BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c80485_g1_i1 len=730 path=[708:0-729]

Length=730
                                                                      Score     E

ref|XP_011000047.1|  PREDICTED: ethylene-responsive transcription...    181   3e-53   
ref|XP_008459604.1|  PREDICTED: ethylene-responsive transcription...    180   1e-52   
ref|XP_004141635.1|  PREDICTED: ethylene-responsive transcription...    178   9e-52   
ref|XP_006376158.1|  AP2 domain-containing transcription factor f...    177   2e-51   
ref|XP_011001613.1|  PREDICTED: ethylene-responsive transcription...    177   2e-51   
ref|XP_002304195.1|  AP2 domain-containing transcription factor f...    173   5e-50   Populus trichocarpa [western balsam poplar]
ref|XP_002325520.2|  AP2 domain-containing transcription factor f...    173   5e-50   Populus trichocarpa [western balsam poplar]
ref|XP_006363865.1|  PREDICTED: ethylene-responsive transcription...    172   1e-49   
ref|XP_009619745.1|  PREDICTED: ethylene-responsive transcription...    172   2e-49   
ref|XP_011005171.1|  PREDICTED: ethylene-responsive transcription...    169   2e-48   
ref|XP_009783971.1|  PREDICTED: ethylene-responsive transcription...    165   7e-47   
ref|XP_004250806.1|  PREDICTED: ethylene-responsive transcription...    164   1e-46   
ref|XP_010245720.1|  PREDICTED: ethylene-responsive transcription...    163   2e-45   
ref|XP_011005172.1|  PREDICTED: ethylene-responsive transcription...    160   6e-45   
ref|XP_007223585.1|  hypothetical protein PRUPE_ppa012354mg             159   7e-45   
ref|XP_008219098.1|  PREDICTED: ethylene-responsive transcription...    159   8e-45   
ref|XP_009757757.1|  PREDICTED: ethylene-responsive transcription...    159   8e-45   
gb|KHN25590.1|  Ethylene-responsive transcription factor ERF021         160   9e-45   
ref|XP_007019866.1|  Integrase-type DNA-binding superfamily protein     160   1e-44   
ref|XP_006441646.1|  hypothetical protein CICLE_v10024063mg             159   1e-44   
ref|XP_010478801.1|  PREDICTED: ethylene-responsive transcription...    159   2e-44   
ref|XP_002534488.1|  DNA binding protein, putative                      159   3e-44   Ricinus communis
ref|XP_009357202.1|  PREDICTED: ethylene-responsive transcription...    158   3e-44   
ref|XP_002534096.1|  DNA binding protein, putative                      159   4e-44   Ricinus communis
ref|XP_006376157.1|  hypothetical protein POPTR_0013s10330g             158   5e-44   
gb|ABQ62982.1|  TINY-like protein                                       158   5e-44   Populus trichocarpa [western balsam poplar]
ref|XP_002325519.1|  hypothetical protein POPTR_0019s10420g             157   5e-44   Populus trichocarpa [western balsam poplar]
ref|XP_009613409.1|  PREDICTED: ethylene-responsive transcription...    157   6e-44   
ref|XP_004299858.1|  PREDICTED: ethylene-responsive transcription...    157   1e-43   
ref|XP_008339085.1|  PREDICTED: ethylene-responsive transcription...    156   2e-43   
ref|XP_006441645.1|  hypothetical protein CICLE_v10023857mg             156   2e-43   
gb|KDO51736.1|  hypothetical protein CISIN_1g035756mg                   156   2e-43   
gb|KDP45624.1|  hypothetical protein JCGZ_17231                         155   6e-43   
ref|XP_011000046.1|  PREDICTED: ethylene-responsive transcription...    155   7e-43   
gb|KDP45622.1|  hypothetical protein JCGZ_17229                         155   7e-43   
ref|XP_004141634.1|  PREDICTED: ethylene-responsive transcription...    153   1e-42   
ref|XP_010501761.1|  PREDICTED: ethylene-responsive transcription...    154   1e-42   
ref|XP_002299698.1|  hypothetical protein POPTR_0001s18180g             154   1e-42   Populus trichocarpa [western balsam poplar]
ref|XP_004511477.1|  PREDICTED: ethylene-responsive transcription...    154   3e-42   
ref|XP_002275853.1|  PREDICTED: ethylene-responsive transcription...    152   5e-42   Vitis vinifera
ref|XP_004250714.1|  PREDICTED: ethylene-responsive transcription...    151   7e-42   
ref|XP_006363854.1|  PREDICTED: ethylene-responsive transcription...    151   7e-42   
ref|XP_006478382.1|  PREDICTED: ethylene-responsive transcription...    152   9e-42   
ref|XP_010104523.1|  Ethylene-responsive transcription factor           152   1e-41   
ref|XP_003610923.1|  Ethylene-responsive transcription factor           152   1e-41   
ref|XP_009335466.1|  PREDICTED: ethylene-responsive transcription...    151   2e-41   
ref|XP_011007591.1|  PREDICTED: ethylene-responsive transcription...    150   3e-41   
ref|XP_010521097.1|  PREDICTED: ethylene-responsive transcription...    150   3e-41   
ref|XP_008378774.1|  PREDICTED: ethylene-responsive transcription...    150   5e-41   
ref|XP_007157007.1|  hypothetical protein PHAVU_002G035900g             150   6e-41   
ref|XP_008459595.1|  PREDICTED: ethylene-responsive transcription...    149   7e-41   
ref|XP_009105814.1|  PREDICTED: ethylene-responsive transcription...    149   7e-41   
emb|CDX72808.1|  BnaC06g32560D                                          149   1e-40   
ref|XP_007019867.1|  Integrase-type DNA-binding superfamily protein     149   2e-40   
ref|XP_006573841.1|  PREDICTED: ethylene-responsive transcription...    148   2e-40   
ref|XP_010471159.1|  PREDICTED: ethylene-responsive transcription...    148   2e-40   
ref|XP_002887374.1|  hypothetical protein ARALYDRAFT_476276             148   3e-40   
ref|XP_003538666.1|  PREDICTED: ethylene-responsive transcription...    148   3e-40   
emb|CDX68310.1|  BnaA07g23500D                                          147   5e-40   
gb|KHN34158.1|  Ethylene-responsive transcription factor ERF021         147   9e-40   
ref|XP_010427981.1|  PREDICTED: ethylene-responsive transcription...    147   9e-40   
ref|XP_009104913.1|  PREDICTED: ethylene-responsive transcription...    147   9e-40   
ref|XP_010415854.1|  PREDICTED: ethylene-responsive transcription...    146   1e-39   
ref|NP_177301.1|  ethylene-responsive transcription factor ERF021       146   1e-39   Arabidopsis thaliana [mouse-ear cress]
emb|CDY36693.1|  BnaCnng07950D                                          146   1e-39   
ref|XP_006301876.1|  hypothetical protein CARUB_v10022349mg             145   3e-39   
ref|XP_010645899.1|  PREDICTED: ethylene-responsive transcription...    145   4e-39   
emb|CDY03695.1|  BnaA02g15420D                                          144   1e-38   
ref|XP_003517540.2|  PREDICTED: ethylene-responsive transcription...    144   2e-38   
ref|XP_007157008.1|  hypothetical protein PHAVU_002G036000g             145   3e-38   
gb|AFJ14636.1|  dehydration-responsive element-binding protein (D...    143   4e-38   
ref|XP_006390770.1|  hypothetical protein EUTSA_v10019659mg             142   4e-38   
ref|XP_008368126.1|  PREDICTED: ethylene-responsive transcription...    142   7e-38   
ref|XP_008339089.1|  PREDICTED: ethylene-responsive transcription...    142   1e-37   
dbj|BAF47188.1|  embryonic element binding Factor 2                     140   1e-37   Daucus carota [carrots]
gb|KFK41579.1|  hypothetical protein AALP_AA2G147200                    141   1e-37   
ref|XP_009127865.1|  PREDICTED: ethylene-responsive transcription...    141   1e-37   
ref|XP_003610926.1|  Ethylene-responsive transcription factor           141   1e-37   
ref|XP_008339090.1|  PREDICTED: ethylene-responsive transcription...    141   1e-37   
ref|XP_010064857.1|  PREDICTED: ethylene-responsive transcription...    140   3e-37   
emb|CDY65867.1|  BnaCnng48950D                                          140   4e-37   
ref|XP_010683050.1|  PREDICTED: ethylene-responsive transcription...    139   7e-37   
ref|XP_009357206.1|  PREDICTED: ethylene-responsive transcription...    139   1e-36   
ref|XP_007227241.1|  hypothetical protein PRUPE_ppa018178mg             139   1e-36   
ref|XP_006303802.1|  hypothetical protein CARUB_v10012215mg             137   4e-36   
gb|KFK45096.1|  hypothetical protein AALP_AA1G343100                    136   6e-36   
ref|XP_006306164.1|  hypothetical protein CARUB_v10011715mg             136   6e-36   
ref|XP_009114787.1|  PREDICTED: ethylene-responsive transcription...    135   3e-35   
ref|XP_010912689.1|  PREDICTED: ethylene-responsive transcription...    134   3e-35   
ref|XP_010499915.1|  PREDICTED: ethylene-responsive transcription...    134   4e-35   
ref|XP_008219101.1|  PREDICTED: ethylene-responsive transcription...    135   5e-35   
emb|CDY15285.1|  BnaC06g07710D                                          134   6e-35   
ref|NP_174636.1|  ethylene-responsive transcription factor ERF022       134   8e-35   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004301452.1|  PREDICTED: ethylene-responsive transcription...    134   8e-35   
ref|XP_004511478.1|  PREDICTED: ethylene-responsive transcription...    132   3e-34   
ref|XP_002891059.1|  hypothetical protein ARALYDRAFT_890960             132   4e-34   
ref|XP_006415065.1|  hypothetical protein EUTSA_v10010002mg             130   2e-33   
emb|CDX91796.1|  BnaC08g07150D                                          129   4e-33   
ref|XP_010930490.1|  PREDICTED: ethylene-responsive transcription...    127   3e-32   
gb|KCW69539.1|  hypothetical protein EUGRSUZ_F02975                     126   7e-32   
ref|XP_010062394.1|  PREDICTED: ethylene-responsive transcription...    126   8e-32   
ref|XP_010062393.1|  PREDICTED: ethylene-responsive transcription...    125   2e-31   
dbj|BAF47187.1|  embryonic element binding Factor 1                     123   4e-31   Daucus carota [carrots]
ref|XP_011098959.1|  PREDICTED: ethylene-responsive transcription...    123   7e-31   
ref|XP_008795312.1|  PREDICTED: ethylene-responsive transcription...    121   5e-30   
ref|XP_010530109.1|  PREDICTED: ethylene-responsive transcription...    120   1e-29   
ref|XP_009390148.1|  PREDICTED: ethylene-responsive transcription...    119   2e-29   
ref|XP_008786418.1|  PREDICTED: ethylene-responsive transcription...    117   1e-28   
ref|XP_009413420.1|  PREDICTED: ethylene-responsive transcription...    116   2e-28   
ref|XP_009151478.1|  PREDICTED: ethylene-responsive transcription...    115   6e-28   
ref|XP_009405186.1|  PREDICTED: ethylene-responsive transcription...    112   1e-26   
ref|XP_004979006.1|  PREDICTED: ethylene-responsive transcription...    112   2e-26   
ref|XP_002449280.1|  hypothetical protein SORBIDRAFT_05g007135          110   1e-25   Sorghum bicolor [broomcorn]
ref|NP_001151893.1|  CBF-like protein                                   110   1e-25   Zea mays [maize]
gb|AFW60540.1|  putative AP2/EREBP transcription factor superfami...    109   3e-25   
ref|XP_010542755.1|  PREDICTED: ethylene-responsive transcription...    108   3e-25   
ref|XP_009383447.1|  PREDICTED: ethylene-responsive transcription...    107   7e-25   
gb|AFG71231.1|  hypothetical protein UMN_6348_01                        106   8e-25   
gb|AEW09361.1|  hypothetical protein UMN_6348_01                        105   1e-24   
gb|EMT09265.1|  Ethylene-responsive transcription factor ERF021         107   1e-24   
ref|XP_003576119.1|  PREDICTED: ethylene-responsive transcription...    106   2e-24   
ref|XP_009125819.1|  PREDICTED: dehydration-responsive element-bi...    107   3e-24   
gb|EAY80480.1|  hypothetical protein OsI_35658                          105   3e-24   Oryza sativa Indica Group [Indian rice]
emb|CDX85705.1|  BnaA02g01080D                                          106   5e-24   
gb|KHN11642.1|  Dehydration-responsive element-binding protein 3        104   6e-24   
emb|CDY27827.1|  BnaC09g28540D                                          106   6e-24   
ref|XP_003534428.2|  PREDICTED: dehydration-responsive element-bi...    105   8e-24   
gb|KFK32565.1|  hypothetical protein AALP_AA6G259700                    103   2e-23   
ref|XP_006399666.1|  hypothetical protein EUTSA_v10015895mg             105   2e-23   
ref|XP_009121933.1|  PREDICTED: dehydration-responsive element-bi...    104   4e-23   
emb|CDX69746.1|  BnaA10g20950D                                          104   4e-23   
ref|XP_004252501.1|  PREDICTED: dehydration-responsive element-bi...    102   4e-23   
gb|AAX95397.1|  AP2 domain, putative                                    103   4e-23   Oryza sativa Japonica Group [Japonica rice]
emb|CDX97125.1|  BnaC09g45000D                                          104   4e-23   
ref|XP_004501158.1|  PREDICTED: dehydration-responsive element-bi...    102   4e-23   
gb|KFK25419.1|  hypothetical protein AALP_AA8G112500                    103   5e-23   
ref|XP_006836896.1|  hypothetical protein AMTR_s00099p00122430          102   5e-23   
ref|XP_008458661.1|  PREDICTED: dehydration-responsive element-bi...    104   5e-23   
ref|XP_011007489.1|  PREDICTED: ethylene-responsive transcription...    102   5e-23   
ref|XP_004975709.1|  PREDICTED: ethylene-responsive transcription...    103   6e-23   
emb|CDY66961.1|  BnaC09g50850D                                          103   6e-23   
ref|XP_010419734.1|  PREDICTED: dehydration-responsive element-bi...    103   6e-23   
ref|XP_009136807.1|  PREDICTED: ethylene-responsive transcription...    102   6e-23   
ref|XP_002873522.1|  hypothetical protein ARALYDRAFT_487996             103   6e-23   
ref|XP_004291182.1|  PREDICTED: dehydration-responsive element-bi...    103   6e-23   
emb|CAN74967.1|  hypothetical protein VITISV_038047                     100   7e-23   Vitis vinifera
ref|XP_006289586.1|  hypothetical protein CARUB_v10003136mg             103   7e-23   
ref|XP_006426907.1|  hypothetical protein CICLE_v10027587mg             103   7e-23   
ref|XP_006465666.1|  PREDICTED: ethylene-responsive transcription...    103   7e-23   
ref|XP_010677077.1|  PREDICTED: ethylene-responsive transcription...    103   7e-23   
ref|XP_004139438.1|  PREDICTED: dehydration-responsive element-bi...    103   8e-23   
gb|KDO56992.1|  hypothetical protein CISIN_1g038538mg                   103   8e-23   
ref|XP_004494833.1|  PREDICTED: ethylene-responsive transcription...    101   8e-23   
ref|XP_002523328.1|  Transcriptional factor TINY, putative              102   9e-23   Ricinus communis
emb|CDX75287.1|  BnaA01g04150D                                          102   1e-22   
emb|CDX68891.1|  BnaC01g05620D                                          102   1e-22   
ref|XP_002516502.1|  Transcriptional factor TINY, putative              103   1e-22   Ricinus communis
gb|ABQ62979.1|  TINY-like protein                                       102   1e-22   Populus trichocarpa [western balsam poplar]
emb|CDX77012.1|  BnaC04g38070D                                          102   1e-22   
gb|KDP28475.1|  hypothetical protein JCGZ_14246                         102   1e-22   
ref|XP_009138144.1|  PREDICTED: ethylene-responsive transcription...    102   1e-22   
gb|KEH36063.1|  AP2 domain class transcription factor                   101   1e-22   
ref|XP_003635248.1|  PREDICTED: ethylene-responsive transcription...    102   1e-22   
ref|XP_009140700.1|  PREDICTED: ethylene-responsive transcription...    102   1e-22   
ref|NP_196720.1|  dehydration-responsive element-binding protein 3      102   1e-22   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006388007.1|  hypothetical protein POPTR_0409s00200g             102   1e-22   
ref|XP_011031921.1|  PREDICTED: ethylene-responsive transcription...    102   1e-22   
ref|XP_002303364.1|  hypothetical protein POPTR_0003s07700g             102   1e-22   Populus trichocarpa [western balsam poplar]
ref|XP_009790153.1|  PREDICTED: ethylene-responsive transcription...    101   1e-22   
ref|XP_011048423.1|  PREDICTED: ethylene-responsive transcription...    102   1e-22   
ref|XP_004301177.1|  PREDICTED: ethylene-responsive transcription...    102   1e-22   
gb|EYU38883.1|  hypothetical protein MIMGU_mgv1a014821mg                101   1e-22   
ref|XP_011023164.1|  PREDICTED: ethylene-responsive transcription...    101   1e-22   
ref|XP_010691437.1|  PREDICTED: ethylene-responsive transcription...    102   1e-22   
emb|CDY13503.1|  BnaA03g52210D                                          102   2e-22   
gb|EPS58378.1|  hypothetical protein M569_16436                       98.6    2e-22   
gb|ACJ84469.1|  unknown                                                 101   2e-22   Medicago truncatula
ref|XP_009350478.1|  PREDICTED: ethylene-responsive transcription...    102   2e-22   
emb|CDY19794.1|  BnaA09g04470D                                          102   2e-22   
ref|XP_009111677.1|  PREDICTED: ethylene-responsive transcription...    102   2e-22   
ref|XP_006368997.1|  hypothetical protein POPTR_0001s15550g             102   2e-22   
gb|ABQ62971.1|  TINY-like protein                                       102   2e-22   Populus trichocarpa [western balsam poplar]
ref|XP_009125436.1|  PREDICTED: ethylene-responsive transcription...    102   2e-22   
ref|XP_007215988.1|  hypothetical protein PRUPE_ppa011735mg             101   2e-22   
ref|XP_008234474.1|  PREDICTED: dehydration-responsive element-bi...    102   3e-22   
ref|XP_002320204.1|  AP2 domain-containing transcription factor f...    101   3e-22   Populus trichocarpa [western balsam poplar]
ref|XP_008462760.1|  PREDICTED: ethylene-responsive transcription...    102   3e-22   
gb|ADE41141.1|  AP2 domain class transcription factor                   102   3e-22   
ref|NP_563624.1|  ethylene-responsive transcription factor ERF023       100   3e-22   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011001450.1|  PREDICTED: ethylene-responsive transcription...    102   3e-22   
gb|AAF97326.1|AC023628_7  Similar to transcription factor TINY          100   3e-22   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004148719.1|  PREDICTED: LOW QUALITY PROTEIN: dehydration-...    101   3e-22   
ref|XP_002991098.1|  hypothetical protein SELMODRAFT_71661            99.8    4e-22   
ref|XP_004161329.1|  PREDICTED: dehydration-responsive element-bi...    101   4e-22   
ref|XP_003520876.1|  PREDICTED: ethylene-responsive transcription...    100   4e-22   
gb|AAM63508.1|  transcription factor TINY, putative                     100   4e-22   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008353703.1|  PREDICTED: ethylene-responsive transcription...    101   4e-22   
ref|XP_009377993.1|  PREDICTED: ethylene-responsive transcription...    101   4e-22   
ref|XP_006345621.1|  PREDICTED: ethylene-responsive transcription...    100   5e-22   
ref|XP_009108829.1|  PREDICTED: ethylene-responsive transcription...    101   5e-22   
ref|XP_004136219.1|  PREDICTED: ethylene-responsive transcription...    100   5e-22   
ref|XP_010278525.1|  PREDICTED: ethylene-responsive transcription...    100   5e-22   
gb|KFK22266.1|  hypothetical protein AALP_AAs66747U002200               100   5e-22   
ref|XP_006340419.1|  PREDICTED: ethylene-responsive transcription...  99.8    5e-22   
ref|XP_002991657.1|  hypothetical protein SELMODRAFT_71659            99.4    6e-22   
emb|CDX72373.1|  BnaC07g43950D                                          100   6e-22   
ref|XP_009782186.1|  PREDICTED: ethylene-responsive transcription...    102   6e-22   
ref|XP_004162335.1|  PREDICTED: ethylene-responsive transcription...    100   6e-22   
gb|AES87852.2|  DNA-binding domain protein                              100   6e-22   
emb|CDY45018.1|  BnaA08g12010D                                          100   7e-22   
ref|XP_009400894.1|  PREDICTED: ethylene-responsive transcription...    100   7e-22   
ref|XP_008448820.1|  PREDICTED: ethylene-responsive transcription...    100   7e-22   
ref|NP_197953.1|  ethylene-responsive transcription factor TINY         100   9e-22   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010049108.1|  PREDICTED: ethylene-responsive transcription...    100   9e-22   
gb|KCW79144.1|  hypothetical protein EUGRSUZ_C00590                   99.0    9e-22   
ref|XP_006394830.1|  hypothetical protein EUTSA_v10004870mg             100   9e-22   
emb|CDY35334.1|  BnaA04g15130D                                        99.8    9e-22   
ref|XP_010421439.1|  PREDICTED: ethylene-responsive transcription...    100   1e-21   
ref|XP_010454922.1|  PREDICTED: ethylene-responsive transcription...    100   1e-21   
ref|XP_006371370.1|  hypothetical protein POPTR_0019s09530g             100   1e-21   
ref|XP_006412430.1|  hypothetical protein EUTSA_v10026204mg           99.8    1e-21   
ref|XP_009353569.1|  PREDICTED: ethylene-responsive transcription...    100   1e-21   
ref|XP_009367456.1|  PREDICTED: ethylene-responsive transcription...    100   1e-21   
ref|XP_008228463.1|  PREDICTED: ethylene-responsive transcription...    100   1e-21   
ref|XP_010493837.1|  PREDICTED: ethylene-responsive transcription...  99.8    1e-21   
ref|XP_010538410.1|  PREDICTED: ethylene-responsive transcription...  99.0    1e-21   
ref|XP_006294983.1|  hypothetical protein CARUB_v10024051mg           99.8    1e-21   
ref|XP_002263994.1|  PREDICTED: ethylene-responsive transcription...  99.4    1e-21   Vitis vinifera
gb|EYU27280.1|  hypothetical protein MIMGU_mgv1a026082mg              97.8    1e-21   
ref|XP_009801170.1|  PREDICTED: dehydration-responsive element-bi...  99.0    1e-21   
ref|XP_009151103.1|  PREDICTED: ethylene-responsive transcription...  99.8    1e-21   
ref|XP_008220077.1|  PREDICTED: dehydration-responsive element-bi...    100   1e-21   
ref|XP_002889375.1|  hypothetical protein ARALYDRAFT_470149           99.0    1e-21   
ref|XP_010660384.1|  PREDICTED: ethylene-responsive transcription...  99.8    1e-21   
ref|XP_006289163.1|  hypothetical protein CARUB_v10002601mg           99.8    1e-21   
gb|KCW79102.1|  hypothetical protein EUGRSUZ_C00546                   99.8    2e-21   
ref|XP_008348502.1|  PREDICTED: ethylene-responsive transcription...    100   2e-21   
ref|XP_010447343.1|  PREDICTED: ethylene-responsive transcription...  99.8    2e-21   
ref|XP_006836818.1|  hypothetical protein AMTR_s00099p00039760        99.0    2e-21   
ref|XP_008354031.1|  PREDICTED: ethylene-responsive transcription...  98.6    2e-21   
ref|XP_010696241.1|  PREDICTED: ethylene-responsive transcription...  98.6    2e-21   
gb|AFG61639.1|  hypothetical protein 0_14481_01                       97.8    2e-21   
ref|XP_002878890.1|  transcription factor                             99.4    2e-21   
ref|XP_010266557.1|  PREDICTED: ethylene-responsive transcription...  98.6    2e-21   
ref|XP_010324621.1|  PREDICTED: dehydration-responsive element-bi...  99.8    2e-21   
ref|XP_007225774.1|  hypothetical protein PRUPE_ppa009533mg             100   2e-21   
ref|XP_010526108.1|  PREDICTED: ethylene-responsive transcription...    100   2e-21   
ref|XP_004165656.1|  PREDICTED: ethylene-responsive transcription...  99.4    2e-21   
ref|XP_004515795.1|  PREDICTED: ethylene-responsive transcription...  97.8    2e-21   
ref|NP_195006.1|  ethylene-responsive transcription factor ERF043     99.0    2e-21   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002869242.1|  hypothetical protein ARALYDRAFT_913157           99.4    2e-21   
ref|XP_010047241.1|  PREDICTED: LOW QUALITY PROTEIN: dehydration-...  99.8    2e-21   
ref|XP_008378086.1|  PREDICTED: ethylene-responsive transcription...  99.8    2e-21   
emb|CDY72344.1|  BnaCnng77210D                                        98.2    2e-21   
ref|XP_006491479.1|  PREDICTED: ethylene-responsive transcription...  98.2    2e-21   
ref|XP_006282817.1|  hypothetical protein CARUB_v10006567mg           99.4    2e-21   
ref|XP_006414307.1|  hypothetical protein EUTSA_v10026276mg           98.6    2e-21   
ref|XP_002976278.1|  hypothetical protein SELMODRAFT_26594            97.8    2e-21   
ref|XP_010264388.1|  PREDICTED: ethylene-responsive transcription...    100   2e-21   
gb|EPS74111.1|  hypothetical protein M569_00645                       95.5    2e-21   
gb|AFG61640.1|  hypothetical protein 0_14481_01                       97.4    2e-21   
ref|XP_002880148.1|  hypothetical protein ARALYDRAFT_483623             100   2e-21   
emb|CDY09667.1|  BnaC07g33940D                                        98.2    2e-21   
ref|XP_002868104.1|  hypothetical protein ARALYDRAFT_493200           97.8    3e-21   
ref|NP_193408.1|  ethylene-responsive transcription factor ERF039     97.8    3e-21   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006440269.1|  hypothetical protein CICLE_v10024602mg             100   3e-21   
gb|KHN34916.1|  Dehydration-responsive element-binding protein 3      98.6    3e-21   
ref|XP_007219742.1|  hypothetical protein PRUPE_ppa026139mg           97.8    3e-21   
ref|XP_009145506.1|  PREDICTED: ethylene-responsive transcription...  97.8    3e-21   
emb|CAN72553.1|  hypothetical protein VITISV_015791                   99.4    3e-21   Vitis vinifera
ref|XP_006282732.1|  hypothetical protein CARUB_v10005867mg           97.8    3e-21   
ref|XP_010440105.1|  PREDICTED: ethylene-responsive transcription...  97.8    3e-21   
gb|KHN04233.1|  Dehydration-responsive element-binding protein 3      98.6    3e-21   
gb|KDO61383.1|  hypothetical protein CISIN_1g023148mg                 99.4    3e-21   
ref|XP_003529759.1|  PREDICTED: dehydration-responsive element-bi...  98.6    3e-21   
ref|XP_010432660.1|  PREDICTED: ethylene-responsive transcription...  99.0    3e-21   
gb|KFK27825.1|  hypothetical protein AALP_AA8G434600                  98.2    3e-21   
emb|CDX84176.1|  BnaC04g09380D                                        98.2    3e-21   
gb|KFK36467.1|  hypothetical protein AALP_AA4G128400                  97.8    3e-21   
ref|XP_002987168.1|  hypothetical protein SELMODRAFT_26604            97.8    3e-21   
ref|XP_002280555.2|  PREDICTED: dehydration-responsive element-bi...  99.4    3e-21   
ref|XP_007051526.1|  Integrase-type DNA-binding superfamily protein   97.8    4e-21   
ref|XP_006410739.1|  hypothetical protein EUTSA_v10017258mg           98.2    4e-21   
emb|CDP03277.1|  unnamed protein product                              99.8    4e-21   
gb|ABA54280.1|  transcription factor DREBIII-2                        98.2    4e-21   
ref|XP_006477148.1|  PREDICTED: ethylene-responsive transcription...  99.4    4e-21   
gb|KDO61381.1|  hypothetical protein CISIN_1g023148mg                 99.4    4e-21   
gb|KDO61382.1|  hypothetical protein CISIN_1g023148mg                 99.4    4e-21   
ref|XP_003610917.1|  Ethylene-responsive transcription factor         97.4    4e-21   
emb|CAD41044.1|  OSJNBa0058G03.2                                      97.4    4e-21   
gb|ABA54281.1|  transcription factor DREBIII-3                        97.8    4e-21   
ref|XP_010437852.1|  PREDICTED: ethylene-responsive transcription...  98.2    4e-21   
emb|CDX80539.1|  BnaC07g29050D                                        98.2    4e-21   
ref|XP_006444825.1|  hypothetical protein CICLE_v10022410mg           97.4    5e-21   
ref|XP_008347178.1|  PREDICTED: ethylene-responsive transcription...  97.4    5e-21   
ref|XP_002515992.1|  Transcriptional factor TINY, putative            98.6    5e-21   
ref|XP_004147220.1|  PREDICTED: ethylene-responsive transcription...  97.8    5e-21   
ref|NP_001151300.1|  dehydration-responsive element-binding prote...  98.6    5e-21   
gb|ADE41137.1|  AP2 domain class transcription factor                 98.6    5e-21   
ref|XP_009375406.1|  PREDICTED: ethylene-responsive transcription...  97.4    5e-21   
ref|XP_003538748.1|  PREDICTED: dehydration-responsive element-bi...  97.4    5e-21   
ref|XP_008678900.1|  PREDICTED: ethylene-responsive transcription...  98.6    5e-21   
ref|XP_010688291.1|  PREDICTED: ethylene-responsive transcription...  99.0    6e-21   
ref|XP_011078266.1|  PREDICTED: ethylene-responsive transcription...  98.6    6e-21   
ref|XP_011091185.1|  PREDICTED: ethylene-responsive transcription...  98.2    6e-21   
ref|XP_008233130.1|  PREDICTED: ethylene-responsive transcription...  97.4    6e-21   
ref|XP_010434773.1|  PREDICTED: ethylene-responsive transcription...  97.1    6e-21   
ref|XP_003605655.1|  Ethylene-responsive transcription factor           100   7e-21   
ref|XP_007218312.1|  hypothetical protein PRUPE_ppa010935mg           97.8    7e-21   
ref|NP_001235341.1|  dehydration-responsive element binding prote...  97.8    7e-21   
ref|XP_003581277.1|  PREDICTED: ethylene-responsive transcription...  97.1    7e-21   
ref|XP_004953341.1|  PREDICTED: dehydration-responsive element-bi...  98.2    8e-21   
ref|XP_004302874.1|  PREDICTED: dehydration-responsive element-bi...  98.2    8e-21   
ref|XP_008393869.1|  PREDICTED: dehydration-responsive element-bi...  97.8    1e-20   
ref|XP_004512200.1|  PREDICTED: ethylene-responsive transcription...  97.4    1e-20   
ref|XP_010518106.1|  PREDICTED: ethylene-responsive transcription...  98.2    1e-20   
gb|KFK29897.1|  hypothetical protein AALP_AA7G192600                  97.1    1e-20   
gb|KFK38980.1|  hypothetical protein AALP_AA3G184500                  97.4    1e-20   
ref|XP_010267583.1|  PREDICTED: ethylene-responsive transcription...  96.3    1e-20   
ref|XP_006345609.1|  PREDICTED: ethylene-responsive transcription...  96.7    1e-20   
ref|XP_004508937.1|  PREDICTED: ethylene-responsive transcription...  97.4    1e-20   
ref|XP_006353483.1|  PREDICTED: ethylene-responsive transcription...  98.2    1e-20   
ref|XP_004308302.1|  PREDICTED: ethylene-responsive transcription...  96.7    1e-20   
dbj|BAB01268.1|  transcription factor TINY-like protein               97.4    1e-20   
ref|XP_010542218.1|  PREDICTED: ethylene-responsive transcription...  97.1    1e-20   
ref|NP_188249.3|  ethylene-responsive transcription factor ERF036     97.1    1e-20   
ref|XP_002879568.1|  hypothetical protein ARALYDRAFT_482537           96.3    1e-20   
ref|NP_181113.1|  ethylene-responsive transcription factor ERF038     96.3    1e-20   
gb|AEM63548.1|  dehydration-responsive element-binding protein DREB1  96.7    1e-20   
ref|XP_006295043.1|  hypothetical protein CARUB_v10024111mg           96.3    1e-20   
ref|XP_011093630.1|  PREDICTED: ethylene-responsive transcription...  97.1    2e-20   
ref|XP_006359467.1|  PREDICTED: dehydration-responsive element-bi...  96.7    2e-20   
gb|ABK28523.1|  unknown                                               96.3    2e-20   
emb|CDY42937.1|  BnaA01g18170D                                        95.9    2e-20   
ref|XP_010254012.1|  PREDICTED: ethylene-responsive transcription...  97.1    2e-20   
ref|XP_010480467.1|  PREDICTED: ethylene-responsive transcription...  95.9    2e-20   
gb|KDP33726.1|  hypothetical protein JCGZ_07297                       97.1    2e-20   
ref|XP_010516772.1|  PREDICTED: ethylene-responsive transcription...  95.9    2e-20   
ref|XP_009118804.1|  PREDICTED: ethylene-responsive transcription...  95.9    2e-20   
gb|AAW28084.1|  transcription factor DREBIII-1                        96.3    2e-20   
ref|XP_002882995.1|  hypothetical protein ARALYDRAFT_897935           96.7    2e-20   
ref|XP_010542217.1|  PREDICTED: ethylene-responsive transcription...  96.7    2e-20   
gb|KDO49961.1|  hypothetical protein CISIN_1g0410151mg                95.9    2e-20   
ref|XP_007013070.1|  Integrase-type DNA-binding superfamily protein   97.1    2e-20   
ref|XP_006294662.1|  hypothetical protein CARUB_v10023699mg           97.8    2e-20   
ref|XP_010505090.1|  PREDICTED: ethylene-responsive transcription...  95.9    2e-20   
ref|XP_011009351.1|  PREDICTED: ethylene-responsive transcription...  97.4    2e-20   
ref|XP_010509574.1|  PREDICTED: ethylene-responsive transcription...  95.9    2e-20   
ref|XP_010457145.1|  PREDICTED: ethylene-responsive transcription...  95.9    2e-20   
ref|XP_009133039.1|  PREDICTED: ethylene-responsive transcription...  95.9    2e-20   
ref|XP_003549925.1|  PREDICTED: ethylene-responsive transcription...  96.7    2e-20   
ref|XP_010474716.1|  PREDICTED: ethylene-responsive transcription...  95.9    2e-20   
ref|XP_006305645.1|  hypothetical protein CARUB_v10010347mg           95.9    2e-20   
ref|XP_009620060.1|  PREDICTED: ethylene-responsive transcription...  97.4    2e-20   
ref|XP_006451256.1|  hypothetical protein CICLE_v10009138mg           97.1    2e-20   
ref|XP_004510113.1|  PREDICTED: ethylene-responsive transcription...  95.9    2e-20   
gb|EYU29281.1|  hypothetical protein MIMGU_mgv1a024895mg              96.7    2e-20   
gb|KEH24686.1|  AP2 domain class transcription factor                 95.1    2e-20   
ref|XP_010506433.1|  PREDICTED: ethylene-responsive transcription...  97.4    2e-20   
ref|XP_010508227.1|  PREDICTED: ethylene-responsive transcription...  97.1    2e-20   
ref|XP_004510292.1|  PREDICTED: ethylene-responsive transcription...  96.3    2e-20   
gb|EYU20436.1|  hypothetical protein MIMGU_mgv1a024757mg              96.3    2e-20   
ref|XP_009141508.1|  PREDICTED: ethylene-responsive transcription...  95.5    3e-20   
emb|CDX79619.1|  BnaC03g19550D                                        95.9    3e-20   
emb|CDY72553.1|  BnaAnng41450D                                        95.5    3e-20   
ref|XP_003517069.1|  PREDICTED: dehydration-responsive element-bi...  95.9    3e-20   
ref|XP_007202464.1|  hypothetical protein PRUPE_ppa010130mg           96.7    3e-20   
ref|XP_010646855.1|  PREDICTED: ethylene-responsive transcription...  96.3    3e-20   
ref|XP_010252352.1|  PREDICTED: ethylene-responsive transcription...  95.5    3e-20   
ref|XP_006397675.1|  hypothetical protein EUTSA_v10001792mg           97.1    3e-20   
ref|XP_003635442.1|  PREDICTED: ethylene-responsive transcription...  96.3    3e-20   
ref|XP_008242523.1|  PREDICTED: dehydration-responsive element-bi...  97.1    3e-20   
ref|XP_009780384.1|  PREDICTED: dehydration-responsive element-bi...  96.3    3e-20   
ref|XP_004240059.1|  PREDICTED: ethylene-responsive transcription...  96.3    3e-20   
gb|KDO66509.1|  hypothetical protein CISIN_1g041119mg                 96.7    3e-20   
emb|CBI23469.3|  unnamed protein product                              96.3    3e-20   
gb|KDP34150.1|  hypothetical protein JCGZ_07721                       96.3    3e-20   
ref|XP_010100723.1|  Ethylene-responsive transcription factor         95.5    4e-20   
ref|XP_003611338.1|  Ethylene-responsive transcription factor TINY    94.7    4e-20   
ref|XP_004301176.1|  PREDICTED: ethylene-responsive transcription...  94.7    4e-20   
ref|XP_009143633.1|  PREDICTED: ethylene-responsive transcription...  95.1    4e-20   
ref|XP_004506390.1|  PREDICTED: ethylene-responsive transcription...  96.7    4e-20   
gb|ABU55662.1|  CBF1-like protein                                     95.1    4e-20   
ref|XP_002514246.1|  Transcriptional factor TINY, putative            96.3    4e-20   
ref|XP_008646011.1|  PREDICTED: ethylene-responsive transcription...  96.3    4e-20   
gb|KHN15832.1|  Dehydration-responsive element-binding protein 3      95.5    4e-20   
ref|XP_007157270.1|  hypothetical protein PHAVU_002G056800g           94.7    4e-20   
emb|CDY32094.1|  BnaC04g44720D                                        94.7    4e-20   
ref|XP_009380474.1|  PREDICTED: ethylene-responsive transcription...  95.9    4e-20   
ref|XP_008347085.1|  PREDICTED: ethylene-responsive transcription...  96.3    5e-20   
gb|KFK42509.1|  hypothetical protein AALP_AA1G003100                  94.7    5e-20   
ref|XP_002324441.2|  hypothetical protein POPTR_0018s09270g           96.3    5e-20   
gb|ABO48369.1|  TINY-like protein 2                                   96.3    5e-20   
ref|XP_010449723.1|  PREDICTED: ethylene-responsive transcription...  94.4    5e-20   
gb|KHN35106.1|  Ethylene-responsive transcription factor ERF021       93.2    5e-20   
ref|XP_010910974.1|  PREDICTED: ethylene-responsive transcription...  95.5    5e-20   
gb|KDP39899.1|  hypothetical protein JCGZ_03430                       95.5    5e-20   
ref|XP_006418405.1|  hypothetical protein EUTSA_v10009402mg           94.7    5e-20   
gb|AAM64613.1|  putative AP2 domain transcription factor              96.3    5e-20   
emb|CBI29555.3|  unnamed protein product                              96.3    5e-20   
gb|AGB05623.1|  DREB4A family transcription factor 2                  95.1    5e-20   
ref|XP_007155687.1|  hypothetical protein PHAVU_003G222600g           95.5    6e-20   
ref|NP_182021.1|  ethylene-responsive transcription factor ERF034     96.3    6e-20   
ref|XP_011090115.1|  PREDICTED: dehydration-responsive element-bi...  94.4    6e-20   
dbj|BAJ34192.1|  unnamed protein product                              94.7    6e-20   
ref|XP_008794173.1|  PREDICTED: dehydration-responsive element-bi...  95.5    6e-20   
ref|XP_009617333.1|  PREDICTED: ethylene-responsive transcription...  95.5    6e-20   
gb|ABA54282.1|  transcription factor DREBIII-4                        94.7    6e-20   
ref|XP_008807523.1|  PREDICTED: dehydration-responsive element-bi...  94.7    6e-20   
ref|XP_008783177.1|  PREDICTED: ethylene-responsive transcription...  94.7    6e-20   
ref|XP_006406852.1|  hypothetical protein EUTSA_v10022278mg           95.5    6e-20   
ref|XP_010915977.1|  PREDICTED: ethylene-responsive transcription...  95.1    6e-20   
ref|XP_003533400.1|  PREDICTED: ethylene-responsive transcription...  95.1    6e-20   
ref|XP_010915978.1|  PREDICTED: ethylene-responsive transcription...  95.1    6e-20   
ref|XP_006450687.1|  hypothetical protein CICLE_v10009370mg           95.1    6e-20   
ref|XP_006476039.1|  PREDICTED: dehydration-responsive element-bi...  95.1    6e-20   
ref|XP_008807522.1|  PREDICTED: dehydration-responsive element-bi...  94.7    6e-20   
ref|XP_010487482.1|  PREDICTED: ethylene-responsive transcription...  95.1    7e-20   
ref|NP_001234759.1|  dehydration responsive element binding protein   95.9    7e-20   
gb|AET05216.2|  ethylene response factor                              95.1    7e-20   
ref|XP_010258834.1|  PREDICTED: ethylene-responsive transcription...  95.9    7e-20   
gb|AFW72636.1|  putative AP2/EREBP transcription factor superfami...  95.5    7e-20   
gb|KHN43745.1|  Ethylene-responsive transcription factor ERF034       93.6    7e-20   
emb|CDP08151.1|  unnamed protein product                              95.9    7e-20   
ref|XP_010940400.1|  PREDICTED: dehydration-responsive element-bi...  94.4    7e-20   
ref|XP_010504078.1|  PREDICTED: ethylene-responsive transcription...  95.1    8e-20   
ref|XP_009409377.1|  PREDICTED: ethylene-responsive transcription...  95.5    8e-20   
ref|XP_008466061.1|  PREDICTED: dehydration-responsive element-bi...  95.1    8e-20   
ref|XP_009399816.1|  PREDICTED: ethylene-responsive transcription...  95.1    8e-20   
ref|XP_011048337.1|  PREDICTED: ethylene-responsive transcription...  95.5    8e-20   
ref|XP_010429589.1|  PREDICTED: ethylene-responsive transcription...  94.7    8e-20   
gb|AES90882.2|  ethylene response factor                              95.1    8e-20   
ref|XP_003626994.1|  Ethylene-responsive transcription factor TINY    94.4    8e-20   
ref|XP_008238439.1|  PREDICTED: ethylene-responsive transcription...  95.1    9e-20   
ref|XP_010556599.1|  PREDICTED: ethylene-responsive transcription...  94.0    9e-20   
ref|XP_010051579.1|  PREDICTED: ethylene-responsive transcription...  94.7    9e-20   
ref|XP_006853624.1|  hypothetical protein AMTR_s00056p00064760        95.5    9e-20   
ref|XP_007161494.1|  hypothetical protein PHAVU_001G073800g           95.1    9e-20   
ref|XP_007209502.1|  hypothetical protein PRUPE_ppa010340mg           95.1    9e-20   
ref|XP_007012129.1|  Integrase-type DNA-binding superfamily protein   95.1    9e-20   
ref|NP_001241356.1|  dehydration-responsive element-binding prote...  94.0    1e-19   
gb|ADE76915.1|  unknown                                               95.1    1e-19   
ref|XP_010915419.1|  PREDICTED: dehydration-responsive element-bi...  95.1    1e-19   
ref|XP_010417360.1|  PREDICTED: ethylene-responsive transcription...  94.4    1e-19   
ref|XP_009146154.1|  PREDICTED: ethylene-responsive transcription...  94.7    1e-19   
ref|XP_010249578.1|  PREDICTED: dehydration-responsive element-bi...  94.7    1e-19   
gb|ACU23160.1|  unknown                                               94.0    1e-19   
emb|CDP09993.1|  unnamed protein product                              94.4    1e-19   
ref|XP_010472602.1|  PREDICTED: ethylene-responsive transcription...  94.4    1e-19   
ref|XP_006298435.1|  hypothetical protein CARUB_v10014506mg           94.7    1e-19   
ref|XP_011033804.1|  PREDICTED: ethylene-responsive transcription...  93.2    1e-19   
ref|XP_002304466.1|  AP2 domain-containing family protein             93.2    1e-19   
ref|NP_001239694.1|  dehydration-responsive element-binding prote...  93.6    1e-19   
ref|XP_010925663.1|  PREDICTED: ethylene-responsive transcription...  94.7    1e-19   
ref|XP_009381193.1|  PREDICTED: dehydration-responsive element-bi...  94.4    1e-19   
ref|XP_006837306.1|  hypothetical protein AMTR_s00111p00051610        95.5    1e-19   
ref|XP_008810659.1|  PREDICTED: ethylene-responsive transcription...  94.4    1e-19   
ref|XP_009785489.1|  PREDICTED: ethylene-responsive transcription...  94.7    1e-19   
ref|XP_003528789.1|  PREDICTED: ethylene-responsive transcription...  93.6    1e-19   
gb|ABR16697.1|  unknown                                               94.7    1e-19   
ref|XP_010098118.1|  Ethylene-responsive transcription factor TINY    94.7    1e-19   
ref|XP_008369428.1|  PREDICTED: ethylene-responsive transcription...  94.7    1e-19   
ref|XP_004503470.1|  PREDICTED: dehydration-responsive element-bi...  94.4    1e-19   
ref|XP_009344189.1|  PREDICTED: ethylene-responsive transcription...  94.7    1e-19   
ref|XP_003521085.1|  PREDICTED: ethylene-responsive transcription...  95.1    1e-19   
ref|XP_011012511.1|  PREDICTED: ethylene-responsive transcription...  94.4    1e-19   
ref|XP_002301414.2|  hypothetical protein POPTR_0002s17320g           92.8    1e-19   
ref|XP_008795185.1|  PREDICTED: dehydration-responsive element-bi...  94.4    1e-19   
ref|XP_002303301.1|  hypothetical protein POPTR_0003s04920g           94.4    1e-19   
ref|XP_011004731.1|  PREDICTED: dehydration-responsive element-bi...  94.4    1e-19   
ref|XP_002324799.1|  hypothetical protein POPTR_0018s00270g           94.4    1e-19   
ref|XP_007152902.1|  hypothetical protein PHAVU_004G169800g           94.0    1e-19   
ref|XP_003597699.1|  Ethylene-responsive transcription factor TINY    93.6    1e-19   
emb|CDY15189.1|  BnaC05g00680D                                        93.2    1e-19   
ref|XP_009404533.1|  PREDICTED: ethylene-responsive transcription...  94.4    1e-19   
ref|XP_010661364.1|  PREDICTED: ethylene-responsive transcription...  94.7    1e-19   
emb|CBI30255.3|  unnamed protein product                              93.6    2e-19   
ref|XP_007024262.1|  Integrase-type DNA-binding superfamily protein   94.4    2e-19   
emb|CDY38001.1|  BnaCnng08620D                                        93.2    2e-19   
ref|XP_009624061.1|  PREDICTED: dehydration-responsive element-bi...  94.4    2e-19   
emb|CDY30151.1|  BnaC05g37110D                                        94.4    2e-19   
ref|XP_003608685.1|  Ethylene-responsive transcription factor TINY    94.7    2e-19   
ref|XP_009777029.1|  PREDICTED: dehydration-responsive element-bi...  94.4    2e-19   
ref|XP_009119681.1|  PREDICTED: ethylene-responsive transcription...  93.2    2e-19   
emb|CDX90020.1|  BnaA10g00620D                                        93.2    2e-19   
ref|XP_006421614.1|  hypothetical protein CICLE_v10006536mg           94.0    2e-19   
gb|ABB45860.1|  DRE-binding protein 3a                                94.0    2e-19   
ref|XP_003630740.1|  Ethylene-responsive transcription factor TINY    94.7    2e-19   
ref|XP_010248418.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...  97.1    2e-19   
gb|ACU24100.1|  unknown                                               94.7    2e-19   
gb|ABU55667.1|  CBF1-like protein                                     92.4    2e-19   
gb|ABP64695.1|  putative C-repeat binding protein 4                   93.6    2e-19   
gb|ABK96506.1|  unknown                                               92.8    2e-19   
ref|XP_006381752.1|  hypothetical protein POPTR_0006s17670g           94.7    2e-19   
ref|XP_006387557.1|  hypothetical protein POPTR_0855s00200g           92.8    2e-19   
gb|ABU55660.1|  CBF1-like protein                                     92.8    2e-19   
ref|XP_009384462.1|  PREDICTED: ethylene-responsive transcription...  94.4    2e-19   
ref|XP_008678901.1|  PREDICTED: ethylene-responsive transcription...  94.0    2e-19   
ref|XP_009368950.1|  PREDICTED: ethylene-responsive transcription...  94.4    2e-19   
ref|XP_010036724.1|  PREDICTED: ethylene-responsive transcription...  94.0    2e-19   



