BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c80489_g1_i1 len=1306 path=[1:0-1305]

Length=1306
                                                                      Score     E

gb|EYU25966.1|  hypothetical protein MIMGU_mgv1a021532mg              96.7    6e-19   
gb|EYU40575.1|  hypothetical protein MIMGU_mgv1a004589mg              98.6    8e-19   
ref|XP_009764935.1|  PREDICTED: protein FAF-like, chloroplastic       92.0    1e-16   
ref|XP_011088985.1|  PREDICTED: protein FAF-like, chloroplastic       91.7    1e-16   
ref|XP_009604443.1|  PREDICTED: protein FAF-like, chloroplastic       89.4    8e-16   
ref|XP_006361108.1|  PREDICTED: protein FAF-like, chloroplastic-like  85.9    1e-14   
emb|CDP15569.1|  unnamed protein product                              85.9    1e-14   
ref|XP_007132501.1|  hypothetical protein PHAVU_011G099500g           79.0    2e-12   
ref|XP_009611290.1|  PREDICTED: protein FAF-like, chloroplastic       77.0    7e-12   
ref|XP_010247410.1|  PREDICTED: protein FAF-like, chloroplastic       77.0    9e-12   
ref|XP_004241354.1|  PREDICTED: protein FAF-like, chloroplastic       75.9    2e-11   
gb|KHG22819.1|  hypothetical protein F383_08710                       73.9    7e-11   
ref|XP_011044595.1|  PREDICTED: protein FAF-like, chloroplastic       73.9    8e-11   
ref|XP_009789564.1|  PREDICTED: protein FAF-like, chloroplastic       73.6    1e-10   
ref|XP_002299770.1|  hypothetical protein POPTR_0001s22350g           73.2    1e-10   Populus trichocarpa [western balsam poplar]
ref|XP_002314255.2|  hypothetical protein POPTR_0009s02170g           71.6    4e-10   Populus trichocarpa [western balsam poplar]
ref|XP_003541957.1|  PREDICTED: protein FAF-like, chloroplastic-like  70.1    1e-09   
gb|KHN36503.1|  Protein FAF-like, chloroplastic                       69.7    1e-09   
ref|XP_011008645.1|  PREDICTED: protein FAF-like, chloroplastic       69.7    2e-09   
ref|XP_010031354.1|  PREDICTED: protein FAF-like, chloroplastic       69.7    2e-09   
gb|KHG29078.1|  hypothetical protein F383_03861                       68.6    5e-09   
ref|XP_011008749.1|  PREDICTED: protein FAF-like, chloroplastic       68.2    5e-09   
ref|XP_004169382.1|  PREDICTED: protein FAF-like, chloroplastic-like  67.8    6e-09   
ref|XP_007015661.1|  Chaperone DnaJ-domain superfamily protein        68.2    6e-09   
ref|XP_009786342.1|  PREDICTED: protein FAF-like, chloroplastic       67.4    9e-09   
ref|XP_008366383.1|  PREDICTED: protein FAF-like, chloroplastic       67.4    9e-09   
ref|XP_008385575.1|  PREDICTED: protein FAF-like, chloroplastic       67.4    9e-09   
ref|XP_008230058.1|  PREDICTED: protein FAF-like, chloroplastic       67.4    1e-08   
ref|XP_009336398.1|  PREDICTED: protein FAF-like, chloroplastic       65.9    3e-08   
ref|XP_009373888.1|  PREDICTED: protein FAF-like, chloroplastic       65.9    3e-08   
ref|XP_007208036.1|  hypothetical protein PRUPE_ppa002898mg           65.5    4e-08   
ref|XP_009368373.1|  PREDICTED: protein FAF-like, chloroplastic       65.5    4e-08   
ref|XP_010263029.1|  PREDICTED: protein FAF-like, chloroplastic       65.5    4e-08   
ref|XP_009591159.1|  PREDICTED: protein FAF-like, chloroplastic       65.1    6e-08   
ref|XP_010535716.1|  PREDICTED: protein FAF-like, chloroplastic       64.7    7e-08   
ref|XP_009126523.1|  PREDICTED: protein FAF-like, chloroplastic       64.3    9e-08   
gb|KDP42960.1|  hypothetical protein JCGZ_23902                       63.9    1e-07   
ref|XP_006400714.1|  hypothetical protein EUTSA_v10013382mg           63.9    1e-07   
ref|XP_004487448.1|  PREDICTED: protein FAF-like, chloroplastic-like  63.2    2e-07   
ref|XP_007050627.1|  Uncharacterized protein TCM_004392               62.8    2e-07   
ref|XP_002513735.1|  conserved hypothetical protein                   63.2    2e-07   Ricinus communis
ref|XP_008361605.1|  PREDICTED: protein FAF-like, chloroplastic       63.2    2e-07   
ref|XP_004139078.1|  PREDICTED: protein FAF-like, chloroplastic-like  61.2    6e-07   
ref|XP_004170966.1|  PREDICTED: protein FAF-like, chloroplastic-like  61.2    6e-07   
gb|KHN17984.1|  Protein FAF-like, chloroplastic                       61.6    6e-07   
ref|XP_010312347.1|  PREDICTED: protein FAF-like, chloroplastic       61.2    9e-07   
ref|XP_010916535.1|  PREDICTED: protein FAF-like, chloroplastic i...  61.2    9e-07   
ref|XP_010421000.1|  PREDICTED: protein FAF-like, chloroplastic       60.8    1e-06   
ref|XP_010916536.1|  PREDICTED: protein FAF-like, chloroplastic i...  60.8    1e-06   
emb|CDY09119.1|  BnaA02g05450D                                        60.8    1e-06   
ref|XP_006287687.1|  hypothetical protein CARUB_v10000895mg           60.8    1e-06   
ref|XP_002874046.1|  hypothetical protein ARALYDRAFT_351234           60.5    1e-06   
ref|XP_008450286.1|  PREDICTED: protein FAF-like, chloroplastic       60.1    2e-06   
emb|CAC34502.1|  putative protein                                     60.1    2e-06   Arabidopsis thaliana [mouse-ear cress]
ref|NP_680195.2|  uncharacterized protein                             60.1    2e-06   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004228872.1|  PREDICTED: protein FAF-like, chloroplastic       60.1    2e-06   
ref|XP_010456623.1|  PREDICTED: protein FAF-like, chloroplastic       60.1    2e-06   
dbj|BAC42736.1|  unknown protein                                      59.7    3e-06   Arabidopsis thaliana [mouse-ear cress]
emb|CDX88810.1|  BnaA03g08390D                                        59.3    3e-06   
ref|XP_010495347.1|  PREDICTED: protein FAF-like, chloroplastic       59.3    5e-06   
ref|XP_006424085.1|  hypothetical protein CICLE_v10028116mg           58.9    5e-06   
ref|XP_010521625.1|  PREDICTED: protein FAF-like, chloroplastic       58.5    7e-06   
gb|KHN21197.1|  Protein FAF-like, chloroplastic                       58.2    8e-06   
emb|CDY65551.1|  BnaCnng47650D                                        58.2    8e-06   
ref|XP_008782273.1|  PREDICTED: helicase SWR1-like                    57.8    1e-05   
ref|XP_007150016.1|  hypothetical protein PHAVU_005G118900g           57.4    1e-05   
ref|XP_009120687.1|  PREDICTED: protein FAF-like, chloroplastic       57.0    2e-05   
ref|XP_006592358.1|  PREDICTED: protein FAF-like, chloroplastic-like  57.0    2e-05   
ref|XP_006356677.1|  PREDICTED: protein FANTASTIC FOUR 3-like         55.5    3e-05   
gb|KCW50926.1|  hypothetical protein EUGRSUZ_J00576                   56.6    3e-05   
ref|XP_003539488.1|  PREDICTED: protein FAF-like, chloroplastic-l...  56.2    3e-05   
ref|XP_010031568.1|  PREDICTED: protein FAF-like, chloroplastic       56.2    3e-05   
ref|XP_006487862.1|  PREDICTED: protein FAF-like, chloroplastic-like  55.5    6e-05   
gb|KDO46581.1|  hypothetical protein CISIN_1g008798mg                 55.5    6e-05   
ref|XP_009623353.1|  PREDICTED: protein FANTASTIC FOUR 3-like         54.7    7e-05   
ref|XP_004251227.1|  PREDICTED: protein FAF-like, chloroplastic       53.9    8e-05   
ref|XP_008449599.1|  PREDICTED: protein FAF-like, chloroplastic       54.7    9e-05   
gb|KGN57007.1|  hypothetical protein Csa_3G149380                     54.3    1e-04   
ref|XP_003605994.1|  hypothetical protein MTR_4g050590                54.7    1e-04   
emb|CDO99018.1|  unnamed protein product                              53.5    1e-04   
gb|KHN19928.1|  Protein FAF-like, chloroplastic                       54.3    2e-04   
ref|XP_009763490.1|  PREDICTED: protein FANTASTIC FOUR 3-like         53.1    2e-04   
ref|XP_006340442.1|  PREDICTED: protein FAF-like, chloroplastic-like  53.5    2e-04   
emb|CDX70983.1|  BnaC03g10670D                                        53.1    3e-04   
ref|XP_010101989.1|  hypothetical protein L484_016279                 53.5    3e-04   
ref|XP_009789905.1|  PREDICTED: protein FANTASTIC FOUR 3-like         52.0    4e-04   
ref|XP_010651658.1|  PREDICTED: protein FAF-like, chloroplastic       52.8    4e-04   
emb|CAN72229.1|  hypothetical protein VITISV_024734                   52.4    6e-04   Vitis vinifera
ref|XP_009131857.1|  PREDICTED: protein FAF-like, chloroplastic       52.0    7e-04   



>gb|EYU25966.1| hypothetical protein MIMGU_mgv1a021532mg [Erythranthe guttata]
Length=332

 Score = 96.7 bits (239),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 82/206 (40%), Positives = 116/206 (56%), Gaps = 25/206 (12%)
 Frame = +1

Query  259  PGQDEVWKAIQAQKQQGDDHNNNKAPPIRSTVSWSAIIL---------SDQKVDVQDSVP  411
            PGQD+VW+AIQA+K++ DD    K  P++    W  ++                     P
Sbjct  81   PGQDDVWRAIQAKKER-DDEEMKKKKPLQMDC-WGTMLTHKSENSAALLAAAATAPLPPP  138

Query  412  YIHPllkkssscclskqslqICTESLGSETGSDCLTSQTRDSDHVQDQVQDNKQAHEEEE  591
            Y+HPL+K+S+S    K    ICTESLGSETGSDC +++T D    Q+++         + 
Sbjct  139  YVHPLVKRSASTLSEKSLE-ICTESLGSETGSDCFSAETED----QEKLVVMLPVVVGDS  193

Query  592  EDIFNDVKIKNYskksassfppplpslan---ssVQLRSHRQGKGEAEGSRLILEAVSVP  762
             D F D  +  Y K     FPPPLPS+A    S++ ++SHR      E  RL+LEAVSVP
Sbjct  194  NDQFADTHVAKYKKSPTRPFPPPLPSIAGGDGSALHVQSHR------ENGRLVLEAVSVP  247

Query  763  QRNYFHAERSHGRLLLTALKSPTSSD  840
            QRN+FHA+R  GRL+LT   +P++ +
Sbjct  248  QRNHFHAQRCDGRLVLTLAHAPSACE  273



>gb|EYU40575.1| hypothetical protein MIMGU_mgv1a004589mg [Erythranthe guttata]
Length=519

 Score = 98.6 bits (244),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 81/203 (40%), Positives = 114/203 (56%), Gaps = 23/203 (11%)
 Frame = +1

Query  259  PGQDEVWKAIQAQKQQGDDHNNNKAPPIRSTVSWSAIIL------SDQKVDVQDSVPYIH  420
            PGQD+VW+AIQA+K++ DD    K  P++  V W  ++       +          PY+H
Sbjct  115  PGQDDVWRAIQAKKER-DDEEMKKKKPLQMDV-WGTMLTHKSENSAALLAAAPLPPPYVH  172

Query  421  PllkkssscclskqslqICTESLGSETGSDCLTSQTRDSDHVQDQVQDNKQAHEEEEEDI  600
            PL+K  +S    K    ICTESLGSETGSDC +++T D + V         ++     D 
Sbjct  173  PLVKILASTLSEKSLE-ICTESLGSETGSDCFSAETEDQEKVVVMPVVVGDSN-----DQ  226

Query  601  FNDVKIKNYskksassfppplpslan---ssVQLRSHRQGKGEAEGSRLILEAVSVPQRN  771
            F D  +  Y K     FPPPLPS+A    +++ ++SHR      E  RL+LEAVSVPQRN
Sbjct  227  FADTHVAKYKKSPTRPFPPPLPSIAGGDGAALHVQSHR------ENGRLVLEAVSVPQRN  280

Query  772  YFHAERSHGRLLLTALKSPTSSD  840
            +FHA+R  GRL+LT   +P + +
Sbjct  281  HFHAQRCDGRLVLTLAHAPPACE  303



>ref|XP_009764935.1| PREDICTED: protein FAF-like, chloroplastic [Nicotiana sylvestris]
Length=493

 Score = 92.0 bits (227),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 105/269 (39%), Positives = 134/269 (50%), Gaps = 48/269 (18%)
 Frame = +1

Query  130  GIVSIIVGSDCDE----------SAHRSSNNWLS---IQNPSTEEDDDDELMKRRRPGQD  270
            GI+SI+ GSD ++          SA  SS  WLS     +P  +    +EL      GQD
Sbjct  38   GIMSIL-GSDNNKAAAASIRRTLSADMSSKKWLSQNGFYSPMKKIGSSEELANL---GQD  93

Query  271  EVWKAIQAQKQQGDDHNNNKAPPIRSTVSWSAIILSDQKVDVQDSVP--YIHPllkksss  444
            +VWK+IQ        + NNK+ PI S   WS+I L+ +K D   ++P  YIHPLLKKSSS
Sbjct  94   DVWKSIQ--------NGNNKSEPITSVDVWSSI-LTQKKDDSSSTIPPPYIHPLLKKSSS  144

Query  445  cclskqslqICTESLGSETGSDCLTSQTRDSDHVQDQVQDNKQAHEEEE-EDIFNDVKIK  621
                     ICTESLGSETGS+   S    SD   D+    +Q  E+E     F +  + 
Sbjct  145  LTEKSLE--ICTESLGSETGSEINLSSYPPSDTDDDKDDHQQQQQEKEFISHSFEEFPVV  202

Query  622  NYskksassfp--------pplpslanssVQLRSHRQGKGEAEGSRLILEAVSVPQRNYF  777
             Y+    SS            L +    SV ++SHRQ        RLILEAVSVP +N F
Sbjct  203  KYNHNKRSSSTPKSFPPPISSLAAEDKPSVHMQSHRQN------GRLILEAVSVPYQNLF  256

Query  778  HAERSHGRLLLTAL-KSPTS--SDQQEAG  855
              +R  GRLLLT +  SPTS   D QE  
Sbjct  257  RTQRVDGRLLLTLISTSPTSETEDNQEVA  285



>ref|XP_011088985.1| PREDICTED: protein FAF-like, chloroplastic [Sesamum indicum]
Length=480

 Score = 91.7 bits (226),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 89/268 (33%), Positives = 132/268 (49%), Gaps = 46/268 (17%)
 Frame = +1

Query  124  KGGIVSIIVGSDCDES----------AHRSSNNWL---SIQNP---------STEEDDDD  237
            K GIV+I+ GSDC+ S          A  SS  WL      +P         S+    + 
Sbjct  23   KQGIVTIL-GSDCERSKAKSIRRTLSADMSSKKWLQQNGFFSPVKKMSCSSSSSSSSSES  81

Query  238  ELMKRRRPGQDEVWKAIQAQKQQGDDHNNNKAPPIRSTVSWSAIILSDQKVDVQDSVPYI  417
            E    + PGQD+VW++IQA+K++ +        P   +V W +I+    +       PY+
Sbjct  82   EEEYEKIPGQDDVWRSIQAEKERTEGRK-----PAEISV-WGSILTQKSESSCLPP-PYV  134

Query  418  HPllkkssscclskqslqICTESLGSETGSDCLTSQTRDSDHVQDQVQDNKQAHEEEEED  597
            HPL+K+S+S    K    ICTESLGSETGSDC +S +       D+ ++ ++A  EE   
Sbjct  135  HPLVKRSTSSLSEKSLE-ICTESLGSETGSDCFSSYSLSDG---DEDKERERAVREESSK  190

Query  598  IFNDV------KIKNYskksassfppplpslanssVQLRSHRQGKGEAEGSRLILEAVSV  759
              N        K K    +      P +     +S+ +++HR      E  RL++EAVSV
Sbjct  191  ELNPFPGSHVAKYKKSPARPFPPPLPSIAGGNGASIHMQAHR------ENGRLVVEAVSV  244

Query  760  PQRNYFHAERSHGRLLLTALKSPTSSDQ  843
            P RN FHA+R  GRL+LT + +  SS +
Sbjct  245  PPRNNFHAQRQDGRLVLTLINTTPSSKE  272



>ref|XP_009604443.1| PREDICTED: protein FAF-like, chloroplastic [Nicotiana tomentosiformis]
Length=503

 Score = 89.4 bits (220),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 104/267 (39%), Positives = 136/267 (51%), Gaps = 46/267 (17%)
 Frame = +1

Query  130  GIVSIIVGSDCDE-----------SAHRSSNNWLS---IQNPSTEEDDDDELMKRRRPGQ  267
            GI+SI+ GSD ++           SA  SS  WLS     +P  +    +EL      GQ
Sbjct  41   GIMSIL-GSDNNKAAAVVSIRRTLSADMSSKKWLSQNGFFSPMKKIASSEELANL---GQ  96

Query  268  DEVWKAIQAQKQQGDDHNNNKAPPIRSTVSWSAIILSDQKVDVQDSVP--YIHPllkkss  441
            D+VWK+IQ        +++ KA PI S   WS+I L+ +K D   +VP  YIHPLLKKSS
Sbjct  97   DDVWKSIQ--------NSSKKAEPITSVDVWSSI-LTQKKDDSSATVPPPYIHPLLKKSS  147

Query  442  scclskqslqICTESLGSETGSDCLTSQTRDSDHVQDQVQDNKQ----AHEEEEEDI--F  603
            S         ICTESLGSETGS+   S    S+   D+    +Q    +H  EE  +  +
Sbjct  148  SLTEKSLE--ICTESLGSETGSEINLSSYPPSESDDDKDDHQQQQEFISHSFEEFPVVKY  205

Query  604  NDVKIKNYskksassfppplpslanssVQLRSHRQGKGEAEGSRLILEAVSVPQRNYFHA  783
            N  K  + + KS       L +    SV ++SHRQ        RLILEAVSVP +N F  
Sbjct  206  NHNKRSSSTPKSFPPPISSLAAEDKPSVHMQSHRQN------GRLILEAVSVPSQNLFRT  259

Query  784  ERSHGRLLLTALKS-PTS--SDQQEAG  855
            +R  GRLLLT + + PTS   D QE  
Sbjct  260  QRVDGRLLLTLISTNPTSETEDNQEVA  286



>ref|XP_006361108.1| PREDICTED: protein FAF-like, chloroplastic-like [Solanum tuberosum]
Length=440

 Score = 85.9 bits (211),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 94/264 (36%), Positives = 131/264 (50%), Gaps = 51/264 (19%)
 Frame = +1

Query  124  KGGIVSIIVGSDCDE-------------SAHRSSNNWLSIQ--NPSTEEDDDDELMKRRR  258
            K GIVSI+ G+D ++             SA  SS  WLS    +P  +     EL     
Sbjct  30   KQGIVSIL-GTDTEKGNKGVAASIRRTLSADMSSKKWLSENGFSPMKKIASSKEL---DV  85

Query  259  PGQDEVWKAIQAQKQQGDDHNNNKAPPIRSTVSWSAIILSDQKVDVQDSVPYIHPllkks  438
             GQDE+W++IQ     G +  +N          WS+I+   ++       PYIHPLLKKS
Sbjct  86   LGQDEIWRSIQ----NGGNKTSNDV--------WSSILTQKKEESSTLPPPYIHPLLKKS  133

Query  439  sscclskqslqICTESLGSETGSDCLTSQTRDSDHVQDQVQDNKQAHEEEEEDIFNDVKI  618
            +S    K    ICTESLGSETGS+ ++      DH+Q Q ++ + + +  EE  F  VK 
Sbjct  134  TSSLTEKSLE-ICTESLGSETGSEIISLD----DHLQKQEEEEELSPQTFEE--FPVVKF  186

Query  619  KNYskksass-------fppplpslanssVQLRSHRQGKGEAEGSRLILEAVSVPQRNYF  777
             +  K S+             + +    SV ++SHRQ        RLILEAVSVP +N+F
Sbjct  187  NHNKKTSSPPLPKSFPPTISSMAAEDKPSVHMQSHRQN------GRLILEAVSVPPQNHF  240

Query  778  HAERSHGRLLLTALKSPTSSDQQE  849
             AER  GRLLLT + + +S  + E
Sbjct  241  RAERVDGRLLLTLIITTSSEIEAE  264



>emb|CDP15569.1| unnamed protein product [Coffea canephora]
Length=568

 Score = 85.9 bits (211),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 100/301 (33%), Positives = 138/301 (46%), Gaps = 92/301 (31%)
 Frame = +1

