BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c80444_g1_i1 len=616 path=[594:0-615]

Length=616
                                                                      Score     E

ref|XP_002269033.1|  PREDICTED: two-component response regulator ...    115   1e-28   Vitis vinifera
gb|KHG18578.1|  Two-component response regulator ARR22 -like protein    109   2e-26   
ref|XP_010102183.1|  Two-component response regulator                   107   4e-25   
ref|XP_002268738.1|  PREDICTED: two-component response regulator ...    105   9e-25   Vitis vinifera
ref|XP_011096653.1|  PREDICTED: two-component response regulator ...    105   1e-24   
ref|XP_011096654.1|  PREDICTED: two-component response regulator ...    105   1e-24   
ref|XP_011096655.1|  PREDICTED: two-component response regulator ...    105   1e-24   
ref|XP_010549639.1|  PREDICTED: two-component response regulator ...    102   8e-24   
ref|XP_004304789.1|  PREDICTED: two-component response regulator ...  99.4    1e-22   
ref|XP_010547349.1|  PREDICTED: two-component response regulator ...  99.4    1e-22   
gb|KCW85327.1|  hypothetical protein EUGRSUZ_B02166                     100   1e-22   
ref|XP_003625416.1|  Chemotaxis protein cheY-like protein             99.4    1e-22   
gb|KCW85326.1|  hypothetical protein EUGRSUZ_B02165                   98.2    3e-22   
gb|KCW58098.1|  hypothetical protein EUGRSUZ_H00822                   97.4    5e-22   
gb|EYU19145.1|  hypothetical protein MIMGU_mgv1a018636mg              97.1    8e-22   
ref|XP_010026028.1|  PREDICTED: two-component response regulator ...  97.1    9e-22   
ref|XP_010046358.1|  PREDICTED: two-component response regulator ...  97.8    9e-22   
ref|XP_006604866.1|  PREDICTED: two-component response regulator ...  97.4    1e-21   
ref|XP_007030298.1|  Response regulator 22, putative                  97.4    1e-21   
ref|XP_002884437.1|  hypothetical protein ARALYDRAFT_477689           96.7    1e-21   
ref|XP_009124004.1|  PREDICTED: two-component response regulator ...  96.7    2e-21   
ref|XP_007147238.1|  hypothetical protein PHAVU_006G107500g           95.9    3e-21   
ref|XP_006371115.1|  hypothetical protein POPTR_0019s04160g           95.5    3e-21   
ref|XP_007147239.1|  hypothetical protein PHAVU_006G107500g           95.9    4e-21   
ref|XP_002268656.1|  PREDICTED: two-component response regulator ...  94.7    6e-21   Vitis vinifera
ref|XP_011004847.1|  PREDICTED: two-component response regulator ...  95.5    6e-21   
ref|XP_002303092.1|  hypothetical protein POPTR_0002s25430g           93.2    3e-20   Populus trichocarpa [western balsam poplar]
ref|XP_002313833.1|  hypothetical protein POPTR_0009s11120g           92.8    3e-20   Populus trichocarpa [western balsam poplar]
gb|KHN43143.1|  GDSL esterase/lipase                                  95.5    4e-20   
emb|CDX92062.1|  BnaC03g33640D                                        92.4    5e-20   
ref|XP_004493838.1|  PREDICTED: two-component response regulator ...  92.0    7e-20   
ref|XP_009134756.1|  PREDICTED: two-component response regulator ...  92.4    7e-20   
ref|XP_010026025.1|  PREDICTED: two-component response regulator ...  92.4    7e-20   
ref|XP_007162622.1|  hypothetical protein PHAVU_001G166700g           91.7    8e-20   
ref|XP_011024538.1|  PREDICTED: two-component response regulator ...  91.7    9e-20   
ref|XP_011002029.1|  PREDICTED: two-component response regulator ...  90.5    2e-19   
ref|XP_007044274.1|  Response regulator 24, putative                  90.9    3e-19   
ref|XP_004292265.1|  PREDICTED: two-component response regulator ...  90.5    3e-19   
dbj|BAG16381.1|  two-component responsive regulator family protein    90.1    3e-19   Brassica rapa var. perviridis [kabuna]
ref|XP_006408204.1|  hypothetical protein EUTSA_v10022233mg           90.1    4e-19   
ref|XP_010485797.1|  PREDICTED: two-component response regulator ...  90.1    4e-19   
ref|XP_010026027.1|  PREDICTED: two-component response regulator ...  90.1    4e-19   
ref|XP_010463903.1|  PREDICTED: LOW QUALITY PROTEIN: two-componen...  89.7    5e-19   
gb|KCW58097.1|  hypothetical protein EUGRSUZ_H00821                   89.7    5e-19   
ref|XP_008358470.1|  PREDICTED: two-component response regulator ...  89.4    8e-19   
ref|XP_003520624.1|  PREDICTED: two-component response regulator ...  89.4    8e-19   
ref|XP_006420329.1|  hypothetical protein CICLE_v10006872mg           89.7    8e-19   
dbj|BAG16375.1|  two-component responsive regulator family protein    88.6    1e-18   Brassica oleracea var. italica [asparagus broccoli]
ref|XP_010463905.1|  PREDICTED: two-component response regulator ...  88.6    2e-18   
ref|XP_006299637.1|  hypothetical protein CARUB_v10015824mg           88.2    2e-18   
ref|NP_850864.1|  response regulator 24                               87.8    3e-18   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006420328.1|  hypothetical protein CICLE_v10006814mg           88.2    3e-18   
ref|XP_002872214.1|  predicted protein                                87.4    4e-18   
ref|XP_008813032.1|  PREDICTED: two-component response regulator ...  87.4    4e-18   
ref|XP_006480178.1|  PREDICTED: two-component response regulator ...  87.0    5e-18   
ref|XP_006604528.1|  PREDICTED: two-component response regulator ...  86.3    5e-18   
ref|XP_003625472.1|  Extra response regulator                         86.7    6e-18   
ref|XP_006443675.1|  hypothetical protein CICLE_v10024122mg           86.7    7e-18   
gb|KDO65835.1|  hypothetical protein CISIN_1g039027mg                 87.0    7e-18   
ref|XP_009614376.1|  PREDICTED: two-component response regulator ...  87.0    8e-18   
ref|XP_010493902.1|  PREDICTED: two-component response regulator ...  86.3    9e-18   
ref|NP_187078.1|  two-component response regulator ARR22              86.7    1e-17   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010046359.1|  PREDICTED: two-component response regulator ...  87.4    1e-17   
ref|XP_010413329.1|  PREDICTED: two-component response regulator ...  86.3    1e-17   
ref|XP_006489755.1|  PREDICTED: two-component response regulator ...  86.3    1e-17   
ref|XP_002522025.1|  sensory transduction histidine kinase bacter...  87.0    1e-17   Ricinus communis
ref|XP_006286701.1|  hypothetical protein CARUB_v10002781mg           85.9    1e-17   
emb|CDX87050.1|  BnaC09g03650D                                        85.5    2e-17   
ref|XP_008235536.1|  PREDICTED: two-component response regulator ...  85.5    2e-17   
ref|XP_010421505.1|  PREDICTED: two-component response regulator ...  85.5    2e-17   
ref|XP_010454992.1|  PREDICTED: two-component response regulator ...  85.5    2e-17   
ref|XP_009371086.1|  PREDICTED: two-component response regulator ...  85.5    2e-17   
ref|XP_009111701.1|  PREDICTED: two-component response regulator ...  85.5    2e-17   
ref|XP_006448069.1|  hypothetical protein CICLE_v10017880mg           85.5    3e-17   
ref|XP_002521152.1|  sensory transduction histidine kinase bacter...  85.1    3e-17   Ricinus communis
ref|XP_007201589.1|  hypothetical protein PRUPE_ppa020702mg           84.7    3e-17   
ref|XP_009786313.1|  PREDICTED: two-component response regulator ...  85.1    4e-17   
ref|XP_010109670.1|  Two-component response regulator                 84.7    4e-17   
ref|XP_003628696.1|  Two-component response regulator ARR22           84.7    5e-17   
ref|XP_009600611.1|  PREDICTED: two-component response regulator ...  84.7    5e-17   
ref|XP_006394879.1|  hypothetical protein EUTSA_v10005298mg           84.0    7e-17   
ref|XP_008372427.1|  PREDICTED: two-component response regulator ...  84.0    7e-17   
ref|XP_010027144.1|  PREDICTED: two-component response regulator ...  83.6    1e-16   
ref|XP_006361623.1|  PREDICTED: LOW QUALITY PROTEIN: two-componen...  84.0    1e-16   
ref|XP_004493857.1|  PREDICTED: two-component response regulator ...  83.2    1e-16   
ref|XP_002325362.2|  hypothetical protein POPTR_0019s04170g           82.0    4e-16   Populus trichocarpa [western balsam poplar]
gb|KDP26430.1|  hypothetical protein JCGZ_17588                       80.5    1e-15   
emb|CDY49351.1|  BnaA05g33130D                                        81.6    1e-15   
ref|XP_007162648.1|  hypothetical protein PHAVU_001G168500g           80.1    2e-15   
ref|XP_007049950.1|  Two-component response regulator ARR22           81.6    2e-15   
ref|XP_010672917.1|  PREDICTED: two-component response regulator ...  79.7    3e-15   
ref|XP_002522026.1|  sensory transduction histidine kinase bacter...  79.7    4e-15   Ricinus communis
gb|KCW58096.1|  hypothetical protein EUGRSUZ_H00820                   78.2    4e-15   
ref|XP_010934661.1|  PREDICTED: two-component response regulator ...  79.3    5e-15   
ref|XP_002304706.1|  hypothetical protein POPTR_0003s17590g           80.9    5e-15   Populus trichocarpa [western balsam poplar]
ref|XP_002981882.1|  hypothetical protein SELMODRAFT_451436           83.2    5e-15   
ref|XP_002986002.1|  hypothetical protein SELMODRAFT_451432           83.2    5e-15   
ref|XP_011020675.1|  PREDICTED: hybrid signal transduction histid...  80.5    6e-15   
ref|XP_010679285.1|  PREDICTED: two-component response regulator ...  77.4    1e-14   
ref|XP_003520625.1|  PREDICTED: two-component response regulator ...  76.6    2e-14   
ref|XP_009129924.1|  PREDICTED: two-component response regulator ...  76.3    5e-14   
ref|XP_011020674.1|  PREDICTED: histidine protein kinase NIK1-lik...  77.4    6e-14   
gb|KFK44929.1|  hypothetical protein AALP_AA1G321100                  73.6    2e-13   
ref|XP_003553515.1|  PREDICTED: two-component response regulator ...  72.8    4e-13   
gb|KDP23753.1|  hypothetical protein JCGZ_23586                       74.3    4e-13   
ref|XP_001783195.1|  predicted protein                                72.8    4e-13   
ref|XP_010548750.1|  PREDICTED: two-component response regulator ...  73.2    5e-13   
gb|KHN02434.1|  Two-component response regulator ARR22                72.0    6e-13   
gb|KCW85328.1|  hypothetical protein EUGRSUZ_B02167                   72.8    8e-13   
ref|XP_002304705.1|  hypothetical protein POPTR_0003s17580g           73.6    1e-12   Populus trichocarpa [western balsam poplar]
ref|XP_006387271.1|  hypothetical protein POPTR_1359s00200g           72.4    2e-12   
ref|XP_007162623.1|  hypothetical protein PHAVU_001G166800g           71.2    3e-12   
ref|XP_001783176.1|  predicted protein                                69.7    3e-12   
emb|CDY05529.1|  BnaA02g31620D                                        75.5    4e-12   
emb|CDY65142.1|  BnaC02g48400D                                        74.7    6e-12   
ref|WP_021020301.1|  sensor histidine kinase                          72.8    2e-11   
ref|XP_011020733.1|  PREDICTED: uncharacterized protein LOC105123004  72.0    2e-11   
ref|WP_040847875.1|  hypothetical protein                             70.1    2e-11   
ref|WP_040920256.1|  hypothetical protein                             71.6    2e-11   
gb|EHQ07024.1|  integral membrane sensor hybrid histidine kinase      72.4    2e-11   
ref|WP_001083807.1|  sensor histidine kinase                          72.0    3e-11   
ref|XP_002992734.1|  hypothetical protein SELMODRAFT_451426           71.6    3e-11   
gb|KHN02435.1|  Two-component response regulator ARR22                67.4    4e-11   
ref|XP_003581069.1|  PREDICTED: two-component response regulator ...  67.8    4e-11   
ref|XP_006858898.1|  hypothetical protein AMTR_s00066p00205980        68.9    5e-11   
ref|XP_002993716.1|  hypothetical protein SELMODRAFT_449209           71.2    6e-11   
ref|WP_012026539.1|  histidine kinase                                 71.2    6e-11   
gb|KHG06261.1|  Two-component response regulator ARR22 -like protein  67.0    9e-11   
ref|XP_001753026.1|  predicted protein                                65.9    9e-11   
ref|XP_002267242.1|  PREDICTED: two-component response regulator ...  67.0    9e-11   Vitis vinifera
ref|WP_000376696.1|  sensor histidine kinase                          70.1    1e-10   
ref|XP_006345288.1|  PREDICTED: two-component response regulator ...  64.3    1e-10   
ref|XP_002967448.1|  hypothetical protein SELMODRAFT_169013           69.7    2e-10   
ref|WP_031840866.1|  histidine kinase                                 65.5    2e-10   
ref|WP_000376697.1|  sensor histidine kinase                          69.3    2e-10   
ref|WP_000376698.1|  MULTISPECIES: sensor histidine kinase            69.3    2e-10   
ref|WP_040371066.1|  hypothetical protein                             68.9    2e-10   
ref|WP_000376695.1|  sensor histidine kinase                          68.9    3e-10   
ref|XP_011034463.1|  PREDICTED: uncharacterized protein LOC105132...  67.8    3e-10   
gb|EPR32860.1|  PAS/PAC sensor hybrid histidine kinase                68.9    4e-10   
ref|WP_022577997.1|  sensor histidine kinase                          68.6    4e-10   
ref|WP_005523014.1|  Signal transduction histidine kinase             68.6    4e-10   
ref|XP_010467996.1|  PREDICTED: two-component response regulator ...  64.7    4e-10   
ref|XP_002297820.1|  hypothetical protein POPTR_0001s14380g           67.8    4e-10   Populus trichocarpa [western balsam poplar]
gb|EKL09623.1|  histidine kinase-, DNA gyrase B-, and HSP90-like ...  65.1    5e-10   
ref|WP_038179338.1|  histidine kinase                                 68.2    5e-10   
ref|WP_007805290.1|  histidine kinase                                 68.6    5e-10   
gb|KCW80642.1|  hypothetical protein EUGRSUZ_C02019                   64.3    5e-10   
ref|XP_003566425.2|  PREDICTED: LOW QUALITY PROTEIN: two-componen...  64.3    6e-10   
ref|WP_022963217.1|  sensor histidine kinase                          67.8    8e-10   
ref|WP_025519761.1|  hypothetical protein                             65.1    8e-10   
ref|XP_007049951.1|  Response regulator 24, putative                  63.5    8e-10   
ref|WP_001914345.1|  signal transduction histidine kinase             65.1    8e-10   
ref|WP_035683166.1|  histidine kinase                                 67.8    9e-10   
ref|NP_001051227.1|  Os03g0742300                                     63.5    9e-10   Oryza sativa Japonica Group [Japonica rice]
ref|XP_011020984.1|  PREDICTED: oxidative stress response two-com...  67.0    1e-09   
gb|ADE77088.1|  unknown                                               65.5    1e-09   
ref|XP_010417616.1|  PREDICTED: two-component response regulator ...  63.5    1e-09   
ref|WP_025640115.1|  hypothetical protein                             65.5    1e-09   
ref|WP_033908231.1|  histidine kinase                                 65.1    1e-09   
ref|WP_007063811.1|  histidine kinase                                 66.2    1e-09   
gb|ETY66475.1|  response regulator                                    65.9    2e-09   
ref|WP_031839876.1|  histidine kinase                                 65.9    2e-09   
gb|ETJ87884.1|  response regulator                                    62.8    2e-09   
ref|XP_003063001.1|  predicted protein                                62.8    2e-09   
ref|WP_031782574.1|  histidine kinase                                 64.7    2e-09   
ref|WP_040949150.1|  hypothetical protein                             62.4    2e-09   
gb|KFY11975.1|  hypothetical protein V491_06970                       63.2    2e-09   
ref|WP_032078483.1|  histidine kinase                                 65.9    2e-09   
ref|WP_023275854.1|  hypothetical protein                             66.6    2e-09   
ref|WP_031838574.1|  histidine kinase                                 65.9    2e-09   
emb|CAN61539.1|  hypothetical protein VITISV_030743                   62.8    2e-09   Vitis vinifera
ref|WP_031380921.1|  histidine kinase                                 65.9    2e-09   
ref|WP_026110111.1|  histidine kinase                                 66.2    3e-09   
ref|XP_007754164.1|  hypothetical protein A1O7_01938                  66.2    3e-09   
emb|CEM61310.1|  ATPase/histidine kinase/DNA gyrase B/HSP90 domai...  66.2    3e-09   
ref|WP_025610937.1|  histidine kinase                                 65.9    3e-09   
gb|EVU18666.1|  his Kinase A domain protein                           65.9    3e-09   
ref|WP_024752999.1|  hypothetical protein                             65.9    3e-09   
ref|XP_002280692.1|  PREDICTED: two-component response regulator ...  62.8    3e-09   Vitis vinifera
ref|WP_029858136.1|  histidine kinase                                 65.9    3e-09   
ref|WP_029864963.1|  histidine kinase                                 65.9    3e-09   
ref|WP_005457375.1|  signal transduction histidine kinase             65.9    3e-09   
ref|WP_021486647.1|  his Kinase A domain protein                      65.9    3e-09   
ref|WP_021450929.1|  his Kinase A domain protein                      65.9    3e-09   
ref|WP_025532585.1|  histidine kinase                                 65.9    3e-09   
ref|WP_021454137.1|  his Kinase A domain protein                      65.9    3e-09   
ref|WP_029829896.1|  histidine kinase                                 65.9    3e-09   
ref|WP_025510282.1|  histidine kinase                                 65.9    3e-09   
ref|WP_031846544.1|  histidine kinase                                 65.9    3e-09   
ref|WP_029796120.1|  histidine kinase                                 65.9    3e-09   
ref|WP_031778244.1|  histidine kinase                                 65.9    3e-09   
ref|WP_032472251.1|  histidine kinase                                 65.9    3e-09   
ref|WP_029862342.1|  histidine kinase                                 65.9    3e-09   
ref|WP_025505233.1|  histidine kinase                                 65.9    3e-09   
gb|EFK09048.1|  ATPase/histidine kinase/DNA gyrase B/HSP90 domain...  65.9    3e-09   
ref|XP_008723969.1|  hypothetical protein G647_09754                  66.2    3e-09   
gb|EDN15718.1|  sensor histidine kinase/response regulator            65.9    3e-09   Vibrio cholerae AM-19226
ref|WP_005505361.1|  chemotaxis protein CheY                          65.9    3e-09   
ref|WP_040042771.1|  hypothetical protein                             65.5    3e-09   
ref|WP_033407406.1|  hypothetical protein                             65.1    3e-09   
ref|WP_025628536.1|  histidine kinase                                 65.5    3e-09   
ref|XP_007748924.1|  hypothetical protein A1O5_10156                  65.9    4e-09   
ref|WP_029857309.1|  histidine kinase                                 65.5    4e-09   
ref|WP_025536070.1|  histidine kinase                                 65.5    4e-09   
ref|WP_024700059.1|  histidine kinase                                 65.5    4e-09   
ref|WP_031821357.1|  histidine kinase                                 65.5    4e-09   
ref|WP_023585872.1|  signal transduction histidine kinase             65.5    4e-09   
ref|WP_029847584.1|  histidine kinase                                 65.5    4e-09   
ref|WP_025523756.1|  histidine kinase                                 65.5    4e-09   
ref|WP_029806345.1|  histidine kinase                                 65.5    4e-09   
ref|XP_009401157.1|  PREDICTED: uncharacterized protein LOC103985239  64.7    4e-09   
ref|WP_025548472.1|  histidine kinase                                 65.5    4e-09   
ref|WP_025976484.1|  histidine kinase                                 65.5    4e-09   
gb|KHF07045.1|  histidine kinase                                      65.5    4e-09   
ref|WP_025501792.1|  histidine kinase                                 65.5    4e-09   
ref|WP_031819035.1|  histidine kinase                                 65.5    4e-09   
ref|WP_021822969.1|  his Kinase A domain protein                      65.5    4e-09   
ref|WP_025796359.1|  histidine kinase                                 65.5    4e-09   
ref|WP_029810757.1|  histidine kinase                                 65.5    4e-09   
ref|WP_025559315.1|  histidine kinase                                 65.5    4e-09   
ref|WP_025554755.1|  histidine kinase                                 65.5    4e-09   
ref|WP_026718661.1|  hypothetical protein                             65.5    4e-09   
ref|WP_025818353.1|  histidine kinase                                 65.5    4e-09   
ref|WP_023001225.1|  MULTISPECIES: hypothetical protein               65.5    4e-09   
emb|CBI20440.3|  unnamed protein product                              62.4    4e-09   
ref|WP_031850627.1|  histidine kinase                                 65.5    4e-09   
ref|WP_020840621.1|  signal transduction histidine kinase             65.5    4e-09   
ref|WP_011261900.1|  chemotaxis protein CheY                          65.5    4e-09   
ref|WP_025626820.1|  histidine kinase                                 65.5    4e-09   
ref|WP_031854743.1|  histidine kinase                                 65.1    4e-09   
ref|WP_005495008.1|  signal transduction histidine kinase             65.1    4e-09   
ref|WP_025632234.1|  histidine kinase                                 65.1    5e-09   
ref|WP_033932560.1|  histidine kinase                                 65.1    5e-09   
ref|WP_001935056.1|  sensor histidine kinase                          65.1    5e-09   
ref|WP_039981209.1|  histidine kinase                                 65.1    5e-09   
ref|WP_031271708.1|  hypothetical protein                             65.1    5e-09   
ref|WP_031388740.1|  hypothetical protein                             64.7    5e-09   
gb|EAX61708.1|  sensor histidine kinase/response regulator            64.7    5e-09   Vibrio cholerae V52
ref|WP_017019646.1|  chemotaxis protein CheY                          65.1    6e-09   
ref|WP_033084789.1|  histidine kinase                                 64.7    6e-09   
ref|WP_011929406.1|  sensor histidine kinase                          64.7    6e-09   
gb|EFI36125.1|  histidine kinase                                      64.7    6e-09   
gb|KFE25719.1|  his Kinase A domain protein                           64.7    6e-09   
ref|WP_035258886.1|  hypothetical protein                             64.7    6e-09   
ref|WP_012532959.1|  chemotaxis protein CheY                          65.1    6e-09   
ref|WP_031852347.1|  histidine kinase                                 64.7    6e-09   
ref|WP_001897373.1|  sensor histidine kinase                          64.7    6e-09   
ref|WP_029803523.1|  histidine kinase                                 64.7    6e-09   
ref|XP_010489670.1|  PREDICTED: two-component response regulator ...  61.2    6e-09   
gb|EQB87233.1|  hypothetical protein M918_10280                       65.1    6e-09   
ref|WP_000376699.1|  sensor histidine kinase                          64.7    7e-09   
ref|WP_026764494.1|  hypothetical protein                             65.1    7e-09   
ref|WP_040846469.1|  hypothetical protein                             64.7    7e-09   
ref|WP_001964982.1|  sensor histidine kinase                          64.7    7e-09   
ref|WP_032469078.1|  histidine kinase                                 64.7    7e-09   
ref|WP_033930962.1|  histidine kinase                                 64.7    7e-09   
ref|WP_014505847.1|  sensor histidine kinase                          64.7    7e-09   
gb|EFH75460.1|  sensor histidine kinase/response regulator            64.7    7e-09   
gb|EGQ99455.1|  his Kinase A domain protein                           64.7    7e-09   
ref|WP_001995242.1|  sensor histidine kinase                          64.7    7e-09   
ref|WP_000781451.1|  sensor histidine kinase                          64.7    7e-09   
gb|EEO06645.1|  signal transduction histidine kinase                  64.7    7e-09   Vibrio cholerae TM 11079-80
ref|WP_001888129.1|  sensor histidine kinase                          64.7    7e-09   
gb|EEO02069.1|  signal transduction histidine kinase                  64.7    7e-09   Vibrio albensis VL426
ref|WP_027694799.1|  MULTISPECIES: histidine kinase                   64.7    7e-09   
ref|WP_025998928.1|  histidine kinase                                 64.7    7e-09   
ref|WP_001986113.1|  sensor histidine kinase                          64.7    7e-09   
ref|WP_032473001.1|  histidine kinase                                 64.7    7e-09   
ref|WP_001912429.1|  sensor histidine kinase                          64.7    7e-09   
ref|WP_000376700.1|  sensor histidine kinase                          64.7    7e-09   
gb|EEN98745.1|  signal transduction histidine kinase                  64.7    7e-09   Vibrio cholerae 12129(1)
ref|WP_032481759.1|  histidine kinase                                 64.7    7e-09   
dbj|GAD88875.1|  putative two-component hybrid sensor and regulator   65.1    7e-09   
ref|WP_002043871.1|  his Kinase A domain protein                      64.7    7e-09   
ref|WP_000376701.1|  sensor histidine kinase                          64.7    8e-09   
gb|EDL72932.1|  sensor histidine kinase/response regulator            64.7    8e-09   Vibrio cholerae 623-39
gb|EDM53251.1|  sensor histidine kinase/response regulator            64.3    8e-09   Vibrio cholerae MZO-2
ref|XP_011034466.1|  PREDICTED: uncharacterized protein LOC105132...  63.5    8e-09   
ref|WP_040473967.1|  histidine kinase                                 64.7    8e-09   
gb|EIA07990.1|  histidine kinase                                      64.7    8e-09   
gb|EKG88988.1|  his Kinase A domain protein                           64.3    8e-09   
gb|KHF19746.1|  histidine kinase                                      64.3    8e-09   
ref|WP_029627496.1|  histidine kinase                                 64.3    8e-09   
ref|WP_033837800.1|  histidine kinase                                 64.3    8e-09   
ref|WP_001925558.1|  sensor histidine kinase                          64.3    8e-09   
ref|WP_029815653.1|  histidine kinase                                 64.3    8e-09   
ref|WP_032479812.1|  histidine kinase                                 64.3    8e-09   
ref|WP_010323390.1|  multi-sensor hybrid histidine kinase             64.7    8e-09   
ref|WP_002023075.1|  sensor histidine kinase                          64.3    9e-09   
ref|WP_033928466.1|  histidine kinase                                 64.3    9e-09   
ref|WP_011713581.1|  PAS/PAC sensor hybrid histidine kinase           64.7    9e-09   
ref|WP_035646955.1|  histidine kinase                                 64.3    1e-08   
emb|CED71450.1|  response regulator, histidine kinase                 64.3    1e-08   
ref|WP_012827088.1|  PAS/PAC sensor hybrid histidine kinase           64.3    1e-08   
ref|WP_025571548.1|  histidine kinase                                 64.3    1e-08   
ref|WP_029853370.1|  histidine kinase                                 63.9    1e-08   
ref|WP_003167880.1|  response regulator receiver domain protein       63.9    1e-08   
ref|WP_029806832.1|  histidine kinase                                 64.3    1e-08   
ref|WP_039461211.1|  chemotaxis protein CheY                          64.3    1e-08   
gb|EEO12539.1|  signal transduction histidine kinase                  63.9    1e-08   
ref|WP_025629837.1|  histidine kinase                                 63.9    1e-08   
ref|WP_025607139.1|  histidine kinase                                 63.9    1e-08   
ref|WP_020903750.1|  signal transduction histidine kinase             63.9    1e-08   
gb|KHF13341.1|  histidine kinase                                      63.9    1e-08   
ref|WP_029850717.1|  histidine kinase                                 63.9    1e-08   
ref|WP_029839105.1|  histidine kinase                                 63.9    1e-08   
ref|WP_025552449.1|  histidine kinase                                 63.9    1e-08   
ref|WP_033839247.1|  histidine kinase                                 63.9    1e-08   
ref|WP_029589074.1|  hypothetical protein                             64.3    1e-08   
ref|WP_025501400.1|  histidine kinase                                 63.9    1e-08   
ref|WP_017448555.1|  signal transduction histidine kinase             63.9    1e-08   
ref|WP_029849952.1|  histidine kinase                                 63.9    1e-08   
ref|WP_031430296.1|  histidine kinase                                 63.9    1e-08   
ref|WP_025792366.1|  histidine kinase                                 63.9    1e-08   
ref|WP_025555961.1|  histidine kinase                                 63.9    1e-08   
ref|WP_024701900.1|  histidine kinase                                 63.9    1e-08   
ref|XP_007672031.1|  hypothetical protein BAUCODRAFT_100388           64.3    1e-08   
ref|WP_029852079.1|  histidine kinase                                 63.9    1e-08   
ref|WP_029835926.1|  histidine kinase                                 63.9    1e-08   
ref|WP_025636602.1|  histidine kinase                                 63.9    1e-08   
ref|WP_025526575.1|  histidine kinase                                 63.9    1e-08   
ref|WP_013646647.1|  histidine kinase                                 60.8    1e-08   
ref|WP_029855638.1|  histidine kinase                                 63.9    1e-08   
ref|WP_040848230.1|  hypothetical protein                             63.9    1e-08   
ref|WP_025788713.1|  histidine kinase                                 63.9    1e-08   
ref|XP_007725720.1|  hypothetical protein A1O1_06652                  64.3    1e-08   
gb|KHF10925.1|  histidine kinase                                      63.9    1e-08   
ref|WP_031849379.1|  histidine kinase                                 63.9    1e-08   
ref|WP_025540913.1|  histidine kinase                                 63.9    1e-08   
ref|WP_025507913.1|  histidine kinase                                 63.9    1e-08   
ref|WP_025638261.1|  histidine kinase                                 63.9    1e-08   
ref|WP_025504637.1|  histidine kinase                                 63.9    1e-08   
ref|WP_015296752.1|  Signal transduction histidine kinase             63.9    1e-08   
ref|WP_031416006.1|  histidine kinase                                 63.9    1e-08   
ref|WP_025633082.1|  histidine kinase                                 63.9    1e-08   
gb|ETZ10302.1|  signal transduction histidine kinase                  63.9    1e-08   
ref|WP_031828129.1|  histidine kinase                                 63.9    1e-08   
ref|WP_005309856.1|  chemotaxis protein CheY                          63.9    1e-08   
ref|WP_001932349.1|  sensor histidine kinase                          63.9    1e-08   
ref|WP_029798228.1|  histidine kinase                                 63.9    1e-08   
gb|EKG62009.1|  his Kinase A domain protein                           63.9    1e-08   
ref|WP_012737820.1|  hybrid sensory histidine kinase in two-compo...  64.3    1e-08   
ref|WP_029833422.1|  histidine kinase                                 63.9    1e-08   
ref|WP_020333290.1|  signal transduction histidine kinase             63.9    1e-08   
ref|WP_008468841.1|  histidine kinase                                 63.9    1e-08   
ref|WP_014231845.1|  signal transduction histidine kinase             63.9    1e-08   
ref|WP_025987764.1|  histidine kinase                                 63.9    1e-08   
ref|WP_025579217.1|  histidine kinase                                 63.9    1e-08   
ref|WP_021703260.1|  putative two-component hybrid sensor and reg...  63.9    1e-08   
ref|WP_001959017.1|  Signal transduction histidine kinase             63.9    1e-08   
ref|XP_007738761.1|  hypothetical protein A1O3_10481                  64.3    1e-08   
gb|AJD50089.1|  sensor histidine kinase/response regulator            63.9    1e-08   
ref|XP_009156732.1|  osomolarity two-component system, sensor his...  64.3    1e-08   
ref|XP_008665397.1|  PREDICTED: two-component system protein A-li...  60.5    1e-08   
ref|WP_040418009.1|  hypothetical protein                             63.5    1e-08   
ref|WP_039970197.1|  hypothetical protein                             63.9    1e-08   
ref|WP_002052510.1|  autoinducer 2 sensor kinase/phosphatase LuxQ     63.5    1e-08   
ref|WP_027914330.1|  MULTISPECIES: histidine kinase                   63.9    1e-08   
gb|EVU18663.1|  response regulator                                    59.7    1e-08   
ref|XP_010239714.1|  PREDICTED: two-component response regulator ...  60.5    2e-08   
ref|WP_035090854.1|  hypothetical protein                             63.2    2e-08   
ref|WP_035073563.1|  hypothetical protein                             63.2    2e-08   
ref|WP_041026040.1|  hypothetical protein                             63.5    2e-08   
ref|WP_013345161.1|  integral membrane sensor hybrid histidine ki...  63.5    2e-08   
ref|WP_039213738.1|  chemotaxis protein CheY                          63.5    2e-08   
dbj|GAL36706.1|  sensor histidine kinase                              63.5    2e-08   
gb|KFN18959.1|  chemotaxis protein CheY                               63.5    2e-08   
gb|EPF32382.1|  hypothetical protein HMPREF9194_00380                 63.5    2e-08   
ref|WP_024943778.1|  chemotaxis protein CheY                          63.5    2e-08   
ref|WP_017783897.1|  chemotaxis protein CheY                          63.5    2e-08   
ref|WP_010634448.1|  two-component system hybrid sensor histidine...  63.5    2e-08   
gb|KGY50373.1|  chemotaxis protein CheY                               63.2    2e-08   
ref|WP_029303434.1|  chemotaxis protein CheY                          63.2    2e-08   
ref|WP_017766056.1|  chemotaxis protein CheY                          63.2    2e-08   
ref|WP_016350248.1|  sensor protein LuxQ                              63.2    2e-08   
gb|KER63621.1|  chemotaxis protein CheY                               63.2    2e-08   
ref|WP_009756577.1|  signal transduction histidine kinase             63.5    2e-08   
ref|WP_029301364.1|  chemotaxis protein CheY                          63.2    2e-08   
gb|EZH82757.1|  chemotaxis protein CheY                               63.2    2e-08   
gb|EMT20417.1|  Hybrid signal transduction histidine kinase I         59.7    2e-08   
ref|WP_017410429.1|  chemotaxis protein CheY                          63.2    2e-08   
ref|WP_021137876.1|  two-component system hybrid sensor histidine...  63.2    2e-08   
ref|WP_017779252.1|  chemotaxis protein CheY                          63.2    2e-08   
ref|WP_005299308.1|  chemotaxis protein CheY                          63.2    2e-08   
ref|WP_024942816.1|  chemotaxis protein CheY                          63.2    2e-08   
ref|WP_017786585.1|  MULTISPECIES: chemotaxis protein CheY            63.2    2e-08   
ref|XP_008719694.1|  hypothetical protein HMPREF1541_07147            63.5    2e-08   
ref|WP_035922603.1|  hypothetical protein                             62.8    2e-08   
ref|WP_021273525.1|  CHASE domain protein                             63.2    2e-08   
ref|WP_025593194.1|  histidine kinase                                 62.8    2e-08   
ref|WP_040201901.1|  hypothetical protein                             62.0    2e-08   
ref|XP_002299303.2|  hypothetical protein POPTR_0001s13920g           62.4    3e-08   
ref|WP_031847545.1|  histidine kinase                                 62.8    3e-08   
ref|XP_011034468.1|  PREDICTED: two-component response regulator ...  60.8    3e-08   
gb|EDL55668.1|  RscS; sensor kinase protein                           63.2    3e-08   
ref|WP_013966302.1|  integral membrane sensor hybrid histidine ki...  62.8    3e-08   
ref|WP_038221591.1|  hypothetical protein                             63.2    3e-08   
ref|XP_002297818.1|  hypothetical protein POPTR_0001s14400g           60.8    3e-08   
ref|WP_036766665.1|  hypothetical protein                             62.8    3e-08   
ref|WP_035040551.1|  hypothetical protein                             62.8    3e-08   
dbj|BAK07176.1|  predicted protein                                    59.3    3e-08   
ref|WP_015806507.1|  histidine kinase                                 63.2    3e-08   
ref|WP_035263217.1|  hypothetical protein                             62.4    3e-08   
ref|WP_022550736.1|  putative TWO-COMPONENT SENSOR PROTEIN HISTID...  62.8    3e-08   
ref|WP_032480318.1|  histidine kinase                                 62.4    3e-08   
ref|WP_015250641.1|  PAS domain-containing protein                    62.8    3e-08   
ref|XP_002297819.2|  hypothetical protein POPTR_0001s14390g           62.0    3e-08   
ref|WP_035620458.1|  histidine kinase                                 62.8    3e-08   
ref|WP_028972917.1|  hypothetical protein                             61.2    3e-08   
ref|WP_022604253.1|  putative TWO-COMPONENT SENSOR PROTEIN HISTID...  62.8    3e-08   
ref|WP_022595100.1|  putative TWO-COMPONENT SENSOR PROTEIN HISTID...  62.8    3e-08   
ref|WP_022590813.1|  putative TWO-COMPONENT SENSOR PROTEIN HISTID...  62.8    3e-08   
ref|WP_004402206.1|  putative sensor protein                          62.8    3e-08   
ref|WP_027390090.1|  hypothetical protein                             62.8    4e-08   
ref|WP_005419221.1|  chemotaxis protein CheY                          62.8    4e-08   
gb|EPR43924.1|  PAS/PAC sensor hybrid histidine kinase                62.8    4e-08   
ref|WP_040347229.1|  histidine kinase                                 62.4    4e-08   
ref|WP_001899547.1|  sensor histidine kinase/response regulator       58.9    4e-08   
ref|WP_039112768.1|  MULTISPECIES: histidine kinase                   62.8    4e-08   
ref|WP_036944252.1|  hypothetical protein                             62.8    4e-08   
ref|WP_032471687.1|  histidine kinase                                 62.4    4e-08   
ref|WP_038642959.1|  hypothetical protein                             62.0    4e-08   
ref|WP_040873818.1|  hypothetical protein                             62.0    4e-08   
ref|WP_033929663.1|  histidine kinase                                 62.4    4e-08   
gb|EST14716.1|  his Kinase A domain protein                           62.4    4e-08   
ref|WP_001929807.1|  sensor histidine kinase                          62.0    4e-08   
ref|WP_032477079.1|  histidine kinase                                 62.0    4e-08   
ref|WP_013260385.1|  sensor histidine kinase                          62.4    4e-08   
ref|WP_033728836.1|  histidine kinase                                 62.4    5e-08   
ref|WP_029305994.1|  chemotaxis protein CheY                          62.0    5e-08   
ref|WP_032081314.1|  histidine kinase                                 62.0    5e-08   
ref|WP_002537140.1|  Signal transduction histidine kinase             62.0    5e-08   
ref|WP_022611452.1|  putative TWO-COMPONENT SENSOR PROTEIN HISTID...  62.0    5e-08   
ref|XP_006650565.1|  PREDICTED: two-component response regulator ...  58.9    5e-08   
ref|WP_040892060.1|  histidine kinase                                 62.0    5e-08   
ref|WP_014747286.1|  histidine kinase                                 62.4    6e-08   
gb|ERJ92123.1|  response regulator receiver domain protein            62.0    6e-08   
ref|WP_020432299.1|  Signal transduction histidine kinase             62.0    6e-08   
ref|WP_020535231.1|  hypothetical protein                             62.0    6e-08   
ref|WP_036665321.1|  hypothetical protein                             62.0    6e-08   
ref|WP_024610144.1|  histidine kinase                                 62.0    6e-08   
ref|WP_034875042.1|  hypothetical protein                             58.5    7e-08   
ref|WP_020331081.1|  Signal transduction histidine kinase             61.6    7e-08   
ref|WP_040418399.1|  hypothetical protein                             61.2    7e-08   
ref|XP_006387272.1|  hypothetical protein POPTR_1359s00210g           59.3    7e-08   
ref|XP_004251430.1|  PREDICTED: two-component response regulator ...  58.5    7e-08   
ref|XP_008800128.1|  PREDICTED: two-component system protein A-like   58.5    7e-08   
ref|WP_038226443.1|  hypothetical protein                             62.0    7e-08   
ref|WP_017074283.1|  signal transduction histidine kinase             61.6    7e-08   
ref|WP_028634784.1|  histidine kinase                                 61.6    7e-08   
ref|WP_017057243.1|  signal transduction histidine kinase             61.6    7e-08   
ref|WP_036831025.1|  chemotaxis protein CheY                          61.6    7e-08   
ref|WP_040504619.1|  hypothetical protein                             61.2    7e-08   
gb|EKL13755.1|  response regulator                                    57.8    8e-08   
ref|XP_004986245.1|  PREDICTED: two-component system protein A-like   58.2    8e-08   
gb|EEX37183.1|  signal transduction histidine kinase                  61.2    8e-08   
ref|WP_040101304.1|  hypothetical protein                             60.5    8e-08   
ref|WP_040904825.1|  histidine kinase                                 61.2    8e-08   
ref|WP_020294602.1|  sensor histidine kinase/response regulator       61.6    9e-08   
dbj|GAL16970.1|  sensor histidine kinase                              61.2    9e-08   
ref|WP_017634894.1|  signal transduction histidine kinase             61.2    9e-08   
ref|WP_017190163.1|  signal transduction histidine kinase             61.2    9e-08   
ref|WP_017817442.1|  signal transduction histidine kinase             61.2    9e-08   
ref|WP_005445768.1|  hypothetical protein                             61.2    9e-08   
ref|WP_038898070.1|  histidine kinase                                 61.2    9e-08   
ref|WP_009697801.1|  signal transduction histidine kinase             61.2    9e-08   
ref|WP_031451736.1|  hypothetical protein                             57.0    9e-08   
ref|WP_039443261.1|  histidine kinase                                 61.2    9e-08   
ref|WP_029788460.1|  histidine kinase                                 61.2    9e-08   
ref|WP_014371235.1|  histidine kinase                                 61.2    9e-08   
ref|WP_033192198.1|  histidine kinase                                 61.6    1e-07   
gb|EFI34654.1|  multi-sensor hybrid histidine kinase                  61.2    1e-07   
ref|WP_014222417.1|  ATPase                                           61.2    1e-07   
ref|WP_038578822.1|  histidine kinase                                 61.2    1e-07   
ref|WP_014205091.1|  sensor histidine kinase                          60.8    1e-07   
gb|KHA54499.1|  chemotaxis protein CheY                               61.2    1e-07   
ref|WP_005396491.1|  Signal transduction histidine kinase             60.8    1e-07   
ref|WP_034689688.1|  hypothetical protein                             61.2    1e-07   
ref|WP_004725975.1|  sensor histidine kinase                          60.8    1e-07   
ref|WP_020720253.1|  hypothetical protein                             60.5    1e-07   
ref|WP_040529036.1|  hypothetical protein                             60.8    1e-07   
gb|EYU30418.1|  hypothetical protein MIMGU_mgv1a019536mg              61.2    1e-07   
gb|EMT14854.1|  Two-component system protein A                        57.8    1e-07   
ref|WP_036569177.1|  hypothetical protein                             60.8    1e-07   
ref|WP_040378112.1|  hypothetical protein                             60.8    1e-07   
ref|WP_004733672.1|  signal transduction histidine kinase             60.8    1e-07   
ref|WP_011385307.1|  sensor protein barA                              61.2    1e-07   
ref|WP_008628423.1|  hypothetical protein                             60.8    1e-07   
ref|WP_012550210.1|  chemotaxis protein CheY                          60.8    1e-07   
gb|EXJ13377.1|  Sensor protein barA                                   61.2    1e-07   
gb|EHK61856.1|  Hpt sensor hybrid histidine kinase                    60.8    1e-07   
ref|WP_006742593.1|  signal transduction histidine kinase             60.8    1e-07   
ref|WP_005377471.1|  signal transduction histidine kinase             60.8    1e-07   
ref|WP_017080463.1|  signal transduction histidine kinase             60.8    1e-07   
ref|WP_017077226.1|  signal transduction histidine kinase             60.8    1e-07   
ref|WP_035540024.1|  hypothetical protein                             60.8    1e-07   
gb|KHD03373.1|  hypothetical protein OT06_60955                       56.6    1e-07   
ref|WP_005389164.1|  signal transduction histidine kinase             60.8    1e-07   
ref|WP_007018517.1|  probable sensor/response regulator hybrid        60.8    1e-07   