>ref|XP_011000047.1| PREDICTED: ethylene-responsive transcription factor ERF021-like 
[Populus euphratica]
Length=180

 Score =   181 bits (460),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 90/158 (57%), Positives = 114/158 (72%), Gaps = 7/158 (4%)
 Frame = -2

Query  729  WGKWVSEIREPGKKTRIWLGSFETPEMAAAAYDVAAFHLRGCKARLNFPELVEGFPKPAS  550
            WGKWVSEIREPGKK+RIWLGSFETPEMAA AYDVAA H RG  A+LNFP+LV   PKPAS
Sbjct  24   WGKWVSEIREPGKKSRIWLGSFETPEMAATAYDVAALHFRGYDAKLNFPDLVHSLPKPAS  83

Query  549  SQPEDVRLAAHQAAMGFKPPA-----EGVPGAGLRPVRIGLSPNQIQAINETPMDSPNKM  385
            S  ED+R+AAH+AAM  +P        G   + + P+ + LSP+QIQAINE+P+DSP KM
Sbjct  84   SDAEDIRIAAHEAAMSLRPSTVESSQGGSSCSNVGPITVRLSPSQIQAINESPLDSP-KM  142

Query  384  WMELAATTLLLREPPLMICEDMMELEDWEEIQDDSIWD  271
            WM+++  + +  E  +    D+ E E+W+  Q DS+WD
Sbjct  143  WMQMSGIS-MPEESMMYSSIDVGEEEEWDNKQTDSLWD  179



>ref|XP_008459604.1| PREDICTED: ethylene-responsive transcription factor ERF021 [Cucumis 
melo]
Length=188

 Score =   180 bits (457),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 90/164 (55%), Positives = 115/164 (70%), Gaps = 12/164 (7%)
 Frame = -2

Query  729  WGKWVSEIREPGKKTRIWLGSFETPEMAAAAYDVAAFHLRGCKARLNFPELVEGFPKPAS  550
            WGKWVSEIREPGKKTRIWLGSFETPEMAA AYDVAA+H RG  ARLNFP LV   P P S
Sbjct  25   WGKWVSEIREPGKKTRIWLGSFETPEMAATAYDVAAYHFRGRDARLNFPHLVNSLPFPLS  84

Query  549  SQPEDVRLAAHQAAMGFKPP--------AEGVPGAGLRPVRIGLSPNQIQAINETPMDSP  394
            S P+D+RLAAH+AA+  +           +     GL PV + LSP+QIQAINE+ +DSP
Sbjct  85   STPDDIRLAAHEAALRVRTTPAVASSELGDETSTLGLAPVTVRLSPSQIQAINESTLDSP  144

Query  393  NKMWMELAATTLLLRE---PPLMICEDMMELEDWEEIQDDSIWD  271
            N MWM++++ ++L+ +      +  +DM + E WE + +DS+WD
Sbjct  145  N-MWMQMSSESMLMDQEFSNGNVFVDDMQDDEMWENMHNDSLWD  187



>ref|XP_004141635.1| PREDICTED: ethylene-responsive transcription factor ERF021-like 
[Cucumis sativus]
 ref|XP_004156249.1| PREDICTED: ethylene-responsive transcription factor ERF021-like 
[Cucumis sativus]
 gb|KGN52671.1| hypothetical protein Csa_5G649890 [Cucumis sativus]
Length=192

 Score =   178 bits (451),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 90/168 (54%), Positives = 115/168 (68%), Gaps = 16/168 (10%)
 Frame = -2

Query  729  WGKWVSEIREPGKKTRIWLGSFETPEMAAAAYDVAAFHLRGCKARLNFPELVEGFPKPAS  550
            WGKWVSEIREPGKKTRIWLGSFETPEMAA AYDVAA+H RG  ARLNFP LV   P P S
Sbjct  25   WGKWVSEIREPGKKTRIWLGSFETPEMAATAYDVAAYHFRGRDARLNFPHLVNSLPFPLS  84

Query  549  SQPEDVRLAAHQAAMGFKPP----------AEGVPGAGLRPVRIGLSPNQIQAINETPMD  400
            S P+D+RLAAH+AA+  +             +     GL PV + LSP+QIQAINE+ +D
Sbjct  85   STPDDIRLAAHEAALRVRTTPVVASSDDQLGDETSTLGLAPVTVRLSPSQIQAINESTLD  144

Query  399  SPNKMWMELAATTLLLREP----PLMICEDMMELED-WEEIQDDSIWD  271
            SP KMWM++++ +LL+ +      + +  DM + +  WE + +DS+WD
Sbjct  145  SP-KMWMQMSSESLLMDQEFSNGNVFVDHDMQDYDQMWENMHNDSLWD  191



>ref|XP_006376158.1| AP2 domain-containing transcription factor family protein [Populus 
trichocarpa]
 gb|ERP53955.1| AP2 domain-containing transcription factor family protein [Populus 
trichocarpa]
Length=180

 Score =   177 bits (448),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 90/158 (57%), Positives = 113/158 (72%), Gaps = 7/158 (4%)
 Frame = -2

Query  729  WGKWVSEIREPGKKTRIWLGSFETPEMAAAAYDVAAFHLRGCKARLNFPELVEGFPKPAS  550
            WGKWVSEIREPGKK+RIWLGSFETPEMAA AYDVAA H RG  A+LNFP+LV   PKPAS
Sbjct  24   WGKWVSEIREPGKKSRIWLGSFETPEMAATAYDVAALHFRGYDAKLNFPDLVHSLPKPAS  83

Query  549  SQPEDVRLAAHQAAMGFKPPA-----EGVPGAGLRPVRIGLSPNQIQAINETPMDSPNKM  385
            S  ED+R+AAH+AAM  +P        G   + + P+ + LSP+QIQAINE+P+DSP KM
Sbjct  84   SDAEDIRIAAHEAAMSLRPSTVESSQGGSSSSNVGPITVRLSPSQIQAINESPLDSP-KM  142

Query  384  WMELAATTLLLREPPLMICEDMMELEDWEEIQDDSIWD  271
            WM+++    +  E  +    D+ E E+W+  Q DS+WD
Sbjct  143  WMQMSGIA-MPDESMIYSSIDVGEEEEWDNKQTDSLWD  179



>ref|XP_011001613.1| PREDICTED: ethylene-responsive transcription factor ERF022-like 
[Populus euphratica]
Length=187

 Score =   177 bits (449),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 92/163 (56%), Positives = 112/163 (69%), Gaps = 10/163 (6%)
 Frame = -2

Query  729  WGKWVSEIREPGKKTRIWLGSFETPEMAAAAYDVAAFHLRGCKARLNFPELVEGFPKPAS  550
            WG WVSEIREPG+KTRIWLGS+E PEMAA AYDVAA HLRG  A+LNFPE+ +  P+PAS
Sbjct  25   WGTWVSEIREPGQKTRIWLGSYEKPEMAAVAYDVAALHLRGRGAQLNFPEMQDSLPRPAS  84

Query  549  SQPEDVRLAAHQAAMGFKPPAEG---------VPGAGLRPVRIGLSPNQIQAINETPMDS  397
            S+ EDV+ AA +AA+ F  P +              G  PVR+GLSP+QIQAINE P+DS
Sbjct  85   SRAEDVQAAAREAALLFSGPVKCSDIVSCGSITSDGGFGPVRVGLSPSQIQAINEAPLDS  144

Query  396  PNKMWMELAATTLLLREPPLMICEDMMELEDWEEIQDDSIWDF  268
            P KMW E  A TLL  +P  M  +  +   +WEEIQ +SIW +
Sbjct  145  P-KMWTEYLAETLLTGDPMAMENDIDVGYSEWEEIQQESIWGY  186



>ref|XP_002304195.1| AP2 domain-containing transcription factor family protein [Populus 
trichocarpa]
 gb|EEE79174.1| AP2 domain-containing transcription factor family protein [Populus 
trichocarpa]
Length=189

 Score =   173 bits (439),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 91/164 (55%), Positives = 110/164 (67%), Gaps = 11/164 (7%)
 Frame = -2

Query  729  WGKWVSEIREPGKKTRIWLGSFETPEMAAAAYDVAAFHLRGCKARLNFPELVEGFPKPAS  550
            WG WVSEIREPG+KTRIWLGS+E PEMAA AYDVAA HLRG  A+LNFPE+ +  P+PAS
Sbjct  26   WGTWVSEIREPGQKTRIWLGSYEKPEMAAVAYDVAALHLRGRGAQLNFPEMEDSLPRPAS  85

Query  549  SQPEDVRLAAHQAAMGFKPP----------AEGVPGAGLRPVRIGLSPNQIQAINETPMD  400
            S+ EDV+ AA +AA+ F                    G  PVR+GLSP+QIQAINE P+D
Sbjct  86   SRAEDVQAAAREAALLFSTGPVKCSDIVSCGSITSDGGFGPVRVGLSPSQIQAINEAPLD  145

Query  399  SPNKMWMELAATTLLLREPPLMICEDMMELEDWEEIQDDSIWDF  268
            SP KMW E  A +LL  EP  M  +  +   +WEEIQ +SIW +
Sbjct  146  SP-KMWTEYLAESLLTGEPMAMENDIGVGYSEWEEIQQESIWGY  188



>ref|XP_002325520.2| AP2 domain-containing transcription factor family protein [Populus 
trichocarpa]
 gb|EEE99901.2| AP2 domain-containing transcription factor family protein [Populus 
trichocarpa]
Length=185

 Score =   173 bits (439),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 102/163 (63%), Positives = 123/163 (75%), Gaps = 11/163 (7%)
 Frame = -2

Query  729  WGKWVSEIREPGKKTRIWLGSFETPEMAAAAYDVAAFHLRGCKARLNFPELVEGFPKPAS  550
            WGKWVSEIREPGKKTRIWLGS+E PEMAAAAYDVAA HLRG  A+LNFPE+V+  P+PAS
Sbjct  25   WGKWVSEIREPGKKTRIWLGSYEIPEMAAAAYDVAALHLRGRGAQLNFPEMVDILPQPAS  84

Query  549  SQPEDVRLAAHQAAMGFKPP--------AEGVPGAGLRPVRIGLSPNQIQAINETPMDSP  394
            S  EDV++AA +AA+ F+ P         +   G GL PVR+GLSP+QIQAINE P+DSP
Sbjct  85   SSAEDVQMAAQEAALMFRRPMKCSEAVSGDSSVGGGLGPVRVGLSPSQIQAINEAPLDSP  144

Query  393  NKMWMELAATTLLLREPPLMICE-DMMELEDWEEIQDDSIWDF  268
             KMWMELA   LLL EP +M  + D+   ++W E+Q DSIWD+
Sbjct  145  -KMWMELAG-ALLLEEPMIMSDDIDVAYRDEWGEMQHDSIWDY  185



>ref|XP_006363865.1| PREDICTED: ethylene-responsive transcription factor ERF022-like 
[Solanum tuberosum]
Length=176

 Score =   172 bits (435),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 106/160 (66%), Positives = 122/160 (76%), Gaps = 11/160 (7%)
 Frame = -2

Query  729  WGKWVSEIREPGKKTRIWLGSFETPEMAAAAYDVAAFHLRGCK--ARLNFPELVEGFPKP  556
            WGKWVSEIREPGKKTRIWLGS+ET EMAAAAYDVAAFHL+G +   RLNFPEL+  FPKP
Sbjct  22   WGKWVSEIREPGKKTRIWLGSYETAEMAAAAYDVAAFHLKGERPNLRLNFPELIHTFPKP  81

Query  555  ASSQPEDVRLAAHQAAMGFKPPAEGVP-GAGLRPVRIGLSPNQIQAINETPMDSPNKMWM  379
            +SS+PEDV++AAH+AAM FK P +  P   G  PVR+GLSP+QIQAINE+P+DSP KMWM
Sbjct  82   SSSRPEDVQMAAHEAAMRFKRPIDDHPDNCGAGPVRVGLSPSQIQAINESPLDSP-KMWM  140

Query  378  ELAATTLLLREPPLMIC-EDMMELEDWEEIQ--DDSIWDF  268
            ELA   L +RE     C     E   W+EIQ   DSIWDF
Sbjct  141  ELAG-LLPVRE---YTCPSSSFEDHQWDEIQYHHDSIWDF  176



>ref|XP_009619745.1| PREDICTED: ethylene-responsive transcription factor ERF022-like 
[Nicotiana tomentosiformis]
Length=195

 Score =   172 bits (435),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 109/177 (62%), Positives = 133/177 (75%), Gaps = 25/177 (14%)
 Frame = -2

Query  729  WGKWVSEIREPGKKTRIWLGSFETPEMAAAAYDVAAFHLRGCKARLNFPELVEGFPKPAS  550
            WGKWVSEIREPGKKTRIWLGS+ETPEMAAAAYDVAAFHL+G +ARLNFPEL++ FPKP+S
Sbjct  21   WGKWVSEIREPGKKTRIWLGSYETPEMAAAAYDVAAFHLKGERARLNFPELIDSFPKPSS  80

Query  549  SQPEDVRLAAHQAAMGFK------PP--AEGVPGAGLRPVRIGLSPNQIQAINETPMDSP  394
            S+PEDV++AAH+AAM FK      PP       G  + PVR+GLS +QIQAINE+P+DSP
Sbjct  81   SKPEDVQMAAHEAAMRFKIRKTPEPPESGGCGGGGTVVPVRVGLSSSQIQAINESPLDSP  140

Query  393  NKMWMELAATTLLLREP-------------PLMICEDMMELEDWEEIQD--DSIWDF  268
             KMWMEL    LLLR+P             P+++CED+ E  +W+E+Q   DS+WDF
Sbjct  141  -KMWMELTG-ALLLRDPVREYTCPSYPFTDPMVLCEDIAEFGEWDEVQQHHDSLWDF  195



>ref|XP_011005171.1| PREDICTED: ethylene-responsive transcription factor ERF022-like 
[Populus euphratica]
Length=185

 Score =   169 bits (428),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 100/164 (61%), Positives = 124/164 (76%), Gaps = 13/164 (8%)
 Frame = -2

Query  729  WGKWVSEIREPGKKTRIWLGSFETPEMAAAAYDVAAFHLRGCKARLNFPELVEGFPKPAS  550
            WGKWVSEIREPGKKTRIWLGS+E PEMAAAAYDVAA HLRG  A+LNFP++V+  P+PAS
Sbjct  25   WGKWVSEIREPGKKTRIWLGSYEMPEMAAAAYDVAALHLRGRGAQLNFPDMVDILPQPAS  84

Query  549  SQPEDVRLAAHQAAMGFKPP--------AEGVPGAGLRPVRIGLSPNQIQAINETPMDSP  394
            S  EDV++AA +AA+ F+ P         +   G GL PVR+GLSP+QIQAINE P+DSP
Sbjct  85   SSAEDVQMAAQEAALLFRRPMKCSEAVSGDSSVGGGLGPVRVGLSPSQIQAINEAPLDSP  144

Query  393  NKMWMELAATTLLLREPPLMICEDM-MELED-WEEIQDDSIWDF  268
             K WMEL  T +LL E P+++ +D+ +E  D W E+Q DSIWD+
Sbjct  145  -KTWMEL--TGVLLLEEPMIMSDDIDVEYRDEWGEMQHDSIWDY  185



>ref|XP_009783971.1| PREDICTED: ethylene-responsive transcription factor ERF022-like 
[Nicotiana sylvestris]
Length=194

 Score =   165 bits (418),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 109/176 (62%), Positives = 134/176 (76%), Gaps = 24/176 (14%)
 Frame = -2

Query  729  WGKWVSEIREPGKKTRIWLGSFETPEMAAAAYDVAAFHLRGCKARLNFPELVEGFPKPAS  550
            WGKWVSEIREPGKKTRIWLGS+ETPEMAAAAYDVAAFHL+G +ARLNFPEL++ FPKP+S
Sbjct  21   WGKWVSEIREPGKKTRIWLGSYETPEMAAAAYDVAAFHLKGERARLNFPELIDSFPKPSS  80

Query  549  SQPEDVRLAAHQAAMGFK-----PP--AEGVPGAGLRPVRIGLSPNQIQAINETPMDSPN  391
            S+ EDV++AAH+AAM FK     PP       G  + PVR+GLS +QIQAINE+P+DSP 
Sbjct  81   SKSEDVQMAAHEAAMRFKRQTPEPPESGGCGGGGTMVPVRVGLSSSQIQAINESPLDSP-  139

Query  390  KMWMELAATTLLLREP-------------PLMICEDMMELEDWEEIQD--DSIWDF  268
            KMWMELA   LLLR+P             P+++ ED++E E+W+E+Q   +SIWDF
Sbjct  140  KMWMELAG-ALLLRDPVREYTCPSYSFTDPMVLGEDIVEFEEWDEMQQHHESIWDF  194



>ref|XP_004250806.1| PREDICTED: ethylene-responsive transcription factor ERF022-like 
[Solanum lycopersicum]
Length=173

 Score =   164 bits (415),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 99/157 (63%), Positives = 117/157 (75%), Gaps = 8/157 (5%)
 Frame = -2

Query  729  WGKWVSEIREPGKKTRIWLGSFETPEMAAAAYDVAAFHLRGCK--ARLNFPELVEGFPKP  556
            WGKWVSEIREPGKKTRIWLGS++  EMAAAAYDVAAFHL+G +   RLNFPEL+  FPKP
Sbjct  22   WGKWVSEIREPGKKTRIWLGSYQKAEMAAAAYDVAAFHLKGERPNLRLNFPELIHTFPKP  81

Query  555  ASSQPEDVRLAAHQAAMGFKPPAEGVP-GAGLRPVRIGLSPNQIQAINETPMDSPNKMWM  379
            +SS+PEDV++AAH+AAM FKP  +  P   G+  VR+GLSP+QIQAINE+P+DSP KMWM
Sbjct  82   SSSRPEDVQMAAHEAAMRFKPSIDDHPEECGVGQVRVGLSPSQIQAINESPLDSP-KMWM  140

Query  378  ELAATTLLLREPPLMICEDMMELEDWEEIQDDSIWDF  268
            ELA   L +RE     C      ED      +SIWDF
Sbjct  141  ELAGALLPVRE---YTCPTDY-FEDETPHHHESIWDF  173



>ref|XP_010245720.1| PREDICTED: ethylene-responsive transcription factor ERF021 [Nelumbo 
nucifera]
Length=233

 Score =   163 bits (412),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 93/164 (57%), Positives = 107/164 (65%), Gaps = 20/164 (12%)
 Frame = -2

Query  729  WGKWVSEIREPGKKTRIWLGSFETPEMAAAAYDVAAFHLRGCKARLNFPELVEGFPKPAS  550
            WGKWVSEIREPGKKTRIWLGSFETPEMAA AYDVAA  LRG  ARLNFPEL    P+P S
Sbjct  76   WGKWVSEIREPGKKTRIWLGSFETPEMAATAYDVAALQLRGRSARLNFPELAGRLPRPVS  135

Query  549  SQPEDVRLAAHQAAMGFKPPAEGVPGAGLR-----------PVRIGLSPNQIQAINETPM  403
            S  +D+R AAH+AA   K    G P                P  +GLS +QIQAINE+P+
Sbjct  136  SNADDIRSAAHEAASLLK----GHPTGSFEVGSSGSSSYSVPTTVGLSQSQIQAINESPL  191

Query  402  DSPNKMWMELAATTLLLREPPLMICEDMMELEDW-EEIQDDSIW  274
            DSP KMW ELA    LL EPP ++  D  E+  W +E+Q D +W
Sbjct  192  DSP-KMWTELAEA--LLVEPPTVVYRD-TEMSYWGDEMQSDFLW  231



>ref|XP_011005172.1| PREDICTED: ethylene-responsive transcription factor ERF021-like 
[Populus euphratica]
Length=178

 Score =   160 bits (404),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 90/158 (57%), Positives = 113/158 (72%), Gaps = 9/158 (6%)
 Frame = -2

Query  729  WGKWVSEIREPGKKTRIWLGSFETPEMAAAAYDVAAFHLRGCKARLNFPELVEGFPKPAS  550
            WGKWVSEIREPGKK RIWLGSFETPEMAAAAYDVAA H RG  ARLNFP+LV   PKP S
Sbjct  24   WGKWVSEIREPGKKNRIWLGSFETPEMAAAAYDVAALHFRGHDARLNFPDLVHNLPKPTS  83

Query  549  SQPEDVRLAAHQAAMGFKP-PAEGVPG----AGLRPVRIGLSPNQIQAINETPMDSPNKM  385
            S  ED+R+AAH+AAM  +P  AE   G    + + P+ + LS +QIQAINE+P+DSP KM
Sbjct  84   SSSEDIRMAAHEAAMSLRPFTAESSHGGSSTSNVGPITVRLSASQIQAINESPLDSP-KM  142

Query  384  WMELAATTLLLREPPLMICEDMMELEDWEEIQDDSIWD  271
            WM+++   +L      M+  + +E ++W+  Q  S+WD
Sbjct  143  WMQMSEIAMLEES---MVFSNNIEEDEWDNKQTYSLWD  177



>ref|XP_007223585.1| hypothetical protein PRUPE_ppa012354mg [Prunus persica]
 gb|EMJ24784.1| hypothetical protein PRUPE_ppa012354mg [Prunus persica]
Length=173

 Score =   159 bits (403),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 93/159 (58%), Positives = 116/159 (73%), Gaps = 17/159 (11%)
 Frame = -2

Query  729  WGKWVSEIREPGKKTRIWLGSFETPEMAAAAYDVAAFHLRGCKARLNFPELVEGFPKPAS  550
            WGKWVSEIREPG KTRIWLGSFETPEMAAAAYDVAA H RG +ARLNFPELV   P+PAS
Sbjct  25   WGKWVSEIREPGTKTRIWLGSFETPEMAAAAYDVAALHFRGREARLNFPELVNSLPRPAS  84

Query  549  SQPEDVRLAAHQAAMGFK--PPAE----GVPGAGLRPVRIGLSPNQIQAINETPMDSPNK  388
            S  ED+R+AAH+AA+  +  P AE    G   + + PV + LSP+QIQAINE+P+DSP K
Sbjct  85   SNAEDIRMAAHEAALRLRSSPAAEAHEAGSSSSNVGPVTVRLSPSQIQAINESPLDSP-K  143

Query  387  MWMELAATTLLLREPPLMICEDMMELEDWEEIQDDSIWD  271
            MWM+++ +         M+     E + WE++Q+DS+WD
Sbjct  144  MWMQMSES---------MMFSGGFE-DQWEDMQNDSLWD  172



>ref|XP_008219098.1| PREDICTED: ethylene-responsive transcription factor ERF021-like 
[Prunus mume]
Length=173

 Score =   159 bits (403),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 93/159 (58%), Positives = 116/159 (73%), Gaps = 17/159 (11%)
 Frame = -2

Query  729  WGKWVSEIREPGKKTRIWLGSFETPEMAAAAYDVAAFHLRGCKARLNFPELVEGFPKPAS  550
            WGKWVSEIREPG KTRIWLGSFETPEMAAAAYDVAA H RG +ARLNFPELV   P+PAS
Sbjct  25   WGKWVSEIREPGTKTRIWLGSFETPEMAAAAYDVAALHFRGREARLNFPELVNSLPRPAS  84

Query  549  SQPEDVRLAAHQAAMGFK--PPAE----GVPGAGLRPVRIGLSPNQIQAINETPMDSPNK  388
            S  ED+R+AAH+AA+  +  P AE    G   + + PV + LSP+QIQAINE+P+DSP K
Sbjct  85   SNAEDIRMAAHEAALRLRSSPAAEAHEAGSSSSNVGPVTVRLSPSQIQAINESPLDSP-K  143

Query  387  MWMELAATTLLLREPPLMICEDMMELEDWEEIQDDSIWD  271
            MWM+++ +         M+     E + WE++Q+DS+WD
Sbjct  144  MWMQMSES---------MMFSGGFE-DQWEDMQNDSLWD  172



>ref|XP_009757757.1| PREDICTED: ethylene-responsive transcription factor ERF021-like 
[Nicotiana sylvestris]
Length=180

 Score =   159 bits (403),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 94/157 (60%), Positives = 114/157 (73%), Gaps = 9/157 (6%)
 Frame = -2

Query  729  WGKWVSEIREPGKKTRIWLGSFETPEMAAAAYDVAAFHLRGCKARLNFPELVEGFPKPAS  550
            WGKWVSEIREPGKKTRIWLGSF+TPEMAAAAYD AA HL+G  A+LNFPELV+  PKPAS
Sbjct  28   WGKWVSEIREPGKKTRIWLGSFDTPEMAAAAYDSAALHLKGHAAKLNFPELVDFLPKPAS  87

Query  549  SQPEDVRLAAHQAAMGFKPPAEGVPGA----GLRPVRIGLSPNQIQAINETPMDSPNKMW  382
              P+D+R AA +AA+  K  +E +  +     L PV IGLSP+QIQAIN+ PMDSP KMW
Sbjct  88   CSPDDIRFAAQEAALTVKRNSEEMASSSATNNLAPVTIGLSPSQIQAINDFPMDSP-KMW  146

Query  381  MELAATTLLLREPPLMICEDMMELEDWEEIQDDSIWD  271
             ++  T   + E  +  C D  E+ D+EEI DD +WD
Sbjct  147  SDV--TREYVGEETMFTCND-YEMSDYEEI-DDCLWD  179



>gb|KHN25590.1| Ethylene-responsive transcription factor ERF021 [Glycine soja]
Length=208

 Score =   160 bits (405),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 99/179 (55%), Positives = 118/179 (66%), Gaps = 27/179 (15%)
 Frame = -2

Query  729  WGKWVSEIREPGKKTRIWLGSFETPEMAAAAYDVAAFHLRGCKARLNFPELVEGFPKPAS  550
            WGKWVSEIREPGKK+RIWLGS+E+PEMAAAAYDVAA HLRG  ARLNFPELVE  P+P S
Sbjct  26   WGKWVSEIREPGKKSRIWLGSYESPEMAAAAYDVAALHLRGRAARLNFPELVETLPRPTS  85

Query  549  SQPEDVRLAAHQAAMGFKPPAEGVPGAGLR-------------------PVRIGLSPNQI  427
            S+PEDV++AA QAA+ FK    G+    ++                   PVR+GLSP QI
Sbjct  86   SKPEDVQVAAQQAALMFKRLRVGLSATKIQINNHQGCVNDNNIIKGSVVPVRVGLSPTQI  145

Query  426  QAINETPMDSPNKMWMELAATTLLL---REPPLMICED----MMELEDWEEIQDDSIWD  271
            QAINE+P+DSP KMWM   A  L         +M+  D     +EL  WEEIQ +S+WD
Sbjct  146  QAINESPLDSP-KMWMVQMAEALRFGFDDHSMMMLPSDDDDYALELSGWEEIQHESLWD  203



>ref|XP_007019866.1| Integrase-type DNA-binding superfamily protein [Theobroma cacao]
 gb|EOY17091.1| Integrase-type DNA-binding superfamily protein [Theobroma cacao]
Length=201

 Score =   160 bits (404),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 92/163 (56%), Positives = 118/163 (72%), Gaps = 14/163 (9%)
 Frame = -2

Query  729  WGKWVSEIREPGKKTRIWLGSFETPEMAAAAYDVAAFHLRGCKARLNFPELVEGFPKPAS  550
            WGKWVSEIREPGKKTRIWLGSFETPEMAAAAYDVAA HLRG +ARLNFPEL++  P+P S
Sbjct  42   WGKWVSEIREPGKKTRIWLGSFETPEMAAAAYDVAALHLRGREARLNFPELIDCLPRPPS  101

Query  549  SQPEDVRLAAHQAAMGFKPPAEGVP----------GAGLRPVRIGLSPNQIQAINETPMD  400
            S  ED+R+ A +AA+  +  A              G G+ PV + LSP QIQAINE+P+D
Sbjct  102  SNAEDIRMVAQEAALRVRTNAAASSSEAGGSCSSAGPGVGPVTVRLSPTQIQAINESPLD  161

Query  399  SPNKMWMELAATTLLLREPPLMICEDMMELEDWEEIQDDSIWD  271
            SP KMWM+++    L+ +  +M C++  E E W+++Q+DS+WD
Sbjct  162  SP-KMWMQMSEP--LMMDEAMMFCDENGENE-WDDMQNDSLWD  200



>ref|XP_006441646.1| hypothetical protein CICLE_v10024063mg [Citrus clementina]
 ref|XP_006478458.1| PREDICTED: ethylene-responsive transcription factor ERF022-like 
[Citrus sinensis]
 gb|ESR54886.1| hypothetical protein CICLE_v10024063mg [Citrus clementina]
 gb|KDO51737.1| hypothetical protein CISIN_1g046901mg [Citrus sinensis]
Length=172

 Score =   159 bits (401),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 96/156 (62%), Positives = 118/156 (76%), Gaps = 7/156 (4%)
 Frame = -2

Query  729  WGKWVSEIREPGKKTRIWLGSFETPEMAAAAYDVAAFHLRG-CKARLNFPELVEGFPKPA  553
            WGKWVSEIR+PG KTRIWLGS+ETPEMAAAAYDVAA H RG   A LNFPEL +  P+PA
Sbjct  21   WGKWVSEIRQPGTKTRIWLGSYETPEMAAAAYDVAALHFRGRSGAHLNFPELADTLPRPA  80

Query  552  SSQPEDVRLAAHQAAMGFKPPAEGVPGAGLRPVRIGLSPNQIQAINETPMDSPNKMWMEL  373
            SS+PEDV+LAA +AA+ F+ P        L PVRIGLSP+QIQAINE+P+DSP KMWMEL
Sbjct  81   SSKPEDVQLAAQEAALSFRKPI--AENCSLGPVRIGLSPSQIQAINESPLDSP-KMWMEL  137

Query  372  AATTLLLREPPLMICEDMMELEDW--EEIQDDSIWD  271
            AA T    E  +++ + + E+ +W   ++Q +SIWD
Sbjct  138  AAGTFWSPE-QMLLYDGIDEVCEWGNYDMQVESIWD  172



>ref|XP_010478801.1| PREDICTED: ethylene-responsive transcription factor ERF022-like 
[Camelina sativa]
Length=184

 Score =   159 bits (401),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 86/158 (54%), Positives = 103/158 (65%), Gaps = 7/158 (4%)
 Frame = -2

Query  729  WGKWVSEIREPGKKTRIWLGSFETPEMAAAAYDVAAFHLRGCKARLNFPELVEGFPKPAS  550
            WGKWVSEIREPGKKTRIWLGS+ET EMAAAAYD A+ +LRGC + LNFPEL   FP+PAS
Sbjct  29   WGKWVSEIREPGKKTRIWLGSYETAEMAAAAYDSASLYLRGCGSHLNFPELAHSFPQPAS  88

Query  549  SQPEDVRLAAHQAAMGFKPPAEGVP--GAGLRPVRIGLSPNQIQAINETPMDSPNKMWM-  379
            S    V+ AA +AA+ FKP     P  G+     R+G SP+QIQAINE P+DSP   WM 
Sbjct  89   SSSNHVQAAAQEAALMFKPDGSNEPELGSSQGLSRVGSSPDQIQAINEFPLDSPRLGWMH  148

Query  378  ELAATTLLLREPPLMICEDMMELEDWEEIQ-DDSIWDF  268
            +LA            +  D    +D+ E+Q   SIWDF
Sbjct  149  DLAVNDCAELYGHYFVQYDR---DDFYEMQHQQSIWDF  183



>ref|XP_002534488.1| DNA binding protein, putative [Ricinus communis]
 gb|EEF27895.1| DNA binding protein, putative [Ricinus communis]
Length=190

 Score =   159 bits (401),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 100/168 (60%), Positives = 118/168 (70%), Gaps = 17/168 (10%)
 Frame = -2

Query  729  WGKWVSEIREPGKKTRIWLGSFETPEMAAAAYDVAAFHLRGCKARLNFPELVEGFPKPAS  550
            WGKWVSEIREPGKKTRIWLGS+E+PEMAAAAYDVAA H RG  A LNFPELV+  P+PAS
Sbjct  26   WGKWVSEIREPGKKTRIWLGSYESPEMAAAAYDVAALHFRGHGAHLNFPELVDSLPRPAS  85

Query  549  SQPEDVRLAAHQAAMGFKPPAE--------------GVPGAGLRPVRIGLSPNQIQAINE  412
            S  EDV++AA +AA+ F+ P +              G  G GL PVRIGLSP+QIQAINE
Sbjct  86   SSAEDVQMAAQEAAVRFRRPIKCSEVGSGGGGGCGGGGSGGGLVPVRIGLSPSQIQAINE  145

Query  411  TPMDSPNKMWMELAATTLLLREPPLMICEDMMELEDWEEIQDDSIWDF  268
            TP+DSP KMWMELA   LL    P +  ++  + E  E  +D SIWD+
Sbjct  146  TPLDSP-KMWMELAGALLLAE--PTVFGDNNDDFEFEETHEDASIWDY  190



>ref|XP_009357202.1| PREDICTED: ethylene-responsive transcription factor ERF021-like 
[Pyrus x bretschneideri]
Length=181

 Score =   158 bits (399),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 95/165 (58%), Positives = 115/165 (70%), Gaps = 22/165 (13%)
 Frame = -2

Query  729  WGKWVSEIREPGKKTRIWLGSFETPEMAAAAYDVAAFHLRGCKARLNFPELVEGFPKPAS  550
            WGKWVSEIREPG KTRIWLGSFETPEMAAAAYDVAA H RG +ARLNFPELV   P+PAS
Sbjct  26   WGKWVSEIREPGTKTRIWLGSFETPEMAAAAYDVAALHFRGREARLNFPELVNNLPRPAS  85

Query  549  SQPEDVRLAAHQAAMGFKPP--------AEGVPGAG----LRPVRIGLSPNQIQAINETP  406
            S  +D+R+AAH+AA+  +          AEG    G    +  VR+ LSP+QIQAINE+P
Sbjct  86   STSDDIRMAAHEAALMLRGSGGGGGGGVAEGHEVGGSSSNVGQVRVRLSPSQIQAINESP  145

Query  405  MDSPNKMWMELAATTLLLREPPLMICEDMMELEDWEEIQDDSIWD  271
            +DSP KMWM++A         P M   D+ E   WE++Q+DS+WD
Sbjct  146  LDSP-KMWMQMAE--------PTMFSNDVFE-NQWEDMQNDSLWD  180



>ref|XP_002534096.1| DNA binding protein, putative [Ricinus communis]
 gb|EEF28287.1| DNA binding protein, putative [Ricinus communis]
Length=215

 Score =   159 bits (401),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 86/170 (51%), Positives = 111/170 (65%), Gaps = 23/170 (14%)
 Frame = -2

Query  729  WGKWVSEIREPGKKTRIWLGSFETPEMAAAAYDVAAFHLRGCKARLNFPELVEGFPKPAS  550
            WGKWVSEIREPGKKTRIWLGSFETPEMAA AYDVAA + RG +A+LNFP LV   P PAS
Sbjct  51   WGKWVSEIREPGKKTRIWLGSFETPEMAATAYDVAALYFRGREAKLNFPHLVHDLPNPAS  110

Query  549  SQPEDVRLAAHQAAMGFK----PPAE-------------GVPGAGLRPVRIGLSPNQIQA  421
               +D+R+AAH+AA+  +    P  E             G   + + P+ + LSP +IQA
Sbjct  111  PNADDIRMAAHEAALRLRSLPIPEREGSNGGGGGGSGGSGSSSSVVGPITVRLSPREIQA  170

Query  420  INETPMDSPNKMWMELAATTLLLREPPLMICEDMMELEDWEEIQDDSIWD  271
            INE+P+DSP KMWM++A       E  +M   D    ++W+ +Q+DS+WD
Sbjct  171  INESPLDSP-KMWMQMATM-----EDSMMFANDDGVDDEWDSMQNDSLWD  214



>ref|XP_006376157.1| hypothetical protein POPTR_0013s10330g [Populus trichocarpa]
 gb|ERP53954.1| hypothetical protein POPTR_0013s10330g [Populus trichocarpa]
Length=188

 Score =   158 bits (399),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 102/166 (61%), Positives = 121/166 (73%), Gaps = 14/166 (8%)
 Frame = -2

