGVDHFCIHPGGRAVIDSVGKSL  365

Query  644   GLSEYDLEPARMSLHRWGNTSAGGLWYVLGYMEAKKRLKKGDRILMLSLGAGFKCNNCVW  465
             GL+ YDLEPARM+LHR+GNTS+ G WYV GYMEAKKRLKKG+RILM+S GAGFKCNNC W
Sbjct  366   GLNAYDLEPARMALHRFGNTSSAGFWYVFGYMEAKKRLKKGERILMISFGAGFKCNNCAW  425

Query  464   EVMKDLGDPNVWEDCIDRYPPETLVNPFTEKFDWIHDPCLNFLRS  330
             EV++DL D NVW+DCID YPP+ L NPF EK+ WI+D  LNF+R+
Sbjct  426   EVIRDLEDENVWKDCIDSYPPQCLTNPFMEKYSWIYDESLNFIRN  470



>ref|XP_007009535.1| 3-ketoacyl-CoA synthase [Theobroma cacao]
 gb|EOY18345.1| 3-ketoacyl-CoA synthase [Theobroma cacao]
Length=491

 Score =   587 bits (1513),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 299/474 (63%), Positives = 372/474 (78%), Gaps = 10/474 (2%)
 Frame = -1

Query  1739  HTQIDLSRSFYHMETLVAIYSLLFLYTVVYILRSYLRRRHQCCYMLNYECYKPTDVARRL  1560
             H+Q  L  S   ME ++AI  L     + YI     ++R+QCCYML YECYK +D  R+L
Sbjct  21    HSQHTLCLS---MELVMAICLLFLCSLISYICNMVFQKRNQCCYMLGYECYKASD-DRKL  76

Query  1559  STDKSALVVYRNRNLGIDEFRFLLQTMVNSGVGEQTYIPINVLEGREDSPTLEDSFTEVD  1380
              T+    VV RN+NLG++++RFLL+T+V+SG+GE+TY P NVL+GRE+SPT +D+ TE+D
Sbjct  77    DTEACVRVVMRNKNLGLEQYRFLLKTIVSSGLGEETYGPRNVLDGREESPTEKDAHTEMD  136

Query  1379  DIMFQTLDNLFAKSKVSPREIDvlvvnvsllasapsLTSRVVNRYKMREDVKTFNLSGMG  1200
             +IMF TLD+LFAK+ VSP EID+LVV+VSL + +PSLT+R+VNRYKMR+D+K+FNLSGMG
Sbjct  137   EIMFDTLDSLFAKTGVSPSEIDILVVDVSLFSPSPSLTARIVNRYKMRDDIKSFNLSGMG  196

Query  1199  CSASVVAIDIVHHLFKVYKNSYAIVVSTESLGANWYSGKERSMMLSNCLFRSGGCSMLFT  1020
             CSAS+VAID+V  LFK YKN +AIVVSTES+G++WY GKE+SMMLSNCLFRSGG S+L T
Sbjct  197   CSASMVAIDLVQRLFKTYKNQFAIVVSTESIGSHWYCGKEKSMMLSNCLFRSGGSSILLT  256

Query  1019  NNPALKPRAILKLKHMVRTHIAAIDEAYECCKQVEDPQGFRGFHLSKRLPKVATKALVTN  840
             N  ALK RAI KLK  VRT+I   DEAY CC Q+ED +G++GF L+K L K A KA   N
Sbjct  257   NKRALKDRAIFKLKCAVRTNIGYDDEAYGCCMQLEDEEGYQGFLLTKSLTKAAAKAFTMN  316

Query  839   FKVLVPKAIPLWETLRFLAVSSLERRKFKLPSLLGKPIL----NMKTGIEHFCLHPGGRA  672
              ++LVP+ +P+ E LR+ A+S L  ++ K  +      L    N+K+GIEHFCLHPGGRA
Sbjct  317   LEILVPQILPVTELLRY-AISFLGSKRIKGQTPDAARALSFNFNLKSGIEHFCLHPGGRA  375

Query  671   VIDGVGVSLGLSEYDLEPARMSLHRWGNTSAGGLWYVLGYMEAKKRLKKGDRILMLSLGA  492
             VIDG+G SL LSEYDLEP RM+L+R+GNTSAGGLWYVL YMEAKKRLKKGDRILM+SLGA
Sbjct  376   VIDGLGKSLRLSEYDLEPTRMALYRFGNTSAGGLWYVLSYMEAKKRLKKGDRILMISLGA  435

Query  491   GFKCNNCVWEVMKD-LGDPNVWEDCIDRYPPETLVNPFTEKFDWIHDPCLNFLR  333
             GF CNNCVWEVMKD L D  VWEDC+D YP + LVNPFTEK+ WI+D CLNF+R
Sbjct  436   GFMCNNCVWEVMKDGLEDTRVWEDCVDSYPRKNLVNPFTEKYSWINDECLNFVR  489



>ref|XP_002315256.1| hypothetical protein POPTR_0010s21940g [Populus trichocarpa]
 gb|EEF01427.1| hypothetical protein POPTR_0010s21940g [Populus trichocarpa]
Length=452

 Score =   581 bits (1498),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 288/452 (64%), Positives = 365/452 (81%), Gaps = 8/452 (2%)
 Frame = -1

Query  1676  LLFLYTVVYIL-RSYLRRRHQCCYMLNYECYK-PTDVARRLSTDKSALVVYRNRNLGIDE  1503
             L  L+ +++ L +    +R  CCYML YECYK P D  R+L T+ SA +V+RN+NLGI+E
Sbjct  3     LCTLFFIIFCLCKLVFLKRESCCYMLAYECYKAPED--RKLDTETSAKIVFRNKNLGIEE  60

Query  1502  FRFLLQTMVNSGVGEQTYIPINVLEGREDSPTLEDSFTEVDDIMFQTLDNLFAKSKVSPR  1323
             ++FLL T+V+SG+GE TY+P N++ G+EDS TL+ S TE+DD++F TLD LFAK+ +SP 
Sbjct  61    YKFLLHTIVSSGIGEGTYVPRNIISGQEDSSTLKVSITEMDDLIFDTLDKLFAKTGISPS  120

Query  1322  EIDvlvvnvsllasapsLTSRVVNRYKMREDVKTFNLSGMGCSASVVAIDIVHHLFKVYK  1143
             EID+LVVNVSL + APSL +RVVNRYKMR +VKTFNLSGMGCSASVV+ID+V HLFK +K
Sbjct  121   EIDILVVNVSLFSPAPSLAARVVNRYKMRSNVKTFNLSGMGCSASVVSIDLVQHLFKSHK  180

Query  1142  NSYAIVVSTESLGANWYSGKERSMMLSNCLFRSGGCSMLFTNNPALKPRAILKLKHMVRT  963
             N++A+VVSTES+G NWY GKE+SMMLSNCLFRSGGCSMLFTNN ALK +AI +LKH+VRT
Sbjct  181   NAFAVVVSTESIGPNWYQGKEKSMMLSNCLFRSGGCSMLFTNNSALKRQAIFRLKHLVRT  240

Query  962   HIAAIDEAYECCKQVEDPQGFRGFHLSKRLPKVATKALVTNFKVLVPKAIPLWETLRFLA  783
             H+ + DE+Y CC Q  D  G++GF L+K L K A +AL  N +VL PK +P+ E +R++ 
Sbjct  241   HLGSKDESYGCCTQTVDDLGYKGFLLTKSLKKSAAQALALNLRVLAPKMLPVSELIRYVY  300

Query  782   VSSLERRKFKLPSL--LGKPILNMKTGIEHFCLHPGGRAVIDGVGVSLGLSEYDLEPARM  609
             V SL  +K K  S+  +G   LN+KTG++H C+HPGGRA+ID VG SLGLS YDLEP RM
Sbjct  301   V-SLREKKTKSTSIQEMGAG-LNLKTGVDHLCIHPGGRAIIDEVGKSLGLSNYDLEPTRM  358

Query  608   SLHRWGNTSAGGLWYVLGYMEAKKRLKKGDRILMLSLGAGFKCNNCVWEVMKDLGDPNVW  429
             +LHR+GNTSAGGLWYVL YMEAK+RLKKG++ILM+SLGAGFKCNNCVWEVM+DL D NVW
Sbjct  359   ALHRFGNTSAGGLWYVLAYMEAKQRLKKGNKILMISLGAGFKCNNCVWEVMRDLEDVNVW  418

Query  428   EDCIDRYPPETLVNPFTEKFDWIHDPCLNFLR  333
             +D ID+YPPET VNPF EK+ WI++  L+F+R
Sbjct  419   KDSIDQYPPETTVNPFIEKYSWINEEYLSFVR  450



>ref|XP_007219422.1| hypothetical protein PRUPE_ppa021980mg [Prunus persica]
 gb|EMJ20621.1| hypothetical protein PRUPE_ppa021980mg [Prunus persica]
Length=465

 Score =   582 bits (1499),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 288/458 (63%), Positives = 353/458 (77%), Gaps = 2/458 (0%)
 Frame = -1

Query  1703  METLVAIYSLLFLYTVVYILRSYLRRRHQCCYMLNYECYKPTDVARRLSTDKSALVVYRN  1524
             ME L+    L   Y +  + +  LR R Q CY+L YECY PTD    +STD    +V RN
Sbjct  1     MELLMVTCLLALFYGLSCLHKIILRMRDQACYLLAYECYMPTD-DMMISTDSCVKIVTRN  59

Query  1523  RNLGIDEFRFLLQTMVNSGVGEQTYIPINVLEGREDSPTLEDSFTEVDDIMFQTLDNLFA  1344
             +NLG++EFRFLL+T+VNSG+GE+TY P N++EGRED  TL D   E+++++F TLD LFA
Sbjct  60    KNLGLEEFRFLLKTIVNSGIGEETYCPKNIIEGREDDATLVDELLEMEEVIFDTLDKLFA  119

Query  1343  K-SKVSPREIDvlvvnvsllasapsLTSRVVNRYKMREDVKTFNLSGMGCSASVVAIDIV  1167
             K S +SP +ID+LVVNVS+ + APSLTSR+VNRYKMRED+KTFNLSGMGCSAS++AID+V
Sbjct  120   KFSAISPSQIDILVVNVSMFSPAPSLTSRIVNRYKMREDIKTFNLSGMGCSASLIAIDVV  179

Query  1166  HHLFKVYKNSYAIVVSTESLGANWYSGKERSMMLSNCLFRSGGCSMLFTNNPALKPRAIL  987
              +LFK YKN  AIVVSTES+  +WY GKE+SMML+NCLFRSGGCSMLFTNN  LK +A L
Sbjct  180   KNLFKSYKNVNAIVVSTESISPHWYCGKEKSMMLTNCLFRSGGCSMLFTNNRDLKHQAKL  239

Query  986   KLKHMVRTHIAAIDEAYECCKQVEDPQGFRGFHLSKRLPKVATKALVTNFKVLVPKAIPL  807
             KL H+VR H  + DEAY CC QVED  G++GF L+K L K A++    N +VL+PK +PL
Sbjct  240   KLNHLVRIHTGSSDEAYNCCIQVEDESGYKGFRLTKYLVKAASQGFTMNLQVLLPKVLPL  299

Query  806   WETLRFLAVSSLERRKFKLPSLLGKPILNMKTGIEHFCLHPGGRAVIDGVGVSLGLSEYD  627
              E LR+L VS L+  K +      +  LN+KTGIEHFC+HPGGRAVIDG+G SLGLS+YD
Sbjct  300   REILRYLVVSKLKSAKSQKLKADERVGLNLKTGIEHFCIHPGGRAVIDGIGKSLGLSDYD  359

Query  626   LEPARMSLHRWGNTSAGGLWYVLGYMEAKKRLKKGDRILMLSLGAGFKCNNCVWEVMKDL  447
             +EP+RM+LHR+GNTSA G WY LGYMEAKKRLKKG++ILM   GAGFKCNN VWEV+KDL
Sbjct  360   VEPSRMALHRFGNTSAAGFWYALGYMEAKKRLKKGNKILMSGFGAGFKCNNIVWEVLKDL  419

Query  446   GDPNVWEDCIDRYPPETLVNPFTEKFDWIHDPCLNFLR  333
              D NVW+DCID YPP TLVNPF EK+ WI D  LNF+R
Sbjct  420   DDANVWKDCIDSYPPNTLVNPFMEKYSWIDDEILNFVR  457



>ref|XP_011038218.1| PREDICTED: 3-ketoacyl-CoA synthase 21-like [Populus euphratica]
Length=468

 Score =   579 bits (1493),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 287/458 (63%), Positives = 363/458 (79%), Gaps = 3/458 (1%)
 Frame = -1

Query  1703  METLVAIYSLLFLYTVVYILRSYLRRRHQCCYMLNYECYKPTDVARRLSTDKSALVVYRN  1524
             ME  +A+  LL  Y +  + +   +++ QCCYML+YEC+K TD  ++L T   A +V RN
Sbjct  1     MELFLAMLPLLLCYIIFNLFKLGYQKKDQCCYMLSYECHKATD-DQKLDTGSCAKIVTRN  59

Query  1523  RNLGIDEFRFLLQTMVNSGVGEQTYIPINVLEGREDSPTLEDSFTEVDDIMFQTLDNLFA  1344
             +NLGI+E+RFLL+TMV+SG+GEQTY P N++EGRE+S T  D+ +E+D I+F TLD LFA
Sbjct  60    KNLGIEEYRFLLRTMVSSGIGEQTYCPKNIMEGREESATHMDAVSEMDGILFHTLDKLFA  119

Query  1343  KSKVSPREIDvlvvnvsllasapsLTSRVVNRYKMREDVKTFNLSGMGCSASVVAIDIVH  1164
             K+ VSP EID++V +VSL + APSLT+RV+NRYKMRED+K FNLSGMGCSASVVA+D+V 
Sbjct  120   KTGVSPSEIDIIVSSVSLFSPAPSLTARVINRYKMREDIKAFNLSGMGCSASVVAVDLVK  179

Query  1163  HLFKVYKNSYAIVVSTESLGANWYSGKERSMMLSNCLFRSGGCSMLFTNNPALKPRAILK  984
              LFK YKNS AIVVSTES+G NWY GK++SMMLSN LFR+GGCSML TNN ALK +A+L+
Sbjct  180   QLFKTYKNSLAIVVSTESMGPNWYCGKDKSMMLSNILFRTGGCSMLLTNNRALKHKALLE  239

Query  983   LKHMVRTHIAAIDEAYECCKQVEDPQGFRGFHLSKRLPKVATKALVTNFKVLVPKAIPLW  804
             L   VRTHI + DEAY  C QVED  G +GF L++ LPK   KAL  N +VL+PK +PL 
Sbjct  240   LTCSVRTHIGSNDEAYSSCIQVEDELGHKGFRLTRDLPKAGAKALTMNLRVLLPKVLPLS  299

Query  803   ETLRFLAVSSLERRKFKLP-SLLGKPILNMKTGIEHFCLHPGGRAVIDGVGVSLGLSEYD  627
             E LR+  +S    +  K P S    P L++++GI+HFC+HPGGRA+ID VG SL L++YD
Sbjct  300   ELLRY-KISYYRNKIMKRPTSKAAGPGLDLRSGIDHFCVHPGGRAIIDEVGKSLALNDYD  358

Query  626   LEPARMSLHRWGNTSAGGLWYVLGYMEAKKRLKKGDRILMLSLGAGFKCNNCVWEVMKDL  447
             LEPARM+L+R+GNTS+GGLWYVLGYMEAKKRLKKGD+ILM+SLGAGFKCNNCVW+VMKDL
Sbjct  359   LEPARMALYRFGNTSSGGLWYVLGYMEAKKRLKKGDKILMISLGAGFKCNNCVWKVMKDL  418

Query  446   GDPNVWEDCIDRYPPETLVNPFTEKFDWIHDPCLNFLR  333
              D NVW+DCID+YPP+ + NPF+EKFDWI+D  +NF R
Sbjct  419   EDTNVWQDCIDQYPPKAVDNPFSEKFDWINDESMNFAR  456



>ref|XP_010658135.1| PREDICTED: 3-ketoacyl-CoA synthase 21 [Vitis vinifera]
 emb|CAN60802.1| hypothetical protein VITISV_017588 [Vitis vinifera]
Length=460

 Score =   579 bits (1492),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 280/445 (63%), Positives = 362/445 (81%), Gaps = 3/445 (1%)
 Frame = -1

Query  1664  YTVVYILRSYLRRRHQCCYMLNYECYKPTDVARRLSTDKSALVVYRNRNLGIDEFRFLLQ  1485
             Y ++   +  L  R Q CYM++YEC+K ++   +L+TD  A +V RN+NLG++E++FLLQ
Sbjct  14    YAIILFCKKLLAWRDQRCYMVHYECFKASE-DTKLNTDTCAGIVLRNKNLGLEEYKFLLQ  72

Query  1484  TMVNSGVGEQTYIPINVLEGREDSPTLEDSFTEVDDIMFQTLDNLFAKSKVSPREIDvlv  1305
             T+V+SG+GE+TY P  VL G+EDSP+L+DS +E+++IM+ TLD LFAK+ VSP EIDVLV
Sbjct  73    TIVSSGIGEETYSPKIVLAGQEDSPSLKDSLSEIEEIMYDTLDKLFAKTGVSPSEIDVLV  132

Query  1304  vnvsllasapsLTSRVVNRYKMREDVKTFNLSGMGCSASVVAIDIVHHLFKVYKNSYAIV  1125
             VNVSLL+ +PSLT+R++NRYKM+ED+K++NLSGMGCSAS++AIDI  ++FK +K+++A+V
Sbjct  133   VNVSLLSPSPSLTARIINRYKMKEDIKSYNLSGMGCSASLLAIDIARNIFKFHKDAFAVV  192

Query  1124  VSTESLGANWYSGKERSMMLSNCLFRSGGCSMLFTNNPALKPRAILKLKHMVRTHIAAID  945
             VSTES+G NWY G+E+SMMLSNCLFR GGCSML TN  A+K RA+ KL  +VRTH+ + D
Sbjct  193   VSTESMGPNWYCGREKSMMLSNCLFRVGGCSMLLTNKRAMKHRALFKLNTLVRTHLGSND  252

Query  944   EAYECCKQVEDPQGFRGFHLSKRLPKVATKALVTNFKVLVPKAIPLWETLRFLAVSSLER  765
             EAY CC Q+ED  G+RGF L+K+L K A  +   N K LVPK +PLW+ LR++ +SS   
Sbjct  253   EAYNCCIQIEDSLGYRGFCLTKKLTKAAALSFTENLKALVPKVLPLWQLLRYV-ISSRFG  311

Query  764   RKFKLPSL-LGKPILNMKTGIEHFCLHPGGRAVIDGVGVSLGLSEYDLEPARMSLHRWGN  588
             +K   P L L    L+ KTG+EHFC+HPGGRAVIDGVG SLGL+EYDLEPARM+LHR+GN
Sbjct  312   KKNDSPVLELVAAGLDFKTGVEHFCIHPGGRAVIDGVGKSLGLTEYDLEPARMALHRFGN  371

Query  587   TSAGGLWYVLGYMEAKKRLKKGDRILMLSLGAGFKCNNCVWEVMKDLGDPNVWEDCIDRY  408
             TSAGGLWYVLGYMEAKKRLKKGDRILM+S GAGFKCNNCVW+VMKDL D NVWEDCI  Y
Sbjct  372   TSAGGLWYVLGYMEAKKRLKKGDRILMISFGAGFKCNNCVWQVMKDLKDANVWEDCIASY  431

Query  407   PPETLVNPFTEKFDWIHDPCLNFLR  333
             PP+++VNPF EK+ WI+DP  +F++
Sbjct  432   PPKSIVNPFIEKYGWINDPSASFVK  456



>dbj|BAJ34933.1| hypothetical protein [Vitis hybrid cultivar]
Length=460

 Score =   578 bits (1491),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 280/445 (63%), Positives = 362/445 (81%), Gaps = 3/445 (1%)
 Frame = -1

Query  1664  YTVVYILRSYLRRRHQCCYMLNYECYKPTDVARRLSTDKSALVVYRNRNLGIDEFRFLLQ  1485
             Y ++   +  L  R Q CYM++YEC+K ++   +L+TD  A +V RN+NLG++E++FLLQ
Sbjct  14    YAIILFCKKLLAWRDQRCYMVHYECFKASE-DTKLNTDTCAGIVLRNKNLGLEEYKFLLQ  72

Query  1484  TMVNSGVGEQTYIPINVLEGREDSPTLEDSFTEVDDIMFQTLDNLFAKSKVSPREIDvlv  1305
             T+V+SG+GE+TY P  VL G+EDSP+L+DS +E+++IM+ TLD LFAK+ VSP EIDVLV
Sbjct  73    TIVSSGIGEETYSPKIVLAGQEDSPSLKDSLSEIEEIMYDTLDKLFAKTGVSPSEIDVLV  132

Query  1304  vnvsllasapsLTSRVVNRYKMREDVKTFNLSGMGCSASVVAIDIVHHLFKVYKNSYAIV  1125
             VNVSLL+ +PSLT+R++NRYKM+ED+K++NLSGMGCSAS++AIDI  ++FK +K+++A+V
Sbjct  133   VNVSLLSPSPSLTARIINRYKMKEDIKSYNLSGMGCSASLLAIDIARNIFKFHKDAFAVV  192

Query  1124  VSTESLGANWYSGKERSMMLSNCLFRSGGCSMLFTNNPALKPRAILKLKHMVRTHIAAID  945
             VSTES+G NWY G+E+SMMLSNCLFR GGCSML TN  A+K RA+ KL  +VRTH+ + D
Sbjct  193   VSTESMGPNWYCGREKSMMLSNCLFRVGGCSMLLTNKRAMKHRALFKLNTLVRTHLGSND  252

Query  944   EAYECCKQVEDPQGFRGFHLSKRLPKVATKALVTNFKVLVPKAIPLWETLRFLAVSSLER  765
             EAY CC Q+ED  G+RGF L+K+L K A  +   N K LVPK +PLW+ LR++ +SS   
Sbjct  253   EAYNCCIQIEDSLGYRGFCLTKKLTKAAALSFTENLKALVPKVLPLWQLLRYV-ISSRFG  311

Query  764   RKFKLPSL-LGKPILNMKTGIEHFCLHPGGRAVIDGVGVSLGLSEYDLEPARMSLHRWGN  588
             +K   P L L    L+ KTG+EHFC+HPGGRAVIDGVG SLGL+EYDLEPARM+LHR+GN
Sbjct  312   KKNDSPVLELVAAGLDFKTGVEHFCIHPGGRAVIDGVGKSLGLTEYDLEPARMALHRFGN  371

Query  587   TSAGGLWYVLGYMEAKKRLKKGDRILMLSLGAGFKCNNCVWEVMKDLGDPNVWEDCIDRY  408
             TSAGGLWYVLGYMEAKKRLKKGDRILM+S GAGFKCNNCVW+VMKDL D NVWEDCI  Y
Sbjct  372   TSAGGLWYVLGYMEAKKRLKKGDRILMISFGAGFKCNNCVWQVMKDLEDANVWEDCIASY  431

Query  407   PPETLVNPFTEKFDWIHDPCLNFLR  333
             PP+++VNPF EK+ WI+DP  +F++
Sbjct  432   PPKSIVNPFIEKYGWINDPSASFVK  456



>ref|XP_011027090.1| PREDICTED: 3-ketoacyl-CoA synthase 21-like [Populus euphratica]
Length=452

 Score =   577 bits (1487),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 285/451 (63%), Positives = 363/451 (80%), Gaps = 6/451 (1%)
 Frame = -1

Query  1676  LLFLYTVVYIL-RSYLRRRHQCCYMLNYECYKPTDVARRLSTDKSALVVYRNRNLGIDEF  1500
             L  L+ +++ L +    +R  CCYML YECYKP +   +L T+ SA +V+RN+NL I+E+
Sbjct  3     LCTLFFIIFCLCKLVFLKRESCCYMLAYECYKPPE-DWKLDTETSAKIVFRNKNLEIEEY  61

Query  1499  RFLLQTMVNSGVGEQTYIPINVLEGREDSPTLEDSFTEVDDIMFQTLDNLFAKSKVSPRE  1320
             +FLLQT+V+SG+GE TY+P N++ G+EDS TL+ S TE+DD++F TLD LFAK+ +SP E
Sbjct  62    KFLLQTIVSSGIGEGTYVPRNIISGQEDSSTLKVSITEMDDLIFDTLDKLFAKTGISPSE  121

Query  1319  IDvlvvnvsllasapsLTSRVVNRYKMREDVKTFNLSGMGCSASVVAIDIVHHLFKVYKN  1140
             ID+LVVNVSL + APSL +RVVNRYKMR +VKTFNLSGMGCSASVV+ID+V HLFK +KN
Sbjct  122   IDILVVNVSLFSPAPSLAARVVNRYKMRSNVKTFNLSGMGCSASVVSIDLVQHLFKSHKN  181

Query  1139  SYAIVVSTESLGANWYSGKERSMMLSNCLFRSGGCSMLFTNNPALKPRAILKLKHMVRTH  960
             ++A+VVSTES+G NWY GKE+SMMLSNCLFRSGGCSMLFTNN AL  +AI +LKH+VRTH
Sbjct  182   AFAVVVSTESIGPNWYQGKEKSMMLSNCLFRSGGCSMLFTNNSALNRQAIFRLKHLVRTH  241

Query  959   IAAIDEAYECCKQVEDPQGFRGFHLSKRLPKVATKALVTNFKVLVPKAIPLWETLRFLAV  780
             + + DE+Y CC Q  D  G++GF L+K L K A +AL  N +VL PK +P+ E +R++ V
Sbjct  242   LGSKDESYGCCTQTVDDLGYKGFLLTKSLKKSAAQALALNLRVLAPKMLPVSELIRYVYV  301

Query  779   SSLERRKFKLPSL--LGKPILNMKTGIEHFCLHPGGRAVIDGVGVSLGLSEYDLEPARMS  606
              SL  +K K  S+  +G   LN+KTG++H C+HPGGRA+ID VG SLGLS YDLEP RM+
Sbjct  302   -SLREKKTKSTSIQEMGAG-LNLKTGVDHLCIHPGGRAIIDEVGKSLGLSTYDLEPTRMA  359

Query  605   LHRWGNTSAGGLWYVLGYMEAKKRLKKGDRILMLSLGAGFKCNNCVWEVMKDLGDPNVWE  426
             LHR+GNTSAGGLWYVL YMEAK+RLKKG++ILM+SLGAGFKCNNCVWEVM+DL D NVW+
Sbjct  360   LHRFGNTSAGGLWYVLAYMEAKQRLKKGNKILMISLGAGFKCNNCVWEVMRDLEDVNVWK  419

Query  425   DCIDRYPPETLVNPFTEKFDWIHDPCLNFLR  333
             D ID+YPPET VNPF EK+ WI++  L+F+R
Sbjct  420   DSIDQYPPETTVNPFIEKYSWINEEYLSFVR  450



>ref|XP_010669795.1| PREDICTED: 3-ketoacyl-CoA synthase 21 [Beta vulgaris subsp. vulgaris]
Length=494

 Score =   577 bits (1488),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 287/470 (61%), Positives = 367/470 (78%), Gaps = 4/470 (1%)
 Frame = -1

Query  1742  THTQIDLSRSFYHMETLVAIYSLLFLYTVVYILRSYLRRRHQCCYMLNYECYKPTDVARR  1563
              H ++    S   ME L A+Y   FLY    + +  +R+R QCCYML+YEC+KP +  R+
Sbjct  27    NHLKLFFFLSVSLMEFLTALYLFPFLYIAYLLCKQAIRKRDQCCYMLHYECFKPPE-DRK  85

Query  1562  LSTDKSALVVYRNRNLGIDEFRFLLQTMVNSGVGEQTYIPINVLEGREDSPTLEDSFTEV  1383
             L+T+  A +V+RN++L I+EF++LL+T+V+SG+GE TY P NVLEGRE SPTL D+  E+
Sbjct  86    LNTETCASIVFRNKSLRIEEFKYLLKTIVSSGIGESTYCPKNVLEGREASPTLSDAIEEM  145

Query  1382  DDIMFQTLDNLFAKSKVSPREIDvlvvnvsllasapsLTSRVVNRYKMREDVKTFNLSGM  1203
             ++I+F TLD LF KS +SP EID+LVVNVSLLA+ PSLTS+VVNRYKMR+++KT+N++GM
Sbjct  146   EEIIFTTLDKLFDKSGISPSEIDILVVNVSLLATLPSLTSQVVNRYKMRDNIKTYNVTGM  205

Query  1202  GCSASVVAIDIVHHLFKVYKNSYAIVVSTESLGANWYSGKERSMMLSNCLFRSGGCSMLF  1023
             GCSAS++AIDIV   FKV+KN  AI+VS+ES+G +WY G++RS MLSNCLFR+GGCSML 
Sbjct  206   GCSASIIAIDIVQQQFKVHKNVNAIIVSSESMGNHWYMGRDRSFMLSNCLFRTGGCSMLL  265

Query  1022  TNNPALKPRAILKLKHMVRTHIAAIDEAYECCKQVEDPQGFRGFHLSKRLPKVATKALVT  843
             +NN  LK RAI+KL +++RTH+ + DEAY+CC Q ED  G+ GF L+K LPK A KA   
Sbjct  266   SNNRNLKHRAIIKLNYLLRTHLGSDDEAYKCCYQKEDDDGYPGFCLTKHLPKAAAKAFTE  325

Query  842   NFKVLVPKAIPLWETLRFLAVSSLERRKFKLPSLLGKPILNMKTGIEHFCLHPGGRAVID  663
             N KVLVP+ +PL E LR+L +SS    K  L   +GK  LN K GI+HFC+HPGGRAVID
Sbjct  326   NLKVLVPRILPLKELLRYLIISS-SWTKGDLEK-VGKG-LNFKAGIQHFCIHPGGRAVID  382

Query  662   GVGVSLGLSEYDLEPARMSLHRWGNTSAGGLWYVLGYMEAKKRLKKGDRILMLSLGAGFK  483
             G G  L LS+YDLEPARM+LHRWGNTSA G WYVLGYMEAKKRLKKGD+ILM+S GAGFK
Sbjct  383   GTGKGLQLSDYDLEPARMALHRWGNTSAAGFWYVLGYMEAKKRLKKGDKILMISFGAGFK  442

Query  482   CNNCVWEVMKDLGDPNVWEDCIDRYPPETLVNPFTEKFDWIHDPCLNFLR  333
             CNNC+WEVM+DL D NVW+DCID YP + +VNPF E++ WI+D  L+F+R
Sbjct  443   CNNCLWEVMRDLKDRNVWDDCIDDYPVKNIVNPFMERYSWINDETLSFVR  492



>gb|AGK30014.1| 3-ketoacyl-CoA synthase 20 [Gossypium raimondii]
Length=437

 Score =   575 bits (1481),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 279/433 (64%), Positives = 353/433 (82%), Gaps = 8/433 (2%)
 Frame = -1

Query  1625  RHQCCYMLNYECYKPTDVARRLSTDKSALVVYRNRNLGIDEFRFLLQTMVNSGVGEQTYI  1446
             R   CYML YEC+K TD  R+L T+    +V RN+NLG+D++RFLLQTMVNSG+GE+TY 
Sbjct  2     RSHSCYMLAYECFKATD-DRKLDTESCVKIVLRNKNLGLDQYRFLLQTMVNSGLGEETYG  60

Query  1445  PINVLEGREDSPTLEDSFTEVDDIMFQTLDNLFAKSKVSPREIDvlvvnvsllasapsLT  1266
             P NVL GRE++PTL +   E+D+IMF TLDNLF+K+ VSP +ID+LVV+VSL + +PSLT
Sbjct  61    PRNVLAGREETPTLMEGHEEMDEIMFGTLDNLFSKTGVSPPDIDILVVDVSLFSPSPSLT  120

Query  1265  SRVVNRYKMREDVKTFNLSGMGCSASVVAIDIVHHLFKVYKNSYAIVVSTESLGANWYSG  1086
             +R+VNRYKMR+++K+F+LSGMGCSAS+VAID+V +LFK YKN++A+VVS+E++G +WY G
Sbjct  121   ARIVNRYKMRDNIKSFSLSGMGCSASMVAIDLVQNLFKSYKNAFAVVVSSETIGPHWYCG  180

Query  1085  KERSMMLSNCLFRSGGCSMLFTNNPALKPRAILKLKHMVRTHIAAIDEAYECCKQVEDPQ  906
             KE SMMLSNCLFRSGGCS+L TN P LK +A++KLKH VRT+I + DEAY CC Q+ED Q
Sbjct  181   KENSMMLSNCLFRSGGCSVLLTNKPCLKHKALMKLKHSVRTNIGSNDEAYGCCIQIEDQQ  240

Query  905   GFRGFHLSKRLPKVATKALVTNFKVLVPKAIPLWETLRFLAVSSLERRKFKLPSLLGKPI  726
             G+ GF L++ L K A KA   N KVLVPK +P+ E +RF  +S       K  +   KP 
Sbjct  241   GYNGFLLTRNLTKAAAKAFTMNLKVLVPKILPIRELIRFTVISIC-----KTNNKTAKPS  295

Query  725   LNMKTGIEHFCLHPGGRAVIDGVGVSLGLSEYDLEPARMSLHRWGNTSAGGLWYVLGYME  546
             LN+KTGI+HFC+HPGGRAVIDG+G SLGL+EYD+EPARM+LHR+GNTSAGGLWYVLGYME
Sbjct  296   LNLKTGIQHFCIHPGGRAVIDGLGKSLGLNEYDMEPARMALHRFGNTSAGGLWYVLGYME  355

Query  545   AKKRLKKGDRILMLSLGAGFKCNNCVWEVMKDLGDPNVWEDCIDRY--PPETLVNPFTEK  372
             AKKRLKKG++ILM+SLGAGF CNNCVWEVMKDLG+ NVWE C+DRY  P + ++NPF +K
Sbjct  356   AKKRLKKGNKILMISLGAGFMCNNCVWEVMKDLGNGNVWEHCMDRYPIPRKNMINPFADK  415

Query  371   FDWIHDPCLNFLR  333
             + WI+D  LNF+R
Sbjct  416   YSWINDERLNFVR  428



>ref|XP_006376363.1| hypothetical protein POPTR_0013s12390g [Populus trichocarpa]
 gb|ERP54160.1| hypothetical protein POPTR_0013s12390g [Populus trichocarpa]
Length=468

 Score =   575 bits (1482),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 279/445 (63%), Positives = 355/445 (80%), Gaps = 3/445 (1%)
 Frame = -1

Query  1664  YTVVYILRSYLRRRHQCCYMLNYECYKPTDVARRLSTDKSALVVYRNRNLGIDEFRFLLQ  1485
             Y +  + +   +++  CCYML+Y+C+K T+  ++L T   A +V RN+NLGI+E+RFLL+
Sbjct  14    YIIFNLFKLGYQKKDHCCYMLSYQCHKATE-DQKLDTGSCAKIVTRNKNLGIEEYRFLLR  72

Query  1484  TMVNSGVGEQTYIPINVLEGREDSPTLEDSFTEVDDIMFQTLDNLFAKSKVSPREIDvlv  1305
             TMV+SG+GEQTY P N++EGRE+S T  D+ +E+D I+F TLD LFAK+ VSP EID++V
Sbjct  73    TMVSSGIGEQTYCPKNIIEGREESATHMDAVSEMDGIIFHTLDKLFAKTGVSPSEIDIIV  132

Query  1304  vnvsllasapsLTSRVVNRYKMREDVKTFNLSGMGCSASVVAIDIVHHLFKVYKNSYAIV  1125
              +VSL +  PSLT+RV+N YKMRED+K FNLSGMGCSASVVA+D+V  LFK YKNS AIV
Sbjct  133   SSVSLFSPVPSLTARVINHYKMREDIKAFNLSGMGCSASVVAVDLVKQLFKTYKNSLAIV  192

Query  1124  VSTESLGANWYSGKERSMMLSNCLFRSGGCSMLFTNNPALKPRAILKLKHMVRTHIAAID  945
             VSTES+G NWYSGK++SMMLSN LFR+GGCSML TNN ALK +A+L+L   VRTHI + D
Sbjct  193   VSTESMGPNWYSGKDKSMMLSNILFRTGGCSMLLTNNRALKHKALLELTCSVRTHIGSND  252

Query  944   EAYECCKQVEDPQGFRGFHLSKRLPKVATKALVTNFKVLVPKAIPLWETLRFLAVSSLER  765
             EAY  C QVED  G +GF L++ LPK   KAL  N +VL+PK +PL E LR+  +S    
Sbjct  253   EAYSSCIQVEDDLGHKGFRLTRDLPKAGAKALTMNLRVLLPKVLPLSELLRY-KISYYRN  311

Query  764   RKFKLP-SLLGKPILNMKTGIEHFCLHPGGRAVIDGVGVSLGLSEYDLEPARMSLHRWGN  588
             +  K P S    P L++++GI+HFC+HPGGRA+ID VG SL L++YDLEPARM+L+R+GN
Sbjct  312   KIMKRPTSKAAGPGLDLRSGIDHFCVHPGGRAIIDEVGKSLALNDYDLEPARMALYRFGN  371

Query  587   TSAGGLWYVLGYMEAKKRLKKGDRILMLSLGAGFKCNNCVWEVMKDLGDPNVWEDCIDRY  408
             TS+GGLWYVLGYMEAKKRLKKGD+ILM+SLGAGFKCNNCVW+VMKDL D NVW+DCID+Y
Sbjct  372   TSSGGLWYVLGYMEAKKRLKKGDKILMISLGAGFKCNNCVWKVMKDLEDTNVWQDCIDQY  431

Query  407   PPETLVNPFTEKFDWIHDPCLNFLR  333
             PP+T+ NPF+EKFDWI+D  +NF R
Sbjct  432   PPKTIDNPFSEKFDWINDESMNFAR  456



>ref|XP_007220454.1| hypothetical protein PRUPE_ppa004944mg [Prunus persica]
 gb|EMJ21653.1| hypothetical protein PRUPE_ppa004944mg [Prunus persica]
Length=484

 Score =   575 bits (1481),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 285/451 (63%), Positives = 358/451 (79%), Gaps = 5/451 (1%)
 Frame = -1

Query  1679  SLLFLYTVVYIL-RSYLRRRHQCCYMLNYECYKPTDVARRLSTDKSALVVYRNRNLGIDE  1503
             SLL L+   + L +  L+RR Q CYML YECYK  +   +L+ D SA +V +N+NLG++E
Sbjct  2     SLLTLFFGFFCLCKLLLQRRDQSCYMLAYECYKAKE-DMKLNCDSSAKIVMQNKNLGLEE  60

Query  1502  FRFLLQTMVNSGVGEQTYIPINVLEGREDSPTLEDSFTEVDDIMFQTLDNLFAK-SKVSP  1326
              RFLL+T+V+SG+GE+T  P N++EGR  +PT  D   E+D I+F TLD LFA+ + +SP
Sbjct  61    LRFLLKTIVSSGIGEETSCPRNIIEGR--NPTRADELCEMDGIIFDTLDKLFARPTSISP  118

Query  1325  REIDvlvvnvsllasapsLTSRVVNRYKMREDVKTFNLSGMGCSASVVAIDIVHHLFKVY  1146
              +ID+LVVNVS+ + APSLTSR++NRYKMRED+KTFNLSGMGCSAS++AID+V +LFK Y
Sbjct  119   SQIDILVVNVSMFSPAPSLTSRIINRYKMREDIKTFNLSGMGCSASLIAIDVVQNLFKSY  178

Query  1145  KNSYAIVVSTESLGANWYSGKERSMMLSNCLFRSGGCSMLFTNNPALKPRAILKLKHMVR  966
             KN+ AIVVSTES+  NWY GKE+SMML+NCLFRSGGCSMLFTNN  LK +A+LKL+H+VR
Sbjct  179   KNANAIVVSTESIAPNWYCGKEKSMMLTNCLFRSGGCSMLFTNNKGLKHQAMLKLRHLVR  238

Query  965   THIAAIDEAYECCKQVEDPQGFRGFHLSKRLPKVATKALVTNFKVLVPKAIPLWETLRFL  786
             THI + DEAY+CC Q ED  G++GF L+K L K A  A   N +VLVPK +PL E LR+L
Sbjct  239   THIGSSDEAYDCCIQAEDESGYQGFRLTKHLTKAAALAFTMNLQVLVPKVLPLREILRYL  298

Query  785   AVSSLERRKFKLPSLLGKPILNMKTGIEHFCLHPGGRAVIDGVGVSLGLSEYDLEPARMS  606
             AVS L+  K + P       LN+KTGIEHFC+HPGGRA+IDG+G SLGLS+YD+EP+RM+
Sbjct  299   AVSRLKSAKSQKPKADEGVGLNLKTGIEHFCIHPGGRAIIDGIGKSLGLSDYDVEPSRMA  358

Query  605   LHRWGNTSAGGLWYVLGYMEAKKRLKKGDRILMLSLGAGFKCNNCVWEVMKDLGDPNVWE  426
             LHR+GNTSA G WY LGYMEAK+RLKKG+RILM   GAGFKCNN VWEV+KDLGD NVW+
Sbjct  359   LHRFGNTSAAGFWYALGYMEAKQRLKKGNRILMSGFGAGFKCNNIVWEVLKDLGDANVWK  418

Query  425   DCIDRYPPETLVNPFTEKFDWIHDPCLNFLR  333
             DCI+ YPP+TLVNPF EK+ W++D  L+FLR
Sbjct  419   DCIESYPPKTLVNPFMEKYGWLNDEYLSFLR  449



>ref|XP_004309416.1| PREDICTED: 3-ketoacyl-CoA synthase 21-like [Fragaria vesca subsp. 
vesca]
Length=467

 Score =   574 bits (1479),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 285/460 (62%), Positives = 356/460 (77%), Gaps = 4/460 (1%)
 Frame = -1

Query  1703  METLVAIYSLLFLYTVVYILRSYLRRRHQCCYMLNYECYKPTDVARRLSTDKSALVVYRN  1524
             ME L+ +  +   Y    +L+S+L+RRHQ CY+L YECYKPT+   +L TD  A +V RN
Sbjct  1     MEFLLTMCLVSLFYGFCCLLKSFLQRRHQSCYLLAYECYKPTE-DMKLRTDSCAKIVMRN  59

Query  1523  RNLGIDEFRFLLQTMVNSGVGEQTYIPINVLEGREDSPTLEDSFTEVDDIMFQTLDNLFA  1344
             +NLG++EFRFLL+T+VNSG+GE+T  P N+L+GRE+ P L DS +E+D+I+F TLDNLF 
Sbjct  60    KNLGLEEFRFLLKTIVNSGIGEETSCPRNILQGREEKPNLADSLSEMDEIIFNTLDNLFT  119

Query  1343  K-SKVSPREIDvlvvnvsllasapsLTSRVVNRYKMREDVKTFNLSGMGCSASVVAIDIV  1167
             +   VSP +ID+LVVNVS+ + +PSLTSR+VNRYKMRE++KTFNLSGMGCSAS+VA+D+V
Sbjct  120   RYPSVSPSQIDILVVNVSMFSPSPSLTSRIVNRYKMRENIKTFNLSGMGCSASLVAVDVV  179

Query  1166  HHLFKVYKNSYAIVVSTESLGANWYSGKERSMMLSNCLFRSGGCSMLFTNNPALKPRAIL  987
               LFK YK+SYA+VVSTES+  NWY GKE+SMML+NCLFRSGGCSMLFTN    + +AIL
Sbjct  180   QGLFKSYKDSYALVVSTESMAPNWYCGKEKSMMLTNCLFRSGGCSMLFTNRRYHRHQAIL  239

Query  986   KLKHMVRTHIAAIDEAYECCKQVEDPQGFRGFHLSKRLPKVATKALVTNFKVLVPKAIPL  807
             KLK +VRTHI + D+AY CC Q+ED  G+ GF L+K L K A  +L  N +VLVPK +PL
Sbjct  240   KLKTLVRTHIGSSDDAYNCCIQLEDDSGYPGFRLTKYLTKAAALSLTMNLQVLVPKVLPL  299

Query  806   WETLRFLAVSSLERRKFKLPSLLGK--PILNMKTGIEHFCLHPGGRAVIDGVGVSLGLSE  633
              E LR++  S L + + K    L      LNMK GIEHFC+HPGGRA+IDG+G SL L E
Sbjct  300   REILRYVLESWLRKNRGKKSQKLEAVGAGLNMKAGIEHFCIHPGGRAIIDGIGKSLALEE  359

Query  632   YDLEPARMSLHRWGNTSAGGLWYVLGYMEAKKRLKKGDRILMLSLGAGFKCNNCVWEVMK  453
             YDLEP+RM+L R+GNTSA G WY LGYMEAKKRLKKGDRILM   GAGFKCNN VWEV++
Sbjct  360   YDLEPSRMALFRFGNTSAAGFWYALGYMEAKKRLKKGDRILMSGFGAGFKCNNIVWEVLR  419

Query  452   DLGDPNVWEDCIDRYPPETLVNPFTEKFDWIHDPCLNFLR  333
             DL D NVW+DCID YPP T+ NPF EKF W++D  L+F+R
Sbjct  420   DLDDANVWKDCIDSYPPHTIDNPFMEKFSWLNDDYLSFVR  459



>ref|XP_004308834.1| PREDICTED: 3-ketoacyl-CoA synthase 21-like [Fragaria vesca subsp. 
vesca]
Length=467

 Score =   570 bits (1468),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 281/460 (61%), Positives = 354/460 (77%), Gaps = 4/460 (1%)
 Frame = -1

Query  1703  METLVAIYSLLFLYTVVYILRSYLRRRHQCCYMLNYECYKPTDVARRLSTDKSALVVYRN  1524
             ME L+ +  +   Y    +L+S+L+RRHQ CY+L YECYKPT+   +L TD  A +V RN
Sbjct  1     MEFLLTMCLVSLFYGFCCLLKSFLQRRHQSCYLLAYECYKPTE-DMKLRTDSCAKIVMRN  59

Query  1523  RNLGIDEFRFLLQTMVNSGVGEQTYIPINVLEGREDSPTLEDSFTEVDDIMFQTLDNLFA  1344
             +NLG++EFRFLL+T+VNSG+GE+T  P N+L+GRE+ P L DS +E+D+I+F TLDNLF 
Sbjct  60    KNLGLEEFRFLLKTIVNSGIGEETSCPRNILQGREEKPNLADSLSEMDEIIFNTLDNLFT  119

Query  1343  K-SKVSPREIDvlvvnvsllasapsLTSRVVNRYKMREDVKTFNLSGMGCSASVVAIDIV  1167
             +   VSP +ID+LVVNVS+ + +PSLTSR+VNRYKMRE++KTFNLSGMGCSAS+VA+D+V
Sbjct  120   RYPSVSPSQIDILVVNVSMFSPSPSLTSRIVNRYKMRENIKTFNLSGMGCSASLVAVDVV  179

Query  1166  HHLFKVYKNSYAIVVSTESLGANWYSGKERSMMLSNCLFRSGGCSMLFTNNPALKPRAIL  987
               LFK YK+SYA+VVSTES+  NWY GKE+SMML+NCLFRSGGCSMLFTN    + +AIL
Sbjct  180   QGLFKSYKDSYALVVSTESMAPNWYCGKEKSMMLTNCLFRSGGCSMLFTNRRYHRHQAIL  239

Query  986   KLKHMVRTHIAAIDEAYECCKQVEDPQGFRGFHLSKRLPKVATKALVTNFKVLVPKAIPL  807
             KLK +VRTHI + D+AY CC Q+ED  G+ GF L+K L K A  A   N +VLVPK +PL
Sbjct  240   KLKTLVRTHIGSSDDAYNCCIQLEDDSGYPGFRLTKYLTKAAVLAFTMNLQVLVPKVLPL  299

Query  806   WETLRFLAVSSLERRKFKLPSLLGK--PILNMKTGIEHFCLHPGGRAVIDGVGVSLGLSE  633
              E  R++  S L++++      L      LNMK GIEHFC+HPGGRA+IDG+G SL L E
Sbjct  300   REIFRYVLESKLQKKRGTKSQKLEAVGAGLNMKAGIEHFCIHPGGRAIIDGIGKSLELDE  359

Query  632   YDLEPARMSLHRWGNTSAGGLWYVLGYMEAKKRLKKGDRILMLSLGAGFKCNNCVWEVMK  453
             YDLEP+RM+L R+GNTSA G WY LGYMEAKKRLKKGDRILM   GAGFKCNN VWEV++
Sbjct  360   YDLEPSRMALFRFGNTSAAGFWYALGYMEAKKRLKKGDRILMSGFGAGFKCNNIVWEVLR  419

Query  452   DLGDPNVWEDCIDRYPPETLVNPFTEKFDWIHDPCLNFLR  333
             DL D NVW++CID YPP  + NPF EKF WI+D  ++F+R
Sbjct  420   DLDDANVWKNCIDSYPPHNIGNPFMEKFGWINDDYISFVR  459



>gb|KDP46105.1| hypothetical protein JCGZ_06616 [Jatropha curcas]
Length=425

 Score =   567 bits (1462),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 277/426 (65%), Positives = 350/426 (82%), Gaps = 7/426 (2%)
 Frame = -1

Query  1607  MLNYECYK-PTDVARRLSTDKSALVVYRNRNLGIDEFRFLLQTMVNSGVGEQTYIPINVL  1431
             ML YECYK P D  R+L ++  A +V+RN+NLG++E+RFLL+T+VNSG+GE+TY P NVL
Sbjct  1     MLAYECYKGPED--RKLDSESCANLVFRNKNLGLEEYRFLLKTIVNSGIGEETYGPKNVL  58

Query  1430  EGREDSPTLEDSFTEVDDIMFQTLDNLFAKSKVSPREIDvlvvnvsllasapsLTSRVVN  1251
              G E+SP+L+++  E DDI+F T+D +F KS +SP +ID+LVVNVSL + +P LTSR+VN
Sbjct  59    TGHEESPSLDEALFETDDIIFSTVDKVFEKSTISPSQIDILVVNVSLFSPSPCLTSRIVN  118

Query  1250  RYKMREDVKTFNLSGMGCSASVVAIDIVHHLFKVYKNSYAIVVSTESLGANWYSGKERSM  1071
             RYKMRE++K+FNLSGMGCSAS+VAIDIV  LFK YKN  A+VVSTES+G NWY GKE+SM
Sbjct  119   RYKMRENIKSFNLSGMGCSASLVAIDIVQQLFKSYKNVTALVVSTESIGPNWYCGKEKSM  178

Query  1070  MLSNCLFRSGGCSMLFTNNPALKPRAILKLKHMVRTHIAAIDEAYECCKQVEDPQGFRGF  891
             +LSNCLFRSGGCSMLFTNN ALK +AILKL H++RTHI + D+AYECC QVED  G+RGF
Sbjct  179   ILSNCLFRSGGCSMLFTNNRALKSQAILKLNHLIRTHIGSNDQAYECCIQVEDDLGYRGF  238

Query  890   HLSKRLPKVATKALVTNFKVLVPKAIPLWETLRFLAVSSLERRKFKLPSLLGKPILNMKT  711
             HLS+ LPKV + AL  N  V+VPK +P+ E +R++ VS   + K +  +  G   LN+K 
Sbjct  239   HLSRNLPKVGSTALSKNLHVIVPKILPVIELIRYVFVS---KYKSRAKTSTGATGLNLKA  295

Query  710   GIEHFCLHPGGRAVIDGVGVSLGLSEYDLEPARMSLHRWGNTSAGGLWYVLGYMEAKKRL  531
             G+EHFC+HPGG+AVI+G+G SLGLS+YDLEPARM+LHR+GNTSAGGLWYVLGYMEAKKRL
Sbjct  296   GVEHFCIHPGGKAVIEGIGKSLGLSDYDLEPARMALHRFGNTSAGGLWYVLGYMEAKKRL  355

Query  530   KKGDRILMLSLGAGFKCNNCVWEVMKDLGDPNVWEDCIDRYPPETL-VNPFTEKFDWIHD  354
             KKGDRILM+SLGAGFKCNNCVWEV++DL D NVW+  ++ YPP  + +NPF EK+ WI+D
Sbjct  356   KKGDRILMISLGAGFKCNNCVWEVIRDLNDVNVWQGIVEHYPPPQIPINPFLEKYSWIND  415

Query  353   PCLNFL  336
               L+F+
Sbjct  416   EYLSFV  421



>ref|XP_003536780.1| PREDICTED: 3-ketoacyl-CoA synthase 21-like [Glycine max]
Length=483

 Score =   569 bits (1466),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 295/470 (63%), Positives = 355/470 (76%), Gaps = 28/470 (6%)
 Frame = -1

Query  1682  YSLLFLYTVVYILRSYLRRRHQCCYMLNYECYKPTDVARRLSTDKSALVVYRNRNLGIDE  1503
             YS   LY ++      L RR Q CYML YEC+ P +   +L TD +A +V RN+ L ++E
Sbjct  14    YSFFTLYKLI------LERRGQPCYMLAYECFMPPE-DTKLDTDSAAKIVLRNKKLRLEE  66

Query  1502  FRFLLQTMVNSGVGEQTYIPINVLEGREDSPTLEDSFTEVDDIMFQTLDNLFAKSKVSPR  1323
              RFLL+T+V+SG+GE TY P  VLEGRE+ PTL+D++ E+D+IMF TLDNLF K+ +SP 
Sbjct  67    LRFLLKTIVSSGIGENTYCPRTVLEGREECPTLKDTYEEIDEIMFDTLDNLFKKTGISPS  126

Query  1322  EIDvlvvnvsllasapsLTSRVVNRYKMREDVKTFNLSGMGCSASVVAIDIVHHLFKVYK  1143
             EID LVVNVSL + APSLT+R++NRYKMRE++K FNL+GMGCSASVVAID+V  LFK YK
Sbjct  127   EIDFLVVNVSLFSPAPSLTARIINRYKMRENIKAFNLAGMGCSASVVAIDVVQQLFKTYK  186

Query  1142  NSYAIVVSTESLGANWYSGKERSMMLSNCLFRSGGCSMLFTNNPALKPRAILKLKHMVRT  963
             NS  IVVSTE LGA+WY G+++ MMLSNCLFRSGGCSM+FTN  +LK RAILKLKHM RT
Sbjct  187   NSVGIVVSTEDLGAHWYCGRDKKMMLSNCLFRSGGCSMMFTNKASLKSRAILKLKHMERT  246

Query  962   HIAAIDEAYECCKQVEDPQGFRGFHLSKRLPKVATKALVTNFKVLVPKAIPLWETLRF--  789
                A DEAY CC QVED  G+ GF L+K L K A +AL  N + + PK +PLWE +RF  
Sbjct  247   QYGADDEAYNCCIQVEDELGYSGFRLTKSLVKSAAQALTVNLQTMAPKILPLWEMVRFFF  306

Query  788   --LAVSSLERRKFKLPSLLGKPI----------------LNMKTGIEHFCLHPGGRAVID  663
               +  S +++R+  LP L G  +                LN K GIEHFC+HPGGRAVID
Sbjct  307   ASIRYSGMKKREL-LPFLTGMVLGKGNKKKTKFNVLGGGLNFKAGIEHFCVHPGGRAVID  365

Query  662   GVGVSLGLSEYDLEPARMSLHRWGNTSAGGLWYVLGYMEAKKRLKKGDRILMLSLGAGFK  483
             GVG  L L+EYDLEPARM+LHRWGNTSAGGLWYVLGYMEAKKRLKKGDRILM+SLGAGFK
Sbjct  366   GVGKGLRLNEYDLEPARMALHRWGNTSAGGLWYVLGYMEAKKRLKKGDRILMISLGAGFK  425

Query  482   CNNCVWEVMKDLGDPNVWEDCIDRYPPETLVNPFTEKFDWIHDPCLNFLR  333
             CNNCVWEVM+DL D NVW+DCI+ YPP TL NPF EK+DWI+D  L+F+R
Sbjct  426   CNNCVWEVMRDLSDTNVWKDCIESYPPNTLNNPFKEKYDWINDEYLSFVR  475



>ref|XP_008233539.1| PREDICTED: 3-ketoacyl-CoA synthase 21-like [Prunus mume]
Length=467

 Score =   566 bits (1458),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 284/462 (61%), Positives = 357/462 (77%), Gaps = 8/462 (2%)
 Frame = -1

Query  1703  METLVAIYSLLFLYTVVYILRSYLRRRHQCCYMLNYECYKPTDVARRLSTDKSALVVYRN  1524
             ME    +  L   Y    + +  L++R Q CYML YECYK  +   ++++D  A +V +N
Sbjct  1     MEIFTTMCLLTLYYGFFCLCKLVLQKRDQSCYMLAYECYKAKE-DMKVNSDSCAKIVMQN  59

Query  1523  RNLGIDEFRFLLQTMVNSGVGEQTYIPINVLEGREDSPTLEDSFTEVDDIMFQTLDNLFA  1344
             +NLG++E RFLL+T+VNSG+GE+T  P N++E R  + T+ED   E+D I+F TLD LFA
Sbjct  60    KNLGLEELRFLLKTIVNSGIGEETSCPRNIIECR--NSTIEDELHEMDGIIFDTLDKLFA  117

Query  1343  KSK-VSPREIDvlvvnvsllasapsLTSRVVNRYKMREDVKTFNLSGMGCSASVVAIDIV  1167
             +S  +SP  ID+LVVNVS+L+ APSLTSR+ NRYKMRED+KTFNLSGMGCSAS++AID+V
Sbjct  118   RSTPISPSHIDILVVNVSMLSPAPSLTSRIANRYKMREDIKTFNLSGMGCSASLIAIDVV  177

Query  1166  HHLFKVYKNSYAIVVSTESLGANWYSGKERSMMLSNCLFRSGGCSMLFTNNPALKPRAIL  987
              +LFK YK + AIVVSTESL  NWYSGKE+SM+L+NCLFRSGGCSMLFTNN  LK RA+L
Sbjct  178   QNLFKSYKKANAIVVSTESLAPNWYSGKEKSMLLTNCLFRSGGCSMLFTNNRDLKHRAML  237

Query  986   KLKHMVRTHIAAIDEAYECCKQVEDPQGFRGFHLSKRLPKVATKALVTNFKVLVPKAIPL  807
             KLKH+VRTHI +IDEAY+CC Q ED  G++GFHL+K L K A  A   N ++LVPK +PL
Sbjct  238   KLKHLVRTHIGSIDEAYDCCIQAEDESGYQGFHLAKYLTKAAALAFTMNLQILVPKMLPL  297

Query  806   WETLRFLAVS---SLERRKFKLPSLLGKPI-LNMKTGIEHFCLHPGGRAVIDGVGVSLGL  639
              E LR+L  S   +L  +   L +  G  + LN+KTGIEHFC+HPGGRA+IDG+G SLGL
Sbjct  298   REILRYLLASLLHNLSTKSQNLEADGGDGVKLNLKTGIEHFCIHPGGRAIIDGIGKSLGL  357

Query  638   SEYDLEPARMSLHRWGNTSAGGLWYVLGYMEAKKRLKKGDRILMLSLGAGFKCNNCVWEV  459
             S+YD+EP+RM+L+R+GNTSA G WY LGYMEAK+RLKKG+RILM   GAGFKCNN VWEV
Sbjct  358   SDYDVEPSRMALYRFGNTSAAGFWYALGYMEAKQRLKKGNRILMSGFGAGFKCNNIVWEV  417

Query  458   MKDLGDPNVWEDCIDRYPPETLVNPFTEKFDWIHDPCLNFLR  333
             +KDL D NVW+DCID YPPETLVNPF EK+ W++D  L+FLR
Sbjct  418   LKDLEDANVWKDCIDSYPPETLVNPFMEKYGWLNDEYLSFLR  459



>ref|XP_007142697.1| hypothetical protein PHAVU_007G009200g [Phaseolus vulgaris]
 gb|ESW14691.1| hypothetical protein PHAVU_007G009200g [Phaseolus vulgaris]
Length=483

 Score =   565 bits (1455),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 287/463 (62%), Positives = 354/463 (76%), Gaps = 20/463 (4%)
 Frame = -1

Query  1664  YTVVYILRSYLRRRHQCCYMLNYECYKPTDVARRLSTDKSALVVYRNRNLGIDEFRFLLQ  1485
             Y+   +L+  L+RR Q CYML YEC+ P +   +L+TD +  +V RNR L ++E RFLL+
Sbjct  14    YSFFSLLKVILQRRGQSCYMLAYECFMPPE-DTKLNTDSAVKIVLRNRKLRLEELRFLLK  72

Query  1484  TMVNSGVGEQTYIPINVLEGREDSPTLEDSFTEVDDIMFQTLDNLFAKSKVSPREIDvlv  1305
             T+V+SG+GE TY P  VLEG+E+ P+L+D++ E+D+IMF TLDNLF ++ +SP EID+LV
Sbjct  73    TIVSSGIGENTYCPRTVLEGKEECPSLKDTYEEIDEIMFDTLDNLFKRTGISPSEIDILV  132

Query  1304  vnvsllasapsLTSRVVNRYKMREDVKTFNLSGMGCSASVVAIDIVHHLFKVYKNSYAIV  1125
             VNVSL + APSLT+R++NRYKMRE+VK FNL+GMGCSASVV ID+V  LFK Y+NS  IV
Sbjct  133   VNVSLFSPAPSLTARIINRYKMRENVKAFNLTGMGCSASVVGIDVVQQLFKTYENSVGIV  192

Query  1124  VSTESLGANWYSGKERSMMLSNCLFRSGGCSMLFTNNPALKPRAILKLKHMVRTHIAAID  945
             VSTE LGA+WY G ++ MMLSNCLFRSGGCSM+FTN P+LK RAILKLKHM RT   A D
Sbjct  193   VSTEDLGAHWYCGTDKKMMLSNCLFRSGGCSMMFTNKPSLKGRAILKLKHMERTQYGADD  252

Query  944   EAYECCKQVEDPQGFRGFHLSKRLPKVATKALVTNFKVLVPKAIPLWETLRFLAVS---S  774
             EAY CC QVED  G+ GF L+K L K A +AL  N + + PK +P+WE +RF   S   S
Sbjct  253   EAYNCCMQVEDELGYSGFRLTKSLVKSAAQALTVNLQAMAPKILPVWEMVRFFFASVRYS  312

Query  773   LERRKFKLPSLLGKPI----------------LNMKTGIEHFCLHPGGRAVIDGVGVSLG  642
               +++  LP L G  +                LN KTGIEHFC+HPGGRAVIDGVG  L 
Sbjct  313   GMKKREMLPFLTGLFLGENKTKKTKVNLLGGGLNFKTGIEHFCVHPGGRAVIDGVGKGLR  372

Query  641   LSEYDLEPARMSLHRWGNTSAGGLWYVLGYMEAKKRLKKGDRILMLSLGAGFKCNNCVWE  462
             LSEYDLEPARM+LHRWGNTSAGGLWYVLGYMEAKKRLKKGDRILM+SLGAGFKCNNCVWE
Sbjct  373   LSEYDLEPARMALHRWGNTSAGGLWYVLGYMEAKKRLKKGDRILMISLGAGFKCNNCVWE  432

Query  461   VMKDLGDPNVWEDCIDRYPPETLVNPFTEKFDWIHDPCLNFLR  333
             VM+DL   NVW+DCI+ YPPE ++NPF EK++WI++  L+F+R
Sbjct  433   VMRDLSHTNVWKDCIESYPPENIINPFKEKYNWINEEYLSFVR  475



>ref|XP_008233540.1| PREDICTED: 3-ketoacyl-CoA synthase 21-like [Prunus mume]
Length=465

 Score =   563 bits (1451),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 278/461 (60%), Positives = 356/461 (77%), Gaps = 10/461 (2%)
 Frame = -1

Query  1703  METLVAIYSLLFLYTVVYILRSYLRRRHQCCYMLNYECYKPTDVARRLSTDKSALVVYRN  1524
             ME  + +  L   +    + +  L+RR Q CYML YECYK  +   +L+ D SA +V +N
Sbjct  1     MEIFMTMSLLTLFFGFFCLCKLLLQRRDQSCYMLAYECYKAKE-DMKLNCDSSAKIVMQN  59

Query  1523  RNLGIDEFRFLLQTMVNSGVGEQTYIPINVLEGREDSPTLEDSFTEVDDIMFQTLDNLFA  1344
             +NLG++E RFLL+T+V+SG+GE+T  P N++EGR  +P   D   E+D I+F TLD LFA
Sbjct  60    KNLGLEELRFLLKTIVSSGIGEETSCPRNIIEGR--NPARADELCEMDGIIFDTLDKLFA  117

Query  1343  K-SKVSPREIDvlvvnvsllasapsLTSRVVNRYKMREDVKTFNLSGMGCSASVVAIDIV  1167
             + + +SP +ID+LVVNVS+ + APSLTSR++NRYKM+ED+KTFNLSGMGCSAS++AID+V
Sbjct  118   RPTSISPSQIDILVVNVSMFSPAPSLTSRIINRYKMKEDIKTFNLSGMGCSASLIAIDVV  177

Query  1166  HHLFKVYKNSYAIVVSTESLGANWYSGKERSMMLSNCLFRSGGCSMLFTNNPALKPRAIL  987
              +LFK YKN+ AIVVSTES+  NWY GKE+SMML+NCLFRSGGCSMLFTNN  LK +A+L
Sbjct  178   QNLFKSYKNANAIVVSTESIAPNWYCGKEKSMMLTNCLFRSGGCSMLFTNNRDLKQQAML  237

Query  986   KLKHMVRTHIAAIDEAYECCKQVEDPQGFRGFHLSKRLPKVATKALVTNFKVLVPKAIPL  807
             KLKH+VRTHI + DEAY+CC Q ED  G++GF L+K L K A  A   N +VL PK +PL
Sbjct  238   KLKHLVRTHIGSSDEAYDCCIQAEDESGYQGFRLTKHLTKAAALAFTMNLQVLAPKVLPL  297

Query  806   WETLRFLAVSSL---ERRKFKLPSLLGKPILNMKTGIEHFCLHPGGRAVIDGVGVSLGLS  636
              E LR+LAVS L   + +K K    +G   LN+KTGIEHFC+HPGGRA+IDG+G SLGLS
Sbjct  298   REILRYLAVSRLKSAKSQKLKADEGVG---LNLKTGIEHFCIHPGGRAIIDGIGKSLGLS  354

Query  635   EYDLEPARMSLHRWGNTSAGGLWYVLGYMEAKKRLKKGDRILMLSLGAGFKCNNCVWEVM  456
             +YD+EP+RM+L+R+GNTSA G WY LGYMEAK+RLKKG+RILM   GAGFKC+N VWEV+
Sbjct  355   DYDVEPSRMALYRFGNTSAAGFWYALGYMEAKQRLKKGNRILMSGFGAGFKCSNIVWEVL  414

Query  455   KDLGDPNVWEDCIDRYPPETLVNPFTEKFDWIHDPCLNFLR  333
             KD  D NVW+DCI+ YPP+TLVNPF EK+ W++D  L+FLR
Sbjct  415   KDFDDANVWKDCIESYPPKTLVNPFMEKYGWLNDEYLSFLR  455



>ref|XP_007217982.1| hypothetical protein PRUPE_ppa005454mg [Prunus persica]
 gb|EMJ19181.1| hypothetical protein PRUPE_ppa005454mg [Prunus persica]
Length=460

 Score =   562 bits (1449),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 281/451 (62%), Positives = 354/451 (78%), Gaps = 6/451 (1%)
 Frame = -1

Query  1676  LLFLYTVVYIL-RSYLRRRHQCCYMLNYECYKPTDVARRLSTDKSALVVYRNRNLGIDEF  1500
             LL LY   + L +  L++R Q CYML YECYK  +   ++++D  A +V +N+NLG++E 
Sbjct  5     LLTLYYGFFCLCKLVLQKRDQSCYMLAYECYKAKE-DMKVNSDSCAKIVMQNKNLGLEEL  63

Query  1499  RFLLQTMVNSGVGEQTYIPINVLEGREDSPTLEDSFTEVDDIMFQTLDNLFAKS-KVSPR  1323
             RFLL+T+VNSG+GE+T  P N++E R  S T+ED   E+D I+F TLD LFA+S  +SP 
Sbjct  64    RFLLKTIVNSGIGEETSCPRNIIECR--SSTIEDELHEMDGIIFDTLDKLFARSTSISPS  121

Query  1322  EIDvlvvnvsllasapsLTSRVVNRYKMREDVKTFNLSGMGCSASVVAIDIVHHLFKVYK  1143
             +ID+LVVNVS+ + APSLTSR++NRYKMRED+K FNLSGMGCSAS++AID+V +LFK YK
Sbjct  122   QIDILVVNVSMFSPAPSLTSRIINRYKMREDIKNFNLSGMGCSASLIAIDVVQNLFKSYK  181

Query  1142  NSYAIVVSTESLGANWYSGKERSMMLSNCLFRSGGCSMLFTNNPALKPRAILKLKHMVRT  963
             N+ AIVVSTESL  NWY GKE+SMML+NCLFRSGGCSMLFTNN  LK +A+LKLKH+VRT
Sbjct  182   NANAIVVSTESLAPNWYCGKEKSMMLTNCLFRSGGCSMLFTNNRDLKHQAMLKLKHLVRT  241

Query  962   HIAAIDEAYECCKQVEDPQGFRGFHLSKRLPKVATKALVTNFKVLVPKAIPLWETLRFLA  783
             HI + +EAY+CC Q ED  G++GF L+K L K A  A   N ++LVPK +PL E LR+L 
Sbjct  242   HIGSSNEAYDCCIQAEDESGYQGFRLTKYLTKAAALAFTMNLQILVPKMLPLREILRYLL  301

Query  782   VSSLERRKFKLPSLLGKPI-LNMKTGIEHFCLHPGGRAVIDGVGVSLGLSEYDLEPARMS  606
              S L +   K  +L    + LN+KTGIEHFC+HPGGRA+IDG+G SLGLS+YD+EP+RM+
Sbjct  302   ASLLHKLSNKSQNLEADGVKLNLKTGIEHFCIHPGGRAIIDGIGKSLGLSDYDVEPSRMA  361

Query  605   LHRWGNTSAGGLWYVLGYMEAKKRLKKGDRILMLSLGAGFKCNNCVWEVMKDLGDPNVWE  426
             L+R+GNTSA G WY LGYMEAK+RLKKG+RILM   GAGFKCNN VWEV+KDL D NVW+
Sbjct  362   LYRFGNTSAAGFWYALGYMEAKQRLKKGNRILMSGFGAGFKCNNIVWEVLKDLEDANVWK  421

Query  425   DCIDRYPPETLVNPFTEKFDWIHDPCLNFLR  333
             DCID YPPETLVNPF EK+ W++D  L+FLR
Sbjct  422   DCIDSYPPETLVNPFMEKYGWLNDEYLSFLR  452



>ref|XP_007009579.1| 3-ketoacyl-CoA synthase [Theobroma cacao]
 gb|EOY18389.1| 3-ketoacyl-CoA synthase [Theobroma cacao]
Length=455

 Score =   561 bits (1446),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 281/455 (62%), Positives = 354/455 (78%), Gaps = 8/455 (2%)
 Frame = -1

Query  1703  METLVAIYSLLFLYTVVY-ILRSYLRRRHQCCYMLNYECYK-PTDVARRLSTDKSALVVY  1530
             ME  + I  L+FLY +V+ I + +L+ R+Q CY+L YECYK P D  R+L T+    ++ 
Sbjct  1     MELFMTI-CLIFLYCIVFFICKLFLQMRNQYCYILAYECYKAPED--RKLDTETCGKLIM  57

Query  1529  RNRNLGIDEFRFLLQTMVNSGVGEQTYIPINVLEGREDSPTLEDSFTEVDDIMFQTLDNL  1350
             RN+NLG++++RFLLQ MVN+G+GE+TY P NV+ G E+SPTL D+ +E+DDI+F TLD L
Sbjct  58    RNKNLGLEQYRFLLQAMVNAGIGEETYGPRNVIAGTEESPTLSDALSEIDDIVFGTLDKL  117

Query  1349  FAKSKVSPREIDvlvvnvsllasapsLTSRVVNRYKMREDVKTFNLSGMGCSASVVAIDI  1170
             FAK+ VSP EID+LVV VS++ SAPSL +RV+NRYKMRED+K FNLSGMGCSASV+A+D+
Sbjct  118   FAKTGVSPSEIDILVVTVSMITSAPSLPARVINRYKMREDIKVFNLSGMGCSASVIAVDL  177

Query  1169  VHHLFKVYKNSYAIVVSTESLGANWYSGKERSMMLSNCLFRSGGCSMLFTNNPALKPRAI  990
             V +LFK YKN++A++VS+ESL  NWY GKERSMML N LFR GGCS+L TN  ALK +A+
Sbjct  178   VQNLFKTYKNAFAVIVSSESLSPNWYRGKERSMMLPNILFRLGGCSLLLTNKRALKHQAM  237

Query  989   LKLKHMVRTHIAAIDEAYECCKQVEDPQGFRGFHLSKRLPKVATKALVTNFKVLVPKAIP  810
             LKLKH VR H  + DEAYE C ++ED QG+ GF L+K LPK A KA+  N +VLVPK +P
Sbjct  238   LKLKHSVRIHAGSSDEAYESCTRIEDAQGYCGFFLTKNLPKAAAKAVTMNLRVLVPKMLP  297

Query  809   LWETLRFLAVSSL-ERRKFKLPSLLGKPILNMKTGIEHFCLHPGGRAVIDGVGVSLGLSE  633
             L E +R+  VS    + K   P   G   LN+K+G+EHFC+HPGGRAVID +G SLGL+E
Sbjct  298   LRELVRYAVVSYWRSKSKTSAPEAAGAA-LNLKSGVEHFCIHPGGRAVIDAMGRSLGLNE  356

Query  632   YDLEPARMSLHRWGNTSAGGLWYVLGYMEAKKRLKKGDRILMLSLGAGFKCNNCVWEVMK  453
             YDLEP RM+LHR+GNTSA GLWYVL Y EAKKRLKKGDRILM+SLGAGFKCNNCVWEVM+
Sbjct  357   YDLEPTRMALHRFGNTSAAGLWYVLSYTEAKKRLKKGDRILMISLGAGFKCNNCVWEVMR  416

Query  452   DLGDPNVWEDCIDRYPPETLVN-PFTEKFDWIHDP  351
             DL D NVWEDCI  YP ++  N  F EK+ W+++P
Sbjct  417   DLEDVNVWEDCIGLYPVKSTANTSFLEKYGWVNEP  451



>ref|XP_011002674.1| PREDICTED: 3-ketoacyl-CoA synthase 21-like [Populus euphratica]
Length=465

 Score =   559 bits (1440),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 278/457 (61%), Positives = 352/457 (77%), Gaps = 2/457 (0%)
 Frame = -1

Query  1703  METLVAIYSLLFLYTVVYILRSYLRRRHQCCYMLNYECYKPTDVARRLSTDKSALVVYRN  1524
             ME  +A   LL  Y +  + +   ++R Q CYML+Y+C+K  +  R+L T   A +V RN
Sbjct  1     MELFLAFCLLLLFYAISKLCKLAYQKRDQRCYMLSYQCHKAAE-DRKLDTGSCAKIVLRN  59

Query  1523  RNLGIDEFRFLLQTMVNSGVGEQTYIPINVLEGREDSPTLEDSFTEVDDIMFQTLDNLFA  1344
              +LGI+E+RFLL+TMV+SG+GE+TY P NV+EGRE+S TL D+ +EVDD++F TLD LFA
Sbjct  60    SSLGIEEYRFLLKTMVSSGIGEETYCPRNVIEGREESATLMDALSEVDDVIFDTLDKLFA  119

Query  1343  KSKVSPREIDvlvvnvsllasapsLTSRVVNRYKMREDVKTFNLSGMGCSASVVAIDIVH  1164
             K+ +SP +ID++V +VSL + APSLT+RV+NRYKM +D+K FNLSGMGCSASVVA+D+V 
Sbjct  120   KTGISPSDIDIIVASVSLFSPAPSLTARVINRYKMGKDIKAFNLSGMGCSASVVAVDLVK  179

Query  1163  HLFKVYKNSYAIVVSTESLGANWYSGKERSMMLSNCLFRSGGCSMLFTNNPALKPRAILK  984
              LFK Y+NS+AIVVSTES+G NWYSGKE+SMMLSN LFR+GGCSML TNN ALK +A+L+
Sbjct  180   QLFKTYRNSFAIVVSTESIGPNWYSGKEKSMMLSNILFRTGGCSMLLTNNIALKEKALLE  239

Query  983   LKHMVRTHIAAIDEAYECCKQVEDPQGFRGFHLSKRLPKVATKALVTNFKVLVPKAIPLW  804
             L   VRTHI +  EAY  C QVED  G RGF L++ LP+   KAL  N +VL+PK +PL 
Sbjct  240   LTCAVRTHIGSDHEAYSSCIQVEDDLGNRGFRLTRDLPRAGAKALTMNLRVLLPKVLPLS  299

Query  803   ETLRFLAVSSLERRKFKLPSLLGKPILNMKTGIEHFCLHPGGRAVIDGVGVSLGLSEYDL  624
             E LR+  +S    +  K    +  P LN+K+GI+HFC+HPGGRA+ID VG SL L+++DL
Sbjct  300   EMLRY-KISYCRNKITKRSKGIAGPGLNLKSGIDHFCVHPGGRAIIDEVGKSLALNDHDL  358

Query  623   EPARMSLHRWGNTSAGGLWYVLGYMEAKKRLKKGDRILMLSLGAGFKCNNCVWEVMKDLG  444
             EPARM+L+R  NT  GGLWYVLGYMEAKKRLKKGDRILM+SLGAGF+CNNCVW+VMKD  
Sbjct  359   EPARMALYRCVNTPTGGLWYVLGYMEAKKRLKKGDRILMISLGAGFECNNCVWKVMKDSE  418

Query  443   DPNVWEDCIDRYPPETLVNPFTEKFDWIHDPCLNFLR  333
             D NVW+DCID YPP T  NPF+EKFDWI+D  + F R
Sbjct  419   DKNVWKDCIDHYPPNTFANPFSEKFDWINDESMRFAR  455



>ref|XP_007142696.1| hypothetical protein PHAVU_007G009100g [Phaseolus vulgaris]
 gb|ESW14690.1| hypothetical protein PHAVU_007G009100g [Phaseolus vulgaris]
Length=483

 Score =   558 bits (1439),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 287/463 (62%), Positives = 347/463 (75%), Gaps = 20/463 (4%)
 Frame = -1

Query  1664  YTVVYILRSYLRRRHQCCYMLNYECYKPTDVARRLSTDKSALVVYRNRNLGIDEFRFLLQ  1485
             Y+   +L+  L+RR Q CYML YEC+ P +   +L+TD +  +V RNR L ++E RFLL+
Sbjct  14    YSFFSLLKVILQRRGQSCYMLAYECFMPPE-DTKLNTDSAVKIVLRNRKLRLEELRFLLK  72

Query  1484  TMVNSGVGEQTYIPINVLEGREDSPTLEDSFTEVDDIMFQTLDNLFAKSKVSPREIDvlv  1305
             T+V+SG+GE TY P  VLEGRE+ P+L+D++ E+D IMF TLDN+F K  +SP EID+LV
Sbjct  73    TIVSSGIGENTYCPRTVLEGREECPSLKDTYEEIDKIMFDTLDNMFQKIGISPSEIDILV  132

Query  1304  vnvsllasapsLTSRVVNRYKMREDVKTFNLSGMGCSASVVAIDIVHHLFKVYKNSYAIV  1125
             VNVSL + APSL +R++NRYKMRE+VK FNL+GMGCSASVV ID+V  LFK  KNS  IV
Sbjct  133   VNVSLFSPAPSLAARIINRYKMRENVKAFNLTGMGCSASVVGIDVVQQLFKTCKNSVGIV  192

Query  1124  VSTESLGANWYSGKERSMMLSNCLFRSGGCSMLFTNNPALKPRAILKLKHMVRTHIAAID  945
             VSTESLGA+WY G ++ MMLSNCLFRSGGCSM+FTN P+LK RAILKLKHM RT   A D
Sbjct  193   VSTESLGAHWYCGTDKKMMLSNCLFRSGGCSMMFTNKPSLKGRAILKLKHMERTQYGADD  252

Query  944   EAYECCKQVEDPQGFRGFHLSKRLPKVATKALVTNFKVLVPKAIPLWETLRFLAVS---S  774
             EAY CC QVED  G+ GF L+K L K A +AL  N + + PK +P+WE +RF   S   S
Sbjct  253   EAYNCCMQVEDELGYSGFRLTKSLVKSAAQALTVNLQAMAPKILPVWEMVRFFFASVRYS  312

Query  773   LERRKFKLPSLLGKPI----------------LNMKTGIEHFCLHPGGRAVIDGVGVSLG  642
               +++  LP L G  +                LN KTGIEH C+HPGGRAVIDGVG  L 
Sbjct  313   GMKKREMLPFLTGLFLGENKTKKTKVNLLGGGLNFKTGIEHICVHPGGRAVIDGVGKGLR  372

Query  641   LSEYDLEPARMSLHRWGNTSAGGLWYVLGYMEAKKRLKKGDRILMLSLGAGFKCNNCVWE  462
             LSEYDLEPARM+LHRWGNTSAGGLWYVLGYMEAKKRLKKGDRILM   GAGFKCNNCVWE
Sbjct  373   LSEYDLEPARMALHRWGNTSAGGLWYVLGYMEAKKRLKKGDRILMFGFGAGFKCNNCVWE  432

Query  461   VMKDLGDPNVWEDCIDRYPPETLVNPFTEKFDWIHDPCLNFLR  333
             VM+DL   NVW+DCI+ YPPE ++NPF EKF+WI+D  L+F+R
Sbjct  433   VMRDLSHTNVWKDCIESYPPENIINPFKEKFNWINDEYLSFVR  475



>ref|XP_010558768.1| PREDICTED: 3-ketoacyl-CoA synthase 21-like [Tarenaya hassleriana]
Length=458

 Score =   556 bits (1434),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 281/459 (61%), Positives = 360/459 (78%), Gaps = 4/459 (1%)
 Frame = -1

Query  1703  METLVAIYSLLFLYTVVYILRSYLRRRHQCCYMLNYECYKPTDVARRLSTDKSALVVYRN  1524
             M+ L   Y LL    V +I R  L  R+Q CYML+YECYK  D   +L+++K A +V RN
Sbjct  1     MDLLTVAYLLLVPCLVFFIARWVLEWRNQRCYMLHYECYKGKD-EMKLNSEKCAQIVQRN  59

Query  1523  RNLGIDEFRFLLQTMVNSGVGEQTYIPINVLEGREDSPTLEDSFTEVDDIMFQTLDNLFA  1344
             +NLG++E+RFLL+TMV+SG+GE+TY P NVLEGRE+SPTL D+ +E+D+I+F TLDNLFA
Sbjct  60    KNLGLEEYRFLLRTMVSSGIGEETYGPRNVLEGREESPTLLDALSEMDEIIFDTLDNLFA  119

Query  1343  KSKVSPREIDvlvvnvsllasapsLTSRVVNRYKMREDVKTFNLSGMGCSASVVAIDIVH  1164
             K+ VSP EID+LVVNVSL A  PSL  RVVNRYKMREDVK +NLSG+GCSASV++ID+V 
Sbjct  120   KTGVSPSEIDILVVNVSLFAPVPSLACRVVNRYKMREDVKCYNLSGLGCSASVISIDLVQ  179

Query  1163  HLFKVYKNSYAIVVSTESLGANWYSGKERSMMLSNCLFRSGGCSMLFTNNPALKPRAILK  984
              LF+  KN+ AIVVSTE++G +WY GK+RSMMLSNCLFR+GG S+L TN+P  K +AI+K
Sbjct  180   RLFRTRKNALAIVVSTETMGPHWYCGKDRSMMLSNCLFRAGGSSVLLTNDPTRKDKAIMK  239

Query  983   LKHMVRTHIAAIDEAYECCKQVEDPQGFRGFHLSKRLPKVATKALVTNFKVLVPKAIPLW  804
             LK +VR H+ + DEAY CC Q+ED +G++GF L+K L   A KAL  N +VL+PK +P+ 
Sbjct  240   LKTVVRAHVGSDDEAYSCCIQMEDKEGYQGFLLTKYLKNAAAKALTKNLRVLLPKVLPMK  299

Query  803   ETLRFLAVSSLERRKFKLPSLLGKPI-LNMKTGIEHFCLHPGGRAVIDGVGVSLGLSEYD  627
             E LR+ A++   ++K K  S  G  I LN+KTG++HFC+HPGGRA+I+G G SLGLSEYD
Sbjct  300   ELLRY-AIARRLKKKTKGESSGGTGIGLNLKTGLQHFCIHPGGRAIIEGAGKSLGLSEYD  358

Query  626   LEPARMSLHRWGNTSAGGLWYVLGYMEAKKRLKKGDRILMLSLGAGFKCNNCVWEVMKDL  447
             +EP+R +LHR+GNTS+GGLWYVLGYMEAKKRLKKGD++LM+S+GAGF+ NNCVWE+MKDL
Sbjct  359   IEPSRNALHRFGNTSSGGLWYVLGYMEAKKRLKKGDKLLMISMGAGFESNNCVWEIMKDL  418

Query  446   GDPNVWEDCIDRYPPETLV-NPFTEKFDWIHDPCLNFLR  333
                N W D ID YP    + NPF EKFDWI+D  L+F+R
Sbjct  419   EGGNAWTDSIDGYPEMAKIPNPFKEKFDWINDDTLSFVR  457



>gb|KHN20288.1| 3-ketoacyl-CoA synthase 21 [Glycine soja]
Length=485

 Score =   557 bits (1436),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 288/469 (61%), Positives = 354/469 (75%), Gaps = 24/469 (5%)
 Frame = -1

Query  1682  YSLLFLYTVVYILRSYLRRRHQCCYMLNYECYKPTDVARRLSTDKSALVVYRNRNLGIDE  1503
             YS    Y ++ IL+   RR  Q CYML YEC+ P +   +L T+ +A +V RNR L ++E
Sbjct  14    YSFFTFYKLI-ILQ---RRSGQACYMLAYECFMPPE-DTKLDTNSAAKIVLRNRKLRLEE  68

Query  1502  FRFLLQTMVNSGVGEQTYIPINVLEGREDSPTLEDSFTEVDDIMFQTLDNLFAKSKVSPR  1323
              RFLL+T+V+SG+GE TY P  VLEGRE+ PTL+D++ E+D+IMF TLDNLF K+ + P 
Sbjct  69    LRFLLKTIVSSGIGENTYCPRTVLEGREECPTLKDTYEEIDEIMFDTLDNLFKKTGIRPS  128

Query  1322  EIDvlvvnvsllasapsLTSRVVNRYKMREDVKTFNLSGMGCSASVVAIDIVHHLFKVYK  1143
             E+D+LVVNVSL + APSLT+R++NRYKMRE++K FNL+GMGCSASVVAID+V  LFK Y+
Sbjct  129   EVDILVVNVSLFSPAPSLTARIINRYKMRENIKAFNLAGMGCSASVVAIDVVQQLFKTYE  188

Query  1142  NSYAIVVSTESLGANWYSGKERSMMLSNCLFRSGGCSMLFTNNPALKPRAILKLKHMVRT  963
             NS  +VVSTE LGA+WY G+++ MMLSNCLFRSGGCSM+FTN  +LK RAILKLKHM RT
Sbjct  189   NSVGVVVSTEDLGAHWYCGRDKKMMLSNCLFRSGGCSMMFTNKASLKSRAILKLKHMERT  248

Query  962   HIAAIDEAYECCKQVEDPQGFRGFHLSKRLPKVATKALVTNFKVLVPKAIPLWETLRFLA  783
                A DEAY CC Q+ED  G+ GF L+K L K A +AL  N + + P  +PLWE +RF  
Sbjct  249   QYGADDEAYNCCIQMEDELGYSGFLLTKSLVKSAAQALTVNLQAMAPNILPLWEMVRFFF  308

Query  782   VS---SLERRKFKLPSLLGKPI----------------LNMKTGIEHFCLHPGGRAVIDG  660
              S   S  +++  LP + G  +                LN K GIEHFC+HPGGRAVIDG
Sbjct  309   ASIWYSGMKKRELLPFVTGMVLGKGNKKKTKLNVLGGGLNFKAGIEHFCVHPGGRAVIDG  368

Query  659   VGVSLGLSEYDLEPARMSLHRWGNTSAGGLWYVLGYMEAKKRLKKGDRILMLSLGAGFKC  480
             VG  L L+EYDLEPARM+LHRWGNTSAGGLWYVLGYMEAKKRLKKGDRILM+SLGAGFKC
Sbjct  369   VGKGLRLNEYDLEPARMALHRWGNTSAGGLWYVLGYMEAKKRLKKGDRILMISLGAGFKC  428

Query  479   NNCVWEVMKDLGDPNVWEDCIDRYPPETLVNPFTEKFDWIHDPCLNFLR  333
             NNCVWEVM+DL D NVW+DCI+ YPP+TL NPF EK+DWI+D  L+F+R
Sbjct  429   NNCVWEVMRDLSDTNVWKDCIETYPPDTLNNPFKEKYDWINDEYLSFVR  477



>gb|KHN37313.1| 3-ketoacyl-CoA synthase 21 [Glycine soja]
Length=451

 Score =   555 bits (1429),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 285/445 (64%), Positives = 343/445 (77%), Gaps = 22/445 (5%)
 Frame = -1

Query  1607  MLNYECYKPTDVARRLSTDKSALVVYRNRNLGIDEFRFLLQTMVNSGVGEQTYIPINVLE  1428
             ML YEC+ P +   +L TD +A +V RN+ L ++E RFLL+T+V+SG+GE TY P  VLE
Sbjct  1     MLAYECFMPPE-DTKLDTDSAAKIVLRNKKLRLEELRFLLKTIVSSGIGENTYCPRTVLE  59

Query  1427  GREDSPTLEDSFTEVDDIMFQTLDNLFAKSKVSPREIDvlvvnvsllasapsLTSRVVNR  1248
             GRE+ PTL+D++ E+D+IMF TLDNLF K+ +SP EID LVVNVSL + APSLT+R++NR
Sbjct  60    GREECPTLKDTYEEIDEIMFDTLDNLFKKTGISPSEIDFLVVNVSLFSPAPSLTARIINR  119

Query  1247  YKMREDVKTFNLSGMGCSASVVAIDIVHHLFKVYKNSYAIVVSTESLGANWYSGKERSMM  1068
             YKMRE++K FNL+GMGCSASVVAID+V  LFK YKNS  IVVSTE LGA+WY G+++ MM
Sbjct  120   YKMRENIKAFNLAGMGCSASVVAIDVVQQLFKTYKNSVGIVVSTEDLGAHWYCGRDKKMM  179

Query  1067  LSNCLFRSGGCSMLFTNNPALKPRAILKLKHMVRTHIAAIDEAYECCKQVEDPQGFRGFH  888
             LSNCLFRSGGCSM+FTN  +LK RAILKLKHM RT   A DEAY CC QVED  G+ GF 
Sbjct  180   LSNCLFRSGGCSMMFTNKASLKSRAILKLKHMERTQYGADDEAYNCCIQVEDELGYSGFR  239

Query  887   LSKRLPKVATKALVTNFKVLVPKAIPLWETLRF----LAVSSLERRKFKLPSLLGKPI--  726
             L+K L K A +AL  N + + PK +PLWE +RF    +  S +++R+  LP L G  +  
Sbjct  240   LTKSLVKSAAQALTVNLQTMAPKILPLWEMVRFFFASIRYSGMKKREL-LPFLTGMVLGK  298

Query  725   --------------LNMKTGIEHFCLHPGGRAVIDGVGVSLGLSEYDLEPARMSLHRWGN  588
                           LN K GIEHFC+HPGGRAVIDGVG  L L+EYDLEPARM+LHRWGN
Sbjct  299   GNKKKTKFNVLGGGLNFKAGIEHFCVHPGGRAVIDGVGKGLRLNEYDLEPARMALHRWGN  358

Query  587   TSAGGLWYVLGYMEAKKRLKKGDRILMLSLGAGFKCNNCVWEVMKDLGDPNVWEDCIDRY  408
             TSAGGLWYVLGYMEAKKRLKKGDRILM+SLGAGFKCNNCVWEVM+DL D NVW+DCI+ Y
Sbjct  359   TSAGGLWYVLGYMEAKKRLKKGDRILMISLGAGFKCNNCVWEVMRDLSDTNVWKDCIESY  418

Query  407   PPETLVNPFTEKFDWIHDPCLNFLR  333
             PP TL NPF EK+DWI+D  L+F+R
Sbjct  419   PPNTLNNPFKEKYDWINDEYLSFVR  443



>ref|XP_011020158.1| PREDICTED: 3-ketoacyl-CoA synthase 21-like [Populus euphratica]
Length=453

 Score =   554 bits (1428),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 285/456 (63%), Positives = 357/456 (78%), Gaps = 10/456 (2%)
 Frame = -1

Query  1739  HTQIDLSRSFYHMETLVAIYSLLFLYTVVYILRSYL-RRRHQCCYMLNYECYK-PTDVAR  1566
             +T+  L   F+    L+ I+ LLF   +++ LR  + ++R  CCYM+ YECYK P D  R
Sbjct  2     YTRSTLKTDFFLPMELIMIFCLLFF--IIFCLRKLVFQKREACCYMMAYECYKAPED--R  57

Query  1565  RLSTDKSALVVYRNRNLGIDEFRFLLQTMVNSGVGEQTYIPINVLEGREDSPTLEDSFTE  1386
             +L TD  A +V RN+NLG+ E++FLL+T+V+SG+GE+TY P NV+ G+EDSPTL+DS +E
Sbjct  58    KLDTDTCARIVLRNKNLGLQEYKFLLKTIVSSGIGEETYSPRNVISGQEDSPTLKDSISE  117

Query  1385  VDDIMFQTLDNLFAKSKVSPREIDvlvvnvsllasapsLTSRVVNRYKMREDVKTFNLSG  1206
             +D ++F TLD LFAK+ +SP +ID+LVVNVSL + APSLT+RVVNRYKMR +VKTFNLS 
Sbjct  118   MDGLIFDTLDKLFAKTGISPTKIDILVVNVSLFSPAPSLTARVVNRYKMRSNVKTFNLSE  177

Query  1205  MGCSASVVAIDIVHHLFKVYKNSYAIVVSTESLGANWYSGKERSMMLSNCLFRSGGCSML  1026
             MGCSAS+VAID+V HLFK YKN++AIVVSTESLG+NWY GKE+SMMLSNCLFRSGGCSML
Sbjct  178   MGCSASIVAIDLVQHLFKSYKNAFAIVVSTESLGSNWYQGKEKSMMLSNCLFRSGGCSML  237

Query  1025  FTNNPALKPRAILKLKHMVRTHIAAIDEAYECCKQVEDPQGFRGFHLSKRLPKVATKALV  846
             FTNN ALK +AI +LKH+VRTH+ + DEA  CC QV D  G++GF L+K L   A KAL 
Sbjct  238   FTNNSALKHQAIYRLKHVVRTHLGSNDEACGCCIQVADDLGYKGFLLTKSLKISAAKALA  297

Query  845   TNFKVLVPKAIPLWETLRFLAVSSLERRKFKLPSL--LGKPILNMKTGIEHFCLHPGGRA  672
              N +VL PK +PL E LR++ VS  ++ K K  SL  +G   LN+KTG +HFC+HPGGRA
Sbjct  298   ANLRVLFPKILPLSEQLRYVYVSR-QQNKTKRNSLQEMGAG-LNLKTGADHFCVHPGGRA  355

Query  671   VIDGVGVSLGLSEYDLEPARMSLHRWGNTSAGGLWYVLGYMEAKKRLKKGDRILMLSLGA  492
             +ID VG SL LS YDLEPARM+LHR+GNTSAGGLWYVL YMEAK+RLKKG++ILM SLGA
Sbjct  356   IIDEVGKSLSLSNYDLEPARMALHRFGNTSAGGLWYVLAYMEAKQRLKKGNKILMTSLGA  415

Query  491   GFKCNNCVWEVMKDLGDPNVWEDCIDRYPPETLVNP  384
             GFKCN+CV+EV +DL D NVW+D ID+YPP     P
Sbjct  416   GFKCNSCVFEVTRDLKDANVWKDSIDQYPPRNHYQP  451



>gb|AGK30011.1| 3-ketoacyl-CoA synthase [Gossypium raimondii]
Length=439

 Score =   553 bits (1425),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 282/436 (65%), Positives = 352/436 (81%), Gaps = 5/436 (1%)
 Frame = -1

Query  1637  YLRRRHQCCYMLNYECYKPTDVARRLSTDKSALVVYRNRNLGIDEFRFLLQTMVNSGVGE  1458
             + ++R + CYML YEC+K +D  RRL TD    VV RN+NLG+D++RFLL+T+V+SG+GE
Sbjct  2     FFQKRDEQCYMLGYECFKASD-DRRLDTDACVKVVLRNKNLGLDQYRFLLKTIVSSGLGE  60

Query  1457  QTYIPINVLEGREDSPTLEDSFTEVDDIMFQTLDNLFAKSKVSPREIDvlvvnvsllasa  1278
             +TY P NV++GRE+ P+  D+  E+D+IMF TLD LF K+ VSP EID+LVV+VSL + A
Sbjct  61    ETYGPRNVIDGREEFPSENDAHAEMDEIMFSTLDTLFEKTGVSPSEIDILVVDVSLFSPA  120

Query  1277  psLTSRVVNRYKMREDVKTFNLSGMGCSASVVAIDIVHHLFKVYKNSYAIVVSTESLGAN  1098
             PSLTSR++NRYKMR+++K+F+LSGMGCSAS+VAID+V  LFK YKN +AIVVSTES+  +
Sbjct  121   PSLTSRIINRYKMRDNIKSFSLSGMGCSASMVAIDMVQQLFKTYKNQFAIVVSTESIARH  180

Query  1097  WYSGKERSMMLSNCLFRSGGCSMLFTNNPALKPRAILKLKHMVRTHIAAIDEAYECCKQV  918
             WY GKE+SMMLSNCLFR+GGCS+L TN   LK R +LKLK  VRT+I   DEAY CC QV
Sbjct  181   WYCGKEKSMMLSNCLFRNGGCSILLTNKRDLKDRCLLKLKCAVRTNIGYDDEAYGCCIQV  240

Query  917   EDPQGFRGFHLSKRLPKVATKALVTNFKVLVPKAIPLWETLRFLAVSSLERRKFKLPSLL  738
             EDPQG++GF L+K L K A KA   N K+L+PK +P+WE LR+ A+S+L ++  K  +L 
Sbjct  241   EDPQGYQGFLLTKSLTKAAAKAFTGNLKLLLPKILPVWELLRY-AISTLGKKSTKGQNLS  299

Query  737   GKPILNMKTGIEHFCLHPGGRAVIDGVGVSLGLSEYDLEPARMSLHRWGNTSAGGLWYVL  558
                 LN+K+G++HFCLHPGGRAVIDG+G SLGLSEYDLEP RM+L+R+GNTSAGGLWYVL
Sbjct  300   FN--LNLKSGVDHFCLHPGGRAVIDGLGKSLGLSEYDLEPTRMALYRFGNTSAGGLWYVL  357

Query  557   GYMEAKKRLKKGDRILMLSLGAGFKCNNCVWEVMKD-LGDPNVWEDCIDRYPPETLVNPF  381
              YMEAKKRLKKGD+I M+SLGAGF CNNCVWEVMKD L D  VWE CID YP + LVNPF
Sbjct  358   SYMEAKKRLKKGDKIFMVSLGAGFMCNNCVWEVMKDGLEDTRVWEGCIDEYPRKNLVNPF  417

Query  380   TEKFDWIHDPCLNFLR  333
             TEK+ WI+D CLNF+R
Sbjct  418   TEKYSWINDECLNFVR  433



>ref|XP_009335920.1| PREDICTED: 3-ketoacyl-CoA synthase 21-like [Pyrus x bretschneideri]
Length=467

 Score =   553 bits (1426),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 276/462 (60%), Positives = 353/462 (76%), Gaps = 8/462 (2%)
 Frame = -1

Query  1703  METLVAIYSLLFLYTVVYILRSYLRRRHQCCYMLNYECYKPTDVARRLSTDKSALVVYRN  1524
             ME L+ + SLL L+     L+   RRR QCC++L YECYK  +   ++++D  A +V RN
Sbjct  1     MEILMTM-SLLVLFGFFSFLKLVFRRRDQCCFLLAYECYKAKE-DMKINSDSCAKIVLRN  58

Query  1523  RNLGIDEFRFLLQTMVNSGVGEQTYIPINVLEGREDSPTLEDSFTEVDDIMFQTLDNLFA  1344
             +NLG++E RFLL+T+VNSG+GE+T  P N++EGRE++PT  D   E+D I+F TLD LFA
Sbjct  59    KNLGLEELRFLLKTIVNSGIGEETSCPRNIIEGREENPTGADELNEMDGIIFDTLDKLFA  118

Query  1343  K-SKVSPREIDvlvvnvsllasapsLTSRVVNRYKMREDVKTFNLSGMGCSASVVAIDIV  1167
             + + + P +ID+LVVNVS+ + APSLTSR++NRYKMRED+K+FNLSGMGCSAS+VAID+V
Sbjct  119   RNAAIPPSQIDILVVNVSMFSPAPSLTSRIINRYKMREDIKSFNLSGMGCSASLVAIDVV  178

Query  1166  HHLFKVYKNSYAIVVSTESLGANWYSGKERSMMLSNCLFRSGGCSMLFTNNPALKPRAIL  987
              +LFK YKN+ A+VVSTESL  NWY GKE+SMML+NCLFRSGGCSMLFTN   L+ +A L
Sbjct  179   QNLFKSYKNANAVVVSTESLAPNWYCGKEKSMMLTNCLFRSGGCSMLFTNKRTLQHQAKL  238

Query  986   KLKHMVRTHIAAIDEAYECCKQVEDPQGFRGFHLSKRLPKVATKALVTNFKVLVPKAIPL  807
             KL+H+VRTHI +  EAYECC Q+ED  G++GF L+K L K A  AL  N + LVPK +PL
Sbjct  239   KLQHLVRTHIGSNTEAYECCIQLEDESGYQGFRLTKHLTKAAAMALTMNLQDLVPKVLPL  298

Query  806   WETLRFLAVSSLERR---KFKLPSLLGKPILNMKTGIEHFCLHPGGRAVIDGVGVSLGLS  636
              E   +L  S +  R   K +    +G   LN+K GIEHFC+HPGGRA+IDG+G SLGLS
Sbjct  299   RELFLYLVASRVRNRTGTKSQKLEAVGTG-LNLKAGIEHFCIHPGGRAIIDGIGKSLGLS  357

Query  635   EYDLEPARMSLHRWGNTSAGGLWYVLGYMEAKKRLKKGDRILMLSLGAGFKCNNCVWEVM  456
             +YDLEP+RM+LHR+GNTS  G WY LGYMEAKKRLKKG++ILM   GAGFKCNN VWEV+
Sbjct  358   DYDLEPSRMTLHRFGNTSTAGFWYALGYMEAKKRLKKGNKILMSGFGAGFKCNNTVWEVL  417

Query  455   KDLGDPNVWEDCIDRYPP-ETLVNPFTEKFDWIHDPCLNFLR  333
             KDL D NVW+DCI+ YPP  TL NP+ EK+ W++D  L+F+R
Sbjct  418   KDLDDANVWKDCIESYPPNNTLGNPYMEKYSWLNDEYLSFVR  459



>ref|XP_009344910.1| PREDICTED: 3-ketoacyl-CoA synthase 21-like [Pyrus x bretschneideri]
Length=475

 Score =   553 bits (1425),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 271/457 (59%), Positives = 358/457 (78%), Gaps = 8/457 (2%)
 Frame = -1

Query  1703  METLVAIYSLLFLYTVVYILRSYLRRRHQCCYMLNYECYKPTDVARRLSTDKSALVVYRN  1524
             ME L+A+  L   +  +Y+    L+ RHQ CY+L YECYK TD  R+L T+    ++ RN
Sbjct  1     MELLLAMCLLFIFFACIYLCELLLQWRHQQCYLLAYECYKATD-ERKLDTESCVKIIRRN  59

Query  1523  RNLGIDEFRFLLQTMVNSGVGEQTYIPINVLEGREDSPTLEDSFTEVDDIMFQTLDNLFA  1344
              NLG++E+RFLL+T+VNSG+GE+TY P NV+ G ED P+LEDS  E+DDIMF TLD LF 
Sbjct  60    TNLGLEEYRFLLKTIVNSGLGEETYGPRNVIAGCEDCPSLEDSLWEMDDIMFGTLDKLFH  119

Query  1343  KSKVSPREIDvlvvnvsllasapsLTSRVVNRYKMREDVKTFNLSGMGCSASVVAIDIVH  1164
             K+ +SP +ID+LVVNVSL + APSLT+R++NRYKM+ D+K FNLSGMGCS S+VAID+V 
Sbjct  120   KTGISPSKIDILVVNVSLFSPAPSLTARIINRYKMKTDIKAFNLSGMGCSGSLVAIDLVQ  179

Query  1163  HLFKVYKNSYAIVVSTESLGANWYSGKERSMMLSNCLFRSGGCSMLFTNNPALKPRAILK  984
             +LFK YKN  A++VSTESL  NWY GK + MML+NCL+RSGGCSM+FTN   LK R++LK
Sbjct  180   NLFKTYKNVNAVIVSTESLAPNWYRGKVQPMMLANCLYRSGGCSMIFTNKMHLKHRSLLK  239

Query  983   LKHMVRTHIAAIDEAYECCKQVEDPQGFRGFHLSKRLPKVATKALVTNFKVLVPKAIPLW  804
             L+ +VRTH+ ++DE Y C  QVED  GFRGF+LSK + KVA KAL  N ++L+ K +PL 
Sbjct  240   LQCIVRTHLGSLDEGYGCSTQVEDKNGFRGFNLSKSIAKVAAKALTMNLRILLRKVLPLT  299

Query  803   ETLRFLAVSSLERRKFKLPSLLGKPILNMKTGIEHFCLHPGGRAVIDGVGVSLGLSEYDL  624
             E LR++ VS   RR+ K+ +      LN+K G++HFC+ P   AV++GVG SLGL++YDL
Sbjct  300   ELLRYVIVS---RRQNKVAN----AGLNLKAGLDHFCIPPTEAAVVNGVGRSLGLNDYDL  352

Query  623   EPARMSLHRWGNTSAGGLWYVLGYMEAKKRLKKGDRILMLSLGAGFKCNNCVWEVMKDLG  444
             EPARM+LHR+GNTS+GGLWYVLGYMEAK+RLKKG++ILM+S GAG++CNNCVWE+++D+ 
Sbjct  353   EPARMALHRFGNTSSGGLWYVLGYMEAKRRLKKGEKILMVSFGAGYECNNCVWEILRDME  412

Query  443   DPNVWEDCIDRYPPETLVNPFTEKFDWIHDPCLNFLR  333
             + NVW+DCI+ YPPET+VNPF EK+ WI+D  L+F+R
Sbjct  413   NANVWKDCIETYPPETIVNPFMEKYSWINDEYLSFVR  449



>ref|XP_009357644.1| PREDICTED: 3-ketoacyl-CoA synthase 21-like [Pyrus x bretschneideri]
Length=467

 Score =   551 bits (1419),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 274/462 (59%), Positives = 354/462 (77%), Gaps = 8/462 (2%)
 Frame = -1