>ref|XP_002269033.1| PREDICTED: two-component response regulator ARR22 [Vitis vinifera]
 emb|CBI28655.3| unnamed protein product [Vitis vinifera]
Length=140

 Score =   115 bits (288),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 67/118 (57%), Positives = 84/118 (71%), Gaps = 0/118 (0%)
 Frame = +2

Query  92   KGLTALVVEDSPILQLVHKTLLKKYgvevqvvnngeeavvLHRSGARFDLLLMDKEMPIK  271
            K ++ L+VED P++Q +HK ++ K+G EVQVV NG+E V L+RSGA FDL+LMD EMPI 
Sbjct  20   KKISVLIVEDDPLIQKIHKVMMAKFGTEVQVVANGKEVVDLYRSGASFDLILMDFEMPIM  79

Query  272  DGVNATKELREMGVKSMIVGATSHGPGPVRDEFLAAGLDECLVKPLRAEVVLGVINKL  445
            DG  ATKELR MGV SMIVG TS         F+ +GL+ C VKPL AE V  V+N+L
Sbjct  80   DGFEATKELRSMGVTSMIVGVTSRSQDSEIQAFMKSGLNACYVKPLNAEKVTAVLNEL  137



>gb|KHG18578.1| Two-component response regulator ARR22 -like protein [Gossypium 
arboreum]
Length=146

 Score =   109 bits (273),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 69/114 (61%), Positives = 83/114 (73%), Gaps = 2/114 (2%)
 Frame = +2

Query  86   VGKGLTALVVEDSPILQLVHKTLLKKYgvevqvvnngeeavvLHRSGARFDLLLMDKEMP  265
            V   LTALVV+DSP+L+L+H   LKKYG++VQV  NG+ AV L   GA FDL+LMDKEMP
Sbjct  20   VNNNLTALVVDDSPLLRLLHDIHLKKYGLKVQVAENGKVAVDLFHLGASFDLVLMDKEMP  79

Query  266  IKDGVNATKELREMGVKSMIVGATSH-GPGPVRDEFLAAGLDECLVKPLRAEVV  424
            + +GV ATKELR MGV SMIVG TS  GPG  +  F+ AGLD C  KPL  E++
Sbjct  80   VMNGVEATKELRAMGVTSMIVGVTSKDGPGE-QQAFMEAGLDYCFEKPLTPEII  132



>ref|XP_010102183.1| Two-component response regulator [Morus notabilis]
 gb|EXB93126.1| Two-component response regulator [Morus notabilis]
Length=178