Query  729  WGKWVSEIREPGKKTRIWLGSFETPEMAAAAYDVAAFHLRGCKARLNFPELVEGFPKPAS  550
            WGKWVSEIREPGKKTRIWLGS+E PEMAAAAYDVAA HLRG  A+LNFPE+V+  P+PAS
Sbjct  25   WGKWVSEIREPGKKTRIWLGSYEMPEMAAAAYDVAALHLRGRGAQLNFPEMVDSLPRPAS  84

Query  549  SQPEDVRLAAHQAAMGFKPPAE---------GVPGAGLRPVRIGLSPNQIQAINETPMDS  397
            S  EDV++AA +AA+ F+ P +            G  L PVR+GLSP+QIQAINE P+DS
Sbjct  85   SSTEDVQMAAQEAALLFRRPIKCSEGVSGSSSGGGGSLGPVRVGLSPSQIQAINEAPLDS  144

Query  396  PNKMWMELAATTLLLREPPLMICEDMMELED-WEEI--QDDSIWDF  268
            P KMWMELA   LLL EP  M  +  +EL D W E+  + DSIWD+
Sbjct  145  P-KMWMELAG-ALLLDEPVAMGDDIDVELSDEWGEMEHEHDSIWDY  188



>gb|ABQ62982.1| TINY-like protein [Populus trichocarpa]
Length=188

 Score =   158 bits (399),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 102/166 (61%), Positives = 121/166 (73%), Gaps = 14/166 (8%)
 Frame = -2

Query  729  WGKWVSEIREPGKKTRIWLGSFETPEMAAAAYDVAAFHLRGCKARLNFPELVEGFPKPAS  550
            WGKWVSEIREPGKKTRIWLGS+E PEMAAAAYDVAA HLRG  A+LNFPE+V+  P+PAS
Sbjct  25   WGKWVSEIREPGKKTRIWLGSYEMPEMAAAAYDVAALHLRGRGAQLNFPEMVDSLPRPAS  84

Query  549  SQPEDVRLAAHQAAMGFKPPAE---------GVPGAGLRPVRIGLSPNQIQAINETPMDS  397
            S  EDV++AA +AA+ F+ P +            G  L PVR+GLSP+QIQAINE P+DS
Sbjct  85   SSTEDVQMAAQEAALLFRRPIKCSEGVGGSSSGGGGSLGPVRVGLSPSQIQAINEAPLDS  144

Query  396  PNKMWMELAATTLLLREPPLMICEDMMELED-WEEI--QDDSIWDF  268
            P KMWMELA   LLL EP  M  +  +EL D W E+  + DSIWD+
Sbjct  145  P-KMWMELAG-ALLLDEPVAMGDDIDVELSDEWGEMEHEHDSIWDY  188



>ref|XP_002325519.1| hypothetical protein POPTR_0019s10420g [Populus trichocarpa]
 gb|EEE99900.1| hypothetical protein POPTR_0019s10420g [Populus trichocarpa]
Length=175

 Score =   157 bits (397),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 89/158 (56%), Positives = 112/158 (71%), Gaps = 9/158 (6%)
 Frame = -2

Query  729  WGKWVSEIREPGKKTRIWLGSFETPEMAAAAYDVAAFHLRGCKARLNFPELVEGFPKPAS  550
            WGKWVSEIREPGKK RIWLGSFETPEMAAAAYDVAA H RG  AR+NFP+LV   PKP S
Sbjct  21   WGKWVSEIREPGKKNRIWLGSFETPEMAAAAYDVAALHFRGHDARVNFPDLVHDLPKPTS  80

Query  549  SQPEDVRLAAHQAAMGFKP-PAEGVPG----AGLRPVRIGLSPNQIQAINETPMDSPNKM  385
            S  ED+R+AAH+AAM  +P  AE   G    + + P+ + LS +QIQAINE+P+DSP KM
Sbjct  81   SSSEDIRMAAHEAAMSLRPFTAESSHGGSSTSNVGPITVRLSASQIQAINESPLDSP-KM  139

Query  384  WMELAATTLLLREPPLMICEDMMELEDWEEIQDDSIWD  271
            WM ++   +L      M+  + +E ++W+  Q  S+WD
Sbjct  140  WMHMSEIAILEES---MVFSNNIEEDEWDNKQTYSLWD  174



>ref|XP_009613409.1| PREDICTED: ethylene-responsive transcription factor ERF021-like 
[Nicotiana tomentosiformis]
Length=180

 Score =   157 bits (397),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 93/157 (59%), Positives = 114/157 (73%), Gaps = 9/157 (6%)
 Frame = -2

Query  729  WGKWVSEIREPGKKTRIWLGSFETPEMAAAAYDVAAFHLRGCKARLNFPELVEGFPKPAS  550
            WGKWVSEIREPGKKTRIWLGSF+T EMAAAAYD AA HLRG  A+LNFPELV+  PKPAS
Sbjct  28   WGKWVSEIREPGKKTRIWLGSFDTSEMAAAAYDSAALHLRGHAAKLNFPELVDFLPKPAS  87

Query  549  SQPEDVRLAAHQAAMGFKPPAEGVPGA----GLRPVRIGLSPNQIQAINETPMDSPNKMW  382
              P+D+R AA +AA+  K  +E +  +     L PV IGLSP+QIQAIN+ PMDSP KMW
Sbjct  88   CSPDDIRFAAQEAALKVKRNSEEMASSSATNNLAPVTIGLSPSQIQAINDFPMDSP-KMW  146

Query  381  MELAATTLLLREPPLMICEDMMELEDWEEIQDDSIWD  271
             ++  T   + E  ++ C D  E+ D+EE+ DD +WD
Sbjct  147  SDV--TREYVGEETMISCND-YEMSDYEEM-DDCLWD  179



>ref|XP_004299858.1| PREDICTED: ethylene-responsive transcription factor ERF021-like 
[Fragaria vesca subsp. vesca]
Length=194

 Score =   157 bits (396),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 94/172 (55%), Positives = 114/172 (66%), Gaps = 22/172 (13%)
 Frame = -2

Query  729  WGKWVSEIREPGKKTRIWLGSFETPEMAAAAYDVAAFHLRGCKARLNFPELVEGFPKPAS  550
            WGKWVSEIREPGKKTRIWLGSFETPEMAAAAYDVAA H RG +ARLNFPELV   P+PAS
Sbjct  25   WGKWVSEIREPGKKTRIWLGSFETPEMAAAAYDVAALHFRGREARLNFPELVSYLPRPAS  84

Query  549  SQPEDVRLAAHQAAMGFKP----PAEGVPGAG-----------LRPVRIGLSPNQIQAIN  415
            S P+D+R+AAH+AA+  +         +  AG           + PV + LSP QIQAIN
Sbjct  85   SSPDDIRMAAHEAAIRLRSNNGDTNNSLVAAGHCEVGSSSSNAVAPVTVRLSPIQIQAIN  144

Query  414  ETPMDSPNKMWMELAATTLLLREPPLMICEDM----MELEDWEEIQDDSIWD  271
            E+P+DSP KMWM+++    L+ E  +M   D     M    W  +Q DS+WD
Sbjct  145  ESPLDSP-KMWMQMSEA--LMSEESMMFSNDFDDEGMNSNQWGNMQQDSLWD  193



>ref|XP_008339085.1| PREDICTED: ethylene-responsive transcription factor ERF021 [Malus 
domestica]
Length=180

 Score =   156 bits (395),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 91/164 (55%), Positives = 111/164 (68%), Gaps = 21/164 (13%)
 Frame = -2

Query  729  WGKWVSEIREPGKKTRIWLGSFETPEMAAAAYDVAAFHLRGCKARLNFPELVEGFPKPAS  550
            WGKWVSEIREPG KTRIWLGSFETPEMAAAAYDVAA H RG  ARLNFPEL    P+PAS
Sbjct  26   WGKWVSEIREPGTKTRIWLGSFETPEMAAAAYDVAALHFRGRDARLNFPELANNLPRPAS  85

Query  549  SQPEDVRLAAHQAAMGFKPPAE-----------GVPGAGLRPVRIGLSPNQIQAINETPM  403
            S  +D+R+AAH+AA+  +  +            G   + +  VR+ LSP+QIQAINE+P+
Sbjct  86   STSDDIRMAAHEAALMLRGSSXGGGGAVEGHEVGGSSSNVGQVRVRLSPSQIQAINESPL  145

Query  402  DSPNKMWMELAATTLLLREPPLMICEDMMELEDWEEIQDDSIWD  271
            DSP KMWM++A         P M   D  E   WE++Q+DS+WD
Sbjct  146  DSP-KMWMQMAE--------PTMFSNDFFE-NQWEDLQNDSLWD  179



>ref|XP_006441645.1| hypothetical protein CICLE_v10023857mg [Citrus clementina]
 gb|ESR54885.1| hypothetical protein CICLE_v10023857mg [Citrus clementina]
Length=189

 Score =   156 bits (395),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 91/164 (55%), Positives = 114/164 (70%), Gaps = 14/164 (9%)
 Frame = -2

Query  729  WGKWVSEIREPGKKTRIWLGSFETPEMAAAAYDVAAFHLRGCKARLNFPELVEGFPKPAS  550
            WGKWVSEIREPG K+RIWLGSFET EMAAAAYDVAA H RG +ARLNFPELV   PKPAS
Sbjct  28   WGKWVSEIREPGTKSRIWLGSFETAEMAAAAYDVAALHFRGREARLNFPELVTSLPKPAS  87

Query  549  SQPEDVRLAAHQAAMGFKPPAEGVPG-----------AGLRPVRIGLSPNQIQAINETPM  403
            S  ED+R+AAH+AA+  +  + G              + L PV + LSP+QIQAIN++ M
Sbjct  88   SNAEDIRMAAHEAALRLRNTSAGSTSEEAGGGSTSGGSSLGPVTVRLSPSQIQAINDSTM  147

Query  402  DSPNKMWMELAATTLLLREPPLMICEDMMELEDWEEIQDDSIWD  271
            DSP KMWM+  A  L+L +   M+  +  E ++W ++Q DS+WD
Sbjct  148  DSP-KMWMDQMAEELMLEQN--MMFSNEFEGDEWNDMQSDSLWD  188



>gb|KDO51736.1| hypothetical protein CISIN_1g035756mg [Citrus sinensis]
Length=186

 Score =   156 bits (394),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 91/164 (55%), Positives = 114/164 (70%), Gaps = 14/164 (9%)
 Frame = -2

Query  729  WGKWVSEIREPGKKTRIWLGSFETPEMAAAAYDVAAFHLRGCKARLNFPELVEGFPKPAS  550
            WGKWVSEIREPG K+RIWLGSFET EMAAAAYDVAA H RG +ARLNFPELV   PKPAS
Sbjct  25   WGKWVSEIREPGTKSRIWLGSFETAEMAAAAYDVAALHFRGREARLNFPELVTSLPKPAS  84

Query  549  SQPEDVRLAAHQAAMGFKPPAEGVPG-----------AGLRPVRIGLSPNQIQAINETPM  403
            S  ED+R+AAH+AA+  +  + G              + L PV + LSP+QIQAIN++ M
Sbjct  85   SNAEDIRMAAHEAALRLRNTSAGSTSEEAGGGSTSGGSSLGPVTVRLSPSQIQAINDSTM  144

Query  402  DSPNKMWMELAATTLLLREPPLMICEDMMELEDWEEIQDDSIWD  271
            DSP KMWM+  A  L+L +   M+  +  E ++W ++Q DS+WD
Sbjct  145  DSP-KMWMDQMAEELMLEQN--MMFSNEFEGDEWNDMQSDSLWD  185



>gb|KDP45624.1| hypothetical protein JCGZ_17231 [Jatropha curcas]
Length=186

 Score =   155 bits (391),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 93/170 (55%), Positives = 116/170 (68%), Gaps = 24/170 (14%)
 Frame = -2

Query  729  WGKWVSEIREPGKKTRIWLGSFETPEMAAAAYDVAAFHLRGCKARLNFPELVEGFPKPAS  550
            WGKWVSEIREPGKKTRIWLGSFETPEMAAAAYDVAA H RG +A+LNFPELV   PKP S
Sbjct  23   WGKWVSEIREPGKKTRIWLGSFETPEMAAAAYDVAALHFRGREAKLNFPELVNELPKPIS  82

Query  549  SQPEDVRLAAHQAAMGFKPPAEGVPGAG-----------------LRPVRIGLSPNQIQA  421
            S  +D+R+AAH+AA+  +PP       G                 + PV + LS +QIQA
Sbjct  83   SNGDDIRMAAHEAAIRLRPPEREGGSGGSSGGSNSNSGGSSSTNVVGPVTVRLSQSQIQA  142

Query  420  INETPMDSPNKMWMELAATTLLLREPPLMICEDMMELEDWEEIQDDSIWD  271
            INE+P+DSP KMWM++A     + E  +M C D  E ++W+ +Q+DS+WD
Sbjct  143  INESPLDSP-KMWMQMA-----MAEEAMMFCND-FEDDEWDNMQNDSLWD  185



>ref|XP_011000046.1| PREDICTED: ethylene-responsive transcription factor ERF022-like 
[Populus euphratica]
Length=188

 Score =   155 bits (391),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 101/166 (61%), Positives = 120/166 (72%), Gaps = 14/166 (8%)
 Frame = -2

Query  729  WGKWVSEIREPGKKTRIWLGSFETPEMAAAAYDVAAFHLRGCKARLNFPELVEGFPKPAS  550
            WGKWVSEIREPGKKTRIWLGS+E PEMAAAAYDVAA HLRG  A+LNFPE+V+  P+PAS
Sbjct  25   WGKWVSEIREPGKKTRIWLGSYEMPEMAAAAYDVAALHLRGRGAQLNFPEMVDSLPRPAS  84

Query  549  SQPEDVRLAAHQAAMGFKPPAE---------GVPGAGLRPVRIGLSPNQIQAINETPMDS  397
            S+ EDV++AA +AA  F+ P +            G  L PVR+GLSP+QIQAINE P+DS
Sbjct  85   SRTEDVQMAAQEAASLFRRPIKCSEGVSGSSSGGGGSLGPVRVGLSPSQIQAINEAPLDS  144

Query  396  PNKMWMELAATTLLLREPPLMICEDMMELED-WEEI--QDDSIWDF  268
            P KMW ELA   LLL EP  M  +  +EL D W E+  + DSIWD+
Sbjct  145  P-KMWTELAG-ALLLDEPVAMGDDIDVELSDEWGEMEHEHDSIWDY  188



>gb|KDP45622.1| hypothetical protein JCGZ_17229 [Jatropha curcas]
Length=196

 Score =   155 bits (391),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 100/171 (58%), Positives = 114/171 (67%), Gaps = 20/171 (12%)
 Frame = -2

Query  729  WGKWVSEIREPGKKTRIWLGSFETPEMAAAAYDVAAFHLRGCKARLNFPELVEGFPKPAS  550
            WGKWVSEIREPGKKTRIWLGS+E PEMAAAAYDVAA H RG  A LNFPELV+  P+PAS
Sbjct  29   WGKWVSEIREPGKKTRIWLGSYELPEMAAAAYDVAALHFRGSGAHLNFPELVDSLPRPAS  88

Query  549  SQPEDVRLAAHQAAMGFKPPAEGVPGA-----------------GLRPVRIGLSPNQIQA  421
            S  EDV++AA +AAM F         +                 GL PVRIGLSP+QIQA
Sbjct  89   SSAEDVQMAAQEAAMRFGNNIRATKCSEVGGCGGSGGGSGGVGDGLGPVRIGLSPSQIQA  148

Query  420  INETPMDSPNKMWMELAATTLLLREPPLMICEDMMELEDWEEIQDDSIWDF  268
            INETP+DSP KMWMELA   LLL E       D  +  + EEI+D SIW++
Sbjct  149  INETPLDSP-KMWMELAG-ALLLAESTAWENVD-FDFNELEEIEDTSIWNY  196



>ref|XP_004141634.1| PREDICTED: ethylene-responsive transcription factor ERF022-like 
[Cucumis sativus]
 ref|XP_004171437.1| PREDICTED: ethylene-responsive transcription factor ERF022-like 
[Cucumis sativus]
 gb|KGN52669.1| hypothetical protein Csa_5G649870 [Cucumis sativus]
Length=163

 Score =   153 bits (387),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 92/157 (59%), Positives = 110/157 (70%), Gaps = 9/157 (6%)
 Frame = -2

Query  729  WGKWVSEIREPGKKTRIWLGSFETPEMAAAAYDVAAFHLRGCKARLNFPELVEGFPKPAS  550
            WGKWVSEIREPGKKTRIWLGS+  PEMAAAAYDVAA HLRG  ARLNFP+L + FP+PAS
Sbjct  13   WGKWVSEIREPGKKTRIWLGSYHLPEMAAAAYDVAALHLRGPDARLNFPDLADSFPRPAS  72

Query  549  SQPEDVRLAAHQAAMGF---KPPAEGVPGAGLRPVRIGLSPNQIQAINETPMDSPNKMWM  379
            S P+ ++ AAH AA+ F   KPP E  P     PVR+GLS +QIQAINE+P+DSP  MWM
Sbjct  73   SSPDHIQAAAHMAALRFANTKPP-EPAPA----PVRVGLSASQIQAINESPLDSPT-MWM  126

Query  378  ELAATTLLLREPPLMICEDMMELEDWEEIQDDSIWDF  268
            ++AA  L L        E+     + +   D SIWD+
Sbjct  127  QMAAEALSLEGHEWDDDEEYNYYNNMQHHHDHSIWDY  163



>ref|XP_010501761.1| PREDICTED: ethylene-responsive transcription factor ERF022-like 
[Camelina sativa]
 ref|XP_010501762.1| PREDICTED: ethylene-responsive transcription factor ERF022-like 
[Camelina sativa]
 ref|XP_010501763.1| PREDICTED: ethylene-responsive transcription factor ERF022-like 
[Camelina sativa]
Length=183

 Score =   154 bits (388),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 76/125 (61%), Positives = 89/125 (71%), Gaps = 2/125 (2%)
 Frame = -2

Query  729  WGKWVSEIREPGKKTRIWLGSFETPEMAAAAYDVAAFHLRGCKARLNFPELVEGFPKPAS  550
            WGKWVSEIREPGKKTRIWLGS+ET EMAAAAYD A+ +LRGC + LNFPEL   FP+ AS
Sbjct  29   WGKWVSEIREPGKKTRIWLGSYETAEMAAAAYDSASLYLRGCGSHLNFPELAHSFPQTAS  88

Query  549  SQPEDVRLAAHQAAMGFKPPAEGVP--GAGLRPVRIGLSPNQIQAINETPMDSPNKMWME  376
            S  + V+ AA +AA+ FKP     P  G+     R+GLSP+QIQAINE P+DSP   WM 
Sbjct  89   SSSKHVQAAAQEAALMFKPGGSSEPELGSSQGLSRVGLSPDQIQAINEFPLDSPRLGWMH  148

Query  375  LAATT  361
              A  
Sbjct  149  DLAVN  153



>ref|XP_002299698.1| hypothetical protein POPTR_0001s18180g [Populus trichocarpa]
 gb|EEE84503.1| hypothetical protein POPTR_0001s18180g [Populus trichocarpa]
Length=180

 Score =   154 bits (388),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 89/157 (57%), Positives = 112/157 (71%), Gaps = 8/157 (5%)
 Frame = -2

Query  729  WGKWVSEIREPGKKTRIWLGSFETPEMAAAAYDVAAFHLRGCKARLNFPELVEGFPKPAS  550
            WGKWVSEIREP KKTRIWLGSFETPEMAAAAYDVAA H RGC+A+LNFPEL    P PAS
Sbjct  25   WGKWVSEIREPEKKTRIWLGSFETPEMAAAAYDVAALHFRGCEAKLNFPELAGKLPMPAS  84

Query  549  SQPEDVRLAAHQAAMGFKPPA-----EGVPGAGLRPVRIGLSPNQIQAINETPMDSPNKM  385
            S  + +R+AAHQAA+  +P        G   + + P+ + LSP+QIQAI+E+P+DSP KM
Sbjct  85   SSADHIRMAAHQAAVSLRPSTVDSSQGGSSSSNVGPITVRLSPSQIQAIHESPLDSP-KM  143

Query  384  WMELAATTLLLREPPLMICEDMMELEDWEEIQDDSIW  274
            WM++A    L  E   M+  D +E ++W+  Q DS+W
Sbjct  144  WMQMAEIATL--EESSMMFSDDIEDDEWDNNQTDSLW  178



>ref|XP_004511477.1| PREDICTED: ethylene-responsive transcription factor ERF022-like 
[Cicer arietinum]
Length=201

 Score =   154 bits (388),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 94/174 (54%), Positives = 121/174 (70%), Gaps = 22/174 (13%)
 Frame = -2

Query  729  WGKWVSEIREPGKKTRIWLGSFETPEMAAAAYDVAAFHLRGCKARLNFPELVEGFPKPAS  550
            WGK+VSEIREPGKK+RIWLGS+E PEMAAAAYDVAA+ L+G  ARLNFPEL+E  P+PAS
Sbjct  28   WGKFVSEIREPGKKSRIWLGSYEEPEMAAAAYDVAAYRLKGRAARLNFPELIENLPQPAS  87

Query  549  SQPEDVRLAAHQAAMGFKPPAE--GVPGAG-LRPVRIGLSPNQIQAINETPMDSPNKMWM  379
            S  ED+R+AA QAA+ FK  A   GV   G + P R+GLSP+QIQAIN++P+DSP KMWM
Sbjct  88   SNAEDIRVAAQQAALQFKEIANEGGVNSNGSVVPTRVGLSPSQIQAINDSPLDSP-KMWM  146

Query  378  ELAATTLLLRE----PPLMI--------------CEDMMELEDWEEIQDDSIWD  271
            +++   +   E       M+                +++EL +WEEIQ +S+WD
Sbjct  147  QMSEALIFGFEFDDQSSRMVNYNYDNNNNNNNNNNSNVLELSEWEEIQYESLWD  200



>ref|XP_002275853.1| PREDICTED: ethylene-responsive transcription factor ERF022 [Vitis 
vinifera]
 emb|CBI31324.3| unnamed protein product [Vitis vinifera]
Length=177

 Score =   152 bits (384),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 91/163 (56%), Positives = 113/163 (69%), Gaps = 16/163 (10%)
 Frame = -2

Query  729  WGKWVSEIREPGKKTRIWLGSFETPEMAAAAYDVAAFHLRGCKARLNFPELVEGFPKPAS  550
            WGKWVSEIREPGKKTRIWLGS+E PEMAAAAYDVAA HL+G +A LNFPEL   FP+P S
Sbjct  22   WGKWVSEIREPGKKTRIWLGSYEAPEMAAAAYDVAALHLKGHRAELNFPELAPSFPRPTS  81

Query  549  SQPEDVRLAAHQAAMGFKPPAEG--------VPGAGLRPVRIGLSPNQIQAINETPMDSP  394
              PEDV+ A+ QAA+  K  A G          G    P R+GLS ++I+ INE PMDSP
Sbjct  82   FSPEDVQFASAQAALHIKSIASGDVSARSPSRVGMSSVPTRVGLSASEIREINEWPMDSP  141

Query  393  NKMWMELAATTLLLREPPLMICEDMMELEDWEEIQDD-SIWDF  268
             +MWM      + LRE PL++ +++ EL +WEE+++  SIWD 
Sbjct  142  -RMWM------MELREEPLVLSDEIFELSEWEEVENQYSIWDL  177



>ref|XP_004250714.1| PREDICTED: ethylene-responsive transcription factor ERF021 [Solanum 
lycopersicum]
Length=163

 Score =   151 bits (382),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 90/157 (57%), Positives = 106/157 (68%), Gaps = 18/157 (11%)
 Frame = -2

Query  729  WGKWVSEIREPGKKTRIWLGSFETPEMAAAAYDVAAFHLRGCKARLNFPELVEGFPKPAS  550
            WGKWVSEIREPGKKTRIWLGSFET +MAAAAYD AAFH RG  A+LNFPEL+E FPKPAS
Sbjct  16   WGKWVSEIREPGKKTRIWLGSFETAQMAAAAYDSAAFHFRGHAAKLNFPELIEHFPKPAS  75

Query  549  SQPEDVRLAAHQAAMGFKPP---AEGVPGAGLRPVRIGLSPNQIQAINETPMDSPNKMWM  379
            S PED+RLAA QAA+  +     A    G G  PV +GLSP +IQAIN+ PMDSP+ MW 
Sbjct  76   SSPEDIRLAAQQAAITVQNTNSMASSSHGHGA-PVTVGLSPTEIQAINDFPMDSPH-MWT  133

Query  378  ELAATTLLLREPPLMICEDMMELEDWEEIQDDSIWDF  268
                                 E+ D++E+ DD +WD+
Sbjct  134  THEDINYTY------------EMSDYQEM-DDCLWDY  157



>ref|XP_006363854.1| PREDICTED: ethylene-responsive transcription factor ERF022-like 
[Solanum tuberosum]
Length=169

 Score =   151 bits (382),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 90/156 (58%), Positives = 103/156 (66%), Gaps = 16/156 (10%)
 Frame = -2

Query  729  WGKWVSEIREPGKKTRIWLGSFETPEMAAAAYDVAAFHLRGCKARLNFPELVEGFPKPAS  550
            WGKWVSEIREPGKKTRIWLGSFET EMAAAAYD AAFHLRG  A+LNFPEL+  FPKPAS
Sbjct  22   WGKWVSEIREPGKKTRIWLGSFETAEMAAAAYDSAAFHLRGHAAKLNFPELIGHFPKPAS  81

Query  549  SQPEDVRLAAHQAAMGFKPPA--EGVPGAGLRPVRIGLSPNQIQAINETPMDSPNKMWME  376
            S PED+RLAA QAA+  +              PV +GLSP QIQAIN+ PMDSPN MW  
Sbjct  82   SSPEDIRLAAQQAAITVQNTNIMASTSHGHEAPVTVGLSPTQIQAINDFPMDSPN-MWTT  140

Query  375  LAATTLLLREPPLMICEDMMELEDWEEIQDDSIWDF  268
                                E+ D++E+ DD +WD+
Sbjct  141  HEDINFTY------------EMSDYQEM-DDCLWDY  163



>ref|XP_006478382.1| PREDICTED: ethylene-responsive transcription factor ERF021-like 
[Citrus sinensis]
Length=186

 Score =   152 bits (383),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 90/164 (55%), Positives = 112/164 (68%), Gaps = 14/164 (9%)
 Frame = -2

Query  729  WGKWVSEIREPGKKTRIWLGSFETPEMAAAAYDVAAFHLRGCKARLNFPELVEGFPKPAS  550
            WGKWVSEIREPG K+RIWLGSFET E AAAAYDVAA H RG +ARLNFPELV   PKPAS
Sbjct  25   WGKWVSEIREPGTKSRIWLGSFETAERAAAAYDVAALHFRGREARLNFPELVTSLPKPAS  84

Query  549  SQPEDVRLAAHQAAMGFKPPAEGVPG-----------AGLRPVRIGLSPNQIQAINETPM  403
            S  ED+R+AAH+AA+     + G              + L PV + LSP+QIQAIN++ M
Sbjct  85   SNAEDIRMAAHEAALRLGNTSAGSTSEEAGGGSTSGGSSLGPVTVRLSPSQIQAINDSTM  144

Query  402  DSPNKMWMELAATTLLLREPPLMICEDMMELEDWEEIQDDSIWD  271
            DSP KMWM+  A  L+L +   M+  +  E ++W ++Q DS+WD
Sbjct  145  DSP-KMWMDQMAEELMLEQN--MMFSNEFEGDEWNDMQSDSLWD  185



>ref|XP_010104523.1| Ethylene-responsive transcription factor [Morus notabilis]
 gb|AHJ25982.1| dehydration responsive element binding transcription factor [Morus 
notabilis]
 gb|EXC01124.1| Ethylene-responsive transcription factor [Morus notabilis]
Length=210

 Score =   152 bits (385),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 94/182 (52%), Positives = 115/182 (63%), Gaps = 30/182 (16%)
 Frame = -2

Query  729  WGKWVSEIREPGKKTRIWLGSFETPEMAAAAYDVAAFHLRGCKARLNFPELVEGFPKPAS  550
            WGKWVSEIREPGKKTRIWLGS+ETPEMAAAAYDVAA HLRG  ARLNFPEL +  P+PAS
Sbjct  29   WGKWVSEIREPGKKTRIWLGSYETPEMAAAAYDVAALHLRGRGARLNFPELSDSLPRPAS  88

Query  549  SQPEDVRLAAHQAAMGFK------------------PPAEGVPGAGLRPVRIGLSPNQIQ  424
            S  EDV++AA QAA+  K                    + G   +   PV +GLS +QIQ
Sbjct  89   SCGEDVQMAAQQAALLLKSSRPSPPPSEAAAPNDKSSDSGGAVKSCSVPVTVGLSASQIQ  148

Query  423  AINETPMDSPNKMWMELAATTLLLREPPLMIC-----------EDMMELEDWEEIQDDSI  277
            AINE+P+DSP KMWM++A   L         C           +D+++  ++EEIQ +SI
Sbjct  149  AINESPLDSP-KMWMQMAEALLFADHHYNHYCYATSSLIFNDDDDVIKFSEFEEIQHNSI  207

Query  276  WD  271
            WD
Sbjct  208  WD  209



>ref|XP_003610923.1| Ethylene-responsive transcription factor [Medicago truncatula]
 gb|AES93881.1| ethylene response factor [Medicago truncatula]
Length=193

 Score =   152 bits (383),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 87/169 (51%), Positives = 115/169 (68%), Gaps = 20/169 (12%)
 Frame = -2

Query  729  WGKWVSEIREPGKKTRIWLGSFETPEMAAAAYDVAAFHLRGCKARLNFPELVEGFPKPAS  550
            WGK+VSEIREPGKK+RIWLGS+E P+MAAAAYD+AAFHL+G  A+LNFP+++E  P PAS
Sbjct  29   WGKFVSEIREPGKKSRIWLGSYEEPQMAAAAYDIAAFHLKGHAAKLNFPDMIEKLPMPAS  88

Query  549  SQPEDVRLAAHQAAMGFK--PPAEGVPGA--------------GLRPVRIGLSPNQIQAI  418
            S+ ED+R+AA Q A+ FK  P +    G                + P R+GLSP+QIQAI
Sbjct  89   SKAEDIRVAAQQGALQFKRRPSSSSSEGGVNSINISDSNSNNDSVVPARVGLSPSQIQAI  148

Query  417  NETPMDSPNKMWMELAATTLLLREPPLMICEDMMELEDWEEIQDDSIWD  271
            NE P+DSP KMWM++        +       +++EL +WEEIQ +S+WD
Sbjct  149  NEAPLDSP-KMWMQMFGFQF---DEYRNYDNNVLELSEWEEIQYESLWD  193



>ref|XP_009335466.1| PREDICTED: ethylene-responsive transcription factor ERF021-like 
[Pyrus x bretschneideri]
Length=177

 Score =   151 bits (381),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 92/162 (57%), Positives = 113/162 (70%), Gaps = 20/162 (12%)
 Frame = -2

Query  729  WGKWVSEIREPGKKTRIWLGSFETPEMAAAAYDVAAFHLRGCKARLNFPELVEGFPKPAS  550
            WGKWVSEIREPG KTRIWLGSFETPEMAAAAYDVAAFH RG  ARLNFPELV   P+PAS
Sbjct  26   WGKWVSEIREPGTKTRIWLGSFETPEMAAAAYDVAAFHFRGRDARLNFPELVSNLPRPAS  85

Query  549  SQPEDVRLAAHQAAMGFK-PPAEGVPG--------AGLRPVRIGLSPNQIQAINETPMDS  397
            S P+D+R+AA +AA+  +   A  V G        + + PV + LSP+QIQAINE+P++S
Sbjct  86   STPDDIRMAAQEAALMLRGSGACAVEGHDQVEGSSSNVGPVTVRLSPSQIQAINESPLES  145

Query  396  PNKMWMELAATTLLLREPPLMICEDMMELEDWEEIQDDSIWD  271
            P KMWM++A         P M  +D      WE++ +DS+WD
Sbjct  146  P-KMWMQMAE--------PTMFSDDFE--NQWEDMPNDSLWD  176



>ref|XP_011007591.1| PREDICTED: ethylene-responsive transcription factor ERF021-like 
[Populus euphratica]
Length=180

 Score =   150 bits (379),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 87/157 (55%), Positives = 110/157 (70%), Gaps = 8/157 (5%)
 Frame = -2

Query  729  WGKWVSEIREPGKKTRIWLGSFETPEMAAAAYDVAAFHLRGCKARLNFPELVEGFPKPAS  550
            WGKWVSEIREPGKKTRIWLGSFETPEMAAAAYDVAA H RGC+A+LNFP+     P PAS
Sbjct  25   WGKWVSEIREPGKKTRIWLGSFETPEMAAAAYDVAALHFRGCEAKLNFPDRAGKLPMPAS  84

Query  549  SQPEDVRLAAHQAAMGFKPPA-----EGVPGAGLRPVRIGLSPNQIQAINETPMDSPNKM  385
            S  + +R+AAHQAA+  +P        G   + + P+ + LS +QIQAINE+P+DSP KM
Sbjct  85   SSADHIRMAAHQAAISLRPSTADSSQGGSSSSNVGPITVRLSASQIQAINESPLDSP-KM  143

Query  384  WMELAATTLLLREPPLMICEDMMELEDWEEIQDDSIW  274
            WM++A    L  E   M+  D +E ++W+  Q D +W
Sbjct  144  WMQMAEIATL--EESSMMFSDDIEDDEWDNNQTDPLW  178



>ref|XP_010521097.1| PREDICTED: ethylene-responsive transcription factor ERF021 [Tarenaya 
hassleriana]
Length=186

 Score =   150 bits (380),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 83/155 (54%), Positives = 103/155 (66%), Gaps = 4/155 (3%)
 Frame = -2

Query  729  WGKWVSEIREPGKKTRIWLGSFETPEMAAAAYDVAAFHLRGCKARLNFPELVEGFPKPAS  550
            WGKWVSEIREPG K RIWLGSFETPEMAA AYD AAFH RG +ARLNFPELV   P+P S
Sbjct  33   WGKWVSEIREPGTKNRIWLGSFETPEMAATAYDAAAFHFRGREARLNFPELVNNLPRPVS  92

Query  549  SQPEDVRLAAHQAAMGFKPPAEGVPGAGLR--PVRIGLSPNQIQAINETPMDSPNKMWME  376
            S P+ VR+AAH+AA+  +   +    +  R  PV + LSP +I+AIN++ + SP  MWM 
Sbjct  93   STPDGVRMAAHEAALSLRAATDDGDSSSSRVGPVTVRLSPTEIEAINDSTLGSP-TMWMH  151

Query  375  LAATTLLLREPPLMICEDMMELEDWEEIQDDSIWD  271
              A  L+L    L   +D  +   W+  Q DS+WD
Sbjct  152  ATAERLMLDGDSLGFADDTYQ-NVWDNYQTDSLWD  185



>ref|XP_008378774.1| PREDICTED: ethylene-responsive transcription factor ERF021-like 
[Malus domestica]
Length=177

 Score =   150 bits (378),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 89/162 (55%), Positives = 108/162 (67%), Gaps = 20/162 (12%)
 Frame = -2

Query  729  WGKWVSEIREPGKKTRIWLGSFETPEMAAAAYDVAAFHLRGCKARLNFPELVEGFPKPAS  550
            WGKWVSEIREPG KT IWLGSFETPEMAAAAYDVAA H RG  ARLNFPELV   P+PAS
Sbjct  26   WGKWVSEIREPGTKTXIWLGSFETPEMAAAAYDVAALHFRGRDARLNFPELVSNLPRPAS  85

Query  549  SQPEDVRLAAHQAAMGFKPPAEGV---------PGAGLRPVRIGLSPNQIQAINETPMDS  397
            S P+D+R AA +AA+  +    G            + + PV + LSP+QIQAINE+P+DS
Sbjct  86   STPDDIRTAAQEAALMLRGSGAGAVEGHDQVEGSSSNVGPVTVRLSPSQIQAINESPLDS  145

Query  396  PNKMWMELAATTLLLREPPLMICEDMMELEDWEEIQDDSIWD  271
            P KMWM++A         P M  +D      WE++ +DS+WD
Sbjct  146  P-KMWMQMAE--------PTMFSDDFE--NQWEDMPNDSLWD  176



>ref|XP_007157007.1| hypothetical protein PHAVU_002G035900g [Phaseolus vulgaris]
 gb|ESW29001.1| hypothetical protein PHAVU_002G035900g [Phaseolus vulgaris]
Length=182

 Score =   150 bits (378),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 85/157 (54%), Positives = 107/157 (68%), Gaps = 5/157 (3%)
 Frame = -2

Query  729  WGKWVSEIREPGKKTRIWLGSFETPEMAAAAYDVAAFHLRGCKARLNFPELVEGFPKPAS  550
            WGKWVSEIREPG KTRIWLGSFETPEMAAAAYDVAA H RG  ARLNFPEL    P+P S
Sbjct  26   WGKWVSEIREPGTKTRIWLGSFETPEMAAAAYDVAALHFRGRDARLNFPELASTLPRPVS  85

Query  549  SQPEDVRLAAHQAAMGFK--PPAEGVPGAGLR--PVRIGLSPNQIQAINETPMDSPNKMW  382
            +  + +R+AAH+AA+  +  P A    G  L   P+ + LSP QIQAIN++PMDSP + W
Sbjct  86   NNADHIRMAAHEAALRLRTNPAAAETGGGSLTAPPLTVRLSPTQIQAINDSPMDSP-QTW  144

Query  381  MELAATTLLLREPPLMICEDMMELEDWEEIQDDSIWD  271
            M++  T ++  +  +       E  +WE +Q DS+WD
Sbjct  145  MQMPDTFMMHDQSMMFANGYAFEDNEWENMQSDSLWD  181



>ref|XP_008459595.1| PREDICTED: ethylene-responsive transcription factor ERF022-like 
[Cucumis melo]
Length=161

 Score =   149 bits (375),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 90/158 (57%), Positives = 111/158 (70%), Gaps = 13/158 (8%)
 Frame = -2

Query  729  WGKWVSEIREPGKKTRIWLGSFETPEMAAAAYDVAAFHLRGCKARLNFPELVEGFPKPAS  550
            WGKWVSEIREPGKKTRIWLGS+  PEMAAAAYDVAA HLRG  ARLNFP+L + FP+PAS
Sbjct  13   WGKWVSEIREPGKKTRIWLGSYHLPEMAAAAYDVAALHLRGPDARLNFPDLADSFPRPAS  72

Query  549  SQPEDVRLAAHQAAMGF----KPPAEGVPGAGLRPVRIGLSPNQIQAINETPMDSPNKMW  382
            S P+ ++ AAH AA+ F    KPP          PVR+GLSP+QIQAINE+P+DSP  MW
Sbjct  73   SSPDHIQAAAHMAALRFANTCKPPEPPA------PVRVGLSPSQIQAINESPLDSPT-MW  125

Query  381  MELAATTLLLREPPLMICEDMMELEDWEEIQDDSIWDF  268
            M++AA  L L+  P    ++     +  ++   SIWD+
Sbjct  126  MQMAAEALSLQ--PREWDDEYNYNNNNMQLHHHSIWDY  161



>ref|XP_009105814.1| PREDICTED: ethylene-responsive transcription factor ERF021 [Brassica 
rapa]
Length=183

 Score =   149 bits (377),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 80/162 (49%), Positives = 100/162 (62%), Gaps = 19/162 (12%)
 Frame = -2

Query  729  WGKWVSEIREPGKKTRIWLGSFETPEMAAAAYDVAAFHLRGCKARLNFPELVEGFPKPAS  550
            WGKWVSEIREPG K RIWLGSFETPEMAA AYDVAAFH RG +ARLNFPELV   P+PA 
Sbjct  31   WGKWVSEIREPGTKNRIWLGSFETPEMAATAYDVAAFHFRGREARLNFPELVGSLPRPAD  90

Query  549  SQPEDVRLAAHQAAMGFKP-PAEG------VPGAGLRPVRIGLSPNQIQAINETPMDSPN  391
            S  + +R+AAH+AA+  +P P E          +   P  + LSP +IQAINE+ + SP 
Sbjct  91   SSSDSIRMAAHEAALCLRPEPVESDMHVDTSSSSNAGPTMVRLSPREIQAINESTLGSP-  149

Query  390  KMWMELAATTLLLR--EPPLMICEDMMELEDWEEIQDDSIWD  271
                     T+L+   +   M   + M +  W+    DS+WD
Sbjct  150  ---------TMLMHSTDDYSMGFANYMGMNVWDTYHTDSLWD  182



>emb|CDX72808.1| BnaC06g32560D [Brassica napus]
Length=183

 Score =   149 bits (375),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 79/160 (49%), Positives = 99/160 (62%), Gaps = 15/160 (9%)
 Frame = -2

Query  729  WGKWVSEIREPGKKTRIWLGSFETPEMAAAAYDVAAFHLRGCKARLNFPELVEGFPKPAS  550
            WGKWVSEIREPG K RIWLGSFETPEMAA AYDVAAFH RG +ARLNFPELV   P+PA 
Sbjct  31   WGKWVSEIREPGTKNRIWLGSFETPEMAATAYDVAAFHFRGGEARLNFPELVGSLPRPAD  90

Query  549  SQPEDVRLAAHQAAMGFKP-PAEG------VPGAGLRPVRIGLSPNQIQAINETPMDSPN  391
            S  + +R+AAH+AA+  +  P E          +   P  + LSP +IQAINE+ + SP 
Sbjct  91   SSSDSIRMAAHEAALCLRTEPVESDMHVDTSSSSNAGPTMVRLSPREIQAINESTLGSPT  150

Query  390  KMWMELAATTLLLREPPLMICEDMMELEDWEEIQDDSIWD  271
               M + +T     +   M   + M +  W+    DS+WD
Sbjct  151  ---MSMHST-----DDYSMGFANHMGMSAWDTYHTDSLWD  182



>ref|XP_007019867.1| Integrase-type DNA-binding superfamily protein [Theobroma cacao]
 gb|EOY17092.1| Integrase-type DNA-binding superfamily protein [Theobroma cacao]
Length=193

 Score =   149 bits (375),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 98/172 (57%), Positives = 115/172 (67%), Gaps = 21/172 (12%)
 Frame = -2

Query  729  WGKWVSEIREPGKKTRIWLGSFETPEMAAAAYDVAAFHLRGCKARLNFPELVEGFPKPAS  550
            WGKWVSEIREPGKKTRIWLGS+ET EMAAAAYDVAA H RG  ARLNFPELV+  P+PAS
Sbjct  24   WGKWVSEIREPGKKTRIWLGSYETAEMAAAAYDVAALHFRGRAARLNFPELVDSLPRPAS  83