Query  1703  METLVAIYSLLFLYTVVYILRSYLRRRHQCCYMLNYECYKPTDVARRLSTDKSALVVYRN  1524
             ME L+ + SLL L+     L+   RRR QCC++L YECYK  +   ++++D  A +V RN
Sbjct  1     MEILMTM-SLLVLFGFFSFLKLVFRRRDQCCFLLAYECYKAKE-DMKINSDSCAKIVLRN  58

Query  1523  RNLGIDEFRFLLQTMVNSGVGEQTYIPINVLEGREDSPTLEDSFTEVDDIMFQTLDNLFA  1344
             +NLG++E RFLL+T+VNSG+GE+T  P +++EGRE++PT  D   E+D I+F TLD LFA
Sbjct  59    KNLGLEELRFLLKTIVNSGIGEETSCPRSIIEGREENPTGADELNEMDGIIFDTLDKLFA  118

Query  1343  K-SKVSPREIDvlvvnvsllasapsLTSRVVNRYKMREDVKTFNLSGMGCSASVVAIDIV  1167
             + + + P +ID+LVVNVS+ + APSLTSR++NRYKMRED+K+FNLSGMGCSAS+VAID+V
Sbjct  119   RNAAIPPSQIDILVVNVSMFSPAPSLTSRIINRYKMREDIKSFNLSGMGCSASLVAIDVV  178

Query  1166  HHLFKVYKNSYAIVVSTESLGANWYSGKERSMMLSNCLFRSGGCSMLFTNNPALKPRAIL  987
              +LFK YKN+ A+VVSTESL  NWY GKE+SMML+NCLFRSGGCSMLFTNN  L+ +A L
Sbjct  179   QNLFKSYKNANAVVVSTESLAPNWYCGKEKSMMLTNCLFRSGGCSMLFTNNRTLQHQAKL  238

Query  986   KLKHMVRTHIAAIDEAYECCKQVEDPQGFRGFHLSKRLPKVATKALVTNFKVLVPKAIPL  807
             KL+H+VRTHI +  EAYECC Q+ED  G++GF L+K L K A  AL  N + LVPK +PL
Sbjct  239   KLQHLVRTHIGSNTEAYECCIQLEDESGYQGFRLTKHLTKAAAMALTMNLQDLVPKVLPL  298

Query  806   WETLRFLAVSSLERR---KFKLPSLLGKPILNMKTGIEHFCLHPGGRAVIDGVGVSLGLS  636
              E   +L  S +  R   K +    +G   LN+K GIEHFC+HPGGRA+IDG+G SLGLS
Sbjct  299   RELFLYLVASRVRNRTGTKSQKLEAVGMG-LNLKAGIEHFCIHPGGRAIIDGIGKSLGLS  357

Query  635   EYDLEPARMSLHRWGNTSAGGLWYVLGYMEAKKRLKKGDRILMLSLGAGFKCNNCVWEVM  456
             ++DLEP+R++LHR+GNTS  G WY LGYMEAKKRLKKG++ILM   GAGFKCNN VWEV+
Sbjct  358   DHDLEPSRLTLHRFGNTSTAGFWYALGYMEAKKRLKKGNKILMSGFGAGFKCNNTVWEVL  417

Query  455   KDLGDPNVWEDCIDRYPP-ETLVNPFTEKFDWIHDPCLNFLR  333
             KDL D NVW+DCI+ YPP  TL NP+ EK+ W++D  L+F+R
Sbjct  418   KDLDDANVWKDCIESYPPNNTLGNPYMEKYSWLNDEYLSFVR  459



>gb|AGK30010.1| 3-ketoacyl-CoA synthase 15 [Gossypium raimondii]
Length=462

 Score =   550 bits (1417),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 273/456 (60%), Positives = 352/456 (77%), Gaps = 14/456 (3%)
 Frame = -1

Query  1703  METLVAIYSLLFLYTVVYILRSYLRRRHQCCYMLNYECYKPTDVARRLSTDKSALVVYRN  1524
             M+  +AI SLLFL  + +I +SYL++R+Q CY+L YECYK +D   +L T+    ++ RN
Sbjct  1     MDLFMAI-SLLFLCFIFFIYKSYLQKRNQNCYLLGYECYKASD-DLKLDTETCGKLILRN  58

Query  1523  RNLGIDEFRFLLQTMVNSGVGEQTYIPINVLEGREDSPTLEDSFTEVDDIMFQTLDNLFA  1344
             +NLG D+++FLL+TMVN+G+GE+TY P NV++G E++P L  S +EVDDI+F TLD LF 
Sbjct  59    KNLGSDQYKFLLRTMVNAGIGEETYGPRNVIDGTEETPNLSGSLSEVDDIVFGTLDKLFD  118

Query  1343  KSKVSPREIDvlvvnvsllasapsLTSRVVNRYKMREDVKTFNLSGMGCSASVVAIDIVH  1164
              + VSP EID+LV+ +S++ S PSL +RV+NRYKMR+DVK FNLSGMGCSASV+A+D+VH
Sbjct  119   NNGVSPSEIDILVITISMITSVPSLPARVINRYKMRDDVKVFNLSGMGCSASVIAVDLVH  178

Query  1163  HLFKVYKNSYAIVVSTESLGANWYSGKERSMMLSNCLFRSGGCSMLFTNNPALKPRAILK  984
             HLFK Y NS+A++VS+ESL  NWY G ERSMML N LFR GGCS+L TN  ++K ++++K
Sbjct  179   HLFKTYMNSFAVIVSSESLIPNWYRGNERSMMLPNILFRLGGCSLLLTNKSSMKHKSLMK  238

Query  983   LKHMVRTHIAAIDEAYECCKQVEDPQGFRGFHLSKRLPKVATKALVTNFKVLVPKAIPLW  804
             LK  VR H  A DEAY+ C +VED QG+ GF LSK LP+ A KA+  NF+VL+PK +PL 
Sbjct  239   LKLSVRFHGGASDEAYQSCTRVEDSQGYCGFSLSKSLPQAAAKAVTMNFRVLLPKTLPLR  298

Query  803   ETLRFLAVSSLERR----KFKLPSLLGKPILNMKTGIEHFCLHPGGRAVIDGVGVSLGLS  636
             E +R+  VS L  +    K K PS      LNMK+G +HFC+HPGGRAVID +G SLGL+
Sbjct  299   ELVRYATVSFLHSKTNNNKGKTPS------LNMKSGFQHFCIHPGGRAVIDAMGRSLGLN  352

Query  635   EYDLEPARMSLHRWGNTSAGGLWYVLGYMEAKKRLKKGDRILMLSLGAGFKCNNCVWEVM  456
             EYDLEP RM+LHR+GNTSA G+WYVL YMEAKKRLKKGDRILM+SLGAGFKCNNCVWEVM
Sbjct  353   EYDLEPTRMALHRFGNTSAAGIWYVLSYMEAKKRLKKGDRILMISLGAGFKCNNCVWEVM  412

Query  455   KD-LGDPNVWEDCIDRYPPETLVN-PFTEKFDWIHD  354
             KD + D NVW+DCI RYP ++  N  F EK+ W+++
Sbjct  413   KDAMDDVNVWKDCISRYPVKSTANTSFLEKYSWVNE  448



>emb|CDX70217.1| BnaA10g25660D [Brassica napus]
Length=463

 Score =   548 bits (1413),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 275/464 (59%), Positives = 362/464 (78%), Gaps = 8/464 (2%)
 Frame = -1

Query  1712  FYHMETLVAIYSLLFLYTVVYILRSYLRRRHQCCYMLNYECYKPTDVARRLSTDKSALVV  1533
              + + +L  I +LL LY   Y+L    +R  + C+ML+YECYK  D  R+L T+  A +V
Sbjct  3     LFSLPSLFLISTLLVLYISKYVLN---KRNQRNCFMLHYECYKGKD-ERKLDTETCAKIV  58

Query  1532  YRNRNLGIDEFRFLLQTMVNSGVGEQTYIPINVLEGREDSPTLEDSFTEVDDIMFQTLDN  1353
              RN+NLG++E+RFLL+TMV+SG+GE+TY P NVLEGRE SPTL D+ +E+D+IMF TLD 
Sbjct  59    QRNKNLGLEEYRFLLRTMVSSGIGEETYGPRNVLEGREASPTLLDAHSEMDEIMFDTLDK  118

Query  1352  LFAKSK--VSPREIDvlvvnvsllasapsLTSRVVNRYKMREDVKTFNLSGMGCSASVVA  1179
             LF K+K  VSP +ID+LVVNVSL A +PSLTSRV+NRYKMRED+K++NLSG+GCSASV++
Sbjct  119   LFHKTKGLVSPSDIDILVVNVSLFAPSPSLTSRVINRYKMREDIKSYNLSGLGCSASVIS  178

Query  1178  IDIVHHLFKVYKNSYAIVVSTESLGANWYSGKERSMMLSNCLFRSGGCSMLFTNNPALKP  999
             IDIV H+F+  +NS+A+VVSTE++G +WY GK+RSMMLSNCLFR+GG S+L TN P  K 
Sbjct  179   IDIVQHIFETRENSFALVVSTETMGPHWYCGKDRSMMLSNCLFRAGGSSVLLTNAPRFKN  238

Query  998   RAILKLKHMVRTHIAAIDEAYECCKQVEDPQGFRGFHLSKRLPKVATKALVTNFKVLVPK  819
              A++KL   VR H+ + DEAY CC Q+ED  G  GF L+K L K A +AL  N KVL+P+
Sbjct  239   MALMKLVTAVRAHVGSDDEAYSCCIQMEDKDGHPGFLLTKYLQKAAARALTLNLKVLLPR  298

Query  818   AIPLWETLRFLAVSSLER-RKFKLPSLLGKPILNMKTGIEHFCLHPGGRAVIDGVGVSLG  642
              +PL E +R+  V + +R    K  S      L++KTG++HFC+HPGGRA+I+GVG SLG
Sbjct  299   VLPLKELIRYAIVRAFKRITTTKGESTSSGIDLDLKTGLDHFCIHPGGRAIIEGVGKSLG  358

Query  641   LSEYDLEPARMSLHRWGNTSAGGLWYVLGYMEAKKRLKKGDRILMLSLGAGFKCNNCVWE  462
             L+E+D+EPARM+LHR+GNTS+GGLWYVLGYMEAKKRLKKGD+ILM+S+GAGF+ NNCVW+
Sbjct  359   LTEFDIEPARMALHRFGNTSSGGLWYVLGYMEAKKRLKKGDKILMMSMGAGFESNNCVWK  418

Query  461   VMKDLGDPNVWEDCIDRYPPETLV-NPFTEKFDWIHDPCLNFLR  333
             V+KDL D NVWED IDRYP  + + NPF EK++WI+D  ++F+R
Sbjct  419   VLKDLDDKNVWEDSIDRYPEMSKIPNPFLEKYNWINDDTMSFVR  462



>ref|XP_010520159.1| PREDICTED: 3-ketoacyl-CoA synthase 21-like [Tarenaya hassleriana]
 ref|XP_010520160.1| PREDICTED: 3-ketoacyl-CoA synthase 21-like [Tarenaya hassleriana]
 ref|XP_010520161.1| PREDICTED: 3-ketoacyl-CoA synthase 21-like [Tarenaya hassleriana]
 ref|XP_010520162.1| PREDICTED: 3-ketoacyl-CoA synthase 21-like [Tarenaya hassleriana]
 ref|XP_010520163.1| PREDICTED: 3-ketoacyl-CoA synthase 21-like [Tarenaya hassleriana]
Length=458

 Score =   548 bits (1412),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 273/443 (62%), Positives = 352/443 (79%), Gaps = 3/443 (1%)
 Frame = -1

Query  1658  VVYILRSYLRRRHQCCYMLNYECYKPTDVARRLSTDKSALVVYRNRNLGIDEFRFLLQTM  1479
             V Y+LR  L  R Q CYML+YECYK  D   +L+T K A VV RN+NLG++E+RFLL+TM
Sbjct  16    VSYMLRWVLEWRSQRCYMLHYECYKGRD-EMKLNTGKCAEVVQRNKNLGLEEYRFLLRTM  74

Query  1478  VNSGVGEQTYIPINVLEGREDSPTLEDSFTEVDDIMFQTLDNLFAKSKVSPREIDvlvvn  1299
             V+SG+GE+TY P NVLEGRE++PTL D+ +E+DDI+F T DNLF ++ VSP EID+LV+N
Sbjct  75    VSSGIGEETYGPRNVLEGREENPTLPDALSEMDDIIFSTTDNLFRRTGVSPSEIDILVLN  134

Query  1298  vsllasapsLTSRVVNRYKMREDVKTFNLSGMGCSASVVAIDIVHHLFKVYKNSYAIVVS  1119
             VSL A APSL SRV+NRYKMR+D+K +NLSG+GCSASV++ID+V  LFK  KNS A+VVS
Sbjct  135   VSLFAPAPSLASRVINRYKMRDDIKCYNLSGLGCSASVISIDLVQRLFKTCKNSLALVVS  194

Query  1118  TESLGANWYSGKERSMMLSNCLFRSGGCSMLFTNNPALKPRAILKLKHMVRTHIAAIDEA  939
             TE++G +WY GK RSMMLSNCLFR+GG S+L TN+P  K +AI++LK +VR H+ + D+A
Sbjct  195   TETMGPHWYCGKNRSMMLSNCLFRAGGSSVLLTNDPRRKNKAIMRLKTVVRAHVGSDDDA  254

Query  938   YECCKQVEDPQGFRGFHLSKRLPKVATKALVTNFKVLVPKAIPLWETLRFLAVSSLERRK  759
             Y CC Q+ED +G++GF L+K L   A KAL  N +VL+PK +P+ E LR+  V SL ++K
Sbjct  255   YSCCIQMEDKEGYQGFLLTKYLKNAAAKALTKNLQVLLPKVLPMKELLRYAIVRSL-KKK  313

Query  758   FKLPSLLGKPILNMKTGIEHFCLHPGGRAVIDGVGVSLGLSEYDLEPARMSLHRWGNTSA  579
              K  S  G   LN+KTG++HFC+HPGGRA+I+G G SLGL+EYD+EP+R +LHR+GNTS+
Sbjct  314   TKGESSGGGIGLNLKTGLQHFCIHPGGRAIIEGAGKSLGLNEYDIEPSRNALHRFGNTSS  373

Query  578   GGLWYVLGYMEAKKRLKKGDRILMLSLGAGFKCNNCVWEVMKDLGDPNVWEDCIDRYPPE  399
             GGLWYVLGYMEAKKRL+KGD++LM+S+GAGF+ NNCVW++MKDL D NVW D I RYP  
Sbjct  374   GGLWYVLGYMEAKKRLRKGDKLLMISMGAGFESNNCVWDIMKDLDDENVWTDSIQRYPEA  433

Query  398   TLV-NPFTEKFDWIHDPCLNFLR  333
               V NPF EKFDWI+D  L+ +R
Sbjct  434   AKVPNPFKEKFDWINDETLSSVR  456



>ref|XP_009357643.1| PREDICTED: 3-ketoacyl-CoA synthase 21-like [Pyrus x bretschneideri]
Length=471

 Score =   547 bits (1410),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 276/463 (60%), Positives = 344/463 (74%), Gaps = 7/463 (2%)
 Frame = -1

Query  1703  METLVAIYSLLFLYTVVYILRSYLRRRHQCCYMLNYECYKPTDVARRLSTDKSALVVYRN  1524
             M  L+A   L   Y    + +  LRRR Q CY+L YEC+ P D   +LS D    +V RN
Sbjct  1     MGILMATCLLALFYGFSCLCKLLLRRRDQACYLLAYECHMPPD-DMKLSADSCVKIVSRN  59

Query  1523  RNLGIDEFRFLLQTMVNSGVGEQTYIPINVLEGREDSPTLEDSFTEVDDIMFQTLDNLFA  1344
             RNLG++EFRFLL+T+ +SG+GE+TY   N+++GRE++ T ED   E+D I+F  LD LFA
Sbjct  60    RNLGLEEFRFLLKTITHSGIGEETYCARNIIQGREETATREDELAEMDGIIFDALDKLFA  119

Query  1343  KS-KVSPREIDvlvvnvsllasapsLTSRVVNRYKMREDVKTFNLSGMGCSASVVAIDIV  1167
             ++  +SP +ID+LVVNVS+ + APSL+SR+VNRYKMR+D+K+FNLSGMGCSAS++AID+V
Sbjct  120   RATSISPSQIDILVVNVSMFSPAPSLSSRIVNRYKMRDDIKSFNLSGMGCSASLIAIDVV  179

Query  1166  HHLFKVYKNSYAIVVSTESLGANWYSGKERSMMLSNCLFRSGGCSMLFTNNPALKPRAIL  987
              +LFK +KN+ AIVVSTESL  +WY G E+SMML+NCLFRSGGC+ML TNN +LK +A L
Sbjct  180   QNLFKSHKNANAIVVSTESLAPHWYCGVEKSMMLTNCLFRSGGCAMLLTNNRSLKHQAKL  239

Query  986   KLKHMVRTHIAAIDEAYECCKQVEDPQGFRGFHLSKRLPKVATKALVTNFKVLVPKAIPL  807
             KL H+VR H  + DEAY CC QVED  G RGF L+K L K AT+    N +VL PK +PL
Sbjct  240   KLNHLVRMHTGSNDEAYNCCIQVEDESGNRGFRLTKYLVKAATQGFTKNLEVLAPKILPL  299

Query  806   WETLRFLAVSSLERRKFKL----PSLLGKPILNMKTGIEHFCLHPGGRAVIDGVGVSLGL  639
              E LR+L VS L   +  +    P   G   LN+KTGIEHFC+HPGGRA+IDG+G SLGL
Sbjct  300   REILRYLVVSRLHNIRTSITSQKPKADGGLRLNLKTGIEHFCIHPGGRAIIDGIGKSLGL  359

Query  638   SEYDLEPARMSLHRWGNTSAGGLWYVLGYMEAKKRLKKGDRILMLSLGAGFKCNNCVWEV  459
             S+YD+EP+RM+LHR+GNTS  G WY LGYMEAKKRLKKG+RILM   GAGFKCNN VWEV
Sbjct  360   SDYDVEPSRMALHRFGNTSGAGFWYALGYMEAKKRLKKGNRILMSGFGAGFKCNNIVWEV  419

Query  458   MKDLGDPNVWEDCIDRYPPE-TLVNPFTEKFDWIHDPCLNFLR  333
             MKDL D NVW+DCID YP +   VNPF EK+ WIHD  L F+R
Sbjct  420   MKDLDDVNVWKDCIDSYPRDLNQVNPFMEKYGWIHDDDLGFVR  462



>ref|XP_010452351.1| PREDICTED: 3-ketoacyl-CoA synthase 21-like [Camelina sativa]
Length=464

 Score =   546 bits (1408),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 273/448 (61%), Positives = 356/448 (79%), Gaps = 8/448 (2%)
 Frame = -1

Query  1658  VVYILR-SYLRRRHQCCYMLNYECYKPTDVARRLSTDKSALVVYRNRNLGIDEFRFLLQT  1482
             V YI +  Y RR  + C+ML+YECYK  D  R+L T+  A VV RN+NLG++E+RFLL+T
Sbjct  17    VFYIFKFVYKRRNQRNCFMLHYECYKGMD-ERKLDTETCAKVVQRNKNLGLEEYRFLLRT  75

Query  1481  MVNSGVGEQTYIPINVLEGREDSPTLEDSFTEVDDIMFQTLDNLFAKSK--VSPREIDvl  1308
             M +SG+GE+TY P NVLEGREDSPTL D+ +E+D+IMF TLD LF K+K  VSP +ID+L
Sbjct  76    MASSGIGEETYGPRNVLEGREDSPTLRDAHSEMDEIMFDTLDKLFQKTKGLVSPSDIDIL  135

Query  1307  vvnvsllasapsLTSRVVNRYKMREDVKTFNLSGMGCSASVVAIDIVHHLFKVYKNSYAI  1128
             VVNVSL A +PSLTSRV+NRYKMRED+++FNLSG+GCSASV++IDIV  +F+  KN+ A+
Sbjct  136   VVNVSLFAPSPSLTSRVINRYKMREDIRSFNLSGLGCSASVISIDIVQRIFETRKNAIAL  195

Query  1127  VVSTESLGANWYSGKERSMMLSNCLFRSGGCSMLFTNNPALKPRAILKLKHMVRTHIAAI  948
             VVSTE++G +WY G++RSMMLSNCLFR+GG S+L TN    K RA++KL  +VR H+ A 
Sbjct  196   VVSTETMGPHWYCGRDRSMMLSNCLFRAGGSSVLLTNAARFKNRALMKLVTVVRAHVGAD  255

Query  947   DEAYECCKQVEDPQGFRGFHLSKRLPKVATKALVTNFKVLVPKAIPLWETLRFLAVSSLE  768
             DEAY CC Q+ED  G  GF L+K L K A +AL  N +VL+P+ +P+ E +R+  V +++
Sbjct  256   DEAYSCCIQMEDGDGHPGFLLTKHLKKAAGRALTKNLQVLLPRVLPIKELIRYAIVRAVK  315

Query  767   RR--KFKLPSLLGKPILNMKTGIEHFCLHPGGRAVIDGVGVSLGLSEYDLEPARMSLHRW  594
             RR  + + P   G   LN+KTG++HFC+HPGGRA+I+GVG SLGL+E+D+EPARM+LHR+
Sbjct  316   RRITRKREPGSSGIG-LNLKTGLQHFCIHPGGRAIIEGVGKSLGLTEFDIEPARMALHRF  374

Query  593   GNTSAGGLWYVLGYMEAKKRLKKGDRILMLSLGAGFKCNNCVWEVMKDLGDPNVWEDCID  414
             GNTS+GGLWYVLGYMEAK RLKKG +ILM+S+GAGF+ NNCVWEV+KDLGD NVWED ID
Sbjct  375   GNTSSGGLWYVLGYMEAKNRLKKGHKILMMSMGAGFESNNCVWEVLKDLGDKNVWEDSID  434

Query  413   RYPP-ETLVNPFTEKFDWIHDPCLNFLR  333
             RYP   ++ NPF EK+DWI+D  ++F+R
Sbjct  435   RYPELSSIPNPFVEKYDWINDDTMSFVR  462



>ref|XP_009335921.1| PREDICTED: 3-ketoacyl-CoA synthase 21-like [Pyrus x bretschneideri]
Length=471

 Score =   546 bits (1408),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 275/463 (59%), Positives = 343/463 (74%), Gaps = 7/463 (2%)
 Frame = -1

Query  1703  METLVAIYSLLFLYTVVYILRSYLRRRHQCCYMLNYECYKPTDVARRLSTDKSALVVYRN  1524
             M  L+A   L   Y    + +  LRRR Q CY+L YEC+ P D   +LS D    +V RN
Sbjct  1     MGILMATCLLALFYGFSCLCKLLLRRRDQACYLLAYECHMPPD-DMKLSADSCVKIVSRN  59

Query  1523  RNLGIDEFRFLLQTMVNSGVGEQTYIPINVLEGREDSPTLEDSFTEVDDIMFQTLDNLFA  1344
             RNLG++EFRFLL+T+ +SG+GE+TY   N+++GRE++ T ED   E+D I+F  LD LFA
Sbjct  60    RNLGLEEFRFLLKTITHSGIGEETYCARNIIQGREETATREDELAEMDGIIFDALDKLFA  119

Query  1343  KS-KVSPREIDvlvvnvsllasapsLTSRVVNRYKMREDVKTFNLSGMGCSASVVAIDIV  1167
             ++  +SP +ID+LVVNVS+ + APSL+SR+VNRYKMR+D+K+FNLSGMGCSAS++AID+V
Sbjct  120   RATSISPSQIDILVVNVSMFSPAPSLSSRIVNRYKMRDDIKSFNLSGMGCSASLIAIDVV  179

Query  1166  HHLFKVYKNSYAIVVSTESLGANWYSGKERSMMLSNCLFRSGGCSMLFTNNPALKPRAIL  987
              +LFK +KN+ AIVVSTESL  +WY G E+SMML+NCLFRSGGC+ML TNN +LK +A L
Sbjct  180   QNLFKSHKNANAIVVSTESLAPHWYCGVEKSMMLTNCLFRSGGCAMLLTNNRSLKHQAKL  239

Query  986   KLKHMVRTHIAAIDEAYECCKQVEDPQGFRGFHLSKRLPKVATKALVTNFKVLVPKAIPL  807
             KL H+VR H  + DEAY CC QVED  G RGF L+K L K AT+    N +VL PK +PL
Sbjct  240   KLNHLVRMHTGSNDEAYNCCIQVEDESGNRGFRLTKYLVKAATQGFTKNLQVLAPKILPL  299

Query  806   WETLRFLAVSSLERRKFKL----PSLLGKPILNMKTGIEHFCLHPGGRAVIDGVGVSLGL  639
              E LR+L  S L   +  +    P   G   LN+KTGIEHFC+HPGGRA+IDG+G SLGL
Sbjct  300   REILRYLVASRLNNIRTSITSQKPKADGGLRLNLKTGIEHFCIHPGGRAIIDGIGKSLGL  359

Query  638   SEYDLEPARMSLHRWGNTSAGGLWYVLGYMEAKKRLKKGDRILMLSLGAGFKCNNCVWEV  459
             S+YD+EP+RM+LHR+GNTS  G WY LGYMEAKKRLKKG+RILM   GAGFKCNN VWEV
Sbjct  360   SDYDVEPSRMALHRFGNTSGAGFWYALGYMEAKKRLKKGNRILMSGFGAGFKCNNIVWEV  419

Query  458   MKDLGDPNVWEDCIDRYPPE-TLVNPFTEKFDWIHDPCLNFLR  333
             MKDL D NVW+DCID YP +   VNPF EK+ WIHD  L F+R
Sbjct  420   MKDLDDVNVWKDCIDSYPRDLNQVNPFMEKYGWIHDDDLGFVR  462



>gb|AGK30013.1| 3-ketoacyl-CoA synthase [Gossypium raimondii]
Length=449

 Score =   545 bits (1405),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 276/451 (61%), Positives = 346/451 (77%), Gaps = 6/451 (1%)
 Frame = -1

Query  1703  METLVAIYSLLFLYTVVYILRSYLRRRHQCCYMLNYECYKPTDVARRLSTDKSALVVYRN  1524
             ME  + I+ L+FLY +       L  R Q CY++ YECYK  D   +L T+    +V RN
Sbjct  1     MELFITIF-LVFLYFMFVFFIYKLLWRTQSCYIVAYECYKAPD-DMKLDTETCGNLVLRN  58

Query  1523  RNLGIDEFRFLLQTMVNSGVGEQTYIPINVLEGREDSPTLEDSFTEVDDIMFQTLDNLFA  1344
             +NLG+ E++FLLQ MVN+G+GE+TY P NV+ GRE+SP L ++ +E+DDI+F TLD LFA
Sbjct  59    KNLGVGEYKFLLQAMVNAGIGEETYGPRNVIAGREESPNLSNALSEIDDIVFGTLDKLFA  118

Query  1343  KSKVSPREIDvlvvnvsllasapsLTSRVVNRYKMREDVKTFNLSGMGCSASVVAIDIVH  1164
             K+ V P EIDVLVV +S+++S PS+ +RV+NRYKMREDVK FNLSGMGCSAS++A+D+V+
Sbjct  119   KTGVLPSEIDVLVVTISMISSVPSIPARVINRYKMREDVKVFNLSGMGCSASLIAVDLVN  178

Query  1163  HLFKVYKNSYAIVVSTESLGANWYSGKERSMMLSNCLFRSGGCSMLFTNNPALKPRAILK  984
             HLF+ YKN +AIVVS+ESL  NWY GKERSMML N LFR GGCS+L TN   LK RAILK
Sbjct  179   HLFQTYKNQFAIVVSSESLSPNWYVGKERSMMLPNILFRIGGCSLLLTNKRGLKHRAILK  238

Query  983   LKHMVRTHIAAIDEAYECCKQVEDPQGFRGFHLSKRLPKVATKALVTNFKVLVPKAIPLW  804
             L H+VRTH+ +IDEAY  C ++ED QG  GF L+K LPK A KA+  N +VLVPK +PL 
Sbjct  239   LNHLVRTHVGSIDEAYGSCTRIEDDQGNCGFFLTKNLPKAAAKAVSMNLRVLVPKMLPLR  298

Query  803   ETLRFLAVSSLERRKFKLPSLLGKPILNMKTGIEHFCLHPGGRAVIDGVGVSLGLSEYDL  624
             E +R+ +V +  R K K  S   +  LN+K+GI++FC+HPGGRAVID +G SLGL+EYDL
Sbjct  299   ELIRY-SVVTYWRNKSKTSS--PESGLNLKSGIDYFCIHPGGRAVIDAMGRSLGLNEYDL  355

Query  623   EPARMSLHRWGNTSAGGLWYVLGYMEAKKRLKKGDRILMLSLGAGFKCNNCVWEVMKDLG  444
             EP RM+LHR+GNTSA GLWYVL YMEAKKRLKKGDRILM+SLGAGFKCNNCVWEVMK+L 
Sbjct  356   EPTRMALHRFGNTSAAGLWYVLSYMEAKKRLKKGDRILMISLGAGFKCNNCVWEVMKNLD  415

Query  443   DPNVWEDCIDRYPPETLVN-PFTEKFDWIHD  354
             D NVWEDCI RYP +   N  F EK+ W+++
Sbjct  416   DVNVWEDCIGRYPLKCTANTSFLEKYSWVNE  446



>ref|XP_010423567.1| PREDICTED: 3-ketoacyl-CoA synthase 21-like [Camelina sativa]
Length=464

 Score =   545 bits (1404),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 272/446 (61%), Positives = 356/446 (80%), Gaps = 8/446 (2%)
 Frame = -1

Query  1652  YILRSYLRRRHQ-CCYMLNYECYKPTDVARRLSTDKSALVVYRNRNLGIDEFRFLLQTMV  1476
             YI +   +RR+Q  C+ML+YECYK  D  R+L T+  A VV RN+NLG++E+RFLL+TM 
Sbjct  19    YIFKFVCKRRNQRNCFMLHYECYKGMD-ERKLDTETCAKVVQRNKNLGLEEYRFLLRTMA  77

Query  1475  NSGVGEQTYIPINVLEGREDSPTLEDSFTEVDDIMFQTLDNLFAKSK--VSPREIDvlvv  1302
             +SG+GE+TY PINVLEGREDSPTL D+ +E+D+I+F TLD LF K+K  VSP +ID+LVV
Sbjct  78    SSGIGEETYGPINVLEGREDSPTLRDAHSEMDEIIFDTLDKLFQKTKGLVSPSDIDILVV  137

Query  1301  nvsllasapsLTSRVVNRYKMREDVKTFNLSGMGCSASVVAIDIVHHLFKVYKNSYAIVV  1122
             NVSL A +PSLTSRV+NRYKMRED+++FNLSG+GCSASV++IDIV  +F+  +N+ A+VV
Sbjct  138   NVSLFAPSPSLTSRVINRYKMREDIRSFNLSGLGCSASVISIDIVQRIFETRENAIALVV  197

Query  1121  STESLGANWYSGKERSMMLSNCLFRSGGCSMLFTNNPALKPRAILKLKHMVRTHIAAIDE  942
             STE++G +WY G++RSMMLSNCLFR+GG S+L TN    K RA++KL  +VR H+ A DE
Sbjct  198   STETMGPHWYCGRDRSMMLSNCLFRAGGSSVLLTNAARFKNRALMKLVTVVRAHVGADDE  257

Query  941   AYECCKQVEDPQGFRGFHLSKRLPKVATKALVTNFKVLVPKAIPLWETLRFLAVSSLERR  762
             AY CC Q+ED  G  GF L+K L K A +AL  N +VL+P+ +P+ E +R+  V +++RR
Sbjct  258   AYSCCIQMEDGDGHPGFLLTKHLKKAAGRALTKNLQVLLPRVLPIKELIRYAIVRAVKRR  317

Query  761   --KFKLPSLLGKPILNMKTGIEHFCLHPGGRAVIDGVGVSLGLSEYDLEPARMSLHRWGN  588
               + + P   G   LN+KTG++HFC+HPGGRA+I+GVG SLGL+E+D+EPARM+LHR+GN
Sbjct  318   ITRKREPGSSGIG-LNLKTGLQHFCIHPGGRAIIEGVGKSLGLTEFDIEPARMALHRFGN  376

Query  587   TSAGGLWYVLGYMEAKKRLKKGDRILMLSLGAGFKCNNCVWEVMKDLGDPNVWEDCIDRY  408
             TS+GGLWYVLGYMEAK RLKKG +ILM+S+GAGF+ NNCVWEV+KDLGD NVWED IDRY
Sbjct  377   TSSGGLWYVLGYMEAKNRLKKGHKILMMSMGAGFESNNCVWEVLKDLGDKNVWEDSIDRY  436

Query  407   PP-ETLVNPFTEKFDWIHDPCLNFLR  333
             P    + NPF EK+DWI+D  ++FLR
Sbjct  437   PELSNIPNPFVEKYDWINDDTMSFLR  462



>ref|XP_002313455.1| beta-ketoacyl-CoA synthase family protein [Populus trichocarpa]
 gb|EEE87410.1| beta-ketoacyl-CoA synthase family protein [Populus trichocarpa]
Length=461

 Score =   545 bits (1404),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 268/463 (58%), Positives = 362/463 (78%), Gaps = 8/463 (2%)
 Frame = -1

Query  1703  METLVAIYSLLFLYTVVYILRSYLRRRHQCCYMLNYECYKPTDVARRLSTDKSALVVYRN  1524
             M+ L+ +Y+ L  Y ++ + R   R+R + CY+L+YECYKPTD  R+L T+ S  V+ R+
Sbjct  1     MDFLLLVYAFLIFYPLLVLWRGIDRKRDRECYILDYECYKPTD-DRKLDTEFSGKVIMRS  59

Query  1523  RNLGIDEFRFLLQTMVNSGVGEQTYIPINVLEGREDSPTLEDSFTEVDDIMFQTLDNLFA  1344
             + LG++E++FLL+ +V+SG+GEQTY P  + +G+E++PTL+DS +EV++    +++ L A
Sbjct  60    KQLGLNEYKFLLKAIVSSGIGEQTYGPRIMFKGQEENPTLQDSVSEVEEFFHDSIEKLLA  119

Query  1343  KSKVSPREIDvlvvnvsllasapsLTSRVVNRYKMREDVKTFNLSGMGCSASVVAIDIVH  1164
             +S +SPREIDVLVVNVS+L+S PSL +R++N YK+REDVK FNLSGMGCSAS++++DIV 
Sbjct  120   RSGISPREIDVLVVNVSMLSSVPSLAARIINHYKLREDVKVFNLSGMGCSASLISVDIVQ  179

Query  1163  HLFKVYKNSYAIVVSTESLGANWYSGKERSMMLSNCLFRSGGCSMLFTNNPALKPRAILK  984
             ++FK  KN YA+VV++ESL  NWYSG +RSM+L+NCLFRSGGC++L TN  ALK RA+ K
Sbjct  180   NVFKSCKNVYALVVTSESLSPNWYSGNDRSMILANCLFRSGGCAILLTNKRALKHRAMFK  239

Query  983   LKHMVRTHIAAIDEAYECCKQVEDPQGFRGFHLSKRLPKVATKALVTNFKVLVPKAIPLW  804
             LK +VRTH  A DE+Y+CC Q ED QG  GFHL K LPK AT+ALV N + + PK +P+ 
Sbjct  240   LKCLVRTHHGARDESYDCCLQREDEQGRLGFHLGKSLPKAATRALVDNLREITPKILPVR  299

Query  803   ETLRFLAVSSLERRKFKLPSLLG----KPILNMKTGIEHFCLHPGGRAVIDGVGVSLGLS  636
             E LRF+ VS + R+ +   S  G    KP++N KTG++HFC+H GG+AVIDG+GV+L L+
Sbjct  300   ELLRFMVVSFI-RKYWSHRSTKGVVSPKPVINFKTGVDHFCIHTGGKAVIDGIGVNLDLT  358

Query  635   EYDLEPARMSLHRWGNTSAGGLWYVLGYMEAKKRLKKGDRILMLSLGAGFKCNNCVWEVM  456
             EYDLEPARM+LHR+GNTSA  LWYVLGYMEAKKRLK+GDR+LM+S GAGFKCN+C+WEV+
Sbjct  359   EYDLEPARMTLHRFGNTSASSLWYVLGYMEAKKRLKRGDRVLMMSFGAGFKCNSCLWEVV  418

Query  455   KDLGDPNVWEDCIDRYPPETLVNPFTEKFDWIH--DPCLNFLR  333
             +DL   NVW+DCID YPP++L NPF EKF WI+  DP    +R
Sbjct  419   RDLDADNVWKDCIDSYPPKSLANPFMEKFGWINNEDPSTFVMR  461



>ref|XP_008369933.1| PREDICTED: 3-ketoacyl-CoA synthase 21-like [Malus domestica]
Length=469

 Score =   545 bits (1404),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 269/457 (59%), Positives = 356/457 (78%), Gaps = 8/457 (2%)
 Frame = -1

Query  1703  METLVAIYSLLFLYTVVYILRSYLRRRHQCCYMLNYECYKPTDVARRLSTDKSALVVYRN  1524
             ME L+A+  LL  +  +Y+    L+ RHQ CY+L YECYK TD  R+L T+    ++ RN
Sbjct  1     MELLLAMCLLLIFFACIYLCELLLQWRHQQCYLLAYECYKATD-ERKLDTESCVKIIRRN  59

Query  1523  RNLGIDEFRFLLQTMVNSGVGEQTYIPINVLEGREDSPTLEDSFTEVDDIMFQTLDNLFA  1344
              NLG++E+RFLL+T+VNSG+GE+TY P NV+ G ED P+LEDS  E+DDIMF TLD LF 
Sbjct  60    TNLGLEEYRFLLKTIVNSGLGEETYGPRNVIAGCEDCPSLEDSLWEMDDIMFGTLDKLFH  119

Query  1343  KSKVSPREIDvlvvnvsllasapsLTSRVVNRYKMREDVKTFNLSGMGCSASVVAIDIVH  1164
             K+ +SP +ID+LVVNVSL + APSLT+R++NRYKM+ D+K FNLSGMGCS S+VAID+V 
Sbjct  120   KTGISPSKIDILVVNVSLFSPAPSLTARIINRYKMKTDIKAFNLSGMGCSGSLVAIDLVQ  179

Query  1163  HLFKVYKNSYAIVVSTESLGANWYSGKERSMMLSNCLFRSGGCSMLFTNNPALKPRAILK  984
             +LFK YKN  A++VSTESL  NWY GK + MML+NCL+RSGGCSM+FTN   LK R++LK
Sbjct  180   NLFKTYKNVNAVLVSTESLAPNWYRGKVQPMMLANCLYRSGGCSMIFTNKMHLKHRSLLK  239

Query  983   LKHMVRTHIAAIDEAYECCKQVEDPQGFRGFHLSKRLPKVATKALVTNFKVLVPKAIPLW  804
             L+ +VRTH+ ++DE Y C  QVED  GFRGF+LSK + KVA KAL  N ++L+ K +PL 
Sbjct  240   LQCIVRTHLGSLDEGYGCSMQVEDENGFRGFNLSKSIAKVAAKALTMNLRILLRKVLPLT  299

Query  803   ETLRFLAVSSLERRKFKLPSLLGKPILNMKTGIEHFCLHPGGRAVIDGVGVSLGLSEYDL  624
             E LR++ VSS + +       +    LN+K G++HFC+ P   AV++GVG SLGL++YDL
Sbjct  300   ELLRYVIVSSRQNK-------VANAGLNLKAGLDHFCIPPTEAAVVNGVGKSLGLNDYDL  352

Query  623   EPARMSLHRWGNTSAGGLWYVLGYMEAKKRLKKGDRILMLSLGAGFKCNNCVWEVMKDLG  444
             EP RM+LHR+GNTS+GGLWYVLGYMEAK+RLKKG++ILM+S GAG++CNNCVWE+++D+ 
Sbjct  353   EPVRMALHRFGNTSSGGLWYVLGYMEAKRRLKKGEKILMVSFGAGYECNNCVWEILRDME  412

Query  443   DPNVWEDCIDRYPPETLVNPFTEKFDWIHDPCLNFLR  333
             + NVW+DCI+ YPPET+VNPF EK+ WI+D  L+F+R
Sbjct  413   NANVWKDCIETYPPETIVNPFMEKYSWINDEYLSFVR  449



>ref|XP_006398912.1| hypothetical protein EUTSA_v10013468mg [Eutrema salsugineum]
 gb|ESQ40365.1| hypothetical protein EUTSA_v10013468mg [Eutrema salsugineum]
Length=464

 Score =   545 bits (1403),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 275/462 (60%), Positives = 367/462 (79%), Gaps = 9/462 (2%)
 Frame = -1

Query  1694  LVAIYSLLFLYTVV--YILRSYLRRRHQ-CCYMLNYECYKPTDVARRLSTDKSALVVYRN  1524
             L +  SLL L T++  YI +  L +R+Q  C+ML+YEC+K  +  R+L T+  A VV RN
Sbjct  3     LFSFPSLLVLSTIIVFYISKFVLNKRNQRNCFMLHYECFKGKE-ERKLDTETCAKVVQRN  61

Query  1523  RNLGIDEFRFLLQTMVNSGVGEQTYIPINVLEGREDSPTLEDSFTEVDDIMFQTLDNLFA  1344
             +NLG++E+RFLL+TM +SG+GE+TY P NVLEGREDSP+L D+ +E+D+IMF TLD LF 
Sbjct  62    KNLGLEEYRFLLRTMASSGIGEETYGPRNVLEGREDSPSLLDAHSEMDEIMFDTLDKLFH  121

Query  1343  KSK--VSPREIDvlvvnvsllasapsLTSRVVNRYKMREDVKTFNLSGMGCSASVVAIDI  1170
             K+K  VSP +ID+LVVNVSL A +PSLTSRV+NRYKMRED+K+FNLSG+GCSASV+++DI
Sbjct  122   KTKGLVSPSDIDILVVNVSLFAPSPSLTSRVINRYKMREDIKSFNLSGLGCSASVISVDI  181

Query  1169  VHHLFKVYKNSYAIVVSTESLGANWYSGKERSMMLSNCLFRSGGCSMLFTNNPALKPRAI  990
             V  +F+  +N++A+VVSTE++G +WY GK+RSMMLSNCLFR+GG S+L TN    K RA+
Sbjct  182   VQRIFETRENAFALVVSTETMGPHWYCGKDRSMMLSNCLFRAGGSSVLLTNAARFKSRAL  241

Query  989   LKLKHMVRTHIAAIDEAYECCKQVEDPQGFRGFHLSKRLPKVATKALVTNFKVLVPKAIP  810
             +KL  +VR H+ + DEAY CC Q+ED +G  GF L+K L K A +AL  N +VL+P+ +P
Sbjct  242   MKLVTVVRAHVGSDDEAYSCCMQMEDKEGHPGFLLTKYLKKAAARALTKNLQVLLPRVLP  301

Query  809   LWETLRFLAVSSLERR-KFKLPSLLGKPI-LNMKTGIEHFCLHPGGRAVIDGVGVSLGLS  636
             + E LR+  V +L+RR   K  S     I L++KTG++HFC+HPGGRA+I+GVG SLGL+
Sbjct  302   IKELLRYAIVRALKRRTTAKGESSASSGIGLDLKTGLQHFCIHPGGRAIIEGVGKSLGLT  361

Query  635   EYDLEPARMSLHRWGNTSAGGLWYVLGYMEAKKRLKKGDRILMLSLGAGFKCNNCVWEVM  456
             E+D+EPARM+LHR+GNTS+GGLWYVLGYMEAKKRLKKGD+ILM+S+GAGF+ NNCVWEV+
Sbjct  362   EFDIEPARMALHRFGNTSSGGLWYVLGYMEAKKRLKKGDKILMMSMGAGFESNNCVWEVL  421

Query  455   KDLGDPNVWEDCIDRYPPETLV-NPFTEKFDWIHDPCLNFLR  333
             K+L   NVWED I+RYP  + + NPFTEK+DWI+D  ++F+R
Sbjct  422   KNLDGKNVWEDSIERYPGMSKIPNPFTEKYDWINDDTMSFVR  463



>ref|XP_010490966.1| PREDICTED: 3-ketoacyl-CoA synthase 21 [Camelina sativa]
Length=464

 Score =   544 bits (1401),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 271/448 (60%), Positives = 356/448 (79%), Gaps = 8/448 (2%)
 Frame = -1

Query  1658  VVYILR-SYLRRRHQCCYMLNYECYKPTDVARRLSTDKSALVVYRNRNLGIDEFRFLLQT  1482
             V YI +  Y RR  + C+ML+YECYK  D  R+L T+  A VV RN+NLG++E+RFLL+T
Sbjct  17    VFYIFKFVYKRRNQRNCFMLHYECYKGMD-ERKLDTETCAKVVQRNKNLGLEEYRFLLRT  75

Query  1481  MVNSGVGEQTYIPINVLEGREDSPTLEDSFTEVDDIMFQTLDNLFAKSK--VSPREIDvl  1308
             M +SG+GE+TY P NVLEGREDSPTL D+ +E+D+IMF TLD LF K+K  VSP +ID+L
Sbjct  76    MASSGIGEETYGPRNVLEGREDSPTLRDAHSEMDEIMFDTLDKLFQKTKGLVSPSDIDIL  135

Query  1307  vvnvsllasapsLTSRVVNRYKMREDVKTFNLSGMGCSASVVAIDIVHHLFKVYKNSYAI  1128
             VVNVSL A +PSLTSRV+NRYKMRED+++FNLSG+GCSASV++IDIV  +F+  +N+ A+
Sbjct  136   VVNVSLFAPSPSLTSRVINRYKMREDIRSFNLSGLGCSASVISIDIVQRIFETRENAIAL  195

Query  1127  VVSTESLGANWYSGKERSMMLSNCLFRSGGCSMLFTNNPALKPRAILKLKHMVRTHIAAI  948
             VVSTE++G +WY G++RSMMLSNCLFR+GG S+L TN    K RA++KL  +VR H+ A 
Sbjct  196   VVSTETMGPHWYCGRDRSMMLSNCLFRAGGSSVLLTNAARFKNRALMKLVTVVRAHVGAD  255

Query  947   DEAYECCKQVEDPQGFRGFHLSKRLPKVATKALVTNFKVLVPKAIPLWETLRFLAVSSLE  768
             DEAY CC Q+ED  G  GF L+K L K A +AL  N +VL+P+ +P+ E +R+  V +++
Sbjct  256   DEAYSCCIQMEDGDGHPGFLLTKHLKKAAGRALTKNLQVLLPRVLPIKELIRYAIVRAVK  315

Query  767   RR--KFKLPSLLGKPILNMKTGIEHFCLHPGGRAVIDGVGVSLGLSEYDLEPARMSLHRW  594
             RR  + + P   G   LN+KTG++HFC+HPGGRA+I+GVG SLGL+E+D+EPARM+LHR+
Sbjct  316   RRITRKREPGSSGIG-LNLKTGLQHFCIHPGGRAIIEGVGKSLGLTEFDIEPARMALHRF  374

Query  593   GNTSAGGLWYVLGYMEAKKRLKKGDRILMLSLGAGFKCNNCVWEVMKDLGDPNVWEDCID  414
             GNTS+GGLWYVLGYMEAK RLKKG +ILM+S+GAGF+ NNCVWEV+KDLGD NVWED +D
Sbjct  375   GNTSSGGLWYVLGYMEAKNRLKKGHKILMMSMGAGFESNNCVWEVLKDLGDKNVWEDSVD  434

Query  413   RYPPETLV-NPFTEKFDWIHDPCLNFLR  333
             RYP  + + NPF EK+DWI+D  ++F+R
Sbjct  435   RYPELSRIPNPFVEKYDWINDDTMSFIR  462



>ref|XP_002873154.1| beta-ketoacyl-CoA synthase family protein [Arabidopsis lyrata 
subsp. lyrata]
 gb|EFH49413.1| beta-ketoacyl-CoA synthase family protein [Arabidopsis lyrata 
subsp. lyrata]
Length=464

 Score =   543 bits (1398),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 270/447 (60%), Positives = 355/447 (79%), Gaps = 6/447 (1%)
 Frame = -1

Query  1658  VVYILRSYLRRRHQ-CCYMLNYECYKPTDVARRLSTDKSALVVYRNRNLGIDEFRFLLQT  1482
             V YI +  L+RR+Q  CYML+YECYK  D  R+L T+  A VV RN+NLG++E+RFLL+T
Sbjct  17    VFYISKFVLKRRNQRKCYMLHYECYKGMD-ERKLDTETCAKVVQRNKNLGLEEYRFLLRT  75

Query  1481  MVNSGVGEQTYIPINVLEGREDSPTLEDSFTEVDDIMFQTLDNLFAKSK--VSPREIDvl  1308
             M +SG+GE+TY P NVL+GREDSPTL D+ +E+D+IMF TLD LF K+K  +SP +ID+L
Sbjct  76    MASSGIGEETYGPRNVLDGREDSPTLLDAHSEMDEIMFDTLDKLFHKTKGLISPSDIDIL  135

Query  1307  vvnvsllasapsLTSRVVNRYKMREDVKTFNLSGMGCSASVVAIDIVHHLFKVYKNSYAI  1128
             VVNVSL A +PSLTSRV+NRYKMRED+K+FNLSG+GCSASV++IDIV  +F+  +N+ A+
Sbjct  136   VVNVSLFAPSPSLTSRVINRYKMREDIKSFNLSGLGCSASVISIDIVQRIFETTENAIAL  195

Query  1127  VVSTESLGANWYSGKERSMMLSNCLFRSGGCSMLFTNNPALKPRAILKLKHMVRTHIAAI  948
             VVSTE++G +WY GK+RSMMLSNCLFR+GG S+L TN    K RA++KL  +VR H+ + 
Sbjct  196   VVSTETMGPHWYCGKDRSMMLSNCLFRAGGSSVLLTNAARFKNRALMKLVTVVRAHVGSD  255

Query  947   DEAYECCKQVEDPQGFRGFHLSKRLPKVATKALVTNFKVLVPKAIPLWETLRFLAVSSLE  768
             DEAY CC Q+ED  G  GF L+K L K A +AL  N +VL+P+ +P+ E +R+  V +L+
Sbjct  256   DEAYSCCMQMEDRDGHPGFLLTKYLKKAAARALTKNLQVLLPRVLPVKELIRYAIVRALK  315

Query  767   RRKFKLPSLLGKPI-LNMKTGIEHFCLHPGGRAVIDGVGVSLGLSEYDLEPARMSLHRWG  591
             RR           I LN+KTG++HFC+HPGGRA+I+GVG SLGL+E+D+EPARM+LHR+G
Sbjct  316   RRTTAKREPASSGIGLNLKTGLQHFCIHPGGRAIIEGVGKSLGLTEFDIEPARMALHRFG  375

Query  590   NTSAGGLWYVLGYMEAKKRLKKGDRILMLSLGAGFKCNNCVWEVMKDLGDPNVWEDCIDR  411
             NTS+GGLWYVLGYMEAK RLKKG++ILM+S+GAGF+ NNCVWEV+KDL D NVW+D +DR
Sbjct  376   NTSSGGLWYVLGYMEAKNRLKKGEKILMMSMGAGFESNNCVWEVLKDLDDKNVWDDSVDR  435

Query  410   YPPETLV-NPFTEKFDWIHDPCLNFLR  333
             YP  + + NPF EK+DWI+D  ++F+R
Sbjct  436   YPELSRIPNPFVEKYDWINDDTMSFVR  462



>ref|XP_009122587.1| PREDICTED: 3-ketoacyl-CoA synthase 21 [Brassica rapa]
Length=463

 Score =   541 bits (1395),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 273/464 (59%), Positives = 360/464 (78%), Gaps = 8/464 (2%)
 Frame = -1

Query  1712  FYHMETLVAIYSLLFLYTVVYILRSYLRRRHQCCYMLNYECYKPTDVARRLSTDKSALVV  1533
              + + +L  I +LL LY   Y+L    +R  + C+ML+YECYK  D  R+L T+  A +V
Sbjct  3     LFSLPSLFLISTLLVLYISKYVLN---KRNQRNCFMLHYECYKGKD-ERKLDTETCAKIV  58

Query  1532  YRNRNLGIDEFRFLLQTMVNSGVGEQTYIPINVLEGREDSPTLEDSFTEVDDIMFQTLDN  1353
              RN+NLG++E+RFLL+TMV+SG+GE+TY P NVLEGRE SPTL D+ +E+D+IMF TLD 
Sbjct  59    QRNKNLGLEEYRFLLRTMVSSGIGEETYGPRNVLEGREASPTLLDAHSEMDEIMFDTLDK  118

Query  1352  LFAKSK--VSPREIDvlvvnvsllasapsLTSRVVNRYKMREDVKTFNLSGMGCSASVVA  1179
             LF K+K  VSP +ID+LVVNVSL A +PSLTSRV+NRYKMRED+K++NLSG+GCSASV++
Sbjct  119   LFHKTKGLVSPSDIDILVVNVSLFAPSPSLTSRVINRYKMREDIKSYNLSGLGCSASVIS  178

Query  1178  IDIVHHLFKVYKNSYAIVVSTESLGANWYSGKERSMMLSNCLFRSGGCSMLFTNNPALKP  999
             IDIV  +F+  +NS+A+VVSTE++G +WY GK+RSMMLSNCLFR+GG S+L TN P  K 
Sbjct  179   IDIVQRIFETRENSFALVVSTETMGPHWYCGKDRSMMLSNCLFRAGGSSVLLTNAPRFKN  238

Query  998   RAILKLKHMVRTHIAAIDEAYECCKQVEDPQGFRGFHLSKRLPKVATKALVTNFKVLVPK  819
              A++KL   VR H+ + DEAY CC Q+ED  G  GF L+K L K A +AL  N KVL+P+
Sbjct  239   MALMKLVTAVRAHVGSDDEAYSCCIQMEDKDGHPGFLLTKYLQKAAARALTLNLKVLLPR  298

Query  818   AIPLWETLRFLAVSSLER-RKFKLPSLLGKPILNMKTGIEHFCLHPGGRAVIDGVGVSLG  642
              +PL E +R+  V + +     K  S      L++KTG++HFC+HPGGRA+I+GVG SLG
Sbjct  299   VLPLKELIRYAIVRAFKGITTTKGESRSSGIGLDLKTGLDHFCIHPGGRAIIEGVGKSLG  358

Query  641   LSEYDLEPARMSLHRWGNTSAGGLWYVLGYMEAKKRLKKGDRILMLSLGAGFKCNNCVWE  462
             L+E+D+EPARM+LHR+GNTS+GGLWYVLGYMEAKKRLKKGD+ILM+S+GAGF+ NNCVW+
Sbjct  359   LTEFDIEPARMALHRFGNTSSGGLWYVLGYMEAKKRLKKGDKILMMSMGAGFESNNCVWK  418

Query  461   VMKDLGDPNVWEDCIDRYPPETLV-NPFTEKFDWIHDPCLNFLR  333
             V+KDL D NVWED IDRYP  + + NPF EK++WI+D  ++F+R
Sbjct  419   VLKDLDDKNVWEDSIDRYPEMSKIPNPFLEKYNWINDDTMSFVR  462



>emb|CDY04915.1| BnaAnng00970D [Brassica napus]
Length=462

 Score =   541 bits (1394),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 269/455 (59%), Positives = 362/455 (80%), Gaps = 7/455 (2%)
 Frame = -1

Query  1679  SLLFLYTV-VYILRSYLRRRHQ-CCYMLNYECYKPTDVARRLSTDKSALVVYRNRNLGID  1506
             SL  L T+ V+ +  +L +R+Q  CYML+YEC+K  D  R+L T+  A VV RN++LG++
Sbjct  8     SLFLLSTLFVFYISKFLNKRNQRNCYMLHYECFKGKD-ERKLDTETCAKVVERNKHLGLE  66

Query  1505  EFRFLLQTMVNSGVGEQTYIPINVLEGREDSPTLEDSFTEVDDIMFQTLDNLFAKSK--V  1332
             E+RFLL+TM +SG+GE+TY PINVL+GRE SPTL D+++E+D+IMF TLD LF K+K  V
Sbjct  67    EYRFLLRTMASSGIGEETYGPINVLQGREASPTLLDAYSEMDEIMFDTLDKLFHKTKGFV  126

Query  1331  SPREIDvlvvnvsllasapsLTSRVVNRYKMREDVKTFNLSGMGCSASVVAIDIVHHLFK  1152
             SP +ID+LVVNVSL A +PSLTSRV+NRYKMRED+K+FNLSG+GCSASV++IDIV  +F+
Sbjct  127   SPSDIDILVVNVSLFAPSPSLTSRVINRYKMREDIKSFNLSGLGCSASVISIDIVQRIFE  186

Query  1151  VYKNSYAIVVSTESLGANWYSGKERSMMLSNCLFRSGGCSMLFTNNPALKPRAILKLKHM  972
               +N++A+VVSTE++G +WY GK+RSMMLSNCLFR+GG S+L TN    K RA++KL  +
Sbjct  187   TRENAFALVVSTETMGPHWYCGKDRSMMLSNCLFRAGGSSVLLTNAARFKNRALMKLVTV  246

Query  971   VRTHIAAIDEAYECCKQVEDPQGFRGFHLSKRLPKVATKALVTNFKVLVPKAIPLWETLR  792
              R H+ A DEAY CC Q+ED  G  GF L+K L K A++AL  N +VL+P+ +P+ E +R
Sbjct  247   ARAHVGAEDEAYSCCMQMEDKDGHPGFLLTKYLKKAASRALTKNLQVLLPRVLPVKELIR  306

Query  791   FLAVSSLERR-KFKLPSLLGKPILNMKTGIEHFCLHPGGRAVIDGVGVSLGLSEYDLEPA  615
             +  V +++RR   K  S      L++KTG++HFC+HPGGRA+I+GVG SLGL+E+D+EP+
Sbjct  307   YAIVRAIKRRTTTKRESTSSGIGLDLKTGLQHFCIHPGGRAIIEGVGTSLGLTEFDIEPS  366

Query  614   RMSLHRWGNTSAGGLWYVLGYMEAKKRLKKGDRILMLSLGAGFKCNNCVWEVMKDLGDPN  435
             RM+LHR+GNTS+GGLWYVLGYMEAKKRLKKGD+ILM+S+GAGF+ NNCVWEV+K+L   N
Sbjct  367   RMALHRFGNTSSGGLWYVLGYMEAKKRLKKGDKILMMSMGAGFESNNCVWEVLKNLDGKN  426

Query  434   VWEDCIDRYPPETLV-NPFTEKFDWIHDPCLNFLR  333
             VWED +DRYP  + + NPF EK+DWI+D  ++F+R
Sbjct  427   VWEDSMDRYPELSKIPNPFVEKYDWINDDTMSFIR  461



>emb|CDY44863.1| BnaC09g50630D [Brassica napus]
Length=463

 Score =   541 bits (1393),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 272/467 (58%), Positives = 360/467 (77%), Gaps = 14/467 (3%)
 Frame = -1

Query  1712  FYHMETLVAIYSLLFLYTVVYILRSYLRRRHQCCYMLNYECYKPTDVARRLSTDKSALVV  1533
              + + +L  + +L   Y   Y+L    +R  + C+ML+YECYK  D  R+L T+  A +V
Sbjct  3     LFSLPSLFLVSTLFIFYISKYVLN---KRNQRNCFMLHYECYKGQD-ERKLDTETCAKIV  58

Query  1532  YRNRNLGIDEFRFLLQTMVNSGVGEQTYIPINVLEGREDSPTLEDSFTEVDDIMFQTLDN  1353
              RN NLG++E+RFLL+TMV+SG+GE+TY P NVLEGRE SPTL D+ +E+D+IMF TLD 
Sbjct  59    QRNENLGLEEYRFLLRTMVSSGIGEETYGPRNVLEGREASPTLLDAHSEMDEIMFDTLDK  118

Query  1352  LFAKSK--VSPREIDvlvvnvsllasapsLTSRVVNRYKMREDVKTFNLSGMGCSASVVA  1179
             LF K+K  VSP +ID+LVVNVSL A +PSLTSRV+NRYK+RED+K+FNLSG+GCSASV++
Sbjct  119   LFHKTKGLVSPSDIDILVVNVSLFAPSPSLTSRVINRYKLREDIKSFNLSGLGCSASVIS  178

Query  1178  IDIVHHLFKVYKNSYAIVVSTESLGANWYSGKERSMMLSNCLFRSGGCSMLFTNNPALKP  999
             IDIV  +F+  +NS+A+VVSTE++G +WY GK+RSMMLSNCLFR+GG S+L TN P  K 
Sbjct  179   IDIVQRIFETRENSFALVVSTETMGPHWYCGKDRSMMLSNCLFRAGGSSVLLTNAPRFKN  238

Query  998   RAILKLKHMVRTHIAAIDEAYECCKQVEDPQGFRGFHLSKRLPKVATKALVTNFKVLVPK  819
             RA++KL   VR H+ + DEAY CC Q+ED  G  GF L+K L K A +AL  N KVL+P+
Sbjct  239   RALMKLVTAVRAHVGSEDEAYSCCIQMEDKDGHPGFLLTKYLQKAAARALTLNLKVLLPR  298

Query  818   AIPLWETLRFLAVSSLE----RRKFKLPSLLGKPILNMKTGIEHFCLHPGGRAVIDGVGV  651
              +PL E +R+  V + +     +     S LG   L++KTG++HFC+HPGGRA+I+GVG 
Sbjct  299   VLPLKELIRYAIVRAFKGITTTKGESRSSGLG---LDLKTGLDHFCIHPGGRAIIEGVGK  355

Query  650   SLGLSEYDLEPARMSLHRWGNTSAGGLWYVLGYMEAKKRLKKGDRILMLSLGAGFKCNNC  471
             SLGL+E+D+EPARM+LHR+GNTS+GGLWYVLGYMEAKKRLKKGD+ILM+S+GAGF+ NNC
Sbjct  356   SLGLTEFDIEPARMALHRFGNTSSGGLWYVLGYMEAKKRLKKGDKILMMSMGAGFESNNC  415

Query  470   VWEVMKDLGDPNVWEDCIDRYPPETLV-NPFTEKFDWIHDPCLNFLR  333
             VW+V+K+L D NVWED IDRYP  + + NPF EK+DWI+D  ++F+R
Sbjct  416   VWKVLKNLDDKNVWEDSIDRYPETSKIPNPFLEKYDWINDDTMSFVR  462



>ref|NP_196073.1| 3-ketoacyl-CoA synthase 19 [Arabidopsis thaliana]
 sp|Q9LZ72.1|KCS21_ARATH RecName: Full=3-ketoacyl-CoA synthase 21; Short=KCS-21; AltName: 
Full=Very long-chain fatty acid condensing enzyme 21; Short=VLCFA 
condensing enzyme 21 [Arabidopsis thaliana]
 emb|CAB85559.1| fatty acid elongase-like protein [Arabidopsis thaliana]
 dbj|BAC41850.1| putative fatty acid elongase [Arabidopsis thaliana]
 gb|AAO63450.1| At5g04530 [Arabidopsis thaliana]
 gb|AED90757.1| 3-ketoacyl-CoA synthase 19 [Arabidopsis thaliana]
Length=464

 Score =   540 bits (1391),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 268/447 (60%), Positives = 354/447 (79%), Gaps = 6/447 (1%)
 Frame = -1

Query  1658  VVYILRSYLRRRHQ-CCYMLNYECYKPTDVARRLSTDKSALVVYRNRNLGIDEFRFLLQT  1482
             V YI +   +RR+Q  CYML+YECYK  +  R+L T+  A VV RN+NLG++E+RFLL+T
Sbjct  17    VFYIFKFVFKRRNQRNCYMLHYECYKGME-ERKLDTETCAKVVQRNKNLGLEEYRFLLRT  75

Query  1481  MVNSGVGEQTYIPINVLEGREDSPTLEDSFTEVDDIMFQTLDNLFAKSK--VSPREIDvl  1308
             M +SG+GE+TY P NVLEGREDSPTL D+ +E+D+IMF TLD LF K+K  +SP +ID+L
Sbjct  76    MASSGIGEETYGPRNVLEGREDSPTLLDAHSEMDEIMFDTLDKLFHKTKGSISPSDIDIL  135

Query  1307  vvnvsllasapsLTSRVVNRYKMREDVKTFNLSGMGCSASVVAIDIVHHLFKVYKNSYAI  1128
             VVNVSL A +PSLTSRV+NRYKMRED+K++NLSG+GCSASV++IDIV  +F+  +N+ A+
Sbjct  136   VVNVSLFAPSPSLTSRVINRYKMREDIKSYNLSGLGCSASVISIDIVQRMFETRENALAL  195

Query  1127  VVSTESLGANWYSGKERSMMLSNCLFRSGGCSMLFTNNPALKPRAILKLKHMVRTHIAAI  948
             VVSTE++G +WY GK+RSMMLSNCLFR+GG S+L TN    K +A++KL  +VR H+ + 
Sbjct  196   VVSTETMGPHWYCGKDRSMMLSNCLFRAGGSSVLLTNAARFKNQALMKLVTVVRAHVGSD  255

Query  947   DEAYECCKQVEDPQGFRGFHLSKRLPKVATKALVTNFKVLVPKAIPLWETLRFLAVSSLE  768
             DEAY CC Q+ED  G  GF L+K L K A +AL  N +VL+P+ +P+ E +R+  V +L+
Sbjct  256   DEAYSCCIQMEDRDGHPGFLLTKYLKKAAARALTKNLQVLLPRVLPVKELIRYAIVRALK  315

Query  767   RRKFKLPSLLGKPI-LNMKTGIEHFCLHPGGRAVIDGVGVSLGLSEYDLEPARMSLHRWG  591
             RR           I LN+KTG++HFC+HPGGRA+I+GVG SLGL+E+D+EPARM+LHR+G
Sbjct  316   RRTSAKREPASSGIGLNLKTGLQHFCIHPGGRAIIEGVGKSLGLTEFDIEPARMALHRFG  375

Query  590   NTSAGGLWYVLGYMEAKKRLKKGDRILMLSLGAGFKCNNCVWEVMKDLGDPNVWEDCIDR  411
             NTS+GGLWYVLGYMEAK RLKKG++ILM+S+GAGF+ NNCVWEV+KDL D NVWED +DR
Sbjct  376   NTSSGGLWYVLGYMEAKNRLKKGEKILMMSMGAGFESNNCVWEVLKDLDDKNVWEDSVDR  435

Query  410   YPPETLV-NPFTEKFDWIHDPCLNFLR  333
             YP  + + NPF EK+DWI+D  ++F+R
Sbjct  436   YPELSRIPNPFVEKYDWINDDTMSFVR  462



>ref|XP_009344902.1| PREDICTED: 3-ketoacyl-CoA synthase 21-like [Pyrus x bretschneideri]
Length=471

 Score =   540 bits (1391),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 272/463 (59%), Positives = 345/463 (75%), Gaps = 7/463 (2%)
 Frame = -1

Query  1703  METLVAIYSLLFLYTVVYILRSYLRRRHQCCYMLNYECYKPTDVARRLSTDKSALVVYRN  1524
             ME L+A   L   Y    + +  L  R Q CY+L YEC+ P D   +LSTD    +V RN
Sbjct  1     MEILMATCLLALFYGFYCLHKLLLGWRDQSCYLLAYECHLPPD-DMKLSTDSCVKIVLRN  59

Query  1523  RNLGIDEFRFLLQTMVNSGVGEQTYIPINVLEGREDSPTLEDSFTEVDDIMFQTLDNLFA  1344
             RNLG+DEFRFLL+T+ NSG+GE+TY   N++EGRE++ TLED   E+D I+F  LD LFA
Sbjct  60    RNLGLDEFRFLLKTITNSGIGEETYCARNIIEGREENATLEDEHAEMDGIIFDMLDKLFA  119

Query  1343  KS-KVSPREIDvlvvnvsllasapsLTSRVVNRYKMREDVKTFNLSGMGCSASVVAIDIV  1167
             ++  +SP +ID+LVVNVS+ + APSL+SR+VNRYKMR+++K+FNLSGMGCSA+++A+D+V
Sbjct  120   RATSISPSQIDILVVNVSMFSPAPSLSSRIVNRYKMRDNIKSFNLSGMGCSATLIAVDVV  179

Query  1166  HHLFKVYKNSYAIVVSTESLGANWYSGKERSMMLSNCLFRSGGCSMLFTNNPALKPRAIL  987
              +LFK +KN+ AIVVSTESL  +WY G E+SMML+NCLFRSGGC+MLFTNN  LK +A L
Sbjct  180   QNLFKSHKNANAIVVSTESLAPHWYCGIEKSMMLTNCLFRSGGCAMLFTNNQDLKHQAKL  239

Query  986   KLKHMVRTHIAAIDEAYECCKQVEDPQGFRGFHLSKRLPKVATKALVTNFKVLVPKAIPL  807
             KL H+VR H  + D+AY CC QV+D  G RGF L+K L K AT+    N + L PK +PL
Sbjct  240   KLNHLVRIHTGSNDDAYNCCVQVDDESGHRGFRLTKYLLKAATQGFTINLQALAPKVLPL  299

Query  806   WETLRFLAVSSLER----RKFKLPSLLGKPILNMKTGIEHFCLHPGGRAVIDGVGVSLGL  639
              E LR+L  S  +      K + P +     LN+KTGIEHFC+HPGGRA+IDG+G SL L
Sbjct  300   REILRYLVASRFKNIITSIKSQQPKVAEGVGLNLKTGIEHFCIHPGGRAIIDGIGKSLEL  359

Query  638   SEYDLEPARMSLHRWGNTSAGGLWYVLGYMEAKKRLKKGDRILMLSLGAGFKCNNCVWEV  459
             S+YD+EP+RM+LHR+GNTSA G WY LGYMEAKKRLKKG++ILM   GAGFKCNN VWEV
Sbjct  360   SDYDVEPSRMALHRFGNTSAAGFWYALGYMEAKKRLKKGNKILMSGFGAGFKCNNIVWEV  419

Query  458   MKDLGDPNVWEDCIDRYPP-ETLVNPFTEKFDWIHDPCLNFLR  333
             MKDL D NVW+DCID YP  +TLVNPF EK+ WI+D  L F++
Sbjct  420   MKDLDDVNVWKDCIDSYPTDQTLVNPFMEKYGWINDDYLGFVK  462



>ref|XP_007221017.1| hypothetical protein PRUPE_ppa019864mg [Prunus persica]
 gb|EMJ22216.1| hypothetical protein PRUPE_ppa019864mg [Prunus persica]
Length=474

 Score =   540 bits (1391),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 272/458 (59%), Positives = 354/458 (77%), Gaps = 3/458 (1%)
 Frame = -1

Query  1703  METLVAIYSLLFLYTVVYILRSYLRRRHQCCYMLNYECYKPTDVARRLSTDKSALVVYRN  1524
             ME  +A+  L      +Y+ +  L+ R+Q CY+L YECYK TD  R+L T+    ++ RN
Sbjct  1     MELFMAMCLLPLFCACLYLCKLVLQWRNQQCYLLAYECYKATD-DRKLDTESCVKIIQRN  59

Query  1523  RNLGIDEFRFLLQTMVNSGVGEQTYIPINVLEGREDSPTLEDSFTEVDDIMFQTLDNLFA  1344
             +NLG++E+RFLL+T+VNSG+GE+TY P NV+ GRED P+LED+  E+DDI   TLD LF 
Sbjct  60    KNLGLEEYRFLLKTIVNSGLGEETYGPRNVIAGREDCPSLEDALWEMDDIFSVTLDKLFD  119

Query  1343  KSKVSPREIDvlvvnvsllasapsLTSRVVNRYKMREDVKTFNLSGMGCSASVVAIDIVH  1164
             ++ +SP +ID+LVVNVSL + APSLTSR++N YKM++D+K FNLSGMGCS S+VAID+V 
Sbjct  120   RTGISPSKIDILVVNVSLFSPAPSLTSRIINHYKMKKDIKAFNLSGMGCSGSLVAIDLVQ  179

Query  1163  HLFKVYKNSYAIVVSTESLGANWYSGKERSMMLSNCLFRSGGCSMLFTNNPALKPRAILK  984
             +LFK YKN +A+VVSTESLG NWY GK + M+L+NCL+RSGGCSMLFTNN ALK RA+LK
Sbjct  180   NLFKTYKNVHAVVVSTESLGPNWYRGKVKPMILANCLYRSGGCSMLFTNNKALKHRALLK  239

Query  983   LKHMVRTHIAAIDEAYECCKQVEDPQGFRGFHLSKRLPKVATKALVTNFKVLVPKAIPLW  804
             L+ +VRTH  + DE Y C  QVED  GFRGF+LSK + KVA KAL  N +VLV K +PL 
Sbjct  240   LECIVRTHHGSSDEGYGCSIQVEDKHGFRGFNLSKSIAKVAAKALTMNLRVLVRKVLPLT  299

Query  803   ETLRFLAVSSLERRKFKLPSLLGK--PILNMKTGIEHFCLHPGGRAVIDGVGVSLGLSEY  630
             E LR++ +S  + +  +    +G     LN+K G+EHFC+ P   AV++GVG SLGL++Y
Sbjct  300   ELLRYVIMSRRQNKVAEHRRGVGADGTGLNLKAGLEHFCIPPTEGAVVNGVGNSLGLNDY  359

Query  629   DLEPARMSLHRWGNTSAGGLWYVLGYMEAKKRLKKGDRILMLSLGAGFKCNNCVWEVMKD  450
             DLEPARM+LHR+GNTS+GGLWYVLGYMEAKKRLKK D+ILM+S GAG++CNNCVW V++D
Sbjct  360   DLEPARMALHRFGNTSSGGLWYVLGYMEAKKRLKKRDKILMVSFGAGYECNNCVWVVLRD  419

Query  449   LGDPNVWEDCIDRYPPETLVNPFTEKFDWIHDPCLNFL  336
             L D NVW+DCI+RYPP TLVNPF ++  WI+D  L+F+
Sbjct  420   LHDANVWKDCIERYPPTTLVNPFMDRLSWINDERLSFV  457



>ref|XP_002526783.1| acyltransferase, putative [Ricinus communis]
 gb|EEF35589.1| acyltransferase, putative [Ricinus communis]
Length=455

 Score =   539 bits (1389),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 269/436 (62%), Positives = 342/436 (78%), Gaps = 5/436 (1%)
 Frame = -1

Query  1703  METLVAIYSLLFLYTVVYILRSYLRRRHQCCYMLNYECYK-PTDVARRLSTDKSALVVYR  1527
             ME  + I+  L  Y +  + +  L+ R +CCYML YEC+K P D    L  +    +V R
Sbjct  1     MEPFIVIFLPLLCYIIFRLWKLVLQNRDKCCYMLAYECHKAPKDSI--LDAESCVKMVLR  58

Query  1526  NRNLGIDEFRFLLQTMVNSGVGEQTYIPINVLEGREDSPTLEDSFTEVDDIMFQTLDNLF  1347
             N+NLG +E+RFL +T+++SG+G +TY+P N+ E RE+ P+LED+ +E+DDIMF TLD LF
Sbjct  59    NKNLGPEEYRFLKKTIISSGIGNETYVPRNINEYREEKPSLEDALSEIDDIMFDTLDKLF  118

Query  1346  AKSKVSPREIDvlvvnvsllasapsLTSRVVNRYKMREDVKTFNLSGMGCSASVVAIDIV  1167
             A++ +SP EIDVLVVNVSL +SAPSLT+R VNRYKMRED+K FNLSGMGCSAS+VA+D+V
Sbjct  119   ARTGISPSEIDVLVVNVSLFSSAPSLTARAVNRYKMREDIKAFNLSGMGCSASLVAVDLV  178

Query  1166  HHLFKVYKNSYAIVVSTESLGANWYSGKERSMMLSNCLFRSGGCSMLFTNNPALKPRAIL  987
               LFK YK   A++ STES+G NWYSGKE+SM+LSNCLFRSGGCSML TN+ ALK ++I 
Sbjct  179   QQLFKSYKKKLAVIFSTESIGPNWYSGKEKSMLLSNCLFRSGGCSMLLTNDRALKHKSIF  238

Query  986   KLKHMVRTHIAAIDEAYECCKQVEDPQGFRGFHLSKRLPKVATKALVTNFKVLVPKAIPL  807
             KL H+VRTHI A DEAY CC Q ED  G RGF L++ L K ATKAL  N ++LVP+ +P+
Sbjct  239   KLNHLVRTHIGANDEAYGCCIQGEDDLGHRGFLLTRSLTKAATKALSMNLRILVPQVLPV  298

Query  806   WETLRFLAVSSLERR-KFKLPSLLGKPILNMKTGIEHFCLHPGGRAVIDGVGVSLGLSEY  630
              E LR++ +S L++R K +    +G   LN+K G+EHFC+HPGG+AVIDG+G SLGLSEY
Sbjct  299   TELLRYIFMSLLQKRGKNRNLEAVGAG-LNLKNGVEHFCIHPGGKAVIDGIGKSLGLSEY  357

Query  629   DLEPARMSLHRWGNTSAGGLWYVLGYMEAKKRLKKGDRILMLSLGAGFKCNNCVWEVMKD  450
             DLEPARM+L R+GNTSAGGLWYVLGYMEAKKRLKKGDRI+M+ LGAGFKCN+CVWEV+KD
Sbjct  358   DLEPARMALRRFGNTSAGGLWYVLGYMEAKKRLKKGDRIMMIGLGAGFKCNSCVWEVLKD  417

Query  449   LGDPNVWEDCIDRYPP  402
             L + NVW++ I+ YPP
Sbjct  418   LDNANVWKESINHYPP  433



>emb|CDY14150.1| BnaC02g02670D [Brassica napus]
Length=462

 Score =   539 bits (1388),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 264/446 (59%), Positives = 356/446 (80%), Gaps = 5/446 (1%)
 Frame = -1

Query  1658  VVYILRSYLRRRHQCCYMLNYECYKPTDVARRLSTDKSALVVYRNRNLGIDEFRFLLQTM  1479
             V YI +   +R  + CYML+YEC+K  D  R+L T+  A VV RN++LG++E+RFLL+TM
Sbjct  17    VFYISKFLNKRNQRNCYMLHYECFKGKD-ERKLDTETCAKVVERNKHLGLEEYRFLLRTM  75

Query  1478  VNSGVGEQTYIPINVLEGREDSPTLEDSFTEVDDIMFQTLDNLFAKSK--VSPREIDvlv  1305
              +SG+GE+TY PINVL+GRE SPTL D+++E+D+IMF+TLD LF K+K  VSP +ID+LV
Sbjct  76    ASSGIGEETYGPINVLQGREASPTLLDAYSEMDEIMFETLDKLFHKTKGFVSPSDIDILV  135

Query  1304  vnvsllasapsLTSRVVNRYKMREDVKTFNLSGMGCSASVVAIDIVHHLFKVYKNSYAIV  1125
             VNVSL A +PSLTSRV+NRYKMRED+K+FNLSG+GCSASV++IDIV  +F+  +N++A+V
Sbjct  136   VNVSLFAPSPSLTSRVINRYKMREDIKSFNLSGLGCSASVISIDIVQRIFETRENAFALV  195

Query  1124  VSTESLGANWYSGKERSMMLSNCLFRSGGCSMLFTNNPALKPRAILKLKHMVRTHIAAID  945
             VSTE++G +WY GK+RSMMLSNCLFR+GG S+L TN    K RA++KL  + R H+ A D
Sbjct  196   VSTETMGPHWYCGKDRSMMLSNCLFRAGGSSVLLTNAARFKNRALMKLVTVARAHVGAED  255

Query  944   EAYECCKQVEDPQGFRGFHLSKRLPKVATKALVTNFKVLVPKAIPLWETLRFLAVSSLER  765
             EAY CC Q+ED  G  GF L+K L K A++AL  N +VL+P+ +P+ E +R+  V +++R
Sbjct  256   EAYSCCMQMEDKDGHPGFLLTKYLKKAASRALTKNLQVLLPRVLPVKELIRYAIVRAIKR  315

Query  764   R-KFKLPSLLGKPILNMKTGIEHFCLHPGGRAVIDGVGVSLGLSEYDLEPARMSLHRWGN  588
             R   K  S      L++KTG++HFC+HPGGRA+I+GVG SLGL+E+D+EP+RM+LHR+GN
Sbjct  316   RTTTKRESTSSGIGLDLKTGLQHFCIHPGGRAIIEGVGTSLGLTEFDIEPSRMALHRFGN  375

Query  587   TSAGGLWYVLGYMEAKKRLKKGDRILMLSLGAGFKCNNCVWEVMKDLGDPNVWEDCIDRY  408
             TS+GGLWYVLGYMEAKKRLKKGD+ILM+S+GAGF+ NNCVWEV+K+L   NVWED +D+Y
Sbjct  376   TSSGGLWYVLGYMEAKKRLKKGDKILMMSMGAGFESNNCVWEVLKNLDGKNVWEDSMDQY  435

Query  407   PPETLV-NPFTEKFDWIHDPCLNFLR  333
             P  + + NPF EK+DWI+D  ++F+R
Sbjct  436   PELSKIPNPFVEKYDWINDDTMSFIR  461



>ref|XP_006376366.1| hypothetical protein POPTR_0013s12410g [Populus trichocarpa]
 gb|ERP54163.1| hypothetical protein POPTR_0013s12410g [Populus trichocarpa]
Length=462

 Score =   538 bits (1385),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 262/443 (59%), Positives = 343/443 (77%), Gaps = 3/443 (1%)
 Frame = -1

Query  1664  YTVVYILRSYLRRRHQCCYMLNYECYKPTDVARRLSTDKSALVVYRNRNLGIDEFRFLLQ  1485
             Y +  + +   +++ QCCYML+YEC+K  +  ++L    SA ++ RN+NLGI+E++FLL+
Sbjct  14    YIIFNLYKLGYQKKDQCCYMLSYECHKAAE-DQKLDPRSSARIISRNKNLGIEEYKFLLK  72

Query  1484  TMVNSGVGEQTYIPINVLEGREDSPTLEDSFTEVDDIMFQTLDNLFAKSKVSPREIDvlv  1305
             T V+SG+GE+TY+P N++EGRE+S TL D  +E+D I+F T+D LFAK+ VSP EI+++V
Sbjct  73    TTVSSGIGEETYVPKNIMEGREESATLMDEISEMDGILFDTVDKLFAKTGVSPSEINIIV  132

Query  1304  vnvsllasapsLTSRVVNRYKMREDVKTFNLSGMGCSASVVAIDIVHHLFKVYKNSYAIV  1125
              +VSL + APSLT+RV+NRYKMRED+K FNLSGMGCSAS VAID+V  LFK YKNS+AIV
Sbjct  133   SSVSLFSPAPSLTARVINRYKMREDIKAFNLSGMGCSASAVAIDLVKQLFKTYKNSFAIV  192

Query  1124  VSTESLGANWYSGKERSMMLSNCLFRSGGCSMLFTNNPALKPRAILKLKHMVRTHIAAID  945
             +STES+ ++WY GK++SMMLSN LFR+GGCS+L TNN   K +A+++L   VRTHI + D
Sbjct  193   MSTESMSSHWYPGKDKSMMLSNILFRTGGCSILLTNNRDWKIKALMELTCSVRTHIGSND  252

Query  944   EAYECCKQVEDPQGFRGFHLSKRLPKVATKALVTNFKVLVPKAIPLWETLRFLAVSSLER  765
             EAY  C Q ED  G  GF L+K LPK   KAL  N +VL+PK IPL E LR+  +S    
Sbjct  253   EAYNSCFQAEDDLGINGFRLNKDLPKAGAKALTMNLRVLLPKVIPLSEVLRY-RISYYRN  311

Query  764   RKFKLPSLL-GKPILNMKTGIEHFCLHPGGRAVIDGVGVSLGLSEYDLEPARMSLHRWGN  588
             +  K P+     P L++K+GI+HFC+HPGGRA+ID  G SL L++YDLEPARM+L+R+GN
Sbjct  312   KIMKRPTPKDAGPGLDLKSGIDHFCVHPGGRAIIDEAGQSLALNDYDLEPARMALYRFGN  371

Query  587   TSAGGLWYVLGYMEAKKRLKKGDRILMLSLGAGFKCNNCVWEVMKDLGDPNVWEDCIDRY  408
             TS+GGLWYVLGYMEAKKRLKKGD ILM+SLGAGFKCNNCVW+VMKDL D NVW++CID+Y
Sbjct  372   TSSGGLWYVLGYMEAKKRLKKGDTILMISLGAGFKCNNCVWKVMKDLEDTNVWKNCIDQY  431

Query  407   PPETLVNPFTEKFDWIHDPCLNF  339
             PP+TL N F++    I D  +NF
Sbjct  432   PPKTLANSFSKILASISDESMNF  454



>ref|XP_008353343.1| PREDICTED: 3-ketoacyl-CoA synthase 21-like [Malus domestica]
Length=471

 Score =   538 bits (1386),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 270/463 (58%), Positives = 341/463 (74%), Gaps = 7/463 (2%)
 Frame = -1

Query  1703  METLVAIYSLLFLYTVVYILRSYLRRRHQCCYMLNYECYKPTDVARRLSTDKSALVVYRN  1524
             M  L+A   L   Y    + +  LRRR Q CY+L YEC+ P D   +LS D    +V RN
Sbjct  1     MGILMATCLLALFYGFSCLCKLLLRRRDQACYLLAYECHMPPD-DMKLSADSCVKIVSRN  59

Query  1523  RNLGIDEFRFLLQTMVNSGVGEQTYIPINVLEGREDSPTLEDSFTEVDDIMFQTLDNLFA  1344
             RNLG++EFRFLL+T+ +SG+G++TY   N+++GRE++ T ED   E+D I+F  LD LFA
Sbjct  60    RNLGLEEFRFLLKTITHSGIGQETYCARNIIQGREETATREDELAEMDGIIFDALDKLFA  119

Query  1343  KS-KVSPREIDvlvvnvsllasapsLTSRVVNRYKMREDVKTFNLSGMGCSASVVAIDIV  1167
             ++  +S  +ID+LVVNVS+ + APSL+SR+VNRYKMR+D+K+FNLSGMGCSAS++AID+V
Sbjct  120   RATSISRSQIDILVVNVSMFSPAPSLSSRIVNRYKMRDDIKSFNLSGMGCSASLIAIDVV  179

Query  1166  HHLFKVYKNSYAIVVSTESLGANWYSGKERSMMLSNCLFRSGGCSMLFTNNPALKPRAIL  987
              +LFK +KN+ AIVVSTESL  +WY G E+SMML+NCLFRSGGC+ML TN  +LK +A L
Sbjct  180   QNLFKSHKNANAIVVSTESLAPHWYCGVEKSMMLTNCLFRSGGCAMLLTNKRSLKHQAKL  239

Query  986   KLKHMVRTHIAAIDEAYECCKQVEDPQGFRGFHLSKRLPKVATKALVTNFKVLVPKAIPL  807
             KL H+VR H  + DEAY CC Q ED  G RGF L+K L K ATK    N +VL PK +PL
Sbjct  240   KLNHLVRMHTGSNDEAYNCCIQTEDESGNRGFRLTKYLVKAATKGFTKNLQVLAPKILPL  299

Query  806   WETLRFLAVSSLERRKFKL----PSLLGKPILNMKTGIEHFCLHPGGRAVIDGVGVSLGL  639
              E LR+L  S L   +  +    P   G+  LN+KTGIEHFC+HPGGRA+IDG+G SLGL
Sbjct  300   REILRYLVASRLNNIRTSITSQKPKADGRLGLNLKTGIEHFCIHPGGRAIIDGIGKSLGL  359

Query  638   SEYDLEPARMSLHRWGNTSAGGLWYVLGYMEAKKRLKKGDRILMLSLGAGFKCNNCVWEV  459
             S++D+EP+RM+LHR+GNTS  G WY LGYMEAKKRLKKG+RILM   GAGFKCNN VWEV
Sbjct  360   SDFDVEPSRMALHRFGNTSGAGFWYALGYMEAKKRLKKGNRILMSGFGAGFKCNNIVWEV  419

Query  458   MKDLGDPNVWEDCIDRYPPE-TLVNPFTEKFDWIHDPCLNFLR  333
             MKDL D NVW+DCID YP +   VNPF EK+ WIHD  + F+R
Sbjct  420   MKDLDDVNVWKDCIDSYPRDLNKVNPFMEKYGWIHDDYIGFVR  462



>ref|XP_009125563.1| PREDICTED: 3-ketoacyl-CoA synthase 21 [Brassica rapa]
Length=462

 Score =   538 bits (1385),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 264/446 (59%), Positives = 355/446 (80%), Gaps = 5/446 (1%)
 Frame = -1

Query  1658  VVYILRSYLRRRHQCCYMLNYECYKPTDVARRLSTDKSALVVYRNRNLGIDEFRFLLQTM  1479
             V YI +   +R  + CYML+YEC+K  D  R+L T+  A VV RN++LG++E+R LL+TM
Sbjct  17    VFYISKFLNKRSQRNCYMLHYECFKGKD-ERKLDTETCAKVVERNKHLGLEEYRSLLRTM  75

Query  1478  VNSGVGEQTYIPINVLEGREDSPTLEDSFTEVDDIMFQTLDNLFAKSK--VSPREIDvlv  1305
              +SG+GE+TY PINVL+GRE SPTL D+++E+D+IMF+TLD LF K+K  VSP +ID+LV
Sbjct  76    ASSGIGEETYGPINVLQGREASPTLLDAYSEMDEIMFETLDKLFHKTKGFVSPSDIDILV  135

Query  1304  vnvsllasapsLTSRVVNRYKMREDVKTFNLSGMGCSASVVAIDIVHHLFKVYKNSYAIV  1125
             VNVSL A +PSLTSRV+NRYKMRED+K+FNLSG+GCSASV++IDIV  +F+  +N++A+V
Sbjct  136   VNVSLFAPSPSLTSRVINRYKMREDIKSFNLSGLGCSASVISIDIVQRIFETRENAFALV  195

Query  1124  VSTESLGANWYSGKERSMMLSNCLFRSGGCSMLFTNNPALKPRAILKLKHMVRTHIAAID  945
             VSTE++G +WY GK+RSMMLSNCLFR+GG S+L TN    K RA++KL  + R H+ A D
Sbjct  196   VSTETMGPHWYCGKDRSMMLSNCLFRAGGSSVLLTNAARFKNRALMKLVTVARAHVGAED  255

Query  944   EAYECCKQVEDPQGFRGFHLSKRLPKVATKALVTNFKVLVPKAIPLWETLRFLAVSSLER  765
             EAY CC Q+ED  G  GF L+K L K A++AL  N +VL+P+ +P+ E +R+  V +++R
Sbjct  256   EAYSCCMQMEDKDGHPGFLLTKYLKKAASRALTKNLQVLLPRVLPVKELIRYAIVRAIKR  315

Query  764   R-KFKLPSLLGKPILNMKTGIEHFCLHPGGRAVIDGVGVSLGLSEYDLEPARMSLHRWGN  588
             R   K  S      L++KTG++HFC+HPGGRA+I+GVG SLGL+E+D+EP+RM+LHR+GN
Sbjct  316   RTTTKRESTSSGIGLDLKTGLQHFCIHPGGRAIIEGVGTSLGLTEFDIEPSRMALHRFGN  375

Query  587   TSAGGLWYVLGYMEAKKRLKKGDRILMLSLGAGFKCNNCVWEVMKDLGDPNVWEDCIDRY  408
             TS+GGLWYVLGYMEAKKRLKKGD+ILM+S+GAGF+ NNCVWEV+K+L   NVWED +DRY
Sbjct  376   TSSGGLWYVLGYMEAKKRLKKGDKILMMSMGAGFESNNCVWEVLKNLDGKNVWEDSMDRY  435

Query  407   PPETLV-NPFTEKFDWIHDPCLNFLR  333
             P  + + NPF EK+DWI+D  ++F+R
Sbjct  436   PELSKIPNPFVEKYDWINDDTMSFIR  461



>ref|XP_006287689.1| hypothetical protein CARUB_v10000897mg [Capsella rubella]
 gb|EOA20587.1| hypothetical protein CARUB_v10000897mg [Capsella rubella]
Length=464

 Score =   537 bits (1384),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 269/448 (60%), Positives = 356/448 (79%), Gaps = 8/448 (2%)
 Frame = -1

Query  1658  VVYILRSYLRRRHQ-CCYMLNYECYKPTDVARRLSTDKSALVVYRNRNLGIDEFRFLLQT  1482
             V Y++   L+RR+Q  C+ML+YECYK  +  R+L T+  A VV RN+NLG++E+RFLL+T
Sbjct  17    VFYVVHFVLKRRNQRNCFMLHYECYKGME-ERKLDTETCAKVVQRNKNLGLEEYRFLLRT  75

Query  1481  MVNSGVGEQTYIPINVLEGREDSPTLEDSFTEVDDIMFQTLDNLFAKSK--VSPREIDvl  1308
             M +SG+GE+TY P NVLEGREDSP+L D+ +E+D+IMF TLD LF K+K  +SP +ID+L
Sbjct  76    MASSGIGEETYGPRNVLEGREDSPSLLDAHSEMDEIMFGTLDKLFQKTKGLISPSDIDIL  135

Query  1307  vvnvsllasapsLTSRVVNRYKMREDVKTFNLSGMGCSASVVAIDIVHHLFKVYKNSYAI  1128
             VVNVSL A +PSLTSRV+NRYKMRED+K+FNLSG+GCSASV++IDIV  +F+  +N+ A+
Sbjct  136   VVNVSLFAPSPSLTSRVINRYKMREDIKSFNLSGLGCSASVISIDIVQRIFETRENAIAL  195

Query  1127  VVSTESLGANWYSGKERSMMLSNCLFRSGGCSMLFTNNPALKPRAILKLKHMVRTHIAAI  948
             VVSTE++G +WY G++RSMMLSNCLFR+GG S+L TN    K RA++KL  +VR H+ A 
Sbjct  196   VVSTETMGPHWYCGRDRSMMLSNCLFRAGGSSVLLTNAARFKNRALMKLVTVVRAHVGAD  255

Query  947   DEAYECCKQVEDPQGFRGFHLSKRLPKVATKALVTNFKVLVPKAIPLWETLRFLAVSSLE  768
             DEAY CC Q+ED  G  GF L+K L K A +AL  N +VL+P+ +P+ E +R+    +L+
Sbjct  256   DEAYSCCIQMEDGDGHPGFLLTKHLKKAAGRALTKNLQVLLPRVLPVKELIRYAIGRALK  315

Query  767   RRKF--KLPSLLGKPILNMKTGIEHFCLHPGGRAVIDGVGVSLGLSEYDLEPARMSLHRW  594
             RR    + P   G   L++KTG++HFC+HPGGRA+I+GVG SLGL+E D+EPARM+LHR+
Sbjct  316   RRTAAKREPGSSGIG-LDLKTGLQHFCIHPGGRAIIEGVGKSLGLTESDIEPARMALHRF  374

Query  593   GNTSAGGLWYVLGYMEAKKRLKKGDRILMLSLGAGFKCNNCVWEVMKDLGDPNVWEDCID  414
             GNTS+GGLWYVLGYMEAK RLKKG++ILM+S+GAGF+ NNCVWEV+KDLGD NVWED ID
Sbjct  375   GNTSSGGLWYVLGYMEAKNRLKKGEKILMMSMGAGFESNNCVWEVLKDLGDKNVWEDSID  434

Query  413   RYPPETLV-NPFTEKFDWIHDPCLNFLR  333
             RYP  + + NPF EK+DWI+D  ++F+R
Sbjct  435   RYPELSRIPNPFVEKYDWINDDTMSFVR  462



>ref|XP_002534162.1| acyltransferase, putative [Ricinus communis]
 gb|EEF28222.1| acyltransferase, putative [Ricinus communis]
Length=475

 Score =   537 bits (1384),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 257/459 (56%), Positives = 353/459 (77%), Gaps = 9/459 (2%)
 Frame = -1

Query  1706  HMETLVAIYSLLFLYTVVYILRSYLRRRHQCCYMLNYECYKPTDVARRLSTDKSALVVYR  1527
              M+ L+ +Y  L LY++  + +    RR Q CY+L+YECYKPTD  R+L T+    ++ R
Sbjct  4     QMDLLMLLYGFLILYSLFLLFKRAGGRRDQECYILDYECYKPTD-DRKLDTNFCGELITR  62

Query  1526  NRNLGIDEFRFLLQTMVNSGVGEQTYIPINVLEGREDSPTLEDSFTEVDDIMFQTLDNLF  1347
             N+NLG++E++FLL+ +V+SG+GEQTY P  V +GRE++PT ED   E+++    +++ L 
Sbjct  63    NKNLGLNEYKFLLKAIVSSGIGEQTYAPRMVFDGREENPTFEDGILEMEEFFHDSIEKLL  122

Query  1346  AKSKVSPREIDvlvvnvsllasapsLTSRVVNRYKMREDVKTFNLSGMGCSASVVAIDIV  1167
             ++S +SP+EIDVL+VNVS+L+ APSL+SR++NRYKMRED+++FNL+GMGCSAS+++++I 
Sbjct  123   SRSGISPQEIDVLIVNVSMLSVAPSLSSRIINRYKMREDIRSFNLTGMGCSASLISVNIA  182

Query  1166  HHLFKVYKNSYAIVVSTESLGANWYSGKERSMMLSNCLFRSGGCSMLFTNNPALKPRAIL  987
              ++FK +KN  A+VV++ESL  NWYSG +RSM+L+NCLFRSGGC+ML TN  AL+ +A+ 
Sbjct  183   QNIFKSHKNVCALVVTSESLTPNWYSGNDRSMILANCLFRSGGCAMLLTNKRALEHKAMF  242

Query  986   KLKHMVRTHIAAIDEAYECCKQVEDPQGFRGFHLSKRLPKVATKALVTNFKVLVPKAIPL  807
             KLK +VRTH    DE+YECC Q ED QG  GFHL K LPK AT+A V N + + PK +P+
Sbjct  243   KLKCLVRTHHGGRDESYECCLQKEDDQGRPGFHLGKSLPKAATRAFVDNLREISPKILPI  302

Query  806   WETLRFLAVSSLERRKFKLPSLLG--------KPILNMKTGIEHFCLHPGGRAVIDGVGV  651
              E LRF  ++ + +      S  G        +P++NM+TG++HFC+H GG+AVIDG+GV
Sbjct  303   RELLRFSIMTFIRKWSQSRNSGKGGGATTPAPRPVINMRTGVDHFCIHTGGKAVIDGIGV  362

Query  650   SLGLSEYDLEPARMSLHRWGNTSAGGLWYVLGYMEAKKRLKKGDRILMLSLGAGFKCNNC  471
             +L LSEYDLEPARM+LHR+GNTSA  LWYVL YMEAKKRLKKGDRILM+S GAGFKCN+C
Sbjct  363   NLDLSEYDLEPARMTLHRFGNTSASSLWYVLAYMEAKKRLKKGDRILMISFGAGFKCNSC  422

Query  470   VWEVMKDLGDPNVWEDCIDRYPPETLVNPFTEKFDWIHD  354
             VWEV++DL + NVW+DCID YPP+TL NPF EK+ WI++
Sbjct  423   VWEVVRDLENSNVWKDCIDSYPPKTLANPFMEKYGWIYN  461



>ref|XP_011005030.1| PREDICTED: 3-ketoacyl-CoA synthase 3-like [Populus euphratica]
Length=467

 Score =   536 bits (1382),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 256/455 (56%), Positives = 351/455 (77%), Gaps = 6/455 (1%)
 Frame = -1

Query  1703  METLVAIYSLLFLYTVVYILRSYLRRRHQCCYMLNYECYKPTDVARRLSTDKSALVVYRN  1524
             M+  + +Y+ L  Y +  + R   R+R + CY+L+YEC+KPTD  R+L T  S  V+ RN
Sbjct  1     MDVPMLVYAFLIFYPLFILWRRIDRKRDRECYILDYECHKPTD-DRKLDTVCSGQVIMRN  59

Query  1523  RNLGIDEFRFLLQTMVNSGVGEQTYIPINVLEGREDSPTLEDSFTEVDDIMFQTLDNLFA  1344
             +NLG++E++FLL+ +V+SG+GEQTY P  +  G+E++PTL+D  +E+++    ++  L A
Sbjct  60    KNLGLNEYKFLLRAIVSSGIGEQTYGPRIIFNGQEENPTLQDLISEMEEFFHDSIGKLLA  119

Query  1343  KSKVSPREIDvlvvnvsllasapsLTSRVVNRYKMREDVKTFNLSGMGCSASVVAIDIVH  1164
             +S ++P+EIDVLVVNVS+ +  PSL + ++N YK+REDVK FNL+GMGCSAS+++++IV 
Sbjct  120   RSGIAPKEIDVLVVNVSMQSIVPSLPAMIINHYKLREDVKVFNLTGMGCSASLISVNIVQ  179

Query  1163  HLFKVYKNSYAIVVSTESLGANWYSGKERSMMLSNCLFRSGGCSMLFTNNPALKPRAILK  984
             ++FK YKN+YA+VV++ESL  NWY+G +RSM+L+NCLFRSGGC+ML TN  ALK RA+ K
Sbjct  180   NIFKTYKNAYALVVTSESLSPNWYAGSDRSMILANCLFRSGGCAMLLTNKRALKQRAMFK  239

Query  983   LKHMVRTHIAAIDEAYECCKQVEDPQGFRGFHLSKRLPKVATKALVTNFKVLVPKAIPLW  804
             LK +VRTH  A DE+Y CC+Q ED QG  GFHL K LPKVAT+ALV N + + PK +P+ 
Sbjct  240   LKCLVRTHHGARDESYNCCQQREDDQGHSGFHLDKSLPKVATRALVDNLREITPKILPVR  299

Query  803   ETLRFLAVSSLER----RKFKLPSLLGKPILNMKTGIEHFCLHPGGRAVIDGVGVSLGLS  636
             E LRF+ VS + +    R  K      KP++N KTG++HFC+H GG+AVIDG+GVSL L+
Sbjct  300   ELLRFMVVSFIRKCWSHRSTKGAGSSPKPVINFKTGVDHFCIHTGGKAVIDGIGVSLDLT  359

Query  635   EYDLEPARMSLHRWGNTSAGGLWYVLGYMEAKKRLKKGDRILMLSLGAGFKCNNCVWEVM  456
             E+DLEPARM+LHR+GNTSA  LWYVLGYMEAK+RLKKGDR+LM+S GAGFKCN+C+WEV+
Sbjct  360   EHDLEPARMTLHRFGNTSASSLWYVLGYMEAKRRLKKGDRVLMMSFGAGFKCNSCLWEVL  419

Query  455   KDLGDP-NVWEDCIDRYPPETLVNPFTEKFDWIHD  354
             +DLG   N W DCID YPP +L+NPF EK+ WI++
Sbjct  420   RDLGGAGNAWTDCIDSYPPNSLINPFLEKYGWINN  454



>ref|XP_010043605.1| PREDICTED: 3-ketoacyl-CoA synthase 12 [Eucalyptus grandis]
 gb|KCW85624.1| hypothetical protein EUGRSUZ_B02412 [Eucalyptus grandis]
Length=460

 Score =   535 bits (1379),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 254/452 (56%), Positives = 350/452 (77%), Gaps = 3/452 (1%)
 Frame = -1

Query  1703  METLVAIYSLLFLYTVVYILRSYLRRRHQCCYMLNYECYKPTDVARRLSTDKSALVVYRN  1524
             ME L+ +Y +   ++++ + R    RR + CY+L+Y+CYKPT+  R L T+    ++ R 
Sbjct  1     MELLLMLYLVPIFFSLLILWRKIDERRDRECYILDYQCYKPTN-DRMLDTEFCGKIIKRT  59

Query  1523  RNLGIDEFRFLLQTMVNSGVGEQTYIPINVLEGREDSPTLEDSFTEVDDIMFQTLDNLFA  1344
             +NLG+ E++FLL+ +V++G+GEQTY P  +  GRED+PTL+D  +E+++  + ++  L  
Sbjct  60    KNLGLLEYQFLLKAIVSAGIGEQTYAPRIMFSGREDNPTLDDGISEMEEFFYDSIGKLLE  119

Query  1343  KSKVSPREIDvlvvnvsllasapsLTSRVVNRYKMREDVKTFNLSGMGCSASVVAIDIVH  1164
             +S +SP +IDVLVVNVS+L++ PSL++R+VNRYKMRED+K FNL+GMGCSAS++++DIV 
Sbjct  120   RSGLSPTQIDVLVVNVSMLSTVPSLSARIVNRYKMREDIKVFNLTGMGCSASLISVDIVR  179

Query  1163  HLFKVYKNSYAIVVSTESLGANWYSGKERSMMLSNCLFRSGGCSMLFTNNPALKPRAILK  984
             ++FK  KN YA+VV++ESL  NWYSG +RS +L+NCLFRSGGC++L +NN AL  +A+ K
Sbjct  180   NVFKSQKNRYALVVTSESLSPNWYSGNDRSKILANCLFRSGGCAILLSNNRALADQAMFK  239

Query  983   LKHMVRTHIAAIDEAYECCKQVEDPQGFRGFHLSKRLPKVATKALVTNFKVLVPKAIPLW  804
             L+ +VRTH  A DE+YECC Q ED QG  GFHL K LPK AT+AL+ N K + P+ +P+ 
Sbjct  240   LRCLVRTHHGARDESYECCIQQEDAQGRIGFHLGKTLPKAATRALIDNLKAISPRILPIR  299

Query  803   ETLRFLAVSSLERRKFKLPSLLG--KPILNMKTGIEHFCLHPGGRAVIDGVGVSLGLSEY  630
             E +RF AVS   +   + P+     +P+LN KTG++HFC+H GG+AVIDG+GV+L LSEY
Sbjct  300   ELVRFAAVSMYRKMMNQNPTKGSGPRPVLNFKTGVDHFCIHTGGKAVIDGIGVNLNLSEY  359

Query  629   DLEPARMSLHRWGNTSAGGLWYVLGYMEAKKRLKKGDRILMLSLGAGFKCNNCVWEVMKD  450
             DLEPARM+LHR+GNTSA  LWYVLGYMEAKKRLKKGD++ M+S GAGFKCN+C+WEV++D
Sbjct  360   DLEPARMTLHRFGNTSASSLWYVLGYMEAKKRLKKGDKVFMISFGAGFKCNSCLWEVVRD  419

Query  449   LGDPNVWEDCIDRYPPETLVNPFTEKFDWIHD  354
             LGD NVW DC+D YPPE++VNPF EKF WI D
Sbjct  420   LGDGNVWSDCVDSYPPESIVNPFLEKFGWIRD  451



>gb|AGK30012.1| 3-ketoacyl-CoA synthase [Gossypium raimondii]
Length=424

 Score =   531 bits (1369),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 275/426 (65%), Positives = 341/426 (80%), Gaps = 5/426 (1%)
 Frame = -1

Query  1607  MLNYECYKPTDVARRLSTDKSALVVYRNRNLGIDEFRFLLQTMVNSGVGEQTYIPINVLE  1428
             ML YEC+K  D  R+L TD    VV RN+ LG+D++RFLL+T+V+SG+GE+TY P NV++
Sbjct  1     MLGYECFKAAD-DRKLDTDACVRVVMRNKKLGLDQYRFLLKTIVSSGLGEETYGPRNVVD  59