 Score =   107 bits (266),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 57/118 (48%), Positives = 86/118 (73%), Gaps = 0/118 (0%)
 Frame = +2

Query  92   KGLTALVVEDSPILQLVHKTLLKKYgvevqvvnngeeavvLHRSGARFDLLLMDKEMPIK  271
            K L+ L+V+DS +++L+H T++ + G+E Q+  +G++AV LHRS A FDL+LMD EMP+ 
Sbjct  52   KKLSVLIVDDSSLIRLLHMTMVTRAGMEAQLAEDGKKAVDLHRSRASFDLILMDMEMPVM  111

Query  272  DGVNATKELREMGVKSMIVGATSHGPGPVRDEFLAAGLDECLVKPLRAEVVLGVINKL  445
            +GV AT+ELR MGV++MIVG TS+  GP R  F+ AGL++C  KPL  + V  ++  +
Sbjct  112  NGVEATRELRAMGVETMIVGVTSNSEGPERQAFVEAGLNDCYTKPLNDDKVAALVQAI  169



>ref|XP_002268738.1| PREDICTED: two-component response regulator ARR22 [Vitis vinifera]
Length=130

 Score =   105 bits (261),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 63/114 (55%), Positives = 81/114 (71%), Gaps = 0/114 (0%)
 Frame = +2

Query  104  ALVVEDSPILQLVHKTLLKKYgvevqvvnngeeavvLHRSGARFDLLLMDKEMPIKDGVN  283
             L+V+D P+ + +HK LL K G+E Q V NG+EAV L+RSGA FDL+LMD EMPI DG  
Sbjct  13   TLIVDDDPLTRRIHKVLLTKVGLETQAVENGKEAVDLYRSGASFDLILMDLEMPIMDGPK  72

Query  284  ATKELREMGVKSMIVGATSHGPGPVRDEFLAAGLDECLVKPLRAEVVLGVINKL  445
            ATKELR MGV+SMIVG T+      +  F+A+GLD+C VKPL  + V  ++ KL
Sbjct  73   ATKELRAMGVQSMIVGVTARDLEVEKQMFMASGLDDCYVKPLTTDTVTALVEKL  126



>ref|XP_011096653.1| PREDICTED: two-component response regulator ARR22-like isoform 
X1 [Sesamum indicum]
Length=148

 Score =   105 bits (261),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 59/116 (51%), Positives = 82/116 (71%), Gaps = 0/116 (0%)
 Frame = +2

Query  98   LTALVVEDSPILQLVHKTLLKKYgvevqvvnngeeavvLHRSGARFDLLLMDKEMPIKDG  277
            + ALVV+D P+++ +H  LL +YG+E +   NG+EAV L  SG  FDL+LMD EMP+ DG
Sbjct  28   ICALVVDDDPLVRRIHGMLLARYGLETEAAENGKEAVDLFLSGKTFDLVLMDMEMPVMDG  87

Query  278  VNATKELREMGVKSMIVGATSHGPGPVRDEFLAAGLDECLVKPLRAEVVLGVINKL  445
            + AT+ LR MGV SMIVG T+ G    ++ F+A GLD C VKPL AE ++ V+++L
Sbjct  88   LQATQRLRGMGVSSMIVGVTARGLEAEKEAFMATGLDACWVKPLNAEAIISVLDEL  143



>ref|XP_011096654.1| PREDICTED: two-component response regulator ARR22-like isoform 
X2 [Sesamum indicum]
Length=154

 Score =   105 bits (261),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 59/116 (51%), Positives = 82/116 (71%), Gaps = 0/116 (0%)
 Frame = +2

Query  98   LTALVVEDSPILQLVHKTLLKKYgvevqvvnngeeavvLHRSGARFDLLLMDKEMPIKDG  277
            + ALVV+D P+++ +H  LL +YG+E +   NG+EAV L  SG  FDL+LMD EMP+ DG
Sbjct  34   ICALVVDDDPLVRRIHGMLLARYGLETEAAENGKEAVDLFLSGKTFDLVLMDMEMPVMDG  93

Query  278  VNATKELREMGVKSMIVGATSHGPGPVRDEFLAAGLDECLVKPLRAEVVLGVINKL  445
            + AT+ LR MGV SMIVG T+ G    ++ F+A GLD C VKPL AE ++ V+++L
Sbjct  94   LQATQRLRGMGVSSMIVGVTARGLEAEKEAFMATGLDACWVKPLNAEAIISVLDEL  149



>ref|XP_011096655.1| PREDICTED: two-component response regulator ARR22-like isoform 
X3 [Sesamum indicum]
Length=146

 Score =   105 bits (261),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 59/116 (51%), Positives = 82/116 (71%), Gaps = 0/116 (0%)
 Frame = +2

Query  98   LTALVVEDSPILQLVHKTLLKKYgvevqvvnngeeavvLHRSGARFDLLLMDKEMPIKDG  277
            + ALVV+D P+++ +H  LL +YG+E +   NG+EAV L  SG  FDL+LMD EMP+ DG
Sbjct  26   ICALVVDDDPLVRRIHGMLLARYGLETEAAENGKEAVDLFLSGKTFDLVLMDMEMPVMDG  85

Query  278  VNATKELREMGVKSMIVGATSHGPGPVRDEFLAAGLDECLVKPLRAEVVLGVINKL  445
            + AT+ LR MGV SMIVG T+ G    ++ F+A GLD C VKPL AE ++ V+++L
Sbjct  86   LQATQRLRGMGVSSMIVGVTARGLEAEKEAFMATGLDACWVKPLNAEAIISVLDEL  141



>ref|XP_010549639.1| PREDICTED: two-component response regulator ARR22 [Tarenaya hassleriana]
Length=141

 Score =   102 bits (255),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 61/114 (54%), Positives = 79/114 (69%), Gaps = 1/114 (1%)
 Frame = +2

Query  107  LVVEDSPILQLVHKTLLKKYgvevqvvnngeeavvLHRSGARFDLLLMDKEMPIKDGVNA  286
            LVV+D PI + +H  L++++G       NGEEAV +HR+GA F+L+LMDKEMPI DG +A
Sbjct  24   LVVDDDPISRKIHVALVRRFGGVAVTAENGEEAVNIHRAGASFNLVLMDKEMPIMDGPSA  83

Query  287  TKELREMGVKSMIVGATSHGPGPV-RDEFLAAGLDECLVKPLRAEVVLGVINKL  445
            TKELR MGV SMIVG TS G     R+ F+ AGL++C  KPL  E +  V N+L
Sbjct  84   TKELRAMGVTSMIVGVTSLGNEEEHREAFMEAGLNQCFGKPLNIEKIAPVFNQL  137



>ref|XP_004304789.1| PREDICTED: two-component response regulator ARR22-like [Fragaria 
vesca subsp. vesca]
Length=126

 Score = 99.4 bits (246),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 57/118 (48%), Positives = 76/118 (64%), Gaps = 0/118 (0%)
 Frame = +2

Query  92   KGLTALVVEDSPILQLVHKTLLKKYgvevqvvnngeeavvLHRSGARFDLLLMDKEMPIK  271
            K + AL+ ED  + Q+ H+ LLK++  E  V  NG+EA+ L+RSGARFD++LMD EMPI 
Sbjct  6    KKIYALIAEDDRVTQMRHRMLLKRFKCESLVAGNGKEAIDLYRSGARFDVVLMDMEMPIM  65

Query  272  DGVNATKELREMGVKSMIVGATSHGPGPVRDEFLAAGLDECLVKPLRAEVVLGVINKL  445
            +G+ ATKELR MG + +IVG TS      +  F  AG D C  KPL  E V  ++ KL
Sbjct  66   NGLEATKELRAMGFEGLIVGVTSRDLEFAKQVFNEAGADSCYEKPLTTEYVTSILQKL  123



>ref|XP_010547349.1| PREDICTED: two-component response regulator ARR22-like [Tarenaya 
hassleriana]
Length=141

 Score = 99.4 bits (246),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 58/119 (49%), Positives = 77/119 (65%), Gaps = 1/119 (1%)
 Frame = +2

Query  92   KGLTALVVEDSPILQLVHKTLLKKYgvevqvvnngeeavvLHRSGARFDLLLMDKEMPIK  271
            K +  LVV+DSP+++ +H   +++ G       NGE A  +HR+GA FDL+LM+KEMPI 
Sbjct  19   KKVRVLVVDDSPVIRKIHVAFIQRLGGVAATAENGEVAGNIHRAGASFDLVLMNKEMPIM  78

Query  272  DGVNATKELREMGVKSMIVGATS-HGPGPVRDEFLAAGLDECLVKPLRAEVVLGVINKL  445
            DG+ ATKELREMGV SMIVG TS       +  F+ AGLD+CL KPL    +  + N L
Sbjct  79   DGLLATKELREMGVTSMIVGVTSLDNEEHKKKAFMEAGLDQCLEKPLTMHKISSLFNHL  137



>gb|KCW85327.1| hypothetical protein EUGRSUZ_B02166 [Eucalyptus grandis]
Length=161

 Score =   100 bits (248),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 57/120 (48%), Positives = 82/120 (68%), Gaps = 2/120 (2%)
 Frame = +2

Query  92   KGLTALVVEDSPILQLVHKTLLKKY--gvevqvvnngeeavvLHRSGARFDLLLMDKEMP  265
            K L+ L+V+D+ +++ +H  L+ +    VE +V  NG+ AV L RSG  FD++LMD EMP
Sbjct  38   KKLSVLIVDDNSMIRTIHNILVNRVGVEVESKVAENGKVAVDLFRSGESFDVVLMDWEMP  97

Query  266  IKDGVNATKELREMGVKSMIVGATSHGPGPVRDEFLAAGLDECLVKPLRAEVVLGVINKL  445
            + +G+ ATKELR MGV SMIVG TSH     +D F+AAGLD+C  KPL  E++  ++ K+
Sbjct  98   VMNGIEATKELRNMGVDSMIVGVTSHSMDTEKDTFMAAGLDDCYGKPLSIEILKNILQKM  157



>ref|XP_003625416.1| Chemotaxis protein cheY-like protein [Medicago truncatula]
 gb|AES81634.1| response regulator receiver domain protein [Medicago truncatula]
Length=140

 Score = 99.4 bits (246),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 59/126 (47%), Positives = 92/126 (73%), Gaps = 5/126 (4%)
 Frame = +2

Query  71   MDSKNVGKGLTALVVEDSPILQLVHKTLLKKYgvevqvvnngeeavvLHRSGARFDLLLM  250
            M+S++ G  LTAL+V+D  +++++H+ LLK+ GV+ + V NG+EAV +H +G RFD++LM
Sbjct  13   MESQDSGTELTALIVDDDKLVRMIHQGLLKRAGVKSEAVKNGKEAVDIHCNGQRFDIILM  72

Query  251  DKEMPIKDGVNATKELREMGVKSMIVGATSHGPGPVRDEFLAAGLDECLVKPLRAEVVLG  430
            DKEMPI +G+ ATK+LR MG+ SMIVG +S      + EF+ AG+++  VKPL     +G
Sbjct  73   DKEMPIMNGIEATKKLRSMGIGSMIVGVSSCTEAE-KQEFMEAGINDYQVKPL----TIG  127

Query  431  VINKLV  448
            V+N ++
Sbjct  128  VLNSIL  133



>gb|KCW85326.1| hypothetical protein EUGRSUZ_B02165 [Eucalyptus grandis]
Length=139

 Score = 98.2 bits (243),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 55/120 (46%), Positives = 80/120 (67%), Gaps = 2/120 (2%)
 Frame = +2

Query  92   KGLTALVVEDSPILQLVHKTLLKKYgvevqvvnnge--eavvLHRSGARFDLLLMDKEMP  265
            K L+ L+V+D  +++ +H  L+ + GVEV+         AV L RSG  FD++LMD EMP
Sbjct  16   KKLSVLIVDDDSMIRTIHTILVNRVGVEVESQVAENGKVAVDLFRSGESFDVILMDWEMP  75

Query  266  IKDGVNATKELREMGVKSMIVGATSHGPGPVRDEFLAAGLDECLVKPLRAEVVLGVINKL  445
            + +G+ ATKELR+MGV SMIVG TSH     +D F+AAGLD+C  KPL  +++  ++ K+
Sbjct  76   VMNGIEATKELRKMGVSSMIVGVTSHSMDVEKDTFMAAGLDDCYGKPLSIKILKNILQKM  135



>gb|KCW58098.1| hypothetical protein EUGRSUZ_H00822, partial [Eucalyptus grandis]
Length=120

 Score = 97.4 bits (241),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 56/116 (48%), Positives = 82/116 (71%), Gaps = 0/116 (0%)
 Frame = +2

Query  98   LTALVVEDSPILQLVHKTLLKKYgvevqvvnngeeavvLHRSGARFDLLLMDKEMPIKDG  277
            +TALVV+D+ + Q++H  LL   G+   VV NG+EAV +H SG +FDL+LMD++MP+ +G
Sbjct  1    VTALVVDDNKVSQMIHHQLLNVLGIVNHVVGNGKEAVEIHSSGKKFDLVLMDRDMPVMNG  60

Query  278  VNATKELREMGVKSMIVGATSHGPGPVRDEFLAAGLDECLVKPLRAEVVLGVINKL  445
            + ATK+LR+MGVKS I G +SH     R EF+ AGLD+   KPL    ++ V++K+
Sbjct  61   IEATKKLRDMGVKSTIAGVSSHSLSEERQEFIEAGLDDYHEKPLTIAKLVSVVSKI  116



>gb|EYU19145.1| hypothetical protein MIMGU_mgv1a018636mg [Erythranthe guttata]
Length=128

 Score = 97.1 bits (240),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 58/120 (48%), Positives = 78/120 (65%), Gaps = 1/120 (1%)
 Frame = +2

Query  89   GKGLTALVVEDSPILQLVHKTLLKKYgvevqvvnng-eeavvLHRSGARFDLLLMDKEMP  265
            GK + ALVV+D  + Q VH  LL+KYG+    V    +EAV L +SG  FDL++MD EMP
Sbjct  4    GKRVCALVVDDDRLSQRVHAALLRKYGILETEVVENGKEAVDLFKSGKTFDLVIMDLEMP  63

Query  266  IKDGVNATKELREMGVKSMIVGATSHGPGPVRDEFLAAGLDECLVKPLRAEVVLGVINKL  445
            + DG  AT+ELREMGV SMIVG T+      + EF+ AGLD C  KPL    ++ ++++L
Sbjct  64   VMDGSEATRELREMGVTSMIVGVTACEVEAEKAEFMRAGLDACWDKPLSGSAIIAMLDEL  123



>ref|XP_010026028.1| PREDICTED: two-component response regulator ARR22-like [Eucalyptus 
grandis]
Length=135

 Score = 97.1 bits (240),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 56/116 (48%), Positives = 82/116 (71%), Gaps = 0/116 (0%)
 Frame = +2

Query  98   LTALVVEDSPILQLVHKTLLKKYgvevqvvnngeeavvLHRSGARFDLLLMDKEMPIKDG  277
            +TALVV+D+ + Q++H  LL   G+   VV NG+EAV +H SG +FDL+LMD++MP+ +G
Sbjct  16   VTALVVDDNKVSQMIHHQLLNVLGIVNHVVGNGKEAVEIHSSGKKFDLVLMDRDMPVMNG  75

Query  278  VNATKELREMGVKSMIVGATSHGPGPVRDEFLAAGLDECLVKPLRAEVVLGVINKL  445
            + ATK+LR+MGVKS I G +SH     R EF+ AGLD+   KPL    ++ V++K+
Sbjct  76   IEATKKLRDMGVKSTIAGVSSHSLSEERQEFIEAGLDDYHEKPLTIAKLVSVVSKI  131



>ref|XP_010046358.1| PREDICTED: two-component response regulator ARR22-like [Eucalyptus 
grandis]
Length=161

 Score = 97.8 bits (242),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 57/120 (48%), Positives = 82/120 (68%), Gaps = 2/120 (2%)
 Frame = +2

Query  92   KGLTALVVEDSPILQLVHKTLLKKY--gvevqvvnngeeavvLHRSGARFDLLLMDKEMP  265
            K L+ L+V+D  +++ +H  L+ +    VE QV  NG+ AV L RSG  FD++LMD EMP
Sbjct  38   KKLSVLIVDDDSMIRTIHTILVNRVGVEVESQVAENGKVAVDLFRSGESFDVILMDWEMP  97

Query  266  IKDGVNATKELREMGVKSMIVGATSHGPGPVRDEFLAAGLDECLVKPLRAEVVLGVINKL  445
            + +G+ ATKELR+MGV SMIVG TSH     +D F+AAGLD+C  KPL  +++  ++ K+
Sbjct  98   VMNGIEATKELRKMGVSSMIVGVTSHSMDVEKDTFMAAGLDDCYGKPLSIKILKNILQKM  157



>ref|XP_006604866.1| PREDICTED: two-component response regulator ARR22-like [Glycine 
max]
Length=150

 Score = 97.4 bits (241),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 54/105 (51%), Positives = 77/105 (73%), Gaps = 1/105 (1%)
 Frame = +2

Query  98   LTALVVEDSPILQLVHKTLLKK-YgvevqvvnngeeavvLHRSGARFDLLLMDKEMPIKD  274
            ++AL+V+D  I++ +HKT+L++ + +E + V +G+EAV L RSG  FD++ MDKEMPI D
Sbjct  29   ISALIVDDDAIIRKIHKTMLERLFNIEAKTVRDGKEAVDLCRSGENFDIIFMDKEMPIMD  88

Query  275  GVNATKELREMGVKSMIVGATSHGPGPVRDEFLAAGLDECLVKPL  409
            G  ATK LR MGVKS+IVG T+   G  ++EFLA+G + C  KPL
Sbjct  89   GHEATKHLRAMGVKSIIVGITTRADGKDKEEFLASGSNHCFEKPL  133



>ref|XP_007030298.1| Response regulator 22, putative [Theobroma cacao]
 gb|EOY10800.1| Response regulator 22, putative [Theobroma cacao]
Length=148

 Score = 97.4 bits (241),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 60/116 (52%), Positives = 77/116 (66%), Gaps = 0/116 (0%)
 Frame = +2

Query  98   LTALVVEDSPILQLVHKTLLKKYgvevqvvnngeeavvLHRSGARFDLLLMDKEMPIKDG  277
             T LVV+D P+++ +H   LKK+G+  QVV NG+ AV L   GA F+L+LMDKEMPI DG
Sbjct  29   FTVLVVDDDPVIRKLHDMHLKKFGLSAQVVENGKRAVDLCHFGATFNLILMDKEMPIMDG  88

Query  278  VNATKELREMGVKSMIVGATSHGPGPVRDEFLAAGLDECLVKPLRAEVVLGVINKL  445
            V ATKELR MGV S+IVG TS         F+ AGLD C  KPL A+ +  ++ +L
Sbjct  89   VEATKELRAMGVNSLIVGVTSRDSQYETQAFMEAGLDFCFEKPLTADKISFILQEL  144



>ref|XP_002884437.1| hypothetical protein ARALYDRAFT_477689 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH60696.1| hypothetical protein ARALYDRAFT_477689 [Arabidopsis lyrata subsp. 
lyrata]
Length=137

 Score = 96.7 bits (239),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 64/125 (51%), Positives = 81/125 (65%), Gaps = 1/125 (1%)
 Frame = +2

Query  77   SKNVGKGLTALVVEDSPILQLVHKTLLKKYgvevqvvnngeeavvLHRSGARFDLLLMDK  256
            S  V K L  L+V+D P+   +H+ ++K  G   Q   NGEEAV+LHR GA FDL+LMDK
Sbjct  11   STEVKKKLNVLIVDDDPLNCRLHEMIIKTIGGISQTAKNGEEAVILHRGGASFDLILMDK  70

Query  257  EMPIKDGVNATKELREMGVKSMIVGATSHG-PGPVRDEFLAAGLDECLVKPLRAEVVLGV  433
            EMP +DGV+ TK+LREM V SMIVG TS       R  F+ AGL+ CL KPL    +L +
Sbjct  71   EMPERDGVSTTKKLREMKVTSMIVGVTSLADQEEERKAFMEAGLNHCLEKPLTKAKILPL  130

Query  434  INKLV  448
            IN L+
Sbjct  131  INHLL  135



>ref|XP_009124004.1| PREDICTED: two-component response regulator ARR22-like [Brassica 
rapa]
 gb|AAC62225.1| response regulator protein [Brassica napus]
 emb|CDY49350.1| BnaA05g33120D [Brassica napus]
 emb|CDY42914.1| BnaC05g47370D [Brassica napus]
Length=136

 Score = 96.7 bits (239),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 62/127 (49%), Positives = 87/127 (69%), Gaps = 2/127 (2%)
 Frame = +2

Query  74   DSKNVGKGLTALVVEDSPILQLVHKTLLKKYgvevqvvnngeeavvLHRSG-ARFDLLLM  250
            D + + K L  L+V+D P+  ++H+ ++K  G   Q  NNGEEAV++HR G + FDL+LM
Sbjct  8    DIEKIKKKLNVLIVDDDPLNLIIHEKIIKAIGGISQTANNGEEAVIIHRDGGSSFDLILM  67

Query  251  DKEMPIKDGVNATKELREMGVKSMIVGATSHGPG-PVRDEFLAAGLDECLVKPLRAEVVL  427
            DKEMP +DGV+ TK+LREM VKSMIVG TS       R  F+ AGL+ CL KPL  + ++
Sbjct  68   DKEMPERDGVSTTKKLREMEVKSMIVGVTSLADNEEERRAFMEAGLNHCLAKPLTKDKII  127

Query  428  GVINKLV  448
             +IN+L+
Sbjct  128  PLINQLM  134



>ref|XP_007147238.1| hypothetical protein PHAVU_006G107500g [Phaseolus vulgaris]
 gb|ESW19232.1| hypothetical protein PHAVU_006G107500g [Phaseolus vulgaris]
Length=134

 Score = 95.9 bits (237),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 54/108 (50%), Positives = 78/108 (72%), Gaps = 1/108 (1%)
 Frame = +2

Query  89   GKGLTALVVEDSPILQLVHKTLLKK-YgvevqvvnngeeavvLHRSGARFDLLLMDKEMP  265
            G  ++AL+V+D  +++ +HK +L++ + ++ + VN+G+EAV L+R GA FD++ MDKEMP
Sbjct  10   GSRISALIVDDDAMIRKIHKAMLERLFNMDAKTVNDGKEAVELYRCGANFDIIFMDKEMP  69

Query  266  IKDGVNATKELREMGVKSMIVGATSHGPGPVRDEFLAAGLDECLVKPL  409
            I DG  ATKELR MGVKS+IVG T+   G   +EFL AG + C  KPL
Sbjct  70   IMDGHEATKELRGMGVKSLIVGITTRADGKDTEEFLGAGSNYCFEKPL  117



>ref|XP_006371115.1| hypothetical protein POPTR_0019s04160g [Populus trichocarpa]
 gb|ERP48912.1| hypothetical protein POPTR_0019s04160g [Populus trichocarpa]
Length=133

 Score = 95.5 bits (236),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 57/113 (50%), Positives = 80/113 (71%), Gaps = 1/113 (1%)
 Frame = +2

Query  74   DSKNVGKG-LTALVVEDSPILQLVHKTLLKKYgvevqvvnngeeavvLHRSGARFDLLLM  250
            ++ N GK   + LVV+D  I+++VH+ L+   G++VQ   NG+EAV LH +GA FDL+LM
Sbjct  6    ENNNGGKNSFSVLVVDDDTIIRMVHRMLVTGLGLKVQEAKNGKEAVDLHINGASFDLILM  65