Query  118  LEKGGIVSIIVGSDCDE-----------SAHRSSNNWLSIQNPST---------------  219
            +EK GIVSI+ GSD +            SA  SS  WL+ QN  T               
Sbjct  28   IEKQGIVSIL-GSDSETTKAAASLRRTLSADMSSKKWLA-QNGFTSSSPMKKIASSEKLA  85

Query  220  ---------------EEDDDDELMK--RRRPGQDEVWKAIQA---QKQQGDDHNNNKAPP  339
                             + ++E  K  + RP QD+VW +IQ+   +KQQ DD  ++K PP
Sbjct  86   LSAADHHHSSSSSSSSSEGEEEYYKGNKERPAQDDVWMSIQSNKEKKQQPDD--SSKLPP  143

Query  340  IRSTVSWSAIILSDQKVDVQDSVPYIHPllkkssscclskqslqICTESLGSETGSDCLT  519
                                   PY+HPL+K+S+S    K    ICTESLGSETGSD  +
Sbjct  144  -----------------------PYVHPLVKRSASSLSEKSLE-ICTESLGSETGSDGFS  179

Query  520  SQTRDSDHVQDQVQDN-KQAHEEEEEDIFNDVKIKNYskksassfp---------pplps  669
            S         D+ +DN +Q  + +    + D++I  Y    +S            P L  
Sbjct  180  SYPPSEVGDVDEEKDNDQQQPQPQLSQSYEDMRIAKYHYSISSRKSGPRSFPPPLPSLAR  239

Query  670  lanssVQLRSHRQGKGEAEGSRLILEAVSVPQRNYFHAERSHGRLLLTALKSPTSSDQQE  849
               +SV ++SHR      E  RL+LEAVSVP +NYF A+R  GRL LT + +P+S  Q+E
Sbjct  240  EDRASVHMQSHR------ENGRLVLEAVSVPPQNYFQAQREDGRLRLTFISTPSS--QEE  291

Query  850  A  852
            A
Sbjct  292  A  292



>ref|XP_007132501.1| hypothetical protein PHAVU_011G099500g [Phaseolus vulgaris]
 gb|ESW04495.1| hypothetical protein PHAVU_011G099500g [Phaseolus vulgaris]
Length=527

 Score = 79.0 bits (193),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 81/241 (34%), Positives = 113/241 (47%), Gaps = 41/241 (17%)
 Frame = +1

Query  169  SAHRSSNNWLS--------------IQNPSTEEDDDDELMKRRRPGQDEVWKAIQAQKQQ  306
            SA  SS NWLS              I +   EE  + EL       + E+W +IQ  K++
Sbjct  61   SADMSSKNWLSQTIATSEELVHAKTIGDWEDEESSNKELEDEAERERLEIWSSIQRNKKE  120

Query  307  GDDHNNNKAPPIRSTVSWSAIILSDQKVDVQDSVP---YIHPllkkssscclskqslqIC  477
              +    K+ P  +   WS+II    K ++  S+P   Y+HPL+K+S SC   K    IC
Sbjct  121  EQE----KSGPFDT---WSSIISLKGKDEISKSLPVSPYVHPLVKRSKSCLNEKSLQ-IC  172

Query  478  TESLGSETGSDCLTSQTRDSDHVQDQVQDNKQA---HEEEEEDIFNDVKIKNYskksass  648
            TESLGSETGSD L   +  S    D  ++ K A   H+EEEE       + NY+   A+ 
Sbjct  173  TESLGSETGSDGLLVSSYSSSETGDAEEEEKVAEPTHQEEEE-------LSNYASVVATK  225

Query  649  fppplpslanssVQLRSHRQG------KGEAEGSRLILEAVSVPQRNYFHAERSHGRLLL  810
                        +   SH+Q       +   +  RL+LEAVSVP  N F  +R  GRL+L
Sbjct  226  KSSSPTRAFPPPLHSLSHQQAGPSLHMRSRRDNGRLVLEAVSVPSHNNFSIQRQGGRLVL  285

Query  811  T  813
            +
Sbjct  286  S  286



>ref|XP_009611290.1| PREDICTED: protein FAF-like, chloroplastic [Nicotiana tomentosiformis]
Length=487

 Score = 77.0 bits (188),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 93/279 (33%), Positives = 140/279 (50%), Gaps = 30/279 (11%)
 Frame = +1

Query  64   CEDMSSSTLCSCELKPNPLEKGGIVSIIVGSDCDE---SAHRSSNNWLSIQNPSTEEDDD  234
            C +M++  L S ++K    EK GI+SI+ GS+ D+    A  S    LS    S  ++  
Sbjct  5    CVNMNNFNL-SLKMKEVTAEKQGIMSIL-GSNTDQRSIKAAASIRRTLSADMSSISKNGF  62

Query  235  DELMKRRRPGQDEVWKAIQAQKQQGDDHNNN---------KAPPIRSTVSWSAIILSDQK  387
               MK+    ++ +  AI +     D  +++         K  PI  T  WS+I+ S  +
Sbjct  63   FSSMKKIASSEELI--AISSAADICDSSSSDGEEDHIEQLKDQPI-GTFDWSSILSSKNE  119

Query  388  VDVQDSVP--YIHPllkkssscclskqslqICTESLGSETGSDCLTSQTRDSDHVQDQVQ  561
                  +P  YIHPL+K+S S    K    ICTESLGSETGSDC +S    ++ +++   
Sbjct  120  EADSSKIPPPYIHPLVKRSGSSLSKKSLE-ICTESLGSETGSDCFSSSPPKNEDLENNKD  178

Query  562  DN--KQAHEEEEEDIFNDVKIKNYskksassfppplpslanssVQLRSHRQGKGEAEGSR  735
            D+   Q         F D+ +  Y+ +   S P   P   +S V ++S RQ        R
Sbjct  179  DHHYHQQQHSSVSQSFEDIPVVKYNYRKNLSSPRSFPPPLHS-VHMQSFRQN------GR  231

Query  736  LILEAVSVPQRNYFHAERSHGRLLLTAL-KSPTSSDQQE  849
            L+LEAVSVP  NYFHA+R  GRL LT + ++ +++DQ E
Sbjct  232  LVLEAVSVPPMNYFHAQRVDGRLCLTYINQNDSTADQPE  270



>ref|XP_010247410.1| PREDICTED: protein FAF-like, chloroplastic [Nelumbo nucifera]
Length=532

 Score = 77.0 bits (188),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 71/204 (35%), Positives = 108/204 (53%), Gaps = 26/204 (13%)
 Frame = +1

Query  262  GQDEVWKAIQAQKQQGDDHNNNKAPPIRSTVSWSAIILSDQKVDVQDSVPYIHPllkkss  441
            GQ +VW +IQ+++++ D        P +  + WS+I+    +     + PY+HPL+K+S+
Sbjct  110  GQFDVWNSIQSEQEKKDLER-----PGQFDI-WSSILSQKSEKASSGAAPYVHPLVKRSA  163

Query  442  scclskqslqICTESLGSETGSDCLTS----QTRDSDHVQDQVQDNKQAHEEEEEDIFND  609
            S    K    ICTESLGSETGSD  +S    ++ D +  Q+  Q++ +   EE + +  D
Sbjct  164  SSLSEKSLE-ICTESLGSETGSDGFSSYPPSESGDLEESQETEQEDDRTKVEESQTVDKD  222

Query  610  -VKIKNYskksassfppplpslan--------ssVQLRSHRQGKGEAEGSRLILEAVSVP  762
              +  NY+   +   PP               SSV +RSHR+        RL+LEAV V 
Sbjct  223  EFRAVNYNCSFSRKSPPRSFPPPLPSLSRRDGSSVYMRSHRKD------GRLVLEAVPVI  276

Query  763  QRNYFHAERSHGRLLLTALKSPTS  834
             ++YFHAER  GRLLL+  K  T+
Sbjct  277  SQSYFHAERQDGRLLLSFAKKTTA  300



>ref|XP_004241354.1| PREDICTED: protein FAF-like, chloroplastic [Solanum lycopersicum]
Length=433

 Score = 75.9 bits (185),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 93/263 (35%), Positives = 124/263 (47%), Gaps = 60/263 (23%)
 Frame = +1

Query  124  KGGIVSIIVGSDCDE-------------SAHRSSNNWLSIQN---PSTEEDDDDELMKRR  255
            K GIVSI+ G+D ++             SA  SS  WLS QN   P  +     EL    
Sbjct  29   KQGIVSIL-GTDTEKRNKGVAGSIRRTLSADMSSKKWLS-QNGFSPMKKIASSKEL---D  83

Query  256  RPGQDEVWKAIQAQKQQGDDHNNNKAPPIRSTVSWSAIILSDQKVDVQDSVP--YIHPll  429
              GQDE+W++IQ     G +  +N          WS+I+  +QK +   ++P  YIHPLL
Sbjct  84   VLGQDEIWRSIQ----NGGNKTSNDV--------WSSIL--NQKNEESSTLPPPYIHPLL  129

Query  430  kkssscclskqslqICTESLGSETGSDCLTSQTRDSDHVQDQVQDNKQAHEEEEEDIFND  609
            KKSSS    K    ICTESLGSETGS+ ++      DH    +Q  +Q  EE     F +
Sbjct  130  KKSSSSLTDKSLE-ICTESLGSETGSEIIS-----LDHHHHHLQKQQQVKEELSPQTFEE  183

Query  610  VKIKNY-----------skksassfppplpslanssVQLRSHRQGKGEAEGSRLILEAVS  756
              +  +            K    +           SV ++SHRQ        RLILEAVS
Sbjct  184  FPVVKFHHNKKSSSPLLPKSFPPTISSLAAEDNKPSVHMQSHRQ------DGRLILEAVS  237

Query  757  VPQRNYFHAERSHGRLLLTALKS  825
            VP +N+F  ER  GRLLLT + +
Sbjct  238  VPPQNHFRVERVDGRLLLTLITT  260



>gb|KHG22819.1| hypothetical protein F383_08710 [Gossypium arboreum]
Length=495

 Score = 73.9 bits (180),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 91/274 (33%), Positives = 136/274 (50%), Gaps = 49/274 (18%)
 Frame = +1

Query  121  EKGGIVSIIVGSDCDE-----------SAHRSSNNWLSI--QNPSTEE-----DDDDELM  246
            +K GIVSI+ GSD +            SA  SS  WLS   ++PS++E       + E  
Sbjct  21   KKQGIVSIL-GSDAERPTKATSLRRTLSADMSSRKWLSPLKKSPSSQEFPVPSSSEGEEE  79

Query  247  KRRRPGQDEVWKAIQAQKQQGDDHNNNKAPPIRSTVSWSAIILSDQKVD---VQDSVPYI  417
            +   P Q  +W +I+ +K+Q  + +            WS+II   QK +    + S PYI
Sbjct  80   ENEAPDQSHIWASIRHEKKQPQNPSQFDI--------WSSII--SQKAEQESFKSSPPYI  129

Query  418  HPllkkssscclskqslqICTESLGSETGSDCLTSQTRDSD---HVQDQVQDNKQA----  576
            HPL+K+S+SC   K    ICTE LGSETGSD  +S+T + +   H+Q Q Q+  +     
Sbjct  130  HPLVKRSTSCLSEKSLE-ICTERLGSETGSDGFSSETGEVEEDQHLQHQKQETLEPMMMP  188

Query  577  --HEEEEEDI-FNDVKIKNYskksassfppplpslanssVQLRSHRQGKGEAEGSRLILE  747
              H E+   + ++    K  S  S     P L     +S +L++HR      +  +L++E
Sbjct  189  CFHGEKATTVKYSYDAGKKSSNPSFPPPIPSLSGKGGASRRLKTHR------DNGKLVIE  242

Query  748  AVSVPQRNYFHAERSHGRLLLTALKSPTSSDQQE  849
            AVS+P  N F A+R  GRL+LT   +   S  QE
Sbjct  243  AVSMPSLNNFLAQRQDGRLVLTFANTTAPSQAQE  276



>ref|XP_011044595.1| PREDICTED: protein FAF-like, chloroplastic [Populus euphratica]
Length=529

 Score = 73.9 bits (180),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 69/211 (33%), Positives = 105/211 (50%), Gaps = 16/211 (8%)
 Frame = +1

Query  214  STEEDDDDELMKRRRPGQDEVWKAIQAQKQQGDDHNNNKAPPIRSTVSWSAIILSDQKVD  393
            S +ED +D        G+ ++W +IQ      +D N  +         WS+I+    K D
Sbjct  88   SEDEDYEDRPKATEAQGKFDIWSSIQ------EDENKKEVEKPGQFDVWSSILSQKTKED  141

Query  394  VQDSVPYIHPllkkssscclskqslqICTESLGSETGSDCLTS--QTRDSDHVQDQVQDN  567
             ++  PY+HPL+K+S+S    K    ICTESLGSETGSD  +S   +   D  +D+ ++ 
Sbjct  142  SKNVQPYVHPLVKRSASSLSEKSLE-ICTESLGSETGSDGFSSYPPSETGDAEEDKEEEQ  200

Query  568  KQAHEEEEEDIFNDVKIKNYskksassfppplpslanssVQLRSHRQG-----KGEAEGS  732
            +Q     + D   D+++  Y+  +A+       S       L S R G     K   +  
Sbjct  201  RQERVTLKFDT-EDLRVAKYNLAAANCKKSQPRSFPPPIPSL-STRDGASVHMKSRRDNG  258

Query  733  RLILEAVSVPQRNYFHAERSHGRLLLTALKS  825
            RL+LEAVSVP    FHA+R  GRL+LT + +
Sbjct  259  RLVLEAVSVPSHKNFHAQRQDGRLVLTFVNT  289



>ref|XP_009789564.1| PREDICTED: protein FAF-like, chloroplastic [Nicotiana sylvestris]
Length=471

 Score = 73.6 bits (179),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 90/270 (33%), Positives = 127/270 (47%), Gaps = 46/270 (17%)
 Frame = +1

Query  121  EKGGIVSIIVGSDCDE-------------SAHRSSNNWLSIQNPSTEEDDDDELMKRRRP  261
            +K GI+SI+ GSD D+             SA  SS  WLS          +      ++ 
Sbjct  8    DKQGIMSIL-GSDTDQRSIKAAASIRRTLSADMSSKKWLS---------KNGFFSSMKKI  57

Query  262  GQDEVWKAIQAQKQQGD--------DHNN--NKAPPIRSTVSWSAIILSDQKVDVQDSVP  411
               E   A+ +     D        DH+   NK  PI +   WS+I+ S  +      +P
Sbjct  58   ASSEELVALSSAAHNCDSSSSDGEHDHDEQLNKDQPI-TKFDWSSILSSKNEEADSSKIP  116

Query  412  --YIHPllkkssscclskqslqICTESLGSETGSDCLTSQTRDSDHVQDQVQDNKQAHEE  585
              YIHPL+K+S S    K    ICTESLGSETGSDC +S    +  +++   D +Q  + 
Sbjct  117  SPYIHPLVKRSGSSLSKKSLE-ICTESLGSETGSDCFSSSPPKNGDLENNKDDQQQQQQH  175

Query  586  EEEDIF-NDVKIKNYskksassfppplpslanssVQLRSHRQGKGEAEGSRLILEAVSVP  762
                    D+ +  Y+ +   S P   P    S V ++S RQ        RLILEAVSVP
Sbjct  176  SSVSQSCEDIPVVKYNYRKNLSSPRSFPPPLPS-VHMQSSRQN------GRLILEAVSVP  228

Query  763  QRNYFHAERSHGRLLLTAL-KSPTSSDQQE  849
              NYFHA+R  GRL LT + ++ +++DQ E
Sbjct  229  TMNYFHAQRVDGRLRLTYINQNDSAADQPE  258



>ref|XP_002299770.1| hypothetical protein POPTR_0001s22350g [Populus trichocarpa]
 gb|EEE84575.1| hypothetical protein POPTR_0001s22350g [Populus trichocarpa]
Length=476

 Score = 73.2 bits (178),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 66/191 (35%), Positives = 98/191 (51%), Gaps = 16/191 (8%)
 Frame = +1

Query  262  GQDEVWKAIQAQKQQGDDHNNNKAPPIRSTVSWSAIILSDQKVDVQDSVPYIHPllkkss  441
            GQ ++W +IQ      +D N  +         WS+I+    K D ++  PY+HPL+K+S+
Sbjct  85   GQFDIWSSIQ------EDKNKKEVEKPGQFDVWSSILSQKTKEDSKNVQPYVHPLVKRSA  138

Query  442  scclskqslqICTESLGSETGSDCLTS--QTRDSDHVQDQVQDNKQAHEEEEEDIFNDVK  615
            S    K    ICTESLGSETGSD  +S   +   D  +D+ ++ +Q     + D   D++
Sbjct  139  SSLSKKSLE-ICTESLGSETGSDGFSSYPPSETGDAEEDKEEEQRQERVTLKFDT-EDLR  196

Query  616  IKNYskksassfppplpslanssVQLRSHRQG-----KGEAEGSRLILEAVSVPQRNYFH  780
            +  Y+  +A+       S       L S R G     K   +  RL+LEAVSVP +  FH
Sbjct  197  VAKYNLAAANCKKSQPRSFPPPIPSL-SSRDGASVLMKSRRDNGRLVLEAVSVPSQKNFH  255

Query  781  AERSHGRLLLT  813
            A+R  GRL+LT
Sbjct  256  AQRQDGRLVLT  266



>ref|XP_002314255.2| hypothetical protein POPTR_0009s02170g [Populus trichocarpa]
 gb|EEE88210.2| hypothetical protein POPTR_0009s02170g [Populus trichocarpa]
Length=528

 Score = 71.6 bits (174),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 71/217 (33%), Positives = 106/217 (49%), Gaps = 26/217 (12%)
 Frame = +1

Query  199  SIQNPSTEEDDDDELMKRRRPGQDEVWKAIQAQKQQGDDHNNNKAPPIRSTVSWSAIILS  378
            SI + S +ED +D   +     Q ++W +IQ      +D N  +         WS+I+  
Sbjct  83   SITDSSEDEDFEDRPKETETRDQFDIWSSIQ------EDKNKKEVEKPGQFDVWSSILSQ  136

Query  379  DQKVDVQDSVPYIHPllkkssscclskqslqICTESLGSETGSDCLTSQTRDSDHVQDQV  558
              K D +D  PY+HPL+K+S+S    K    ICTESLGSETG D  +S      +   ++
Sbjct  137  KAKEDSKDVQPYVHPLVKRSASSLSEKSLE-ICTESLGSETGCDGFSS------YPPSEI  189

Query  559  QDNKQAHEEEE--EDI-----FNDVKIKNYskksassfppplpslanssVQLRSHRQG--  711
             D +   EEE+  E +       D++   Y+  +++S      S       L S R G  
Sbjct  190  GDAEDEKEEEQLQERVTQKFDMEDLRAAKYNLAASNSKKSQPRSFPPPIPSL-SSRDGAS  248

Query  712  ---KGEAEGSRLILEAVSVPQRNYFHAERSHGRLLLT  813
               +   +  RL+LE VSVP +N FHA+R  GRL+LT
Sbjct  249  VHMRSRRDNGRLVLEVVSVPSQNNFHAQRQDGRLVLT  285



>ref|XP_003541957.1| PREDICTED: protein FAF-like, chloroplastic-like [Glycine max]
Length=424

 Score = 70.1 bits (170),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 66/185 (36%), Positives = 105/185 (57%), Gaps = 21/185 (11%)
 Frame = +1

Query  265  QDEVWKAIQAQKQQGDDHNNNKAPPIRSTVSWSAIIL--SDQKVDVQDSVPYIHPllkks  438
            Q ++W  IQ ++Q    H +NK  P +  V WS+I++  ++++     + PY+HPL+++S
Sbjct  103  QFQIWNTIQKEQQ----HEDNK--PGQVDV-WSSILVQKANEETLKLSTTPYVHPLVRRS  155

Query  439  sscclskqslqICTESLGSETGSDCLTSQTRDSDHVQDQVQDNKQAHEEEEEDIFNDVKI  618
             SC   K    ICTESLGSETGSD  +S +      +++ ++ +      EED    V  
Sbjct  156  KSCLSEKSLE-ICTESLGSETGSDGFSSYSPSETEEKEEEKEEESMQITHEEDF--QVPK  212

Query  619  KNYskksassfppplpslanssVQLRSHRQGKGEAEGSRLILEAVSVPQRNYFHAERSHG  798
            +NY++K +     P P  +   + +RSHR      +  RL L+AVSVP +N F A+R +G
Sbjct  213  QNYAEKKSLPRSFPPPLPS---LHMRSHR------DNGRLFLQAVSVPSQNNFCAQRENG  263

Query  799  RLLLT  813
            RL+LT
Sbjct  264  RLVLT  268



>gb|KHN36503.1| Protein FAF-like, chloroplastic [Glycine soja]
Length=425

 Score = 69.7 bits (169),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 66/185 (36%), Positives = 105/185 (57%), Gaps = 21/185 (11%)
 Frame = +1

Query  265  QDEVWKAIQAQKQQGDDHNNNKAPPIRSTVSWSAIIL--SDQKVDVQDSVPYIHPllkks  438
            Q ++W  IQ ++Q    H +NK  P +  V WS+I++  ++++     + PY+HPL+++S
Sbjct  103  QFQIWNTIQKEQQ----HEDNK--PGQVDV-WSSILVQKANEETLKLSTTPYVHPLVRRS  155