Query  1427  GREDSPTLEDSFTEVDDIMFQTLDNLFAKSKVSPREIDvlvvnvsllasapsLTSRVVNR  1248
             GRE+ P   D+  E+D+IMF TLD+LF K+ VSP EID+LVV+VSL + APSLTSR++NR
Sbjct  60    GREEFPLENDAHAEMDEIMFSTLDSLFEKTGVSPSEIDILVVDVSLFSPAPSLTSRIINR  119

Query  1247  YKMREDVKTFNLSGMGCSASVVAIDIVHHLFKVYKNSYAIVVSTESLGANWYSGKERSMM  1068
             YKMR ++K+F+LSGMGCSAS++AID+V  LFK YKN +AIVVSTES+  +WY GKE+SMM
Sbjct  120   YKMRHNIKSFSLSGMGCSASMLAIDLVQQLFKTYKNQFAIVVSTESIARHWYCGKEKSMM  179

Query  1067  LSNCLFRSGGCSMLFTNNPALKPRAILKLKHMVRTHIAAIDEAYECCKQVEDPQGFRGFH  888
             LSNCLFR+GG S+L TN   LK R +LKLK  VRT+I   DEAY CC QVEDPQG++GF 
Sbjct  180   LSNCLFRNGGSSILLTNKRDLKDRCLLKLKCAVRTNIGYDDEAYGCCIQVEDPQGYQGFL  239

Query  887   LSKRLPKVATKALVTNFKVLVPKAIPLWETLRFLAVSSLERRKFKLPSLLGKPILNMKTG  708
             L+K L K A KA   N K+L+PK +P+WE LR+ A+S+L ++  K  +L     LN+K+G
Sbjct  240   LTKNLTKAAAKAFTGNLKLLLPKILPVWELLRY-AISTLGKKSTKGQNLSFN--LNLKSG  296

Query  707   IEHFCLHPGGRAVIDGVGVSLGLSEYDLEPARMSLHRWGNTSAGGLWYVLGYMEAKKRLK  528
             ++HFCLHPGGRAVIDG+G SLGLSEYDLEP RM+L+R+GNTSAGGLWYVL YMEAKKRLK
Sbjct  297   VDHFCLHPGGRAVIDGLGKSLGLSEYDLEPTRMALYRFGNTSAGGLWYVLSYMEAKKRLK  356

Query  527   KGDRILMLSLGAGFKCNNCVWEVMKD-LGDPNVWEDCIDRYPPETLVNPFTEKFDWIHDP  351
             KGD+I M+SLGAGF CNNCVWEVMKD L D  VWEDCID YP + LVNPFTEK+ WI+D 
Sbjct  357   KGDKIFMVSLGAGFMCNNCVWEVMKDGLDDTRVWEDCIDEYPRKNLVNPFTEKYSWINDE  416

Query  350   CLNFLR  333
              LNF+R
Sbjct  417   ILNFVR  422



>gb|ABK95107.1| unknown [Populus trichocarpa]
Length=450

 Score =   532 bits (1371),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 254/431 (59%), Positives = 342/431 (79%), Gaps = 6/431 (1%)
 Frame = -1

Query  1631  RRRHQCCYMLNYECYKPTDVARRLSTDKSALVVYRNRNLGIDEFRFLLQTMVNSGVGEQT  1452
             R+R + CY+L+YEC+KPTD  R+L T+ S  V+ RN+NLG++E++FLL+ +V+SG+GEQT
Sbjct  8     RKRDRECYILDYECHKPTD-DRKLDTECSGQVIRRNKNLGLNEYKFLLRAIVSSGIGEQT  66

Query  1451  YIPINVLEGREDSPTLEDSFTEVDDIMFQTLDNLFAKSKVSPREIDvlvvnvsllasaps  1272
             Y P  +  G+E++PTL+D  +E+++    ++  L A+S ++P+EIDVLVVNVS+ +  PS
Sbjct  67    YGPRIIFNGQEENPTLQDLISEMEEFFHDSIGKLLARSGIAPKEIDVLVVNVSMQSVVPS  126

Query  1271  LTSRVVNRYKMREDVKTFNLSGMGCSASVVAIDIVHHLFKVYKNSYAIVVSTESLGANWY  1092
             L + ++N YK+REDVK FNL+GMGCSAS+++++IV ++FK YKN+YA+VV++ESL  NWY
Sbjct  127   LPAMIINHYKLREDVKVFNLTGMGCSASLISVNIVQNIFKTYKNAYALVVTSESLSPNWY  186

Query  1091  SGKERSMMLSNCLFRSGGCSMLFTNNPALKPRAILKLKHMVRTHIAAIDEAYECCKQVED  912
             +G +RSM+L+NCLFRSGGC+ML TN  ALK RA+LKLK +VRTH  AIDE+Y+CC Q ED
Sbjct  187   AGSDRSMILANCLFRSGGCAMLLTNKRALKHRAMLKLKCLVRTHHGAIDESYDCCHQRED  246

Query  911   PQGFRGFHLSKRLPKVATKALVTNFKVLVPKAIPLWETLRFLAVSSLER----RKFKLPS  744
              QG  GFHL K LPKVAT+ALV N + + PK +P+ E LRF+ VS + +    R  K   
Sbjct  247   DQGRSGFHLDKSLPKVATRALVDNLREITPKILPVRELLRFMVVSFIRKYWSHRSTKGAG  306

Query  743   LLGKPILNMKTGIEHFCLHPGGRAVIDGVGVSLGLSEYDLEPARMSLHRWGNTSAGGLWY  564
                KP +N KTG++HFC+H GG+AVIDG+GVSL L+E+DLEPARM+LHR+GNTSA  LWY
Sbjct  307   SSPKPAINFKTGVDHFCIHTGGKAVIDGIGVSLDLTEHDLEPARMTLHRFGNTSASSLWY  366

Query  563   VLGYMEAKKRLKKGDRILMLSLGAGFKCNNCVWEVMKDLGDP-NVWEDCIDRYPPETLVN  387
             VLGYMEAK+RLKKGDR+LM+S GAGFKCN+C+WEV++DLGD  N W DCID YPP +L N
Sbjct  367   VLGYMEAKRRLKKGDRVLMISFGAGFKCNSCLWEVLRDLGDAGNAWTDCIDSYPPNSLTN  426

Query  386   PFTEKFDWIHD  354
             PF EK+ WI++
Sbjct  427   PFLEKYGWINN  437



>ref|XP_009794082.1| PREDICTED: 3-ketoacyl-CoA synthase 12-like [Nicotiana sylvestris]
Length=466

 Score =   531 bits (1369),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 256/447 (57%), Positives = 339/447 (76%), Gaps = 2/447 (0%)
 Frame = -1

Query  1691  VAIYSLLFLYTVVYILRSYLRRRHQCCYMLNYECYKPTDVARRLSTDKSALVVYRNRNLG  1512
             + +YSL        I +   ++RHQ CY+L+Y+CYKPTD  R LST     V+ RN+NLG
Sbjct  6     ILLYSLPIFCLFFTIWKIIDQKRHQHCYILDYQCYKPTD-DRMLSTRFCGEVIRRNKNLG  64

Query  1511  IDEFRFLLQTMVNSGVGEQTYIPINVLEGREDSPTLEDSFTEVDDIMFQTLDNLFAKSKV  1332
             ++E++FLL+ +V+SG+GEQTY P  V  GRE+ PT +D  +E+++    ++D +  ++K+
Sbjct  65    LNEYKFLLKAIVSSGIGEQTYAPRMVFYGREECPTYDDGISEMEEFFHDSIDKILKRTKI  124

Query  1331  SPREIDvlvvnvsllasapsLTSRVVNRYKMREDVKTFNLSGMGCSASVVAIDIVHHLFK  1152
              P EIDVLVVN+S+LA+ PSL++R++N Y MRED+K +NL+GMGCSAS ++I+IV ++FK
Sbjct  125   LPSEIDVLVVNISMLATMPSLSARIINHYNMREDIKVYNLTGMGCSASPISINIVQNIFK  184

Query  1151  VYKNSYAIVVSTESLGANWYSGKERSMMLSNCLFRSGGCSMLFTNNPALKPRAILKLKHM  972
             + KN  A+VV++ESL  NWYSG +RSM+LSNCLFRSGGC++L TN  +LK + + KLK +
Sbjct  185   IQKNKLALVVTSESLSPNWYSGNDRSMILSNCLFRSGGCAILLTNKLSLKNKTMFKLKCL  244

Query  971   VRTHIAAIDEAYECCKQVEDPQGFRGFHLSKRLPKVATKALVTNFKVLVPKAIPLWETLR  792
             VRTH  A DE+Y CC Q ED QG  GFHL K LPK AT+A V N K + PK +P+ E LR
Sbjct  245   VRTHHGAKDESYNCCIQKEDDQGRIGFHLDKTLPKAATRAFVDNLKEIAPKILPIRELLR  304

Query  791   FLAVSSLERRKFKLPSLLG-KPILNMKTGIEHFCLHPGGRAVIDGVGVSLGLSEYDLEPA  615
             F  +S+L +   K     G +P++N KTG++HFCLH GG+AVIDG+G +L LSEYDLEPA
Sbjct  305   FAIISTLRKFNQKYKGKFGPRPVINFKTGVDHFCLHTGGKAVIDGIGANLNLSEYDLEPA  364

Query  614   RMSLHRWGNTSAGGLWYVLGYMEAKKRLKKGDRILMLSLGAGFKCNNCVWEVMKDLGDPN  435
             RM+LHR+GNTSA  LWYVLGYMEAKKRLKKGD + M+S GAGFKCN+C+WEV++DLGD N
Sbjct  365   RMTLHRFGNTSASSLWYVLGYMEAKKRLKKGDNVFMISFGAGFKCNSCLWEVVRDLGDGN  424

Query  434   VWEDCIDRYPPETLVNPFTEKFDWIHD  354
             VWEDCID YPP+TL NPF EKF WI +
Sbjct  425   VWEDCIDNYPPKTLANPFLEKFGWIQN  451



>ref|XP_007219332.1| hypothetical protein PRUPE_ppa019292mg [Prunus persica]
 gb|EMJ20531.1| hypothetical protein PRUPE_ppa019292mg [Prunus persica]
Length=434

 Score =   528 bits (1361),  Expect = 3e-180, Method: Compositional matrix adjust.
 Identities = 268/454 (59%), Positives = 328/454 (72%), Gaps = 29/454 (6%)
 Frame = -1

Query  1691  VAIYSLLFLYTVVYILRSYLRRRHQCCYMLNYECYKPTDVARRLSTDKSALVVYRNRNLG  1512
             +A+  L   Y +  + +  LRRR Q CY+L YECY PT+    LSTD    +V RN+NLG
Sbjct  1     MAMCLLALFYGLSCLHKIVLRRRDQACYLLAYECYMPTN-DMMLSTDSCVKIVTRNKNLG  59

Query  1511  IDEFRFLLQTMVNSGVGEQTYIPINVLEGREDSPTLEDSFTEVDDIMFQTLDNLFAK-SK  1335
             ++EFRFLL+T+VNSG+GE+TY P N++EGRED  TL D   E+DDI+F TLD LFAK S 
Sbjct  60    LEEFRFLLKTIVNSGIGEETYCPKNIIEGREDDATLVDELLEMDDIVFDTLDKLFAKFSA  119

Query  1334  VSPREIDvlvvnvsllasapsLTSRVVNRYKMREDVKTFNLSGMGCSASVVAIDIVHHLF  1155
             +SP +ID+LVVNVS+ + APSLTSR+VNRYKMRED+KTFNLSGMGC              
Sbjct  120   ISPSQIDILVVNVSMFSPAPSLTSRIVNRYKMREDIKTFNLSGMGC--------------  165

Query  1154  KVYKNSYAIVVSTESLGANWYSGKERSMMLSNCLFRSGGCSMLFTNNPALKPRAILKLKH  975
                          +S+  +WY GKE+SMML+NCLFRSGGCSMLFTNN  LK +A LKL H
Sbjct  166   -------------KSISPHWYCGKEKSMMLTNCLFRSGGCSMLFTNNRDLKHQAKLKLNH  212

Query  974   MVRTHIAAIDEAYECCKQVEDPQGFRGFHLSKRLPKVATKALVTNFKVLVPKAIPLWETL  795
             +VR H  + DEAY CC QVED  G++GF L+K L K A++    N +VL+PK +PL E L
Sbjct  213   LVRMHTGSSDEAYNCCMQVEDESGYKGFRLTKYLVKAASQGFTMNLQVLLPKVLPLREML  272

Query  794   RFLAVSSLERRKFKLPSLLGKPILNMKTGIEHFCLHPGGRAVIDGVGVSLGLSEYDLEPA  615
             R+L +S L+  K +         LN+KTGIEHFC+HPGGRAVIDG+G SLGLS+YD+EP+
Sbjct  273   RYLVISKLKSAKSQKVKADEGVGLNLKTGIEHFCIHPGGRAVIDGIGKSLGLSDYDVEPS  332

Query  614   RMSLHRWGNTSAGGLWYVLGYMEAKKRLKKGDRILMLSLGAGFKCNNCVWEVMKDLGDPN  435
             RM+LHR+GNTSA G WY LGYMEAKKRLKKG++ILM   GAGFKCNN VWEV+KDL D N
Sbjct  333   RMALHRFGNTSAAGFWYALGYMEAKKRLKKGNKILMSGFGAGFKCNNIVWEVLKDLDDAN  392

Query  434   VWEDCIDRYPPETLVNPFTEKFDWIHDPCLNFLR  333
             VW+DCID YPP  LVNPF EK+ WI D  LNF+R
Sbjct  393   VWKDCIDSYPPNNLVNPFMEKYSWIDDEILNFVR  426



>ref|XP_003606593.1| 3-ketoacyl-CoA synthase [Medicago truncatula]
 gb|AES88790.1| 3-ketoacyl-CoA synthase-like protein [Medicago truncatula]
Length=464

 Score =   530 bits (1364),  Expect = 4e-180, Method: Compositional matrix adjust.
 Identities = 257/451 (57%), Positives = 345/451 (76%), Gaps = 2/451 (0%)
 Frame = -1

Query  1703  METLVAIYSLLFLYTVVYILRSYLRRRHQCCYMLNYECYKPTDVARRLSTDKSALVVYRN  1524
             ME L  +Y +  LY    I + Y ++R Q CY+L+Y+CYKPT   R L T+    V+ R 
Sbjct  1     MEFLSLVYVVPALYICFLIWKLYDQKRDQECYILDYQCYKPTQ-DRMLGTEFCGKVITRT  59

Query  1523  RNLGIDEFRFLLQTMVNSGVGEQTYIPINVLEGREDSPTLEDSFTEVDDIMFQTLDNLFA  1344
             +NLG++E++FLL+ +V+ G+GEQTY P NV EGRE SPTL+D  +E+++    ++  L +
Sbjct  60    QNLGLNEYKFLLKAIVSCGIGEQTYAPRNVFEGREASPTLKDGISEMEEFFDDSIAKLLS  119

Query  1343  KSKVSPREIDvlvvnvsllasapsLTSRVVNRYKMREDVKTFNLSGMGCSASVVAIDIVH  1164
             +S + P EIDVLVVN+++L+  PSL+SR++NRYKMR DVK +NL+ MGCSAS++++DIV 
Sbjct  120   RSGICPSEIDVLVVNIAMLSVLPSLSSRIINRYKMRHDVKVYNLTAMGCSASLISLDIVK  179

Query  1163  HLFKVYKNSYAIVVSTESLGANWYSGKERSMMLSNCLFRSGGCSMLFTNNPALKPRAILK  984
             ++FK  +N  A++V++ESL  NWY+G ++SM+L+NCLFRSGGC++L TN  +LK R+ILK
Sbjct  180   NIFKSQRNKLALLVTSESLCPNWYTGNDKSMILANCLFRSGGCAVLLTNKRSLKNRSILK  239

Query  983   LKHMVRTHIAAIDEAYECCKQVEDPQGFRGFHLSKRLPKVATKALVTNFKVLVPKAIPLW  804
             LK +VRTH  A D++Y CC Q ED QG  G HL K LPK AT+A V N +V+ PK +P  
Sbjct  240   LKCLVRTHHGARDDSYTCCTQKEDEQGRLGIHLGKTLPKAATRAFVDNLRVISPKILPTK  299

Query  803   ETLRFLAVSSLER-RKFKLPSLLGKPILNMKTGIEHFCLHPGGRAVIDGVGVSLGLSEYD  627
             E LRFL V+ L++ +K    +   K  LN KTG++HFCLH GG+AVIDG+G+SL LSEYD
Sbjct  300   EILRFLFVTLLKKLKKTSGGTKSTKSPLNFKTGVDHFCLHTGGKAVIDGIGMSLDLSEYD  359

Query  626   LEPARMSLHRWGNTSAGGLWYVLGYMEAKKRLKKGDRILMLSLGAGFKCNNCVWEVMKDL  447
             LEPARM+LHR+GNTSA  LWYVLGYMEAKKRLKKGDR+ M+S GAGFKCN+C+WEVMKD+
Sbjct  360   LEPARMTLHRFGNTSASSLWYVLGYMEAKKRLKKGDRVFMISFGAGFKCNSCLWEVMKDV  419

Query  446   GDPNVWEDCIDRYPPETLVNPFTEKFDWIHD  354
             GD NVWEDCID YPP++LVNPF EK+ W+++
Sbjct  420   GDANVWEDCIDNYPPKSLVNPFMEKYGWVNE  450



>ref|XP_003606586.1| 3-ketoacyl-CoA synthase [Medicago truncatula]
 gb|AES88783.1| 3-ketoacyl-CoA synthase-like protein [Medicago truncatula]
Length=472

 Score =   528 bits (1361),  Expect = 1e-179, Method: Compositional matrix adjust.
 Identities = 264/459 (58%), Positives = 343/459 (75%), Gaps = 10/459 (2%)
 Frame = -1

Query  1703  METLVAIYSLLFLYTVVYILRSYLRRRHQCCYMLNYECYKPTDVARRLSTDKSALVVYRN  1524
             ME L  +Y +  LY    I + Y ++R Q CY+L+Y+CYKPT   R L T+    ++ R 
Sbjct  1     MEFLSLLYVVPALYICFLIWKLYDQKRDQECYILDYQCYKPTQ-DRMLGTEFCGKIIRRT  59

Query  1523  RNLGIDEFRFLLQTMVNSGVGEQTYIPINVLEGREDSPTLEDSFTEVDDIMFQTLDNLFA  1344
             +NLG+DE++FLL+ +V+SG+GEQTY P NV EGRE SPTL D  +E+++    ++  L A
Sbjct  60    KNLGLDEYKFLLKAVVSSGIGEQTYAPRNVFEGRESSPTLNDGISEMEEFFNDSIAKLLA  119

Query  1343  KSKVSPREIDvlvvnvsllasapsLTSRVVNRYKMREDVKTFNLSGMGCSASVVAIDIVH  1164
             +S +SP EID+LVVN+S+LA  PSL+SR++NRYKMR DVK +NL+GMGCSAS++++DIV 
Sbjct  120   RSAISPSEIDILVVNISMLAILPSLSSRIINRYKMRHDVKVYNLTGMGCSASLISLDIVK  179

Query  1163  HLFKVYKNSYAIVVSTESLGANWYSGKERSMMLSNCLFRSGGCSMLFTNNPALKPRAILK  984
             ++FK  +N  A++V++ESL  NWY+G +RSM+L+NCLFRSGGCS+L TN  +LK R+ILK
Sbjct  180   NIFKSQRNKLALLVTSESLSPNWYTGNDRSMILANCLFRSGGCSILLTNKRSLKNRSILK  239

Query  983   LKHMVRTHIAAIDEAYECCKQVEDPQGFRGFHLSKRLPKVATKALVTNFKVLVPKAIPLW  804
             LK +VRTH  A +++Y CC Q ED QG  GFHL K LPK ATK  V N +V+ PK +P  
Sbjct  240   LKCLVRTHHGAREDSYNCCIQKEDEQGRLGFHLGKTLPKAATKVFVDNLRVISPKILPTR  299

Query  803   ETLRFLAVSSLERRKFKLPSLLG---------KPILNMKTGIEHFCLHPGGRAVIDGVGV  651
             E LRFL V    + K    S            K  LN KTG++HFCLH GG+AVIDG+G+
Sbjct  300   ELLRFLLVLLFNKLKIATSSSKSYSGGATKSTKSPLNFKTGVDHFCLHTGGKAVIDGIGM  359

Query  650   SLGLSEYDLEPARMSLHRWGNTSAGGLWYVLGYMEAKKRLKKGDRILMLSLGAGFKCNNC  471
             SL LSEYDLEPARM+LHR+GNTSA  LWYVLGYMEAKKRLKKGDR+ M+S GAGFKCN+C
Sbjct  360   SLDLSEYDLEPARMTLHRFGNTSASSLWYVLGYMEAKKRLKKGDRVFMISFGAGFKCNSC  419

Query  470   VWEVMKDLGDPNVWEDCIDRYPPETLVNPFTEKFDWIHD  354
             +WEVMKD+GD NVWEDCID YPP++LVNPF EK+ W+++
Sbjct  420   LWEVMKDVGDANVWEDCIDNYPPKSLVNPFMEKYSWVNE  458



>ref|XP_008461615.1| PREDICTED: 3-ketoacyl-CoA synthase 21-like [Cucumis melo]
 ref|XP_008461616.1| PREDICTED: 3-ketoacyl-CoA synthase 21-like [Cucumis melo]
Length=469

 Score =   528 bits (1360),  Expect = 1e-179, Method: Compositional matrix adjust.
 Identities = 265/460 (58%), Positives = 351/460 (76%), Gaps = 7/460 (2%)
 Frame = -1

Query  1703  METLVAIYSLLFLYTVVYILRSYLRRRHQCCYMLNYECYKPTDVARRLSTDKSALVVYRN  1524
             ME  V I  L   Y   YI +  L+RR QCCY+L YECYK T+  R+L  +    ++ RN
Sbjct  1     MEIFVPICLLSLFYVFFYIWKLILQRRGQCCYLLGYECYKTTE-DRKLGVESCINIILRN  59

Query  1523  RNLGIDEFRFLLQTMVNSGVGEQTYIPINVLEGREDSPTLEDSFTEVDDIMFQTLDNLFA  1344
             +NLG++E+R+LL+++VNSG+G +TY P NV+ GRE++P+L ++  E+DD+    LD LFA
Sbjct  60    KNLGLEEYRYLLKSIVNSGLGGETYGPRNVIAGREENPSLSEAILEMDDVFSSILDKLFA  119

Query  1343  KSKVSPREIDvlvvnvsllasapsLTSRVVNRYKMREDVKTFNLSGMGCSASVVAIDIVH  1164
             K+ VSP +ID+LVVNVSL + APSLT+R++NRYKM+ED+K FNLSGMGCSAS+VAID+V 
Sbjct  120   KTGVSPSDIDILVVNVSLFSPAPSLTARIINRYKMKEDIKAFNLSGMGCSASIVAIDLVK  179

Query  1163  HLFKVYKNSYAIVVSTESLGANWYSGKERSMMLSNCLFRSGGCSMLFTNNPALKPRAILK  984
             HLFK  +N+YA+VVSTES+G NWYSGKE+ MML+NCL+RSGGCSML TNN ALK  A+LK
Sbjct  180   HLFKTNRNAYAVVVSTESIGPNWYSGKEQPMMLTNCLYRSGGCSMLLTNNSALKHSALLK  239

Query  983   LKHMVRTHIAAIDEAYECCKQVEDPQGFRGFHLSKRLPKVATKALVTNFKVLVPKAIPLW  804
             LK ++RTH+ + +EAY C  QVED  G RGF L+K +  VAT+AL  N + L+P+ +PL 
Sbjct  240   LKCILRTHLGSSNEAYGCSIQVEDDHGHRGFRLTKHIKAVATQALTFNLQSLLPRILPLR  299

Query  803   ETLRFLAVSSLERRKFKL--PSLLGKPI-LNMKTGIEHFCLHPGGRAVIDGVGVSLGLSE  633
             E +R+   S L    +KL   ++  K + LN+KTG++HF + P  RAVIDG+G SLGLS+
Sbjct  300   ELIRY---SILTHPLYKLVDKNIEAKKVRLNLKTGVDHFGIPPTERAVIDGLGKSLGLSD  356

Query  632   YDLEPARMSLHRWGNTSAGGLWYVLGYMEAKKRLKKGDRILMLSLGAGFKCNNCVWEVMK  453
             YDLEPARM+LHR+GNTS GGLWYVLGYMEAKKRLKKGD++LM+S GAG++CN+CVWEVM 
Sbjct  357   YDLEPARMALHRFGNTSTGGLWYVLGYMEAKKRLKKGDKVLMISFGAGYECNSCVWEVMS  416

Query  452   DLGDPNVWEDCIDRYPPETLVNPFTEKFDWIHDPCLNFLR  333
             +L D NVW+DCI  YP +   +P  EK  W++D  L+F++
Sbjct  417   NLKDDNVWKDCILNYPTKNTKHPLAEKCGWLNDERLSFVK  456



>ref|XP_009598249.1| PREDICTED: 3-ketoacyl-CoA synthase 3-like [Nicotiana tomentosiformis]
Length=467

 Score =   528 bits (1359),  Expect = 2e-179, Method: Compositional matrix adjust.
 Identities = 256/446 (57%), Positives = 335/446 (75%), Gaps = 1/446 (0%)
 Frame = -1

Query  1691  VAIYSLLFLYTVVYILRSYLRRRHQCCYMLNYECYKPTDVARRLSTDKSALVVYRNRNLG  1512
             +  Y L F Y +  I +   R+RHQ CY+L+YEC+KPTD  R LST  S  V+ RN++LG
Sbjct  6     ILFYGLPFFYLLFLIWKIIDRKRHQNCYILDYECHKPTD-DRMLSTKFSGEVIRRNKHLG  64

Query  1511  IDEFRFLLQTMVNSGVGEQTYIPINVLEGREDSPTLEDSFTEVDDIMFQTLDNLFAKSKV  1332
             I+E++FLL+ +V+SG+GEQTY P  +  GRE  PT ED   E+++    ++D +  ++ +
Sbjct  65    INEYQFLLKAIVSSGIGEQTYAPRMIFYGREACPTYEDGILEMEEFFHDSIDKVLKRNGI  124

Query  1331  SPREIDvlvvnvsllasapsLTSRVVNRYKMREDVKTFNLSGMGCSASVVAIDIVHHLFK  1152
             SP EIDVLVVN+S+L   PSL +R++N YKMRED+K +N++GMGCSASV++I+IV  +FK
Sbjct  125   SPSEIDVLVVNISMLTCMPSLAARIINYYKMREDIKVYNITGMGCSASVISINIVESIFK  184

Query  1151  VYKNSYAIVVSTESLGANWYSGKERSMMLSNCLFRSGGCSMLFTNNPALKPRAILKLKHM  972
               KN  A++V++ESL  NWY+G  RSM+L+NCLFRSGG ++L TN  ALK +A+ KLK +
Sbjct  185   NEKNKVALMVTSESLSPNWYTGNNRSMILANCLFRSGGSAILLTNKVALKNKAMFKLKCL  244

Query  971   VRTHIAAIDEAYECCKQVEDPQGFRGFHLSKRLPKVATKALVTNFKVLVPKAIPLWETLR  792
             VRTH  A DEAY+ C Q ED QG  GFHL K LPK ATKALV N K + P  +P+ E LR
Sbjct  245   VRTHHGAKDEAYDSCIQKEDDQGHIGFHLDKTLPKAATKALVDNLKTIAPLILPVRELLR  304

Query  791   FLAVSSLERRKFKLPSLLGKPILNMKTGIEHFCLHPGGRAVIDGVGVSLGLSEYDLEPAR  612
             F  VS + +  +       +P++N KTG++H CLH GG+AVIDGVG +L LSEYDLEPAR
Sbjct  305   FAIVSLVRKMNWGSTKGGARPVVNFKTGVDHICLHTGGKAVIDGVGTNLNLSEYDLEPAR  364

Query  611   MSLHRWGNTSAGGLWYVLGYMEAKKRLKKGDRILMLSLGAGFKCNNCVWEVMKDLGDPNV  432
             M+LHR+GNTSA  LWYVLGYMEAKKRLKKGD++LM+S GAGFKCN+C+WEV++DLG+ NV
Sbjct  365   MTLHRFGNTSASSLWYVLGYMEAKKRLKKGDKVLMISFGAGFKCNSCLWEVLRDLGNENV  424

Query  431   WEDCIDRYPPETLVNPFTEKFDWIHD  354
             W+DCID YPP+TL NPF EKF W+HD
Sbjct  425   WKDCIDNYPPKTLANPFLEKFGWLHD  450



>ref|XP_002298380.2| hypothetical protein POPTR_0001s24120g [Populus trichocarpa]
 gb|EEE83185.2| hypothetical protein POPTR_0001s24120g [Populus trichocarpa]
Length=446

 Score =   526 bits (1356),  Expect = 2e-179, Method: Compositional matrix adjust.
 Identities = 253/444 (57%), Positives = 344/444 (77%), Gaps = 6/444 (1%)
 Frame = -1

Query  1703  METLVAIYSLLFLYTVVYILRSYLRRRHQCCYMLNYECYKPTDVARRLSTDKSALVVYRN  1524
             M+  + +Y+ L  Y +  + R   R+R + CY+L+YEC+KPTD  R+L T+ S  V+ RN
Sbjct  1     MDVPMLVYAFLIFYPLFMLWRRIDRKRDRECYILDYECHKPTD-DRKLDTECSGQVIRRN  59

Query  1523  RNLGIDEFRFLLQTMVNSGVGEQTYIPINVLEGREDSPTLEDSFTEVDDIMFQTLDNLFA  1344
             +NLG++E++FLL+ +V+SG+GEQTY P  +  G+E++PTL+D  +E+++    ++  L A
Sbjct  60    KNLGLNEYKFLLRAIVSSGIGEQTYGPRIIFNGQEENPTLQDLISEMEEFFHDSIGKLLA  119

Query  1343  KSKVSPREIDvlvvnvsllasapsLTSRVVNRYKMREDVKTFNLSGMGCSASVVAIDIVH  1164
             +S ++P+EIDVLVVNVS+ +  PSL + ++N YK+REDVK FNL+GMGCSAS+++++IV 
Sbjct  120   RSGIAPKEIDVLVVNVSMQSVVPSLPAMIINHYKLREDVKVFNLTGMGCSASLISVNIVQ  179

Query  1163  HLFKVYKNSYAIVVSTESLGANWYSGKERSMMLSNCLFRSGGCSMLFTNNPALKPRAILK  984
             ++FK YKN+YA+VV++ESL  NWY+G +RSM+L+NCLFRSGGC+ML TN  ALK RA+LK
Sbjct  180   NIFKTYKNAYALVVTSESLSPNWYAGSDRSMILANCLFRSGGCAMLLTNKRALKHRAMLK  239

Query  983   LKHMVRTHIAAIDEAYECCKQVEDPQGFRGFHLSKRLPKVATKALVTNFKVLVPKAIPLW  804
             LK +VRTH  AIDE+Y+CC Q ED QG  GFHL K LPKVAT+ALV N + + PK +P+ 
Sbjct  240   LKCLVRTHHGAIDESYDCCHQREDDQGRSGFHLDKSLPKVATRALVDNLREITPKILPVR  299

Query  803   ETLRFLAVSSLER----RKFKLPSLLGKPILNMKTGIEHFCLHPGGRAVIDGVGVSLGLS  636
             E LRF+ VS + +    R  K      KP +N KTG++HFC+H GG+AVIDG+GVSL L+
Sbjct  300   ELLRFMVVSFIRKYWSHRSTKGAGSSPKPAINFKTGVDHFCIHTGGKAVIDGIGVSLDLT  359

Query  635   EYDLEPARMSLHRWGNTSAGGLWYVLGYMEAKKRLKKGDRILMLSLGAGFKCNNCVWEVM  456
             E+DLEPARM+LHR+GNTSA  LWYVLGYMEAK+RLKKGDR+LM+S GAGFKCN+C+WEV+
Sbjct  360   EHDLEPARMTLHRFGNTSASSLWYVLGYMEAKRRLKKGDRVLMISFGAGFKCNSCLWEVL  419

Query  455   KDLGDP-NVWEDCIDRYPPETLVN  387
             +DLGD  N W DCID YPP +L N
Sbjct  420   RDLGDAGNAWTDCIDSYPPNSLTN  443



>ref|XP_009358307.1| PREDICTED: 3-ketoacyl-CoA synthase 12-like [Pyrus x bretschneideri]
Length=469

 Score =   526 bits (1356),  Expect = 7e-179, Method: Compositional matrix adjust.
 Identities = 261/459 (57%), Positives = 350/459 (76%), Gaps = 13/459 (3%)
 Frame = -1

Query  1697  TLVAIYSLLFLYTVVYILRSYLRRRHQCCYMLNYECYKPTDVARRLSTDKSALVVYRNRN  1518
              LV ++S LF   +++ L  ++ RR   CY+L+Y+CYKPTD  R+L T+ S  ++ R +N
Sbjct  5     ALVCVFSALFFIFMMWKL--FVERRDHECYILDYQCYKPTD-DRKLDTEYSGEIIKRTKN  61

Query  1517  LGIDEFRFLLQTMVNSGVGEQTYIPINVLEGREDSPTLEDSFTEVDDIMFQTLDNLFAKS  1338
             LG+ E++FLL+ +V+SG+GEQTY P  +  GRE  PTLEDS +E+++    ++  L  +S
Sbjct  62    LGLLEYQFLLKAIVSSGIGEQTYAPRIMFSGRESCPTLEDSISEMEEFFHDSIKKLLDRS  121

Query  1337  KVSPREIDvlvvnvsllasapsLTSRVVNRYKMREDVKTFNLSGMGCSASVVAIDIVHHL  1158
              +SP EIDVLVVNVS+ AS PSL+SR++N YKMRED+K FNLSGMGCSAS++++DIV ++
Sbjct  122   GISPSEIDVLVVNVSMFASVPSLSSRIINHYKMREDIKVFNLSGMGCSASLISVDIVKNI  181

Query  1157  FKVYKNSYAIVVSTESLGANWYSGKERSMMLSNCLFRSGGCSMLFTNNPALKPRAILKLK  978
             FK +KN YA+VV++ESL  NWY+G  RSM+L+NCLFRSGGC++L TN  ALK RA+ KLK
Sbjct  182   FKSHKNVYALVVTSESLSPNWYTGNARSMILANCLFRSGGCAILLTNKRALKHRAMFKLK  241

Query  977   HMVRTHIAAIDEAYECCKQVEDPQGFRGFHLSKRLPKVATKALVTNFKVLVPKAIPLWET  798
              +VRTH  A D++Y CC Q ED QG  GFHL K LPK AT+A V N +V+ PK +P+ E 
Sbjct  242   CLVRTHHGARDDSYGCCIQQEDTQGNPGFHLDKFLPKAATRAFVDNLRVMSPKILPIREL  301

Query  797   LRFLAVSSLER-RKFKLPSLLG-------KPILNMKTGIEHFCLHPGGRAVIDGVGVSLG  642
             +RFL V+ +++   F+ P+  G       K ++N KTG +HFCLH GG+AVIDG+G++LG
Sbjct  302   VRFLLVTLVKKLTSFQQPTKGGATSSPSPKAVINFKTGADHFCLHTGGKAVIDGIGLNLG  361

Query  641   LSEYDLEPARMSLHRWGNTSAGGLWYVLGYMEAKKRLKKGDRILMLSLGAGFKCNNCVWE  462
             LSEYDLEPARM+LHR+GNTSA  LWYVLGYMEAK+RLKKG+++LM+S GAGFKCN+C+WE
Sbjct  362   LSEYDLEPARMTLHRFGNTSASSLWYVLGYMEAKQRLKKGEKVLMISFGAGFKCNSCLWE  421

Query  461   VMKDLGDPNVWEDCIDRYPPETLVNPFTEKFDWIH--DP  351
             V++DLGD NVW++ I  YPP+TL NPF E + WIH  DP
Sbjct  422   VVRDLGDENVWKEDIAVYPPKTLTNPFLENYGWIHQEDP  460



>ref|XP_008385185.1| PREDICTED: 3-ketoacyl-CoA synthase 12-like [Malus domestica]
Length=471

 Score =   525 bits (1351),  Expect = 3e-178, Method: Compositional matrix adjust.
 Identities = 259/461 (56%), Positives = 345/461 (75%), Gaps = 11/461 (2%)
 Frame = -1

Query  1703  METLVAIYSLLFLYTVVYILRSYLRRRHQCCYMLNYECYKPTDVARRLSTDKSALVVYRN  1524
             ME L  +     LY +  + + + +RR Q CY+L+Y CYKPTD  R+L T+ S  ++ R 
Sbjct  1     MELLALVCVFSALYFIFIMWKLFDKRRDQECYILDYHCYKPTD-DRKLDTEFSGEIIKRT  59

Query  1523  RNLGIDEFRFLLQTMVNSGVGEQTYIPINVLEGREDSPTLEDSFTEVDDIMFQTLDNLFA  1344
             +NLG+ E++FLL+ +V+SG+GEQTY P  +  GRE  PTL+DS +E+++    ++  L  
Sbjct  60    KNLGLLEYQFLLKAIVSSGIGEQTYAPRIMFSGRESCPTLDDSISEMEEFFHDSIKKLLD  119

Query  1343  KSKVSPREIDvlvvnvsllasapsLTSRVVNRYKMREDVKTFNLSGMGCSASVVAIDIVH  1164
             +S +SP EIDVLVVNVS+ AS PSL+SR++N YKMRE++K FNLSGMGCSAS++++DIV 
Sbjct  120   RSGISPSEIDVLVVNVSMFASVPSLSSRIINHYKMRENIKVFNLSGMGCSASLISVDIVK  179

Query  1163  HLFKVYKNSYAIVVSTESLGANWYSGKERSMMLSNCLFRSGGCSMLFTNNPALKPRAILK  984
             ++FK ++N YA+VV++ESL  NWYSG  RSM+L+NCLFRSGGC++L TN  ALK RA+ K
Sbjct  180   NIFKSHRNVYALVVTSESLSPNWYSGNARSMILANCLFRSGGCAILLTNKRALKHRAMFK  239

Query  983   LKHMVRTHIAAIDEAYECCKQVEDPQGFRGFHLSKRLPKVATKALVTNFKVLVPKAIPLW  804
             LK +VRTH    D++Y CC Q ED QG+ GFHL K LPK AT+A V N +V+ PK +P+ 
Sbjct  240   LKCLVRTHHGGRDDSYGCCIQQEDTQGYLGFHLDKYLPKAATRAFVDNLRVISPKILPIR  299

Query  803   ETLRFLAVSSLERRKFKLPSLLG--------KPILNMKTGIEHFCLHPGGRAVIDGVGVS  648
             E +RFL V+ ++++     S  G        KP++N KTG++HFC+H GG+AVIDG+G++
Sbjct  300   ELMRFLLVTLVKKKTSSQQSTKGGAISSPSPKPVINFKTGVDHFCIHTGGKAVIDGIGLN  359

Query  647   LGLSEYDLEPARMSLHRWGNTSAGGLWYVLGYMEAKKRLKKGDRILMLSLGAGFKCNNCV  468
             LGLSEYDLEPARM+LHR+GNTSA  LWYVLGYMEAKKRLKKGD +LM+S GAGFKCN+C+
Sbjct  360   LGLSEYDLEPARMTLHRFGNTSASSLWYVLGYMEAKKRLKKGDTVLMISFGAGFKCNSCL  419

Query  467   WEVMKDLGDPNVWEDCIDRYPPETLVNPFTEKFDWI--HDP  351
              EV +DLGD NVW++ I  YPP+TL NPF EKF WI   DP
Sbjct  420   LEVXRDLGDENVWKEDIATYPPKTLTNPFLEKFGWIRHEDP  460



>ref|XP_007150274.1| hypothetical protein PHAVU_005G140100g [Phaseolus vulgaris]
 gb|ESW22268.1| hypothetical protein PHAVU_005G140100g [Phaseolus vulgaris]
Length=473

 Score =   525 bits (1351),  Expect = 4e-178, Method: Compositional matrix adjust.
 Identities = 262/462 (57%), Positives = 345/462 (75%), Gaps = 15/462 (3%)
 Frame = -1

Query  1703  METLVAIYSLLFLYTVVYILRSYLRRRHQCCYMLNYECYKPTDVARRLSTDKSALVVYRN  1524
             ME L+ +Y    LY    I + + +RR Q CY+L Y+ YKP D ++ L T+    ++ RN
Sbjct  1     MEFLILLYGATTLYLCFLIWKLFDQRRDQECYILEYQLYKPKDESK-LGTECCGRIIERN  59

Query  1523  RNLGIDEFRFLLQTMVNSGVGEQTYIPINVLEGREDSPTLEDSFTEVDDIMFQTLDNLFA  1344
             ++LG++E++FLL+ +VNSG+GE+TY P NV+EGRE +PTL D  TE+++    ++  L A
Sbjct  60    KHLGLNEYKFLLKAIVNSGIGEETYAPSNVIEGREATPTLNDGVTEMEEFFNDSIAKLLA  119

Query  1343  KSKVSPREIDvlvvnvsllasapsLTSRVVNRYKMREDVKTFNLSGMGCSASVVAIDIVH  1164
             +S +SP +IDVLVVNVS+ + APSLTSR++N YKMREDVK +NL+GMGCSAS++++DI+ 
Sbjct  120   RSGISPSQIDVLVVNVSMFSIAPSLTSRIINHYKMREDVKAYNLTGMGCSASLISLDIIR  179

Query  1163  HLFKVYKNSYAIVVSTESLGANWYSGKERSMMLSNCLFRSGGCSMLFTNNPALKPRAILK  984
              +FK  KN +A++V++ESL  NWY+G +RSM+L+NCLFRSGGC +L TN  +LK RA+L+
Sbjct  180   SVFKSQKNKFALLVTSESLSPNWYNGNDRSMILANCLFRSGGCVILLTNKRSLKNRAMLR  239

Query  983   LKHMVRTHIAAIDEAYECCKQVEDPQGFRGFHLSKRLPKVATKALVTNFKVLVPKAIPLW  804
             LK +VRTH  A ++AY CC Q ED +G  GF+L+K LPK AT+A V N +VL PK +P  
Sbjct  240   LKCLVRTHHGAREDAYSCCSQKEDEEGRLGFYLAKNLPKAATRAFVDNLRVLSPKVLPTR  299

Query  803   ETLRFLAVSSLERRKFKLPSLL-----------GKPILNMKTGIEHFCLHPGGRAVIDGV  657
             E LRF+ V  +  +K + PS              K  LN KTGIEHFCLH GG+AVIDG+
Sbjct  300   ELLRFMVVFLI--KKLRQPSSSLKSSSVGSNKSNKSPLNFKTGIEHFCLHTGGKAVIDGI  357

Query  656   GVSLGLSEYDLEPARMSLHRWGNTSAGGLWYVLGYMEAKKRLKKGDRILMLSLGAGFKCN  477
             G+SL L EYDLEPARM+LHR+GNTSA  LWYVLGYMEAKKRL KGDR+LM+S GAGFKCN
Sbjct  358   GMSLDLCEYDLEPARMTLHRFGNTSASSLWYVLGYMEAKKRLMKGDRVLMISFGAGFKCN  417

Query  476   NCVWEVMKDLGD-PNVWEDCIDRYPPETLVNPFTEKFDWIHD  354
             +C+WEVMKDL D PNVW +CID YPP++L NPF EKF WI+D
Sbjct  418   SCLWEVMKDLRDRPNVWNECIDDYPPDSLANPFMEKFGWIND  459



>gb|KDP44173.1| hypothetical protein JCGZ_05640 [Jatropha curcas]
Length=465

 Score =   524 bits (1350),  Expect = 4e-178, Method: Compositional matrix adjust.
 Identities = 250/450 (56%), Positives = 347/450 (77%), Gaps = 7/450 (2%)
 Frame = -1

Query  1685  IYSLLFLYTVVYILRSYLRRRHQCCYMLNYECYKPTDVARRLSTDKSALVVYRNRNLGID  1506
             +Y+ L  Y +  I R    +R Q CY+L+YECYKPTD  R+L T+ S  ++ R++NLG++
Sbjct  7     VYAFLIFYPLFLIWRWIDGKRDQECYILDYECYKPTD-DRKLDTEFSGEIIKRSKNLGLN  65

Query  1505  EFRFLLQTMVNSGVGEQTYIPINVLEGREDSPTLEDSFTEVDDIMFQTLDNLFAKSKVSP  1326
             E++FLL+ +V+SG+GEQTY P  +  GRE++PT ED   E+++   +++  L +++ +SP
Sbjct  66    EYKFLLKAIVSSGIGEQTYGPRMIFAGREENPTYEDGILEMEEFFQESIQKLLSRTGISP  125

Query  1325  REIDvlvvnvsllasapsLTSRVVNRYKMREDVKTFNLSGMGCSASVVAIDIVHHLFKVY  1146
             +EID LVVNVS+L++ PSL++R++N YKMRED+K FNL+GMGCSAS+++++I  +LFK Y
Sbjct  126   QEIDALVVNVSMLSAVPSLSARIINHYKMREDIKVFNLTGMGCSASLISVNIAQNLFKTY  185

Query  1145  KNSYAIVVSTESLGANWYSGKERSMMLSNCLFRSGGCSMLFTNNPALKPRAILKLKHMVR  966
             KNSY +V+++ESL  NWY+G  RSM+L+NCLFRSGGC++L TN  ALK +A+ KLK +VR
Sbjct  186   KNSYTLVITSESLSPNWYAGNNRSMILANCLFRSGGCAILLTNKRALKHKAMFKLKCLVR  245

Query  965   THIAAIDEAYECCKQVEDPQGFRGFHLSKRLPKVATKALVTNFKVLVPKAIPLWETLRFL  786
             TH  A D++Y+CC Q ED QG  GFHL K LPK AT+A V N +V+ PK +P+ E LRFL
Sbjct  246   THHGARDDSYDCCLQKEDEQGRVGFHLGKNLPKAATRAFVDNLRVISPKILPVRELLRFL  305

Query  785   AVSSLERRKFKLPSLL------GKPILNMKTGIEHFCLHPGGRAVIDGVGVSLGLSEYDL  624
              VS +++   ++ S         + ++N KTG++HFC+H GG+AVIDG+GV+L L+EYDL
Sbjct  306   IVSFIKKWSSQIRSSSSSKGGEDRAVINFKTGVDHFCIHTGGKAVIDGIGVNLDLTEYDL  365

Query  623   EPARMSLHRWGNTSAGGLWYVLGYMEAKKRLKKGDRILMLSLGAGFKCNNCVWEVMKDLG  444
             EPARM+LHR+GNTSA  LWYVL YMEAKKRLKKGDRILM+S GAGFKCN+C+WEV++DL 
Sbjct  366   EPARMTLHRFGNTSACSLWYVLAYMEAKKRLKKGDRILMISFGAGFKCNSCLWEVVRDLD  425

Query  443   DPNVWEDCIDRYPPETLVNPFTEKFDWIHD  354
               NVW+DCI+ YPP+TL NPF EK+ WI++
Sbjct  426   GSNVWKDCINDYPPKTLTNPFMEKYGWINN  455



>ref|XP_009771429.1| PREDICTED: 3-ketoacyl-CoA synthase 3-like [Nicotiana sylvestris]
Length=465

 Score =   524 bits (1350),  Expect = 5e-178, Method: Compositional matrix adjust.
 Identities = 252/446 (57%), Positives = 333/446 (75%), Gaps = 1/446 (0%)
 Frame = -1

Query  1691  VAIYSLLFLYTVVYILRSYLRRRHQCCYMLNYECYKPTDVARRLSTDKSALVVYRNRNLG  1512
             +  Y L   Y +  I +   R+RHQ CY+L+YEC+KPTD  R LST  S  ++ RN++LG
Sbjct  6     ILFYGLPLFYLLFLIWKIIDRKRHQNCYILDYECHKPTD-DRMLSTGFSGEIIRRNKHLG  64

Query  1511  IDEFRFLLQTMVNSGVGEQTYIPINVLEGREDSPTLEDSFTEVDDIMFQTLDNLFAKSKV  1332
             ++E++FLL+ +V+SG+GEQTY P NV  GRE  PT ED   E+++    ++D +  ++ +
Sbjct  65    LNEYKFLLKAIVSSGIGEQTYAPRNVFYGRETCPTYEDGILEMEEFFHDSIDKVLKRNGI  124

Query  1331  SPREIDvlvvnvsllasapsLTSRVVNRYKMREDVKTFNLSGMGCSASVVAIDIVHHLFK  1152
             SP EIDVLVVN+S+L   PSL  R++N YKMR+D+K +N++GMGCSAS+++I+IV ++FK
Sbjct  125   SPNEIDVLVVNISMLTCMPSLAGRIINYYKMRKDIKVYNITGMGCSASLISINIVENIFK  184

Query  1151  VYKNSYAIVVSTESLGANWYSGKERSMMLSNCLFRSGGCSMLFTNNPALKPRAILKLKHM  972
               KN  A++V++ESL  NWY G  RSM+LSNCLFRSGGC++L TN  ALK +A+ +LK++
Sbjct  185   NEKNKVALMVTSESLSPNWYIGNNRSMILSNCLFRSGGCAVLLTNKMALKNKAMFQLKNL  244

Query  971   VRTHIAAIDEAYECCKQVEDPQGFRGFHLSKRLPKVATKALVTNFKVLVPKAIPLWETLR  792
             VRTH  A DEAY+ C Q ED QG  GFHL K LPK ATKAL+ N K + P  +P+ E LR
Sbjct  245   VRTHHGAKDEAYDSCIQKEDDQGHIGFHLDKTLPKAATKALIDNLKTIAPLILPVRELLR  304

Query  791   FLAVSSLERRKFKLPSLLGKPILNMKTGIEHFCLHPGGRAVIDGVGVSLGLSEYDLEPAR  612
             F  VS + +  +       KP++N KTG++H CLH GG+AVIDGVG +L LSEYDLEPAR
Sbjct  305   FAIVSLVRKMNWGSTKGGAKPVINFKTGVDHICLHTGGKAVIDGVGTNLNLSEYDLEPAR  364

Query  611   MSLHRWGNTSAGGLWYVLGYMEAKKRLKKGDRILMLSLGAGFKCNNCVWEVMKDLGDPNV  432
             M+LHR+GNTSA  LWYVLGYMEAK+RLKKGD++LM+S GAGFKCN+C+WEV++DLGD NV
Sbjct  365   MTLHRFGNTSASSLWYVLGYMEAKERLKKGDKVLMISFGAGFKCNSCLWEVLRDLGDGNV  424

Query  431   WEDCIDRYPPETLVNPFTEKFDWIHD  354
             W+DCID YPP+   NPF EKF WI D
Sbjct  425   WKDCIDNYPPKNTANPFLEKFGWIQD  450



>ref|XP_004150960.1| PREDICTED: 3-ketoacyl-CoA synthase 21-like [Cucumis sativus]
 gb|KGN50504.1| Beta-ketoacyl-coa synthase family protein [Cucumis sativus]
Length=469

 Score =   524 bits (1350),  Expect = 5e-178, Method: Compositional matrix adjust.
 Identities = 260/458 (57%), Positives = 349/458 (76%), Gaps = 3/458 (1%)
 Frame = -1

Query  1703  METLVAIYSLLFLYTVVYILRSYLRRRHQCCYMLNYECYKPTDVARRLSTDKSALVVYRN  1524
             ME  V +  L   Y   YI +  L+RR QCCY+L YECYK ++  R+L  +    ++ RN
Sbjct  1     MEIFVPVCLLSLFYVFFYIWKLILQRRGQCCYLLGYECYKASE-DRKLGIESCINIILRN  59

Query  1523  RNLGIDEFRFLLQTMVNSGVGEQTYIPINVLEGREDSPTLEDSFTEVDDIMFQTLDNLFA  1344
              NLG++E+R+LL+++VNSG+G +TY P NV+ G E++P+L ++ +E+DD+    LD LFA
Sbjct  60    NNLGLEEYRYLLKSIVNSGLGGETYGPRNVIAGTEENPSLSEAISEMDDVFSSILDKLFA  119

Query  1343  KSKVSPREIDvlvvnvsllasapsLTSRVVNRYKMREDVKTFNLSGMGCSASVVAIDIVH  1164
             K+ VSP +ID+LVVNVSL + APSLT+R++NRYKM+ED+K FNLSGMGCSAS+VAID+V 
Sbjct  120   KTGVSPSDIDILVVNVSLFSPAPSLTARIINRYKMKEDIKAFNLSGMGCSASIVAIDLVK  179

Query  1163  HLFKVYKNSYAIVVSTESLGANWYSGKERSMMLSNCLFRSGGCSMLFTNNPALKPRAILK  984
             HLFK  +N+YA+VVSTES+G NWYSGKE+ MML+NCL+RSGGCSML TNN ALK  A+LK
Sbjct  180   HLFKTNRNAYAVVVSTESIGPNWYSGKEQPMMLTNCLYRSGGCSMLLTNNAALKHSALLK  239

Query  983   LKHMVRTHIAAIDEAYECCKQVEDPQGFRGFHLSKRLPKVATKALVTNFKVLVPKAIPLW  804
             LK ++RTH+ + +EAY C  QVED  G RGF L+K +  VAT+AL  N + L+P+ +PL 
Sbjct  240   LKCILRTHLGSSNEAYGCSIQVEDDHGHRGFRLTKHIKAVATQALTFNLQSLLPRILPLR  299

Query  803   ETLRFLAVSSLERRKFKLPSLLGKPI-LNMKTGIEHFCLHPGGRAVIDGVGVSLGLSEYD  627
             E +R+ A+ +    K    ++  K + LN+KTG++HF + P  RAVIDG+G SLGLS+YD
Sbjct  300   ELIRY-AILTHPLYKLVDRNIEAKKVRLNLKTGVDHFGIPPTERAVIDGLGKSLGLSDYD  358

Query  626   LEPARMSLHRWGNTSAGGLWYVLGYMEAKKRLKKGDRILMLSLGAGFKCNNCVWEVMKDL  447
             LEPARM+LHR+GNTS GGLWYVLGYMEAKKRLKKGD++LM+S GAG++CN+CVWEVM +L
Sbjct  359   LEPARMALHRFGNTSTGGLWYVLGYMEAKKRLKKGDKVLMISFGAGYECNSCVWEVMSNL  418

Query  446   GDPNVWEDCIDRYPPETLVNPFTEKFDWIHDPCLNFLR  333
              D NVW+DCI  YP +   +P  EK  W++D  L+F++
Sbjct  419   KDDNVWKDCILSYPTKNTKHPLAEKCSWLNDERLSFVK  456



>ref|XP_009782321.1| PREDICTED: 3-ketoacyl-CoA synthase 3-like [Nicotiana sylvestris]
Length=467

 Score =   524 bits (1349),  Expect = 7e-178, Method: Compositional matrix adjust.
 Identities = 255/443 (58%), Positives = 332/443 (75%), Gaps = 1/443 (0%)
 Frame = -1

Query  1682  YSLLFLYTVVYILRSYLRRRHQCCYMLNYECYKPTDVARRLSTDKSALVVYRNRNLGIDE  1503
             Y L F Y +  I +   R+RHQ CY+L+YEC+KPTD  R LST  S  V+ RN++LG++E
Sbjct  9     YGLPFFYLLFLIWKIIDRKRHQNCYILDYECHKPTD-DRMLSTKFSGEVIRRNKHLGLNE  67

Query  1502  FRFLLQTMVNSGVGEQTYIPINVLEGREDSPTLEDSFTEVDDIMFQTLDNLFAKSKVSPR  1323
             ++FLL+ +V+SG+GEQTY P  V  GRE  PT ED   E+++    ++D +  ++  SP 
Sbjct  68    YQFLLKAIVSSGIGEQTYAPRMVFYGREACPTYEDGILEMEEFFHDSIDKVLKRNGFSPS  127

Query  1322  EIDvlvvnvsllasapsLTSRVVNRYKMREDVKTFNLSGMGCSASVVAIDIVHHLFKVYK  1143
             +IDVLVVN+S+L   PSL  R++N YKMRED+K +N++GMGCSASV+AI+IV  +FK  K
Sbjct  128   DIDVLVVNISMLTCMPSLAGRIINYYKMREDIKVYNITGMGCSASVIAINIVQSIFKNEK  187

Query  1142  NSYAIVVSTESLGANWYSGKERSMMLSNCLFRSGGCSMLFTNNPALKPRAILKLKHMVRT  963
             N  A++V++ESL  NWY+G  RSM+L+NCLFRSGG ++L TN  ALK +A+ KLK +VRT
Sbjct  188   NKVALMVTSESLSPNWYTGNNRSMILANCLFRSGGSAILLTNKVALKNKAMFKLKCLVRT  247

Query  962   HIAAIDEAYECCKQVEDPQGFRGFHLSKRLPKVATKALVTNFKVLVPKAIPLWETLRFLA  783
             H  A DEAY+ C Q ED QG  GFHL K LPK ATKALV N K + P  +P+ E LRF  
Sbjct  248   HHGAKDEAYDSCIQKEDDQGHIGFHLDKTLPKAATKALVDNLKTIAPLVLPVRELLRFAI  307

Query  782   VSSLERRKFKLPSLLGKPILNMKTGIEHFCLHPGGRAVIDGVGVSLGLSEYDLEPARMSL  603
             VS + +  +       +P++N KTG++H CLH GG+AVIDGVG +L LSEYDLEPARM+L
Sbjct  308   VSLVRKMNWGSTKGGARPVINFKTGVDHICLHTGGKAVIDGVGTNLNLSEYDLEPARMTL  367

Query  602   HRWGNTSAGGLWYVLGYMEAKKRLKKGDRILMLSLGAGFKCNNCVWEVMKDLGDPNVWED  423
             HR+GNTSA  LWYVLGYMEAKKRLKKGD++LM+S GAGFKCN+C+WEV++DLG+ NVW+D
Sbjct  368   HRFGNTSASSLWYVLGYMEAKKRLKKGDKVLMISFGAGFKCNSCLWEVLRDLGNENVWKD  427

Query  422   CIDRYPPETLVNPFTEKFDWIHD  354
             CID YPP+TL NPF EKF W+H+
Sbjct  428   CIDNYPPKTLANPFLEKFGWLHN  450



>ref|XP_003547033.2| PREDICTED: 3-ketoacyl-CoA synthase 12-like [Glycine max]
 gb|KHN33421.1| 3-ketoacyl-CoA synthase 12 [Glycine soja]
Length=470

 Score =   524 bits (1349),  Expect = 7e-178, Method: Compositional matrix adjust.
 Identities = 258/456 (57%), Positives = 344/456 (75%), Gaps = 7/456 (2%)
 Frame = -1

Query  1703  METLVAIYSLLFLYTVVYILRSYLRRRHQCCYMLNYECYKPTDVARRLSTDKSALVVYRN  1524
             ME L  +Y  + LY    I + + +RR Q CY+L+Y+ YKP+D  R+L T++   ++ RN
Sbjct  1     MEFLSLLYGAMALYFCFLIWKLFDQRRDQECYVLDYQLYKPSD-ERKLGTERCGKIIGRN  59

Query  1523  RNLGIDEFRFLLQTMVNSGVGEQTYIPINVLEGREDSPTLEDSFTEVDDIMFQTLDNLFA  1344
             ++LG++E++FLL+ +VNSG+GE+TY P NV+EGRE +PTL+D  TE+++    +++ L  
Sbjct  60    KHLGLNEYKFLLKAIVNSGIGEETYAPRNVIEGREANPTLDDGVTEMEEFFHGSIEKLLE  119

Query  1343  KSKVSPREIDvlvvnvsllasapsLTSRVVNRYKMREDVKTFNLSGMGCSASVVAIDIVH  1164
             +S +SP +IDVLVVNVS+ A  PSLTSR++N YKMRED+K +NL+GMGCSAS++++DI+ 
Sbjct  120   RSGISPSQIDVLVVNVSMFAVVPSLTSRIINHYKMREDIKAYNLTGMGCSASLISLDIIR  179

Query  1163  HLFKVYKNSYAIVVSTESLGANWYSGKERSMMLSNCLFRSGGCSMLFTNNPALKPRAILK  984
             ++FK  KN  A++V++ESL  NWY+GK+RSM+L+NCLFR+GGC +L TN  +LK RA+ K
Sbjct  180   NIFKSQKNKCALLVTSESLSPNWYNGKDRSMILANCLFRTGGCVILLTNKRSLKQRAMFK  239

Query  983   LKHMVRTHIAAIDEAYECCKQVEDPQGFRGFHLSKRLPKVATKALVTNFKVLVPKAIPLW  804
             LK +VRTH  A +++Y CC Q ED QG  GF+L+K LPK AT+A V N +VL PK +P  
Sbjct  240   LKCLVRTHHGAKEDSYSCCNQKEDEQGKLGFYLAKNLPKAATRAFVENLRVLSPKVLPTR  299

Query  803   ETLRFLAVSSLER-----RKFKLPSLLGKPILNMKTGIEHFCLHPGGRAVIDGVGVSLGL  639
             E LRF+ VS +++               K  LN KTG+EHFCLH GG+AVIDG+G SL L
Sbjct  300   ELLRFMIVSLIKKLSQTSSLKSSGGGSSKSPLNFKTGVEHFCLHTGGKAVIDGIGKSLDL  359

Query  638   SEYDLEPARMSLHRWGNTSAGGLWYVLGYMEAKKRLKKGDRILMLSLGAGFKCNNCVWEV  459
              EYDLEPARM+LHR+GNTSA  LWYVLGYMEAKKRLKKGDR+LM+S GAGFKCN+C+WEV
Sbjct  360   CEYDLEPARMTLHRFGNTSASSLWYVLGYMEAKKRLKKGDRVLMISFGAGFKCNSCLWEV  419

Query  458   MKDLGD-PNVWEDCIDRYPPETLVNPFTEKFDWIHD  354
             MKDLGD  NVW  CID YPPE+L NPF E F WI++
Sbjct  420   MKDLGDHTNVWSYCIDDYPPESLANPFMETFGWINN  455



>ref|XP_002526784.1| acyltransferase, putative [Ricinus communis]
 gb|EEF35590.1| acyltransferase, putative [Ricinus communis]
Length=452

 Score =   523 bits (1346),  Expect = 1e-177, Method: Compositional matrix adjust.
 Identities = 273/461 (59%), Positives = 346/461 (75%), Gaps = 19/461 (4%)
 Frame = -1

Query  1703  METLVAIYSLLFLYTVVYILRSYLRRRHQCCYMLNYECYK-PTDVARRLSTDKSALVVYR  1527
             ME  + I+  L  Y +  + +   ++R QCCYML+YECYK P D  R L T+    +V R
Sbjct  1     MEPFMIIFLTLLFYVIFQLCKLISQKRDQCCYMLDYECYKAPED--RMLDTESCVKLVLR  58

Query  1526  NRNLGIDEFRFLLQTMVNSGVGEQTYIPINVLEGREDSPTLEDSFTEVDDIMFQTLDNLF  1347
             N+NLG++++RFLLQT+VN+G+G +TY P N++EGRE++P+LED+F+E+DDIMF TLD LF
Sbjct  59    NKNLGLEQYRFLLQTIVNAGIGNETYGPRNIIEGREENPSLEDAFSEIDDIMFDTLDKLF  118

Query  1346  AKSKVSPREIDvlvvnvsllasapsLTSRVVNRYKMREDVKTFNLSGMGCSASVVAIDIV  1167
              ++ +SP EID+LVVNVSL + APSLT+RVVNRYKMRED+K FNLSGMGCSAS+V  + +
Sbjct  119   ERTGISPSEIDILVVNVSLFSPAPSLTARVVNRYKMREDIKAFNLSGMGCSASLVIQEQI  178

Query  1166  HHLFKVYKNSYAIVVSTESLGANWYSGKERSMMLSNCLFRSGGCSMLFTNNPALKPRAIL  987
                 +   N   +V+    +   ++           CLFRSGGCSM+ TNN ALK +AI 
Sbjct  179   SCCCEHRINRPKLVLWEREIHDPFH-----------CLFRSGGCSMVLTNNRALKHKAIF  227

Query  986   KLKHMVRTHIAAIDEAYECCKQVEDPQGFRGFHLSKRLPKVATKALVTNFKVLVPKAIPL  807
             KL H+VRTH+ + DEAY CC QVED  G+ GF L++ L K A KAL  N +VLVPK +P+
Sbjct  228   KLNHLVRTHLGSNDEAYGCCIQVEDDSGYGGFLLTRSLTKAAAKALTMNLRVLVPKVLPV  287

Query  806   WETLRFLAVSSLERRKFKLPSL--LGKPILNMKTGIEHFCLHPGGRAVIDGVGVSLGLSE  633
              E LR+ AV S  R K K PSL  +G  I N+KTG+EHFCLHPGG+AVIDGVG SLGL++
Sbjct  288   TELLRY-AVMSRRRNKSKNPSLEAVGAGI-NLKTGVEHFCLHPGGKAVIDGVGKSLGLND  345

Query  632   YDLEPARMSLHRWGNTSAGGLWYVLGYMEAKKRLKKGDRILMLSLGAGFKCNNCVWEVMK  453
             YDLEPARM+LHR+GNTSAGGLWYVLGYMEAKKRL++GDRILM+SLGAGFKCNNCVWEVMK
Sbjct  346   YDLEPARMALHRFGNTSAGGLWYVLGYMEAKKRLRQGDRILMISLGAGFKCNNCVWEVMK  405

Query  452   DLGDPNVWEDCIDRYPPETL-VNPFTEKFDWIHDPCLNFLR  333
             DL +PNVW+D ID YPP+   VN F EK+ WI+D  LNF++
Sbjct  406   DLDNPNVWKDSIDHYPPKAAPVNQFLEKYGWINDEYLNFVQ  446



>ref|XP_010112930.1| 3-ketoacyl-CoA synthase 12 [Morus notabilis]
 gb|EXC35079.1| 3-ketoacyl-CoA synthase 12 [Morus notabilis]
Length=470

 Score =   523 bits (1346),  Expect = 2e-177, Method: Compositional matrix adjust.
 Identities = 263/468 (56%), Positives = 350/468 (75%), Gaps = 12/468 (3%)
 Frame = -1

Query  1703  METLVAIYSLLFLYTVVYILRSYLRRRHQCCYMLNYECYKPTDVARRLSTDKSALVVYRN  1524
             ME LV +Y L  +Y +  I + +  +R Q CY+L+Y+CYKPTD  R L T+ S  V+ R 
Sbjct  1     MELLVLLYGLSIIYFLFTIWKRFDEKRDQECYILDYQCYKPTD-DRMLDTEFSGEVIKRT  59

Query  1523  RNLGIDEFRFLLQTMVNSGVGEQTYIPINVLEGREDSPTLEDSFTEVDDIMFQTLDNLFA  1344
             +NLG++E++FLL+ +V++G+GEQTY P  +  GRE+SPTL DS +E+++  F ++  L  
Sbjct  60    KNLGLNEYKFLLKAIVSAGIGEQTYAPRIMFAGREESPTLIDSISEMEEFFFDSVGKLLD  119

Query  1343  KSKVSPREIDvlvvnvsllasapsLTSRVVNRYKMREDVKTFNLSGMGCSASVVAIDIVH  1164
             +S +SP +IDVLVVNVS+L+  PSL +R++NRYKMREDVK +NL+GMGCSAS++++DIV 
Sbjct  120   RSGLSPSQIDVLVVNVSMLSVVPSLAARIINRYKMREDVKVYNLTGMGCSASLISVDIVR  179

Query  1163  HLFKVYKNSYAIVVSTESLGANWYSGKERSMMLSNCLFRSGGCSMLFTNNPALKPRAILK  984
             H+FK ++N  A+VV++ESL  NWYSG +RSM+LSNCLFRSGGC++L TN  +LK RA+L+
Sbjct  180   HVFKSHRNLNALVVTSESLSPNWYSGNDRSMILSNCLFRSGGCAILLTNKRSLKDRAMLR  239

Query  983   LKHMVRTHIAAIDEAYECCKQVEDPQGFRGFHLSKRLPKVATKALVTNFKVLVPKAIPLW  804
             LK +VRTH  A D++Y CC Q ED QG  GFHL+K LPK AT+A V N +V+ PK +PL 
Sbjct  240   LKCLVRTHHGAKDDSYGCCIQREDDQGLLGFHLAKNLPKAATRAFVDNLRVIAPKILPLR  299

Query  803   ETLRFLAV---------SSLERRKFKLPSLLGK-PILNMKTGIEHFCLHPGGRAVIDGVG  654
             E LRF+AV         SS  +       L  K P++N KTG++HFC+H GG+AVIDG+G
Sbjct  300   ELLRFMAVWIHWKISKLSSSSKNSSMKGGLKEKPPLINFKTGVDHFCIHTGGKAVIDGIG  359

Query  653   VSLGLSEYDLEPARMSLHRWGNTSAGGLWYVLGYMEAKKRLKKGDRILMLSLGAGFKCNN  474
             V+L LSEYDLEPARM+LHR+GNTSA  LWYVLGYMEAK+RLKKGD I M+S GAGFKCN+
Sbjct  360   VNLNLSEYDLEPARMTLHRFGNTSASSLWYVLGYMEAKRRLKKGDTIFMISFGAGFKCNS  419

Query  473   CVWEVMKDL-GDPNVWEDCIDRYPPETLVNPFTEKFDWIHDPCLNFLR  333
             C+WEV++DL  D NVW D ++ YPPE L NPF EK+ WI D  L+  +
Sbjct  420   CLWEVVRDLKADGNVWNDDVEHYPPEKLTNPFMEKYGWIQDEDLSTFK  467



>ref|XP_003539757.1| PREDICTED: 3-ketoacyl-CoA synthase 12-like [Glycine max]
Length=471

 Score =   522 bits (1345),  Expect = 3e-177, Method: Compositional matrix adjust.
 Identities = 257/457 (56%), Positives = 340/457 (74%), Gaps = 8/457 (2%)
 Frame = -1

Query  1703  METLVAIYSLLFLYTVVYILRSYLRRRHQCCYMLNYECYKPTDVARRLSTDKSALVVYRN  1524
             ME +  +Y +  LY    I +    RR + CY+LNY+CYKP +  R L T+    ++ R 
Sbjct  1     MELIYLLYLVPTLYACFLIWKMLDERRDRECYILNYQCYKPPN-DRMLGTEFCGKLIRRT  59

Query  1523  RNLGIDEFRFLLQTMVNSGVGEQTYIPINVLEGREDSPTLEDSFTEVDDIMFQTLDNLFA  1344
              NLG  E+RFLL+ +V+SG+GEQTY P N+ EGRE +PTL DS  E+++    ++  L A
Sbjct  60    ENLGPSEYRFLLKAIVSSGIGEQTYAPRNIFEGREATPTLRDSIGEMEEFFHDSIGKLLA  119

Query  1343  KSKVSPREIDvlvvnvsllasapsLTSRVVNRYKMREDVKTFNLSGMGCSASVVAIDIVH  1164
             KS VSP EIDVLVVN+S+LA+ PSL+SR++N YKMR DVK +NL+GMGCSAS++++DIV 
Sbjct  120   KSNVSPSEIDVLVVNISMLATVPSLSSRIINHYKMRHDVKVYNLTGMGCSASLISMDIVK  179

Query  1163  HLFKVYKNSYAIVVSTESLGANWYSGKERSMMLSNCLFRSGGCSMLFTNNPALKPRAILK  984
              +FK  +N  A+++++ESL  NWY+G +RSM+L+NCLFRSGGC++L TN  +LK +A+L+
Sbjct  180   CIFKTQRNKLALLITSESLSPNWYTGSDRSMILANCLFRSGGCAILLTNKRSLKDKAMLR  239

Query  983   LKHMVRTHIAAIDEAYECCKQVEDPQGFRGFHLSKRLPKVATKALVTNFKVLVPKAIPLW  804
             LK +VRTH  A +EAY CC Q ED QG  GFHL K LPK AT+A V N +V+ PK +P+ 
Sbjct  240   LKCLVRTHHGAREEAYGCCTQQEDDQGRLGFHLGKTLPKAATRAFVDNLRVIAPKILPIR  299

Query  803   ETLRFLAVSSLER--RKFKLPSLLG-----KPILNMKTGIEHFCLHPGGRAVIDGVGVSL  645
             E LRFL VS++++  +    P  +      K  LN +TG++HFCLH GG+AVIDG+G+SL
Sbjct  300   ELLRFLFVSTIKKINKSSNAPKSVASTGATKSPLNFRTGVDHFCLHTGGKAVIDGIGMSL  359

Query  644   GLSEYDLEPARMSLHRWGNTSAGGLWYVLGYMEAKKRLKKGDRILMLSLGAGFKCNNCVW  465
              LSEYDLEPARM+LHR+GNTSA  LWYVL YMEAKKRLKKGD + M+S GAGFKCN+C+W
Sbjct  360   DLSEYDLEPARMTLHRFGNTSASSLWYVLSYMEAKKRLKKGDTVFMISFGAGFKCNSCLW  419

Query  464   EVMKDLGDPNVWEDCIDRYPPETLVNPFTEKFDWIHD  354
             EVMKDLG+ NVW+DCID YPPE+L NPF E + WI++
Sbjct  420   EVMKDLGEANVWDDCIDEYPPESLANPFMEAYGWINE  456



>ref|XP_003606588.1| 3-ketoacyl-CoA synthase [Medicago truncatula]
 gb|AES88785.1| 3-ketoacyl-CoA synthase-like protein [Medicago truncatula]
Length=473

 Score =   522 bits (1344),  Expect = 5e-177, Method: Compositional matrix adjust.
 Identities = 257/462 (56%), Positives = 343/462 (74%), Gaps = 15/462 (3%)
 Frame = -1

Query  1703  METLVAIYSLLFLYTVVYILRSYLRRRHQCCYMLNYECYKPTDVARRLSTDKSALVVYRN  1524
             ME L  +Y +L LY    I +   ++R Q CY+L+Y+CYKPT   R L T+    ++ R 
Sbjct  1     MEFLSLLYGVLALYICFLIWKLLDQKRDQECYILDYQCYKPTQ-DRMLGTEFCGKLIRRT  59

Query  1523  RNLGIDEFRFLLQTMVNSGVGEQTYIPINVLEGREDSPTLEDSFTEVDDIMFQTLDNLFA  1344
              NLG++E++FLL+++V+ G+GEQTY P NV+EGRE SPTL D  +E+++    ++  L A
Sbjct  60    ENLGLNEYKFLLKSIVSCGIGEQTYAPRNVIEGREASPTLNDGISEMEEFFDDSIAKLLA  119

Query  1343  KSKVSPREIDvlvvnvsllasapsLTSRVVNRYKMREDVKTFNLSGMGCSASVVAIDIVH  1164
             +S  SP EIDVLVVN+S+  S PSL+S ++NRYK+R DVK +N++GMGCSAS++++DIV 
Sbjct  120   RSATSPSEIDVLVVNISMFTSVPSLSSLIINRYKLRHDVKVYNITGMGCSASLISVDIVK  179

Query  1163  HLFKVYKNSYAIVVSTESLGANWYSGKERSMMLSNCLFRSGGCSMLFTNNPALKPRAILK  984
             ++FK  +N  A++V++ESL  NWY G  RSM+L+NCLFR+GGC++L TN  +LK ++ILK
Sbjct  180   NIFKSQRNKLALLVTSESLSPNWYPGSNRSMILANCLFRTGGCAILLTNKRSLKNKSILK  239

Query  983   LKHMVRTHIAAIDEAYECCKQVEDPQGFRGFHLSKRLPKVATKALVTNFKVLVPKAIPLW  804
             LK +VRTH  A D++Y CC + ED +G  GF+LSK LP VAT+A V N +V+ PK +P+ 
Sbjct  240   LKCLVRTHHGARDDSYNCCLKKEDERGAVGFYLSKTLPLVATRAFVENLRVISPKILPIR  299

Query  803   ETLRFLAVSSLERRKFKLPSLLGKPI------------LNMKTGIEHFCLHPGGRAVIDG  660
             E +RFL VS    +K K+ S                  LN KTG++HFCLH GG+AVIDG
Sbjct  300   ELVRFLVVSHF--KKLKIASFCSSKSSSGGGTKSTKSPLNFKTGVDHFCLHTGGKAVIDG  357

Query  659   VGVSLGLSEYDLEPARMSLHRWGNTSAGGLWYVLGYMEAKKRLKKGDRILMLSLGAGFKC  480
             VG SL LSEYDLEPARM+LHR+GNTSAG LWYVLGYMEAKKRLKKGDR+ M+S GAGFKC
Sbjct  358   VGKSLDLSEYDLEPARMTLHRFGNTSAGSLWYVLGYMEAKKRLKKGDRVFMISFGAGFKC  417

Query  479   NNCVWEVMKDLGDPNVWEDCIDRYPPETLVNPFTEKFDWIHD  354
             N+C+WEVMKD+GD NVWEDCID YPPE+L+NPF EK+ W+++
Sbjct  418   NSCLWEVMKDVGDANVWEDCIDDYPPESLINPFMEKYGWLNE  459



>ref|XP_008448355.1| PREDICTED: 3-ketoacyl-CoA synthase 12 [Cucumis melo]
Length=461

 Score =   521 bits (1342),  Expect = 6e-177, Method: Compositional matrix adjust.
 Identities = 255/452 (56%), Positives = 342/452 (76%), Gaps = 5/452 (1%)
 Frame = -1

Query  1703  METLVAIYSLLFLYTVVYILRSYLRRRHQCCYMLNYECYKPTDVARRLSTDKSALVVYRN  1524
             ME L   +     Y +  I + +  +R Q CY+LNY+CYKPTD  R+LST+    V+ R 
Sbjct  1     MELLCFFFLCSVFYFLFTIWKYFDDKRDQECYILNYQCYKPTD-DRKLSTEFCGEVIKRT  59

Query  1523  RNLGIDEFRFLLQTMVNSGVGEQTYIPINVLEGREDSPTLEDSFTEVDDIMFQTLDNLFA  1344
             +NLG++E++FLL+ +V+SG+GE+TY P  +  GREDSPTL+D  +E+D+    ++  +F 
Sbjct  60    KNLGLNEYKFLLKAIVSSGIGEETYGPRIMFAGREDSPTLDDGISEMDEFFHDSIGKIFQ  119

Query  1343  KSKVSPREIDvlvvnvsllasapsLTSRVVNRYKMREDVKTFNLSGMGCSASVVAIDIVH  1164
             KS  SP +IDVLVVNVS+LA+ PSL++R++N YK+R DVK FNL+GMGCSAS+++ID+V 
Sbjct  120   KSGFSPSDIDVLVVNVSMLATIPSLSARIINYYKLRSDVKVFNLTGMGCSASLISIDVVS  179

Query  1163  HLFKVYKNSYAIVVSTESLGANWYSGKERSMMLSNCLFRSGGCSMLFTNNPALKPRAILK  984
              +FK YKN  A+V+++ESL  NWYSG +RSM+LSNCLFRSGGC++L TNN ALK RA+ K
Sbjct  180   RVFKSYKNINALVITSESLSPNWYSGNDRSMILSNCLFRSGGCAILLTNNRALKNRAMFK  239

Query  983   LKHMVRTHIAAIDEAYECCKQVEDPQGFRGFHLSKRLPKVATKALVTNFKVLVPKAIPLW  804
             LK ++RTH  A DE+Y CC Q ED +G+ GFHL K LPK AT+A V N + + P+ +P  
Sbjct  240   LKCLIRTHHGARDESYGCCIQTEDDKGYMGFHLGKNLPKAATRAFVDNLREIAPRILPAR  299

Query  803   ETLRFLAVSSLERRKFKLPSLLGKP---ILNMKTGIEHFCLHPGGRAVIDGVGVSLGLSE  633
             E ++FL + SL ++  + P     P    +N KTG++HFC+H GG+AVIDG+G+SLGL +
Sbjct  300   ELVQFL-ILSLGKKLNRNPKQGSGPKTSAVNFKTGVDHFCIHTGGKAVIDGIGLSLGLEK  358

Query  632   YDLEPARMSLHRWGNTSAGGLWYVLGYMEAKKRLKKGDRILMLSLGAGFKCNNCVWEVMK  453
             YDLEPARM+LHR+GNTSA  LWYVL YMEAKKRLKKG+RILM+S GAGFKCN+C+WEV++
Sbjct  359   YDLEPARMTLHRFGNTSASSLWYVLAYMEAKKRLKKGERILMISFGAGFKCNSCLWEVVR  418

Query  452   DLGDPNVWEDCIDRYPPETLVNPFTEKFDWIH  357
             DL D NVWEDCI+ YPPE++ NPF EK+ WI 
Sbjct  419   DLEDGNVWEDCIEHYPPESISNPFLEKYGWIQ  450



>ref|XP_009354553.1| PREDICTED: 3-ketoacyl-CoA synthase 12-like [Pyrus x bretschneideri]
Length=471

 Score =   521 bits (1341),  Expect = 1e-176, Method: Compositional matrix adjust.
 Identities = 256/461 (56%), Positives = 345/461 (75%), Gaps = 11/461 (2%)
 Frame = -1

Query  1703  METLVAIYSLLFLYTVVYILRSYLRRRHQCCYMLNYECYKPTDVARRLSTDKSALVVYRN  1524
             ME L  +     LY +  + + +  RR Q CY+L+Y+C+KPTD  R+L T+ S  ++ R 
Sbjct  1     MELLALVCVFSALYFIFIMWKLFDERRDQECYILDYQCHKPTD-DRKLDTEFSGEIIKRT  59

Query  1523  RNLGIDEFRFLLQTMVNSGVGEQTYIPINVLEGREDSPTLEDSFTEVDDIMFQTLDNLFA  1344
             +NLG+ E++FLL+ +V+SG+GEQTY P  +  GRE  PTL+DS +E+++    ++  L  
Sbjct  60    KNLGLLEYQFLLKAIVSSGIGEQTYAPRIMFSGRESCPTLDDSISEMEEFFHDSIKKLLD  119

Query  1343  KSKVSPREIDvlvvnvsllasapsLTSRVVNRYKMREDVKTFNLSGMGCSASVVAIDIVH  1164
             +S +SP E+DVLVVNVS+ AS PSL+SR++N YKMRED+K FNLSGMGCSAS++++DIV 
Sbjct  120   RSGISPSEVDVLVVNVSMFASVPSLSSRIINHYKMREDIKVFNLSGMGCSASLISVDIVK  179

Query  1163  HLFKVYKNSYAIVVSTESLGANWYSGKERSMMLSNCLFRSGGCSMLFTNNPALKPRAILK  984
             ++FK ++N YA+VV++ESL  NWYSG  RSM+L+NCLFRSGGC++L TN  ALK RA+ K
Sbjct  180   NIFKSHRNVYALVVTSESLSPNWYSGNARSMILANCLFRSGGCAILLTNKRALKHRAMFK  239

Query  983   LKHMVRTHIAAIDEAYECCKQVEDPQGFRGFHLSKRLPKVATKALVTNFKVLVPKAIPLW  804
             LK +VRTH    D++Y CC Q ED QG+ GFHL K LPK AT+A V N +V+ PK +P+ 
Sbjct  240   LKCLVRTHHGGRDDSYGCCIQQEDTQGYLGFHLDKFLPKAATRAFVDNLRVISPKILPIR  299

Query  803   ETLRFLAVSSLERRKFKLPSLLG--------KPILNMKTGIEHFCLHPGGRAVIDGVGVS  648
             E +RFL V+ ++++     S  G        KP++N KTG++HFC+H GG+AVIDG+G++
Sbjct  300   ELMRFLLVTLVKKKTSSQQSTKGGAIGSPSPKPVINFKTGVDHFCIHTGGKAVIDGIGLN  359

Query  647   LGLSEYDLEPARMSLHRWGNTSAGGLWYVLGYMEAKKRLKKGDRILMLSLGAGFKCNNCV  468
             LGLSEYDLEPARM+LHR+GNTSA  LWYVLGYMEAKKRLKKG+ +LM+S GAGFKCN+C+
Sbjct  360   LGLSEYDLEPARMTLHRFGNTSASSLWYVLGYMEAKKRLKKGNTVLMISFGAGFKCNSCL  419

Query  467   WEVMKDLGDPNVWEDCIDRYPPETLVNPFTEKFDWI--HDP  351
              EV++DLGD NVW++ I  YPP+TL NPF E F WI   DP
Sbjct  420   LEVVRDLGDENVWKEDIATYPPKTLTNPFLEMFGWIRQEDP  460



>ref|XP_007207633.1| hypothetical protein PRUPE_ppa021836mg [Prunus persica]
 gb|EMJ08832.1| hypothetical protein PRUPE_ppa021836mg [Prunus persica]
Length=466

 Score =   520 bits (1339),  Expect = 2e-176, Method: Compositional matrix adjust.
 Identities = 259/460 (56%), Positives = 345/460 (75%), Gaps = 9/460 (2%)
 Frame = -1

Query  1703  METLVAIYSLLFLYTVVYILRSYLRRRHQCCYMLNYECYKPTDVARRLSTDKSALVVYRN  1524
             ME L  + +   LY +  + + +  +R Q CY+L+Y+C+KP+D  R+L T  S  V+ R 
Sbjct  1     MELLSLLCAFSALYFIFMMWKRFDEKRDQECYILDYQCHKPSD-DRKLDTRFSGEVIRRT  59

Query  1523  RNLGIDEFRFLLQTMVNSGVGEQTYIPINVLEGREDSPTLEDSFTEVDDIMFQTLDNLFA  1344
             +NLG+ E++FLL+ +V+SG+GEQTY P  +  GRE  PTLEDS +E+++    ++  L  
Sbjct  60    KNLGLLEYQFLLKAIVSSGIGEQTYAPRIIFSGRESCPTLEDSVSEMEEFFHDSIQKLLD  119

Query  1343  KSKVSPREIDvlvvnvsllasapsLTSRVVNRYKMREDVKTFNLSGMGCSASVVAIDIVH  1164
             +S +SP ++DVLVVNVS+ AS PSL SR++N YKMRED+K FNL+GMGCSAS+++ DIV 
Sbjct  120   RSGISPSQLDVLVVNVSMFASVPSLASRIINHYKMREDIKVFNLTGMGCSASLISTDIVR  179

Query  1163  HLFKVYKNSYAIVVSTESLGANWYSGKERSMMLSNCLFRSGGCSMLFTNNPALKPRAILK  984
             ++FK YKN YA+VV++ESL  NWYSG +RSM+L+NCLFRSGGC++L TN  ALK +A+ K
Sbjct  180   NIFKSYKNVYALVVTSESLSPNWYSGNDRSMILANCLFRSGGCAVLLTNKRALKNQAMFK  239

Query  983   LKHMVRTHIAAIDEAYECCKQVEDPQGFRGFHLSKRLPKVATKALVTNFKVLVPKAIPLW  804
             LK +VRTH  A DE+Y CC Q ED QG  GFHL K LPK AT+A V N + + PK +P+ 
Sbjct  240   LKCLVRTHHGARDESYGCCIQQEDGQGMLGFHLDKILPKAATRAFVDNLREISPKILPIR  299

Query  803   ETLRFLAVSSLERRKFKLPSLLG------KPILNMKTGIEHFCLHPGGRAVIDGVGVSLG  642
             E +RF+ V+ +  RK K  S  G      KP++N KTG++HFCLH GG+AVIDG+G++LG
Sbjct  300   ELVRFMLVTLV--RKLKSQSSKGGASTSPKPVINFKTGVDHFCLHTGGKAVIDGIGLNLG  357

Query  641   LSEYDLEPARMSLHRWGNTSAGGLWYVLGYMEAKKRLKKGDRILMLSLGAGFKCNNCVWE  462
             LSEYDLEPARM+LHR+GNTSA  LWYVLGYMEAKKRLKKGD +LM+S GAGFKCN+C+ E
Sbjct  358   LSEYDLEPARMTLHRFGNTSASSLWYVLGYMEAKKRLKKGDTVLMISFGAGFKCNSCLLE  417

Query  461   VMKDLGDPNVWEDCIDRYPPETLVNPFTEKFDWIHDPCLN  342
             V++DLGD NVW++ I  YPP++L NPF EK+ WIH   L+
Sbjct  418   VVRDLGDENVWKEDIAVYPPKSLTNPFLEKYGWIHQEDLS  457



>ref|XP_008222749.1| PREDICTED: 3-ketoacyl-CoA synthase 12 [Prunus mume]
 ref|XP_008222758.1| PREDICTED: 3-ketoacyl-CoA synthase 12 [Prunus mume]
Length=466

 Score =   520 bits (1338),  Expect = 3e-176, Method: Compositional matrix adjust.
 Identities = 258/455 (57%), Positives = 341/455 (75%), Gaps = 9/455 (2%)
 Frame = -1

Query  1703  METLVAIYSLLFLYTVVYILRSYLRRRHQCCYMLNYECYKPTDVARRLSTDKSALVVYRN  1524
             ME L  + +   LY +  + + +  +R Q CY+L+Y+CYKPTD  R+L T  S  V+ R 
Sbjct  1     MELLSLLCAFSALYFIFMMWKRFDEKRDQECYILDYQCYKPTD-DRKLDTQFSGEVIRRT  59

Query  1523  RNLGIDEFRFLLQTMVNSGVGEQTYIPINVLEGREDSPTLEDSFTEVDDIMFQTLDNLFA  1344
             +NLG+ E++FLL+ +V+SG+GEQTY P  +  GRE  PTLED  +E+++    ++  L  
Sbjct  60    KNLGLLEYQFLLKAIVSSGIGEQTYAPRIIFSGRESCPTLEDGISEMEEFFHDSIQKLLD  119

Query  1343  KSKVSPREIDvlvvnvsllasapsLTSRVVNRYKMREDVKTFNLSGMGCSASVVAIDIVH  1164
             +S +SP ++DVLVVNVS+ AS PSL SR++N YKMRED+K FNL+GMGCSAS+++ DIV 
Sbjct  120   RSGISPSQLDVLVVNVSMFASMPSLASRIINHYKMREDIKVFNLTGMGCSASLISTDIVR  179

Query  1163  HLFKVYKNSYAIVVSTESLGANWYSGKERSMMLSNCLFRSGGCSMLFTNNPALKPRAILK  984
             ++FK YKN YA+VV++ESL  NWYSG  RSM+L+NCLFRSGGC++L TN  ALK +A+ K
Sbjct  180   NMFKSYKNVYALVVTSESLSPNWYSGNARSMILANCLFRSGGCAVLLTNKRALKNQAMFK  239

Query  983   LKHMVRTHIAAIDEAYECCKQVEDPQGFRGFHLSKRLPKVATKALVTNFKVLVPKAIPLW  804
             LK +VRTH  A DE+Y CC Q ED QG  GFHL K LPK AT+A V N + + PK +P+ 
Sbjct  240   LKCLVRTHHGARDESYGCCIQQEDGQGMLGFHLDKILPKAATRAFVDNLREMSPKILPIR  299

Query  803   ETLRFLAVSSLERRKFKLPSLLG------KPILNMKTGIEHFCLHPGGRAVIDGVGVSLG  642
             E +RF+ V+ +  RK K  S  G      KP++N KTG++HFCLH GG+AVIDG+G++LG
Sbjct  300   ELVRFMLVTLV--RKLKSQSSKGGASTSPKPVINFKTGVDHFCLHTGGKAVIDGIGLNLG  357

Query  641   LSEYDLEPARMSLHRWGNTSAGGLWYVLGYMEAKKRLKKGDRILMLSLGAGFKCNNCVWE  462
             L+EYDLEPARM+LHR+GNTSA  LWYVLGYMEAKKRLKKGD +LM+S GAGFKCN+C+ E
Sbjct  358   LNEYDLEPARMTLHRFGNTSACSLWYVLGYMEAKKRLKKGDTVLMISFGAGFKCNSCLLE  417

Query  461   VMKDLGDPNVWEDCIDRYPPETLVNPFTEKFDWIH  357
             V++DLGD NVW++ I  YPP++L NPF EK+ WIH
Sbjct  418   VVRDLGDENVWKEDIAVYPPKSLTNPFLEKYGWIH  452



>ref|XP_010651070.1| PREDICTED: 3-ketoacyl-CoA synthase 12 [Vitis vinifera]
Length=470

 Score =   520 bits (1339),  Expect = 3e-176, Method: Compositional matrix adjust.
 Identities = 251/449 (56%), Positives = 342/449 (76%), Gaps = 2/449 (0%)
 Frame = -1

Query  1703  METLVAIYSLLFLYTVVYILRSYLRRRHQCCYMLNYECYKPTDVARRLSTDKSALVVYRN  1524
             ME +V ++ L   Y    + +    +R Q CY+L+Y+CYKPTD  R+LST+    ++ RN
Sbjct  1     MEAMVYLFLLPVFYLFFLLWKFIDGKRDQECYILDYQCYKPTD-DRKLSTEFCGDMIRRN  59

Query  1523  RNLGIDEFRFLLQTMVNSGVGEQTYIPINVLEGREDSPTLEDSFTEVDDIMFQTLDNLFA  1344
             ++LG+ E++FLL+ +VNSG+GE+TY P NV  G E  P++ D  +E+D+    +++ L  
Sbjct  60    KSLGLQEYKFLLKAIVNSGIGEETYGPRNVFSGNETHPSVLDGISEMDEFFNDSIEKLLD  119

Query  1343  KSKVSPREIDvlvvnvsllasapsLTSRVVNRYKMREDVKTFNLSGMGCSASVVAIDIVH  1164
             +  VSP EID LVVNVS++ +APSL  R++NRYKMRE++K FNL+GMGCSAS+++I+IV 
Sbjct  120   RVGVSPSEIDALVVNVSMITTAPSLAGRIINRYKMRENIKAFNLTGMGCSASLISINIVQ  179

Query  1163  HLFKVYKNSYAIVVSTESLGANWYSGKERSMMLSNCLFRSGGCSMLFTNNPALKPRAILK  984
             +LFK YKN YA+VV++ESL  NWY+G +RSM+LSNCLFRSGGC++L TN  AL+ RA+LK
Sbjct  180   NLFKSYKNMYALVVTSESLSPNWYTGNDRSMILSNCLFRSGGCAVLLTNKRALRHRAMLK  239

Query  983   LKHMVRTHIAAIDEAYECCKQVEDPQGFRGFHLSKRLPKVATKALVTNFKVLVPKAIPLW  804
             L+ +VRTH  A DE++ CC Q ED QG  GF L+K LPK AT+A + N +V+ PK +P+ 
Sbjct  240   LRCLVRTHHGAKDESFGCCIQKEDDQGRLGFFLNKSLPKAATRAFIDNLRVISPKILPVR  299

Query  803   ETLRFLAVSSLERRKFKLPSLLGKPILNMKTGIEHFCLHPGGRAVIDGVGVSLGLSEYDL  624
             E LR++ V+SL R+ ++     GK ++N KTG++HFC+H GG+AVIDG+G SL L+EYDL
Sbjct  300   ELLRYM-VASLVRKMYQNSKGGGKVVINFKTGVDHFCIHTGGKAVIDGIGKSLELTEYDL  358

Query  623   EPARMSLHRWGNTSAGGLWYVLGYMEAKKRLKKGDRILMLSLGAGFKCNNCVWEVMKDLG  444
             EPARM+LHR+GNTSA  LWYVL YM+ KKRLKKGDR+LM+S GAGFKCN+C+WEV +DL 
Sbjct  359   EPARMTLHRFGNTSASSLWYVLAYMDEKKRLKKGDRVLMISFGAGFKCNSCMWEVARDLD  418

Query  443   DPNVWEDCIDRYPPETLVNPFTEKFDWIH  357
               NVW+DCID YPPE+L NPF EK+ WI+
Sbjct  419   GGNVWKDCIDSYPPESLSNPFMEKYGWIN  447



>gb|KHN05688.1| 3-ketoacyl-CoA synthase 12 [Glycine soja]
Length=471

 Score =   519 bits (1336),  Expect = 7e-176, Method: Compositional matrix adjust.
 Identities = 256/457 (56%), Positives = 338/457 (74%), Gaps = 8/457 (2%)
 Frame = -1

Query  1703  METLVAIYSLLFLYTVVYILRSYLRRRHQCCYMLNYECYKPTDVARRLSTDKSALVVYRN  1524
             ME +  +Y +  LY    I +    RR + CY+LNY+CYKP +  R L T+    ++ R 
Sbjct  1     MELIYLLYLVPTLYACFLIWKMLDERRDRECYILNYQCYKPPN-DRMLGTEFCGKLIRRT  59

Query  1523  RNLGIDEFRFLLQTMVNSGVGEQTYIPINVLEGREDSPTLEDSFTEVDDIMFQTLDNLFA  1344
              NLG  E+RFLL+ +V+SG+GEQTY P N+ EGRE +PTL D   E+++    ++  L A
Sbjct  60    ENLGPSEYRFLLKAIVSSGIGEQTYAPRNIFEGREATPTLRDGIGEMEEFFHDSIGKLLA  119

Query  1343  KSKVSPREIDvlvvnvsllasapsLTSRVVNRYKMREDVKTFNLSGMGCSASVVAIDIVH  1164
             KS VSP EIDVLVVN+S+LA+ PSL+SR++N YKMR DVK +NL+GMGCSAS++++DIV 
Sbjct  120   KSNVSPSEIDVLVVNISMLATVPSLSSRIINHYKMRHDVKVYNLTGMGCSASLISMDIVK  179

Query  1163  HLFKVYKNSYAIVVSTESLGANWYSGKERSMMLSNCLFRSGGCSMLFTNNPALKPRAILK  984
              +FK  +N  A+++++ESL  NWY+G +RSM+L+NCLFRSGGC++L TN  +LK +A+L+
Sbjct  180   CIFKTQRNKLALLITSESLSPNWYTGSDRSMILANCLFRSGGCAILLTNKRSLKDKAMLR  239

Query  983   LKHMVRTHIAAIDEAYECCKQVEDPQGFRGFHLSKRLPKVATKALVTNFKVLVPKAIPLW  804
             LK +VRTH  A +EAY CC Q ED QG  GFHL K LPK AT+A V N +V+ PK +P+ 
Sbjct  240   LKCLVRTHHGAREEAYGCCTQQEDDQGRLGFHLGKTLPKAATRAFVDNLRVIAPKILPIR  299

Query  803   ETLRFLAVSSLER--RKFKLPSLLG-----KPILNMKTGIEHFCLHPGGRAVIDGVGVSL  645
             E LRFL VS +++  +    P  +      K  LN +TG++HFCLH GG+AVIDG+G+SL
Sbjct  300   ELLRFLFVSIIKKINKSSNAPKSVASTGATKSPLNFRTGVDHFCLHTGGKAVIDGIGMSL  359

Query  644   GLSEYDLEPARMSLHRWGNTSAGGLWYVLGYMEAKKRLKKGDRILMLSLGAGFKCNNCVW  465
              LSEYDLEPARM+LHR+GNTSA  LWYVL YMEAKKRLKKGD + M+S GAGFKCN+C+W
Sbjct  360   DLSEYDLEPARMTLHRFGNTSASSLWYVLSYMEAKKRLKKGDTVFMISFGAGFKCNSCLW  419

Query  464   EVMKDLGDPNVWEDCIDRYPPETLVNPFTEKFDWIHD  354
             EVMKDLG+ NVW+DCID YPPE+L NPF E + WI++
Sbjct  420   EVMKDLGEANVWDDCIDEYPPESLANPFMEAYGWINE  456



>ref|XP_006363390.1| PREDICTED: 3-ketoacyl-CoA synthase 3-like [Solanum tuberosum]
Length=466

 Score =   518 bits (1335),  Expect = 9e-176, Method: Compositional matrix adjust.
 Identities = 246/426 (58%), Positives = 330/426 (77%), Gaps = 1/426 (0%)
 Frame = -1

Query  1631  RRRHQCCYMLNYECYKPTDVARRLSTDKSALVVYRNRNLGIDEFRFLLQTMVNSGVGEQT  1452
             R+RHQ CY+L+YEC+KPTD  R LST  S  ++ RN+NLG++E++FLL+  V+SG+GEQT
Sbjct  26    RKRHQNCYILDYECHKPTD-DRMLSTKFSGEIIMRNKNLGLNEYKFLLKAAVSSGIGEQT  84

Query  1451  YIPINVLEGREDSPTLEDSFTEVDDIMFQTLDNLFAKSKVSPREIDvlvvnvsllasaps  1272
             Y P  V  GRE  PT ED   E+++    ++D LF ++K+SP EIDVLVVN+S+LA+ PS
Sbjct  85    YAPRMVFHGREACPTYEDGILEMEEFFHDSIDKLFKRNKISPCEIDVLVVNISMLATMPS  144

Query  1271  LTSRVVNRYKMREDVKTFNLSGMGCSASVVAIDIVHHLFKVYKNSYAIVVSTESLGANWY  1092
             + +R++N YK+RED+K +NL+GMGCSAS+++++I+ ++FK  KN  A+VV++ESL  NWY
Sbjct  145   MAARIINYYKLREDIKVYNLTGMGCSASLISLNIIENIFKNEKNKVALVVTSESLSPNWY  204

Query  1091  SGKERSMMLSNCLFRSGGCSMLFTNNPALKPRAILKLKHMVRTHIAAIDEAYECCKQVED  912
             SG +RSM+LSNCLFRSGGC++L TN  +LK +A+ KLK +VR H  A DEAY+ C Q ED
Sbjct  205   SGSDRSMILSNCLFRSGGCAILLTNKLSLKNKAMFKLKQLVRVHHGAKDEAYDSCAQRED  264

Query  911   PQGFRGFHLSKRLPKVATKALVTNFKVLVPKAIPLWETLRFLAVSSLERRKFKLPSLLGK  732
              QG  GFHL K+LPK A++ALV N K + P  +P+ E LR+     +++  +       K
Sbjct  265   NQGNTGFHLDKKLPKAASRALVDNLKQIAPLILPIRELLRYSIAIFMKKMNWSSTKGGPK  324

Query  731   PILNMKTGIEHFCLHPGGRAVIDGVGVSLGLSEYDLEPARMSLHRWGNTSAGGLWYVLGY  552
             P++N KTG++H CLH GG+AVIDGVG +L LSE+DLEPARM+LHR+GNTSA  LWYVLGY
Sbjct  325   PMINFKTGVDHICLHTGGKAVIDGVGANLNLSEHDLEPARMTLHRFGNTSASSLWYVLGY  384

Query  551   MEAKKRLKKGDRILMLSLGAGFKCNNCVWEVMKDLGDPNVWEDCIDRYPPETLVNPFTEK  372
             MEAKKRLKKGD +LM+S GAGFKCN+C+WEV++DL D NVW+DCID YPP+T+VNPF  +
Sbjct  385   MEAKKRLKKGDTMLMISFGAGFKCNSCLWEVLRDLDDGNVWKDCIDNYPPKTIVNPFMAQ  444

Query  371   FDWIHD  354
             F W+HD
Sbjct  445   FGWLHD  450



>ref|XP_003543495.1| PREDICTED: 3-ketoacyl-CoA synthase 12-like [Glycine max]
Length=473

 Score =   518 bits (1335),  Expect = 9e-176, Method: Compositional matrix adjust.
 Identities = 256/459 (56%), Positives = 339/459 (74%), Gaps = 10/459 (2%)
 Frame = -1

Query  1703  METLVAIYSLLFLYTVVYILRSYLRRRHQCCYMLNYECYKPTDVARRLSTDKSALVVYRN  1524
             ME L  +Y  + LY    I + + +RR Q  Y+L+Y+ YKP+D  R+L T+    ++ RN
Sbjct  1     MEFLTLLYGAMALYLCFLIWKLFDQRRDQESYILDYQLYKPSD-ERKLGTELCGKIIGRN  59

Query  1523  RNLGIDEFRFLLQTMVNSGVGEQTYIPINVLEGREDSPTLEDSFTEVDDIMFQTLDNLFA  1344
             + LG++E++FLL+ +VNSG+GE+TY P NV+EGRE +PTL+DS TE+++    ++  L  
Sbjct  60    KQLGLNEYKFLLKAIVNSGIGEETYAPRNVIEGRETNPTLDDSVTEMEEFFHDSIAKLLE  119

Query  1343  KSKVSPREIDvlvvnvsllasapsLTSRVVNRYKMREDVKTFNLSGMGCSASVVAIDIVH  1164
             +S +SP +IDVLVVNVS+ A  PSLTSR++N YKMRED+K +NL+GMGCSAS++++DI+ 
Sbjct  120   RSGISPSQIDVLVVNVSMFAVVPSLTSRIINHYKMREDIKAYNLTGMGCSASLISLDIIR  179

Query  1163  HLFKVYKNSYAIVVSTESLGANWYSGKERSMMLSNCLFRSGGCSMLFTNNPALKPRAILK  984
             ++FK  KN  A++V++ESL  NWY+G +RSM+L+NCLFR+GGC +L TN  +LK RA+ K
Sbjct  180   NIFKSQKNKIALLVTSESLSPNWYNGNDRSMILANCLFRTGGCVILLTNKRSLKQRAMFK  239

Query  983   LKHMVRTHIAAIDEAYECCKQVEDPQGFRGFHLSKRLPKVATKALVTNFKVLVPKAIPLW  804
             LK +VRTH  A ++AY CC Q ED QG  GF+L+K LPK AT+A V N ++L PK +P  
Sbjct  240   LKCLVRTHHGAKEDAYSCCNQKEDEQGNLGFYLAKNLPKAATRAFVENLRMLSPKVLPTR  299

Query  803   ETLRFLAVSSLERRKFKLPSLLGKPI--------LNMKTGIEHFCLHPGGRAVIDGVGVS  648
             E LRF+ VS +++                     LN KTG+EHFCLH GG+AVIDG+G S
Sbjct  300   ELLRFMIVSLIKKLSQTSSLKSSSGGSSKSSKSPLNFKTGVEHFCLHTGGKAVIDGIGKS  359

Query  647   LGLSEYDLEPARMSLHRWGNTSAGGLWYVLGYMEAKKRLKKGDRILMLSLGAGFKCNNCV  468
             L L EYDLEPARM+LHR+GNTSA  LWYVLGYMEAKKRLKKGDR+LM+S GAGFKCN+C+
Sbjct  360   LDLCEYDLEPARMTLHRFGNTSASSLWYVLGYMEAKKRLKKGDRVLMISFGAGFKCNSCL  419

Query  467   WEVMKDLGD-PNVWEDCIDRYPPETLVNPFTEKFDWIHD  354
             WEVMKDLGD  NVW  CID YPPE+L NPF E F WI++
Sbjct  420   WEVMKDLGDHTNVWSYCIDDYPPESLANPFMETFGWINN  458



>ref|XP_006363392.1| PREDICTED: 3-ketoacyl-CoA synthase 3-like [Solanum tuberosum]
Length=464

 Score =   518 bits (1334),  Expect = 1e-175, Method: Compositional matrix adjust.
 Identities = 249/446 (56%), Positives = 335/446 (75%), Gaps = 1/446 (0%)
 Frame = -1

Query  1691  VAIYSLLFLYTVVYILRSYLRRRHQCCYMLNYECYKPTDVARRLSTDKSALVVYRNRNLG  1512
             +  Y L   Y +  I +   R+RHQ CY+L+YEC+KPTD  R LST  S  ++ RN++LG
Sbjct  6     ILFYGLPLFYLLYLIWKIIDRKRHQNCYILDYECHKPTD-DRMLSTKFSGEIIRRNKHLG  64

Query  1511  IDEFRFLLQTMVNSGVGEQTYIPINVLEGREDSPTLEDSFTEVDDIMFQTLDNLFAKSKV  1332
             + E++FLL+ +V+SG+GEQTY P  V +GRE  PT ED   E+++    ++D +  ++K+
Sbjct  65    LHEYKFLLKAIVSSGIGEQTYAPQMVFDGREACPTYEDGILEMEEFFQDSIDKVLKRNKI  124

