BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c80518_g1_i1 len=860 path=[838:0-859]

Length=860
                                                                      Score     E

ref|XP_006363449.1|  PREDICTED: uncharacterized protein LOC102588655  75.9    3e-13   
ref|XP_009804677.1|  PREDICTED: uncharacterized protein LOC104249865  75.1    7e-13   
ref|XP_009628291.1|  PREDICTED: uncharacterized protein LOC104118692  70.9    2e-11   



>ref|XP_006363449.1| PREDICTED: uncharacterized protein LOC102588655 [Solanum tuberosum]
Length=202

 Score = 75.9 bits (185),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 53/179 (30%), Positives = 87/179 (49%), Gaps = 9/179 (5%)
 Frame = +3

Query  156  MVSP--TTAGPLSRPSPNVKLIQKACKYTVDHKLCLDYLSKTPRVMSAAGKS-PLAFAGA  326
            +V+P  +TA PLS+P+  + L+ K C    D   C++YL   P+VM+AA  S PL FA A
Sbjct  20   LVAPLYSTAAPLSKPNNAIALVNKVCSGMKDKSSCINYLKSNPKVMAAAATSKPLEFALA  79

Query  327  IAETGLNYAQRMRGYAS--KKGARSPAVKSAYGECAKLLGSTTLQLELVVNVLRRPgala  500
            I ++ ++ ++    Y S  K+G  SP    AY  C          LE  + V+++    A
Sbjct  80   ILQSAVDQSKNTHSYLSKHKRGKLSPQAIEAYALCKTYWDEVASGLEGNLKVIKKDKGYA  139

Query  501  eegageDASYSLMVSTDGLRGCSEKLAALRVEDHYMKASAKRVKICSIVANSILTDLTP  677
             +     + Y L V+ D    C+  LA  +++D  +       ++    A++IL  L P
Sbjct  140  SDT----SDYDLKVTLDNATSCATGLANAQIQDPEIAKGLNNTQMAVGAADTILEGLKP  194



>ref|XP_009804677.1| PREDICTED: uncharacterized protein LOC104249865 [Nicotiana sylvestris]
Length=210

 Score = 75.1 bits (183),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 48/168 (29%), Positives = 80/168 (48%), Gaps = 6/168 (4%)
 Frame = +3

Query  183  LSRPSPN--VKLIQKACKYTVDHKLCLDYLSKTPRVMSAAGKSPLAFAGAIAETGLNYAQ  356
            +S+P+ N    LI KAC    +  LC++YL   P+VM+AA   PL FA AI ++ ++ A+
Sbjct  30   VSKPNNNNATALIDKACSTLTNKVLCMNYLKSNPKVMAAATSKPLDFALAIIQSAISEAK  89

Query  357  RMRGYASKKGAR-SPAVKSAYGECAKLLGSTTLQLELVVNVLRRPgalaeegageDASYS  533
             +  + SK   + SP    AY  C    G     LE  + ++R+              Y 
Sbjct  90   NIHSHLSKPREKLSPPAIEAYNFCKTQWGDVASGLEWSLKIIRK---DKGYAPDTSTDYD  146

Query  534  LMVSTDGLRGCSEKLAALRVEDHYMKASAKRVKICSIVANSILTDLTP  677
             +V+ D    C   LA  +++D  ++   ++V++    AN+IL    P
Sbjct  147  FVVNLDHATNCGTTLAQAKIQDPVIEKGKEKVQLVVGGANNILEWAKP  194



>ref|XP_009628291.1| PREDICTED: uncharacterized protein LOC104118692 [Nicotiana tomentosiformis]
Length=211

 Score = 70.9 bits (172),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 53/175 (30%), Positives = 80/175 (46%), Gaps = 9/175 (5%)
 Frame = +3

Query  168  TTAGPLSRPSPNVKLIQ---KACKYTVDHKLCLDYLSKTPRVMSAAGKSPLAFAGAIAET  338
            + A P+S+P+ N        KAC    D   C++YL   P+VM+A    PL FA AI ++
Sbjct  36   SNAAPISKPNNNNNATALLNKACSRASDKPFCMNYLKSNPKVMAATTSKPLDFALAIIQS  95

Query  339  GLNYAQRMRGYASK-KGAR-SPAVKSAYGECAKLLGSTTLQLELVVNVLRRPgalaeega  512
            G + A+    Y SK KG + SP    AY  C          LE  V  +       +  A
Sbjct  96   GADQAKITHAYFSKPKGTKLSPQAIKAYNHCKNHWSELASGLERSVKNI----TDQQGYA  151

Query  513  geDASYSLMVSTDGLRGCSEKLAALRVEDHYMKASAKRVKICSIVANSILTDLTP  677
             +   Y L V+ D    C   L ++R+ D     + K+V +  + A++IL D+ P
Sbjct  152  YDTTDYDLKVNLDKAANCGRALESVRIYDPVFAEANKKVSLAVMGADAILVDVKP  206



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1740960733735