Query  439  sscclskqslqICTESLGSETGSDCLTSQTRDSDHVQDQVQDNKQAHEEEEEDIFNDVKI  618
             SC   K    ICTESLGSETGSD  +S +      +++ ++ +      EED    V  
Sbjct  156  KSCLSEKSLE-ICTESLGSETGSDGFSSYSPSETEEKEEEKEEESMQITHEEDF--QVPK  212

Query  619  KNYskksassfppplpslanssVQLRSHRQGKGEAEGSRLILEAVSVPQRNYFHAERSHG  798
            +NY++K +     P P  +   + +RSHR      +  RL L+AVSVP +N F A+R +G
Sbjct  213  QNYAEKKSLPRSFPPPLPS---LHMRSHR------DNGRLFLQAVSVPSQNNFCAQRENG  263

Query  799  RLLLT  813
            RL+LT
Sbjct  264  RLVLT  268



>ref|XP_011008645.1| PREDICTED: protein FAF-like, chloroplastic [Populus euphratica]
Length=526

 Score = 69.7 bits (169),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 71/223 (32%), Positives = 112/223 (50%), Gaps = 16/223 (7%)
 Frame = +1

Query  199  SIQNPSTEEDDDDELMKRRRPGQDEVWKAIQAQKQQGDDHNNNKAPPIRSTVSWSAIILS  378
            SI + S +ED +D   +     Q ++W +IQ      +D N  +         WS+I+  
Sbjct  81   SITDSSEDEDFEDRPKETETRDQFDIWSSIQ------EDKNKKEVEKPGQFDVWSSILSQ  134

Query  379  DQKVDVQDSVPYIHPllkkssscclskqslqICTESLGSETGSDCLTS--QTRDSDHVQD  552
              K D +D  PY+HPL+K+S+S    K    ICTESLGSETG D  +S   +   D  ++
Sbjct  135  KAKEDSEDVQPYVHPLVKRSASSLSEKSLE-ICTESLGSETGCDGFSSYPPSEIGDAEEE  193

Query  553  QVQDNKQAHEEEEEDIFNDVKIKNYskksassfppplpslanssVQLRSHRQG-----KG  717
            + ++ +Q    E+ D+  D++   Y+  +++S      S       L S R G     + 
Sbjct  194  KEEEQRQERVTEKFDM-EDLRAAKYNLAASNSKKSQPRSFPPPIPSL-SSRDGASVHMRS  251

Query  718  EAEGSRLILEAVSVPQRNYFHAERSHGRLLLTALKSPTSSDQQ  846
              +  RL+LE VSVP +N FHA+R  GRL+LT   +    D++
Sbjct  252  RRDNGRLVLEVVSVPSQNNFHAQRQDGRLVLTLANTANQEDEE  294



>ref|XP_010031354.1| PREDICTED: protein FAF-like, chloroplastic [Eucalyptus grandis]
 gb|KCW50618.1| hypothetical protein EUGRSUZ_J00324 [Eucalyptus grandis]
Length=529

 Score = 69.7 bits (169),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 90/289 (31%), Positives = 131/289 (45%), Gaps = 71/289 (25%)
 Frame = +1

Query  121  EKGGIVSIIVGSDCDE----------SAHRSSNNWLSIQNPS------------------  216
            EK GIVSI+ GSDC+           SA  SS  WL+    S                  
Sbjct  25   EKQGIVSIL-GSDCERAMNASLRRTLSADMSSKKWLTQNGFSPIKKIASAEELQASIVAA  83

Query  217  ---TEEDDDDELMKRRRPGQDEVWKAIQAQKQQGDDHNNNKAPPIRSTVSWSAIILSDQK  387
               +EEDD+D        GQ ++W +IQ  K+Q ++             +WS +ILS + 
Sbjct  84   SSFSEEDDEDAQKDDEGRGQLDIWNSIQEAKKQENEK-----------CTWS-LILSHKS  131

Query  388  VDVQD-SVPYIHPllkkssscclskqslqICTESLGSETGSDCLTSQTRDSDHVQDQVQD  564
             D +    PY+HPL+K+S+S    K     CTESLGSETGSD  +S       V D V+D
Sbjct  132  ADSKSLPPPYVHPLVKRSASSLSEKSLQT-CTESLGSETGSDAFSSYP--PSEVGD-VED  187

Query  565  NK--------------QAHEEEEEDI--FNDVKIKNYskksassfppplpslanssVQLR  696
             K              Q+ + E+ D+  +N    +    +S     P L     +S+ ++
Sbjct  188  GKEEEPEPLQQEGMPLQSVDREDFDVVKYNYAASRKIQPRSFPPPLPSLSREDGASLSVQ  247

Query  697  SHRQGKGEAEGSRLILEAVSVPQRNYFHAERSHGRLLLTALKSPTSSDQ  843
            S R      +  RL+LEAVS+     F A+R  GRL+LT + S +S ++
Sbjct  248  SRR------DNGRLVLEAVSILSEKNFQAQREDGRLILTFVDSVSSGEE  290



>gb|KHG29078.1| hypothetical protein F383_03861 [Gossypium arboreum]
Length=499

 Score = 68.6 bits (166),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 92/289 (32%), Positives = 127/289 (44%), Gaps = 78/289 (27%)
 Frame = +1

Query  79   SSTLCSCELKPNPLEKGGIVSIIVGSDCDE------------SAHRSSNNWL--------  198
            SS L   E   N   K GIVSI+ GSD D+            SA  SS  WL        
Sbjct  27   SSALNITEEATNVTNKQGIVSIL-GSDTDQRPTKGSSLRRTLSADMSSKKWLTQLNNTAS  85

Query  199  ------SIQNPSTEEDDDDELMKRR---RPGQDEVWKAIQAQKQQGDDHNNNKAPPIRST  351
                  SI + S++E +++   +++   +P Q ++W +I + K Q D   +   PP    
Sbjct  86   SDELPVSIADSSSQEAEEENYQEKKALEKPAQFDIWTSIISSKPQDD---SKPLPP----  138

Query  352  VSWSAIILSDQKVDVQDSVPYIHPllkkssscclskqslqICTESLGSETGSDCLTSQT-  528
                               PYIHPL+K+S SC   K    ICTESLGSETGSD  +S   
Sbjct  139  -------------------PYIHPLVKRSGSCLSEKSLE-ICTESLGSETGSDGFSSYPP  178

Query  529  -------RDSDHVQDQVQDNKQAHEEEEED------IFNDVKIKNYsk-ksassfppplp  666
                    D      +++  K A  ++E+D        NDV  K      S     P L 
Sbjct  179  SETGDVEEDRKEEDQRLRQQKLASYDDEDDQPRILKYNNDVVAKKAPHHGSFPPPIPSLS  238

Query  667  slanssVQLRSHRQGKGEAEGSRLILEAVSVPQRNYFHAERSHGRLLLT  813
                +SV++ +HR      +  RL+LEAVSVP +  F A+R  GRL+LT
Sbjct  239  RKDGASVRMETHR------DNGRLVLEAVSVPSKKNFLAQRQDGRLVLT  281



>ref|XP_011008749.1| PREDICTED: protein FAF-like, chloroplastic [Populus euphratica]
Length=526

 Score = 68.2 bits (165),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 70/223 (31%), Positives = 113/223 (51%), Gaps = 16/223 (7%)
 Frame = +1

Query  199  SIQNPSTEEDDDDELMKRRRPGQDEVWKAIQAQKQQGDDHNNNKAPPIRSTVSWSAIILS  378
            SI + S +ED +D   +     Q ++W +IQ      +D N  +         WS+I+  
Sbjct  81   SITDSSEDEDFEDRPKETETRDQFDIWSSIQ------EDKNKKEVEKPGQFDVWSSILSQ  134

Query  379  DQKVDVQDSVPYIHPllkkssscclskqslqICTESLGSETGSDCLTS--QTRDSDHVQD  552
              K D ++  PY+HPL+K+S+S    K    ICTESLGSETG D  +S   +   D  ++
Sbjct  135  KTKEDSKNVQPYVHPLVKRSASSLSEKSLE-ICTESLGSETGCDGFSSYPPSEIGDAEEE  193

Query  553  QVQDNKQAHEEEEEDIFNDVKIKNYskksassfppplpslanssVQLRSHRQG-----KG  717
            + ++ +Q    E+ D+  D++   Y+  +++S      S       L S R G     + 
Sbjct  194  KEEEQRQERVTEKFDM-EDLRAAKYNLAASNSKKSQPRSFPPPIPSL-SSRDGASVHMRS  251

Query  718  EAEGSRLILEAVSVPQRNYFHAERSHGRLLLTALKSPTSSDQQ  846
              +  RL+LE VSVP +N FHA+R  GRL+LT   + +  D++
Sbjct  252  RRDNGRLVLEVVSVPSQNNFHAQRQDGRLVLTLANTASQEDEE  294



>ref|XP_004169382.1| PREDICTED: protein FAF-like, chloroplastic-like [Cucumis sativus]
Length=433

 Score = 67.8 bits (164),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 82/256 (32%), Positives = 117/256 (46%), Gaps = 43/256 (17%)
 Frame = +1

Query  112  NPLEKGGIVSIIVGSDCDESAHRSSNNWLSIQNPSTEEDDDDELMKRRRPGQDEVW----  279
            N L+K GI++I+  SD         N++ S+  PS       ++   +       W    
Sbjct  8    NSLQKQGILTILPSSD---------NHYPSLPPPSLRRTLSADMSSTK-------WCSPI  51

Query  280  KAIQAQKQQGDDHNNNKAPP----IRSTVSWSAIILSDQKVDVQD-----SVPYIHPllk  432
            K I + +   D+ NNNK       +  +V WS+I+L +   D        + PY+HPLLK
Sbjct  52   KKIPSSQAFHDNSNNNKIDSSKHGVHDSVPWSSILLHNSVSDDPPKSPVVAAPYVHPLLK  111

Query  433  kssscclskqslqICTESLGSETGSDCLTSQTRDSDHVQDQVQDNKQAHEEEEEDIF--N  606
            K+S          ICTESLGSETGSD  +S     D   D+   +    +  E D F   
Sbjct  112  KTSHSLSDISLQ-ICTESLGSETGSDGFSSYPSSEDGDFDR---HITETDYSEIDTFEWK  167

Query  607  DVKI--KNYskksassfppplpslanssVQLRSHRQGKGEAEGSRLILEAVSVPQRNYFH  780
             VK   K    +S       L S    S+ ++S R      E  RL+L+AVSVP R  F 
Sbjct  168  PVKFSRKKSPPRSFPPPISSLDSPDGVSICIQSRR------EDGRLMLDAVSVPSRKNFR  221

Query  781  AERSHGRLLLTALKSP  828
            AER  GRL+L+  ++P
Sbjct  222  AERRDGRLILSLFRTP  237



>ref|XP_007015661.1| Chaperone DnaJ-domain superfamily protein [Theobroma cacao]
 gb|EOY33280.1| Chaperone DnaJ-domain superfamily protein [Theobroma cacao]
Length=753

 Score = 68.2 bits (165),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 91/281 (32%), Positives = 133/281 (47%), Gaps = 64/281 (23%)
 Frame = +1

Query  121  EKGGIVSIIVGSDCDE-----------SAHRSSNNWL-------------------SIQN  210
            +K GIVSI+ GSD D            SA  SS  WL                   SI +
Sbjct  25   KKQGIVSIL-GSDTDRPSRAASLRRTLSADMSSKKWLTEYGLSPLKKIASSEEFPFSIID  83

Query  211  PSTE--EDDDDELMKRRRPGQDEVWKAIQAQKQQGDDHNNNKAPPIRSTVSWSAIILSDQ  384
             S+E  E+D +E       GQ ++W +IQ +K + +     +         W++II    
Sbjct  84   SSSEGGEEDYEERKDTEARGQFDIWTSIQQEKNKKELEKPGQFD------MWTSIISEKA  137

Query  385  KVDVQDSV--PYIHPllkkssscclskqslqICTESLGSETGSDCLTS----QTRDSDHV  546
            + D    +  PYIHPL+K+S+S    K    ICTESLGSETGSD  +S    +T D +  
Sbjct  138  QEDSSKPLTPPYIHPLVKRSASSLSEKSLE-ICTESLGSETGSDGFSSYPPSETGDMEED  196

Query  547  QDQVQDNKQAHEE----------EEEDI--FNDVKIKNYskksassfppplpslanssVQ  690
            +++ Q+ +Q  +E          EE  I  +N    K    +S     P L  +  +SV+
Sbjct  197  KEEDQELQQQKQERVAQLNSFDGEEPRIVKYNYDVGKKSPHRSFPPPIPSLSRIDGASVR  256

Query  691  LRSHRQGKGEAEGSRLILEAVSVPQRNYFHAERSHGRLLLT  813
            +++HR      +  RL+LEAVS+P  N F A+R  GRL+LT
Sbjct  257  MKTHR------DNGRLVLEAVSMPSLNNFLAQRQDGRLVLT  291



>ref|XP_009786342.1| PREDICTED: protein FAF-like, chloroplastic [Nicotiana sylvestris]
Length=490

 Score = 67.4 bits (163),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 67/204 (33%), Positives = 93/204 (46%), Gaps = 40/204 (20%)
 Frame = +1

Query  271  EVWKAIQAQKQQGDDHNNNKAPPIRSTVSWSAIILSDQKVDVQDSVPYIHPllkkssscc  450
            +VW +I ++K+  DD +N + P I   V  S   LS++ ++                   
Sbjct  107  DVWSSILSKKKDDDDMSNLETPYIHPLVKRSTSSLSEKSLE-------------------  147

Query  451  lskqslqICTESLGSETGSDCLTSQT---------RDSDHVQDQVQDNKQAHEEEEEDIF  603
                   ICTE+LGSETGSD  +S T          D D  Q Q Q    +   EE  + 
Sbjct  148  -------ICTENLGSETGSDTFSSYTPSETGDVAEEDKDDQQQQQQQYCYSQSSEELRV-  199

Query  604  NDVKIKNYskksassfppplpslanssVQLRSHRQGKGEAEGSRLILEAVSVPQRNYFHA  783
              VK     K S+     P P  + ++ + +     +   E  RLILEA+SVP RN FHA
Sbjct  200  --VKYNYSKKSSSFPKSFPPPIPSLANGENKPSLHMQSRRENGRLILEAISVPSRNLFHA  257

Query  784  ERSHGRLLLTALK--SPTSSDQQE  849
             R  GRLLLT +   +PTSS + E
Sbjct  258  HRHDGRLLLTFIDDCTPTSSSKPE  281



>ref|XP_008366383.1| PREDICTED: protein FAF-like, chloroplastic [Malus domestica]
Length=529

 Score = 67.4 bits (163),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 92/301 (31%), Positives = 132/301 (44%), Gaps = 72/301 (24%)
 Frame = +1

Query  121  EKGGIVSIIVGSDCDE----------SAHRSSNNWLSIQN---PSTEEDDDDEL------  243
            EK GIV+++  SD +           SA  SS  WL+ QN   P  +    +EL      
Sbjct  13   EKQGIVTVLGPSDSERTKAASLRRTLSADMSSKRWLA-QNGFSPMKKIASSEELCGSADM  71

Query  244  -------------MKRRRPGQDEVWKAI--QAQKQQGDDHNNNKAPPIRSTVSWSAIILS  378
                          + +R  +   W +I  QAQ+Q+       + P       WS+I+  
Sbjct  72   RDNSSSSSEDEDHYQDQRKAKFHTWSSIDEQAQRQKNKAEAXKQQP--GQADLWSSIVCQ  129

Query  379  D----QKVDVQDSVPYIHPllkkssscclskqslqICTESLGSETGSDCL----TSQTRD  534
                 +   V  + PY+HPL+KK SS    K    +CTESLGSETGS+      TS+T D
Sbjct  130  KANEXEASKVATAAPYVHPLVKKQSSALTKKSLE-VCTESLGSETGSEGFSSYPTSETSD  188

Query  535  SDHVQDQVQDNK--------------QAHEEEEEDIFNDVKI------KNYskksassfp  654
             + V+   Q+++              Q  +  +E+ F  VK       K  S +S+    
Sbjct  189  IEVVEKDQQEDQAVVQQQEEKEKEKPQRSKAFDENEFRAVKYNSAASKKLPSARSSPPPL  248

Query  655  pplpslanssVQLRSHRQGKGEAEGSRLILEAVSVPQRNYFHAERSHGRLLLTALKSPTS  834
              L      SV +R+HR      +  RL+LEAVS+P  N F AER  GRL+LT L +  S
Sbjct  249  SSLSGCDGVSVHMRTHR------DNGRLVLEAVSIPSPNNFRAERHDGRLVLTFLNATPS  302

Query  835  S  837
            S
Sbjct  303  S  303



>ref|XP_008385575.1| PREDICTED: protein FAF-like, chloroplastic [Malus domestica]
Length=529

 Score = 67.4 bits (163),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 92/301 (31%), Positives = 132/301 (44%), Gaps = 72/301 (24%)
 Frame = +1

Query  121  EKGGIVSIIVGSDCDE----------SAHRSSNNWLSIQN---PSTEEDDDDEL------  243
            EK GIV+++  SD +           SA  SS  WL+ QN   P  +    +EL      
Sbjct  13   EKQGIVTVLGPSDSERTKAASLRRTLSADMSSKRWLA-QNGFSPMKKIASSEELCGSADM  71

Query  244  -------------MKRRRPGQDEVWKAI--QAQKQQGDDHNNNKAPPIRSTVSWSAIILS  378
                          + +R  +   W +I  QAQ+Q+       + P       WS+I+  
Sbjct  72   RDNSSSSSEDEDHYQDQRKAKFHTWSSIDEQAQRQKNKAEAXKQQP--GQADLWSSIVCQ  129

Query  379  D----QKVDVQDSVPYIHPllkkssscclskqslqICTESLGSETGSDCL----TSQTRD  534
                 +   V  + PY+HPL+KK SS    K    +CTESLGSETGS+      TS+T D
Sbjct  130  KANEXEASKVATAAPYVHPLVKKQSSALTKKSLE-VCTESLGSETGSEGFSSYPTSETSD  188

Query  535  SDHVQDQVQDNK--------------QAHEEEEEDIFNDVKI------KNYskksassfp  654
             + V+   Q+++              Q  +  +E+ F  VK       K  S +S+    
Sbjct  189  IEVVEKDQQEDQAVVQQQEEKEKEKPQRSKAFDENEFRAVKYNSAASKKLPSARSSPPPL  248

Query  655  pplpslanssVQLRSHRQGKGEAEGSRLILEAVSVPQRNYFHAERSHGRLLLTALKSPTS  834
              L      SV +R+HR      +  RL+LEAVS+P  N F AER  GRL+LT L +  S
Sbjct  249  SSLSGCDGVSVHMRTHR------DNGRLVLEAVSIPSPNNFRAERHDGRLVLTFLNATPS  302

Query  835  S  837
            S
Sbjct  303  S  303



>ref|XP_008230058.1| PREDICTED: protein FAF-like, chloroplastic [Prunus mume]
Length=563

 Score = 67.4 bits (163),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 85/302 (28%), Positives = 135/302 (45%), Gaps = 74/302 (25%)
 Frame = +1

Query  121  EKGGIVSIIVGSDCDE----------SAHRSSNNWLSIQ---------------------  207
            EK GIV+I+  SD +           SA  SS  WL+                       
Sbjct  33   EKQGIVTILGPSDSERTKAASLRRTLSADMSSKRWLAQHGFFPMKKIASSEELSASIDTQ  92

Query  208  -NPSTEEDDDDELMKRRRPGQDEVWKAIQAQKQQGDDHNNNKAPPIRSTVS-WSAIILSD  381
             N S+  +D+D   +R+  G+  +W ++  + Q+            +  +  WS+II   
Sbjct  93   DNTSSSSEDEDRYQERK--GKFLIWNSLDEEDQKKKMSKAEAEKKQQGQLDLWSSIIC--  148

Query  382  QKVD------VQDSVPYIHPllkkssscclskqslqICTESLGSETGSDCLTS-------  522
            QK +      V  + PY+HPL+KK SS    K    +CTESLGSETGS+  +S       
Sbjct  149  QKANEEGNKAVDTAAPYVHPLVKKQSSALTVKSLE-VCTESLGSETGSEVFSSYPPSETG  207

Query  523  --QTRDSDHVQDQVQDNKQAHEEEEE----DIFN--DVKIKNYskksassfppplpslan  678
              +  D +  +D+ +  +Q  EE+E+      F+  + ++  Y+  ++   PP       
Sbjct  208  DIEVLDKEQEEDRAEVPRQQEEEKEKVPVAQAFDGEEFRVVKYNSAASKKLPPTRSFPPP  267

Query  679  ---------ssVQLRSHRQGKGEAEGSRLILEAVSVPQRNYFHAERSHGRLLLTALKSPT  831
                     +SV++R+HR         R++LEAVS+P  N F A+R  GRL+LT L +  
Sbjct  268  LPSLSGCDGTSVRMRTHRNN------GRVVLEAVSMPSPNNFRAQRQDGRLVLTFLATTP  321

Query  832  SS  837
            SS
Sbjct  322  SS  323



>ref|XP_009336398.1| PREDICTED: protein FAF-like, chloroplastic [Pyrus x bretschneideri]
Length=559

 Score = 65.9 bits (159),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 88/298 (30%), Positives = 135/298 (45%), Gaps = 70/298 (23%)
 Frame = +1