Query  251  DKEMPIKDGVNATKELREMGVKSMIVGATSHGPGPVRDEFLAAGLDECLVKPL  409
            D EMPI +G  AT+ELR MGVKS+IVG TSH    +  +F+ AGL+ C+ KP+
Sbjct  66   DMEMPIMNGPAATRELRAMGVKSIIVGVTSHTSESIHKDFMEAGLNHCVAKPM  118



>ref|XP_007147239.1| hypothetical protein PHAVU_006G107500g [Phaseolus vulgaris]
 gb|ESW19233.1| hypothetical protein PHAVU_006G107500g [Phaseolus vulgaris]
Length=146

 Score = 95.9 bits (237),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 54/108 (50%), Positives = 78/108 (72%), Gaps = 1/108 (1%)
 Frame = +2

Query  89   GKGLTALVVEDSPILQLVHKTLLKK-YgvevqvvnngeeavvLHRSGARFDLLLMDKEMP  265
            G  ++AL+V+D  +++ +HK +L++ + ++ + VN+G+EAV L+R GA FD++ MDKEMP
Sbjct  22   GSRISALIVDDDAMIRKIHKAMLERLFNMDAKTVNDGKEAVELYRCGANFDIIFMDKEMP  81

Query  266  IKDGVNATKELREMGVKSMIVGATSHGPGPVRDEFLAAGLDECLVKPL  409
            I DG  ATKELR MGVKS+IVG T+   G   +EFL AG + C  KPL
Sbjct  82   IMDGHEATKELRGMGVKSLIVGITTRADGKDTEEFLGAGSNYCFEKPL  129



>ref|XP_002268656.1| PREDICTED: two-component response regulator ARR22 [Vitis vinifera]
 emb|CAN76616.1| hypothetical protein VITISV_013274 [Vitis vinifera]
Length=131

 Score = 94.7 bits (234),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 56/116 (48%), Positives = 79/116 (68%), Gaps = 0/116 (0%)
 Frame = +2

Query  98   LTALVVEDSPILQLVHKTLLKKYgvevqvvnngeeavvLHRSGARFDLLLMDKEMPIKDG  277
            ++ALV +D  I+Q +HK LL K G+EV VV NG+E + L+RSG  FDL+ MD EMPI DG
Sbjct  12   ISALVADDDTIIQKIHKALLTKLGLEVNVVANGKEVLDLYRSGTSFDLIFMDMEMPIMDG  71

Query  278  VNATKELREMGVKSMIVGATSHGPGPVRDEFLAAGLDECLVKPLRAEVVLGVINKL  445
               TKELR MGV+S+I+G TS      ++ F+A+GL++C +KPL    +  ++  L
Sbjct  72   PEVTKELRAMGVQSIIMGVTSRDLDSEKEAFMASGLNDCYMKPLTISKISSLLQDL  127



>ref|XP_011004847.1| PREDICTED: two-component response regulator ARR22-like [Populus 
euphratica]
Length=151

 Score = 95.5 bits (236),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 56/126 (44%), Positives = 86/126 (68%), Gaps = 0/126 (0%)
 Frame = +2

Query  68   DMDSKNVGKGLTALVVEDSPILQLVHKTLLKKYgvevqvvnngeeavvLHRSGARFDLLL  247
            +M + N    +TALVV+D  I++ +H  LL K G+E  V  NG+EAV LH SG +FDL++
Sbjct  22   EMATSNGRTKITALVVDDDRIIKTIHSKLLSKLGIENHVAANGKEAVDLHCSGKKFDLIV  81

Query  248  MDKEMPIKDGVNATKELREMGVKSMIVGATSHGPGPVRDEFLAAGLDECLVKPLRAEVVL  427
            MD+EMPI +G+ AT+ELR +G++S+IVG ++   G    EF+ AGLD    KPL +  V+
Sbjct  82   MDREMPIMNGIEATRELRALGIRSIIVGVSTRSLGQEIQEFMDAGLDYYQEKPLTSSKVI  141

Query  428  GVINKL  445
             +++++
Sbjct  142  SILHQI  147



>ref|XP_002303092.1| hypothetical protein POPTR_0002s25430g [Populus trichocarpa]
 gb|EEE82365.1| hypothetical protein POPTR_0002s25430g [Populus trichocarpa]
Length=138

 Score = 93.2 bits (230),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 54/123 (44%), Positives = 85/123 (69%), Gaps = 0/123 (0%)
 Frame = +2

Query  77   SKNVGKGLTALVVEDSPILQLVHKTLLKKYgvevqvvnngeeavvLHRSGARFDLLLMDK  256
            S  +G  +TALVV+D  I Q +H  LL++ G+E QV  NG+EA+ +H SG +FDL+LMD+
Sbjct  8    SWKLGTKMTALVVDDDSINQTIHHRLLEQLGIENQVARNGKEAIDIHCSGKKFDLILMDR  67

Query  257  EMPIKDGVNATKELREMGVKSMIVGATSHGPGPVRDEFLAAGLDECLVKPLRAEVVLGVI  436
            +MPI +G+ AT++LR MG++SMI G ++        EF+ AGLD+   KPL +  ++ ++
Sbjct  68   DMPIMNGIEATRKLRAMGIRSMIAGVSTRCVKQEIQEFMEAGLDDYQEKPLTSAKIISIL  127

Query  437  NKL  445
            +K+
Sbjct  128  HKI  130



>ref|XP_002313833.1| hypothetical protein POPTR_0009s11120g [Populus trichocarpa]
 gb|EEE87788.1| hypothetical protein POPTR_0009s11120g [Populus trichocarpa]
Length=129

 Score = 92.8 bits (229),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 57/125 (46%), Positives = 86/125 (69%), Gaps = 0/125 (0%)
 Frame = +2

Query  71   MDSKNVGKGLTALVVEDSPILQLVHKTLLKKYgvevqvvnngeeavvLHRSGARFDLLLM  250
            M + N    +TALVV+D  I++ +H  LL K G+E QV  NGEEAV LH SG +FDL++M
Sbjct  1    MATSNGRTKITALVVDDDRIIKTIHSKLLSKLGIENQVAANGEEAVDLHCSGKKFDLIVM  60

Query  251  DKEMPIKDGVNATKELREMGVKSMIVGATSHGPGPVRDEFLAAGLDECLVKPLRAEVVLG  430
            D++MPI +G+ AT+ELR +G++S+IVG ++        EF+ AGLD+   KPL +  V+ 
Sbjct  61   DRDMPIMNGIEATRELRALGIRSIIVGVSTRSLEQEIQEFMDAGLDDYQEKPLTSSKVIS  120

Query  431  VINKL  445
            +++K+
Sbjct  121  ILHKI  125



>gb|KHN43143.1| GDSL esterase/lipase [Glycine soja]
Length=279

 Score = 95.5 bits (236),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 54/105 (51%), Positives = 77/105 (73%), Gaps = 1/105 (1%)
 Frame = +2

Query  98   LTALVVEDSPILQLVHKTLLKK-YgvevqvvnngeeavvLHRSGARFDLLLMDKEMPIKD  274
            ++AL+V+D  I++ +HKT+L++ + +E + V +G+EAV L RSG  FD++ MDKEMPI D
Sbjct  158  ISALIVDDDAIIRKIHKTMLERLFNIEAKTVRDGKEAVDLCRSGENFDIIFMDKEMPIMD  217

Query  275  GVNATKELREMGVKSMIVGATSHGPGPVRDEFLAAGLDECLVKPL  409
            G  ATK LR MGVKS+IVG T+   G  ++EFLA+G + C  KPL
Sbjct  218  GHEATKHLRAMGVKSIIVGITTRADGKDKEEFLASGSNHCFEKPL  262



>emb|CDX92062.1| BnaC03g33640D [Brassica napus]
Length=141

 Score = 92.4 bits (228),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 61/126 (48%), Positives = 83/126 (66%), Gaps = 2/126 (2%)
 Frame = +2

Query  77   SKNVGKGLTALVVEDSPILQLVHKTLLKKYgvevqvvnngeeavvLHRSG-ARFDLLLMD  253
            S  V K L  L+V+D P+++ +H+ ++K  G   Q   NGEEAV +HR G A FDL+LMD
Sbjct  14   SVEVKKKLNVLIVDDDPVIRKLHEIIIKSIGGISQTAKNGEEAVNIHRDGNASFDLILMD  73

Query  254  KEMPIKDGVNATKELREMGVKSMIVGATSHGPG-PVRDEFLAAGLDECLVKPLRAEVVLG  430
            KEMP +DG++ATK+LREM V SMI+G T+       R  F+ AGL+ CL KPL    +L 
Sbjct  74   KEMPERDGLSATKKLREMKVTSMIIGVTTLADNEEERKAFMEAGLNHCLAKPLSKAKILP  133

Query  431  VINKLV  448
            +IN L+
Sbjct  134  LINNLM  139



>ref|XP_004493838.1| PREDICTED: two-component response regulator ARR22-like [Cicer 
arietinum]
Length=134

 Score = 92.0 bits (227),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 55/113 (49%), Positives = 81/113 (72%), Gaps = 1/113 (1%)
 Frame = +2

Query  71   MDSKNVGKGLTALVVEDSPILQLVHKTLLKKYgvevqvvnngeeavvLHRSGARFDLLLM  250
            M+  N    L ALVV+D  +L+ +H+ LLK+ GV+ + V NG+EAV + R+G  FD++LM
Sbjct  1    MERVNSANQLRALVVDDDSLLRKIHQGLLKRAGVKYEAVKNGKEAVEIIRAGQSFDIILM  60

Query  251  DKEMPIKDGVNATKELREMGVKSMIVGATSHGPGPVRDEFLAAGLDECLVKPL  409
            DKEMPI +G+ ATK++R MG++S+IVG +S     ++ EF+ AGLD+  VKPL
Sbjct  61   DKEMPIMNGIQATKKMRSMGIRSVIVGVSSCSAAEIQ-EFMEAGLDDYQVKPL  112



>ref|XP_009134756.1| PREDICTED: two-component response regulator ARR22-like [Brassica 
rapa]
Length=143

 Score = 92.4 bits (228),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 58/123 (47%), Positives = 81/123 (66%), Gaps = 2/123 (2%)
 Frame = +2

Query  86   VGKGLTALVVEDSPILQLVHKTLLKKYgvevqvvnngeeavvLHRSG-ARFDLLLMDKEM  262
            V K L  L+V+D  +++ +H+ ++K  G   Q   NGEEAV +HR G A FDL+LMDKEM
Sbjct  19   VKKKLNVLIVDDDTVIRKLHENIIKSIGGISQTAKNGEEAVNIHRDGNASFDLILMDKEM  78

Query  263  PIKDGVNATKELREMGVKSMIVGATSHGPG-PVRDEFLAAGLDECLVKPLRAEVVLGVIN  439
            P +DG++ATK+LREM V +MI+G T+       R  F+ AGL+ CL KPL    +L +IN
Sbjct  79   PERDGLSATKKLREMKVTAMIIGVTTLADNEEERKAFMEAGLNHCLAKPLSKAKILPLIN  138

Query  440  KLV  448
             L+
Sbjct  139  NLM  141



>ref|XP_010026025.1| PREDICTED: two-component response regulator ARR22-like [Eucalyptus 
grandis]
Length=150

 Score = 92.4 bits (228),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 56/124 (45%), Positives = 83/124 (67%), Gaps = 0/124 (0%)
 Frame = +2

Query  98   LTALVVEDSPILQLVHKTLLKKYgvevqvvnngeeavvLHRSGARFDLLLMDKEMPIKDG  277
            +TALVV+D  + Q++H  LL   G+E  +V NG+EAV +H SG +F+L+LMD++MP+ +G
Sbjct  16   VTALVVDDDKVSQMIHHRLLNILGIENHIVGNGKEAVEIHLSGKKFNLILMDRDMPVMNG  75

Query  278  VNATKELREMGVKSMIVGATSHGPGPVRDEFLAAGLDECLVKPLRAEVVLGVINKLVA*N  457
            + ATK+LREMG++S I G +SH     R  F+ AGLD+   KPL    +L  I+K+    
Sbjct  76   IEATKKLREMGIRSTIAGVSSHSVSQERQAFIEAGLDDYHEKPLSVTKLLSAISKIKHKA  135

Query  458  EFDL  469
            E +L
Sbjct  136  EHEL  139



>ref|XP_007162622.1| hypothetical protein PHAVU_001G166700g [Phaseolus vulgaris]
 gb|ESW34616.1| hypothetical protein PHAVU_001G166700g [Phaseolus vulgaris]
Length=128

 Score = 91.7 bits (226),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 56/127 (44%), Positives = 83/127 (65%), Gaps = 3/127 (2%)
 Frame = +2

Query  71   MDSKNVGKGLTALVVEDSPILQLVHKTLLKKYgvevqvvnng-eeavvLHRSGARFDLLL  247
            M  KN    L ALVV+D  + ++ H+ LLKK GVE        ++AV LH +G  FDL+L
Sbjct  1    MKPKNSSSQLKALVVDDDRVNRMTHQALLKKVGVENLASVENGKKAVDLHCNGESFDLIL  60

Query  248  MDKEMPIKDGVNATKELREMGVKSMIVG-ATSHGPGPVRDEFLAAGLDECLVKPLRAEVV  424
            MDK+MP+ +G+ ATK+LR MG++ MIVG ++SHG   V + F+ AGLD+   KPL  + +
Sbjct  61   MDKDMPVMNGIEATKQLRSMGIRDMIVGVSSSHGAENV-EAFMEAGLDDYYTKPLTVDTL  119

Query  425  LGVINKL  445
              +++K+
Sbjct  120  KAILDKI  126



>ref|XP_011024538.1| PREDICTED: two-component response regulator ARR22-like [Populus 
euphratica]
Length=138

 Score = 91.7 bits (226),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 55/123 (45%), Positives = 84/123 (68%), Gaps = 0/123 (0%)
 Frame = +2

Query  77   SKNVGKGLTALVVEDSPILQLVHKTLLKKYgvevqvvnngeeavvLHRSGARFDLLLMDK  256
            S  +G  +TALVV+D  I Q +H  LL++ G+E QV  NG+EAV +H SG  FDL+LMD+
Sbjct  8    SWKLGTRMTALVVDDDSINQTIHHRLLEQLGIENQVARNGKEAVDIHCSGKTFDLILMDR  67

Query  257  EMPIKDGVNATKELREMGVKSMIVGATSHGPGPVRDEFLAAGLDECLVKPLRAEVVLGVI  436
            +MPI +G+ AT++LR MG++SMI G ++        EF+ AGLD+   KPL +  ++ ++
Sbjct  68   DMPIMNGIEATRKLRAMGIRSMIAGVSTRCVKQEIQEFMEAGLDDYQEKPLTSAKIISIL  127

Query  437  NKL  445
            +K+
Sbjct  128  HKI  130



>ref|XP_011002029.1| PREDICTED: two-component response regulator ARR22 [Populus euphratica]
Length=133

 Score = 90.5 bits (223),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 49/105 (47%), Positives = 74/105 (70%), Gaps = 0/105 (0%)
 Frame = +2

Query  95   GLTALVVEDSPILQLVHKTLLKKYgvevqvvnngeeavvLHRSGARFDLLLMDKEMPIKD  274
              + LVV++  ++++VH+ L+   G++VQ   NG+E V L+ +GA FDL+LMD EMPI +
Sbjct  14   SFSVLVVDNDTVIRMVHRMLMTSLGLKVQEAKNGKEVVDLYINGASFDLILMDMEMPIMN  73

Query  275  GVNATKELREMGVKSMIVGATSHGPGPVRDEFLAAGLDECLVKPL  409
            G  AT+ELR MGVKS+I+G TSH    +  +F+ AGL+ C+ KP+
Sbjct  74   GPAATRELRAMGVKSIIIGVTSHTSESIHKDFIEAGLNHCVAKPI  118



>ref|XP_007044274.1| Response regulator 24, putative [Theobroma cacao]
 gb|EOY00106.1| Response regulator 24, putative [Theobroma cacao]
Length=154

 Score = 90.9 bits (224),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 54/104 (52%), Positives = 80/104 (77%), Gaps = 1/104 (1%)
 Frame = +2

Query  98   LTALVVEDSPILQLVHKTLLKKYgvevqvvnngeeavvLHRSGARFDLLLMDKEMPIKDG  277
            + ALVV+D+ + Q +H TLL K+G+E +V+ NG+EAV  H SG +FDL+LMD++MP+ +G
Sbjct  36   IMALVVDDNLLNQRIHSTLLNKHGIETEVMGNGKEAVDAHLSGKKFDLILMDRDMPVMNG  95

Query  278  VNATKELREMGVKSMIVGATSHGPGPVRDEFLAAGLDECLVKPL  409
            + AT++LREMGV+S+IVG +SH    V+ EF+ AGL++   KPL
Sbjct  96   IQATRKLREMGVRSIIVGLSSHSSEQVK-EFMEAGLNDYQEKPL  138



>ref|XP_004292265.1| PREDICTED: two-component response regulator ARR22-like [Fragaria 
vesca subsp. vesca]
Length=140

 Score = 90.5 bits (223),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 55/116 (47%), Positives = 79/116 (68%), Gaps = 0/116 (0%)
 Frame = +2

Query  98   LTALVVEDSPILQLVHKTLLKKYgvevqvvnngeeavvLHRSGARFDLLLMDKEMPIKDG  277
            +TALVV+DS I Q +H+ LL+  G+E QV  NG+EAV +H SG +FDL+LMD +MPI +G
Sbjct  22   ITALVVDDSGINQSIHRKLLENLGIENQVAGNGKEAVDVHCSGKQFDLILMDMDMPIMNG  81

Query  278  VNATKELREMGVKSMIVGATSHGPGPVRDEFLAAGLDECLVKPLRAEVVLGVINKL  445
            + AT+ LR MG++S I G +SH       EF+ AGLD+   KPL    ++ ++ K+
Sbjct  82   IEATRTLRAMGIRSTIAGVSSHSHTETIQEFVKAGLDDYQEKPLTISKLVSILQKV  137



>dbj|BAG16381.1| two-component responsive regulator family protein [Brassica rapa 
var. perviridis]
Length=121

 Score = 90.1 bits (222),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 58/116 (50%), Positives = 79/116 (68%), Gaps = 2/116 (2%)
 Frame = +2

Query  86   VGKGLTALVVEDSPILQLVHKTLLKKYgvevqvvnngeeavvLHRSG-ARFDLLLMDKEM  262
            + K L  L+V+D P+  ++H+ ++K  G   Q  NNGEEAV++HR G + FDL+LMDKEM
Sbjct  4    IKKKLNVLIVDDDPLNLIIHEKIIKAIGGISQTANNGEEAVIIHRDGGSSFDLILMDKEM  63

Query  263  PIKDGVNATKELREMGVKSMIVGATSHGPG-PVRDEFLAAGLDECLVKPLRAEVVL  427
            P +DGV+ TK+LREM VKSMIVG TS       R  F+ AGL+ CL KPL  + ++
Sbjct  64   PERDGVSTTKKLREMEVKSMIVGVTSLADNEEERRAFMEAGLNHCLAKPLTKDKII  119



>ref|XP_006408204.1| hypothetical protein EUTSA_v10022233mg [Eutrema salsugineum]
 gb|ESQ49657.1| hypothetical protein EUTSA_v10022233mg [Eutrema salsugineum]
Length=138

 Score = 90.1 bits (222),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 60/121 (50%), Positives = 82/121 (68%), Gaps = 2/121 (2%)
 Frame = +2

Query  92   KGLTALVVEDSPILQLVHKTLLKKYgvevqvvnngeeavvLHRSG-ARFDLLLMDKEMPI  268
            K L  L+V+D P+   +H++++K  G   Q   NGEEAV++HR+G A FDL+LMDKEMP 
Sbjct  16   KKLNVLIVDDDPLNLKLHESIIKTIGGISQTAKNGEEAVIIHRAGGASFDLILMDKEMPE  75

Query  269  KDGVNATKELREMGVKSMIVGATSHGPG-PVRDEFLAAGLDECLVKPLRAEVVLGVINKL  445
            +DGV+ TK+LREM V SMIVG TS       R  F+ AGL+ CL KPL    +L +I++L
Sbjct  76   RDGVSTTKKLREMKVTSMIVGVTSLADHEEERRAFMEAGLNHCLAKPLTKAKILPLISRL  135

Query  446  V  448
            +
Sbjct  136  L  136



>ref|XP_010485797.1| PREDICTED: two-component response regulator ARR22-like [Camelina 
sativa]
Length=141

 Score = 90.1 bits (222),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 59/121 (49%), Positives = 79/121 (65%), Gaps = 2/121 (2%)
 Frame = +2

Query  92   KGLTALVVEDSPILQLVHKTLLKKYgvevqvvnngeeavvLHRSG-ARFDLLLMDKEMPI  268
            K L  L+V+D  I + +H  ++ + G   +   NGEEAV+LHR G A FDL+LMDKEMP 
Sbjct  19   KKLNVLIVDDDAINRTLHARIINQIGGVSKTAGNGEEAVILHRDGNASFDLILMDKEMPE  78

Query  269  KDGVNATKELREMGVKSMIVGATSHGPG-PVRDEFLAAGLDECLVKPLRAEVVLGVINKL  445
            +DG +ATK+LREM V SMI+G T+       R  F+ AGL+ CL KPL  E +L +IN L
Sbjct  79   RDGASATKKLREMKVTSMIIGVTTLADNEEERAAFMEAGLNHCLAKPLSKENLLPLINHL  138

Query  446  V  448
            +
Sbjct  139  L  139



>ref|XP_010026027.1| PREDICTED: two-component response regulator ARR22-like [Eucalyptus 
grandis]
Length=145

 Score = 90.1 bits (222),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 55/116 (47%), Positives = 78/116 (67%), Gaps = 0/116 (0%)
 Frame = +2

Query  98   LTALVVEDSPILQLVHKTLLKKYgvevqvvnngeeavvLHRSGARFDLLLMDKEMPIKDG  277
            LTALVV+D  + Q +H  LL   G+E  VV NG+EAV +H SG +F+L+LMD++MP+ +G
Sbjct  16   LTALVVDDDGVSQKIHHRLLNILGIENDVVANGKEAVDIHLSGKKFNLILMDRDMPVMNG  75

Query  278  VNATKELREMGVKSMIVGATSHGPGPVRDEFLAAGLDECLVKPLRAEVVLGVINKL  445
            + ATK LR+MG+ S I G +SH    ++ EF  AGLD    KPL    +L V++K+
Sbjct  76   IEATKRLRDMGIGSTIAGVSSHSSSKIKQEFTEAGLDVYHEKPLTVAKLLSVVSKI  131



>ref|XP_010463903.1| PREDICTED: LOW QUALITY PROTEIN: two-component response regulator 
ARR22-like [Camelina sativa]
Length=137

 Score = 89.7 bits (221),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 59/121 (49%), Positives = 79/121 (65%), Gaps = 2/121 (2%)
 Frame = +2

Query  92   KGLTALVVEDSPILQLVHKTLLKKYgvevqvvnngeeavvLHRSG-ARFDLLLMDKEMPI  268
            K L  L+V+D  I +++H  ++ + G   Q   NGEEAV+LHR G A FDL+LMDKEMP 
Sbjct  12   KKLNVLIVDDDAINRILHARIINQIGGVSQTAENGEEAVILHRDGNASFDLILMDKEMPK  71