Query  549  SQPEDVRLAAHQAAMGFKPP---------------AEGVPGAGLRPVRIGLSPNQIQAIN  415
            S  EDV++AA +AA+  + P               A       L P+R+GLS +QIQAIN
Sbjct  84   SSAEDVQMAAQEAALRLRRPKISSEVAMGACAGTGAAAAADGSLGPIRVGLSQSQIQAIN  143

Query  414  ETPMDSPNKMWMELAATTLLLREPPLMICE----DMMELEDWEEIQDDSIWD  271
            E P+DSP KMWMELA   LL+ EP L   E    ++M  E  E +Q +SIWD
Sbjct  144  EFPLDSP-KMWMELAG-ALLMAEPTLYGDEFDDAELMISEYEEIVQVESIWD  193



>ref|XP_006573841.1| PREDICTED: ethylene-responsive transcription factor ERF021-like 
[Glycine max]
Length=186

 Score =   148 bits (374),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 86/161 (53%), Positives = 109/161 (68%), Gaps = 10/161 (6%)
 Frame = -2

Query  729  WGKWVSEIREPGKKTRIWLGSFETPEMAAAAYDVAAFHLRGCKARLNFPELVEGFPKPAS  550
            WGKWVSEIREPG KTRIWLGSFETPEMAAAAYDVAA H RG  ARLNFPEL    P+P S
Sbjct  27   WGKWVSEIREPGTKTRIWLGSFETPEMAAAAYDVAALHFRGRDARLNFPELASTLPRPVS  86

Query  549  SQPEDVRLAAHQAAMGFK--PPAEGV----PGAGLRPVRIGLSPNQIQAINETPMDSPNK  388
            +  + +R+AAHQAA+  +  P A         +   P+ + LSP QIQAIN++PMDSP +
Sbjct  87   NNADHIRMAAHQAALRLRTNPAAPDTAGSAGSSSSAPLTVRLSPTQIQAINDSPMDSP-Q  145

Query  387  MWMELAATTLLLREPPLMICEDMMELED--WEEIQDDSIWD  271
             WM++   T ++ +  +M   +    ED  WE +Q+DS+WD
Sbjct  146  TWMQM-PDTFMMHDQSMMFASNGYSFEDNEWEHMQNDSLWD  185



>ref|XP_010471159.1| PREDICTED: ethylene-responsive transcription factor ERF021 [Camelina 
sativa]
Length=183

 Score =   148 bits (373),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 76/160 (48%), Positives = 97/160 (61%), Gaps = 16/160 (10%)
 Frame = -2

Query  729  WGKWVSEIREPGKKTRIWLGSFETPEMAAAAYDVAAFHLRGCKARLNFPELVEGFPKPAS  550
            WGKWVSEIREPG K RIWLGSFETPEMAA AYDVAAFH RG +ARLNFPEL    P+P  
Sbjct  32   WGKWVSEIREPGTKHRIWLGSFETPEMAATAYDVAAFHFRGREARLNFPELASSLPRPVD  91

Query  549  SQPEDVRLAAHQAAMGFKPPA-------EGVPGAGLRPVRIGLSPNQIQAINETPMDSPN  391
            S  + +R+AAH+A +  +  A       +    + + P  + LSP +IQAINE+ + SP 
Sbjct  92   SSSDSIRMAAHEATLCRRTEASESAMQVDSSSSSTVGPTMVSLSPREIQAINESTLGSP-  150

Query  390  KMWMELAATTLLLREPPLMICEDMMELEDWEEIQDDSIWD  271
                    +TL+      M   + +E+  WE  Q D +WD
Sbjct  151  --------STLMHSTYDSMGFANDVEMYAWETYQSDFLWD  182



>ref|XP_002887374.1| hypothetical protein ARALYDRAFT_476276 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH63633.1| hypothetical protein ARALYDRAFT_476276 [Arabidopsis lyrata subsp. 
lyrata]
Length=183

 Score =   148 bits (373),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 79/162 (49%), Positives = 96/162 (59%), Gaps = 20/162 (12%)
 Frame = -2

Query  729  WGKWVSEIREPGKKTRIWLGSFETPEMAAAAYDVAAFHLRGCKARLNFPELVEGFPKPAS  550
            WGKWVSEIREPG K RIWLGSFETPEMAA AYDVAAFH RG +ARLNFPEL    P+PA 
Sbjct  32   WGKWVSEIREPGTKNRIWLGSFETPEMAATAYDVAAFHFRGREARLNFPELASSLPRPAD  91

Query  549  SQPEDVRLAAHQAAMGFKPPAEGVPGA---------GLRPVRIGLSPNQIQAINETPMDS  397
            S  + +R+A  +A +      EG   A          + P  + LSP +IQAINE+ + S
Sbjct  92   SSSDSIRMAVQEATLC--RTTEGSESAMQVNSSSSSTVVPTMVRLSPTEIQAINESTLGS  149

Query  396  PNKMWMELAATTLLLREPPLMICEDMMELEDWEEIQDDSIWD  271
            P         TTL+      M+  + ME+  WE  Q D +WD
Sbjct  150  P---------TTLMHSTYDSMVFANDMEMNAWETYQSDFLWD  182



>ref|XP_003538666.1| PREDICTED: ethylene-responsive transcription factor ERF021-like 
[Glycine max]
Length=185

 Score =   148 bits (373),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 83/159 (52%), Positives = 108/159 (68%), Gaps = 7/159 (4%)
 Frame = -2

Query  729  WGKWVSEIREPGKKTRIWLGSFETPEMAAAAYDVAAFHLRGCKARLNFPELVEGFPKPAS  550
            WGKWVSEIREPG KTRIWLGSFETPEMAAAAYDVAA H RG  ARLNFPEL    P+P S
Sbjct  27   WGKWVSEIREPGTKTRIWLGSFETPEMAAAAYDVAALHFRGRDARLNFPELASTLPRPVS  86

Query  549  SQPEDVRLAAHQAAMGFK-----PPAEGVPGA-GLRPVRIGLSPNQIQAINETPMDSPNK  388
            +  + +R+AAH+AA+  +     P   G  G+    P+ + LSP QIQAIN++PMDSP +
Sbjct  87   NNADHIRMAAHEAALRLRTNPAAPNTVGSAGSVSAAPLTVRLSPTQIQAINDSPMDSP-Q  145

Query  387  MWMELAATTLLLREPPLMICEDMMELEDWEEIQDDSIWD  271
             WM++  T ++  +  +       E  +WE++ +DS+WD
Sbjct  146  TWMQMPDTFMMHDQSMMFANGYSFEDNEWEDMHNDSLWD  184



>emb|CDX68310.1| BnaA07g23500D [Brassica napus]
Length=176

 Score =   147 bits (371),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 81/162 (50%), Positives = 99/162 (61%), Gaps = 23/162 (14%)
 Frame = -2

Query  729  WGKWVSEIREPGKKTRIWLGSFETPEMAAAAYDVAAFHLRGCKARLNFPELVEGFPKPAS  550
            WGKWVSEIREPG   RIWLGSFETPEMAA AYDVAAFH RG  ARLNFPELV   P+PA 
Sbjct  28   WGKWVSEIREPGTTNRIWLGSFETPEMAATAYDVAAFHFRGQGARLNFPELVNSLPRPAD  87

Query  549  SQPEDVRLAAHQAAMGFKP-PAEGV------PGAGLRPVRIGLSPNQIQAINETPMDSPN  391
            S  + VR+AAHQAA+  +  PAE          + +    + LSP +IQAINE+ + SP 
Sbjct  88   SSADSVRMAAHQAALYLRTEPAESAMQVDTSSSSNVGTTMVRLSPREIQAINESTLGSP-  146

Query  390  KMWMELAATTLLLREPPLMICEDMMELED--WEEIQDDSIWD  271
                     T+L+        +D M  ++  W+  Q DS+WD
Sbjct  147  ---------TMLMHSS----YDDPMGFDNDVWDAYQTDSLWD  175



>gb|KHN34158.1| Ethylene-responsive transcription factor ERF021 [Glycine soja]
Length=186

 Score =   147 bits (370),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 85/161 (53%), Positives = 108/161 (67%), Gaps = 10/161 (6%)
 Frame = -2

Query  729  WGKWVSEIREPGKKTRIWLGSFETPEMAAAAYDVAAFHLRGCKARLNFPELVEGFPKPAS  550
            WGKWVSE REPG KTRIWLGSFETPEMAAAAYDVAA H RG  ARLNFPEL    P+P S
Sbjct  27   WGKWVSETREPGTKTRIWLGSFETPEMAAAAYDVAALHFRGRDARLNFPELASTLPRPVS  86

Query  549  SQPEDVRLAAHQAAMGFK--PPAEGV----PGAGLRPVRIGLSPNQIQAINETPMDSPNK  388
            +  + +R+AAHQAA+  +  P A         +   P+ + LSP QIQAIN++PMDSP +
Sbjct  87   NNADHIRMAAHQAALRLRTNPAAPDTAGSAGSSSSAPLTVRLSPTQIQAINDSPMDSP-Q  145

Query  387  MWMELAATTLLLREPPLMICEDMMELED--WEEIQDDSIWD  271
             WM++   T ++ +  +M   +    ED  WE +Q+DS+WD
Sbjct  146  TWMQM-PDTFMMHDQSMMFASNGYSFEDNEWEHMQNDSLWD  185



>ref|XP_010427981.1| PREDICTED: ethylene-responsive transcription factor ERF021-like 
[Camelina sativa]
Length=183

 Score =   147 bits (370),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 75/160 (47%), Positives = 97/160 (61%), Gaps = 16/160 (10%)
 Frame = -2

Query  729  WGKWVSEIREPGKKTRIWLGSFETPEMAAAAYDVAAFHLRGCKARLNFPELVEGFPKPAS  550
            WGKWVSEIREPG K RIWLGSFETPEMAA AYDVAAFH RG +ARLNFPEL    P+P  
Sbjct  32   WGKWVSEIREPGTKNRIWLGSFETPEMAATAYDVAAFHFRGREARLNFPELASSLPRPVD  91

Query  549  SQPEDVRLAAHQAAMGFKPPA-------EGVPGAGLRPVRIGLSPNQIQAINETPMDSPN  391
            S  + +R+AAH+A +  +  A       +    + + P  + LSP +IQAINE+ + SP 
Sbjct  92   SSSDSIRMAAHEATLCRRTEASESAMQVDSSSSSTVGPTMVSLSPREIQAINESTLGSP-  150

Query  390  KMWMELAATTLLLREPPLMICEDMMELEDWEEIQDDSIWD  271
                    +TL+      M   + +E+  WE  Q + +WD
Sbjct  151  --------STLMHSTYDSMGFANDVEMYAWETYQSEFLWD  182



>ref|XP_009104913.1| PREDICTED: ethylene-responsive transcription factor ERF021-like 
[Brassica rapa]
Length=184

 Score =   147 bits (370),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 80/163 (49%), Positives = 99/163 (61%), Gaps = 21/163 (13%)
 Frame = -2

Query  729  WGKWVSEIREPGKKTRIWLGSFETPEMAAAAYDVAAFHLRGCKARLNFPELVEGFPKPAS  550
            WGKWVSEIREPG   RIWLGSFETPEMAA AYDVAAFH RG  ARLNFPELV   P+PA 
Sbjct  32   WGKWVSEIREPGTTNRIWLGSFETPEMAATAYDVAAFHFRGQGARLNFPELVNSLPRPAD  91

Query  549  SQPEDVRLAAHQAAMGFKP-PAEGV------PGAGLRPVRIGLSPNQIQAINETPMDSPN  391
            S  + VR+AAHQAA+  +  P E          + +    + LSP +IQAINE+ + SP 
Sbjct  92   SSADSVRMAAHQAALYLRTEPVESAMQVDTSSSSNVGTTMVRLSPREIQAINESTLGSP-  150

Query  390  KMWMELAATTLLLR---EPPLMICEDMMELEDWEEIQDDSIWD  271
                     T+L+    + P+    D + +  W+  Q DS+WD
Sbjct  151  ---------TMLMHSSYDDPMGFDND-VGMNVWDAYQTDSLWD  183



>ref|XP_010415854.1| PREDICTED: ethylene-responsive transcription factor ERF021-like 
[Camelina sativa]
 ref|XP_010415855.1| PREDICTED: ethylene-responsive transcription factor ERF021-like 
[Camelina sativa]
Length=183

 Score =   146 bits (369),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 79/164 (48%), Positives = 96/164 (59%), Gaps = 24/164 (15%)
 Frame = -2

Query  729  WGKWVSEIREPGKKTRIWLGSFETPEMAAAAYDVAAFHLRGCKARLNFPELVEGFPKPAS  550
            WGKWVSEIREPG K RIWLGSFETPEMAA AYDVAAFH RG +ARLNFPEL    P+P  
Sbjct  32   WGKWVSEIREPGTKNRIWLGSFETPEMAATAYDVAAFHFRGREARLNFPELASSLPRPID  91

Query  549  SQPEDVRLAAHQA-----------AMGFKPPAEGVPGAGLRPVRIGLSPNQIQAINETPM  403
            S  + +R+AAH+A           AM    P+    G    P  + LSP +IQAINE+ +
Sbjct  92   SSSDSIRMAAHEATLCRRTEASESAMQVDRPSSSTVG----PTMVSLSPREIQAINESTL  147

Query  402  DSPNKMWMELAATTLLLREPPLMICEDMMELEDWEEIQDDSIWD  271
             SP         +TL+      M   + +E+  WE  Q D +WD
Sbjct  148  GSP---------STLMHSTYDSMGFANDVEMYAWETYQSDFLWD  182



>ref|NP_177301.1| ethylene-responsive transcription factor ERF021 [Arabidopsis 
thaliana]
 sp|Q9C9I2.1|ERF21_ARATH RecName: Full=Ethylene-responsive transcription factor ERF021 
[Arabidopsis thaliana]
 gb|AAG51821.1|AC016163_10 putative TINY; 48985-48434 [Arabidopsis thaliana]
 gb|AAR23734.1| At1g71450 [Arabidopsis thaliana]
 gb|AAS68114.1| At1g71450 [Arabidopsis thaliana]
 gb|AEE35202.1| ethylene-responsive transcription factor ERF021 [Arabidopsis 
thaliana]
Length=183

 Score =   146 bits (369),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 75/160 (47%), Positives = 94/160 (59%), Gaps = 16/160 (10%)
 Frame = -2

Query  729  WGKWVSEIREPGKKTRIWLGSFETPEMAAAAYDVAAFHLRGCKARLNFPELVEGFPKPAS  550
            WGKWVSEIREPG K RIWLGSFETPEMAA AYDVAAFH RG +ARLNFPEL    P+PA 
Sbjct  32   WGKWVSEIREPGTKNRIWLGSFETPEMAATAYDVAAFHFRGREARLNFPELASSLPRPAD  91

Query  549  SQPEDVRLAAHQAAMGFKPPA-------EGVPGAGLRPVRIGLSPNQIQAINETPMDSPN  391
            S  + +R+A H+A +             +    + + P  + LSP +IQAINE+ + SP 
Sbjct  92   SSSDSIRMAVHEATLCRTTEGTESAMQVDSSSSSNVAPTMVRLSPREIQAINESTLGSPT  151

Query  390  KMWMELAATTLLLREPPLMICEDMMELEDWEEIQDDSIWD  271
             M        +     P+    D +E+  WE  Q D +WD
Sbjct  152  TM--------MHSTYDPMEFAND-VEMNAWETYQSDFLWD  182



>emb|CDY36693.1| BnaCnng07950D [Brassica napus]
Length=185

 Score =   146 bits (369),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 80/160 (50%), Positives = 98/160 (61%), Gaps = 14/160 (9%)
 Frame = -2

Query  729  WGKWVSEIREPGKKTRIWLGSFETPEMAAAAYDVAAFHLRGCKARLNFPELVEGFPKPAS  550
            WGKWVSEIREPG   RIWLGSFETPEMAA AYDVAAFH RG  ARLNFPELV   P+PA 
Sbjct  32   WGKWVSEIREPGTTNRIWLGSFETPEMAATAYDVAAFHFRGQGARLNFPELVNSLPRPAD  91

Query  549  SQPEDVRLAAHQAAMGFKP-PAEGV------PGAGLRPVRIGLSPNQIQAINETPMDSPN  391
            S  + VR+AAHQAA+  +  P E          + +    + LSP +IQAINE+ + SP 
Sbjct  92   SSADSVRMAAHQAALCLRTEPVESAMQVDTSSSSNIGTTMVRLSPREIQAINESTLGSP-  150

Query  390  KMWMELAATTLLLREPPLMICEDMMELEDWEEIQDDSIWD  271
             M M  +       + P+    D + +  W+  Q DS+WD
Sbjct  151  TMLMHSS-----YDDDPMGFDND-VGMNVWDAYQTDSLWD  184



>ref|XP_006301876.1| hypothetical protein CARUB_v10022349mg [Capsella rubella]
 gb|EOA34774.1| hypothetical protein CARUB_v10022349mg [Capsella rubella]
Length=182

 Score =   145 bits (366),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 77/160 (48%), Positives = 98/160 (61%), Gaps = 16/160 (10%)
 Frame = -2

Query  729  WGKWVSEIREPGKKTRIWLGSFETPEMAAAAYDVAAFHLRGCKARLNFPELVEGFPKPAS  550
            WGKWVSEIREPG K RIWLGSFETPEMAA AYDVAAFH RG +ARLNFPEL    P+PA 
Sbjct  31   WGKWVSEIREPGTKNRIWLGSFETPEMAATAYDVAAFHFRGREARLNFPELASTLPRPAD  90

Query  549  SQPEDVRLAAHQAA--MGFKP-----PAEGVPGAGLRPVRIGLSPNQIQAINETPMDSPN  391
            S  + +R+AAH+A   +G +P       +    + + P  + LSP +IQAINE+ + SP+
Sbjct  91   SSSDSIRMAAHEATLCLGTQPVDSAMQVDSSSSSAVSPTMVRLSPREIQAINESTLGSPS  150

Query  390  KMWMELAATTLLLREPPLMICEDMMELEDWEEIQDDSIWD  271
             MWM      +             + +  W+  Q DS+WD
Sbjct  151  -MWMHSTDDCMGFATD--------LGMNVWDTYQSDSLWD  181



>ref|XP_010645899.1| PREDICTED: ethylene-responsive transcription factor ERF021 [Vitis 
vinifera]
 emb|CAN74966.1| hypothetical protein VITISV_038046 [Vitis vinifera]
 emb|CBI31325.3| unnamed protein product [Vitis vinifera]
Length=182

 Score =   145 bits (365),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 92/160 (58%), Positives = 113/160 (71%), Gaps = 11/160 (7%)
 Frame = -2

Query  729  WGKWVSEIREPGKKTRIWLGSFETPEMAAAAYDVAAFHLRGCKARLNFPELVEGFPKPAS  550
            WGKWVSEIREPG KTRIWLGSFETPEMAA AYD AA H RG  A+LNFPEL    P+PAS
Sbjct  27   WGKWVSEIREPGTKTRIWLGSFETPEMAAMAYDAAALHFRGHGAKLNFPELAPNLPRPAS  86

Query  549  SQPEDVRLAAHQAAMGFKPPAE----GVPGAGLRPVRIGLSPNQIQAINETPMDSPNKMW  382
            S  E +RLAA +AA+      E       G+GL PVR+GLSP+QIQAIN++ +DSP + W
Sbjct  87   SAAEHIRLAAQEAALRLTRAPESAGQSGSGSGLGPVRVGLSPSQIQAINDSTLDSP-RNW  145

Query  381  MELAATTLLLREPPLMICEDMMELEDWEEIQ---DDSIWD  271
             EL A T+ L E  +M CE  +E+ DW+E +   ++S+WD
Sbjct  146  TEL-AQTVFLDESMIMSCE--LEISDWDEEEVEVNESLWD  182



>emb|CDY03695.1| BnaA02g15420D [Brassica napus]
Length=182

 Score =   144 bits (362),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 78/160 (49%), Positives = 94/160 (59%), Gaps = 16/160 (10%)
 Frame = -2

Query  729  WGKWVSEIREPGKKTRIWLGSFETPEMAAAAYDVAAFHLRGCKARLNFPELVEGFPKPAS  550
            WGKWVSEIREPG K RIWLGSFETPEMAA AYDVAAFH RG +ARLNFPEL    P+P  
Sbjct  31   WGKWVSEIREPGTKNRIWLGSFETPEMAATAYDVAAFHFRGREARLNFPELASSLPRPVD  90

Query  549  SQPEDVRLAAHQAAMGFKP-PAEGV------PGAGLRPVRIGLSPNQIQAINETPMDSPN  391
            S  + VR+AAH+AA+  +  P E          +   P  + LSP +IQAINE+ M SP 
Sbjct  91   SSSDSVRMAAHEAALCLRTEPVESAMQVDTSSSSNAGPTMVRLSPREIQAINESTMGSP-  149

Query  390  KMWMELAATTLLLREPPLMICEDMMELEDWEEIQDDSIWD  271
                    T ++      M     M +  W+    DS+WD
Sbjct  150  --------TMMMHSTYDSMGFGYDMGMNVWDTYLTDSLWD  181



>ref|XP_003517540.2| PREDICTED: ethylene-responsive transcription factor ERF022-like 
[Glycine max]
Length=213

 Score =   144 bits (363),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 99/174 (57%), Positives = 117/174 (67%), Gaps = 22/174 (13%)
 Frame = -2

Query  729  WGKWVSEIREPGKKTRIWLGSFETPEMAAAAYDVAAFHLRGCKARLNFPELVEGFPKPAS  550
            WGKWVSEIREPGKK+RIWLGS+E+PEMAAAAYDVAA HLRG  ARLNFPELVE  P+P S
Sbjct  36   WGKWVSEIREPGKKSRIWLGSYESPEMAAAAYDVAALHLRGRAARLNFPELVETLPRPTS  95

Query  549  SQPEDVRLAAHQAAMGFK-----PPAEGVPG---------AGLRPVRIGLSPNQIQAINE  412
            S+PEDV++AA QAA+ F+      P     G           + PVR+GLSP QIQAINE
Sbjct  96   SKPEDVQVAAQQAAVMFRISPTMSPINNHQGCVNDNNIIKGSVVPVRVGLSPTQIQAINE  155

Query  411  TPMDSPNKMWMELAATTLLL---REPPLMICED----MMELEDWEEIQDDSIWD  271
            +P+DSP KMWM   A  L         +M+  D     +EL  WEEIQ +S+WD
Sbjct  156  SPLDSP-KMWMVQMAEALRFGFDDHSMMMLPSDDDDYALELSGWEEIQHESLWD  208



>ref|XP_007157008.1| hypothetical protein PHAVU_002G036000g [Phaseolus vulgaris]
 gb|ESW29002.1| hypothetical protein PHAVU_002G036000g [Phaseolus vulgaris]
Length=266

 Score =   145 bits (365),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 92/176 (52%), Positives = 116/176 (66%), Gaps = 24/176 (14%)
 Frame = -2

Query  729  WGKWVSEIREPGKKTRIWLGSFETPEMAAAAYDVAAFHLRGCKARLNFPELVEGFPKPAS  550
            WGKWVSEIREPGKK+RIWLGS+E+PEMAAAAYDVAA HLRG  A+LNFPEL E  P+PAS
Sbjct  87   WGKWVSEIREPGKKSRIWLGSYESPEMAAAAYDVAALHLRGRAAKLNFPELAETLPRPAS  146

Query  549  SQPEDVRLAAHQAAMGF--------------KPPAEGVPGAGLRPVRIGLSPNQIQAINE  412
            S+ EDV++AA QAA+ F              +        +G+ P+++GLS  QIQAINE
Sbjct  147  SKSEDVQMAAQQAALRFTRSPTMSHNQICMSETSNSNSNSSGVVPLQVGLSATQIQAINE  206

Query  411  TPMDSPNKMWMELAATTLLL---REPPLMI--CED----MMELEDWEEIQDDSIWD  271
            +P++SP KMWM   A T       E  +M+  C+      MEL  WEE+  +S+WD
Sbjct  207  SPLESP-KMWMMQMAETPRFGFGDEYSMMMVSCDGDDGYGMELSGWEEMHHESLWD  261



>gb|AFJ14636.1| dehydration-responsive element-binding protein (DREB5), partial 
[Malus domestica]
Length=201

 Score =   143 bits (360),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 91/179 (51%), Positives = 109/179 (61%), Gaps = 27/179 (15%)
 Frame = -2

Query  729  WGKWVSEIREPGKKTRIWLGSFETPEMAAAAYDVAAFHLRGCKARLNFPELVEGFPKPAS  550
            WGKWVSEIREPGKKTRIWLGS+E PEMAAAAYD AA HL+GC A LNFPE+ +  P+PAS
Sbjct  23   WGKWVSEIREPGKKTRIWLGSYEAPEMAAAAYDAAALHLKGCGAALNFPEMADSLPRPAS  82

Query  549  SQPEDVRLAAHQAAMGFKP---PAEGVP---------GAGLRPVRIGLSPNQIQAINETP  406
            S   DV+LAA +AA+  +    P E  P         G    PV +GLSP+QIQAINE+P
Sbjct  83   SSAMDVQLAAQEAALRVRRQQLPMEAFPKEEVGGSSRGLSSAPVTVGLSPSQIQAINESP  142

Query  405  MDSPNKMWMELAATTLLLREP--------------PLMICEDMMELEDWEEIQDDSIWD  271
            +DSP KMWM+          P              P    E  +E  D+E++Q  SIWD
Sbjct  143  LDSP-KMWMQYMCRAHCHEAPSSLGGDLWDTDNSSPNKYYEGDVESMDYEDMQHWSIWD  200



>ref|XP_006390770.1| hypothetical protein EUTSA_v10019659mg [Eutrema salsugineum]
 gb|ESQ28056.1| hypothetical protein EUTSA_v10019659mg [Eutrema salsugineum]
Length=185

 Score =   142 bits (358),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 77/164 (47%), Positives = 98/164 (60%), Gaps = 21/164 (13%)
 Frame = -2

Query  729  WGKWVSEIREPGKKTRIWLGSFETPEMAAAAYDVAAFHLRGCKARLNFPELVEGFPKPAS  550
            WGKWVSEIREPG K RIWLGSFETPEMAA AYDVAA+H RG +ARLNFPEL    P+PA 
Sbjct  31   WGKWVSEIREPGTKNRIWLGSFETPEMAATAYDVAAYHFRGREARLNFPELASNLPRPAD  90

Query  549  SQPEDVRLAAHQAAMGFKP-PAE-------GVPGAGLRPVRIGLSPNQIQAINETPMDSP  394
            S  + +R+AAH+A +  +  P E           + + P  + LSP +IQAINE+ + SP
Sbjct  91   SSSDSIRMAAHEAVLCLRTEPVESDMQVDTSSSSSNVGPTMVRLSPREIQAINESTLGSP  150

Query  393  NKMWMELAATTLLLREP--PLMICEDM-MELEDWEEIQDDSIWD  271
                      T+L+      +    D+ M + D    Q DS+WD
Sbjct  151  ----------TMLMHSTYDSMGFANDVGMNVWDTYHYQSDSLWD  184



>ref|XP_008368126.1| PREDICTED: ethylene-responsive transcription factor ERF022-like 
[Malus domestica]
Length=201

 Score =   142 bits (358),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 91/179 (51%), Positives = 109/179 (61%), Gaps = 27/179 (15%)
 Frame = -2

Query  729  WGKWVSEIREPGKKTRIWLGSFETPEMAAAAYDVAAFHLRGCKARLNFPELVEGFPKPAS  550
            WGKWVSEIREPGKKTRIWLGS+E PEMAAAAYD AA HL+GC A LNFPE+ +  P+PAS
Sbjct  23   WGKWVSEIREPGKKTRIWLGSYEAPEMAAAAYDAAALHLKGCGAALNFPEMADSLPRPAS  82

Query  549  SQPEDVRLAAHQAAMGFKP---PAEGVP---------GAGLRPVRIGLSPNQIQAINETP  406
            S   DV+LAA +AA+  +    P E  P         G    PV +GLSP+QIQAINE+P
Sbjct  83   SSAMDVQLAAQEAALRVRRQQLPMEAFPKEEXGDSSRGLSSAPVTVGLSPSQIQAINESP  142

Query  405  MDSPNKMWMELAATTLLLREP--------------PLMICEDMMELEDWEEIQDDSIWD  271
            +DSP KMWM+          P              P    E  +E  D+E++Q  SIWD
Sbjct  143  LDSP-KMWMQYMCRAHXHEAPSSLGGDLWDTDNSSPNKYYEGDVESMDYEDMQHWSIWD  200



>ref|XP_008339089.1| PREDICTED: ethylene-responsive transcription factor ERF022-like 
[Malus domestica]
Length=201

 Score =   142 bits (357),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 91/179 (51%), Positives = 109/179 (61%), Gaps = 27/179 (15%)
 Frame = -2

Query  729  WGKWVSEIREPGKKTRIWLGSFETPEMAAAAYDVAAFHLRGCKARLNFPELVEGFPKPAS  550
            WGKWVSEIREPGKKTRIWLGS+E PEMAAAAYD AA HL+GC A LNFPE+ +  P+PAS
Sbjct  23   WGKWVSEIREPGKKTRIWLGSYEAPEMAAAAYDAAALHLKGCGAALNFPEMADSLPRPAS  82

Query  549  SQPEDVRLAAHQAAMGFKP---PAEGVP---------GAGLRPVRIGLSPNQIQAINETP  406
            S   DV+LAA +AA+  +    P E  P         G    PV +GLSP+QIQAINE+P
Sbjct  83   SSAMDVQLAAQEAALRVRRQQLPMEAFPKEEAGDSSRGLSSAPVTVGLSPSQIQAINESP  142

Query  405  MDSPNKMWMELAATTLLLREP--------------PLMICEDMMELEDWEEIQDDSIWD  271
            +DSP KMWM+          P              P    E  +E  D+E++Q  SIWD
Sbjct  143  LDSP-KMWMQYMCRAHGHEAPSSLGGDLWDTDNSSPNKYYEGDVESMDYEDMQHWSIWD  200



>dbj|BAF47188.1| embryonic element binding Factor 2 [Daucus carota]
Length=157

 Score =   140 bits (353),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 87/155 (56%), Positives = 102/155 (66%), Gaps = 18/155 (12%)
 Frame = -2

Query  729  WGKWVSEIREPGKKTRIWLGSFETPEMAAAAYDVAAFHLRGCKARLNFPELVEGFPKPAS  550
            WGKWVSEIREPGKK RIWLGS+E PEMAAAAYDVAA HLRG  A LNFPELV   PKP  
Sbjct  20   WGKWVSEIREPGKKARIWLGSYEAPEMAAAAYDVAALHLRGSAAHLNFPELVGSLPKPVG  79

Query  549  SQPEDVRLAAHQAAMGF-KPPAEGVPGAGLRPVRIGLSPNQIQAINETPMDSPNKMWMEL  373
            S   DV+ AA +AAMGF K    G       PV + LS ++I+AINE+P+DSP KMWME+
Sbjct  80   SSHADVQRAAQEAAMGFGKSENRG-------PVTVQLSSSEIRAINESPLDSP-KMWMEM  131

Query  372  AATTLLLREPPLMICEDMMELEDWEEIQDDSIWDF  268
              +  L         E+  + E  EE+Q  S+W F
Sbjct  132  GGSVFL---------EERRDEEQLEEMQCSSLWKF  157



>gb|KFK41579.1| hypothetical protein AALP_AA2G147200 [Arabis alpina]
Length=190

 Score =   141 bits (356),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 78/163 (48%), Positives = 97/163 (60%), Gaps = 19/163 (12%)
 Frame = -2

Query  729  WGKWVSEIREPGKKTRIWLGSFETPEMAAAAYDVAAFHLRGCKARLNFPELVEGFPKPAS  550
            WGKWVSEIREPG K RIWLGSFETPEMAA AYDVAAFH RG +ARLNFPEL    P+P  
Sbjct  36   WGKWVSEIREPGTKNRIWLGSFETPEMAATAYDVAAFHFRGREARLNFPELASSLPRPVD  95

Query  549  SQPEDVRLAAHQAAMGFKP--PAEGV------PGAGLRPVRIGLSPNQIQAINETPMDSP  394
            S  + +R AAH+A +  K   P E          + + P  + LSP +IQAINE+ + SP
Sbjct  96   STSDSIRTAAHEAVLCLKTEKPVESAMQVDTSSSSNVGPTMVRLSPREIQAINESTLGSP  155

Query  393  NKMWMELAATTLLLREPPLMICEDMMELEDWE--EIQDDSIWD  271
                     TT++      M   + ME+  W+  + Q D +WD
Sbjct  156  ---------TTMMHPIDDSMWFPNDMEMNVWDTYQTQTDYLWD  189



>ref|XP_009127865.1| PREDICTED: ethylene-responsive transcription factor ERF021-like 
[Brassica rapa]
Length=182

 Score =   141 bits (355),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 77/160 (48%), Positives = 93/160 (58%), Gaps = 16/160 (10%)
 Frame = -2

Query  729  WGKWVSEIREPGKKTRIWLGSFETPEMAAAAYDVAAFHLRGCKARLNFPELVEGFPKPAS  550
            WGKWVSEIREPG K RIWLGSFETPEMAA AYD AAFH RG +ARLNFPEL    P+P  
Sbjct  31   WGKWVSEIREPGTKNRIWLGSFETPEMAATAYDGAAFHFRGREARLNFPELASSLPRPVD  90

Query  549  SQPEDVRLAAHQAAMGFKP-PAEGV------PGAGLRPVRIGLSPNQIQAINETPMDSPN  391
            S  + VR+AAH+AA+  +  P E          +   P  + LSP +IQAINE+ M SP 
Sbjct  91   SSSDSVRMAAHEAALCLRTEPVESAMQVDTSSSSNAGPTMVRLSPREIQAINESTMGSP-  149

Query  390  KMWMELAATTLLLREPPLMICEDMMELEDWEEIQDDSIWD  271
                    T ++      M     M +  W+    DS+WD
Sbjct  150  --------TMMMHSTYDSMGFGYDMGMNVWDTYLTDSLWD  181



>ref|XP_003610926.1| Ethylene-responsive transcription factor [Medicago truncatula]
 gb|AES93884.1| ethylene response factor [Medicago truncatula]
Length=187

 Score =   141 bits (355),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 86/169 (51%), Positives = 111/169 (66%), Gaps = 17/169 (10%)
 Frame = -2

Query  729  WGKWVSEIREPGKKTRIWLGSFETPEMAAAAYDVAAFHLRGCKARLNFPELVEGFPKPAS  550
            WGKWVSEIREPG KTRIWLGSFETPEMAAAAYDVAA H RG +ARLNFPEL    P+P S
Sbjct  19   WGKWVSEIREPGTKTRIWLGSFETPEMAAAAYDVAALHFRGREARLNFPELANTLPRPLS  78

Query  549  SQPEDVRLAAHQAAMGFK------PPAEGVPGAG--------LRPVRIGLSPNQIQAINE  412
            +  + +R+AAH+AA+  +       P +   G G        + P+R+ LSP+QIQAIN+
Sbjct  79   NNADHIRMAAHEAALRLRANTNMLAPLDNNSGTGCSASSTDAVAPLRVRLSPSQIQAIND  138

Query  411  TPMDSPNKMWMELAATTLLLREPPLMICEDMMELEDWEEIQ--DDSIWD  271
            +PMDSP   WM+++   ++  +  L       E  +WE+IQ   DS+WD
Sbjct  139  SPMDSP-PTWMQMSHPFMMDDQNMLYGNGYEFEENEWEDIQQHSDSLWD  186



>ref|XP_008339090.1| PREDICTED: ethylene-responsive transcription factor ERF022-like 
[Malus domestica]
Length=201

 Score =   141 bits (356),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 91/179 (51%), Positives = 109/179 (61%), Gaps = 27/179 (15%)
 Frame = -2

Query  729  WGKWVSEIREPGKKTRIWLGSFETPEMAAAAYDVAAFHLRGCKARLNFPELVEGFPKPAS  550
            WGKWVSEIREPGKKTRIWLGS+E PEMAAAAYD AA HL+GC A LNFPE+ +  P+PAS
Sbjct  23   WGKWVSEIREPGKKTRIWLGSYEAPEMAAAAYDAAALHLKGCGAALNFPEMADSLPRPAS  82

Query  549  SQPEDVRLAAHQAAMGFKP---PAEGVP---------GAGLRPVRIGLSPNQIQAINETP  406
            S   DV+LAA +AA+  +    P E  P         G    PV +GLSP+QIQAINE+P
Sbjct  83   SSAMDVQLAAQEAALRVRRQQLPMEAFPKEEAGDSSRGLSSAPVTVGLSPSQIQAINESP  142

Query  405  MDSPNKMWMELAATTLLLREP--------------PLMICEDMMELEDWEEIQDDSIWD  271
            +DSP KMWM+          P              P    E  +E  D+E++Q  SIWD
Sbjct  143  LDSP-KMWMQYMCRAHGHEAPSSLGGDLWDTDNSSPNKYYEGDVESMDYEDMQHWSIWD  200



>ref|XP_010064857.1| PREDICTED: ethylene-responsive transcription factor ERF022-like 
[Eucalyptus grandis]
 gb|KCW69540.1| hypothetical protein EUGRSUZ_F02976 [Eucalyptus grandis]
Length=188

 Score =   140 bits (353),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 92/165 (56%), Positives = 109/165 (66%), Gaps = 20/165 (12%)
 Frame = -2

Query  729  WGKWVSEIREPGKKTRIWLGSFETPEMAAAAYDVAAFHLRGCKARLNFPELVEGFPKPAS  550
            WGKWVSEIREPGKKTRIWLGS+E+PEMAAAAYDVAA HLRG  A LNFPELVE  PKPA 
Sbjct  32   WGKWVSEIREPGKKTRIWLGSYESPEMAAAAYDVAARHLRGPGAALNFPELVEALPKPAG  91

Query  549  SQPEDVRLAAHQAAMGFKPP------------AEGVPGAGLRPVRIGLSPNQIQAINETP  406
            S  E V++AA +AA+ F+              + G   +G  P R+GLSP+QI+AINE P
Sbjct  92   SSSEAVQMAAQEAALRFRRAEGGPGASGGDGHSTGNRSSG--PARVGLSPSQIEAINEAP  149

Query  405  MDSPNKMWMELAATTLLLREPPLMICEDMMELEDWEEIQDDSIWD  271
            +DSP KMWMEL A      +         ME++ W  +Q  SIWD
Sbjct  150  LDSP-KMWMELGAGA----DSAAAFDLGDMEVDQWGMLQ-QSIWD  188



>emb|CDY65867.1| BnaCnng48950D [Brassica napus]
Length=182

 Score =   140 bits (352),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 74/160 (46%), Positives = 92/160 (58%), Gaps = 16/160 (10%)
 Frame = -2

Query  729  WGKWVSEIREPGKKTRIWLGSFETPEMAAAAYDVAAFHLRGCKARLNFPELVEGFPKPAS  550
            WGKWVSEIREPG K  IWLGSFETPEMAA AYDVAAFH RG +ARLNFPEL    P+P  
Sbjct  31   WGKWVSEIREPGTKNHIWLGSFETPEMAATAYDVAAFHFRGREARLNFPELASSLPRPVD  90

Query  549  SQPEDVRLAAHQAAMGFKP-PAEGV------PGAGLRPVRIGLSPNQIQAINETPMDSPN  391
            S  + VR+AAH+AA+  +  P E          +   P  + LSP +IQAINE+ + SP 
Sbjct  91   SSSDSVRMAAHEAALCLRTEPVESAMQLDTSSSSNAGPTMVRLSPREIQAINESTLGSPT  150

Query  390  KMWMELAATTLLLREPPLMICEDMMELEDWEEIQDDSIWD  271
             M      +     +  + +         W+    DS+WD
Sbjct  151  MMMHSTYDSMGFGYDTGMNV---------WDTYLTDSLWD  181



>ref|XP_010683050.1| PREDICTED: ethylene-responsive transcription factor ERF021-like 
[Beta vulgaris subsp. vulgaris]
Length=200

 Score =   139 bits (351),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 86/177 (49%), Positives = 109/177 (62%), Gaps = 26/177 (15%)
 Frame = -2

Query  729  WGKWVSEIREPGKKTRIWLGSFETPEMAAAAYDVAAFHLRGCKARLNFPELVEGFPKPAS  550
            WGKWVSEIREPGKKTRIWLGSF+T EMAA AYDVAAFHLRG  A LNFPEL +  P PA+
Sbjct  27   WGKWVSEIREPGKKTRIWLGSFDTQEMAAIAYDVAAFHLRGRGAHLNFPELADELPCPAN  86

Query  549  SQPEDVRLAAHQAA-------------------MGFKPPAEGVPGAGLRPVRIGLSPNQI  427
            S  E++R AA +AA                    G +  A+        P R+GLSP QI
Sbjct  87   SGAEEIRRAAQEAAAALQSRAAATGGMNNPYTLQGGEASAQPSYYNSSSPTRVGLSPMQI  146

Query  426  QAINETPMDSPNKMWMELAATTLLLREPPLMICEDM-MELE-DWE--EIQDDSIWDF  268
            QAINE+P++SP ++W  +  T  L+ +     C ++ M +   WE  E+ DDS+WD+
Sbjct  147  QAINESPLESP-QLWSSM--TDTLMMDDNYYYCNNVEMNMNIGWEEDEVPDDSLWDY  200



>ref|XP_009357206.1| PREDICTED: ethylene-responsive transcription factor ERF022-like 
[Pyrus x bretschneideri]
Length=201

 Score =   139 bits (350),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 91/179 (51%), Positives = 108/179 (60%), Gaps = 27/179 (15%)
 Frame = -2

Query  729  WGKWVSEIREPGKKTRIWLGSFETPEMAAAAYDVAAFHLRGCKARLNFPELVEGFPKPAS  550
            WGKWVSEIREPGKKTRIWLGS+E PEMAAAAYD AA HL+G  A LNFPE+ +  P+PAS
Sbjct  23   WGKWVSEIREPGKKTRIWLGSYEAPEMAAAAYDAAALHLKGRGAALNFPEMADSLPRPAS  82

Query  549  SQPEDVRLAAHQAAMGFKP---PAEGVP---------GAGLRPVRIGLSPNQIQAINETP  406
            S   DV+LAA +AA+  +    P E  P         G    PV +GLSP+QIQAINE+P
Sbjct  83   SSAMDVQLAAQEAALRVRRQQLPMEAFPTEEAGDSSRGLSSAPVTVGLSPSQIQAINESP  142