Query  121  EKGGIVSIIVGSDCDE----------SAHRSSNNWLSIQ--NPSTEEDDDDEL-------  243
            EK GIV+I+  SD +           SA  SS  WLS    +P  +    +EL       
Sbjct  28   EKRGIVTILGPSDSERTKAASLRRTLSADMSSKRWLSQHGFSPMKKIASSEELCVSVNIR  87

Query  244  ------------MKRRRPGQDEVWKAI--QAQKQQGDDHNNNKAPPIRSTVSWSAIILSD  381
                         + +   +  +W +I  QAQKQ+       + P       WS+I+   
Sbjct  88   DDSSSSSEDVDHYQDQGKAKFHIWSSIDEQAQKQKNKAEAAKQQP--GQADLWSSIVC--  143

Query  382  QKVDVQDS---VPYIHPllkkssscclskqslqICTESLGSETGSDCL----TSQTRDSD  540
            QK + +++    PY+HPL+KK SS    K    +CTESLGSETGS+      TS+T D +
Sbjct  144  QKANEEEASKAAPYVHPLVKKQSSSLTKKSLE-VCTESLGSETGSEGFASYPTSETGDVE  202

Query  541  HVQDQVQDNKQAHEEEEED--------IF--NDVKIKNYskksassfppplpslan----  678
             V+   ++ + A +++EE+         F  N+ +   Y+  ++   P            
Sbjct  203  IVEKDPKEEQAAVQQQEEEKEKPQLSQAFDGNEFRFVKYNSAASKKLPSVRSFPPPLPSL  262

Query  679  -----ssVQLRSHRQGKGEAEGSRLILEAVSVPQRNYFHAERSHGRLLLTALKSPTSS  837
                  SV +R+ R      +  RL+LEAVS+P  N F A+R  GRL+LT L + +SS
Sbjct  263  SGYDGESVCMRTRR------DNGRLVLEAVSMPSLNNFRAQRQDGRLVLTFLNATSSS  314



>ref|XP_009373888.1| PREDICTED: protein FAF-like, chloroplastic [Pyrus x bretschneideri]
Length=558

 Score = 65.9 bits (159),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 88/298 (30%), Positives = 135/298 (45%), Gaps = 70/298 (23%)
 Frame = +1

Query  121  EKGGIVSIIVGSDCDE----------SAHRSSNNWLSIQ--NPSTEEDDDDEL-------  243
            EK GIV+I+  SD +           SA  SS  WLS    +P  +    +EL       
Sbjct  28   EKRGIVTILGPSDSERTKAASLRRTLSADMSSKRWLSQHGFSPMKKIASSEELCVSVNIR  87

Query  244  ------------MKRRRPGQDEVWKAI--QAQKQQGDDHNNNKAPPIRSTVSWSAIILSD  381
                         + +   +  +W +I  QAQKQ+       + P       WS+I+   
Sbjct  88   DDSSSSSEDVDHYQDQGKAKFHIWSSIDEQAQKQKNKAEAAKQQP--GQADLWSSIVC--  143

Query  382  QKVDVQDS---VPYIHPllkkssscclskqslqICTESLGSETGSDCL----TSQTRDSD  540
            QK + +++    PY+HPL+KK SS    K    +CTESLGSETGS+      TS+T D +
Sbjct  144  QKANEEEASKAAPYVHPLVKKQSSSLTKKSLE-VCTESLGSETGSEGFASYPTSETGDVE  202

Query  541  HVQDQVQDNKQAHEEEEED--------IF--NDVKIKNYskksassfppplpslan----  678
             V+   ++ + A +++EE+         F  N+ +   Y+  ++   P            
Sbjct  203  IVEKDPEEEQAAVQQQEEEKEKPQLSQAFDGNEFRFVKYNSAASKKMPSVRSFPPPLPSL  262

Query  679  -----ssVQLRSHRQGKGEAEGSRLILEAVSVPQRNYFHAERSHGRLLLTALKSPTSS  837
                  SV +R+ R      +  RL+LEAVS+P  N F A+R  GRL+LT L + +SS
Sbjct  263  SGYDGESVCMRTRR------DNGRLVLEAVSMPSLNNFRAQRQDGRLVLTFLNTNSSS  314



>ref|XP_007208036.1| hypothetical protein PRUPE_ppa002898mg [Prunus persica]
 gb|EMJ09235.1| hypothetical protein PRUPE_ppa002898mg [Prunus persica]
Length=623

 Score = 65.5 bits (158),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 83/299 (28%), Positives = 134/299 (45%), Gaps = 74/299 (25%)
 Frame = +1

Query  118  LEKGGIVSIIVGSDCDE----------SAHRSSNNWLSIQ--------------------  207
            +EK GIV+I+  SD +           SA  SS  WL+                      
Sbjct  91   VEKLGIVTILGPSDSERTKAASLRRTLSADMSSKRWLAQHGFFPMKKIASSEELSASIDT  150

Query  208  --NPSTEEDDDDELMKRRRPGQDEVWKAIQAQKQQGDDHNNNKAPPIRSTVS-WSAIILS  378
              N S+  +D+D   +R+  G+  +W ++  + Q+            +  +  WS+II  
Sbjct  151  QDNTSSSSEDEDRYQERK--GKFPIWSSLDEEDQKKKMSKAEAEKKQQGQLDLWSSIIC-  207

Query  379  DQKVD------VQDSVPYIHPllkkssscclskqslqICTESLGSETGSDCLTS------  522
             QK +      V  + PY+HPL+KK SS    K    +CTESLGSETGS+  +S      
Sbjct  208  -QKANEEANKAVDTAAPYVHPLVKKQSSSLTVKSLE-VCTESLGSETGSEGFSSYPPSET  265

Query  523  ---QTRDSDHVQDQVQDNKQAHEEEEE----DIFN--DVKIKNYskksassfppplpsla  675
               +  D +  +D+ +  +Q  EE+E+      F+  + ++  Y+  ++   PP      
Sbjct  266  GDIEVLDKEQEEDRAEVPRQQEEEKEKVPVAQAFDGEEFRVVKYNSAASKKLPPTRSFPP  325

Query  676  n---------ssVQLRSHRQGKGEAEGSRLILEAVSVPQRNYFHAERSHGRLLLTALKS  825
                      +SV++R+HR         R++LEAVS+P  N F A+R  GRL+LT L +
Sbjct  326  PLPSFSGCDGTSVRMRTHRNN------GRVVLEAVSMPSPNNFRAQRQDGRLVLTFLAT  378



>ref|XP_009368373.1| PREDICTED: protein FAF-like, chloroplastic [Pyrus x bretschneideri]
Length=564

 Score = 65.5 bits (158),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 93/301 (31%), Positives = 137/301 (46%), Gaps = 72/301 (24%)
 Frame = +1

Query  121  EKGGIVSIIVGSDCDE----------SAHRSSNNWLSIQN---PSTEEDDDDEL------  243
            EK GIV+++  SD +           SA  SS  WL+ QN   P  +    +EL      
Sbjct  28   EKQGIVTVLGPSDSERTKAASLRRTLSADMSSKRWLA-QNGFSPMKKIASSEELGVSADM  86

Query  244  -------------MKRRRPGQDEVWKAI--QAQKQQGDDHNNNKAPPIRSTVSWSAIIL-  375
                          + +R  +   W +I  QAQ+Q+ +     K  P ++ + WS+I+  
Sbjct  87   RDNSSSSSEDEDHYQDQRKAKFHTWSSIDEQAQRQK-NKAEAAKQQPGQADI-WSSIVCQ  144

Query  376  ---SDQKVDVQDSVPYIHPllkkssscclskqslqICTESLGSETGSDCL----TSQTRD  534
                ++   V  + PYIHPL+KK SS    K    +CTESLGSETGS+      TS+T D
Sbjct  145  KANEEEASKVATAAPYIHPLVKKQSSALTKKSLQ-VCTESLGSETGSEGFSSYPTSETSD  203

Query  535  SDHV--------------QDQVQDNKQAHEEEEEDIFNDVKI------KNYskksassfp  654
             + V              +++ ++  Q  +  +E+ F  VK       K  S +S+    
Sbjct  204  IEVVDKDQQADQAVVQQQEEKEKEKPQRSKAFDENEFRAVKYNSAASKKLPSARSSPPPL  263

Query  655  pplpslanssVQLRSHRQGKGEAEGSRLILEAVSVPQRNYFHAERSHGRLLLTALKSPTS  834
              L      SV +R+HR      +  RL+LEAVS+P  N F AER  GRL+LT L +  S
Sbjct  264  SSLSGCDGVSVHMRTHR------DNGRLVLEAVSIPSPNNFRAERHDGRLVLTFLNATPS  317

Query  835  S  837
            S
Sbjct  318  S  318



>ref|XP_010263029.1| PREDICTED: protein FAF-like, chloroplastic [Nelumbo nucifera]
Length=540

 Score = 65.5 bits (158),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 64/201 (32%), Positives = 98/201 (49%), Gaps = 30/201 (15%)
 Frame = +1

Query  262  GQDEVWKAIQAQKQQGDDHNNNKAPPIRSTVSWSAIILSDQKVDVQDSVPYIHPllkkss  441
            GQ ++W +IQ+++ + D        P +  + WS+I+       +  S PY+HPL+K+S+
Sbjct  111  GQFDIWNSIQSEQAKKDLER-----PGQFDI-WSSILSQKSDNGLNASAPYVHPLVKRST  164

Query  442  scclskqslqICTESLGSETGSDCLTSQT-RDSDHVQDQ----------------VQDNK  570
            S    K    ICTESLGSETGSD  +S    +S  V++                 V +++
Sbjct  165  SSLSEKSLE-ICTESLGSETGSDGFSSHPPSESSDVEENPEEETAVEEEEEHRTPVDESE  223

Query  571  QAHEEEEEDIFNDVKIKNYskksassfppplpslanssVQLRSHRQGKGEAEGSRLILEA  750
               ++E   +  +  I+    +S     P L      SV +R HR+        RL+LEA
Sbjct  224  TVDKDEFGAVNYNFSIRKSPPRSFPPPLPSLSRRDGPSVYMRPHRRD------GRLVLEA  277

Query  751  VSVPQRNYFHAERSHGRLLLT  813
            V +   NYF AER  GRLLL+
Sbjct  278  VPIVSHNYFRAERQDGRLLLS  298



>ref|XP_009591159.1| PREDICTED: protein FAF-like, chloroplastic [Nicotiana tomentosiformis]
Length=533

 Score = 65.1 bits (157),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 66/205 (32%), Positives = 91/205 (44%), Gaps = 44/205 (21%)
 Frame = +1

Query  271  EVWKAIQAQKQQGDDHNNNKAPPIRSTVSWSAIILSDQKVDVQDSVPYIHPllkkssscc  450
            +VW +I ++K+  DD +N + P I   V  S   LS++ ++                   
Sbjct  90   DVWSSILSKKKDDDDMSNLETPYIHPLVKRSTSSLSEKSLE-------------------  130

Query  451  lskqslqICTESLGSETGSDCLTSQT---------RDSDHVQDQVQDNKQAHEEEEEDIF  603
                   ICTESLGSETGSD  +S            + D  Q Q Q   Q+ EE     +
Sbjct  131  -------ICTESLGSETGSDSFSSYAPSEIGDVEEEEKDEQQQQQQYCSQSFEELRVVKY  183

Query  604  NDVK-IKNYskksassfppplpslanssVQLRSHRQGKGEAEGSRLILEAVSVPQRNYFH  780
            N +K   ++ K      P         S+ ++S RQ        RLILEA+S+P RN F 
Sbjct  184  NYIKKSSSFPKSFPPPIPSLARGDNKPSLHMKSQRQD------GRLILEAISIPPRNLFR  237

Query  781  AERSHGRLLLTAL--KSPTSSDQQE  849
            A R  GRLLLT +   +PTSS   E
Sbjct  238  AHRHDGRLLLTFIDDSTPTSSSNSE  262



>ref|XP_010535716.1| PREDICTED: protein FAF-like, chloroplastic [Tarenaya hassleriana]
Length=435

 Score = 64.7 bits (156),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 70/236 (30%), Positives = 99/236 (42%), Gaps = 54/236 (23%)
 Frame = +1

Query  121  EKGGIVSIIVGSDCDESAHRSSNNWLSIQNPSTEEDDDDELMKRRRPGQDEVWKAIQAQK  300
            E+GG   +I G D           W  IQN       DDE     RPGQ  VW +I +QK
Sbjct  78   EEGGGEELISGFDI----------WAQIQNEKKNNKIDDE-----RPGQSGVWSSILSQK  122

Query  301  QQGDDHNNNKAPPIRSTVSWSAIILSDQKVDVQDSVPYIHPllkkssscclskqslqICT  480
             +          PI+                     PY+HP++K++SS    K    ICT
Sbjct  123  SE----------PIKMVPP-----------------PYVHPIVKRASSSLNEKSLE-ICT  154

Query  481  ESLGSETGSDCLTSQTRDSDHVQDQVQDNKQAHEEEEEDIFNDVKIKNYskksassfppp  660
            ESLGSETGSD        S       +D ++  EE++ +   +  + N++  S       
Sbjct  155  ESLGSETGSDVF------SRFPSPGKRDAEEQKEEDQSEAEQETWVPNHNLNSTIVKKSL  208

Query  661  lpslanssVQLRSHRQGKG-----EAEGSRLILEAVSVPQRNYFHAERSHGRLLLT  813
                    +   S + GK        +  RL+LEAVS+  +N F A+R  GRL+LT
Sbjct  209  GGGSFPPPIPSLSSQSGKSLHMKTRRDNGRLVLEAVSMASQNNFCAKRQDGRLVLT  264



>ref|XP_009126523.1| PREDICTED: protein FAF-like, chloroplastic [Brassica rapa]
Length=439

 Score = 64.3 bits (155),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 80/249 (32%), Positives = 113/249 (45%), Gaps = 36/249 (14%)
 Frame = +1

Query  130  GIVSIIVGSDCDES----------AHRSSNNWLSIQNPSTEED-------DDDELMKRRR  258
            GIV+I+ G   + S          A  SS NWLS    S  +        D++E     R
Sbjct  21   GIVTILGGISSNTSSAPSLRRTFSADLSSKNWLSRNESSPMKKLHASSVADEEE---GSR  77

Query  259  PGQDEVWKAIQAQKQQGDDHNNNKAPPIRSTVSWSAIILSDQKVDVQDSV---PYIHPll  429
             G D +W  IQ  K Q       +  P ++ V WS+I+   +K +  D     PY+HPL+
Sbjct  78   SGFD-IWAQIQEVKNQ----TKEEIEPDQTDV-WSSILSDKKKAESSDDAVPPPYVHPLV  131

Query  430  kkssscclskqslqICTESLGSETGSDCLTSQT-RDSDHVQDQVQDNKQAHEEEEEDIFN  606
            K++SS         ICTESLGSETG +   S    + +  +  +  N    +EEEE I  
Sbjct  132  KRASSLSEKSLE--ICTESLGSETGCEGFASYADAEIEKEEADLTLNVTVTKEEEEAI--  187

Query  607  DVKIKNYskksassfppplpslanssVQLRSHRQGKGEAEGSRLILEAVSVPQRNYFHAE  786
               + N++           P + + S Q       K   +  RL+LEAVS+P  N F A+
Sbjct  188  --TVPNHTPCMELPRGSFPPPIRSLSSQSGLALHMKTRRDNGRLVLEAVSMPSHNNFSAK  245

Query  787  RSHGRLLLT  813
            R  GRLLLT
Sbjct  246  RQDGRLLLT  254



>gb|KDP42960.1| hypothetical protein JCGZ_23902 [Jatropha curcas]
Length=510

 Score = 63.9 bits (154),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 91/293 (31%), Positives = 134/293 (46%), Gaps = 73/293 (25%)
 Frame = +1

Query  130  GIVSIIVGSDCDE----------SAHRSSNNWLS---------------------IQNPS  216
            GIVSI+ GSD +           SA  SS  WLS                     I + S
Sbjct  25   GIVSIL-GSDSELKTNKPLRRTLSADMSSKKWLSQNGFSSRLKKIASSKEFSVSIITDSS  83

Query  217  TEEDDDDELMKRRRPGQDEVWKAIQAQKQQGDDHNNNKAPPIRSTVSWSAIILSD-QKVD  393
            + E D+DE  K     + EVW +IQ +KQ+ D        P      WS+I+    Q+  
Sbjct  84   SSEGDEDEYEK-----ETEVWSSIQQEKQKKDSS------PRGQFDIWSSILTQKAQEAK  132

Query  394  VQDSVPYIHPllkkssscclskqslqICTESLGSETGSDCLTS----QTRDSDHVQDQVQ  561
                 PY+HPL+K+S+S    K    ICTESLGSETGSD  +S    +T D++  +++ Q
Sbjct  133  NLLPPPYVHPLVKRSASSLSEKSLE-ICTESLGSETGSDGFSSYPPSETGDAEEDKEEEQ  191

Query  562  D-------------NKQAHEEEEEDIFNDVKI--KNYskksassfppplpslanssVQLR  696
                          +K    E+ + I  ++    K    ++     P L S   +S+++R
Sbjct  192  QEEEEEEEEEEEKVSKNYDMEDWQVIKCNITAASKKLPPRTFPPPIPSLSSRDGASLRMR  251

Query  697  SHRQGKGEAEGSRLILEAVSVPQRNYFHAERSHGRLLLTALKSPTSSDQQEAG  855
              R      +  R +LEA+SVP +N F AER  GRL+L+ + +P   D +E G
Sbjct  252  PRR------DNGRFVLEAISVPSQNNFKAERQDGRLVLSFIDTP---DGEEEG  295



>ref|XP_006400714.1| hypothetical protein EUTSA_v10013382mg [Eutrema salsugineum]
 gb|ESQ42167.1| hypothetical protein EUTSA_v10013382mg [Eutrema salsugineum]
Length=488

 Score = 63.9 bits (154),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 79/283 (28%), Positives = 120/283 (42%), Gaps = 64/283 (23%)
 Frame = +1

Query  130  GIVSIIVGSDCD--------------ESAHRSSNNWLS----------------IQNPST  219
            GIV+I+ G +CD               SA  SS  WLS                ++  S 
Sbjct  21   GIVTILGGGECDISSNTLAAPSLRRTFSADLSSKTWLSQNGYAPPMKRISSSEKLRAHSL  80

Query  220  EEDDDDELMKRRRPGQDEVWKAIQAQKQQGDDHNNNKAPPIRSTVSWSAIILSDQKVDVQ  399
              DD +E     R  + ++W  IQ  K   ++    K  P +S V WS+I+   +K +  
Sbjct  81   SSDDGEEEQGGSR-SEFDIWAQIQEDKNNKEEE---KIEPGQSDV-WSSILSDKKKTESS  135

Query  400  DSV----PYIHPllkkssscclskqslqICTESLGSETGSDCLTSQTRDSDHVQDQVQDN  567
            +      PY+HPL+K++SS         ICTESLGSETG +  +S    S    D   + 
Sbjct  136  NETVPPPPYVHPLMKRASSLSEKSLE--ICTESLGSETGCEGFSSYA--SSENGDAETEK  191

Query  568  KQAHEEEEEDIFN---------------------DVKIKNYskksassfppplpslanss  684
            + +++EE + + N                      + + N++           P +   S
Sbjct  192  EISNQEEAKLVLNETATKEEEETDAEAEFEVEQESITVPNHTSSIELPRGSFPPPIRPLS  251

Query  685  VQLRSHRQGKGEAEGSRLILEAVSVPQRNYFHAERSHGRLLLT  813
             Q  S    K   +  RL++EAVS+P  N F A+R +GRLLLT
Sbjct  252  SQSGSSLHMKTRRDNGRLVVEAVSMPSHNNFDAKRQNGRLLLT  294



>ref|XP_004487448.1| PREDICTED: protein FAF-like, chloroplastic-like [Cicer arietinum]
Length=348

 Score = 63.2 bits (152),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 64/170 (38%), Positives = 88/170 (52%), Gaps = 24/170 (14%)
 Frame = +1

Query  358  WSAIILSDQKVDVQD---SVPYIHPllkkssscclskqslqICTESLGSETGSDCLTSQT  528
            WS+I L+    D      ++PYIHPL KKS S    K    ICTESLGSETGSD  +S  
Sbjct  26   WSSIFLTQNDKDEASKLKTLPYIHPLEKKSKSFLSEKSLQ-ICTESLGSETGSDDFSSSN  84

Query  529  RDSDHVQDQVQDNKQAHEE-----EEEDIFNDVKIKNYskksassfppplpslans----  681
              S+   +  +D+++  EE     E +D+    K  NY     S   PP  S  ++    
Sbjct  85   TSSE--DNNSEDDEKFKEEVKTCDEFDDVLKVPKYNNYYYVKKSPSFPPPLSSLSTQSQH  142

Query  682  ----sVQLRSHRQGKGEAEGSRLILEAVSVPQRNYFHAERSHGRLLLTAL  819
                + Q+RSHR   G      L L+ VSVP +N+F A+R +GRL+LT +
Sbjct  143  GQSQTFQMRSHRDN-GRL---FLFLQTVSVPSQNFF-AKRQNGRLILTFV  187



>ref|XP_007050627.1| Uncharacterized protein TCM_004392 [Theobroma cacao]
 gb|EOX94784.1| Uncharacterized protein TCM_004392 [Theobroma cacao]
Length=322

 Score = 62.8 bits (151),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 81/251 (32%), Positives = 112/251 (45%), Gaps = 28/251 (11%)
 Frame = +1