Query  269  KDGVNATKELREMGVKSMIVGATSHGPG-PVRDEFLAAGLDECLVKPLRAEVVLGVINKL  445
            +DG +ATK+LR M V SMI+G T+       R  F+ AGL+ CL KPL  E +L +IN L
Sbjct  72   RDGASATKKLRNMKVTSMIIGVTTLADNEEERAAFMEAGLNHCLAKPLSKENLLPLINHL  131

Query  446  V  448
            +
Sbjct  132  L  132



>gb|KCW58097.1| hypothetical protein EUGRSUZ_H00821 [Eucalyptus grandis]
Length=135

 Score = 89.7 bits (221),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 55/116 (47%), Positives = 78/116 (67%), Gaps = 0/116 (0%)
 Frame = +2

Query  98   LTALVVEDSPILQLVHKTLLKKYgvevqvvnngeeavvLHRSGARFDLLLMDKEMPIKDG  277
            LTALVV+D  + Q +H  LL   G+E  VV NG+EAV +H SG +F+L+LMD++MP+ +G
Sbjct  16   LTALVVDDDGVSQKIHHRLLNILGIENDVVANGKEAVDIHLSGKKFNLILMDRDMPVMNG  75

Query  278  VNATKELREMGVKSMIVGATSHGPGPVRDEFLAAGLDECLVKPLRAEVVLGVINKL  445
            + ATK LR+MG+ S I G +SH    ++ EF  AGLD    KPL    +L V++K+
Sbjct  76   IEATKRLRDMGIGSTIAGVSSHSSSKIKQEFTEAGLDVYHEKPLTVAKLLSVVSKI  131



>ref|XP_008358470.1| PREDICTED: two-component response regulator ARR22-like [Malus 
domestica]
Length=131

 Score = 89.4 bits (220),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 55/124 (44%), Positives = 85/124 (69%), Gaps = 1/124 (1%)
 Frame = +2

Query  77   SKNVGKGLTALVVEDSPILQLVHKTLLKKYgvevqvvnngeeavvLHRSGARFDLLLMDK  256
            SKN    +TALVV+DS + Q++H  LL+ +G+E+QVV NG+EA+ +H SG +FDL+LMD 
Sbjct  4    SKNATTKITALVVDDSMVNQIIHHKLLENHGIEIQVVGNGKEAIDVHCSGKQFDLILMDM  63

Query  257  EMPIKDGVNATKELREMGVKSMIVGATSHGP-GPVRDEFLAAGLDECLVKPLRAEVVLGV  433
            +MP+ +G+ AT+ LR MG++S I G +SH        EF+ AG+D+   KPL    ++ +
Sbjct  64   DMPVMNGIEATRTLRAMGIRSTIAGVSSHSSLSEDAQEFMEAGIDDYQEKPLTPAKLVSI  123

Query  434  INKL  445
            + K+
Sbjct  124  LQKV  127



>ref|XP_003520624.1| PREDICTED: two-component response regulator ARR22-like [Glycine 
max]
 gb|KHN09412.1| Two-component response regulator ARR22 [Glycine soja]
Length=132

 Score = 89.4 bits (220),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 57/125 (46%), Positives = 84/125 (67%), Gaps = 0/125 (0%)
 Frame = +2

Query  71   MDSKNVGKGLTALVVEDSPILQLVHKTLLKKYgvevqvvnngeeavvLHRSGARFDLLLM  250
            M  +N+G  LTALVV+D+ I + +H+ LL+  G++ Q V NG+EAV +H  G RFDL+LM
Sbjct  1    MAHQNLGTKLTALVVDDNKINRKIHQKLLESVGMKNQGVENGQEAVDIHCHGQRFDLILM  60

Query  251  DKEMPIKDGVNATKELREMGVKSMIVGATSHGPGPVRDEFLAAGLDECLVKPLRAEVVLG  430
            D +MPI +G+ ATKELR MG+ SMIVG +S        +F+ AGL++   KPL    +  
Sbjct  61   DMDMPIMNGIEATKELRSMGIGSMIVGVSSRCTEAEIRKFMEAGLNDYHEKPLNNSKLSS  120

Query  431  VINKL  445
            +++K+
Sbjct  121  LLDKI  125



>ref|XP_006420329.1| hypothetical protein CICLE_v10006872mg [Citrus clementina]
 gb|ESR33569.1| hypothetical protein CICLE_v10006872mg [Citrus clementina]
 gb|KDO43342.1| hypothetical protein CISIN_1g048318mg [Citrus sinensis]
Length=145

 Score = 89.7 bits (221),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 55/120 (46%), Positives = 79/120 (66%), Gaps = 0/120 (0%)
 Frame = +2

Query  98   LTALVVEDSPILQLVHKTLLKKYgvevqvvnngeeavvLHRSGARFDLLLMDKEMPIKDG  277
            L ALVV+D   ++ +H   LK  G +V+V  NG+EAV L RSGA+FD++ +DKEMP+ +G
Sbjct  26   LFALVVDDDCFIRTIHSMALKSLGFKVEVAENGKEAVDLFRSGAKFDIVFIDKEMPVMNG  85

Query  278  VNATKELREMGVKSMIVGATSHGPGPVRDEFLAAGLDECLVKPLRAEVVLGVINKLVA*N  457
            + AT+E+R MG+K  IVG TS      R+ F+ AGLD C  KPL  + +L ++  L+  N
Sbjct  86   IEATREIRSMGIKIKIVGVTSLNSEAEREAFMQAGLDLCHTKPLSVDKILPLMEDLMKNN  145



>dbj|BAG16375.1| two-component responsive regulator family protein [Brassica oleracea 
var. italica]
Length=121

 Score = 88.6 bits (218),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 57/116 (49%), Positives = 79/116 (68%), Gaps = 2/116 (2%)
 Frame = +2

Query  86   VGKGLTALVVEDSPILQLVHKTLLKKYgvevqvvnngeeavvLHRSG-ARFDLLLMDKEM  262
            + K L  L+V+D P+  ++H+ +++  G   Q  NNGEEAV++HR G + FDL+LMDKEM
Sbjct  4    IKKKLNVLIVDDDPLNLIIHEKIIEAIGGISQTANNGEEAVIIHRDGGSSFDLILMDKEM  63

Query  263  PIKDGVNATKELREMGVKSMIVGATSHGPG-PVRDEFLAAGLDECLVKPLRAEVVL  427
            P +DGV+ TK+LREM VKSMIVG TS       R  F+ AGL+ CL KPL  + ++
Sbjct  64   PERDGVSTTKKLREMEVKSMIVGVTSLADNEEERRAFMEAGLNHCLAKPLTKDKII  119



>ref|XP_010463905.1| PREDICTED: two-component response regulator ARR22-like [Camelina 
sativa]
Length=144

 Score = 88.6 bits (218),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 60/125 (48%), Positives = 79/125 (63%), Gaps = 2/125 (2%)
 Frame = +2

Query  80   KNVGKGLTALVVEDSPILQLVHKTLLKKYgvevqvvnngeeavvLHRSG-ARFDLLLMDK  256
            K   K L  L+V+D  I + +H  ++ + G   Q   NGEEAV+LHR G A FDL+LMDK
Sbjct  15   KETKKKLNVLIVDDDAINRKLHARIINQIGGVSQTAENGEEAVILHRDGNASFDLILMDK  74

Query  257  EMPIKDGVNATKELREMGVKSMIVGATSHGPG-PVRDEFLAAGLDECLVKPLRAEVVLGV  433
            EMP +DG +ATK+LR M V SMI+G T+       R  F+ AGL+ CL KPL  E +L +
Sbjct  75   EMPKRDGASATKKLRAMKVTSMIIGVTTLADNEEERAAFMEAGLNHCLAKPLSKENLLPL  134

Query  434  INKLV  448
            IN L+
Sbjct  135  INHLL  139



>ref|XP_006299637.1| hypothetical protein CARUB_v10015824mg [Capsella rubella]
 gb|EOA32535.1| hypothetical protein CARUB_v10015824mg [Capsella rubella]
Length=141

 Score = 88.2 bits (217),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 60/118 (51%), Positives = 78/118 (66%), Gaps = 2/118 (2%)
 Frame = +2

Query  98   LTALVVEDSPILQLVHKTLLKKYgvevqvvnngeeavvLHRSG-ARFDLLLMDKEMPIKD  274
            L  L+V+D  + +++H  ++K  G   Q   NGEEAV+LH  G A FDL+LMDKEMP +D
Sbjct  21   LNVLIVDDDALNRILHDKIIKTIGGVSQTAKNGEEAVILHLDGKASFDLILMDKEMPERD  80

Query  275  GVNATKELREMGVKSMIVGATSHGPG-PVRDEFLAAGLDECLVKPLRAEVVLGVINKL  445
            GV+ATK+LREM V SMIVG TS       R  F+ AGL+ CL KPL  + +L +IN L
Sbjct  81   GVSATKKLREMKVTSMIVGVTSLADNEEERKAFMEAGLNHCLAKPLTKDKLLPLINHL  138



>ref|NP_850864.1| response regulator 24 [Arabidopsis thaliana]
 gb|AED93557.1| response regulator 24 [Arabidopsis thaliana]
Length=139

 Score = 87.8 bits (216),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 54/116 (47%), Positives = 80/116 (69%), Gaps = 0/116 (0%)
 Frame = +2

Query  98   LTALVVEDSPILQLVHKTLLKKYgvevqvvnngeeavvLHRSGARFDLLLMDKEMPIKDG  277
            LTALVV+DS + Q +H+ LL + G++  VV NG+EAV ++ SG  +DL+LMD +MPI +G
Sbjct  18   LTALVVDDSFVNQTIHQKLLNRLGIKNDVVTNGKEAVDVYCSGGNYDLILMDMDMPIMNG  77

Query  278  VNATKELREMGVKSMIVGATSHGPGPVRDEFLAAGLDECLVKPLRAEVVLGVINKL  445
            + ATK LREMG++S I G T+      + EF+ AGL++   KPL    +L +++KL
Sbjct  78   IQATKRLREMGIESKIAGVTTRANEGEKKEFMEAGLNDFQEKPLTISKLLSILHKL  133



>ref|XP_006420328.1| hypothetical protein CICLE_v10006814mg [Citrus clementina]
 gb|ESR33568.1| hypothetical protein CICLE_v10006814mg [Citrus clementina]
Length=145

 Score = 88.2 bits (217),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 52/118 (44%), Positives = 79/118 (67%), Gaps = 0/118 (0%)
 Frame = +2

Query  104  ALVVEDSPILQLVHKTLLKKYgvevqvvnngeeavvLHRSGARFDLLLMDKEMPIKDGVN  283
            ALVV+D P ++ +H   LK  G +V+V  NG+EAV L R+GA+FD++ +DKEMP+ +G+ 
Sbjct  28   ALVVDDDPFIRTIHSMALKSLGFKVEVAENGKEAVDLFRAGAKFDIVFIDKEMPVMNGIE  87

Query  284  ATKELREMGVKSMIVGATSHGPGPVRDEFLAAGLDECLVKPLRAEVVLGVINKLVA*N  457
            AT+E+R MG+++ IVG TS      ++ F+ AGLD C  KPL    +L ++  L+  N
Sbjct  88   ATREIRSMGIETKIVGVTSLNSETEKEAFMQAGLDLCHTKPLNVCKILPLMEDLMKNN  145



>ref|XP_002872214.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH48473.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=139

 Score = 87.4 bits (215),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 55/116 (47%), Positives = 80/116 (69%), Gaps = 0/116 (0%)
 Frame = +2

Query  98   LTALVVEDSPILQLVHKTLLKKYgvevqvvnngeeavvLHRSGARFDLLLMDKEMPIKDG  277
            LTALVV+DS + Q +H+ LL + G+E  VV NG+EAV ++ SG  +DL+LMD +MPI +G
Sbjct  18   LTALVVDDSFVNQTIHQKLLNRLGIENDVVTNGKEAVDVYCSGRNYDLILMDMDMPIMNG  77

Query  278  VNATKELREMGVKSMIVGATSHGPGPVRDEFLAAGLDECLVKPLRAEVVLGVINKL  445
            + ATK LREMG++S I G T+      + EF+ AGL++   KPL    +L +++KL
Sbjct  78   IQATKRLREMGIESKIAGVTTRANEGEKKEFMEAGLNDFQEKPLTISKLLSILHKL  133



>ref|XP_008813032.1| PREDICTED: two-component response regulator ARR22-like [Phoenix 
dactylifera]
Length=135

 Score = 87.4 bits (215),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 54/106 (51%), Positives = 72/106 (68%), Gaps = 0/106 (0%)
 Frame = +2

Query  98   LTALVVEDSPILQLVHKTLLKKYgvevqvvnngeeavvLHRSGARFDLLLMDKEMPIKDG  277
            L ALVV+D+ +++L   +LLKK  VE +V  +G+ AV     G  +D++LMDK+MP  DG
Sbjct  17   LRALVVDDNRMIRLYMVSLLKKANVEAEVAEDGKAAVNCFLQGKTYDIILMDKDMPQMDG  76

Query  278  VNATKELREMGVKSMIVGATSHGPGPVRDEFLAAGLDECLVKPLRA  415
            V AT+ LREMGVK+ IVG TSH     + EFL AGLD+  VKPL +
Sbjct  77   VQATRILREMGVKTKIVGVTSHSTEEEKREFLEAGLDDFFVKPLTS  122



>ref|XP_006480178.1| PREDICTED: two-component response regulator ARR22-like [Citrus 
sinensis]
Length=129

 Score = 87.0 bits (214),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 51/116 (44%), Positives = 82/116 (71%), Gaps = 0/116 (0%)
 Frame = +2

Query  98   LTALVVEDSPILQLVHKTLLKKYgvevqvvnngeeavvLHRSGARFDLLLMDKEMPIKDG  277
            +TALVV+D+ +++ +H  LL+  G+E QV  NG+EAV +H SG  FDL+LMD +MP+ +G
Sbjct  9    ITALVVDDNMVVRAIHHRLLQDLGIENQVAVNGKEAVDVHSSGQYFDLILMDMDMPVMNG  68

Query  278  VNATKELREMGVKSMIVGATSHGPGPVRDEFLAAGLDECLVKPLRAEVVLGVINKL  445
            + AT++LR MG++S I G +S      + EF+ AGLD+   KPL A+ ++ +++K+
Sbjct  69   IEATRKLRAMGIRSTIAGISSRSLEREKQEFMEAGLDDYHEKPLTADKIVSILHKI  124



>ref|XP_006604528.1| PREDICTED: two-component response regulator ARR22-like [Glycine 
max]
Length=108

 Score = 86.3 bits (212),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 48/105 (46%), Positives = 74/105 (70%), Gaps = 0/105 (0%)
 Frame = +2

Query  92   KGLTALVVEDSPILQLVHKTLLKKYgvevqvvnngeeavvLHRSGARFDLLLMDKEMPIK  271
            + LTAL+VED  ++++VH+ +L   G+++QV  NG+EA+ +H SG  FDL+LMD++MP+ 
Sbjct  4    RQLTALIVEDDMVIRMVHQKILNSVGLKIQVAENGKEAIEIHGSGQSFDLILMDRDMPVM  63

Query  272  DGVNATKELREMGVKSMIVGATSHGPGPVRDEFLAAGLDECLVKP  406
            +G+ ATK LR MG+ SMI G ++        EF+ AGLD+ + KP
Sbjct  64   NGIEATKTLRSMGINSMITGVSTRSVAAHIREFMEAGLDDYVEKP  108



>ref|XP_003625472.1| Extra response regulator [Medicago truncatula]
 gb|AES81690.1| response regulator receiver domain protein [Medicago truncatula]
Length=130

 Score = 86.7 bits (213),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 56/123 (46%), Positives = 81/123 (66%), Gaps = 0/123 (0%)
 Frame = +2

Query  80   KNVGKGLTALVVEDSPILQLVHKTLLKKYgvevqvvnngeeavvLHRSGARFDLLLMDKE  259
            +N    LTALVV+D+ I + +H+ +L K+GV+ Q V NG+EAV +H  G +FDL+LMD +
Sbjct  5    QNFVSKLTALVVDDNIINRKIHQKMLNKFGVKSQGVENGKEAVDIHWRGQKFDLILMDMD  64

Query  260  MPIKDGVNATKELREMGVKSMIVGATSHGPGPVRDEFLAAGLDECLVKPLRAEVVLGVIN  439
            MPI +G+ ATKELR MG+ S IVG +S        +F+ AGLDE   KPL   ++  ++ 
Sbjct  65   MPIMNGIEATKELRAMGICSTIVGVSSRSMEDEILKFMEAGLDEYQEKPLNNAILSSILG  124

Query  440  KLV  448
            K+ 
Sbjct  125  KIT  127



>ref|XP_006443675.1| hypothetical protein CICLE_v10024122mg [Citrus clementina]
 gb|ESR56915.1| hypothetical protein CICLE_v10024122mg [Citrus clementina]
Length=141

 Score = 86.7 bits (213),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 51/116 (44%), Positives = 82/116 (71%), Gaps = 0/116 (0%)
 Frame = +2

Query  98   LTALVVEDSPILQLVHKTLLKKYgvevqvvnngeeavvLHRSGARFDLLLMDKEMPIKDG  277
            +TALVV+D+ +++ +H  LL+  G+E QV  NG+EAV +H SG  FDL+LMD +MP+ +G
Sbjct  21   ITALVVDDNMVVRAIHHRLLQDLGIENQVAVNGKEAVDVHSSGQYFDLILMDMDMPVMNG  80

Query  278  VNATKELREMGVKSMIVGATSHGPGPVRDEFLAAGLDECLVKPLRAEVVLGVINKL  445
            + AT++LR MG++S I G +S      + EF+ AGLD+   KPL A+ ++ +++K+
Sbjct  81   IEATRKLRAMGIRSTIAGISSRSLEREKQEFMEAGLDDYHEKPLTADKIVSILHKI  136



>gb|KDO65835.1| hypothetical protein CISIN_1g039027mg [Citrus sinensis]
Length=145

 Score = 87.0 bits (214),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 51/116 (44%), Positives = 82/116 (71%), Gaps = 0/116 (0%)
 Frame = +2

Query  98   LTALVVEDSPILQLVHKTLLKKYgvevqvvnngeeavvLHRSGARFDLLLMDKEMPIKDG  277
            +TALVV+D+ +++ +H  LL+  G+E QV  NG+EAV +H SG  FDL+LMD +MP+ +G
Sbjct  25   ITALVVDDNMVVRAIHHRLLQDLGIENQVAVNGKEAVDVHSSGQYFDLILMDMDMPVMNG  84

Query  278  VNATKELREMGVKSMIVGATSHGPGPVRDEFLAAGLDECLVKPLRAEVVLGVINKL  445
            + AT++LR MG++S I G +S      + EF+ AGLD+   KPL A+ ++ +++K+
Sbjct  85   IEATRKLRAMGIRSTIAGISSRSLEREKQEFMEAGLDDYHEKPLTADKIVSILHKI  140



>ref|XP_009614376.1| PREDICTED: two-component response regulator ARR22-like [Nicotiana 
tomentosiformis]
Length=149

 Score = 87.0 bits (214),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 56/122 (46%), Positives = 77/122 (63%), Gaps = 2/122 (2%)
 Frame = +2

Query  86   VGKGLTALVVEDSPILQLVHKTLLKKYgvevqvvnngeeavvLHR-SGARFDLLLMDKEM  262
            VGK L  L+V+D  + Q  H   L+K GVE   V NG  AV +H  +  RFDL+ M+  +
Sbjct  24   VGKQLKVLIVDDDDVSQTTHILFLQKCGVETLGVRNGNVAVNIHDITQMRFDLIFMNSVL  83

Query  263  PIKDGVNATKELREMGVKSMIVGATS-HGPGPVRDEFLAAGLDECLVKPLRAEVVLGVIN  439
            P+ DG+ ATK+LREMG+ +MIVG T+ +    VR EF+ AGLD+C  KPL  E+   ++ 
Sbjct  84   PLMDGIQATKKLREMGITTMIVGMTNVNDKEEVRKEFMEAGLDDCYEKPLTPEIFRSLLE  143

Query  440  KL  445
            KL
Sbjct  144  KL  145



>ref|XP_010493902.1| PREDICTED: two-component response regulator ARR22-like [Camelina 
sativa]
Length=135

 Score = 86.3 bits (212),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 54/116 (47%), Positives = 79/116 (68%), Gaps = 0/116 (0%)
 Frame = +2

Query  98   LTALVVEDSPILQLVHKTLLKKYgvevqvvnngeeavvLHRSGARFDLLLMDKEMPIKDG  277
            LTALVV+D+ + Q +H+ LL + G++  VV NG+EAV  H SG  +DL+LMD +MPI +G
Sbjct  14   LTALVVDDNFVNQSIHQKLLARLGIQNDVVCNGKEAVDAHCSGRNYDLILMDMDMPIMNG  73

Query  278  VNATKELREMGVKSMIVGATSHGPGPVRDEFLAAGLDECLVKPLRAEVVLGVINKL  445
            + ATK LREMG++S I G T+      + EF+ AGL++   KPL    +L +++KL
Sbjct  74   IQATKRLREMGIESKIAGVTTRANEGEKKEFMEAGLNDFQEKPLTISKLLSILHKL  129



>ref|NP_187078.1| two-component response regulator ARR22 [Arabidopsis thaliana]
 ref|NP_850511.1| two-component response regulator ARR22 [Arabidopsis thaliana]
 ref|NP_001078102.1| two-component response regulator ARR22 [Arabidopsis thaliana]
 sp|Q9M8Y4.1|ARR22_ARATH RecName: Full=Two-component response regulator ARR22 [Arabidopsis 
thaliana]
 gb|AAF26786.1|AC016829_10 putative response regulator protein (receiver component) [Arabidopsis 
thaliana]
 gb|AAM62859.1| putative response regulator protein (receiver component) [Arabidopsis 
thaliana]
 gb|AEE74060.1| two-component response regulator ARR22 [Arabidopsis thaliana]
 gb|AEE74061.1| two-component response regulator ARR22 [Arabidopsis thaliana]
 gb|AEE74062.1| two-component response regulator ARR22 [Arabidopsis thaliana]
Length=142

 Score = 86.7 bits (213),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 59/120 (49%), Positives = 78/120 (65%), Gaps = 2/120 (2%)
 Frame = +2

Query  92   KGLTALVVEDSPILQLVHKTLLKKYgvevqvvnngeeavvLHRSG-ARFDLLLMDKEMPI  268
            K +  L+V+D P+ + +H+ ++K  G   Q   NGEEAV+LHR G A FDL+LMDKEMP 
Sbjct  20   KLINVLIVDDDPLNRRLHEMIIKTIGGISQTAKNGEEAVILHRDGEASFDLILMDKEMPE  79

Query  269  KDGVNATKELREMGVKSMIVGATS-HGPGPVRDEFLAAGLDECLVKPLRAEVVLGVINKL  445
            +DGV+ TK+LREM V SMIVG TS       R  F+ AGL+ CL KPL    +  +I+ L
Sbjct  80   RDGVSTTKKLREMKVTSMIVGVTSVADQEEERKAFMEAGLNHCLEKPLTKAKIFPLISHL  139



>ref|XP_010046359.1| PREDICTED: two-component response regulator ARR22-like [Eucalyptus 
grandis]
Length=182

 Score = 87.4 bits (215),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 57/141 (40%), Positives = 82/141 (58%), Gaps = 23/141 (16%)
 Frame = +2