Query  1331  SPREIDvlvvnvsllasapsLTSRVVNRYKMREDVKTFNLSGMGCSASVVAIDIVHHLFK  1152
             SP EIDVLVVN+S+LA  PSL +R++N YKMRED+K +N++GMGCSAS+++I+ +  +FK
Sbjct  125   SPSEIDVLVVNISMLACLPSLAARIINYYKMREDIKVYNITGMGCSASLISINAIQSVFK  184

Query  1151  VYKNSYAIVVSTESLGANWYSGKERSMMLSNCLFRSGGCSMLFTNNPALKPRAILKLKHM  972
               KN  A++V++ESL  NWY+G +RSM+L+NCLFRSGGC++L TN  +LK +A+ KLK +
Sbjct  185   NEKNKVALMVTSESLSPNWYTGNDRSMILANCLFRSGGCAILLTNKLSLKNKAMFKLKQL  244

Query  971   VRTHIAAIDEAYECCKQVEDPQGFRGFHLSKRLPKVATKALVTNFKVLVPKAIPLWETLR  792
             VR H  A DE+Y+ C Q ED QG  GFHL K+LPK AT+ALV N K + P  +P+ E LR
Sbjct  245   VRVHHGANDESYDSCVQREDNQGNIGFHLDKKLPKAATRALVDNLKQIAPLILPIRELLR  304

Query  791   FLAVSSLERRKFKLPSLLGKPILNMKTGIEHFCLHPGGRAVIDGVGVSLGLSEYDLEPAR  612
             +     +++  +       KP++N KTG++H CLH GG+AVIDGVG +L LSEYDLEPAR
Sbjct  305   YAIAIFMKKMNWGSTKGGPKPMINFKTGVDHICLHTGGKAVIDGVGANLNLSEYDLEPAR  364

Query  611   MSLHRWGNTSAGGLWYVLGYMEAKKRLKKGDRILMLSLGAGFKCNNCVWEVMKDLGDPNV  432
             M+LHR+GNTSA  LWYVLGYMEAKKRLKKGD++LMLS GAGFKCN+C+WEV++DL + NV
Sbjct  365   MTLHRFGNTSASSLWYVLGYMEAKKRLKKGDKVLMLSFGAGFKCNSCLWEVLRDLDNGNV  424

Query  431   WEDCIDRYPPETLVNPFTEKFDWIHD  354
             W+DCID YPP TLVNPF EKF W+HD
Sbjct  425   WKDCIDNYPPNTLVNPFLEKFGWLHD  450



>ref|XP_011089407.1| PREDICTED: 3-ketoacyl-CoA synthase 12 [Sesamum indicum]
Length=470

 Score =   518 bits (1334),  Expect = 1e-175, Method: Compositional matrix adjust.
 Identities = 255/451 (57%), Positives = 334/451 (74%), Gaps = 5/451 (1%)
 Frame = -1

Query  1694  LVAIYSLLFLYTVVYILRSYLRRRHQCCYMLNYECYKPTDVARRLSTDKSALVVYRNRNL  1515
             L+  Y L  L  V    R   +RRHQ CY+L+YECY PTD  R+LST     V+ RN++L
Sbjct  5     LMFFYCLPLLPLVYMAWRVLDQRRHQNCYILDYECYMPTD-DRKLSTKFCGEVIRRNKHL  63

Query  1514  GIDEFRFLLQTMVNSGVGEQTYIPINVLEGREDSPTLEDSFTEVDDIMFQTLDNLFAKSK  1335
             G++E++FLL+ +V+SG+GE+TY P  V +GRE SPTL D   E+D+    +++ LF ++ 
Sbjct  64    GLNEYKFLLKAIVSSGIGEETYAPRMVFDGREASPTLADGLLEMDEFFLDSINRLFKRTG  123

Query  1334  VSPREIDvlvvnvsllasapsLTSRVVNRYKMREDVKTFNLSGMGCSASVVAIDIVHHLF  1155
             +SP EIDVLVVN+S+LA+ PSL+SR++N YKMREDVK +NL+GMGCSAS+V+I+IV  +F
Sbjct  124   ISPSEIDVLVVNISMLATLPSLSSRIINFYKMREDVKVYNLTGMGCSASLVSINIVQSIF  183

Query  1154  KVYKNSYAIVVSTESLGANWYSGKERSMMLSNCLFRSGGCSMLFTNNPALKPRAILKLKH  975
             K  KN  A+VV++ESL   WYSG  RSM+L+NCLFR+GGC+M+ TN P+LK RA+ KLK 
Sbjct  184   KSEKNLQALVVTSESLSLGWYSGNNRSMILANCLFRAGGCAMIVTNKPSLKDRAMFKLKT  243

Query  974   MVRTHIAAIDEAYECCKQVEDPQGFRGFHLSKRLPKVATKALVTNFKVLVPKAIPLWETL  795
             +VRTH  A DE+YECC Q ED +GF GFHL K LPK AT+A V N K + PK +P+ E L
Sbjct  244   LVRTHHGAKDESYECCIQKEDEKGFVGFHLGKNLPKAATRAFVDNLKEIAPKILPVRELL  303

Query  794   RFLAVSSLERRKFK----LPSLLGKPILNMKTGIEHFCLHPGGRAVIDGVGVSLGLSEYD  627
             RF A+  + + + K          +P++N  TG++HFCLH GG+AVID +  +LGLSEYD
Sbjct  304   RFSALLFVRKLRQKWSKAAAGATARPMINFSTGVDHFCLHTGGKAVIDAIAQNLGLSEYD  363

Query  626   LEPARMSLHRWGNTSAGGLWYVLGYMEAKKRLKKGDRILMLSLGAGFKCNNCVWEVMKDL  447
             +EPARM+LHR+GNTSA  LWYVL YMEAKKRLKKGD++ M+S GAGFKCN+C+WEVM+DL
Sbjct  364   VEPARMTLHRFGNTSAASLWYVLAYMEAKKRLKKGDKVFMISFGAGFKCNSCLWEVMRDL  423

Query  446   GDPNVWEDCIDRYPPETLVNPFTEKFDWIHD  354
                NVW D ID YPP+ L NPF EK+ WI +
Sbjct  424   DGKNVWADFIDSYPPKNLANPFLEKYGWIQN  454



>ref|XP_003539099.2| PREDICTED: 3-ketoacyl-CoA synthase 12-like [Glycine max]
Length=512

 Score =   518 bits (1335),  Expect = 4e-175, Method: Compositional matrix adjust.
 Identities = 255/457 (56%), Positives = 338/457 (74%), Gaps = 8/457 (2%)
 Frame = -1

Query  1703  METLVAIYSLLFLYTVVYILRSYLRRRHQCCYMLNYECYKPTDVARRLSTDKSALVVYRN  1524
             ME L  +Y +  LY    I + +  +R + CY+LNY+CYKP +  R L T+    ++ R 
Sbjct  42    MELLYLLYLVPTLYACFLIWKMFDEKRDRECYILNYQCYKPPN-DRMLGTEFCGKLIRRT  100

Query  1523  RNLGIDEFRFLLQTMVNSGVGEQTYIPINVLEGREDSPTLEDSFTEVDDIMFQTLDNLFA  1344
              NLG  E+RFLL+ +V+SG+GEQTY P N+ EGRE SPTL D   E+++    ++  L A
Sbjct  101   ENLGPSEYRFLLKAIVSSGIGEQTYAPRNIFEGREASPTLRDGIGEMEEFFHDSIGKLLA  160

Query  1343  KSKVSPREIDvlvvnvsllasapsLTSRVVNRYKMREDVKTFNLSGMGCSASVVAIDIVH  1164
             KS VSP EIDVLVVN+S+LA+ PSL+SR++N YKMR DVK +NL+GMGCSAS++++DIV 
Sbjct  161   KSNVSPSEIDVLVVNISMLATVPSLSSRIINHYKMRHDVKVYNLAGMGCSASLISMDIVK  220

Query  1163  HLFKVYKNSYAIVVSTESLGANWYSGKERSMMLSNCLFRSGGCSMLFTNNPALKPRAILK  984
              +FK  +N  A+++++ESL  NWY+G +RSM+L+NCLFRSGGC++L TN  +LK +A+L+
Sbjct  221   SIFKTQRNKLALLITSESLSPNWYTGSDRSMILANCLFRSGGCAILLTNKRSLKDKAMLR  280

Query  983   LKHMVRTHIAAIDEAYECCKQVEDPQGFRGFHLSKRLPKVATKALVTNFKVLVPKAIPLW  804
             LK +VRTH  A +EAY CC Q ED +G  GFHL K LPK AT+A V N +V+ PK +P+ 
Sbjct  281   LKCLVRTHHGAREEAYGCCIQQEDVEGRLGFHLGKTLPKAATRAFVDNLRVIAPKILPIR  340

Query  803   ETLRFLAVSSLER--RKFKLPSLLG-----KPILNMKTGIEHFCLHPGGRAVIDGVGVSL  645
             E LRF+  S +++  +    P  +      K  LN +TG++HFCLH GG+AVIDG+G+SL
Sbjct  341   ELLRFMFASLVKKINKNTNAPKSVASTGATKSPLNFRTGVDHFCLHTGGKAVIDGIGMSL  400

Query  644   GLSEYDLEPARMSLHRWGNTSAGGLWYVLGYMEAKKRLKKGDRILMLSLGAGFKCNNCVW  465
              LSEYDLEPARM+LHR+GNTSA  LWYVL YMEAKKRLKKGD + M+S GAGFKCN+C+W
Sbjct  401   DLSEYDLEPARMTLHRFGNTSASSLWYVLSYMEAKKRLKKGDAVFMISFGAGFKCNSCLW  460

Query  464   EVMKDLGDPNVWEDCIDRYPPETLVNPFTEKFDWIHD  354
             EVMKDLGD NVW+DCID YPPE+L NPF E + WI++
Sbjct  461   EVMKDLGDANVWDDCIDEYPPESLANPFMETYGWINE  497



>ref|XP_010096695.1| 3-ketoacyl-CoA synthase 21 [Morus notabilis]
 gb|EXB65363.1| 3-ketoacyl-CoA synthase 21 [Morus notabilis]
Length=456

 Score =   516 bits (1329),  Expect = 5e-175, Method: Compositional matrix adjust.
 Identities = 277/427 (65%), Positives = 343/427 (80%), Gaps = 5/427 (1%)
 Frame = -1

Query  1703  METLVAIYSLLFL-YTVVYILRSYLRRRHQCCYMLNYECYKPTDVARRLSTDKSALVVYR  1527
             ME L+AI   L + Y  +++ +S L+++HQCCYML YECYKP +   +LSTD  A +V R
Sbjct  1     MELLMAISLFLVISYAFLHLTKSLLQKQHQCCYMLAYECYKPLE-ETKLSTDACAKIVLR  59

Query  1526  NRNLGIDEFRFLLQTMVNSGVGEQTYIPINVLEGREDSPTLEDSFTEVDDIMFQTLDNLF  1347
             N+N+ +DE RFLL  MV+SG+G+++Y P NVLEGRE+SPTL D+ +E+D+++F TLD+LF
Sbjct  60    NKNISVDELRFLLNAMVSSGIGDESYGPKNVLEGREESPTLTDAISEMDEVIFTTLDSLF  119

Query  1346  AKSKVSPREIDvlvvnvsllasapsLTSRVVNRYKMREDVKTFNLSGMGCSASVVAIDIV  1167
             AK+ VSP +ID+LVVNVSL + APSLTSR+VNRYKMRE+V ++NLSGMGCSAS++ ID+V
Sbjct  120   AKTGVSPAQIDILVVNVSLFSPAPSLTSRIVNRYKMRENVMSYNLSGMGCSASIIGIDLV  179

Query  1166  HHLFKVYKNSYAIVVSTESLGANWYSGKERSMMLSNCLFRSGGCSMLFTNNPALKPRAIL  987
              HLFK ++NSYAIVVSTES G +WY GKE+SMMLSNCLFRSGGCSMLFTN   LK +AIL
Sbjct  180   QHLFKTHENSYAIVVSTESFGLHWYCGKEKSMMLSNCLFRSGGCSMLFTNKNELKKKAIL  239

Query  986   KLKHMVRTHIAAIDEAYECCKQVEDPQGFRGFHLSKRLPKVATKALVTNFKVLVPKAIPL  807
             KLK +VRTH+ A DEAYECC Q+ED +G  GF L+K+L K A KAL  N +VLVPK +P+
Sbjct  240   KLKCLVRTHLGADDEAYECCIQLEDEKGHEGFRLTKKLTKAAAKALRLNLRVLVPKILPV  299

Query  806   WETLRFLAVSSLERRKFKLPSLL---GKPILNMKTGIEHFCLHPGGRAVIDGVGVSLGLS  636
              E LR+  V+ +     K    L   G   L+ KTG EHFC+HPGGRAVIDGVG+SLGLS
Sbjct  300   REILRYWIVNLIRNTNNKGDPQLTSSGANNLDFKTGAEHFCIHPGGRAVIDGVGMSLGLS  359

Query  635   EYDLEPARMSLHRWGNTSAGGLWYVLGYMEAKKRLKKGDRILMLSLGAGFKCNNCVWEVM  456
             EYDLEP+RM+LHR+GNTSAGG WYVLGYMEAKKRLKKGDRILM+S GAGFKCNNC+WEVM
Sbjct  360   EYDLEPSRMALHRFGNTSAGGFWYVLGYMEAKKRLKKGDRILMMSFGAGFKCNNCLWEVM  419

Query  455   KDLGDPN  435
             +DL D +
Sbjct  420   RDLDDED  426



>ref|XP_004251303.1| PREDICTED: 3-ketoacyl-CoA synthase 3-like [Solanum lycopersicum]
Length=466

 Score =   516 bits (1330),  Expect = 5e-175, Method: Compositional matrix adjust.
 Identities = 251/447 (56%), Positives = 334/447 (75%), Gaps = 2/447 (0%)
 Frame = -1

Query  1691  VAIYSLLFLYTVVYILRSYLRRRHQCCYMLNYECYKPTDVARRLSTDKSALVVYRNRNLG  1512
             +  Y +   Y +  I +   R+RHQ CY+L+YEC+K TD  R LST  S  ++ RN++LG
Sbjct  6     ILFYGVPLFYLLYLIWKIIDRKRHQNCYILDYECHKSTD-DRMLSTKFSGEIIRRNKHLG  64

Query  1511  IDEFRFLLQTMVNSGVGEQTYIPINVLEGREDSPTLEDSFTEVDDIMFQTLDNLFAKSKV  1332
             ++E++FLL+ +V+SG+GEQTY P  V +GRE  PT ED   E+++    ++D +  ++K+
Sbjct  65    LNEYKFLLKAIVSSGIGEQTYAPQMVFDGREACPTFEDGILEMEEFFQDSIDKVLKRNKI  124

Query  1331  SPREIDvlvvnvsllasapsLTSRVVNRYKMREDVKTFNLSGMGCSASVVAIDIVHHLFK  1152
             SP EIDVLVVN+S+LA  PSL +R++N YKMRED+K +N++GMGCSAS+++I+ +  +FK
Sbjct  125   SPSEIDVLVVNISMLACMPSLAARIINYYKMREDIKVYNITGMGCSASLISINAIQSVFK  184

Query  1151  VYKNSYAIVVSTESLGANWYSGKERSMMLSNCLFRSGGCSMLFTNNPALKPRAILKLKHM  972
               KN  A++V++ESL  NWY G +RSM+L+NCLFRSGGC++L TN  +LK +A+ KLK +
Sbjct  185   NEKNKVALMVTSESLSPNWYIGNDRSMILANCLFRSGGCAILLTNKLSLKNKAMFKLKQL  244

Query  971   VRTHIAAIDEAYECCKQVEDPQGFRGFHLSKRLPKVATKALVTNFKVLVPKAIPLWETLR  792
             VR H  A DE+YE C Q ED QG  GFHL K LPK AT+ALV N K + P  +P+ E LR
Sbjct  245   VRVHHGAKDESYESCVQREDSQGNIGFHLDKTLPKAATRALVDNLKQIAPLILPIRELLR  304

Query  791   FLAVSSLERRKFKLPSLLG-KPILNMKTGIEHFCLHPGGRAVIDGVGVSLGLSEYDLEPA  615
             +     + +  +   S  G KP++N KTG++H CLH GG+AVIDGVG SL LSEYDLEPA
Sbjct  305   YAIAIFMRKMNWGSSSKGGPKPMINFKTGVDHICLHTGGKAVIDGVGASLNLSEYDLEPA  364

Query  614   RMSLHRWGNTSAGGLWYVLGYMEAKKRLKKGDRILMLSLGAGFKCNNCVWEVMKDLGDPN  435
             RM+LHR+GNTSA  LWYVLGYMEAKKRLKKGD++LMLS GAGFKCN+C+WEV++DL + N
Sbjct  365   RMTLHRFGNTSASSLWYVLGYMEAKKRLKKGDKVLMLSFGAGFKCNSCLWEVLRDLDNGN  424

Query  434   VWEDCIDRYPPETLVNPFTEKFDWIHD  354
             VW+DCID YPP TLVNPF EKF W+HD
Sbjct  425   VWKDCIDNYPPNTLVNPFLEKFGWLHD  451



>ref|XP_004251302.1| PREDICTED: 3-ketoacyl-CoA synthase 3-like [Solanum lycopersicum]
Length=464

 Score =   516 bits (1329),  Expect = 6e-175, Method: Compositional matrix adjust.
 Identities = 247/426 (58%), Positives = 331/426 (78%), Gaps = 3/426 (1%)
 Frame = -1

Query  1631  RRRHQCCYMLNYECYKPTDVARRLSTDKSALVVYRNRNLGIDEFRFLLQTMVNSGVGEQT  1452
             R RHQ CY+L+YEC+KPTD  R LST  S  ++ RN++LG++E++FLL+ +V+SG+GEQT
Sbjct  26    RERHQNCYILDYECHKPTD-DRMLSTKFSGEIIMRNKHLGLNEYKFLLKAVVSSGIGEQT  84

Query  1451  YIPINVLEGREDSPTLEDSFTEVDDIMFQTLDNLFAKSKVSPREIDvlvvnvsllasaps  1272
             Y P  V +GRE  PT ED   E+++    ++D LF ++K+SP +IDVLVVN+S+LAS PS
Sbjct  85    YAPRMVFDGREACPTYEDGILEMEEFFHDSIDKLFKRNKISPSQIDVLVVNISMLASMPS  144

Query  1271  LTSRVVNRYKMREDVKTFNLSGMGCSASVVAIDIVHHLFKVYKNSYAIVVSTESLGANWY  1092
             + +R++N YKMRED+K +NL+GMGCSAS+++++IV ++FK  KN  A++V++ESL  NWY
Sbjct  145   MAARIINYYKMREDIKVYNLTGMGCSASLISLNIVENIFKNEKNKVALLVTSESLSPNWY  204

Query  1091  SGKERSMMLSNCLFRSGGCSMLFTNNPALKPRAILKLKHMVRTHIAAIDEAYECCKQVED  912
              G +RSM+LSNCLFRSGGC++L TN  +LK +A+ KLK +VR H  A DEAY+ C Q ED
Sbjct  205   VGNDRSMILSNCLFRSGGCAILLTNKLSLKNKAMFKLKQLVRVHHGAKDEAYDSCAQRED  264

Query  911   PQGFRGFHLSKRLPKVATKALVTNFKVLVPKAIPLWETLRFLAVSSLERRKFKLPSLLGK  732
              QG  GFHL K LPK A++ALV N K + P  +P+ E LR+    ++  +K    S  G 
Sbjct  265   IQGNTGFHLDKTLPKAASRALVDNLKQIAPLILPIRELLRYSI--AIFMKKMNWSSTKGG  322

Query  731   PILNMKTGIEHFCLHPGGRAVIDGVGVSLGLSEYDLEPARMSLHRWGNTSAGGLWYVLGY  552
             P +N KTG++H CLH GG+AVIDGVG +L LSE+DLEPARM+LHR+GNTSA  LWYVLGY
Sbjct  323   PKINFKTGVDHICLHTGGKAVIDGVGANLNLSEHDLEPARMTLHRFGNTSASSLWYVLGY  382

Query  551   MEAKKRLKKGDRILMLSLGAGFKCNNCVWEVMKDLGDPNVWEDCIDRYPPETLVNPFTEK  372
             MEAKKRLKKGD++LM+S GAGFKCN+C+W+V++DL D NVW+DCID YPP+T+VNPF E+
Sbjct  383   MEAKKRLKKGDKMLMISFGAGFKCNSCLWQVLRDLDDGNVWKDCIDNYPPKTIVNPFMEQ  442

Query  371   FDWIHD  354
             F W+HD
Sbjct  443   FGWLHD  448



>ref|XP_007132127.1| hypothetical protein PHAVU_011G068900g [Phaseolus vulgaris]
 gb|ESW04121.1| hypothetical protein PHAVU_011G068900g [Phaseolus vulgaris]
Length=469

 Score =   515 bits (1327),  Expect = 1e-174, Method: Compositional matrix adjust.
 Identities = 256/455 (56%), Positives = 342/455 (75%), Gaps = 6/455 (1%)
 Frame = -1

Query  1703  METLVAIYSLLFLYTVVYILRSYLRRRHQCCYMLNYECYKPTDVARRLSTDKSALVVYRN  1524
             ME L  +Y +  LY+   I +    RR + CY+L+Y+CYKP +  R L T+    ++ R 
Sbjct  1     MEFLYLLYLVPTLYSCFLIWKMLEERRDRECYILDYQCYKPPN-HRMLGTEFCGKLIKRT  59

Query  1523  RNLGIDEFRFLLQTMVNSGVGEQTYIPINVLEGREDSPTLEDSFTEVDDIMFQTLDNLFA  1344
              NLG  E+RFLL+ +V+SG+GEQTY P N+ EGRE +PTL D   E+++     +  L A
Sbjct  60    ENLGPSEYRFLLKAIVSSGIGEQTYAPRNIFEGREGAPTLFDGIEEMEEFFNDAIAKLLA  119

Query  1343  KSKVSPREIDvlvvnvsllasapsLTSRVVNRYKMREDVKTFNLSGMGCSASVVAIDIVH  1164
             KSKVSP EID+LVVN+S+LA+ PSL+SR++N YK+R DVK +NL+GMGCSAS++++DIV 
Sbjct  120   KSKVSPSEIDILVVNISMLAAVPSLSSRIINLYKLRHDVKVYNLTGMGCSASLISMDIVK  179

Query  1163  HLFKVYKNSYAIVVSTESLGANWYSGKERSMMLSNCLFRSGGCSMLFTNNPALKPRAILK  984
              +FK  +N  A+++++ESL  NWY+G +RSM+L+NCLFR+GGC++L TN  ++K RA+L+
Sbjct  180   SIFKTQRNKLALLITSESLSPNWYTGSDRSMILANCLFRTGGCAILLTNKRSMKDRALLR  239

Query  983   LKHMVRTHIAAIDEAYECCKQVEDPQGFRGFHLSKRLPKVATKALVTNFKVLVPKAIPLW  804
             LK +VRTH  A +EAY CC Q ED QG  GFHL K LPK AT+A V N +V+ PK +P+ 
Sbjct  240   LKCLVRTHHGAREEAYGCCVQREDEQGRLGFHLGKTLPKAATRAFVDNLRVMAPKILPVR  299

Query  803   ETLRFLAVSSLER-RKFKLP--SLLG--KPILNMKTGIEHFCLHPGGRAVIDGVGVSLGL  639
             E LRFL +S +++  K   P  ++ G  K  LN +TG++HFCLH GG+AVIDG+G+SL L
Sbjct  300   ELLRFLFMSLIKKVNKNNSPKSAITGATKSPLNFRTGVDHFCLHTGGKAVIDGIGLSLDL  359

Query  638   SEYDLEPARMSLHRWGNTSAGGLWYVLGYMEAKKRLKKGDRILMLSLGAGFKCNNCVWEV  459
             SEYDLEPARM+LHR+GNTSA  LWYVL YMEAKKRLKKGD + M+S GAGFKCN+C+WEV
Sbjct  360   SEYDLEPARMTLHRFGNTSASSLWYVLSYMEAKKRLKKGDTVFMISFGAGFKCNSCLWEV  419

Query  458   MKDLGDPNVWEDCIDRYPPETLVNPFTEKFDWIHD  354
             MKDLGDPNVW+DCID YPPE+L NPF + + WI++
Sbjct  420   MKDLGDPNVWDDCIDDYPPESLENPFMKTYGWINE  454



>gb|EYU36246.1| hypothetical protein MIMGU_mgv1a005714mg [Erythranthe guttata]
Length=473

 Score =   514 bits (1324),  Expect = 4e-174, Method: Compositional matrix adjust.
 Identities = 249/453 (55%), Positives = 336/453 (74%), Gaps = 8/453 (2%)
 Frame = -1

Query  1691  VAIYSLLFLYTVVYILRSYLRRRHQCCYMLNYECYKPTDVARRLSTDKSALVVYRNRNLG  1512
             V  YSL  L    ++ R + RRR+Q CY+L+YEC  P +  R+LST  S  ++ RN+ L 
Sbjct  6     VLFYSLFLLPLSYFLWRLFDRRRNQSCYILDYECQMPPE-DRKLSTKFSGEIIIRNKQLR  64

Query  1511  IDEFRFLLQTMVNSGVGEQTYIPINVLEGREDSPTLEDSFTEVDDIMFQTLDNLFAKSKV  1332
             ++E++FLL+ +V+SG+GE+TY P  V +GRE SP+L D   E+D+    T+D LF ++ +
Sbjct  65    VNEYKFLLKAIVSSGIGEETYGPKMVFDGRESSPSLADGILEMDEFFTDTIDRLFKRTGI  124

Query  1331  SPREIDvlvvnvsllasapsLTSRVVNRYKMREDVKTFNLSGMGCSASVVAIDIVHHLFK  1152
              P EIDVLVVN+S++A+ PSL+SR+VN YKMRED+K +NL+GMGCSAS+V++DIV ++ +
Sbjct  125   HPSEIDVLVVNISMIATLPSLSSRIVNMYKMREDIKVYNLTGMGCSASLVSVDIVRNICR  184

Query  1151  VYKNSYAIVVSTESLGANWYSGKERSMMLSNCLFRSGGCSMLFTNNPALKPRAILKLKHM  972
               KN  A+VV++ESL  NWY+G  RSM+L+NCLFR+GGC+M+ TN P+LK RA+ +LK +
Sbjct  185   NQKNVQALVVTSESLSLNWYNGNNRSMILANCLFRTGGCAMILTNKPSLKHRAMFRLKTL  244

Query  971   VRTHIAAIDEAYECCKQVEDPQGFRGFHLSKRLPKVATKALVTNFKVLVPKAIPLWETLR  792
             VRTH  A DE+Y CC+Q ED +GF G +L K LPK AT+A   N KV+ PK +P+ E LR
Sbjct  245   VRTHHGARDESYGCCEQKEDEKGFVGIYLGKNLPKAATRAFADNLKVIAPKILPVRELLR  304

Query  791   FLAVSSLERRKFKLPS-------LLGKPILNMKTGIEHFCLHPGGRAVIDGVGVSLGLSE  633
             F AV    + + K             +P++N KTG++HFCLH GG+AVIDGV  +LGLSE
Sbjct  305   FAAVLIFRKLRQKWSKAAAAAAAAAARPMINFKTGVDHFCLHTGGKAVIDGVAQNLGLSE  364

Query  632   YDLEPARMSLHRWGNTSAGGLWYVLGYMEAKKRLKKGDRILMLSLGAGFKCNNCVWEVMK  453
             YD+EPARM+LHR+GNTSA  +WYVL YME+KKRLKKGDR+ M+S GAGFKCN+C+WEVM+
Sbjct  365   YDVEPARMTLHRFGNTSASSVWYVLAYMESKKRLKKGDRVFMISFGAGFKCNSCLWEVMR  424

Query  452   DLGDPNVWEDCIDRYPPETLVNPFTEKFDWIHD  354
             DL   NVWE+CIDRYP + L NPF EKF W+H+
Sbjct  425   DLEGKNVWENCIDRYPQKNLANPFLEKFGWLHE  457



>emb|CAN62551.1| hypothetical protein VITISV_002308 [Vitis vinifera]
Length=467

 Score =   513 bits (1322),  Expect = 7e-174, Method: Compositional matrix adjust.
 Identities = 249/445 (56%), Positives = 339/445 (76%), Gaps = 2/445 (0%)
 Frame = -1

Query  1703  METLVAIYSLLFLYTVVYILRSYLRRRHQCCYMLNYECYKPTDVARRLSTDKSALVVYRN  1524
             ME +V ++ L   Y    + +    +R Q CY+L+Y+CYKPTD  R+LST+    ++ RN
Sbjct  1     MEAMVYLFLLPVFYLFFLLWKFIDGKRDQECYILDYQCYKPTD-DRKLSTEFCGDMIRRN  59

Query  1523  RNLGIDEFRFLLQTMVNSGVGEQTYIPINVLEGREDSPTLEDSFTEVDDIMFQTLDNLFA  1344
             ++LG+ E++FLL+ +VNSG+GE+TY P NV  G E  P++ D  +E+D+    +++ L  
Sbjct  60    KSLGLQEYKFLLKAIVNSGIGEETYGPRNVFSGNETHPSVLDGISEMDEFFNDSIEKLLD  119

Query  1343  KSKVSPREIDvlvvnvsllasapsLTSRVVNRYKMREDVKTFNLSGMGCSASVVAIDIVH  1164
             +  VSP EID LVVNVS++ +APSL  R++NRYKMRE++K FNL+GMGCSAS+++I+IV 
Sbjct  120   RVGVSPSEIDALVVNVSMITTAPSLAGRIINRYKMRENIKAFNLTGMGCSASLISINIVQ  179

Query  1163  HLFKVYKNSYAIVVSTESLGANWYSGKERSMMLSNCLFRSGGCSMLFTNNPALKPRAILK  984
             +LFK YKN YA+VV++ESL  NWY+G +RSM+LSNCLFRSGGC++L TN  AL+ RA+LK
Sbjct  180   NLFKSYKNMYALVVTSESLSPNWYTGNDRSMILSNCLFRSGGCAVLLTNKRALRHRAMLK  239

Query  983   LKHMVRTHIAAIDEAYECCKQVEDPQGFRGFHLSKRLPKVATKALVTNFKVLVPKAIPLW  804
             L+ +VRTH  A DE++ CC Q ED QG  GF L+K LPK AT+A + N +V+ PK +P+ 
Sbjct  240   LRCLVRTHHGAKDESFGCCIQKEDDQGRLGFFLNKSLPKAATRAFIDNLRVISPKILPVR  299

Query  803   ETLRFLAVSSLERRKFKLPSLLGKPILNMKTGIEHFCLHPGGRAVIDGVGVSLGLSEYDL  624
             E LR++ V+SL R+ ++     GK ++N KTG++HFC+H GG+AVIDG+G SL L+EYDL
Sbjct  300   ELLRYM-VASLVRKMYQNSKGGGKVVINFKTGVDHFCIHTGGKAVIDGIGKSLELTEYDL  358

Query  623   EPARMSLHRWGNTSAGGLWYVLGYMEAKKRLKKGDRILMLSLGAGFKCNNCVWEVMKDLG  444
             EPARM+LHR+GNTSA  LWYVL YM+ KKRLKKGDR+LM+S GAGFKCN+C+WEV +DL 
Sbjct  359   EPARMTLHRFGNTSASSLWYVLAYMDEKKRLKKGDRVLMISFGAGFKCNSCMWEVARDLD  418

Query  443   DPNVWEDCIDRYPPETLVNPFTEKF  369
               NVW+DCID YPPE+L NPF EK+
Sbjct  419   GGNVWKDCIDSYPPESLSNPFMEKY  443



>ref|XP_010260016.1| PREDICTED: 3-ketoacyl-CoA synthase 12-like [Nelumbo nucifera]
Length=475

 Score =   514 bits (1323),  Expect = 7e-174, Method: Compositional matrix adjust.
 Identities = 251/456 (55%), Positives = 349/456 (77%), Gaps = 7/456 (2%)
 Frame = -1

Query  1703  METLVAIYSLLFLYTVVYIL-RSYLRRRHQCCYMLNYECYKPTDVARRLSTDKSALVVYR  1527
             M+    +  L+ L+  +++L R   + R Q CY+++YEC+KP+D  R+LST+    +++ 
Sbjct  1     MDLFATVLCLIALFYPLFLLWRLIDQWRGQACYIIDYECFKPSD-DRKLSTEFCGKLIHN  59

Query  1526  NRNLGIDEFRFLLQTMVNSGVGEQTYIPINVLEGREDSPTLEDSFTEVDDIMFQTLDNLF  1347
             N+ LG+++F+FLL+ +V+SG+GE+TY P NVLEGR ++PTL D   E+++  F TLD LF
Sbjct  60    NKYLGLEDFKFLLRAIVSSGIGEETYGPRNVLEGRAENPTLMDGILEMEEFFFDTLDKLF  119

Query  1346  AKSKVSPREIDvlvvnvsllasapsLTSRVVNRYKMREDVKTFNLSGMGCSASVVAIDIV  1167
             +K+ VSP EID+LVVNVS+LA+ P L +R++N YKMREDVK +N+SGMGCSAS+++I++V
Sbjct  120   SKTGVSPSEIDILVVNVSMLATEPDLAARIINHYKMREDVKVYNISGMGCSASLISINLV  179

Query  1166  HHLFKVYKNSYAIVVSTESLGANWYSGKERSMMLSNCLFRSGGCSMLFTNNPALKPRAIL  987
               +FK +K ++A+VV++E++G +WYSG +RSM+L+NCLFRSGGCS+L +NNP+L+ RA+ 
Sbjct  180   QSIFKAHKKAFAVVVTSEAIGPHWYSGNDRSMLLTNCLFRSGGCSILLSNNPSLRHRAMF  239

Query  986   KLKHMVRTHIAAIDEAYECCKQVEDPQGFRGFHLSKRLPKVATKALVTNFKVLVPKAIPL  807
             +LK +VRTH+ + DEAY C  Q ED  G  GFHL K LPK AT+A V N +VL PK +PL
Sbjct  240   RLKCLVRTHLGSNDEAYGCAIQKEDAAGRPGFHLGKNLPKSATRAFVENLRVLAPKVLPL  299

Query  806   WETLRFLAVSSLERRKFKLPSLLG-----KPILNMKTGIEHFCLHPGGRAVIDGVGVSLG  642
              E LR++ V+ L  R  K  +  G     K  +N KTGIEHFCLH GG+AVIDGVG SLG
Sbjct  300   RELLRYVMVTRLLPRPKKDNASAGKSGGVKAGVNFKTGIEHFCLHTGGKAVIDGVGKSLG  359

Query  641   LSEYDLEPARMSLHRWGNTSAGGLWYVLGYMEAKKRLKKGDRILMLSLGAGFKCNNCVWE  462
             L+EYDLEPARM+LHR+GNTSA  LWYVL YMEAKKRL++GDR++M+S G GFKCN+C+ E
Sbjct  360   LTEYDLEPARMTLHRFGNTSASSLWYVLAYMEAKKRLRRGDRVMMISFGGGFKCNSCLLE  419

Query  461   VMKDLGDPNVWEDCIDRYPPETLVNPFTEKFDWIHD  354
             V++DL D NVW+D I  YPP+TLV+PF  ++ WI++
Sbjct  420   VVRDLEDDNVWKDFIANYPPKTLVSPFISEYGWINN  455



>ref|XP_004487041.1| PREDICTED: 3-ketoacyl-CoA synthase 12-like [Cicer arietinum]
Length=472

 Score =   514 bits (1323),  Expect = 8e-174, Method: Compositional matrix adjust.
 Identities = 254/456 (56%), Positives = 344/456 (75%), Gaps = 8/456 (2%)
 Frame = -1

Query  1703  METLVAIYSLLFLYTVVYILRSYLRRRHQCCYMLNYECYKPTDVARRLSTDKSALVVYRN  1524
             ME L  IY +  ++    I + + +RR Q CY+L+Y+CYKP+D  R+L T+    ++ ++
Sbjct  1     MEFLTFIYVVTIMHLCFQIWKLFDKRRDQECYILDYQCYKPSD-ERKLGTNLCGKIIGKS  59

Query  1523  RNLGIDEFRFLLQTMVNSGVGEQTYIPINVLEGREDSPTLEDSFTEVDDIMFQTLDNLFA  1344
              N+G+ E +F L+ +VNSG+GE+TY P N +EGR  + TL+D   E+++    ++  L  
Sbjct  60    ENIGLAECKFFLKAIVNSGIGEETYAPRNFIEGRVVNTTLDDGIMEMEEFYHDSIAKLLK  119

Query  1343  KSKVSPREIDvlvvnvsllasapsLTSRVVNRYKMREDVKTFNLSGMGCSASVVAIDIVH  1164
             KS +SP +ID+LVVNVSL ++ PSLTSR++N YKMR+D+K +NLSGMGCSAS++++DI+ 
Sbjct  120   KSNISPSDIDILVVNVSLFSAVPSLTSRIINHYKMRQDIKAYNLSGMGCSASLISLDIIK  179

Query  1163  HLFKVYKNSYAIVVSTESLGANWYSGKERSMMLSNCLFRSGGCSMLFTNNPALKPRAILK  984
              +FK  KN YA+++++ESL  NWYSG ERSM+L+NCLFR+GGC++L TN  +LK +AILK
Sbjct  180   SIFKSQKNKYALLLTSESLSTNWYSGNERSMILANCLFRTGGCAILLTNKRSLKHKAILK  239

Query  983   LKHMVRTHIAAIDEAYECCKQVEDPQGFRGFHLSKRLPKVATKALVTNFKVLVPKAIPLW  804
             LK ++RTH  A D+AY CC Q ED QG  GF L+K LPK AT+A V N +VL PK +P  
Sbjct  240   LKCLIRTHHGARDDAYNCCSQKEDEQGRLGFFLAKDLPKAATRAFVDNLRVLSPKILPAR  299

Query  803   ETLRFLAVSSLER-RKFKLP--SLLGKPILNMKTGIEHFCLHPGGRAVIDGVGVSLGLSE  633
             E LR+L +S +++  K  +P  S   K  LN K+G++HFCLH GG+AVIDG+G+SL LS+
Sbjct  300   ELLRYLLISLIKKVTKSHVPKSSTSNKSPLNFKSGVDHFCLHTGGKAVIDGIGLSLDLSD  359

Query  632   YDLEPARMSLHRWGNTSAGGLWYVLGYMEAKKRLKKGDRILMLSLGAGFKCNNCVWEVMK  453
             YDLEPARMSLHR+GNTSA  LWYVLGYMEAKKRLKKG+R+LM+SLGAGFKCN+C+WEVM+
Sbjct  360   YDLEPARMSLHRFGNTSASSLWYVLGYMEAKKRLKKGERVLMISLGAGFKCNSCLWEVMR  419

Query  452   ---DLG-DPNVWEDCIDRYPPETLVNPFTEKFDWIH  357
                D+G D NVWEDCI  YPPE+L NPF EK+ WI+
Sbjct  420   EKEDVGSDGNVWEDCIHYYPPESLANPFMEKYGWIN  455



>gb|AGK30015.1| 3-ketoacyl-CoA synthase 6 [Gossypium raimondii]
Length=467

 Score =   513 bits (1321),  Expect = 1e-173, Method: Compositional matrix adjust.
 Identities = 251/458 (55%), Positives = 347/458 (76%), Gaps = 13/458 (3%)
 Frame = -1

Query  1691  VAIYSLLFLYTVVYILRSYLR----RRHQCCYMLNYECYKPTDVARRLSTDKSALVVYRN  1524
             + ++S L +  + Y+L          R Q CY+L+Y+CYKP+D  R + T+ S  V+ RN
Sbjct  1     MELFSFLLIIPIFYLLFKIWNWINDVRDQQCYILDYQCYKPSD-DRMVGTEFSGEVIKRN  59

Query  1523  RNLGIDEFRFLLQTMVNSGVGEQTYIPINVLEGREDSPTLEDSFTEVDDIMFQTLDNLFA  1344
             +NLG++E++FLL+ +V+SG+GEQTY P  +  GRE+SP LED   E+++    +++ + +
Sbjct  60    KNLGLNEYKFLLKAIVSSGIGEQTYAPRIMFSGREESPKLEDGILEMEEFFHDSIEKVLS  119

Query  1343  KSKVSPREIDvlvvnvsllasapsLTSRVVNRYKMREDVKTFNLSGMGCSASVVAIDIVH  1164
             ++ +SP+EID+LVVNVS+L++ PSL SR++N YKMR D+K+FNL+GMGCSAS++++DIV 
Sbjct  120   RAGISPQEIDLLVVNVSMLSTVPSLCSRIINHYKMRPDIKSFNLTGMGCSASLISLDIVR  179

Query  1163  HLFKVYKNSYAIVVSTESLGANWYSGKERSMMLSNCLFRSGGCSMLFTNNPALKPRAILK  984
             ++FK YKN +A++V++ESL  NWY+G +RSM+LSNCLFRSGGC++L TN  +LK RA+ K
Sbjct  180   NVFKSYKNKFALLVTSESLSPNWYAGNDRSMILSNCLFRSGGCAVLLTNKKSLKHRAMFK  239

Query  983   LKHMVRTHIAAIDEAYECCKQVEDPQGFRGFHLSKRLPKVATKALVTNFKVLVPKAIPLW  804
             LK +VRTH  A DE+Y CC Q ED +G  GFHLSK LPK AT++ V N +V+ PK +P+ 
Sbjct  240   LKCLVRTHHGAKDESYGCCIQREDDKGKMGFHLSKSLPKAATRSFVDNLRVITPKILPVR  299

Query  803   ETLRFLAVSSLE-----RRKFKLPSLLGKPI---LNMKTGIEHFCLHPGGRAVIDGVGVS  648
             E +RF+AVS L+     R           PI   +N K+G++HFC+H GG+AVIDG+G+S
Sbjct  300   ELVRFMAVSLLKKWNVVRHGSSHKGASQGPIKAGVNFKSGVDHFCIHTGGKAVIDGIGIS  359

Query  647   LGLSEYDLEPARMSLHRWGNTSAGGLWYVLGYMEAKKRLKKGDRILMLSLGAGFKCNNCV  468
             L L+EYDLEPARM+LHR+GNTSA  LWYVL YMEAKKRLKKGD++LM+S GAGFKCN+C+
Sbjct  360   LDLTEYDLEPARMTLHRFGNTSASSLWYVLAYMEAKKRLKKGDKVLMISFGAGFKCNSCL  419

Query  467   WEVMKDLGDPNVWEDCIDRYPPETLVNPFTEKFDWIHD  354
             WEV++DLGD NVW+D I  YPP+TLVNP+ EKF WI D
Sbjct  420   WEVVRDLGDGNVWKDEIYMYPPKTLVNPYMEKFGWIQD  457



>ref|XP_004294622.1| PREDICTED: 3-ketoacyl-CoA synthase 12-like [Fragaria vesca subsp. 
vesca]
Length=465

 Score =   513 bits (1320),  Expect = 1e-173, Method: Compositional matrix adjust.
 Identities = 254/457 (56%), Positives = 339/457 (74%), Gaps = 7/457 (2%)
 Frame = -1

Query  1703  METLVAIYSLLFLYTVVYILRSYLRRRHQCCYMLNYECYKPTDVARRLSTDKSALVVYRN  1524
             ME L  +Y+L  LY +  + + Y  +R Q CY+L+YEC+KPTD  R+L T+ S  ++ R 
Sbjct  1     MEFLSILYALSALYFIFTLWKRYDEKRDQQCYILDYECHKPTD-DRKLDTEYSGEIIKRT  59

Query  1523  RNLGIDEFRFLLQTMVNSGVGEQTYIPINVLEGREDSPTLEDSFTEVDDIMFQTLDNLFA  1344
             +NLG+ E++FLL+ +V+SG+GEQTY P  + + RE  PTLEDS TE+++    ++  +  
Sbjct  60    KNLGLLEYQFLLKAIVSSGIGEQTYAPRIMFDCRESCPTLEDSITEMEEFFHDSIQKVLD  119

Query  1343  KSKVSPREIDvlvvnvsllasapsLTSRVVNRYKMREDVKTFNLSGMGCSASVVAIDIVH  1164
             K  +SP +IDVLVVNVS+ AS PSL SR++N YKMRED+K +NLSGMGCSAS++++ IV 
Sbjct  120   KQGLSPSQIDVLVVNVSMFASVPSLASRIINHYKMREDIKVYNLSGMGCSASLISVGIVR  179

Query  1163  HLFKVYKNSYAIVVSTESLGANWYSGKERSMMLSNCLFRSGGCSMLFTNNPALKPRAILK  984
              +FK  KN YA+VV++ESL  NWY+G  RSM+L+NCLFRSGGC++L TN  ALK +A+ K
Sbjct  180   SIFKTNKNIYALVVTSESLSPNWYTGNARSMILANCLFRSGGCAILLTNKRALKNKAMFK  239

Query  983   LKHMVRTHIAAIDEAYECCKQVEDPQGFRGFHLSKRLPKVATKALVTNFKVLVPKAIPLW  804
             L  +VRTH  A DE+Y CC Q ED QG  GFHL+K LPK AT+A V N + + PK +P+ 
Sbjct  240   LNCLVRTHHGAKDESYGCCIQQEDEQGRLGFHLAKHLPKAATRAFVDNLREISPKILPIG  299

Query  803   ETLRFLAVSSLERRKF----KLPSLLGKPILNMKTGIEHFCLHPGGRAVIDGVGVSLGLS  636
             E +RF+  + L + +     KL + L KP++N KTG++HFC+H GG+AVIDG+G SLGL+
Sbjct  300   ELVRFMLATFLRKLRQSSSNKLGTTLPKPVINFKTGVDHFCIHTGGKAVIDGIGKSLGLT  359

Query  635   EYDLEPARMSLHRWGNTSAGGLWYVLGYMEAKKRLKKGDRILMLSLGAGFKCNNCVWEVM  456
             E+DLEPARM+LHR+GNTSA  LWYVL YMEAKKRLKKGD +LM+S GAGFKCN+C  EV+
Sbjct  360   EHDLEPARMTLHRFGNTSASSLWYVLAYMEAKKRLKKGDTVLMISFGAGFKCNSCFLEVV  419

Query  455   KDLGDPNVWEDCIDRYPPETLVNPFTEKFDWIH--DP  351
             +DL D NVW+D I  YPP++L NPF EKF W+   DP
Sbjct  420   RDLEDGNVWKDEIAMYPPKSLTNPFMEKFGWLQQEDP  456



>ref|XP_004157020.1| PREDICTED: LOW QUALITY PROTEIN: 3-ketoacyl-CoA synthase 12-like 
[Cucumis sativus]
Length=461

 Score =   512 bits (1319),  Expect = 2e-173, Method: Compositional matrix adjust.
 Identities = 249/451 (55%), Positives = 340/451 (75%), Gaps = 3/451 (1%)
 Frame = -1

Query  1703  METLVAIYSLLFLYTVVYILRSYLRRRHQCCYMLNYECYKPTDVARRLSTDKSALVVYRN  1524
             ME L   +     Y +  I + +  ++ Q CY+L+Y+CYKPTD  R+LST+    ++ R 
Sbjct  1     MELLYFFFLCSVFYFLFIIWKHFNDKQDQECYILSYQCYKPTD-DRKLSTEFCGEIIKRT  59

Query  1523  RNLGIDEFRFLLQTMVNSGVGEQTYIPINVLEGREDSPTLEDSFTEVDDIMFQTLDNLFA  1344
             +NLG++E++FLL+ +V+SG+GE+TY P  +  GRED+PTL+D  +E+D+    ++  +F 
Sbjct  60    KNLGLNEYKFLLKAVVSSGIGEETYGPRVMFAGREDTPTLDDGISEMDEFFXDSIGKIFQ  119

Query  1343  KSKVSPREIDvlvvnvsllasapsLTSRVVNRYKMREDVKTFNLSGMGCSASVVAIDIVH  1164
             KS  SP +IDVLVVNVS+LA+ PSL++R++N YK+R DVK FNL+GMGCSAS++++DIV 
Sbjct  120   KSGFSPSDIDVLVVNVSMLATIPSLSARIINYYKLRSDVKVFNLTGMGCSASLISVDIVS  179

Query  1163  HLFKVYKNSYAIVVSTESLGANWYSGKERSMMLSNCLFRSGGCSMLFTNNPALKPRAILK  984
              +FK +KN  A+V+++ESL  NWYSG +RSM+LSNCLFRSGGC++L TNN ALK RA+ K
Sbjct  180   RVFKSHKNINALVITSESLSPNWYSGNDRSMILSNCLFRSGGCAILLTNNRALKNRAMFK  239

Query  983   LKHMVRTHIAAIDEAYECCKQVEDPQGFRGFHLSKRLPKVATKALVTNFKVLVPKAIPLW  804
             LK ++RTH  A DE+Y CC Q ED +G+ GFHL K LPK AT+A V N + + P+ +P  
Sbjct  240   LKCLIRTHHGARDESYGCCIQTEDDKGYTGFHLGKNLPKAATRAFVDNLREIAPRILPAR  299

Query  803   ETLRFLAVSSLERRKF--KLPSLLGKPILNMKTGIEHFCLHPGGRAVIDGVGVSLGLSEY  630
             E L+FL +S +++     K  S      +N KTG++HFC+H GG+AVIDG+G+SLGL +Y
Sbjct  300   ELLQFLILSLVKKLNTNPKQGSGAKTSAVNFKTGVDHFCIHTGGKAVIDGIGLSLGLEKY  359

Query  629   DLEPARMSLHRWGNTSAGGLWYVLGYMEAKKRLKKGDRILMLSLGAGFKCNNCVWEVMKD  450
             DLEPARM+LHR+GNTSA  LWYVL YMEAKKRLKKG+RILM+S GAGFKCN+C+WEV++D
Sbjct  360   DLEPARMTLHRFGNTSASSLWYVLAYMEAKKRLKKGERILMISFGAGFKCNSCLWEVVRD  419

Query  449   LGDPNVWEDCIDRYPPETLVNPFTEKFDWIH  357
             L D NVWEDCI+ YP E++ NPF EK+ WI 
Sbjct  420   LEDGNVWEDCIEHYPRESISNPFLEKYGWIQ  450



>gb|ABX10441.1| 3-ketoacyl-CoA synthase 6 [Gossypium hirsutum]
Length=467

 Score =   513 bits (1320),  Expect = 2e-173, Method: Compositional matrix adjust.
 Identities = 250/455 (55%), Positives = 345/455 (76%), Gaps = 13/455 (3%)
 Frame = -1

Query  1682  YSLLFLYTVVYILRSYLR----RRHQCCYMLNYECYKPTDVARRLSTDKSALVVYRNRNL  1515
             +S L + ++ Y+L          R Q CY+L+Y+CYKP+D  R + T+    V+ RN+NL
Sbjct  4     FSFLLVISIFYLLFKIWNWINNVRDQQCYILDYQCYKPSD-DRMVGTEFCGEVIKRNKNL  62

Query  1514  GIDEFRFLLQTMVNSGVGEQTYIPINVLEGREDSPTLEDSFTEVDDIMFQTLDNLFAKSK  1335
             G++E++FLL+ +V+SG+GEQTY P  +  GRE+SP LED   E+++    +++ + +++ 
Sbjct  63    GLNEYKFLLKAIVSSGIGEQTYAPRIIFSGREESPKLEDGILEMEEFFHDSIEKVLSRAG  122

Query  1334  VSPREIDvlvvnvsllasapsLTSRVVNRYKMREDVKTFNLSGMGCSASVVAIDIVHHLF  1155
             +SP+EID+LVVNVS+L++ PSL SR++N +KMR D+K FNL+GMGCSAS++++DIV ++F
Sbjct  123   ISPQEIDLLVVNVSMLSAVPSLCSRIINHFKMRPDIKVFNLTGMGCSASLISLDIVRNVF  182

Query  1154  KVYKNSYAIVVSTESLGANWYSGKERSMMLSNCLFRSGGCSMLFTNNPALKPRAILKLKH  975
             K YKN +A++V++ESL  NWY+G +RSM+LSNCLFRSGGC++L TNN +LK RA+ KLK 
Sbjct  183   KSYKNKFALLVTSESLSPNWYAGNDRSMILSNCLFRSGGCAVLLTNNKSLKHRAMFKLKC  242

Query  974   MVRTHIAAIDEAYECCKQVEDPQGFRGFHLSKRLPKVATKALVTNFKVLVPKAIPLWETL  795
             +VRTH  A DE+Y CC Q ED +G  GFHLSK LPK AT++ V N +V+ PK +P+ E +
Sbjct  243   LVRTHHGAKDESYGCCIQREDDKGKMGFHLSKSLPKAATRSFVDNLRVITPKILPVRELV  302

Query  794   RFLAVSSLE-----RRKFKLPSLLGKPI---LNMKTGIEHFCLHPGGRAVIDGVGVSLGL  639
             RF+AVS L+     R           PI   +N K+G++HFC+H GG+AVIDG+G+SL L
Sbjct  303   RFMAVSLLKKWNVVRHGSSHKGASQGPIKAGVNFKSGVDHFCIHTGGKAVIDGIGISLDL  362

Query  638   SEYDLEPARMSLHRWGNTSAGGLWYVLGYMEAKKRLKKGDRILMLSLGAGFKCNNCVWEV  459
             +EYDLEPARM+LHR+GNTSA  LWYVL YMEAKKRLKKGD++LM+S GAGFKCN+C+WEV
Sbjct  363   TEYDLEPARMTLHRFGNTSASSLWYVLAYMEAKKRLKKGDKVLMISFGAGFKCNSCLWEV  422

Query  458   MKDLGDPNVWEDCIDRYPPETLVNPFTEKFDWIHD  354
             ++DLGD NVW+D I  YPP+TLVNP+ EKF WI D
Sbjct  423   VRDLGDGNVWKDEIYMYPPKTLVNPYMEKFGWIQD  457



>emb|CDP08983.1| unnamed protein product [Coffea canephora]
Length=469

 Score =   513 bits (1320),  Expect = 2e-173, Method: Compositional matrix adjust.
 Identities = 246/430 (57%), Positives = 330/430 (77%), Gaps = 5/430 (1%)
 Frame = -1

Query  1631  RRRHQCCYMLNYECYKPTDVARRLSTDKSALVVYRNRNLGIDEFRFLLQTMVNSGVGEQT  1452
             R RHQ CY+L+YECYKPTD  R LST     ++ RN+NLG+ E++FLL+ +V+SG+GEQT
Sbjct  26    RMRHQSCYILDYECYKPTD-DRMLSTRFCGELIRRNKNLGLLEYKFLLKAIVSSGIGEQT  84

Query  1451  YIPINVLEGREDSPTLEDSFTEVDDIMFQTLDNLFAKSKVSPREIDvlvvnvsllasaps  1272
             Y P  V   RE+ PT +D   E+++  +  +D +  ++ +SP EIDVLVVN+S+LA+ PS
Sbjct  85    YAPRMVFHNREECPTQDDGIEEMEEFFYDCIDKVLKRNGISPSEIDVLVVNISMLAAVPS  144

Query  1271  LTSRVVNRYKMREDVKTFNLSGMGCSASVVAIDIVHHLFKVYKNSYAIVVSTESLGANWY  1092
             L++R+VN YKMR+++KT+NL+GMGCSAS+++++IV ++FK  KN YA+V+++ESL  NWY
Sbjct  145   LSARIVNHYKMRDNIKTYNLTGMGCSASLISVNIVQNIFKTQKNLYALVITSESLSPNWY  204

Query  1091  SGKERSMMLSNCLFRSGGCSMLFTNNPALKPRAILKLKHMVRTHIAAIDEAYECCKQVED  912
              G +RSM+L+NCLFRSGGC++L TN  AL+ +A+ KLK +VRTH  A DEAY+CC Q ED
Sbjct  205   PGNDRSMILANCLFRSGGCAILLTNKVALRNKAMFKLKCLVRTHHGARDEAYDCCIQKED  264

Query  911   PQGFRGFHLSKRLPKVATKALVTNFKVLVPKAIPLWETLRFLAVSSL-ERRKFKL---PS  744
              QG  GFHL K LPK AT+A V N K + PK +P+ E LRF  VS + ER +       S
Sbjct  265   DQGRVGFHLGKNLPKAATRAFVDNLKEIAPKMLPIRELLRFTVVSFIWERMRSNTKDGSS  324

Query  743   LLGKPILNMKTGIEHFCLHPGGRAVIDGVGVSLGLSEYDLEPARMSLHRWGNTSAGGLWY  564
                +P++N KTG++HFC+H GG+AVIDG+G SL L+EYDLEPARM+LHR+GNTSA  LWY
Sbjct  325   SSSRPVINFKTGVDHFCIHTGGKAVIDGIGQSLNLTEYDLEPARMTLHRFGNTSASSLWY  384

Query  563   VLGYMEAKKRLKKGDRILMLSLGAGFKCNNCVWEVMKDLGDPNVWEDCIDRYPPETLVNP  384
             VLGYMEAKKRLKKGDR+ M+S GAGFKCN+C+WEV++D+G  N WEDCI+ YPP+TL NP
Sbjct  385   VLGYMEAKKRLKKGDRVFMISFGAGFKCNSCLWEVVRDVGGGNAWEDCINSYPPKTLTNP  444

Query  383   FTEKFDWIHD  354
             F E + W+ +
Sbjct  445   FLEMYGWLQN  454



>ref|XP_004148222.1| PREDICTED: 3-ketoacyl-CoA synthase 12-like [Cucumis sativus]
Length=461

 Score =   512 bits (1319),  Expect = 2e-173, Method: Compositional matrix adjust.
 Identities = 249/451 (55%), Positives = 340/451 (75%), Gaps = 3/451 (1%)
 Frame = -1

Query  1703  METLVAIYSLLFLYTVVYILRSYLRRRHQCCYMLNYECYKPTDVARRLSTDKSALVVYRN  1524
             ME L   +     Y +  I + +  ++ Q CY+L+Y+CYKPTD  R+LST+    ++ R 
Sbjct  1     MELLYFFFLCSVFYFLFIIWKHFNDKQDQECYILSYQCYKPTD-DRKLSTEFCGEIIKRT  59

Query  1523  RNLGIDEFRFLLQTMVNSGVGEQTYIPINVLEGREDSPTLEDSFTEVDDIMFQTLDNLFA  1344
             +NLG++E++FLL+ +V+SG+GE+TY P  +  GRED+PTL+D  +E+D+    ++  +F 
Sbjct  60    KNLGLNEYKFLLKAVVSSGIGEETYGPRVMFAGREDTPTLDDGISEMDEFFHDSIGKIFQ  119

Query  1343  KSKVSPREIDvlvvnvsllasapsLTSRVVNRYKMREDVKTFNLSGMGCSASVVAIDIVH  1164
             KS  SP +IDVLVVNVS+LA+ PSL++R++N YK+R DVK FNL+GMGCSAS++++DIV 
Sbjct  120   KSGFSPSDIDVLVVNVSMLATIPSLSARIINYYKLRSDVKVFNLTGMGCSASLISVDIVS  179

Query  1163  HLFKVYKNSYAIVVSTESLGANWYSGKERSMMLSNCLFRSGGCSMLFTNNPALKPRAILK  984
              +FK +KN  A+V+++ESL  NWYSG +RSM+LSNCLFRSGGC++L TNN ALK RA+ K
Sbjct  180   RVFKSHKNINALVITSESLSPNWYSGNDRSMILSNCLFRSGGCAILLTNNRALKNRAMFK  239

Query  983   LKHMVRTHIAAIDEAYECCKQVEDPQGFRGFHLSKRLPKVATKALVTNFKVLVPKAIPLW  804
             LK ++RTH  A DE+Y CC Q ED +G+ GFHL K LPK AT+A V N + + P+ +P  
Sbjct  240   LKCLIRTHHGARDESYGCCIQTEDDKGYTGFHLGKNLPKAATRAFVDNLREIAPRILPAR  299

Query  803   ETLRFLAVSSLERRKF--KLPSLLGKPILNMKTGIEHFCLHPGGRAVIDGVGVSLGLSEY  630
             E L+FL +S +++     K  S      +N KTG++HFC+H GG+AVIDG+G+SLGL +Y
Sbjct  300   ELLQFLILSLVKKLNTNPKQGSGAKTSAVNFKTGVDHFCIHTGGKAVIDGIGLSLGLEKY  359

Query  629   DLEPARMSLHRWGNTSAGGLWYVLGYMEAKKRLKKGDRILMLSLGAGFKCNNCVWEVMKD  450
             DLEPARM+LHR+GNTSA  LWYVL YMEAKKRLKKG+RILM+S GAGFKCN+C+WEV++D
Sbjct  360   DLEPARMTLHRFGNTSASSLWYVLAYMEAKKRLKKGERILMISFGAGFKCNSCLWEVVRD  419

Query  449   LGDPNVWEDCIDRYPPETLVNPFTEKFDWIH  357
             L D NVWEDCI+ YP E++ NPF EK+ WI 
Sbjct  420   LEDGNVWEDCIEHYPRESISNPFLEKYGWIQ  450



>ref|XP_008233538.1| PREDICTED: 3-ketoacyl-CoA synthase 21-like [Prunus mume]
Length=465

 Score =   512 bits (1319),  Expect = 2e-173, Method: Compositional matrix adjust.
 Identities = 269/467 (58%), Positives = 344/467 (74%), Gaps = 25/467 (5%)
 Frame = -1

Query  1703  METLVAIYSLLFLYTVVYILRSYLRRRHQCCYMLNYECYKPTDVARRLSTDKSALVVYRN  1524
             ME L+A+  L      VY+ +  L+ R+Q CY+L YECYK TD  R+L T+    ++ RN
Sbjct  1     MELLMAMCLLPLFCACVYLCKLVLQWRNQQCYLLAYECYKATD-DRKLDTESCVKIIQRN  59

Query  1523  RNLGIDEFRFLLQTMVNSGVGEQTYIPINVLEGREDSPTLEDSFTEVDDIMFQTLDNLFA  1344
             +NLG++E+RFLL+T+VNSG+GE+TY P NV+ GRED P+LED+  E+DDI   TLD LF 
Sbjct  60    KNLGLEEYRFLLKTIVNSGLGEETYGPRNVIAGREDCPSLEDALWEMDDIFSVTLDKLFD  119

Query  1343  KSKVSPREIDvlvvnvsllasapsLTSRVVNRYKMREDVKTFNLSGMGCSASVVAIDIVH  1164
             K+ +SP +ID+LVVNVSL + APSLT+R++N YKM++D+K FNLSGMGCS S+VAID+V 
Sbjct  120   KTGISPSKIDILVVNVSLFSPAPSLTARIINHYKMKKDIKAFNLSGMGCSGSLVAIDLVQ  179

Query  1163  HLFKVYKNSYAIVVSTESLGANWYSGKERSMMLSNCLFRSGGCSMLFTNNPALKPRAILK  984
             +LFK YKN +A+VVSTESLG NWY GK + M+L+NCL+RSGGCSMLFTNN ALK RA+LK
Sbjct  180   NLFKTYKNVHAVVVSTESLGPNWYRGKVKPMILANCLYRSGGCSMLFTNNKALKHRALLK  239

Query  983   LKHMVRTHIAAIDEAYECCKQVEDPQGFRGFHLSKRLPKVATKALVTNFKVLVPKAIPLW  804
             L+ +VRTH+ + DE Y C  QVED  GFRGF LSK + KVA KAL  N +VLV K +PL 
Sbjct  240   LECIVRTHLGSSDEGYGCSIQVEDKHGFRGFSLSKSIAKVAAKALTMNLRVLVHKVLPLT  299

Query  803   ETLRFLAVSSLERRKFKLPSL-----LGKPILNMKTGIEHFCLHPGGRAVIDGVGVSLGL  639
             E LR++ +S   RR+ K+         G   LN+K G+EHFC+ P   AV++GVG SLGL
Sbjct  300   ELLRYVIMS---RRQNKVAEHHRGVGAGGTGLNLKAGLEHFCIPPTEGAVVNGVGNSLGL  356

Query  638   SEYDLEPARMSLHRWGNTSAGGLWYVLGYMEAKKRLKKGDRILMLSLGAGFKCNNCVWEV  459
             ++YDLEPARM+LHR+GNTS+GGLWYVLGYMEAKKRLKK D+ILM+S GAG++CNNCVW V
Sbjct  357   NDYDLEPARMALHRFGNTSSGGLWYVLGYMEAKKRLKKRDKILMVSFGAGYECNNCVWVV  416

Query  458   MKDLGDPNVWEDCID----------------RYPPETLVNPFTEKFD  366
             ++DL D NVW+DCI+                +    TLVNPF    D
Sbjct  417   LRDLHDANVWKDCIESACRWRWTWMMPMSELKRLQITLVNPFKRGTD  463



>gb|KHN30213.1| 3-ketoacyl-CoA synthase 12 [Glycine soja]
Length=463

 Score =   512 bits (1318),  Expect = 3e-173, Method: Compositional matrix adjust.
 Identities = 252/447 (56%), Positives = 333/447 (74%), Gaps = 10/447 (2%)
 Frame = -1

Query  1667  LYTVVYILRSYLRRRHQCCYMLNYECYKPTDVARRLSTDKSALVVYRNRNLGIDEFRFLL  1488
             LY    I + + +RR Q  Y+L+Y+ YKP+D  R+L T+    ++ RN+ LG++E++FLL
Sbjct  3     LYLCFLIWKLFDQRRDQESYILDYQLYKPSD-ERKLGTELCGKIIGRNKQLGLNEYKFLL  61

Query  1487  QTMVNSGVGEQTYIPINVLEGREDSPTLEDSFTEVDDIMFQTLDNLFAKSKVSPREIDvl  1308
             + +VNSG+GE+TY P NV+EGRE +PTL+DS TE+++    ++  L  +S +SP +IDVL
Sbjct  62    KAIVNSGIGEETYAPRNVIEGRETNPTLDDSVTEMEEFFHDSIAKLLERSGISPSQIDVL  121

Query  1307  vvnvsllasapsLTSRVVNRYKMREDVKTFNLSGMGCSASVVAIDIVHHLFKVYKNSYAI  1128
             VVNVS+ A  PSLTSR++N YKMRED+K +NL+GMGCSAS++++DI+ ++FK  KN  A+
Sbjct  122   VVNVSMFAVVPSLTSRIINHYKMREDIKAYNLTGMGCSASLISLDIIRNIFKSQKNKIAL  181

Query  1127  VVSTESLGANWYSGKERSMMLSNCLFRSGGCSMLFTNNPALKPRAILKLKHMVRTHIAAI  948
             +V++ESL  NWY+G +RSM+L+NCLFR+GGC +L TN  +LK RA+ KLK +VRTH  A 
Sbjct  182   LVTSESLSPNWYNGNDRSMILANCLFRTGGCVILLTNKRSLKQRAMFKLKCLVRTHHGAK  241

Query  947   DEAYECCKQVEDPQGFRGFHLSKRLPKVATKALVTNFKVLVPKAIPLWETLRFLAVSSLE  768
             ++AY CC Q ED QG  GF+L+K LPK AT+A V N ++L PK +P  E LRF+ VS ++
Sbjct  242   EDAYSCCNQKEDEQGNLGFYLAKNLPKAATRAFVENLRMLSPKVLPTRELLRFMIVSLIK  301

Query  767   RRKFKLPSLLGKPI--------LNMKTGIEHFCLHPGGRAVIDGVGVSLGLSEYDLEPAR  612
             +                     LN KTG+EHFCLH GG+AVIDG+G SL L EYDLEPAR
Sbjct  302   KLSQTSSLKSSSGGSSKSSKSPLNFKTGVEHFCLHTGGKAVIDGIGKSLDLCEYDLEPAR  361

Query  611   MSLHRWGNTSAGGLWYVLGYMEAKKRLKKGDRILMLSLGAGFKCNNCVWEVMKDLGD-PN  435
             M+LHR+GNTSA  LWYVLGYMEAKKRLKKGDR+LM+S GAGFKCN+C+WEVMKDLGD  N
Sbjct  362   MTLHRFGNTSASSLWYVLGYMEAKKRLKKGDRVLMISFGAGFKCNSCLWEVMKDLGDHTN  421

Query  434   VWEDCIDRYPPETLVNPFTEKFDWIHD  354
             VW  CID YPPE+L NPF E F WI++
Sbjct  422   VWSYCIDDYPPESLANPFMETFGWINN  448



>ref|XP_010534310.1| PREDICTED: 3-ketoacyl-CoA synthase 21-like [Tarenaya hassleriana]
Length=475

 Score =   512 bits (1318),  Expect = 4e-173, Method: Compositional matrix adjust.
 Identities = 260/461 (56%), Positives = 345/461 (75%), Gaps = 6/461 (1%)
 Frame = -1

Query  1703  METLVAIYSLLFLYTVVYILRSYLRRRHQCCYMLNYECYKPTDVARRLSTDKSALVVYRN  1524
             ME L     LL  Y +  ++RS L  R + C++L+YECYK  D A+ L  +    +  RN
Sbjct  1     MEFLTVTCLLLVSYAIFSLVRSVLEERSKRCFVLHYECYKGKDEAK-LDCETCLGIAARN  59

Query  1523  RNLGIDEFRFLLQTMVNSGVGEQTYIPINVLEGREDSPTLEDSFTEVDDIMFQTLDNLFA  1344
             +NLG++E++FLL+TM+ SG+GE+TY P NVLEGRE+ PTL D+++E+D+IMF TLD LFA
Sbjct  60    KNLGLEEYQFLLRTMIRSGIGEETYCPRNVLEGREECPTLLDAYSEMDEIMFDTLDKLFA  119

Query  1343  KSKVSPREIDvlvvnvsllasapsLTSRVVNRYKMREDVKTFNLSGMGCSASVVAIDIVH  1164
             K+ +SP EID+LV+NVSL + APS+TSRV+NRYKMRED+K++NLSG+GCSA VV+I +V 
Sbjct  120   KTGISPSEIDILVMNVSLFSPAPSMTSRVINRYKMREDIKSYNLSGLGCSAGVVSIGLVQ  179

Query  1163  HLFKVYKNSYAIVVSTESLGANWYSGKERSMMLSNCLFRSGGCSMLFTNNPALKPRAILK  984
              LF+ YKNS AIVVSTE +G  WY G ERSMMLSNCLFR+GG S+L TN   LK +AI++
Sbjct  180   SLFRTYKNSLAIVVSTELMGPIWYCGVERSMMLSNCLFRAGGTSVLLTNKTKLKNKAIME  239

Query  983   LKHMVRTHIAAIDEAYECCKQVEDPQGFRGFHLSKRLPKVATKALVTNFKVLVPKAIPLW  804
             LK +VR H+ + DEAY CC+Q+ED +G  G  L+K + + AT AL  N +VL+PK +PL 
Sbjct  240   LKTVVRAHVGSDDEAYSCCQQMEDKEGRPGCILTKYVKEAATMALTENLQVLLPKVLPLK  299

Query  803   ETLRFLAVSSLERRKFKLPSLLGKPILNMKTGIEHFCLHPGGRAVIDGVGVSLGLSEYDL  624
             E L +    +L+R      S  G+  LN+K+GI+HFCLHPGGRA+I+G+G SLGLSE+D+
Sbjct  300   ELLHYTIGRALKRSTKGESS--GRR-LNLKSGIQHFCLHPGGRAIIEGMGKSLGLSEFDV  356

Query  623   EPARMSLHRWGNTSAGGLWYVLGYMEAKKRLKKGDRILMLSLGAGFKCNNCVWEVMKDLG  444
             EPA+ +LHR+GNTS+ G+WY+LGYMEAKKRLKKGD+ILM+ LGAGF+CNNCV EVMKD+ 
Sbjct  357   EPAKSTLHRFGNTSSSGVWYILGYMEAKKRLKKGDKILMIGLGAGFECNNCVLEVMKDMD  416

Query  443   DPN-VWEDCIDRYPPE-TLVNPFTEKFDWIHDPCLNFLRSI  327
             D N  W D I+RYP    + +PF EK+D I++    F   I
Sbjct  417   DKNAAWADSIERYPDVLKITSPFKEKYDQINEDESGFFEMI  457



>gb|KHN22006.1| 3-ketoacyl-CoA synthase 12 [Glycine soja]
Length=450

 Score =   510 bits (1314),  Expect = 7e-173, Method: Compositional matrix adjust.
 Identities = 248/432 (57%), Positives = 327/432 (76%), Gaps = 8/432 (2%)
 Frame = -1

Query  1628  RRHQCCYMLNYECYKPTDVARRLSTDKSALVVYRNRNLGIDEFRFLLQTMVNSGVGEQTY  1449
             +R + CY+LNY+CYKP +  R L T+    ++ R  NLG  E+RFLL+ +V+SG+GEQTY
Sbjct  5     KRDRECYILNYQCYKPPN-DRMLGTEFCGKLIRRTENLGPSEYRFLLKAIVSSGIGEQTY  63

Query  1448  IPINVLEGREDSPTLEDSFTEVDDIMFQTLDNLFAKSKVSPREIDvlvvnvsllasapsL  1269
              P N+ EGRE SPTL D   E+++    ++  L AKS VSP EIDVLVVN+S+LA+ PSL
Sbjct  64    APRNIFEGREASPTLRDGIGEMEEFFHDSIGKLLAKSNVSPSEIDVLVVNISMLATVPSL  123

Query  1268  TSRVVNRYKMREDVKTFNLSGMGCSASVVAIDIVHHLFKVYKNSYAIVVSTESLGANWYS  1089
             +SR++N YKMR DVK +NL+GMGCSAS++++DIV  +FK  +N  A+++++ESL  NWY+
Sbjct  124   SSRIINHYKMRHDVKVYNLAGMGCSASLISMDIVKSIFKTQRNKLALLITSESLSPNWYT  183

Query  1088  GKERSMMLSNCLFRSGGCSMLFTNNPALKPRAILKLKHMVRTHIAAIDEAYECCKQVEDP  909
             G +RSM+L+NCLFRSGGC++L TN  +LK +A+L+LK +VRTH  A +EAY CC Q ED 
Sbjct  184   GSDRSMILANCLFRSGGCAILLTNKRSLKDKAMLRLKCLVRTHHGAREEAYGCCIQQEDV  243

Query  908   QGFRGFHLSKRLPKVATKALVTNFKVLVPKAIPLWETLRFLAVSSLER--RKFKLPSLLG  735
             +G  GFHL K LPK AT+A V N +V+ PK +P+ E LRF+  S +++  +    P  + 
Sbjct  244   EGRLGFHLGKTLPKAATRAFVDNLRVIAPKILPIRELLRFMFASLVKKINKNTNAPKSVA  303

Query  734   -----KPILNMKTGIEHFCLHPGGRAVIDGVGVSLGLSEYDLEPARMSLHRWGNTSAGGL  570
                  K  LN +TG++HFCLH GG+AVIDG+G+SL LSEYDLEPARM+LHR+GNTSA  L
Sbjct  304   STGATKSPLNFRTGVDHFCLHTGGKAVIDGIGMSLDLSEYDLEPARMTLHRFGNTSASSL  363

Query  569   WYVLGYMEAKKRLKKGDRILMLSLGAGFKCNNCVWEVMKDLGDPNVWEDCIDRYPPETLV  390
             WYVL YMEAKKRLKKGD + M+S GAGFKCN+C+WEVMKDLGD NVW+DCID YPPE+L 
Sbjct  364   WYVLSYMEAKKRLKKGDAVFMISFGAGFKCNSCLWEVMKDLGDANVWDDCIDEYPPESLA  423

Query  389   NPFTEKFDWIHD  354
             NPF E + WI++
Sbjct  424   NPFMETYGWINE  435



>ref|XP_008796343.1| PREDICTED: 3-ketoacyl-CoA synthase 12-like [Phoenix dactylifera]
Length=450

 Score =   510 bits (1314),  Expect = 8e-173, Method: Compositional matrix adjust.
 Identities = 246/438 (56%), Positives = 329/438 (75%), Gaps = 5/438 (1%)
 Frame = -1

Query  1661  TVVYILRSYLRRRHQCCYMLNYECYKPTDVARRLSTDKSALVVYRNRNLGIDEFRFLLQT  1482
             ++  + R +  RR++ CY+L+Y C+K +D +R +ST+ S  ++YRN NLG+ E++FLL+ 
Sbjct  15    SLFLVWRVFDGRRNRNCYLLDYICFKASD-SRMISTELSGDIIYRNENLGLPEYKFLLKV  73

Query  1481  MVNSGVGEQTYIPINVLEGREDSPTLEDSFTEVDDIMFQTLDNLFAKSKVSPREIDvlvv  1302
             +VNSG+GEQTY P N+++GRE+SPT ED  +E+DD    TL+ LF KS   P +ID+LVV
Sbjct  74    IVNSGIGEQTYGPKNIVDGRENSPTHEDGISEMDDCFNATLEELFRKSGFGPSDIDMLVV  133

Query  1301  nvsllasapsLTSRVVNRYKMREDVKTFNLSGMGCSASVVAIDIVHHLFKVYKNSYAIVV  1122
             +VS+ +  PSL SR+V RY MRED+K FNLSGMGCSAS++A+ +V  +F+V K   A+V 
Sbjct  134   SVSMFSPGPSLASRIVQRYGMREDIKVFNLSGMGCSASLIAVQLVRDVFRVRKKMLAVVA  193

Query  1121  STESLGANWYSGKERSMMLSNCLFRSGGCSMLFTNNPALKPRAILKLKHMVRTHIAAIDE  942
             ++ES+  NWYSG ++SMML NCLFRSGGC+ML TN+PALK RA ++L  +VRTHI A D+
Sbjct  194   TSESISPNWYSGSDKSMMLGNCLFRSGGCTMLLTNDPALKRRAKMRLGCLVRTHIGASDD  253

Query  941   AYECCKQVEDPQGFRGFHLSKRLPKVATKALVTNFKVLVPKAIPLWETLRFLA--VSSLE  768
             A+ C  Q ED  G  GFHLSK LPK A +A   N + L P+ +P+ E L ++A  V  + 
Sbjct  254   AHGCAMQKEDDVGRVGFHLSKSLPKAAARAFSDNLQTLAPQVLPVRELLLYIARGVRQML  313

Query  767   RRKFKLPSLLGKPILNMKTGIEHFCLHPGGRAVIDGVGVSLGLSEYDLEPARMSLHRWGN  588
                 K P+   +  +N K G+EHFCLHPGG AVI+GVG SLGL++YDLEPARM+LHRWGN
Sbjct  314   NGGSKDPTAAAR--VNFKAGVEHFCLHPGGAAVIEGVGRSLGLTKYDLEPARMTLHRWGN  371

Query  587   TSAGGLWYVLGYMEAKKRLKKGDRILMLSLGAGFKCNNCVWEVMKDLGDPNVWEDCIDRY  408
             TSA  LWYVLGYMEAKKRL++ DR+LM+S GAGFKCN+C+WEV++DL D  VWEDCI  Y
Sbjct  372   TSASSLWYVLGYMEAKKRLRRSDRVLMISFGAGFKCNSCLWEVLRDLEDGGVWEDCIQSY  431

Query  407   PPETLVNPFTEKFDWIHD  354
             PP++LVNPF E++ WI+D
Sbjct  432   PPQSLVNPFMERYGWIND  449



>ref|XP_006376369.1| hypothetical protein POPTR_0013s12440g [Populus trichocarpa]
 gb|ERP54166.1| hypothetical protein POPTR_0013s12440g [Populus trichocarpa]
Length=408

 Score =   508 bits (1308),  Expect = 1e-172, Method: Compositional matrix adjust.
 Identities = 249/408 (61%), Positives = 321/408 (79%), Gaps = 3/408 (1%)
 Frame = -1

Query  1607  MLNYECYKPTDVARRLSTDKSALVVYRNRNLGIDEFRFLLQTMVNSGVGEQTYIPINVLE  1428
             ML+YEC+K  +  ++L    SA ++ RN+NLGI+E++FLL+T V+SG+GE+TYIP N++E
Sbjct  1     MLSYECHKAAE-DQKLDPRSSARIISRNKNLGIEEYKFLLKTTVSSGIGEETYIPKNIME  59

Query  1427  GREDSPTLEDSFTEVDDIMFQTLDNLFAKSKVSPREIDvlvvnvsllasapsLTSRVVNR  1248
             GRE+S TL D  +E+D I+F T+D LFAK+ VSP EI+ +V +VSL + APSLT+RV+NR
Sbjct  60    GREESATLMDEISEMDGILFDTVDKLFAKTGVSPSEINSIVSSVSLFSPAPSLTARVINR  119

Query  1247  YKMREDVKTFNLSGMGCSASVVAIDIVHHLFKVYKNSYAIVVSTESLGANWYSGKERSMM  1068
             YKMRED+K FNLSGMGCSAS VAID+V  LFK YKNS+AIV+STES+ ++WY GK++SMM
Sbjct  120   YKMREDIKAFNLSGMGCSASAVAIDLVKQLFKTYKNSFAIVMSTESMSSHWYPGKDKSMM  179

Query  1067  LSNCLFRSGGCSMLFTNNPALKPRAILKLKHMVRTHIAAIDEAYECCKQVEDPQGFRGFH  888
             LSN LFR+G CS+L TNN   K +A+++L   VRTHI + DEAY  C Q ED  G  GF 
Sbjct  180   LSNILFRTGSCSILLTNNRDWKNKALMELTCSVRTHIGSNDEAYNSCFQAEDDLGINGFR  239

Query  887   LSKRLPKVATKALVTNFKVLVPKAIPLWETLRFLAVSSLERRKFKLPSLL-GKPILNMKT  711
             L+K LPK   KAL  N +VL+PK IPL E LR+  +S    +  K P+     P L++K+
Sbjct  240   LNKDLPKAGAKALTMNLRVLLPKVIPLSEVLRY-RISYYRNKIMKRPTPKDAGPGLDLKS  298

Query  710   GIEHFCLHPGGRAVIDGVGVSLGLSEYDLEPARMSLHRWGNTSAGGLWYVLGYMEAKKRL  531
             GI+HFC+HPG RA+IDG G SL L++YDLEPARM+L+R+GNTS+GGLWYVLGYMEAKKRL
Sbjct  299   GIDHFCVHPGWRAIIDGAGQSLALNDYDLEPARMALYRFGNTSSGGLWYVLGYMEAKKRL  358

Query  530   KKGDRILMLSLGAGFKCNNCVWEVMKDLGDPNVWEDCIDRYPPETLVN  387
             KKGD+ILM+SLGAGFKCNNCVW+VMKD+ D NVW++C D+YP +TL N
Sbjct  359   KKGDKILMISLGAGFKCNNCVWKVMKDVEDTNVWKNCTDQYPTKTLAN  406



>ref|XP_007016547.1| 3-ketoacyl-CoA synthase 12 [Theobroma cacao]
 gb|EOY34166.1| 3-ketoacyl-CoA synthase 12 [Theobroma cacao]
Length=465

 Score =   510 bits (1313),  Expect = 2e-172, Method: Compositional matrix adjust.
 Identities = 242/431 (56%), Positives = 337/431 (78%), Gaps = 8/431 (2%)
 Frame = -1

Query  1628  RRHQCCYMLNYECYKPTDVARRLSTDKSALVVYRNRNLGIDEFRFLLQTMVNSGVGEQTY  1449
             +R Q CY+L+Y+C+KP D  R + T+    V+ RN+NLG++E++FLL+ +V+SG+GEQTY
Sbjct  26    KRDQDCYILDYQCFKPAD-DRMVGTEFCGEVIKRNKNLGLNEYKFLLKAIVSSGIGEQTY  84

Query  1448  IPINVLEGREDSPTLEDSFTEVDDIMFQTLDNLFAKSKVSPREIDvlvvnvsllasapsL  1269
              P  +  GRE+SPTL D   E+++  + ++  L ++S +S +EID+LVVNVS+L++ PSL
Sbjct  85    APRIMFSGREESPTLSDGILEMEEFFYDSIGKLLSRSGISAQEIDLLVVNVSMLSAVPSL  144

Query  1268  TSRVVNRYKMREDVKTFNLSGMGCSASVVAIDIVHHLFKVYKNSYAIVVSTESLGANWYS  1089
             +SR++N YKMR+D+K FNL+GMGCSAS+V++DI+ ++FK YKN YA++V++ESL  NWY+
Sbjct  145   SSRIINHYKMRQDIKAFNLTGMGCSASLVSLDIIRNVFKSYKNKYALLVTSESLSPNWYA  204

Query  1088  GKERSMMLSNCLFRSGGCSMLFTNNPALKPRAILKLKHMVRTHIAAIDEAYECCKQVEDP  909
             G +RSM+L+NCLFRSGGC++L TNN +L+ RA+ KLK +VRTH  A DE+Y CC Q ED 
Sbjct  205   GNDRSMILANCLFRSGGCAILLTNNKSLRHRAMFKLKCLVRTHHGARDESYNCCIQTEDE  264

Query  908   QGFRGFHLSKRLPKVATKALVTNFKVLVPKAIPLWETLRFLAVSSLERRKFKLPSLLGKP  729
             +G  GFHL K LPK AT++ V N +V+ PK +P+ E LRF+ V SL ++  +  S  G P
Sbjct  265   KGRMGFHLGKSLPKAATRSFVDNLRVISPKILPIRELLRFMVV-SLVKKWNRHGSPKGTP  323

Query  728   ------ILNMKTGIEHFCLHPGGRAVIDGVGVSLGLSEYDLEPARMSLHRWGNTSAGGLW  567
                    +N K+G++HFC+H GG+AVIDG+G+SL L+EYDLEPARM+LHR+GNTSA  LW
Sbjct  324   QGPIKAAVNFKSGVDHFCIHTGGKAVIDGIGISLDLTEYDLEPARMTLHRFGNTSASSLW  383

Query  566   YVLGYMEAKKRLKKGDRILMLSLGAGFKCNNCVWEVMKDLGDPNVWEDCIDRYPPETLVN  387
             YVL YMEAKKRLK+ DR+LM+S GAGFKCN+C+WEV++DLGD NVW+D IDRYPP++L N
Sbjct  384   YVLAYMEAKKRLKREDRVLMISFGAGFKCNSCLWEVVRDLGDGNVWKDEIDRYPPKSLAN  443

Query  386   PFTEKFDWIHD  354
             P+ EK+ WI +
Sbjct  444   PYMEKYGWIQN  454



>ref|XP_002276028.1| PREDICTED: 3-ketoacyl-CoA synthase 12-like [Vitis vinifera]
Length=460

 Score =   509 bits (1310),  Expect = 4e-172, Method: Compositional matrix adjust.
 Identities = 251/428 (59%), Positives = 331/428 (77%), Gaps = 8/428 (2%)
 Frame = -1

Query  1625  RHQC-CYMLNYECYKPTDVARRLSTDKSALVVYRNRNLGIDEFRFLLQTMVNSGVGEQTY  1449
             R QC CY+L+YEC+KP+D  R+++++    ++ RN+NLG  E++FLL+ +V+S +GE+TY
Sbjct  30    RGQCSCYILHYECFKPSD-ERKMNSEFCGEIIKRNKNLGHQEYKFLLRAIVSSSIGEETY  88

Query  1448  IPINVLEGREDSPTLEDSFTEVDDIMFQTLDNLFAKSKVSPREIDvlvvnvsllasapsL  1269
              P  +++GRED P L D   E+++  ++TLDNLF KS +SP ++DVLVVNVS+LAS PS 
Sbjct  89    GPRTIIDGREDCPCLMDGIQEMEEFFYKTLDNLFEKSGISPLDVDVLVVNVSMLASVPSW  148

Query  1268  TSRVVNRYKMREDVKTFNLSGMGCSASVVAIDIVHHLFKVYKNSYAIVVSTESLGANWYS  1089
             +SR++N YKMR D+K FNLSGMGCSAS+++ID+V  +F   KNS AIVV++ES+  NWYS
Sbjct  149   SSRIINHYKMRNDIKAFNLSGMGCSASLISIDLVRRIFNSRKNSLAIVVTSESIAPNWYS  208

Query  1088  GKERSMMLSNCLFRSGGCSMLFTNNPALKPRAILKLKHMVRTHIAAIDEAYECCKQVEDP  909
             G ++SM+LSNCLFRSGGCS+L TNN ALK +++LKLK ++RTH+ + DEA+ CC Q ED 
Sbjct  209   GNDKSMILSNCLFRSGGCSILLTNNKALKDQSLLKLKCLIRTHMGSSDEAHSCCMQKEDD  268

Query  908   QGFRGFHLSKRLPKVATKALVTNFKVLVPKAIPLWETLRFLAVSSLERRKFKLPSLLGKP  729
              G +GFHLSK +PK A +A   N + L PKA+PL E LR+ AVS+     F       K 
Sbjct  269   LGRKGFHLSKSVPKAANQAFTENIRELAPKALPLRELLRYTAVSTF----FHYTKGGFKA  324

Query  728   ILNMKTGIEHFCLHPGGRAVIDGVGVSLGLSEYDLEPARMSLHRWGNTSAGGLWYVLGYM  549
              LN KTG++HFCLHPGG A+IDGV  SL LSE D+EPARM+LHR+GNTSA  +WYVLGYM
Sbjct  325   KLNFKTGVDHFCLHPGGTAMIDGVAKSLELSESDMEPARMTLHRFGNTSASSVWYVLGYM  384

Query  548   EAKKRLKKGDRILMLSLGAGFKCNNCVWEVMKDLGDPNVWEDCIDRYPPETLVNPFTEKF  369
             EAKKRLKKGDR+LM+S GAGFKCN+C+W+V++DL D NVWEDC+  YPP+TL NPF EK+
Sbjct  385   EAKKRLKKGDRVLMISFGAGFKCNSCMWDVVRDLEDGNVWEDCVSLYPPKTLANPFMEKY  444

Query  368   DWIH--DP  351
              WI+  DP
Sbjct  445   GWIYQEDP  452



>ref|XP_010935997.1| PREDICTED: 3-ketoacyl-CoA synthase 12-like [Elaeis guineensis]
Length=452

 Score =   508 bits (1309),  Expect = 4e-172, Method: Compositional matrix adjust.
 Identities = 254/455 (56%), Positives = 337/455 (74%), Gaps = 9/455 (2%)
 Frame = -1

Query  1703  METLVAIY-SLLFLYTVVYILRSYLRRRHQCCYMLNYECYKPTDVARRLSTDKSALVVYR  1527
             ME L AI  ++L LY+     R + RRR+Q CY+L+Y C+K ++  R +ST+ S  ++ R
Sbjct  1     MELLSAITCAILLLYSFFLAWRFFERRRNQNCYLLDYICFKASN-ERMISTELSGDIIRR  59

Query  1526  NRNLGIDEFRFLLQTMVNSGVGEQTYIPINVLEGREDSPTLEDSFTEVDDIMFQTLDNLF  1347
             N NLG  E++FLL+ +VNSG+GEQTY P N+++GRE+SPT ED+ +E+DD    TLD LF
Sbjct  60    NENLGFPEYKFLLKVIVNSGIGEQTYGPKNIIDGRENSPTYEDAISEMDDCFNATLDELF  119

Query  1346  AKSKVSPREIDvlvvnvsllasapsLTSRVVNRYKMREDVKTFNLSGMGCSASVVAIDIV  1167
              KS  +P +ID+LVVNVS+ + APSL+SR+V+RY MRED+K FNLSGMGCSAS++A+ +V
Sbjct  120   RKSGFAPSDIDMLVVNVSMFSPAPSLSSRIVHRYGMREDIKVFNLSGMGCSASLIAVHLV  179

Query  1166  HHLFKVYKNSYAIVVSTESLGANWYSGKERSMMLSNCLFRSGGCSMLFTNNPALKPRAIL  987
               +FK      A+VV++ES+  NWYSG ++SMML NCLFRSGGCSML TN+PALK RA +
Sbjct  180   RDVFKTRNKMLAVVVTSESISPNWYSGNDKSMMLGNCLFRSGGCSMLLTNDPALKHRAKM  239

Query  986   KLKHMVRTHIAAIDEAYECCKQVEDPQGFRGFHLSKRLPKVATKALVTNFKVLVPKAIPL  807
              L+ ++RTHI A D+A+ C  Q ED  G  GF+LSK LPK A +A   N + L P+ +P+
Sbjct  240   SLRCLLRTHIGASDDAHSCAMQKEDDVGRIGFYLSKSLPKAAVRAFSENLQTLAPQVLPV  299

Query  806   WETLRFLAVSSLERRKF----KLPSLLGKPILNMKTGIEHFCLHPGGRAVIDGVGVSLGL  639
              E L ++A   + RR      K P+   +  +N K G+EHFCLH GG AVI+GVG SLGL
Sbjct  300   RELLLYIA-RGVRRRMLNGGSKDPTAAAR--VNFKAGVEHFCLHTGGSAVIEGVGRSLGL  356

Query  638   SEYDLEPARMSLHRWGNTSAGGLWYVLGYMEAKKRLKKGDRILMLSLGAGFKCNNCVWEV  459
             S+YDLEPARM+LHRWGNTSA  +WYVLGYMEAKKRL++ DR+LM+S GAGFKCN+C+WEV
Sbjct  357   SKYDLEPARMTLHRWGNTSASSVWYVLGYMEAKKRLRRRDRVLMISFGAGFKCNSCLWEV  416

Query  458   MKDLGDPNVWEDCIDRYPPETLVNPFTEKFDWIHD  354
             ++DL    VWEDCI  YPP+TL NPF E++ WI++
Sbjct  417   LRDLEGGGVWEDCIQSYPPQTLANPFMERYGWINE  451



>ref|XP_010533206.1| PREDICTED: 3-ketoacyl-CoA synthase 21-like [Tarenaya hassleriana]
Length=454

 Score =   508 bits (1309),  Expect = 5e-172, Method: Compositional matrix adjust.
 Identities = 250/441 (57%), Positives = 338/441 (77%), Gaps = 3/441 (1%)
 Frame = -1

Query  1658  VVYILRSYLRRRHQCCYMLNYECYKPTDVARRLSTDKSALVVYRNRNLGIDEFRFLLQTM  1479
             V  +L+  L RR++ C++L+YECYK  D  R+L +   A +V RN  LG++E+RFLL+TM
Sbjct  16    VFLLLKPILERRNRACFVLHYECYKGKD-ERKLDSGTCAQIVQRNEKLGLEEYRFLLKTM  74

Query  1478  VNSGVGEQTYIPINVLEGREDSPTLEDSFTEVDDIMFQTLDNLFAKSKVSPREIDvlvvn  1299
             ++SG+GE+TY P N+LEGRED+P L D++TE+D+IMF TLDNLFA++ +SPREI +LVVN
Sbjct  75    ISSGIGEETYGPRNILEGREDNPNLLDAYTEMDEIMFDTLDNLFAETGISPREIGILVVN  134

Query  1298  vsllasapsLTSRVVNRYKMREDVKTFNLSGMGCSASVVAIDIVHHLFKVYKNSYAIVVS  1119
             VSL   APSL SR+VNRYKMRED+K++NLSGMGC ASV++ID+V  LFK+YKN+ A+VVS
Sbjct  135   VSLFPPAPSLVSRLVNRYKMREDIKSYNLSGMGCGASVISIDLVQRLFKIYKNTLALVVS  194

Query  1118  TESLGANWYSGKERSMMLSNCLFRSGGCSMLFTNNPALKPRAILKLKHMVRTHIAAIDEA  939
             TESL  +WYSGK+RSMMLSNCLFR+GG S+L TNN  LK +AI+KLK +VR H+   +EA
Sbjct  195   TESLSPHWYSGKDRSMMLSNCLFRTGGSSVLLTNNVKLKNKAIMKLKTVVRAHVGYDEEA  254

Query  938   YECCKQVEDPQGFRGFHLSKRLPKVATKALVTNFKVLVPKAIPLWETLRFLAVSSLERRK  759
             Y C  Q+ED +G +GF  +K L K A +A+  NF+VL+P+ +P+ E  R+   SS +RR 
Sbjct  255   YACSMQMEDSEGHKGFLRTKHLEKAAARAMAKNFQVLIPRVLPVKELFRYSITSSFKRRG  314

Query  758   FKLPSLLGKPILNMKTGIEHFCLHPGGRAVIDGVGVSLGLSEYDLEPARMSLHRWGNTSA  579
                 S   +  LN+K+GI+HFC+ PG RA I+ +G  LGL E+D EPARM+LHR+GNTS+
Sbjct  315   ANGES-SSRIGLNLKSGIQHFCIPPGRRANIESIGKRLGLDEHDTEPARMALHRFGNTSS  373

Query  578   GGLWYVLGYMEAKKRLKKGDRILMLSLGAGFKCNNCVWEVMKDLGDPNVWEDCIDRYPPE  399
              G+WYVLGYMEAKKRL+KG+  LM+S+GAGF+ +NCVW++MKD+   N+W+D I  YP  
Sbjct  374   SGIWYVLGYMEAKKRLRKGENALMISMGAGFESSNCVWQIMKDMNCENIWKDSIGHYPEL  433

Query  398   TLV-NPFTEKFDWIHDPCLNF  339
             +   NPF  K+DWI+D  ++F
Sbjct  434   SETPNPFEGKYDWINDDAVSF  454



>ref|XP_010253345.1| PREDICTED: 3-ketoacyl-CoA synthase 12-like [Nelumbo nucifera]
Length=470

 Score =   508 bits (1308),  Expect = 1e-171, Method: Compositional matrix adjust.
 Identities = 251/452 (56%), Positives = 343/452 (76%), Gaps = 4/452 (1%)
 Frame = -1

Query  1703  METLVA-IYSLLFLYTVVYILRSYLRRRHQCCYMLNYECYKPTDVARRLSTDKSALVVYR  1527
             ME  V+ +  ++  +T+  + R   + R   CY+++YEC+KP D  R+L T     ++ R
Sbjct  1     MEFFVSCVLCIIGFFTLSLLWRLVTQWRDGECYIMHYECFKPND-DRKLDTKLCGDIILR  59

Query  1526  NRNLGIDEFRFLLQTMVNSGVGEQTYIPINVLEGREDSPTLEDSFTEVDDIMFQTLDNLF  1347
             N +LG+D+++FLL+ +VNSG+GE+TY P N+++GRE+ PTL D   E+++  F TLD LF
Sbjct  60    NESLGLDDYKFLLKVIVNSGIGEETYGPRNIIQGREECPTLGDGILEMEEFFFDTLDKLF  119

Query  1346  AKSKVSPREIDvlvvnvsllasapsLTSRVVNRYKMREDVKTFNLSGMGCSASVVAIDIV  1167
              K+ +SP +IDVLVVNVS+LA  PSLT+RVVN +KMREDVK +N+SGMGCSAS+++I++V
Sbjct  120   CKTGLSPSQIDVLVVNVSMLALQPSLTTRVVNHFKMREDVKVYNISGMGCSASLISINLV  179

Query  1166  HHLFKVYKNSYAIVVSTESLGANWYSGKERSMMLSNCLFRSGGCSMLFTNNPALKPRAIL  987
              ++FK Y  ++A+VV++E++G +WY+G +RSM+LSNCLFRSGGC +L TNNP+L+ RA+ 
Sbjct  180   QNIFKSYNKAFALVVTSEAIGPHWYTGNDRSMILSNCLFRSGGCCILLTNNPSLRHRAMF  239

Query  986   KLKHMVRTHIAAIDEAYECCKQVEDPQGFRGFHLSKRLPKVATKALVTNFKVLVPKAIPL  807
             +LK +VRTH+ A D+AYEC  Q ED +G  GF+L K LPK A++A+V N +V+  K +PL
Sbjct  240   RLKCLVRTHLGASDDAYECAMQREDAKGRAGFYLGKNLPKAASRAMVENLRVISTKILPL  299

Query  806   WETLRFLAVSSLERRKFKLPSLL--GKPILNMKTGIEHFCLHPGGRAVIDGVGVSLGLSE  633
              E LR+L VS L  R  K   +L      LN KTG++HFCLH GG+AVIDGVG SLGL+E
Sbjct  300   RELLRYLLVSRLLPRPPKKGGVLKASSSSLNFKTGVQHFCLHTGGKAVIDGVGKSLGLTE  359

Query  632   YDLEPARMSLHRWGNTSAGGLWYVLGYMEAKKRLKKGDRILMLSLGAGFKCNNCVWEVMK  453
             +DLEPARM+LHR+GNTSA  LWYVL YMEAK+RLKKGDR+LM+S G GFKCN+C+WEV++
Sbjct  360   HDLEPARMTLHRFGNTSASSLWYVLAYMEAKRRLKKGDRVLMMSFGGGFKCNSCLWEVVR  419

Query  452   DLGDPNVWEDCIDRYPPETLVNPFTEKFDWIH  357
             DL   NVW+DCI  YP  +LVNPF EKF  I+
Sbjct  420   DLEGDNVWKDCIATYPLNSLVNPFMEKFGEIN  451



>ref|XP_010033177.1| PREDICTED: 3-ketoacyl-CoA synthase 12-like [Eucalyptus grandis]
 gb|KCW52739.1| hypothetical protein EUGRSUZ_J02097 [Eucalyptus grandis]
Length=469

 Score =   507 bits (1305),  Expect = 3e-171, Method: Compositional matrix adjust.
 Identities = 250/458 (55%), Positives = 339/458 (74%), Gaps = 8/458 (2%)
 Frame = -1

Query  1703  METLVAIYSLLFLYTVVYILRSYLRRRHQCCYMLNYECYKPTDVARRLSTDKSALVVYRN  1524
             ME ++ +Y+   LY +  I +    RR + CY+L+Y+CYKPTD  R L T     ++ R 
Sbjct  1     MELIMIMYASSILYLLFIIWKRIDERRDKHCYILDYQCYKPTD-DRMLGTGFCGELMKRT  59

Query  1523  RNLGIDEFRFLLQTMVNSGVGEQTYIPINVLEGREDSPTLEDSFTEVDDIMFQTLDNLFA  1344
             ++LG+ E +FLL+ +VNSG+GEQTY P  V  GRED+P L D   E+D+    ++  L  
Sbjct  60    KSLGLLECKFLLKAIVNSGIGEQTYGPRMVFAGREDNPALADGLVEMDEFFHDSIQKLLD  119

Query  1343  KSKVSPREIDvlvvnvsllasapsLTSRVVNRYKMREDVKTFNLSGMGCSASVVAIDIVH  1164
             +S ++P +IDVLVVNVS+LA  PSL++R++N YK+R DVK FNL+GMGCSAS++++DIV 
Sbjct  120   RSGIAPLQIDVLVVNVSMLACIPSLSARIINHYKLRHDVKVFNLTGMGCSASLISMDIVR  179

Query  1163  HLFKVYKNSYAIVVSTESLGANWYSGKERSMMLSNCLFRSGGCSMLFTNNPALKPRAILK  984
             ++FK YKN+ A++V++ESL +NWYSG +RSM+L+NCLFRSGGC+ML TNN ALK RA+ K
Sbjct  180   NIFKSYKNANALLVTSESLSSNWYSGNDRSMILANCLFRSGGCAMLLTNNRALKSRAMFK  239

Query  983   LKHMVRTHIAAIDEAYECCKQVEDPQGFRGFHLSKRLPKVATKALVTNFKVLVPKAIPLW  804
             LK +VRTH  A DE+Y CC Q ED QG  GFHL K LPK AT+A + N KV+ PK +P  
Sbjct  240   LKCLVRTHHGARDESYGCCLQKEDDQGLPGFHLGKSLPKAATRAFIDNMKVIAPKILPAR  299

Query  803   ETLRFLAVSSLERRKFKLPSLLG-KPILNMKTGIEHFCLHPGGRAVIDGVGVSLGLSEYD  627
             E LR+  ++ + + +     L G +P+L+ +TG++HFC+H GG+AVIDG+G +L LSE+D
Sbjct  300   ELLRYGVMTLVRKMRRGSAKLAGPRPVLDFRTGVDHFCIHTGGKAVIDGIGANLQLSEHD  359

Query  626   LEPARMSLHRWGNTSAGGLWYVLGYMEAKKRLKKGDRILMLSLGAGFKCNNCVWEVMKDL  447
             LEPARM+LHR+GNTSA  LWYVL YMEAK+RLK+GDR+ M+S GAGFKCN+CVWEV +DL
Sbjct  360   LEPARMTLHRFGNTSASSLWYVLAYMEAKRRLKRGDRVFMISFGAGFKCNSCVWEVFRDL  419

Query  446   GD----PNVWEDCIDRYPPETLVNPFTEKFDWIH--DP  351
             G+     NVWEDCI+  P + +VNPF EK+ WI+  DP
Sbjct  420   GNEKGKANVWEDCIESCPSKNMVNPFMEKYGWINQEDP  457



>ref|XP_004170359.1| PREDICTED: LOW QUALITY PROTEIN: 3-ketoacyl-CoA synthase 12-like 
[Cucumis sativus]
Length=461

 Score =   505 bits (1301),  Expect = 8e-171, Method: Compositional matrix adjust.
 Identities = 249/452 (55%), Positives = 332/452 (73%), Gaps = 4/452 (1%)
 Frame = -1

Query  1703  METLVAIYSLLFLYTVVYILRSYLRRRHQCCYMLNYECYKPTDVARRLSTDKSALVVYRN  1524
             ME L  +Y++  LY  + + + +  +R Q CY+L+Y+C+KP++  R L T     ++ R 
Sbjct  1     MEPLFLLYAIPLLYLALKLWKHFDAKRDQQCYILDYQCFKPSE-DRMLGTQLCRDLMKRT  59

Query  1523  RNLGIDEFRFLLQTMVNSGVGEQTYIPINVLEGREDSPTLEDSFTEVDDIMFQTLDNLFA  1344
             +NLG++EF+FLL+ +VNSG+GEQTY P  V  G+E  P+L DS  EV++     L  LF 
Sbjct  60    KNLGLEEFKFLLKAVVNSGIGEQTYGPRVVFSGKESHPSLVDSIIEVEEFFLDCLHKLFQ  119

Query  1343  KSKVSPREIDvlvvnvsllasapsLTSRVVNRYKMREDVKTFNLSGMGCSASVVAIDIVH  1164
             KS VSP +ID+LVVN+S+L+++PSL S ++N++KM+ED+K FNLSGMGCSAS++++D+V 
Sbjct  120   KSGVSPSQIDILVVNISMLSTSPSLASIIINKFKMKEDIKVFNLSGMGCSASLISVDVVR  179

Query  1163  HLFKVYKNSYAIVVSTESLGANWYSGKERSMMLSNCLFRSGGCSMLFTNNPALKPRAILK  984
              +FK + NSY IVV++ESL ANWYSG +RSM+L+NCLFRSGG ++L TN  +LK +A+LK
Sbjct  180   RMFKSHMNSYGIVVTSESLTANWYSGNDRSMILANCLFRSGGAAILLTNKRSLKNKAMLK  239

Query  983   LKHMVRTHIAAIDEAYECCKQVEDPQGFRGFHLSKRLPKVATKALVTNFKVLVPKAIPLW  804
             LK +VRTH  A DE+YECC Q ED QG  GFHL K LP+ A +A   N + + PK +P+ 
Sbjct  240   LKCLVRTHHGAQDESYECCYQKEDDQGNLGFHLGKSLPRAAIRAFTDNLREISPKILPIT  299

Query  803   ETLRFLAVSSLERRKFKLPS--LLGKPILNMKTGIEHFCLHPGGRAVIDGVGVSLGLSEY  630
             E  R   ++ + +      S     KP+ N KTG EHFCLH GG+AVIDGVG SL L+E+
Sbjct  300   EIFRLTILTIIHKISLASSSKPRWPKPMANFKTGAEHFCLHTGGKAVIDGVGKSLNLTEH  359