Query  358   WSAI--ILSDQKVDVQDSVPYIHPllkkssscclskqslqICTESLGSETGSDCLTSQTR  531
             WS +  + ++ K   ++   Y+HPL+K+S+S    K    +CTESLGSETGS+   S   
Sbjct  89    WSFLQSLAANAKDSTENDKVYVHPLVKRSASMLSEKSLE-MCTESLGSETGSEVSESSDD  147

Query  532   DSDHVQDQVQDNKQAHEEEEEDIFNDVKIKNYskksassfppplpslanssVQLRSHRQG  711
              S    + V  N     E          +     +S+S  PP      ++ VQ+RSHR  
Sbjct  148   ISLLSLETVVCNPSKPRES--------LVARKMTRSSSFPPPLTSISGSNGVQVRSHR--  197

Query  712   KGEAEGSRLILEAVSVPQ-RNYFHAERSHGRLLLTALKSPTSSDQQEAGddetdedeeel  888
                 EG RL+L+AVS+P   +YFHAERS GRL L+ LK  T     E G +E  E  EE 
Sbjct  198   ----EGGRLVLQAVSIPPCHSYFHAERSEGRLRLSLLKDATPIFGDEGGQEEDQEVVEED  253

Query  889   ------essttpsfnsnsnHLYWNSSSIAeykqqqqekeeGLIPLLRNCKEARR--RSLL  1044
                                  YW             E   G +P   +CKE+ R  + LL
Sbjct  254   EHGEVVYEKKGVEGEVEDEECYWGEGMEGNSGNVGGEIGTGKLPRPSSCKESGRGHKGLL  313

Query  1045  TWVPPNYCIAT  1077
              W P  + +AT
Sbjct  314   NWGP--FWVAT  322



>ref|XP_002513735.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF48682.1| conserved hypothetical protein [Ricinus communis]
Length=542

 Score = 63.2 bits (152),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 65/197 (33%), Positives = 102/197 (52%), Gaps = 21/197 (11%)
 Frame = +1

Query  262  GQDEVWKAIQAQKQQGDDHNNNKAPPIRSTVSWSAIILSDQKVDVQD-SVPYIHPllkks  438
            G+ E+W +IQ +K++ D  N     P +  + WS+I+    + D +    PY+HPL+K+S
Sbjct  100  GRFEIWSSIQEEKEKKDQEN-----PGQFDI-WSSILTQKAQEDTKTLPPPYVHPLVKRS  153

Query  439  sscclskqslqICTESLGSETGSDCLTSQTRDSDHVQDQVQDNKQAHEEEEEDI------  600
            +S    K    ICTESLGSE GSD  +S         ++ ++ +Q  EE+E++       
Sbjct  154  ASSLSEKSLE-ICTESLGSENGSDGFSSYPPSETGEAEEDKEEEQEQEEQEQEERATPKY  212

Query  601  -FNDVKIKNYskksassfppplpslanssVQLRSHRQG-----KGEAEGSRLILEAVSVP  762
               D+ +  Y+  ++++      S       L S R G     K   +  RL+LEAVSVP
Sbjct  213  DMEDLHVAKYNFAASATKKSSPKSFPPPLPSL-SSRDGASLRMKPRRDNGRLVLEAVSVP  271

Query  763  QRNYFHAERSHGRLLLT  813
             +N F A+R  GRL+LT
Sbjct  272  SQNNFQAQRQDGRLVLT  288



>ref|XP_008361605.1| PREDICTED: protein FAF-like, chloroplastic [Malus domestica]
Length=560

 Score = 63.2 bits (152),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 87/298 (29%), Positives = 132/298 (44%), Gaps = 70/298 (23%)
 Frame = +1

Query  121  EKGGIVSIIVGSDCDE----------SAHRSSNNWLSIQ--NPSTEEDDDDELMKR----  252
            EK GIV+I+  SD +           SA  SS  WL+    +P  +    +EL       
Sbjct  28   EKRGIVAILSPSDSERTKAASLRRTLSADMSSKRWLAQHGFSPMKKIASSEELCASVDIR  87

Query  253  ---------------RRPGQDEVWKAI--QAQKQQGDDHNNNKAPPIRSTVSWSAIILSD  381
                           +R  +  +W +I  QAQKQ+       + P       WS+I+   
Sbjct  88   DDSSSSSEDVGHYQDQRKAKFHIWSSIDEQAQKQKTKTEAAKQQP--GQADLWSSIVC--  143

Query  382  QKVDVQDS---VPYIHPllkkssscclskqslqICTESLGSETGSDCL----TSQTRDSD  540
            QK + +++    PY+HPL+KK SS    K    +CTESLGSETGS+      TS+T D +
Sbjct  144  QKANEEEASKAAPYVHPLVKKQSSSLTKKSLE-VCTESLGSETGSEGFASYPTSETGDVE  202

Query  541  HVQDQV----------QDNKQAHEEEEEDIFNDVKIKNYskksassfppplpslan----  678
             V+ +           Q+ K+  +  +    N+ ++  Y+  ++   P            
Sbjct  203  IVEKETEVEQAAVQQQQEEKEKPQLSQAFDGNEFRVVKYNSAASKKLPSVRSFPPPLPSL  262

Query  679  -----ssVQLRSHRQGKGEAEGSRLILEAVSVPQRNYFHAERSHGRLLLTALKSPTSS  837
                  SV +R+ R      +  RL+LEAVS+P  N F A+R  GRL+LT L S +SS
Sbjct  263  SGCDGESVCMRTRR------DNGRLVLEAVSMPSLNNFRAQRQDGRLVLTFLNSTSSS  314



>ref|XP_004139078.1| PREDICTED: protein FAF-like, chloroplastic-like [Cucumis sativus]
 gb|KGN66592.1| hypothetical protein Csa_1G635920 [Cucumis sativus]
Length=387

 Score = 61.2 bits (147),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 58/160 (36%), Positives = 89/160 (56%), Gaps = 13/160 (8%)
 Frame = +1

Query  358  WSAIILSDQKVDVQDSVPYIHPllkkssscclskqslqICTESLGSETGSDCLTSQ-TRD  534
            WS+I+   ++     S PY+HPLLK+S  C   K    ICTESLGSETGSD  +S  + +
Sbjct  78   WSSIVKESRQESKNISDPYVHPLLKRSGKCLSEKSLE-ICTESLGSETGSDGFSSYPSSE  136

Query  535  SDHVQDQVQDN--KQAHEEEEEDIFNDVKI---KNYskksassfppplpslanssVQLRS  699
            +    D+ ++N  +     E E+ +  VKI   K+  ++S     P L      +++++ 
Sbjct  137  NGDTDDENEENMIEGTQTFEVENQWKPVKISYKKSPPRRSLPPPLPTLSGPDGETLRMQP  196

Query  700  HRQGKGEAEGSRLILEAVSVPQRNYFHAERSHGRLLLTAL  819
             R      +  RL+LEA+SVP +N FHA+R  GRL+LT +
Sbjct  197  RR------DNGRLVLEAMSVPSQNNFHAQRQDGRLVLTLV  230



>ref|XP_004170966.1| PREDICTED: protein FAF-like, chloroplastic-like [Cucumis sativus]
Length=387

 Score = 61.2 bits (147),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 58/160 (36%), Positives = 89/160 (56%), Gaps = 13/160 (8%)
 Frame = +1

Query  358  WSAIILSDQKVDVQDSVPYIHPllkkssscclskqslqICTESLGSETGSDCLTSQ-TRD  534
            WS+I+   ++     S PY+HPLLK+S  C   K    ICTESLGSETGSD  +S  + +
Sbjct  78   WSSIVKESRQESKSISDPYVHPLLKRSGKCLSEKSLE-ICTESLGSETGSDGFSSYPSSE  136

Query  535  SDHVQDQVQDN--KQAHEEEEEDIFNDVKI---KNYskksassfppplpslanssVQLRS  699
            +    D+ ++N  +     E E+ +  VKI   K+  ++S     P L      +++++ 
Sbjct  137  NGDTDDENEENMIEGTQTFEVENQWKPVKISYKKSPPRRSLPPPLPTLSGPDGETLRMQP  196

Query  700  HRQGKGEAEGSRLILEAVSVPQRNYFHAERSHGRLLLTAL  819
             R      +  RL+LEA+SVP +N FHA+R  GRL+LT +
Sbjct  197  RR------DNGRLVLEAMSVPSQNNFHAQRQDGRLVLTLV  230



>gb|KHN17984.1| Protein FAF-like, chloroplastic [Glycine soja]
Length=434

 Score = 61.6 bits (148),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 71/209 (34%), Positives = 106/209 (51%), Gaps = 32/209 (15%)
 Frame = +1

Query  214  STEEDDDDELMKRRRPGQDEVWKAIQAQKQQGDDHNNNKAPPIRSTVSWSAIIL--SDQK  387
            S  ++D  E MK+ R    ++W  IQ      + H +NK    R    WS+I+   ++++
Sbjct  90   SLSDEDYSEKMKQNR---FQIWNTIQK-----EHHEDNKP---RHVDVWSSILAQKANEE  138

Query  388  VDVQDSVPYIHPllkkssscclskqslqICTESLGSETGSDCLT----SQTRDSDHVQDQ  555
                 + PY+HPL+++S SC   K    ICTESLGSETGSD  +    S+T DS+  +  
Sbjct  139  TSKLTTTPYVHPLVRRSKSCLSEKSLE-ICTESLGSETGSDGFSSYSPSETEDSEGEKKN  197

Query  556  VQDNKQAHEEE---EEDIFNDVKIKNYskksassfppplpslanssVQLRSHRQGKGEAE  726
            V++ +     +   EED    V   NY   +     P        S+ +RSHR      +
Sbjct  198  VEEEEGEESVQITHEEDF--QVPKCNY---AEKKPLPRSFPPPLPSLHMRSHR------D  246

Query  727  GSRLILEAVSVPQRNYFHAERSHGRLLLT  813
              RL L+AVSVP +N F A+R +G L+LT
Sbjct  247  NGRLFLQAVSVPSQNNFCAQRENGCLVLT  275



>ref|XP_010312347.1| PREDICTED: protein FAF-like, chloroplastic [Solanum lycopersicum]
Length=481

 Score = 61.2 bits (147),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 61/170 (36%), Positives = 85/170 (50%), Gaps = 19/170 (11%)
 Frame = +1

Query  358  WSAIILSDQKVDVQDSVPYIHPllkkssscclskqslqICTESLGSETGSDCLTSQTR--  531
            WS+I+   +  D+Q   PYIHPL+K+S+S    K     CTE+LGSE GSD  +S T   
Sbjct  106  WSSILSQKKNDDLQ--TPYIHPLVKRSTSSLSEKSLET-CTENLGSENGSDGFSSYTPSE  162

Query  532  --DSDHVQDQVQDNKQAHEEEEEDIFNDVKIKNYskksassfppplpslans------sV  687
              D D  +         H +       +++   Y     SS   P P  + +      S+
Sbjct  163  NGDVDEEKHDHHHYHYRHHQYCSQFIEELRAVKYKNSKRSSSSFPPPITSLAIGDNKPSI  222

Query  688  QLRSHRQGKGEAEGSRLILEAVSVPQRNYFHAERSHGRLLLTALKSPTSS  837
            Q++S RQ        RLILE VS+P R +FHA R  GRLLLT + + TS+
Sbjct  223  QMQSRRQD------GRLILEVVSIPPRYHFHAHRHDGRLLLTLVDNSTST  266



>ref|XP_010916535.1| PREDICTED: protein FAF-like, chloroplastic isoform X1 [Elaeis 
guineensis]
Length=495

 Score = 61.2 bits (147),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 76/270 (28%), Positives = 108/270 (40%), Gaps = 80/270 (30%)
 Frame = +1

Query  139  SIIVGSDCDESAHRSSNNW------LSIQNPSTEEDDDDELMKRRRPGQDEVWKAIQAQK  300
            SI+  +   E    S  NW           P  E + DD+     RPGQ ++W +IQ+QK
Sbjct  21   SILAPNLAREPLPISPTNWQPPAEQYKPTEPPVEAEKDDD-----RPGQFDIWSSIQSQK  75

Query  301  QQGDDHNNNKAPPIRSTVSWSAIILSDQKVDVQDSVPYIHPllkkssscclskqslqICT  480
                          R T +   +            VPY+HPL+++SSS    K    ICT
Sbjct  76   A-------------RETATADPM------------VPYVHPLVRRSSSLMSQKSLE-ICT  109

Query  481  ESLGSETGS----------DCLTSQT----RDSDHVQDQVQDNKQAHEEEEEDIFNDVKI  618
            ESLGSETGS          DC +S+      + + +   + + +   +EEE   F   K 
Sbjct  110  ESLGSETGSADFSSLLDDPDCFSSKIEAEEEEHNELAPPIHETRPLVDEEERPRFRVAKA  169

Query  619  ---------------KNYskksassfppplpslanss--------VQLRSHRQGKGEAEG  729
                            NY    +   PP        S        + +R HR        
Sbjct  170  VEERRVQSGRKELVSVNYHCSISRRSPPRSFPPPLPSISRRDGPCIHMRPHRC------N  223

Query  730  SRLILEAVSVPQRNYFHAERSHGRLLLTAL  819
             RL++EAV VP +NY HA+R  GRLLL+ +
Sbjct  224  GRLVVEAVPVPSQNYLHAQRQDGRLLLSFI  253



>ref|XP_010421000.1| PREDICTED: protein FAF-like, chloroplastic [Camelina sativa]
Length=471

 Score = 60.8 bits (146),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 87/277 (31%), Positives = 129/277 (47%), Gaps = 61/277 (22%)
 Frame = +1

Query  130  GIVSIIVGSDCDES----------AHRSSNNWLS---------------IQNPSTEEDDD  234
            GIV+I+ G   + S          A  SS  W+S               ++ PS+   DD
Sbjct  21   GIVTILGGISSNTSSAPSLRRTFSADLSSKTWVSQNGFSPMKRISSSEKLRVPSSP-PDD  79

Query  235  DELMKRRRPGQDEVWKAIQAQKQQGDDHNNNKAPPIRSTVSWSAIILSDQKVD--VQDSV  408
            DE  +  R G D +W  IQ   Q  +    ++  P +S V WS+I LSD+K +    D+V
Sbjct  80   DEADEESRSGVD-IWAQIQ---QDKNAKKEDETEPGQSNV-WSSI-LSDKKKNESSNDTV  133

Query  409  P--YIHPllkkssscclskqslqICTESLGSETG----SDCLTSQTRDSD----------  540
            P  Y+HPL+K++SS         ICTESLGSETG    S   +S+T D++          
Sbjct  134  PPPYVHPLMKRASSLSEKSLE--ICTESLGSETGCEGFSSYASSETGDAEIEIQEETSLV  191

Query  541  ------HVQDQVQDNKQAHEEEEEDIFNDVKIKNYskksassfppplpslanssVQLRSH  702
                   V+D++ ++    E E+E   + + +  ++           P + + S Q  S 
Sbjct  192  LNVTETKVEDEITESLVEVEAEQE---SPITVPIHTPCIELPRGSFPPPIRSLSSQSGSS  248

Query  703  RQGKGEAEGSRLILEAVSVPQRNYFHAERSHGRLLLT  813
               K   +  RL+LEAVS+P  N F A+R  GRLLLT
Sbjct  249  LHMKTRRDNGRLVLEAVSMPSHNNFAAKRQDGRLLLT  285



>ref|XP_010916536.1| PREDICTED: protein FAF-like, chloroplastic isoform X2 [Elaeis 
guineensis]
Length=489

 Score = 60.8 bits (146),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 76/270 (28%), Positives = 108/270 (40%), Gaps = 80/270 (30%)
 Frame = +1

Query  139  SIIVGSDCDESAHRSSNNW------LSIQNPSTEEDDDDELMKRRRPGQDEVWKAIQAQK  300
            SI+  +   E    S  NW           P  E + DD+     RPGQ ++W +IQ+QK
Sbjct  15   SILAPNLAREPLPISPTNWQPPAEQYKPTEPPVEAEKDDD-----RPGQFDIWSSIQSQK  69

Query  301  QQGDDHNNNKAPPIRSTVSWSAIILSDQKVDVQDSVPYIHPllkkssscclskqslqICT  480
                          R T +   +            VPY+HPL+++SSS    K    ICT
Sbjct  70   -------------ARETATADPM------------VPYVHPLVRRSSSLMSQKSLE-ICT  103

Query  481  ESLGSETGS----------DCLTSQ----TRDSDHVQDQVQDNKQAHEEEEEDIFNDVKI  618
            ESLGSETGS          DC +S+      + + +   + + +   +EEE   F   K 
Sbjct  104  ESLGSETGSADFSSLLDDPDCFSSKIEAEEEEHNELAPPIHETRPLVDEEERPRFRVAKA  163

Query  619  ---------------KNYskksassfppplpslanss--------VQLRSHRQGKGEAEG  729
                            NY    +   PP        S        + +R HR        
Sbjct  164  VEERRVQSGRKELVSVNYHCSISRRSPPRSFPPPLPSISRRDGPCIHMRPHRC------N  217

Query  730  SRLILEAVSVPQRNYFHAERSHGRLLLTAL  819
             RL++EAV VP +NY HA+R  GRLLL+ +
Sbjct  218  GRLVVEAVPVPSQNYLHAQRQDGRLLLSFI  247



>emb|CDY09119.1| BnaA02g05450D [Brassica napus]
Length=446

 Score = 60.8 bits (146),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 81/253 (32%), Positives = 114/253 (45%), Gaps = 36/253 (14%)
 Frame = +1

Query  130  GIVSIIVGSDCDES----------AHRSSNNWLSIQNPSTEED-------DDDELMKRRR  258
            GIV+I+ G   + S          A  SS NWLS    S  +        D++E     R
Sbjct  21   GIVTILGGISSNTSSAPSLRRTFSADLSSKNWLSRNESSPMKKLHASSVADEEE---GSR  77

Query  259  PGQDEVWKAIQAQKQQGDDHNNNKAPPIRSTVSWSAIILSDQKVDVQ-DSVP--YIHPll  429
             G D +W  IQ  K Q       +  P ++ V WS+I+   +K +   D+VP  Y+HPL+
Sbjct  78   SGFD-IWAQIQEVKNQ----TKEEIEPDQTDV-WSSILSDKKKAESSGDAVPPPYVHPLM  131

Query  430  kkssscclskqslqICTESLGSETGSDCLTSQT-----RDSDHVQDQVQDNKQAHEEEEE  594
            K++SS         ICTESLGSETG +   S       ++   +   V   K+  E E E
Sbjct  132  KRASSLSEKSLE--ICTESLGSETGCEGFASYADAEIEKEEADLTLNVTVTKEEEETEAE  189

Query  595  DIFNDVKIKNYskksassfppplpslanssVQLRSHRQGKGEAEGSRLILEAVSVPQRNY  774
                 + + N +           P + + S Q  S    K   +  RL+LEAVS+P  N 
Sbjct  190  AEEEAITVPNLTPCMELPRGSFPPPIRSLSSQSGSALHMKTRRDNGRLVLEAVSMPSHNN  249

Query  775  FHAERSHGRLLLT  813
            F A+R  GRLLLT
Sbjct  250  FSAKRQDGRLLLT  262



>ref|XP_006287687.1| hypothetical protein CARUB_v10000895mg [Capsella rubella]
 gb|EOA20585.1| hypothetical protein CARUB_v10000895mg [Capsella rubella]
Length=465

 Score = 60.8 bits (146),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 94/282 (33%), Positives = 137/282 (49%), Gaps = 57/282 (20%)
 Frame = +1

Query  130  GIVSIIVGSDCDES----------AHRSSNNWLS------IQNPSTEED------DDDEL  243
            GIV+I+ G   + S          A  SS  WLS      ++  S+ E       D +E 
Sbjct  21   GIVTILAGISSNTSSAPSLRRTFSADLSSKTWLSQNGFSPMKRISSSEKLRASSPDHEEA  80

Query  244  MKRRRPGQDEVWKAIQAQKQQGDDHNNNKAPPIRSTVSWSAIILSDQKVD--VQDSVP--  411
             +  R G D +W  IQ   Q  +D   N+  P +S V WS+I LSD+K D    D+VP  
Sbjct  81   EEESRSGVD-IWAQIQ---QDKNDKKENETEPGQSDV-WSSI-LSDKKKDEASNDTVPPP  134

Query  412  YIHPllkkssscclskqslqICTESLGSETG----SDCLTSQTRDSD-HVQDQVQDNKQ-  573
            Y+HPL+K++SS         ICTESLGSETG    S   +S+T D++  +Q+ V +  + 
Sbjct  135  YVHPLMKRASSLSEKSLE--ICTESLGSETGCEGFSSYASSETGDAEIEIQELVVNVTET  192

Query  574  -------AHEEEEEDIFNDVKIKN--YskksassfppplpslanssVQLRSHRQGKGEAE  726
                   A    E D    V + N    + S       L S + SS+ +++ R      +
Sbjct  193  KVEEETEAAAVIEVDQQESVTVPNNELPRGSFPPPIRSLSSQSGSSLHMKTRR------D  246

Query  727  GSRLILEAVSVPQRNYFHAERSHGRLLLTA--LKSPTSSDQQ  846
              RL+LEAVS+P  N F A+R  GRLLL+   + + T+ DQ+
Sbjct  247  NGRLVLEAVSMPSHNNFSAKREDGRLLLSFAEISNETTYDQE  288