Query  92   KGLTALVVEDSPILQLVHKTLLKKY--gvevqvvnngeeavvLHRSGARFDLLLMDKEMP  265
            K L+ L+V+D+ +++ +H  L+ +    VE +V  NG+ AV L RSG  FD++LMD EMP
Sbjct  38   KKLSVLIVDDNSMIRTIHNILVNRVGVEVESKVAENGKVAVDLFRSGESFDVVLMDWEMP  97

Query  266  IKDGV---------------------NATKELREMGVKSMIVGATSHGPGPVRDEFLAAG  382
            + +G+                      ATKELR MGV SMIVG TSH     +D F+AAG
Sbjct  98   VMNGIEFSLIIKYPFCAVTTAFHLPPQATKELRNMGVDSMIVGVTSHSMDTEKDTFMAAG  157

Query  383  LDECLVKPLRAEVVLGVINKL  445
            LD+C  KPL  E++  ++ K+
Sbjct  158  LDDCYGKPLSIEILKNILQKM  178



>ref|XP_010413329.1| PREDICTED: two-component response regulator ARR22-like [Camelina 
sativa]
 ref|XP_010413395.1| PREDICTED: two-component response regulator ARR22-like [Camelina 
sativa]
Length=139

 Score = 86.3 bits (212),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 60/121 (50%), Positives = 77/121 (64%), Gaps = 2/121 (2%)
 Frame = +2

Query  92   KGLTALVVEDSPILQLVHKTLLKKYgvevqvvnngeeavvLHRSG-ARFDLLLMDKEMPI  268
            K L  L+V+D  I + +H  ++   G   Q   NGEEAV+LHR G A FDL+LMDKEMP 
Sbjct  17   KILNVLIVDDDAINRRLHARIINLIGGVSQTAENGEEAVILHRDGNASFDLILMDKEMPE  76

Query  269  KDGVNATKELREMGVKSMIVGATSHGPGPV-RDEFLAAGLDECLVKPLRAEVVLGVINKL  445
             DG +ATK+LREM V SMI+G T+       R  F+ AGL+ CL KPL  E +L +IN L
Sbjct  77   TDGASATKKLREMKVTSMIIGVTTLADNEEKRAAFMEAGLNHCLAKPLSKENLLPLINHL  136

Query  446  V  448
            +
Sbjct  137  L  137



>ref|XP_006489755.1| PREDICTED: two-component response regulator ARR22-like [Citrus 
sinensis]
Length=138

 Score = 86.3 bits (212),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 48/103 (47%), Positives = 72/103 (70%), Gaps = 0/103 (0%)
 Frame = +2

Query  104  ALVVEDSPILQLVHKTLLKKYgvevqvvnngeeavvLHRSGARFDLLLMDKEMPIKDGVN  283
            ALVV+D P ++ +H   LK  G +V+V  NG+EAV L R+GA+FD++ +DKEMP+ +G+ 
Sbjct  21   ALVVDDDPFIRTIHSMALKSLGFKVEVAENGKEAVDLFRAGAKFDIVFIDKEMPVMNGIE  80

Query  284  ATKELREMGVKSMIVGATSHGPGPVRDEFLAAGLDECLVKPLR  412
            AT+E+R +G+++ IVG TS      ++ F+ AGLD C  KPL 
Sbjct  81   ATREIRSLGIETKIVGVTSLNSETEKEAFMQAGLDLCHTKPLN  123



>ref|XP_002522025.1| sensory transduction histidine kinase bacterial, putative [Ricinus 
communis]
 gb|EEF40429.1| sensory transduction histidine kinase bacterial, putative [Ricinus 
communis]
Length=181

 Score = 87.0 bits (214),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 51/116 (44%), Positives = 75/116 (65%), Gaps = 1/116 (1%)
 Frame = +2

Query  89   GKGLTALVVEDSPILQLVHKTLLKKYgvevqvvnngeeavvLHRSGARFDLLLMDKEMPI  268
             K L+ L+V+D+ +L+ +HK +L + G+EV +  NG+EAV  HR+GA FDL+LMD +MPI
Sbjct  24   SKPLSVLLVDDNIVLRTIHKAMLTRQGMEVHLAVNGQEAVEFHRAGASFDLILMDLDMPI  83

Query  269  KDGVNATKELREMGVKSMIVGATSHGPGPVRDEFLAAGLDECLVKPLRAEVVLGVI  436
             DG  ATKELR+MG+   I+G  +      R  F+ +GLD+C+  P   E +   I
Sbjct  84   MDGCQATKELRDMGINCAIIGVAACSDSE-RKTFMESGLDDCISVPFSLEKIACYI  138



>ref|XP_006286701.1| hypothetical protein CARUB_v10002781mg [Capsella rubella]
 gb|EOA19599.1| hypothetical protein CARUB_v10002781mg [Capsella rubella]
Length=137

 Score = 85.9 bits (211),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 55/116 (47%), Positives = 79/116 (68%), Gaps = 0/116 (0%)
 Frame = +2

Query  98   LTALVVEDSPILQLVHKTLLKKYgvevqvvnngeeavvLHRSGARFDLLLMDKEMPIKDG  277
            LTALVV+D+ + Q +HK LL + G+E  VV NG+EAV +H SG  +DL+LMD +MPI +G
Sbjct  14   LTALVVDDNFVNQSIHKKLLARVGIENDVVCNGKEAVDVHCSGRNYDLILMDMDMPIMNG  73

Query  278  VNATKELREMGVKSMIVGATSHGPGPVRDEFLAAGLDECLVKPLRAEVVLGVINKL  445
            + ATK LREMG++  I G T+      + EF+ AGL++   KPL    +L +++KL
Sbjct  74   IQATKRLREMGIECKIAGVTTRAEEGEKKEFMEAGLNDFQEKPLTISKLLSILHKL  129



>emb|CDX87050.1| BnaC09g03650D [Brassica napus]
Length=134

 Score = 85.5 bits (210),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 54/116 (47%), Positives = 79/116 (68%), Gaps = 0/116 (0%)
 Frame = +2

Query  98   LTALVVEDSPILQLVHKTLLKKYgvevqvvnngeeavvLHRSGARFDLLLMDKEMPIKDG  277
            LTALVV+D+ + Q +H  LL + G++  VV NG+EAV +H SG  +DL+LMD EMPI +G
Sbjct  13   LTALVVDDNFVNQTMHHKLLDRLGIQNDVVCNGQEAVDVHCSGRNYDLILMDMEMPILNG  72

Query  278  VNATKELREMGVKSMIVGATSHGPGPVRDEFLAAGLDECLVKPLRAEVVLGVINKL  445
            + ATK LREMG++S I G T+      + EF+ AGL++   KPL    +L ++++L
Sbjct  73   IQATKRLREMGIESKIAGVTTRANEGDKKEFMEAGLNDFQEKPLTISKLLSILHRL  128



>ref|XP_008235536.1| PREDICTED: two-component response regulator ARR22 [Prunus mume]
Length=131

 Score = 85.5 bits (210),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 55/117 (47%), Positives = 80/117 (68%), Gaps = 1/117 (1%)
 Frame = +2

Query  98   LTALVVEDSPILQLVHKTLLKKYgvevqvvnngeeavvLHRSGARFDLLLMDKEMPIKDG  277
            +TALVV+DS I Q +H  LL+  G+E QVV NG+EA+ +H SG  FDL+LMD +MPI +G
Sbjct  11   ITALVVDDSKINQRIHHKLLENLGIENQVVGNGKEAIDVHCSGKHFDLILMDMDMPIMNG  70

Query  278  VNATKELREMGVKSMIVGATSHGP-GPVRDEFLAAGLDECLVKPLRAEVVLGVINKL  445
            + AT+ LR MG++S I G +SH        EF+ AGLD+   KPL  + ++ +++K+
Sbjct  71   IEATRTLRAMGIRSTIAGVSSHSSLSEDTQEFIEAGLDDYQEKPLTPDKLVAILHKV  127



>ref|XP_010421505.1| PREDICTED: two-component response regulator ARR22-like [Camelina 
sativa]
Length=135

 Score = 85.5 bits (210),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 54/116 (47%), Positives = 78/116 (67%), Gaps = 0/116 (0%)
 Frame = +2

Query  98   LTALVVEDSPILQLVHKTLLKKYgvevqvvnngeeavvLHRSGARFDLLLMDKEMPIKDG  277
            LTALVV+D+ + Q +H+ LL + G++  VV NG+EAV  H SG  +DL+LMD +MPI +G
Sbjct  14   LTALVVDDNFVNQSIHQKLLSRLGIQNDVVCNGKEAVDAHCSGRNYDLILMDMDMPIMNG  73

Query  278  VNATKELREMGVKSMIVGATSHGPGPVRDEFLAAGLDECLVKPLRAEVVLGVINKL  445
              ATK LREMG++S I G T+      + EF+ AGL++   KPL    +L +++KL
Sbjct  74   TQATKRLREMGIESKIAGVTTRANEGEKKEFMEAGLNDFQEKPLTISKLLSILHKL  129



>ref|XP_010454992.1| PREDICTED: two-component response regulator ARR22-like [Camelina 
sativa]
Length=135

 Score = 85.5 bits (210),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 53/116 (46%), Positives = 78/116 (67%), Gaps = 0/116 (0%)
 Frame = +2

Query  98   LTALVVEDSPILQLVHKTLLKKYgvevqvvnngeeavvLHRSGARFDLLLMDKEMPIKDG  277
            LTALVV+D+ + Q +H+ LL + G+  +VV NG+EAV  H SG  +DL+LMD +MPI +G
Sbjct  14   LTALVVDDNFVNQSIHQKLLARLGITNEVVCNGKEAVDAHCSGRNYDLILMDMDMPIMNG  73

Query  278  VNATKELREMGVKSMIVGATSHGPGPVRDEFLAAGLDECLVKPLRAEVVLGVINKL  445
            + ATK LREMG++S I G T+      + EF+ AGL++   KPL    +L +++K 
Sbjct  74   IQATKRLREMGIESKIAGVTTRANEGEKKEFMEAGLNDFQEKPLTISKLLSILHKF  129



>ref|XP_009371086.1| PREDICTED: two-component response regulator ARR22 [Pyrus x bretschneideri]
Length=131

 Score = 85.5 bits (210),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 55/124 (44%), Positives = 82/124 (66%), Gaps = 1/124 (1%)
 Frame = +2

Query  77   SKNVGKGLTALVVEDSPILQLVHKTLLKKYgvevqvvnngeeavvLHRSGARFDLLLMDK  256
            SKN    + ALVV+DS + Q +H  LL+ +G+E QVV NG+EA+ +H SG  FDL+LMD 
Sbjct  4    SKNATTKMMALVVDDSIVNQRIHHKLLENFGIENQVVGNGKEAIDVHCSGKHFDLILMDM  63

Query  257  EMPIKDGVNATKELREMGVKSMIVGATSHGP-GPVRDEFLAAGLDECLVKPLRAEVVLGV  433
            +MP+ +G+ AT+ LR MG++S I G +SH        EF+ AGLD+   KPL    ++ +
Sbjct  64   DMPVMNGIEATRMLRAMGIRSTIAGVSSHSSLSEDTKEFIEAGLDDYQEKPLTPAKLVSI  123

Query  434  INKL  445
            ++K+
Sbjct  124  LHKV  127



>ref|XP_009111701.1| PREDICTED: two-component response regulator ARR22-like [Brassica 
rapa]
 emb|CDY19769.1| BnaA09g04220D [Brassica napus]
Length=134

 Score = 85.5 bits (210),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 54/116 (47%), Positives = 79/116 (68%), Gaps = 0/116 (0%)
 Frame = +2

Query  98   LTALVVEDSPILQLVHKTLLKKYgvevqvvnngeeavvLHRSGARFDLLLMDKEMPIKDG  277
            LTALVV+D+ + Q +H  LL + G++  VV NG+EAV +H SG  +DL+LMD EMPI +G
Sbjct  13   LTALVVDDNFVNQTMHHKLLDRLGIKNDVVCNGQEAVDVHCSGRNYDLILMDMEMPILNG  72

Query  278  VNATKELREMGVKSMIVGATSHGPGPVRDEFLAAGLDECLVKPLRAEVVLGVINKL  445
            + ATK LREMG++S I G T+      + EF+ AGL++   KPL    +L ++++L
Sbjct  73   IQATKRLREMGIESKIAGVTTRANEGDKKEFMEAGLNDFQEKPLTISKLLSILHRL  128



>ref|XP_006448069.1| hypothetical protein CICLE_v10017880mg [Citrus clementina]
 ref|XP_006492307.1| PREDICTED: two-component response regulator ARR22-like [Citrus 
sinensis]
 gb|ESR61309.1| hypothetical protein CICLE_v10017880mg [Citrus clementina]
 gb|KDO40589.1| hypothetical protein CISIN_1g045936mg [Citrus sinensis]
Length=145

 Score = 85.5 bits (210),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 54/123 (44%), Positives = 80/123 (65%), Gaps = 2/123 (2%)
 Frame = +2

Query  77   SKNVGKGLTALVVEDSPILQLVHKTLLKKYgvevqvvnngeeavvLHRSGARFDLLLMDK  256
            SKN  +   ALVV+D P+++ +H  +LK  G +V+V  NG+EAV L R+GA+F ++ +D 
Sbjct  22   SKN--RPYFALVVDDDPMIRRIHSMILKSVGFKVEVAENGKEAVDLFRTGAKFHIVFIDM  79

Query  257  EMPIKDGVNATKELREMGVKSMIVGATSHGPGPVRDEFLAAGLDECLVKPLRAEVVLGVI  436
            EMP+ DG+ ATK +R M V+S IVG TS      R+ F+ AGLD C  KPL    ++ ++
Sbjct  80   EMPVMDGIEATKAMRAMKVESKIVGVTSRNSETEREVFMQAGLDLCYTKPLTMAKIVPLL  139

Query  437  NKL  445
             +L
Sbjct  140  EEL  142



>ref|XP_002521152.1| sensory transduction histidine kinase bacterial, putative [Ricinus 
communis]
 gb|EEF41303.1| sensory transduction histidine kinase bacterial, putative [Ricinus 
communis]
Length=148

 Score = 85.1 bits (209),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 50/116 (43%), Positives = 79/116 (68%), Gaps = 0/116 (0%)
 Frame = +2

Query  98   LTALVVEDSPILQLVHKTLLKKYgvevqvvnngeeavvLHRSGARFDLLLMDKEMPIKDG  277
            +TALVV+D    +++H+ LL+  G+E Q V NG+EA+ +H SG  FDL+LMD +MPI +G
Sbjct  26   MTALVVDDDTTNRIIHRRLLQNLGIENQEVRNGKEAIDIHCSGTNFDLILMDMDMPIMNG  85

Query  278  VNATKELREMGVKSMIVGATSHGPGPVRDEFLAAGLDECLVKPLRAEVVLGVINKL  445
            + ATK+LR MG++S I G ++        EF+ AGLD+   KPL +  ++ +++K+
Sbjct  86   IEATKQLRAMGIRSTIAGVSTRTMEEEVQEFMEAGLDDYQEKPLTSAKLISILHKI  141



>ref|XP_007201589.1| hypothetical protein PRUPE_ppa020702mg [Prunus persica]
 gb|EMJ02788.1| hypothetical protein PRUPE_ppa020702mg [Prunus persica]
Length=131

 Score = 84.7 bits (208),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 56/117 (48%), Positives = 80/117 (68%), Gaps = 1/117 (1%)
 Frame = +2

Query  98   LTALVVEDSPILQLVHKTLLKKYgvevqvvnngeeavvLHRSGARFDLLLMDKEMPIKDG  277
            +TALVV+DS I Q +H  LL+  G+E QVV NG+EAV +H SG  FDL+LMD +MPI +G
Sbjct  11   ITALVVDDSMINQRIHHKLLENLGIENQVVGNGKEAVDVHCSGKHFDLILMDMDMPIMNG  70

Query  278  VNATKELREMGVKSMIVGATSHGP-GPVRDEFLAAGLDECLVKPLRAEVVLGVINKL  445
            + AT+ LR MG++S I G +SH        EF+ AGLD+   KPL  + ++ +++K+
Sbjct  71   IEATRTLRAMGIQSTIAGVSSHSSLSEDTQEFIEAGLDDYQEKPLTPDKLVAILHKV  127



>ref|XP_009786313.1| PREDICTED: two-component response regulator ARR22-like [Nicotiana 
sylvestris]
Length=149

 Score = 85.1 bits (209),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 55/122 (45%), Positives = 79/122 (65%), Gaps = 2/122 (2%)
 Frame = +2

Query  86   VGKGLTALVVEDSPILQLVHKTLLKKYgvevqvvnngeeavvLHR-SGARFDLLLMDKEM  262
            VGK L  L+V+D  + Q  +   L+K GVE   V NG  AV +H  +  RFDL+LM+  +
Sbjct  24   VGKQLQVLIVDDDDVSQTTYILFLQKCGVETLGVRNGNVAVTIHDITEMRFDLILMNSVL  83

Query  263  PIKDGVNATKELREMGVKSMIVGATS-HGPGPVRDEFLAAGLDECLVKPLRAEVVLGVIN  439
            P+ DG+ ATK+LREMG+ +MIVG T+ +    VR EF+ AG+D+C  KPL  E++  ++ 
Sbjct  84   PLMDGIQATKKLREMGITTMIVGMTNVNDKEEVRKEFMEAGVDDCYEKPLTPEILRSLLE  143

Query  440  KL  445
            KL
Sbjct  144  KL  145



>ref|XP_010109670.1| Two-component response regulator [Morus notabilis]
 gb|EXC24140.1| Two-component response regulator [Morus notabilis]
Length=144

 Score = 84.7 bits (208),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 55/122 (45%), Positives = 79/122 (65%), Gaps = 0/122 (0%)
 Frame = +2

Query  80   KNVGKGLTALVVEDSPILQLVHKTLLKKYgvevqvvnngeeavvLHRSGARFDLLLMDKE  259
            +N    + ALVV+D+ I Q +H+TLL+  G+E  VV NG EAV +H SG RFDL+LMD +
Sbjct  19   QNQRTKIKALVVDDNMINQALHRTLLRNLGIENHVVGNGREAVDVHCSGRRFDLILMDLD  78

Query  260  MPIKDGVNATKELREMGVKSMIVGATSHGPGPVRDEFLAAGLDECLVKPLRAEVVLGVIN  439
            MP+ +G+ ATK+LR MG++S I G +S        EF  AGLD+   KPL    ++ ++ 
Sbjct  79   MPVMNGIEATKKLRAMGIQSTIAGVSSRSVDENIQEFWEAGLDDYQQKPLNFPKLVSILQ  138

Query  440  KL  445
            K+
Sbjct  139  KV  140



>ref|XP_003628696.1| Two-component response regulator ARR22 [Medicago truncatula]
 gb|AET03172.1| response regulator receiver domain protein [Medicago truncatula]
Length=144

 Score = 84.7 bits (208),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 54/113 (48%), Positives = 73/113 (65%), Gaps = 2/113 (2%)
 Frame = +2

Query  77   SKNVGKGLTALVVEDSPILQLVHKTLLKKYgvevqvvnngeeavvLHRSGARFDLLLMDK  256
            S+N    LTALVV+D  + + +H+  L   GV    V NG+EAV +H+ G +FDL+LMDK
Sbjct  5    SQNFASKLTALVVDDDAMTRRIHQMTLSNLGVNNTCVKNGKEAVEIHQYGKKFDLILMDK  64

Query  257  EMPIKDGVNATKELREMGVKSMIVGATSHG--PGPVRDEFLAAGLDECLVKPL  409
            +MP  +G  ATK+LR MG+ S IVG +SH      +  +F+ AGLDE L KPL
Sbjct  65   DMPEMNGTEATKQLRLMGISSTIVGVSSHSMEEKEIVVKFMEAGLDEYLEKPL  117



>ref|XP_009600611.1| PREDICTED: two-component response regulator ARR22-like [Nicotiana 
tomentosiformis]
Length=149

 Score = 84.7 bits (208),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 55/122 (45%), Positives = 77/122 (63%), Gaps = 2/122 (2%)
 Frame = +2

Query  86   VGKGLTALVVEDSPILQLVHKTLLKKYgvevqvvnngeeavvLHR-SGARFDLLLMDKEM  262
            VGK L  L+V+D  + Q  +   L+K GVE   V NG  AV +H  +  RFDL+ M+  +
Sbjct  24   VGKQLKVLIVDDDDVSQTTYILFLQKCGVETLGVRNGNVAVNIHDITQMRFDLIFMNSVL  83

Query  263  PIKDGVNATKELREMGVKSMIVGATS-HGPGPVRDEFLAAGLDECLVKPLRAEVVLGVIN  439
            P+ DG+ ATK+LREMG+ +MIVG T+ +    VR EF+ AGLD+C  KPL  E+   ++ 
Sbjct  84   PLMDGIRATKKLREMGITTMIVGMTNVNDKEEVRKEFMEAGLDDCYEKPLTPEIFRSLLE  143

Query  440  KL  445
            KL
Sbjct  144  KL  145



>ref|XP_006394879.1| hypothetical protein EUTSA_v10005298mg [Eutrema salsugineum]
 gb|ESQ32165.1| hypothetical protein EUTSA_v10005298mg [Eutrema salsugineum]
Length=138

 Score = 84.0 bits (206),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 54/116 (47%), Positives = 78/116 (67%), Gaps = 0/116 (0%)
 Frame = +2

Query  98   LTALVVEDSPILQLVHKTLLKKYgvevqvvnngeeavvLHRSGARFDLLLMDKEMPIKDG  277
            LTALVV+D+ + Q +H  LL + G++  VV NG+EAV +H SG  +DL+LMD +MPI +G
Sbjct  17   LTALVVDDNFVNQSMHHKLLDRLGIKNDVVCNGKEAVDVHCSGRNYDLILMDMDMPIMNG  76

Query  278  VNATKELREMGVKSMIVGATSHGPGPVRDEFLAAGLDECLVKPLRAEVVLGVINKL  445
            + ATK LREMG++S I G T+      R EF+ AGL++   KPL    ++ ++ KL
Sbjct  77   IQATKRLREMGIESKIAGVTTRANEVERKEFMEAGLNDFQEKPLTISKLISILIKL  132



>ref|XP_008372427.1| PREDICTED: two-component response regulator ARR22 [Malus domestica]
Length=131

 Score = 84.0 bits (206),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 54/124 (44%), Positives = 82/124 (66%), Gaps = 1/124 (1%)
 Frame = +2

Query  77   SKNVGKGLTALVVEDSPILQLVHKTLLKKYgvevqvvnngeeavvLHRSGARFDLLLMDK  256
            SKN    + ALVV+D+ + Q +H  LL+ +G+E QVV NG+EA+ +H SG  FDL+LMD 
Sbjct  4    SKNATTKMMALVVDDNIVNQRIHHKLLENFGIENQVVGNGKEAIDVHCSGKHFDLILMDM  63

Query  257  EMPIKDGVNATKELREMGVKSMIVGATSHGP-GPVRDEFLAAGLDECLVKPLRAEVVLGV  433
            +MP+ +G+ AT+ LR MG++S I G +SH        EF+ AGLD+   KPL    ++ +
Sbjct  64   DMPVMNGIEATRMLRAMGIRSTIAGVSSHSSLSEDTREFIEAGLDDYQEKPLTPAKLVSI  123

Query  434  INKL  445
            ++K+
Sbjct  124  LHKV  127



>ref|XP_010027144.1| PREDICTED: two-component response regulator ARR22-like [Eucalyptus 
grandis]
 gb|KCW61462.1| hypothetical protein EUGRSUZ_H04198 [Eucalyptus grandis]
Length=144