Query  629   DLEPARMSLHRWGNTSAGGLWYVLGYMEAKKRLKKGDRILMLSLGAGFKCNNCVWEVMKD  450
             DLEPARM+LHR+GNTSA  LWYVLGYMEAKKRLKKGD++LM+S GAGFKCN+C+WEVM +
Sbjct  360   DLEPARMTLHRFGNTSASSLWYVLGYMEAKKRLKKGDKVLMISFGAGFKCNSCLWEVMTE  419

Query  449   LGDP-NVWEDCIDRYPPETLVNPFTEKFDWIH  357
             LG   NVWEDCI+ YPP +L NPF E F WI 
Sbjct  420   LGKKGNVWEDCINGYPPVSLANPFMESFGWIQ  451



>ref|XP_008457509.1| PREDICTED: 3-ketoacyl-CoA synthase 12-like [Cucumis melo]
Length=462

 Score =   503 bits (1295),  Expect = 8e-170, Method: Compositional matrix adjust.
 Identities = 247/454 (54%), Positives = 332/454 (73%), Gaps = 5/454 (1%)
 Frame = -1

Query  1703  METLVAIYSLLFLYTVVYILRSYLRRRHQCCYMLNYECYKPTDVARRLSTDKSALVVYRN  1524
             ME L  +Y++  LY  + + + +  +R Q CY+L+Y+C+KP+D  R L T     ++ R 
Sbjct  1     MELLFLLYAIPLLYLALKLWKYFDAKRDQQCYILDYQCFKPSD-DRMLGTQLCRDLMKRT  59

Query  1523  RNLGIDEFRFLLQTMVNSGVGEQTYIPINVLEGREDSPTLEDSFTEVDDIMFQTLDNLFA  1344
             +NLG+DEF+FLL+ +VNSG+GEQTY P  V  G+E  P+L DS  EV++     L  LF 
Sbjct  60    KNLGLDEFKFLLKAVVNSGIGEQTYGPRVVFSGKESHPSLVDSIVEVEEFFLDCLHKLFQ  119

Query  1343  KSKVSPREIDvlvvnvsllasapsLTSRVVNRYKMREDVKTFNLSGMGCSASVVAIDIVH  1164
             KS VSP +ID+LVVN+S+ +++PSL S ++N++KMRED++ FNLSGMGCSAS++++D+V 
Sbjct  120   KSGVSPSQIDILVVNISMFSTSPSLASIIINKFKMREDIRVFNLSGMGCSASLISVDVVR  179

Query  1163  HLFKVYKNSYAIVVSTESLGANWYSGKERSMMLSNCLFRSGGCSMLFTNNPALKPRAILK  984
              +FK + NSY IVV++ESL +NWYSG +RSM+LSNCLFRSGG ++L TN  +LK +A+LK
Sbjct  180   RMFKSHMNSYGIVVTSESLTSNWYSGNDRSMILSNCLFRSGGAAILLTNKRSLKNKAMLK  239

Query  983   LKHMVRTHIAAIDEAYECCKQVEDPQGFRGFHLSKRLPKVATKALVTNFKVLVPKAIPLW  804
             LK +VRTH  A DE+Y CC Q ED +G  GFHL K LP+ A +A   N + + PK +P+ 
Sbjct  240   LKCLVRTHHGAQDESYGCCYQKEDDKGNLGFHLGKNLPRAAIRAFTDNLREISPKILPIT  299

Query  803   ETLRFLAVSSLERRKFKLPS--LLGKPILNMKTGIEHFCLHPGGRAVIDGVGVSLGLSEY  630
             E  R   ++ + +      S     KP+ N KTG EHFCLH GG+AVIDGVG SL L+E+
Sbjct  300   EIFRLTILTIIHKISLASSSKPRWPKPMANFKTGAEHFCLHTGGKAVIDGVGKSLNLTEH  359

Query  629   DLEPARMSLHRWGNTSAGGLWYVLGYMEAKKRLKKGDRILMLSLGAGFKCNNCVWEVMKD  450
             DLEPARM+LHR+GNTSA  LWYVLGYMEAKKRLKKGD++LM+S GAGFKCN+C+WEV+ +
Sbjct  360   DLEPARMTLHRFGNTSASSLWYVLGYMEAKKRLKKGDKVLMISFGAGFKCNSCLWEVVTE  419

Query  449   LGDP--NVWEDCIDRYPPETLVNPFTEKFDWIHD  354
             LG+   NVWEDCI+ YPP +L NPF E F WI +
Sbjct  420   LGEKKGNVWEDCINGYPPVSLANPFLESFGWIQN  453



>ref|XP_010032269.1| PREDICTED: 3-ketoacyl-CoA synthase 21 [Eucalyptus grandis]
 ref|XP_010032270.1| PREDICTED: 3-ketoacyl-CoA synthase 21 [Eucalyptus grandis]
 gb|KCW51680.1| hypothetical protein EUGRSUZ_J01159 [Eucalyptus grandis]
 gb|KCW51681.1| hypothetical protein EUGRSUZ_J01159 [Eucalyptus grandis]
Length=473

 Score =   503 bits (1295),  Expect = 1e-169, Method: Compositional matrix adjust.
 Identities = 255/467 (55%), Positives = 344/467 (74%), Gaps = 13/467 (3%)
 Frame = -1

Query  1706  HMETLVAIYSLLFLYTVVYILRSYLRRRHQCCYMLNYECYK-PTDVARRLSTDKSALVVY  1530
              +  L A+Y     Y ++ ++R  LRRR QCCYML YECYK P D   +LSTD+ A ++ 
Sbjct  2     EITVLAAMYIFAVSYAMLSLVRGVLRRRSQCCYMLGYECYKAPEDT--KLSTDECARIIL  59

Query  1529  RNRNLGIDEFRFLLQTMVNSGVGEQTYIPINVLEGREDSPTLEDSFTEVDDIMFQTLDNL  1350
             RN+NL ++++RFLL+TM  SG+GE TY P  VLEG E++PTL ++  E+D++  QT+  +
Sbjct  60    RNKNLDLEDYRFLLKTMARSGIGEDTYGPRLVLEGHEETPTLSEAHRELDEVFQQTVSKV  119

Query  1349  FAKSKVSPREIDvlvvnvsllasapsLTSRVVNRYKMREDVKTFNLSGMGCSASVVAIDI  1170
              A + V+P EID+L+VNVSL + APSLTSR+VN +K+R+++KTFNL+GMGCSAS+VAI +
Sbjct  120   LASTGVAPSEIDILIVNVSLFSPAPSLTSRIVNHFKLRDNIKTFNLAGMGCSASLVAIHL  179

Query  1169  VHHLFKVYKNSYAIVVSTESLGANWYSGKERSMMLSNCLFRSGGCSMLFTNN-PALKPRA  993
             V  LFK   N+ A+VVSTES+G++WY GKE+SM++SNCLFR GGC++L TN+    K  A
Sbjct  180   VQELFKTKDNALALVVSTESMGSHWYCGKEKSMIISNCLFRMGGCAVLLTNDRNRAKDGA  239

Query  992   ILKLKHMVRTHIAAIDEAYECCKQVEDPQGFRGFHLSKRLPKVATKALVTNFKVLVPKAI  813
             I+KL H VR H  + DE+Y CC Q ED QG +GF L+K L K A +AL  N ++L+P+ +
Sbjct  240   IMKLSHSVRIHHGSHDESYSCCIQEEDGQGHQGFRLTKYLVKAAGQALEANLRILLPQVL  299

Query  812   PLWETLRF-----LAVSSLERRKFKLPSLLGKPI--LNMKTGIEHFCLHPGGRAVIDGVG  654
             P+ E +R+     LA + L +RK +   + G P   LN+++GI+HFC+HPGG+AVID VG
Sbjct  300   PVRELVRYKLANALANNPLAKRKNR--KVRGGPSLNLNLRSGIDHFCVHPGGKAVIDTVG  357

Query  653   VSLGLSEYDLEPARMSLHRWGNTSAGGLWYVLGYMEAKKRLKKGDRILMLSLGAGFKCNN  474
               L LS+YDLEP+RM+LHR+GNTSAGG WYVL YMEAKKRLK+GD++LM+SLGAGFK N 
Sbjct  358   KGLNLSDYDLEPSRMALHRFGNTSAGGNWYVLAYMEAKKRLKRGDKVLMISLGAGFKSNT  417

Query  473   CVWEVMKDLGDPNVWEDCIDRYPPETLVNPFTEKFDWIHDPCLNFLR  333
             CVWEVM+DL  PNVWED +  YP  +    F +KF WI+D  LNF+R
Sbjct  418   CVWEVMRDLERPNVWEDSLKNYPRVSADTSFMDKFGWIYDEFLNFVR  464



>ref|XP_003597312.1| 3-ketoacyl-CoA synthase [Medicago truncatula]
 gb|AES67563.1| 3-ketoacyl-CoA synthase-like protein [Medicago truncatula]
Length=480

 Score =   503 bits (1295),  Expect = 1e-169, Method: Compositional matrix adjust.
 Identities = 251/458 (55%), Positives = 344/458 (75%), Gaps = 17/458 (4%)
 Frame = -1

Query  1679  SLLFLYTVVY----ILRSYLRRRHQCCYMLNYECYKPTDVARRLSTDKSALVVYRNRNLG  1512
             +LLF++T ++    I + + +RR Q CY+LNY+CYKP+D  R+L + +   ++  N ++G
Sbjct  5     TLLFIFTTMHLCFLIWKKFDQRRDQECYILNYQCYKPSD-ERKLGSVQCGKIIGNNESIG  63

Query  1511  IDEFRFLLQTMVNSGVGEQTYIPINVLEGREDSPTLEDSFTEVDDIMFQTLDNLFAKSKV  1332
             +DE +F L+ +VNSG+GE+TY P N +EGR  +PTLED   E+++    ++  L  KS +
Sbjct  64    LDECKFFLKAVVNSGIGEETYAPRNFIEGRTVNPTLEDGVEEMEEFCNDSITKLLNKSGI  123

Query  1331  SPREIDvlvvnvsllasapsLTSRVVNRYKMREDVKTFNLSGMGCSASVVAIDIVHHLFK  1152
             SP EID+LVVNVSL +S PSLTSR++N YKMRED+K +NLSGMGCSAS++++D++ ++FK
Sbjct  124   SPSEIDILVVNVSLFSSVPSLTSRIINHYKMREDIKAYNLSGMGCSASLISLDVIQNIFK  183

Query  1151  VYKNSYAIVVSTESLGANWYSGKERSMMLSNCLFRSGGCSMLFTNNPALKPRAILKLKHM  972
               KN YA+++++ESL  NWYSG  RSM+L+NCLFR+GGC++L TN  +LK +AILKLK +
Sbjct  184   SEKNKYALLLTSESLSTNWYSGINRSMILANCLFRTGGCAILLTNKRSLKHKAILKLKCL  243

Query  971   VRTHIAAIDEAYECCKQVEDPQGFRGFHLSKRLPKVATKALVTNFKVLVPKAIPLWETLR  792
             VRTH  A D+A+ CC Q ED QG  GF+L+K LPK AT+A   N +VL PK +P  E LR
Sbjct  244   VRTHHGARDDAHNCCSQKEDEQGKLGFYLAKDLPKAATRAFTDNLRVLSPKILPARELLR  303

Query  791   FLAVSSLERR-KFKLPSLLG-------KPILNMKTGIEHFCLHPGGRAVIDGVGVSLGLS  636
             ++ +S +++  K+  P           K  +N KTG++HF LH GG+AVIDG+G+SL L+
Sbjct  304   YMLMSLIKKVIKYFAPKSAARWFGTSSKSPVNFKTGVDHFVLHTGGKAVIDGIGMSLDLN  363

Query  635   EYDLEPARMSLHRWGNTSAGGLWYVLGYMEAKKRLKKGDRILMLSLGAGFKCNNCVWEVM  456
             +YDLEPARMSLHR+GNTSA  LWYVLGYMEAKKRLKKG+R+LM+SLGAGFKCN+C WEVM
Sbjct  364   DYDLEPARMSLHRFGNTSASSLWYVLGYMEAKKRLKKGERVLMISLGAGFKCNSCYWEVM  423

Query  455   KD--LGDP--NVWEDCIDRYPPETLVNPFTEKFDWIHD  354
             +D  +GD   NVW+DCID YPP +L NPF EK+ WI++
Sbjct  424   RDVVVGDDRNNVWDDCIDYYPPHSLANPFMEKYGWINN  461



>gb|ABX10439.1| 3-ketoacyl-CoA synthase 3 [Gossypium hirsutum]
Length=466

 Score =   502 bits (1293),  Expect = 2e-169, Method: Compositional matrix adjust.
 Identities = 240/431 (56%), Positives = 331/431 (77%), Gaps = 7/431 (2%)
 Frame = -1

Query  1628  RRHQCCYMLNYECYKPTDVARRLSTDKSALVVYRNRNLGIDEFRFLLQTMVNSGVGEQTY  1449
             +R Q CY+L+Y+CYKP D  R + T+ S  V+ RN+NLG++E++FLL+ +V+SG+GEQTY
Sbjct  26    KRDQECYILDYQCYKPAD-DRMVGTEFSGEVIKRNKNLGLNEYKFLLKAIVSSGIGEQTY  84

Query  1448  IPINVLEGREDSPTLEDSFTEVDDIMFQTLDNLFAKSKVSPREIDvlvvnvsllasapsL  1269
              P  +  GRE++PTL D   E+++    ++  L +++ VSP EID+LVVNVS++ + P L
Sbjct  85    APRIMFSGREETPTLADGILEMEEFFQDSIGKLLSRAGVSPHEIDLLVVNVSMITAPPCL  144

Query  1268  TSRVVNRYKMREDVKTFNLSGMGCSASVVAIDIVHHLFKVYKNSYAIVVSTESLGANWYS  1089
             +SR++N YKMR+D+K FNL+GMGCSAS++++DIV ++FK YKN YA++V++ESL  NWY+
Sbjct  145   SSRIINHYKMRQDIKCFNLTGMGCSASLISLDIVRNVFKSYKNKYALLVTSESLSPNWYA  204

Query  1088  GKERSMMLSNCLFRSGGCSMLFTNNPALKPRAILKLKHMVRTHIAAIDEAYECCKQVEDP  909
             G +RSM+L+NCLFRSGGC++L TNN +LK RA+ KLK +VRTH  A DE+Y CC Q ED 
Sbjct  205   GNDRSMILANCLFRSGGCAILLTNNKSLKHRAMFKLKCLVRTHHGARDESYNCCIQREDE  264

Query  908   QGFRGFHLSKRLPKVATKALVTNFKVLVPKAIPLWETLRFLAVSSLE---RRKFKLPSLL  738
              G  GF+L K LPK AT++ V N +V+ PK +P+ E +RF+ VS ++   R      +  
Sbjct  265   IGKVGFYLGKNLPKAATRSFVDNLRVITPKILPVTELVRFMVVSLVKKWNRHGSTKGTTT  324

Query  737   GKPI---LNMKTGIEHFCLHPGGRAVIDGVGVSLGLSEYDLEPARMSLHRWGNTSAGGLW  567
               PI   +N K+G++HFC+H GG+AVIDG+G SL L+EYDLEPARM+LHR+GNTSA  LW
Sbjct  325   QGPIKAGVNFKSGVDHFCIHTGGKAVIDGIGFSLDLTEYDLEPARMTLHRFGNTSASSLW  384

Query  566   YVLGYMEAKKRLKKGDRILMLSLGAGFKCNNCVWEVMKDLGDPNVWEDCIDRYPPETLVN  387
             YVL YMEAKKRLKKGD++LM+S GAGFKCN+C+WE+++DL D NVW+D I  YPP+TLVN
Sbjct  385   YVLAYMEAKKRLKKGDKVLMISFGAGFKCNSCLWEIVRDLEDGNVWKDEIQNYPPKTLVN  444

Query  386   PFTEKFDWIHD  354
             P+ EK+ WI D
Sbjct  445   PYMEKYGWIKD  455



>gb|KGN47350.1| hypothetical protein Csa_6G302180 [Cucumis sativus]
Length=641

 Score =   508 bits (1309),  Expect = 2e-169, Method: Compositional matrix adjust.
 Identities = 245/426 (58%), Positives = 331/426 (78%), Gaps = 3/426 (1%)
 Frame = -1

Query  1628  RRHQCCYMLNYECYKPTDVARRLSTDKSALVVYRNRNLGIDEFRFLLQTMVNSGVGEQTY  1449
             R +Q CY+L+Y+CYKPTD  R+LST+    ++ R +NLG++E++FLL+ +V+SG+GE+TY
Sbjct  206   RFNQECYILSYQCYKPTD-DRKLSTEFCGEIIKRTKNLGLNEYKFLLKAVVSSGIGEETY  264

Query  1448  IPINVLEGREDSPTLEDSFTEVDDIMFQTLDNLFAKSKVSPREIDvlvvnvsllasapsL  1269
              P  +  GRED+PTL+D  +E+D+    ++  +F KS  SP +IDVLVVNVS+LA+ PSL
Sbjct  265   GPRVMFAGREDTPTLDDGISEMDEFFHDSIGKIFQKSGFSPSDIDVLVVNVSMLATIPSL  324

Query  1268  TSRVVNRYKMREDVKTFNLSGMGCSASVVAIDIVHHLFKVYKNSYAIVVSTESLGANWYS  1089
             ++R++N YK+R DVK FNL+GMGCSAS++++DIV  +FK +KN  A+V+++ESL  NWYS
Sbjct  325   SARIINYYKLRSDVKVFNLTGMGCSASLISVDIVSRVFKSHKNINALVITSESLSPNWYS  384

Query  1088  GKERSMMLSNCLFRSGGCSMLFTNNPALKPRAILKLKHMVRTHIAAIDEAYECCKQVEDP  909
             G +RSM+LSNCLFRSGGC++L TNN ALK RA+ KLK ++RTH  A DE+Y CC Q ED 
Sbjct  385   GNDRSMILSNCLFRSGGCAILLTNNRALKNRAMFKLKCLIRTHHGARDESYGCCIQTEDD  444

Query  908   QGFRGFHLSKRLPKVATKALVTNFKVLVPKAIPLWETLRFLAVSSLERRKF--KLPSLLG  735
             +G+ GFHL K LPK AT+A V N + + P+ +P  E L+FL +S +++     K  S   
Sbjct  445   KGYTGFHLGKNLPKAATRAFVDNLREIAPRILPARELLQFLILSLVKKLNTNPKQGSGAK  504

Query  734   KPILNMKTGIEHFCLHPGGRAVIDGVGVSLGLSEYDLEPARMSLHRWGNTSAGGLWYVLG  555
                +N KTG++HFC+H GG+AVIDG+G+SLGL +YDLEPARM+LHR+GNTSA  LWYVL 
Sbjct  505   TSAVNFKTGVDHFCIHTGGKAVIDGIGLSLGLEKYDLEPARMTLHRFGNTSASSLWYVLA  564

Query  554   YMEAKKRLKKGDRILMLSLGAGFKCNNCVWEVMKDLGDPNVWEDCIDRYPPETLVNPFTE  375
             YMEAKKRLKKG+RILM+S GAGFKCN+C+WEV++DL D NVWEDCI+ YP E++ NPF E
Sbjct  565   YMEAKKRLKKGERILMISFGAGFKCNSCLWEVVRDLEDGNVWEDCIEHYPRESISNPFLE  624

Query  374   KFDWIH  357
             K+ WI 
Sbjct  625   KYGWIQ  630



>ref|XP_006294126.1| hypothetical protein CARUB_v10023121mg [Capsella rubella]
 gb|EOA27024.1| hypothetical protein CARUB_v10023121mg [Capsella rubella]
Length=476

 Score =   502 bits (1292),  Expect = 3e-169, Method: Compositional matrix adjust.
 Identities = 247/466 (53%), Positives = 340/466 (73%), Gaps = 19/466 (4%)
 Frame = -1

Query  1703  METLVAIYSLLFLYTVVYILRSYLRRRHQCCYMLNYECYKPTDVARRLSTDKSALVVYRN  1524
             M+ +  ++S L  Y    I +    ++ + CY+L+Y+C+KP+D  R ++T  S  ++YRN
Sbjct  1     MDLVFLLFSPLLCYLFFKIWKLIDSKQDKDCYILDYQCHKPSD-DRMVTTHFSGEIIYRN  59

Query  1523  RNLGIDEFRFLLQTMVNSGVGEQTYIPINVLEGREDSPTLEDSFTEVDDIMFQTLDNLFA  1344
             +NLG+ E++FLL+ +V+SG+GEQTY P  V EGRE+ P+L+D  +E+++    ++  +  
Sbjct  60    QNLGLTEYKFLLKAIVSSGIGEQTYAPRLVFEGREERPSLQDGISEMEEFYIDSIGKVLE  119

Query  1343  KSKVSPREIDvlvvnvsllasapsLTSRVVNRYKMREDVKTFNLSGMGCSASVVAIDIVH  1164
             ++++SP++ID+LVVNVS+L+S PSL SR++N YKMREDVK FNL+GMGCSAS++++DIV 
Sbjct  120   RNQISPQDIDILVVNVSMLSSTPSLASRIINHYKMREDVKVFNLTGMGCSASLISVDIVK  179

Query  1163  HLFKVYKNSYAIVVSTESLGANWYSGKERSMMLSNCLFRSGGCSMLFTNNPALKPRAILK  984
             ++FK Y N  A+V ++ESL  NWYSG  RSM+L+NCLFRSGGC++L TN  +L+ +A+ K
Sbjct  180   NIFKSYSNKLALVATSESLSPNWYSGNNRSMILANCLFRSGGCAILLTNKRSLRKKAMFK  239

Query  983   LKHMVRTHIAAIDEAYECCKQVEDPQGFRGFHLSKRLPKVATKALVTNFKVLVPKAIPLW  804
             LK MVRTH  A DE+Y CC Q ED QG  GF+L K LPK AT+A V N K++ PK +P+ 
Sbjct  240   LKCMVRTHHGARDESYNCCIQSEDEQGRVGFYLGKNLPKAATRAFVDNLKIITPKILPVT  299

Query  803   ETLRFLAV---------SSLERRKFKLPSLLGKPI---LNMKTGIEHFCLHPGGRAVIDG  660
             E LRF+            +  +    LPS  G P+   +N KTGIEHFC+H GG+AVIDG
Sbjct  300   ELLRFMIKLLIKKIKIRQNPSKGSTNLPS--GTPLKAGINFKTGIEHFCIHTGGKAVIDG  357

Query  659   VGVSLGLSEYDLEPARMSLHRWGNTSAGGLWYVLGYMEAKKRLKKGDRILMLSLGAGFKC  480
             +G SL L+EYD+EPARM+LHR+GNTSA  LWYVL YMEAKKRLK+GDR+ M+S GAGFKC
Sbjct  358   IGHSLDLNEYDIEPARMTLHRFGNTSASSLWYVLAYMEAKKRLKRGDRVFMISFGAGFKC  417

Query  479   NNCVWEVMKDL----GDPNVWEDCIDRYPPETLVNPFTEKFDWIHD  354
             N+CVWEV++DL       NVW  CID YPP+++VNP+ EKF WI D
Sbjct  418   NSCVWEVVRDLTVGESKGNVWNHCIDDYPPKSIVNPYMEKFGWIQD  463



>ref|XP_009410745.1| PREDICTED: 3-ketoacyl-CoA synthase 3-like [Musa acuminata subsp. 
malaccensis]
Length=463

 Score =   501 bits (1291),  Expect = 3e-169, Method: Compositional matrix adjust.
 Identities = 255/455 (56%), Positives = 344/455 (76%), Gaps = 7/455 (2%)
 Frame = -1

Query  1703  METLVAIYSLLFLYTVV-YILRSYLRRRHQCCYMLNYECYKPTDVARRLSTDKSALVVYR  1527
             ME L  I ++LFLY+ + ++ +++  RR+Q CY+L+Y CYKP+D  R+LST+  + V+ R
Sbjct  10    MELLWMIATVLFLYSSLSFLWKAFDCRRNQNCYLLDYVCYKPSD-DRKLSTELCSDVIKR  68

Query  1526  NRNLGIDEFRFLLQTMVNSGVGEQTYIPINVLEGREDSPTLEDSFTEVDDIMFQTLDNLF  1347
             N+ L + +++FLL+ +VNSG+ E+TY P +++EGRE+SPTL+D   EVDD M  TLD LF
Sbjct  69    NKRLSMPDYKFLLKVVVNSGISEETYGPRSIIEGREESPTLDDCDDEVDDCMHSTLDELF  128

Query  1346  AKSKVSPREIDvlvvnvsllasapsLTSRVVNRYKMREDVKTFNLSGMGCSASVVAIDIV  1167
              ++ +SP ++DVLVVN+S+ A APSLTSR+VNRYKMREDVKTFNLSGMGCSAS +AID+V
Sbjct  129   HRTGISPGDVDVLVVNISMFAPAPSLTSRIVNRYKMREDVKTFNLSGMGCSASPIAIDLV  188

Query  1166  HHLFKVYKNSYAIVVSTESLGANWYSGKERSMMLSNCLFRSGGCSMLFTNNPALKPRAIL  987
             +++F+  K + A+V+++ES+  NWY G ++SMML NCLFRSGGCS + TN+P+LK RA +
Sbjct  189   NNVFETRKRTLAVVITSESIAPNWYCGTDKSMMLGNCLFRSGGCSFMLTNDPSLKHRAKM  248

Query  986   KLKHMVRTHIAAIDEAYECCKQVEDPQGFRGFHLSKRLPKVATKALVTNFKVLVPKAIPL  807
             +LK +VR H  A D+AY C  Q ED  G  GFHLSK LPKVA +A   N + L PK +P+
Sbjct  249   RLKCLVRAHSGANDDAYSCAMQNEDTDGRVGFHLSKSLPKVAVRAFTENLQALAPKVLPV  308

Query  806   WETLRFLAVSSLE---RRKFKLPSLLGKPI-LNMKTGIEHFCLHPGGRAVIDGVGVSLGL  639
              E L    +  L    RR  +  +  G  + +N K+G+EHFCLH GG AVID VG +LGL
Sbjct  309   GE-LALYVIRGLRHRLRRSKETKAYAGTAVRVNFKSGVEHFCLHTGGAAVIDAVGSALGL  367

Query  638   SEYDLEPARMSLHRWGNTSAGGLWYVLGYMEAKKRLKKGDRILMLSLGAGFKCNNCVWEV  459
             ++YD+EPARM+LHRWGNTSA  LWYVLGYMEAKKRL++ DR+LMLS GAGFKCN+C+WEV
Sbjct  368   NKYDVEPARMTLHRWGNTSASSLWYVLGYMEAKKRLRRKDRVLMLSFGAGFKCNSCLWEV  427

Query  458   MKDLGDPNVWEDCIDRYPPETLVNPFTEKFDWIHD  354
             ++DL D   WED I  YPP++LVNPF +KF W+++
Sbjct  428   LRDLEDGGAWEDSIQAYPPQSLVNPFMDKFGWVNE  462



>gb|AGK30020.1| 3-ketoacyl-CoA synthase 3 [Gossypium raimondii]
Length=466

 Score =   501 bits (1291),  Expect = 4e-169, Method: Compositional matrix adjust.
 Identities = 240/431 (56%), Positives = 331/431 (77%), Gaps = 7/431 (2%)
 Frame = -1

Query  1628  RRHQCCYMLNYECYKPTDVARRLSTDKSALVVYRNRNLGIDEFRFLLQTMVNSGVGEQTY  1449
             +R Q CY+L+Y+CYKP D  R + T+ S  V+ RN+NLG++E++FLL+ +V+SG+GEQTY
Sbjct  26    KRDQECYILDYQCYKPAD-DRMVGTEFSGEVIKRNKNLGLNEYKFLLKAIVSSGIGEQTY  84

Query  1448  IPINVLEGREDSPTLEDSFTEVDDIMFQTLDNLFAKSKVSPREIDvlvvnvsllasapsL  1269
              P  +  GRE++PTL D   E+++    ++  L +++ VSP EID+LVVNVS++ + P L
Sbjct  85    APRIMFSGREETPTLADGILEMEEFFQDSIGKLLSRAGVSPHEIDLLVVNVSMITAPPCL  144

Query  1268  TSRVVNRYKMREDVKTFNLSGMGCSASVVAIDIVHHLFKVYKNSYAIVVSTESLGANWYS  1089
             +SR++N YKMR+D+K FNL+GMGCSAS++++DIV ++FK YKN YA++V++ESL  NWY+
Sbjct  145   SSRIINHYKMRQDIKCFNLTGMGCSASLISLDIVRNVFKSYKNKYALLVTSESLSPNWYA  204

Query  1088  GKERSMMLSNCLFRSGGCSMLFTNNPALKPRAILKLKHMVRTHIAAIDEAYECCKQVEDP  909
             G +RSM+L+NCLFRSGGC++L TNN +LK RA+ KLK +VRTH  A DE+Y CC Q ED 
Sbjct  205   GNDRSMILANCLFRSGGCAILLTNNKSLKHRAMFKLKCLVRTHHGARDESYNCCIQREDE  264

Query  908   QGFRGFHLSKRLPKVATKALVTNFKVLVPKAIPLWETLRFLAVSSLE---RRKFKLPSLL  738
              G  GF+L K LPK AT++ V N +V+ PK +P+ E +RF+ VS ++   R      +  
Sbjct  265   IGKVGFYLGKNLPKAATRSFVDNLRVITPKILPVTELVRFMVVSLVKKWNRHGSTKGTTT  324

Query  737   GKPI---LNMKTGIEHFCLHPGGRAVIDGVGVSLGLSEYDLEPARMSLHRWGNTSAGGLW  567
               PI   +N K+G++HFC+H GG+AVIDG+G SL L+EYDLEPARM+LHR+GNTSA  LW
Sbjct  325   QGPIKAGVNFKSGVDHFCIHTGGKAVIDGIGFSLDLTEYDLEPARMTLHRFGNTSASSLW  384

Query  566   YVLGYMEAKKRLKKGDRILMLSLGAGFKCNNCVWEVMKDLGDPNVWEDCIDRYPPETLVN  387
             YVL YMEAKKRLKKGD++LM+S GAGFKCN+C+WE+++DL D NVW+D I  YPP+TLVN
Sbjct  385   YVLAYMEAKKRLKKGDKVLMISFGAGFKCNSCLWEIVRDLEDGNVWKDEIQNYPPKTLVN  444

Query  386   PFTEKFDWIHD  354
             P+ EK+ WI D
Sbjct  445   PYMEKYGWIKD  455



>ref|XP_009140927.1| PREDICTED: 3-ketoacyl-CoA synthase 12 [Brassica rapa]
Length=476

 Score =   501 bits (1291),  Expect = 6e-169, Method: Compositional matrix adjust.
 Identities = 243/446 (54%), Positives = 334/446 (75%), Gaps = 15/446 (3%)
 Frame = -1

Query  1628  RRHQCCYMLNYECYKPTDVARRLSTDKSALVVYRNRNLGIDEFRFLLQTMVNSGVGEQTY  1449
             ++ + CY+L+Y+C+KP+D  R +ST  S  +++RN+NLG++E++FLL+ +V+SG+GEQTY
Sbjct  26    KKDKDCYILDYQCHKPSD-DRMVSTQFSGEIIHRNKNLGLNEYKFLLKAIVSSGIGEQTY  84

Query  1448  IPINVLEGREDSPTLEDSFTEVDDIMFQTLDNLFAKSKVSPREIDvlvvnvsllasapsL  1269
              P  V EGRE+ P+L+D  +E++D   +++  L  + K+SP+EID+LVVNVS+L++ PSL
Sbjct  85    APRLVFEGREERPSLQDGISEMEDFYVESIGKLLERQKISPKEIDILVVNVSMLSTMPSL  144

Query  1268  TSRVVNRYKMREDVKTFNLSGMGCSASVVAIDIVHHLFKVYKNSYAIVVSTESLGANWYS  1089
              SR++N YKMREDVK FNL+GMGCSAS++++DIV ++FK Y N  A++ ++ESLG NWYS
Sbjct  145   ASRIINHYKMREDVKVFNLTGMGCSASLISVDIVKNIFKSYANKLALIATSESLGPNWYS  204

Query  1088  GKERSMMLSNCLFRSGGCSMLFTNNPALKPRAILKLKHMVRTHIAAIDEAYECCKQVEDP  909
             G  RSM+L+NCLFRSGGC++L TN  +L+ +A+ +LK MVRTH  A +++Y CC Q ED 
Sbjct  205   GNNRSMILANCLFRSGGCAILLTNKRSLRKKAMFRLKCMVRTHHGAREDSYNCCIQSEDE  264

Query  908   QGFRGFHLSKRLPKVATKALVTNFKVLVPKAIPLWETLRFLAVSSLERRK---------F  756
             QG  GF+L K LPK AT+A V N KV+ PK +P+ E LRF+    +++ K          
Sbjct  265   QGRVGFYLGKNLPKAATRAFVDNLKVITPKILPVTELLRFMLKLLIKKIKMHQNPSKASM  324

Query  755   KLPSLLG-KPILNMKTGIEHFCLHPGGRAVIDGVGVSLGLSEYDLEPARMSLHRWGNTSA  579
              LP +   K  +N KTGIEHFC+H GG+AVIDG+G SL LSEYD+EPARM+LHR+GNTSA
Sbjct  325   NLPPVTPIKAGINFKTGIEHFCIHTGGKAVIDGIGHSLDLSEYDIEPARMTLHRFGNTSA  384

Query  578   GGLWYVLGYMEAKKRLKKGDRILMLSLGAGFKCNNCVWEVMKDL----GDPNVWEDCIDR  411
               LWYVL YMEAKKRLK+GDR+ M+S GAGFKCN+CVWEV++DL       NVW  CID 
Sbjct  385   SSLWYVLAYMEAKKRLKRGDRVFMISFGAGFKCNSCVWEVVRDLTVGGSKGNVWNHCIDD  444

Query  410   YPPETLVNPFTEKFDWIHDPCLNFLR  333
             YPP+++ NP+ EKF WI D  L+  +
Sbjct  445   YPPKSISNPYLEKFGWIQDEELDTFK  470



>emb|CDY31720.1| BnaA04g16560D [Brassica napus]
Length=476

 Score =   501 bits (1290),  Expect = 7e-169, Method: Compositional matrix adjust.
 Identities = 244/448 (54%), Positives = 334/448 (75%), Gaps = 19/448 (4%)
 Frame = -1

Query  1628  RRHQCCYMLNYECYKPTDVARRLSTDKSALVVYRNRNLGIDEFRFLLQTMVNSGVGEQTY  1449
             ++ + CY+L+Y+C+KP+D  R +ST  S  +++RN+NLG++E++FLL+ +V+SG+GEQTY
Sbjct  26    KKDKDCYILDYQCHKPSD-DRMVSTQFSGEIIHRNKNLGLNEYKFLLKAIVSSGIGEQTY  84

Query  1448  IPINVLEGREDSPTLEDSFTEVDDIMFQTLDNLFAKSKVSPREIDvlvvnvsllasapsL  1269
              P  V EGRE+ P+L+D  +E++D   +++  L  + K+SP+EID+LVVNVS+L++ PSL
Sbjct  85    APRLVFEGREERPSLQDGISEMEDFYVESIGKLLERQKISPKEIDILVVNVSMLSTMPSL  144

Query  1268  TSRVVNRYKMREDVKTFNLSGMGCSASVVAIDIVHHLFKVYKNSYAIVVSTESLGANWYS  1089
              SR++N YKMREDVK FNL+GMGCSAS++++DIV ++FK Y N  A++ ++ESLG NWYS
Sbjct  145   ASRIINHYKMREDVKVFNLTGMGCSASLISVDIVKNIFKSYANKLALIATSESLGPNWYS  204

Query  1088  GKERSMMLSNCLFRSGGCSMLFTNNPALKPRAILKLKHMVRTHIAAIDEAYECCKQVEDP  909
             G  RSM+L+NCLFRSGGC++L TN  +L+ +A+ +LK MVRTH  A +++Y CC Q ED 
Sbjct  205   GNNRSMILANCLFRSGGCAILLTNKRSLRKKAMFRLKCMVRTHHGAREDSYNCCIQSEDE  264

Query  908   QGFRGFHLSKRLPKVATKALVTNFKVLVPKAIPLWETLRFLAVSSLERRK---------F  756
             QG  GF+L K LPK AT+A V N KV+ PK +P+ E  RF+    +++ K          
Sbjct  265   QGRVGFYLGKNLPKAATRAFVDNLKVITPKILPVTELFRFMLKLLIKKIKMHQNPSKASM  324

Query  755   KLPSLLGKPI---LNMKTGIEHFCLHPGGRAVIDGVGVSLGLSEYDLEPARMSLHRWGNT  585
              LP   G PI   +N KTGIEHFC+H GG+AVIDG+G SL LSEYD+EPARM+LHR+GNT
Sbjct  325   NLPP--GTPIKAGINFKTGIEHFCIHTGGKAVIDGIGHSLDLSEYDIEPARMTLHRFGNT  382

Query  584   SAGGLWYVLGYMEAKKRLKKGDRILMLSLGAGFKCNNCVWEVMKDL----GDPNVWEDCI  417
             SA  LWYVL YMEAKKRLK+GDR+ M+S GAGFKCN+CVWEV++DL       NVW  CI
Sbjct  383   SASSLWYVLAYMEAKKRLKRGDRVFMISFGAGFKCNSCVWEVVRDLTVGGSKGNVWNHCI  442

Query  416   DRYPPETLVNPFTEKFDWIHDPCLNFLR  333
             D YPP+++ NP+ EKF WI D  L+  +
Sbjct  443   DDYPPKSISNPYLEKFGWIQDEELDTFK  470



>ref|XP_010685852.1| PREDICTED: 3-ketoacyl-CoA synthase 12 [Beta vulgaris subsp. vulgaris]
Length=483

 Score =   501 bits (1290),  Expect = 8e-169, Method: Compositional matrix adjust.
 Identities = 254/458 (55%), Positives = 343/458 (75%), Gaps = 14/458 (3%)
 Frame = -1

Query  1688  AIYSLLFLYTVVYILRSYLR----RRHQCCYMLNYECYKPTDVARRLSTDKSALVVYRNR  1521
             + + LL L+  +Y L  +L+    +RHQ CY+L YEC+KPTD  R++ST  S  ++ RN+
Sbjct  3     SFFILLLLFPSLYCLFHFLKWFHIKRHQNCYILGYECFKPTD-DRKVSTHFSGEILIRNQ  61

Query  1520  NLGIDEFRFLLQTMVNSGVGEQTYIPINVLEGREDSPTLEDSFTEVDDIMFQTLDNLFAK  1341
             NLG++E++FLL+  V+SG+GE+TY P N+L GRE+SPTL DS  E+D+    ++  L  K
Sbjct  62    NLGLNEYKFLLKAAVSSGIGEETYGPRNILLGREESPTLNDSLDEMDEFFQDSVGKLLQK  121

Query  1340  SKVSPREIDvlvvnvsllasapsLTSRVVNRYKMREDVKTFNLSGMGCSASVVAIDIVHH  1161
               ++P +ID+LVVNVS+  S PSL SR+VN YKMR++VK +NLSGMGCSAS++++ IV +
Sbjct  122   FGINPEDIDILVVNVSMFTSVPSLASRIVNYYKMRDNVKVYNLSGMGCSASLISMSIVQN  181

Query  1160  LFKVYKNSYAIVVSTESLGANWYSGKERSMMLSNCLFRSGGCSMLFTNNPALKPRAILKL  981
             +FK  K  YAI+V++ESL +NWY+G +RSM+LSNCLFRSGGC++L TN  +L+ +A+LKL
Sbjct  182   VFKHEKECYAIIVTSESLSSNWYTGNDRSMILSNCLFRSGGCAILLTNKWSLRNKAMLKL  241

Query  980   KHMVRTHIAAIDEAYECCKQVEDPQGFRGFHLSKRLPKVATKALVTNFKVLVPKAIPLWE  801
             K +VRTH  A DE+Y CC Q+ED  G  GFHLSK LPK A + LV N K L PK +P+ E
Sbjct  242   KCLVRTHHGAKDESYGCCMQMEDSLGRLGFHLSKDLPKSAARCLVDNLKELAPKILPIRE  301

Query  800   TLRFLAVSSLERRKFKLPSLLG--------KPILNMKTGIEHFCLHPGGRAVIDGVGVSL  645
              +RF+ +  + R  F     +G        +P++N KTG+EHFCLH GG+AVIDG+G +L
Sbjct  302   VVRFVVLVMVRRFNFGPNKHVGTGTREQCNRPVINFKTGVEHFCLHTGGKAVIDGLGENL  361

Query  644   GLSEYDLEPARMSLHRWGNTSAGGLWYVLGYMEAKKRLKKGDRILMLSLGAGFKCNNCVW  465
              L +YD+EPARM+LHR+GNTSA  LWYVLGYMEAKKRLKKG+R+LM+S GAGFKCN+C+W
Sbjct  362   KLGDYDIEPARMTLHRFGNTSASSLWYVLGYMEAKKRLKKGERVLMVSFGAGFKCNSCLW  421

Query  464   EVMKDL-GDPNVWEDCIDRYPPETLVNPFTEKFDWIHD  354
             EV++DL G  NVW DCI+ YPP+TL NP+ EKF WI +
Sbjct  422   EVLRDLDGSDNVWNDCIEDYPPKTLANPYLEKFGWIQN  459



>ref|XP_010260036.1| PREDICTED: 3-ketoacyl-CoA synthase 12-like [Nelumbo nucifera]
Length=484

 Score =   501 bits (1290),  Expect = 9e-169, Method: Compositional matrix adjust.
 Identities = 246/442 (56%), Positives = 332/442 (75%), Gaps = 12/442 (3%)
 Frame = -1

Query  1625  RHQCCYMLNYECYKPTDVARRLSTDKSALVVYRNRNLGIDEFRFLLQTMVNSGVGEQTYI  1446
             R Q CY+L+YECYKPTD  R+L T     +++RN+ LG++ ++FLL+ +V+SG GE+TY 
Sbjct  27    RGQDCYILHYECYKPTD-DRKLDTQLCGNIIHRNKTLGLEAYKFLLKAIVSSGFGEETYG  85

Query  1445  PINVLEGREDSPTLEDSFTEVDDIMFQTLDNLFAKSKVSPREIDvlvvnvsllasapsLT  1266
             P NVL+GRE++PTL D   E+++  F +LDNLF+K+ VSP EID+LVVNVS+ A  PSL 
Sbjct  86    PRNVLQGREETPTLADGMLEMEEFFFDSLDNLFSKTGVSPSEIDILVVNVSMFAPEPSLA  145

Query  1265  SRVVNRYKMREDVKTFNLSGMGCSASVVAIDIVHHLFKVYKNSYAIVVSTESLGANWYSG  1086
             +R++N YK+RED+K +N+SGMGCSAS+++I++V  +FK +K ++A+VV++ES+G +WYSG
Sbjct  146   ARIINHYKLREDIKVYNISGMGCSASLISINLVQSIFKSHKKAFAVVVTSESIGPHWYSG  205

Query  1085  KERSMMLSNCLFRSGGCSMLFTNNPALKPRAILKLKHMVRTHIAAIDEAYECCKQVEDPQ  906
              ++SM+L+NCLFRSGGCS+L TNNP L+ RA+ +LK +VRTH  A DEAY C  Q ED  
Sbjct  206   NDKSMILANCLFRSGGCSILLTNNPNLRHRAMFRLKCLVRTHTGANDEAYGCAIQQEDAM  265

Query  905   GFRGFHLSKRLPKVATKALVTNFKVLVPKAIPLWETLRFLAVSSLER----------RKF  756
             G  GF+LSK LP+ AT+A V N +V+ PK +P  E LR++ V SL R             
Sbjct  266   GRPGFYLSKNLPRAATRAFVENLRVIAPKILPSRELLRYVIV-SLSRFLPGCKKDGSSST  324

Query  755   KLPSLLGKPILNMKTGIEHFCLHPGGRAVIDGVGVSLGLSEYDLEPARMSLHRWGNTSAG  576
                    K  +N KTG++HFCLH GG+AVIDGVG SLGL+E+D+EPARM+LHR+GNTSA 
Sbjct  325   GGKGAGVKVGVNFKTGVDHFCLHTGGKAVIDGVGRSLGLTEHDVEPARMTLHRFGNTSAS  384

Query  575   GLWYVLGYMEAKKRLKKGDRILMLSLGAGFKCNNCVWEVMKDLGDPNVWEDCIDRYPPET  396
              LWYVL YMEAKKRL++GDR+LM+S G GFKCN+C+WEV++DL   NVW++CI  YP +T
Sbjct  385   SLWYVLAYMEAKKRLREGDRVLMISFGGGFKCNSCLWEVVRDLEGDNVWKECIATYPRKT  444

Query  395   LVNPFTEKFDWIHDPCLNFLRS  330
             LVNPF +KF WI+D      RS
Sbjct  445   LVNPFMDKFGWINDQTEETFRS  466



>ref|XP_010521808.1| PREDICTED: 3-ketoacyl-CoA synthase 12-like [Tarenaya hassleriana]
Length=514

 Score =   500 bits (1288),  Expect = 6e-168, Method: Compositional matrix adjust.
 Identities = 262/482 (54%), Positives = 343/482 (71%), Gaps = 20/482 (4%)
 Frame = -1

Query  1742  THTQIDLSRSFYHMETL-VAIYSLLFLYTVVYILRSYLRRRHQCCYMLNYECYKPTDVAR  1566
             THT+ +  +    M+ L + +YSLL  Y    I +    +R Q CY+L+Y+CYKP+D  R
Sbjct  18    THTRKERQKEKLIMDLLFLCMYSLLVSYLFFMIWKLIDSKRDQECYILDYQCYKPSD-DR  76

Query  1565  RLSTDKSALVVYRNRNLGIDEFRFLLQTMVNSGVGEQTYIPINVLEGREDSPTLEDSFTE  1386
              +ST  S  ++ RN+NL ++E++FLL+ +V+SG+GEQTY P  V EGRE++PT+ D   E
Sbjct  77    MVSTHFSGEIIRRNQNLRLNEYKFLLKAIVSSGIGEQTYAPRLVFEGREENPTIRDGILE  136

Query  1385  VDDIMFQTLDNLFAKSKVSPREIDvlvvnvsllasapsLTSRVVNRYKMREDVKTFNLSG  1206
             +++     +  L  ++ VSP+EIDVLVVNVS+L+S PSL+SR++N YKMREDVK FNL+G
Sbjct  137   MEEFYADCVGKLLERNTVSPQEIDVLVVNVSMLSSVPSLSSRIINHYKMREDVKVFNLTG  196

Query  1205  MGCSASVVAIDIVHHLFKVYKNSYAIVVSTESLGANWYSGKERSMMLSNCLFRSGGCSML  1026
             MGCSAS+++IDIV ++FK YKN Y +VV++ESL  NWYSG  RSM+L+NCLFRSGGC+ML
Sbjct  197   MGCSASLISIDIVKNIFKNYKNMYGLVVTSESLSPNWYSGNNRSMILANCLFRSGGCAML  256

Query  1025  FTNNPALKPRAILKLKHMVRTHIAAIDEAYECCKQVEDPQGFRGFHLSKRLPKVATKALV  846
              TN  +L   A+ KLK MVRTH  + D++Y CC Q ED +G  GFHL K LPK AT+A V
Sbjct  257   MTNKRSLSRGAMFKLKCMVRTHHGSRDDSYNCCIQTEDEEGRMGFHLGKNLPKAATRAFV  316

Query  845   TNFKVLVPKAIPLWETLRF---LAVSSLERRKFK------LPSLLGKPILNMKTGIEHFC  693
              N KV+ PK +P+ E LRF   L    L R   K      L     K  +N KTGIEHFC
Sbjct  317   DNLKVITPKILPVTELLRFMLSLMAKRLRRNSSKGSNASNLAPAAPKAGINFKTGIEHFC  376

Query  692   LHPGGRAVIDGVGVSLGLSEYDLEPARMSLHRWGNTSAGGLWYVLGYMEAKKRLKKGDRI  513
             +H GG+AVIDG+G SL LSEYDLEPARM+LHR+GNTSA  LWYVL YMEAKKRLK+GDR+
Sbjct  377   IHTGGKAVIDGIGYSLDLSEYDLEPARMTLHRFGNTSASSLWYVLAYMEAKKRLKRGDRV  436

Query  512   LMLSLGAGFKCNNCVWEVMK---------DLGDPNVWEDCIDRYPPETLVNPFTEKFDWI  360
              M+S GAGFKCN+CVWEV++         D  D NVW+ CID YPP++++NP+ EK+ WI
Sbjct  437   FMISFGAGFKCNSCVWEVVRDLGHDDGDGDDDDGNVWKHCIDNYPPKSILNPYLEKYGWI  496

Query  359   HD  354
              +
Sbjct  497   QN  498



>gb|EYU39553.1| hypothetical protein MIMGU_mgv1a0261841mg, partial [Erythranthe 
guttata]
Length=418

 Score =   496 bits (1277),  Expect = 8e-168, Method: Compositional matrix adjust.
 Identities = 239/427 (56%), Positives = 327/427 (77%), Gaps = 10/427 (2%)
 Frame = -1

Query  1625  RHQCCYMLNYECYKPTDVARRLSTDKSALVVYRNRNLGIDEFRFLLQTMVNSGVGEQTYI  1446
             R Q CY+++YEC+KP+D  R++ T     ++ RN+NLG ++++FLL+ +VNSG+GEQTY 
Sbjct  1     RDQSCYLVDYECHKPSD-ERKIDTKFCGSIIARNKNLGHEDYKFLLRIIVNSGIGEQTYG  59

Query  1445  PINVLEGREDSPTLEDSFTEVDDIMFQTLDNLFAKSKVSPREIDvlvvnvsllasapsLT  1266
             P N++E RE+SPTL+D   E+++   +TLD LF K+ VSP+EIDVLVVNVSLL+S PSLT
Sbjct  60    PRNIIERRENSPTLQDGILEMEEFFVETLDRLFRKTGVSPQEIDVLVVNVSLLSSTPSLT  119

Query  1265  SRVVNRYKMREDVKTFNLSGMGCSASVVAIDIVHHLFKVYKNSYAIVVSTESLGANWYSG  1086
             S ++NRYKMR D+K+FNL+GMGCSAS+++I++V ++FK  KN++A+VVS+ES+  NWYSG
Sbjct  120   SGIINRYKMRGDIKSFNLTGMGCSASLISINLVQNIFKSKKNAFAVVVSSESIAPNWYSG  179

Query  1085  KERSMMLSNCLFRSGGCSMLFTNNPALKPRAILKLKHMVRTHIAAIDEAYECCKQVEDPQ  906
              ++SM+L+NCLFRSGGCS+L TNNP  K RA + LK +VRTH+ + DEA+ CC Q ED Q
Sbjct  180   NDKSMILTNCLFRSGGCSILLTNNPDFKNRAKMMLKCLVRTHLGSSDEAHNCCMQTEDNQ  239

Query  905   GFRGFHLSKRLPKVATKALVTNFKVLVPKAIPLWETLRFLAVSSLERRKFKLPSLLGKPI  726
             G  G +L K LPK AT+A   N   +  K +P  E +R++ +  + ++          PI
Sbjct  240   GRLGVYLGKNLPKTATRAFTKNVAEIATKFLPFKELVRYIVLKYVGKK---------VPI  290

Query  725   LNMKTGIEHFCLHPGGRAVIDGVGVSLGLSEYDLEPARMSLHRWGNTSAGGLWYVLGYME  546
             L++K G++HFCLHPGG AVI+ V  +LGL EYD+EP+RM+LHR+GNTS+  LWYVLGYME
Sbjct  291   LDLKAGVDHFCLHPGGTAVIEEVRKNLGLGEYDVEPSRMTLHRFGNTSSSSLWYVLGYME  350

Query  545   AKKRLKKGDRILMLSLGAGFKCNNCVWEVMKDLGDPNVWEDCIDRYPPETLVNPFTEKFD  366
             AKKRLKKGD++ M++ G+GFKCN+CVWEV+KDL D NVW D IDRYPP+T  NP+ EK+ 
Sbjct  351   AKKRLKKGDKVWMITFGSGFKCNSCVWEVLKDLEDGNVWGDDIDRYPPKTTANPYLEKYG  410

Query  365   WIHDPCL  345
             WI+   L
Sbjct  411   WINQDTL  417



>gb|AFK48573.1| unknown [Medicago truncatula]
Length=419

 Score =   496 bits (1276),  Expect = 1e-167, Method: Compositional matrix adjust.
 Identities = 237/404 (59%), Positives = 317/404 (78%), Gaps = 1/404 (0%)
 Frame = -1

Query  1562  LSTDKSALVVYRNRNLGIDEFRFLLQTMVNSGVGEQTYIPINVLEGREDSPTLEDSFTEV  1383
             L T+    V+ R +NLG++E++FLL+ +V+ G+GEQTY P NV EGRE SPTL+D  +E+
Sbjct  2     LGTEFCGKVITRTQNLGLNEYKFLLKAIVSCGIGEQTYAPRNVFEGREASPTLKDGISEM  61

Query  1382  DDIMFQTLDNLFAKSKVSPREIDvlvvnvsllasapsLTSRVVNRYKMREDVKTFNLSGM  1203
             ++    ++  L ++S + P EIDVLVVN+++L+  PSL+SR++NRYKMR DVK +NL+ M
Sbjct  62    EEFFDDSIAKLLSRSGICPSEIDVLVVNIAMLSVLPSLSSRIINRYKMRHDVKVYNLTAM  121

Query  1202  GCSASVVAIDIVHHLFKVYKNSYAIVVSTESLGANWYSGKERSMMLSNCLFRSGGCSMLF  1023
             GCSAS++++DIV ++FK  +N  A++V++ESL  NWY+G ++SM+L+NCLFRSGGC++L 
Sbjct  122   GCSASLISLDIVKNIFKSQRNKLALLVTSESLCPNWYTGNDKSMILANCLFRSGGCAVLL  181

Query  1022  TNNPALKPRAILKLKHMVRTHIAAIDEAYECCKQVEDPQGFRGFHLSKRLPKVATKALVT  843
             TN  +LK R+ILKLK +VRTH  A D++Y CC Q ED QG  G HL K LPK AT+A V 
Sbjct  182   TNKRSLKNRSILKLKCLVRTHHGARDDSYTCCTQKEDEQGRLGIHLGKTLPKAATRAFVD  241

Query  842   NFKVLVPKAIPLWETLRFLAVSSLER-RKFKLPSLLGKPILNMKTGIEHFCLHPGGRAVI  666
             N +V+ PK +P  E LRFL V+ L++ +K    +   K  LN KTG++HFCLH GG+AVI
Sbjct  242   NLRVISPKILPTKEILRFLFVTLLKKLKKTSGGTKSTKSPLNFKTGVDHFCLHTGGKAVI  301

Query  665   DGVGVSLGLSEYDLEPARMSLHRWGNTSAGGLWYVLGYMEAKKRLKKGDRILMLSLGAGF  486
             DG+G+SL LSEYDLEPARM+LHR+GNTSA  LWYVLGYMEAKKRLKKGDR+ M+S GAGF
Sbjct  302   DGIGMSLDLSEYDLEPARMTLHRFGNTSASSLWYVLGYMEAKKRLKKGDRVFMISFGAGF  361

Query  485   KCNNCVWEVMKDLGDPNVWEDCIDRYPPETLVNPFTEKFDWIHD  354
             KCN+C+WEVMKD+GD NVWEDCID YPP++LVNPF EK+ W+++
Sbjct  362   KCNSCLWEVMKDVGDANVWEDCIDNYPPKSLVNPFMEKYGWVNE  405



>ref|XP_004505912.1| PREDICTED: 3-ketoacyl-CoA synthase 3-like [Cicer arietinum]
Length=472

 Score =   498 bits (1281),  Expect = 1e-167, Method: Compositional matrix adjust.
 Identities = 245/460 (53%), Positives = 337/460 (73%), Gaps = 12/460 (3%)
 Frame = -1

Query  1703  METLVAIYSLLFLYTVVYILRSYLRRRHQCCYMLNYECYKPTDVARRLSTDKSALVVYRN  1524
             ME L   Y +  LY    I + + +++ Q CY+L+Y+CYKPT   R L T+    ++ R 
Sbjct  1     MEFLFLFYIVPTLYLCFLIWKLFDKKKDQECYILDYQCYKPTQ-DRMLGTEFCGKLIKRT  59

Query  1523  RNLGIDEFRFLLQTMVNSGVGEQTYIPINVLEGREDSPTLEDSFTEVDDIMFQTLDNLFA  1344
              NLG+DE++FLL+ +V+SG+GEQTY P N+ EGRE S TL D  +E+++    +++ L  
Sbjct  60    ENLGLDEYKFLLKAIVSSGIGEQTYAPRNIFEGREASATLADGISEMEEFFNDSIEKLLL  119

Query  1343  KSKVSPREIDvlvvnvsllasapsLTSRVVNRYKMREDVKTFNLSGMGCSASVVAIDIVH  1164
             +S + P EIDVLVVN+S+ A+ PSL+SR++NRYKMR+D+K +NL+ MGCSAS++++DI+ 
Sbjct  120   RSSIPPSEIDVLVVNISMFATLPSLSSRIINRYKMRDDIKVYNLTAMGCSASLISLDIIK  179

Query  1163  HLFKVYKNSYAIVVSTESLGANWYSGKERSMMLSNCLFRSGGCSMLFTNNPALKPRAILK  984
             ++FK   N  A++V++ESL  NWY G ERSM+L+NC+FRSGGC++L TN  +LK + +LK
Sbjct  180   NIFKTQSNKLALLVTSESLCPNWYQGNERSMILTNCIFRSGGCAILLTNKRSLKNKVMLK  239

Query  983   LKHMVRTHIAAIDEAYECCKQVEDPQGFRGFHLSKRLPKVATKALVTNFKVLVPKAIPLW  804
             LK +VRTH  A D+++ CC Q ED +G  G HLSK LPK AT+A V N +V+ PK +P  
Sbjct  240   LKCLVRTHHGAKDDSFTCCIQKEDEKGRIGVHLSKSLPKAATRAFVDNLRVISPKILPTK  299

Query  803   ETLRFLAVS----------SLERRKFKLPSLLGKPILNMKTGIEHFCLHPGGRAVIDGVG  654
             E LRFL V+          S  +      +    PI N+KTG++HFC+H GG+AVIDG+G
Sbjct  300   ELLRFLVVTLFKKFSISSSSSSKTSSGGKTSTKSPI-NLKTGVDHFCIHTGGKAVIDGIG  358

Query  653   VSLGLSEYDLEPARMSLHRWGNTSAGGLWYVLGYMEAKKRLKKGDRILMLSLGAGFKCNN  474
             +SL L+EYDLEPARM+L+R+GNTSA  LWYVLGYMEAKKRLKKGD+I M+S GAGFKCN+
Sbjct  359   LSLDLNEYDLEPARMTLNRFGNTSASSLWYVLGYMEAKKRLKKGDKIFMISFGAGFKCNS  418

Query  473   CVWEVMKDLGDPNVWEDCIDRYPPETLVNPFTEKFDWIHD  354
             C+WEV+KDLGD NVWEDCI  YP ++LVNPF EK+ W+++
Sbjct  419   CLWEVVKDLGDGNVWEDCIHDYPLDSLVNPFMEKYSWLNE  458



>gb|KDO72994.1| hypothetical protein CISIN_1g039047mg [Citrus sinensis]
Length=465

 Score =   497 bits (1280),  Expect = 2e-167, Method: Compositional matrix adjust.
 Identities = 237/427 (56%), Positives = 325/427 (76%), Gaps = 3/427 (1%)
 Frame = -1

Query  1628  RRHQCCYMLNYECYKPTDVARRLSTDKSALVVYRNRNLGIDEFRFLLQTMVNSGVGEQTY  1449
             +R + CY+L+Y+CYKPTD  R +STD +  V+ R +NLG++E++FLL+ +V+SG+GEQTY
Sbjct  26    KRDKECYILDYQCYKPTD-DRMVSTDFAGQVIKRTKNLGLNEYKFLLKAIVSSGIGEQTY  84

Query  1448  IPINVLEGREDSPTLEDSFTEVDDIMFQTLDNLFAKSKVSPREIDvlvvnvsllasapsL  1269
              P  +  GRED+PTL+D   E+++    ++  +  +S +SP+EID+LVVN+S++A  PSL
Sbjct  85    SPRIMFAGREDNPTLQDGIDEMEEFFEDSIAKILDRSGISPKEIDILVVNISMIAIMPSL  144

Query  1268  TSRVVNRYKMREDVKTFNLSGMGCSASVVAIDIVHHLFKVYKNSYAIVVSTESLGANWYS  1089
             +SR++NRYKMR+D+K FNL+GMGCSAS++++DIV  +FK YKN  A+VV++ESL  NWYS
Sbjct  145   SSRIINRYKMRKDIKVFNLTGMGCSASLISVDIVRSVFKTYKNMNAMVVTSESLSPNWYS  204

Query  1088  GKERSMMLSNCLFRSGGCSMLFTNNPALKPRAILKLKHMVRTHIAAIDEAYECCKQVEDP  909
             G +RSM+L+NCLFRSGG  +L +N  +L+  A+ KLK +VRTH  A D++Y CC Q ED 
Sbjct  205   GNDRSMILANCLFRSGGAVILLSNKRSLERNALFKLKCLVRTHHGARDDSYGCCVQTEDE  264

Query  908   QGFRGFHLSKRLPKVATKALVTNFKVLVPKAIPLWETLRFLAVSSLERRKFKLPSLLGKP  729
             QG  GFHL K LPK AT+A V N +V+ P  +P+ E LR+  V+ + +     P    K 
Sbjct  265   QGRPGFHLGKNLPKAATRAFVDNLRVISPMILPIRELLRYALVTFVRKMSNNTPKGEKKA  324

Query  728   ILNMKTGIEHFCLHPGGRAVIDGVGVSLGLSEYDLEPARMSLHRWGNTSAGGLWYVLGYM  549
              +N +TG++HFC+H GG+AVIDG+G SL L+EYDLEPARM+LHR+GNTSA  LWYVL YM
Sbjct  325   GVNFRTGVDHFCIHTGGKAVIDGIGFSLDLTEYDLEPARMTLHRFGNTSAASLWYVLAYM  384

Query  548   EAKKRLKKGDRILMLSLGAGFKCNNCVWEVMKDLGD--PNVWEDCIDRYPPETLVNPFTE  375
             EAKKRLKKGDR+LM+S GAGFKCN+CVWEV++DL     NVW+D ID YPP++L NP+ E
Sbjct  385   EAKKRLKKGDRVLMISFGAGFKCNSCVWEVVRDLDGNVGNVWKDIIDSYPPQSLANPYLE  444

Query  374   KFDWIHD  354
             K+ WI +
Sbjct  445   KYGWIQN  451



>ref|XP_010470059.1| PREDICTED: 3-ketoacyl-CoA synthase 12-like [Camelina sativa]
Length=476

 Score =   496 bits (1277),  Expect = 6e-167, Method: Compositional matrix adjust.
 Identities = 241/441 (55%), Positives = 329/441 (75%), Gaps = 19/441 (4%)
 Frame = -1

Query  1628  RRHQCCYMLNYECYKPTDVARRLSTDKSALVVYRNRNLGIDEFRFLLQTMVNSGVGEQTY  1449
             ++ + CY+L+Y+C+KP+D  R ++T  S  ++YRN+NLG+ E++FLL+ +V+SG+GEQTY
Sbjct  26    KQDKDCYILDYQCHKPSD-DRMVTTQVSGEIIYRNQNLGLTEYKFLLKAIVSSGIGEQTY  84

Query  1448  IPINVLEGREDSPTLEDSFTEVDDIMFQTLDNLFAKSKVSPREIDvlvvnvsllasapsL  1269
              P  V EGRE+ P+L+D  +E+++    ++  +  ++++SP++ID+LVVNVS+L+S PSL
Sbjct  85    APRLVFEGREERPSLQDGISEMEEFYVDSIGKVLERNQISPKDIDILVVNVSMLSSTPSL  144

Query  1268  TSRVVNRYKMREDVKTFNLSGMGCSASVVAIDIVHHLFKVYKNSYAIVVSTESLGANWYS  1089
              SR++N YKMR+DVK FNL+GMGCSAS++++DIV ++FK Y N  A+V ++ESL  NWYS
Sbjct  145   ASRIINHYKMRDDVKVFNLTGMGCSASLISVDIVKNIFKTYSNKLALVATSESLSPNWYS  204

Query  1088  GKERSMMLSNCLFRSGGCSMLFTNNPALKPRAILKLKHMVRTHIAAIDEAYECCKQVEDP  909
             G  RSM+L+NCLFRSGGC++L TN  +L+ RA+ KLK MVRTH  A +E+Y CC Q ED 
Sbjct  205   GNNRSMILANCLFRSGGCAILLTNKRSLRKRAMFKLKCMVRTHHGAREESYNCCVQSEDE  264

Query  908   QGFRGFHLSKRLPKVATKALVTNFKVLVPKAIPLWETLRFLAV---------SSLERRKF  756
             QG  GF+L K LPK AT+A V N KV+ PK +P+ E LRF+            +  +   
Sbjct  265   QGRVGFYLGKNLPKAATRAFVDNLKVITPKILPVTELLRFMLKLLIKKIKIRQNPSKGST  324

Query  755   KLPSLLGKPI---LNMKTGIEHFCLHPGGRAVIDGVGVSLGLSEYDLEPARMSLHRWGNT  585
              LPS  G P+   +N KTGIEHFC+H GG+AVIDG+  SL L+EYD+EPARM+LHR+GNT
Sbjct  325   NLPS--GTPLKAGINFKTGIEHFCIHTGGKAVIDGIKNSLDLTEYDIEPARMTLHRFGNT  382

Query  584   SAGGLWYVLGYMEAKKRLKKGDRILMLSLGAGFKCNNCVWEVMKDL----GDPNVWEDCI  417
             SA  LWYVL YMEAKKRLK+GDR+ M+S GAGFKCN+CVWEV++DL       NVW  CI
Sbjct  383   SASSLWYVLAYMEAKKRLKRGDRVFMISFGAGFKCNSCVWEVVRDLTVGESKGNVWNHCI  442

Query  416   DRYPPETLVNPFTEKFDWIHD  354
             D YPP+++VNP+ EKF WI D
Sbjct  443   DDYPPKSIVNPYMEKFGWIQD  463



>ref|XP_010510599.1| PREDICTED: 3-ketoacyl-CoA synthase 12 [Camelina sativa]
Length=476

 Score =   496 bits (1277),  Expect = 6e-167, Method: Compositional matrix adjust.
 Identities = 241/441 (55%), Positives = 330/441 (75%), Gaps = 19/441 (4%)
 Frame = -1

Query  1628  RRHQCCYMLNYECYKPTDVARRLSTDKSALVVYRNRNLGIDEFRFLLQTMVNSGVGEQTY  1449
             ++ + CY+L+Y+C+KP++  R ++T  S  ++YRN+NLG+ E++FLL+ +V+SG+GEQTY
Sbjct  26    KQDKDCYILDYQCHKPSN-DRMVTTQFSGEIIYRNQNLGLTEYKFLLKAIVSSGIGEQTY  84

Query  1448  IPINVLEGREDSPTLEDSFTEVDDIMFQTLDNLFAKSKVSPREIDvlvvnvsllasapsL  1269
              P  V EGRE+ P+L+D  +E+++    ++  +  ++++SP++ID+LVVNVS+L+S PSL
Sbjct  85    APRLVFEGREERPSLQDGISEMEEFYVDSIGKVLERNQISPKDIDILVVNVSMLSSTPSL  144

Query  1268  TSRVVNRYKMREDVKTFNLSGMGCSASVVAIDIVHHLFKVYKNSYAIVVSTESLGANWYS  1089
              SR++N YKMR+DVK FNL+GMGCSAS++++DIV ++FK Y N  A+V ++ESL  NWYS
Sbjct  145   ASRIINHYKMRDDVKVFNLTGMGCSASLISVDIVKNIFKTYSNKLALVATSESLSPNWYS  204

Query  1088  GKERSMMLSNCLFRSGGCSMLFTNNPALKPRAILKLKHMVRTHIAAIDEAYECCKQVEDP  909
             G  RSM+L+NCLFRSGGC++L TN  +L+ RA+ KLK MVRTH  A +E+Y CC Q ED 
Sbjct  205   GNNRSMILANCLFRSGGCAILLTNKRSLRKRAMFKLKCMVRTHHGAREESYNCCIQSEDE  264

Query  908   QGFRGFHLSKRLPKVATKALVTNFKVLVPKAIPLWETLRFLAV---------SSLERRKF  756
             QG  GF+L K LPK AT+A V N KV+ PK +P+ E LRF+            +  +   
Sbjct  265   QGRVGFYLGKNLPKAATRAFVDNLKVITPKILPVTELLRFMLKLLIKKIKIRQNPSKGST  324

Query  755   KLPSLLGKPI---LNMKTGIEHFCLHPGGRAVIDGVGVSLGLSEYDLEPARMSLHRWGNT  585
              LPS  G P+   +N KTGIEHFC+H GG+AVIDG+G SL L+EYD+EPARM+LHR+GNT
Sbjct  325   NLPS--GTPLKAGINFKTGIEHFCIHTGGKAVIDGIGHSLDLTEYDIEPARMTLHRFGNT  382

Query  584   SAGGLWYVLGYMEAKKRLKKGDRILMLSLGAGFKCNNCVWEVMKDL----GDPNVWEDCI  417
             SA  LWYVL YMEAKKRLK+GDR+ M+S GAGFKCN+CVWEV++DL       NVW  CI
Sbjct  383   SASSLWYVLAYMEAKKRLKRGDRVFMISFGAGFKCNSCVWEVVRDLTVGESKGNVWNHCI  442

Query  416   DRYPPETLVNPFTEKFDWIHD  354
             D YPP+++VNP+ EKF WI D
Sbjct  443   DDYPPKSIVNPYLEKFGWIQD  463



>emb|CDX77194.1| BnaC04g39890D [Brassica napus]
Length=476

 Score =   496 bits (1276),  Expect = 1e-166, Method: Compositional matrix adjust.
 Identities = 240/448 (54%), Positives = 333/448 (74%), Gaps = 19/448 (4%)
 Frame = -1

Query  1628  RRHQCCYMLNYECYKPTDVARRLSTDKSALVVYRNRNLGIDEFRFLLQTMVNSGVGEQTY  1449
             ++ + CY+L+Y+C+KP+D  R +ST  S  +++RN+NLG++E++FLL+ +V+SG+GEQTY
Sbjct  26    KKDKDCYILDYQCHKPSD-DRMVSTQFSGEIIHRNKNLGLNEYKFLLKAIVSSGIGEQTY  84

Query  1448  IPINVLEGREDSPTLEDSFTEVDDIMFQTLDNLFAKSKVSPREIDvlvvnvsllasapsL  1269
              P  V EGRE+ P+L+D  +E+++    ++  L  + ++SP+E+D+LVVNVS+L++ PSL
Sbjct  85    APRLVFEGREERPSLQDGISEMEEFYVDSIGKLLERQQISPKEVDILVVNVSMLSTMPSL  144

Query  1268  TSRVVNRYKMREDVKTFNLSGMGCSASVVAIDIVHHLFKVYKNSYAIVVSTESLGANWYS  1089
              SR++N YKMREDVK FNL+GMGCSAS++++DIV ++FK Y N  A++ ++ESLG NWYS
Sbjct  145   ASRIINHYKMREDVKVFNLTGMGCSASLISVDIVKNIFKSYANKLALIATSESLGPNWYS  204

Query  1088  GKERSMMLSNCLFRSGGCSMLFTNNPALKPRAILKLKHMVRTHIAAIDEAYECCKQVEDP  909
             G  RSM+L+NCLFRSGGC++L TN  +L+ +A+ +LK MVRTH  A +++Y CC Q ED 
Sbjct  205   GNNRSMILANCLFRSGGCAILLTNKRSLRKKAMFRLKCMVRTHHGAREDSYNCCIQSEDE  264

Query  908   QGFRGFHLSKRLPKVATKALVTNFKVLVPKAIPLWETLRFLAVSSLERRK---------F  756
             Q   GF+L K LPK AT+A V N KV+ PK +P+ E LRF+    +++ K          
Sbjct  265   QSRVGFYLGKNLPKAATRAFVDNLKVITPKILPVTELLRFMLKLLIKKIKMHQNPSKGSM  324

Query  755   KLPSLLGKPI---LNMKTGIEHFCLHPGGRAVIDGVGVSLGLSEYDLEPARMSLHRWGNT  585
              LP   G P+   +N KTGIEHFC+H GG+AVIDG+G SL LSEYD+EPARM+LHR+GNT
Sbjct  325   NLPP--GTPVKAGINFKTGIEHFCIHTGGKAVIDGIGHSLDLSEYDIEPARMTLHRFGNT  382

Query  584   SAGGLWYVLGYMEAKKRLKKGDRILMLSLGAGFKCNNCVWEVMKDL----GDPNVWEDCI  417
             SA  LWYVL YMEAKKRLK+GDR+ M+S GAGFKCN+CVWEV++DL       NVW  CI
Sbjct  383   SASSLWYVLAYMEAKKRLKRGDRVFMISFGAGFKCNSCVWEVVRDLTVGGSKGNVWNHCI  442

Query  416   DRYPPETLVNPFTEKFDWIHDPCLNFLR  333
             D YPP+++ NP+ EKF WI D  L+  +
Sbjct  443   DDYPPKSISNPYLEKFGWIQDEELDTFK  470



>ref|XP_011041958.1| PREDICTED: 3-ketoacyl-CoA synthase 12-like [Populus euphratica]
Length=406

 Score =   493 bits (1268),  Expect = 1e-166, Method: Compositional matrix adjust.
 Identities = 236/396 (60%), Positives = 318/396 (80%), Gaps = 5/396 (1%)
 Frame = -1

Query  1529  RNRNLGIDEFRFLLQTMVNSGVGEQTYIPINVLEGREDSPTLEDSFTEVDDIMFQTLDNL  1350
             R++ LG++E++FLL+ +V+SG+GEQTY P  + +G+E++PTL+DS +E+++    +++ L
Sbjct  2     RSKQLGLNEYKFLLKAIVSSGIGEQTYAPRIMFKGQEENPTLQDSVSEMEEFFHDSIEKL  61

Query  1349  FAKSKVSPREIDvlvvnvsllasapsLTSRVVNRYKMREDVKTFNLSGMGCSASVVAIDI  1170
              A+S +SPREID+LVVNVS+L+S PSL +R++N YK+REDVK FNLSGMGCSAS++++DI
Sbjct  62    LARSGISPREIDLLVVNVSMLSSVPSLAARIINHYKLREDVKVFNLSGMGCSASLISVDI  121

Query  1169  VHHLFKVYKNSYAIVVSTESLGANWYSGKERSMMLSNCLFRSGGCSMLFTNNPALKPRAI  990
             V ++FK  KN YA+ V++ESL  NWY+G +RSM+L+NCLFRSGGC++L TN  ALK RA+
Sbjct  122   VQNVFKSCKNVYALAVTSESLSPNWYAGNDRSMILANCLFRSGGCAILLTNKRALKHRAM  181

Query  989   LKLKHMVRTHIAAIDEAYECCKQVEDPQGFRGFHLSKRLPKVATKALVTNFKVLVPKAIP  810
              KLK +VRTH  A DE+YECC Q ED Q   GFHL K LPK AT+ALV N + + PK +P
Sbjct  182   FKLKCLVRTHHGARDESYECCLQREDEQRRLGFHLGKSLPKAATRALVDNLREITPKILP  241

Query  809   LWETLRFLAVSSLERRKFKLPSLLG----KPILNMKTGIEHFCLHPGGRAVIDGVGVSLG  642
             + E LRF+ V SL R+ +   S  G    KP++N KTG++HFC+H GG+AVIDG+GV+L 
Sbjct  242   VRELLRFMVV-SLVRKYWSHRSAKGVVSPKPVINFKTGVDHFCIHTGGKAVIDGIGVNLD  300

Query  641   LSEYDLEPARMSLHRWGNTSAGGLWYVLGYMEAKKRLKKGDRILMLSLGAGFKCNNCVWE  462
             L+EYDLEPARM+LHR+GNTSA  LWYVLGYMEAKKRLK+GDR+LM+S GAGFKCN+C+WE
Sbjct  301   LTEYDLEPARMTLHRFGNTSASSLWYVLGYMEAKKRLKRGDRVLMMSFGAGFKCNSCLWE  360

Query  461   VMKDLGDPNVWEDCIDRYPPETLVNPFTEKFDWIHD  354
             V++DL   N W+DCID YPP++L NPF EK+ WI++
Sbjct  361   VVRDLDADNAWKDCIDSYPPKSLANPFMEKYGWINN  396



>ref|XP_008457508.1| PREDICTED: 3-ketoacyl-CoA synthase 12-like [Cucumis melo]
Length=462

 Score =   494 bits (1273),  Expect = 2e-166, Method: Compositional matrix adjust.
 Identities = 238/454 (52%), Positives = 330/454 (73%), Gaps = 5/454 (1%)
 Frame = -1

Query  1703  METLVAIYSLLFLYTVVYILRSYLRRRHQCCYMLNYECYKPTDVARRLSTDKSALVVYRN  1524
             ME L  +Y++  LY  + + + +  +R Q CY+L+Y+CYKP+D  R L T     ++ R 
Sbjct  1     MEPLFLLYAIPLLYLALKLWKHFDAKRDQQCYILDYQCYKPSD-DRMLGTQLCRDLMKRT  59

Query  1523  RNLGIDEFRFLLQTMVNSGVGEQTYIPINVLEGREDSPTLEDSFTEVDDIMFQTLDNLFA  1344
             +NLG++EF+FLL+ +VNSG+GEQTY P  V  G+E  P+L DS  EV++     L  LF 
Sbjct  60    KNLGLEEFKFLLKAVVNSGIGEQTYGPHVVFSGKESHPSLVDSIVEVEEFFLDCLQKLFQ  119

Query  1343  KSKVSPREIDvlvvnvsllasapsLTSRVVNRYKMREDVKTFNLSGMGCSASVVAIDIVH  1164
             KS +SP +ID+LVVN+S+ +++PSL S ++NR+KMRED+K FN+SGMGCSAS++++D++ 
Sbjct  120   KSGISPSQIDILVVNISMFSTSPSLASIIINRFKMREDIKVFNISGMGCSASLISVDVMR  179

Query  1163  HLFKVYKNSYAIVVSTESLGANWYSGKERSMMLSNCLFRSGGCSMLFTNNPALKPRAILK  984
              +FK + NSY IVV++ESL  NWYSG +RSM+L+NCLFR+GG ++L TN   LK +A+ K
Sbjct  180   RMFKSHMNSYGIVVTSESLTPNWYSGNDRSMILANCLFRTGGAAILLTNKRNLKNKAMFK  239

Query  983   LKHMVRTHIAAIDEAYECCKQVEDPQGFRGFHLSKRLPKVATKALVTNFKVLVPKAIPLW  804
             LK ++RTH  A +E+Y+CC Q ED QG  G HL K LP+ A +A   N + + PK +P+ 
Sbjct  240   LKCLIRTHHGAQNESYDCCYQKEDDQGNLGIHLGKNLPRAAIRAFTDNLREIAPKILPIT  299

Query  803   ETLRFLAVSSLERRKFKLPS--LLGKPILNMKTGIEHFCLHPGGRAVIDGVGVSLGLSEY  630
             E  R   ++ + +      S     KP+ N KTG EHFCLH GG+AVIDGVG SL L+E+
Sbjct  300   EIFRLTILTIIHKISLASSSKPRWPKPMANFKTGAEHFCLHTGGKAVIDGVGKSLNLTEH  359

Query  629   DLEPARMSLHRWGNTSAGGLWYVLGYMEAKKRLKKGDRILMLSLGAGFKCNNCVWEVMKD  450
             DLEPARM+LHR+GNTSA  LWYVLGYMEAK+RLKKGD+++M++ GAGFKCN+C+WEV+++
Sbjct  360   DLEPARMTLHRFGNTSASSLWYVLGYMEAKRRLKKGDKVMMINFGAGFKCNSCLWEVVRE  419

Query  449   LGDP--NVWEDCIDRYPPETLVNPFTEKFDWIHD  354
             LG+   NVWEDCI+ YPP +L NPF E F WI +
Sbjct  420   LGEKKGNVWEDCINGYPPVSLANPFMESFGWIQN  453



>ref|NP_180431.1| 3-ketoacyl-CoA synthase 12 [Arabidopsis thaliana]
 sp|Q9SIB2.1|KCS12_ARATH RecName: Full=3-ketoacyl-CoA synthase 12; Short=KCS-12; AltName: 
Full=Very long-chain fatty acid condensing enzyme 12; Short=VLCFA 
condensing enzyme 12; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AAD24372.1| putative fatty acid elongase [Arabidopsis thaliana]
 gb|AAL07019.1| putative fatty acid elongase [Arabidopsis thaliana]
 gb|AAM14134.1| putative fatty acid elongase [Arabidopsis thaliana]
 gb|AEC08152.1| 3-ketoacyl-CoA synthase 12 [Arabidopsis thaliana]
Length=476

 Score =   494 bits (1273),  Expect = 2e-166, Method: Compositional matrix adjust.
 Identities = 241/441 (55%), Positives = 329/441 (75%), Gaps = 19/441 (4%)
 Frame = -1

Query  1628  RRHQCCYMLNYECYKPTDVARRLSTDKSALVVYRNRNLGIDEFRFLLQTMVNSGVGEQTY  1449
             ++ + CY+L+Y+C+KPTD  R +ST  S  ++YRN+NLG+ E++FLL+ +V+SG+GEQTY
Sbjct  26    KQDKDCYILDYQCHKPTD-DRMVSTQFSGEIIYRNQNLGLTEYKFLLKAIVSSGIGEQTY  84

Query  1448  IPINVLEGREDSPTLEDSFTEVDDIMFQTLDNLFAKSKVSPREIDvlvvnvsllasapsL  1269
              P  V EGRE+ P+L+D  +E+++    ++  L  ++++SP++ID+LVVNVS+L+S PSL
Sbjct  85    APRLVFEGREERPSLQDGISEMEEFYVDSIGKLLERNQISPKDIDILVVNVSMLSSTPSL  144

Query  1268  TSRVVNRYKMREDVKTFNLSGMGCSASVVAIDIVHHLFKVYKNSYAIVVSTESLGANWYS  1089
              SR++N YKMR+DVK FNL+GMGCSAS++++DIV ++FK Y N  A+V ++ESL  NWYS
Sbjct  145   ASRIINHYKMRDDVKVFNLTGMGCSASLISVDIVKNIFKSYANKLALVATSESLSPNWYS  204

Query  1088  GKERSMMLSNCLFRSGGCSMLFTNNPALKPRAILKLKHMVRTHIAAIDEAYECCKQVEDP  909
             G  RSM+L+NCLFRSGGC++L TN  +L+ +A+ KLK MVRTH  A +E+Y CC Q ED 
Sbjct  205   GNNRSMILANCLFRSGGCAILLTNKRSLRKKAMFKLKCMVRTHHGAREESYNCCIQAEDE  264

Query  908   QGFRGFHLSKRLPKVATKALVTNFKVLVPKAIPLWETLRFLAV---------SSLERRKF  756
             QG  GF+L K LPK AT+A V N KV+ PK +P+ E +RF+            +  +   
Sbjct  265   QGRVGFYLGKNLPKAATRAFVENLKVITPKILPVTELIRFMLKLLIKKIKIRQNPSKGST  324

Query  755   KLPSLLGKPI---LNMKTGIEHFCLHPGGRAVIDGVGVSLGLSEYDLEPARMSLHRWGNT  585
              LP   G P+   +N KTGIEHFC+H GG+AVIDG+G SL L+EYD+EPARM+LHR+GNT
Sbjct  325   NLPP--GTPLKAGINFKTGIEHFCIHTGGKAVIDGIGHSLDLNEYDIEPARMTLHRFGNT  382

Query  584   SAGGLWYVLGYMEAKKRLKKGDRILMLSLGAGFKCNNCVWEVMKDL----GDPNVWEDCI  417
             SA  LWYVL YMEAKKRLK+GDR+ M+S GAGFKCN+CVWEV++DL       NVW  CI
Sbjct  383   SASSLWYVLAYMEAKKRLKRGDRVFMISFGAGFKCNSCVWEVVRDLTGGESKGNVWNHCI  442

Query  416   DRYPPETLVNPFTEKFDWIHD  354
             D YPP++++NP+ EKF WI D
Sbjct  443   DDYPPKSILNPYLEKFGWIQD  463



>ref|XP_008802414.1| PREDICTED: 3-ketoacyl-CoA synthase 12-like [Phoenix dactylifera]
Length=454

 Score =   494 bits (1271),  Expect = 2e-166, Method: Compositional matrix adjust.
 Identities = 241/425 (57%), Positives = 315/425 (74%), Gaps = 2/425 (0%)
 Frame = -1

Query  1625  RHQCCYMLNYECYKPTDVARRLSTDKSALVVYRNRNLGIDEFRFLLQTMVNSGVGEQTYI  1446
             R+Q CY+++Y C+KP+D  R+L T+    ++ RN++LG+DE++FLL+ +V+SG+GE TY 
Sbjct  27    RNQGCYLIDYVCFKPSD-DRKLPTELCGEIIQRNKSLGLDEYKFLLKVIVSSGIGEATYG  85

Query  1445  PINVLEGREDSPTL-EDSFTEVDDIMFQTLDNLFAKSKVSPREIDvlvvnvsllasapsL  1269
             P N++ G E SP L  D   E+D+    +LD LF +S + P  +DVLVVNVS+ + APSL
Sbjct  86    PRNIILGHESSPNLCSDGIIEMDECFHASLDALFRRSSIPPSAVDVLVVNVSMFSPAPSL  145

Query  1268  TSRVVNRYKMREDVKTFNLSGMGCSASVVAIDIVHHLFKVYKNSYAIVVSTESLGANWYS  1089
             ++R+V+RY MREDV T+NLSGMGCSAS++AID+V ++F+ ++   A+VV++ES+  NWYS
Sbjct  146   SARIVHRYGMREDVVTYNLSGMGCSASLIAIDLVRNMFRCHEKKLALVVTSESIAPNWYS  205

Query  1088  GKERSMMLSNCLFRSGGCSMLFTNNPALKPRAILKLKHMVRTHIAAIDEAYECCKQVEDP  909
             G +RS ML NCLFRSGGCS L +N+P L+ RA L+LKH+VRTHI A D+AY C  Q ED 
Sbjct  206   GNKRSFMLGNCLFRSGGCSFLLSNDPKLRHRAKLQLKHLVRTHIGANDDAYSCAVQKEDE  265

Query  908   QGFRGFHLSKRLPKVATKALVTNFKVLVPKAIPLWETLRFLAVSSLERRKFKLPSLLGKP  729
              G  GFHL K LPK A +AL  N + L P+ +P+WE LR+LAV    R K       G  
Sbjct  266   DGRLGFHLGKELPKAAARALFENLRELAPRVLPVWELLRYLAVRLARRGKEPKSGGGGGG  325

Query  728   ILNMKTGIEHFCLHPGGRAVIDGVGVSLGLSEYDLEPARMSLHRWGNTSAGGLWYVLGYM  549
              + MKTGIEHFCLH GG AVIDGVG SLGL E++LEPARM+LHR+GNTSA  +WYV+GYM
Sbjct  326   GVRMKTGIEHFCLHTGGAAVIDGVGRSLGLGEFELEPARMTLHRFGNTSASSVWYVMGYM  385

Query  548   EAKKRLKKGDRILMLSLGAGFKCNNCVWEVMKDLGDPNVWEDCIDRYPPETLVNPFTEKF  369
             EAK RLKKG+R+LM++ GAGFKCN+CVW V   LGD  VWEDCI  YPP+ L NPF EK+
Sbjct  386   EAKGRLKKGERVLMITFGAGFKCNSCVWVVQGGLGDAGVWEDCIKEYPPKELSNPFMEKY  445

Query  368   DWIHD  354
              W+ D
Sbjct  446   GWVKD  450



>gb|AAM61290.1| putative fatty acid elongase [Arabidopsis thaliana]
Length=476

 Score =   494 bits (1273),  Expect = 2e-166, Method: Compositional matrix adjust.
 Identities = 242/441 (55%), Positives = 332/441 (75%), Gaps = 19/441 (4%)
 Frame = -1

Query  1628  RRHQCCYMLNYECYKPTDVARRLSTDKSALVVYRNRNLGIDEFRFLLQTMVNSGVGEQTY  1449
             ++ + CY+L+Y+C+KPTD  R +ST  S  ++YRN+NLG+ E++FLL+ +V+SG+GEQTY
Sbjct  26    KQDKDCYILDYQCHKPTD-DRMVSTQFSGEIIYRNQNLGLTEYKFLLKAIVSSGIGEQTY  84

Query  1448  IPINVLEGREDSPTLEDSFTEVDDIMFQTLDNLFAKSKVSPREIDvlvvnvsllasapsL  1269
              P  V EGRE+ P+L+D  +E+++    ++  L  ++++SP++ID+LVVNVS+L+S PSL
Sbjct  85    APRLVFEGREERPSLQDGISEMEEFYVDSIGKLLERNQISPKDIDILVVNVSMLSSTPSL  144

Query  1268  TSRVVNRYKMREDVKTFNLSGMGCSASVVAIDIVHHLFKVYKNSYAIVVSTESLGANWYS  1089
              SR++N YKMR+DVK FNL+GMGCSAS++++DIV ++FK Y N  A+V ++ESL  NWYS
Sbjct  145   ASRIINHYKMRDDVKVFNLTGMGCSASLISVDIVKNIFKSYANKLALVATSESLSPNWYS  204

Query  1088  GKERSMMLSNCLFRSGGCSMLFTNNPALKPRAILKLKHMVRTHIAAIDEAYECCKQVEDP  909
             G  RSM+L+NCLFRSGGC++L TN  +L+ +A+ KLK MVRTH  A +E+Y CC Q ED 
Sbjct  205   GNNRSMILANCLFRSGGCAILLTNKRSLRKKAMFKLKCMVRTHHGAREESYNCCIQAEDE  264

Query  908   QGFRGFHLSKRLPKVATKALVTNFKVLVPKAIPLWETLRFLAVSSLERRKFK--------  753
             QG  GF+L K LPK AT+A V N KV+ PK +P+ E +RF+    +++ K +        
Sbjct  265   QGRVGFYLGKNLPKAATRAFVDNLKVITPKILPVTELIRFMLKLLIKKIKIRQNPSXGST  324

Query  752   -LPSLLGKPI---LNMKTGIEHFCLHPGGRAVIDGVGVSLGLSEYDLEPARMSLHRWGNT  585
              LP   G P+   +N KTGIEHFC+H GG+AVIDG+G SL L+EYD+EPARM+LHR+GNT
Sbjct  325   NLPP--GTPLKAGINFKTGIEHFCIHTGGKAVIDGIGHSLDLNEYDIEPARMTLHRFGNT  382

Query  584   SAGGLWYVLGYMEAKKRLKKGDRILMLSLGAGFKCNNCVWEVMKDL----GDPNVWEDCI  417
             SA  LWYVL YMEAKKRLK+GDR+ M+S GAGFKCN+CVWEV++DL       NVW  CI
Sbjct  383   SASSLWYVLAYMEAKKRLKRGDRVFMISFGAGFKCNSCVWEVVRDLTGGESKGNVWNHCI  442

Query  416   DRYPPETLVNPFTEKFDWIHD  354
             D YPP++++NP+ EKF WI D
Sbjct  443   DDYPPKSILNPYLEKFGWIQD  463



>ref|XP_004152899.1| PREDICTED: 3-ketoacyl-CoA synthase 12-like [Cucumis sativus]
Length=462

 Score =   494 bits (1272),  Expect = 2e-166, Method: Compositional matrix adjust.
 Identities = 241/453 (53%), Positives = 327/453 (72%), Gaps = 5/453 (1%)
 Frame = -1

Query  1703  METLVAIYSLLFLYTVVYILRSYLRRRHQCCYMLNYECYKPTDVARRLSTDKSALVVYRN  1524
             ME L  +Y++  LY    + + +  +R Q CY+L+Y+CYKP+D  R L T     V+ R 
Sbjct  1     MEPLFLLYAIPLLYLAFKLWKHFDAKRDQQCYILDYQCYKPSD-DRMLGTQLCRDVMKRT  59

Query  1523  RNLGIDEFRFLLQTMVNSGVGEQTYIPINVLEGREDSPTLEDSFTEVDDIMFQTLDNLFA  1344
             + LG++EF+FLL+ +VNSG+GEQTY P  +  G+E  P+L DS  EV++     L  LF 
Sbjct  60    KVLGLEEFKFLLKAVVNSGIGEQTYGPNVIFSGKESHPSLVDSIVEVEEFFLDCLHKLFE  119

Query  1343  KSKVSPREIDvlvvnvsllasapsLTSRVVNRYKMREDVKTFNLSGMGCSASVVAIDIVH  1164
             KS +SP +ID+LVVN+S+ +++PSL S ++N++KMRED+K FNLSGMGCSAS++++D++ 
Sbjct  120   KSGISPSQIDILVVNISMFSTSPSLASMLINKFKMREDIKVFNLSGMGCSASLISMDVMR  179

Query  1163  HLFKVYKNSYAIVVSTESLGANWYSGKERSMMLSNCLFRSGGCSMLFTNNPALKPRAILK  984
              +FK + NSY IVV++ESL  NWYSG +RSM+L+NCLFR+GG ++L TN  +LK +A+LK
Sbjct  180   RMFKSHMNSYGIVVTSESLTPNWYSGNDRSMILANCLFRTGGAAILLTNKRSLKNKAMLK  239

Query  983   LKHMVRTHIAAIDEAYECCKQVEDPQGFRGFHLSKRLPKVATKALVTNFKVLVPKAIPLW  804
             LK +VRTH  A DE+Y+CC Q ED QG  G HL K LP+ A +A   N + + PK +P+ 
Sbjct  240   LKCLVRTHHGAQDESYDCCYQKEDDQGHLGIHLGKNLPRAAIRAFTDNLREIAPKILPIT  299

Query  803   ETLRFLAVSSLERRKFKLPS--LLGKPILNMKTGIEHFCLHPGGRAVIDGVGVSLGLSEY  630
             E  R   ++ + +      S     KP+ N KTG EHFC+H GG+AVIDGVG  L L+E+
Sbjct  300   EIFRLTILTIIHKISLASSSKPRWPKPMANFKTGAEHFCIHTGGKAVIDGVGKGLNLTEH  359

Query  629   DLEPARMSLHRWGNTSAGGLWYVLGYMEAKKRLKKGDRILMLSLGAGFKCNNCVWEVMKD  450
             DLEPARM+LHR+GNTSA  LWYVLGYMEAKKRLKKGD++LM+S GAGFKCN+C+WEV+++
Sbjct  360   DLEPARMTLHRFGNTSASSLWYVLGYMEAKKRLKKGDKVLMISFGAGFKCNSCLWEVVRE  419

Query  449   LGDP--NVWEDCIDRYPPETLVNPFTEKFDWIH  357
             LG    NVWEDCI+ YPP +L NPF E F WI 
Sbjct  420   LGGKKGNVWEDCINSYPPLSLANPFMESFGWIQ  452



>ref|XP_006424733.1| hypothetical protein CICLE_v10028377mg [Citrus clementina]
 ref|XP_006488240.1| PREDICTED: 3-ketoacyl-CoA synthase 12-like [Citrus sinensis]
 gb|ESR37973.1| hypothetical protein CICLE_v10028377mg [Citrus clementina]
Length=465

 Score =   494 bits (1271),  Expect = 3e-166, Method: Compositional matrix adjust.
 Identities = 236/427 (55%), Positives = 324/427 (76%), Gaps = 3/427 (1%)
 Frame = -1

Query  1628  RRHQCCYMLNYECYKPTDVARRLSTDKSALVVYRNRNLGIDEFRFLLQTMVNSGVGEQTY  1449
             +R + CY+L+Y+CYKPTD  R +STD +  V+ R +NLG++E++FLL+ +V+SG+GEQTY
Sbjct  26    KRDKECYILDYQCYKPTD-DRMVSTDFAGQVIKRTKNLGLNEYKFLLKAIVSSGIGEQTY  84

Query  1448  IPINVLEGREDSPTLEDSFTEVDDIMFQTLDNLFAKSKVSPREIDvlvvnvsllasapsL  1269
              P  +  GRED+PTL+D   E+++    ++  +  +S +SP+EID+LVVN+S++A  PSL
Sbjct  85    SPRIMFAGREDNPTLQDGIDEMEEFFEDSIAKILDRSGISPKEIDILVVNISMIAIMPSL  144

Query  1268  TSRVVNRYKMREDVKTFNLSGMGCSASVVAIDIVHHLFKVYKNSYAIVVSTESLGANWYS  1089
             +SR++NRYKMR+D+K FNL+GMGCSAS++++DIV  +FK  KN  A+VV++ESL  NWYS
Sbjct  145   SSRIINRYKMRKDIKVFNLTGMGCSASLISVDIVRSVFKTNKNMNAMVVTSESLSPNWYS  204

Query  1088  GKERSMMLSNCLFRSGGCSMLFTNNPALKPRAILKLKHMVRTHIAAIDEAYECCKQVEDP  909
             G +RSM+L+NCLFRSGG  +L +N  +L+  A+ KLK +VRTH  A D++Y CC Q ED 
Sbjct  205   GNDRSMILANCLFRSGGAVILLSNKRSLERNALFKLKCLVRTHHGARDDSYGCCVQTEDE  264

Query  908   QGFRGFHLSKRLPKVATKALVTNFKVLVPKAIPLWETLRFLAVSSLERRKFKLPSLLGKP  729
             QG  GFHL K LPK AT+A V N +V+ P  +P+ E LR+  V+ + +     P    K 
Sbjct  265   QGRPGFHLGKNLPKAATRAFVDNLRVISPMILPIRELLRYALVTFVRKMSNNTPKGEKKA  324

Query  728   ILNMKTGIEHFCLHPGGRAVIDGVGVSLGLSEYDLEPARMSLHRWGNTSAGGLWYVLGYM  549
              +N +TG++HFC+H GG+AVIDG+G SL L+EYDLEPARM+LHR+GNTSA  LWYVL YM
Sbjct  325   GVNFRTGVDHFCIHTGGKAVIDGIGFSLDLTEYDLEPARMTLHRFGNTSAASLWYVLAYM  384

Query  548   EAKKRLKKGDRILMLSLGAGFKCNNCVWEVMKDLGD--PNVWEDCIDRYPPETLVNPFTE  375
             EAKKRLKKGDR+LM+S GAGFKCN+CVWEV++DL     NVW+D ID YPP++L NP+ E
Sbjct  385   EAKKRLKKGDRVLMISFGAGFKCNSCVWEVVRDLDGNVGNVWKDIIDSYPPQSLANPYLE  444

Query  374   KFDWIHD  354
             K+ WI +
Sbjct  445   KYGWIQN  451



>ref|XP_006409896.1| hypothetical protein EUTSA_v10016592mg [Eutrema salsugineum]
 gb|ESQ51349.1| hypothetical protein EUTSA_v10016592mg [Eutrema salsugineum]
Length=478

 Score =   494 bits (1272),  Expect = 3e-166, Method: Compositional matrix adjust.
 Identities = 239/441 (54%), Positives = 330/441 (75%), Gaps = 19/441 (4%)
 Frame = -1

Query  1628  RRHQCCYMLNYECYKPTDVARRLSTDKSALVVYRNRNLGIDEFRFLLQTMVNSGVGEQTY  1449
             ++ + CY+L+Y+C+KP+D  R +ST  S  ++YRN+NLG+ E++FLL+ +V+SG+GEQTY
Sbjct  26    KQDKDCYILDYQCHKPSD-DRMVSTQFSGEIIYRNQNLGLTEYKFLLKAIVSSGIGEQTY  84

Query  1448  IPINVLEGREDSPTLEDSFTEVDDIMFQTLDNLFAKSKVSPREIDvlvvnvsllasapsL  1269
              P  V EGRE+ P+L+D  +E+++    ++  L  + ++SP++ID+LVVNVS+L+S PSL
Sbjct  85    APRLVFEGREERPSLQDGISEMEEFYVDSIGKLLERQQISPKQIDILVVNVSMLSSMPSL  144

Query  1268  TSRVVNRYKMREDVKTFNLSGMGCSASVVAIDIVHHLFKVYKNSYAIVVSTESLGANWYS  1089
              SR++N YKMR+DVK FNL+GMGCSAS++++DIV ++FK Y N  A+V ++ESL  NWYS
Sbjct  145   ASRIINHYKMRDDVKVFNLTGMGCSASLISVDIVKNIFKSYTNKLALVATSESLSPNWYS  204

Query  1088  GKERSMMLSNCLFRSGGCSMLFTNNPALKPRAILKLKHMVRTHIAAIDEAYECCKQVEDP  909
             G  RSM+L+NCLFRSGGC++L TN  +L+ +A+ KLK MVRTH  A +++Y CC Q ED 
Sbjct  205   GNNRSMILANCLFRSGGCAILLTNKRSLRKKAMFKLKCMVRTHHGAREDSYNCCIQTEDE  264

Query  908   QGFRGFHLSKRLPKVATKALVTNFKVLVPKAIPLWETLRFLAVSSLERRKF---------  756
             QG  GF+L K LPK AT+A V N K++ PK +P+ E LRF+    +++ K          
Sbjct  265   QGRVGFYLGKNLPKAATRAFVDNLKIITPKILPITELLRFMLKHLIKKIKILQNPSKGST  324

Query  755   KLPSLLGKPI---LNMKTGIEHFCLHPGGRAVIDGVGVSLGLSEYDLEPARMSLHRWGNT  585
              LP   G P+   +N KTGIEHFC+H GG+AVIDG+G SL L+EYD+EPARM+LHR+GNT
Sbjct  325   NLPP--GTPLKAGINFKTGIEHFCIHTGGKAVIDGIGHSLDLTEYDIEPARMTLHRFGNT  382

Query  584   SAGGLWYVLGYMEAKKRLKKGDRILMLSLGAGFKCNNCVWEVMKDL----GDPNVWEDCI  417
             SA  LWYVL YMEAKKRLK+GDR+ M+S GAGFKCN+CVWEV++DL       NVW  CI
Sbjct  383   SASSLWYVLAYMEAKKRLKRGDRVFMISFGAGFKCNSCVWEVVRDLTVGEAKGNVWNHCI  442

Query  416   DRYPPETLVNPFTEKFDWIHD  354
             + YPP++++NP+ EKF WI D
Sbjct  443   NDYPPKSILNPYMEKFGWIQD  463



>ref|XP_010534309.1| PREDICTED: 3-ketoacyl-CoA synthase 21-like [Tarenaya hassleriana]
Length=468

 Score =   493 bits (1268),  Expect = 1e-165, Method: Compositional matrix adjust.
 Identities = 251/466 (54%), Positives = 337/466 (72%), Gaps = 17/466 (4%)
 Frame = -1

Query  1703  METLVAIYSLLFLYTVVYILRSYLRRRHQCCYMLNYECYKPTDVARRLSTDKSALVVYRN  1524
             ME L  I  LL  + +  + +S L RR++ C++L+YECYK     R+L +     +  RN
Sbjct  1     MELLAVICLLLVSHVIFCVFKSVLERRNRRCFVLHYECYKGKH-ERKLDSKTCMQIAGRN  59

Query  1523  RNLGIDEFRFLLQTMVNSGVGEQTYIPINVLEGREDSPTLEDSFTEVDDIMFQTLDNLFA  1344
             +NL ++++RFLL+TMV+SG+GE+TY P NVLEGRE+ P L D+++E+D+I+F TLD+LF 
Sbjct  60    KNLSLEDYRFLLRTMVSSGIGEETYGPSNVLEGREECPALLDAYSEMDEIVFDTLDSLFV  119

Query  1343  KSKVSPREIDvlvvnvsllasapsLTSRVVNRYKMREDVKTFNLSGMGCSASVVAIDIVH  1164
             K+ VSP EIDVLVVNVSL + APSL SRV+ RY MRED+K++NLSG+GC ASV+++D+V 
Sbjct  120   KTGVSPSEIDVLVVNVSLFSPAPSLASRVIKRYTMREDIKSYNLSGLGCGASVISVDLVQ  179

Query  1163  HLFKVYKNSYAIVVSTESLGANWYSGKERSMMLSNCLFRSGGCSMLFTNNPALKPRAILK  984
               F  +KN+ AIVVSTES+G +WYSGK+RSMML NC FR GG S+L TN   +K ++I+K
Sbjct  180   RYFMTHKNAMAIVVSTESMGPSWYSGKDRSMMLPNCHFRVGGSSVLLTNKAKMKNKSIMK  239

Query  983   LKHMVRTHIAAIDEAYECCKQVEDPQGFRGFHLSKRLPKVATKALVTNFKVLVPKAIPLW  804
             LK MVRTHI + D AY CC Q ED +G RGF  +K L   A +AL  N +VL+PK +P+ 
Sbjct  240   LKSMVRTHIGSEDLAYSCCLQKEDTEGRRGFQQTKYLKNSAVRALTKNLRVLLPKVLPMK  299

Query  803   ETLRFLAVSSLERRKFKLPSLLGKPI-----LNMKTGIEHFCLHPGGRAVIDGVGVSLGL  639
             E LR++ V SL ++        GKP      LN+K+GI+HFC+ P  RA I+ +G SLGL
Sbjct  300   ELLRYVIVRSLSKK--------GKPTGEKNGLNLKSGIQHFCIQPTTRANIESIGKSLGL  351

Query  638   SEYDLEPARMSLHRWGNTSAGGLWYVLGYMEAKKRLKKGDRILMLSLGAGFKCNNCVWEV  459
               YD+EP+ ++LHR+GNTS+GG+WYVLGYMEAKKRL KGDRILM+ L AG +C +CVWE+
Sbjct  352   CGYDIEPSSVTLHRFGNTSSGGVWYVLGYMEAKKRLTKGDRILMIGLSAGVECISCVWEI  411

Query  458   MKDLGDPNVWEDCIDRYPP--ETLVNPFTEKFDWIHDPCLNFLRSI  327
              KD+   NVW D ++RYP   ET  NPF EK+ WI+D  L+F+  I
Sbjct  412   TKDMNGENVWNDSVERYPEMMETR-NPFEEKYGWINDDALSFVEMI  456



>gb|KGN65695.1| hypothetical protein Csa_1G501850 [Cucumis sativus]
Length=462

 Score =   493 bits (1268),  Expect = 1e-165, Method: Compositional matrix adjust.
 Identities = 240/453 (53%), Positives = 327/453 (72%), Gaps = 5/453 (1%)
 Frame = -1

Query  1703  METLVAIYSLLFLYTVVYILRSYLRRRHQCCYMLNYECYKPTDVARRLSTDKSALVVYRN  1524
             ME L  +Y++  LY    + + +  +R Q CY+L+Y+CYKP+D  R L T     V+ R 
Sbjct  1     MEPLFLLYAIPLLYLAFKLWKHFDAKRDQQCYILDYQCYKPSD-DRMLGTQLCRDVMKRT  59

Query  1523  RNLGIDEFRFLLQTMVNSGVGEQTYIPINVLEGREDSPTLEDSFTEVDDIMFQTLDNLFA  1344
             + LG++EF+FLL+ +VNSG+GEQTY P  +  G+E  P+L DS  EV++     L  LF 
Sbjct  60    KVLGLEEFKFLLKAVVNSGIGEQTYGPNVIFSGKESHPSLVDSIVEVEEFFLDCLHKLFE  119