>ref|XP_002874046.1| hypothetical protein ARALYDRAFT_351234 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH50305.1| hypothetical protein ARALYDRAFT_351234 [Arabidopsis lyrata subsp. 
lyrata]
Length=462

 Score = 60.5 bits (145),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 72/267 (27%), Positives = 111/267 (42%), Gaps = 58/267 (22%)
 Frame = +1

Query  70   DMSSSTLCSCELKPNPLEKGGIVSIIVGSDCDESAHRSSNNWLSIQNPSTEEDDDDELMK  249
            D+SS T  S    P P+++      +   + +E      + W  IQ    ++  ++E+  
Sbjct  45   DLSSKTWVSQNGFP-PMKRISSSEKLRADEAEEETRSGVDIWAQIQQDKNDKKKEEEI--  101

Query  250  RRRPGQDEVWKAIQAQKQQGDDHNNNKAPPIRSTVSWSAIILSDQKVDVQDSVPYIHPll  429
               PGQ +VW +I ++K++ +  +N+  PP                       PY+HPL+
Sbjct  102  --EPGQSDVWSSILSEKKKTES-SNDAVPP-----------------------PYVHPLM  135

Query  430  kkssscclskqslqICTESLGSETGSDCLTSQTRDSDHVQDQVQDNKQAHEEEEEDIFN-  606
            K++SS         ICTESLGSETG D  +S      H   +  D +    EE   + N 
Sbjct  136  KRASSLSEKSLE--ICTESLGSETGCDGYSS------HASSETGDVEIEIHEETNLVINV  187

Query  607  ------------------DVKIKNYskksassfppplpslanssVQLRSHRQGKGEAEGS  732
                               + + N+  +      PP     +S      H   K   +  
Sbjct  188  TETKVEEITETEVEIEQESITVPNHIIELPRGSFPPPIRSLSSQSGSSLHM--KTRRDNG  245

Query  733  RLILEAVSVPQRNYFHAERSHGRLLLT  813
            RL+LEAVS+P  N F A+R  GRLLLT
Sbjct  246  RLVLEAVSMPSHNNFSAKRQDGRLLLT  272



>ref|XP_008450286.1| PREDICTED: protein FAF-like, chloroplastic [Cucumis melo]
Length=387

 Score = 60.1 bits (144),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 62/164 (38%), Positives = 90/164 (55%), Gaps = 21/164 (13%)
 Frame = +1

Query  358  WSAIILSDQKVDVQDSVP----YIHPllkkssscclskqslqICTESLGSETGSDCLTSQ  525
            WS+II    K   QDS P    Y+HPLLK+S  C   K    ICTESLGSETGSD  +S 
Sbjct  78   WSSII----KESRQDSKPILDPYVHPLLKRSGKCLSEKSLE-ICTESLGSETGSDGFSSY  132

Query  526  -TRDSDHVQDQVQDN--KQAHEEEEEDIFNDVKI---KNYskksassfppplpslanssV  687
             + ++    D+ ++N  +     E E+ +  VKI   K+  ++S     P L      ++
Sbjct  133  PSSENGDTDDENEENMIESTQTFEMENQWKPVKISHKKSPPRRSLPPPLPTLSGPDGETL  192

Query  688  QLRSHRQGKGEAEGSRLILEAVSVPQRNYFHAERSHGRLLLTAL  819
            +++  R      +  RL+LEA+SVP +N FHA+R  GRL+LT +
Sbjct  193  RMQPRR------DNGRLVLEAMSVPSQNNFHAQRQDGRLVLTLI  230



>emb|CAC34502.1| putative protein [Arabidopsis thaliana]
Length=462

 Score = 60.1 bits (144),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 83/264 (31%), Positives = 121/264 (46%), Gaps = 44/264 (17%)
 Frame = +1

Query  130  GIVSIIVGSDCDES----------AHRSSNNWLS---------IQNPSTEEDDDDELMKR  252
            GIVSI+ G   + S          A  SS  W+S         I +      D++E  + 
Sbjct  20   GIVSILGGISSNTSSAPSLRRTFSADLSSKTWVSQNGFSPMKRISSSEKLRPDEEEAEEE  79

Query  253  RRPGQDEVWKAIQAQKQQGDDHNNNKAPPIRSTVSWSAIILSDQKVDV-QDSVP--YIHP  423
             R G D +W  IQ  K   D     +  P +S V WS+I+   +K +  +D+VP  Y+HP
Sbjct  80   SRSGVD-IWAQIQQDKN--DKKKEEEIEPGQSDV-WSSILSEKKKTESSKDTVPPPYVHP  135

Query  424  llkkssscclskqslqICTESLGSETGSDCLTS----QTRDSD-HVQDQVQDNKQAHEEE  588
            L+K++SS         ICTESLGSETG D  +S    +T D++  + D+        E +
Sbjct  136  LMKRASSLSEKSLE--ICTESLGSETGCDGFSSHASSETGDAEIEIHDETNLVVNVTETK  193

Query  589  EEDIF---------NDVKIKNYskksassfppplpslanssVQLRSHRQGKGEAEGSRLI  741
             E+I          + + + N+  +      PP     +S      H   K   +  RL+
Sbjct  194  VEEITETEIVVEQESSIIVPNHIIELPPGSFPPPIRSLSSQSGSSLHM--KTRRDNGRLV  251

Query  742  LEAVSVPQRNYFHAERSHGRLLLT  813
            LEAVS+P  N F A+R  GRLLLT
Sbjct  252  LEAVSMPSHNNFSAKRQDGRLLLT  275



>ref|NP_680195.2| uncharacterized protein [Arabidopsis thaliana]
 ref|NP_001190360.1| uncharacterized protein [Arabidopsis thaliana]
 sp|Q0V865.1|FAFL_ARATH RecName: Full=Protein FAF-like, chloroplastic; Flags: Precursor 
[Arabidopsis thaliana]
 gb|ABH04462.1| At5g22090 [Arabidopsis thaliana]
 gb|AED92981.1| uncharacterized protein AT5G22090 [Arabidopsis thaliana]
 gb|AED92982.1| uncharacterized protein AT5G22090 [Arabidopsis thaliana]
Length=463

 Score = 60.1 bits (144),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 83/264 (31%), Positives = 121/264 (46%), Gaps = 44/264 (17%)
 Frame = +1

Query  130  GIVSIIVGSDCDES----------AHRSSNNWLS---------IQNPSTEEDDDDELMKR  252
            GIVSI+ G   + S          A  SS  W+S         I +      D++E  + 
Sbjct  21   GIVSILGGISSNTSSAPSLRRTFSADLSSKTWVSQNGFSPMKRISSSEKLRPDEEEAEEE  80

Query  253  RRPGQDEVWKAIQAQKQQGDDHNNNKAPPIRSTVSWSAIILSDQKVDV-QDSVP--YIHP  423
             R G D +W  IQ  K   D     +  P +S V WS+I+   +K +  +D+VP  Y+HP
Sbjct  81   SRSGVD-IWAQIQQDKN--DKKKEEEIEPGQSDV-WSSILSEKKKTESSKDTVPPPYVHP  136

Query  424  llkkssscclskqslqICTESLGSETGSDCLTS----QTRDSD-HVQDQVQDNKQAHEEE  588
            L+K++SS         ICTESLGSETG D  +S    +T D++  + D+        E +
Sbjct  137  LMKRASSLSEKSLE--ICTESLGSETGCDGFSSHASSETGDAEIEIHDETNLVVNVTETK  194

Query  589  EEDIF---------NDVKIKNYskksassfppplpslanssVQLRSHRQGKGEAEGSRLI  741
             E+I          + + + N+  +      PP     +S      H   K   +  RL+
Sbjct  195  VEEITETEIVVEQESSIIVPNHIIELPPGSFPPPIRSLSSQSGSSLHM--KTRRDNGRLV  252

Query  742  LEAVSVPQRNYFHAERSHGRLLLT  813
            LEAVS+P  N F A+R  GRLLLT
Sbjct  253  LEAVSMPSHNNFSAKRQDGRLLLT  276



>ref|XP_004228872.1| PREDICTED: protein FAF-like, chloroplastic [Solanum lycopersicum]
Length=471

 Score = 60.1 bits (144),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 60/168 (36%), Positives = 79/168 (47%), Gaps = 18/168 (11%)
 Frame = +1

Query  358  WSAIILSDQKVDVQDSVPYIHPllkkssscclskqslqICTESLGSETGSDCLTS----Q  525
            WS+I+   +  D Q   PYIHPL+K+S+S    K    ICTE+LGSE GSD  +S    +
Sbjct  95   WSSILSQKKNDDFQ--TPYIHPLVKRSTSSLSEKSLE-ICTENLGSENGSDGFSSYASSE  151

Query  526  TRDSDHVQDQVQDNKQAHEE-----EEEDIFNDVKIKNYskksassfppplpslanssVQ  690
              D D  +         H+      EE  +      K  S                 S+Q
Sbjct  152  YEDVDEEKHDHHHYHHHHQYCSQFIEELRVVKHNNSKRPSSSFPPPITSLARGDNKPSIQ  211

Query  691  LRSHRQGKGEAEGSRLILEAVSVPQRNYFHAERSHGRLLLTALKSPTS  834
            ++S RQ        +LILE VS+P RN FHA R  GRLLLT + + TS
Sbjct  212  MQSRRQD------GKLILEVVSIPPRNRFHAHRLDGRLLLTLVDNSTS  253



>ref|XP_010456623.1| PREDICTED: protein FAF-like, chloroplastic [Camelina sativa]
Length=719

 Score = 60.1 bits (144),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 83/271 (31%), Positives = 124/271 (46%), Gaps = 50/271 (18%)
 Frame = +1

Query  130  GIVSIIVGSDCDES----------AHRSSNNWLS------IQNPSTEED-------DDDE  240
            GIV+I+ G   + S          A  SS  W+S      ++  S+ E        DDDE
Sbjct  21   GIVTILGGISSNTSSAPSLRRTFSADLSSKTWVSQNGFSPMKRISSSEKLRASSSPDDDE  80

Query  241  LMKRRRPGQDEVWKAIQAQKQQGDDHNNNKAPPIRSTVSWSAIILSDQKVDVQDSV---P  411
              +  R G D +W  IQ  K    D       P +S V WS+I+   +K +  + V   P
Sbjct  81   AEEVSRSGVD-IWAQIQQDKNAKKDEETE---PGQSDV-WSSILSDKKKNESSNDVAPPP  135

Query  412  YIHPllkkssscclskqslqICTESLGSETG----SDCLTSQTRDSD-HVQDQV------  558
            Y+HPL+K++SS         ICTESLGSETG    S   +S+T D++  +Q++       
Sbjct  136  YVHPLMKRASSLSEKSLE--ICTESLGSETGCEGFSSYASSETEDAEIEIQEETSLVLNV  193

Query  559  ------QDNKQAHEEEEEDIFNDVKIKNYskksassfppplpslanssVQLRSHRQGKGE  720
                  +D  ++  E E +  + + +  ++           P + + S Q  S    K  
Sbjct  194  TETNVEEDITESLVEAEAEQESPITVPIHTPCIELPKGSFPPPIRSLSSQSGSSLHMKTR  253

Query  721  AEGSRLILEAVSVPQRNYFHAERSHGRLLLT  813
             +  RL+LEAVS+P  N F A+R  GRLLLT
Sbjct  254  RDNGRLVLEAVSMPSHNNFAAKRQDGRLLLT  284



>dbj|BAC42736.1| unknown protein [Arabidopsis thaliana]
Length=463

 Score = 59.7 bits (143),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 83/264 (31%), Positives = 121/264 (46%), Gaps = 44/264 (17%)
 Frame = +1

Query  130  GIVSIIVGSDCDES----------AHRSSNNWLS---------IQNPSTEEDDDDELMKR  252
            GIVSI+ G   + S          A  SS  W+S         I +      D++E  + 
Sbjct  21   GIVSILGGISSNTSSAPSLRRTFSADLSSKTWVSQNGFSPMKRISSSEKLRPDEEEAEEE  80

Query  253  RRPGQDEVWKAIQAQKQQGDDHNNNKAPPIRSTVSWSAIILSDQKVDV-QDSVP--YIHP  423
             R G D +W  IQ  K   D     +  P +S V WS+I+   +K +  +D+VP  Y+HP
Sbjct  81   SRYGVD-IWAQIQQDKN--DKKKEEEIEPGQSDV-WSSILSEKKKTESSKDTVPPPYVHP  136

Query  424  llkkssscclskqslqICTESLGSETGSDCLTS----QTRDSD-HVQDQVQDNKQAHEEE  588
            L+K++SS         ICTESLGSETG D  +S    +T D++  + D+        E +
Sbjct  137  LMKRASSLSEKSLE--ICTESLGSETGCDGFSSHASSETGDAEIEIHDETNLVVNVTETK  194

Query  589  EEDIF---------NDVKIKNYskksassfppplpslanssVQLRSHRQGKGEAEGSRLI  741
             E+I          + + + N+  +      PP     +S      H   K   +  RL+
Sbjct  195  VEEITETEIVVEQESSIIVPNHIIELPPGSFPPPIRSLSSQSGSSLHM--KTRRDNGRLV  252

Query  742  LEAVSVPQRNYFHAERSHGRLLLT  813
            LEAVS+P  N F A+R  GRLLLT
Sbjct  253  LEAVSMPSHNNFSAKRQDGRLLLT  276



>emb|CDX88810.1| BnaA03g08390D [Brassica napus]
Length=520

 Score = 59.3 bits (142),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 72/253 (28%), Positives = 111/253 (44%), Gaps = 51/253 (20%)
 Frame = +1

Query  130  GIVSIIVGSDCDE--------SAHRSSNNWLS---------------IQNPSTEEDDDDE  240
            GIV+I+ GS            SA  SS NWL+               + N   +  +  +
Sbjct  21   GIVTILGGSSISSAPSLRRTFSADLSSKNWLTQNGTPPMKRISSSEKLHNFGADSLNSQD  80

Query  241  LMKRRRPGQDEVWKAIQAQKQQGDDHNNNKAPPIRSTVSWSAIILSDQKVDVQDSVP--Y  414
                 R G D +W  IQ  K + +    ++  P ++ V WS+I+   +K    ++VP  Y
Sbjct  81   EEHGSRSGVD-IWTQIQEDKNKKE----HETEPSQTDV-WSSILSDKKKKTDTETVPPPY  134

Query  415  IHPllkkssscclskqslqICTESLGSETGSDCLTSQTRDSDHVQDQVQDNKQAHEEEEE  594
            +HPL+K++SS         ICTESLGSETG +  +S              + +  E EE 
Sbjct  135  VHPLVKRASSLSEKSLE--ICTESLGSETGCEGFSSYA------------SSETGEAEEN  180

Query  595  DIFNDVKIKNYskksassfppplpslanssVQLRSHRQGKGEAEGSRLILEAVSVPQRNY  774
             +      K   +             + S++ +++ R      +  RL+LEAVS+P  N 
Sbjct  181  LVLEVTVTKEEEETEFGVEVEQEQVTSGSALHMKTRR------DNGRLVLEAVSMPSHNN  234

Query  775  FHAERSHGRLLLT  813
            F A+R  GRLLLT
Sbjct  235  FSAKRQDGRLLLT  247



>ref|XP_010495347.1| PREDICTED: protein FAF-like, chloroplastic [Camelina sativa]
Length=718

 Score = 59.3 bits (142),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 87/274 (32%), Positives = 127/274 (46%), Gaps = 55/274 (20%)
 Frame = +1

Query  130  GIVSIIVGSDCDES----------AHRSSNNWLS---------------IQNPSTEEDDD  234
            GIV+I+ G   + S          A  SS  W+S               ++ PS+   DD
Sbjct  21   GIVTILGGISSNTSSAPSLRRTFFADLSSKTWVSQNGFSPMKRISSSEKLRVPSSP-PDD  79

Query  235  DELMKRRRPGQDEVWKAIQAQKQQGDDHNNNKAPPIRSTVSWSAIILSDQKVD--VQDSV  408
            DE  +  R G D +W  IQ  K    D       P +S V WS+I LSD+K +    D+V
Sbjct  80   DEAEEVSRSGVD-IWAQIQQDKNAKKDEETE---PDQSDV-WSSI-LSDKKKNESSNDTV  133

Query  409  P--YIHPllkkssscclskqslqICTESLGSETG----SDCLTSQTRDSD-HVQDQV---  558
            P  Y+HPL+K++SS         ICTESLGSETG    S   +S+T D++  +Q++    
Sbjct  134  PPPYVHPLMKRASSLSEKSLE--ICTESLGSETGCEGFSSYASSETGDAEIEIQEETSLV  191

Query  559  ---------QDNKQAHEEEEEDIFNDVKIKNYskksassfppplpslanssVQLRSHRQG  711
                     +D  ++  E E +  + + +  ++           P + + S Q  S    
Sbjct  192  LNVTETKVEEDITESLVEVEAEQESPITVPIHTPCIELPRGSFPPPIRSLSSQSGSSLHM  251

Query  712  KGEAEGSRLILEAVSVPQRNYFHAERSHGRLLLT  813
            K   +  RL+LEAVS+P  N F A+R  GRLLLT
Sbjct  252  KTRRDNGRLVLEAVSMPTHNNFSAKRQDGRLLLT  285



>ref|XP_006424085.1| hypothetical protein CICLE_v10028116mg [Citrus clementina]
 gb|ESR37325.1| hypothetical protein CICLE_v10028116mg [Citrus clementina]
Length=558

 Score = 58.9 bits (141),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 66/219 (30%), Positives = 98/219 (45%), Gaps = 37/219 (17%)
 Frame = +1

Query  193  WLSIQNPSTEEDDDDELMKRRRPGQDEVWKAIQAQKQQGDDHNNNKAPPIRSTVSWSAII  372
            W SIQ    EE    + +  ++ GQ ++W +I  QK Q +  +N   PP           
Sbjct  115  WSSIQ----EEVAKKKELDHQKQGQFDIWSSIIHQKSQ-EITDNKPLPP-----------  158

Query  373  LSDQKVDVQDSVPYIHPllkkssscclskqslqICTESLGSETGSDCLTS--QTRDSDHV  546
                        PYIHPL+K+S+S    K    ICTESLGSETGS+  +S   +   D  
Sbjct  159  ------------PYIHPLVKRSASSLSEKSLE-ICTESLGSETGSEGFSSYPASESGDDD  205

Query  547  QDQVQDNKQAHEEEEEDIFNDVKIKNYskksassfppplpslanssVQLRSHRQG-----  711
            ++  Q+ ++  E+     F  + I  Y+               +    + S   G     
Sbjct  206  KETEQEQQERVEQSLSFAFEAMSIPKYNYVVGRKPLAQQRQQRSFPPPIPSRGNGASSIR  265

Query  712  -KGEAEGSRLILEAVSVPQRNYFHAERSHGRLLLTALKS  825
             +   +  RL+LEAVSVP  N F A+R +GRL+LT + S
Sbjct  266  MQSRRDNGRLVLEAVSVPSTNNFLAQRQNGRLVLTFVNS  304



>ref|XP_010521625.1| PREDICTED: protein FAF-like, chloroplastic [Tarenaya hassleriana]
Length=486

 Score = 58.5 bits (140),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 83/282 (29%), Positives = 130/282 (46%), Gaps = 47/282 (17%)
 Frame = +1

Query  121  EKGGIVSIIVGSDCDE------------SAHRSSNNWLS---IQNPSTEEDDDDELMKRR  255
            +K GIVSI+ GSD D             SA  SS  WLS   + +P  +    +      
Sbjct  26   KKHGIVSIL-GSDSDNRSSRASSLRRTLSADMSSKKWLSQNGLSSPPKKNASQESRGGGG  84

Query  256  RPGQD-------EVWKAIQAQKQQGDDHNNNKAPPIRSTVSWSAIILSDQKVDV--QDSV  408
              G+D       ++W +IQ +K++  +   N        V    +ILS++K DV    SV
Sbjct  85   GGGEDSEVKSAFDIWTSIQEEKKKEIEGERN------GQVDVWGLILSEKKKDVCMGKSV  138

Query  409  P--YIHPllkkssscclskqslqICTESLGSETGSDC-----LTSQTRDSDHVQDQVQDN  567
            P  Y+HPL+++S S    +    ICTESLGSETGS+      L+ ++ +    +D V + 
Sbjct  139  PPPYVHPLVRRSKSSLSERSLE-ICTESLGSETGSEGFSWYNLSEKSEEVLEEKDDVGNF  197

Query  568  KQAHEEEEEDIFNDVKIKNYskksass---fppplpslanssVQLRSHRQG-----KGEA  723
            +   +E E+  F   K +     + SS               +Q  S + G     +   
Sbjct  198  QGLQKEPEKQEFRAWKQEEPVMAAKSSCLGDKKSTQRSFPPPIQSLSRQDGASTYMRTRR  257

Query  724  EGSRLILEAVSVPQRNYFHAERSHGRLLLTALKSPTSSDQQE  849
            +  RL+LEAV +P ++ F A+R  GRL+LT  K+  + D+ E
Sbjct  258  DNGRLVLEAVEIPSKDNFCAQRQDGRLVLTFAKANQNVDKTE  299



>gb|KHN21197.1| Protein FAF-like, chloroplastic [Glycine soja]
Length=525

 Score = 58.2 bits (139),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 66/202 (33%), Positives = 97/202 (48%), Gaps = 35/202 (17%)
 Frame = +1