Query  405  MDSPNKMWMELAATTLLLREP--------------PLMICEDMMELEDWEEIQDDSIWD  271
            +DSP KMWM+          P              P    E  +E  D+E+IQ  SIWD
Sbjct  143  LDSP-KMWMQYMCRAHCHEAPSSLGGDLWDIDNSSPNKYYEGDVESMDYEDIQHWSIWD  200



>ref|XP_007227241.1| hypothetical protein PRUPE_ppa018178mg [Prunus persica]
 gb|EMJ28440.1| hypothetical protein PRUPE_ppa018178mg [Prunus persica]
Length=199

 Score =   139 bits (350),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 90/174 (52%), Positives = 110/174 (63%), Gaps = 23/174 (13%)
 Frame = -2

Query  729  WGKWVSEIREPGKKTRIWLGSFETPEMAAAAYDVAAFHLRGCKARLNFPELVEGFPKPAS  550
            WGKWVSEIREPGKKTRIWLGS+E PEMAAAAYD AA HLRG  A LNFPEL++  P+PAS
Sbjct  25   WGKWVSEIREPGKKTRIWLGSYEEPEMAAAAYDAAALHLRGRGAVLNFPELIDSLPRPAS  84

Query  549  SQPEDVRLAAHQAAMGFKPPAEGV------------PGAGLRPVRIGLSPNQIQAINETP  406
            S P DV+LAA +AA+  +    G              G    PV +GLSP+QIQAINE+P
Sbjct  85   SSPMDVQLAAQEAALRVRRLRIGAVSTEAAGGSSSPRGLSSMPVTVGLSPSQIQAINESP  144

Query  405  MDSPNKMWMELAATTLLLREPPLMICEDM---------MELEDWEEIQDDSIWD  271
            +DSP K+WM+         E   ++ +DM         +EL + E +Q  SIWD
Sbjct  145  LDSP-KLWMQYMYRA-HCHEGLSLLGDDMSCVEYYDEEVELGECENMQHLSIWD  196



>ref|XP_006303802.1| hypothetical protein CARUB_v10012215mg [Capsella rubella]
 gb|EOA36700.1| hypothetical protein CARUB_v10012215mg [Capsella rubella]
Length=186

 Score =   137 bits (345),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 84/152 (55%), Positives = 99/152 (65%), Gaps = 25/152 (16%)
 Frame = -2

Query  729  WGKWVSEIREPGKKTRIWLGSFETPEMAAAAYDVAAFHLRGCKARLNFPELVEGFPKPAS  550
            WGKWVSEIREPG KTRIWLGS+ET EMAAAAYDVAA HL+G    LNFPEL   FP+P S
Sbjct  28   WGKWVSEIREPGTKTRIWLGSYETAEMAAAAYDVAALHLKGHGTNLNFPELAYSFPQPES  87

Query  549  SQPEDVRLAAHQAAMGFKPPAEGV------PGAGLRPVRIGLSPNQIQAINETPMDSPNK  388
            S PE V+ AA +AA+ FKPP           G GL   R+GLSP+QIQAINE P+DSP  
Sbjct  88   SSPEHVQAAAQEAALMFKPPGRSSTEPSLESGHGL--PRVGLSPDQIQAINEFPLDSPRM  145

Query  387  MWMELAATTLLLREPPLMICEDMMELEDWEEI  292
             WM                 +D++E+ D+EE+
Sbjct  146  GWM-----------------QDVLEVTDYEEL  160



>gb|KFK45096.1| hypothetical protein AALP_AA1G343100 [Arabis alpina]
Length=178

 Score =   136 bits (343),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 78/120 (65%), Positives = 89/120 (74%), Gaps = 2/120 (2%)
 Frame = -2

Query  729  WGKWVSEIREPGKKTRIWLGSFETPEMAAAAYDVAAFHLRGCKARLNFPELVEGFPKPAS  550
            WGKWVSEIREPGKKTRIWLGS+ET EMAAAAYD AA H RG    LNFPEL + FP+P S
Sbjct  25   WGKWVSEIREPGKKTRIWLGSYETAEMAAAAYDAAALHFRGLGTHLNFPELADSFPRPES  84

Query  549  SQPEDVRLAAHQAAMGFKP--PAEGVPGAGLRPVRIGLSPNQIQAINETPMDSPNKMWME  376
            S PE V+ AA +AA+ FKP    E   G+G    R+GLSP+QIQAINE P+DSP   WM+
Sbjct  85   SSPEHVQAAAQEAALMFKPGWSTEQDIGSGQEFSRVGLSPDQIQAINEFPLDSPKMGWMQ  144



>ref|XP_006306164.1| hypothetical protein CARUB_v10011715mg [Capsella rubella]
 gb|EOA39062.1| hypothetical protein CARUB_v10011715mg [Capsella rubella]
Length=182

 Score =   136 bits (343),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 85/161 (53%), Positives = 107/161 (66%), Gaps = 11/161 (7%)
 Frame = -2

Query  729  WGKWVSEIREPGKKTRIWLGSFETPEMAAAAYDVAAFHLRGCKARLNFPELVEGFPKPAS  550
            WGKWVSEIREPGKKTRIWLGS+ET EMAAAAYD AA +LRG +  LNFPEL + FP+PAS
Sbjct  25   WGKWVSEIREPGKKTRIWLGSYETAEMAAAAYDSAALYLRGSETHLNFPELADSFPQPAS  84

Query  549  SQPEDVRLAAHQAAMGFKPPA----EGVPGAGLRPVRIGLSPNQIQAINETPMDSPNKMW  382
            S  + V+ AA +AA+ FK P     E    +G    R+GLSP++IQAINE P+DSP   W
Sbjct  85   SSSKHVQAAAQEAALMFKLPGGSSNEPTQESGQGLSRVGLSPDEIQAINEFPLDSPRLGW  144

Query  381  MELAATTLLLREPPLMICE--DMMELEDWEEI-QDDSIWDF  268
            M+     L + +   +  +     + +D+ EI Q  SIWDF
Sbjct  145  MQ----DLEVNDYEELYGQYFGQYDRDDFYEIQQQQSIWDF  181



>ref|XP_009114787.1| PREDICTED: ethylene-responsive transcription factor ERF022 [Brassica 
rapa]
 emb|CDX93754.1| BnaA09g23540D [Brassica napus]
Length=183

 Score =   135 bits (339),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 86/158 (54%), Positives = 102/158 (65%), Gaps = 6/158 (4%)
 Frame = -2

Query  729  WGKWVSEIREPGKKTRIWLGSFETPEMAAAAYDVAAFHLRGCKARLNFPELVEGFPKPAS  550
            WGKWVSEIREPGKKTRIWLGS+ET EMAAAAYD AA +LRG    LNFPE    FP+P S
Sbjct  28   WGKWVSEIREPGKKTRIWLGSYETAEMAAAAYDSAAIYLRGRGTYLNFPEHAGSFPRPES  87

Query  549  SQPEDVRLAAHQAAMGFKPP---AEGVPGAGLRPVRIGLSPNQIQAINETPMDSPNKMWM  379
               E V++AA +AA+ FKP    AE   G+G  P R+GLSP+QIQAI + PMDSP   WM
Sbjct  88   FSSEHVQVAAREAALMFKPGVSFAEHAIGSGQGPSRVGLSPDQIQAIIDFPMDSPRMGWM  147

Query  378  ELAATTLLLREPPLMICEDMMELEDWEEIQD-DSIWDF  268
            +         E     C    + +++ EIQ   SIWDF
Sbjct  148  QDLEVNDY--EELYGRCCGQCDGDEFSEIQPLQSIWDF  183



>ref|XP_010912689.1| PREDICTED: ethylene-responsive transcription factor ERF022-like 
[Elaeis guineensis]
Length=176

 Score =   134 bits (338),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 80/155 (52%), Positives = 100/155 (65%), Gaps = 12/155 (8%)
 Frame = -2

Query  729  WGKWVSEIREPGKKTRIWLGSFETPEMAAAAYDVAAFHLRGCKARLNFPELVEGFPKPAS  550
            WGKWVSEIREPGKKTRIWLGSFE+ EMAA A+DVAA HL+G +ARLNFPE  +  P+PAS
Sbjct  29   WGKWVSEIREPGKKTRIWLGSFESAEMAAVAHDVAALHLKGREARLNFPETADQLPRPAS  88

Query  549  SQPEDVRLAAHQAAMGF--KPPAEGVPGAGLRPVRIGLSPNQIQAINETPMDSPNKMWME  376
            S P D+R AA +AA  F  +P   G PG    PV  G    +    +E  ++SPN MW+E
Sbjct  89   SDPSDIRAAALEAASRFRLRPEFSGRPG----PVSSGSPAFERLWNDELGLESPN-MWVE  143

Query  375  LAATTLLLREPPLMICEDMMELEDWEEIQDDSIWD  271
            +A   LL  +PP    +   + EDW +    S+WD
Sbjct  144  MAEAMLL--DPPAWSNDTGDQAEDWSQ---GSLWD  173



>ref|XP_010499915.1| PREDICTED: ethylene-responsive transcription factor ERF022 [Camelina 
sativa]
 ref|XP_010461198.1| PREDICTED: ethylene-responsive transcription factor ERF022 [Camelina 
sativa]
 ref|XP_010478800.1| PREDICTED: ethylene-responsive transcription factor ERF022 [Camelina 
sativa]
Length=183

 Score =   134 bits (338),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 86/156 (55%), Positives = 101/156 (65%), Gaps = 5/156 (3%)
 Frame = -2

Query  729  WGKWVSEIREPGKKTRIWLGSFETPEMAAAAYDVAAFHLRGCKARLNFPELVEGFPKPAS  550
            WGKWVSEIREPGKKTRIWLGS+ET EMAAAAYD AA HLRG    LNFPEL   FP+P S
Sbjct  28   WGKWVSEIREPGKKTRIWLGSYETAEMAAAAYDAAALHLRGHGTNLNFPELANSFPQPES  87

Query  549  SQPEDVRLAAHQAAMGFKPPAEGVPG--AGLRPVRIGLSPNQIQAINETPMDSPNKMWM-  379
            S PE V+ AA +AA+ FKP     P   +G    R+GLSP+QIQAINE P+DSP   WM 
Sbjct  88   SSPEHVQAAAQEAALMFKPGGSTEPSLDSGQGISRVGLSPDQIQAINEFPLDSPRMGWMQ  147

Query  378  ELAATTLLLREPPLMICEDMMELEDWEEIQDDSIWD  271
            +L  T             D  E  + +++Q  SIW+
Sbjct  148  DLEVTDYEELYGRFFGQYDRDEFFEMQQLQ--SIWN  181



>ref|XP_008219101.1| PREDICTED: ethylene-responsive transcription factor ERF022-like 
[Prunus mume]
Length=199

 Score =   135 bits (339),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 91/174 (52%), Positives = 111/174 (64%), Gaps = 23/174 (13%)
 Frame = -2

Query  729  WGKWVSEIREPGKKTRIWLGSFETPEMAAAAYDVAAFHLRGCKARLNFPELVEGFPKPAS  550
            WGKWVSEIREPGKKTRIWLGS+E PEMAAAAYD AA HLRG    LNFPELV+  P+PAS
Sbjct  25   WGKWVSEIREPGKKTRIWLGSYEEPEMAAAAYDAAALHLRGRGGVLNFPELVDSLPRPAS  84

Query  549  SQPEDVRLAAHQAAMGFKP------PAEGVPGA----GLR--PVRIGLSPNQIQAINETP  406
            S P DV+LAA +AA+  +         E V G+    GL   PV +GLSP+QIQAINE+P
Sbjct  85   SSPMDVQLAAQEAALRVRRLRMGAVSTEAVGGSSSPRGLSSMPVTVGLSPSQIQAINESP  144

Query  405  MDSPNKMWMELAATTLLLREPPLMICEDMMELEDWE---------EIQDDSIWD  271
            +DSP K+WM+         E   ++ +DM  +E  +          +Q  SIWD
Sbjct  145  LDSP-KLWMQYMYRA-HCHEGLSLLGDDMSCVEYHDEEVELEECENMQHLSIWD  196



>emb|CDY15285.1| BnaC06g07710D [Brassica napus]
Length=183

 Score =   134 bits (337),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 87/161 (54%), Positives = 103/161 (64%), Gaps = 12/161 (7%)
 Frame = -2

Query  729  WGKWVSEIREPGKKTRIWLGSFETPEMAAAAYDVAAFHLRGCKARLNFPELVEGFPKPAS  550
            WGKWVSEIREPGKKTRIWLGS+ET EMAAAAYD AA +LRG    LNFPE    FP+P S
Sbjct  28   WGKWVSEIREPGKKTRIWLGSYETAEMAAAAYDSAAIYLRGRGTHLNFPEHAGSFPRPES  87

Query  549  SQPEDVRLAAHQAAMGFKPPAEGVP------GAGLRPVRIGLSPNQIQAINETPMDSPNK  388
               E V++AA +AA+ FKP   GVP      G+G  P R+GLSP+QIQAI + PMDSP  
Sbjct  88   FSSEHVQVAAREAALMFKP---GVPFTEHAIGSGQGPSRVGLSPDQIQAIIDFPMDSPRM  144

Query  387  MWMELAATTLLLREPPLMICEDMMELEDWEEIQD-DSIWDF  268
             WM+         E     C    + +++ EIQ   SIWDF
Sbjct  145  GWMQDLEVNDY--EELYGRCCGQCDGDEFSEIQPLQSIWDF  183



>ref|NP_174636.1| ethylene-responsive transcription factor ERF022 [Arabidopsis 
thaliana]
 sp|Q9LQ28.1|ERF22_ARATH RecName: Full=Ethylene-responsive transcription factor ERF022 
[Arabidopsis thaliana]
 gb|AAF97285.1|AC010164_7 Hypothetical protein [Arabidopsis thaliana]
 gb|AAT44905.1| putative AP2/EREBP transcription factor [Arabidopsis thaliana]
 gb|AAV31158.1| At1g33760 [Arabidopsis thaliana]
 gb|AAW78585.1| At1g33760 [Arabidopsis thaliana]
 gb|AEE31621.1| ethylene-responsive transcription factor ERF022 [Arabidopsis 
thaliana]
Length=184

 Score =   134 bits (336),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 79/122 (65%), Positives = 90/122 (74%), Gaps = 6/122 (5%)
 Frame = -2

Query  729  WGKWVSEIREPGKKTRIWLGSFETPEMAAAAYDVAAFHLRGCKARLNFPELVEGFPKPAS  550
            WGKWVSEIREPGKKTRIWLGS+ET EMAAAAYD AA HLRG    LNFPELV+ FP+P S
Sbjct  28   WGKWVSEIREPGKKTRIWLGSYETAEMAAAAYDAAALHLRGRGTNLNFPELVDSFPRPES  87

Query  549  SQPEDVRLAAHQAAMGFKPPAEGVP----GAGLRPVRIGLSPNQIQAINETPMDSPNKMW  382
            S  E ++ AA  AA+ FKP     P    G GL   R+GLSP+QIQAINE+P+DSP   W
Sbjct  88   SSSEHIQAAAQDAALMFKPGRLSEPALESGQGL--SRVGLSPDQIQAINESPLDSPRMGW  145

Query  381  ME  376
            M+
Sbjct  146  MQ  147



>ref|XP_004301452.1| PREDICTED: ethylene-responsive transcription factor ERF022-like 
[Fragaria vesca subsp. vesca]
Length=185

 Score =   134 bits (336),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 85/168 (51%), Positives = 107/168 (64%), Gaps = 18/168 (11%)
 Frame = -2

Query  729  WGKWVSEIREPGKKTRIWLGSFETPEMAAAAYDVAAFHLRGCKARLNFPELVEGFPKPAS  550
            WGKWVSEIREP KK+RIWLGS+E PEMAAAAYD AA HL+G    LNFPE+V+  P+PAS
Sbjct  20   WGKWVSEIREPRKKSRIWLGSYEAPEMAAAAYDAAALHLKGPGVVLNFPEMVDSLPRPAS  79

Query  549  SQPEDVRLAAHQAAMGFKPPAE----------GVPGAGLRPVRIGLSPNQIQAINETPMD  400
            S P DV+LAA +AA   +  ++          G    G  PV +GLSP+QIQAINE+P+D
Sbjct  80   SNPTDVQLAAQEAANAIRFRSQPMNSVSTEVAGGSSGGAAPVTVGLSPSQIQAINESPLD  139

Query  399  SPNKMWMELAATTLLLREPPLMICEDMME----LEDWEEI-QDDSIWD  271
            SP  MWM+     +   +  L+  EDM       +D E++    SIWD
Sbjct  140  SP-MMWMQ--DMYMSYSDEALVFGEDMSSSMGFYDDHEDVLLHQSIWD  184



>ref|XP_004511478.1| PREDICTED: ethylene-responsive transcription factor ERF021-like 
[Cicer arietinum]
Length=185

 Score =   132 bits (332),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 82/167 (49%), Positives = 105/167 (63%), Gaps = 15/167 (9%)
 Frame = -2

Query  729  WGKWVSEIREPGKKTRIWLGSFETPEMAAAAYDVAAFHLRGCKARLNFPELVEGFPKPAS  550
            WGKWVSEIREPG KTRIWLGSFETPEMAAAAYDVAA H RG +ARLNFPEL    P+P S
Sbjct  19   WGKWVSEIREPGTKTRIWLGSFETPEMAAAAYDVAALHFRGREARLNFPELASSLPRPLS  78

Query  549  SQPEDVRLAAHQAAMGFKP----PAEGVPGAG---------LRPVRIGLSPNQIQAINET  409
            +  + +R+AAH+AA+  +     P E   G           + P+ + LS  QIQAIN++
Sbjct  79   NNADHIRMAAHEAALRLRTNTLMPPENNSGTDSVTDCSTDVVAPLTVRLSSTQIQAINDS  138

Query  408  PMDSPNKMWMELAATTLLLREPPLMICEDMMELEDWEEIQ-DDSIWD  271
            PMDSP   WM+++   ++  +          E  +WE +Q  DS+WD
Sbjct  139  PMDSP-PTWMQMSHPFMMDDQTMYFGNGYEFEENEWENMQHSDSLWD  184



>ref|XP_002891059.1| hypothetical protein ARALYDRAFT_890960 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH67318.1| hypothetical protein ARALYDRAFT_890960 [Arabidopsis lyrata subsp. 
lyrata]
Length=174

 Score =   132 bits (331),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 78/127 (61%), Positives = 89/127 (70%), Gaps = 6/127 (5%)
 Frame = -2

Query  729  WGKWVSEIREPGKKTRIWLGSFETPEMAAAAYDVAAFHLRGCKARLNFPELVEGFPKPAS  550
            WGKWVSEIREPGKKTRIWLGS+ET  MAAAAYD AA +LRG    LNFPEL + FP+P S
Sbjct  28   WGKWVSEIREPGKKTRIWLGSYETAAMAAAAYDAAALYLRGHGTNLNFPELADSFPRPES  87

Query  549  SQPEDVRLAAHQAAMGFKPPAEGVP----GAGLRPVRIGLSPNQIQAINETPMDSPNKMW  382
            S  E V+ AA +AA+ FKP     P    G GL   R+GLSP+QIQAINE P+DSP   W
Sbjct  88   SSSEHVQAAAQEAALKFKPGGSTEPALESGQGL--SRVGLSPDQIQAINEFPLDSPRLGW  145

Query  381  MELAATT  361
            M+    T
Sbjct  146  MQDLEVT  152



>ref|XP_006415065.1| hypothetical protein EUTSA_v10010002mg [Eutrema salsugineum]
 gb|ESQ33418.1| hypothetical protein EUTSA_v10010002mg [Eutrema salsugineum]
Length=183

 Score =   130 bits (327),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 75/120 (63%), Positives = 84/120 (70%), Gaps = 2/120 (2%)
 Frame = -2

Query  729  WGKWVSEIREPGKKTRIWLGSFETPEMAAAAYDVAAFHLRGCKARLNFPELVEGFPKPAS  550
            WGKWVSEIREPGKKTRIWLGS+ET EMAAAAYD AA HLRG    LNFPEL + FP+P S
Sbjct  28   WGKWVSEIREPGKKTRIWLGSYETAEMAAAAYDSAALHLRGRGTHLNFPELADSFPRPES  87

Query  549  SQPEDVRLAAHQAAMGFKPPAEGVPGAGLRP--VRIGLSPNQIQAINETPMDSPNKMWME  376
            S  E V+ AA  AA+  KP     P  G      R+GLS +QIQAINE P+DSP   WM+
Sbjct  88   SSSEHVQAAAQGAALMLKPGGSTEPDTGSAQGLSRVGLSLDQIQAINEFPLDSPRMGWMQ  147



>emb|CDX91796.1| BnaC08g07150D [Brassica napus]
Length=171

 Score =   129 bits (324),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 77/122 (63%), Positives = 89/122 (73%), Gaps = 6/122 (5%)
 Frame = -2

Query  729  WGKWVSEIREPGKKTRIWLGSFETPEMAAAAYDVAAFHLRGCKARLNFPELVEGFPKPAS  550
            WGKWVSEIREPGKKTRIWLGS+ET EMAAAAYD AA HLRG    LNFPEL + FP+P S
Sbjct  28   WGKWVSEIREPGKKTRIWLGSYETAEMAAAAYDAAALHLRGRGTHLNFPELADSFPRPES  87

Query  549  SQPEDVRLAAHQAAMGFKPPA----EGVPGAGLRPVRIGLSPNQIQAINETPMDSPNKMW  382
            S  E V+ AA +A++ FKP      + V G GL   R+GLSP+QIQA NE P+DSP   W
Sbjct  88   SSSEHVQAAAQEASLMFKPGGSTEPDIVSGQGL--SRVGLSPDQIQANNEFPLDSPRMGW  145

Query  381  ME  376
            M+
Sbjct  146  MQ  147



>ref|XP_010930490.1| PREDICTED: ethylene-responsive transcription factor ERF038-like 
[Elaeis guineensis]
Length=174

 Score =   127 bits (318),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 79/153 (52%), Positives = 95/153 (62%), Gaps = 10/153 (7%)
 Frame = -2

Query  729  WGKWVSEIREPGKKTRIWLGSFETPEMAAAAYDVAAFHLRGCKARLNFPELVEGFPKPAS  550
            WGKWVSEIREPGKKTRIWLGSFE+ EMAA A+DVAA  L+G  ARLNFPE V+  P+PAS
Sbjct  29   WGKWVSEIREPGKKTRIWLGSFESAEMAAVAHDVAALSLKGRDARLNFPESVDQLPRPAS  88

Query  549  SQPEDVRLAAHQAAMGFKPPAEGVPGAGLRPVRIGLSPNQIQAINETPMDSPNKMWMELA  370
            S P D+R AA +AA   +   E    +   PV  G    +    +E  ++SP KMW ELA
Sbjct  89   SDPSDIRSAALEAAARVRLRQEFARSS---PVSSGSPALEWLWNDELGLESP-KMWAELA  144

Query  369  ATTLLLREPPLMICEDMMELEDWEEIQDDSIWD  271
               LL    P +   D  ELEDW +    S+WD
Sbjct  145  EAMLL---APPVWSNDTGELEDWVQ---GSLWD  171



>gb|KCW69539.1| hypothetical protein EUGRSUZ_F02975, partial [Eucalyptus grandis]
Length=180

 Score =   126 bits (316),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 78/130 (60%), Positives = 88/130 (68%), Gaps = 11/130 (8%)
 Frame = -2

Query  729  WGKWVSEIREPGKKTRIWLGSFETPEMAAAAYDVAAFHLRGCKARLNFPELVEGFPKPAS  550
            WGKWVSEIREPGKKTRIWLGSF+TPEMAAAAYDVAA H RGC A LNFP    G P+P S
Sbjct  23   WGKWVSEIREPGKKTRIWLGSFDTPEMAAAAYDVAALHFRGCNACLNFPAQATGLPRPES  82

Query  549  SQPEDVRLAAHQAAM----GFKPPAEGVPGAGLR------PVRIGLSPNQIQAINETPMD  400
            S  +DVR+AAH+AA+    G  PP     G          PV + L P  I AINE P+D
Sbjct  83   SGADDVRMAAHEAALQRRVGAAPPGSTGGGGKSGALNKAAPVTVSLPPAMIAAINEWPLD  142

Query  399  SPNKMWMELA  370
            SP  MWM++A
Sbjct  143  SPT-MWMQMA  151



>ref|XP_010062394.1| PREDICTED: ethylene-responsive transcription factor ERF021-like 
[Eucalyptus grandis]
Length=187

 Score =   126 bits (316),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 78/130 (60%), Positives = 88/130 (68%), Gaps = 11/130 (8%)
 Frame = -2

Query  729  WGKWVSEIREPGKKTRIWLGSFETPEMAAAAYDVAAFHLRGCKARLNFPELVEGFPKPAS  550
            WGKWVSEIREPGKKTRIWLGSF+TPEMAAAAYDVAA H RGC A LNFP    G P+P S
Sbjct  23   WGKWVSEIREPGKKTRIWLGSFDTPEMAAAAYDVAALHFRGCNACLNFPAQATGLPRPES  82

Query  549  SQPEDVRLAAHQAAM----GFKPPAEGVPGAGLR------PVRIGLSPNQIQAINETPMD  400
            S  +DVR+AAH+AA+    G  PP     G          PV + L P  I AINE P+D
Sbjct  83   SGADDVRMAAHEAALQRRVGAAPPGSTGGGGKSGALNKAAPVTVSLPPAMIAAINEWPLD  142

Query  399  SPNKMWMELA  370
            SP  MWM++A
Sbjct  143  SPT-MWMQMA  151



>ref|XP_010062393.1| PREDICTED: ethylene-responsive transcription factor ERF021-like 
[Eucalyptus grandis]
 gb|KCW69538.1| hypothetical protein EUGRSUZ_F02974 [Eucalyptus grandis]
Length=178

 Score =   125 bits (313),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 92/166 (55%), Positives = 111/166 (67%), Gaps = 22/166 (13%)
 Frame = -2

Query  729  WGKWVSEIREPGKKTRIWLGSFETPEMAAAAYDVAAFHLRGCKARLNFPELVEGFPKPAS  550
            WGKWVSE+REPG KTRIWLGSFETPEMAAAAYDVAA H RG  ARLNFPEL++  P+PA 
Sbjct  23   WGKWVSEVREPGTKTRIWLGSFETPEMAAAAYDVAALHFRGRGARLNFPELMDSLPRPAG  82

Query  549  SQPEDVRLAAHQAAMGFK------PPAEGVPGAGLR------PVRIGLSPNQIQAINETP  406
            S PEDVR AAH+AA   +      P +E V G+G        P+ + LSP+QIQAINE+ 
Sbjct  83   SSPEDVRAAAHEAAARLRMAPAAAPESEDVGGSGGSGGSDPAPLTVRLSPSQIQAINEST  142

Query  405  MDSPNKMWMELAATTLLLREPPLMICEDMMELEDWEEIQDDSIWDF  268
            +DSP KMWM++    L     P     D+ E +D+E    DS+WD 
Sbjct  143  LDSP-KMWMQMGEDLLA----PDCSNNDVEE-DDFE----DSLWDL  178



>dbj|BAF47187.1| embryonic element binding Factor 1 [Daucus carota]
Length=157

 Score =   123 bits (309),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 72/125 (58%), Positives = 87/125 (70%), Gaps = 5/125 (4%)
 Frame = -2

Query  729  WGKWVSEIREPGKKTRIWLGSFETPEMAAAAYDVAAFHLRGCKARLNFPELVEGFPKPAS  550
            WGKWVSEIREPGKK RIWLGS+E PEMAAAAYDVAA HLRG  A LNFPE+V   PKP  
Sbjct  18   WGKWVSEIREPGKKARIWLGSYEAPEMAAAAYDVAALHLRGSAAHLNFPEMVGSLPKPVG  77

Query  549  SQPEDVRLAAHQAAMGFKPPAEGVPGAGLRPVRIGLSPNQIQAINETPMDSPNKMWMELA  370
            S   DV+ AA +AAM  +       G    PV + LS ++I+AINE+P+DS  +MWME+ 
Sbjct  78   SSHADVQRAAQEAAMSMRFGRSENRG----PVTVQLSSSEIRAINESPLDS-QEMWMEMG  132

Query  369  ATTLL  355
             +  +
Sbjct  133  GSVFV  137



>ref|XP_011098959.1| PREDICTED: ethylene-responsive transcription factor ERF022-like 
[Sesamum indicum]
Length=174

 Score =   123 bits (308),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 84/159 (53%), Positives = 104/159 (65%), Gaps = 12/159 (8%)
 Frame = -2

Query  729  WGKWVSEIREPGKKTRIWLGSFETPEMAAAAYDVAAFHLRGCKARLNFPELVEGFPKPAS  550
            +G+WVSEIREPGKKTRIWLGSF+TPEMAAAAYD AA  LRG   R NFP LV+  PKPAS
Sbjct  22   YGRWVSEIREPGKKTRIWLGSFDTPEMAAAAYDAAALQLRGPDTRFNFPGLVDRLPKPAS  81

Query  549  SQPEDVRLAAHQAAMGFKPPAE------GVPGAGLRPVRIGLSPNQIQAINETPMDSPNK  388
            +  +D+R AA QAAM  +   +      G  G G    R+ LSP  IQAINE+P+DSP K
Sbjct  82   ANADDIRQAAQQAAMQLRSGQQSEEVNIGSKG-GNSLARVELSPTHIQAINESPLDSP-K  139

Query  387  MWMELAATTLLLREPPLMICEDMMELEDWEEIQDDSIWD  271
            MWMELA  ++L               ++++E++  SIWD
Sbjct  140  MWMELAGPSMLGEAANY----GETHTDEYDEMESYSIWD  174



>ref|XP_008795312.1| PREDICTED: ethylene-responsive transcription factor ERF038-like 
[Phoenix dactylifera]
Length=176

 Score =   121 bits (303),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 71/126 (56%), Positives = 83/126 (66%), Gaps = 4/126 (3%)
 Frame = -2

Query  729  WGKWVSEIREPGKKTRIWLGSFETPEMAAAAYDVAAFHLRGCKARLNFPELVEGFPKPAS  550
            WGKWVSEIREPGKKTRIWLGSFE+ EMAA A+DVAA  L+G  ARLNFPE  +  P+PAS
Sbjct  29   WGKWVSEIREPGKKTRIWLGSFESAEMAAVAHDVAALRLKGRDARLNFPEAADQLPRPAS  88

Query  549  SQPEDVRLAAHQAAMGFK-PPAEGVPGAGLRPVRIGLSPNQIQAINETPMDSPNKMWMEL  373
            S P D+R AA +AA  F+  P  G    G  PV  G    +  + +E  +DSP  MW EL
Sbjct  89   SDPSDIRSAALEAAARFRLAPDFGASRPG--PVSSGSPAFERLSNDELGLDSPT-MWDEL  145

Query  372  AATTLL  355
            A   LL
Sbjct  146  AEAMLL  151



>ref|XP_010530109.1| PREDICTED: ethylene-responsive transcription factor ERF022-like 
[Tarenaya hassleriana]
Length=189

 Score =   120 bits (301),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 85/162 (52%), Positives = 101/162 (62%), Gaps = 10/162 (6%)
 Frame = -2

Query  729  WGKWVSEIREPGKKTRIWLGSFETPEMAAAAYDVAAFHLRGCKARLNFPELVEGFPKPAS  550
            WGKWVSEIR+PGKKTRIWLGS+++PEMAAAAYD AA HLRG  A LNFPEL   F  P S
Sbjct  29   WGKWVSEIRQPGKKTRIWLGSYDSPEMAAAAYDAAALHLRGQGAHLNFPELAGIFTPPES  88

Query  549  SQPEDVRLAAHQAAMGFKP---------PAEGVPGAGLRPVRIGLSPNQIQAINETPMDS  397
            S  E ++ AA  AAM  K            E   G+GL PVR+GLSP QI AIN  P+DS
Sbjct  89   SAAEHIQAAAQSAAMMVKSGRFHGQNPITDELGSGSGLGPVRVGLSPAQILAINGFPLDS  148

Query  396  PNKMWMELAATTLLLREPPLMICEDMMELEDWEEIQDDSIWD  271
            P +  M+L +  +   E  L       E ED+ E+Q  S+WD
Sbjct  149  PERWCMDLESVHVNDYE-ELYGQYFGYEREDYVEVQLHSLWD  189



>ref|XP_009390148.1| PREDICTED: ethylene-responsive transcription factor ERF021-like 
[Musa acuminata subsp. malaccensis]
Length=164

 Score =   119 bits (298),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 77/155 (50%), Positives = 95/155 (61%), Gaps = 18/155 (12%)
 Frame = -2

Query  729  WGKWVSEIREPGKKTRIWLGSFETPEMAAAAYDVAAFHLRGCKARLNFPELVEGFPKPAS  550
            WGKWVSEIREPGKKTRIWLGSFE+ EMAA A+DVAA  L+G  A+LNFPE  E  P+P S
Sbjct  23   WGKWVSEIREPGKKTRIWLGSFESAEMAAVAHDVAALRLKGRDAQLNFPESAEQLPRPRS  82

Query  549  SQPEDVR--LAAHQAAMGFKPPAEGVPGAGLRPVRIGLSPNQIQAINETPMDSPNKMWME  376
            S+P+D+R       A +  +  A     AGL   R+G         +E  +DSP ++W E
Sbjct  83   SEPKDIRSAALEAAARLRCRTTARAGISAGLE--RLG--------NDELGLDSP-RLWAE  131

Query  375  LAATTLLLREPPLMICEDMMELEDWEEIQDDSIWD  271
            LA   LL   PP    E + ELE+WE  Q  S+WD
Sbjct  132  LAEALLL--SPPAWTTE-VTELEEWE--QHGSLWD  161



>ref|XP_008786418.1| PREDICTED: ethylene-responsive transcription factor ERF038 [Phoenix 
dactylifera]
Length=172

 Score =   117 bits (293),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 80/153 (52%), Positives = 99/153 (65%), Gaps = 10/153 (7%)
 Frame = -2

Query  729  WGKWVSEIREPGKKTRIWLGSFETPEMAAAAYDVAAFHLRGCKARLNFPELVEGFPKPAS  550
            WGKWVSEIREPGKKTRIWLGSFE+ EMAAAA+DVAA  L+G  ARLNFPE V+  P+PAS
Sbjct  27   WGKWVSEIREPGKKTRIWLGSFESAEMAAAAHDVAALRLKGRDARLNFPEAVDQLPRPAS  86

Query  549  SQPEDVRLAAHQAAMGFKPPAEGVPGAGLRPVRIGLSPNQIQAINETPMDSPNKMWMELA  370
            S P D+R AA +AA   +   E    +   PV  G + ++    +E  +DSP KMW+ELA
Sbjct  87   SDPSDIRSAALEAAARVRLRQEFARSS---PVSSGSTASEWPWNDELGLDSP-KMWVELA  142

Query  369  ATTLLLREPPLMICEDMMELEDWEEIQDDSIWD  271
               LL    P +   D  EL+DW +    S+WD
Sbjct  143  EAMLL---APPVWSNDTGELDDWVQ---GSLWD  169



>ref|XP_009413420.1| PREDICTED: ethylene-responsive transcription factor ERF038-like 
[Musa acuminata subsp. malaccensis]
Length=165

 Score =   116 bits (291),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 75/154 (49%), Positives = 90/154 (58%), Gaps = 15/154 (10%)
 Frame = -2

Query  729  WGKWVSEIREPGKKTRIWLGSFETPEMAAAAYDVAAFHLRGCKARLNFPELVEGFPKPAS  550
            WGKWVSEIREPGKK+RIWLGSFE+ EMAA A+DVAA  L+G  A+LNFPE  E  P+P S
Sbjct  23   WGKWVSEIREPGKKSRIWLGSFESAEMAAVAHDVAALRLKGHDAQLNFPESAEQLPRPRS  82

Query  549  SQPEDVRLAAHQAAMGFKPPAEGVPGAGLRPVRIGLSPNQIQAIN-ETPMDSPNKMWMEL  373
            S P+D+R             A           R G+S    +  N E  +DSP KMW++L
Sbjct  83   SDPKDIR--------SAALEAAARLRCKTTTARAGMSSALERLGNDELGLDSP-KMWLDL  133

Query  372  AATTLLLREPPLMICEDMMELEDWEEIQDDSIWD  271
            A   LL   PP    E + ELEDWE     S+WD
Sbjct  134  AEALLLT--PPAWNSE-VSELEDWE--HHGSLWD  162



>ref|XP_009151478.1| PREDICTED: ethylene-responsive transcription factor ERF022-like 
[Brassica rapa]
Length=185

 Score =   115 bits (289),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 77/121 (64%), Positives = 91/121 (75%), Gaps = 3/121 (2%)
 Frame = -2

Query  729  WGKWVSEIREPGKKTRIWLGSFETPEMAAAAYDVAAFHLRGCKARLNFPELVEGFPKPAS  550
            WGKWVSEIREPGKKTRIWLGS+ET EMAAAAYDVAA HLRG    +NFPEL + FP+P S
Sbjct  27   WGKWVSEIREPGKKTRIWLGSYETAEMAAAAYDVAAIHLRGRGTHVNFPELADSFPQPQS  86

Query  549  SQPEDVRLAAHQAAMGFKP---PAEGVPGAGLRPVRIGLSPNQIQAINETPMDSPNKMWM  379
            S  E ++ AA +AA+ FKP     E   G+G    R+GLSP+QIQAINE P+DSP + WM
Sbjct  87   SSSEHIQAAAQEAALLFKPGVSSTEADLGSGQGHSRVGLSPDQIQAINEFPLDSPRRGWM  146

Query  378  E  376
            +
Sbjct  147  Q  147



>ref|XP_009405186.1| PREDICTED: ethylene-responsive transcription factor ERF022-like 
[Musa acuminata subsp. malaccensis]
Length=159

 Score =   112 bits (279),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 77/153 (50%), Positives = 94/153 (61%), Gaps = 16/153 (10%)
 Frame = -2

Query  729  WGKWVSEIREPGKKTRIWLGSFETPEMAAAAYDVAAFHLRGCKARLNFPELVEGFPKPAS  550
            WGKWVSEIREPGKK+RIWLGSFE+ EMAA A+DVAA  L+G  A+LNFPE  E  P+P S
Sbjct  20   WGKWVSEIREPGKKSRIWLGSFESAEMAAVAHDVAALRLKGRDAQLNFPESAEQLPRPRS  79

Query  549  SQPEDVRLAAHQAAMGFKPPAEGVPGAGLRPVRIGLSPNQIQAINETPMDSPNKMWMELA  370
            S PED+R AA +AA   +           R VR+     +    +E  +DSP KMW+ELA
Sbjct  80   SDPEDIRAAALEAAARLR----------CRTVRVSAPALERLGNDELGLDSP-KMWVELA  128

Query  369  ATTLLLREPPLMICEDMMELEDWEEIQDDSIWD  271
               LL   PP    E + E E+WE     S+WD
Sbjct  129  EALLL--SPPAWNPE-VSEPEEWE--HHASLWD  156



>ref|XP_004979006.1| PREDICTED: ethylene-responsive transcription factor ERF023-like 
[Setaria italica]
Length=196

 Score =   112 bits (280),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 51/67 (76%), Positives = 60/67 (90%), Gaps = 0/67 (0%)
 Frame = -2

Query  729  WGKWVSEIREPGKKTRIWLGSFETPEMAAAAYDVAAFHLRGCKARLNFPELVEGFPKPAS  550
            WGKWVSEIREPGKKTRIWLGSFE+PEMAA A+DVAA HLRG +ARLNFP LV  F +PA+
Sbjct  28   WGKWVSEIREPGKKTRIWLGSFESPEMAAVAHDVAALHLRGREARLNFPALVHHFRRPAT  87

Query  549  SQPEDVR  529
            ++P+D+R
Sbjct  88   AEPDDIR  94



>ref|XP_002449280.1| hypothetical protein SORBIDRAFT_05g007135 [Sorghum bicolor]
 gb|EES08268.1| hypothetical protein SORBIDRAFT_05g007135 [Sorghum bicolor]
Length=194

 Score =   110 bits (274),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 51/67 (76%), Positives = 59/67 (88%), Gaps = 0/67 (0%)
 Frame = -2

Query  729  WGKWVSEIREPGKKTRIWLGSFETPEMAAAAYDVAAFHLRGCKARLNFPELVEGFPKPAS  550
            WGKWVSEIREPGKKTRIWLGSFE+PEMAA A+DVAA  LRG +ARLNFP LV  F +PA+
Sbjct  27   WGKWVSEIREPGKKTRIWLGSFESPEMAAVAHDVAALRLRGREARLNFPGLVHRFRRPAT  86

Query  549  SQPEDVR  529
            ++P+DVR
Sbjct  87   AEPDDVR  93



>ref|NP_001151893.1| CBF-like protein [Zea mays]
 gb|ACG44799.1| CBF-like protein [Zea mays]
Length=216

 Score =   110 bits (275),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 77/177 (44%), Positives = 104/177 (59%), Gaps = 28/177 (16%)
 Frame = -2

Query  729  WGKWVSEIREPGKKTRIWLGSFETPEMAAAAYDVAAFHLRGCKARLNFPELVEGFPKPAS  550
            WGKWVSEIREPGKKTRIWLGSFE+PEMAA A+DVAA  LRG +ARLNFP  V  F +PA+
Sbjct  27   WGKWVSEIREPGKKTRIWLGSFESPEMAAVAHDVAALRLRGREARLNFPGXVHRFRRPAT  86

Query  549  SQPEDVRLAAHQAA--MGFKPPAEGVPGAGL------------------RPVRIG---LS  439
            ++P+DVR AA +AA  + F+P    +  +G                    P+  G   ++
Sbjct  87   AEPDDVRAAALEAAAQVRFRPDLVAMQASGGEGGCRFGGAGGSDDTGSPEPLAAGEDDVA  146

Query  438  PNQIQAINETPMDSPNKMWMELAATTLLLREPPLMICEDMMELEDWEEIQDDSIWDF  268
             + +   +   ++SP KMW ELA   L+   PP +   DM + +DW   Q  ++WD 
Sbjct  147  XDVLLGTDVEVVESP-KMWDELAEAMLVA--PPPVWEGDMEDTDDW--AQGGNLWDL  198



>gb|AFW60540.1| putative AP2/EREBP transcription factor superfamily protein [Zea 
mays]
 gb|AIB05002.1| AP2-EREBP transcription factor, partial [Zea mays]
Length=212

 Score =   109 bits (273),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 51/67 (76%), Positives = 59/67 (88%), Gaps = 0/67 (0%)
 Frame = -2