Query  1343  KSKVSPREIDvlvvnvsllasapsLTSRVVNRYKMREDVKTFNLSGMGCSASVVAIDIVH  1164
             KS +SP +ID+LVVN+S+ +++PSL S ++N++KMRED+K FNLSGMGCSAS++++D++ 
Sbjct  120   KSGISPSQIDILVVNISMFSTSPSLASMLINKFKMREDIKVFNLSGMGCSASLISMDVMR  179

Query  1163  HLFKVYKNSYAIVVSTESLGANWYSGKERSMMLSNCLFRSGGCSMLFTNNPALKPRAILK  984
              +FK + NSY IVV++ESL  NWYSG +RSM+L+NCLFR+GG ++L TN  +LK +A+LK
Sbjct  180   RMFKSHMNSYGIVVTSESLTPNWYSGNDRSMILANCLFRTGGAAILLTNKRSLKNKAMLK  239

Query  983   LKHMVRTHIAAIDEAYECCKQVEDPQGFRGFHLSKRLPKVATKALVTNFKVLVPKAIPLW  804
             LK +VRTH  A DE+Y+CC Q ED QG  G HL K LP+ A +A   N + + PK +P+ 
Sbjct  240   LKCLVRTHHGAQDESYDCCYQKEDDQGHLGIHLGKNLPRAAIRAFTDNLREIAPKILPIT  299

Query  803   ETLRFLAVSSLERRKFKLPS--LLGKPILNMKTGIEHFCLHPGGRAVIDGVGVSLGLSEY  630
             E  R   ++ + +      S     KP+ N KTG EHFC+H GG+AVIDGVG  L L+E+
Sbjct  300   EIFRLTILTIIHKISLASSSKPRWPKPMANFKTGAEHFCIHTGGKAVIDGVGKGLNLTEH  359

Query  629   DLEPARMSLHRWGNTSAGGLWYVLGYMEAKKRLKKGDRILMLSLGAGFKCNNCVWEVMKD  450
             DLEPARM+LHR+GNTSA  LWYVLGYMEAKKRLKKGD++LM++ GAGFKCN+C+WEV+++
Sbjct  360   DLEPARMTLHRFGNTSASSLWYVLGYMEAKKRLKKGDKVLMINFGAGFKCNSCLWEVVRE  419

Query  449   LGDP--NVWEDCIDRYPPETLVNPFTEKFDWIH  357
             LG    NVWEDCI+ YPP +L NPF E F WI 
Sbjct  420   LGGKKGNVWEDCINSYPPLSLANPFMETFGWIQ  452



>emb|CDY68412.1| BnaCnng58900D [Brassica napus]
Length=471

 Score =   493 bits (1268),  Expect = 1e-165, Method: Compositional matrix adjust.
 Identities = 245/461 (53%), Positives = 333/461 (72%), Gaps = 12/461 (3%)
 Frame = -1

Query  1703  METLVAIYSLLFLYTVVYILRSYLRRRHQCCYMLNYECYKPTDVARRLSTDKSALVVYRN  1524
             M+ L  + SLL  Y +  I +    +R Q CY+L+Y+C+KP+D  R LST  S  ++ RN
Sbjct  1     MDILYILSSLLISYLIFKIWKRIDSKRDQNCYILDYQCHKPSD-DRMLSTQISGEIIRRN  59

Query  1523  RNLGIDEFRFLLQTMVNSGVGEQTYIPINVLEGREDSPTLEDSFTEVDDIMFQTLDNLFA  1344
             +++ ++E++FLL+ +V+SG+GEQTY P    EGRE+SPT++D+ +E+++    T++ L  
Sbjct  60    KHIRLNEYKFLLKAIVSSGIGEQTYAPRLYFEGREESPTIQDALSEMEEFYIDTIEKLLK  119

Query  1343  KSKVSPREIDvlvvnvsllasapsLTSRVVNRYKMREDVKTFNLSGMGCSASVVAIDIVH  1164
             ++K+ P++IDVLVVNVS+L S PSL++R++N YKMREDVK FNL+ MGCSASV+++DIV 
Sbjct  120   RNKLKPKDIDVLVVNVSMLNSTPSLSARIINHYKMREDVKVFNLTAMGCSASVISVDIVK  179

Query  1163  HLFKVYKNSYAIVVSTESLGANWYSGKERSMMLSNCLFRSGGCSMLFTNNPALKPRAILK  984
             ++FK YKN  A+VV++ESL  NWYSG  RSM+L+NCLFRSGGC++L TN   L  RA+ K
Sbjct  180   NIFKTYKNKLALVVTSESLSPNWYSGNNRSMILANCLFRSGGCAVLLTNKRCLSKRAMFK  239

Query  983   LKHMVRTHIAAIDEAYECCKQVEDPQGFRGFHLSKRLPKVATKALVTNFKVLVPKAIPLW  804
             LK +VRTH  A ++++  C Q ED  G  G HL K LPK AT+A V N KV+ PK +P+ 
Sbjct  240   LKCLVRTHHGAREDSFNACVQKEDELGRVGIHLDKTLPKAATRAFVDNLKVITPKILPVT  299

Query  803   ETLRFLAVSSL-------ERRKFKLPSLLGKPILNMKTGIEHFCLHPGGRAVIDGVGVSL  645
             +  RF+    L        +    +     K  +N KTGIEHFC+H GG+AVID +G SL
Sbjct  300   QLFRFMLSLLLKKLRRSPSKGSTNVAQAAPKAGINFKTGIEHFCIHTGGKAVIDAIGYSL  359

Query  644   GLSEYDLEPARMSLHRWGNTSAGGLWYVLGYMEAKKRLKKGDRILMLSLGAGFKCNNCVW  465
              L+EYDLEPARM+LHR+GNTSA  LWYVLGYMEAKKRLK+GDR+ M+S GAGFKCN+CVW
Sbjct  360   DLTEYDLEPARMTLHRFGNTSASSLWYVLGYMEAKKRLKRGDRVFMISFGAGFKCNSCVW  419

Query  464   EVMKDL--GD--PNVWEDCIDRYPPETLVNPFTEKFDWIHD  354
             EV +DL  G+   NVW  CID+YPP +L+NPF EK+ WI +
Sbjct  420   EVARDLNVGECLGNVWNHCIDQYPPTSLLNPFLEKYGWIRE  460



>gb|KFK32277.1| hypothetical protein AALP_AA6G221500 [Arabis alpina]
Length=476

 Score =   492 bits (1266),  Expect = 3e-165, Method: Compositional matrix adjust.
 Identities = 242/441 (55%), Positives = 324/441 (73%), Gaps = 19/441 (4%)
 Frame = -1

Query  1628  RRHQCCYMLNYECYKPTDVARRLSTDKSALVVYRNRNLGIDEFRFLLQTMVNSGVGEQTY  1449
             ++ + CY+L+Y+C+KP+D  R +ST  S  ++YRN+NLG+ E++FLL+ +V+SG+GEQTY
Sbjct  26    KQEKDCYILDYQCHKPSD-DRMVSTQFSGEIIYRNQNLGLTEYKFLLKAIVSSGIGEQTY  84

Query  1448  IPINVLEGREDSPTLEDSFTEVDDIMFQTLDNLFAKSKVSPREIDvlvvnvsllasapsL  1269
              P  V EGRE+ P+L+D   E+++    ++  L  + ++S +EID+LVVNVS+L+S PSL
Sbjct  85    APRLVFEGREERPSLQDGIIEMEEFYVDSIGKLLERQQISAKEIDILVVNVSMLSSVPSL  144

Query  1268  TSRVVNRYKMREDVKTFNLSGMGCSASVVAIDIVHHLFKVYKNSYAIVVSTESLGANWYS  1089
              SR++N YKMREDVK FNL+GMGCSAS+++IDIV ++FK Y +  A+V ++ESL  NWYS
Sbjct  145   ASRIINHYKMREDVKVFNLTGMGCSASLISIDIVRNIFKSYTDKLALVATSESLSPNWYS  204

Query  1088  GKERSMMLSNCLFRSGGCSMLFTNNPALKPRAILKLKHMVRTHIAAIDEAYECCKQVEDP  909
             G  RSM+L+NCLFRSGGC++L TN  +L+ +A+ KLK MVRTH  A +E+Y CC Q ED 
Sbjct  205   GNNRSMILANCLFRSGGCAILLTNKRSLRKKAMFKLKCMVRTHHGAREESYNCCIQSEDE  264

Query  908   QGFRGFHLSKRLPKVATKALVTNFKVLVPKAIPLWETLRFLAVSSL---------ERRKF  756
             QG  GF+L K LPK AT+A V N KV+ PK +P+ E LRF+    +          +   
Sbjct  265   QGRVGFYLGKNLPKAATRAFVDNLKVITPKILPVTELLRFMLKLLIKKIKIRQNPSKGST  324

Query  755   KLPSLLGKPI---LNMKTGIEHFCLHPGGRAVIDGVGVSLGLSEYDLEPARMSLHRWGNT  585
              LP   G P+   +N KTGIEHFC+H GG+AVIDG+G SL L+EYD+EPARM+LHR+GNT
Sbjct  325   NLPP--GTPLKAGINFKTGIEHFCIHTGGKAVIDGIGHSLDLTEYDIEPARMTLHRFGNT  382

Query  584   SAGGLWYVLGYMEAKKRLKKGDRILMLSLGAGFKCNNCVWEVMKDL----GDPNVWEDCI  417
             SA  LWYVL YMEAKKRLK GDR+ M+S GAGFKCN+CVWEV++DL       NVW  CI
Sbjct  383   SASSLWYVLSYMEAKKRLKSGDRVFMISFGAGFKCNSCVWEVVRDLTVGESKGNVWNHCI  442

Query  416   DRYPPETLVNPFTEKFDWIHD  354
             D YPP+++ NP+ EKF WI D
Sbjct  443   DNYPPKSISNPYLEKFGWIQD  463



>ref|XP_010920343.1| PREDICTED: LOW QUALITY PROTEIN: 3-ketoacyl-CoA synthase 12-like 
[Elaeis guineensis]
Length=455

 Score =   490 bits (1262),  Expect = 5e-165, Method: Compositional matrix adjust.
 Identities = 237/426 (56%), Positives = 315/426 (74%), Gaps = 3/426 (1%)
 Frame = -1

Query  1625  RHQCCYMLNYECYKPTDVARRLSTDKSALVVYRNRNLGIDEFRFLLQTMVNSGVGEQTYI  1446
             R+Q CY+++Y C+KP+D  R+L T+    ++ RN++LG+DE++FLL+ +VNSG+GE TY 
Sbjct  27    RNQGCYLIDYACFKPSD-DRKLPTELCGEIIRRNKSLGLDEYKFLLKVIVNSGIGEATYG  85

Query  1445  PINVLEGREDSPTL-EDSFTEVDDIMFQTLDNLFAKSKV-SPREIDvlvvnvsllasaps  1272
             P N++ G E SP L  D   E+D+     LD LF  S +  P  IDVLVVNVS+ + APS
Sbjct  86    PRNIILGHESSPNLCSDGIMEMDECFHACLDALFRSSSIPXPSAIDVLVVNVSMFSPAPS  145

Query  1271  LTSRVVNRYKMREDVKTFNLSGMGCSASVVAIDIVHHLFKVYKNSYAIVVSTESLGANWY  1092
             L++R+++RY MREDV  +NLSGMGCSAS++AID+V ++F+ ++N  A+VV++ES+  NWY
Sbjct  146   LSARIIHRYGMREDVVAYNLSGMGCSASLIAIDLVRNMFRCHENKLALVVTSESIAPNWY  205

Query  1091  SGKERSMMLSNCLFRSGGCSMLFTNNPALKPRAILKLKHMVRTHIAAIDEAYECCKQVED  912
             +G +RS ML NCLFRSGGCS L +N+P L+ RA L+LKH+VRTHI A DEAY C  Q ED
Sbjct  206   TGNKRSFMLGNCLFRSGGCSFLLSNDPKLRHRAKLQLKHLVRTHIGANDEAYNCAVQKED  265

Query  911   PQGFRGFHLSKRLPKVATKALVTNFKVLVPKAIPLWETLRFLAVSSLERRKFKLPSLLGK  732
               G  GFHL K LPK A +AL  N +VL P+ +P+W  LR++ VS   R K       G 
Sbjct  266   EDGRLGFHLGKELPKTAARALFENLRVLAPRVLPVWALLRYVMVSLARRGKEAKSGGGGG  325

Query  731   PILNMKTGIEHFCLHPGGRAVIDGVGVSLGLSEYDLEPARMSLHRWGNTSAGGLWYVLGY  552
              ++  KTG+EHFC+H GG AVIDGVG SLGL E++LEP RM+LHR+GNTSA  +WYV+GY
Sbjct  326   GVVRFKTGVEHFCVHTGGAAVIDGVGRSLGLGEFELEPGRMTLHRFGNTSASSVWYVMGY  385

Query  551   MEAKKRLKKGDRILMLSLGAGFKCNNCVWEVMKDLGDPNVWEDCIDRYPPETLVNPFTEK  372
             MEAK RL+KG+R+LM++ GAGFKCN+C+W V +DLGD  VWEDCI  YPP+TL NPF E+
Sbjct  386   MEAKGRLRKGERVLMITFGAGFKCNSCLWVVKRDLGDAGVWEDCIKEYPPKTLANPFIER  445

Query  371   FDWIHD  354
             F W+ D
Sbjct  446   FGWVKD  451



>ref|XP_004170358.1| PREDICTED: LOW QUALITY PROTEIN: 3-ketoacyl-CoA synthase 12-like 
[Cucumis sativus]
Length=462

 Score =   489 bits (1260),  Expect = 1e-164, Method: Compositional matrix adjust.
 Identities = 239/453 (53%), Positives = 326/453 (72%), Gaps = 5/453 (1%)
 Frame = -1

Query  1703  METLVAIYSLLFLYTVVYILRSYLRRRHQCCYMLNYECYKPTDVARRLSTDKSALVVYRN  1524
             ME L  +Y++  LY    + + +  +R Q CY+L+Y+CYKP+D  R L T     V+ R 
Sbjct  1     MEPLFLLYAIPLLYLAFKLWKHFDAKRDQQCYILDYQCYKPSD-DRMLGTQLCRDVMKRT  59

Query  1523  RNLGIDEFRFLLQTMVNSGVGEQTYIPINVLEGREDSPTLEDSFTEVDDIMFQTLDNLFA  1344
             + LG++EF+FLL+ +VNSG+GEQTY P  +  G+E  P+L DS  EV++     L  LF 
Sbjct  60    KVLGLEEFKFLLKAVVNSGIGEQTYGPNVIFSGKESHPSLVDSIVEVEEFFLDCLHKLFE  119

Query  1343  KSKVSPREIDvlvvnvsllasapsLTSRVVNRYKMREDVKTFNLSGMGCSASVVAIDIVH  1164
             KS +SP +ID+LVVN+S+ +++PSL S ++N++KMRED+K FNLSGMGCSAS++++D++ 
Sbjct  120   KSGISPSQIDILVVNISMFSTSPSLASILINKFKMREDIKVFNLSGMGCSASLISMDVMR  179

Query  1163  HLFKVYKNSYAIVVSTESLGANWYSGKERSMMLSNCLFRSGGCSMLFTNNPALKPRAILK  984
              +FK + NSY IVV++ESL  NWYSG +RSM+L+NCLFR+GG ++L TN  +LK +A+LK
Sbjct  180   RMFKSHMNSYGIVVTSESLTPNWYSGNDRSMILANCLFRTGGAAILLTNKRSLKNKAMLK  239

Query  983   LKHMVRTHIAAIDEAYECCKQVEDPQGFRGFHLSKRLPKVATKALVTNFKVLVPKAIPLW  804
             LK +VRTH  A DE+Y+CC Q ED QG  G HL K LP+ A +A   N + + PK +P+ 
Sbjct  240   LKCLVRTHHGAQDESYDCCYQKEDDQGHLGIHLGKNLPRAAIRAFTDNLREIAPKILPIT  299

Query  803   ETLRFLAVSSLERRKFKLPS--LLGKPILNMKTGIEHFCLHPGGRAVIDGVGVSLGLSEY  630
             E  R   ++ + +      S     KP+ N KTG EHFC+H GG+AVIDGVG  L L+E+
Sbjct  300   EIFRLTILTIIHKISLASSSKPRWPKPMANFKTGAEHFCIHTGGKAVIDGVGKGLNLTEH  359

Query  629   DLEPARMSLHRWGNTSAGGLWYVLGYMEAKKRLKKGDRILMLSLGAGFKCNNCVWEVMKD  450
             DLEPARM+LHR+GNTSA  LWYVLGYMEAK RLKKGD++LM++ GAGFKCN+C+WEV+++
Sbjct  360   DLEPARMTLHRFGNTSASSLWYVLGYMEAKXRLKKGDKVLMINFGAGFKCNSCLWEVVRE  419

Query  449   LGDP--NVWEDCIDRYPPETLVNPFTEKFDWIH  357
             LG    NVWEDCI+ YPP +L NPF E F WI 
Sbjct  420   LGGKKGNVWEDCINSYPPLSLANPFMETFGWIQ  452



>ref|XP_009405939.1| PREDICTED: 3-ketoacyl-CoA synthase 12-like [Musa acuminata subsp. 
malaccensis]
Length=453

 Score =   489 bits (1258),  Expect = 2e-164, Method: Compositional matrix adjust.
 Identities = 244/426 (57%), Positives = 321/426 (75%), Gaps = 2/426 (0%)
 Frame = -1

Query  1631  RRRHQCCYMLNYECYKPTDVARRLSTDKSALVVYRNRNLGIDEFRFLLQTMVNSGVGEQT  1452
             R R++ CY+L Y C+K +D  R++ST+ S  +V RN+ LG  E++FLL+ +VNSG+GE T
Sbjct  26    RWRYRNCYLLEYVCFKASD-DRKISTELSGDIVERNKRLGFPEYKFLLKVIVNSGIGEDT  84

Query  1451  YIPINVLEGREDSPTLEDSFTEVDDIMFQTLDNLFAKSKVSPREIDvlvvnvsllasaps  1272
             Y P N++EGRE+ PT +D  +E+DD M  TLD LF K+  SP +IDVLVVNVS+ + APS
Sbjct  85    YGPRNIVEGREECPTHDDGLSEMDDFMNTTLDELFRKTGFSPEDIDVLVVNVSMFSPAPS  144

Query  1271  LTSRVVNRYKMREDVKTFNLSGMGCSASVVAIDIVHHLFKVYKNSYAIVVSTESLGANWY  1092
             L SR+V RYKMREDVK FNLSGMGCSAS++A+D+V+ +FK    + A+VV++ES+G NWY
Sbjct  145   LASRIVRRYKMREDVKVFNLSGMGCSASLIAVDLVNSIFKTRGRTLAVVVASESIGPNWY  204

Query  1091  SGKERSMMLSNCLFRSGGCSMLFTNNPALKPRAILKLKHMVRTHIAAIDEAYECCKQVED  912
              G ++SMML NCLFRSGGCSML +N+P+L+ RA + LK +VRTHI A ++A+ C  Q ED
Sbjct  205   CGSDKSMMLGNCLFRSGGCSMLLSNDPSLQHRAKMSLKCLVRTHIGANNDAHNCAAQKED  264

Query  911   PQGFRGFHLSKRLPKVATKALVTNFKVLVPKAIPLWETLRFLAVSSLERRKF-KLPSLLG  735
               G  GF+L + LPK A +A   N + L+PK +P+ E + + A ++ +R +  K  +   
Sbjct  265   DGGLVGFYLGRDLPKAAVRAFSENLQRLLPKVLPVRELILYAARAARQRLRRSKADAAAA  324

Query  734   KPILNMKTGIEHFCLHPGGRAVIDGVGVSLGLSEYDLEPARMSLHRWGNTSAGGLWYVLG  555
                +N K G++HFCLHPGG AVI+GVG SLGLS YDLEPARM+LHRWGNTSA  LWYVL 
Sbjct  325   AARVNFKAGVDHFCLHPGGSAVIEGVGRSLGLSNYDLEPARMTLHRWGNTSASSLWYVLA  384

Query  554   YMEAKKRLKKGDRILMLSLGAGFKCNNCVWEVMKDLGDPNVWEDCIDRYPPETLVNPFTE  375
             YMEAKKRLKK DR+LM++ GAGFKCN+C+WEV +DL D  VWEDCI  YPPETLVNP+ E
Sbjct  385   YMEAKKRLKKRDRLLMVTFGAGFKCNSCMWEVSRDLQDEGVWEDCIHGYPPETLVNPYME  444

Query  374   KFDWIH  357
             K+ W++
Sbjct  445   KYGWVN  450



>ref|XP_004152906.1| PREDICTED: 3-ketoacyl-CoA synthase 12-like [Cucumis sativus]
Length=462

 Score =   489 bits (1259),  Expect = 2e-164, Method: Compositional matrix adjust.
 Identities = 248/453 (55%), Positives = 333/453 (74%), Gaps = 5/453 (1%)
 Frame = -1

Query  1703  METLVAIYSLLFLYTVVYILRSYLRRRHQCCYMLNYECYKPTDVARRLSTDKSALVVYRN  1524
             ME L  +Y++  LY  + + + +  +R Q CY+L+Y+C+KP++  R L T     ++ R 
Sbjct  1     MEPLFLLYAIPLLYLALKLWKHFDAKRDQQCYILDYQCFKPSE-DRMLGTQLCRDLMKRT  59

Query  1523  RNLGIDEFRFLLQTMVNSGVGEQTYIPINVLEGREDSPTLEDSFTEVDDIMFQTLDNLFA  1344
             +NLG++EF+FLL+ +VNSG+GEQTY P  +  G+E  P+L DS  EV++     L  LF 
Sbjct  60    KNLGLEEFKFLLKAVVNSGIGEQTYGPNVIFSGKESHPSLVDSIIEVEEFFLDCLHKLFQ  119

Query  1343  KSKVSPREIDvlvvnvsllasapsLTSRVVNRYKMREDVKTFNLSGMGCSASVVAIDIVH  1164
             KS VSP +ID+LVVN+S+L+++PSL S ++N++KM+ED+K FNLSGMGCSAS++++D+V 
Sbjct  120   KSGVSPSQIDILVVNISMLSTSPSLASIIINKFKMKEDIKVFNLSGMGCSASLISVDVVR  179

Query  1163  HLFKVYKNSYAIVVSTESLGANWYSGKERSMMLSNCLFRSGGCSMLFTNNPALKPRAILK  984
              +FK + NSY IVV++ESL ANWYSG +RSM+L+NCLFRSGG ++L TN  +LK +A+LK
Sbjct  180   RMFKSHMNSYGIVVTSESLTANWYSGNDRSMILANCLFRSGGAAILLTNKRSLKNKALLK  239

Query  983   LKHMVRTHIAAIDEAYECCKQVEDPQGFRGFHLSKRLPKVATKALVTNFKVLVPKAIPLW  804
             LK +VRTH  A DE+YECC Q ED QG  GFHL K LP+ A +A   N + + PK +P+ 
Sbjct  240   LKCLVRTHHGAQDESYECCYQKEDDQGNLGFHLGKSLPRAAIRAFTDNLREISPKILPIT  299

Query  803   ETLRFLAVSSLERRKFKLPS--LLGKPILNMKTGIEHFCLHPGGRAVIDGVGVSLGLSEY  630
             E  R   ++ + +      S     KP+ N KTG EHFCLH GG+AVIDGVG SL L+E+
Sbjct  300   EIFRLTILTIIHKISLASSSKPRWPKPMANFKTGAEHFCLHTGGKAVIDGVGKSLNLTEH  359

Query  629   DLEPARMSLHRWGNTSAGGLWYVLGYMEAKKRLKKGDRILMLSLGAGFKCNNCVWEVMKD  450
             DLEPARM+LHR+GNTSA  LWYVLGYMEAKKRLKKGD++LM+S GAGFKCN+C+WEVM +
Sbjct  360   DLEPARMTLHRFGNTSASSLWYVLGYMEAKKRLKKGDKVLMISFGAGFKCNSCLWEVMTE  419

Query  449   LGDP--NVWEDCIDRYPPETLVNPFTEKFDWIH  357
             LG+   NVWEDCI+ YPP +L NPF E F WI 
Sbjct  420   LGEKKGNVWEDCINGYPPVSLANPFMESFGWIQ  452



>ref|XP_002880999.1| beta-ketoacyl-CoA synthase family protein [Arabidopsis lyrata 
subsp. lyrata]
 gb|EFH57258.1| beta-ketoacyl-CoA synthase family protein [Arabidopsis lyrata 
subsp. lyrata]
Length=476

 Score =   489 bits (1260),  Expect = 2e-164, Method: Compositional matrix adjust.
 Identities = 240/441 (54%), Positives = 326/441 (74%), Gaps = 19/441 (4%)
 Frame = -1

Query  1628  RRHQCCYMLNYECYKPTDVARRLSTDKSALVVYRNRNLGIDEFRFLLQTMVNSGVGEQTY  1449
             ++ + CY+L+Y+C+KP+D  R +ST  S  ++YRN+NLG+ E++FLL+ +V+SG+GEQTY
Sbjct  26    KKDKDCYILDYQCHKPSD-DRMVSTQFSGEIIYRNQNLGLTEYKFLLKAIVSSGIGEQTY  84

Query  1448  IPINVLEGREDSPTLEDSFTEVDDIMFQTLDNLFAKSKVSPREIDvlvvnvsllasapsL  1269
              P  V EGRE+  +L+D  +E+++    ++  L  ++++SP++ID+LVVNVS+L+S PSL
Sbjct  85    APRLVFEGREERASLQDGISEMEEFYVDSIGKLLERNQISPKDIDILVVNVSMLSSTPSL  144

Query  1268  TSRVVNRYKMREDVKTFNLSGMGCSASVVAIDIVHHLFKVYKNSYAIVVSTESLGANWYS  1089
              SR++N YKMR+DVK FNL+GMGCSAS++++DIV ++FK Y N  A+V ++ESL  NWYS
Sbjct  145   ASRIINHYKMRDDVKVFNLTGMGCSASLISVDIVKNIFKSYANKLALVATSESLSPNWYS  204

Query  1088  GKERSMMLSNCLFRSGGCSMLFTNNPALKPRAILKLKHMVRTHIAAIDEAYECCKQVEDP  909
             G  RSM+L+NCLFRSGGC++L TN  +LK  A+ KLK MVRTH  A +E+Y CC Q ED 
Sbjct  205   GNNRSMILANCLFRSGGCAILLTNKRSLKKNAMFKLKCMVRTHHGAREESYNCCIQAEDE  264

Query  908   QGFRGFHLSKRLPKVATKALVTNFKVLVPKAIPLWETLRFLAV---------SSLERRKF  756
             QG  GF+L K LPK AT+A V N KV+ PK +P+ E LRF+            +  +   
Sbjct  265   QGRVGFYLGKNLPKAATRAFVDNLKVITPKILPITELLRFMLKLLIKKIKIRQNPSKGST  324

Query  755   KLPSLLGKPI---LNMKTGIEHFCLHPGGRAVIDGVGVSLGLSEYDLEPARMSLHRWGNT  585
              LP   G P+   +N KTGIEHFC+H GG+AVIDG+G SL L+EYD+EPARM+LHR+GNT
Sbjct  325   NLPP--GTPLKAGINFKTGIEHFCIHTGGKAVIDGIGHSLDLNEYDIEPARMTLHRFGNT  382

Query  584   SAGGLWYVLGYMEAKKRLKKGDRILMLSLGAGFKCNNCVWEVMKDL----GDPNVWEDCI  417
             SA  LWYVL YMEAKKRLK+GDR+ M+S GAGFKCN+CVWEV++DL       NVW  CI
Sbjct  383   SASSLWYVLAYMEAKKRLKRGDRVFMISFGAGFKCNSCVWEVVRDLTVGESKGNVWNHCI  442

Query  416   DRYPPETLVNPFTEKFDWIHD  354
               YPP++++NP+ EKF WI D
Sbjct  443   GDYPPKSILNPYLEKFGWIQD  463



>emb|CDY04576.1| BnaA07g14020D [Brassica napus]
Length=473

 Score =   489 bits (1259),  Expect = 3e-164, Method: Compositional matrix adjust.
 Identities = 236/427 (55%), Positives = 323/427 (76%), Gaps = 10/427 (2%)
 Frame = -1

Query  1613  CYMLNYECYKPTDVARRLSTDKSALVVYRNRNLGIDEFRFLLQTMVNSGVGEQTYIPINV  1434
             CY+L+Y+C+KP+D  R +ST  S  +++RN+NLG++E++FLL+ +V+SG+GEQTY P  V
Sbjct  31    CYILDYQCHKPSD-DRMVSTHFSGEIIHRNKNLGLEEYKFLLKAIVSSGIGEQTYAPRLV  89

Query  1433  LEGREDSPTLEDSFTEVDDIMFQTLDNLFAKSKVSPREIDvlvvnvsllasapsLTSRVV  1254
              EGRE+ PTL+D  +E+++    T+  L  + ++SP+E+D+LVVNVS+L S PSL SR++
Sbjct  90    FEGREERPTLQDGISEMEEFYVDTIGKLLERQQISPKEVDILVVNVSMLTSMPSLPSRII  149

Query  1253  NRYKMREDVKTFNLSGMGCSASVVAIDIVHHLFKVYKNSYAIVVSTESLGANWYSGKERS  1074
             N YKMRED+K FNL+GMGCSAS++++DIV ++FK Y N  A+V ++ESL  NWYSG  RS
Sbjct  150   NHYKMREDIKVFNLTGMGCSASLISVDIVKNIFKSYPNKLALVATSESLSPNWYSGNNRS  209

Query  1073  MMLSNCLFRSGGCSMLFTNNPALKPRAILKLKHMVRTHIAAIDEAYECCKQVEDPQGFRG  894
             M+L+NCLFRSGG ++L TN  +L+ +A+ KLK +VRTH  A +E+Y CC Q ED QG  G
Sbjct  210   MILANCLFRSGGAAILLTNKRSLREKAMFKLKCLVRTHHGAREESYNCCIQSEDKQGRVG  269

Query  893   FHLSKRLPKVATKALVTNFKVLVPKAIPLWETLRFLAVSSLERRKFKLPSLLGKPI---L  723
             F+L K LPK AT+ALV N KV+ PK +P+ E LRF+   +  +    LP   G PI   +
Sbjct  270   FYLGKNLPKAATRALVDNLKVIAPKILPVTELLRFMMRQNPSKGSTNLPP--GTPIKAGI  327

Query  722   NMKTGIEHFCLHPGGRAVIDGVGVSLGLSEYDLEPARMSLHRWGNTSAGGLWYVLGYMEA  543
             N KTGIEHFC+H GG+AVIDG+  SL L++YD+EPARM+L+R+GNTSA  LWYVL YMEA
Sbjct  328   NFKTGIEHFCIHTGGKAVIDGIQHSLDLTDYDIEPARMTLYRFGNTSASSLWYVLAYMEA  387

Query  542   KKRLKKGDRILMLSLGAGFKCNNCVWEVMKDL----GDPNVWEDCIDRYPPETLVNPFTE  375
             KKRLK+GDR+ M+S GAGFKCN+CVWEV++DL       NVW  CI+ YPP+++ NPFT+
Sbjct  388   KKRLKRGDRVFMISFGAGFKCNSCVWEVLRDLTTGESKGNVWNHCINDYPPKSISNPFTK  447

Query  374   KFDWIHD  354
              + W+ D
Sbjct  448   MYGWLQD  454



>ref|XP_010682271.1| PREDICTED: 3-ketoacyl-CoA synthase 12-like isoform X1 [Beta vulgaris 
subsp. vulgaris]
 ref|XP_010682272.1| PREDICTED: 3-ketoacyl-CoA synthase 12-like isoform X2 [Beta vulgaris 
subsp. vulgaris]
Length=482

 Score =   488 bits (1256),  Expect = 1e-163, Method: Compositional matrix adjust.
 Identities = 245/459 (53%), Positives = 334/459 (73%), Gaps = 14/459 (3%)
 Frame = -1

Query  1691  VAIYSLLFLYTVVYILRSYLR----RRHQCCYMLNYECYKPTDVARRLSTDKSALVVYRN  1524
             +  Y L+ L+  +Y L  +L+    +RHQ CY+L YEC+KP++  R+LST  S  ++ RN
Sbjct  1     MGFYILVLLFPSLYFLFHFLKWVCIKRHQDCYILGYECFKPSN-DRKLSTKLSGTIICRN  59

Query  1523  RNLGIDEFRFLLQTMVNSGVGEQTYIPINVLEGREDSPTLEDSFTEVDDIMFQTLDNLFA  1344
              NLG+D ++FLL+ +V +G+GE+TY P ++L GRE+ P L+D+  E+D+ +  ++  LF+
Sbjct  60    ENLGLDTYKFLLKAVVGAGLGEETYAPRSILMGREERPNLDDTLNEMDEFLQDSIAKLFS  119

Query  1343  KSKVSPREIDvlvvnvsllasapsLTSRVVNRYKMREDVKTFNLSGMGCSASVVAIDIVH  1164
             KS +SP++ID+LVVNVS+ AS PSL SR+VN YKMR+D+K  NLSGMGCSAS++++ +V 
Sbjct  120   KSNISPQDIDILVVNVSMFASTPSLASRIVNHYKMRDDIKVCNLSGMGCSASLISLSVVQ  179

Query  1163  HLFKVYKNSYAIVVSTESLGANWYSGKERSMMLSNCLFRSGGCSMLFTNNPALKPRAILK  984
             ++FKV K+ YA++V+TESL  NWYSG +RSM+LSN LFRSGG ++L TN   L+ +A+LK
Sbjct  180   NVFKVQKDRYALIVTTESLSPNWYSGTDRSMILSNSLFRSGGSAILLTNKWCLRKKAMLK  239

Query  983   LKHMVRTHIAAIDEAYECCKQVEDPQGFRGFHLSKRLPKVATKALVTNFKVLVPKAIPLW  804
             LK +VRTH  AI+E+YECC QVED  G +G  L K LPK AT+ LV N K+L PK +P+ 
Sbjct  240   LKCLVRTHHGAINESYECCMQVEDSVGKQGVRLHKGLPKTATRCLVDNLKILAPKILPIR  299

Query  803   ETLRFLAV--------SSLERRKFKLPSLLGKPILNMKTGIEHFCLHPGGRAVIDGVGVS  648
             E +RF              + R  +      KP +N KTG+EHFC H GG+AVIDG+  S
Sbjct  300   ELVRFAMTVIVWKYIWKPFKHRYTRTMEKGNKPAINFKTGVEHFCFHTGGKAVIDGLQES  359

Query  647   LGLSEYDLEPARMSLHRWGNTSAGGLWYVLGYMEAKKRLKKGDRILMLSLGAGFKCNNCV  468
             L L E+D+EPARM+LHR+GNTSA  LWYVLGYMEAKKRLKKGD++LM+  G+GFKCN+C+
Sbjct  360   LKLEEFDVEPARMTLHRFGNTSACSLWYVLGYMEAKKRLKKGDKLLMVGFGSGFKCNSCL  419

Query  467   WEVMKDL-GDPNVWEDCIDRYPPETLVNPFTEKFDWIHD  354
             WEV++DL G  NVW D I  YP ++L NP+ E F WIHD
Sbjct  420   WEVVRDLDGSHNVWSDFITDYPLKSLANPYLELFGWIHD  458



>emb|CDP19958.1| unnamed protein product [Coffea canephora]
Length=443

 Score =   486 bits (1251),  Expect = 2e-163, Method: Compositional matrix adjust.
 Identities = 258/481 (54%), Positives = 333/481 (69%), Gaps = 42/481 (9%)
 Frame = -1

Query  1703  METLVAIYSLLFLYTVVYILRSYLRRRHQCCYMLNYECYKPTDVARRLSTDKSALVVYRN  1524
             ME   AI  L FLY + ++ + +LR  +Q  YM+ Y+CYKP +  R+L+TD  A ++ RN
Sbjct  1     MELFTAICILCFLYLMHHLYKLFLRITNQRFYMIAYQCYKPAE-DRKLTTDLCASIILRN  59

Query  1523  RNLGIDEFRFLLQTMVNSGVGEQTYIPINVLEGREDSPTLEDSFTEVDDIMFQTLDNLFA  1344
             +NLG+D++RFLLQTMVNSG+GE TY P N++ G+E  P L DS +E+D+I F TLD LFA
Sbjct  60    KNLGLDDYRFLLQTMVNSGIGENTYAPKNIILGKEVHPELIDSLSEIDEIFFDTLDKLFA  119

Query  1343  KSKVSPREIDvlvvnvsllasapsLTSRVVNRYKMREDVKTFNLSGMGCSASVVAIDIVH  1164
              S +SP+EID+LVVNVSLL+S PSLTSR++N YKMR D+K FNLSGMGCSAS++AID+V 
Sbjct  120   NSGISPQEIDILVVNVSLLSSVPSLTSRIINHYKMRPDIKAFNLSGMGCSASLIAIDLVK  179

Query  1163  HLFKVYKNSYAIVVSTESLGANWYSGKERSMMLSNCLFRSGGCSMLFTNNPALKPRAILK  984
             HLF  + NS+AIV ST++LGA W                              +  AILK
Sbjct  180   HLFTTHSNSFAIVFSTDALGAKW----------------------------VFQDLAILK  211

Query  983   LKHMVRTHIAAIDEAYECCKQVEDPQGFRGFHL--SKRLPKVATKALVTNFKVLVPKAIP  810
             LK+ +RTH  A DEAY C   +ED QG+ GF L  +K L K A +   +N +VLVPK +P
Sbjct  212   LKYTIRTHFGANDEAYNCGIDMEDNQGYPGFRLALTKELVKAAAQ---SNLRVLVPKLLP  268

Query  809   LWETLRFLAVSSLER-RKFKLPSLLGKPILNMKTGIEHFCLHPGGRAVIDGVGVSLGLSE  633
             L E + F+ + S  +  K K  SL   P  NMKTG+EHFC+HPG +AV++G G SLGL E
Sbjct  269   LREVILFVIMVSYRKITKTKSSSLAAAP--NMKTGVEHFCIHPGAKAVVEGFGKSLGLDE  326

Query  632   YDLEPARMSLHRWGNTSAGGLWYVLGYMEAKKRLKKGDRILMLSLGAGFKCNNCVWEVMK  453
             YD+EP+RM+LHR+GNT+AG +WYVLGYMEAKKRLKKGDRILM++ GAG KCN CVWEVM+
Sbjct  327   YDIEPSRMTLHRFGNTAAGSIWYVLGYMEAKKRLKKGDRILMITFGAGLKCNTCVWEVMR  386

Query  452   DLGDPNVWEDCIDRYPPETLVNPFTEKFDWIHDPCLNFLRSIS*LDSCMHACFF-VAASK  276
             D+   NVWEDCID YPP++LVN F EKF W++D  ++FL     LD       F + AS+
Sbjct  387   DMEGSNVWEDCIDNYPPKSLVNHFMEKFAWLNDESMSFLS----LDDIREKISFEIKASR  442

Query  275   C  273
             C
Sbjct  443   C  443



>ref|XP_011077046.1| PREDICTED: 3-ketoacyl-CoA synthase 12-like [Sesamum indicum]
Length=442

 Score =   486 bits (1250),  Expect = 2e-163, Method: Compositional matrix adjust.
 Identities = 236/446 (53%), Positives = 326/446 (73%), Gaps = 11/446 (2%)
 Frame = -1

Query  1694  LVAIYSLLFLYTVVYILRSYLRRRHQCCYMLNYECYKPTDVARRLSTDKSALVVYRNRNL  1515
             +V ++++  L+ +  + +    RRH+CCY+++YEC+KP+D  R+L+T     +V RN+ L
Sbjct  5     MVVMFAICLLFLLYQLYKVSDERRHRCCYLVHYECHKPSD-DRKLNTKFCGDIVARNKIL  63

Query  1514  GIDEFRFLLQTMVNSGVGEQTYIPINVLEGREDSPTLEDSFTEVDDIMFQTLDNLFAKSK  1335
             G +E +FLL+ +V+SG+GE+TY P N++E RE+SPT+ED  +E+ +    TLD LF K+ 
Sbjct  64    GQEEHKFLLRAIVSSGIGEETYGPRNIIECRENSPTVEDGISEMYECFIDTLDQLFRKTG  123

Query  1334  VSPREIDvlvvnvsllasapsLTSRVVNRYKMREDVKTFNLSGMGCSASVVAIDIVHHLF  1155
             VSP+EIDVLVVN+S L S PS TS ++N YKMR+DVK+FNLSGMGCS S++++ +V +  
Sbjct  124   VSPQEIDVLVVNISSLTSVPSFTSTIINHYKMRDDVKSFNLSGMGCSGSLISLSLVQNTL  183

Query  1154  KVYKNSYAIVVSTESLGANWYSGKERSMMLSNCLFRSGGCSMLFTNNPALKPRAILKLKH  975
             K YKN +AIVV++ES+  NWYSG ++SMML+NCLFRSGGCS L TN  + + RA L+LK 
Sbjct  184   KSYKNVFAIVVASESIAPNWYSGNDKSMMLTNCLFRSGGCSFLLTNKRSFRTRAKLRLKC  243

Query  974   MVRTHIAAIDEAYECCKQVEDPQGFRGFHLSKRLPKVATKALVTNFKVLVPKAIPLWETL  795
             +VRTH+ A DEA+ CC Q ED QG  GF+L K LPK AT A + N   + PK +PL E +
Sbjct  244   LVRTHLGANDEAHACCMQKEDDQGRLGFYLGKNLPKTATLAFIKNITGIAPKVLPLQELI  303

Query  794   RFLAVSSLERRKFKLPSLLGKPILNMKTGIEHFCLHPGGRAVIDGVGVSLGLSEYDLEPA  615
             R++ +  L               LN+K GI+HFCLHPGG AVI+ +  +LGL E D+EP+
Sbjct  304   RYIVMKYLGNMT----------TLNLKAGIDHFCLHPGGNAVIEEIRKNLGLIEKDVEPS  353

Query  614   RMSLHRWGNTSAGGLWYVLGYMEAKKRLKKGDRILMLSLGAGFKCNNCVWEVMKDLGDPN  435
             RM+LHR+GNTS+  LWYVLGYMEAKKRLKKGD++ M+S G+GFKCN+CVWEV++DL D N
Sbjct  354   RMTLHRFGNTSSSSLWYVLGYMEAKKRLKKGDKVWMISFGSGFKCNSCVWEVLRDLEDGN  413

Query  434   VWEDCIDRYPPETLVNPFTEKFDWIH  357
             VW D ID YPP+T  NP+ E++  ++
Sbjct  414   VWGDIIDGYPPKTTTNPYMEQYGRVN  439



>ref|XP_009148023.1| PREDICTED: 3-ketoacyl-CoA synthase 3-like [Brassica rapa]
Length=472

 Score =   487 bits (1253),  Expect = 2e-163, Method: Compositional matrix adjust.
 Identities = 240/437 (55%), Positives = 326/437 (75%), Gaps = 13/437 (3%)
 Frame = -1

Query  1628  RRHQCCYMLNYECYKPTDVARRLSTDKSALVVYRNRNLGIDEFRFLLQTMVNSGVGEQTY  1449
             +R Q CY+L+Y+C+KP+D  R LST  S  ++ RN++L ++EF+FLL+ +V+SG+GEQTY
Sbjct  26    KRDQNCYILDYQCHKPSD-DRMLSTQISGEIIRRNKHLRLNEFKFLLKAIVSSGIGEQTY  84

Query  1448  IPINVLEGREDSPTLEDSFTEVDDIMFQTLDNLFAKSKVSPREIDvlvvnvsllasapsL  1269
              P    EGRE+SPT++D+ +E+++    T++ L  ++K+ P++IDVLVVNVS+L S PSL
Sbjct  85    APCIYFEGREESPTIQDALSEMEEFYIDTIEQLLKRNKLKPKDIDVLVVNVSMLNSTPSL  144

Query  1268  TSRVVNRYKMREDVKTFNLSGMGCSASVVAIDIVHHLFKVYKNSYAIVVSTESLGANWYS  1089
             ++R++N YKMREDVK FNL+ MGCSASV+++DIV ++FK YKN  A+VV++ESL  NWYS
Sbjct  145   SARIINHYKMREDVKVFNLTAMGCSASVISVDIVKNIFKTYKNKLALVVTSESLSPNWYS  204

Query  1088  GKERSMMLSNCLFRSGGCSMLFTNNPALKPRAILKLKHMVRTHIAAIDEAYECCKQVEDP  909
             G  RSM+L+NCLFRSGGC++L TN   L PRA+ KLK +VRTH  A ++++  C Q ED 
Sbjct  205   GNNRSMILANCLFRSGGCAVLLTNKRCLSPRAMFKLKCLVRTHHGAREDSFNACVQKEDE  264

Query  908   QGFRGFHLSKRLPKVATKALVTNFKVLVPKAIPLWETLRFLAVSSLERRKF--------K  753
              G  G HL K LPK AT+A V N KV+ PK +P+    RF+    L++ +          
Sbjct  265   LGRVGIHLDKTLPKAATRAFVDNLKVITPKILPVTVLFRFMLSLLLKKLRRSPSKGSTSN  324

Query  752   LPSLLGKPILNMKTGIEHFCLHPGGRAVIDGVGVSLGLSEYDLEPARMSLHRWGNTSAGG  573
             +     K  +N KTGI+HFC+H GG+AVID +G SL L+EYDLEPARM+LHR+GNTSA  
Sbjct  325   VAQAAPKAGINFKTGIDHFCIHTGGKAVIDAIGYSLDLTEYDLEPARMTLHRFGNTSASS  384

Query  572   LWYVLGYMEAKKRLKKGDRILMLSLGAGFKCNNCVWEVMKDL--GD--PNVWEDCIDRYP  405
             LWYVLGYMEAKKRLK+GDR+ M+S GAGFKCN+CVWEV++DL  G+   NVW  CID+YP
Sbjct  385   LWYVLGYMEAKKRLKRGDRVFMISFGAGFKCNSCVWEVVRDLSVGECLGNVWNHCIDQYP  444

Query  404   PETLVNPFTEKFDWIHD  354
             P++L+NPF EK+ WI +
Sbjct  445   PKSLLNPFLEKYGWIRE  461



>ref|XP_002892414.1| beta-ketoacyl-CoA synthase family protein [Arabidopsis lyrata 
subsp. lyrata]
 gb|EFH68673.1| beta-ketoacyl-CoA synthase family protein [Arabidopsis lyrata 
subsp. lyrata]
Length=478

 Score =   487 bits (1253),  Expect = 3e-163, Method: Compositional matrix adjust.
 Identities = 247/465 (53%), Positives = 336/465 (72%), Gaps = 16/465 (3%)
 Frame = -1

Query  1703  METLVAIYSLLFLYTVVYILRSYLRRRHQCCYMLNYECYKPTDVARRLSTDKSALVVYRN  1524
             M+ LV + SLL  Y +  I +    +R Q CY+L+Y+C+KP+D  R +ST  S  V+ RN
Sbjct  1     MDLLVMLSSLLISYLIFKIWKHIDSKRDQNCYILDYQCHKPSD-DRMVSTQFSGDVILRN  59

Query  1523  RNLGIDEFRFLLQTMVNSGVGEQTYIPINVLEGREDSPTLEDSFTEVDDIMFQTLDNLFA  1344
             ++L ++E++FLL+ +V+SG+GEQTY P    EGRE  PTL+D  +E+++    T++ +  
Sbjct  60    KHLRLNEYKFLLKAIVSSGIGEQTYAPRLFFEGREQRPTLQDGISEMEEFYIDTIEKVLE  119

Query  1343  KSKVSPREIDvlvvnvsllasapsLTSRVVNRYKMREDVKTFNLSGMGCSASVVAIDIVH  1164
             ++K+SP EID+LVVNVS+L S PSL++R++  YKMRED+K FNL+ MGCSASV++IDIV 
Sbjct  120   RNKISPSEIDILVVNVSMLNSTPSLSARIIKHYKMREDIKVFNLTAMGCSASVISIDIVK  179

Query  1163  HLFKVYKNSYAIVVSTESLGANWYSGKERSMMLSNCLFRSGGCSMLFTNNPALKPRAILK  984
             ++FK YKN  A+VV++ESL  NWYSG  RSM+L+NCLFRSGGC++L TN  +   RA+ K
Sbjct  180   NIFKTYKNKLALVVTSESLSPNWYSGNNRSMILANCLFRSGGCAVLLTNKRSQSRRAMFK  239

Query  983   LKHMVRTHIAAIDEAYECCKQVEDPQGFRGFHLSKRLPKVATKALVTNFKVLVPKAIPLW  804
             L+ +VRTH  A D++Y  C Q ED  G  G HL K LPK AT+A + N KV+ PK +P+ 
Sbjct  240   LRCLVRTHHGARDDSYSACVQKEDELGHIGVHLDKTLPKAATRAFIDNLKVITPKILPVT  299

Query  803   ETLRFLAVSSLERRKFK-----------LPSLLGKPILNMKTGIEHFCLHPGGRAVIDGV  657
             E LRF+    L++ +              P    K  +N KTGI+HFC+H GG+AVID +
Sbjct  300   ELLRFMLCLLLKKLRSNPSKGSTNVTQAAPKAGIKAGINFKTGIDHFCIHTGGKAVIDAI  359

Query  656   GVSLGLSEYDLEPARMSLHRWGNTSAGGLWYVLGYMEAKKRLKKGDRILMLSLGAGFKCN  477
             G SL L+EYDLEPARM+LHR+GNTSA  LWYVLGYMEAKKRLK+GDR+ M+S GAGFKCN
Sbjct  360   GYSLDLNEYDLEPARMTLHRFGNTSASSLWYVLGYMEAKKRLKRGDRVFMISFGAGFKCN  419

Query  476   NCVWEVMKDL--GDP--NVWEDCIDRYPPETLVNPFTEKFDWIHD  354
             +CVWEV++DL  G+   NVW  CID+YPP++++NPF EK+ WIH+
Sbjct  420   SCVWEVVRDLTVGESLGNVWNHCIDQYPPKSILNPFFEKYGWIHE  464



>emb|CDY58835.1| BnaAnng15510D [Brassica napus]
Length=474

 Score =   486 bits (1251),  Expect = 5e-163, Method: Compositional matrix adjust.
 Identities = 239/450 (53%), Positives = 329/450 (73%), Gaps = 16/450 (4%)
 Frame = -1

Query  1664  YTVVYILRSYLRRRHQCCYMLNYECYKPTDVARRLSTDKSALVVYRNRNLGIDEFRFLLQ  1485
             Y +  I +    +R Q CY+L+Y+C+KP+D  R +ST  S  ++ RN++L ++E++FLL+
Sbjct  14    YLIFKIWKRIDSKRDQSCYILDYQCHKPSD-DRMVSTQFSGEIILRNKHLRLNEYKFLLK  72

Query  1484  TMVNSGVGEQTYIPINVLEGREDSPTLEDSFTEVDDIMFQTLDNLFAKSKVSPREIDvlv  1305
              +V+SG+GEQTY P    EGRE+ PT +D+ +E+++    T+  L  ++K+SP +IDVLV
Sbjct  73    AIVSSGIGEQTYAPRLFFEGREECPTQQDALSEMEEFYIDTIKKLLERNKLSPTDIDVLV  132

Query  1304  vnvsllasapsLTSRVVNRYKMREDVKTFNLSGMGCSASVVAIDIVHHLFKVYKNSYAIV  1125
             VNV++L + PSL++R++N YKMRED+K FNL+ MGCSASV+++DIV ++FK YKN  A+V
Sbjct  133   VNVAMLNTTPSLSARIINHYKMREDIKVFNLTAMGCSASVISVDIVKNIFKTYKNKLALV  192

Query  1124  VSTESLGANWYSGKERSMMLSNCLFRSGGCSMLFTNNPALKPRAILKLKHMVRTHIAAID  945
             V++ESL  NWYSG  RSM+L+NCLFRSGGC++L TN  +L  +A+ KLK +VRTH  A +
Sbjct  193   VTSESLSQNWYSGNNRSMILANCLFRSGGCAVLLTNKRSLSGKAMFKLKCLVRTHHGARE  252

Query  944   EAYECCKQVEDPQGFRGFHLSKRLPKVATKALVTNFKVLVPKAIPLWETLRFLAVSSLER  765
             ++Y  C Q ED  G  G HL K LPK AT+A V N KV+ PK +P+ E  RF+   SL  
Sbjct  253   DSYNACVQKEDELGRVGIHLDKTLPKAATRAFVDNLKVITPKILPVTELFRFML--SLLL  310

Query  764   RKFK---------LPSLLGKPILNMKTGIEHFCLHPGGRAVIDGVGVSLGLSEYDLEPAR  612
             +K +         +     K  +N KTGI+HFC+H GG+AVID +G SL LSEYDLEPAR
Sbjct  311   KKLRGNPSKGSTAVAQAAPKAGINFKTGIDHFCIHTGGKAVIDAIGYSLDLSEYDLEPAR  370

Query  611   MSLHRWGNTSAGGLWYVLGYMEAKKRLKKGDRILMLSLGAGFKCNNCVWEVMKDL--GDP  438
             M+LHR+GNTSA  LWYVLGYMEAKKRL++GDR+ M+S GAGFKCN+CVWEV++DL  G+ 
Sbjct  371   MTLHRFGNTSASSLWYVLGYMEAKKRLRRGDRVFMISFGAGFKCNSCVWEVVRDLNVGES  430

Query  437   --NVWEDCIDRYPPETLVNPFTEKFDWIHD  354
               NVW  CID+YPP+++VNPF EK+ WI +
Sbjct  431   LGNVWNHCIDQYPPQSIVNPFLEKYGWIRE  460



>ref|XP_010475542.1| PREDICTED: 3-ketoacyl-CoA synthase 3-like [Camelina sativa]
Length=476

 Score =   486 bits (1251),  Expect = 5e-163, Method: Compositional matrix adjust.
 Identities = 247/464 (53%), Positives = 335/464 (72%), Gaps = 15/464 (3%)
 Frame = -1

Query  1703  METLVAIYSLLFLYTVVYILRSYLRRRHQCCYMLNYECYKPTDVARRLSTDKSALVVYRN  1524
             M+ L  + SL   Y +  I +    +R Q CY+L+Y+C+KP+D  R ++T  S  ++ RN
Sbjct  1     MDLLFMLLSLFISYLIFKIWKRIDSKRDQNCYILDYQCHKPSD-DRMVNTQLSGDIILRN  59

Query  1523  RNLGIDEFRFLLQTMVNSGVGEQTYIPINVLEGREDSPTLEDSFTEVDDIMFQTLDNLFA  1344
             ++L ++E++FLL+ +V+SG+GEQTY P    EGRE SPTL+D+ +E+++    T++ +  
Sbjct  60    KHLQLNEYKFLLKAIVSSGIGEQTYAPRVFFEGREQSPTLQDAISEMEEFYIDTIEKVLE  119

Query  1343  KSKVSPREIDvlvvnvsllasapsLTSRVVNRYKMREDVKTFNLSGMGCSASVVAIDIVH  1164
             ++K+SP +ID+LVVNVS+L S PSL++R++N YKMR+D+K FNL+ MGCSASV++IDIV 
Sbjct  120   RNKISPSDIDILVVNVSMLNSTPSLSARIINHYKMRDDIKVFNLTAMGCSASVISIDIVK  179

Query  1163  HLFKVYKNSYAIVVSTESLGANWYSGKERSMMLSNCLFRSGGCSMLFTNNPALKPRAILK  984
             ++FK YKN  A+VV++ESL  NWYSG  RSM+L+NCLFRSGGC++L TN  +L  RA+ K
Sbjct  180   NIFKTYKNKLALVVTSESLSPNWYSGCNRSMILANCLFRSGGCAVLLTNKRSLSRRAMFK  239

Query  983   LKHMVRTHIAAIDEAYECCKQVEDPQGFRGFHLSKRLPKVATKALVTNFKVLVPKAIPLW  804
             LK +VRTH  A D++Y  C Q ED  G  G HL K LPK AT+A V N KV+ PK +P+ 
Sbjct  240   LKCLVRTHHGARDDSYSACVQKEDELGHIGVHLDKTLPKAATRAFVDNLKVITPKILPVT  299

Query  803   ETLRFLAV----------SSLERRKFKLPSLLGKPILNMKTGIEHFCLHPGGRAVIDGVG  654
             E LRF+            S         P    K  +N KTGI+HFC+H GG+AVID +G
Sbjct  300   ELLRFMLCLLLKKLRKNPSKGSNVAQAAPKAGIKAGINFKTGIDHFCIHTGGKAVIDAIG  359

Query  653   VSLGLSEYDLEPARMSLHRWGNTSAGGLWYVLGYMEAKKRLKKGDRILMLSLGAGFKCNN  474
              SL LSEYDLEPARM+LHR+GNTSA  LWYVLGYMEAKKRLK+GDR+ M+S GAGFKCN+
Sbjct  360   YSLDLSEYDLEPARMTLHRFGNTSASSLWYVLGYMEAKKRLKRGDRVFMISFGAGFKCNS  419

Query  473   CVWEVMKDL--GDP--NVWEDCIDRYPPETLVNPFTEKFDWIHD  354
             CVWEV++DL  G+   NVW  CID+YPP++L+NPF EK+ WI++
Sbjct  420   CVWEVVRDLNVGEAIGNVWNHCIDQYPPKSLLNPFFEKYGWINE  463



>ref|XP_010557292.1| PREDICTED: 3-ketoacyl-CoA synthase 12-like [Tarenaya hassleriana]
Length=489

 Score =   486 bits (1252),  Expect = 6e-163, Method: Compositional matrix adjust.
 Identities = 246/444 (55%), Positives = 325/444 (73%), Gaps = 20/444 (5%)
 Frame = -1

Query  1628  RRHQCCYMLNYECYKPTDVARRLSTDKSALVVYRNRNLGIDEFRFLLQTMVNSGVGEQTY  1449
             +R Q CY+L+Y+CYKP+D  R +ST  S  ++ RN  LG++E++FLL+ +V+SG+GEQTY
Sbjct  35    KRDQECYILDYQCYKPSD-DRMVSTHFSGEIIRRNNRLGLNEYKFLLKAIVSSGIGEQTY  93

Query  1448  IPINVLEGREDSPTLEDSFTEVDDIMFQTLDNLFAKSKVSPREIDvlvvnvsllasapsL  1269
              P  V EGRE++PTL D   E+++    ++  L  ++KVSP+EIDV+V+NVS+L+S PSL
Sbjct  94    GPRLVFEGREENPTLRDGILEMEEFYTDSVGKLLHRNKVSPQEIDVVVINVSMLSSVPSL  153

Query  1268  TSRVVNRYKMREDVKTFNLSGMGCSASVVAIDIVHHLFKVYKNSYAIVVSTESLGANWYS  1089
             +SR+VN YKMR DVK FNL+GMGCSAS+++IDIV ++FK YKN   +VV++ESL  NWY+
Sbjct  154   SSRIVNHYKMRGDVKVFNLTGMGCSASLISIDIVRNIFKCYKNMCGLVVTSESLSPNWYN  213

Query  1088  GKERSMMLSNCLFRSGGCSMLFTNNPALKPRAILKLKHMVRTHIAAIDEAYECCKQVEDP  909
             G  RSM+L+NCLFRSGGC+ML TN  +L  RA+ KLK MVRTH  + D++Y CC Q ED 
Sbjct  214   GNNRSMILANCLFRSGGCAMLMTNKRSLSRRAMFKLKGMVRTHHGSRDDSYNCCIQTEDE  273

Query  908   QGFRGFHLSKRLPKVATKALVTNFKVLVPKAIPLWETLRFLAVSSLERRKFK--------  753
             +G  GFHL K LPK AT+A V N +V+ PK +P+ E  RF+     ER +          
Sbjct  274   EGRIGFHLGKNLPKSATRAFVDNLRVITPKILPVTELSRFVLRLMAERLRGNPSKGSTTS  333

Query  752   --LPSLLGKPILNMKTGIEHFCLHPGGRAVIDGVGVSLGLSEYDLEPARMSLHRWGNTSA  579
                P +  K  +N+KTGIEHFC+H GG+AVIDG+G SL LSEYDLEPARM+LHR+GNTSA
Sbjct  334   NLAPVVAPKAGINLKTGIEHFCIHTGGKAVIDGIGNSLDLSEYDLEPARMTLHRFGNTSA  393

Query  578   GGLWYVLGYMEAKKRLKKGDRILMLSLGAGFKCNNCVWEVMK---------DLGDPNVWE  426
               LWYVL YMEAKKRLK+GDR+ M+S GAGFKCN+CVWEV++         D  D NVW 
Sbjct  394   SSLWYVLAYMEAKKRLKRGDRVFMVSFGAGFKCNSCVWEVVRDLGLDDDDDDDDDGNVWR  453

Query  425   DCIDRYPPETLVNPFTEKFDWIHD  354
              CID+YPP+++ NP+ EK+ WI +
Sbjct  454   HCIDKYPPKSISNPYLEKYGWIQN  477



>emb|CDX93620.1| BnaA06g04280D [Brassica napus]
Length=472

 Score =   486 bits (1250),  Expect = 6e-163, Method: Compositional matrix adjust.
 Identities = 240/437 (55%), Positives = 326/437 (75%), Gaps = 13/437 (3%)
 Frame = -1

Query  1628  RRHQCCYMLNYECYKPTDVARRLSTDKSALVVYRNRNLGIDEFRFLLQTMVNSGVGEQTY  1449
             +R Q CY+L+Y+C+KP+D  R LST  S  ++ RN++L ++EF+FLL+ +V+SG+GEQTY
Sbjct  26    KRDQNCYILDYQCHKPSD-DRMLSTQISGEIIRRNKHLRLNEFKFLLKAIVSSGIGEQTY  84

Query  1448  IPINVLEGREDSPTLEDSFTEVDDIMFQTLDNLFAKSKVSPREIDvlvvnvsllasapsL  1269
              P    EGRE+SPT++D+ +E+++    T++ L  ++K+ P++IDVLVVNVS+L S PSL
Sbjct  85    APRIYFEGREESPTIQDALSEMEEFYIDTIEKLLKRNKLKPKDIDVLVVNVSMLNSTPSL  144

Query  1268  TSRVVNRYKMREDVKTFNLSGMGCSASVVAIDIVHHLFKVYKNSYAIVVSTESLGANWYS  1089
             ++R++N YKMREDVK FNL+ MGCSASV+++DIV ++FK YKN  A+VV++ESL  NWYS
Sbjct  145   SARIINHYKMREDVKVFNLTAMGCSASVISVDIVKNIFKTYKNKLALVVTSESLSPNWYS  204

Query  1088  GKERSMMLSNCLFRSGGCSMLFTNNPALKPRAILKLKHMVRTHIAAIDEAYECCKQVEDP  909
             G  RSM+L+NCLFRSGGC++L TN   L PRA+ KLK +VRTH  A ++++  C Q ED 
Sbjct  205   GNNRSMILANCLFRSGGCAVLLTNKRCLSPRAMFKLKCLVRTHHGAREDSFNACVQKEDE  264

Query  908   QGFRGFHLSKRLPKVATKALVTNFKVLVPKAIPLWETLRFLAVSSLERRKF--------K  753
              G  G HL K LPK AT+A V N KV+ PK +P+    RF+    L++ +          
Sbjct  265   LGRVGIHLDKTLPKAATRAFVDNLKVITPKILPVTVLFRFMLSLLLKKLRRSPSKGSTSN  324

Query  752   LPSLLGKPILNMKTGIEHFCLHPGGRAVIDGVGVSLGLSEYDLEPARMSLHRWGNTSAGG  573
             +     K  +N KTGI+HFC+H GG+AVID +G SL L+EYDLEPARM+LHR+GNTSA  
Sbjct  325   VAQAAPKAGINFKTGIDHFCIHTGGKAVIDAIGYSLDLTEYDLEPARMTLHRFGNTSASS  384

Query  572   LWYVLGYMEAKKRLKKGDRILMLSLGAGFKCNNCVWEVMKDL--GD--PNVWEDCIDRYP  405
             LWYVLGYMEAKKRLK+GDR+ M+S GAGFKCN+CVWEV++DL  G+   NVW  CID+YP
Sbjct  385   LWYVLGYMEAKKRLKRGDRVFMISFGAGFKCNSCVWEVVRDLSVGECLGNVWNHCIDQYP  444

Query  404   PETLVNPFTEKFDWIHD  354
             P++L+NPF EK+ WI +
Sbjct  445   PKSLLNPFLEKYGWIRE  461



>emb|CDY66950.1| BnaCnng52900D [Brassica napus]
Length=474

 Score =   485 bits (1249),  Expect = 9e-163, Method: Compositional matrix adjust.
 Identities = 237/448 (53%), Positives = 327/448 (73%), Gaps = 12/448 (3%)
 Frame = -1

Query  1664  YTVVYILRSYLRRRHQCCYMLNYECYKPTDVARRLSTDKSALVVYRNRNLGIDEFRFLLQ  1485
             Y +  I +    +R Q CY+L+Y+C+KP+D  R +ST  S  ++ RN++L ++E++FLL+
Sbjct  14    YLIFKIWKRIDSKRDQSCYILDYQCHKPSD-DRMVSTQFSGEIILRNKHLRLNEYKFLLK  72

Query  1484  TMVNSGVGEQTYIPINVLEGREDSPTLEDSFTEVDDIMFQTLDNLFAKSKVSPREIDvlv  1305
              +V+SG+GEQTY P    EGRE+ PT +D+ +E+++    T+  L  ++K+SP +IDVLV
Sbjct  73    AIVSSGIGEQTYAPRLFFEGREECPTQQDALSEMEEFYIDTIKKLLERNKLSPTDIDVLV  132

Query  1304  vnvsllasapsLTSRVVNRYKMREDVKTFNLSGMGCSASVVAIDIVHHLFKVYKNSYAIV  1125
             VNV++L + PSL++R++N YKMRED+K FNL+ MGCSASV+++DIV ++FK YKN  A+V
Sbjct  133   VNVAMLNTTPSLSARIINHYKMREDIKVFNLTAMGCSASVISVDIVKNIFKTYKNKLALV  192

Query  1124  VSTESLGANWYSGKERSMMLSNCLFRSGGCSMLFTNNPALKPRAILKLKHMVRTHIAAID  945
             V++ESL  NWYSG  RSM+L+NCLFRSGGC++L TN   L  +A+ KLK +VRTH  A +
Sbjct  193   VTSESLSQNWYSGNNRSMILANCLFRSGGCAVLLTNKRCLSGKAMFKLKCLVRTHHGARE  252

Query  944   EAYECCKQVEDPQGFRGFHLSKRLPKVATKALVTNFKVLVPKAIPLWETLRFLAVSSLER  765
             ++Y  C Q ED  G  G HL K LPK AT+A V N KV+ PK +P+ E  RF+    L++
Sbjct  253   DSYNACVQKEDELGRVGIHLDKTLPKAATRAFVDNLKVITPKILPVTELFRFMLSVLLKK  312

Query  764   RK-------FKLPSLLGKPILNMKTGIEHFCLHPGGRAVIDGVGVSLGLSEYDLEPARMS  606
              +         +     K  +N KTGI+HFC+H GG+AVID +G SL LSEYDLEPARM+
Sbjct  313   LRGNPSKGSTAVAQAAPKAGINFKTGIDHFCIHTGGKAVIDAIGYSLDLSEYDLEPARMT  372

Query  605   LHRWGNTSAGGLWYVLGYMEAKKRLKKGDRILMLSLGAGFKCNNCVWEVMKDL--GDP--  438
             LHR+GNTSA  LWYVLGYMEAKKRL++GDR+ M+S GAGFKCN+CVWEV++DL  G+   
Sbjct  373   LHRFGNTSASSLWYVLGYMEAKKRLRRGDRVFMISFGAGFKCNSCVWEVVRDLNVGESLG  432

Query  437   NVWEDCIDRYPPETLVNPFTEKFDWIHD  354
             NVW  CID+YPP+++VNPF EK+ WI +
Sbjct  433   NVWNHCIDQYPPQSIVNPFLEKYGWIRE  460



>gb|KFK43092.1| hypothetical protein AALP_AA1G078700 [Arabis alpina]
Length=476

 Score =   485 bits (1249),  Expect = 1e-162, Method: Compositional matrix adjust.
 Identities = 243/463 (52%), Positives = 334/463 (72%), Gaps = 14/463 (3%)
 Frame = -1

Query  1703  METLVAIYSLLFLYTVVYILRSYLRRRHQCCYMLNYECYKPTDVARRLSTDKSALVVYRN  1524
             M+ L+ ++SLL  Y +  I +    +R Q CY+L+Y+C+KP+D  R LST  S  ++ RN
Sbjct  1     MDLLMILFSLLISYLIFKIWKRIDSKRDQNCYILDYQCHKPSD-DRMLSTQYSGEIIARN  59

Query  1523  RNLGIDEFRFLLQTMVNSGVGEQTYIPINVLEGREDSPTLEDSFTEVDDIMFQTLDNLFA  1344
             ++L + E++FLL+ +V+SG+GEQTY P    EGRE+ PT++D   E+ D    T+  +  
Sbjct  60    KHLRLSEYKFLLRAIVSSGIGEQTYAPKVYFEGREERPTIQDGILEMQDFYIDTIAKILE  119

Query  1343  KSKVSPREIDvlvvnvsllasapsLTSRVVNRYKMREDVKTFNLSGMGCSASVVAIDIVH  1164
             ++K++  +IDVLVVNVS+L + PSL +R++N YKMRED+K FNL+ MGCSASV+++DIV 
Sbjct  120   RNKLAASDIDVLVVNVSMLNATPSLAARIINHYKMREDIKVFNLTAMGCSASVISVDIVK  179

Query  1163  HLFKVYKNSYAIVVSTESLGANWYSGKERSMMLSNCLFRSGGCSMLFTNNPALKPRAILK  984
             ++FK YKN  A+VV++ESL  NWY+G  RSM+L+NCLFRSGGC++L TN  +L  +A+ K
Sbjct  180   NIFKTYKNKLALVVTSESLSPNWYTGNNRSMILANCLFRSGGCAVLLTNKRSLSHKAMFK  239

Query  983   LKHMVRTHIAAIDEAYECCKQVEDPQGFRGFHLSKRLPKVATKALVTNFKVLVPKAIPLW  804
             LK +VRTH  A D+++  C Q ED  G  G  L K LPK AT+A V N KV+ PK +P+ 
Sbjct  240   LKCLVRTHHGARDDSFNACVQKEDELGRVGVFLDKTLPKAATRAFVDNLKVITPKILPVT  299

Query  803   ETLRFLAVSSLER-----RKFKLPSLLG----KPILNMKTGIEHFCLHPGGRAVIDGVGV  651
             E LRF+    L++      K    S +G    K  +N KTGIEHFC+H GG+AVID +G 
Sbjct  300   EILRFMLCLLLKKLRGSPSKGSAASNVGQAAPKAGINFKTGIEHFCIHTGGKAVIDAIGH  359

Query  650   SLGLSEYDLEPARMSLHRWGNTSAGGLWYVLGYMEAKKRLKKGDRILMLSLGAGFKCNNC  471
             SL L+EYDLEPARM+LHR+GNTSA  LWYVLGYMEAKKRLK+GDR+ M+S GAGFKCN+C
Sbjct  360   SLDLTEYDLEPARMTLHRFGNTSASSLWYVLGYMEAKKRLKRGDRVFMISFGAGFKCNSC  419

Query  470   VWEVMKDL--GDP--NVWEDCIDRYPPETLVNPFTEKFDWIHD  354
             VWEV++DL  G+   NVW  CID YPP+++++PF EK+ WI++
Sbjct  420   VWEVVRDLNVGESLGNVWNHCIDNYPPKSILSPFMEKYGWINN  462



>ref|XP_009407581.1| PREDICTED: 3-ketoacyl-CoA synthase 3-like [Musa acuminata subsp. 
malaccensis]
Length=454

 Score =   484 bits (1246),  Expect = 1e-162, Method: Compositional matrix adjust.
 Identities = 240/433 (55%), Positives = 325/433 (75%), Gaps = 4/433 (1%)
 Frame = -1

Query  1643  RSYLRRRHQCCYMLNYECYKPTDVARRLSTDKSALVVYRNRNLGIDEFRFLLQTMVNSGV  1464
             + + RRR++ CY+L++ CYKP+D  R+LS++  + ++ RN+ L + +++FLL+ +VNSG+
Sbjct  22    KGFDRRRNRSCYLLDFVCYKPSD-DRKLSSELCSDIIVRNKRLSVPDYKFLLKVVVNSGI  80

Query  1463  GEQTYIPINVLEGREDSPTLEDSFTEVDDIMFQTLDNLFAKSKVSPREIDvlvvnvslla  1284
              E TY P +++EGRE+ PT +D   EVDD M++TLD LF ++ +SP ++DVLVVNVS+ A
Sbjct  81    SEDTYGPRSIIEGREECPTHDDCVDEVDDCMYRTLDELFLRTSISPIDVDVLVVNVSMFA  140

Query  1283  sapsLTSRVVNRYKMREDVKTFNLSGMGCSASVVAIDIVHHLFKVYKNSYAIVVSTESLG  1104
              +PSLTSR+VNRY+MREDVK F+L+GMGCSAS +AID+V+++FK  K + A+VV++ES+ 
Sbjct  141   PSPSLTSRIVNRYRMREDVKNFSLAGMGCSASPIAIDLVNNIFKTRKRTLAVVVTSESIA  200

Query  1103  ANWYSGKERSMMLSNCLFRSGGCSMLFTNNPALKPRAILKLKHMVRTHIAAIDEAYECCK  924
              NWY G ++SMML NCLFRSGGCS + TN+P+LK RA + LK +VR HI A D+AY C  
Sbjct  201   PNWYYGTDKSMMLGNCLFRSGGCSFMLTNDPSLKHRAKMSLKCLVRAHIGANDDAYSCAI  260

Query  923   QVEDPQGFRGFHLSKRLPKVATKALVTNFKVLVPKAIPLWETLRFLAVS---SLERRKFK  753
             Q ED +G  GFHLSK LPK A +A   N + L PK +P+ E   ++       L R K  
Sbjct  261   QKEDDEGRVGFHLSKSLPKAAVRAFAENLQRLAPKVLPVGELALYVLRGFRHRLWRSKEA  320

Query  752   LPSLLGKPILNMKTGIEHFCLHPGGRAVIDGVGVSLGLSEYDLEPARMSLHRWGNTSAGG  573
                     ++N K+G++HFCLH GG AVID VG +LGL++YD+EPARM+LHRWGNTSA  
Sbjct  321   KTDAATAAMVNFKSGVDHFCLHTGGAAVIDAVGRALGLTKYDVEPARMTLHRWGNTSASS  380

Query  572   LWYVLGYMEAKKRLKKGDRILMLSLGAGFKCNNCVWEVMKDLGDPNVWEDCIDRYPPETL  393
             LWYVLGYMEAKKRL++ DR+LMLS GAGFKCN+C+WEV++DL D   WEDCI  YPP+TL
Sbjct  381   LWYVLGYMEAKKRLRRKDRVLMLSFGAGFKCNSCLWEVLRDLNDGGAWEDCIRAYPPQTL  440

Query  392   VNPFTEKFDWIHD  354
             VNPF EKF W+ +
Sbjct  441   VNPFMEKFGWVKE  453



>ref|XP_009110921.1| PREDICTED: 3-ketoacyl-CoA synthase 3 [Brassica rapa]
 emb|CDY58836.1| BnaAnng15520D [Brassica napus]
Length=474

 Score =   484 bits (1246),  Expect = 3e-162, Method: Compositional matrix adjust.
 Identities = 240/438 (55%), Positives = 326/438 (74%), Gaps = 16/438 (4%)
 Frame = -1

Query  1628  RRHQCCYMLNYECYKPTDVARRLSTDKSALVVYRNRNLGIDEFRFLLQTMVNSGVGEQTY  1449
             +R Q CY+L+Y+C+KP+D  R +ST  S  ++ RN++L ++E++FLL+ +V+SG+GEQTY
Sbjct  26    KRDQNCYILDYQCHKPSD-DRMVSTQFSGEIILRNKHLRLNEYKFLLKAIVSSGIGEQTY  84

Query  1448  IPINVLEGREDSPTLEDSFTEVDDIMFQTLDNLFAKSKVSPREIDvlvvnvsllasapsL  1269
              P    EGRE+ PT +D+ +E+++    T+  L  ++K+SP +IDVLVVNV++L SAPSL
Sbjct  85    APRLFFEGREECPTQQDALSEMEEFYIDTIKKLLERNKLSPTDIDVLVVNVAMLNSAPSL  144

Query  1268  TSRVVNRYKMREDVKTFNLSGMGCSASVVAIDIVHHLFKVYKNSYAIVVSTESLGANWYS  1089
             ++R+VN YKMRED+K FNL+ MGCSASV+++DIV ++FK YKN  A+VV++ESL  NWYS
Sbjct  145   SARIVNHYKMREDIKVFNLTAMGCSASVISVDIVKNIFKTYKNKLALVVTSESLSQNWYS  204

Query  1088  GKERSMMLSNCLFRSGGCSMLFTNNPALKPRAILKLKHMVRTHIAAIDEAYECCKQVEDP  909
             G  RSM+L+NCLFRSGGC++L TN  +L  +A+ KLK +VRTH  A +++Y  C Q ED 
Sbjct  205   GNNRSMILANCLFRSGGCAVLLTNKRSLSGKAMFKLKCLVRTHHGAREDSYNACVQKEDE  264

Query  908   QGFRGFHLSKRLPKVATKALVTNFKVLVPKAIPLWETLRFLAVSSLERRKFK--------  753
              G  G HL K LPK AT+A V N KV+ PK +P+ E  RF+   SL  +K +        
Sbjct  265   LGRVGIHLDKTLPKAATRAFVDNLKVITPKILPVTELFRFML--SLLLKKLRGNPSKGST  322

Query  752   -LPSLLGKPILNMKTGIEHFCLHPGGRAVIDGVGVSLGLSEYDLEPARMSLHRWGNTSAG  576
              +     K  +N KTGI+HFC+H GG+AVID +G SL LSEYDLEPARM+LHR+GNTSA 
Sbjct  323   AVAQAAPKAGINFKTGIDHFCIHTGGKAVIDAIGYSLDLSEYDLEPARMTLHRFGNTSAS  382

Query  575   GLWYVLGYMEAKKRLKKGDRILMLSLGAGFKCNNCVWEVMKDL--GDP--NVWEDCIDRY  408
              LWYVLGYMEAKKRL++GDR+ M+S GAGFKCN+CVWEV++DL  G+   NVW  CID+Y
Sbjct  383   SLWYVLGYMEAKKRLRRGDRVFMISFGAGFKCNSCVWEVVRDLNVGESLGNVWNHCIDQY  442

Query  407   PPETLVNPFTEKFDWIHD  354
             PP+++VNPF EK+ WI +
Sbjct  443   PPQSIVNPFLEKYGWIRE  460



>ref|XP_009103702.1| PREDICTED: 3-ketoacyl-CoA synthase 12-like [Brassica rapa]
Length=482

 Score =   484 bits (1247),  Expect = 3e-162, Method: Compositional matrix adjust.
 Identities = 237/436 (54%), Positives = 325/436 (75%), Gaps = 19/436 (4%)
 Frame = -1

Query  1613  CYMLNYECYKPTDVARRLSTDKSALVVYRNRNLGIDEFRFLLQTMVNSGVGEQTYIPINV  1434
             CY+L+Y+C+KP+D  R +ST  S  +++RN+NLG++E++FLL+ +V+SG+GEQTY P  V
Sbjct  31    CYILDYQCHKPSD-DRMVSTHFSGEIIHRNKNLGLEEYKFLLKAIVSSGIGEQTYAPRLV  89

Query  1433  LEGREDSPTLEDSFTEVDDIMFQTLDNLFAKSKVSPREIDvlvvnvsllasapsLTSRVV  1254
              EGRE+ PTL+D  +E+++    T+  L  + ++SP+E+D+LVVNVS+L S PSL SR++
Sbjct  90    FEGREERPTLQDGISEMEEFYVDTIGKLLERQQISPKEVDILVVNVSMLTSMPSLPSRII  149

Query  1253  NRYKMREDVKTFNLSGMGCSASVVAIDIVHHLFKVYKNSYAIVVSTESLGANWYSGKERS  1074
             N YKMRED+K FNL+GMGCSAS++++DIV ++FK Y N  A+V ++ESL  NWYSG  RS
Sbjct  150   NHYKMREDIKVFNLTGMGCSASLISVDIVKNIFKSYPNKLALVATSESLSPNWYSGNNRS  209

Query  1073  MMLSNCLFRSGGCSMLFTNNPALKPRAILKLKHMVRTHIAAIDEAYECCKQVEDPQGFRG  894
             M+L+NCLFRSGG ++L TN  +L+ +A+ KLK +VRTH  A +E+Y CC Q ED QG  G
Sbjct  210   MILANCLFRSGGAAILLTNKRSLRKKAMFKLKCLVRTHHGAREESYNCCIQSEDKQGRVG  269

Query  893   FHLSKRLPKVATKALVTNFKVLVPKAIPLWETLRFLAVSSLERRKF---------KLPSL  741
             F+L K LPK AT+ALV N KV+ PK +P+ E LRF+    +++ K           LP  
Sbjct  270   FYLGKNLPKAATRALVDNLKVIAPKILPVTELLRFMVKLFIKKIKMHQNPSKGSTNLPP-  328

Query  740   LGKPI---LNMKTGIEHFCLHPGGRAVIDGVGVSLGLSEYDLEPARMSLHRWGNTSAGGL  570
              G PI   +N KTGIEHFC+H GG+AVIDG+  SL L++YD+EPARM+L+R+GNTSA  L
Sbjct  329   -GTPIKAGINFKTGIEHFCIHTGGKAVIDGIQHSLDLTDYDIEPARMTLYRFGNTSASSL  387

Query  569   WYVLGYMEAKKRLKKGDRILMLSLGAGFKCNNCVWEVMKDL----GDPNVWEDCIDRYPP  402
             WYVL YMEAKKRLK+GDR+ M+S GAGFKCN+CVWEV++DL       NVW  CI+ YPP
Sbjct  388   WYVLAYMEAKKRLKRGDRVFMISFGAGFKCNSCVWEVLRDLTTGESKGNVWNHCINDYPP  447

Query  401   ETLVNPFTEKFDWIHD  354
             +++ NPFT+ + W+ D
Sbjct  448   KSISNPFTKMYGWLQD  463



>ref|XP_006417769.1| hypothetical protein EUTSA_v10009782mg [Eutrema salsugineum]
 gb|ESQ36122.1| hypothetical protein EUTSA_v10009782mg [Eutrema salsugineum]
Length=476

 Score =   484 bits (1245),  Expect = 4e-162, Method: Compositional matrix adjust.
 Identities = 242/450 (54%), Positives = 326/450 (72%), Gaps = 14/450 (3%)
 Frame = -1

Query  1664  YTVVYILRSYLRRRHQCCYMLNYECYKPTDVARRLSTDKSALVVYRNRNLGIDEFRFLLQ  1485
             Y +  I +    +R Q CY+L+Y+C+KPTD  R +ST  S  ++ RN++L ++E++FLL+
Sbjct  14    YLIFKIWKRIDSKRDQNCYILDYQCHKPTD-DRMVSTQFSGEIILRNKHLRLNEYKFLLK  72

Query  1484  TMVNSGVGEQTYIPINVLEGREDSPTLEDSFTEVDDIMFQTLDNLFAKSKVSPREIDvlv  1305
              +V+SG+GEQTY P    EGRE+ PTL+D  +E+++    T+  L  ++K++P +IDVLV
Sbjct  73    AIVSSGIGEQTYAPRLFFEGREERPTLQDGISEMEEFYIDTIAKLLERNKLTPSDIDVLV  132

Query  1304  vnvsllasapsLTSRVVNRYKMREDVKTFNLSGMGCSASVVAIDIVHHLFKVYKNSYAIV  1125
             VNV++L S PSL++R++N YKMRED+K FNL+ MGCSASV++IDIV ++FK YKN  A+V
Sbjct  133   VNVAMLNSTPSLSARIINHYKMREDIKVFNLTAMGCSASVISIDIVKNIFKTYKNKLALV  192

Query  1124  VSTESLGANWYSGKERSMMLSNCLFRSGGCSMLFTNNPALKPRAILKLKHMVRTHIAAID  945
             V++ESL  NWY+G  RSM+L+NCLFRSGGC++L TN  +L  RA+ KLK +VRTH  A +
Sbjct  193   VTSESLSPNWYNGNNRSMILANCLFRSGGCAVLLTNKRSLSQRAMFKLKCLVRTHHGARE  252

Query  944   EAYECCKQVEDPQGFRGFHLSKRLPKVATKALVTNFKVLVPKAIPLWETLRF---LAVSS  774
             ++Y  C Q ED  G  G +L K LPK AT+A V N KV+ PK +P+ E LRF   L +  
Sbjct  253   DSYNACVQKEDELGRVGIYLDKTLPKAATRAFVDNLKVITPKILPVTELLRFMFCLLLKK  312

Query  773   LERRKFK------LPSLLGKPILNMKTGIEHFCLHPGGRAVIDGVGVSLGLSEYDLEPAR  612
             L R   K      +     K  +N KTGI+HFC+H GG+AVID +G SL LSEYDLEPAR
Sbjct  313   LRRNPSKGSTASNVAQAAPKAGINFKTGIDHFCIHTGGKAVIDAIGYSLELSEYDLEPAR  372

Query  611   MSLHRWGNTSAGGLWYVLGYMEAKKRLKKGDRILMLSLGAGFKCNNCVWEVMKDLGD---  441
             M+LHR+GNTSA  LWYVLGYM+AKKRLK+GDR+ M+S GAGFKCN+CVWEV++DL     
Sbjct  373   MTLHRFGNTSASSLWYVLGYMDAKKRLKRGDRVFMISFGAGFKCNSCVWEVVRDLNAGES  432

Query  440   -PNVWEDCIDRYPPETLVNPFTEKFDWIHD  354
               NVW  CID+YPP++L NPF EK+ WI +
Sbjct  433   LGNVWNHCIDQYPPKSLSNPFLEKYGWIRE  462



>emb|CDY15765.1| BnaC04g15590D [Brassica napus]
Length=473

 Score =   482 bits (1241),  Expect = 2e-161, Method: Compositional matrix adjust.
 Identities = 234/427 (55%), Positives = 319/427 (75%), Gaps = 10/427 (2%)
 Frame = -1

Query  1613  CYMLNYECYKPTDVARRLSTDKSALVVYRNRNLGIDEFRFLLQTMVNSGVGEQTYIPINV  1434
             CY+L+Y+C KP+D  R +ST  S  +++RN+ LG++E++FLL+ +V+SG+GEQTY P  V
Sbjct  31    CYILDYQCQKPSD-DRMVSTHFSGEIIHRNKKLGLEEYKFLLKAIVSSGIGEQTYAPRLV  89

Query  1433  LEGREDSPTLEDSFTEVDDIMFQTLDNLFAKSKVSPREIDvlvvnvsllasapsLTSRVV  1254
              EGRE+ PTL+D   E+++    T+  L  + ++SP+E+D+LVVNVS+L S PSL SR++
Sbjct  90    FEGREERPTLQDGILEMEEFYVDTIGKLLERQQISPQEVDILVVNVSMLTSMPSLPSRII  149

Query  1253  NRYKMREDVKTFNLSGMGCSASVVAIDIVHHLFKVYKNSYAIVVSTESLGANWYSGKERS  1074
             N YKMRED+K FNL+GMGCSAS++++DIV ++FK Y N  A+V ++ESL  NWYSG  RS
Sbjct  150   NHYKMREDIKVFNLTGMGCSASLISVDIVKNIFKSYPNKLALVATSESLSPNWYSGNNRS  209

Query  1073  MMLSNCLFRSGGCSMLFTNNPALKPRAILKLKHMVRTHIAAIDEAYECCKQVEDPQGFRG  894
             M+L+NCLFRSGG ++L TN  +L+ +A+ KLK + RTH  A +E+Y CC Q ED QG  G
Sbjct  210   MILANCLFRSGGAAILLTNKRSLRKKAMFKLKCLERTHHGAKEESYNCCIQSEDKQGRVG  269

Query  893   FHLSKRLPKVATKALVTNFKVLVPKAIPLWETLRFLAVSSLERRKFKLPSLLGKPI---L  723
             F+L K LPK AT+ALV N KV+ PK +P+ E LRF+   +  +    LP   G PI   +
Sbjct  270   FYLGKNLPKAATRALVDNLKVIAPKILPVTELLRFMMRQNPSKGSTNLPP--GTPIKAGI  327

Query  722   NMKTGIEHFCLHPGGRAVIDGVGVSLGLSEYDLEPARMSLHRWGNTSAGGLWYVLGYMEA  543
             N KTGIEHFC+H GG+AVIDG+  SL L++YD+EPARM+L+R+GNTSA  LWYVL YMEA
Sbjct  328   NFKTGIEHFCIHTGGKAVIDGIQHSLDLTDYDIEPARMTLYRFGNTSASSLWYVLAYMEA  387

Query  542   KKRLKKGDRILMLSLGAGFKCNNCVWEVMKDL----GDPNVWEDCIDRYPPETLVNPFTE  375
             KKRLK+GDR+ M+S GAGFKCN+CVWEV++DL       NVW  CI+ YPP+++ NPFT+
Sbjct  388   KKRLKRGDRVFMISFGAGFKCNSCVWEVLRDLTTGESKGNVWNHCINDYPPKSISNPFTK  447

Query  374   KFDWIHD  354
              + W+ D
Sbjct  448   MYGWLQD  454



>ref|XP_006304468.1| hypothetical protein CARUB_v10011152mg [Capsella rubella]
 gb|EOA37366.1| hypothetical protein CARUB_v10011152mg [Capsella rubella]
Length=477

 Score =   482 bits (1240),  Expect = 2e-161, Method: Compositional matrix adjust.
 Identities = 240/451 (53%), Positives = 326/451 (72%), Gaps = 15/451 (3%)
 Frame = -1

Query  1664  YTVVYILRSYLRRRHQCCYMLNYECYKPTDVARRLSTDKSALVVYRNRNLGIDEFRFLLQ  1485
             Y    I +    +R Q CY+L+Y+C+KP+D  R ++T  S  V+ RN++L ++E++FLL+
Sbjct  14    YLTFKIWKRIDSKRDQNCYILDYQCHKPSD-DRMVNTQFSGDVILRNKHLRLNEYKFLLK  72

Query  1484  TMVNSGVGEQTYIPINVLEGREDSPTLEDSFTEVDDIMFQTLDNLFAKSKVSPREIDvlv  1305
              +V+SG+GEQTY P    EGRE  PT++D+ +E+++    T++ +  ++K+SP +ID+LV
Sbjct  73    AIVSSGIGEQTYAPRLFFEGREQHPTIQDAISEMEEFYIDTIEKVLERNKISPSDIDILV  132

Query  1304  vnvsllasapsLTSRVVNRYKMREDVKTFNLSGMGCSASVVAIDIVHHLFKVYKNSYAIV  1125
             VNVS+L S PSL++R++N YKMR+D+K FNL+ MGCSASV+AIDIV ++FK YKN  A+V
Sbjct  133   VNVSMLNSTPSLSARIINHYKMRDDIKVFNLTAMGCSASVIAIDIVKNIFKTYKNKLALV  192

Query  1124  VSTESLGANWYSGKERSMMLSNCLFRSGGCSMLFTNNPALKPRAILKLKHMVRTHIAAID  945
             V++ESL  NWYSG  RSM+L+NCLFRSGGC++L TN  +L  RA+ KL+ +VRTH  A D
Sbjct  193   VTSESLSPNWYSGSNRSMILANCLFRSGGCAVLLTNKRSLSRRAMFKLRCLVRTHHGARD  252

Query  944   EAYECCKQVEDPQGFRGFHLSKRLPKVATKALVTNFKVLVPKAIPLWETLRF---LAVSS  774
             +++  C Q ED  G  G HL K LPK AT+A V N KV+ PK +P+ E LRF   L +  
Sbjct  253   DSFNACIQKEDELGHIGVHLDKTLPKAATRAFVDNLKVITPKILPVTELLRFMLCLLIKK  312

Query  773   LERRKFK-------LPSLLGKPILNMKTGIEHFCLHPGGRAVIDGVGVSLGLSEYDLEPA  615
             L +   K        P    K  +N KTGI+HFC+H GG+AVID +G SL L+EYDLEPA
Sbjct  313   LRQNPSKGSNVAQAAPKAGIKAGINFKTGIDHFCIHTGGKAVIDAIGYSLDLNEYDLEPA  372

Query  614   RMSLHRWGNTSAGGLWYVLGYMEAKKRLKKGDRILMLSLGAGFKCNNCVWEVMKDL----  447
             RM+LHR+GNTSA  LWYVLGYMEAKKRL +GDR+ M+S GAGFKCN+CVWEV++DL    
Sbjct  373   RMTLHRFGNTSASSLWYVLGYMEAKKRLMRGDRVFMISFGAGFKCNSCVWEVVRDLNVGE  432

Query  446   GDPNVWEDCIDRYPPETLVNPFTEKFDWIHD  354
                NVW  CID YPP++L+NPF EK+ WI++
Sbjct  433   AKGNVWNHCIDEYPPKSLLNPFFEKYGWINE  463



>gb|EPS63851.1| hypothetical protein M569_10932, partial [Genlisea aurea]
Length=463

 Score =   480 bits (1236),  Expect = 6e-161, Method: Compositional matrix adjust.
 Identities = 245/452 (54%), Positives = 332/452 (73%), Gaps = 6/452 (1%)
 Frame = -1

Query  1694  LVAIYSLLFLYTVVYILRSYLRRRHQCCYMLNYECYKPTDVARRLSTDKSALVVYRNRNL  1515
             LV +Y +  L  + ++ R    RRHQ CY+L+YE +KP+D  R+LST  S  +++RN++L
Sbjct  5     LVLLYFIPLLPLLYFVWRIADERRHQNCYILDYELHKPSD-DRKLSTKHSGEIIFRNKHL  63

Query  1514  GIDEFRFLLQTMVNSGVGEQTYIPINVLEGREDSPTLEDSFTEVDDIMFQTLDNLFAKSK  1335
             GI E++FLL+ +V+SG+GE+TY P  V EGRE SP L D   E+D+    ++  +F ++ 
Sbjct  64    GIQEYQFLLKAVVSSGIGEETYGPRMVFEGRETSPLLSDGILEMDEFFMDSVGEIFRRNG  123

Query  1334  VSPREIDvlvvnvsllasapsLTSRVVNRYKMREDVKTFNLSGMGCSASVVAIDIVHHLF  1155
             +SP EIDVLVVNVS+LA+ PSL++R+VNRYKMREDVK +NL+GMGCSAS+V+++IV  +F
Sbjct  124   ISPSEIDVLVVNVSMLATMPSLSARIVNRYKMREDVKVYNLTGMGCSASLVSVNIVESIF  183

Query  1154  KVYKNSYAIVVSTESLGANWYSGKERSMMLSNCLFRSGGCSMLFTNNPALKPRAILKLKH  975
             K  KN  A+VV++ESL   WY+G ++SM+LSNCLFRSGGC++L TN P+LK +A+L+L+ 
Sbjct  184   KSRKNIQALVVTSESLSLCWYNGNDKSMILSNCLFRSGGCAILLTNKPSLKDKAMLRLRR  243

Query  974   MVRTHIAAIDEAYECCKQVEDPQGFRGFHLSKRLPKVATKALVTNFKVLVPKAIPLWE--  801
             +VRTH  A DE+Y CC Q ED +G  GF+L K LPK A +A   N K + PK +P+ E  
Sbjct  244   LVRTHHGARDESYGCCLQREDDKGNSGFYLGKNLPKAAARAFSENLKTIAPKILPVRELL  303

Query  800   --TLRFLAVSSLERRKFKLPSLLGKPILNMKTGIEHFCLHPGGRAVIDGVGVSLGLSEYD  627
               TL  LA    +R      +   +P+++ K G++HFC+H GG+AVID V  +LGL+EYD
Sbjct  304   RFTLLLLARKLRQRWNKAAAAASARPMIDFKKGVDHFCIHTGGKAVIDAVVQNLGLTEYD  363

Query  626   LEPARMSLHRWGNTSAGGLWYVLGYMEAKKRLKKGDRILMLSLGAGFKCNNCVWEVMKDL  447
             +EPARM+LHR+GNTSA  LWYVLGYMEAKKRLKKGDR+ M+S GAGFKCN+C+WEV++DL
Sbjct  364   VEPARMTLHRFGNTSASSLWYVLGYMEAKKRLKKGDRLFMISFGAGFKCNSCLWEVVRDL  423

Query  446   -GDPNVWEDCIDRYPPETLVNPFTEKFDWIHD  354
              G  NVW D I  YP + L NPF EKF WI +
Sbjct  424   DGKNNVWSDFIHSYPRQDLSNPFLEKFGWIQN  455



>ref|XP_010457975.1| PREDICTED: 3-ketoacyl-CoA synthase 3 [Camelina sativa]
Length=476

 Score =   479 bits (1233),  Expect = 3e-160, Method: Compositional matrix adjust.
 Identities = 241/439 (55%), Positives = 325/439 (74%), Gaps = 15/439 (3%)
 Frame = -1

Query  1628  RRHQCCYMLNYECYKPTDVARRLSTDKSALVVYRNRNLGIDEFRFLLQTMVNSGVGEQTY  1449
             +R Q CY+L+Y+C+KP+D  R ++T  S  V+ RN++L ++E++FLL+ +V+SG+GEQTY
Sbjct  26    KRDQNCYILDYQCHKPSD-DRMVNTQFSGDVILRNKHLQLNEYKFLLKAIVSSGIGEQTY  84

Query  1448  IPINVLEGREDSPTLEDSFTEVDDIMFQTLDNLFAKSKVSPREIDvlvvnvsllasapsL  1269
              P    EGRE SPTL+D+ +E+++    T++ +  ++K+SP +ID+LVVNVS+L S PSL
Sbjct  85    APRLFFEGREQSPTLQDAISEMEEFYIDTIEKVLERNKISPSDIDILVVNVSMLNSTPSL  144

Query  1268  TSRVVNRYKMREDVKTFNLSGMGCSASVVAIDIVHHLFKVYKNSYAIVVSTESLGANWYS  1089
             ++R++N YKMR+D+K FNL+ MGCSASV+++DIV ++FK YKN  A+VV++ESL  NWYS
Sbjct  145   SARIINHYKMRDDIKVFNLTAMGCSASVISVDIVKNMFKTYKNKLALVVTSESLSPNWYS  204

Query  1088  GKERSMMLSNCLFRSGGCSMLFTNNPALKPRAILKLKHMVRTHIAAIDEAYECCKQVEDP  909
             G  RSM+L+NCLFRSGGC++L TN  +L  RA+ KLK +VRTH  A D++Y  C Q ED 
Sbjct  205   GSNRSMILANCLFRSGGCAVLLTNKRSLSRRAMFKLKCLVRTHHGARDDSYSACVQKEDE  264

Query  908   QGFRGFHLSKRLPKVATKALVTNFKVLVPKAIPLWETLRFLAV----------SSLERRK  759
              G  G HL K LPK AT+A V N KV+ PK +P+ E LRF+            S      
Sbjct  265   LGHIGVHLDKTLPKAATRAFVDNLKVITPKILPVTELLRFMLCLLLKKLRKNPSKGSNVA  324

Query  758   FKLPSLLGKPILNMKTGIEHFCLHPGGRAVIDGVGVSLGLSEYDLEPARMSLHRWGNTSA  579
                P    K  +N KTGI+HFC+H GG+AVID +G SL LSEYDLEPARM+LHR+GNTSA
Sbjct  325   QAAPKAGIKAGINFKTGIDHFCIHTGGKAVIDAIGYSLDLSEYDLEPARMTLHRFGNTSA  384

Query  578   GGLWYVLGYMEAKKRLKKGDRILMLSLGAGFKCNNCVWEVMKDL--GDP--NVWEDCIDR  411
               LWYVLGYMEAKKRLK+GDR+ M+S GAGFKCN+CVWEV++DL  G+   NVW  CID+
Sbjct  385   SSLWYVLGYMEAKKRLKRGDRVFMISFGAGFKCNSCVWEVVRDLNVGEAIGNVWNHCIDQ  444

Query  410   YPPETLVNPFTEKFDWIHD  354
             YPP++L+NPF EK+ WI++
Sbjct  445   YPPKSLLNPFFEKYGWINE  463



>ref|XP_011089840.1| PREDICTED: 3-ketoacyl-CoA synthase 12-like [Sesamum indicum]
Length=482

 Score =   479 bits (1233),  Expect = 3e-160, Method: Compositional matrix adjust.
 Identities = 237/436 (54%), Positives = 316/436 (72%), Gaps = 5/436 (1%)
 Frame = -1

Query  1652  YILRSYLRRRHQCCYMLNYECYKPTDVARRLSTDKSALVVYRNRNLGIDEFRFLLQTMVN  1473
             YIL   L  R   CY+L+YECY PTD  R+L+T  S  V+ RN+ LG+ E++FLL+ +VN
Sbjct  35    YILWRSLGWRRNRCYILDYECYMPTD-DRKLTTKFSGEVIMRNKLLGLHEYKFLLKAIVN  93

Query  1472  SGVGEQTYIPINVLEGREDSPTLEDSFTEVDDIMFQTLDNLFAKSKVSPREIDvlvvnvs  1293
             SG+GE+TY P  V +GRE+S TL+D   E+D+    ++D LF ++ + P EIDVLVVN+S
Sbjct  94    SGIGEETYAPKMVFDGREESATLDDGRLEMDEFFLASIDKLFKRTGIPPSEIDVLVVNIS  153

Query  1292  llasapsLTSRVVNRYKMREDVKTFNLSGMGCSASVVAIDIVHHLFKVYKNSYAIVVSTE  1113
             +L++ PSL++RV+N YKMREDVK +NLSGMGCSAS+++I IV ++ K   N  A+VV++E
Sbjct  154   MLSTIPSLSARVINIYKMREDVKVYNLSGMGCSASLISIHIVQNICKTRGNVQALVVTSE  213

Query  1112  SLGANWYSGKERSMMLSNCLFRSGGCSMLFTNNPALKPRAILKLKHMVRTHIAAIDEAYE  933
             SL  NWY+G ERSM+LSNCLFR+GGC+M+ TN  +LK +A+ KLK +VRTH    DE+Y 
Sbjct  214   SLSQNWYTGNERSMILSNCLFRTGGCTMILTNKDSLKNKAMFKLKCLVRTHHGWKDESYG  273

Query  932   CCKQVEDPQGFRGFHLSKRLPKVATKALVTNFKVLVPKAIPLWETLRFLAVSSLERRKFK  753
             CC Q ED +G  GFHL K LPK AT A V N K + PK +P+ E LRF  +        K
Sbjct  274   CCLQKEDEKGLVGFHLGKNLPKAATSAFVDNLKEIAPKILPVHELLRFTLLKFAPELHHK  333

Query  752   LPSLL----GKPILNMKTGIEHFCLHPGGRAVIDGVGVSLGLSEYDLEPARMSLHRWGNT  585
                        P+++ +TG++HFCLH GG+AVID V  +L LSEYD+EPARM+LHR+GNT
Sbjct  334   WSKTAAGTSASPLVDFRTGVDHFCLHTGGKAVIDAVAQNLSLSEYDVEPARMTLHRFGNT  393

Query  584   SAGGLWYVLGYMEAKKRLKKGDRILMLSLGAGFKCNNCVWEVMKDLGDPNVWEDCIDRYP  405
             SA  +WYVL YME+KKRLKKGDR+ M+S GAGFKCN+C+WEV++DL   NVW++ ID YP
Sbjct  394   SASSMWYVLAYMESKKRLKKGDRVFMISFGAGFKCNSCLWEVVRDLEGNNVWKNFIDSYP  453

Query  404   PETLVNPFTEKFDWIH  357
             P+   NPF E++ W+H
Sbjct  454   PKNSANPFMEEYGWLH  469



>ref|XP_010542615.1| PREDICTED: 3-ketoacyl-CoA synthase 12-like [Tarenaya hassleriana]
Length=476

 Score =   479 bits (1232),  Expect = 3e-160, Method: Compositional matrix adjust.
 Identities = 244/448 (54%), Positives = 330/448 (74%), Gaps = 12/448 (3%)
 Frame = -1

Query  1664  YTVVYILRSYLRRRHQCCYMLNYECYKPTDVARRLSTDKSALVVYRNRNLGIDEFRFLLQ  1485
             Y +  I +    +R Q CY+L+YECYKP+D    +ST  S  ++ RN+NLG++EF+FLL+
Sbjct  14    YLIFKIWKFIDSKRDQECYILDYECYKPSD-DLMVSTHLSGEIIRRNKNLGLNEFKFLLK  72

Query  1484  TMVNSGVGEQTYIPINVLEGREDSPTLEDSFTEVDDIMFQTLDNLFAKSKVSPREIDvlv  1305
              +V+SG+GEQTY P  VL+GRE++PT+ D   E+++    ++  L  ++ VSPRE+DVLV
Sbjct  73    AIVSSGIGEQTYAPRLVLQGREENPTVRDGIEEMEEFYTDSVGKLLRRNGVSPREVDVLV  132

Query  1304  vnvsllasapsLTSRVVNRYKMREDVKTFNLSGMGCSASVVAIDIVHHLFKVYKNSYAIV  1125
             VNVS+LAS PSL+SR++N YKMREDVK FNL+GMGCSAS+++I+IV ++FK Y N  A+V
Sbjct  133   VNVSMLASVPSLSSRIINHYKMREDVKVFNLTGMGCSASLISIEIVKNIFKSYMNMTALV  192

Query  1124  VSTESLGANWYSGKERSMMLSNCLFRSGGCSMLFTNNPALKPRAILKLKHMVRTHIAAID  945
             V++E L  NWYSG  RSM+L+NCLFR GGC++L TNN +L  RA+ +LK MVRTH  + D
Sbjct  193   VTSECLSPNWYSGNNRSMILANCLFRLGGCAILLTNNRSLSTRAMFRLKCMVRTHHGSRD  252

Query  944   EAYECCKQVEDPQGFRGFHLSKRLPKVATKALVTNFKVLVPKAIPLWETLRFL------A  783
             ++Y CC Q ED  G  G HL K LPKVAT+A V N +V+ PK +P+ E L+F+       
Sbjct  253   DSYNCCVQREDEHGRVGIHLDKSLPKVATRAFVENLRVITPKILPVTELLKFMLRLMAKR  312

Query  782   VSSLERRKFKLPSLLGKPILNMKTGIEHFCLHPGGRAVIDGVGVSLGLSEYDLEPARMSL  603
             +S   R+     +L  K  ++ K GI+HFC+H GG+AVIDG+G SL LSEYDL+PARM+L
Sbjct  313   ISRNPRKGSSATNLAPKIGIDYKRGIDHFCIHTGGKAVIDGIGYSLDLSEYDLKPARMTL  372

Query  602   HRWGNTSAGGLWYVLGYMEAKKRLKKGDRILMLSLGAGFKCNNCVWEVMK-----DLGDP  438
             HR+GNTSA  LWYVL YMEAKKRLK+G+R+ M+S GAGFKCN+CVWE+++     D GD 
Sbjct  373   HRFGNTSASSLWYVLAYMEAKKRLKRGERVFMISFGAGFKCNSCVWEIVRDLGLDDDGDG  432