Query  271  EVWKAIQAQKQQGDDHNNNKAPPIRSTVSWSAIILSDQKVDVQDSVP---YIHPllkkss  441
            E+W +IQ  K++  + +        +   WS+I+    K ++  S+P   Y+HPL+K+S 
Sbjct  98   EIWSSIQRNKKEEQEKSG-------AFDMWSSIVSLKGKDEISKSMPITPYVHPLVKRSK  150

Query  442  scclskqslqICTESLGSETGSDC----LTSQTRDSDHVQDQVQDNKQAHEEEEEDIFND  609
            SC   K    ICTESLGSETGSD       S + ++    +Q QD +Q +EEEEE++ N 
Sbjct  151  SCLSGKSLE-ICTESLGSETGSDALLLSSHSSSSETGDATEQEQDKEQVNEEEEEELCNY  209

Query  610  VKI--------------KNYskksassfppplpslanssVQLRSHRQGKGEAEGSRLILE  747
              +                                ++S   +RSHR      +  RL+LE
Sbjct  210  ASVVATKKASASASASASPPRAFPPPLPSLSHHQASSSVTHMRSHR------DNGRLVLE  263

Query  748  AVSVPQRNYFHAERSHGRLLLT  813
            AVSVP  N F  +R  GRL+LT
Sbjct  264  AVSVPSHNNFSIQRQDGRLVLT  285



>emb|CDY65551.1| BnaCnng47650D [Brassica napus]
Length=465

 Score = 58.2 bits (139),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 63/223 (28%), Positives = 101/223 (45%), Gaps = 38/223 (17%)
 Frame = +1

Query  163  DESAHRSSNNWLSIQNPSTEEDDDDELMKRRRPGQDEVWKAIQAQKQQGDDHNNNKAPPI  342
            DE +    + W  IQ+   +++++ EL      GQ +VW +I + K++  + +N+  PP 
Sbjct  90   DEESRSGFDIWAQIQDDKNKKNEETEL------GQSDVWSSILSDKKKVSESSNDTVPP-  142

Query  343  RSTVSWSAIILSDQKVDVQDSVPYIHPllkkssscclskqslqICTESLGSETGSDCLT-  519
                                  PY+HPL+K++SS         ICTESLGSETG +  + 
Sbjct  143  ----------------------PYVHPLMKRASSLSEKSLE--ICTESLGSETGCEGFSW  178

Query  520  ---SQTRDSD-HVQDQVQDNKQAHEEEEEDIFND--VKIKNYskksassfppplpslans  681
               S+T D++  V +     ++   E E        + + NY+           P + + 
Sbjct  179  HASSETGDAEIEVLNVTVTKEEEETETEVVEIEQEPITVPNYTPCIELPRGSFPPPIRSL  238

Query  682  sVQLRSHRQGKGEAEGSRLILEAVSVPQRNYFHAERSHGRLLL  810
            + Q  S    K   +  RL+LEAVS+P  N F A+R  G LLL
Sbjct  239  TSQSGSALHMKTRRDNGRLVLEAVSMPSHNNFSAKRQDGHLLL  281



>ref|XP_008782273.1| PREDICTED: helicase SWR1-like [Phoenix dactylifera]
Length=509

 Score = 57.8 bits (138),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 75/263 (29%), Positives = 108/263 (41%), Gaps = 68/263 (26%)
 Frame = +1

Query  139  SIIVGSDCDESAHRSSNNWL-------SIQNPSTEEDDDDELMKRRRPGQDEVWKAIQAQ  297
            SI++ +   E+   S   WL       +++NP   E DDD      RPGQ ++W +IQ+Q
Sbjct  15   SIVMPNIARETIPISLTKWLPPPEQYTTVENPVEVEKDDD------RPGQFDLWSSIQSQ  68

Query  298  KQQGDDHNNNKAPPIRSTVSWSAIILSDQKVDVQDSVPYIHPllkkssscclskqslqIC  477
            K +                                  PY+HPL+++SS     K    IC
Sbjct  69   KAKEAAAAATAD----------------------PPAPYVHPLVRRSSKLMSQKSLE-IC  105

Query  478  TESLGSETGSDCLTSQTRDSDHVQDQVQDNKQAHE---------EEEEDIFNDVKI----  618
            TESLGSETGS   +S   + D +  +++  K+ H          EEE   F   K     
Sbjct  106  TESLGSETGSADFSSFLDELDCLSSKIESEKEEHSGPIYSTSMAEEEVPRFRVAKAVEER  165

Query  619  -----------KNYskksassfppplpslanssVQLRSHRQG-----KGEAEGSRLILEA  750
                        NY    +   PP       SS+   S R G     +      RL++EA
Sbjct  166  RVQSGRKELVEVNYHCSISRRSPPRSFPPPLSSI---SRRDGPCIHMRPYRRDGRLVVEA  222

Query  751  VSVPQRNYFHAERSHGRLLLTAL  819
            V+V  +NY HA+R  GRLLL+ +
Sbjct  223  VAVRSQNYLHAQRQDGRLLLSLI  245



>ref|XP_007150016.1| hypothetical protein PHAVU_005G118900g [Phaseolus vulgaris]
 gb|ESW22010.1| hypothetical protein PHAVU_005G118900g [Phaseolus vulgaris]
Length=423

 Score = 57.4 bits (137),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 81/274 (30%), Positives = 126/274 (46%), Gaps = 67/274 (24%)
 Frame = +1

Query  118  LEKGGIVSIIVGSDCDE--------SAHRSSNNWLSIQN---PSTEEDDDDEL-------  243
            ++K GIV+I+ GS+ D         SA  SS  WLS QN   P  +    +E+       
Sbjct  24   MQKQGIVTIL-GSNNDSATSLRRTLSADMSSKKWLS-QNGFSPKKKIASSEEISRSLTEA  81

Query  244  ----------------MKRRRPGQDEVWKAIQAQKQQGDDHNNNKAPPIRSTVSWSAII-  372
                            MK+ R    ++WK +Q +++  D               WS+I+ 
Sbjct  82   TAADSSSSSEDDNSEEMKQNR---CQIWKTVQKKEENVDKLGEFDV--------WSSILS  130

Query  373  -LSDQKVDVQDSVPYIHPllkkssscclskqslqICTESLGSETGSDCLTSQTRDSDHVQ  549
               +++     ++PY+HPL+++S SC   K    ICTESLGSETGSD  +S +       
Sbjct  131  KKGNEESSKLTTLPYVHPLVRRSKSCLSEKSLQ-ICTESLGSETGSDGFSSYSPSETEDS  189

Query  550  DQVQDNKQAHE------EEEEDIFNDVKIKNYskksassfppplpslanssVQLRSHRQG  711
            ++ ++ K+  E        EED    V+ +N+   +     P        S+ +RSHR  
Sbjct  190  EEEKEEKEEEEREKVELSHEEDF--QVQEQNH---AVKKSSPRSFPPPLPSLHMRSHR--  242

Query  712  KGEAEGSRLILEAVSVPQRNYFHAERSHGRLLLT  813
                +  RL +EAVSVP  N F A+R +GRL+L+
Sbjct  243  ----DNGRLFIEAVSVPSLNQFSAQRENGRLVLS  272



>ref|XP_009120687.1| PREDICTED: protein FAF-like, chloroplastic [Brassica rapa]
 emb|CDX92383.1| BnaA10g14220D [Brassica napus]
Length=458

 Score = 57.0 bits (136),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 62/213 (29%), Positives = 98/213 (46%), Gaps = 38/213 (18%)
 Frame = +1

Query  193  WLSIQNPSTEEDDDDELMKRRRPGQDEVWKAIQAQKQQGDDHNNNKAPPIRSTVSWSAII  372
            W  IQ+  +++ ++ EL      GQ +VW +I + K++  + +N+  PP           
Sbjct  100  WAQIQDDKSKKSEEIEL------GQSDVWSSILSDKKKVSESSNDTVPP-----------  142

Query  373  LSDQKVDVQDSVPYIHPllkkssscclskqslqICTESLGSETGSDCLT----SQTRDSD  540
                        PY+HPL+K++SS         ICTESLGSETG +  +    S+T D++
Sbjct  143  ------------PYVHPLMKRASSLSEKSLE--ICTESLGSETGCEGFSWHASSETGDAE  188

Query  541  -HVQDQVQDNKQAHEEEEEDIFND--VKIKNYskksassfppplpslanssVQLRSHRQG  711
              V +     ++   E E        + + NY+  +        P + + S Q  S    
Sbjct  189  IEVLNVTVTKEEEETETEVVEIEQEPITVPNYTPCTELPRGSFPPPIRSLSSQSGSALHM  248

Query  712  KGEAEGSRLILEAVSVPQRNYFHAERSHGRLLL  810
            K   +  RL+LEAVS+P  N F A+R  G LLL
Sbjct  249  KTRRDNGRLVLEAVSMPSHNNFSAKRQDGHLLL  281



>ref|XP_006592358.1| PREDICTED: protein FAF-like, chloroplastic-like [Glycine max]
Length=525

 Score = 57.0 bits (136),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 65/202 (32%), Positives = 97/202 (48%), Gaps = 35/202 (17%)
 Frame = +1

Query  271  EVWKAIQAQKQQGDDHNNNKAPPIRSTVSWSAIILSDQKVDVQDSVP---YIHPllkkss  441
            E+W +IQ  K++  + +        +   WS+I+    K ++  S+P   Y+HPL+K+S 
Sbjct  98   EIWSSIQRNKKEEQEKSG-------AFDMWSSIVSLKGKDEISKSMPITPYVHPLVKRSK  150

Query  442  scclskqslqICTESLGSETGSDC----LTSQTRDSDHVQDQVQDNKQAHEEEEEDIFND  609
            SC   K    ICTESLGSETGSD       S + ++    +Q QD +Q +EEEEE++ N 
Sbjct  151  SCLSGKSLE-ICTESLGSETGSDALLLSSHSSSSETGDATEQEQDKEQVNEEEEEELCNY  209

Query  610  VKI--------------KNYskksassfppplpslanssVQLRSHRQGKGEAEGSRLILE  747
              +                                ++S   +RSHR      +  RL+L+
Sbjct  210  ASVVATKKASASASASASPPRAFPPPLPSLSHHQASSSVTHMRSHR------DNGRLVLQ  263

Query  748  AVSVPQRNYFHAERSHGRLLLT  813
            AVSVP  N F  +R  GRL+LT
Sbjct  264  AVSVPSHNNFSIQRQDGRLVLT  285



>ref|XP_006356677.1| PREDICTED: protein FANTASTIC FOUR 3-like [Solanum tuberosum]
Length=272

 Score = 55.5 bits (132),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 45/122 (37%), Positives = 64/122 (52%), Gaps = 16/122 (13%)
 Frame = +1

Query  472  ICTESLGSETGSDCLTSQTRDSDHVQDQVQDNKQAHEEEEEDIFNDVKIKNYskksassf  651
            +CTE+LGSETG+D    Q  D++      ++ K      E+  +N V     ++ S    
Sbjct  75   LCTENLGSETGTD----QAIDNNIFSFSSREFKT-----EQSNYNKVMSYKNTQTSRKLP  125

Query  652  ppplpslanssVQLRSHRQGKGEAEGSRLILEAVSVPQ-RNYFHAERSHGRLLLTALKSP  828
            P       ++S+Q R +R      EG RL+++AV  PQ R YFHAERS+GRL L  L   
Sbjct  126  PLLTTLRGSNSLQCRPYR------EGGRLVIKAVETPQIRTYFHAERSNGRLRLCFLNDG  179

Query  829  TS  834
            TS
Sbjct  180  TS  181



>gb|KCW50926.1| hypothetical protein EUGRSUZ_J00576 [Eucalyptus grandis]
Length=484

 Score = 56.6 bits (135),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 56/172 (33%), Positives = 88/172 (51%), Gaps = 27/172 (16%)
 Frame = +1

Query  358  WSAIILSD-QKVDVQDSVPYIHPllkkssscclskqslqICTESLGSETGSD----CLTS  522
            WS+II    ++  VQ   PY+HPL+++S+S    K    ICTESLGSETGSD    C  S
Sbjct  115  WSSIISQKREEPSVQAPPPYVHPLVRRSASSLSEKSLE-ICTESLGSETGSDRFSSCPAS  173

Query  523  QT--------RDSDHVQDQVQDNKQAHEEEEEDI-------FNDVKIKNYskksassfpp  657
            +         ++SD V   +   +   E++++ +       +  +  K +  KS     P
Sbjct  174  EMGDLPDEDDKESDTVLQDLAKLQSPQEDQDQQLHLAKYSSYAGLGKKRHQPKSFPPPLP  233

Query  658  plpslanssVQLRSHRQGKGEAEGSRLILEAVSVPQRNYFHAERSHGRLLLT  813
             L     +S+++++HR      +  RL+LEA+S+P    F  +R  GRLLLT
Sbjct  234  WLSRSDGASLRMQTHR------DNGRLVLEAISIPSEKNFCVQRQDGRLLLT  279



>ref|XP_003539488.1| PREDICTED: protein FAF-like, chloroplastic-like isoform X1 [Glycine 
max]
 ref|XP_006592782.1| PREDICTED: protein FAF-like, chloroplastic-like isoform X2 [Glycine 
max]
Length=434

 Score = 56.2 bits (134),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 64/179 (36%), Positives = 94/179 (53%), Gaps = 24/179 (13%)
 Frame = +1

Query  304  QGDDHNNNKAPPIRSTVSWSAIIL--SDQKVDVQDSVPYIHPllkkssscclskqslqIC  477
            Q + H +NK    R    WS+I+   ++++     + PY+HPL++KS SC   K    IC
Sbjct  112  QKEHHEDNKP---RHVDVWSSILAQKANEETSKLTTTPYVHPLVRKSKSCLSEKSLE-IC  167

Query  478  TESLGSETGSDCLT----SQTRDSDHVQDQVQDNKQAHEEE---EEDIFNDVKIKNYskk  636
            TESLGSETGSD ++    S+T DS+  +  V++ +     +   EED    V   NY   
Sbjct  168  TESLGSETGSDGVSSYSPSETEDSEGEKKNVEEEEAEESVQITHEEDF--QVPKCNY---  222

Query  637  sassfppplpslanssVQLRSHRQGKGEAEGSRLILEAVSVPQRNYFHAERSHGRLLLT  813
            +     P        S+ +RSHR      +  RL L+AVSVP +N F A+R +G L+LT
Sbjct  223  AEKKPLPRSFPPPLPSLHMRSHR------DNGRLFLQAVSVPSQNNFCAQRENGCLVLT  275



>ref|XP_010031568.1| PREDICTED: protein FAF-like, chloroplastic [Eucalyptus grandis]
Length=514

 Score = 56.2 bits (134),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 56/172 (33%), Positives = 88/172 (51%), Gaps = 27/172 (16%)
 Frame = +1

Query  358  WSAIILSD-QKVDVQDSVPYIHPllkkssscclskqslqICTESLGSETGSD----CLTS  522
            WS+II    ++  VQ   PY+HPL+++S+S    K    ICTESLGSETGSD    C  S
Sbjct  115  WSSIISQKREEPSVQAPPPYVHPLVRRSASSLSEKSLE-ICTESLGSETGSDRFSSCPAS  173

Query  523  QT--------RDSDHVQDQVQDNKQAHEEEEEDI-------FNDVKIKNYskksassfpp  657
            +         ++SD V   +   +   E++++ +       +  +  K +  KS     P
Sbjct  174  EMGDLPDEDDKESDTVLQDLAKLQSPQEDQDQQLHLAKYSSYAGLGKKRHQPKSFPPPLP  233

Query  658  plpslanssVQLRSHRQGKGEAEGSRLILEAVSVPQRNYFHAERSHGRLLLT  813
             L     +S+++++HR      +  RL+LEA+S+P    F  +R  GRLLLT
Sbjct  234  WLSRSDGASLRMQTHR------DNGRLVLEAISIPSEKNFCVQRQDGRLLLT  279



>ref|XP_006487862.1| PREDICTED: protein FAF-like, chloroplastic-like [Citrus sinensis]
Length=551

 Score = 55.5 bits (132),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 66/208 (32%), Positives = 100/208 (48%), Gaps = 36/208 (17%)
 Frame = +1

Query  265  QDEVWKAIQAQ--KQQGDDHNNNKAPPIRSTVSWSAII------LSDQKVDVQDSVPYIH  420
            Q ++W +IQ +  K++  DH N     I     WS+II      ++D K       PYIH
Sbjct  111  QFDIWSSIQEEVAKKKELDHQNQGQFDI-----WSSIIHQKSQEITDNK---PLPPPYIH  162

Query  421  PllkkssscclskqslqICTESLGSETGSDCLTS--QTRDSDHVQDQVQDNKQAHEEEEE  594
            PL+K+S+     K    ICTESLGSETGS+  +S   +   D  ++  Q+ ++  E+   
Sbjct  163  PLVKRSARSLTEKSLE-ICTESLGSETGSEGFSSYPASESGDDDKETEQEQQERVEQSLS  221

Query  595  DIFNDVKIKNYskksassfppplpsla-----------nssVQLRSHRQGKGEAEGSRLI  741
              F  + I  Y+              +            SS++++S R      +  RL+
Sbjct  222  FAFEAMSIPKYNYVVGRKPLAQQRQRSFPPPIPSRGNGASSIRMQSRR------DNGRLV  275

Query  742  LEAVSVPQRNYFHAERSHGRLLLTALKS  825
            LEAVSVP  N F A+R +GRL+LT + S
Sbjct  276  LEAVSVPSTNNFLAQRQNGRLVLTFVNS  303



>gb|KDO46581.1| hypothetical protein CISIN_1g008798mg [Citrus sinensis]
Length=553

 Score = 55.5 bits (132),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 66/208 (32%), Positives = 100/208 (48%), Gaps = 36/208 (17%)
 Frame = +1

Query  265  QDEVWKAIQAQ--KQQGDDHNNNKAPPIRSTVSWSAII------LSDQKVDVQDSVPYIH  420
            Q ++W +IQ +  K++  DH N     I     WS+II      ++D K       PYIH
Sbjct  111  QFDIWSSIQEEVAKKKELDHQNQGQFDI-----WSSIIHQKSQEITDNK---PLPPPYIH  162

Query  421  PllkkssscclskqslqICTESLGSETGSDCLTS--QTRDSDHVQDQVQDNKQAHEEEEE  594
            PL+K+S+     K    ICTESLGSETGS+  +S   +   D  ++  Q+ ++  E+   
Sbjct  163  PLVKRSARSLTEKSLE-ICTESLGSETGSEGFSSYPASESGDDDKETEQEQQERVEQSLS  221

Query  595  DIFNDVKIKNYskksassfppplpsla-----------nssVQLRSHRQGKGEAEGSRLI  741
              F  + I  Y+              +            SS++++S R      +  RL+
Sbjct  222  FAFEAMSIPKYNYVVGRKPLAQQRQRSFPPPIPSRGNGASSIRMQSRR------DNGRLV  275

Query  742  LEAVSVPQRNYFHAERSHGRLLLTALKS  825
            LEAVSVP  N F A+R +GRL+LT + S
Sbjct  276  LEAVSVPSTNNFLAQRQNGRLVLTFVNS  303



>ref|XP_009623353.1| PREDICTED: protein FANTASTIC FOUR 3-like [Nicotiana tomentosiformis]
Length=293

 Score = 54.7 bits (130),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 53/148 (36%), Positives = 72/148 (49%), Gaps = 19/148 (13%)
 Frame = +1

Query  382  QKVDVQDSVPYIHPllkkssscclskqslqICTESLGSETGSDCLTSQTRDSDHVQDQVQ  561
            +K  ++D   Y+HPL K  +    S +   +CTESLGSETGSD   S    S  + ++  
Sbjct  96   KKGYLEDEEVYVHPLEKLCTLNTKSLE---MCTESLGSETGSDISESMEEFSPFLSEKET  152

Query  562  DNKQAHEEEEEDIFNDVKIKNYskksassfppplpslanssVQLRSHRQGKGEAEGSRLI  741
            +  ++   E    FN            S  PP      N  VQ+R HR      EG RL+
Sbjct  153  NFHRSKSREFTKKFNRAS---------SFPPPLTSMSGNEGVQVRPHR------EGGRLV  197

Query  742  LEAVSVPQRN-YFHAERSHGRLLLTALK  822
            L+AV +   N YF AERS GRL L+ L+
Sbjct  198  LKAVIINSCNSYFQAERSDGRLRLSLLR  225



>ref|XP_004251227.1| PREDICTED: protein FAF-like, chloroplastic [Solanum lycopersicum]
Length=248

 Score = 53.9 bits (128),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 62/171 (36%), Positives = 85/171 (50%), Gaps = 17/171 (10%)
 Frame = +1

Query  328  KAPPIRSTVSWSAIILSDQKVDVQDSVPYIHPllkkssscclskqslqICTESLGSETGS  507
            K  PI+    WS+I+ S +  +   +  Y+HPL K S +    K    ICTESLGSETGS
Sbjct  30   KDQPIK-IFDWSSILSSSKNEESSSTSLYVHPLDKSSRNSLSEKSLE-ICTESLGSETGS  87

Query  508  --DCL----TSQTRDSDHVQDQVQDNKQAHEEEE-EDIFNDVKIKNYskksassfppplp  666
              DC     TS+  DS+  +          +     + F D  + N+SK+  SS     P
Sbjct  88   GSDCFLSSPTSEHEDSNDDKHDHHHYYHQQQYSVVSESFEDFHVYNHSKRLISSSKSFPP  147