Query  729  WGKWVSEIREPGKKTRIWLGSFETPEMAAAAYDVAAFHLRGCKARLNFPELVEGFPKPAS  550
            WGKWVSEIREPGKKTRIWLGSFE+PEMAA A+DVAA  LRG +ARLNFP LV  F +PA+
Sbjct  25   WGKWVSEIREPGKKTRIWLGSFESPEMAAVAHDVAALRLRGREARLNFPGLVHRFRRPAT  84

Query  549  SQPEDVR  529
            ++P+DVR
Sbjct  85   AEPDDVR  91



>ref|XP_010542755.1| PREDICTED: ethylene-responsive transcription factor ERF022 [Tarenaya 
hassleriana]
Length=188

 Score =   108 bits (270),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 89/163 (55%), Positives = 102/163 (63%), Gaps = 12/163 (7%)
 Frame = -2

Query  729  WGKWVSEIREPGKKTRIWLGSFETPEMAAAAYDVAAFHLRGCKARLNFPELVEGFPKPAS  550
            WGKWVSEIREPGKKTRIWLGS++T EMAAAAYD AA HLRG    LNFP+L    P+P S
Sbjct  28   WGKWVSEIREPGKKTRIWLGSYDTAEMAAAAYDAAAVHLRGQGPHLNFPDLAGSLPRPES  87

Query  549  SQPEDVRLAAHQAAMGFK-------PPAEGVPG--AGLRPVRIGLSPNQIQAINETPMDS  397
            S  E V+ AA  AAM  K        P     G  +GL PVR+GLS  QIQAINE P+DS
Sbjct  88   SAAEHVQAAAQAAAMMVKSGRFPGTSPVTDETGLCSGLGPVRVGLSDAQIQAINEFPLDS  147

Query  396  PNKMW-MELAATTLLLREPPLMICEDMMELEDWEEIQDDSIWD  271
            P KMW M L +  +   E P        + ED+ E+Q  SIWD
Sbjct  148  P-KMWCMGLDSVHVNDEEEPYGQFFG-YDREDYVEMQLQSIWD  188



>ref|XP_009383447.1| PREDICTED: ethylene-responsive transcription factor ERF022-like 
[Musa acuminata subsp. malaccensis]
Length=166

 Score =   107 bits (267),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 79/155 (51%), Positives = 96/155 (62%), Gaps = 16/155 (10%)
 Frame = -2

Query  729  WGKWVSEIREPGKKTRIWLGSFETPEMAAAAYDVAAFHLRGCKARLNFPELVEGFPKPAS  550
            WGKWVSEIREPGKKTRIWLGSFE+ EMAA A+DVA   LRG  A+LNFPE V+  P+P S
Sbjct  23   WGKWVSEIREPGKKTRIWLGSFESAEMAAVAHDVAELRLRGRDAQLNFPESVDQLPRPRS  82

Query  549  SQPEDVRLAAHQAAMGFKPPAEGVPGAGLRPV--RIGLSPNQIQAINETPMDSPNKMWME  376
            S P+D+R AA  AA   +        AG+ P   R+G         +E  +DSP KMW+E
Sbjct  83   SDPQDIRSAALDAAARLRCRTVATARAGIAPALERLG--------NDELGLDSP-KMWLE  133

Query  375  LAATTLLLREPPLMICEDMMELEDWEEIQDDSIWD  271
            LA   LL   PP+   E   E+E+WE     S+WD
Sbjct  134  LAEALLL--SPPVWSSE-ASEVEEWE--PHGSLWD  163



>gb|AFG71231.1| hypothetical protein UMN_6348_01, partial [Pinus taeda]
Length=140

 Score =   106 bits (264),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 60/108 (56%), Positives = 75/108 (69%), Gaps = 2/108 (2%)
 Frame = -2

Query  726  GKWVSEIREPGKKTRIWLGSFETPEMAAAAYDVAAFHLRGCK-ARLNFPELVEGFPKPAS  550
            GKWVSEIREP KK+RIWLGSFETPEMAA AYDVAAFHL+G K A +NFPEL++  P+P S
Sbjct  3    GKWVSEIREPKKKSRIWLGSFETPEMAARAYDVAAFHLKGKKLAFINFPELIDHLPRPIS  62

Query  549  SQPEDVRLAAHQAAMGFKPPAEGVPGAGLRPVR-IGLSPNQIQAINET  409
            S P D++ AA +AA+ F   + G  G      +    SP ++   NE+
Sbjct  63   SSPRDIQAAAAEAAVAFHCGSAGKHGRLNEEYKGARRSPTKVSVCNES  110



>gb|AEW09361.1| hypothetical protein UMN_6348_01, partial [Pinus radiata]
 gb|AFG71232.1| hypothetical protein UMN_6348_01, partial [Pinus taeda]
 gb|AFG71233.1| hypothetical protein UMN_6348_01, partial [Pinus taeda]
 gb|AFG71234.1| hypothetical protein UMN_6348_01, partial [Pinus taeda]
 gb|AFG71235.1| hypothetical protein UMN_6348_01, partial [Pinus taeda]
 gb|AFG71236.1| hypothetical protein UMN_6348_01, partial [Pinus taeda]
 gb|AFG71237.1| hypothetical protein UMN_6348_01, partial [Pinus taeda]
 gb|AFG71238.1| hypothetical protein UMN_6348_01, partial [Pinus taeda]
 gb|AFG71239.1| hypothetical protein UMN_6348_01, partial [Pinus taeda]
 gb|AFG71240.1| hypothetical protein UMN_6348_01, partial [Pinus taeda]
 gb|AFG71241.1| hypothetical protein UMN_6348_01, partial [Pinus taeda]
Length=140

 Score =   105 bits (263),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 60/108 (56%), Positives = 75/108 (69%), Gaps = 2/108 (2%)
 Frame = -2

Query  726  GKWVSEIREPGKKTRIWLGSFETPEMAAAAYDVAAFHLRGCK-ARLNFPELVEGFPKPAS  550
            GKWVSEIREP KK+RIWLGSFETPEMAA AYDVAAFHL+G K A +NFPEL++  P+P S
Sbjct  3    GKWVSEIREPKKKSRIWLGSFETPEMAARAYDVAAFHLKGKKLAFINFPELIDHLPRPIS  62

Query  549  SQPEDVRLAAHQAAMGFKPPAEGVPGAGLRPVR-IGLSPNQIQAINET  409
            S P D++ AA +AA+ F   + G  G      +    SP ++   NE+
Sbjct  63   SSPRDIQAAAAEAAVAFHCGSAGKYGRLNEEYKGARRSPTKVSVCNES  110



>gb|EMT09265.1| Ethylene-responsive transcription factor ERF021 [Aegilops tauschii]
Length=185

 Score =   107 bits (266),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 70/134 (52%), Positives = 88/134 (66%), Gaps = 10/134 (7%)
 Frame = -2

Query  729  WGKWVSEIREPGKKTRIWLGSFETPEMAAAAYDVAAFHLRGCKARLNFPELVEGFPKPAS  550
            WGKWVSEIREPGKKTRIWLGSFE+PEMAA A+DVAA  LRG +ARLNFP L   F +P +
Sbjct  25   WGKWVSEIREPGKKTRIWLGSFESPEMAAVAHDVAALRLRGHEARLNFPGLAHLFRRPDT  84

Query  549  SQPEDVRLAAHQAA--------MGFKPPAEGVPGAGLRPVRI-GLSPNQIQAINETPMDS  397
            ++P+DVR AA +AA        +  +P   G  G G  P R+  ++ N +   ++   +S
Sbjct  85   AEPDDVRAAALEAAAQVRFRPDLVLQPGGCGSSGGGGFPDRLDDVACNALLRSDDLEPES  144

Query  396  PNKMWMELAATTLL  355
            PN MW ELA   LL
Sbjct  145  PN-MWAELAEAMLL  157



>ref|XP_003576119.1| PREDICTED: ethylene-responsive transcription factor ERF022-like 
[Brachypodium distachyon]
Length=192

 Score =   106 bits (265),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 50/67 (75%), Positives = 57/67 (85%), Gaps = 0/67 (0%)
 Frame = -2

Query  729  WGKWVSEIREPGKKTRIWLGSFETPEMAAAAYDVAAFHLRGCKARLNFPELVEGFPKPAS  550
            WGKWVSEIREPGKKTRIWLGSFE+PEMAA A+DVAA  LRG  ARLNFP L   F +PA+
Sbjct  29   WGKWVSEIREPGKKTRIWLGSFESPEMAAVAHDVAALRLRGRDARLNFPGLAHLFRRPAT  88

Query  549  SQPEDVR  529
            ++P+DVR
Sbjct  89   AEPDDVR  95



>ref|XP_009125819.1| PREDICTED: dehydration-responsive element-binding protein 3-like 
[Brassica rapa]
Length=234

 Score =   107 bits (267),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 50/74 (68%), Positives = 59/74 (80%), Gaps = 0/74 (0%)
 Frame = -2

Query  729  WGKWVSEIREPGKKTRIWLGSFETPEMAAAAYDVAAFHLRGCKARLNFPELVEGFPKPAS  550
            WGKWVSEIREP KK+RIWLG+F TPEMAA A+DVAA  ++G  A LNFPELVE FP+P S
Sbjct  71   WGKWVSEIREPRKKSRIWLGTFPTPEMAARAHDVAALSIKGSSAILNFPELVESFPRPVS  130

Query  549  SQPEDVRLAAHQAA  508
              P D++ AA +AA
Sbjct  131  LSPRDIQTAALKAA  144



>gb|EAY80480.1| hypothetical protein OsI_35658 [Oryza sativa Indica Group]
Length=154

 Score =   105 bits (261),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 48/67 (72%), Positives = 55/67 (82%), Gaps = 0/67 (0%)
 Frame = -2

Query  729  WGKWVSEIREPGKKTRIWLGSFETPEMAAAAYDVAAFHLRGCKARLNFPELVEGFPKPAS  550
            WGKWVSEIREPGKKTRIWLGSFE+PEMAA A+DVAA  LRG  ARLNFP +   F +P +
Sbjct  26   WGKWVSEIREPGKKTRIWLGSFESPEMAAVAHDVAALRLRGRDARLNFPAIAHRFRRPDT  85

Query  549  SQPEDVR  529
            ++P DVR
Sbjct  86   AEPGDVR  92



>emb|CDX85705.1| BnaA02g01080D [Brassica napus]
Length=234

 Score =   106 bits (265),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 50/74 (68%), Positives = 59/74 (80%), Gaps = 0/74 (0%)
 Frame = -2

Query  729  WGKWVSEIREPGKKTRIWLGSFETPEMAAAAYDVAAFHLRGCKARLNFPELVEGFPKPAS  550
            WGKWVSEIREP KK+RIWLG+F TPEMAA A+DVAA  ++G  A LNFPELVE FP+P S
Sbjct  71   WGKWVSEIREPRKKSRIWLGTFPTPEMAARAHDVAALSIKGSSAILNFPELVESFPRPVS  130

Query  549  SQPEDVRLAAHQAA  508
              P D++ AA +AA
Sbjct  131  LSPRDIQTAALKAA  144



>gb|KHN11642.1| Dehydration-responsive element-binding protein 3 [Glycine soja]
Length=164

 Score =   104 bits (260),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 50/82 (61%), Positives = 61/82 (74%), Gaps = 0/82 (0%)
 Frame = -2

Query  729  WGKWVSEIREPGKKTRIWLGSFETPEMAAAAYDVAAFHLRGCKARLNFPELVEGFPKPAS  550
            WG++VSEIR PG+KTRIWLGSF +PEMAA AYD AAF L+G  A LNFP+LV   P+P S
Sbjct  24   WGRYVSEIRLPGQKTRIWLGSFGSPEMAARAYDSAAFFLKGTSATLNFPDLVHSLPRPLS  83

Query  549  SQPEDVRLAAHQAAMGFKPPAE  484
            S   D++ AA +AA+   PP E
Sbjct  84   SSRRDIQSAAAEAALHSPPPKE  105



>emb|CDY27827.1| BnaC09g28540D [Brassica napus]
 emb|CDX91203.1| BnaC02g03940D [Brassica napus]
Length=231

 Score =   106 bits (264),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 50/74 (68%), Positives = 59/74 (80%), Gaps = 0/74 (0%)
 Frame = -2

Query  729  WGKWVSEIREPGKKTRIWLGSFETPEMAAAAYDVAAFHLRGCKARLNFPELVEGFPKPAS  550
            WGKWVSEIREP KK+RIWLG+F TPEMAA A+DVAA  ++G  A LNFPELVE FP+P S
Sbjct  68   WGKWVSEIREPRKKSRIWLGTFPTPEMAARAHDVAALSIKGNSAILNFPELVESFPRPVS  127

Query  549  SQPEDVRLAAHQAA  508
              P D++ AA +AA
Sbjct  128  LSPRDIQTAALKAA  141



>ref|XP_003534428.2| PREDICTED: dehydration-responsive element-binding protein 3 [Glycine 
max]
Length=190

 Score =   105 bits (261),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 50/82 (61%), Positives = 61/82 (74%), Gaps = 0/82 (0%)
 Frame = -2

Query  729  WGKWVSEIREPGKKTRIWLGSFETPEMAAAAYDVAAFHLRGCKARLNFPELVEGFPKPAS  550
            WG++VSEIR PG+KTRIWLGSF +PEMAA AYD AAF L+G  A LNFP+LV   P+P S
Sbjct  50   WGRYVSEIRLPGQKTRIWLGSFGSPEMAARAYDSAAFFLKGTSATLNFPDLVHSLPRPLS  109

Query  549  SQPEDVRLAAHQAAMGFKPPAE  484
            S   D++ AA +AA+   PP E
Sbjct  110  SSRRDIQSAAAEAALHSPPPKE  131



>gb|KFK32565.1| hypothetical protein AALP_AA6G259700 [Arabis alpina]
Length=197

 Score =   103 bits (258),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 50/82 (61%), Positives = 62/82 (76%), Gaps = 1/82 (1%)
 Frame = -2

Query  729  WGKWVSEIREPGKKTRIWLGSFETPEMAAAAYDVAAFHLRGCKARLNFPELVEGFPKPAS  550
            WGKWVSEIREP KK+RIWLG+F T EMAA A+DVAA  ++G  A LNFPEL +  P+P S
Sbjct  32   WGKWVSEIREPRKKSRIWLGTFPTAEMAARAHDVAALSIKGSSAILNFPELSDYLPRPVS  91

Query  549  SQPEDVRLAAHQAA-MGFKPPA  487
              P D++ AA++AA M FK P+
Sbjct  92   LSPSDIQDAANKAALMDFKTPS  113



>ref|XP_006399666.1| hypothetical protein EUTSA_v10015895mg [Eutrema salsugineum]
 gb|ESQ41119.1| hypothetical protein EUTSA_v10015895mg [Eutrema salsugineum]
Length=243

 Score =   105 bits (261),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 49/74 (66%), Positives = 58/74 (78%), Gaps = 0/74 (0%)
 Frame = -2

Query  729  WGKWVSEIREPGKKTRIWLGSFETPEMAAAAYDVAAFHLRGCKARLNFPELVEGFPKPAS  550
            WGKWVSEIREP KK+RIWLG+F TPEMAA A+DVAA  ++G  A LNFPEL E FP+P S
Sbjct  66   WGKWVSEIREPRKKSRIWLGTFPTPEMAARAHDVAALSIKGSSAILNFPELAESFPRPVS  125

Query  549  SQPEDVRLAAHQAA  508
              P D++ AA +AA
Sbjct  126  LSPRDIQTAALKAA  139



>ref|XP_009121933.1| PREDICTED: dehydration-responsive element-binding protein 3-like 
[Brassica rapa]
Length=240

 Score =   104 bits (259),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 48/74 (65%), Positives = 58/74 (78%), Gaps = 0/74 (0%)
 Frame = -2

Query  729  WGKWVSEIREPGKKTRIWLGSFETPEMAAAAYDVAAFHLRGCKARLNFPELVEGFPKPAS  550
            WGKWVSEIREP KK+RIWLG+F TPEMAA A+DVAA  ++G  A LNFPEL + FP+P S
Sbjct  70   WGKWVSEIREPRKKSRIWLGTFPTPEMAARAHDVAALSIKGASAILNFPELADSFPRPVS  129

Query  549  SQPEDVRLAAHQAA  508
              P D++ AA +AA
Sbjct  130  LNPRDIQTAALKAA  143



>emb|CDX69746.1| BnaA10g20950D [Brassica napus]
Length=240

 Score =   104 bits (259),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 48/74 (65%), Positives = 58/74 (78%), Gaps = 0/74 (0%)
 Frame = -2

Query  729  WGKWVSEIREPGKKTRIWLGSFETPEMAAAAYDVAAFHLRGCKARLNFPELVEGFPKPAS  550
            WGKWVSEIREP KK+RIWLG+F TPEMAA A+DVAA  ++G  A LNFPEL + FP+P S
Sbjct  70   WGKWVSEIREPRKKSRIWLGTFPTPEMAARAHDVAALSIKGASAILNFPELADSFPRPVS  129

Query  549  SQPEDVRLAAHQAA  508
              P D++ AA +AA
Sbjct  130  LNPRDIQTAALKAA  143



>ref|XP_004252501.1| PREDICTED: dehydration-responsive element-binding protein 3 [Solanum 
lycopersicum]
Length=143

 Score =   102 bits (253),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 46/70 (66%), Positives = 56/70 (80%), Gaps = 0/70 (0%)
 Frame = -2

Query  729  WGKWVSEIREPGKKTRIWLGSFETPEMAAAAYDVAAFHLRGCKARLNFPELVEGFPKPAS  550
            WGKWVSEIR+P KK+RIWLG++ TPEMAA A+DVAA  ++G  A LNFP+LVE  P+PAS
Sbjct  38   WGKWVSEIRQPRKKSRIWLGTYPTPEMAARAHDVAALSIKGNSAILNFPQLVESLPRPAS  97

Query  549  SQPEDVRLAA  520
              P DV+ AA
Sbjct  98   ISPRDVQAAA  107



>gb|AAX95397.1| AP2 domain, putative [Oryza sativa Japonica Group]
 gb|AAX95971.1| AP2 domain, putative [Oryza sativa Japonica Group]
 gb|ABA92331.1| AP2 domain containing protein, expressed [Oryza sativa Japonica 
Group]
Length=201

 Score =   103 bits (256),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 75/176 (43%), Positives = 95/176 (54%), Gaps = 25/176 (14%)
 Frame = -2

Query  729  WGKWVSEIREPGKKTRIWLGSFETPEMAAAAYDVAAFHLRGCKARLNFPELVEGFPKPAS  550
            WGKWVSEIREPGKKTRIWLGSFE+PEMAA A+DVAA  LRG  ARLNFP +   F +P +
Sbjct  29   WGKWVSEIREPGKKTRIWLGSFESPEMAAVAHDVAALRLRGRDARLNFPAIAHRFRRPDT  88

Query  549  SQPEDVRLAAHQAA--MGFKPPAEGVPGAGLRPVRIGLSPNQIQAI--------------  418
            ++P DVR AA +AA  + F P    V G      R   +     A               
Sbjct  89   AEPGDVRAAALEAAAQVRFTPDLLVVAGGDDARRRCCSAGEAEAAAVAAAAWEWDVVVGG  148

Query  417  --NETPMDSPNKMWMELAATTLLLREPPLMICEDMMELEDWEE----IQDDSIWDF  268
              +E    SPN MW ELA   L+   PP+       + ++W +    + D S+WD+
Sbjct  149  GGDELEAKSPN-MWAELAEAMLMA--PPVWEGGGETDNDEWAQQAASLWDPSVWDY  201



>emb|CDX97125.1| BnaC09g45000D [Brassica napus]
Length=244

 Score =   104 bits (259),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 48/74 (65%), Positives = 58/74 (78%), Gaps = 0/74 (0%)
 Frame = -2

Query  729  WGKWVSEIREPGKKTRIWLGSFETPEMAAAAYDVAAFHLRGCKARLNFPELVEGFPKPAS  550
            WGKWVSEIREP KK+RIWLG+F TPEMAA A+DVAA  ++G  A LNFPEL + FP+P S
Sbjct  70   WGKWVSEIREPRKKSRIWLGTFPTPEMAARAHDVAALSIKGASAILNFPELADSFPRPVS  129

Query  549  SQPEDVRLAAHQAA  508
              P D++ AA +AA
Sbjct  130  LNPRDIQTAALKAA  143



>ref|XP_004501158.1| PREDICTED: dehydration-responsive element-binding protein 3-like 
[Cicer arietinum]
 ref|XP_004517241.1| PREDICTED: dehydration-responsive element-binding protein 3-like 
[Cicer arietinum]
Length=171

 Score =   102 bits (254),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 49/74 (66%), Positives = 57/74 (77%), Gaps = 0/74 (0%)
 Frame = -2

Query  729  WGKWVSEIREPGKKTRIWLGSFETPEMAAAAYDVAAFHLRGCKARLNFPELVEGFPKPAS  550
            WGKWVSEIREP KK+RIWLG+F TPEMAA A+DVAA  ++G  A LNFPEL    P+PAS
Sbjct  40   WGKWVSEIREPRKKSRIWLGTFSTPEMAARAHDVAALSIKGNAAILNFPELANSLPRPAS  99

Query  549  SQPEDVRLAAHQAA  508
              P DV+ AA +AA
Sbjct  100  LAPRDVQAAATKAA  113



>gb|KFK25419.1| hypothetical protein AALP_AA8G112500 [Arabis alpina]
Length=236

 Score =   103 bits (258),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 48/74 (65%), Positives = 58/74 (78%), Gaps = 0/74 (0%)
 Frame = -2

Query  729  WGKWVSEIREPGKKTRIWLGSFETPEMAAAAYDVAAFHLRGCKARLNFPELVEGFPKPAS  550
            WGKWVSEIREP KK+RIWLG+F TPEMAA A+DVAA  ++G  A LNFPEL + FP+P S
Sbjct  61   WGKWVSEIREPRKKSRIWLGTFPTPEMAARAHDVAALSIKGTSAILNFPELADSFPRPVS  120

Query  549  SQPEDVRLAAHQAA  508
              P D++ AA +AA
Sbjct  121  LNPRDIQTAALKAA  134



>ref|XP_006836896.1| hypothetical protein AMTR_s00099p00122430 [Amborella trichopoda]
 gb|ERM99749.1| hypothetical protein AMTR_s00099p00122430 [Amborella trichopoda]
Length=189

 Score =   102 bits (255),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 49/74 (66%), Positives = 59/74 (80%), Gaps = 0/74 (0%)
 Frame = -2

Query  729  WGKWVSEIREPGKKTRIWLGSFETPEMAAAAYDVAAFHLRGCKARLNFPELVEGFPKPAS  550
            WG++VSEIREP KKTRIWLGSF +PEMAA AYD AAF L+G K+ LNFPEL E  P+PAS
Sbjct  41   WGRYVSEIREPKKKTRIWLGSFLSPEMAARAYDSAAFFLKGNKSALNFPELAEFLPRPAS  100

Query  549  SQPEDVRLAAHQAA  508
            +   D++ AA +AA
Sbjct  101  NSRRDIQAAALKAA  114



>ref|XP_008458661.1| PREDICTED: dehydration-responsive element-binding protein 3-like 
[Cucumis melo]
Length=252

 Score =   104 bits (259),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 50/74 (68%), Positives = 58/74 (78%), Gaps = 0/74 (0%)
 Frame = -2

Query  729  WGKWVSEIREPGKKTRIWLGSFETPEMAAAAYDVAAFHLRGCKARLNFPELVEGFPKPAS  550
            WGKWVSEIREP KK+RIWLG+F TP+MAA A+DVAA  ++G  A LNFPEL   FP+PAS
Sbjct  64   WGKWVSEIREPKKKSRIWLGTFATPDMAARAHDVAALTIKGNSAILNFPELAASFPRPAS  123

Query  549  SQPEDVRLAAHQAA  508
            S P DV+ AA  AA
Sbjct  124  SSPRDVQSAAALAA  137



>ref|XP_011007489.1| PREDICTED: ethylene-responsive transcription factor ERF023-like 
[Populus euphratica]
Length=193

 Score =   102 bits (255),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 52/100 (52%), Positives = 65/100 (65%), Gaps = 1/100 (1%)
 Frame = -2

Query  729  WGKWVSEIREPGKKTRIWLGSFETPEMAAAAYDVAAFHLRGCKARLNFPELVEGFPKPAS  550
            WG++VSEIR PGKKTR+WLGSF +PEMAA A+D AAF L+G  A LNFP+ V   P+P S
Sbjct  44   WGRYVSEIRLPGKKTRVWLGSFGSPEMAARAHDSAAFFLKGNSASLNFPDSVGSLPRPKS  103

Query  549  SQPEDVRLAAHQAAMGFKPPAEGVPGAGLRPVRIGLSPNQ  430
               +D++LAA +AA GF     G  G G      G  P+ 
Sbjct  104  CSSKDIQLAAAKAATGFDETRVG-NGVGFEDCESGGEPDS  142



>ref|XP_004975709.1| PREDICTED: ethylene-responsive transcription factor ERF027-like 
[Setaria italica]
Length=204

 Score =   103 bits (256),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 66/146 (45%), Positives = 81/146 (55%), Gaps = 22/146 (15%)
 Frame = -2

Query  729  WGKWVSEIREPGKKTRIWLGSFETPEMAAAAYDVAAFHLRGCKARLNFPELVEGFPKPAS  550
            WGKWVSEIR+PG KTRIWLGSFE+ EMAA A+DVAA  LRG  A+LNFP  V   P+PAS
Sbjct  39   WGKWVSEIRQPGTKTRIWLGSFESAEMAAVAHDVAALRLRGRDAQLNFPGCVGWLPRPAS  98

Query  549  SQPEDVR----------------LAAHQAAMGFKPPAEGVPGAGLRPVRIGLSPNQIQAI  418
            + P DVR                L  HQAA         +      PV + L  ++    
Sbjct  99   THPGDVRAAAAEAADRVRCDPALLVLHQAAAARCHHELELDLGAAGPVVVELGSDE---E  155

Query  417  NETPMDSPNKMWMELAATTLLLREPP  340
             E  +DSP ++W E+A   LL  +PP
Sbjct  156  FELDLDSP-RLWAEMAEAMLL--DPP  178



>emb|CDY66961.1| BnaC09g50850D [Brassica napus]
Length=218

 Score =   103 bits (256),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 48/74 (65%), Positives = 59/74 (80%), Gaps = 0/74 (0%)
 Frame = -2

Query  729  WGKWVSEIREPGKKTRIWLGSFETPEMAAAAYDVAAFHLRGCKARLNFPELVEGFPKPAS  550
            WGKWVSEIREP KK+RIWLG+F +PEMAA A+DVAA  ++G  A LNFPELV  FP+P+S
Sbjct  45   WGKWVSEIREPRKKSRIWLGTFPSPEMAARAHDVAALSIKGTSATLNFPELVGSFPRPSS  104

Query  549  SQPEDVRLAAHQAA  508
              P D++ AA +AA
Sbjct  105  LSPRDIQAAALKAA  118



>ref|XP_010419734.1| PREDICTED: dehydration-responsive element-binding protein 3 [Camelina 
sativa]
Length=241

 Score =   103 bits (258),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 48/74 (65%), Positives = 58/74 (78%), Gaps = 0/74 (0%)
 Frame = -2

Query  729  WGKWVSEIREPGKKTRIWLGSFETPEMAAAAYDVAAFHLRGCKARLNFPELVEGFPKPAS  550
            WGKWVSEIREP KK+RIWLG+F TPEMAA A+DVAA  ++G  A LNFPEL + FP+P S
Sbjct  64   WGKWVSEIREPRKKSRIWLGTFPTPEMAARAHDVAALSIKGTSAILNFPELADSFPRPVS  123

Query  549  SQPEDVRLAAHQAA  508
              P D++ AA +AA
Sbjct  124  LSPRDIQTAALKAA  137



>ref|XP_009136807.1| PREDICTED: ethylene-responsive transcription factor ERF039-like 
[Brassica rapa]
 emb|CDX90497.1| BnaA03g42840D [Brassica napus]
Length=177

 Score =   102 bits (254),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 52/80 (65%), Positives = 63/80 (79%), Gaps = 0/80 (0%)
 Frame = -2

Query  729  WGKWVSEIREPGKKTRIWLGSFETPEMAAAAYDVAAFHLRGCKARLNFPELVEGFPKPAS  550
            WGKWVSEIREP KK+RIWLG+F TPEMAA A+DVAA  ++G  A LNFPEL    P+PAS
Sbjct  48   WGKWVSEIREPKKKSRIWLGTFSTPEMAARAHDVAALAIKGGSAHLNFPELACHLPRPAS  107

Query  549  SQPEDVRLAAHQAAMGFKPP  490
            S P+D++ AA  AA+ +KPP
Sbjct  108  SDPKDIQAAATAAAVEWKPP  127



>ref|XP_002873522.1| hypothetical protein ARALYDRAFT_487996 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH49781.1| hypothetical protein ARALYDRAFT_487996 [Arabidopsis lyrata subsp. 
lyrata]
Length=236

 Score =   103 bits (257),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 48/74 (65%), Positives = 58/74 (78%), Gaps = 0/74 (0%)
 Frame = -2

Query  729  WGKWVSEIREPGKKTRIWLGSFETPEMAAAAYDVAAFHLRGCKARLNFPELVEGFPKPAS  550
            WGKWVSEIREP KK+RIWLG+F TPEMAA A+DVAA  ++G  A LNFPEL + FP+P S
Sbjct  60   WGKWVSEIREPRKKSRIWLGTFPTPEMAARAHDVAALSIKGTSAILNFPELADSFPRPVS  119

Query  549  SQPEDVRLAAHQAA  508
              P D++ AA +AA
Sbjct  120  LSPRDIQTAALKAA  133



>ref|XP_004291182.1| PREDICTED: dehydration-responsive element-binding protein 3-like 
[Fragaria vesca subsp. vesca]
Length=254

 Score =   103 bits (258),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 49/74 (66%), Positives = 59/74 (80%), Gaps = 0/74 (0%)
 Frame = -2

Query  729  WGKWVSEIREPGKKTRIWLGSFETPEMAAAAYDVAAFHLRGCKARLNFPELVEGFPKPAS  550
            WGKWVSEIREP KK+RIWLG+F TPEMAA A+DVAA  ++G  A LNFPEL++  P+PAS
Sbjct  74   WGKWVSEIREPRKKSRIWLGTFPTPEMAARAHDVAALSIKGNSAILNFPELIDSLPRPAS  133

Query  549  SQPEDVRLAAHQAA  508
              P DV+ AA +AA
Sbjct  134  LAPRDVQAAASKAA  147



>emb|CAN74967.1| hypothetical protein VITISV_038047 [Vitis vinifera]
Length=130

 Score =   100 bits (250),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 67/137 (49%), Positives = 88/137 (64%), Gaps = 16/137 (12%)
 Frame = -2

Query  651  MAAAAYDVAAFHLRGCKARLNFPELVEGFPKPASSQPEDVRLAAHQAAMGFKPPAEG---  481
            MAAAAYDVAA HL+G +A LNFPEL   FP+P S  PEDV+ A+ QAA+  K  A G   
Sbjct  1    MAAAAYDVAALHLKGHRAELNFPELAPSFPRPTSFSPEDVQFASAQAALHIKSIASGDVS  60

Query  480  -----VPGAGLRPVRIGLSPNQIQAINETPMDSPNKMWMELAATTLLLREPPLMICEDMM  316
                   G    P R+GLS ++I+ INE PMDSP +MWM      + LRE PL++ +++ 
Sbjct  61   ARSPSRVGMSSVPTRVGLSASEIREINEWPMDSP-RMWM------MELREEPLVLSDEIF  113

Query  315  ELEDWEEIQDD-SIWDF  268
            EL +WEE+++  SIWD 
Sbjct  114  ELSEWEEVENQYSIWDL  130



>ref|XP_006289586.1| hypothetical protein CARUB_v10003136mg [Capsella rubella]
 gb|EOA22484.1| hypothetical protein CARUB_v10003136mg [Capsella rubella]
Length=228

 Score =   103 bits (257),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 48/74 (65%), Positives = 58/74 (78%), Gaps = 0/74 (0%)
 Frame = -2

Query  729  WGKWVSEIREPGKKTRIWLGSFETPEMAAAAYDVAAFHLRGCKARLNFPELVEGFPKPAS  550
            WGKWVSEIREP KK+RIWLG+F TPEMAA A+DVAA  ++G  A LNFPEL + FP+P S
Sbjct  54   WGKWVSEIREPRKKSRIWLGTFPTPEMAARAHDVAALSIKGTSAILNFPELADSFPRPVS  113

Query  549  SQPEDVRLAAHQAA  508
              P D++ AA +AA
Sbjct  114  LSPRDIQTAALKAA  127



>ref|XP_006426907.1| hypothetical protein CICLE_v10027587mg [Citrus clementina]
 gb|ESR40147.1| hypothetical protein CICLE_v10027587mg [Citrus clementina]
Length=243

 Score =   103 bits (257),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 50/84 (60%), Positives = 60/84 (71%), Gaps = 0/84 (0%)
 Frame = -2

Query  729  WGKWVSEIREPGKKTRIWLGSFETPEMAAAAYDVAAFHLRGCKARLNFPELVEGFPKPAS  550
            WGKWVSEIREP KK+RIWLG+F TPEMAA A+DVAA  ++G  A LNFPELVE  P+P S
Sbjct  73   WGKWVSEIREPRKKSRIWLGTFRTPEMAARAHDVAALSIKGDSAVLNFPELVEVLPRPVS  132

Query  549  SQPEDVRLAAHQAAMGFKPPAEGV  478
              P D++ AA +AA     P+   
Sbjct  133  LLPRDIQTAATKAASMIIDPSSST  156



>ref|XP_006465666.1| PREDICTED: ethylene-responsive transcription factor ERF036-like 
[Citrus sinensis]
 ref|XP_006495405.1| PREDICTED: ethylene-responsive transcription factor ERF036-like 
[Citrus sinensis]
Length=243

 Score =   103 bits (257),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 50/84 (60%), Positives = 60/84 (71%), Gaps = 0/84 (0%)
 Frame = -2

Query  729  WGKWVSEIREPGKKTRIWLGSFETPEMAAAAYDVAAFHLRGCKARLNFPELVEGFPKPAS  550
            WGKWVSEIREP KK+RIWLG+F TPEMAA A+DVAA  ++G  A LNFPELVE  P+P S
Sbjct  73   WGKWVSEIREPRKKSRIWLGTFRTPEMAARAHDVAALSIKGDSAVLNFPELVEVLPRPVS  132

Query  549  SQPEDVRLAAHQAAMGFKPPAEGV  478
              P D++ AA +AA     P+   
Sbjct  133  LLPRDIQTAATKAASMIIDPSSST  156



>ref|XP_010677077.1| PREDICTED: ethylene-responsive transcription factor ERF039 [Beta 
vulgaris subsp. vulgaris]
Length=241

 Score =   103 bits (257),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 48/77 (62%), Positives = 60/77 (78%), Gaps = 0/77 (0%)
 Frame = -2

Query  729  WGKWVSEIREPGKKTRIWLGSFETPEMAAAAYDVAAFHLRGCKARLNFPELVEGFPKPAS  550
            WGKWVSEIREP KK+RIWLG+F T +MAA A+DVAA  ++G  A LNFP+L    PKPAS
Sbjct  73   WGKWVSEIREPRKKSRIWLGTFATADMAARAHDVAALAIKGHNAYLNFPDLAHQLPKPAS  132

Query  549  SQPEDVRLAAHQAAMGF  499
            + P+D++ AA +AAM F
Sbjct  133  TTPKDIQAAAIKAAMDF  149



>ref|XP_004139438.1| PREDICTED: dehydration-responsive element-binding protein 3-like 
[Cucumis sativus]
 ref|XP_004165092.1| PREDICTED: dehydration-responsive element-binding protein 3-like 
[Cucumis sativus]
Length=252

 Score =   103 bits (257),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 50/74 (68%), Positives = 58/74 (78%), Gaps = 0/74 (0%)
 Frame = -2

Query  729  WGKWVSEIREPGKKTRIWLGSFETPEMAAAAYDVAAFHLRGCKARLNFPELVEGFPKPAS  550
            WGKWVSEIREP KK+RIWLG+F TP+MAA A+DVAA  ++G  A LNFPEL   FP+PAS
Sbjct  64   WGKWVSEIREPKKKSRIWLGTFATPDMAARAHDVAALTIKGNSAILNFPELAASFPRPAS  123

Query  549  SQPEDVRLAAHQAA  508
            S P DV+ AA  AA
Sbjct  124  SSPRDVQSAAALAA  137



>gb|KDO56992.1| hypothetical protein CISIN_1g038538mg [Citrus sinensis]
Length=243

 Score =   103 bits (257),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 50/84 (60%), Positives = 60/84 (71%), Gaps = 0/84 (0%)
 Frame = -2

Query  729  WGKWVSEIREPGKKTRIWLGSFETPEMAAAAYDVAAFHLRGCKARLNFPELVEGFPKPAS  550
            WGKWVSEIREP KK+RIWLG+F TPEMAA A+DVAA  ++G  A LNFPELVE  P+P S
Sbjct  73   WGKWVSEIREPRKKSRIWLGTFRTPEMAARAHDVAALSIKGDSAVLNFPELVEVLPRPVS  132

Query  549  SQPEDVRLAAHQAAMGFKPPAEGV  478
              P D++ AA +AA     P+   
Sbjct  133  LLPRDIQTAATKAASMIIDPSSST  156



>ref|XP_004494833.1| PREDICTED: ethylene-responsive transcription factor ERF023-like 
[Cicer arietinum]
Length=170

 Score =   101 bits (252),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 53/87 (61%), Positives = 62/87 (71%), Gaps = 1/87 (1%)
 Frame = -2

Query  729  WGKWVSEIREPGKKTRIWLGSFETPEMAAAAYDVAAFHLRGCKARLNFPELVEGFPKPAS  550
            WGKWVSEIREP KK+RIWLGSF  PEMAA AYDVAA+ L+G KA+LNFP+ VE  P PA+
Sbjct  36   WGKWVSEIREPKKKSRIWLGSFSVPEMAARAYDVAAYCLKGRKAQLNFPDEVEQLPLPAT  95

Query  549  SQPEDVRLAAHQAAMGFK-PPAEGVPG  472
                D++ AA +AA   K  P E   G
Sbjct  96   CTARDIQAAASKAASMVKASPGEKSDG  122



>ref|XP_002523328.1| Transcriptional factor TINY, putative [Ricinus communis]
 gb|EEF39044.1| Transcriptional factor TINY, putative [Ricinus communis]
Length=198

 Score =   102 bits (254),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 45/66 (68%), Positives = 54/66 (82%), Gaps = 0/66 (0%)
 Frame = -2

Query  729  WGKWVSEIREPGKKTRIWLGSFETPEMAAAAYDVAAFHLRGCKARLNFPELVEGFPKPAS  550
            WGKWVSEIREP KK+RIWLGSF  PEMAA AYDVAA+ L+GCKA+LNFP+ VE  P+P++
Sbjct  53   WGKWVSEIREPRKKSRIWLGSFPVPEMAAKAYDVAAYCLKGCKAQLNFPDEVEDLPRPST  112

Query  549  SQPEDV  532
                D+
Sbjct  113  CTARDI  118



>emb|CDX75287.1| BnaA01g04150D [Brassica napus]
Length=198

 Score =   102 bits (254),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 47/75 (63%), Positives = 57/75 (76%), Gaps = 0/75 (0%)
 Frame = -2

Query  729  WGKWVSEIREPGKKTRIWLGSFETPEMAAAAYDVAAFHLRGCKARLNFPELVEGFPKPAS  550
            WGKWVSEIREP KK+RIWLG+F+T EMA  A+DVAA  ++G  A LNFPEL +  P+P S
Sbjct  30   WGKWVSEIREPRKKSRIWLGTFQTAEMAMRAHDVAALSIKGSSAILNFPELSDSLPRPVS  89

Query  549  SQPEDVRLAAHQAAM  505
              P DVR AA +AA+
Sbjct  90   LSPRDVRAAATKAAL  104



>emb|CDX68891.1| BnaC01g05620D [Brassica napus]
Length=190

 Score =   102 bits (253),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 47/75 (63%), Positives = 57/75 (76%), Gaps = 0/75 (0%)
 Frame = -2

Query  729  WGKWVSEIREPGKKTRIWLGSFETPEMAAAAYDVAAFHLRGCKARLNFPELVEGFPKPAS  550
            WGKWVSEIREP KK+RIWLG+F+T EMA  A+DVAA  ++G  A LNFPEL +  P+P S
Sbjct  30   WGKWVSEIREPRKKSRIWLGTFQTAEMAMRAHDVAALSIKGSSAILNFPELSDSLPRPVS  89

Query  549  SQPEDVRLAAHQAAM  505
              P DVR AA +AA+
Sbjct  90   LSPRDVRAAATKAAL  104



>ref|XP_002516502.1| Transcriptional factor TINY, putative [Ricinus communis]
 gb|EEF45843.1| Transcriptional factor TINY, putative [Ricinus communis]
Length=270

 Score =   103 bits (257),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 49/74 (66%), Positives = 59/74 (80%), Gaps = 0/74 (0%)
 Frame = -2

Query  729  WGKWVSEIREPGKKTRIWLGSFETPEMAAAAYDVAAFHLRGCKARLNFPELVEGFPKPAS  550
            WGKWVSEIREP KK+RIWLG+F TPEMAA A+DVAA  ++G  A LNFPEL +  P+PAS
Sbjct  61   WGKWVSEIREPRKKSRIWLGTFPTPEMAARAHDVAALSIKGNSAILNFPELADSLPRPAS  120

Query  549  SQPEDVRLAAHQAA  508
              P DV++AA +AA
Sbjct  121  LAPRDVQIAAAKAA  134



>gb|ABQ62979.1| TINY-like protein [Populus trichocarpa]
Length=193

 Score =   102 bits (253),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 52/100 (52%), Positives = 65/100 (65%), Gaps = 1/100 (1%)
 Frame = -2

Query  729  WGKWVSEIREPGKKTRIWLGSFETPEMAAAAYDVAAFHLRGCKARLNFPELVEGFPKPAS  550
            WG++VSEIR PGKKTR+WLGSF +PEMAA A+D AAF L+G  A LNFP+ V   P+P S
Sbjct  44   WGRYVSEIRLPGKKTRVWLGSFGSPEMAARAHDSAAFFLKGNSACLNFPDSVGSLPRPKS  103

Query  549  SQPEDVRLAAHQAAMGFKPPAEGVPGAGLRPVRIGLSPNQ  430
               +D++LAA +AA GF     G  G G      G  P+ 
Sbjct  104  CSSKDIQLAAAKAATGFDESRVG-NGVGFEDCESGGEPDS  142