Query  437   NVWEDCIDRYPPETLVNPFTEKFDWIHD  354
             NVW+ CID YPP+++ NPF EK+ WI +
Sbjct  433   NVWKHCIDDYPPKSISNPFLEKYGWIQN  460



>ref|NP_172251.1| 3-ketoacyl-CoA synthase 3 [Arabidopsis thaliana]
 sp|Q9LQP8.3|KCS3_ARATH RecName: Full=3-ketoacyl-CoA synthase 3; Short=KCS-3; AltName: 
Full=Very long-chain fatty acid condensing enzyme 3; Short=VLCFA 
condensing enzyme 3; Flags: Precursor [Arabidopsis thaliana]
 gb|AAF75082.1|AC007583_18 Contains similarity to fatty acid elongase 3-ketoacyl-CoA synthase 
1 from Arabidopsis thaliana gb|AF053345. It contains chalcone 
and stilbene synthases domain PF|00195 [Arabidopsis 
thaliana]
 gb|AAL16279.1|AF428349_1 At1g07720/F24B9_16 [Arabidopsis thaliana]
 gb|AAL32778.1| Unknown protein [Arabidopsis thaliana]
 gb|AAM91194.1| unknown protein [Arabidopsis thaliana]
 gb|AEE28169.1| 3-ketoacyl-CoA synthase 3 [Arabidopsis thaliana]
Length=478

 Score =   478 bits (1230),  Expect = 9e-160, Method: Compositional matrix adjust.
 Identities = 239/452 (53%), Positives = 330/452 (73%), Gaps = 16/452 (4%)
 Frame = -1

Query  1664  YTVVYILRSYLRRRHQCCYMLNYECYKPTDVARRLSTDKSALVVYRNRNLGIDEFRFLLQ  1485
             Y +  I +    +R Q CY+L+Y+C+KP+D  R ++T  S  ++ RN++L ++E++FLL+
Sbjct  14    YLIFKIWKRIDSKRDQNCYILDYQCHKPSD-DRMVNTQFSGDIILRNKHLRLNEYKFLLK  72

Query  1484  TMVNSGVGEQTYIPINVLEGREDSPTLEDSFTEVDDIMFQTLDNLFAKSKVSPREIDvlv  1305
              +V+SG+GEQTY P    EGRE  PTL+D  +E+++    T++ +  ++K+SP EID+LV
Sbjct  73    AIVSSGIGEQTYAPRLFFEGREQRPTLQDGLSEMEEFYIDTIEKVLKRNKISPSEIDILV  132

Query  1304  vnvsllasapsLTSRVVNRYKMREDVKTFNLSGMGCSASVVAIDIVHHLFKVYKNSYAIV  1125
             VNVS+L S PSL++R++N YKMRED+K FNL+ MGCSASV++IDIV ++FK YKN  A+V
Sbjct  133   VNVSMLNSTPSLSARIINHYKMREDIKVFNLTAMGCSASVISIDIVKNIFKTYKNKLALV  192

Query  1124  VSTESLGANWYSGKERSMMLSNCLFRSGGCSMLFTNNPALKPRAILKLKHMVRTHIAAID  945
             V++ESL  NWYSG  RSM+L+NCLFRSGGC++L TN  +L  RA+ KL+ +VRTH  A D
Sbjct  193   VTSESLSPNWYSGNNRSMILANCLFRSGGCAVLLTNKRSLSRRAMFKLRCLVRTHHGARD  252

Query  944   EAYECCKQVEDPQGFRGFHLSKRLPKVATKALVTNFKVLVPKAIPLWETLRFLAVSSLER  765
             +++  C Q ED  G  G HL K LPK AT+A + N KV+ PK +P+ E LRF+    L++
Sbjct  253   DSFNACVQKEDELGHIGVHLDKTLPKAATRAFIDNLKVITPKILPVTELLRFMLCLLLKK  312

Query  764   RKFK-----------LPSLLGKPILNMKTGIEHFCLHPGGRAVIDGVGVSLGLSEYDLEP  618
              +              P    K  +N KTGI+HFC+H GG+AVID +G SL L+EYDLEP
Sbjct  313   LRSSPSKGSTNVTQAAPKAGVKAGINFKTGIDHFCIHTGGKAVIDAIGYSLDLNEYDLEP  372

Query  617   ARMSLHRWGNTSAGGLWYVLGYMEAKKRLKKGDRILMLSLGAGFKCNNCVWEVMKDL--G  444
             ARM+LHR+GNTSA  LWYVLGYMEAKKRLK+GDR+ M+S GAGFKCN+CVWEV++DL  G
Sbjct  373   ARMTLHRFGNTSASSLWYVLGYMEAKKRLKRGDRVFMISFGAGFKCNSCVWEVVRDLNVG  432

Query  443   DP--NVWEDCIDRYPPETLVNPFTEKFDWIHD  354
             +   NVW  CI++YPP++++NPF EK+ WIH+
Sbjct  433   EAVGNVWNHCINQYPPKSILNPFFEKYGWIHE  464



>ref|XP_010487912.1| PREDICTED: 3-ketoacyl-CoA synthase 3-like [Camelina sativa]
Length=476

 Score =   477 bits (1227),  Expect = 2e-159, Method: Compositional matrix adjust.
 Identities = 239/439 (54%), Positives = 323/439 (74%), Gaps = 15/439 (3%)
 Frame = -1

Query  1628  RRHQCCYMLNYECYKPTDVARRLSTDKSALVVYRNRNLGIDEFRFLLQTMVNSGVGEQTY  1449
             +R Q CY+L+Y+C+KP+D  R +ST  S  ++ RN++L ++E++FLL+ +V+SG+GEQTY
Sbjct  26    KRDQNCYILDYQCHKPSD-DRMVSTKFSGDIILRNKHLQLNEYKFLLKAIVSSGIGEQTY  84

Query  1448  IPINVLEGREDSPTLEDSFTEVDDIMFQTLDNLFAKSKVSPREIDvlvvnvsllasapsL  1269
              P    EGRE SPTL+D+ +E+++    T++ +  ++K+SP +ID+LVVNVS+  S PSL
Sbjct  85    APRLFFEGREQSPTLQDAISEMEEFYIDTIEKVLERNKISPSDIDILVVNVSMFNSTPSL  144

Query  1268  TSRVVNRYKMREDVKTFNLSGMGCSASVVAIDIVHHLFKVYKNSYAIVVSTESLGANWYS  1089
             ++R++N YKMR+D+K FNL+ MGCSASV+++DIV ++ K YKN  A+VV++ESL  NWYS
Sbjct  145   SARIINHYKMRDDIKVFNLTAMGCSASVISVDIVKNILKTYKNKLALVVTSESLSPNWYS  204

Query  1088  GKERSMMLSNCLFRSGGCSMLFTNNPALKPRAILKLKHMVRTHIAAIDEAYECCKQVEDP  909
             G  RSM+L+NCLFRSGGC++L TN  +L  RA+ KLK +VRTH  A D++Y  C Q ED 
Sbjct  205   GSNRSMILANCLFRSGGCAVLLTNKRSLSRRAMFKLKCLVRTHHGARDDSYSACVQKEDE  264

Query  908   QGFRGFHLSKRLPKVATKALVTNFKVLVPKAIPLWETLRFLAV----------SSLERRK  759
              G  G HL K LPK AT+A V N KV+ PK +P+ E LRF+            S      
Sbjct  265   LGHIGVHLDKTLPKAATRAFVDNLKVITPKILPVTELLRFMLCLLLKKLRKTPSKGSNVA  324

Query  758   FKLPSLLGKPILNMKTGIEHFCLHPGGRAVIDGVGVSLGLSEYDLEPARMSLHRWGNTSA  579
                P    K  +N KTGI+HFC+H GG+AVID +G SL LSEYDLEPARM+LHR+GNTSA
Sbjct  325   QAAPKAGIKAGINFKTGIDHFCIHTGGKAVIDAIGYSLDLSEYDLEPARMTLHRFGNTSA  384

Query  578   GGLWYVLGYMEAKKRLKKGDRILMLSLGAGFKCNNCVWEVMKDL--GDP--NVWEDCIDR  411
               LWYVLGYMEAKKRLK+GDR+ M+S GAGFKCN+CVWEV++DL  G+   NVW  CID+
Sbjct  385   SSLWYVLGYMEAKKRLKRGDRVFMISFGAGFKCNSCVWEVVRDLNVGEAIGNVWNHCIDQ  444

Query  410   YPPETLVNPFTEKFDWIHD  354
             YPP++L+NPF EK+ WI++
Sbjct  445   YPPKSLLNPFFEKYGWINE  463



>ref|XP_006379567.1| hypothetical protein POPTR_0008s04840g, partial [Populus trichocarpa]
 gb|ERP57364.1| hypothetical protein POPTR_0008s04840g, partial [Populus trichocarpa]
Length=372

 Score =   471 bits (1212),  Expect = 1e-158, Method: Compositional matrix adjust.
 Identities = 246/387 (64%), Positives = 304/387 (79%), Gaps = 19/387 (5%)
 Frame = -1

Query  1568  RRLSTDKSALVVYRNRNLGIDEFRFLLQTMVNSGVGEQTYIPINVLEGREDSPTLEDSFT  1389
             R+L TD  A +V RN+NLG+ E++FLL+T+V+SG+GE+TY P NV+ G+EDSPTL+DS +
Sbjct  2     RKLDTDTCARIVLRNKNLGLQEYKFLLKTIVSSGIGEETYGPRNVISGQEDSPTLKDSIS  61

Query  1388  EVDDIMFQTLDNLFAKSKVSPREIDvlvvnvsllasapsLTSRVVNRYKMREDVKTFNLS  1209
             E+D ++F TLD LFAK+ +SP EIDVLVVNVSL + APSLT+RVVNRYKMR +VKTFNLS
Sbjct  62    EMDGLIFDTLDKLFAKTGISPSEIDVLVVNVSLFSPAPSLTARVVNRYKMRSNVKTFNLS  121

Query  1208  GMGCSASVVAIDIVHHLFKVYKNSYAIVVSTESLGANWYSGKERSMMLSNCLFRSGGCSM  1029
             GMGCSAS+VAID+V HLFK YKN++AIVVSTESLG+NWY GKE+SMMLS CLFRSGGCSM
Sbjct  122   GMGCSASIVAIDLVQHLFKSYKNAFAIVVSTESLGSNWYQGKEKSMMLSICLFRSGGCSM  181

Query  1028  LFTNNPALKPRAILKLKHMVRTHIAAIDEAYECCKQVEDPQGFRGFHLSKRLPKVATKAL  849
             LFTNN ALK +AI +LKH+VRTH+ + DEAY CC QV D  G++GF L++ L   A KAL
Sbjct  182   LFTNNSALKHQAIFRLKHVVRTHLGSNDEAYGCCIQVADDLGYKGFLLTRSLKISAAKAL  241

Query  848   VTNFKVLVPKAIPLWETLRFLAVSSLERRKFKLPSL--LGKPILNMKTGIEHFCLHPGGR  675
               N +VL+PK +PL E LR++ VS  ++ K K  SL  +G   LN+KTG++ FC+HPGGR
Sbjct  242   AANLRVLLPKILPLSEQLRYVYVSR-QQNKTKRNSLQEMGAG-LNLKTGVDPFCVHPGGR  299

Query  674   AVIDGVGVSLGLSEYDLEPARMSLHRWGNTSAGGLWYVLGYMEAKKRLKKGDRILMLSLG  495
             A+ID VG SL LS YDLEPARM+LHR+GNTSAGGLWYVL Y     RL +G R       
Sbjct  300   AIIDEVGKSLSLSNYDLEPARMALHRFGNTSAGGLWYVLAY-----RLSRGLR-------  347

Query  494   AGFKCNNCVWEVMKDLGDPNVWEDCID  414
                KCNNCV+EVM+DL D  VW+D I+
Sbjct  348   ---KCNNCVFEVMRDLKDATVWKDSIE  371



>ref|XP_010682269.1| PREDICTED: 3-ketoacyl-CoA synthase 12-like [Beta vulgaris subsp. 
vulgaris]
Length=483

 Score =   473 bits (1216),  Expect = 1e-157, Method: Compositional matrix adjust.
 Identities = 246/462 (53%), Positives = 335/462 (73%), Gaps = 19/462 (4%)
 Frame = -1

Query  1691  VAIYSLLFLYTVVYILRSYLR----RRHQCCYMLNYECYKPTDVARRLSTDKSALVVYRN  1524
             +  + L+ L+  +Y L  +L+     RHQ CY+L YEC+KP +  R+LST  SA +++RN
Sbjct  1     MGFFILVLLFPSLYFLFHFLKWVCIERHQNCYILGYECFKPNN-DRKLSTKLSAQIMFRN  59

Query  1523  RNLGIDEFRFLLQTMVNSGVGEQTYIPINVLEGREDSPTLEDSFTEVDDIMFQ--TLDNL  1350
             +NLG+D ++FLL+T+V +G+GE+TY P +++ GRE+ PTL DS  E+D+  FQ  ++  L
Sbjct  60    QNLGLDNYKFLLKTVVRAGLGEETYAPRSIIMGREERPTLADSLNEMDEF-FQDSSIAKL  118

Query  1349  FAKSKVSPREIDvlvvnvsllasapsLTSRVVNRYKMREDVKTFNLSGMGCSASVVAIDI  1170
             F+ S++SP++IDVLVVNVS+ AS PSL SR+VN YKMR+DVK  NLSGMGCSAS++++ +
Sbjct  119   FSNSEISPQDIDVLVVNVSMFASTPSLASRIVNHYKMRDDVKVCNLSGMGCSASLISLSV  178

Query  1169  VHHLFKVYKNSYAIVVSTESLGANWYSGKERSMMLSNCLFRSGGCSMLFTNNPALKPRAI  990
             V + FKV K+ YA++V++ESL  NWYSG +RSM+LSN LFRSGG ++L TN   L+ +A+
Sbjct  179   VQNHFKVQKDCYALIVTSESLSPNWYSGNDRSMILSNSLFRSGGSAILLTNKWCLRKKAM  238

Query  989   LKLKHMVRTHIAAIDEAYECCKQVEDPQGFRGFHLSKRLPKVATKALVTNFKVLVPKAIP  810
             LKLK +VR H  +IDE+YE C QVED  G  GF L K LPK AT+ LV N K L PK +P
Sbjct  239   LKLKCLVRMHHGSIDESYESCMQVEDSAGKLGFRLYKGLPKTATRCLVDNLKNLAPKILP  298

Query  809   LWETLRFLAVSSLERRKFKLPSLLG---------KPILNMKTGIEHFCLHPGGRAVIDGV  657
             + E +RF    ++ R  +K P   G         +P +N KTG+EHFC H GG+AVIDG+
Sbjct  299   IRELVRFAVAVTVWRYIWK-PIKHGCTRTMEQSNRPTINFKTGVEHFCFHTGGKAVIDGL  357

Query  656   GVSLGLSEYDLEPARMSLHRWGNTSAGGLWYVLGYMEAKKRLKKGDRILMLSLGAGFKCN  477
               SL L EYD+EPARM+LHR+GNTSA  LWYVLGYMEAKKRLK+G ++LM+  G+GF+CN
Sbjct  358   RESLKLEEYDVEPARMTLHRFGNTSACSLWYVLGYMEAKKRLKRGHKVLMIGFGSGFQCN  417

Query  476   NCVWEVMKDL-GDPNVWEDCIDRYPPETLVNPFTEKFDWIHD  354
             +C+WEV++DL G  NVW D I  YP + L NP+ E+  WIH+
Sbjct  418   SCLWEVVRDLDGVDNVWSDFIRDYPSKGLANPYLEQLGWIHN  459



>gb|EPS61832.1| hypothetical protein M569_12961, partial [Genlisea aurea]
Length=457

 Score =   468 bits (1204),  Expect = 3e-156, Method: Compositional matrix adjust.
 Identities = 235/449 (52%), Positives = 327/449 (73%), Gaps = 10/449 (2%)
 Frame = -1

Query  1694  LVAIYSLLFLYTVVYILRSYLRRRHQCCYMLNYECYKPTDVARRLSTDKSALVVYRNRNL  1515
             L +I  L+ ++T++       RR H+ CY+L+Y+CYKP D  R++ST  S  V+ RN+ L
Sbjct  1     LCSIPLLVLIWTLLE------RRMHRNCYILDYQCYKPAD-DRKISTKFSGEVILRNKQL  53

Query  1514  GIDEFRFLLQTMVNSGVGEQTYIPINVLEGREDSPTLEDSFTEVDDIMFQTLDNLFAKSK  1335
             GI E++FLL+ +V+SG+GE+TY P  V EGRE SP L D   E+D+    ++  L A++ 
Sbjct  54    GIREYKFLLKAIVSSGIGEETYGPKMVFEGRETSPELSDGILEMDEFFLDSVGKLLARNG  113

Query  1334  VSPREIDvlvvnvsllasapsLTSRVVNRYKMREDVKTFNLSGMGCSASVVAIDIVHHLF  1155
             V+  EIDVLVVNVS+LA+ PS+++R++N Y MREDVK +N+SGMGCSAS+++I++V  +F
Sbjct  114   VAASEIDVLVVNVSMLAAVPSMSARIINHYGMREDVKVYNISGMGCSASLISINLVESIF  173

Query  1154  KVYKNSYAIVVSTESLGANWYSGKERSMMLSNCLFRSGGCSMLFTNNPALKPRAILKLKH  975
             +  +N  A+VV++ESL   WY+G++RSM+L NCLFR GGC++L TN+PA+K RA+ KL  
Sbjct  174   RCRRNVRALVVASESLSLGWYAGRDRSMILPNCLFRVGGCAILLTNSPAMKHRAMFKLSR  233

Query  974   MVRTHIAAIDEAYECCKQVEDPQGFRGFHLSKRLPKVATKALVTNFKVLVPKAIPLWETL  795
             +VRTH  A DE+YE C Q ED  G  GF+L K LPK AT+A   N K + PK +P+ E L
Sbjct  234   LVRTHHGARDESYESCLQREDEDGVSGFYLGKNLPKAATRAFSDNLKTIAPKILPVRELL  293

Query  794   RFLAVSSLERRKFKLPSLLGKPILNMKTGIEHFCLHPGGRAVIDGVGVSLGLSEYDLEPA  615
             RF+ +  L  R  +  +   +P ++ KTG++HFC+H GG+AVIDGV  +LGL+E+D+EPA
Sbjct  294   RFVLL-KLRHRWSRKSAAAPRPTIDFKTGVDHFCIHTGGKAVIDGVMQNLGLTEHDVEPA  352

Query  614   RMSLHRWGNTSAGGLWYVLGYMEAKKRLKKGDRILMLSLGAGFKCNNCVWEVMKDL-GDP  438
             RM+LHR+GNTSA  +WYVLGYMEAK RLK+GDR+ M+S GAGFKCN+CVWEV++DL G+ 
Sbjct  353   RMTLHRFGNTSASSVWYVLGYMEAKGRLKRGDRVFMISFGAGFKCNSCVWEVVRDLAGED  412

Query  437   NVWEDCIDRYPPETL-VNPFTEKFDWIHD  354
              VW++ I  YP   L  NPF EK+ WI D
Sbjct  413   GVWKEFIHGYPKRDLNNNPFLEKYGWIQD  441



>ref|XP_010558801.1| PREDICTED: 3-ketoacyl-CoA synthase 21-like [Tarenaya hassleriana]
Length=472

 Score =   468 bits (1203),  Expect = 7e-156, Method: Compositional matrix adjust.
 Identities = 241/462 (52%), Positives = 331/462 (72%), Gaps = 9/462 (2%)
 Frame = -1

Query  1703  METLVAIYSLLFLYTVVYILRSYLRRRHQCCYMLNYECYKPTDVARRLSTDKSALVVYRN  1524
             ME LV     L  Y    +L+S L RR++ C+ML+Y CY       +L       V+ RN
Sbjct  1     MEFLVLACLSLLSYATFCLLKSLLDRRNRSCFMLHYGCYNGKH-ETKLDNKTLMQVLSRN  59

Query  1523  RNLGIDEFRFLLQTMVNSGVGEQTYIPINVLEGREDSPTLEDSFTEVDDIMFQTLDNLFA  1344
             ++L ++++RFL++TMVNSG+GE+TY P N +E RE+ PTL D+ +E+D I+F  LDNLFA
Sbjct  60    KDLDLEDYRFLVRTMVNSGLGEETYGPRNFVE-REERPTLHDAHSEMDKILFDLLDNLFA  118

Query  1343  KSKVSPREIDvlvvnvsllasapsLTSRVVNRYKMREDVKTFNLSGMGCSASVVAIDIVH  1164
             K+ +SP EID+L+VNVSL A  PSL SRV++RYKMRED+K++NLSG+GC+AS +AID+  
Sbjct  119   KTGISPSEIDILIVNVSLFAPVPSLASRVISRYKMREDIKSYNLSGLGCAASSIAIDLAQ  178

Query  1163  HLFKVYKNSYAIVVSTESLGANWYSGKERSMMLSNCLFRSGGCSMLFTNNPALKPRAILK  984
              +FK+YKN+ AIV+STES+G N Y GK RSM+L NC FR GG S L TNN  +K RAI+K
Sbjct  179   RMFKMYKNATAIVLSTESIGPNIYYGKNRSMILPNCFFRVGGSSFLLTNNAKMKNRAIMK  238

Query  983   LKHMVRTHIAAIDEAYECCKQVEDPQGFRGFHLSKRLPKVATKALVTNFKVLVPKAIPLW  804
             LK++VRTHI + DEAY CC Q+ED +G RG   +K L     +AL  N KVL+PK +P+ 
Sbjct  239   LKNVVRTHIGSDDEAYACCMQMEDAEGLRGVQQTKHLKNAGVRALNKNLKVLLPKVLPMK  298

Query  803   ETLRFLAVSSLERR-KFKLPSLLGKPILNMKTGIEHFCLHPGGRAVIDGVGVSLGLSEYD  627
             E  R++ V SL ++ K + P  LG   LN+KTG++HFC+ P  RA I+ +G SLGL+EYD
Sbjct  299   ELFRYVIVRSLGKKTKGETPGGLG---LNLKTGLKHFCIQPTTRANIEAIGKSLGLNEYD  355

Query  626   LEPARMSLHRWGNTSAGGLWYVLGYMEAKKRLKKGDRILMLSLGAGFKCNNCVWEVMKDL  447
             +EP+R++LHR+GNTS+ G+WYV GYMEAKKRLKKGD++L++ L AG +  N VWE+MKD+
Sbjct  356   IEPSRVALHRFGNTSSCGVWYVFGYMEAKKRLKKGDKVLVMGLSAGVESVNSVWEIMKDI  415

Query  446   GDPNVWEDCIDRYPPETLVNP--FTEKFDWIHDPCLNFLRSI  327
              + NVW D  + Y PE LV+P  F   + WI+D  L+  +++
Sbjct  416   DEENVWSDSAEHY-PEMLVSPNLFELNYGWINDQTLSLSQAV  456



>ref|XP_002326030.2| hypothetical protein POPTR_0019s12140g [Populus trichocarpa]
 gb|EEF00412.2| hypothetical protein POPTR_0019s12140g [Populus trichocarpa]
Length=368

 Score =   463 bits (1192),  Expect = 1e-155, Method: Compositional matrix adjust.
 Identities = 227/357 (64%), Positives = 284/357 (80%), Gaps = 1/357 (0%)
 Frame = -1

Query  1400  DSFTEVDDIMFQTLDNLFAKSKVSPREIDvlvvnvsllasapsLTSRVVNRYKMREDVKT  1221
             D+ +E+DDI+F TLD LFAK+ VSP EID++V +VSL + APSL++RV+ RYKMR+D+K 
Sbjct  2     DALSEMDDIIFDTLDKLFAKTGVSPSEIDIIVASVSLFSPAPSLSARVIKRYKMRKDIKA  61

Query  1220  FNLSGMGCSASVVAIDIVHHLFKVYKNSYAIVVSTESLGANWYSGKERSMMLSNCLFRSG  1041
             FNLSGMGCSASVVA+D+V  LFK Y+NS+AIVVSTES+G NWYSGKE+SMMLSN LFR+G
Sbjct  62    FNLSGMGCSASVVAVDLVKQLFKTYRNSFAIVVSTESIGPNWYSGKEKSMMLSNILFRTG  121

Query  1040  GCSMLFTNNPALKPRAILKLKHMVRTHIAAIDEAYECCKQVEDPQGFRGFHLSKRLPKVA  861
             GCSML TNN AL  +A+L+L   VRTHI +  EAY  C QVED  G +GF L++ LP+  
Sbjct  122   GCSMLLTNNRALNEKALLELTCAVRTHIGSDHEAYSSCIQVEDDLGNKGFRLTRDLPRAG  181

Query  860   TKALVTNFKVLVPKAIPLWETLRF-LAVSSLERRKFKLPSLLGKPILNMKTGIEHFCLHP  684
              KAL    +VL+PK +PL E LR+ ++    +  K   P  +  P LN+K+GI+HFC+HP
Sbjct  182   AKALTMILRVLLPKVLPLSEMLRYKISYYRNKITKRSTPKGIAGPGLNLKSGIDHFCVHP  241

Query  683   GGRAVIDGVGVSLGLSEYDLEPARMSLHRWGNTSAGGLWYVLGYMEAKKRLKKGDRILML  504
             GGRA+ID VG SL L+++DLEPARM+L+R+GNTS+GGLWYVLGYMEAKK LKKG+ ILM+
Sbjct  242   GGRAIIDEVGKSLALNDHDLEPARMALYRFGNTSSGGLWYVLGYMEAKKMLKKGETILMI  301

Query  503   SLGAGFKCNNCVWEVMKDLGDPNVWEDCIDRYPPETLVNPFTEKFDWIHDPCLNFLR  333
             SLGAGFKC NCVW+VMKD+ D NVW+DCID YPP TL NPF+EKFDWI+D  + F R
Sbjct  302   SLGAGFKCYNCVWKVMKDMEDTNVWKDCIDHYPPNTLANPFSEKFDWINDESMRFAR  358



>gb|AGT16173.1| acyltransferase [Saccharum hybrid cultivar R570]
Length=468

 Score =   466 bits (1200),  Expect = 2e-155, Method: Compositional matrix adjust.
 Identities = 228/436 (52%), Positives = 306/436 (70%), Gaps = 11/436 (3%)
 Frame = -1

Query  1631  RRRHQCCYMLNYECYKPTDVARRLSTDKSALVVYRNRNLGIDEFRFLLQTMVNSGVGEQT  1452
             RRR   CY+L+Y C+KP D  R+LST+ +  V+ RN  LG+ ++RFLL+ +V SG+GE+T
Sbjct  26    RRRQSRCYLLDYVCHKPRD-DRKLSTETAGDVIQRNARLGLTDYRFLLRVIVRSGIGEET  84

Query  1451  YIPINVLEGREDSPTLEDSFTEVDDIMFQTLDNLFAKSKVSPREIDvlvvnvsllasaps  1272
             Y P N+L GREDSPTL DS  E+D    + +  LFA++  +PR++DVLV NVS+L+ +PS
Sbjct  85    YAPRNILAGREDSPTLRDSLEEMDAFFDEAIAELFARTGFAPRDVDVLVFNVSMLSPSPS  144

Query  1271  LTSRVVNRYKMREDVKTFNLSGMGCSASVVAIDIVHHLFKVYKNSYAIVVSTESLGANWY  1092
             L+SR+V RY +REDV  +NL+GMGCSA ++A+D+  +  +    + A+VVS+ES+  NWY
Sbjct  145   LSSRIVRRYGLREDVAAYNLTGMGCSAGLIALDLARNALRTRPRALALVVSSESIAPNWY  204

Query  1091  SGKERSMMLSNCLFRSGGCSMLFTNNPALKPRAILKLKHMVRTHIAAIDEAYECCKQVED  912
             SG ++SMML+NCLFR GG ++L TN+PA + RA ++L  +VR +I A D+A+ C  Q ED
Sbjct  205   SGTDKSMMLANCLFRCGGSAVLVTNDPAHRGRAKMELSCLVRANIGASDDAHACALQRED  264

Query  911   PQGFRGFHLSKRLPKVATKALVTNFKVLVPKAIPLWETLRFLAVSSLERRKFKLPSLLGK  732
              +G  G  LSK LPK A +A   N + L P+ +P  E  RF A     R  F+LP +LG 
Sbjct  265   VEGRVGISLSKALPKAAVRAFTVNLRRLAPRVLPFAELARFTARHLARRLFFQLPHMLGS  324

Query  731   ----------PILNMKTGIEHFCLHPGGRAVIDGVGVSLGLSEYDLEPARMSLHRWGNTS  582
                       P +N+K G++HFCLHPGG AVI+ V  SLGL + D+EPARM+LHRWGNT 
Sbjct  325   GKQHKGGDAAPKINIKAGVDHFCLHPGGTAVIEAVKQSLGLEDEDVEPARMTLHRWGNTL  384

Query  581   AGGLWYVLGYMEAKKRLKKGDRILMLSLGAGFKCNNCVWEVMKDLGDPNVWEDCIDRYPP  402
             A  LWYVL YMEAK RLK GDR+LM++ G+GFKCN+CVWEV  D+ D   W DCID YPP
Sbjct  385   ASSLWYVLSYMEAKGRLKVGDRVLMVTFGSGFKCNSCVWEVTGDMADRGAWADCIDAYPP  444

Query  401   ETLVNPFTEKFDWIHD  354
             ETL NP+ +KF WI+D
Sbjct  445   ETLSNPYMDKFGWIND  460



>ref|XP_004984200.1| PREDICTED: 3-ketoacyl-CoA synthase 12-like [Setaria italica]
Length=463

 Score =   464 bits (1195),  Expect = 1e-154, Method: Compositional matrix adjust.
 Identities = 227/433 (52%), Positives = 310/433 (72%), Gaps = 10/433 (2%)
 Frame = -1

Query  1631  RRRHQCCYMLNYECYKPTDVARRLSTDKSALVVYRNRNLGIDEFRFLLQTMVNSGVGEQT  1452
             RRR   CY+L+Y C+KP D  R++ST+++  ++ RN+ LG+ ++RFLL+ +V SG+GE+T
Sbjct  26    RRRQSRCYLLDYVCHKPCDT-RKISTEEAGDLIQRNKRLGLADYRFLLRVIVRSGIGEET  84

Query  1451  YIPINVLEGREDSPTLEDSFTEVDDIMFQTLDNLFAKSKVSPREIDvlvvnvsllasaps  1272
             Y P ++LEGREDSPTL+D+  E+D  + + +  LFA++ V+PR++DVLV NVS+L+ APS
Sbjct  85    YAPRSILEGREDSPTLQDALDEMDAFLDEAVAGLFARTGVAPRDVDVLVFNVSMLSPAPS  144

Query  1271  LTSRVVNRYKMREDVKTFNLSGMGCSASVVAIDIVHHLFKVYKNSYAIVVSTESLGANWY  1092
             L SRVV RY +REDV  +NL+GMGCSA +VA+D+  +  +    + A+VVS+ES+  NWY
Sbjct  145   LASRVVRRYGLREDVAAYNLAGMGCSAGLVALDLARNALRTRPRALALVVSSESIAPNWY  204

Query  1091  SGKERSMMLSNCLFRSGGCSMLFTNNPALKPRAILKLKHMVRTHIAAIDEAYECCKQVED  912
             SG ++SMML+NCLFRSGG ++L TN+PA + RA ++L+ +VR HI A D+A+ C  Q ED
Sbjct  205   SGTDKSMMLANCLFRSGGAAVLITNDPARRGRAKMELRCLVRAHIGANDDAHACALQRED  264

Query  911   PQGFRGFHLSKRLPKVATKALVTNFKVLVPKAIPLWETLRFLAVSSLERRKFKLPSLLGK  732
              +G  G  LSK LPK A +A   N + + P  +P+ E  RF A   L   +   PS   K
Sbjct  265   AEGRVGISLSKALPKAAVRAFAANLRRVAPSILPVSELARFAA--RLLSWRLLHPSSGKK  322

Query  731   -------PILNMKTGIEHFCLHPGGRAVIDGVGVSLGLSEYDLEPARMSLHRWGNTSAGG  573
                    P +N KTG++HFCLHPGG AVI+ V  SLGL + D+EPARM+LHRWGNTSA  
Sbjct  323   QGGAGDAPRINFKTGVDHFCLHPGGTAVIEAVKQSLGLDDGDVEPARMTLHRWGNTSASS  382

Query  572   LWYVLGYMEAKKRLKKGDRILMLSLGAGFKCNNCVWEVMKDLGDPNVWEDCIDRYPPETL  393
             LWYVL YMEAK RL+ GDR+LM++ G+GFKCN+C+WEV  D+ D   WE CID YPPE L
Sbjct  383   LWYVLSYMEAKGRLEVGDRVLMVTFGSGFKCNSCLWEVTGDMADKGPWESCIDSYPPERL  442

Query  392   VNPFTEKFDWIHD  354
              NP+ +KF WI+D
Sbjct  443   ANPYMDKFGWIND  455



>ref|XP_008660002.1| PREDICTED: 3-ketoacyl-CoA synthase 12-like [Zea mays]
 gb|ACF82788.1| unknown [Zea mays]
 gb|AFW87985.1| acyltransferase [Zea mays]
 gb|AFW87987.1| acyltransferase [Zea mays]
Length=472

 Score =   463 bits (1192),  Expect = 3e-154, Method: Compositional matrix adjust.
 Identities = 229/441 (52%), Positives = 309/441 (70%), Gaps = 17/441 (4%)
 Frame = -1

Query  1631  RRRHQCCYMLNYECYKPTDVARRLSTDKSALVVYRNRNLGIDEFRFLLQTMVNSGVGEQT  1452
             RRR   CY+L+Y C+KP+D  R+LST+ +  V+ RN  LG+ ++RFLL+ +V SG+GE+T
Sbjct  26    RRRQSRCYLLDYVCHKPSD-DRKLSTETAGNVIQRNARLGLTDYRFLLRVIVRSGIGEET  84

Query  1451  YIPINVLEGREDSPTLEDSFTEVDDIMFQTLDNLFAKSKVSPREIDvlvvnvsllasaps  1272
             Y P N+LEGREDSPTLED+  E+D    + +  LFA++ ++PR++DVLV NVS+L+ APS
Sbjct  85    YAPRNILEGREDSPTLEDAVDEMDAFFDEAIAELFARTGLAPRDVDVLVFNVSMLSPAPS  144

Query  1271  LTSRVVNRYKMREDVKTFNLSGMGCSASVVAIDIVHHLFKVYKNSYAIVVSTESLGANWY  1092
             L+SR+V RY +REDV  +NL+GMGCSA ++A+D+  +  +    + A+VVS+ES+  NWY
Sbjct  145   LSSRIVRRYGLREDVAAYNLTGMGCSAGLIALDLARNALRTRPRALALVVSSESIAPNWY  204

Query  1091  SGKERSMMLSNCLFRSGGCSMLFTNNPALKPRAILKLKHMVRTHIAAIDEAYECCKQVED  912
             SG +++MML+NCLFRSGG ++L TN+PA + +A ++L  +VR +I A D+A+ C  Q ED
Sbjct  205   SGTDKTMMLANCLFRSGGSAVLVTNDPARRGQAKMELSCLVRANIGASDDAHACALQRED  264

Query  911   PQGFRGFHLSKRLPKVATKALVTNFKVLVPKAIPLWETLRFLAVSSLERRKFKLPSLL--  738
              +G  G  LSK LPK A +A   N + L P+ +P+ E  RF A   L RR F     L  
Sbjct  265   GEGRVGISLSKALPKAAVRAFAVNLRRLAPRVLPVGELARF-AARLLARRLFTTSPHLRQ  323

Query  737   -----GK--------PILNMKTGIEHFCLHPGGRAVIDGVGVSLGLSEYDLEPARMSLHR  597
                  GK        P +N K G++HFCLHPGG AVI+ V  SL L + D+EPARM+LHR
Sbjct  324   QHLSGGKQKGDAAAAPKINFKAGVDHFCLHPGGTAVIEAVKKSLDLEDEDVEPARMTLHR  383

Query  596   WGNTSAGGLWYVLGYMEAKKRLKKGDRILMLSLGAGFKCNNCVWEVMKDLGDPNVWEDCI  417
             WGNTSA  LWYVL YMEAK RLK GDR+LM++ G+GFKCN+CVWEV  D+ D   W DCI
Sbjct  384   WGNTSASSLWYVLSYMEAKGRLKVGDRVLMVTFGSGFKCNSCVWEVTGDMADKGAWADCI  443

Query  416   DRYPPETLVNPFTEKFDWIHD  354
             D YPPE L NP+ +KF WI+D
Sbjct  444   DAYPPEKLANPYLDKFGWIND  464



>ref|NP_001152498.1| acyltransferase precursor [Zea mays]
 gb|ACG47900.1| acyltransferase [Zea mays]
Length=472

 Score =   462 bits (1189),  Expect = 1e-153, Method: Compositional matrix adjust.
 Identities = 228/441 (52%), Positives = 307/441 (70%), Gaps = 17/441 (4%)
 Frame = -1

Query  1631  RRRHQCCYMLNYECYKPTDVARRLSTDKSALVVYRNRNLGIDEFRFLLQTMVNSGVGEQT  1452
             RRR   CY+L+Y C+KP+D  R+LST+ +  V+ RN  LG+ ++RFLL+ +V SG+GE+T
Sbjct  26    RRRQSRCYLLDYVCHKPSD-DRKLSTETAGNVIQRNARLGLTDYRFLLRVIVRSGIGEET  84

Query  1451  YIPINVLEGREDSPTLEDSFTEVDDIMFQTLDNLFAKSKVSPREIDvlvvnvsllasaps  1272
             Y P N+LEGREDSPTLED+  E+D    + +  LFA++ ++PR++DVLV NVS+L   PS
Sbjct  85    YAPRNILEGREDSPTLEDAVDEMDAFFDEAIAELFARTGLAPRDVDVLVFNVSMLXPXPS  144

Query  1271  LTSRVVNRYKMREDVKTFNLSGMGCSASVVAIDIVHHLFKVYKNSYAIVVSTESLGANWY  1092
             L+SR+V RY +REDV  +NL+GMGCSA ++A+D+  +  +    + A+VVS+ES+  NWY
Sbjct  145   LSSRIVRRYGLREDVAAYNLTGMGCSAGLIALDLARNALRTRPRALALVVSSESIAPNWY  204

Query  1091  SGKERSMMLSNCLFRSGGCSMLFTNNPALKPRAILKLKHMVRTHIAAIDEAYECCKQVED  912
             SG +++MML+NCLFRSGG ++L TN+PA + +A ++L  +VR +I A D+A+ C  Q ED
Sbjct  205   SGTDKTMMLANCLFRSGGSAVLVTNDPARRGQAKMELSCLVRANIGASDDAHACALQRED  264

Query  911   PQGFRGFHLSKRLPKVATKALVTNFKVLVPKAIPLWETLRFLAVSSLERRKFKLPSLL--  738
              +G  G  LSK LPK A +A   N + L P+ +P+ E  RF A   L RR F     L  
Sbjct  265   GEGRVGISLSKALPKAAVRAFAVNLRRLAPRVLPVGELARF-AARLLARRLFTTSPHLRQ  323

Query  737   -----GK--------PILNMKTGIEHFCLHPGGRAVIDGVGVSLGLSEYDLEPARMSLHR  597
                  GK        P +N K G++HFCLHPGG AVI+ V  SL L + D+EPARM+LHR
Sbjct  324   QHLSGGKQKGDAAAAPKINFKAGVDHFCLHPGGTAVIEAVKKSLDLEDEDVEPARMTLHR  383

Query  596   WGNTSAGGLWYVLGYMEAKKRLKKGDRILMLSLGAGFKCNNCVWEVMKDLGDPNVWEDCI  417
             WGNTSA  LWYVL YMEAK RLK GDR+LM++ G+GFKCN+CVWEV  D+ D   W DCI
Sbjct  384   WGNTSASSLWYVLSYMEAKGRLKVGDRVLMVTFGSGFKCNSCVWEVTGDMADKGAWADCI  443

Query  416   DRYPPETLVNPFTEKFDWIHD  354
             D YPPE L NP+ +KF WI+D
Sbjct  444   DAYPPEKLANPYLDKFGWIND  464



>ref|XP_006850575.1| hypothetical protein AMTR_s00034p00045070 [Amborella trichopoda]
 gb|ERN12156.1| hypothetical protein AMTR_s00034p00045070 [Amborella trichopoda]
Length=470

 Score =   462 bits (1188),  Expect = 1e-153, Method: Compositional matrix adjust.
 Identities = 233/459 (51%), Positives = 326/459 (71%), Gaps = 9/459 (2%)
 Frame = -1

Query  1721  SRSFYHMETLVAIYSLLFLYT--VVYILRSYLRRRHQCCYMLNYECYKPTDVARRLSTDK  1548
             S + +  E  + + SLL L    ++++ + Y RR +Q CY+L+Y C+KP D    L T+ 
Sbjct  3     SLTSFTSENTIFLASLLALLVNGLIFLWKLYTRRVNQACYLLDYACFKPPD-DWMLDTEL  61

Query  1547  SALVVYRNRNLGIDEFRFLLQTMVNSGVGEQTYIPINVLEGREDSPTLEDSFTEVDDIMF  1368
                ++ RN+ LG+DE +FLL+  V+SG+ E+TY P  +  G  ++ +L D   E+D+   
Sbjct  62    CGEIIKRNKKLGVDECQFLLKMTVSSGISEETYAPRCLSFGNPNNVSLNDGLDEMDECFK  121

Query  1367  QTLDNLFAKSKVSPREIDvlvvnvsllasapsLTSRVVNRYKMREDVKTFNLSGMGCSAS  1188
               LD LFAK+ +SP+++D+LVVNV+LL  APSL++R+VN YKM+ED+  +NLSGMGCSAS
Sbjct  122   GCLDTLFAKTGISPKDVDILVVNVALLWPAPSLSARIVNMYKMKEDIMAYNLSGMGCSAS  181

Query  1187  VVAIDIVHHLFKVYKNSYAIVVSTESLGANWYSGKERSMMLSNCLFRSGGCSMLFTNNPA  1008
             V++I++V +LFK +  S A+VV++ES+  NWYSG +RSMML+NCLFRSG C+M+ +N   
Sbjct  182   VISINLVENLFKQHTESLAVVVTSESIAMNWYSGLDRSMMLANCLFRSGCCAMMLSNRST  241

Query  1007  LKPRAILKLKHMVRTHIAAIDEAYECCKQVEDPQGFRGFHLSKRLPKVATKALVTNFKVL  828
              +  +   LK++VRTH+   D+A+ C  ++ED  G  G  LSK LPK A +A V N  VL
Sbjct  242   DRVCSKFLLKNLVRTHMGENDQAHYCAYEMEDEDGCPGVKLSKHLPKAAAQAFVKNLSVL  301

Query  827   VPKAIPLWETLRFLAVSSLERRKFKLPSLLGKPILNMKTGIEHFCLHPGGRAVIDGVGVS  648
              PK +P+ E +R+L    L +R  +  S      +N+KT ++HFCLH GG AVID VG S
Sbjct  302   GPKILPVTEIVRYLVARYLLKRSKETVS------VNLKTAVQHFCLHAGGTAVIDAVGKS  355

Query  647   LGLSEYDLEPARMSLHRWGNTSAGGLWYVLGYMEAKKRLKKGDRILMLSLGAGFKCNNCV  468
             LGL++YDLEP+RM+LHRWGNTSA  LWYVL YMEAKKRL+KG R+L +S GAGFKCN+CV
Sbjct  356   LGLTDYDLEPSRMTLHRWGNTSASSLWYVLSYMEAKKRLRKGHRVLQISFGAGFKCNSCV  415

Query  467   WEVMKDLGDPNVWEDCIDRYPPETLVNPFTEKFDWIHDP  351
             WEV++DLGD +VWED + RYP +TLVNPF EK+ WI++P
Sbjct  416   WEVVRDLGDLSVWEDSVHRYPAKTLVNPFLEKYGWINNP  454



>ref|XP_006848688.1| hypothetical protein AMTR_s00178p00018030 [Amborella trichopoda]
 gb|ERN10269.1| hypothetical protein AMTR_s00178p00018030 [Amborella trichopoda]
Length=469

 Score =   461 bits (1186),  Expect = 2e-153, Method: Compositional matrix adjust.
 Identities = 235/430 (55%), Positives = 310/430 (72%), Gaps = 9/430 (2%)
 Frame = -1

Query  1637  YLRRRHQCCYMLNYECYKPTDVARRLSTDKSALVVYRNRNLGIDEFRFLLQTMVNSGVGE  1458
             Y +R +Q CY+L+Y C+KP D   +L T+    VV RN+NLG++E++FLL+ +  SG+GE
Sbjct  33    YCKRVNQACYLLDYVCFKPPD-DWKLDTELCGKVVRRNKNLGLNEYQFLLKVVFGSGMGE  91

Query  1457  QTYIPINVLEGREDSPTLEDSFTEVDDIMFQTLDNLFAKSKVSPREIDvlvvnvsllasa  1278
             +TY P ++  G  +S  L    +E+D      LD LF K+ +SP++ID+LVVNVS+L  A
Sbjct  92    ETYAPRSLTSGDPNSCNLNSGISEMDQCFIGALDPLFEKTGISPKDIDILVVNVSMLWPA  151

Query  1277  psLTSRVVNRYKMREDVKTFNLSGMGCSASVVAIDIVHHLFKVYKNSYAIVVSTESLGAN  1098
             PSL +R+VNRYKMREDVK FN+SGMGCSAS+++I++V +LFK+   S A++VS ES+  N
Sbjct  152   PSLCARIVNRYKMREDVKAFNISGMGCSASLISINLVQNLFKLRPESRALIVSGESIAPN  211

Query  1097  WYSGKERSMMLSNCLFRSGGCSMLFTNNPALKPRAILKLKHMVRTHIAAIDEAYECCKQV  918
             WY+G E+SM+L+NCLFR+G C+ML TN  A + R+ L LK +VR H+ A DEAY C  QV
Sbjct  212   WYAGNEKSMILTNCLFRTGCCAMLLTNRRADRTRSKLLLKTLVRFHLGASDEAYNCASQV  271

Query  917   EDPQGFRGFHLSKRLPKVATKALVTNFKVLVPKAIPLWETLRFLAVSSLERRKFKLPSLL  738
             ED  G  G  LSK LPK AT+A+V   KVL PK +P  E LR+L +      +F   +  
Sbjct  272   EDDLGRPGVKLSKDLPKAATQAIVKMIKVLGPKILPTKEILRYLVI------RFLAGAGS  325

Query  737   GKPILNMKTGIEHFCLHPGGRAVIDGVGVSLGLSEYDLEPARMSLHRWGNTSAGGLWYVL  558
             G   LN KTG+EHFC+HPGG AVI+ V   LGLS YDLEP+RM+LHRWGNTSA  LWYVL
Sbjct  326   GPMSLNFKTGVEHFCIHPGGAAVINAVERGLGLSRYDLEPSRMTLHRWGNTSASSLWYVL  385

Query  557   GYMEAKKRLKKGDRILMLSLGAGFKCNNCVWEVMKDLG--DPNVWEDCIDRYPPETLVNP  384
              YMEAKKRL+KG R+L L+ G+GFKCN+C+WEV++DL   + NVWEDC+ RYP + L NP
Sbjct  386   SYMEAKKRLRKGHRVLQLTFGSGFKCNSCLWEVVRDLENLNHNVWEDCVHRYPAQNLTNP  445

Query  383   FTEKFDWIHD  354
             F EK+ WI+D
Sbjct  446   FMEKYGWIND  455



>ref|XP_002467779.1| hypothetical protein SORBIDRAFT_01g033910 [Sorghum bicolor]
 gb|EER94777.1| hypothetical protein SORBIDRAFT_01g033910 [Sorghum bicolor]
Length=523

 Score =   462 bits (1190),  Expect = 4e-153, Method: Compositional matrix adjust.
 Identities = 232/441 (53%), Positives = 310/441 (70%), Gaps = 16/441 (4%)
 Frame = -1

Query  1631  RRRHQCCYMLNYECYKPTDVARRLSTDKSALVVYRNRNLGIDEFRFLLQTMVNSGVGEQT  1452
             RRR   CY+L+Y C+KP D  R+LST+ +  V+ RN  LG+ ++RFLL+ +V SG+GE+T
Sbjct  26    RRRQSRCYLLDYVCHKPRD-DRKLSTETAGDVIQRNARLGLTDYRFLLRVVVRSGIGEET  84

Query  1451  YIPINVLEGREDSPTLEDSFTEVDDIMFQTLDNLFAKSKVSPREIDvlvvnvsllasaps  1272
             Y P ++LEGRED+PTL+DS  E+D  + + +  LFA++ VSP ++DVLV NVS+L+ +PS
Sbjct  85    YAPRSILEGREDTPTLKDSLEEMDAFLDEAVAELFARTGVSPGDVDVLVFNVSMLSPSPS  144

Query  1271  LTSRVVNRYKMREDVKTFNLSGMGCSASVVAIDIVHHLFKVY--KNSYAIVVSTESLGAN  1098
             L+SRVV RY +R+DV  +NL+GMGCSA +VA+D+  +  +    + S A+VVS+ES+  N
Sbjct  145   LSSRVVRRYGLRDDVAAYNLAGMGCSAGLVALDLARNALRARPRRASLALVVSSESIAPN  204

Query  1097  WYSGKERSMMLSNCLFRSGGCSMLFTNNPALKPRAILKLKHMVRTHIAAIDEAYECCKQV  918
             WYSG ++SMML+NCLFR GG + L TN+PA + RA ++L+ +VR HI A D+A+ C  Q 
Sbjct  205   WYSGTDKSMMLANCLFRCGGAAALVTNDPARRGRAKMELRCLVRAHIGASDDAHACALQR  264

Query  917   EDPQGFRGFHLSKRLPKVATKALVTNFKVLVPKAIPLWETLRFLAVSSLERRKFKLPSLL  738
             ED +G  G  LSK LPK A +A   N + L P+ +P+ E  RF A     R  F+ P +L
Sbjct  265   EDGEGRVGISLSKALPKAAVRAFAVNLRRLAPRVLPVAELARFTARHLARRLFFQFPHML  324

Query  737   ---GK----------PILNMKTGIEHFCLHPGGRAVIDGVGVSLGLSEYDLEPARMSLHR  597
                GK            +N K G+EHFCLHPGG AVI+ V  SLGL + D+EPARM+LHR
Sbjct  325   QGSGKQQQKGGGDAAAKINFKAGVEHFCLHPGGTAVIEAVKQSLGLEDEDVEPARMTLHR  384

Query  596   WGNTSAGGLWYVLGYMEAKKRLKKGDRILMLSLGAGFKCNNCVWEVMKDLGDPNVWEDCI  417
             WGNTSA  LWYVL YMEAK RLK GDR+LM++ G+GFKCN+CVWEV  D+ D   W DCI
Sbjct  385   WGNTSASSLWYVLSYMEAKGRLKVGDRVLMVTFGSGFKCNSCVWEVTGDMADRGAWADCI  444

Query  416   DRYPPETLVNPFTEKFDWIHD  354
             D YPPETL NP+ +KF WI+D
Sbjct  445   DDYPPETLANPYMDKFGWIND  465



>ref|XP_006661857.1| PREDICTED: 3-ketoacyl-CoA synthase 12-like [Oryza brachyantha]
Length=460

 Score =   457 bits (1175),  Expect = 8e-152, Method: Compositional matrix adjust.
 Identities = 222/427 (52%), Positives = 308/427 (72%), Gaps = 9/427 (2%)
 Frame = -1

Query  1613  CYMLNYECYKPTDVARRLSTDKSALVVYRNRNLGIDEFRFLLQTMVNSGVGEQTYIPINV  1434
             CY+L+Y CYK TD  R+L TD    ++ RN+ LG++E++FLL+ +VNSG+GE+TY P N+
Sbjct  32    CYLLDYVCYKGTD-DRKLPTDLCGEIIQRNKLLGLEEYKFLLKVIVNSGIGEETYGPRNI  90

Query  1433  LEGREDSPT-LEDSFTEVDDIMFQTLDNLFAKSK------VSPREIDvlvvnvsllasap  1275
             ++G E  P  L +   E+D+     LD LFA++       V P ++D+LVVNVS+ + AP
Sbjct  91    IDGGEARPDRLAEGMEEMDETFHAVLDELFARAAAPGGVGVRPADVDLLVVNVSMFSPAP  150

Query  1274  sLTSRVVNRYKMREDVKTFNLSGMGCSASVVAIDIVHHLFKVYKNSYAIVVSTESLGANW  1095
             SL++R+V+RY +REDVK +NL+GMGCSA+++A+D+V++  +   N  A+V+++ES+  NW
Sbjct  151   SLSARIVSRYNLREDVKVYNLTGMGCSATLIALDLVNNFLRTEANKVAVVMTSESIAPNW  210

Query  1094  YSGKERSMMLSNCLFRSGGCSMLFTNNPALKPRAILKLKHMVRTHIAAIDEAYECCKQVE  915
             Y+G +RS ML NCLFRSGGC+   TN PAL+P A L+L+H+VRTH  A DEAY C  Q+E
Sbjct  211   YAGNKRSFMLGNCLFRSGGCAYFLTNRPALRPHAKLRLRHLVRTHTGASDEAYSCALQME  270

Query  914   DPQGFRGFHLSKRLPKVATKALVTNFKVLVPKAIPLWETLRFLAVSSLERRKFKLPSLLG  735
             D  G  GFHL K LP+ A  A V N +VL P+ +PL E LR LA+++L  R  +      
Sbjct  271   DDAGRPGFHLGKELPRAAVTAFVKNLRVLAPRVLPLPELLR-LALATLSARLARKKQSAS  329

Query  734   KPILNMKTGIEHFCLHPGGRAVIDGVGVSLGLSEYDLEPARMSLHRWGNTSAGGLWYVLG  555
             +  + MK+G++HFC+H GG AVIDGVG  L L+E+DLEP+RM+LHR+GNTSA  +WYVLG
Sbjct  330   QLTIRMKSGVDHFCVHTGGAAVIDGVGKGLTLTEHDLEPSRMTLHRFGNTSASSVWYVLG  389

Query  554   YMEAKKRLKKGDRILMLSLGAGFKCNNCVWEVMKDLGDPNVWEDCIDRYPPETLVNPFTE  375
             YMEAK+RL+ GDR+LML+ GAGFKCN+CVW V K + D  VW DCI  YPP+ L NPF +
Sbjct  390   YMEAKRRLRPGDRVLMLTFGAGFKCNSCVWTVEKPVSDAGVWADCIHHYPPKELSNPFLD  449

Query  374   KFDWIHD  354
             K+ ++ D
Sbjct  450   KYGFVKD  456



>ref|NP_001148161.1| acyltransferase [Zea mays]
 gb|ACG29982.1| acyltransferase [Zea mays]
 tpg|DAA45618.1| TPA: acyltransferase [Zea mays]
Length=494

 Score =   457 bits (1177),  Expect = 1e-151, Method: Compositional matrix adjust.
 Identities = 227/438 (52%), Positives = 308/438 (70%), Gaps = 14/438 (3%)
 Frame = -1

Query  1631  RRRHQCCYMLNYECYKPTDVARRLSTDKSALVVYRNRNLGIDEFRFLLQTMVNSGVGEQT  1452
             RRR   CY+L+Y C+KP +  R+LST+ +  V+ RN  LG+ ++RFLL+ +V SG+GE+T
Sbjct  51    RRRQSRCYLLDYVCHKPRE-DRKLSTEAAGAVIQRNARLGLTDYRFLLRVIVRSGIGEET  109

Query  1451  YIPINVLEGREDSPTLEDSFTEVDDIMFQTLDNLFAKSKVSPREIDvlvvnvsllasaps  1272
             Y P N+LEGREDSPTL D+  E+D    + +  LFA++ V+PR++DVLV NVS+L+ APS
Sbjct  110   YAPRNILEGREDSPTLRDAVDEMDAFFDEAIAELFARTDVAPRDVDVLVFNVSMLSPAPS  169

Query  1271  LTSRVVNRYKMREDVKTFNLSGMGCSASVVAIDIVHHLFKVYKNSYAIVVSTESLGANWY  1092
             L+SR+  RY +REDV  +NL+GMGCSA ++A+D+  +  +    + A+VVS+ES+  NWY
Sbjct  170   LSSRIARRYGLREDVAAYNLTGMGCSAGLIALDLARNALRTRPRALALVVSSESIAPNWY  229

Query  1091  SGKERSMMLSNCLFRSGGCSMLFTNNPALKPRAILKLKHMVRTHIAAIDEAYECCKQVED  912
             SG ++SMML+NCLFRSGG ++L TN+PA + RA ++L  +VR +I A D+A+ C +Q ED
Sbjct  230   SGTDKSMMLANCLFRSGGSAVLVTNDPARRGRAKMELSCLVRANIGASDDAHTCAQQRED  289

Query  911   PQGFRGFHLSKRLPKVATKALVTNFKVLVPKAIPLWETLRFLAVSSLERRKF---KLPSL  741
              +G  G  LSK LPK A +A   N + L P+ +P+ E  RF A   L RR F   +  S 
Sbjct  290   AEGRVGISLSKALPKAAVRAFAVNLRRLAPRVLPVAELARF-AARLLARRLFPHLQQHSS  348

Query  740   LGK--------PILNMKTGIEHFCLHPGGRAVIDGVGVSLGLSEYDLEPARMSLHRWGNT  585
              GK        P +N K G++HFCLHPGG AVI+ V  SLGL + D+E ARM+LHRWGNT
Sbjct  349   SGKHKGDTAAPPKINFKAGVDHFCLHPGGTAVIEAVKQSLGLEDEDVEAARMTLHRWGNT  408

Query  584   SAGGLWYVLGYMEAKKRLKKGDRILMLSLGAGFKCNNCVWEVMKDLGDP-NVWEDCIDRY  408
             SA  LWYVL YMEAK+RLK GDR+LM++ G+GFKCN+CVWEV  D+ D    W DCI  Y
Sbjct  409   SASSLWYVLSYMEAKRRLKVGDRVLMVTFGSGFKCNSCVWEVTGDMADDRGAWADCIHAY  468

Query  407   PPETLVNPFTEKFDWIHD  354
             PPE L NP+ +KF WI++
Sbjct  469   PPERLANPYMDKFGWINN  486



>dbj|BAK06890.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=463

 Score =   456 bits (1173),  Expect = 2e-151, Method: Compositional matrix adjust.
 Identities = 236/465 (51%), Positives = 319/465 (69%), Gaps = 21/465 (5%)
 Frame = -1

Query  1706  HMETLVAIYSLLF-LYTVVYILRSYLRRRHQCCYMLNYECYKPTDVARRLSTDKSALVVY  1530
              + T+V +  L F   T+  +L    RRR   CY+L+Y CYK TD  R+L TD    ++ 
Sbjct  2     ELATMVTLTLLAFSAATLARLLVERARRRR--CYLLDYVCYKGTD-DRKLPTDLCGEIIQ  58

Query  1529  RNRNLGIDEFRFLLQTMVNSGVGEQTYIPINVLEGREDSPTL-EDSFTEVDDIMFQTLDN  1353
             RN+ LG++E++FLL+ +VNSG+GE+TY P N++ G E SP L  +   E+D+     LD 
Sbjct  59    RNKLLGLEEYKFLLKVIVNSGIGEETYGPRNIIAGGEASPDLLAEGMEEMDETFHAVLDE  118

Query  1352  LFAKSK------VSPREIDvlvvnvsllasapsLTSRVVNRYKMREDVKTFNLSGMGCSA  1191
             LFA+S       V P ++D+LVVNVS+ + APSL++RVV RY +R+DVK FN++GMGCSA
Sbjct  119   LFARSAAPGGLGVRPADVDLLVVNVSMFSPAPSLSARVVRRYGLRDDVKVFNVTGMGCSA  178

Query  1190  SVVAIDIVHHLFKVYKNSYAIVVSTESLGANWYSGKERSMMLSNCLFRSGGCSMLFTNNP  1011
             +++A+D+ ++ F+ + N+ A+V+++ES+  NWY G  RS ML NCLFRSGGC+   TN+P
Sbjct  179   TLIALDLANNFFRTHANTVALVMTSESIAPNWYPGNRRSFMLGNCLFRSGGCAYFLTNSP  238

Query  1010  ALKPRAILKLKHMVRTHIAAIDEAYECCKQVEDPQGFRGFHLSKRLPKVATKALVTNFKV  831
              L+P A L+L+H+VRTH  A DEAY C  Q+ED  G  GFHL K LP+ A  A V N +V
Sbjct  239   RLRPHAKLRLRHVVRTHTGASDEAYNCALQMEDDAGRPGFHLGKELPRAAVHAFVKNLRV  298

Query  830   LVPKAIPLWETLRFLAVSSLERR------KFKLPSLLGKPILNMKTGIEHFCLHPGGRAV  669
             L P+ +PL E LR LA ++L  R      K K  S L    + MK G++HFC+H GG AV
Sbjct  299   LAPRVLPLPELLR-LAYATLSARFLTRSNKKKSSSAL---TIRMKEGVDHFCVHTGGAAV  354

Query  668   IDGVGVSLGLSEYDLEPARMSLHRWGNTSAGGLWYVLGYMEAKKRLKKGDRILMLSLGAG  489
             IDGVG  L L+E+D+EPARM+LHR+GNTSA  +WYVL YMEAKKRL KGDR+LML+ GAG
Sbjct  355   IDGVGKGLTLTEHDIEPARMTLHRFGNTSASSVWYVLSYMEAKKRLSKGDRVLMLTFGAG  414

Query  488   FKCNNCVWEVMKDLGDPNVWEDCIDRYPPETLVNPFTEKFDWIHD  354
             FKCN+CVW V +   D  VW DCI  YPP+ + NPF EK+ ++ D
Sbjct  415   FKCNSCVWTVERATADAGVWADCIHEYPPKEIRNPFMEKYGFVKD  459



>gb|EYU18919.1| hypothetical protein MIMGU_mgv1a006441mg [Erythranthe guttata]
Length=444

 Score =   453 bits (1165),  Expect = 2e-150, Method: Compositional matrix adjust.
 Identities = 232/440 (53%), Positives = 311/440 (71%), Gaps = 28/440 (6%)
 Frame = -1

Query  1670  FLYTVVYILRSYLRRRHQCCYMLNYECYKPTDVARRLSTDKSALVVYRNRNLGIDEFRFL  1491
              +YTV  IL    +RRHQ CY+L+YECYK  D  R+LST  S  ++ RN++LGI +++FL
Sbjct  16    LIYTVWNILD---QRRHQNCYILDYECYKAAD-ERKLSTKFSGEIIRRNKHLGIADYKFL  71

Query  1490  LQTMVNSGVGEQTYIPINVLEGREDSPTLEDSFTEVDDIMFQTLDNLFAKSKVSPREIDv  1311
             L+ +V+SG+GE+TY P  V +GRE +P+L D   E+D+    ++  L A++ + P EIDV
Sbjct  72    LKAIVSSGIGEETYAPKMVFDGREATPSLSDGVLEMDEFFSDSVGKLLARTGIHPSEIDV  131

Query  1310  lvvnvsllasapsLTSRVVNRYKMREDVKTFNLSGMGCSASVVAIDIVHHLFKVYKNSYA  1131
             LVVNVS+LA+ PSL++R++N+YKM+ED+K +NLSGMGCSAS+++++IV ++FK  +N  A
Sbjct  132   LVVNVSMLATCPSLSARIINKYKMKEDIKVYNLSGMGCSASLISVNIVQNIFKSLRNRNA  191

Query  1130  IVVSTESLGANWYSGKERSMMLSNCLFRSGGCSMLFTNNPALKPRAILKLKHMVRTHIAA  951
             +VV++ESL   WY+G +RSM+L+NCLFR+GGC M+ TN PALK RA+L+LK +VRTH  +
Sbjct  192   VVVTSESLSLGWYNGNDRSMILANCLFRTGGCVMVLTNKPALKNRAMLELKQLVRTHHGS  251

Query  950   IDEAYECCKQVEDPQGFRGFHLSKRLPKVATKALVTNFKVLVPKAIPLWETLRFLAVSSL  771
              DE+Y CC Q ED  G  GFHL K LPK AT+A   N K + PK +P  E LRF A  +L
Sbjct  252   RDESYGCCIQKEDENGLAGFHLGKNLPKSATRAFADNLKQIAPKILPATELLRFAA--AL  309

Query  770   ERRKFKLPSLLGKPILNMKTGIEHFCLHPGGRAVIDGVGVSLGLSEYDLEPARMSLHRWG  591
               RK +                        G+AVIDG+  +LGLSE D+EPARM+LHR+G
Sbjct  310   LFRKLR---------------------GGAGKAVIDGIAENLGLSEDDVEPARMTLHRFG  348

Query  590   NTSAGGLWYVLGYMEAKKRLKKGDRILMLSLGAGFKCNNCVWEVMKDL-GDPNVWEDCID  414
             NTSA  LWYVL YM AK RLKKGDR+ M+S GAGFKCN+C+W+V++DL G  NVWED I 
Sbjct  349   NTSASSLWYVLAYMAAKGRLKKGDRVFMISFGAGFKCNSCLWKVLRDLDGRNNVWEDSIH  408

Query  413   RYPPETLVNPFTEKFDWIHD  354
              YP   L NPF EK+ WIH+
Sbjct  409   TYPRTNLNNPFLEKYGWIHN  428



>ref|XP_002454759.1| hypothetical protein SORBIDRAFT_04g036880 [Sorghum bicolor]
 gb|EES07735.1| hypothetical protein SORBIDRAFT_04g036880 [Sorghum bicolor]
Length=461

 Score =   453 bits (1165),  Expect = 3e-150, Method: Compositional matrix adjust.
 Identities = 221/433 (51%), Positives = 302/433 (70%), Gaps = 16/433 (4%)
 Frame = -1

Query  1631  RRRHQCCYMLNYECYKPTDVARRLSTDKSALVVYRNRNLGIDEFRFLLQTMVNSGVGEQT  1452
             RRR  CCY+L+Y C+KP+D  R+++T+ +  V+ RN+ LG+ ++RFLL+ +VNSG+GE T
Sbjct  26    RRRRACCYLLDYACHKPSD-DRKVTTEMAGDVIERNKRLGLSDYRFLLKVIVNSGIGEHT  84

Query  1451  YIPINVLEGREDSPTLEDSFTEVDDIMFQTLDNLFAKSKVSPREIDvlvvnvsllasaps  1272
             Y P NVL+GRE+SPT  D+  E+DD     +  + AK+ V  R++D++V+NV   + APS
Sbjct  85    YCPRNVLQGREESPTHHDALEEMDDFFAHAVAGVLAKTAVRARDVDLVVLNVGSFSPAPS  144

Query  1271  LTSRVVNRYKMREDVKTFNLSGMGCSASVVAIDIVHH--LFKVYKNSYAIVVSTESLGAN  1098
             L SR+V R+ MREDV  +NLSGMGCSA ++A+D+  +  L +  + + A+VV++ES   N
Sbjct  145   LVSRLVRRFGMREDVMAYNLSGMGCSAGLIAVDLARNVMLTRRPRTTMALVVTSESCAPN  204

Query  1097  WYSGKERSMMLSNCLFRSGGCSMLFTNNPALKPRAILKLKHMVRTHIAAIDEAYECCKQV  918
             WY G ++SMML NCLFR GG + L TN+PA + RA ++L+ +VR +I A D+A+      
Sbjct  205   WYVGTDKSMMLGNCLFRCGGAAALLTNDPAFRSRAKMELRCLVRANIGANDDAHAAAVHR  264

Query  917   EDPQGFRGFHLSKRLPKVATKALVTNFKVLVPKAIPLWETLRFLAVSSLERRKFKLPSLL  738
             ED  G  G  LSK LPK A +A   N + L P+ +P  E  RF   S L  RK     L+
Sbjct  265   EDADGRLGVSLSKALPKAAVRAFTENLQRLAPRILPARELARF--ASRLLLRKL----LM  318

Query  737   GK-------PILNMKTGIEHFCLHPGGRAVIDGVGVSLGLSEYDLEPARMSLHRWGNTSA  579
             G        P ++ KTG++HFCLHPGG AVI+ V  SLGL+ +D+EPARM+LHRWGNTSA
Sbjct  319   GPRKHAAEGPKIDFKTGVDHFCLHPGGTAVIEAVRKSLGLTAHDVEPARMTLHRWGNTSA  378

Query  578   GGLWYVLGYMEAKKRLKKGDRILMLSLGAGFKCNNCVWEVMKDLGDPNVWEDCIDRYPPE  399
               LWYVL YMEAK+RLK+GDR+LM++ G+GFKCN+C WEV +DL D   WEDCID YPPE
Sbjct  379   SSLWYVLSYMEAKRRLKRGDRVLMVTFGSGFKCNSCYWEVTRDLADAGAWEDCIDEYPPE  438

Query  398   TLVNPFTEKFDWI  360
             TLVNP+ +KF W+
Sbjct  439   TLVNPYMDKFGWV  451



>ref|NP_001064831.1| Os10g0472900 [Oryza sativa Japonica Group]
 gb|AAG16863.1|AC069145_12 putative fatty acid elongase [Oryza sativa Japonica Group]
 gb|AAL31025.1|AC078948_9 putative fatty acid elongase 3-ketoacyl-CoA synthase [Oryza sativa 
Japonica Group]
 gb|AAP54239.1| beta-ketoacyl-CoA synthase family protein, putative, expressed 
[Oryza sativa Japonica Group]
 dbj|BAF26745.1| Os10g0472900 [Oryza sativa Japonica Group]
 dbj|BAG99955.1| unnamed protein product [Oryza sativa Japonica Group]
Length=465

 Score =   453 bits (1165),  Expect = 3e-150, Method: Compositional matrix adjust.
 Identities = 229/462 (50%), Positives = 318/462 (69%), Gaps = 13/462 (3%)
 Frame = -1

Query  1703  METLVAIYSLLFLYTVVYILRSYL-RRRHQCCYMLNYECYKPTDVARRLSTDKSALVVYR  1527
             ME    +   L  Y+   + R  + R R + CY+L+Y CYK TD  R+L TD    ++ R
Sbjct  1     MEVATMLTLTLLAYSAAMLARLLVARSRRRRCYLLDYVCYKATD-DRKLPTDLCGEIIQR  59

Query  1526  NRNLGIDEFRFLLQTMVNSGVGEQTYIPINVLEGREDSPT-LEDSFTEVDDIMFQTLDNL  1350
             N+ LG++E++FLL+ +VNSG+GE+TY P N++ G +  P  L +   E+D+     LD L
Sbjct  60    NKLLGLEEYKFLLKVIVNSGIGEETYGPRNIIGGGDARPDRLAEGMEEMDETFHAVLDEL  119

Query  1349  FAKSK------VSPREIDvlvvnvsllasapsLTSRVVNRYKMREDVKTFNLSGMGCSAS  1188
             FA+S       V P ++D+LVVNVS+ + APSL++RVV RY +REDVK +NL+GMGCSA+
Sbjct  120   FARSSAAGGGGVRPADVDLLVVNVSMFSPAPSLSARVVRRYNLREDVKVYNLTGMGCSAT  179

Query  1187  VVAIDIVHHLFKVYKNSYAIVVSTESLGANWYSGKERSMMLSNCLFRSGGCSMLFTNNPA  1008
             ++A+D+V++  + + N  A+V+++ES+  NWY+G +RS ML NCLFRSGGC+   TN+P 
Sbjct  180   LIALDLVNNFLRTHANKVALVMTSESIAPNWYAGNKRSFMLGNCLFRSGGCAYFLTNDPR  239

Query  1007  LKPRAILKLKHMVRTHIAAIDEAYECCKQVEDPQGFRGFHLSKRLPKVATKALVTNFKVL  828
              +  A L+L+H+VRTH  A D+AY C  Q+ED  G  GFHL K LP+ A  A V N ++L
Sbjct  240   HRRHAKLRLRHLVRTHTGASDDAYSCALQMEDDAGRPGFHLGKDLPRAAVHAFVKNLRLL  299

Query  827   VPKAIPLWETLRFLA---VSSLERRKFKLPSLLGKPI-LNMKTGIEHFCLHPGGRAVIDG  660
              P+ +PL E LR      +SS  R   K  S   +P+ + MK G++HFC+H GG AVIDG
Sbjct  300   APRVLPLPELLRLAFATFLSSGRRSGGKKTSPSQQPLTIRMKAGVDHFCVHTGGAAVIDG  359

Query  659   VGVSLGLSEYDLEPARMSLHRWGNTSAGGLWYVLGYMEAKKRLKKGDRILMLSLGAGFKC  480
             VG  L L+E+DLEP+RM+LHR+GNTSA  +WYVLGYMEAK+RL+ GDR+LML+ GAGFKC
Sbjct  360   VGKGLTLTEHDLEPSRMTLHRFGNTSASSVWYVLGYMEAKRRLRPGDRVLMLTFGAGFKC  419

Query  479   NNCVWEVMKDLGDPNVWEDCIDRYPPETLVNPFTEKFDWIHD  354
             N+CVW V K + D  VW+DCID YPP+ L NPF EK+ ++ D
Sbjct  420   NSCVWTVEKPVSDAGVWKDCIDHYPPKELANPFMEKYGFVKD  461



>ref|XP_008461613.1| PREDICTED: 3-ketoacyl-CoA synthase 21-like isoform X2 [Cucumis 
melo]
Length=390

 Score =   450 bits (1158),  Expect = 3e-150, Method: Compositional matrix adjust.
 Identities = 228/383 (60%), Positives = 293/383 (77%), Gaps = 12/383 (3%)
 Frame = -1

Query  1691  VAIYSLLFLYTVVYILRSYLRRRHQ-CCYMLNYECYKPTDVARRLSTDKSALVVYRNRNL  1515
             +A+  +  L+T+  + +  L+ ++Q CCYML Y+CYKP D  R+L+TD    +V RN+NL
Sbjct  7     MALCLITLLFTIFTLFKLLLQWKNQSCCYMLAYQCYKPIDPTRKLNTDSCVKIVLRNKNL  66

Query  1514  GIDEFRFLLQTMVNSGVGEQTYIPINVLEGREDSPTLEDSFTEVDDIMFQTLDNLFAKSK  1335
             G+DE+RFLL+T+V+SG+ E TY P NVLEG E++PTL ++  E+DDI+F TLD LFAK+ 
Sbjct  67    GLDEYRFLLKTIVSSGISEHTYAPKNVLEGHEENPTLNEAVAEMDDIIFDTLDKLFAKTL  126

Query  1334  VSPREIDvlvvnvsllasapsLTSRVVNRYKMREDVKTFNLSGMGCSASVVAIDIVHHLF  1155
             VSP +I +LVV+VSL + +P LTSR+VNRYKMRED+K FNLSGMGCSAS+VAID+V++LF
Sbjct  127   VSPSDIKILVVSVSLFSPSPCLTSRIVNRYKMREDIKAFNLSGMGCSASIVAIDLVNNLF  186

Query  1154  KVYKNSYAIVVSTESLGANWYSGKERSMMLSNCLFRSGGCSMLFTNNPALKPRAILKLKH  975
             K Y NSYAIVV+TES+G NWY GKE+ M+LSNCLFRSGGCSMLFTN   LK +A+LKL  
Sbjct  187   KCYDNSYAIVVATESMGPNWYVGKEKQMVLSNCLFRSGGCSMLFTNKRELKHQAMLKLNC  246

Query  974   MVRTHIAAIDEAYECCKQVEDPQGFRGFHLSKRLPKVATKALVTNFKVLVPKAIPLWETL  795
             +VRTH+ A DEAY+CC QVED  G+RGF L+K LPK A+K    N +VLVPK +P  E  
Sbjct  247   LVRTHLGANDEAYQCCIQVEDDSGYRGFRLTKNLPKAASKIFAMNLRVLVPKILPWRELS  306

Query  794   RFLAVSSLERRKFKLP--------SLLGKPI--LNMKTGIEHFCLHPGGRAVIDGVGVSL  645
             R++  +S  R+  KLP         L   PI  LN+KTG++HFC+HPGGRAVID VG SL
Sbjct  307   RYVIANSFIRKN-KLPKGAMGAKGGLRQGPIIGLNLKTGVDHFCIHPGGRAVIDSVGKSL  365

Query  644   GLSEYDLEPARMSLHRWGNTSAG  576
             GL+ YDLEPARM+LHR+GNTS+ 
Sbjct  366   GLNAYDLEPARMALHRFGNTSSA  388



>gb|KGN65694.1| Beta-ketoacyl-coa synthase family protein [Cucumis sativus]
Length=431

 Score =   451 bits (1159),  Expect = 7e-150, Method: Compositional matrix adjust.
 Identities = 231/423 (55%), Positives = 313/423 (74%), Gaps = 3/423 (1%)
 Frame = -1

Query  1703  METLVAIYSLLFLYTVVYILRSYLRRRHQCCYMLNYECYKPTDVARRLSTDKSALVVYRN  1524
             ME L  +Y++  LY  + + + +  +R Q CY+L+Y+C+KP++  R L T     ++ R 
Sbjct  1     MEPLFLLYAIPLLYLALKLWKHFDAKRDQQCYILDYQCFKPSE-DRMLGTQLCRDLMKRT  59

Query  1523  RNLGIDEFRFLLQTMVNSGVGEQTYIPINVLEGREDSPTLEDSFTEVDDIMFQTLDNLFA  1344
             +NLG++EF+FLL+ +VNSG+GEQTY P  V  G+E  P+L DS  EV++     L  LF 
Sbjct  60    KNLGLEEFKFLLKAVVNSGIGEQTYGPRVVFSGKESHPSLVDSIIEVEEFFLDCLHKLFQ  119

Query  1343  KSKVSPREIDvlvvnvsllasapsLTSRVVNRYKMREDVKTFNLSGMGCSASVVAIDIVH  1164
             KS VSP +ID+LVVN+S+L+++PSL S ++N++KM+ED+K FNLSGMGCSAS++++D+V 
Sbjct  120   KSGVSPSQIDILVVNISMLSTSPSLASIIINKFKMKEDIKVFNLSGMGCSASLISVDVVR  179

Query  1163  HLFKVYKNSYAIVVSTESLGANWYSGKERSMMLSNCLFRSGGCSMLFTNNPALKPRAILK  984
              +FK + NSY IVV++ESL ANWYSG +RSM+L+NCLFRSGG ++L TN  +LK +A+LK
Sbjct  180   RMFKSHMNSYGIVVTSESLTANWYSGNDRSMILANCLFRSGGAAILLTNKRSLKNKALLK  239

Query  983   LKHMVRTHIAAIDEAYECCKQVEDPQGFRGFHLSKRLPKVATKALVTNFKVLVPKAIPLW  804
             LK +VRTH  A DE+YECC Q ED QG  GFHL K LP+ A +A   N + + PK +P+ 
Sbjct  240   LKCLVRTHHGAQDESYECCYQKEDDQGNLGFHLGKSLPRAAIRAFTDNLREISPKILPIT  299

Query  803   ETLRFLAVSSLERRKFKLPS--LLGKPILNMKTGIEHFCLHPGGRAVIDGVGVSLGLSEY  630
             E  R   ++ + +      S     KP+ N KTG EHFCLH GG+AVIDGVG SL L+E+
Sbjct  300   EIFRLTILTIIHKISLASSSKPRWPKPMANFKTGAEHFCLHTGGKAVIDGVGKSLNLTEH  359

Query  629   DLEPARMSLHRWGNTSAGGLWYVLGYMEAKKRLKKGDRILMLSLGAGFKCNNCVWEVMKD  450
             DLEPARM+LHR+GNTSA  LWYVLGYMEAKKRLKKGD++LM+S GAGFKCN+C+WEVM +
Sbjct  360   DLEPARMTLHRFGNTSASSLWYVLGYMEAKKRLKKGDKVLMISFGAGFKCNSCLWEVMTE  419

Query  449   LGD  441
             LG+
Sbjct  420   LGE  422



>ref|XP_003574048.1| PREDICTED: 3-ketoacyl-CoA synthase 12-like [Brachypodium distachyon]
Length=473

 Score =   449 bits (1155),  Expect = 1e-148, Method: Compositional matrix adjust.
 Identities = 227/454 (50%), Positives = 314/454 (69%), Gaps = 26/454 (6%)
 Frame = -1

Query  1655  VYILRSYLRRRHQCCYMLNYECYKPTDVARRLSTDKSALVVYRNRNLGIDEFRFLLQTMV  1476
             V + R+ +RR    CY+L+Y CYK TD  R+L TD    ++ RN+ LG++E++FLL+ +V
Sbjct  22    VLVARARMRR----CYLLDYVCYKGTD-DRKLPTDLCGEIIQRNKLLGLEEYKFLLKVIV  76

Query  1475  NSGVGEQTYIPINVLEGREDSPT-LEDSFTEVDDIMFQTLDNLFAKSK------VSPREI  1317
             NSG+GE+TY P N++ G + SP  + +   E+D+     LD LFA+S       V P ++
Sbjct  77    NSGIGEETYGPRNIIAGGDASPDRVNEGMEEMDETFHAVLDELFARSAAPGGIGVRPEDV  136

Query  1316  DvlvvnvsllasapsLTSRVVNRYKMREDVKTFNLSGMGCSASVVAIDIVHHLFKVYKNS  1137
             D+LVVNVS+ + APSL++RVV RY +REDVK FNL+GMGCSA+++A+D+ ++ F+ + + 
Sbjct  137   DLLVVNVSMFSPAPSLSARVVRRYGLREDVKVFNLTGMGCSATLIALDLANNFFRTHASK  196

Query  1136  YAIVVSTESLGANWYSGKERSMMLSNCLFRSGGCSMLFTNNPALKPRAILKLKHMVRTHI  957
              A+V+++ES+  NWY G +RS ML NCLFRSGGC+   TN+P L+P A L+L+H+VRTH 
Sbjct  197   VALVMTSESIAPNWYPGNKRSFMLGNCLFRSGGCAYFLTNSPRLRPHAKLRLRHVVRTHT  256

Query  956   AAIDEAYECCKQVEDPQGFRGFHLSKRLPKVATKALVTNFKVLVPKAIPLWETLRFLAVS  777
              A DE+Y C  Q+ED  G  GFHL K LP+ A  A V N +VL P+ +PL E LR LA S
Sbjct  257   GASDESYNCALQMEDDAGRPGFHLGKELPRAAVGAFVKNLRVLAPRVLPLPELLR-LAYS  315

Query  776   SLERRKFKL------------PSLLGKPILNMKTGIEHFCLHPGGRAVIDGVGVSLGLSE  633
             +L  R  +             P       + MK G++HFC+H GG AVIDGVG  L L+E
Sbjct  316   TLSSRLARRSNNNNNNNNNTKPKSSSAMTIRMKAGVDHFCVHTGGAAVIDGVGKGLTLTE  375

Query  632   YDLEPARMSLHRWGNTSAGGLWYVLGYMEAKKRLKKGDRILMLSLGAGFKCNNCVWEVMK  453
             +D+EP+RM+LHR+GNTSA  +WYVL YMEAK+RLK+GDR+LML+ GAGFKCN+CVW V K
Sbjct  376   HDIEPSRMTLHRFGNTSASSVWYVLSYMEAKRRLKRGDRVLMLTFGAGFKCNSCVWTVEK  435

Query  452   -DLGDPNVWEDCIDRYPPETLVNPFTEKFDWIHD  354
              D+ D  VW+DCI  YPP+ + NPF EK+ ++ D
Sbjct  436   DDIADAGVWKDCIHEYPPKEIRNPFMEKYGFVKD  469



>gb|EMS56142.1| 3-ketoacyl-CoA synthase 12 [Triticum urartu]
Length=458

 Score =   448 bits (1152),  Expect = 2e-148, Method: Compositional matrix adjust.
 Identities = 224/437 (51%), Positives = 304/437 (70%), Gaps = 14/437 (3%)
 Frame = -1

Query  1631  RRRHQCCYMLNYECYKPTDVARRLSTDKSALVVYRNRNLGIDEFRFLLQTMVNSGVGEQT  1452
             R R + CY+++Y CYK TD  R+L TD    ++ RN+ LG++E++FLL+ +VNSG+GE+T
Sbjct  21    RSRRRRCYLVDYVCYKGTD-DRKLPTDLCGEIIQRNKLLGLEEYKFLLKVIVNSGIGEET  79

Query  1451  YIPINVLEGREDSPT-LEDSFTEVDDIMFQTLDNLFAKSK------VSPREIDvlvvnvs  1293
             Y P N++ G + SP  + +   E+D+     LD LFA+S       + P ++D+LVVNVS
Sbjct  80    YGPRNIIAGGDASPDRVAEGMEEMDETFHSVLDELFARSAAPGGLGLRPADVDLLVVNVS  139

Query  1292  llasapsLTSRVVNRYKMREDVKTFNLSGMGCSASVVAIDIVHHLFKVYKNSYAIVVSTE  1113
             + + APSL++RVV RY +REDVK FNL+GMGCSA+++A+D+ ++ F+ + N  A+V+++E
Sbjct  140   MFSPAPSLSARVVRRYGLREDVKVFNLTGMGCSATLIALDLANNFFRTHANKVALVMTSE  199

Query  1112  SLGANWYSGKERSMMLSNCLFRSGGCSMLFTNNPALKPRAILKLKHMVRTHIAAIDEAYE  933
             S+  NWY G  RS ML NCLFRSGGC+   TN+P L+P A L+L+H+VRTH  A DEAY 
Sbjct  200   SIAPNWYPGNRRSFMLGNCLFRSGGCAYFLTNSPRLRPHAKLRLRHVVRTHTGASDEAYN  259

Query  932   CCKQVEDPQGFRGFHLSKRLPKVATKALVTNFKVLVPKAIPLWETLRF----LAVSSLER  765
             C  Q+ED  G  GFHL K LP+ A  A V N +VL P+ +PL E LR     L+   L R
Sbjct  260   CALQMEDDAGRPGFHLGKELPRAAVHAFVKNLRVLSPRVLPLPELLRLAYATLSARFLTR  319

Query  764   RKFKLPSLLGKPILNMKTGIEHFCLHPGGRAVIDGVGVSLGLSEYDLEPARMSLHRWGNT  585
                K PS      + MK G++HFC+H GG AVIDGVG  L L+E+D+EP+RM+LHR+GNT
Sbjct  320   TNKKKPS--SALTIRMKAGVDHFCVHTGGAAVIDGVGKGLTLTEHDIEPSRMTLHRFGNT  377

Query  584   SAGGLWYVLGYMEAKKRLKKGDRILMLSLGAGFKCNNCVWEVMKDLGDPNVWEDCIDRYP  405
             SA  +WYVL YMEAKKRL KGDR+LML+ GAGFKCN+CVW V +   D  VW DCI  YP
Sbjct  378   SASSVWYVLSYMEAKKRLNKGDRVLMLTFGAGFKCNSCVWTVERPGTDAGVWADCIHEYP  437

Query  404   PETLVNPFTEKFDWIHD  354
             P+ + NPF EK+ ++ D
Sbjct  438   PKEIRNPFMEKYGFVKD  454



>ref|NP_001050243.1| Os03g0382100 [Oryza sativa Japonica Group]
 gb|AAR96244.1| putative fatty acid elongase [Oryza sativa Japonica Group]
 gb|ABF96278.1| beta-ketoacyl-CoA synthase family protein, putative, expressed 
[Oryza sativa Japonica Group]
 dbj|BAF12157.1| Os03g0382100 [Oryza sativa Japonica Group]
 dbj|BAH01093.1| unnamed protein product [Oryza sativa Japonica Group]
Length=467

 Score =   447 bits (1149),  Expect = 8e-148, Method: Compositional matrix adjust.
 Identities = 222/460 (48%), Positives = 310/460 (67%), Gaps = 11/460 (2%)
 Frame = -1

Query  1703  METLVAIYSLLFLYTVVYIL-RSYLRRRHQCCYMLNYECYKPTDVARRLSTDKSALVVYR  1527
             ME L  +  LL  + V Y+   +  RRR   CY+L+Y C+KP+D  R++ST+ +  V+ R
Sbjct  1     MELLALVTVLLLAHAVAYLAWTAAARRRQSRCYLLDYVCHKPSD-DRKVSTEAAGAVIER  59

Query  1526  NRNLGIDEFRFLLQTMVNSGVGEQTYIPINVLEGREDSPTLEDSFTEVDDIMFQTLDNLF  1347
             ++ L + E+RFLL+ +V SG+GE+TY P NVL+GRE  PT  DS  E++D    ++  LF
Sbjct  60    SKRLSLPEYRFLLRVIVRSGIGEETYAPRNVLDGREGEPTHGDSLGEMEDFFGDSIAELF  119

Query  1346  AKSKVSPREIDvlvvnvsllasapsLTSRVVNRYKMREDVKTFNLSGMGCSASVVAIDIV  1167
             A++   PR++DVLVVN S+ +  PSL S +V+RY MREDV  ++L+GMGCSA ++++D+ 
Sbjct  120   ARTGFGPRDVDVLVVNASMFSPDPSLASMIVHRYGMREDVAAYSLAGMGCSAGLISLDLA  179

Query  1166  HHLFKVYKNSYAIVVSTESLGANWYSGKERSMMLSNCLFRSGGCSMLFTNNPALKPRAIL  987
              +       + A+VVSTES+  NWY+G ++SMML+NCLFR GG S+L TN+P L+ RA +
Sbjct  180   RNTLATRPRALALVVSTESIAPNWYTGTDKSMMLANCLFRCGGASVLVTNDPVLRGRAKM  239

Query  986   KLKHMVRTHIAAIDEAYECCKQVEDPQGFRGFHLSKRLPKVATKALVTNFKVLVPKAIPL  807
             +L  +VR +IAA D+A+ C  Q ED  G  G  LSK LPK A +A   N + L P+ +P+
Sbjct  240   ELGCLVRANIAANDDAHACALQREDDDGTVGISLSKALPKAAVRAFAANLRRLAPRILPI  299

Query  806   WETLRFLAVSSLERRKFKLPSLL---------GKPILNMKTGIEHFCLHPGGRAVIDGVG  654
              E  RF A   + ++  +  +             P +N KTG++HFCLHPGG AVI+ V 
Sbjct  300   TELARFAAQLLITKKLLRRRATAATATKHTGGDGPRINFKTGVDHFCLHPGGTAVIEAVK  359

Query  653   VSLGLSEYDLEPARMSLHRWGNTSAGGLWYVLGYMEAKKRLKKGDRILMLSLGAGFKCNN  474
              SLGL + D+EPARM+LHRWGNTSA  LWYVL YMEAK RL++GD++LM++ G+GFKCN+
Sbjct  360   RSLGLDDDDVEPARMTLHRWGNTSASSLWYVLSYMEAKGRLRRGDKVLMVTFGSGFKCNS  419

Query  473   CVWEVMKDLGDPNVWEDCIDRYPPETLVNPFTEKFDWIHD  354
             CVWEV  D+ D   W DCID YPPE   NP+ EK+ WI+D
Sbjct  420   CVWEVTGDMADKGAWADCIDAYPPENTANPYMEKYSWIND  459



>gb|EAZ27140.1| hypothetical protein OsJ_11071 [Oryza sativa Japonica Group]
Length=467

 Score =   447 bits (1149),  Expect = 9e-148, Method: Compositional matrix adjust.
 Identities = 222/460 (48%), Positives = 310/460 (67%), Gaps = 11/460 (2%)
 Frame = -1

Query  1703  METLVAIYSLLFLYTVVYILRSYLRRRHQC-CYMLNYECYKPTDVARRLSTDKSALVVYR  1527
             ME L  +  LL  + V Y+  +   RR Q  CY+L+Y C+KP+D  R++ST+ +  V+ R
Sbjct  1     MELLALVTVLLLAHAVAYLAWTAAARRQQSRCYLLDYVCHKPSD-DRKVSTEAAGAVIER  59

Query  1526  NRNLGIDEFRFLLQTMVNSGVGEQTYIPINVLEGREDSPTLEDSFTEVDDIMFQTLDNLF  1347
             ++ L + E+RFLL+ +V SG+GE+TY P NVL+GRE  PT  DS  E++D    ++  LF
Sbjct  60    SKRLSLPEYRFLLRVIVRSGIGEETYAPRNVLDGREGEPTHGDSLGEMEDFFGDSIAELF  119

Query  1346  AKSKVSPREIDvlvvnvsllasapsLTSRVVNRYKMREDVKTFNLSGMGCSASVVAIDIV  1167
             A++   PR++DVLVVN S+ +  PSL S +V+RY MREDV  ++L+GMGCSA ++++D+ 
Sbjct  120   ARTGFGPRDVDVLVVNASMFSPDPSLASMIVHRYGMREDVAAYSLAGMGCSAGLISLDLA  179

Query  1166  HHLFKVYKNSYAIVVSTESLGANWYSGKERSMMLSNCLFRSGGCSMLFTNNPALKPRAIL  987
              +       + A+VVSTES+  NWY+G ++SMML+NCLFR GG S+L TN+P L+ RA +
Sbjct  180   RNTLATRPRALALVVSTESIAPNWYTGTDKSMMLANCLFRCGGASVLVTNDPVLRGRAKM  239

Query  986   KLKHMVRTHIAAIDEAYECCKQVEDPQGFRGFHLSKRLPKVATKALVTNFKVLVPKAIPL  807
             +L  +VR +IAA D+A+ C  Q ED  G  G  LSK LPK A +A   N + L P+ +P+
Sbjct  240   ELGCLVRANIAANDDAHACALQREDDDGTVGISLSKALPKAAVRAFAANLRRLAPRILPI  299

Query  806   WETLRFLAVSSLERRKFKLPSLL---------GKPILNMKTGIEHFCLHPGGRAVIDGVG  654
              E  RF A   + ++  +  +             P +N KTG++HFCLHPGG AVI+ V 
Sbjct  300   TELARFAAQLLITKKLLRRRATAATATKHTGGDGPRINFKTGVDHFCLHPGGTAVIEAVK  359

Query  653   VSLGLSEYDLEPARMSLHRWGNTSAGGLWYVLGYMEAKKRLKKGDRILMLSLGAGFKCNN  474
              SLGL + D+EPARM+LHRWGNTSA  LWYVL YMEAK RL++GD++LM++ G+GFKCN+
Sbjct  360   RSLGLDDDDVEPARMTLHRWGNTSASSLWYVLSYMEAKGRLRRGDKVLMVTFGSGFKCNS  419

Query  473   CVWEVMKDLGDPNVWEDCIDRYPPETLVNPFTEKFDWIHD  354
             CVWEV  D+ D   W DCID YPPE   NP+ EK+ WI+D
Sbjct  420   CVWEVTGDMADKGAWADCIDAYPPENTANPYMEKYSWIND  459



>ref|XP_004982889.1| PREDICTED: 3-ketoacyl-CoA synthase 12-like [Setaria italica]
Length=461

 Score =   445 bits (1145),  Expect = 3e-147, Method: Compositional matrix adjust.
 Identities = 221/430 (51%), Positives = 306/430 (71%), Gaps = 14/430 (3%)
 Frame = -1

Query  1613  CYMLNYECYKPTDVARRLSTDKSALVVYRNRNLGIDEFRFLLQTMVNSGVGEQTYIPINV  1434
             CY+L+Y CYK TD  R+L TD    ++ RN+ LG++E++FLL+ +VNSG+GE+TY P N+
Sbjct  32    CYLLDYVCYKATD-DRKLPTDLCGEIIQRNKLLGLEEYKFLLKVIVNSGIGEETYGPRNI  90

Query  1433  LEGREDSPT-LEDSFTEVDDIMFQTLDNLFAKSK------VSPREIDvlvvnvsllasap  1275
             +EG E  P  L++   E+D+     LD LFA+S       + P ++D+LVVNVS+ + AP
Sbjct  91    IEGGEARPDRLKEGMEEMDETFHAVLDELFARSAAPGGVGIRPADVDILVVNVSMFSPAP  150

Query  1274  sLTSRVVNRYKMREDVKTFNLSGMGCSASVVAIDIVHHLFKVYKNSYAIVVSTESLGANW  1095
             SL +RVV RY +REDVK +NL+GMGCSA+++A+D+V++ F+ +    A+V+++ES+  NW
Sbjct  151   SLAARVVRRYGLREDVKVYNLTGMGCSATLIALDLVNNFFRTHAGQVALVMTSESIAPNW  210

Query  1094  YSGKERSMMLSNCLFRSGGCSMLFTNNPALKPRAILKLKHMVRTHIAAIDEAYECCKQVE  915
             Y+G +RS ML NCLFRSGGC+   TN+P L+P A L+L+H+VRTH  + +EAY C  Q+E
Sbjct  211   YAGNKRSFMLGNCLFRSGGCAYFLTNDPRLRPHAKLRLRHVVRTHTGSSEEAYNCALQME  270

Query  914   DPQGFRGFHLSKRLPKVATKALVTNFKVLVPKAIPLWETLRFLAV---SSLERRKFKLPS  744
             D  G  GFHL K LP+ A  A V N +VL P+ +PL E LR       + L R+K +  +
Sbjct  271   DDAGRPGFHLGKELPRAAVHAFVHNLRVLAPRVLPLPELLRLACATLSARLARKKQRGSN  330

Query  743   LLGKPILNMKTGIEHFCLHPGGRAVIDGVGVSLGLSEYDLEPARMSLHRWGNTSAGGLWY  564
              L    + MK G++HFC+H GG AVIDGVG  L L+E+DLEP+RM+LHR+GNTSA  +WY
Sbjct  331   HL---TIRMKAGVDHFCVHTGGAAVIDGVGKGLTLTEHDLEPSRMTLHRFGNTSASSVWY  387

Query  563   VLGYMEAKKRLKKGDRILMLSLGAGFKCNNCVWEVMKDLGDPNVWEDCIDRYPPETLVNP  384
             VLGYMEAK RL+KGDR+LML+ GAGFKCN+CVW V K   D  VW+D ID+YP + + NP
Sbjct  388   VLGYMEAKGRLRKGDRVLMLTFGAGFKCNSCVWTVEKPATDAGVWKDRIDQYPLKDVSNP  447

Query  383   FTEKFDWIHD  354
             F EK+ ++ D
Sbjct  448   FMEKYGFVKD  457



>gb|AFW73988.1| hypothetical protein ZEAMMB73_394221, partial [Zea mays]
Length=463

 Score =   445 bits (1144),  Expect = 5e-147, Method: Compositional matrix adjust.
 Identities = 226/458 (49%), Positives = 313/458 (68%), Gaps = 12/458 (3%)
 Frame = -1

Query  1703  METLVAIYSLLFLYTVVYIL-RSYLRRRHQCCYMLNYECYKPTDVARRLSTDKSALVVYR  1527
             ME L  +  LL  +T  Y+  ++  RRR  CCY+L+Y C+KP+D  R+++T+ +  V+ R
Sbjct  1     MELLALLTVLLLAHTAAYLAWQAVSRRRRACCYLLDYACHKPSD-DRKVTTETAGAVIER  59

Query  1526  NRNLGIDEFRFLLQTMVNSGVGEQTYIPINVLEGREDSPTLEDSFTEVDDIMFQTLDNLF  1347
             N+ LG+ E+RFLL+ +VNSG+GE TY P NVL+GRE+SPT  D+  E+D+     +  + 
Sbjct  60    NKRLGLSEYRFLLKVIVNSGIGEHTYCPRNVLQGREESPTHGDALEEMDEFFADAVAGVL  119

Query  1346  AKSKVSPREIDvlvvnvsllasapsLTSRVVNRYKMREDVKTFNLSGMGCSASVVAIDIV  1167
             A++ V  R++D++V+NV   + APSL SR+V R+ MR+DV  +NLSGMGCSA +VA+D+ 
Sbjct  120   ARTGVRARDVDLVVLNVGSFSPAPSLVSRLVRRFGMRDDVMAYNLSGMGCSAGLVAVDLA  179

Query  1166  HHLFKVYKNSYAIVVSTESLGANWYSGKERSMMLSNCLFRSGGCSMLFTNNPALKPRAIL  987
               +      + A+VV++ES   NWY G ++SMML NCLFR GG + L TN+ A + RA +
Sbjct  180   RGVMLTRPRTMALVVTSESCAPNWYVGTDKSMMLGNCLFRCGGAAALLTNDRAFRARAKM  239

Query  986   KLKHMVRTHIAAIDEAYECCKQVEDPQGFRGFHLSKRLPKVATKALVTNFKVLVPKAIPL  807
             +L+ +VR +I A D+A+      ED  G  G  LSK LPK A +A   N + L P+ +P 
Sbjct  240   ELRCLVRANIGAHDDAHAAAVHREDADGRLGVSLSKALPKAAVRAFTENLQRLAPRILPA  299

Query  806   WETLRFLAVSSLERRKFKLPS-------LLGKPILNMKTGIEHFCLHPGGRAVIDGVGVS  648
              E  RF   S L  RK  LP+         G P ++ K G++HFCLHPGG AVI+ V  S
Sbjct  300   RELARF--ASRLLLRKL-LPAGTPRNKHAGGSPKIDFKAGVDHFCLHPGGTAVIEAVRKS  356

Query  647   LGLSEYDLEPARMSLHRWGNTSAGGLWYVLGYMEAKKRLKKGDRILMLSLGAGFKCNNCV  468
             LGL+ +D+EPARM+LHRWGNTSA  LWYVL YMEAK+RLK+GDR+LM++ G+GFKCN+C 
Sbjct  357   LGLTAHDVEPARMTLHRWGNTSASSLWYVLSYMEAKRRLKRGDRVLMVTFGSGFKCNSCY  416

Query  467   WEVMKDLGDPNVWEDCIDRYPPETLVNPFTEKFDWIHD  354
             WEV +DL D   WEDCID+YPPETLVNP+ +KF W++D
Sbjct  417   WEVTRDLADAGAWEDCIDQYPPETLVNPYMDKFGWVND  454



>gb|KCW51679.1| hypothetical protein EUGRSUZ_J01159 [Eucalyptus grandis]
Length=501

 Score =   444 bits (1142),  Expect = 3e-146, Method: Compositional matrix adjust.
 Identities = 229/418 (55%), Positives = 312/418 (75%), Gaps = 13/418 (3%)
 Frame = -1

Query  1703  METLVAIYSLLFLYTVVYILRSYLRRRHQCCYMLNYECYK-PTDVARRLSTDKSALVVYR  1527
             +  L A+Y     Y ++ ++R  LRRR QCCYML YECYK P D   +LSTD+ A ++ R
Sbjct  3     ITVLAAMYIFAVSYAMLSLVRGVLRRRSQCCYMLGYECYKAPEDT--KLSTDECARIILR  60

Query  1526  NRNLGIDEFRFLLQTMVNSGVGEQTYIPINVLEGREDSPTLEDSFTEVDDIMFQTLDNLF  1347
             N+NL ++++RFLL+TM  SG+GE TY P  VLEG E++PTL ++  E+D++  QT+  + 
Sbjct  61    NKNLDLEDYRFLLKTMARSGIGEDTYGPRLVLEGHEETPTLSEAHRELDEVFQQTVSKVL  120

Query  1346  AKSKVSPREIDvlvvnvsllasapsLTSRVVNRYKMREDVKTFNLSGMGCSASVVAIDIV  1167
             A + V+P EID+L+VNVSL + APSLTSR+VN +K+R+++KTFNL+GMGCSAS+VAI +V
Sbjct  121   ASTGVAPSEIDILIVNVSLFSPAPSLTSRIVNHFKLRDNIKTFNLAGMGCSASLVAIHLV  180

Query  1166  HHLFKVYKNSYAIVVSTESLGANWYSGKERSMMLSNCLFRSGGCSMLFTNN-PALKPRAI  990
               LFK   N+ A+VVSTES+G++WY GKE+SM++SNCLFR GGC++L TN+    K  AI
Sbjct  181   QELFKTKDNALALVVSTESMGSHWYCGKEKSMIISNCLFRMGGCAVLLTNDRNRAKDGAI  240

Query  989   LKLKHMVRTHIAAIDEAYECCKQVEDPQGFRGFHLSKRLPKVATKALVTNFKVLVPKAIP  810
             +KL H VR H  + DE+Y CC Q ED QG +GF L+K L K A +AL  N ++L+P+ +P
Sbjct  241   MKLSHSVRIHHGSHDESYSCCIQEEDGQGHQGFRLTKYLVKAAGQALEANLRILLPQVLP  300

Query  809   LWETLRF-----LAVSSLERRKFKLPSLLGKPI--LNMKTGIEHFCLHPGGRAVIDGVGV  651
             + E +R+     LA + L +RK +   + G P   LN+++GI+HFC+HPGG+AVID VG 
Sbjct  301   VRELVRYKLANALANNPLAKRKNR--KVRGGPSLNLNLRSGIDHFCVHPGGKAVIDTVGK  358

Query  650   SLGLSEYDLEPARMSLHRWGNTSAGGLWYVLGYMEAKKRLKKGDRILMLSLGAGFKCN  477
              L LS+YDLEP+RM+LHR+GNTSAGG WYVL YMEAKKRLK+GD++LM+SLGAGFK N
Sbjct  359   GLNLSDYDLEPSRMALHRFGNTSAGGNWYVLAYMEAKKRLKRGDKVLMISLGAGFKSN  416



>gb|EPS65202.1| hypothetical protein M569_09577, partial [Genlisea aurea]
Length=426

 Score =   441 bits (1133),  Expect = 6e-146, Method: Compositional matrix adjust.
 Identities = 223/420 (53%), Positives = 304/420 (72%), Gaps = 14/420 (3%)
 Frame = -1

Query  1613  CYMLNYECYKPTDVARRLSTDKSALVVYRNRNLGIDEFRFLLQTMVNSGVGEQTYIPINV  1434
             CY+++YEC+KP+D  R+L T     +V RN+NLG+ E RFLL+ +V SG+GE++Y P ++
Sbjct  16    CYLVDYECHKPSD-DRKLDTGYCGDIVARNKNLGLQECRFLLRAIVKSGIGEESYAPRSI  74

Query  1433  LEGREDSPTLEDSFTEVDDIMFQTLDNLFAKSKVSPREIDvlvvnvsllasapsLTSRVV  1254
             +EGRE+   L+D   E+D+    TL  LF K+ V+P EID+LVVNVSLL+  PSLTSR++
Sbjct  75    MEGRENCHRLDDGIAEMDEFFGDTLAELFRKTAVAPEEIDLLVVNVSLLSGVPSLTSRII  134

Query  1253  NRYKMREDVKTFNLSGMGCSASVVAIDIVHHLFKVYKNSYAIVVSTESLGANWYSGKERS  1074
             NRYKMRED+K+FNLSGMGCSAS+++ID+V++ FK ++N  AIVV++ES+  NWYSG ++S
Sbjct  135   NRYKMREDIKSFNLSGMGCSASLISIDLVNNFFKTHRNKLAIVVTSESIAPNWYSGTDKS  194

Query  1073  MMLSNCLFRSGGCSMLFTNNPALKPRAILKLKHMVRTHIAAIDEAYECCKQVEDPQGFRG  894
             M+L+NCLFRSGGCSML TN P+ + RA L+LK +VRTH+ + DEAY CC Q ED  G  G
Sbjct  195   MILTNCLFRSGGCSMLLTNRPSFRRRAKLRLKWLVRTHLGSSDEAYTCCMQREDADGNPG  254

Query  893   FHLSKRLPKVATKALVTNFKVLVPKAIPLWETLRFLAVSSLERRKFKLPSLLGKPILNMK  714
             F L K LPK A++A   N   +  KA+P    +R+      + R++ L        LN+K
Sbjct  255   FFLGKNLPKTASRAFAKNVAAIATKALPWSVLIRY------DHRRYALTRE-----LNLK  303