 Score = 83.6 bits (205),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 52/116 (45%), Positives = 67/116 (58%), Gaps = 3/116 (3%)
 Frame = +2

Query  107  LVVEDSPILQLVHKTLLKKYgvevqvvnngeeavv---LHRSGARFDLLLMDKEMPIKDG  277
            L+V D  +   VH+TL  K  V+ +V            LH SG+ FD++LMD + PI DG
Sbjct  25   LIVGDDVLECRVHETLFGKLEVKEEVQTEMATDKEDLDLHLSGSSFDIILMDIDSPIMDG  84

Query  278  VNATKELREMGVKSMIVGATSHGPGPVRDEFLAAGLDECLVKPLRAEVVLGVINKL  445
            +   KELR  GVKSMIVG TS      R  F+AAGLDECL KPL  E +  +++ L
Sbjct  85   LEVMKELRAKGVKSMIVGLTSQNAEADRAAFMAAGLDECLEKPLTDEKIKSLVDTL  140



>ref|XP_006361623.1| PREDICTED: LOW QUALITY PROTEIN: two-component response regulator 
ARR22-like [Solanum tuberosum]
Length=155

 Score = 84.0 bits (206),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 61/141 (43%), Positives = 85/141 (60%), Gaps = 2/141 (1%)
 Frame = +2

Query  77   SKNVGKGLTALVVEDSPILQLVHKTLLKKYgvevqvvnngeeavvLHRSGARFDLLLMDK  256
            + NV K L AL+V+D  I +++ K LL K+GVE     NG+EA++ H SGA FDL+LMD 
Sbjct  9    NSNVVKKLKALIVDDDTITRMILKALLMKFGVETHEAKNGQEAILAHHSGACFDLILMDL  68

Query  257  EMPIKDGVNATKELREMGVKSMIVGATSHGPGPVRDEFLAAGLDECLVKPLRAEVVLGVI  436
             MP+ +G   TKELR+M V S+IVG TS      +  F+ AGLD    KPL  + +  ++
Sbjct  69   YMPVMNGHQTTKELRDMHVCSLIVGMTSQEKEEEKKSFMDAGLDYYYXKPLTNDEIRYLV  128

Query  437  NKLV--A*NEFDLKSIFLSYY  493
             K+   A +   LKSI+   Y
Sbjct  129  EKIKGNALSLSKLKSIWFDPY  149



>ref|XP_004493857.1| PREDICTED: two-component response regulator ARR22-like [Cicer 
arietinum]
Length=133

 Score = 83.2 bits (204),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 52/122 (43%), Positives = 80/122 (66%), Gaps = 0/122 (0%)
 Frame = +2

Query  80   KNVGKGLTALVVEDSPILQLVHKTLLKKYgvevqvvnngeeavvLHRSGARFDLLLMDKE  259
            +N G  LTALVV+D+ I + +H+ +L  +GV+   V NG+EAV +H  G +FDL+LMD +
Sbjct  5    QNFGSKLTALVVDDNMINRKIHQKMLNNFGVKTHGVENGKEAVDIHWYGQKFDLILMDMD  64

Query  260  MPIKDGVNATKELREMGVKSMIVGATSHGPGPVRDEFLAAGLDECLVKPLRAEVVLGVIN  439
            MPI +G+ ATK+LR MG+ S I+G +S        +F+ AGLD+   KPL    +  +++
Sbjct  65   MPIMNGIEATKKLRAMGICSTIIGVSSRSMEAEILKFMEAGLDDYQEKPLDNSKLNSILD  124

Query  440  KL  445
            K+
Sbjct  125  KV  126



>ref|XP_002325362.2| hypothetical protein POPTR_0019s04170g [Populus trichocarpa]
 gb|EEE99743.2| hypothetical protein POPTR_0019s04170g [Populus trichocarpa]
Length=133

 Score = 82.0 bits (201),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 50/92 (54%), Positives = 65/92 (71%), Gaps = 0/92 (0%)
 Frame = +2

Query  134  QLVHKTLLKKYgvevqvvnngeeavvLHRSGARFDLLLMDKEMPIKDGVNATKELREMGV  313
            ++VH+ L+   G++VQ   NG+EAV LH +GA FDL+LMD EMPI +G  AT+ELR MGV
Sbjct  27   RMVHRMLVTSLGLKVQEAKNGKEAVDLHINGASFDLILMDMEMPIMNGPTATRELRAMGV  86

Query  314  KSMIVGATSHGPGPVRDEFLAAGLDECLVKPL  409
            KS I+G TS     V  +F+ AGLD C+ KPL
Sbjct  87   KSTIIGVTSCTFESVHKDFIEAGLDHCVAKPL  118



>gb|KDP26430.1| hypothetical protein JCGZ_17588 [Jatropha curcas]
Length=127

 Score = 80.5 bits (197),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 51/116 (44%), Positives = 77/116 (66%), Gaps = 0/116 (0%)
 Frame = +2

Query  98   LTALVVEDSPILQLVHKTLLKKYgvevqvvnngeeavvLHRSGARFDLLLMDKEMPIKDG  277
            +TALVV+D    +++H+ LL+  G+E Q V NG+EAV +H  G  FDL+LMD +MPI +G
Sbjct  7    ITALVVDDDITNRIIHRRLLQHLGIENQEVKNGKEAVDIHCPGTFFDLILMDMDMPIMNG  66

Query  278  VNATKELREMGVKSMIVGATSHGPGPVRDEFLAAGLDECLVKPLRAEVVLGVINKL  445
            + ATK+LR MG++S IVG ++        EF+ AGLD    KPL    ++ +++K+
Sbjct  67   IEATKQLRAMGIRSTIVGVSTRSIQEQVQEFMEAGLDGYQEKPLTNAKLISILDKI  122



>emb|CDY49351.1| BnaA05g33130D [Brassica napus]
Length=178

 Score = 81.6 bits (200),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 56/125 (45%), Positives = 76/125 (61%), Gaps = 8/125 (6%)
 Frame = +2

Query  80   KNVGKGLTALVVEDSPILQLVHKTLLKKYgvevqvvnngeeavvLHRSGARFDLLLMDKE  259
            K   K L  LVV+D    + ++   ++  G    +  NGEEAV L+R G  F+L+LMD E
Sbjct  56   KKTFKKLCVLVVDDDRSCRSLYMGFIQMRGGFPYMAENGEEAVNLYRDGQTFNLILMDNE  115

Query  260  MPIKDGVNATKELREMGVKSMIVGATSHGPGPVRDE---FLAAGLDECLVKPLRAEVVLG  430
            MP+ +GV+ATKELR++GV SMIVG TSH      DE   F+ AG D CL KP+  E +  
Sbjct  116  MPVMNGVSATKELRDLGVTSMIVGLTSH-----EDENSGFMEAGADHCLAKPITFENIYL  170

Query  431  VINKL  445
            +I +L
Sbjct  171  LIEQL  175



>ref|XP_007162648.1| hypothetical protein PHAVU_001G168500g [Phaseolus vulgaris]
 gb|ESW34642.1| hypothetical protein PHAVU_001G168500g [Phaseolus vulgaris]
Length=132

 Score = 80.1 bits (196),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 51/126 (40%), Positives = 80/126 (63%), Gaps = 1/126 (1%)
 Frame = +2

Query  71   MDSKNVGKGLTALVVEDSPILQLVHKTLLKKYgvevqvvnng-eeavvLHRSGARFDLLL  247
            M  +N G  +TALVV+D+ + + +H+ LL+  GV  Q      +EAV +H  G RFDL+L
Sbjct  1    MAPRNFGTQITALVVDDNVLNRKIHQKLLESAGVRNQEGVANGKEAVEIHCHGRRFDLIL  60

Query  248  MDKEMPIKDGVNATKELREMGVKSMIVGATSHGPGPVRDEFLAAGLDECLVKPLRAEVVL  427
            MD +MP+ +G+ ATKELR MG+ SMIVG +S        +F+ +GL++   KPL +  + 
Sbjct  61   MDMDMPVMNGLEATKELRSMGIGSMIVGVSSRCTETEIRKFMESGLNDYHEKPLNSAKLN  120

Query  428  GVINKL  445
             +++K+
Sbjct  121  SILDKM  126



>ref|XP_007049950.1| Two-component response regulator ARR22 [Theobroma cacao]
 gb|EOX94107.1| Two-component response regulator ARR22 [Theobroma cacao]
Length=236

 Score = 81.6 bits (200),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 56/113 (50%), Positives = 76/113 (67%), Gaps = 0/113 (0%)
 Frame = +2

Query  98   LTALVVEDSPILQLVHKTLLKKYgvevqvvnngeeavvLHRSGARFDLLLMDKEMPIKDG  277
            +TALVV+D+ I + +H  LL   GVE +VV NG+EAV  H SG +FDL+LMD EMPI +G
Sbjct  33   ITALVVDDNRINRTIHCRLLNNLGVENEVVGNGKEAVDAHCSGKKFDLILMDMEMPIMNG  92

Query  278  VNATKELREMGVKSMIVGATSHGPGPVRDEFLAAGLDECLVKPLRAEVVLGVI  436
            + AT++LREMG +SMI G +S        EF+ AGLD+   KPL    ++ +I
Sbjct  93   IEATRKLREMGNRSMIAGVSSRSMEEDIQEFIEAGLDDYQEKPLTMSKLISLI  145



>ref|XP_010672917.1| PREDICTED: two-component response regulator ARR22-like [Beta 
vulgaris subsp. vulgaris]
Length=132

 Score = 79.7 bits (195),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 50/115 (43%), Positives = 71/115 (62%), Gaps = 0/115 (0%)
 Frame = +2

Query  101  TALVVEDSPILQLVHKTLLKKYgvevqvvnngeeavvLHRSGARFDLLLMDKEMPIKDGV  280
            +ALVV+D+  ++ V + LL K G + +V  +G++AV +   G  FD + MD EMP+ DG+
Sbjct  16   SALVVDDNACIRNVAQMLLNKCGFKTKVAEHGKDAVDICSEGNVFDAIFMDMEMPVMDGI  75

Query  281  NATKELREMGVKSMIVGATSHGPGPVRDEFLAAGLDECLVKPLRAEVVLGVINKL  445
             ATKELR MGVKS+IVG T+         F+ AGLDE   KPL    V  ++ +L
Sbjct  76   QATKELRAMGVKSLIVGVTTCESKSSLQAFVEAGLDEYFEKPLNVAKVENILKRL  130



>ref|XP_002522026.1| sensory transduction histidine kinase bacterial, putative [Ricinus 
communis]
 gb|EEF40430.1| sensory transduction histidine kinase bacterial, putative [Ricinus 
communis]
Length=171

 Score = 79.7 bits (195),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 52/114 (46%), Positives = 77/114 (68%), Gaps = 3/114 (3%)
 Frame = +2

Query  74   DSKNVG-KGLTALVVEDSPILQLVHKTLLK-KYgvevqvvnngeeavvLHRSGARFDLLL  247
            D K  G K  +AL+V+D  +L+ +HK +L  +  VE+Q   +G+EAV LHR+GA FDL+L
Sbjct  12   DEKTKGNKIFSALIVDDDRVLRRIHKKILTGQGVVEIQEAGDGQEAVELHRAGASFDLIL  71

Query  248  MDKEMPIKDGVNATKELREMGVKSMIVGATSHGPGPVRDEFLAAGLDECLVKPL  409
            MD  MPI DG  ATKELR+MG+   I+G ++      + +F+ +G+D+C+ KPL
Sbjct  72   MDLHMPIMDGCQATKELRDMGINCTILGVSTCYEEEHK-KFMESGIDDCISKPL  124



>gb|KCW58096.1| hypothetical protein EUGRSUZ_H00820, partial [Eucalyptus grandis]
Length=100

 Score = 78.2 bits (191),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 35/75 (47%), Positives = 51/75 (68%), Gaps = 0/75 (0%)
 Frame = +2

Query  212  LHRSGARFDLLLMDKEMPIKDGVNATKELREMGVKSMIVGATSHGPGPVRDEFLAAGLDE  391
            +H SG +F+L+LMD++MP+ +G+ ATK+LREMG++S I G +SH     R  F+ AGLD+
Sbjct  26   IHLSGKKFNLILMDRDMPVMNGIEATKKLREMGIRSTIAGVSSHSVSQERQAFIEAGLDD  85

Query  392  CLVKPLRAEVVLGVI  436
               KPL    +L  I
Sbjct  86   YHEKPLSVTKLLSAI  100



>ref|XP_010934661.1| PREDICTED: two-component response regulator ARR22-like [Elaeis 
guineensis]
 ref|XP_010934662.1| PREDICTED: two-component response regulator ARR22-like [Elaeis 
guineensis]
Length=146

 Score = 79.3 bits (194),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 46/104 (44%), Positives = 67/104 (64%), Gaps = 0/104 (0%)
 Frame = +2

Query  98   LTALVVEDSPILQLVHKTLLKKYgvevqvvnngeeavvLHRSGARFDLLLMDKEMPIKDG  277
            L ALVV+D+ +++L   +LLK   VE     +G+ AV     G  +D++LMDK+MP  +G
Sbjct  28   LRALVVDDNSVIRLYMVSLLKDVDVETDEAEDGKAAVSRFLEGKTYDIILMDKDMPQMNG  87

Query  278  VNATKELREMGVKSMIVGATSHGPGPVRDEFLAAGLDECLVKPL  409
            V A ++LREMGVK+ I G T+H     + EFL AG+D+  VKP+
Sbjct  88   VQAARKLREMGVKAKIAGVTAHSTDEEKREFLEAGIDDFFVKPI  131



>ref|XP_002304706.1| hypothetical protein POPTR_0003s17590g [Populus trichocarpa]
 gb|EEE79685.1| hypothetical protein POPTR_0003s17590g [Populus trichocarpa]
Length=248

 Score = 80.9 bits (198),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 51/118 (43%), Positives = 73/118 (62%), Gaps = 9/118 (8%)
 Frame = +2

Query  74   DSKNVGKGLTALVVEDSPILQLVHKTLL------KKYgvevqvvnngeeavvLHRSGARF  235
            D ++ G   + L+V+D   ++  ++  +      K+  +E Q   NG+EAV LH +GA F
Sbjct  111  DEEDQGNNFSVLIVDDDRTIRETNRRFMALAGTQKQLRMEFQEAKNGKEAVYLHLAGASF  170

Query  236  DLLLMDKEMPIKDGVNATKELREMGVKSMIVGATSHGPGPVRDEFLAAGLDECLVKPL  409
            DL+LMD +MPI  G+ AT+ LR+MGVKS IVG TS    P R  F+ AGL+ C+ KPL
Sbjct  171  DLILMDNQMPIMTGIQATQLLRKMGVKSRIVGVTSE---PDRQAFIDAGLNNCIQKPL  225



>ref|XP_002981882.1| hypothetical protein SELMODRAFT_451436 [Selaginella moellendorffii]
 gb|EFJ16975.1| hypothetical protein SELMODRAFT_451436 [Selaginella moellendorffii]
Length=526

 Score = 83.2 bits (204),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 45/101 (45%), Positives = 70/101 (69%), Gaps = 0/101 (0%)
 Frame = +2

Query  107  LVVEDSPILQLVHKTLLKKYgvevqvvnngeeavvLHRSGARFDLLLMDKEMPIKDGVNA  286
            L+VED+ + + + K LL  + +E     +G +AV + RSGA++D++L+DKEMP+ DG  A
Sbjct  410  LIVEDNQVNRRILKKLLASFNIESDAAEDGLQAVDMCRSGAQYDMILIDKEMPVMDGHEA  469

Query  287  TKELREMGVKSMIVGATSHGPGPVRDEFLAAGLDECLVKPL  409
            T+E+R MGVK+ IVG T +     R++FLAAG+++   KPL
Sbjct  470  TREIRAMGVKTTIVGLTGNALDSDRNQFLAAGVNDFFTKPL  510



>ref|XP_002986002.1| hypothetical protein SELMODRAFT_451432 [Selaginella moellendorffii]
 gb|EFJ12821.1| hypothetical protein SELMODRAFT_451432 [Selaginella moellendorffii]
Length=526

 Score = 83.2 bits (204),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 45/101 (45%), Positives = 70/101 (69%), Gaps = 0/101 (0%)
 Frame = +2

Query  107  LVVEDSPILQLVHKTLLKKYgvevqvvnngeeavvLHRSGARFDLLLMDKEMPIKDGVNA  286
            L+VED+ + + + K LL  + +E     +G +AV + RSGA++D++L+DKEMP+ DG  A
Sbjct  410  LIVEDNQVNRRILKKLLASFNIESDAAEDGLQAVDMCRSGAQYDMILIDKEMPVMDGHEA  469

Query  287  TKELREMGVKSMIVGATSHGPGPVRDEFLAAGLDECLVKPL  409
            T+E+R MGVK+ IVG T +     R++FLAAG+++   KPL
Sbjct  470  TREIRAMGVKTTIVGLTGNALDSDRNQFLAAGVNDFFTKPL  510



>ref|XP_011020675.1| PREDICTED: hybrid signal transduction histidine kinase I-like 
isoform X2 [Populus euphratica]
Length=248

 Score = 80.5 bits (197),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 51/118 (43%), Positives = 73/118 (62%), Gaps = 9/118 (8%)
 Frame = +2

Query  74   DSKNVGKGLTALVVEDSPILQLVHKTLL------KKYgvevqvvnngeeavvLHRSGARF  235
            D ++ G   + L+V+D   ++  ++  +      K+  +E Q   NG+EAV LH +GA F
Sbjct  111  DEEDQGNNFSVLIVDDDRTIRETNRRFMALAGTQKQLRMEFQEAKNGKEAVYLHLAGASF  170

Query  236  DLLLMDKEMPIKDGVNATKELREMGVKSMIVGATSHGPGPVRDEFLAAGLDECLVKPL  409
            DL+LMD +MPI  G+ AT+ LR+MGVKS IVG TS    P R  F+ AGL+ C+ KPL
Sbjct  171  DLILMDNQMPIMTGIQATQLLRKMGVKSRIVGVTSE---PDRQAFIDAGLNNCIQKPL  225



>ref|XP_010679285.1| PREDICTED: two-component response regulator ARR22-like [Beta 
vulgaris subsp. vulgaris]
Length=127

 Score = 77.4 bits (189),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 44/112 (39%), Positives = 66/112 (59%), Gaps = 3/112 (3%)
 Frame = +2

Query  83   NVGKGLTALVVEDSPILQLVHKTLLKK--YgvevqvvnngeeavvLHRSGARFDLLLMDK  256
            N  K  TALVV+D  I + ++   L +  + +     N  E     H +G +FDL++MD 
Sbjct  2    NTIKKFTALVVDDDSINRAINMKFLGRNGFEIIKIAKNGKEAVEYFH-AGDKFDLVVMDM  60

Query  257  EMPIKDGVNATKELREMGVKSMIVGATSHGPGPVRDEFLAAGLDECLVKPLR  412
            EMPI DG+ ATKE+R +GVKS+I+G ++        EF++AGLD+   KP+ 
Sbjct  61   EMPIMDGIQATKEIRAIGVKSLIIGMSASSSQAKIQEFVSAGLDDFYAKPMN  112



>ref|XP_003520625.1| PREDICTED: two-component response regulator ARR22-like [Glycine 
max]
Length=113

 Score = 76.6 bits (187),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 46/103 (45%), Positives = 69/103 (67%), Gaps = 0/103 (0%)
 Frame = +2

Query  137  LVHKTLLKKYgvevqvvnngeeavvLHRSGARFDLLLMDKEMPIKDGVNATKELREMGVK  316
            +VH+ +L   G+++QV  NG+EAV +HRSG  FDL+LMD++MP+ +G+ ATK LR MG+ 
Sbjct  1    MVHRKMLNSVGLKIQVAENGKEAVEIHRSGQSFDLILMDRDMPVMNGIEATKTLRSMGIN  60

Query  317  SMIVGATSHGPGPVRDEFLAAGLDECLVKPLRAEVVLGVINKL  445
            S I G ++        EF+ AGLD+ L KPL    +  +I+K+
Sbjct  61   STITGVSTRSVTAHIREFMEAGLDDYLEKPLTLVKLTSIIHKM  103



>ref|XP_009129924.1| PREDICTED: two-component response regulator ARR22-like [Brassica 
rapa]
Length=134

 Score = 76.3 bits (186),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 52/116 (45%), Positives = 78/116 (67%), Gaps = 0/116 (0%)
 Frame = +2

Query  98   LTALVVEDSPILQLVHKTLLKKYgvevqvvnngeeavvLHRSGARFDLLLMDKEMPIKDG  277
            LTALVV+D+ + Q VH  LL + G++  VV+NG+EAV +H SG  +DL+LMD +MPI +G
Sbjct  13   LTALVVDDNFVNQSVHHKLLDRLGIKNDVVSNGQEAVDVHCSGRNYDLILMDMDMPIMNG  72

Query  278  VNATKELREMGVKSMIVGATSHGPGPVRDEFLAAGLDECLVKPLRAEVVLGVINKL  445
            + AT+ LREMG++S I G T+        EF+ AGL++   KPL    ++ +++ L
Sbjct  73   IQATRRLREMGIESKIAGVTTRAEEEEVKEFMEAGLNDFQEKPLTISKLVSILHNL  128



>ref|XP_011020674.1| PREDICTED: histidine protein kinase NIK1-like isoform X1 [Populus 
euphratica]
Length=251

 Score = 77.4 bits (189),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 38/66 (58%), Positives = 47/66 (71%), Gaps = 3/66 (5%)
 Frame = +2

Query  212  LHRSGARFDLLLMDKEMPIKDGVNATKELREMGVKSMIVGATSHGPGPVRDEFLAAGLDE  391
            LH +GA FDL+LMD +MPI  G+ AT+ LR+MGVKS IVG TS    P R  F+ AGL+ 
Sbjct  166  LHLAGASFDLILMDNQMPIMTGIQATQLLRKMGVKSRIVGVTSE---PDRQAFIDAGLNN  222

Query  392  CLVKPL  409
            C+ KPL
Sbjct  223  CIQKPL  228



>gb|KFK44929.1| hypothetical protein AALP_AA1G321100 [Arabis alpina]
Length=108

 Score = 73.6 bits (179),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 35/78 (45%), Positives = 52/78 (67%), Gaps = 0/78 (0%)
 Frame = +2

Query  212  LHRSGARFDLLLMDKEMPIKDGVNATKELREMGVKSMIVGATSHGPGPVRDEFLAAGLDE  391
            +H SG  +DL+LMD +MPI +G+ ATK+LREMG++S I G T+      + EF+ AGL++
Sbjct  25   VHCSGKHYDLILMDMDMPIMNGIQATKKLREMGIESKIAGVTTRSKEGEKQEFMDAGLND  84

Query  392  CLVKPLRAEVVLGVINKL  445
               KPL    +L ++ KL
Sbjct  85   FQEKPLTLSKLLSILQKL  102



>ref|XP_003553515.1| PREDICTED: two-component response regulator ARR22-like [Glycine 
max]
 gb|KHN02453.1| Two-component response regulator ARR22 [Glycine soja]
Length=103

 Score = 72.8 bits (177),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 37/80 (46%), Positives = 54/80 (68%), Gaps = 2/80 (3%)
 Frame = +2

Query  212  LHR-SGARFDLLLMDKEMPIKDGVNATKELREMGVKSMIVGATSHGPGPVR-DEFLAAGL  385
            LHR +G  FDL+LMDK+MPI +G+ ATKELR  G+ S I+G +S         EF+ AGL
Sbjct  22   LHRINGQSFDLILMDKDMPIMNGIQATKELRSTGISSKIIGVSSSSREESNVQEFVEAGL  81