Query  667  slanssVQLRSHRQGKGEAEGSRLILEAVSVPQRNYFHAERSHGRLLLTAL  819
            SL +  + ++SHRQ        RLILEA S+   N  HA+R  G LLLT +
Sbjct  148  SLPS--IHMQSHRQN------GRLILEAASISPNNSLHAQRLDGHLLLTVI  190



>ref|XP_008449599.1| PREDICTED: protein FAF-like, chloroplastic [Cucumis melo]
Length=449

 Score = 54.7 bits (130),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 44/121 (36%), Positives = 59/121 (49%), Gaps = 8/121 (7%)
 Frame = +1

Query  472  ICTESLGSETGSDCLTSQTRDSDHVQDQVQDNKQAHEEEEEDIFNDVKI--KNYskksas  645
            ICTESLGSETGSD  +S     D   D +       ++ +   +  VK   K    +S  
Sbjct  136  ICTESLGSETGSDGFSSYPSSEDGDFDGLMTETDCSDDIDTFEWKPVKFSRKKSPPRSFP  195

Query  646  sfppplpslanssVQLRSHRQGKGEAEGSRLILEAVSVPQRNYFHAERSHGRLLLTALKS  825
                 L S    S+ ++S R+        RLIL+AVSVP R  F AER  GRL+L+   +
Sbjct  196  PLISSLDSPDGVSIGIQSRRKD------GRLILDAVSVPSRKNFRAERRDGRLILSLFTT  249

Query  826  P  828
            P
Sbjct  250  P  250



>gb|KGN57007.1| hypothetical protein Csa_3G149380 [Cucumis sativus]
Length=332

 Score = 54.3 bits (129),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 55/149 (37%), Positives = 76/149 (51%), Gaps = 21/149 (14%)
 Frame = +1

Query  412  YIHPllkkssscclskqslqICTESLGSETGSDCLTSQTRDSDHVQDQVQDNKQAHEEEE  591
            Y+HPL+K+S S    +    +CTE+LG+ETG D        SD + ++    K+      
Sbjct  107  YVHPLVKRSRSALSDESLA-LCTENLGNETGDD-FVEDVVFSDLINERSSMRKR------  158

Query  592  EDIFNDVKIKNYskksassfppplpslanssVQLRSHRQGKGEAEGSRLILEAVSVPQR-  768
                  VK K     +    PP        S+++RS+R      E  RLI+EAV  P R 
Sbjct  159  ------VKSKRNQGNNKVFPPPLTTIAGVDSIRVRSYR------EDGRLIMEAVKTPARL  206

Query  769  NYFHAERSHGRLLLTALKSPTSSDQQEAG  855
            +YFH ERSHGRL L+ LKS TSS + + G
Sbjct  207  SYFHVERSHGRLRLSILKSSTSSSRFDCG  235



>ref|XP_003605994.1| hypothetical protein MTR_4g050590 [Medicago truncatula]
 gb|AES88191.1| FAF-like protein [Medicago truncatula]
Length=566

 Score = 54.7 bits (130),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 60/214 (28%), Positives = 97/214 (45%), Gaps = 43/214 (20%)
 Frame = +1

Query  274  VWKAIQAQKQQGDDHNNNKAPPIRSTVSWSAIILSDQKVDVQDSVP-YIHPllkkssscc  450
            +W +IQ  K++             S  +W +++      ++  S+P YIHPL K++ S  
Sbjct  109  IWSSIQKNKKEEQQKGG-------SFDTWGSLMCLKTNDEISKSLPPYIHPLAKRTKSSL  161

Query  451  lskqslqICTESLGSETGSDCLTS------------------------QTRDS-----DH  543
              K    ICTESLGSETGSD   S                        +T D+     +H
Sbjct  162  SRKSLE-ICTESLGSETGSDGPVSSYPPSESLGSDTGSDGLLSSDPPSETEDTEEHQQNH  220

Query  544  VQDQVQDNKQAHEEEEEDIFNDVKIKNYskksassfppplpslanssVQLRSH----RQG  711
            ++ + +++K+  E++E+++  +V   NY   +A++   P  S       L        Q 
Sbjct  221  LEQEPEEDKKEVEDKEQEVL-EVARFNYGGVAATTKKSPPRSFPPPLPSLSRQDGPSFQM  279

Query  712  KGEAEGSRLILEAVSVPQRNYFHAERSHGRLLLT  813
            +      RL+LEAVS+P  N F  +R  GRL+LT
Sbjct  280  RPPPHNGRLVLEAVSLPSLNNFCVQRQDGRLVLT  313



>emb|CDO99018.1| unnamed protein product [Coffea canephora]
Length=300

 Score = 53.5 bits (127),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 52/142 (37%), Positives = 74/142 (52%), Gaps = 16/142 (11%)
 Frame = +1

Query  412  YIHPllkkssscclskqslqICTESLGSETGSDCLTSQTRDSDHVQDQVQD-----NKQA  576
            Y+HPL K+ SS  LS++SL++CTE+LGSETGSD +                      ++ 
Sbjct  83   YVHPLTKQYSSSRLSEKSLELCTENLGSETGSDIMDISILSLSSSNSPTSSEDSWIKQEG  142

Query  577  HEEEEEDIFNDVKIKNYskksassfppplpslanssVQLRSHRQGKGEAEGSRLILEAVS  756
               +E +  +  K+ N    S +  PP      ++S+Q R HR      E  RL++ AV 
Sbjct  143  KLPQEAETSSKCKVNN----SRNFPPPLTTISGSNSLQFRPHR------EDGRLVIHAVE  192

Query  757  VP-QRNYFHAERSHGRLLLTAL  819
             P + NYF AERSHGRL L+ L
Sbjct  193  APLKHNYFQAERSHGRLRLSFL  214



>gb|KHN19928.1| Protein FAF-like, chloroplastic [Glycine soja]
Length=552

 Score = 54.3 bits (129),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 72/206 (35%), Positives = 105/206 (51%), Gaps = 43/206 (21%)
 Frame = +1

Query  274  VWKAIQAQKQQGDDHNNNKAPPIRSTVSWSAIILSDQKVDVQDSVP---YIHPllkksss  444
            +W +IQ  K++  + +        +  +WS+I+    K ++  S+P   Y+HPL+K+S S
Sbjct  114  IWSSIQRNKKEEQEKSG-------AFDTWSSIMSLKGKDEISKSMPITPYVHPLVKRSKS  166

Query  445  cclskqslqICTESLGSETGSDCL-------TSQTRDSDHVQDQVQDNKQAHEEEEEDIF  603
            C   K    ICTESLGSETGSD L       +S+T D+D  Q Q Q+ +Q  EEEEE   
Sbjct  167  CLSEKSLE-ICTESLGSETGSDALLFSSYSSSSETGDADAEQQQQQEKEQVKEEEEEG--  223

Query  604  NDVKIKNYskksassfppplps----------------lanssVQLRSHRQGKGEAEGSR  735
             + ++ NY+   A+       S                 ++S   +RSHR      +  R
Sbjct  224  -EEELCNYASVVATKKASASASPPRAFPPPLPSLSHHQASSSVTHMRSHR------DNGR  276

Query  736  LILEAVSVPQRNYFHAERSHGRLLLT  813
            L+LEAVSVP  N F  +R  GRL+LT
Sbjct  277  LVLEAVSVPSHNNFSIQRQDGRLVLT  302



>ref|XP_009763490.1| PREDICTED: protein FANTASTIC FOUR 3-like [Nicotiana sylvestris]
Length=286

 Score = 53.1 bits (126),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 59/154 (38%), Positives = 79/154 (51%), Gaps = 15/154 (10%)
 Frame = +1

Query  412  YIHPllkkssscclskqslqICTESLGSETGSDCLT-----SQTRD-SDHVQDQVQDNKQ  573
            Y+HPL K+ SS  LS++SL +CTE+LG ETG+D +T     S + D S+ VQ Q    K 
Sbjct  86   YVHPLSKQHSSSRLSEKSLALCTENLGCETGTDHITESSIFSFSSDVSNTVQSQSSTTKT  145

Query  574  --AHEEEEEDIFNDVKIKNYskksassfppplpslanssVQLRSHRQGKGEAEGSRLILE  747
                E       N   I N         PP      + S+Q+ +HR      +G RLI++
Sbjct  146  NIRVEYTPSSTTNYKVISNTKISCRKLPPPLTTLRGSHSLQVSTHR------DGGRLIIK  199

Query  748  AVSVPQR-NYFHAERSHGRLLLTALKSPTSSDQQ  846
            AV  P+   Y HAERS+GRL L  LK   SS  +
Sbjct  200  AVEAPKVCTYLHAERSNGRLRLCFLKEYRSSSSK  233



>ref|XP_006340442.1| PREDICTED: protein FAF-like, chloroplastic-like [Solanum tuberosum]
Length=443

 Score = 53.5 bits (127),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 56/172 (33%), Positives = 76/172 (44%), Gaps = 19/172 (11%)
 Frame = +1

Query  337  PIRSTVSWSAIILSDQKVDVQDSV----PYIHPllkkssscclskqslqICTESLGSETG  504
            PI+    WS+I+   +  D  + +    PY+HPL K+S++    K    ICTESLGSETG
Sbjct  28   PIK-IFDWSSILSPSKNEDSSNKLIPTNPYVHPLDKRSTNSLSEKSLE-ICTESLGSETG  85

Query  505  S--DCLTSQTRDSDHVQDQVQDNKQAHEEEEEDIFNDVK-----IKNYskksassfpppl  663
            S  DC  S         D  +DN   +    +  +  V         Y+           
Sbjct  86   SGSDCFPSSPTSEHEGSDDDKDNHHHYHHHHQQQYFVVSESSEDFHVYNHSKRLISSCRS  145

Query  664  pslanssVQLRSHRQGKGEAEGSRLILEAVSVPQRNYFHAERSHGRLLLTAL  819
               +  SV ++SHRQ        RLILEA SV   N  H +R  G LLLT +
Sbjct  146  FPPSLPSVHMQSHRQN------GRLILEAASVSPNNSLHTQRLDGHLLLTLI  191



>emb|CDX70983.1| BnaC03g10670D [Brassica napus]
Length=451

 Score = 53.1 bits (126),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 77/260 (30%), Positives = 118/260 (45%), Gaps = 40/260 (15%)
 Frame = +1

Query  130  GIVSIIVGSDCDE--------SAHRSSNNWLS---------------IQNPSTEEDDDDE  240
            G+V+I+ GS            SA  SS NWL+               + N   +  +  +
Sbjct  21   GVVTILGGSSISSAPSLRRTFSADLSSKNWLTQNGTPPMKRISSSEKLHNFGADSLNSQD  80

Query  241  LMKRRRPGQDEVWKAIQAQKQQGDDHNNNKAPPIRSTVSWSAIILSDQKVDVQDSVP--Y  414
              +  R G D +W    AQ Q+  +    +  P +S V WS+I+   +K    ++VP  Y
Sbjct  81   EEQGSRSGVD-IW----AQIQEDKNKKKEEIEPSQSDV-WSSILSDKKKKTDTETVPPPY  134

Query  415  IHPllkkssscclskqslqICTESLGSETGSDCLTS----QTRDSDH---VQDQVQDNKQ  573
            +HPL+K++SS         ICTESLGSETG +  +S    +T +++    ++  V   ++
Sbjct  135  VHPLVKRASSLSEKSLE--ICTESLGSETGCEGFSSYASSETGEAEENLVLEVTVTKEEE  192

Query  574  AHEEEEEDIFNDVKIKNYskksassfppplpslanssVQLRSHRQGKGEAEGSRLILEAV  753
              E   E     V + N +           P + + S Q  S    K   +  RL+LEAV
Sbjct  193  ETEFVVEVEQEQVTVPNQTSCMELPRGSFPPPIRSLSSQTGSALHMKTRRDNGRLVLEAV  252

Query  754  SVPQRNYFHAERSHGRLLLT  813
            S+P  N F A+R  GRLLLT
Sbjct  253  SMPSHNNFSAKRQDGRLLLT  272



>ref|XP_010101989.1| hypothetical protein L484_016279 [Morus notabilis]
 gb|EXB91209.1| hypothetical protein L484_016279 [Morus notabilis]
Length=568

 Score = 53.5 bits (127),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 84/293 (29%), Positives = 135/293 (46%), Gaps = 64/293 (22%)
 Frame = +1

Query  121  EKGGIVSIIVGSDCDE--------------SAHRSSNNWLS---IQNPSTEEDDDDEL--  243
            EK GIV  I+GSD  +              SA  SS  WL+     +P  +    +EL  
Sbjct  38   EKQGIVVAILGSDDSDRGRACAGASLRRTLSADMSSKKWLAQNGFYSPMKKIASSEELSL  97

Query  244  ----------------MKRRRPGQDEVWKAIQAQKQQGDDHNNNKAPPIRSTVSWSAIIL  375
                                 PG+ ++W +IQ Q ++ +  N       R    WS+I L
Sbjct  98   PALNSFSSSEDEGEEEEDMNCPGELDIWNSIQEQNKRNEKENEKVG---REFDIWSSI-L  153

Query  376  SDQKVDVQDS----VPYIHPllkkssscclskqslqICTESLGSETGSDCLTSQTRDSDH  543
            S ++ D++ S     PYIHPL+K+S+S    K    +CTESLGSETGSD  +S++     
Sbjct  154  SQKEKDIESSKSLPPPYIHPLVKRSASSLSEKSLE-VCTESLGSETGSDGFSSESSSDVE  212

Query  544  VQDQVQDNKQAHEE-------EEEDIFNDVKIKNYskksassfppplpslans-------  681
               +  + ++  +E       + ++ F  VK K YS    S+     P L +        
Sbjct  213  ADSKEDEEEEQQQEKQVLIDGDNQEEFRPVKFKYYSGGRKSAARSFPPPLLSLSRNDGSP  272

Query  682  sVQLRSHRQGKGEAEGSRLILEAVSVPQRNYFHAERSHGRLLLTALKSPTSSD  840
            ++++++ R      +  RL++EAVSV  +  F A+R  GRL+LT + S +++D
Sbjct  273  TLRMQTRR------DNGRLVMEAVSVHSQKNFAAQRRDGRLVLTFVNSASTAD  319



>ref|XP_009789905.1| PREDICTED: protein FANTASTIC FOUR 3-like [Nicotiana sylvestris]
Length=250

 Score = 52.0 bits (123),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 63/188 (34%), Positives = 95/188 (51%), Gaps = 29/188 (15%)
 Frame = +1

Query  259  PGQDEVWKAIQAQKQQGDDHNNNKAPPIRSTVSWSAI-ILSDQKVDVQDSVPYIHPllkk  435
            P ++   ++   Q Q G+D   NK         WS +  L   K D  ++  YIHPL+K+
Sbjct  56   PNEEICVRSNDLQNQHGND---NKG-------GWSFLEALDSAKKDNAENEVYIHPLMKR  105

Query  436  ssscclskqslqICTESLGSETGSDCLTSQTRDSDHVQDQVQDNKQAHEEEEEDIFNDVK  615
            SSS  LS +SL++CTE+LGSETGSD   S   +S  + ++   +     +  E I    +
Sbjct  106  SSSSTLSPKSLEMCTENLGSETGSDISESIEENSCFLSERENSHDVGRSKRREIIKKHYR  165

Query  616  IKNYskksassfppplpslanssVQLRSHRQGKGEAEGSRLILEAVSVPQRNYFHAERSH  795
            I ++          P P  + + VQ+RS R      EG RLIL+A +   ++ F  ER+ 
Sbjct  166  ISSF----------PPPLTSLNVVQVRSQR------EGGRLILKATTC--KSCFQTERAD  207

Query  796  GRLLLTAL  819
            GRL L+ L
Sbjct  208  GRLRLSLL  215



>ref|XP_010651658.1| PREDICTED: protein FAF-like, chloroplastic [Vitis vinifera]
Length=500

 Score = 52.8 bits (125),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 81/289 (28%), Positives = 115/289 (40%), Gaps = 83/289 (29%)
 Frame = +1

Query  118  LEKGGIVSIIVGSDCDESAH----------RSSNNWLSIQNPS-----------------  216
            +EK GIVSI+ GSDC+ +             SS  WL+    S                 
Sbjct  24   IEKQGIVSIL-GSDCERTKAASLRRTLSWDMSSRKWLAQHGFSHMRKIASSQQFIVSAAD  82

Query  217  -----TEEDDDDELMKRRRPGQDEVWKAIQAQKQQGDDHNNNKAPPIRSTVSWSAIILSD  381
                   ED+ +E  +  RPG  + W +I  QK   +   +   P               
Sbjct  83   SSSSSEGEDEYEEGKEVERPGGFQTWSSILTQKGGEESGKSGTLP---------------  127

Query  382  QKVDVQDSVPYIHPllkkssscclskqslqICTESLGSETGSDCLTSQTRDSDHVQD---  552
                    +PY+HPL+K+SSS    K    +CTESLGSETGS+  +S     +  QD   
Sbjct  128  --------LPYVHPLVKRSSSSLSEKSLQ-VCTESLGSETGSEGFSSSANTQEDKQDQQQ  178

Query  553  -------------QVQDNKQAHEE----EEEDIFNDVKIKNYskksassfppplpslans  681
                         + + +    +E    E  D +  V+ +     S     P L      
Sbjct  179  QNQHQQKQQQQQYEKESSSLGKQELTVVERPDNYYSVRKRLQPPSSFPPPLPSLSPTQGP  238

Query  682  sVQLRSHRQGKGEAEGSRLILEAVSVPQRNYFHAERSHGRLLLTALKSP  828
            +V+  +HRQ        RL+LEAVSVP +N F A+R  GRL+LT    P
Sbjct  239  NVRFHTHRQN------GRLVLEAVSVPTQNCFQAQRHGGRLVLTFANIP  281



>emb|CAN72229.1| hypothetical protein VITISV_024734 [Vitis vinifera]
Length=500

 Score = 52.4 bits (124),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 64/211 (30%), Positives = 89/211 (42%), Gaps = 50/211 (24%)
 Frame = +1

Query  256  RPGQDEVWKAIQAQKQQGDDHNNNKAPPIRSTVSWSAIILSDQKVDVQDSVPYIHPllkk  435
            RPG  + W +I  QK   +   +   P                       +PY+HPL+K+
Sbjct  101  RPGGFQTWSSILTQKGGEESGKSGTLP-----------------------LPYVHPLVKR  137

Query  436  ssscclskqslqICTESLGSETGSDCLTSQTRDSDHVQDQVQDNKQAHEE----------  585
            SSS    K    +CTESLGSETGS+  +S     +  QDQ Q N+   ++          
Sbjct  138  SSSSLSEKSLQ-VCTESLGSETGSEGFSSSANTQEDKQDQQQQNQHQQKQQQQQYEKESS  196

Query  586  ----------EEEDIFNDVKIKNYskksassfppplpslanssVQLRSHRQGKGEAEGSR  735
                      E  D +  V+ +     S     P L      +V+  +HRQ        R
Sbjct  197  SLGKQELTVVERPDNYYSVRKRLQPPSSFPPPLPSLSPTQGPNVRFHTHRQN------GR  250

Query  736  LILEAVSVPQRNYFHAERSHGRLLLTALKSP  828
            L+LEAVSVP +N F A+R  GRL+LT    P
Sbjct  251  LVLEAVSVPTQNCFQAQRHGGRLVLTFANIP  281



>ref|XP_009131857.1| PREDICTED: protein FAF-like, chloroplastic [Brassica rapa]
Length=451

 Score = 52.0 bits (123),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 80/261 (31%), Positives = 116/261 (44%), Gaps = 42/261 (16%)
 Frame = +1

Query  130  GIVSIIVGSDCDE--------SAHRSSNNWLSIQN--PSTEEDDDDELMKR---------  252
            GIV+I+ GS            SA  SS NWL+ QN  P  +     E +           
Sbjct  21   GIVTILGGSSISSAPSLRRTFSADLSSKNWLT-QNGTPPMKRISSSEKLHNFGADSLNSQ  79

Query  253  -----RRPGQDEVWKAIQAQKQQGDDHNNNKAPPIRSTVSWSAIILSDQKVDVQDSVP--  411
                  R G D +W  IQ  K + +        P ++ V WS+I+   +K    ++VP  
Sbjct  80   DEEHGSRSGVD-IWTQIQEDKNKKEHETE----PSQTDV-WSSILSDKKKKTDTETVPPP  133

Query  412  YIHPllkkssscclskqslqICTESLGSETGSDCLTS----QTRDSDH---VQDQVQDNK  570
            Y+HPL+K++SS         ICTESLGSETG +  +S    +T +++    ++  V   +
Sbjct  134  YVHPLVKRASSLSEKSLE--ICTESLGSETGCEGFSSYASSETGEAEENLVLEVTVTKEE  191

Query  571  QAHEEEEEDIFNDVKIKNYskksassfppplpslanssVQLRSHRQGKGEAEGSRLILEA  750
            +  E   E     V + N             P + + S Q  S    K   +  RL+LEA
Sbjct  192  EETEFVVEVEQEQVTVPNQISCMEMPRGSFPPPIRSLSSQSGSALHMKTRRDNGRLVLEA  251

Query  751  VSVPQRNYFHAERSHGRLLLT  813
            VS+P  N F A+R  GRLLLT
Sbjct  252  VSMPSHNNFSAKRQDGRLLLT  272



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 3380901351172