>emb|CDX77012.1| BnaC04g38070D [Brassica napus]
Length=209

 Score =   102 bits (254),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 51/82 (62%), Positives = 59/82 (72%), Gaps = 1/82 (1%)
 Frame = -2

Query  729  WGKWVSEIREPGKKTRIWLGSFETPEMAAAAYDVAAFHLRGCKARLNFPELVEGFPKPAS  550
            WGKWVSEIREP KK+RIWLGSF T EMAA A+DVAA  ++G  A LNFPEL    P+P S
Sbjct  33   WGKWVSEIREPRKKSRIWLGSFPTAEMAARAHDVAALSIKGSSAILNFPELTNSLPRPVS  92

Query  549  SQPEDVRLAAHQAA-MGFKPPA  487
              P D++ AA +AA M FK P 
Sbjct  93   LSPADIQAAATKAAFMEFKTPT  114



>gb|KDP28475.1| hypothetical protein JCGZ_14246 [Jatropha curcas]
Length=195

 Score =   102 bits (253),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 46/67 (69%), Positives = 55/67 (82%), Gaps = 0/67 (0%)
 Frame = -2

Query  729  WGKWVSEIREPGKKTRIWLGSFETPEMAAAAYDVAAFHLRGCKARLNFPELVEGFPKPAS  550
            WGKWVSEIREP KK+RIWLGSF  PEMAA AYDVAA+ L+GCKA+LNFPE +E  P+P+S
Sbjct  54   WGKWVSEIREPRKKSRIWLGSFPVPEMAAKAYDVAAYCLKGCKAQLNFPEELEDLPRPSS  113

Query  549  SQPEDVR  529
                D++
Sbjct  114  CTARDIQ  120



>ref|XP_009138144.1| PREDICTED: ethylene-responsive transcription factor ERF043-like 
[Brassica rapa]
Length=235

 Score =   102 bits (255),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 48/75 (64%), Positives = 57/75 (76%), Gaps = 0/75 (0%)
 Frame = -2

Query  729  WGKWVSEIREPGKKTRIWLGSFETPEMAAAAYDVAAFHLRGCKARLNFPELVEGFPKPAS  550
            WGKWVSEIREP KK+RIWLG+F T EMA  A+DVAA  ++G  A LNFPEL +  P+PAS
Sbjct  28   WGKWVSEIREPRKKSRIWLGTFPTAEMAMRAHDVAALSIKGSSAILNFPELSDSLPRPAS  87

Query  549  SQPEDVRLAAHQAAM  505
              P DVR AA +AA+
Sbjct  88   LSPRDVRAAATKAAL  102



>gb|KEH36063.1| AP2 domain class transcription factor [Medicago truncatula]
Length=187

 Score =   101 bits (252),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 49/74 (66%), Positives = 58/74 (78%), Gaps = 0/74 (0%)
 Frame = -2

Query  729  WGKWVSEIREPGKKTRIWLGSFETPEMAAAAYDVAAFHLRGCKARLNFPELVEGFPKPAS  550
            WGKWVSEIREP KK+RIWLG+F TPEMAA A+DVAA  ++G  A LNFPEL    P+PAS
Sbjct  51   WGKWVSEIREPKKKSRIWLGTFPTPEMAARAHDVAALSIKGSAAILNFPELANLLPRPAS  110

Query  549  SQPEDVRLAAHQAA  508
              P DV+ AA++AA
Sbjct  111  LAPRDVQAAANKAA  124



>ref|XP_003635248.1| PREDICTED: ethylene-responsive transcription factor ERF039-like 
[Vitis vinifera]
Length=225

 Score =   102 bits (255),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 52/79 (66%), Positives = 60/79 (76%), Gaps = 0/79 (0%)
 Frame = -2

Query  729  WGKWVSEIREPGKKTRIWLGSFETPEMAAAAYDVAAFHLRGCKARLNFPELVEGFPKPAS  550
            WGKWVSEIREP KK+RIWLGSF TPEMAA A+DVAA  ++G  A LNFPEL   FP+P +
Sbjct  56   WGKWVSEIREPRKKSRIWLGSFATPEMAARAHDVAALAIKGHSAHLNFPELAHQFPRPET  115

Query  549  SQPEDVRLAAHQAAMGFKP  493
              PED+R AA +AAM   P
Sbjct  116  KSPEDIRAAAAKAAMFTHP  134



>ref|XP_009140700.1| PREDICTED: ethylene-responsive transcription factor ERF042 [Brassica 
rapa]
Length=203

 Score =   102 bits (253),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 52/91 (57%), Positives = 63/91 (69%), Gaps = 5/91 (5%)
 Frame = -2

Query  729  WGKWVSEIREPGKKTRIWLGSFETPEMAAAAYDVAAFHLRGCKARLNFPELVEGFPKPAS  550
            WGKWVSEIREP KK+RIWLG+F T EMAA A+DVAA  ++G  A LNFPEL    P+P S
Sbjct  33   WGKWVSEIREPRKKSRIWLGTFPTAEMAARAHDVAALSIKGSSAILNFPELTNSLPRPVS  92

Query  549  SQPEDVRLAAHQAA-MGFKPPA----EGVPG  472
              P D++ AA +AA M FK P+    +G P 
Sbjct  93   LSPADIQAAATKAAFMEFKTPSLHLEDGTPS  123



>ref|NP_196720.1| dehydration-responsive element-binding protein 3 [Arabidopsis 
thaliana]
 sp|Q9LYD3.1|DREB3_ARATH RecName: Full=Dehydration-responsive element-binding protein 
3; AltName: Full=Protein TINY 2 [Arabidopsis thaliana]
 emb|CAB87719.1| transcription factor like protein [Arabidopsis thaliana]
 gb|AAT44918.1| putative AP2/EREBP transcription factor [Arabidopsis thaliana]
 gb|AAX38232.1| DREB3 [Arabidopsis thaliana]
 gb|AED91698.1| dehydration-responsive element-binding protein 3 [Arabidopsis 
thaliana]
Length=236

 Score =   102 bits (255),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 48/74 (65%), Positives = 58/74 (78%), Gaps = 0/74 (0%)
 Frame = -2

Query  729  WGKWVSEIREPGKKTRIWLGSFETPEMAAAAYDVAAFHLRGCKARLNFPELVEGFPKPAS  550
            WGKWVSEIREP KK+RIWLG+F TPEMAA A+DVAA  ++G  A LNFPEL + FP+P S
Sbjct  59   WGKWVSEIREPRKKSRIWLGTFPTPEMAARAHDVAALSIKGTAAILNFPELADSFPRPVS  118

Query  549  SQPEDVRLAAHQAA  508
              P D++ AA +AA
Sbjct  119  LSPRDIQTAALKAA  132



>ref|XP_006388007.1| hypothetical protein POPTR_0409s00200g [Populus trichocarpa]
 gb|ABQ62978.1| TINY-like protein [Populus trichocarpa]
 gb|ERP46921.1| hypothetical protein POPTR_0409s00200g [Populus trichocarpa]
Length=193

 Score =   102 bits (253),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 52/99 (53%), Positives = 65/99 (66%), Gaps = 1/99 (1%)
 Frame = -2

Query  729  WGKWVSEIREPGKKTRIWLGSFETPEMAAAAYDVAAFHLRGCKARLNFPELVEGFPKPAS  550
            WG++VSEIR PGKKTR+WLGSF +PEMAA A+D AAF L+G  A LNFP+ V   P+P S
Sbjct  44   WGRYVSEIRLPGKKTRVWLGSFGSPEMAARAHDSAAFFLKGNSACLNFPDSVGSLPRPKS  103

Query  549  SQPEDVRLAAHQAAMGFKPPAEGVPGAGLRPVRIGLSPN  433
               +D++LAA +AA GF     G  G G      G  P+
Sbjct  104  CSSKDIQLAAAKAATGFDESRVG-NGVGFEDCESGGEPD  141



>ref|XP_011031921.1| PREDICTED: ethylene-responsive transcription factor ERF039 [Populus 
euphratica]
Length=226

 Score =   102 bits (254),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 45/67 (67%), Positives = 55/67 (82%), Gaps = 0/67 (0%)
 Frame = -2

Query  729  WGKWVSEIREPGKKTRIWLGSFETPEMAAAAYDVAAFHLRGCKARLNFPELVEGFPKPAS  550
            WGKWVSEIR+P KK+RIWLG+F TPEMAA A+DVAA  ++G  A LNFPEL   FP+PAS
Sbjct  49   WGKWVSEIRQPKKKSRIWLGTFSTPEMAARAHDVAALTIKGHSAHLNFPELAHEFPRPAS  108

Query  549  SQPEDVR  529
            S P+D++
Sbjct  109  SSPKDIQ  115



>ref|XP_002303364.1| hypothetical protein POPTR_0003s07700g [Populus trichocarpa]
 gb|ABQ62970.1| TINY-like protein [Populus trichocarpa]
 gb|EEE78343.1| hypothetical protein POPTR_0003s07700g [Populus trichocarpa]
Length=225

 Score =   102 bits (254),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 45/67 (67%), Positives = 55/67 (82%), Gaps = 0/67 (0%)
 Frame = -2

Query  729  WGKWVSEIREPGKKTRIWLGSFETPEMAAAAYDVAAFHLRGCKARLNFPELVEGFPKPAS  550
            WGKWVSEIR+P KK+RIWLG+F TPEMAA A+DVAA  ++G  A LNFPEL   FP+PAS
Sbjct  48   WGKWVSEIRQPKKKSRIWLGTFSTPEMAARAHDVAALTIKGHSAHLNFPELAHEFPRPAS  107

Query  549  SQPEDVR  529
            S P+D++
Sbjct  108  SSPKDIQ  114



>ref|XP_009790153.1| PREDICTED: ethylene-responsive transcription factor ERF023-like 
[Nicotiana sylvestris]
Length=183

 Score =   101 bits (252),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 44/67 (66%), Positives = 55/67 (82%), Gaps = 0/67 (0%)
 Frame = -2

Query  729  WGKWVSEIREPGKKTRIWLGSFETPEMAAAAYDVAAFHLRGCKARLNFPELVEGFPKPAS  550
            WGKWVSEIREP KK+RIWLGSF +PEMAA AYDVAA+ L+GCK +LNFP+ +E  P+P +
Sbjct  45   WGKWVSEIREPRKKSRIWLGSFSSPEMAARAYDVAAYCLKGCKTQLNFPDEIERLPRPIT  104

Query  549  SQPEDVR  529
            S   D++
Sbjct  105  STARDIQ  111



>ref|XP_011048423.1| PREDICTED: ethylene-responsive transcription factor ERF039-like 
[Populus euphratica]
Length=227

 Score =   102 bits (254),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 45/67 (67%), Positives = 55/67 (82%), Gaps = 0/67 (0%)
 Frame = -2

Query  729  WGKWVSEIREPGKKTRIWLGSFETPEMAAAAYDVAAFHLRGCKARLNFPELVEGFPKPAS  550
            WGKWVSEIR+P KK+RIWLG+F TPEMAA A+DVAA  ++G  A LNFPEL   FP+PAS
Sbjct  49   WGKWVSEIRQPKKKSRIWLGTFSTPEMAARAHDVAALTIKGHSAHLNFPELAHEFPRPAS  108

Query  549  SQPEDVR  529
            S P+D++
Sbjct  109  SSPKDIQ  115



>ref|XP_004301177.1| PREDICTED: ethylene-responsive transcription factor ERF034-like 
[Fragaria vesca subsp. vesca]
Length=225

 Score =   102 bits (254),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 46/67 (69%), Positives = 56/67 (84%), Gaps = 0/67 (0%)
 Frame = -2

Query  729  WGKWVSEIREPGKKTRIWLGSFETPEMAAAAYDVAAFHLRGCKARLNFPELVEGFPKPAS  550
            WGKWVSEIREP KK+RIWLG+FETPEMAA A+DVAA  ++G  A LNFPEL +  P+PAS
Sbjct  67   WGKWVSEIREPRKKSRIWLGTFETPEMAARAHDVAALTIKGSSAYLNFPELAQELPRPAS  126

Query  549  SQPEDVR  529
            S P+D++
Sbjct  127  SSPKDIQ  133



>gb|EYU38883.1| hypothetical protein MIMGU_mgv1a014821mg [Erythranthe guttata]
Length=177

 Score =   101 bits (251),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 48/74 (65%), Positives = 59/74 (80%), Gaps = 0/74 (0%)
 Frame = -2

Query  729  WGKWVSEIREPGKKTRIWLGSFETPEMAAAAYDVAAFHLRGCKARLNFPELVEGFPKPAS  550
            WGKWVSEIREP KKTRIWLGSF  PEMAA AYDVAA+ L+G KA+LNFP+ ++  P+P++
Sbjct  40   WGKWVSEIREPKKKTRIWLGSFPAPEMAARAYDVAAYCLKGQKAQLNFPQEIDHLPRPST  99

Query  549  SQPEDVRLAAHQAA  508
            S   D++ AA  AA
Sbjct  100  STARDIQAAASLAA  113



>ref|XP_011023164.1| PREDICTED: ethylene-responsive transcription factor ERF023-like 
[Populus euphratica]
 ref|XP_011023166.1| PREDICTED: ethylene-responsive transcription factor ERF023-like 
[Populus euphratica]
 ref|XP_011023167.1| PREDICTED: ethylene-responsive transcription factor ERF023-like 
[Populus euphratica]
Length=177

 Score =   101 bits (251),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 52/92 (57%), Positives = 63/92 (68%), Gaps = 4/92 (4%)
 Frame = -2

Query  729  WGKWVSEIREPGKKTRIWLGSFETPEMAAAAYDVAAFHLRGCKARLNFPELVEGFPKPAS  550
            WGKWVSEIREP KK+RIWLGSF  PEMAA AYDVAA+ L+GCKA+LNFPE V+  P P++
Sbjct  28   WGKWVSEIREPRKKSRIWLGSFPVPEMAAKAYDVAAYCLKGCKAQLNFPEEVDDLPIPST  87

Query  549  SQPEDVR----LAAHQAAMGFKPPAEGVPGAG  466
                D++     AAH   +  K  +E   G G
Sbjct  88   CTARDIQAAAAKAAHSVLIPMKKSSETNSGGG  119



>ref|XP_010691437.1| PREDICTED: ethylene-responsive transcription factor ERF039 [Beta 
vulgaris subsp. vulgaris]
Length=236

 Score =   102 bits (255),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 47/67 (70%), Positives = 54/67 (81%), Gaps = 0/67 (0%)
 Frame = -2

Query  729  WGKWVSEIREPGKKTRIWLGSFETPEMAAAAYDVAAFHLRGCKARLNFPELVEGFPKPAS  550
            WGKWVSEIREP KK+RIWLG+F TPEMAA A+DVAA  ++G  A LNFPEL E  P+PAS
Sbjct  72   WGKWVSEIREPKKKSRIWLGTFNTPEMAARAHDVAALCIKGNSAILNFPELSESLPRPAS  131

Query  549  SQPEDVR  529
            S P DV+
Sbjct  132  SSPRDVQ  138



>emb|CDY13503.1| BnaA03g52210D [Brassica napus]
Length=223

 Score =   102 bits (254),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 48/75 (64%), Positives = 57/75 (76%), Gaps = 0/75 (0%)
 Frame = -2

Query  729  WGKWVSEIREPGKKTRIWLGSFETPEMAAAAYDVAAFHLRGCKARLNFPELVEGFPKPAS  550
            WGKWVSEIREP KK+RIWLG+F T EMA  A+DVAA  ++G  A LNFPEL +  P+PAS
Sbjct  28   WGKWVSEIREPRKKSRIWLGTFPTAEMAMRAHDVAALSIKGSSAILNFPELSDSLPRPAS  87

Query  549  SQPEDVRLAAHQAAM  505
              P DVR AA +AA+
Sbjct  88   LSPRDVRAAATKAAL  102



>gb|EPS58378.1| hypothetical protein M569_16436, partial [Genlisea aurea]
Length=93

 Score = 98.6 bits (244),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 46/70 (66%), Positives = 54/70 (77%), Gaps = 0/70 (0%)
 Frame = -2

Query  729  WGKWVSEIREPGKKTRIWLGSFETPEMAAAAYDVAAFHLRGCKARLNFPELVEGFPKPAS  550
            WGKWVSEIREP KKTRIWLG+F +PEMAA A+DVA+  ++G  A LNFPEL    P+P S
Sbjct  17   WGKWVSEIREPRKKTRIWLGTFASPEMAARAHDVASLSIKGSNAVLNFPELSSVLPRPVS  76

Query  549  SQPEDVRLAA  520
             +P DVR AA
Sbjct  77   LRPHDVRAAA  86



>gb|ACJ84469.1| unknown [Medicago truncatula]
 gb|AFK43951.1| unknown [Medicago truncatula]
Length=194

 Score =   101 bits (252),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 49/74 (66%), Positives = 58/74 (78%), Gaps = 0/74 (0%)
 Frame = -2

Query  729  WGKWVSEIREPGKKTRIWLGSFETPEMAAAAYDVAAFHLRGCKARLNFPELVEGFPKPAS  550
            WGKWVSEIREP KK+RIWLG+F TPEMAA A+DVAA  ++G  A LNFPEL    P+PAS
Sbjct  51   WGKWVSEIREPKKKSRIWLGTFPTPEMAARAHDVAALSIKGSAAILNFPELANLLPRPAS  110

Query  549  SQPEDVRLAAHQAA  508
              P DV+ AA++AA
Sbjct  111  LAPRDVQAAANKAA  124



>ref|XP_009350478.1| PREDICTED: ethylene-responsive transcription factor TINY-like 
[Pyrus x bretschneideri]
Length=245

 Score =   102 bits (254),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 47/67 (70%), Positives = 55/67 (82%), Gaps = 0/67 (0%)
 Frame = -2

Query  729  WGKWVSEIREPGKKTRIWLGSFETPEMAAAAYDVAAFHLRGCKARLNFPELVEGFPKPAS  550
            WGKWVSEIREP KK+RIWLG+F TPEMAA A+DVAA  ++G  A LNFPEL E  P+PAS
Sbjct  80   WGKWVSEIREPRKKSRIWLGTFSTPEMAARAHDVAALSIKGSSAILNFPELTELLPRPAS  139

Query  549  SQPEDVR  529
             +PEDV+
Sbjct  140  LKPEDVQ  146



>emb|CDY19794.1| BnaA09g04470D [Brassica napus]
Length=217

 Score =   102 bits (253),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 47/74 (64%), Positives = 59/74 (80%), Gaps = 0/74 (0%)
 Frame = -2

Query  729  WGKWVSEIREPGKKTRIWLGSFETPEMAAAAYDVAAFHLRGCKARLNFPELVEGFPKPAS  550
            WGKWVSEIREP KK+RIWLG+F +PEMAA A+DVAA  ++G  A LNFP+LV  FP+P+S
Sbjct  44   WGKWVSEIREPRKKSRIWLGTFPSPEMAARAHDVAALSIKGTSATLNFPDLVGSFPRPSS  103

Query  549  SQPEDVRLAAHQAA  508
              P D++ AA +AA
Sbjct  104  LSPRDIQAAALKAA  117



>ref|XP_009111677.1| PREDICTED: ethylene-responsive transcription factor TINY-like 
[Brassica rapa]
Length=217

 Score =   102 bits (253),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 47/74 (64%), Positives = 59/74 (80%), Gaps = 0/74 (0%)
 Frame = -2

Query  729  WGKWVSEIREPGKKTRIWLGSFETPEMAAAAYDVAAFHLRGCKARLNFPELVEGFPKPAS  550
            WGKWVSEIREP KK+RIWLG+F +PEMAA A+DVAA  ++G  A LNFP+LV  FP+P+S
Sbjct  44   WGKWVSEIREPRKKSRIWLGTFPSPEMAARAHDVAALSIKGTSATLNFPDLVGSFPRPSS  103

Query  549  SQPEDVRLAAHQAA  508
              P D++ AA +AA
Sbjct  104  LSPRDIQAAALKAA  117



>ref|XP_006368997.1| hypothetical protein POPTR_0001s15550g [Populus trichocarpa]
 gb|ERP65566.1| hypothetical protein POPTR_0001s15550g [Populus trichocarpa]
Length=252

 Score =   102 bits (255),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 56/108 (52%), Positives = 71/108 (66%), Gaps = 1/108 (1%)
 Frame = -2

Query  729  WGKWVSEIREPGKKTRIWLGSFETPEMAAAAYDVAAFHLRGCKARLNFPELVEGFPKPAS  550
            WGKWVSEIR+P KK+RIWLG+F TPEMAA A+DVAA  ++G  A LNFPEL   FP+PAS
Sbjct  81   WGKWVSEIRQPKKKSRIWLGTFPTPEMAARAHDVAALTIKGHSAHLNFPELAHEFPRPAS  140

Query  549  SQPEDVR-LAAHQAAMGFKPPAEGVPGAGLRPVRIGLSPNQIQAINET  409
            S P+D++  AA  A +  K   +G        + +  SP+   A NET
Sbjct  141  SSPKDIQAAAALAATLSCKTSPKGRETEAEDELMLPHSPDSTLASNET  188



>gb|ABQ62971.1| TINY-like protein [Populus trichocarpa]
Length=221

 Score =   102 bits (253),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 55/108 (51%), Positives = 71/108 (66%), Gaps = 1/108 (1%)
 Frame = -2

Query  729  WGKWVSEIREPGKKTRIWLGSFETPEMAAAAYDVAAFHLRGCKARLNFPELVEGFPKPAS  550
            WGKWVSEIR+P KK+RIWLG+F TPEMAA A+DVAA  ++G  A LNFPE+   FP+PAS
Sbjct  50   WGKWVSEIRQPKKKSRIWLGTFPTPEMAARAHDVAALTIKGHSAHLNFPEIAHEFPRPAS  109

Query  549  SQPEDVR-LAAHQAAMGFKPPAEGVPGAGLRPVRIGLSPNQIQAINET  409
            S P+D++  AA  A +  K   +G        + +  SP+   A NET
Sbjct  110  SSPKDIQAAAALAATLSCKTSQKGRETEAEDELMLPHSPDSTLASNET  157



>ref|XP_009125436.1| PREDICTED: ethylene-responsive transcription factor ERF043 [Brassica 
rapa]
Length=229

 Score =   102 bits (253),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 47/75 (63%), Positives = 57/75 (76%), Gaps = 0/75 (0%)
 Frame = -2

Query  729  WGKWVSEIREPGKKTRIWLGSFETPEMAAAAYDVAAFHLRGCKARLNFPELVEGFPKPAS  550
            WGKWVSEIREP KK+RIWLG+F+T EMA  A+DVAA  ++G  A LNFPEL +  P+P S
Sbjct  30   WGKWVSEIREPRKKSRIWLGTFQTAEMAMRAHDVAALSIKGSSAILNFPELSDSLPRPVS  89

Query  549  SQPEDVRLAAHQAAM  505
              P DVR AA +AA+
Sbjct  90   LSPRDVRAAATKAAL  104



>ref|XP_007215988.1| hypothetical protein PRUPE_ppa011735mg [Prunus persica]
 gb|EMJ17187.1| hypothetical protein PRUPE_ppa011735mg [Prunus persica]
Length=198

 Score =   101 bits (251),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 44/67 (66%), Positives = 55/67 (82%), Gaps = 0/67 (0%)
 Frame = -2

Query  729  WGKWVSEIREPGKKTRIWLGSFETPEMAAAAYDVAAFHLRGCKARLNFPELVEGFPKPAS  550
            WGKWVSEIREP KK+RIWLG+F TP+MAA A+DVAA  ++G  A LNFPEL E  P+PAS
Sbjct  79   WGKWVSEIREPRKKSRIWLGTFSTPDMAARAHDVAALSIKGNSAILNFPELAELLPRPAS  138

Query  549  SQPEDVR  529
             +P+D++
Sbjct  139  RKPQDIQ  145



>ref|XP_008234474.1| PREDICTED: dehydration-responsive element-binding protein 1B 
[Prunus mume]
Length=268

 Score =   102 bits (254),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 66/157 (42%), Positives = 88/157 (56%), Gaps = 10/157 (6%)
 Frame = -2

Query  726  GKWVSEIREPGKKTRIWLGSFETPEMAAAAYDVAAFHLRGCKARLNFPELVEGFPKPASS  547
            GKWVSE+REP KKTRIWLG+F T EMAA A+DVAA  LRG  A LNF +     P PAS+
Sbjct  116  GKWVSEVREPNKKTRIWLGTFPTAEMAARAHDVAAIALRGRSACLNFADSAWRLPVPASA  175

Query  546  QPEDVRLAAHQAAMGFKPPAEG---VPGA-GLRPVRIGLSPNQIQAINETPMDSPNKMWM  379
              +D++  A +AA  F+PPAEG   V GA  + P     +  Q+  ++E  +     +  
Sbjct  176  NAKDIQTTASEAAEAFRPPAEGSDEVSGASAVAPSECASASEQVFYMDEEAVFGMPGLLA  235

Query  378  ELAATTLLLREPPLMICEDMMELEDWEEIQDDSIWDF  268
             +A   LL   PPL   +D    +D E   D  +W +
Sbjct  236  NMAEGMLL--SPPLYTEDD----DDVEFYADVPLWSY  266



>ref|XP_002320204.1| AP2 domain-containing transcription factor family protein [Populus 
trichocarpa]
 gb|ABQ62977.1| TINY-like protein [Populus trichocarpa]
 gb|EEE98519.1| AP2 domain-containing transcription factor family protein [Populus 
trichocarpa]
Length=198

 Score =   101 bits (251),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 44/67 (66%), Positives = 55/67 (82%), Gaps = 0/67 (0%)
 Frame = -2

Query  729  WGKWVSEIREPGKKTRIWLGSFETPEMAAAAYDVAAFHLRGCKARLNFPELVEGFPKPAS  550
            WGKWVSEIREP KK+RIWLGSF  PEMAA AYDVAA+ L+GCKA+LNFP+ V+  P+P++
Sbjct  48   WGKWVSEIREPRKKSRIWLGSFPVPEMAAKAYDVAAYCLKGCKAQLNFPDEVDDLPRPST  107

Query  549  SQPEDVR  529
                D++
Sbjct  108  CTARDIQ  114



>ref|XP_008462760.1| PREDICTED: ethylene-responsive transcription factor TINY-like 
[Cucumis melo]
Length=250

 Score =   102 bits (253),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 46/67 (69%), Positives = 54/67 (81%), Gaps = 0/67 (0%)
 Frame = -2

Query  729  WGKWVSEIREPGKKTRIWLGSFETPEMAAAAYDVAAFHLRGCKARLNFPELVEGFPKPAS  550
            WGKWVSEIREP KK+RIWLG+F TPEMAA A+DVAA  ++G  A LNFPEL   FP+PAS
Sbjct  62   WGKWVSEIREPRKKSRIWLGTFSTPEMAARAHDVAALTIKGTSAILNFPELAHQFPRPAS  121

Query  549  SQPEDVR  529
            + P DV+
Sbjct  122  TSPRDVQ  128



>gb|ADE41141.1| AP2 domain class transcription factor [Malus domestica]
Length=243

 Score =   102 bits (253),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 46/67 (69%), Positives = 55/67 (82%), Gaps = 0/67 (0%)
 Frame = -2

Query  729  WGKWVSEIREPGKKTRIWLGSFETPEMAAAAYDVAAFHLRGCKARLNFPELVEGFPKPAS  550
            WGKWVSEIREP KK+RIWLG+F TPEMAA A+DVAA  ++G  A LNFPEL E  P+PAS
Sbjct  78   WGKWVSEIREPRKKSRIWLGTFSTPEMAARAHDVAALSIKGSSAILNFPELTELLPRPAS  137

Query  549  SQPEDVR  529
             +P+DV+
Sbjct  138  LKPQDVQ  144



>ref|NP_563624.1| ethylene-responsive transcription factor ERF023 [Arabidopsis 
thaliana]
 sp|Q1ECI2.1|ERF23_ARATH RecName: Full=Ethylene-responsive transcription factor ERF023 
[Arabidopsis thaliana]
 gb|ABF83642.1| At1g01250 [Arabidopsis thaliana]
 gb|AEE27261.1| ethylene-responsive transcription factor ERF023 [Arabidopsis 
thaliana]
Length=192

 Score =   100 bits (250),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 46/67 (69%), Positives = 55/67 (82%), Gaps = 0/67 (0%)
 Frame = -2

Query  729  WGKWVSEIREPGKKTRIWLGSFETPEMAAAAYDVAAFHLRGCKARLNFPELVEGFPKPAS  550
            WGKWVSEIREP KK+RIWLGSF  PEMAA AYDVAAF L+G KA+LNFPE +E  P+P++
Sbjct  53   WGKWVSEIREPRKKSRIWLGSFPVPEMAAKAYDVAAFCLKGRKAQLNFPEEIEDLPRPST  112

Query  549  SQPEDVR  529
              P D++
Sbjct  113  CTPRDIQ  119



>ref|XP_011001450.1| PREDICTED: ethylene-responsive transcription factor ERF039-like 
[Populus euphratica]
Length=253

 Score =   102 bits (253),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 45/67 (67%), Positives = 55/67 (82%), Gaps = 0/67 (0%)
 Frame = -2

Query  729  WGKWVSEIREPGKKTRIWLGSFETPEMAAAAYDVAAFHLRGCKARLNFPELVEGFPKPAS  550
            WGKWVSEIR+P KK+RIWLG+F TPEMAA A+DVAA  ++G  A LNFPEL   FP+PAS
Sbjct  81   WGKWVSEIRQPKKKSRIWLGTFPTPEMAARAHDVAALTIKGSSAHLNFPELAHEFPRPAS  140

Query  549  SQPEDVR  529
            S P+D++
Sbjct  141  SSPKDIQ  147



>gb|AAF97326.1|AC023628_7 Similar to transcription factor TINY [Arabidopsis thaliana]
Length=187

 Score =   100 bits (249),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 46/67 (69%), Positives = 55/67 (82%), Gaps = 0/67 (0%)
 Frame = -2

Query  729  WGKWVSEIREPGKKTRIWLGSFETPEMAAAAYDVAAFHLRGCKARLNFPELVEGFPKPAS  550
            WGKWVSEIREP KK+RIWLGSF  PEMAA AYDVAAF L+G KA+LNFPE +E  P+P++
Sbjct  48   WGKWVSEIREPRKKSRIWLGSFPVPEMAAKAYDVAAFCLKGRKAQLNFPEEIEDLPRPST  107

Query  549  SQPEDVR  529
              P D++
Sbjct  108  CTPRDIQ  114



>ref|XP_004148719.1| PREDICTED: LOW QUALITY PROTEIN: dehydration-responsive element-binding 
protein 3-like [Cucumis sativus]
Length=242

 Score =   101 bits (252),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 46/67 (69%), Positives = 54/67 (81%), Gaps = 0/67 (0%)
 Frame = -2

Query  729  WGKWVSEIREPGKKTRIWLGSFETPEMAAAAYDVAAFHLRGCKARLNFPELVEGFPKPAS  550
            WGKWVSEIREP KK+RIWLG+F TPEMAA A+DVAA  ++G  A LNFPEL   FP+PAS
Sbjct  65   WGKWVSEIREPRKKSRIWLGTFSTPEMAARAHDVAALTIKGTSAILNFPELAHQFPRPAS  124

Query  549  SQPEDVR  529
            + P DV+
Sbjct  125  TSPRDVQ  131



>ref|XP_002991098.1| hypothetical protein SELMODRAFT_71661, partial [Selaginella moellendorffii]
 gb|EFJ07906.1| hypothetical protein SELMODRAFT_71661, partial [Selaginella moellendorffii]
Length=153

 Score = 99.8 bits (247),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 49/78 (63%), Positives = 56/78 (72%), Gaps = 0/78 (0%)
 Frame = -2

Query  729  WGKWVSEIREPGKKTRIWLGSFETPEMAAAAYDVAAFHLRGCKARLNFPELVEGFPKPAS  550
            WGKWVSEIREP KK RIWLGSF TPEMAA A+DVAA  LRG  A LNFP+ V   P+P  
Sbjct  13   WGKWVSEIREPKKKNRIWLGSFPTPEMAARAHDVAALCLRGEDAHLNFPDSVHTLPRPER  72

Query  549  SQPEDVRLAAHQAAMGFK  496
              P+ ++ AA  AAM F+
Sbjct  73   LSPKCIQEAATSAAMSFQ  90



>ref|XP_004161329.1| PREDICTED: dehydration-responsive element-binding protein 3-like 
[Cucumis sativus]
 gb|KGN65347.1| hypothetical protein Csa_1G364460 [Cucumis sativus]
Length=250

 Score =   101 bits (252),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 46/67 (69%), Positives = 54/67 (81%), Gaps = 0/67 (0%)
 Frame = -2

Query  729  WGKWVSEIREPGKKTRIWLGSFETPEMAAAAYDVAAFHLRGCKARLNFPELVEGFPKPAS  550
            WGKWVSEIREP KK+RIWLG+F TPEMAA A+DVAA  ++G  A LNFPEL   FP+PAS
Sbjct  65   WGKWVSEIREPRKKSRIWLGTFSTPEMAARAHDVAALTIKGTSAILNFPELAHQFPRPAS  124

Query  549  SQPEDVR  529
            + P DV+
Sbjct  125  TSPRDVQ  131



>ref|XP_003520876.1| PREDICTED: ethylene-responsive transcription factor ERF023-like 
[Glycine max]
Length=184

 Score =   100 bits (249),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 50/78 (64%), Positives = 58/78 (74%), Gaps = 0/78 (0%)
 Frame = -2

Query  729  WGKWVSEIREPGKKTRIWLGSFETPEMAAAAYDVAAFHLRGCKARLNFPELVEGFPKPAS  550
            WGKWVSEIREP KK RIWLGSF  PEMAA AYDVAA+ L+G KA+LNFP+ V+  P P+S
Sbjct  35   WGKWVSEIREPRKKNRIWLGSFPVPEMAARAYDVAAYCLKGRKAQLNFPDDVDSLPLPSS  94

Query  549  SQPEDVRLAAHQAAMGFK  496
                D++ AA QAA   K
Sbjct  95   RTARDIQTAAAQAARMMK  112



>gb|AAM63508.1| transcription factor TINY, putative [Arabidopsis thaliana]
Length=187

 Score =   100 bits (249),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 46/67 (69%), Positives = 55/67 (82%), Gaps = 0/67 (0%)
 Frame = -2

Query  729  WGKWVSEIREPGKKTRIWLGSFETPEMAAAAYDVAAFHLRGCKARLNFPELVEGFPKPAS  550
            WGKWVSEIREP KK+RIWLGSF  PEMAA AYDVAAF L+G KA+LNFPE +E  P+P++
Sbjct  48   WGKWVSEIREPRKKSRIWLGSFPVPEMAAKAYDVAAFCLKGRKAQLNFPEEIEDLPRPST  107

Query  549  SQPEDVR  529
              P D++
Sbjct  108  CTPRDIQ  114



>ref|XP_008353703.1| PREDICTED: ethylene-responsive transcription factor TINY-like 
[Malus domestica]
Length=243

 Score =   101 bits (252),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 46/67 (69%), Positives = 55/67 (82%), Gaps = 0/67 (0%)
 Frame = -2

Query  729  WGKWVSEIREPGKKTRIWLGSFETPEMAAAAYDVAAFHLRGCKARLNFPELVEGFPKPAS  550
            WGKWVSEIREP KK+RIWLG+F TPEMAA A+DVAA  ++G  A LNFPEL E  P+PAS
Sbjct  78   WGKWVSEIREPRKKSRIWLGTFSTPEMAARAHDVAALSIKGSSAILNFPELTELLPRPAS  137

Query  549  SQPEDVR  529
             +P+DV+
Sbjct  138  LKPQDVQ  144



>ref|XP_009377993.1| PREDICTED: ethylene-responsive transcription factor TINY-like 
[Pyrus x bretschneideri]
Length=241

 Score =   101 bits (251),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 46/67 (69%), Positives = 55/67 (82%), Gaps = 0/67 (0%)
 Frame = -2

Query  729  WGKWVSEIREPGKKTRIWLGSFETPEMAAAAYDVAAFHLRGCKARLNFPELVEGFPKPAS  550
            WGKWVSEIREP KK+RIWLG+F TPEMAA A+DVAA  ++G  A LNFPEL E  P+PAS
Sbjct  80   WGKWVSEIREPRKKSRIWLGTFSTPEMAARAHDVAALSIKGSSAILNFPELTELLPRPAS  139

Query  549  SQPEDVR  529
             +P+DV+
Sbjct  140  LKPQDVQ  146



>ref|XP_006345621.1| PREDICTED: ethylene-responsive transcription factor ERF023-like 
[Solanum tuberosum]
Length=178

 Score =   100 bits (248),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 50/78 (64%), Positives = 59/78 (76%), Gaps = 1/78 (1%)
 Frame = -2

Query  729  WGKWVSEIREPGKKTRIWLGSFETPEMAAAAYDVAAFHLRGCKARLNFPELVEGFPKPAS  550
            WGKWVSEIREP KK+RIWLGSF +PE AA AYDVAA+ L+G KA LNFP+ +E  P+P S
Sbjct  38   WGKWVSEIREPKKKSRIWLGSFISPETAARAYDVAAYCLKGSKAELNFPDEIERLPRPIS  97

Query  549  SQPEDVRLAAHQAA-MGF  499
            S   D++ AA  AA MG 
Sbjct  98   SGARDIQAAATMAANMGI  115



>ref|XP_009108829.1| PREDICTED: ethylene-responsive transcription factor ERF043-like 
[Brassica rapa]
Length=232

 Score =   101 bits (251),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 48/75 (64%), Positives = 57/75 (76%), Gaps = 0/75 (0%)
 Frame = -2

Query  729  WGKWVSEIREPGKKTRIWLGSFETPEMAAAAYDVAAFHLRGCKARLNFPELVEGFPKPAS  550
            WGKWVSEIREP KK+RIWLG+F T EMA  A+DVAA  ++G  A LNFPEL +  P+PAS
Sbjct  28   WGKWVSEIREPRKKSRIWLGTFPTAEMAMRAHDVAALSIKGTSAILNFPELSDVLPRPAS  87

Query  549  SQPEDVRLAAHQAAM  505
              P DVR AA +AA+
Sbjct  88   LSPRDVRAAATKAAL  102



>ref|XP_004136219.1| PREDICTED: ethylene-responsive transcription factor ERF043-like 
[Cucumis sativus]
 gb|KGN60322.1| AP2 domain class transcription factor [Cucumis sativus]
Length=227

 Score =   100 bits (250),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 49/79 (62%), Positives = 58/79 (73%), Gaps = 1/79 (1%)
 Frame = -2

Query  729  WGKWVSEIREPGKKTRIWLGSFETPEMAAAAYDVAAFHLRGCKARLNFPELVEGFPKPAS  550
            WGKWVSEIREP KK+RIWLG+F TPEMAA A+DVAA  ++G  A LNFPEL    P+P S
Sbjct  50   WGKWVSEIREPRKKSRIWLGTFPTPEMAARAHDVAALSIKGNSAILNFPELAHSLPRPVS  109

Query  549  SQPEDVRLAAHQAA-MGFK  496
              P D++ AA +AA M F 
Sbjct  110  FAPRDIQAAASKAAHMDFN  128



>ref|XP_010278525.1| PREDICTED: ethylene-responsive transcription factor ERF026-like 
[Nelumbo nucifera]
Length=187

 Score =   100 bits (248),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 52/83 (63%), Positives = 58/83 (70%), Gaps = 0/83 (0%)
 Frame = -2

Query  726  GKWVSEIREPGKKTRIWLGSFETPEMAAAAYDVAAFHLRGCKARLNFPELVEGFPKPASS  547
            GKWVSEIREP K TRIWLG+F TPEMAA AYDVAA  L+G  A LNFPE V  +P PAS+
Sbjct  31   GKWVSEIREPRKSTRIWLGTFPTPEMAATAYDVAALALKGSDAVLNFPETVSSYPIPASA  90

Query  546  QPEDVRLAAHQAAMGFKPPAEGV  478
             P D+R AA  AA    P  E +
Sbjct  91   SPSDIRAAAAAAAASRLPKTESI  113



>gb|KFK22266.1| hypothetical protein AALP_AAs66747U002200 [Arabis alpina]
Length=182

 Score =   100 bits (248),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 50/82 (61%), Positives = 63/82 (77%), Gaps = 0/82 (0%)
 Frame = -2

Query  729  WGKWVSEIREPGKKTRIWLGSFETPEMAAAAYDVAAFHLRGCKARLNFPELVEGFPKPAS  550
            WGKWVSEIREP KK+RIWLG+F TPEMAA A+DVAA  ++G  A LNFP+L    P+PAS
Sbjct  51   WGKWVSEIREPRKKSRIWLGTFSTPEMAARAHDVAALAIKGGSAHLNFPDLAYHLPRPAS  110

Query  549  SQPEDVRLAAHQAAMGFKPPAE  484
            + P+D++ AA  AA+ +K P E
Sbjct  111  ADPKDIQAAATAAAVDWKEPPE  132



>ref|XP_006340419.1| PREDICTED: ethylene-responsive transcription factor TINY-like, 
partial [Solanum tuberosum]
Length=180

 Score = 99.8 bits (247),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 46/74 (62%), Positives = 57/74 (77%), Gaps = 0/74 (0%)
 Frame = -2

Query  729  WGKWVSEIREPGKKTRIWLGSFETPEMAAAAYDVAAFHLRGCKARLNFPELVEGFPKPAS  550
            WGKWVSEIREP KK+RIWLG+F +PEMAA A+DVAA  ++G  A LNFP+L    P+PAS
Sbjct  19   WGKWVSEIREPRKKSRIWLGTFSSPEMAARAHDVAALSIKGTAAILNFPKLASYLPRPAS  78

Query  549  SQPEDVRLAAHQAA  508
              P D++ AA +AA
Sbjct  79   LSPRDIQAAATKAA  92



>ref|XP_002991657.1| hypothetical protein SELMODRAFT_71659, partial [Selaginella moellendorffii]
 gb|EFJ07228.1| hypothetical protein SELMODRAFT_71659, partial [Selaginella moellendorffii]
Length=161

 Score = 99.4 bits (246),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 49/78 (63%), Positives = 56/78 (72%), Gaps = 0/78 (0%)
 Frame = -2

Query  729  WGKWVSEIREPGKKTRIWLGSFETPEMAAAAYDVAAFHLRGCKARLNFPELVEGFPKPAS  550
            WGKWVSEIREP KK RIWLGSF TPEMAA A+DVAA  LRG  A LNFP+ V   P+P  
Sbjct  13   WGKWVSEIREPKKKNRIWLGSFPTPEMAARAHDVAALCLRGEDAHLNFPDSVHTLPRPER  72