Query  713   TGIEHFCLHPGGRAVIDGVGVSLGLSEYDLEPARMSLHRWGNTSAGGLWYVLGYMEAKKR  534
              GI+HFC+HPGG AVI+ +   L L++ D+EP+RM+LHR+GNTSA  LWYVLGYMEAK R
Sbjct  304   EGIDHFCVHPGGTAVIEEIRKGLRLTDEDVEPSRMTLHRFGNTSASALWYVLGYMEAKGR  363

Query  533   LKKGDRILMLSLGAGFKCNNCVWEVMKD-LGDPNVWEDCIDRYPPETLVNPFTEKFDWIH  357
             L KGD++ M+S G+GFKCN+CVWEV  + + D NVWEDC      E  VNPF ++F  ++
Sbjct  364   LGKGDKVWMISFGSGFKCNSCVWEVANEGVKDANVWEDCGAAGRVEG-VNPFMDRFGGVY  422



>dbj|BAJ92417.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ88762.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=459

 Score =   441 bits (1135),  Expect = 9e-146, Method: Compositional matrix adjust.
 Identities = 218/423 (52%), Positives = 296/423 (70%), Gaps = 8/423 (2%)
 Frame = -1

Query  1613  CYMLNYECYKPTDVARRLSTDKSALVVYRNRNLGIDEFRFLLQTMVNSGVGEQTYIPINV  1434
             CY+L+Y C+KP+D  R+++T+ +  V+ RN+ LG+ ++RFLL+ +VNSG+GE TY P NV
Sbjct  32    CYLLDYACHKPSD-DRKVTTEMAGAVIERNKLLGMPDYRFLLKVIVNSGIGEHTYCPRNV  90

Query  1433  LEGREDSPTLEDSFTEVDDIMFQTLDNLFAKSKVSPREIDvlvvnvsllasapsLTSRVV  1254
             L+GRE+  T  D+  E+D      +  +F K+ VSPR++D++V+NV   + APSL +RVV
Sbjct  91    LDGREECATHYDALDEMDAFFDDAVRGVFDKTGVSPRDVDLVVLNVGSFSPAPSLAARVV  150

Query  1253  NRYKMREDVKTFNLSGMGCSASVVAIDIVHHLFKVYKNSYAIVVSTESLGANWYSGKERS  1074
              R+ MREDV+ +NLSGMGCSA ++++D+   +      + A+VV++ES   NWY+G ++S
Sbjct  151   ARFGMREDVQAYNLSGMGCSAGLISVDLARRVMLTRPRTMALVVTSESCAPNWYNGTDKS  210

Query  1073  MMLSNCLFRSGGCSMLFTNNPALKPRAILKLKHMVRTHIAAIDEAYECCKQVEDPQGFRG  894
             MML NCLFR GG + L TN+PA + RA ++L+ +VR HI A D+A+      ED  G  G
Sbjct  211   MMLGNCLFRCGGAAALLTNDPAYRSRAKMELRCLVRAHIGAHDDAHAAAVHCEDADGRLG  270

Query  893   FHLSKRLPKVATKALVTNFKVLVPKAIPLWETLRF---LAVSSLERRKFKLPSLLGKPIL  723
               LSK LPK A +A   N + L P+ +P  E  RF   L    L RRK K       P +
Sbjct  271   VSLSKALPKAAVRAFSENLQRLAPRILPAAELARFTVRLLARKLMRRKLKFEG----PKI  326

Query  722   NMKTGIEHFCLHPGGRAVIDGVGVSLGLSEYDLEPARMSLHRWGNTSAGGLWYVLGYMEA  543
             N KTG++HFCLHPGG AVI+ V  +LGL+ YD+EPA M+LHRWGNTSA  LWYVL YMEA
Sbjct  327   NFKTGVDHFCLHPGGTAVIEAVRKNLGLNSYDVEPAAMTLHRWGNTSASSLWYVLSYMEA  386

Query  542   KKRLKKGDRILMLSLGAGFKCNNCVWEVMKDLGDPNVWEDCIDRYPPETLVNPFTEKFDW  363
             K+RLK GDR+LM++ G+GFKCN+C WEV KDL D   WEDCID YPPET+VNP+TEKF W
Sbjct  387   KRRLKAGDRVLMVTFGSGFKCNSCYWEVSKDLDDAGAWEDCIDDYPPETMVNPYTEKFGW  446

Query  362   IHD  354
             ++D
Sbjct  447   VND  449



>ref|XP_004954331.1| PREDICTED: 3-ketoacyl-CoA synthase 3-like [Setaria italica]
Length=462

 Score =   440 bits (1131),  Expect = 4e-145, Method: Compositional matrix adjust.
 Identities = 219/429 (51%), Positives = 301/429 (70%), Gaps = 5/429 (1%)
 Frame = -1

Query  1631  RRRHQCCYMLNYECYKPTDVARRLSTDKSALVVYRNRNLGIDEFRFLLQTMVNSGVGEQT  1452
             RRR   CY+L+Y C+KP+D  R+++T+ +  V+ RN+ LG+ E+RFLL+ +VNSG+GE T
Sbjct  26    RRRRSRCYLLDYACHKPSD-DRKVTTETAGAVIERNKRLGLSEYRFLLKVIVNSGIGEHT  84

Query  1451  YIPINVLEGREDSPTLEDSFTEVDDIMFQTLDNLFAKSKVSPREIDvlvvnvsllasaps  1272
             Y P NVLEGRE++PT  DS  E+DD     +  + +++ V  R++D++V+NV   +  PS
Sbjct  85    YCPRNVLEGREETPTHADSLEEMDDFFADAVATVLSRTGVPARDVDLVVLNVGSFSPEPS  144

Query  1271  LTSRVVNRYKMREDVKTFNLSGMGCSASVVAIDIVHHLFKVYKNSYAIVVSTESLGANWY  1092
             L SR+V R+ MREDV  +NLSGMGCSA ++A+D+  ++      + A+VV++ES   NWY
Sbjct  145   LVSRLVRRFGMREDVMAYNLSGMGCSAGLIAVDLARNVMLTRPRTVALVVTSESCAPNWY  204

Query  1091  SGKERSMMLSNCLFRSGGCSMLFTNNPALKPRAILKLKHMVRTHIAAIDEAYECCKQVED  912
              G ++SMML NCLFR GG + L TN+PAL+ RA ++L+ +VR +IAA D+A+      ED
Sbjct  205   VGTDKSMMLGNCLFRCGGAAALLTNDPALRHRAKMELRCLVRANIAAHDDAHAAAVHRED  264

Query  911   PQGFRGFHLSKRLPKVATKALVTNFKVLVPKAIPLWETLRFLAVSSLERRKFKLPSLLGK  732
               G  G  LSK LPK A +A   N + L P+ +P  E  RF A   L R+  K P   G 
Sbjct  265   ADGRLGVSLSKALPKAAVRAFTDNLQRLAPRILPARELARF-ASRLLLRKLLKKPKAAGA  323

Query  731   ---PILNMKTGIEHFCLHPGGRAVIDGVGVSLGLSEYDLEPARMSLHRWGNTSAGGLWYV  561
                P ++  TG++HFCLHPGG AVI+ V  SLGL+ + +EPARM+LHRWGNTSA  LWYV
Sbjct  324   GEGPKIDFTTGVDHFCLHPGGTAVIEAVRKSLGLTAHHVEPARMTLHRWGNTSASSLWYV  383

Query  560   LGYMEAKKRLKKGDRILMLSLGAGFKCNNCVWEVMKDLGDPNVWEDCIDRYPPETLVNPF  381
             L YMEAK+RLK+GDR+LM++ G+GFKCN+C WEV +DL D   WEDCID+YPPETLVNP+
Sbjct  384   LSYMEAKRRLKRGDRVLMVTFGSGFKCNSCYWEVSRDLADAGAWEDCIDQYPPETLVNPY  443

Query  380   TEKFDWIHD  354
              +KF W++D
Sbjct  444   MDKFGWVND  452



>ref|XP_003570371.1| PREDICTED: 3-ketoacyl-CoA synthase 12-like [Brachypodium distachyon]
Length=465

 Score =   439 bits (1130),  Expect = 6e-145, Method: Compositional matrix adjust.
 Identities = 224/431 (52%), Positives = 299/431 (69%), Gaps = 7/431 (2%)
 Frame = -1

Query  1631  RRRHQCCYMLNYECYKPTDVARRLSTDKSALVVYRNRNLGIDEFRFLLQTMVNSGVGEQT  1452
             RRR   CY+L Y C+KP+D  R+++T+ +  V+ RN+ LG+ ++RFLL+ +VNSG+GE T
Sbjct  26    RRRRSRCYLLGYACHKPSD-DRKVTTEMAGAVIERNKRLGLPDYRFLLKVIVNSGIGEHT  84

Query  1451  YIPINVLEGREDSPTLEDSFTEVDDIMFQTLDNLFAKSKVSPREIDvlvvnvsllasaps  1272
             Y P NVL+GRE+S T  D+  E+D      +  +FA + VSPR++D+LV+NV   + APS
Sbjct  85    YSPRNVLDGREESATHLDALDEMDAFFDDAVARVFATTGVSPRQVDLLVLNVGSFSPAPS  144

Query  1271  LTSRVVNRYKMREDVKTFNLSGMGCSASVVAIDIVHHLFKVYKNS-YAIVVSTESLGANW  1095
             L SRV +R+ MR+DV  +NLSGMGCSA +V++D+   +      +  A+VV++ES   NW
Sbjct  145   LASRVASRFGMRDDVMAYNLSGMGCSAGLVSVDLARRVMLTRPGATMALVVTSESCAPNW  204

Query  1094  YSGKERSMMLSNCLFRSGGCSMLFTNNPALKPRAILKLKHMVRTHIAAIDEAYECCKQVE  915
             Y+G ++SMML NCLFR GG + L TN+PAL+ RA ++LK +VR HI A D+A+      E
Sbjct  205   YNGTDKSMMLGNCLFRCGGAAALLTNDPALRGRAKMELKCLVRAHIGAHDDAHAAAVHRE  264

Query  914   DPQGFRGFHLSKRLPKVATKALVTNFKVLVPKAIPLWE----TLRFLAVSSLERRKFKLP  747
             D  G  G  LSK LPK A +A   N + L P+ +P  E    T R LA   L     K+ 
Sbjct  265   DADGRLGVSLSKNLPKAAVRAFTENLQRLAPRILPASELARFTFRLLARKLLRHGGRKVV  324

Query  746   SLLGKPILNMKTGIEHFCLHPGGRAVIDGVGVSLGLSEYDLEPARMSLHRWGNTSAGGLW  567
                G P ++ KTG++HFCLHPGG AVID V  +LGL+ YD+EPA M+LHRWGNTSA  LW
Sbjct  325   KFEG-PKIDFKTGVDHFCLHPGGTAVIDAVRKNLGLNGYDVEPATMTLHRWGNTSASSLW  383

Query  566   YVLGYMEAKKRLKKGDRILMLSLGAGFKCNNCVWEVMKDLGDPNVWEDCIDRYPPETLVN  387
             YVL YMEAK+RLK GDR+LM++ G+GFKCN+C WEV KDL D  VWEDCID YPP T+VN
Sbjct  384   YVLSYMEAKRRLKAGDRVLMVTFGSGFKCNSCYWEVTKDLDDAGVWEDCIDDYPPATMVN  443

Query  386   PFTEKFDWIHD  354
             P+TEKF W++D
Sbjct  444   PYTEKFGWVND  454



>ref|NP_001148181.1| acyltransferase [Zea mays]
 gb|ACG30081.1| acyltransferase [Zea mays]
 gb|ACN30933.1| unknown [Zea mays]
Length=466

 Score =   439 bits (1129),  Expect = 7e-145, Method: Compositional matrix adjust.
 Identities = 224/464 (48%), Positives = 316/464 (68%), Gaps = 16/464 (3%)
 Frame = -1

Query  1703  METLVAIYSLLFLYTVVYILRSYLRR-RHQCCYMLNYECYKPTDVARRLSTDKSALVVYR  1527
             ME +  +   L  Y+   + R  + R + + CY+L+Y CYK TD  R+L TD    ++ R
Sbjct  1     MELVTIVTLTLLAYSAAMLARVLVARAQRRRCYLLDYVCYKATD-DRKLPTDLCGEIIQR  59

Query  1526  NRNLGIDEFRFLLQTMVNSGVGEQTYIPINVLEGREDSPT-LEDSFTEVDDIMFQTLDNL  1350
             N+ LG++E++FLL+ +VNSG+GE+TY P N++EG E  P  L +   E+D+     LD L
Sbjct  60    NKLLGLEEYKFLLKVIVNSGIGEETYGPRNMIEGGEARPDRLREGMEEMDETFHAVLDEL  119

Query  1349  FAKSK------VSPREIDvlvvnvsllasapsLTSRVVNRYKMREDVKTFNLSGMGCSAS  1188
             FA+S       + P ++DVLVVNVS+ + APSL++RVV RY +RED K +NL+GMGCSA+
Sbjct  120   FARSAAPGGVGIRPADVDVLVVNVSMFSPAPSLSARVVRRYGLREDAKVYNLTGMGCSAT  179

Query  1187  VVAIDIVHHLFKVYKNSYAIVVSTESLGANWYSGKERSMMLSNCLFRSGGCSMLFTNNPA  1008
             ++A+D+V+  F+ +    A+V+++ES+  NWY+G +R+ ML NCLFRSGGC+   TN+P 
Sbjct  180   LIALDLVNGYFRTHAGQVALVMTSESIAPNWYAGNKRTFMLGNCLFRSGGCAYFLTNDPR  239

Query  1007  LKPRAILKLKHMVRTHIAAIDEAYECCKQVEDPQGFRGFHLSKRLPKVATKALVTNFKVL  828
             L+P A L+L+H+VRTH  A DEAY C  Q+ED  G  GFHL K LP+ A  A V N +VL
Sbjct  240   LRPHAKLRLRHVVRTHTGASDEAYNCALQMEDEAGRPGFHLGKELPRAAVHAFVHNLRVL  299

Query  827   VPKAIPLWETLRFLAVSSL------ERRKFKLPSLLGKPILNMKTGIEHFCLHPGGRAVI  666
              P+ +PL E LR LA ++L      ++R+       G   + MK G++HFC+H GG AVI
Sbjct  300   APRVLPLPELLR-LACATLSARLARKKRQRGAGHGHGHLTIRMKAGVDHFCVHTGGAAVI  358

Query  665   DGVGVSLGLSEYDLEPARMSLHRWGNTSAGGLWYVLGYMEAKKRLKKGDRILMLSLGAGF  486
             DGVG  L L+E+DLEP+RM+LHR+GNTSA  +WYVL YMEAK RL++GDR+LML+ GAGF
Sbjct  359   DGVGKGLTLTEHDLEPSRMTLHRFGNTSASSVWYVLAYMEAKGRLRQGDRVLMLTFGAGF  418

Query  485   KCNNCVWEVMKDLGDPNVWEDCIDRYPPETLVNPFTEKFDWIHD  354
             KCN+CVW V +   D  VW+D I  YP + + NPF +K+ ++ D
Sbjct  419   KCNSCVWTVERPATDAGVWKDRIHHYPLKDVSNPFMDKYGFVKD  462



>ref|NP_001152441.1| acyltransferase [Zea mays]
 gb|ACF84426.1| unknown [Zea mays]
 gb|ACG47636.1| acyltransferase [Zea mays]
 tpg|DAA49666.1| TPA: acyltransferase [Zea mays]
Length=466

 Score =   439 bits (1128),  Expect = 1e-144, Method: Compositional matrix adjust.
 Identities = 224/464 (48%), Positives = 316/464 (68%), Gaps = 16/464 (3%)
 Frame = -1

Query  1703  METLVAIYSLLFLYTVVYILRSYLRR-RHQCCYMLNYECYKPTDVARRLSTDKSALVVYR  1527
             ME +  +   L  Y+   + R  + R + + CY+L+Y CYK TD  R+L TD    ++ R
Sbjct  1     MELVTMVTLTLLAYSAAMLARLLVARAQRRRCYLLDYVCYKATD-DRKLPTDLCGEIIQR  59

Query  1526  NRNLGIDEFRFLLQTMVNSGVGEQTYIPINVLEGREDSPT-LEDSFTEVDDIMFQTLDNL  1350
             N+ LG++E++FLL+ +VNSG+GE+TY P N++EG E  P  L +   E+D+     LD L
Sbjct  60    NKLLGLEEYKFLLKVIVNSGIGEETYGPRNMIEGGEARPDRLREGMEEMDETFHAVLDEL  119

Query  1349  FAKSK------VSPREIDvlvvnvsllasapsLTSRVVNRYKMREDVKTFNLSGMGCSAS  1188
             FA+S       + P ++DVLVVNVS+ + APSL++RVV RY +RED K +NL+GMGCSA+
Sbjct  120   FARSAAPGGVGIRPADVDVLVVNVSMFSPAPSLSARVVRRYGLREDAKVYNLTGMGCSAT  179

Query  1187  VVAIDIVHHLFKVYKNSYAIVVSTESLGANWYSGKERSMMLSNCLFRSGGCSMLFTNNPA  1008
             ++A+D+V+  F+ +    A+V+++ES+  NWY+G +R+ ML NCLFRSGGC+   TN+P 
Sbjct  180   LIALDLVNGYFRTHAGQVALVMTSESIAPNWYAGNKRTFMLGNCLFRSGGCAYFLTNDPR  239

Query  1007  LKPRAILKLKHMVRTHIAAIDEAYECCKQVEDPQGFRGFHLSKRLPKVATKALVTNFKVL  828
             L+P A L+L+H+VRTH  A DEAY C  Q+ED  G  GFHL K LP+ A  A V N +VL
Sbjct  240   LRPHAKLRLRHVVRTHTGASDEAYNCALQMEDEAGRPGFHLGKELPRAAVHAFVHNLRVL  299

Query  827   VPKAIPLWETLRFLAVSSL------ERRKFKLPSLLGKPILNMKTGIEHFCLHPGGRAVI  666
              P+ +PL E LR LA ++L      ++R+       G   + MK G++HFC+H GG AVI
Sbjct  300   APRVLPLPELLR-LACATLSARLARKKRQRGAGHGHGHLTIRMKAGVDHFCVHTGGAAVI  358

Query  665   DGVGVSLGLSEYDLEPARMSLHRWGNTSAGGLWYVLGYMEAKKRLKKGDRILMLSLGAGF  486
             DGVG  L L+E+DLEP+RM+LHR+GNTSA  +WYVL YMEAK RL++GDR+LML+ GAGF
Sbjct  359   DGVGKGLTLTEHDLEPSRMTLHRFGNTSASSVWYVLAYMEAKGRLRQGDRVLMLTFGAGF  418

Query  485   KCNNCVWEVMKDLGDPNVWEDCIDRYPPETLVNPFTEKFDWIHD  354
             KCN+CVW V +   D  VW+D I  YP + + NPF +K+ ++ D
Sbjct  419   KCNSCVWTVERPATDAGVWKDRIHHYPLKDVSNPFMDKYGFVKD  462



>gb|EMT31337.1| 3-ketoacyl-CoA synthase 12 [Aegilops tauschii]
Length=734

 Score =   443 bits (1139),  Expect = 9e-143, Method: Compositional matrix adjust.
 Identities = 234/453 (52%), Positives = 314/453 (69%), Gaps = 10/453 (2%)
 Frame = -1

Query  1703  METLVAI-YSLLFLYTVVYILRSYL-RRRHQCCYMLNYECYKPTDVARRLSTDKSALVVY  1530
             ME L+ +  ++L  + V  +LR+ + RRRH   Y+L+Y C++P D  R++STD    VV 
Sbjct  1     MEPLLMLSVAILLAHAVTSLLRTVMARRRHSRYYLLDYVCHRPCD-DRKVSTDTVGRVVT  59

Query  1529  RNRNLGIDEFRFLLQTMVNSGVGEQTYIPINVLEGREDSPTLEDSFTEVDDIMFQTLDNL  1350
             RN  LG+ E+RFLL+ +V SG+GE++Y P ++LEGRE+SPT +D+  E+D    + +  L
Sbjct  60    RNMRLGVPEYRFLLRVIVRSGIGEESYCPRSILEGREESPTHQDALDEMDAFFDEAIAEL  119

Query  1349  FAKSKVSPREIDvlvvnvsllasapsLTSRVVNRYKMREDVKTFNLSGMGCSASVVAIDI  1170
             FA+S V+PR++DVLVVNVSLLA APSL SR+V R+ MREDV  +NLSGMGC AS++++D+
Sbjct  120   FARSGVAPRDVDVLVVNVSLLAPAPSLASRIVRRFGMREDVAEYNLSGMGCGASLISLDL  179

Query  1169  VHHLFKVYKNSYAIVVSTESLGANWYSGKERSMMLSNCLFRSGGCSMLFTNNPALKPRAI  990
                  +    S A+VVS+ES+  +WY+G +RSMM+ NCLFRSGG ++L TN P+L+ RA 
Sbjct  180   ARRALRTRPASLALVVSSESIAPSWYAGTDRSMMMGNCLFRSGGSAVLLTNTPSLRGRAK  239

Query  989   LKLKHMVRTHIAAIDEAYECCKQVEDPQGFRGFHLSKRLPKVATKALVTNFKVLVPKAIP  810
             + L+H+V T+IAA DEA+ C  Q ED  G  G  LSK LPK A +A+  N + LVP+ +P
Sbjct  240   MALRHLVHTNIAADDEAHTCALQREDGDGHVGISLSKDLPKAAVRAMTLNLRRLVPRVLP  299

Query  809   LWETLRFLA--VSS--LERRKFKLPSLLGKPILNMKTGIEHFCLHPGGRAVIDGVGVSLG  642
               E LRF A  VSS  L     ++ +    P +N KTG+EH+CLHPGG AV++ V  SLG
Sbjct  300   RSELLRFAAHYVSSKLLSHCPMQVKADGRLPKINFKTGVEHYCLHPGGAAVVEAVKESLG  359

Query  641   LSEYDLEPARMSLHRWGNTSAGGLWYVLGYMEAKKRLKKGDRILMLSLGAGFKCNNCVWE  462
             L   D+EPA M+L RWGNTSA  LWYVL YMEAK RLKKGDR LML+ G+GFKCN+C+WE
Sbjct  360   LDADDVEPALMTLRRWGNTSASSLWYVLSYMEAKGRLKKGDRALMLTFGSGFKCNSCLWE  419

Query  461   VMKDLGDPNVWEDCIDRYPP---ETLVNPFTEK  372
             V  D+ D   W DCID YPP       NP+ +K
Sbjct  420   VTGDMADKGAWADCIDDYPPPPESATTNPYMDK  452



>ref|XP_003557811.1| PREDICTED: 3-ketoacyl-CoA synthase 12-like [Brachypodium distachyon]
Length=468

 Score =   426 bits (1095),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 210/429 (49%), Positives = 293/429 (68%), Gaps = 11/429 (3%)
 Frame = -1

Query  1613  CYMLNYECYKPTDVARRLSTDKSALVVYRNRNLGIDEFRFLLQTMVNSGVGEQTYIPINV  1434
             CY+++Y C+KP+D  R++ST+ +  ++ RN  LG+ E+RFLL+ +V SG+GE TY P N+
Sbjct  32    CYLIDYVCHKPSD-DRKVSTEFAGELIQRNTRLGLAEYRFLLRVIVGSGIGEDTYCPYNI  90

Query  1433  LEGREDSPTLEDSFTEVDDIMFQTLDNLFAKSKVSPREIDvlvvnvsllasapsLTSRVV  1254
             LE RED+PT ED+  E+D  +  T+ +LFAK+     ++DVLVVN+S+ + APS+ SR+V
Sbjct  91    LESREDTPTHEDALGEMDAFVDATIADLFAKTGFRALDVDVLVVNISMFSPAPSVASRIV  150

Query  1253  NRYKMREDVKTFNLSGMGCSASVVAIDIVHHLFKVYKNSYAIVVSTESLGANWYSGKERS  1074
              R+ +RE+V  +NLSGMGCSA ++++D+  +  +   NS A+VVSTES+  NWYSG ++S
Sbjct  151   GRFGLRENVAAYNLSGMGCSAGLISLDLARNALRTRPNSVALVVSTESIAPNWYSGNDKS  210

Query  1073  MMLSNCLFRSGGCSMLFTNNPALKPR--AILKLKHMVRTHIAAIDEAYECCKQVEDPQGF  900
             MML NCLFR GG ++L TN+PA        ++L+ +VR +IAA D+A+ C  Q ED +G 
Sbjct  211   MMLGNCLFRCGGSAVLLTNDPAKAQGHGCKMELRCLVRANIAANDDAHACALQREDAEGR  270

Query  899   RGFHLSKRLPKVATKALVTNFKVLVPKAIPLWETLRF--------LAVSSLERRKFKLPS  744
              G  LSK LPK A  A   N K L P+ +P+ E  RF        L  S   +      +
Sbjct  271   VGISLSKALPKAAVGAFTVNLKTLAPRILPVSELARFAFHLFSRKLLSSRANKDSDNKTN  330

Query  743   LLGKPILNMKTGIEHFCLHPGGRAVIDGVGVSLGLSEYDLEPARMSLHRWGNTSAGGLWY  564
               G P +N KTG+EHFCLHPGG AVI+ V  SLGL + D+EPARM+LHRWGNTSA  LWY
Sbjct  331   NNGAPKINFKTGVEHFCLHPGGTAVIEAVKRSLGLDDGDVEPARMTLHRWGNTSASSLWY  390

Query  563   VLGYMEAKKRLKKGDRILMLSLGAGFKCNNCVWEVMKDLGDPNVWEDCIDRYPPETLVNP  384
             VL YMEAK RL++GDR+LM++ G+GFKCN+C+WEV  D+ D   W DCI  YP  +  NP
Sbjct  391   VLSYMEAKGRLRRGDRVLMVTFGSGFKCNSCMWEVKADMADKGAWADCIGDYPLASTANP  450

Query  383   FTEKFDWIH  357
             + +K+ W++
Sbjct  451   YMDKYGWLN  459



>ref|XP_002467095.1| hypothetical protein SORBIDRAFT_01g019520 [Sorghum bicolor]
 gb|EER94093.1| hypothetical protein SORBIDRAFT_01g019520 [Sorghum bicolor]
Length=466

 Score =   425 bits (1093),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 215/437 (49%), Positives = 299/437 (68%), Gaps = 15/437 (3%)
 Frame = -1

Query  1631  RRRHQCCYMLNYECYKPTDVARRLSTDKSALVVYRNRNLGIDEFRFLLQTMVNSGVGEQT  1452
             R + + CY+L+Y CYK TD  R+L TD    ++ RN+ LG++E++FLL+ + NSG+GE+T
Sbjct  26    RAQRRRCYLLDYVCYKATD-DRKLPTDLCGEIIQRNQLLGLEEYKFLLKVIANSGIGEET  84

Query  1451  YIPINVLEGREDSPT-LEDSFTEVDDIMFQTLDNLFAKSK------VSPREIDvlvvnvs  1293
             Y P N++EG E  P  L +   E+D+     LD LFA+S       + P ++DVLVVNVS
Sbjct  85    YGPRNMIEGGEARPDRLREGMEEMDETFHAVLDELFARSAAPGGVGIRPADVDVLVVNVS  144

Query  1292  llasapsLTSRVVNRYKMREDVKTFNLSGMGCSASVVAIDIVHHLFKVYKNSYAIVVSTE  1113
             + + APSL++RVV RY +REDVK +NL+GMGCSA+++A+D+V+  F       A+V+++E
Sbjct  145   MFSPAPSLSARVVRRYGLREDVKVYNLTGMGCSATLIALDLVNRFFSTRAGQVALVMTSE  204

Query  1112  SLGANWYSGKERSMMLSNCLFRSGGCSMLFTNNPALKPRAILKLKHMVRTHIAAIDEAYE  933
             S+  NWY+G ++S ML NCLFRSGGC+   +N+P L+  A L+L+H+VRTH  A DEAY 
Sbjct  205   SIAPNWYAGNKKSFMLGNCLFRSGGCAYFLSNDPRLRSHAKLRLRHVVRTHTGASDEAYN  264

Query  932   CCKQVEDPQGFRGFHLSKRLPKVATKALVTNFKVLVPKAIPLWETLRFLAVSSLER----  765
             C  Q+ED  G  GFHL K LP+ A  A + N +VL PK +PL E LR    +   R    
Sbjct  265   CALQMEDDAGRPGFHLGKELPRAAVHAFIHNLRVLAPKVLPLPELLRLTCATFSARLARK  324

Query  764   RKFKLPSLLGKPILNMKTGIEHFCLHPGGRAVIDGVGVSLGLSEYDLEPARMSLHRWGNT  585
             R +K  + L    + MK G++HFC+H GG AVIDGVG  L L+E+DLEP+RM+LHR+GNT
Sbjct  325   RGYKSSNHL---TIRMKAGVDHFCVHTGGAAVIDGVGKGLTLTEHDLEPSRMTLHRFGNT  381

Query  584   SAGGLWYVLGYMEAKKRLKKGDRILMLSLGAGFKCNNCVWEVMKDLGDPNVWEDCIDRYP  405
             SA  +WYVL YMEA+ RL+KGDR+LM++ GAGFKCN+C+W V     D  VW+D I  YP
Sbjct  382   SASSVWYVLSYMEAQGRLRKGDRVLMVTFGAGFKCNSCIWTVENPATDAGVWKDRIHLYP  441

Query  404   PETLVNPFTEKFDWIHD  354
              + + NPF EK+ ++ D
Sbjct  442   LKDVSNPFMEKYGFLKD  458



>ref|XP_009804844.1| PREDICTED: 3-ketoacyl-CoA synthase 3-like, partial [Nicotiana 
sylvestris]
Length=346

 Score =   420 bits (1079),  Expect = 4e-139, Method: Compositional matrix adjust.
 Identities = 203/326 (62%), Positives = 255/326 (78%), Gaps = 0/326 (0%)
 Frame = -1

Query  1331  SPREIDvlvvnvsllasapsLTSRVVNRYKMREDVKTFNLSGMGCSASVVAIDIVHHLFK  1152
             SP +IDVLVVN+S+L   PSL  R++N YKMRED+K +N++GMGCSASV+AI+IV  +FK
Sbjct  4     SPSDIDVLVVNISMLTCMPSLAGRIINYYKMREDIKVYNITGMGCSASVIAINIVQSIFK  63

Query  1151  VYKNSYAIVVSTESLGANWYSGKERSMMLSNCLFRSGGCSMLFTNNPALKPRAILKLKHM  972
               KN  A++V++ESL  NWY+G  RSM+L+NCLFRSGG ++L TN  ALK +A+ KLK +
Sbjct  64    NEKNKVALMVTSESLSPNWYTGNNRSMILANCLFRSGGSAILLTNKVALKNKAMFKLKCL  123

Query  971   VRTHIAAIDEAYECCKQVEDPQGFRGFHLSKRLPKVATKALVTNFKVLVPKAIPLWETLR  792
             VRTH  A DEAY+ C Q ED QG  GFHL K LPK ATKALV N K + P  +P+ E LR
Sbjct  124   VRTHHGAKDEAYDSCIQKEDDQGHIGFHLDKTLPKAATKALVDNLKTIAPLVLPVRELLR  183

Query  791   FLAVSSLERRKFKLPSLLGKPILNMKTGIEHFCLHPGGRAVIDGVGVSLGLSEYDLEPAR  612
             F  VS + +  +       +P++N KTG++H CLH GG+AVIDGVG +L LSEYDLEPAR
Sbjct  184   FAIVSLVRKMNWGSTKGGARPVINFKTGVDHICLHTGGKAVIDGVGTNLNLSEYDLEPAR  243

Query  611   MSLHRWGNTSAGGLWYVLGYMEAKKRLKKGDRILMLSLGAGFKCNNCVWEVMKDLGDPNV  432
             M+LHR+GNTSA  LWYVLGYMEAKKRLKKGD++LM+S GAGFKCN+C+WEV++DLG+ NV
Sbjct  244   MTLHRFGNTSASSLWYVLGYMEAKKRLKKGDKVLMISFGAGFKCNSCLWEVLRDLGNENV  303

Query  431   WEDCIDRYPPETLVNPFTEKFDWIHD  354
             W+DCID YPP+TL NPF EKF W+H+
Sbjct  304   WKDCIDNYPPKTLANPFLEKFGWLHN  329



>gb|EEE51123.1| hypothetical protein OsJ_31866 [Oryza sativa Japonica Group]
Length=427

 Score =   419 bits (1077),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 216/459 (47%), Positives = 299/459 (65%), Gaps = 45/459 (10%)
 Frame = -1

Query  1703  METLVAIYSLLFLYTVVYILRSYL-RRRHQCCYMLNYECYKPTDVARRLSTDKSALVVYR  1527
             ME    +   L  Y+   + R  + R R + CY+L+Y CYK TD  R+L TD    ++ R
Sbjct  1     MEVATMLTLTLLAYSAAMLARLLVARSRRRRCYLLDYVCYKATD-DRKLPTDLCGEIIQR  59

Query  1526  NRNLGIDEFRFLLQTMVNSGVGEQTYIPINVLEGREDSPT-LEDSFTEVDDIMFQTLDNL  1350
             N+ LG++E++FLL+ +VNSG+GE+TY P N++ G +  P  L +   E+D+     LD L
Sbjct  60    NKLLGLEEYKFLLKVIVNSGIGEETYGPRNIIGGGDARPDRLAEGMEEMDETFHAVLDEL  119

Query  1349  FAKSK------VSPREIDvlvvnvsllasapsLTSRVVNRYKMREDVKTFNLSGMGCSAS  1188
             FA+S       V P ++D+LVVNVS+ + APSL++RVV RY +REDVK +NL+GMGCSA+
Sbjct  120   FARSSAAGGGGVRPADVDLLVVNVSMFSPAPSLSARVVRRYNLREDVKVYNLTGMGCSAT  179

Query  1187  VVAIDIVHHLFKVYKNSYAIVVSTESLGANWYSGKERSMMLSNCLFRSGGCSMLFTNNPA  1008
             ++A+D+V++  + + N  A+V+++ES+  NWY+G +RS ML NCLFRSGGC+   TN+P 
Sbjct  180   LIALDLVNNFLRTHANKVALVMTSESIAPNWYAGNKRSFMLGNCLFRSGGCAYFLTNDPR  239

Query  1007  LKPRAILKLKHMVRTHIAAIDEAYECCKQVEDPQGFRGFHLSKRLPK-VATKALVTNFKV  831
              +  A L+L+H+VRTH  A D+AY C  Q+ED  G  GFHL K LP      A V N ++
Sbjct  240   HRRHAKLRLRHLVRTHTGASDDAYSCALQMEDDAGRPGFHLGKDLPPGPPVHAFVKNLRL  299

Query  830   LVPKAIPLWETLRFLAVSSLERRKFKLPSLLGKPILNMKTGIEHFCLHPGGRAVIDGVGV  651
             L P+A                                   G++HFC+H GG AVIDGVG 
Sbjct  300   LAPRA-----------------------------------GVDHFCVHTGGAAVIDGVGK  324

Query  650   SLGLSEYDLEPARMSLHRWGNTSAGGLWYVLGYMEAKKRLKKGDRILMLSLGAGFKCNNC  471
              L L+E+DLEP+RM+LHR+GNTSA  +WYVLGYMEAK+RL+ GDR+LML+ GAGFKCN+C
Sbjct  325   GLTLTEHDLEPSRMTLHRFGNTSASSVWYVLGYMEAKRRLRPGDRVLMLTFGAGFKCNSC  384

Query  470   VWEVMKDLGDPNVWEDCIDRYPPETLVNPFTEKFDWIHD  354
             VW V K + D  VW+DCID YPP+ L NPF EK+ ++ D
Sbjct  385   VWTVEKPVSDAGVWKDCIDHYPPKELANPFMEKYGFVKD  423



>gb|EAZ27142.1| hypothetical protein OsJ_11076 [Oryza sativa Japonica Group]
Length=467

 Score =   420 bits (1079),  Expect = 3e-137, Method: Compositional matrix adjust.
 Identities = 210/433 (48%), Positives = 293/433 (68%), Gaps = 11/433 (3%)
 Frame = -1

Query  1631  RRRHQCCYMLNYECYKPTDVARRLSTDKSALVVYRNRNLGIDEFRFLLQTMVNSGVGEQT  1452
             RRRH  CY+L+Y CYKP D  R L+ + +  +V RN  LG+ EFRFLL+ +  +G+G++T
Sbjct  29    RRRHTRCYLLDYVCYKPED-DRTLTAELAGEIVQRNERLGMAEFRFLLRLISRAGLGDRT  87

Query  1451  YIPINVLEGREDSPTLE-DSFTEVDDIMFQTLDNLFAKSKVSPREIDvlvvnvsllasap  1275
             Y+P N+L+GRE+    +  +  E+D      +  L A++ +  R++DVLVVNVS     P
Sbjct  88    YVPRNLLDGREELAAGQLHAVDEMDACFDGAVPELLARTGLRARDVDVLVVNVSGFFPEP  147

Query  1274  sLTSRVVNRYKMREDVKTFNLSGMGCSASVVAIDIVHHLFKVY--KNSYAIVVSTESLGA  1101
              L SRVV RY MREDV  +NLSGMGCSA++VA+D+  +  +    +   A+VVSTESL  
Sbjct  148   CLASRVVRRYGMREDVAAYNLSGMGCSATLVAVDVARNAMRARSPRPVMALVVSTESLAP  207

Query  1100  NWYSGKERSMMLSNCLFRSGGCSMLFTNNPALKPRAILKLKHMVRTHIAAIDEAYECCKQ  921
             +WY+GK+R+MML  CLFR GG ++L +++PA + RA ++L+ +VR+  AA D+AY C  Q
Sbjct  208   HWYAGKDRTMMLGQCLFRCGGAAVLLSSDPAHRGRAKMELRRLVRSTTAASDDAYSCIMQ  267

Query  920   VEDPQGFRGFHLSKRLPKVATKALVTNFKVLVPKAIPLWETLRFLA----VSSLERRKFK  753
              ED  G RG  +SK LPK A +A   N + L+P+ +P  E  R  A     + L+RR+ +
Sbjct  268   REDDDGLRGVSISKALPKAALRAFAANLQRLLPRVLPAMEIARLAADLAWQNLLQRRRHR  327

Query  752   LPSLLGKPILNMKTGIEHFCLHPGGRAVIDGVGVSLGLSEYDLEPARMSLHRWGNTSAGG  573
               + L    +N+K G++H CLH GG AVID V  S GL E D+EP+RM+LHRWGNTSA  
Sbjct  328   GQTKLK---INLKAGVDHICLHAGGVAVIDAVKKSFGLEERDVEPSRMTLHRWGNTSASS  384

Query  572   LWYVLGYMEAKKRLKKGDRILMLSLGAGFKCNNCVWEVMKDLGDPNVWEDCIDRYPPETL  393
             +WYVL YMEAK RL++GD++LM++ G+GFKCN+CVWEV  D+ D   W DCID YPPE+ 
Sbjct  385   VWYVLSYMEAKGRLRRGDKVLMVTFGSGFKCNSCVWEVTGDMADKGAWADCIDAYPPESK  444

Query  392   VNPFTEKFDWIHD  354
              +PF EKF W++D
Sbjct  445   PSPFLEKFAWVND  457



>ref|NP_001050246.1| Os03g0383600 [Oryza sativa Japonica Group]
 gb|ABF96286.1| Chalcone and stilbene synthases, C-terminal domain containing 
protein, expressed [Oryza sativa Japonica Group]
 dbj|BAF12160.1| Os03g0383600 [Oryza sativa Japonica Group]
Length=472

 Score =   420 bits (1079),  Expect = 4e-137, Method: Compositional matrix adjust.
 Identities = 210/433 (48%), Positives = 293/433 (68%), Gaps = 11/433 (3%)
 Frame = -1

Query  1631  RRRHQCCYMLNYECYKPTDVARRLSTDKSALVVYRNRNLGIDEFRFLLQTMVNSGVGEQT  1452
             RRRH  CY+L+Y CYKP D  R L+ + +  +V RN  LG+ EFRFLL+ +  +G+G++T
Sbjct  34    RRRHTRCYLLDYVCYKPED-DRTLTAELAGEIVQRNERLGMAEFRFLLRLISRAGLGDRT  92

Query  1451  YIPINVLEGREDSPTLE-DSFTEVDDIMFQTLDNLFAKSKVSPREIDvlvvnvsllasap  1275
             Y+P N+L+GRE+    +  +  E+D      +  L A++ +  R++DVLVVNVS     P
Sbjct  93    YVPRNLLDGREELAAGQLHAVDEMDACFDGAVPELLARTGLRARDVDVLVVNVSGFFPEP  152

Query  1274  sLTSRVVNRYKMREDVKTFNLSGMGCSASVVAIDIVHHLFKVY--KNSYAIVVSTESLGA  1101
              L SRVV RY MREDV  +NLSGMGCSA++VA+D+  +  +    +   A+VVSTESL  
Sbjct  153   CLASRVVRRYGMREDVAAYNLSGMGCSATLVAVDVARNAMRARSPRPVMALVVSTESLAP  212

Query  1100  NWYSGKERSMMLSNCLFRSGGCSMLFTNNPALKPRAILKLKHMVRTHIAAIDEAYECCKQ  921
             +WY+GK+R+MML  CLFR GG ++L +++PA + RA ++L+ +VR+  AA D+AY C  Q
Sbjct  213   HWYAGKDRTMMLGQCLFRCGGAAVLLSSDPAHRGRAKMELRRLVRSTTAASDDAYSCIMQ  272

Query  920   VEDPQGFRGFHLSKRLPKVATKALVTNFKVLVPKAIPLWETLRFLA----VSSLERRKFK  753
              ED  G RG  +SK LPK A +A   N + L+P+ +P  E  R  A     + L+RR+ +
Sbjct  273   REDDDGLRGVSISKALPKAALRAFAANLQRLLPRVLPAMEIARLAADLAWQNLLQRRRHR  332

Query  752   LPSLLGKPILNMKTGIEHFCLHPGGRAVIDGVGVSLGLSEYDLEPARMSLHRWGNTSAGG  573
               + L    +N+K G++H CLH GG AVID V  S GL E D+EP+RM+LHRWGNTSA  
Sbjct  333   GQTKLK---INLKAGVDHICLHAGGVAVIDAVKKSFGLEERDVEPSRMTLHRWGNTSASS  389

Query  572   LWYVLGYMEAKKRLKKGDRILMLSLGAGFKCNNCVWEVMKDLGDPNVWEDCIDRYPPETL  393
             +WYVL YMEAK RL++GD++LM++ G+GFKCN+CVWEV  D+ D   W DCID YPPE+ 
Sbjct  390   VWYVLSYMEAKGRLRRGDKVLMVTFGSGFKCNSCVWEVTGDMADKGAWADCIDAYPPESK  449

Query  392   VNPFTEKFDWIHD  354
              +PF EKF W++D
Sbjct  450   PSPFLEKFAWVND  462



>ref|NP_001173448.1| Os03g0383200 [Oryza sativa Japonica Group]
 gb|AAR96223.1| putative fatty acid elongase [Oryza sativa Japonica Group]
 dbj|BAH92176.1| Os03g0383200 [Oryza sativa Japonica Group]
Length=466

 Score =   418 bits (1075),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 213/432 (49%), Positives = 291/432 (67%), Gaps = 10/432 (2%)
 Frame = -1

Query  1631  RRRHQCCYMLNYECYKPTDVARRLSTDKSALVVYRNRNLGIDEFRFLLQTMVNSGVGEQT  1452
             RRR   CY+L+Y CYKP D    L+T+ +  +V RN  LGI EFRFL++ +  +G+G++T
Sbjct  29    RRRGMRCYLLDYVCYKPADDLT-LTTELACAIVQRNERLGIPEFRFLVRLISRTGLGDRT  87

Query  1451  YIPINVLEGREDSPTLEDSFTEVDDIMFQTLDNLFAKSKVSPREIDvlvvnvsllasaps  1272
             Y P N+L+GRE+     DS  E+D      +  L A++ +  R++DVLVVNV+     P 
Sbjct  88    YAPRNLLDGREELAAQRDSVDEMDACFDGAVPELLARTGLRARDVDVLVVNVNGFFPEPC  147

Query  1271  LTSRVVNRYKMREDVKTFNLSGMGCSASVVAIDIVHHLFKVY--KNSYAIVVSTESLGAN  1098
             L SRVV RY MREDV  +NLSGMGCSA++VA+D+  +  +    +   A+VVSTESL  +
Sbjct  148   LASRVVRRYGMREDVAAYNLSGMGCSATLVAVDVGRNAMRARSPRPVVALVVSTESLAPH  207

Query  1097  WYSGKERSMMLSNCLFRSGGCSMLFTNNPALKPRAILKLKHMVRTHIAAIDEAYECCKQV  918
             WY+GKER+MML+ CLFR GG ++L +N+PA + RA ++L+ +VR+  AA D+AY C  Q 
Sbjct  208   WYAGKERTMMLAQCLFRCGGAAVLLSNDPAHRGRAKMELRRLVRSTTAASDDAYSCIMQR  267

Query  917   EDPQGFRGFHLSKRLPKVATKALVTNFKVLVPKAIPLWETLRFLA----VSSLERRKFKL  750
             ED  G RG  +SK LPK A +A   N + L+P+ +P  E  R  A     + L+RR+ + 
Sbjct  268   EDDDGLRGVSISKALPKAALRAFAANLQRLLPRVLPAMEIARLAADLAWQNLLQRRRHRG  327

Query  749   PSLLGKPILNMKTGIEHFCLHPGGRAVIDGVGVSLGLSEYDLEPARMSLHRWGNTSAGGL  570
              + L    +N+K G++H CLH GG AVID V  S GL E D+EP RM+LHRWGNTSA  +
Sbjct  328   QTKLK---INLKAGVDHICLHAGGVAVIDAVKKSFGLEERDVEPLRMTLHRWGNTSASSV  384

Query  569   WYVLGYMEAKKRLKKGDRILMLSLGAGFKCNNCVWEVMKDLGDPNVWEDCIDRYPPETLV  390
             WYVL YMEAK RL++GD++LM++ G+GFKCN+CVWEV  D+ D   W DCID YPPE+  
Sbjct  385   WYVLSYMEAKGRLRRGDKVLMVTFGSGFKCNSCVWEVAGDMADKGAWADCIDAYPPESKP  444

Query  389   NPFTEKFDWIHD  354
             +PF EKF WI+D
Sbjct  445   SPFLEKFAWIND  456



>gb|EAY87986.1| hypothetical protein OsI_09409 [Oryza sativa Indica Group]
Length=463

 Score =   418 bits (1074),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 209/420 (50%), Positives = 288/420 (69%), Gaps = 1/420 (0%)
 Frame = -1

Query  1613  CYMLNYECYKPTDVARRLSTDKSALVVYRNRNLGIDEFRFLLQTMVNSGVGEQTYIPINV  1434
             CY+L+Y C+KP+D  R+++T+ +  ++ RN+ LG+ E+RFLL+ +VNSG+GE TY P NV
Sbjct  32    CYLLDYACHKPSD-DRKVTTELAGAIIERNKRLGLPEYRFLLKVIVNSGIGEHTYSPRNV  90

Query  1433  LEGREDSPTLEDSFTEVDDIMFQTLDNLFAKSKVSPREIDvlvvnvsllasapsLTSRVV  1254
             L+ RED PTL D+  E+DD     +  + A++ VSPR++D+LV+NV   + +PSL  RVV
Sbjct  91    LDAREDCPTLRDALDEMDDFFDDAVAAVLARAAVSPRDVDLLVINVGSFSPSPSLADRVV  150

Query  1253  NRYKMREDVKTFNLSGMGCSASVVAIDIVHHLFKVYKNSYAIVVSTESLGANWYSGKERS  1074
              R+ +R+DV  +NLSGMGCSA +V++D+  ++      + A+V+++ES   NWY+G ++S
Sbjct  151   RRFGLRDDVMAYNLSGMGCSAGLVSVDLARNVMLTRPRTMALVLTSESCAPNWYTGTDKS  210

Query  1073  MMLSNCLFRSGGCSMLFTNNPALKPRAILKLKHMVRTHIAAIDEAYECCKQVEDPQGFRG  894
             MML NCLFR GG + L TN+PA + RA ++L+ +VR HI A D+A+      ED  G  G
Sbjct  211   MMLGNCLFRCGGAAALLTNDPAFRSRAKMELRCLVRAHIGAHDDAHAAAVHREDADGRLG  270

Query  893   FHLSKRLPKVATKALVTNFKVLVPKAIPLWETLRFLAVSSLERRKFKLPSLLGKPILNMK  714
               LSK LPK A +A   N + L P+ +P  E  RF A   L +   +  +      +N K
Sbjct  271   VSLSKALPKAAVRAFTENLQRLAPRILPAGELARFAARLLLRKLLRRKAAGGAAAKINFK  330

Query  713   TGIEHFCLHPGGRAVIDGVGVSLGLSEYDLEPARMSLHRWGNTSAGGLWYVLGYMEAKKR  534
             TG++HFCLHPGG AVI+ V  SLGL  YD+EPARM+LHRWGNTSA  LWYVL YMEAK+R
Sbjct  331   TGVDHFCLHPGGTAVIEAVRKSLGLDSYDVEPARMTLHRWGNTSASSLWYVLSYMEAKRR  390

Query  533   LKKGDRILMLSLGAGFKCNNCVWEVMKDLGDPNVWEDCIDRYPPETLVNPFTEKFDWIHD  354
             L  GDR+LM++ G+GFKCN+  W V KDL D   WEDCI  YPP  LVNP+ EKF W++D
Sbjct  391   LNAGDRVLMVTFGSGFKCNSSYWVVTKDLADAGAWEDCIHDYPPANLVNPYMEKFGWVND  450



>ref|NP_001048486.1| Os02g0813600 [Oryza sativa Japonica Group]
 dbj|BAD21655.1| putative fatty acid elongase 3-ketoacyl-CoA synthase 1 [Oryza 
sativa Japonica Group]
 dbj|BAD22394.1| putative fatty acid elongase 3-ketoacyl-CoA synthase 1 [Oryza 
sativa Japonica Group]
 dbj|BAF10400.1| Os02g0813600 [Oryza sativa Japonica Group]
 gb|EAZ25051.1| hypothetical protein OsJ_08843 [Oryza sativa Japonica Group]
Length=463

 Score =   417 bits (1073),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 209/420 (50%), Positives = 288/420 (69%), Gaps = 1/420 (0%)
 Frame = -1

Query  1613  CYMLNYECYKPTDVARRLSTDKSALVVYRNRNLGIDEFRFLLQTMVNSGVGEQTYIPINV  1434
             CY+L+Y C+KP+D  R+++T+ +  ++ RN+ LG+ E+RFLL+ +VNSG+GE TY P NV
Sbjct  32    CYLLDYACHKPSD-DRKVTTELAGAIIERNKRLGLPEYRFLLKVIVNSGIGEHTYSPRNV  90

Query  1433  LEGREDSPTLEDSFTEVDDIMFQTLDNLFAKSKVSPREIDvlvvnvsllasapsLTSRVV  1254
             L+ RED PTL D+  E+DD     +  + A++ VSPR++D+LV+NV   + +PSL  RVV
Sbjct  91    LDAREDCPTLRDALDEMDDFFDDAVAAVLARAAVSPRDVDLLVINVGSFSPSPSLADRVV  150

Query  1253  NRYKMREDVKTFNLSGMGCSASVVAIDIVHHLFKVYKNSYAIVVSTESLGANWYSGKERS  1074
              R+ +R+DV  +NLSGMGCSA +V++D+  ++      + A+V+++ES   NWY+G ++S
Sbjct  151   RRFGLRDDVMAYNLSGMGCSAGLVSVDLARNVMLTRPRTMALVLTSESCAPNWYTGTDKS  210

Query  1073  MMLSNCLFRSGGCSMLFTNNPALKPRAILKLKHMVRTHIAAIDEAYECCKQVEDPQGFRG  894
             MML NCLFR GG + L TN+PA + RA ++L+ +VR HI A D+A+      ED  G  G
Sbjct  211   MMLGNCLFRCGGAAALLTNDPAFRSRAKMELRCLVRAHIGAHDDAHAAAVHREDADGRLG  270

Query  893   FHLSKRLPKVATKALVTNFKVLVPKAIPLWETLRFLAVSSLERRKFKLPSLLGKPILNMK  714
               LSK LPK A +A   N + L P+ +P  E  RF A   L +   +  +      +N K
Sbjct  271   VSLSKALPKAAVRAFTENLQRLAPRILPAGELARFAARLLLRKLLRRKAAAGAAAKINFK  330

Query  713   TGIEHFCLHPGGRAVIDGVGVSLGLSEYDLEPARMSLHRWGNTSAGGLWYVLGYMEAKKR  534
             TG++HFCLHPGG AVI+ V  SLGL  YD+EPARM+LHRWGNTSA  LWYVL YMEAK+R
Sbjct  331   TGVDHFCLHPGGTAVIEAVRKSLGLDSYDVEPARMALHRWGNTSASSLWYVLSYMEAKRR  390

Query  533   LKKGDRILMLSLGAGFKCNNCVWEVMKDLGDPNVWEDCIDRYPPETLVNPFTEKFDWIHD  354
             L  GDR+LM++ G+GFKCN+  W V KDL D   WEDCI  YPP  LVNP+ EKF W++D
Sbjct  391   LNAGDRVLMVTFGSGFKCNSSYWVVTKDLADAGAWEDCIHDYPPANLVNPYMEKFGWVND  450



>gb|EAY90260.1| hypothetical protein OsI_11835 [Oryza sativa Indica Group]
Length=468

 Score =   416 bits (1070),  Expect = 7e-136, Method: Compositional matrix adjust.
 Identities = 212/434 (49%), Positives = 289/434 (67%), Gaps = 12/434 (3%)
 Frame = -1

Query  1631  RRRHQCCYMLNYECYKPTDVARRLSTDKSALVVYRNRNLGIDEFRFLLQTMVNSGVGEQT  1452
             RRRH  CY+L+Y CYKP D  R L+ + +  +V RN  LG+ EFRFLL+ +  +G+G++T
Sbjct  29    RRRHTRCYLLDYVCYKPED-DRTLTAELAGEIVQRNERLGMAEFRFLLRLISRAGLGDRT  87

Query  1451  YIPINVLEGREDSPTLE-DSFTEVDDIMFQTLDNLFAKSKVSPREIDvlvvnvsllasap  1275
             Y+P N+L+GRE+    + D+  E+D      +  L A++ +  R++DVLVVNVS     P
Sbjct  88    YVPRNLLDGREELAAGQLDAVDEMDACFDGAVPELLARTGLRARDVDVLVVNVSGFFPEP  147

Query  1274  sLTSRVVNRYKMREDVKTFNLSGMGCSASVVAIDIVHHLF--KVYKNSYAIVVSTESLGA  1101
              L SRVV RY MREDV  +NLSGMGCSA++VA+D+  +    +  +   A+VVSTESL  
Sbjct  148   CLASRVVRRYGMREDVAAYNLSGMGCSATLVAVDVARNAMHARSPRPVVALVVSTESLAP  207

Query  1100  NWYSGKERSMMLSNCLFRSGGCSMLFTNNPALKPRAILKLKHMVRTHIAAIDEAYECCKQ  921
              WY+GKER+MML  CLFR GG ++L +++PA + RA ++L  +VR   AA D+AY C  Q
Sbjct  208   LWYAGKERTMMLGQCLFRCGGAAVLLSSDPAHRGRAKMELHRLVRATTAASDDAYSCIMQ  267

Query  920   VEDPQGFRGFHLSKRLPKVATKALVTNFKVLVPKAIPLWETLRFLAVSSLE-----RRKF  756
              ED  GF G  +SK LPK A +A   N K L+P+ +P  E  R  A  + +     RR+ 
Sbjct  268   REDDDGFLGASISKALPKAALRAFAANLKRLLPRVLPAMEIARLAADLAWQNLLQWRRRG  327

Query  755   KLPSLLGKPILNMKTGIEHFCLHPGGRAVIDGVGVSLGLSEYDLEPARMSLHRWGNTSAG  576
             +  + L    +N+K G++H CLH GG AVID V  S G+ E D+EP+RM+LHRWGNTSA 
Sbjct  328   QAKAKLK---INLKAGVDHICLHAGGVAVIDAVKKSFGVEERDVEPSRMTLHRWGNTSAS  384

Query  575   GLWYVLGYMEAKKRLKKGDRILMLSLGAGFKCNNCVWEVMKDLGDPNVWEDCIDRYPPET  396
              +WYVL YMEAK RL++GD++LM++ G+GFKCN+CVWEV  D+ D   W DCID YPPE 
Sbjct  385   SVWYVLSYMEAKGRLRRGDKVLMVTFGSGFKCNSCVWEVAGDMADKGAWADCIDAYPPEG  444

Query  395   LVNPFTEKFDWIHD  354
               NPF EKF W++D
Sbjct  445   KPNPFLEKFAWVND  458



>ref|XP_011069412.1| PREDICTED: 3-ketoacyl-CoA synthase 12-like, partial [Sesamum 
indicum]
Length=381

 Score =   403 bits (1035),  Expect = 6e-132, Method: Compositional matrix adjust.
 Identities = 205/377 (54%), Positives = 275/377 (73%), Gaps = 5/377 (1%)
 Frame = -1

Query  1694  LVAIYSLLFLYTVVYILRSYLRRRHQCCYMLNYECYKPTDVARRLSTDKSALVVYRNRNL  1515
             L+  Y L  L  V    R   +RRHQ CY+L+YECY PTD  R+LST     V+ RN++L
Sbjct  5     LMFFYCLPLLPLVYMAWRVLDQRRHQNCYILDYECYMPTD-DRKLSTKFCGEVIRRNKHL  63

Query  1514  GIDEFRFLLQTMVNSGVGEQTYIPINVLEGREDSPTLEDSFTEVDDIMFQTLDNLFAKSK  1335
             G++E++FLL+ +V+SG+GE+TY P  V +GRE SPTL D   E+D+    +++ LF ++ 
Sbjct  64    GLNEYKFLLKAIVSSGIGEETYAPRMVFDGREASPTLADGLLEMDEFFLDSINRLFKRTG  123

Query  1334  VSPREIDvlvvnvsllasapsLTSRVVNRYKMREDVKTFNLSGMGCSASVVAIDIVHHLF  1155
             +SP EIDVLVVN+S+LA+ PSL+SR++N YKMREDVK +NL+GMGCSAS+V+I+IV  +F
Sbjct  124   ISPSEIDVLVVNISMLATLPSLSSRIINFYKMREDVKVYNLTGMGCSASLVSINIVQSIF  183

Query  1154  KVYKNSYAIVVSTESLGANWYSGKERSMMLSNCLFRSGGCSMLFTNNPALKPRAILKLKH  975
             K  KN  A+VV++ESL   WYSG  RSM+L+NCLFR+GGC+M+ TN P+LK RA+ KLK 
Sbjct  184   KSEKNLQALVVTSESLSLGWYSGNNRSMILANCLFRAGGCAMIVTNKPSLKDRAMFKLKT  243

Query  974   MVRTHIAAIDEAYECCKQVEDPQGFRGFHLSKRLPKVATKALVTNFKVLVPKAIPLWETL  795
             +VRTH  A DE+YECC Q ED +GF GFHL K LPK AT+A V N K + PK +P+ E L
Sbjct  244   LVRTHHGAKDESYECCIQKEDEKGFVGFHLGKNLPKAATRAFVDNLKEIAPKILPVRELL  303

Query  794   RFLAVSSLERRKFK----LPSLLGKPILNMKTGIEHFCLHPGGRAVIDGVGVSLGLSEYD  627
             RF A+  + + + K          +P++N  TG++HFCLH GG+AVID +  +LGLSEYD
Sbjct  304   RFSALLFVRKLRQKWSKAAAGATARPMINFSTGVDHFCLHTGGKAVIDAIAQNLGLSEYD  363

Query  626   LEPARMSLHRWGNTSAG  576
             +EPARM+LHR+GNTSA 
Sbjct  364   VEPARMTLHRFGNTSAA  380



>gb|EMS48112.1| 3-ketoacyl-CoA synthase 12 [Triticum urartu]
Length=458

 Score =   391 bits (1004),  Expect = 3e-126, Method: Compositional matrix adjust.
 Identities = 202/432 (47%), Positives = 280/432 (65%), Gaps = 14/432 (3%)
 Frame = -1

Query  1631  RRRHQCCYMLNYECYKPTDVARRLSTDKSALVVYRNRNLGIDEFRFLLQTMVNSGVGEQT  1452
             RRR   CY+L+Y CYKP D  R+++TD    +  RN+ LG  E R+L +    +G+GEQT
Sbjct  27    RRRCSQCYLLDYVCYKPPD-DRKVTTDMGVALAERNKRLGAPELRYLFRLTSRAGLGEQT  85

Query  1451  YIPINVLEGREDSPTLEDSFTEVDDIMFQTLDNLFAKSKVSPREIDvlvvnvsllasaps  1272
             Y+P   L GRE   T +D+  E+D  +   +  LFA ++  PR++DVLVVNV++    P 
Sbjct  86    YLPFGPLAGREKCLTHQDALDEMDAFIIDAVAGLFANTRFGPRDVDVLVVNVNMFNPEPC  145

Query  1271  LTSRVVNRYKMREDVKTFNLSGMGCSASVVAIDIVHHLFKVY--KNSYAIVVSTESLGAN  1098
             L SR+ + Y MREDV  +N+SGMGCSA++V++DIV ++ +    +   A+V+STE L   
Sbjct  146   LASRIGHHYGMREDVAAYNVSGMGCSATLVSLDIVQNVMRARSPRPVLALVLSTEVLSPG  205

Query  1097  WYSGKERSMMLSNCLFRSGGCSMLFTNNPALKPRAILKLKHMVRTHIAAIDEAYECCKQV  918
              Y G +RSMML  CLFR GG + L T++PAL  RA +KL+ +VR ++AA D+AY    Q 
Sbjct  206   NYQGTDRSMMLGLCLFRCGGAAALLTSDPALGGRAKMKLRRLVRANVAANDDAYSAIFQR  265

Query  917   EDPQGFRGFHLSKRLPKVATKALVTNFKVLVPKAIPLWETLRFLAVSS----LERRKFKL  750
             ED     GF ++K LPK A +A   N K LVP  +P  E LR  A  +    L R++ K+
Sbjct  266   EDADNITGFSINKTLPKAAVRAFAANLKRLVPYVLPARELLRLAASFTWQKMLRRQRVKI  325

Query  749   PSLLGKPILNMKTGIEHFCLHPGGRAVIDGVGVSLGLSEYDLEPARMSLHRWGNTSAGGL  570
                     +N+KTG++HFCLH GG AVID V  + GL E D+EP+RM+LHRWGNTS   +
Sbjct  326   N-------VNLKTGVDHFCLHSGGIAVIDAVKKNFGLKETDVEPSRMTLHRWGNTSTSSV  378

Query  569   WYVLGYMEAKKRLKKGDRILMLSLGAGFKCNNCVWEVMKDLGDPNVWEDCIDRYPPETLV  390
             WYVL YMEAK RLK+GDR+LM++ G+GFKCN C+W+V ++L D   W D ID+YP E+  
Sbjct  379   WYVLAYMEAKGRLKRGDRMLMVTFGSGFKCNTCMWDVNRNLADKGAWADSIDKYPMESTA  438

Query  389   NPFTEKFDWIHD  354
             N   +K+ WI+D
Sbjct  439   NTSLDKYSWIND  450



>gb|EAZ27141.1| hypothetical protein OsJ_11073 [Oryza sativa Japonica Group]
Length=447

 Score =   385 bits (988),  Expect = 6e-124, Method: Compositional matrix adjust.
 Identities = 204/432 (47%), Positives = 274/432 (63%), Gaps = 29/432 (7%)
 Frame = -1

Query  1631  RRRHQCCYMLNYECYKPTDVARRLSTDKSALVVYRNRNLGIDEFRFLLQTMVNSGVGEQT  1452
             RRR   CY+L+Y CYKP D    L+T+ +  +V RN  LGI EFRFL++ +  +G+G++T
Sbjct  29    RRRGMRCYLLDYVCYKPAD-DLTLTTELACAIVQRNERLGIPEFRFLVRLISRTGLGDRT  87

Query  1451  YIPINVLEGREDSPTLEDSFTEVDDIMFQTLDNLFAKSKVSPREIDvlvvnvsllasaps  1272
             Y P N+L+GRE+     DS  E+D      +  L A++ +  R++DVLVVNV+     P 
Sbjct  88    YAPRNLLDGREELAAQRDSVDEMDACFDGAVPELLARTGLRARDVDVLVVNVNGFFPEPC  147

Query  1271  LTSRVVNRYKMREDVKTFNLSGMGCSASVVAIDIVHHLFKVY--KNSYAIVVSTESLGAN  1098
             L SRVV RY MREDV  +NLSGMGCSA++VA+D+  +  +    +   A+VVSTESL  +
Sbjct  148   LASRVVRRYGMREDVAAYNLSGMGCSATLVAVDVGRNAMRARSPRPVVALVVSTESLAPH  207

Query  1097  WYSGKERSMMLSNCLFRSGGCSMLFTNNPALKPRAILKLKHMVRTHIAAIDEAYECCKQV  918
             WY+GKER+MML+ CLFR    +                    VR+  AA D+AY C  Q 
Sbjct  208   WYAGKERTMMLAQCLFRWSSAAF-------------------VRSTTAASDDAYSCIMQR  248

Query  917   EDPQGFRGFHLSKRLPKVATKALVTNFKVLVPKAIPLWETLRFLA----VSSLERRKFKL  750
             ED  G RG  +SK LPK A +A   N + L+P+ +P  E  R  A     + L+RR+ + 
Sbjct  249   EDDDGLRGVSISKALPKAALRAFAANLQRLLPRVLPAMEIARLAADLAWQNLLQRRRHRG  308

Query  749   PSLLGKPILNMKTGIEHFCLHPGGRAVIDGVGVSLGLSEYDLEPARMSLHRWGNTSAGGL  570
              + L    +N+K G++H CLH GG AVID V  S GL E D+EP RM+LHRWGNTSA  +
Sbjct  309   QTKLK---INLKAGVDHICLHAGGVAVIDAVKKSFGLEERDVEPLRMTLHRWGNTSASSV  365

Query  569   WYVLGYMEAKKRLKKGDRILMLSLGAGFKCNNCVWEVMKDLGDPNVWEDCIDRYPPETLV  390
             WYVL YMEAK RL++GD++LM++ G+GFKCN+CVWEV  D+ D   W DCID YPPE+  
Sbjct  366   WYVLSYMEAKGRLRRGDKVLMVTFGSGFKCNSCVWEVAGDMADKGAWADCIDAYPPESKP  425

Query  389   NPFTEKFDWIHD  354
             +PF EKF WI+D
Sbjct  426   SPFLEKFAWIND  437



>gb|KDO67811.1| hypothetical protein CISIN_1g010144mg [Citrus sinensis]
Length=365

 Score =   372 bits (955),  Expect = 4e-120, Method: Compositional matrix adjust.
 Identities = 187/307 (61%), Positives = 236/307 (77%), Gaps = 0/307 (0%)
 Frame = -1

Query  1712  FYHMETLVAIYSLLFLYTVVYILRSYLRRRHQCCYMLNYECYKPTDVARRLSTDKSALVV  1533
             F+    +  +Y L   Y + ++ +  L++R QCCYML YECYKP D  RRL T+  A VV
Sbjct  52    FFFSFIMALLYLLPLFYIIFHLYKWVLQKRGQCCYMLAYECYKPCDETRRLDTESCARVV  111

Query  1532  YRNRNLGIDEFRFLLQTMVNSGVGEQTYIPINVLEGREDSPTLEDSFTEVDDIMFQTLDN  1353
             +RN+ LG++E+RFLL+ MV+SG+GE+TY P NV+EGRE+SP+L ++F+E+D+I+F TLD 
Sbjct  112   WRNKKLGLEEYRFLLKNMVSSGIGEETYGPRNVVEGREESPSLAEAFSEMDEIIFDTLDK  171

Query  1352  LFAKSKVSPREIDvlvvnvsllasapsLTSRVVNRYKMREDVKTFNLSGMGCSASVVAID  1173
             LFA++ +SP EIDVLVVNVSL + APSLTSR++NRY +R D+K FNLSGMGCSASVVA+D
Sbjct  172   LFARTDISPSEIDVLVVNVSLFSPAPSLTSRIINRYNLRNDIKAFNLSGMGCSASVVAVD  231

Query  1172  IVHHLFKVYKNSYAIVVSTESLGANWYSGKERSMMLSNCLFRSGGCSMLFTNNPALKPRA  993
             +V  LF+ YKN  AIVVSTES+G NWY G+E+SMMLSN LFRSGGCSML TNN ALK +A
Sbjct  232   LVQQLFRTYKNKLAIVVSTESMGPNWYCGREKSMMLSNILFRSGGCSMLLTNNRALKHKA  291

Query  992   ILKLKHMVRTHIAAIDEAYECCKQVEDPQGFRGFHLSKRLPKVATKALVTNFKVLVPKAI  813
             ILKL  +VRTH  + DEAYECC QVED QG  GF L+K+L K A  A   N +VLVPK +
Sbjct  292   ILKLNCLVRTHFGSNDEAYECCMQVEDQQGHPGFRLTKQLTKAAALAFTMNLQVLVPKIL  351

Query  812   PLWETLR  792
             PL E  R
Sbjct  352   PLREQFR  358



>ref|XP_009357760.1| PREDICTED: 3-ketoacyl-CoA synthase 21-like [Pyrus x bretschneideri]
Length=409

 Score =   372 bits (954),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 199/366 (54%), Positives = 250/366 (68%), Gaps = 19/366 (5%)
 Frame = -1

Query  1409  TLEDSFTEVDDIMFQTLDNLFAKS-KVSPREIDvlvvnvsllasapsLTSRVVNRYKMRE  1233
              LED   E+D I+F  LD LFA++  +SP +ID+LVVNVS+ +  PSL+S +VNRYKMR+
Sbjct  47    NLEDELVEMDGIIFDALDKLFARATSISPSQIDILVVNVSMFSHVPSLSSYIVNRYKMRD  106

Query  1232  DVKTFNLSGMGCSASVVAIDIVHH-LFKVYKNSYAIVVSTESLGANWYSGKERSMMLSNC  1056
             D+K+FNLSGMGC A+++AID+    +   +K S  +    ++          R       
Sbjct  107   DIKSFNLSGMGCIATLIAIDVRRRKIHDAHKLSLPLKRVRDAAHEQPKPKAPR-------  159

Query  1055  LFRSGGCSMLFTNNPALKPRAILKLKHMVRTHIAAIDEAYECCKQVEDPQGFRGFHLSKR  876
                  GC+ML TNN +LK +A LKL H+VR H  + DEAY CC QVED  G RGF L+K 
Sbjct  160   -----GCAMLLTNNQSLKHQAKLKLNHLVRMHTGSNDEAYNCCIQVEDESGNRGFRLTKY  214

Query  875   LPKVATKALVTNFKVLVPKAIPLWETLRFLAVSSLERRKFKLPSLLGKPI----LNMKTG  708
             L K AT++   N +VL PK +PL E LR+L  S L   +  + S   KP     LN+KTG
Sbjct  215   LVKAATQSFTKNLQVLAPKMLPLREILRYLVASRLNNIRTSITSQKPKPAGGLGLNLKTG  274

Query  707   IEHFCLHPGGRAVIDGVGVSLGLSEYDLEPARMSLHRWGNTSAGGLWYVLGYMEAKKRLK  528
             IEHFC+HPGGRA+IDG+G SLGLS+YD+EP+RM+LHR+GNTS  G WY LGYMEAKKRLK
Sbjct  275   IEHFCVHPGGRAIIDGIGKSLGLSDYDVEPSRMALHRFGNTSGAGFWYALGYMEAKKRLK  334

Query  527   KGDRILMLSLGAGFKCNNCVWEVMKDLGDPNVWEDCIDRYPPE-TLVNPFTEKFDWIHDP  351
             KG+RILM   GAGFKCNN VWEVMKDL D NVW+DCID YP +   VNPF EK+ WI+D 
Sbjct  335   KGNRILMSGFGAGFKCNNIVWEVMKDLDDVNVWKDCIDSYPRDLNQVNPFMEKYGWINDD  394

Query  350   CLNFLR  333
              L F+R
Sbjct  395   YLGFVR  400



>ref|XP_008675478.1| PREDICTED: acyltransferase isoform X1 [Zea mays]
 gb|ACN28128.1| unknown [Zea mays]
 tpg|DAA49664.1| TPA: hypothetical protein ZEAMMB73_006811 [Zea mays]
Length=377

 Score =   369 bits (946),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 187/374 (50%), Positives = 258/374 (69%), Gaps = 14/374 (4%)
 Frame = -1

Query  1436  VLEGREDSPT-LEDSFTEVDDIMFQTLDNLFAKSK------VSPREIDvlvvnvsllasa  1278
             ++EG E  P  L +   E+D+     LD LFA+S       + P ++DVLVVNVS+ + A
Sbjct  1     MIEGGEARPDRLREGMEEMDETFHAVLDELFARSAAPGGVGIRPADVDVLVVNVSMFSPA  60

Query  1277  psLTSRVVNRYKMREDVKTFNLSGMGCSASVVAIDIVHHLFKVYKNSYAIVVSTESLGAN  1098
             PSL++RVV RY +RED K +NL+GMGCSA+++A+D+V+  F+ +    A+V+++ES+  N
Sbjct  61    PSLSARVVRRYGLREDAKVYNLTGMGCSATLIALDLVNGYFRTHAGQVALVMTSESIAPN  120

Query  1097  WYSGKERSMMLSNCLFRSGGCSMLFTNNPALKPRAILKLKHMVRTHIAAIDEAYECCKQV  918
             WY+G +R+ ML NCLFRSGGC+   TN+P L+P A L+L+H+VRTH  A DEAY C  Q+
Sbjct  121   WYAGNKRTFMLGNCLFRSGGCAYFLTNDPRLRPHAKLRLRHVVRTHTGASDEAYNCALQM  180

Query  917   EDPQGFRGFHLSKRLPKVATKALVTNFKVLVPKAIPLWETLRFLAVSSL------ERRKF  756
             ED  G  GFHL K LP+ A  A V N +VL P+ +PL E LR LA ++L      ++R+ 
Sbjct  181   EDEAGRPGFHLGKELPRAAVHAFVHNLRVLAPRVLPLPELLR-LACATLSARLARKKRQR  239

Query  755   KLPSLLGKPILNMKTGIEHFCLHPGGRAVIDGVGVSLGLSEYDLEPARMSLHRWGNTSAG  576
                   G   + MK G++HFC+H GG AVIDGVG  L L+E+DLEP+RM+LHR+GNTSA 
Sbjct  240   GAGHGHGHLTIRMKAGVDHFCVHTGGAAVIDGVGKGLTLTEHDLEPSRMTLHRFGNTSAS  299

Query  575   GLWYVLGYMEAKKRLKKGDRILMLSLGAGFKCNNCVWEVMKDLGDPNVWEDCIDRYPPET  396
              +WYVL YMEAK RL++GDR+LML+ GAGFKCN+CVW V +   D  VW+D I  YP + 
Sbjct  300   SVWYVLAYMEAKGRLRQGDRVLMLTFGAGFKCNSCVWTVERPATDAGVWKDRIHHYPLKD  359

Query  395   LVNPFTEKFDWIHD  354
             + NPF +K+ ++ D
Sbjct  360   VSNPFMDKYGFVKD  373



>ref|XP_004984199.1| PREDICTED: 3-ketoacyl-CoA synthase 12-like [Setaria italica]
Length=495

 Score =   370 bits (950),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 200/427 (47%), Positives = 274/427 (64%), Gaps = 11/427 (3%)
 Frame = -1

Query  1613  CYMLNYECYKPTDVARRLSTDKSALVVYRNRNLGIDEFRFLLQTMVNSGVGEQTYIPINV  1434
             C++L+Y CYKP D   +  T+    ++ R+  L     RFLL+ +V SG+GE TY P  +
Sbjct  31    CFLLDYVCYKPPD-DLKFPTETMRALLDRSERLDGPARRFLLRVVVRSGLGEHTYAPRTL  89

Query  1433  LEGREDS-PTLEDSFTEVDDIMFQTLDNLFAKSK-VSPREIDvlvvnvsllasapsLTSR  1260
             + GR D   T +D   E+D      ++ LFA++  + PR++DVLVVNVS    APSL SR
Sbjct  90    VAGRADGRATHQDCLDEMDPFFHGAVEELFARTPGLGPRDVDVLVVNVSTFHPAPSLASR  149

Query  1259  VVNRYKMREDVKTFNLSGMGCSASVVAIDIVHHLFKV--YKNSYAIVVSTESLGANWYSG  1086
             +   + MR+DV  +NLSGMGC A +VA+D+  +  +    + + A+VVS E +  NWY G
Sbjct  150   IARAHGMRDDVAAYNLSGMGCGAVLVAVDLARNALRARSTRPALALVVSAECIVPNWYVG  209

Query  1085  KERSMMLSNCLFRSGGCSMLFTNNPALKPR-AILKLKHMVRTHIAAIDEAYECCKQVEDP  909
              +RSMML +CLFR GG ++L  N+PAL+ R A ++L+ + R  +AA D+A+    Q ED 
Sbjct  210   NDRSMMLGSCLFRCGGAAVLLANDPALRGRRAKMELRLVERATVAADDDAHGAIVQREDD  269

Query  908   QGFRGFHLSKRLPKVATKALVTNFKVLVPKAIPLWETLRF---LAVSSLERRKFKLPSLL  738
             +G  G  LS+ LPKVA  A   N + LVP+ +P  E +RF   +A   L RR+    +  
Sbjct  270   EGRVGISLSRSLPKVAVAAFAANMRRLVPRVLPATELVRFAAAVACRKLLRRRGGGAATG  329

Query  737   GKPILNMKTGIEHFCLHPGGRAVIDGVGVSLGLSEYDLEPARMSLHRWGNTSAGGLWYVL  558
              K  +N K G +HFCLHPGG AVID V  S+GL E D+EP+RM+LHRWGNTSA  +WYVL
Sbjct  330   SK--INFKAGADHFCLHPGGVAVIDAVKRSMGLEERDVEPSRMTLHRWGNTSASSVWYVL  387

Query  557   GYMEAKKRLKKGDRILMLSLGAGFKCNNCVWEVMKDLGDPNVWEDCIDRYPPETLVNPFT  378
              YMEAK  LK GDR+LM++ G+GFKCN+CVWEV  D+ D   W  CID YPPE L NP+ 
Sbjct  388   SYMEAKGWLKVGDRVLMVAFGSGFKCNSCVWEVTGDMADKGAWAHCIDSYPPERLANPYM  447

Query  377   EKFDWIH  357
             EK+ +I+
Sbjct  448   EKYGYIN  454



>ref|XP_010418816.1| PREDICTED: 3-ketoacyl-CoA synthase 12-like, partial [Camelina 
sativa]
Length=295

 Score =   358 bits (920),  Expect = 6e-116, Method: Compositional matrix adjust.
 Identities = 168/286 (59%), Positives = 214/286 (75%), Gaps = 14/286 (5%)
 Frame = -1

Query  1268  TSRVVNRYKMREDVKTFNLSGMGCSASVVAIDIVHHLFKVYKNSYAIVVSTESLGANWYS  1089
              SR++N YKMR+DVK FNL+GMGCSAS++++DIV ++FK Y N  A+V ++ESL  NWYS
Sbjct  9     ASRIINHYKMRDDVKVFNLTGMGCSASLISVDIVKNIFKTYSNKLALVATSESLSPNWYS  68

Query  1088  GKERSMMLSNCLFRSGGCSMLFTNNPALKPRAILKLKHMVRTHIAAIDEAYECCKQVEDP  909
             G  RSM+L+NCLFRSGGC++L TN  +L+ RA+ KLK MVRTH  A +E+Y CC Q ED 
Sbjct  69    GNNRSMILANCLFRSGGCAILLTNKRSLRKRAMFKLKCMVRTHHGAREESYNCCVQSEDE  128

Query  908   QGFRGFHLSKRLPKVATKALVTNFKVLVPKAIPLWETLRFLAVSSL---------ERRKF  756
             QG  GF+L K LPK AT+A V N K++ PK +P+ E LRF+    +          +   
Sbjct  129   QGRVGFYLGKNLPKAATRAFVDNLKIITPKILPVTELLRFMLKLLIKKIKIRQNPSKGST  188

Query  755   KLPSLLGKPI---LNMKTGIEHFCLHPGGRAVIDGVGVSLGLSEYDLEPARMSLHRWGNT  585
              LPS  G P+   +N KTGIEHFC+H GG+AVIDG+  SL L+EYD+EPARM+LHR+GNT
Sbjct  189   NLPS--GTPLKAGINFKTGIEHFCIHTGGKAVIDGIKHSLDLTEYDIEPARMTLHRFGNT  246

Query  584   SAGGLWYVLGYMEAKKRLKKGDRILMLSLGAGFKCNNCVWEVMKDL  447
             SA  LWYVL YMEAKKRLK+GDR+ M+S GAGFKCN+CVWEV++DL
Sbjct  247   SASSLWYVLAYMEAKKRLKRGDRVFMISFGAGFKCNSCVWEVVRDL  292



>gb|EMS49160.1| 3-ketoacyl-CoA synthase 12 [Triticum urartu]
Length=353

 Score =   360 bits (923),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 181/347 (52%), Positives = 238/347 (69%), Gaps = 7/347 (2%)
 Frame = -1

Query  1385  VDDIMFQTLDNLFAKSKVSPREIDvlvvnvsllasapsLTSRVVNRYKMREDVKTFNLSG  1206
             +D      +  +F K+ VSPR++D++V+NV   + APSL +RVV R+ MREDV+ +NLSG
Sbjct  1     MDAFFDDAVRAVFEKTGVSPRDVDLVVLNVGSFSPAPSLAARVVARFGMREDVQAYNLSG  60

Query  1205  MGCSASVVAIDIVHHLFKVYKNSYAIVVSTESLGANWYSGKERSMMLSNCLFRSGGCSML  1026
             MGCSA +V++D+   +      + A+VV++ES   NWY+G ++SMML NCLFR GG + L
Sbjct  61    MGCSAGLVSVDLARQVMLTRPRTMALVVTSESCAPNWYNGTDKSMMLGNCLFRCGGAAAL  120

Query  1025  FTNNPALKPRAILKLKHMVRTHIAAIDEAYECCKQVEDPQGFRGFHLSKRLPKVATKALV  846
              TN+PA + RA ++L+ +VR HI A D+A+      ED  G  G  LSK LPK A +A  
Sbjct  121   LTNDPAYRSRAKMELRCLVRAHIGAHDDAHAAAVHCEDADGRLGVSLSKALPKAAVRAFS  180

Query  845   TNFKVLVPKAIPLWETLRF---LAVSSLERRKFKLPSLLGKPILNMKTGIEHFCLHPGGR  675
              N + L P+ +P  E  RF   L    L RRK K       P +N KTG++HFCLHPGG 
Sbjct  181   ENLQRLAPRILPAAELARFTVRLLARKLMRRKLKFEG----PKINFKTGVDHFCLHPGGT  236

Query  674   AVIDGVGVSLGLSEYDLEPARMSLHRWGNTSAGGLWYVLGYMEAKKRLKKGDRILMLSLG  495
             AVI+ V  +LGL+ YD+EPA M+LHRWGNTSA  LWYVL YMEAK+RLK GDR+LM++ G
Sbjct  237   AVIEAVRKNLGLNSYDVEPATMTLHRWGNTSASSLWYVLSYMEAKRRLKAGDRVLMVTFG  296

Query  494   AGFKCNNCVWEVMKDLGDPNVWEDCIDRYPPETLVNPFTEKFDWIHD  354
             +G KCN+C WEV KDL D   WEDCID YPPET+VNP+TEKF W++D
Sbjct  297   SGVKCNSCYWEVSKDLDDAGAWEDCIDDYPPETMVNPYTEKFGWVND  343



>ref|XP_007219070.1| hypothetical protein PRUPE_ppa014834mg, partial [Prunus persica]
 gb|EMJ20269.1| hypothetical protein PRUPE_ppa014834mg, partial [Prunus persica]
Length=319

 Score =   357 bits (915),  Expect = 9e-115, Method: Compositional matrix adjust.
 Identities = 184/340 (54%), Positives = 241/340 (71%), Gaps = 35/340 (10%)
 Frame = -1

Query  1340  SKVSPREIDvlvvnvsllasapsLTSRVVNRYKMREDVKTFNLSGMGCSASVVAIDIVHH  1161
             + +SP +ID+L V++ + + APSLTSR++NRYKMRED+KTFNL GMGC+AS+++ID+  +
Sbjct  3     TSISPSQIDILAVDMLMFSPAPSLTSRIINRYKMREDIKTFNLPGMGCNASLISIDVEQN  62

Query  1160  LFKVYKNSYAIVVSTESLGANWYSGKERSMMLSNCLFRSGGCSMLFTNNPALKPRAILKL  981
             LFK YK++ A+          +Y GKE+SMM +NCLFRSGG S++FTNN +LK +A+L+L
Sbjct  63    LFKSYKDANAL----------FYCGKEKSMMFTNCLFRSGGFSLMFTNNRSLKHQALLRL  112

Query  980   KHMVRTHIAAIDEAYECCKQVEDPQGFRGFHLSKRLPKVATKALVTNFKVLVPKAIPLWE  801
             KH+VRTH  + DE+           G+ GF  +K L K AT+    N +VLVPK +PL E
Sbjct  113   KHLVRTHTGSKDES-----------GYHGFRFTKYLVKAATQGFTINLQVLVPKVLPLRE  161

Query  800   TLRFLA---VSSLERRKFKLPSLLGKPI-LNMKTGIEHFCLHPGGRAVIDGVGVSLGLSE  633
              L +L    + +L  +  KL    G  + LN+KTGIEHFC+HPGGRA+IDG G SLGLS+
Sbjct  162   ILTYLLAYLLHNLSTKSQKLEVAGGDGVKLNLKTGIEHFCIHPGGRAIIDGNGKSLGLSD  221

Query  632   YDLEPARMSLHRWGNTSAGGLWYVLGYMEAKKRLKKGDRILMLSLGAGFKCNNCVWEVMK  453
             YD+         W  TSA G WY LGY+EAKKRLKKG+RILM  LG GFKCNN VWEV+K
Sbjct  222   YDV---------W-QTSAAGFWYALGYLEAKKRLKKGNRILMSGLGEGFKCNNIVWEVLK  271

Query  452   DLGDPNVWEDCIDRYPPETLVNPFTEKFDWIHDPCLNFLR  333
             DL D NVW+DC+D YPP TL+NPF EK+ W++D  LNF+R
Sbjct  272   DLDDANVWKDCMDSYPPNTLINPFMEKYSWLNDEILNFVR  311



>ref|XP_006649160.1| PREDICTED: 3-ketoacyl-CoA synthase 12-like [Oryza brachyantha]
Length=382

 Score =   347 bits (891),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 160/304 (53%), Positives = 210/304 (69%), Gaps = 2/304 (1%)
 Frame = -1

Query  1259  VVNRYKMREDVKTFNLSGMGCSASVVAIDIVHHLFKVYKNSYAIVVSTESLGANWYSGKE  1080
             VV R+ MR DV  +NLSGMGCSA +V++D+  ++      + A+V+++ES   NWY+G +
Sbjct  66    VVRRFGMRGDVMAYNLSGMGCSAGLVSVDLARNVMLTRPRTMALVLTSESCAPNWYTGTD  125

Query  1079  RSMMLSNCLFRSGGCSMLFTNNPALKPRAILKLKHMVRTHIAAIDEAYECCKQVEDPQGF  900
             +SMML NCLFR GG + L TN+PAL+ RA ++L+ +VR HI A D+A+      ED  G 
Sbjct  126   KSMMLGNCLFRCGGAAALLTNDPALRSRAKMELRCLVRAHIGAQDDAHAAAVHREDADGR  185

Query  899   RGFHLSKRLPKVATKALVTNFKVLVPKAIPLWETLRFLAVSSLERRKFKLPSLLGK--PI  726
              G  LSK LPK A +A   N + L P+ +P  E  RF A   L +   +  +      P 
Sbjct  186   LGVSLSKALPKAAVRAFTENLQRLAPRILPAGELARFAARLLLRKLLRRKSAGAKGEGPK  245

Query  725   LNMKTGIEHFCLHPGGRAVIDGVGVSLGLSEYDLEPARMSLHRWGNTSAGGLWYVLGYME  546
             +N KTG++HFCLHPGG+AVI+ V  SLGL+ YD+EPARM+LHRWGNTSA  LWYVL YME
Sbjct  246   INFKTGVDHFCLHPGGKAVIEAVSKSLGLNSYDVEPARMTLHRWGNTSASSLWYVLSYME  305

Query  545   AKKRLKKGDRILMLSLGAGFKCNNCVWEVMKDLGDPNVWEDCIDRYPPETLVNPFTEKFD  366
             AK+RLK GDR+LM++ G+GFKCN+C WEV KDL D   WEDCI  YPPE +VNP+ EKF 
Sbjct  306   AKRRLKAGDRLLMVTFGSGFKCNSCYWEVTKDLADAGAWEDCIADYPPEKMVNPYMEKFG  365

Query  365   WIHD  354
             W++D
Sbjct  366   WVND  369



>ref|XP_009798489.1| PREDICTED: 3-ketoacyl-CoA synthase 3-like [Nicotiana sylvestris]
Length=354

 Score =   345 bits (886),  Expect = 5e-110, Method: Compositional matrix adjust.
 Identities = 158/249 (63%), Positives = 194/249 (78%), Gaps = 0/249 (0%)
 Frame = -1

Query  1100  NWYSGKERSMMLSNCLFRSGGCSMLFTNNPALKPRAILKLKHMVRTHIAAIDEAYECCKQ  921
             NWY+G  RSM+L+NCLFRSGG ++L TN  ALK +A+ KLK +VRTH  A DEAY+ C Q
Sbjct  89    NWYTGNNRSMILANCLFRSGGSAILLTNKVALKNKAMFKLKCLVRTHHGAKDEAYDSCIQ  148

Query  920   VEDPQGFRGFHLSKRLPKVATKALVTNFKVLVPKAIPLWETLRFLAVSSLERRKFKLPSL  741
              ED QG  GFHL K LPK ATKALV N K + P  +P+ E LRF  VS + +  +     
Sbjct  149   KEDDQGHIGFHLDKTLPKAATKALVDNLKTIAPLVLPVRELLRFAIVSLVRKMNWGSTKG  208

Query  740   LGKPILNMKTGIEHFCLHPGGRAVIDGVGVSLGLSEYDLEPARMSLHRWGNTSAGGLWYV  561
               +P++N KTG++H CLH GG+AVIDGVG +L LSEYDLEPARM+LHR+GNTSA  LWYV
Sbjct  209   GARPVINFKTGVDHICLHTGGKAVIDGVGTNLNLSEYDLEPARMTLHRFGNTSASSLWYV  268

Query  560   LGYMEAKKRLKKGDRILMLSLGAGFKCNNCVWEVMKDLGDPNVWEDCIDRYPPETLVNPF  381
             LGYMEAKKRLKKGD++LM+S GAGFKCN+C+WEV++DLG+ NVW+DCID YPP+TL NPF
Sbjct  269   LGYMEAKKRLKKGDKVLMISFGAGFKCNSCLWEVLRDLGNENVWKDCIDNYPPKTLANPF  328

Query  380   TEKFDWIHD  354
              EKF W+H+
Sbjct  329   LEKFGWLHN  337



>ref|XP_004309415.1| PREDICTED: 3-ketoacyl-CoA synthase 21-like, partial [Fragaria 
vesca subsp. vesca]
Length=281

 Score =   340 bits (873),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 173/282 (61%), Positives = 223/282 (79%), Gaps = 2/282 (1%)
 Frame = -1

Query  1703  METLVAIYSLLFLYTVVYILRSYLRRRHQCCYMLNYECYKPTDVARRLSTDKSALVVYRN  1524
             ME L+ +  +   Y    +L+S+L+RRHQ CY+L YECYKPT+   +L TD  A +V RN
Sbjct  1     MEFLLTMCLVSLFYGFCCLLKSFLQRRHQSCYLLAYECYKPTE-DMKLRTDSCAKIVMRN  59

Query  1523  RNLGIDEFRFLLQTMVNSGVGEQTYIPINVLEGREDSPTLEDSFTEVDDIMFQTLDNLFA  1344
             +NLG++EFRFLL+T+VNSG+GE+T  P N+L+GRE+ P L DS +E+D+I+F TLDNLF 
Sbjct  60    KNLGLEEFRFLLKTIVNSGIGEETSCPRNILQGREEKPNLADSLSEMDEIIFNTLDNLFT  119

Query  1343  K-SKVSPREIDvlvvnvsllasapsLTSRVVNRYKMREDVKTFNLSGMGCSASVVAIDIV  1167
             +   VSP +ID+LVVNVS+ + +PSLTSR+VNRYKMRE++KTFNLSGMGCSAS+VA+D+V
Sbjct  120   RYPSVSPSQIDILVVNVSMFSPSPSLTSRIVNRYKMRENIKTFNLSGMGCSASLVAVDVV  179

Query  1166  HHLFKVYKNSYAIVVSTESLGANWYSGKERSMMLSNCLFRSGGCSMLFTNNPALKPRAIL  987
               LFK YK+SYA+VVSTES+  NWY GKE+SMML+NCLFRSGGCSMLFTN    + +AIL
Sbjct  180   QGLFKSYKDSYALVVSTESMAPNWYCGKEKSMMLTNCLFRSGGCSMLFTNRRYHRHQAIL  239

Query  986   KLKHMVRTHIAAIDEAYECCKQVEDPQGFRGFHLSKRLPKVA  861
             KLK +VRTHI + D+AY CC Q+ED  G+ GF L+K L K A
Sbjct  240   KLKTLVRTHIGSSDDAYNCCIQLEDDSGYPGFRLTKYLTKAA  281



>gb|EAY90259.1| hypothetical protein OsI_11832 [Oryza sativa Indica Group]
Length=396

 Score =   335 bits (858),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 175/395 (44%), Positives = 251/395 (64%), Gaps = 26/395 (7%)
 Frame = -1

Query  1520  NLGIDEFRFLLQTMVNSGVGEQTYIPINVLEGREDSPTLEDSFTEVDDIMFQTLDNLFAK  1341
             + G+   R +++ +  +G+G++TY P N+L+GRE+     D+  E+D      +  L A+
Sbjct  12    DTGVPLPRPVVRLISRTGLGDRTYAPRNLLDGREELAAQRDAIDEMDACFDGAVPELLAR  71

Query  1340  SKVSPREIDvlvvnvsllasapsLTSRVVNRYKMREDVKTFNLSGMGCSASVVAIDIVHH  1161
             + +  R++DVLVVNV+     P L SRVV RY MREDV  +NLSGMGCS ++VA+D+  +
Sbjct  72    TGLRARDVDVLVVNVNGFFPEPCLASRVVRRYGMREDVAAYNLSGMGCSGTLVAVDVARN  131

Query  1160  LFKVY--KNSYAIVVSTESLGANWYSGKERSMMLSNCLFRSGGCSMLFTNNPALKPRAIL  987
               +    +   A+VVSTESL  +WY+GKER+MML+ CLFR GG ++L +++PA   RA +
Sbjct  132   AMRARSPRPVVALVVSTESLAPHWYAGKERTMMLAQCLFRCGGAAVLLSSDPAHSGRAKM  191

Query  986   KLKHMVRTHIAAIDEAYECCKQVEDPQGFRGFHLSKRLPKVATKALVTNFKVLVPKAIPL  807
             +L+ +                  ED  G RG  +SK LPK A +A   + + L+P+ +P 
Sbjct  192   ELRSLR-----------------EDDDGLRGVSISKALPKAALRAFAASLQRLLPRVLPA  234

Query  806   WETLRFLA----VSSLERRKFKLPSLLGKPILNMKTGIEHFCLHPGGRAVIDGVGVSLGL  639
              E  R  A     + L+RR+ +  + L    +N+K G++H CLH GG AVID V  S GL
Sbjct  235   MEIARLAANLAWQNLLQRRRHRGQTKLK---INLKAGVDHICLHAGGVAVIDAVKKSFGL  291

Query  638   SEYDLEPARMSLHRWGNTSAGGLWYVLGYMEAKKRLKKGDRILMLSLGAGFKCNNCVWEV  459
              E D+EP RM+LHRWGNTSA  +WYVL YMEAK RL++GD++LM++ G+GFKCN+CVWEV
Sbjct  292   EERDVEPTRMTLHRWGNTSASSVWYVLSYMEAKGRLRRGDKVLMVAFGSGFKCNSCVWEV  351

Query  458   MKDLGDPNVWEDCIDRYPPETLVNPFTEKFDWIHD  354
               ++     W DCID YPPE+  +PF EKF WI+D
Sbjct  352   AGNMAHKGAWADCIDAYPPESKPSPFLEKFAWIND  386



>ref|XP_011100666.1| PREDICTED: 3-ketoacyl-CoA synthase 1 [Sesamum indicum]
Length=546

 Score =   336 bits (862),  Expect = 6e-104, Method: Compositional matrix adjust.
 Identities = 186/455 (41%), Positives = 279/455 (61%), Gaps = 22/455 (5%)
 Frame = -1

Query  1736  TQIDLSRSFYHMETLVAIYSLLFLYTVVYILRSYLRRRHQCCYMLNYECYKPTDVARRLS  1557
             + I ++++   M+T   ++    L   +++L  Y  +R    Y++++ CYKP D  R+LS
Sbjct  100   SDIWMNQTLNVMDTATLVFGSTLL---MFLLAIYWAKRPTPVYLVDFACYKPED-ERKLS  155

Query  1556  TDKSALVVYRNRNLGIDEFRFLLQTMVNSGVGEQTYIPINVLEGREDSP---TLEDSFTE  1386
              D    +   N     D   F  +    SG+G++TY      +G   +P   +++++  E
Sbjct  156   IDSFMKLTEENGAFEQDSINFQKRISYRSGLGDETYFA----KGITSNPPMLSMKEARLE  211

Query  1385  VDDIMFQTLDNLFAKSKVSPREIDvlvvnvsllasapsLTSRVVNRYKMREDVKTFNLSG  1206
              + +MF  LD+LF+K+ V P++I +L+VN SL    PSL+S +VNRYK+R D+K+FNL G
Sbjct  212   AEAVMFGALDSLFSKTGVEPKDIGILIVNCSLFNPTPSLSSMLVNRYKLRTDIKSFNLGG  271

Query  1205  MGCSASVVAIDIVHHLFKVYKNSYAIVVSTESLGANWYSGKERSMMLSNCLFRSGGCSML  1026
             MGCSA +++ID+  HL +   N+YAIVVSTE++  NWY G +RSM+L NC+FR GG ++L
Sbjct  272   MGCSAGLISIDLAKHLLQANPNTYAIVVSTENITQNWYFGNDRSMLLCNCIFRMGGAAIL  331

Query  1025  FTNNPALKPRAILKLKHMVRTHIAAIDEAYECCKQVEDPQGFRGFHLSKRLPKVATKALV  846
              +N    + R+  +L H VRTH  A D +Y C  Q ED +G  G  L++ L  VA  AL 
Sbjct  332   LSNKGRDRRRSKYELVHSVRTHKGADDNSYNCVYQREDDKGIVGVSLARELMAVAGDALK  391

Query  845   TNFKVLVPKAIPLWETLRFLAVSSLERRKFKLPSLLGKPILNMKTGIEHFCLHPGGRAVI  666
             TN   L P  +P  E L FL   +L +RK  L + +   I N K   EHFC+H GGRAV+
Sbjct  392   TNITTLGPLVLPFSEQLMFLV--TLVKRKV-LRAKVRPYIPNFKLAFEHFCIHAGGRAVL  448

Query  665   DGVGVSLGLSEYDLEPARMSLHRWGNTSAGGLWYVLGYMEAKKRLKKGDRILMLSLGAGF  486
             D +  +L L+E+ +EP+RM+LHR+GNTS+  LWY L Y EAK R+ +G+R+  ++ G+GF
Sbjct  449   DAIQKNLQLTEWHMEPSRMTLHRFGNTSSSSLWYELAYTEAKGRVSRGNRVWQIAFGSGF  508

Query  485   KCNNCVWEVMKDL------GDPNVWEDCIDRYPPE  399
             KCN+ VW+ ++D+      G P  W DCID+YP E
Sbjct  509   KCNSAVWKALRDIPAKECRGSP--WYDCIDKYPVE  541



>ref|XP_004507452.1| PREDICTED: 3-ketoacyl-CoA synthase 4-like [Cicer arietinum]
Length=505

 Score =   334 bits (856),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 182/444 (41%), Positives = 277/444 (62%), Gaps = 18/444 (4%)
 Frame = -1

Query  1709  YHMETLVAIYSLLFLYTVVYILRSYLRRRHQCCYMLNYECYKPTDVARRLSTDKSALVVY  1530
             Y++ +++A  ++L   + VYI+      R +  Y++++ CYKP      LS   +  V +
Sbjct  74    YNLVSVIACSTILVFGSTVYIMT-----RPRSVYLVDFSCYKPPS---NLSVKFTKFVEH  125

Query  1529  RNRNLGIDE--FRFLLQTMVNSGVGEQTYIPINVLEGREDSPTLEDSFTEVDDIMFQTLD  1356
                    DE    F  + +  SG+GE+TY+P   +     +P++  +  E + +M+  LD
Sbjct  126   SRLKGDFDESSLEFQRKILERSGLGEETYLP-EAMHQIPPTPSMASAREEAEQVMYGALD  184

Query  1355  NLFAKSKVSPREIDvlvvnvsllasapsLTSRVVNRYKMREDVKTFNLSGMGCSASVVAI  1176
             NLFA +K+ P++I +LVVN SL    PSL++ +VN+YK+R ++++FNL GMGCSA V+AI
Sbjct  185   NLFANTKIKPKDIGILVVNCSLFNPTPSLSAMIVNKYKLRGNIRSFNLGGMGCSAGVIAI  244

Query  1175  DIVHHLFKVYKNSYAIVVSTESLGANWYSGKERSMMLSNCLFRSGGCSMLFTNNPALKPR  996
             D+   + +V++N+YA+VVSTE++  NWY G ++SM++ NCLFR GG ++L +N  + + R
Sbjct  245   DLAKDMLQVHRNTYAVVVSTENITQNWYFGNKKSMLIPNCLFRVGGAAVLLSNKGSDRRR  304

Query  995   AILKLKHMVRTHIAAIDEAYECCKQVEDPQGFRGFHLSKRLPKVATKALVTNFKVLVPKA  816
             A  KL H+VRTH  A D+A++C  Q +D  G  G  LSK L  +A  AL TN   L P  
Sbjct  305   AKYKLVHVVRTHKGADDKAFKCVYQEQDDVGKTGVSLSKDLMAIAGGALKTNITTLGPLV  364

Query  815   IPLWETLRFLAVSSLERRKFKLPSLLGKP-ILNMKTGIEHFCLHPGGRAVIDGVGVSLGL  639
             +P+ E L F     ++    KL +   KP I + K   EHFC+H GGRAVID +  +L L
Sbjct  365   LPVSEQLLFFTTLVVK----KLFNAKAKPYIPDFKLAFEHFCIHAGGRAVIDELEKNLQL  420

Query  638   SEYDLEPARMSLHRWGNTSAGGLWYVLGYMEAKKRLKKGDRILMLSLGAGFKCNNCVWEV  459
                 +E +RM+LHR+GNTS+  +WY L Y+EAK R++KG+RI  ++ G+GFKCN+ VW+ 
Sbjct  421   LPMHVEASRMTLHRFGNTSSSSIWYELAYIEAKGRMRKGNRIWQIAFGSGFKCNSAVWQA  480

Query  458   MKDL--GDPNVWEDCIDRYPPETL  393
             MK +     + WEDCIDRYP E +
Sbjct  481   MKHVRASSKSPWEDCIDRYPVEIV  504



>emb|CCW28736.1| putative 3-Oxoacyl-[acyl-carrier-protein (ACP)] synthase III 
[Arachis duranensis]
Length=521

 Score =   333 bits (855),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 185/436 (42%), Positives = 269/436 (62%), Gaps = 14/436 (3%)
 Frame = -1

Query  1688  AIYSLLFLYTVVYILRSYLRRRHQCCYMLNYECYKPTDVARRLSTDKSALVVYRNRNLGI  1509
             A+  L F   ++++   Y   R    Y++++ CYKP+   R++S +    +   N     
Sbjct  87    ALTRLAFSAALLFLFGLYYATRPSPVYLVDFSCYKPSK-ERKISVESFLKMTEENGAFDE  145

Query  1508  DEFRFLLQTMVNSGVGEQTYIPINVLEGREDSPTLEDSFTEVDDIMFQTLDNLFAKSKVS  1329
             +  +F  +    SG+G++TY+P  +   R  + ++E++  E + +MF  LD LFAK+ ++
Sbjct  146   NAIQFQRRISTKSGLGDETYLPRGI-TSRPPNLSMEEARLEAEAVMFGALDALFAKTGLN  204

Query  1328  PREIDvlvvnvsllasapsLTSRVVNRYKMREDVKTFNLSGMGCSASVVAIDIVHHLFKV  1149
             PR+ID+L+VN SL    PSL++ +VN YK+R ++K++NLSGMGCSA +++ID+   L K 
Sbjct  205   PRDIDILIVNCSLFNPTPSLSAMIVNHYKLRTNIKSYNLSGMGCSAGLISIDLAKDLLKA  264

Query  1148  YKNSYAIVVSTESLGANWYSGKERSMMLSNCLFRSGGCSMLFTNNPALKPRAILKLKHMV  969
               NSYA+VVSTE++  NWY G ERSM+L NC+FR GG ++L +N    + R+  +L H V
Sbjct  265   NPNSYAVVVSTENITLNWYFGNERSMLLCNCIFRMGGAAVLLSNKRRDRARSKYELVHTV  324

Query  968   RTHIAAIDEAYECCKQVEDPQGFRGFHLSKRLPKVATKALVTNFKVLVPKAIPLWETLRF  789
             RTH  A D+ Y C  Q ED  G  G  L++ L +VA  AL TN   L P  +PL E L F
Sbjct  325   RTHKGADDKNYNCVYQREDETGKIGVCLARELMEVAGDALKTNITTLGPLVLPLSEQLMF  384

Query  788   LAVSSLERRKFKLPSLLGKP-ILNMKTGIEHFCLHPGGRAVIDGVGVSLGLSEYDLEPAR  612
                 SL RRK        KP I + K   EHFC+H GGRAV+D +  +LGLSE+ +EP+R
Sbjct  385   FM--SLVRRKVMKGRNRVKPYIPDFKLAFEHFCIHAGGRAVLDALQKNLGLSEWHMEPSR  442

Query  611   MSLHRWGNTSAGGLWYVLGYMEAKKRLKKGDRILMLSLGAGFKCNNCVWEVMKDL-----  447
             M+LHR+GNTS+  LWY L Y EAK R+KKGDR+  +  G+GFKCN+ VW+ ++ L     
Sbjct  443   MTLHRFGNTSSSSLWYELAYTEAKGRVKKGDRVWQIGFGSGFKCNSAVWKALRGLPVLHD  502

Query  446   --GDPNVWEDCIDRYP  405
               G+P  W+D I  YP
Sbjct  503   WRGNP--WDDSIHTYP  516



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 5205224884464