Query  549  SQPEDVRLAAHQAAMGFK  496
              P+ ++ AA  AAM F+
Sbjct  73   LSPKCIQEAATSAAMSFQ  90



>emb|CDX72373.1| BnaC07g43950D [Brassica napus]
Length=228

 Score =   100 bits (250),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 48/75 (64%), Positives = 56/75 (75%), Gaps = 0/75 (0%)
 Frame = -2

Query  729  WGKWVSEIREPGKKTRIWLGSFETPEMAAAAYDVAAFHLRGCKARLNFPELVEGFPKPAS  550
            WGKWVSEIREP KK+RIWLG+F T EMA  A+DVAA  ++G  A LNFPEL    P+PAS
Sbjct  29   WGKWVSEIREPRKKSRIWLGTFPTAEMAMRAHDVAALSIKGTSAILNFPELSNSLPRPAS  88

Query  549  SQPEDVRLAAHQAAM  505
              P DVR AA +AA+
Sbjct  89   LSPRDVRAAATKAAL  103



>ref|XP_009782186.1| PREDICTED: ethylene-responsive transcription factor TINY-like 
[Nicotiana sylvestris]
Length=300

 Score =   102 bits (253),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 51/86 (59%), Positives = 62/86 (72%), Gaps = 1/86 (1%)
 Frame = -2

Query  729  WGKWVSEIREPGKKTRIWLGSFETPEMAAAAYDVAAFHLRGCKARLNFPELVEGFPKPAS  550
            WGKWVSEIREP KK+RIWLG+F TPEMAA A+DVAA  ++G  A LNFP+L +  P+PA+
Sbjct  89   WGKWVSEIREPKKKSRIWLGTFATPEMAARAHDVAAMSIKGGSAILNFPQLADLLPRPAT  148

Query  549  SQPEDVRLAAHQAA-MGFKPPAEGVP  475
              P DV+ AA +AA M    P E  P
Sbjct  149  CSPRDVQAAALKAAHMDHLNPTESSP  174



>ref|XP_004162335.1| PREDICTED: ethylene-responsive transcription factor ERF034-like 
[Cucumis sativus]
Length=214

 Score =   100 bits (249),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 46/67 (69%), Positives = 54/67 (81%), Gaps = 0/67 (0%)
 Frame = -2

Query  729  WGKWVSEIREPGKKTRIWLGSFETPEMAAAAYDVAAFHLRGCKARLNFPELVEGFPKPAS  550
            WGKWVSEIREP KK+RIWLG+F TPEMAA A+DVAA  ++G  A LNFPEL    P+PAS
Sbjct  52   WGKWVSEIREPKKKSRIWLGTFSTPEMAARAHDVAAKTIKGHSAYLNFPELAHRLPRPAS  111

Query  549  SQPEDVR  529
            S P+D+R
Sbjct  112  SSPKDIR  118



>gb|AES87852.2| DNA-binding domain protein [Medicago truncatula]
Length=222

 Score =   100 bits (249),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 48/74 (65%), Positives = 57/74 (77%), Gaps = 0/74 (0%)
 Frame = -2

Query  729  WGKWVSEIREPGKKTRIWLGSFETPEMAAAAYDVAAFHLRGCKARLNFPELVEGFPKPAS  550
            WG++VSEIR PG+KTRIWLGSFE+ EMAA AYD AAF L+G  A LNFPE VE  P+P S
Sbjct  40   WGRYVSEIRLPGQKTRIWLGSFESAEMAARAYDSAAFFLKGNSASLNFPEEVEFLPRPLS  99

Query  549  SQPEDVRLAAHQAA  508
            S   D++ AA +AA
Sbjct  100  SSRRDIQSAASKAA  113



>emb|CDY45018.1| BnaA08g12010D [Brassica napus]
Length=222

 Score =   100 bits (249),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 48/75 (64%), Positives = 57/75 (76%), Gaps = 0/75 (0%)
 Frame = -2

Query  729  WGKWVSEIREPGKKTRIWLGSFETPEMAAAAYDVAAFHLRGCKARLNFPELVEGFPKPAS  550
            WGKWVSEIREP KK+RIWLG+F T EMA  A+DVAA  ++G  A LNFPEL +  P+PAS
Sbjct  28   WGKWVSEIREPRKKSRIWLGTFPTAEMAMRAHDVAALSIKGTSAILNFPELSDVLPRPAS  87

Query  549  SQPEDVRLAAHQAAM  505
              P DVR AA +AA+
Sbjct  88   LSPRDVRAAATKAAL  102



>ref|XP_009400894.1| PREDICTED: ethylene-responsive transcription factor ERF039-like 
[Musa acuminata subsp. malaccensis]
Length=244

 Score =   100 bits (250),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 48/77 (62%), Positives = 59/77 (77%), Gaps = 0/77 (0%)
 Frame = -2

Query  729  WGKWVSEIREPGKKTRIWLGSFETPEMAAAAYDVAAFHLRGCKARLNFPELVEGFPKPAS  550
            WGKWVSEIREP KK+RIWLG+F T EMAA A+DVAA  ++G  A LNFPEL    P+PAS
Sbjct  86   WGKWVSEIREPRKKSRIWLGTFPTAEMAARAHDVAALTIKGQSAHLNFPELTAQLPRPAS  145

Query  549  SQPEDVRLAAHQAAMGF  499
            + P+D++ AA  AA+ F
Sbjct  146  ASPKDIQAAAMLAAVTF  162



>ref|XP_008448820.1| PREDICTED: ethylene-responsive transcription factor ERF039 [Cucumis 
melo]
Length=214

 Score =   100 bits (248),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 46/67 (69%), Positives = 54/67 (81%), Gaps = 0/67 (0%)
 Frame = -2

Query  729  WGKWVSEIREPGKKTRIWLGSFETPEMAAAAYDVAAFHLRGCKARLNFPELVEGFPKPAS  550
            WGKWVSEIREP KK+RIWLG+F TPEMAA A+DVAA  ++G  A LNFPEL    P+PAS
Sbjct  52   WGKWVSEIREPKKKSRIWLGTFSTPEMAARAHDVAAKTIKGHSAYLNFPELAHRLPRPAS  111

Query  549  SQPEDVR  529
            S P+D+R
Sbjct  112  SSPKDIR  118



>ref|NP_197953.1| ethylene-responsive transcription factor TINY [Arabidopsis thaliana]
 sp|Q39127.1|TINY_ARATH RecName: Full=Ethylene-responsive transcription factor TINY [Arabidopsis 
thaliana]
 emb|CAA64359.1| TINY [Arabidopsis thaliana]
 gb|AAC29139.1| TINY [Arabidopsis thaliana]
 gb|AAT44922.1| putative AP2/EREBP transcription factor [Arabidopsis thaliana]
 gb|ABD94079.1| At5g25810 [Arabidopsis thaliana]
 gb|AED93490.1| ethylene-responsive transcription factor TINY [Arabidopsis thaliana]
Length=218

 Score =   100 bits (248),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 46/74 (62%), Positives = 59/74 (80%), Gaps = 0/74 (0%)
 Frame = -2

Query  729  WGKWVSEIREPGKKTRIWLGSFETPEMAAAAYDVAAFHLRGCKARLNFPELVEGFPKPAS  550
            WGKWVSEIREP KK+RIWLG+F +PEMAA A+DVAA  ++G  A LNFP+L   FP+P+S
Sbjct  44   WGKWVSEIREPRKKSRIWLGTFPSPEMAARAHDVAALSIKGASAILNFPDLAGSFPRPSS  103

Query  549  SQPEDVRLAAHQAA  508
              P D+++AA +AA
Sbjct  104  LSPRDIQVAALKAA  117



>ref|XP_010049108.1| PREDICTED: ethylene-responsive transcription factor TINY-like 
[Eucalyptus grandis]
 gb|KCW81571.1| hypothetical protein EUGRSUZ_C02928 [Eucalyptus grandis]
Length=258

 Score =   100 bits (250),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 48/74 (65%), Positives = 56/74 (76%), Gaps = 0/74 (0%)
 Frame = -2

Query  729  WGKWVSEIREPGKKTRIWLGSFETPEMAAAAYDVAAFHLRGCKARLNFPELVEGFPKPAS  550
            WGKWVSEIREP KK+RIWLG+F TPEMAA A+DVAA H++G  A LNFP L    P+P+S
Sbjct  66   WGKWVSEIREPRKKSRIWLGTFPTPEMAARAHDVAALHIKGSSAFLNFPHLAASLPRPSS  125

Query  549  SQPEDVRLAAHQAA  508
              P DV+ AA  AA
Sbjct  126  LSPRDVQAAASLAA  139



>gb|KCW79144.1| hypothetical protein EUGRSUZ_C00590 [Eucalyptus grandis]
Length=166

 Score = 99.0 bits (245),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 48/74 (65%), Positives = 57/74 (77%), Gaps = 0/74 (0%)
 Frame = -2

Query  729  WGKWVSEIREPGKKTRIWLGSFETPEMAAAAYDVAAFHLRGCKARLNFPELVEGFPKPAS  550
            WGKWVSEIREP KK+RIWLG+F TPEMAA A+DVAA  ++G  A LNFPEL+   P+P S
Sbjct  4    WGKWVSEIREPRKKSRIWLGTFPTPEMAARAHDVAALSIKGSSAILNFPELIGLLPRPIS  63

Query  549  SQPEDVRLAAHQAA  508
              P DV+ AA +AA
Sbjct  64   LSPRDVQAAALKAA  77



>ref|XP_006394830.1| hypothetical protein EUTSA_v10004870mg [Eutrema salsugineum]
 gb|ESQ32116.1| hypothetical protein EUTSA_v10004870mg [Eutrema salsugineum]
Length=228

 Score =   100 bits (248),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 46/74 (62%), Positives = 59/74 (80%), Gaps = 0/74 (0%)
 Frame = -2

Query  729  WGKWVSEIREPGKKTRIWLGSFETPEMAAAAYDVAAFHLRGCKARLNFPELVEGFPKPAS  550
            WGKWVSEIREP KK+RIWLG+F +PEMAA A+DVAA  ++G  A LNFP+L   FP+P+S
Sbjct  46   WGKWVSEIREPRKKSRIWLGTFPSPEMAARAHDVAALSIKGTSAILNFPDLAGSFPRPSS  105

Query  549  SQPEDVRLAAHQAA  508
              P+D++ AA +AA
Sbjct  106  LSPQDIQAAALKAA  119



>emb|CDY35334.1| BnaA04g15130D [Brassica napus]
Length=203

 Score = 99.8 bits (247),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 49/82 (60%), Positives = 59/82 (72%), Gaps = 1/82 (1%)
 Frame = -2

Query  729  WGKWVSEIREPGKKTRIWLGSFETPEMAAAAYDVAAFHLRGCKARLNFPELVEGFPKPAS  550
            WGKWVSEIREP KK+RIWLG+F T EMAA A+DVA   ++G  A LNFPEL    P+P S
Sbjct  33   WGKWVSEIREPRKKSRIWLGTFPTAEMAARAHDVAELSIKGSSAILNFPELSNSLPRPVS  92

Query  549  SQPEDVRLAAHQAA-MGFKPPA  487
              P D++ AA +AA M FK P+
Sbjct  93   LSPADIQAAATKAAFMEFKTPS  114



>ref|XP_010421439.1| PREDICTED: ethylene-responsive transcription factor TINY-like 
[Camelina sativa]
Length=225

 Score =   100 bits (248),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 46/74 (62%), Positives = 58/74 (78%), Gaps = 0/74 (0%)
 Frame = -2

Query  729  WGKWVSEIREPGKKTRIWLGSFETPEMAAAAYDVAAFHLRGCKARLNFPELVEGFPKPAS  550
            WGKWVSEIREP KK+RIWLG+F +PEMAA A+DVAA  ++G  A LNFP+L   FP+P+S
Sbjct  43   WGKWVSEIREPRKKSRIWLGTFPSPEMAARAHDVAALSIKGASAILNFPDLAGSFPRPSS  102

Query  549  SQPEDVRLAAHQAA  508
              P D++ AA +AA
Sbjct  103  LSPRDIQAAALKAA  116



>ref|XP_010454922.1| PREDICTED: ethylene-responsive transcription factor TINY-like 
[Camelina sativa]
Length=226

 Score =   100 bits (248),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 46/74 (62%), Positives = 58/74 (78%), Gaps = 0/74 (0%)
 Frame = -2

Query  729  WGKWVSEIREPGKKTRIWLGSFETPEMAAAAYDVAAFHLRGCKARLNFPELVEGFPKPAS  550
            WGKWVSEIREP KK+RIWLG+F +PEMAA A+DVAA  ++G  A LNFP+L   FP+P+S
Sbjct  43   WGKWVSEIREPRKKSRIWLGTFPSPEMAARAHDVAALSIKGASAILNFPDLAGSFPRPSS  102

Query  549  SQPEDVRLAAHQAA  508
              P D++ AA +AA
Sbjct  103  LSPRDIQAAALKAA  116



>ref|XP_006371370.1| hypothetical protein POPTR_0019s09530g, partial [Populus trichocarpa]
 gb|ERP49167.1| hypothetical protein POPTR_0019s09530g, partial [Populus trichocarpa]
Length=233

 Score =   100 bits (248),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 47/77 (61%), Positives = 59/77 (77%), Gaps = 0/77 (0%)
 Frame = -2

Query  729  WGKWVSEIREPGKKTRIWLGSFETPEMAAAAYDVAAFHLRGCKARLNFPELVEGFPKPAS  550
            WG++VSEIR PGKKTR+WLGSF +PEMAA A+D AAF L+G  A LNFP+ V   P+P S
Sbjct  84   WGRYVSEIRLPGKKTRVWLGSFGSPEMAARAHDSAAFFLKGNSACLNFPDSVGSLPRPKS  143

Query  549  SQPEDVRLAAHQAAMGF  499
               +D++LAA +AA GF
Sbjct  144  CSSKDIQLAAAKAATGF  160



>ref|XP_006412430.1| hypothetical protein EUTSA_v10026204mg [Eutrema salsugineum]
 gb|ESQ53883.1| hypothetical protein EUTSA_v10026204mg [Eutrema salsugineum]
Length=217

 Score = 99.8 bits (247),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 49/75 (65%), Positives = 56/75 (75%), Gaps = 0/75 (0%)
 Frame = -2

Query  729  WGKWVSEIREPGKKTRIWLGSFETPEMAAAAYDVAAFHLRGCKARLNFPELVEGFPKPAS  550
            WGKWVSEIREP KK+RIWLG+F T EMA  A+DVAA  ++G  A LNFPEL E  P+PAS
Sbjct  28   WGKWVSEIREPRKKSRIWLGTFPTAEMAMRAHDVAALSIKGTSAILNFPELSEFLPRPAS  87

Query  549  SQPEDVRLAAHQAAM  505
              P DVR AA +AA 
Sbjct  88   LSPRDVRAAATKAAF  102



>ref|XP_009353569.1| PREDICTED: ethylene-responsive transcription factor TINY [Pyrus 
x bretschneideri]
Length=241

 Score =   100 bits (248),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 45/67 (67%), Positives = 55/67 (82%), Gaps = 0/67 (0%)
 Frame = -2

Query  729  WGKWVSEIREPGKKTRIWLGSFETPEMAAAAYDVAAFHLRGCKARLNFPELVEGFPKPAS  550
            WGKWVSEIREP KK+RIWLG+F TPEMAA A+DVAA  ++G  A LNFPEL E  P+PAS
Sbjct  77   WGKWVSEIREPRKKSRIWLGTFSTPEMAARAHDVAALSIKGNSAILNFPELTELLPRPAS  136

Query  549  SQPEDVR  529
             +P+D++
Sbjct  137  LKPQDIQ  143



>ref|XP_009367456.1| PREDICTED: ethylene-responsive transcription factor TINY-like 
[Pyrus x bretschneideri]
Length=245

 Score =   100 bits (248),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 48/74 (65%), Positives = 58/74 (78%), Gaps = 0/74 (0%)
 Frame = -2

Query  729  WGKWVSEIREPGKKTRIWLGSFETPEMAAAAYDVAAFHLRGCKARLNFPELVEGFPKPAS  550
            WGKWVSEIREP KK+RIWLG+F TPEMAA A+DVAA  ++G  A LNFPEL +  P+P S
Sbjct  74   WGKWVSEIREPRKKSRIWLGTFPTPEMAARAHDVAALSIKGNSAILNFPELSDLLPRPVS  133

Query  549  SQPEDVRLAAHQAA  508
            + P DV+ AA +AA
Sbjct  134  NAPRDVQAAASKAA  147



>ref|XP_008228463.1| PREDICTED: ethylene-responsive transcription factor TINY [Prunus 
mume]
Length=251

 Score =   100 bits (249),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 46/67 (69%), Positives = 55/67 (82%), Gaps = 0/67 (0%)
 Frame = -2

Query  729  WGKWVSEIREPGKKTRIWLGSFETPEMAAAAYDVAAFHLRGCKARLNFPELVEGFPKPAS  550
            WGKWVSEIREP KK+RIWLG+F TPEMAA A+DVAA  ++G  A LNFPEL E  P+PAS
Sbjct  86   WGKWVSEIREPRKKSRIWLGTFSTPEMAARAHDVAALSIKGNSAILNFPELAELLPRPAS  145

Query  549  SQPEDVR  529
             +P+DV+
Sbjct  146  LKPQDVQ  152



>ref|XP_010493837.1| PREDICTED: ethylene-responsive transcription factor TINY-like 
[Camelina sativa]
Length=225

 Score = 99.8 bits (247),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 46/74 (62%), Positives = 58/74 (78%), Gaps = 0/74 (0%)
 Frame = -2

Query  729  WGKWVSEIREPGKKTRIWLGSFETPEMAAAAYDVAAFHLRGCKARLNFPELVEGFPKPAS  550
            WGKWVSEIREP KK+RIWLG+F +PEMAA A+DVAA  ++G  A LNFP+L   FP+P+S
Sbjct  43   WGKWVSEIREPRKKSRIWLGTFPSPEMAARAHDVAALSIKGASAILNFPDLAGSFPRPSS  102

Query  549  SQPEDVRLAAHQAA  508
              P D++ AA +AA
Sbjct  103  LSPRDIQAAALKAA  116



>ref|XP_010538410.1| PREDICTED: ethylene-responsive transcription factor ERF039-like 
[Tarenaya hassleriana]
Length=187

 Score = 99.0 bits (245),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 45/67 (67%), Positives = 54/67 (81%), Gaps = 0/67 (0%)
 Frame = -2

Query  729  WGKWVSEIREPGKKTRIWLGSFETPEMAAAAYDVAAFHLRGCKARLNFPELVEGFPKPAS  550
            WGKWVSEIREP KK+RIWLG+F TPEMAA A+DVAA  ++G  A LNFPEL    P+P+S
Sbjct  54   WGKWVSEIREPRKKSRIWLGTFSTPEMAARAHDVAALAIKGGGAHLNFPELACHLPRPSS  113

Query  549  SQPEDVR  529
            S P+D+R
Sbjct  114  SDPKDIR  120



>ref|XP_006294983.1| hypothetical protein CARUB_v10024051mg [Capsella rubella]
 gb|EOA27881.1| hypothetical protein CARUB_v10024051mg [Capsella rubella]
Length=213

 Score = 99.8 bits (247),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 47/75 (63%), Positives = 58/75 (77%), Gaps = 0/75 (0%)
 Frame = -2

Query  729  WGKWVSEIREPGKKTRIWLGSFETPEMAAAAYDVAAFHLRGCKARLNFPELVEGFPKPAS  550
            WGKWVSEIREP KK+RIWLG+F T EMAA A+DVAA  ++G  A LNFPEL E  P+P S
Sbjct  35   WGKWVSEIREPRKKSRIWLGTFPTAEMAARAHDVAALSIKGNSAILNFPELAEFLPRPIS  94

Query  549  SQPEDVRLAAHQAAM  505
              P+D++ AA +AA+
Sbjct  95   MSPQDIQAAATKAAL  109



>ref|XP_002263994.1| PREDICTED: ethylene-responsive transcription factor ERF023 [Vitis 
vinifera]
Length=207

 Score = 99.4 bits (246),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 46/67 (69%), Positives = 55/67 (82%), Gaps = 0/67 (0%)
 Frame = -2

Query  729  WGKWVSEIREPGKKTRIWLGSFETPEMAAAAYDVAAFHLRGCKARLNFPELVEGFPKPAS  550
            WGKWVSEIREP KK+RIWLGSF  PEMAA AYDVAA+HL+G KA+LNFP+ VE  P+P+S
Sbjct  54   WGKWVSEIREPRKKSRIWLGSFPVPEMAARAYDVAAYHLKGRKAQLNFPDEVELLPRPSS  113

Query  549  SQPEDVR  529
                D++
Sbjct  114  CTARDIQ  120



>gb|EYU27280.1| hypothetical protein MIMGU_mgv1a026082mg [Erythranthe guttata]
Length=145

 Score = 97.8 bits (242),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 49/76 (64%), Positives = 59/76 (78%), Gaps = 1/76 (1%)
 Frame = -2

Query  729  WGKWVSEIREPGKKTRIWLGSFETPEMAAAAYDVAAFHLRGC-KARLNFPELVEGFPKPA  553
            WGKWVSEIREP KK+RIWLG+F TPEMAA A+DVAA  ++G   A LNFPEL    P+PA
Sbjct  28   WGKWVSEIREPKKKSRIWLGTFATPEMAARAHDVAALAIKGGDSAILNFPELSHLLPRPA  87

Query  552  SSQPEDVRLAAHQAAM  505
            +  P DVR AA++AA+
Sbjct  88   TCSPRDVRDAANKAAL  103



>ref|XP_009801170.1| PREDICTED: dehydration-responsive element-binding protein 3 [Nicotiana 
sylvestris]
Length=194

 Score = 99.0 bits (245),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 46/74 (62%), Positives = 55/74 (74%), Gaps = 0/74 (0%)
 Frame = -2

Query  729  WGKWVSEIREPGKKTRIWLGSFETPEMAAAAYDVAAFHLRGCKARLNFPELVEGFPKPAS  550
            WGKWVSEIREPGKK+RIWLG+F TPEMAA A+DVAA  ++G    LNFPEL    P+P S
Sbjct  26   WGKWVSEIREPGKKSRIWLGTFPTPEMAARAHDVAALAIKGNGVTLNFPELANSLPRPVS  85

Query  549  SQPEDVRLAAHQAA  508
                D++ AA +AA
Sbjct  86   LNARDIQAAATKAA  99



>ref|XP_009151103.1| PREDICTED: ethylene-responsive transcription factor TINY [Brassica 
rapa]
 emb|CDX88199.1| BnaA06g27900D [Brassica napus]
Length=224

 Score = 99.8 bits (247),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 46/74 (62%), Positives = 58/74 (78%), Gaps = 0/74 (0%)
 Frame = -2

Query  729  WGKWVSEIREPGKKTRIWLGSFETPEMAAAAYDVAAFHLRGCKARLNFPELVEGFPKPAS  550
            WGKWVSEIREP KK+RIWLG+F +PEMAA A+DVAA  ++G  A LNFP+L   FP+P+S
Sbjct  45   WGKWVSEIREPRKKSRIWLGTFPSPEMAARAHDVAALSIKGASAILNFPDLAGSFPRPSS  104

Query  549  SQPEDVRLAAHQAA  508
              P D++ AA +AA
Sbjct  105  LSPRDIQAAALKAA  118



>ref|XP_008220077.1| PREDICTED: dehydration-responsive element-binding protein 3-like 
[Prunus mume]
Length=258

 Score =   100 bits (249),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 48/75 (64%), Positives = 57/75 (76%), Gaps = 0/75 (0%)
 Frame = -2

Query  729  WGKWVSEIREPGKKTRIWLGSFETPEMAAAAYDVAAFHLRGCKARLNFPELVEGFPKPAS  550
            WGKWVSEIREP KK+RIWLG+F TPEMAA A+DVAA  ++G  A LNFPEL +  P+P S
Sbjct  77   WGKWVSEIREPRKKSRIWLGTFPTPEMAARAHDVAALSIKGNSAILNFPELSDSLPRPVS  136

Query  549  SQPEDVRLAAHQAAM  505
              P DV+ AA +AA 
Sbjct  137  LAPRDVQAAASKAAQ  151



>ref|XP_002889375.1| hypothetical protein ARALYDRAFT_470149 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH65634.1| hypothetical protein ARALYDRAFT_470149 [Arabidopsis lyrata subsp. 
lyrata]
Length=186

 Score = 99.0 bits (245),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 44/67 (66%), Positives = 55/67 (82%), Gaps = 0/67 (0%)
 Frame = -2

Query  729  WGKWVSEIREPGKKTRIWLGSFETPEMAAAAYDVAAFHLRGCKARLNFPELVEGFPKPAS  550
            WGKWVSEIREP KK+RIWLGSF  PEMAA AYDVAAF L+G KA+LNFP+ ++  P+P++
Sbjct  47   WGKWVSEIREPRKKSRIWLGSFPVPEMAAKAYDVAAFCLKGRKAQLNFPDEIDDLPRPST  106

Query  549  SQPEDVR  529
              P D++
Sbjct  107  CTPRDIQ  113



>ref|XP_010660384.1| PREDICTED: ethylene-responsive transcription factor ERF038-like 
[Vitis vinifera]
Length=236

 Score = 99.8 bits (247),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 53/122 (43%), Positives = 76/122 (62%), Gaps = 3/122 (2%)
 Frame = -2

Query  729  WGKWVSEIREPGKKTRIWLGSFETPEMAAAAYDVAAFHLRGCKARLNFPELVEGFPKPAS  550
            WGKWVSEIREP K ++IWLG+F   EMAA A+DVA+  L+G  A LNFPEL +G P+P +
Sbjct  81   WGKWVSEIREPKKNSKIWLGTFPNAEMAALAHDVASLSLKGHTAYLNFPELAQGLPRPTT  140

Query  549  SQPEDVRLAAHQAAMGFKPPAEGVPGAGLR-PVRIG--LSPNQIQAINETPMDSPNKMWM  379
            + P+D+R AA +AA    P +     A L  P   G  +  N +Q  + +P+   +  ++
Sbjct  141  ASPKDIRAAAVKAATLHYPRSHEPHQAALMGPYSSGPSVRSNILQESSTSPITEDDDAFL  200

Query  378  EL  373
            +L
Sbjct  201  DL  202



>ref|XP_006289163.1| hypothetical protein CARUB_v10002601mg [Capsella rubella]
 gb|EOA22061.1| hypothetical protein CARUB_v10002601mg [Capsella rubella]
Length=226

 Score = 99.8 bits (247),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 46/74 (62%), Positives = 58/74 (78%), Gaps = 0/74 (0%)
 Frame = -2

Query  729  WGKWVSEIREPGKKTRIWLGSFETPEMAAAAYDVAAFHLRGCKARLNFPELVEGFPKPAS  550
            WGKWVSEIREP KK+RIWLG+F +PEMAA A+DVAA  ++G  A LNFP+L   FP+P+S
Sbjct  43   WGKWVSEIREPRKKSRIWLGTFPSPEMAARAHDVAALSIKGASAILNFPDLAVSFPRPSS  102

Query  549  SQPEDVRLAAHQAA  508
              P D++ AA +AA
Sbjct  103  LSPRDIQAAALKAA  116



>gb|KCW79102.1| hypothetical protein EUGRSUZ_C00546 [Eucalyptus grandis]
Length=239

 Score = 99.8 bits (247),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 48/74 (65%), Positives = 57/74 (77%), Gaps = 0/74 (0%)
 Frame = -2

Query  729  WGKWVSEIREPGKKTRIWLGSFETPEMAAAAYDVAAFHLRGCKARLNFPELVEGFPKPAS  550
            WGKWVSEIREP KK+RIWLG+F TPEMAA A+DVAA  ++G  A LNFPEL+   P+P S
Sbjct  77   WGKWVSEIREPRKKSRIWLGTFPTPEMAARAHDVAALSIKGSSAILNFPELISLLPRPIS  136

Query  549  SQPEDVRLAAHQAA  508
              P DV+ AA +AA
Sbjct  137  LSPRDVQAAALKAA  150



>ref|XP_008348502.1| PREDICTED: ethylene-responsive transcription factor TINY-like 
[Malus domestica]
 gb|ADE41102.1| AP2 domain class transcription factor [Malus domestica]
Length=241

 Score =   100 bits (248),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 45/67 (67%), Positives = 54/67 (81%), Gaps = 0/67 (0%)
 Frame = -2

Query  729  WGKWVSEIREPGKKTRIWLGSFETPEMAAAAYDVAAFHLRGCKARLNFPELVEGFPKPAS  550
            WGKWVSEIREP KK+RIWLG+F TPEMAA A+DVAA  ++G  A LNFPEL E  P+PAS
Sbjct  77   WGKWVSEIREPRKKSRIWLGTFSTPEMAARAHDVAALSIKGNSAILNFPELTELLPRPAS  136

Query  549  SQPEDVR  529
              P+D++
Sbjct  137  LTPQDIQ  143



>ref|XP_010447343.1| PREDICTED: ethylene-responsive transcription factor ERF043-like 
[Camelina sativa]
Length=234

 Score = 99.8 bits (247),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 50/78 (64%), Positives = 57/78 (73%), Gaps = 1/78 (1%)
 Frame = -2

Query  729  WGKWVSEIREPGKKTRIWLGSFETPEMAAAAYDVAAFHLRGCKARLNFPELVEGFPKPAS  550
            WGKWVSEIREP KK+RIWLG+F T EMA  A+DVAA  ++G  A LNFPEL +  PKP S
Sbjct  27   WGKWVSEIREPRKKSRIWLGTFPTAEMAMRAHDVAAMSIKGTSAILNFPELSDFLPKPVS  86

Query  549  SQPEDVRLAAHQAA-MGF  499
              P DVR AA +AA M F
Sbjct  87   LSPRDVRAAATKAAFMDF  104



>ref|XP_006836818.1| hypothetical protein AMTR_s00099p00039760 [Amborella trichopoda]
 gb|ERM99671.1| hypothetical protein AMTR_s00099p00039760 [Amborella trichopoda]
Length=201

 Score = 99.0 bits (245),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 67/134 (50%), Positives = 80/134 (60%), Gaps = 4/134 (3%)
 Frame = -2

Query  729  WGKWVSEIREPGKKTRIWLGSFETPEMAAAAYDVAAFHLRGCKARLNFPELVEGFPKPAS  550
            WGKWVSEIREPGKK+RIWLGSFETPEMAA+AYD AA  L+G  ARLNFPE  +  PKP +
Sbjct  52   WGKWVSEIREPGKKSRIWLGSFETPEMAASAYDAAALSLKGRSARLNFPEFADKLPKPLT  111

Query  549  SQPEDVRLAAHQAAMGFKPPAEGVPGAGLRPVRIGLSPNQI-QAINETPMDSPNKMWMEL  373
              P+D+R  A +AA       E        P    +    I Q   E P+ SP  MW +L
Sbjct  112  KDPKDIRSVALEAARSKSREKELSGENQSFPASFPVIQAPINQYSGEFPVGSPG-MWSDL  170

Query  372  AATTLLLREPPLMI  331
            A   LL   PP+ +
Sbjct  171  AEALLL--SPPVFV  182



>ref|XP_008354031.1| PREDICTED: ethylene-responsive transcription factor ERF023-like 
[Malus domestica]
Length=186

 Score = 98.6 bits (244),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 46/66 (70%), Positives = 54/66 (82%), Gaps = 0/66 (0%)
 Frame = -2

Query  729  WGKWVSEIREPGKKTRIWLGSFETPEMAAAAYDVAAFHLRGCKARLNFPELVEGFPKPAS  550
            WGKWVSEIREP KK+RIWLGSF  PEMAA AYDVAA+ L+G KA+LNFPE V+  P+PA+
Sbjct  41   WGKWVSEIREPRKKSRIWLGSFPVPEMAAKAYDVAAYCLKGRKAQLNFPEDVDHLPRPAT  100

Query  549  SQPEDV  532
            S   D+
Sbjct  101  STARDI  106



>ref|XP_010696241.1| PREDICTED: ethylene-responsive transcription factor ERF023 [Beta 
vulgaris subsp. vulgaris]
Length=183

 Score = 98.6 bits (244),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 46/67 (69%), Positives = 53/67 (79%), Gaps = 0/67 (0%)
 Frame = -2

Query  729  WGKWVSEIREPGKKTRIWLGSFETPEMAAAAYDVAAFHLRGCKARLNFPELVEGFPKPAS  550
            WGKWVSEIREP KKTRIWLGSF  PEMAA AYDVAA  L+GCKA+LNFP  ++  P+P S
Sbjct  47   WGKWVSEIREPRKKTRIWLGSFPIPEMAARAYDVAAHCLKGCKAQLNFPGEIDFLPRPIS  106

Query  549  SQPEDVR  529
              P D++
Sbjct  107  CSPRDIQ  113



>gb|AFG61639.1| hypothetical protein 0_14481_01, partial [Pinus taeda]
 gb|AFG61641.1| hypothetical protein 0_14481_01, partial [Pinus taeda]
 gb|AFG61642.1| hypothetical protein 0_14481_01, partial [Pinus taeda]
 gb|AFG61643.1| hypothetical protein 0_14481_01, partial [Pinus taeda]
 gb|AFG61644.1| hypothetical protein 0_14481_01, partial [Pinus taeda]
 gb|AFG61645.1| hypothetical protein 0_14481_01, partial [Pinus taeda]
 gb|AFG61646.1| hypothetical protein 0_14481_01, partial [Pinus taeda]
 gb|AFG61647.1| hypothetical protein 0_14481_01, partial [Pinus taeda]
 gb|AFG61649.1| hypothetical protein 0_14481_01, partial [Pinus taeda]
 gb|AFG61650.1| hypothetical protein 0_14481_01, partial [Pinus taeda]
 gb|AFG61651.1| hypothetical protein 0_14481_01, partial [Pinus taeda]
Length=151

 Score = 97.8 bits (242),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 48/82 (59%), Positives = 61/82 (74%), Gaps = 0/82 (0%)
 Frame = -2

Query  729  WGKWVSEIREPGKKTRIWLGSFETPEMAAAAYDVAAFHLRGCKARLNFPELVEGFPKPAS  550
            WGKWVSEIREP KK+RIWLG+F TPEMAA A+DVAA  ++G  A LNFP++    P+PA+
Sbjct  6    WGKWVSEIREPKKKSRIWLGTFPTPEMAARAHDVAALSIKGKSAFLNFPQIASSLPRPAT  65

Query  549  SQPEDVRLAAHQAAMGFKPPAE  484
              P+D++ AA  AA  F  P+E
Sbjct  66   LSPKDIQAAAAVAAAEFHMPSE  87



>ref|XP_002878890.1| transcription factor [Arabidopsis lyrata subsp. lyrata]
 gb|EFH55149.1| transcription factor [Arabidopsis lyrata subsp. lyrata]
Length=219

 Score = 99.4 bits (246),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 46/75 (61%), Positives = 57/75 (76%), Gaps = 0/75 (0%)
 Frame = -2

Query  729  WGKWVSEIREPGKKTRIWLGSFETPEMAAAAYDVAAFHLRGCKARLNFPELVEGFPKPAS  550
            WGKWVSEIREP KK+RIWLG+F T EMAA A+DVAA  ++G  A LNFPEL +  P+P S
Sbjct  35   WGKWVSEIREPSKKSRIWLGTFPTAEMAARAHDVAALSIKGSSAILNFPELADFLPRPVS  94

Query  549  SQPEDVRLAAHQAAM  505
               +D++ AA +AAM
Sbjct  95   LSQQDIQAAATKAAM  109



>ref|XP_010266557.1| PREDICTED: ethylene-responsive transcription factor ERF023-like 
[Nelumbo nucifera]
Length=187

 Score = 98.6 bits (244),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 47/67 (70%), Positives = 54/67 (81%), Gaps = 0/67 (0%)
 Frame = -2

Query  729  WGKWVSEIREPGKKTRIWLGSFETPEMAAAAYDVAAFHLRGCKARLNFPELVEGFPKPAS  550
            WGKWVSEIREP KK+RIWLGSF TPEMAA AYDVAA+ LRG KA LNFPE VE  P+P++
Sbjct  45   WGKWVSEIREPRKKSRIWLGSFPTPEMAARAYDVAAYCLRGHKALLNFPEEVELLPRPST  104

Query  549  SQPEDVR  529
                D++
Sbjct  105  CTARDIQ  111



>ref|XP_010324621.1| PREDICTED: dehydration-responsive element-binding protein 1E-like 
[Solanum lycopersicum]
Length=244

 Score = 99.8 bits (247),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 59/152 (39%), Positives = 82/152 (54%), Gaps = 11/152 (7%)
 Frame = -2

Query  726  GKWVSEIREPGKKTRIWLGSFETPEMAAAAYDVAAFHLRGCKARLNFPELVEGFPKPASS  547
             KWV E+REP ++ RIWLG++ TPEMAA A+DVAA  LRG  A LNF +   G P PAS 
Sbjct  60   NKWVCELREPSQQKRIWLGTYSTPEMAARAHDVAALALRGNLATLNFADSRWGLPVPASK  119

Query  546  QPEDVRLAAHQAAMGFKPPAEGVPGAGLRPVRIGLSPNQIQAINETPMD---SPNKMWME  376
             P+D+R AA  AA  F    E V   G+  +   ++ N I  I    +D   + +    +
Sbjct  120  DPKDIRQAAVMAAQAFSQDTELV---GVDYMNEEVNSNTIDEIKYQEIDIARANDGSSSD  176

Query  375  LAATTLLLREPPLMIC-----EDMMELEDWEE  295
              A  L +    ++ C      DM+E+E W+E
Sbjct  177  FGAKELCIDMENILCCNWGEDNDMLEMEGWQE  208



>ref|XP_007225774.1| hypothetical protein PRUPE_ppa009533mg [Prunus persica]
 gb|EMJ26973.1| hypothetical protein PRUPE_ppa009533mg [Prunus persica]
Length=288

 Score =   100 bits (249),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 48/75 (64%), Positives = 57/75 (76%), Gaps = 0/75 (0%)
 Frame = -2

Query  729  WGKWVSEIREPGKKTRIWLGSFETPEMAAAAYDVAAFHLRGCKARLNFPELVEGFPKPAS  550
            WGKWVSEIREP KK+RIWLG+F TPEMAA A+DVAA  ++G  A LNFPEL +  P+P S
Sbjct  77   WGKWVSEIREPRKKSRIWLGTFPTPEMAARAHDVAALSIKGNSAILNFPELSDSLPRPVS  136

Query  549  SQPEDVRLAAHQAAM  505
              P DV+ AA +AA 
Sbjct  137  LAPRDVQAAASKAAQ  151



>ref|XP_010526108.1| PREDICTED: ethylene-responsive transcription factor ERF043 [Tarenaya 
hassleriana]
Length=262

 Score =   100 bits (248),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 46/75 (61%), Positives = 58/75 (77%), Gaps = 0/75 (0%)
 Frame = -2

Query  729  WGKWVSEIREPGKKTRIWLGSFETPEMAAAAYDVAAFHLRGCKARLNFPELVEGFPKPAS  550
            WGKWVSEIREP KK+RIWLG+F T EMAA A+DVAA  ++G  A LNFPEL   FP+P S
Sbjct  52   WGKWVSEIREPRKKSRIWLGTFPTAEMAARAHDVAAMSIKGSSAILNFPELSGSFPRPVS  111

Query  549  SQPEDVRLAAHQAAM  505
              P+D++ A+ +AA+
Sbjct  112  LSPKDIQAASAKAAL  126



>ref|XP_004165656.1| PREDICTED: ethylene-responsive transcription factor ERF043-like 
[Cucumis sativus]
Length=235

 Score = 99.4 bits (246),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 49/79 (62%), Positives = 58/79 (73%), Gaps = 1/79 (1%)
 Frame = -2

Query  729  WGKWVSEIREPGKKTRIWLGSFETPEMAAAAYDVAAFHLRGCKARLNFPELVEGFPKPAS  550
            WGKWVSEIREP KK+RIWLG+F TPEMAA A+DVAA  ++G  A LNFPEL    P+P S
Sbjct  58   WGKWVSEIREPRKKSRIWLGTFPTPEMAARAHDVAALSIKGNSAILNFPELAHSLPRPVS  117

Query  549  SQPEDVRLAAHQAA-MGFK  496
              P D++ AA +AA M F 
Sbjct  118  FAPRDIQAAASKAAHMDFN  136



>ref|XP_004515795.1| PREDICTED: ethylene-responsive transcription factor ERF026-like 
[Cicer arietinum]
Length=171

 Score = 97.8 bits (242),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 47/73 (64%), Positives = 55/73 (75%), Gaps = 0/73 (0%)
 Frame = -2

Query  726  GKWVSEIREPGKKTRIWLGSFETPEMAAAAYDVAAFHLRGCKARLNFPELVEGFPKPASS  547
            GKWV+EIREP K  RIWLG+F TPEMAAAAYDVA   L+G +A LNFP+L   +P PAS+
Sbjct  21   GKWVTEIREPRKTNRIWLGTFSTPEMAAAAYDVATLALKGGEAILNFPDLARRYPVPASN  80

Query  546  QPEDVRLAAHQAA  508
              ED+R AA  AA
Sbjct  81   SAEDIRSAATSAA  93



>ref|NP_195006.1| ethylene-responsive transcription factor ERF043 [Arabidopsis 
thaliana]
 sp|Q9M080.1|ERF43_ARATH RecName: Full=Ethylene-responsive transcription factor ERF043 
[Arabidopsis thaliana]
 emb|CAB79997.1| transcription factor TINY homolog [Arabidopsis thaliana]
 gb|AAM67224.1| transcription factor TINY homolog [Arabidopsis thaliana]
 gb|AAO22740.1| putative transcription factor TINY [Arabidopsis thaliana]
 gb|AAO42337.1| putative transcription factor TINY [Arabidopsis thaliana]
 gb|AEE86120.1| ethylene-responsive transcription factor ERF043 [Arabidopsis 
thaliana]
Length=221

 Score = 99.0 bits (245),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 50/82 (61%), Positives = 58/82 (71%), Gaps = 1/82 (1%)
 Frame = -2

Query  729  WGKWVSEIREPGKKTRIWLGSFETPEMAAAAYDVAAFHLRGCKARLNFPELVEGFPKPAS  550
            WGKWVSEIREP KK+RIWLG+F T EMA  A+DVAA  ++G  A LNFPEL +  P+P S
Sbjct  27   WGKWVSEIREPRKKSRIWLGTFPTAEMAMRAHDVAAMSIKGTSAILNFPELSKLLPRPVS  86

Query  549  SQPEDVRLAAHQAA-MGFKPPA  487
              P DVR AA +AA M F   A
Sbjct  87   LSPRDVRAAATKAALMDFDTTA  108



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1210457312932