Query  386  DECLVKPLRAEVVLGVINKL  445
            D+  +KPL  E++  +++K+
Sbjct  82   DDYYMKPLTEEMLREILDKI  101



>gb|KDP23753.1| hypothetical protein JCGZ_23586 [Jatropha curcas]
Length=176

 Score = 74.3 bits (181),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 50/106 (47%), Positives = 69/106 (65%), Gaps = 2/106 (2%)
 Frame = +2

Query  101  TALVVEDSPILQLVHKTLLKKYgvevqvvnngeeavvLHRSGARFDLLLMDKEMPIKDGV  280
            T L+V+   I++ +HK +L ++GVEV+   NG+EAV LH  G  ++L+LM+ EMP+ +G 
Sbjct  38   TVLLVDADSIMRAIHKLMLTEHGVEVEEAFNGKEAVDLHCVGLSYNLILMNLEMPVMNGY  97

Query  281  NATKELREMGVKSMIVGATSHGPGPVRDEFLAAGLDECLVKPLRAE  418
             ATKELR+MGV S IVG  S         F+ AGLD C+ KPL  E
Sbjct  98   EATKELRDMGVYSAIVGVVSRNEEA--QHFMEAGLDGCVSKPLSIE  141



>ref|XP_001783195.1| predicted protein [Physcomitrella patens]
 gb|EDQ52026.1| predicted protein [Physcomitrella patens]
Length=115

 Score = 72.8 bits (177),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 41/101 (41%), Positives = 63/101 (62%), Gaps = 0/101 (0%)
 Frame = +2

Query  107  LVVEDSPILQLVHKTLLKKYgvevqvvnngeeavvLHRSGARFDLLLMDKEMPIKDGVNA  286
            L+VED+ I +++ + +L+   +      NG+ A+  H+ G  +DL+LMDKEMP+ DG  A
Sbjct  3    LLVEDTRINRIILRKVLQNLNLLCDEAENGQIAIDFHKQGRTYDLVLMDKEMPVMDGHEA  62

Query  287  TKELREMGVKSMIVGATSHGPGPVRDEFLAAGLDECLVKPL  409
            T++LR MGVK+ IV  T +     R+ F  AG+D+   KPL
Sbjct  63   TRQLRNMGVKTPIVALTGNALTTDREMFFEAGVDDFQTKPL  103



>ref|XP_010548750.1| PREDICTED: two-component response regulator ARR22 [Tarenaya hassleriana]
Length=123

 Score = 73.2 bits (178),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 33/78 (42%), Positives = 53/78 (68%), Gaps = 0/78 (0%)
 Frame = +2

Query  212  LHRSGARFDLLLMDKEMPIKDGVNATKELREMGVKSMIVGATSHGPGPVRDEFLAAGLDE  391
            +H SG  +DL+LMD +MP+ +G+ AT+ LREMG++S+I G ++      + EF+ AGLD+
Sbjct  35   VHSSGKNYDLILMDMDMPVMNGIQATRRLREMGIESVIAGVSTRTKEGEKKEFMEAGLDD  94

Query  392  CLVKPLRAEVVLGVINKL  445
               KPL    +L +++KL
Sbjct  95   FQEKPLTISKLLSILHKL  112



>gb|KHN02434.1| Two-component response regulator ARR22 [Glycine soja]
Length=90

 Score = 72.0 bits (175),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 41/90 (46%), Positives = 62/90 (69%), Gaps = 0/90 (0%)
 Frame = +2

Query  137  LVHKTLLKKYgvevqvvnngeeavvLHRSGARFDLLLMDKEMPIKDGVNATKELREMGVK  316
            +VH+ +L   G+++QV  NG+EA+ +H SG  FDL+LMD++MP+ +G+ ATK LR MG+ 
Sbjct  1    MVHRKMLNSVGLKIQVAENGKEAIEIHGSGQSFDLILMDRDMPVMNGIEATKTLRSMGIN  60

Query  317  SMIVGATSHGPGPVRDEFLAAGLDECLVKP  406
            SMI G ++        EF+ AGLD+ + KP
Sbjct  61   SMITGVSTRSVAAHIREFMEAGLDDYVEKP  90



>gb|KCW85328.1| hypothetical protein EUGRSUZ_B02167 [Eucalyptus grandis]
Length=141

 Score = 72.8 bits (177),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 46/121 (38%), Positives = 71/121 (59%), Gaps = 5/121 (4%)
 Frame = +2

Query  89   GKGLTALVVEDSPILQLVHKTLLKKYgvevqvvnnge--eavvLHRSGARFDLLLMDKEM  262
             K L+ L+V+D  +++ +H  L+ + GV V+         AV L   G  FD++LMD EM
Sbjct  20   AKKLSVLIVDDDSMIRTIHTILVNRVGVVVESQVTENGKVAVDLFGPGDSFDVILMDWEM  79

Query  263  PIKDGVNATKELREMGVKSMIVGATSHGPGPVRDEFLAAGLDECLVKPLRAEVVLGVINK  442
            P+ +G+   +ELR + V SMI G TSH      D F+AAGLD+C  KPL  +++  ++ K
Sbjct  80   PMMNGI---EELRNIRVSSMIGGVTSHSMDTEEDTFMAAGLDDCYGKPLLIKILKNILQK  136

Query  443  L  445
            +
Sbjct  137  M  137



>ref|XP_002304705.1| hypothetical protein POPTR_0003s17580g [Populus trichocarpa]
 gb|EEE79684.1| hypothetical protein POPTR_0003s17580g [Populus trichocarpa]
Length=223

 Score = 73.6 bits (179),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 48/118 (41%), Positives = 71/118 (60%), Gaps = 9/118 (8%)
 Frame = +2

Query  74   DSKNVGKGLTALVVEDSPILQLVHKTLL------KKYgvevqvvnngeeavvLHRSGARF  235
            D ++ G   + L+V+D   ++  ++ L+      K+  +E Q   NG+EAV LH +GA +
Sbjct  86   DDQDEGYNFSVLIVDDDLTVRDTNRRLMMSVETQKQLTMEFQEAKNGKEAVYLHLAGASY  145

Query  236  DLLLMDKEMPIKDGVNATKELREMGVKSMIVGATSHGPGPVRDEFLAAGLDECLVKPL  409
            DL+LM+  MPI  G+ AT+ LR+MGVKS IVG +S         F+ AGLD C+ KPL
Sbjct  146  DLILMENHMPIMTGIQATQRLRKMGVKSQIVGISSESDQQA---FIDAGLDNCIQKPL  200



>ref|XP_006387271.1| hypothetical protein POPTR_1359s00200g [Populus trichocarpa]
 gb|ERP46185.1| hypothetical protein POPTR_1359s00200g [Populus trichocarpa]
Length=213

 Score = 72.4 bits (176),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 36/69 (52%), Positives = 46/69 (67%), Gaps = 3/69 (4%)
 Frame = +2

Query  212  LHRSGARFDLLLMDKEMPIKDGVNATKELREMGVKSMIVGATSHGPGPVRDEFLAAGLDE  391
            LH +GA FDL++MD +MPI  G+ AT+ LR+MGVKS I+G  S     V+  F+ AG DE
Sbjct  148  LHLAGASFDLIIMDDQMPIMTGIQATQLLRKMGVKSQIIGFASE---SVQQAFIDAGADE  204

Query  392  CLVKPLRAE  418
            CL  PL  E
Sbjct  205  CLQMPLDTE  213



>ref|XP_007162623.1| hypothetical protein PHAVU_001G166800g, partial [Phaseolus vulgaris]
 gb|ESW34617.1| hypothetical protein PHAVU_001G166800g, partial [Phaseolus vulgaris]
Length=147

 Score = 71.2 bits (173),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 45/118 (38%), Positives = 73/118 (62%), Gaps = 2/118 (2%)
 Frame = +2

Query  98   LTALVVEDSPILQLVHKTLLKKYgvevqvvnng-eeavvLHRSGARFDLLLMDKEMPIKD  274
            L  L+V+D  ++++ HK LL + GV+  V     +EAV LH +G  FDL+LMDK+MP+ +
Sbjct  28   LKVLIVDDVRVIRMTHKMLLDRVGVKDHVAVENGKEAVELHNNGQSFDLILMDKDMPVMN  87

Query  275  GVNATKELREMGVKSMIVGATSHGPGPVR-DEFLAAGLDECLVKPLRAEVVLGVINKL  445
            G+ AT+ LR MG+   I+G +S     +   EF+ AGL+    KPL  +++  ++ K+
Sbjct  88   GIEATRTLRSMGISCKIIGVSSSTCNQLYVQEFVEAGLNGFYTKPLTVKMLGEILEKI  145



>ref|XP_001783176.1| predicted protein [Physcomitrella patens]
 gb|EDQ52007.1| predicted protein [Physcomitrella patens]
Length=89

 Score = 69.7 bits (169),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 33/77 (43%), Positives = 51/77 (66%), Gaps = 0/77 (0%)
 Frame = +2

Query  212  LHRSGARFDLLLMDKEMPIKDGVNATKELREMGVKSMIVGATSHGPGPVRDEFLAAGLDE  391
            LH+ G  +DL+LMDKEMP+ DG  AT++LR MGVK+ IV  T +     R+ F  AG+D+
Sbjct  12   LHKQGRTYDLVLMDKEMPVMDGHEATRQLRNMGVKTPIVALTGNALTSDRELFFEAGVDD  71

Query  392  CLVKPLRAEVVLGVINK  442
               KPL  + ++ ++++
Sbjct  72   FQTKPLSRDKLVQLLSR  88



>emb|CDY05529.1| BnaA02g31620D [Brassica napus]
Length=1312

 Score = 75.5 bits (184),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 52/116 (45%), Positives = 78/116 (67%), Gaps = 0/116 (0%)
 Frame = +2

Query  98    LTALVVEDSPILQLVHKTLLKKYgvevqvvnngeeavvLHRSGARFDLLLMDKEMPIKDG  277
             LTALVV+D+ + Q VH  LL + G++  VV+NG+EAV +H SG  +DL+LMD +MPI +G
Sbjct  1191  LTALVVDDNFVNQSVHHKLLDRLGIKNDVVSNGQEAVDVHCSGRNYDLILMDMDMPIMNG  1250

Query  278   VNATKELREMGVKSMIVGATSHGPGPVRDEFLAAGLDECLVKPLRAEVVLGVINKL  445
             + AT+ LREMG++S I G T+        EF+ AGL++   KPL    ++ +++ L
Sbjct  1251  IQATRRLREMGIESKIAGVTTRAEEEEVKEFMEAGLNDFQEKPLTISKLVSILHNL  1306



>emb|CDY65142.1| BnaC02g48400D [Brassica napus]
Length=1315

 Score = 74.7 bits (182),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 51/116 (44%), Positives = 78/116 (67%), Gaps = 0/116 (0%)
 Frame = +2

Query  98    LTALVVEDSPILQLVHKTLLKKYgvevqvvnngeeavvLHRSGARFDLLLMDKEMPIKDG  277
             +TALVV+D+ + Q VH  LL + G++  VV+NG+EAV +H SG  +DL+LMD +MPI +G
Sbjct  1194  ITALVVDDNFVNQSVHHKLLDRLGIKNDVVSNGQEAVDVHCSGRNYDLILMDMDMPIMNG  1253

Query  278   VNATKELREMGVKSMIVGATSHGPGPVRDEFLAAGLDECLVKPLRAEVVLGVINKL  445
             + AT+ LREMG++S I G T+        EF+ AGL++   KPL    ++ +++ L
Sbjct  1254  IQATRRLREMGIESKIAGVTTRAEEEEVKEFMEAGLNDFQEKPLTISKLVSILHNL  1309



>ref|WP_021020301.1| sensor histidine kinase [Vibrio gazogenes]
Length=577

 Score = 72.8 bits (177),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 45/117 (38%), Positives = 70/117 (60%), Gaps = 0/117 (0%)
 Frame = +2

Query  107  LVVEDSPILQLVHKTLLKKYgvevqvvnngeeavvLHRSGARFDLLLMDKEMPIKDGVNA  286
            LVVED+   Q+V + LL++ G  V +  NG+E + +      FDL+LMD  MP+ DG+ A
Sbjct  460  LVVEDTKTNQMVIQILLEQMGYGVTIAGNGQEFLDVIAENTNFDLILMDISMPVMDGIEA  519

Query  287  TKELREMGVKSMIVGATSHGPGPVRDEFLAAGLDECLVKPLRAEVVLGVINKLVA*N  457
            TK LR   + + +V  T+H     RD+ L AG+D+ +VKP R   +  ++NK ++ N
Sbjct  520  TKRLRHHNILTPVVALTAHSTPEDRDKCLLAGMDDFIVKPFRKHHIQAIVNKYLSEN  576



>ref|XP_011020733.1| PREDICTED: uncharacterized protein LOC105123004 [Populus euphratica]
Length=411

 Score = 72.0 bits (175),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 36/69 (52%), Positives = 46/69 (67%), Gaps = 3/69 (4%)
 Frame = +2

Query  212  LHRSGARFDLLLMDKEMPIKDGVNATKELREMGVKSMIVGATSHGPGPVRDEFLAAGLDE  391
            LH +GA FDL++MD +MPI  G+ AT+ LR+MGVKS I+G  S     V+  F+ AG DE
Sbjct  346  LHLAGASFDLIIMDDQMPIMTGIQATQLLRKMGVKSQIIGFASES---VQQAFIDAGADE  402

Query  392  CLVKPLRAE  418
            CL  PL  E
Sbjct  403  CLKMPLDTE  411



>ref|WP_040847875.1| hypothetical protein [Nitrospirillum amazonense]
Length=268

 Score = 70.1 bits (170),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 45/113 (40%), Positives = 70/113 (62%), Gaps = 1/113 (1%)
 Frame = +2

Query  71   MDSKNVGKGLTALVVEDSPILQLVHKTLLKKYgvevqvvnngeeavvLHRSGARFDLLLM  250
            M ++  G G   L+VED+P+ Q V   +L K G E  +V +G +A+   R   RFDL+LM
Sbjct  1    MPAEGRGVGRCVLLVEDNPVNQEVASLMLAKEGFEAVLVQDGVDALEAVRC-RRFDLVLM  59

Query  251  DKEMPIKDGVNATKELREMGVKSMIVGATSHGPGPVRDEFLAAGLDECLVKPL  409
            D +MP  DG+ AT+ +R MG +  I+  T++    +R+E+LAAG+D+ + KP 
Sbjct  60   DIQMPRMDGIEATRRMRAMGARMPIIAITANAMAGMREEYLAAGMDDYVAKPF  112



>ref|WP_040920256.1| hypothetical protein, partial [Leptonema illini]
Length=387

 Score = 71.6 bits (174),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 40/125 (32%), Positives = 71/125 (57%), Gaps = 1/125 (1%)
 Frame = +2

Query  74   DSKNVGKGLTALVVEDSPILQLVHKTLLKKYgvevqvvnngeeavvLHRSGARFDLLLMD  253
             ++N  + L  L+ EDSP LQ++ + +L+        + +  +  V+    A FD++ MD
Sbjct  257  STENGRESLRVLLAEDSPDLQILIRHMLES-TGCTVELASNGQEAVIAAQAAPFDIIFMD  315

Query  254  KEMPIKDGVNATKELREMGVKSMIVGATSHGPGPVRDEFLAAGLDECLVKPLRAEVVLGV  433
             +MP+ DG+ AT+ELR +G    +V  T+H     R+  LAAG++E + KP+R + ++ V
Sbjct  316  VQMPVMDGLRATQELRRLGYAGPVVALTAHAMTEERNRCLAAGMNEHISKPVRRQALIDV  375

Query  434  INKLV  448
            I +  
Sbjct  376  IARFT  380



>gb|EHQ07024.1| integral membrane sensor hybrid histidine kinase [Leptonema illini 
DSM 21528]
Length=686

 Score = 72.4 bits (176),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 40/123 (33%), Positives = 71/123 (58%), Gaps = 1/123 (1%)
 Frame = +2

Query  77   SKNVGKGLTALVVEDSPILQLVHKTLLKKYgvevqvvnngeeavvLHRSGARFDLLLMDK  256
            ++N  + L  L+ EDSP LQ++ + +L+        + +  +  V+    A FD++ MD 
Sbjct  557  TENGRESLRVLLAEDSPDLQILIRHMLES-TGCTVELASNGQEAVIAAQAAPFDIIFMDV  615

Query  257  EMPIKDGVNATKELREMGVKSMIVGATSHGPGPVRDEFLAAGLDECLVKPLRAEVVLGVI  436
            +MP+ DG+ AT+ELR +G    +V  T+H     R+  LAAG++E + KP+R + ++ VI
Sbjct  616  QMPVMDGLRATQELRRLGYAGPVVALTAHAMTEERNRCLAAGMNEHISKPVRRQALIDVI  675

Query  437  NKL  445
             + 
Sbjct  676  ARF  678



>ref|WP_001083807.1| sensor histidine kinase [Vibrio sp. RC586]
 gb|EEZ00057.1| signal transduction histidine kinase [Vibrio sp. RC586]
Length=569

 Score = 72.0 bits (175),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 45/128 (35%), Positives = 76/128 (59%), Gaps = 0/128 (0%)
 Frame = +2

Query  68   DMDSKNVGKGLTALVVEDSPILQLVHKTLLKKYgvevqvvnngeeavvLHRSGARFDLLL  247
            D +  +V +    LVVED+   Q+V + LL K G +V +  NG EA+ L    + FDL+L
Sbjct  442  DSEQSSVTRNQHILVVEDTKTNQMVIQLLLNKMGYDVTIAENGREAIELLEMNSIFDLIL  501

Query  248  MDKEMPIKDGVNATKELREMGVKSMIVGATSHGPGPVRDEFLAAGLDECLVKPLRAEVVL  427
            MD  MPI DG+ ATK++R   +   I+  T+H  G  +   + AG+++ ++KP+R + ++
Sbjct  502  MDISMPIMDGIAATKKIRSKNIDIPIIALTAHTAGSDKQNCIDAGMNDIVLKPIRGKDIV  561

Query  428  GVINKLVA  451
             V+N+ + 
Sbjct  562  NVVNRFIT  569



>ref|XP_002992734.1| hypothetical protein SELMODRAFT_451426 [Selaginella moellendorffii]
 gb|EFJ06215.1| hypothetical protein SELMODRAFT_451426 [Selaginella moellendorffii]
Length=440

 Score = 71.6 bits (174),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 43/101 (43%), Positives = 64/101 (63%), Gaps = 0/101 (0%)
 Frame = +2

Query  107  LVVEDSPILQLVHKTLLKKYgvevqvvnngeeavvLHRSGARFDLLLMDKEMPIKDGVNA  286
            L+VED+ I +++ + +L+   ++     NG+ AV LHR G  +DL+LMDKEMP+ DG  A
Sbjct  312  LLVEDTRINRIILRKVLQNLNLQCDEAENGQIAVDLHRQGKSYDLVLMDKEMPVMDGHEA  371

Query  287  TKELREMGVKSMIVGATSHGPGPVRDEFLAAGLDECLVKPL  409
            T+ LR MGVK+ IV  T +     ++ F  AG++E   KPL
Sbjct  372  TRALRMMGVKTPIVALTGNALQSDKELFFEAGVNEFQTKPL  412



>gb|KHN02435.1| Two-component response regulator ARR22 [Glycine soja]
 gb|KHN46687.1| Two-component response regulator ARR22 [Glycine soja]
Length=116

 Score = 67.4 bits (163),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 34/78 (44%), Positives = 50/78 (64%), Gaps = 0/78 (0%)
 Frame = +2

Query  212  LHRSGARFDLLLMDKEMPIKDGVNATKELREMGVKSMIVGATSHGPGPVRDEFLAAGLDE  391
            +H  G  FDL+LMD +MPI +G+ ATKELR MG+ SMIVG +S        +F+ AGL++
Sbjct  32   IHCHGQIFDLILMDMDMPIMNGIEATKELRSMGIGSMIVGVSSRCTEAEIRKFMEAGLND  91

Query  392  CLVKPLRAEVVLGVINKL  445
               KPL    +  +++K+
Sbjct  92   YHEKPLNNAKLSSILDKI  109



>ref|XP_003581069.1| PREDICTED: two-component response regulator ARR22-like [Brachypodium 
distachyon]
Length=134

 Score = 67.8 bits (164),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 47/127 (37%), Positives = 70/127 (55%), Gaps = 3/127 (2%)
 Frame = +2

Query  71   MDSKNVGKGLTALVVEDSPILQLVHKTLLKKYgvevqvvnngeeavvLHRSGARFDLLLM  250
            MD K  G  L  LV+EDS          L+++  E     NG EAV L+  G +FD++L 
Sbjct  1    MDFKTQGSSLKVLVIEDSEFQSWFLLAKLRRFSCETTRAKNGREAVDLYLEGKKFDIILC  60

Query  251  DKEMPIKDGVNATKELREMGVKSM-IVGATSHGPGPVRDEFLAAGLDECLVKPLRAEVVL  427
            DKEMPI  G  A  ++R MG   + IVG ++    P  +EF++AG D  + KP+  EV+ 
Sbjct  61   DKEMPIMKGPEAIVKIRSMGSTEVKIVGMSADSNAP--EEFMSAGADMFVPKPMDFEVLE  118

Query  428  GVINKLV  448
             +I +++
Sbjct  119  AIIKEVI  125



>ref|XP_006858898.1| hypothetical protein AMTR_s00066p00205980 [Amborella trichopoda]
 gb|ERN20365.1| hypothetical protein AMTR_s00066p00205980 [Amborella trichopoda]
Length=221

 Score = 68.9 bits (167),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 44/108 (41%), Positives = 71/108 (66%), Gaps = 1/108 (1%)
 Frame = +2

Query  107  LVVEDSPILQLVHKTLLKKYgvevqvvnngeeavvLHRSGARFDLLLMDKEMPIKDGVNA  286
            L+VED  + +++ + LL+   ++ +   NG+ AV L + G ++DL+ MDKEMP+ DG  A
Sbjct  101  LLVEDIELNRILVRKLLRDLNLQCEEAENGQVAVDLFKQGKQYDLVFMDKEMPVMDGHEA  160

Query  287  TKELREMGVKSMIVGATSHGPGPVRDEFLAAGLDECLVKPL-RAEVVL  427
            T++LR +GV++ IV  T +     ++ FLAAG+DE   KPL + E+VL
Sbjct  161  TRQLRTLGVQTPIVALTGNNLPSDKESFLAAGVDEFRAKPLTKNELVL  208



>ref|XP_002993716.1| hypothetical protein SELMODRAFT_449209 [Selaginella moellendorffii]
 gb|EFJ05208.1| hypothetical protein SELMODRAFT_449209 [Selaginella moellendorffii]
Length=679

 Score = 71.2 bits (173),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 43/101 (43%), Positives = 64/101 (63%), Gaps = 0/101 (0%)
 Frame = +2

Query  107  LVVEDSPILQLVHKTLLKKYgvevqvvnngeeavvLHRSGARFDLLLMDKEMPIKDGVNA  286
            L+VED+ I +++ + +L+   ++     NG+ AV LHR G  +DL+LMDKEMP+ DG  A
Sbjct  551  LLVEDTRINRIILRKVLQNLNLQCDEAENGQIAVDLHRQGKSYDLVLMDKEMPVMDGHEA  610

Query  287  TKELREMGVKSMIVGATSHGPGPVRDEFLAAGLDECLVKPL  409
            T+ LR MGVK+ IV  T +     ++ F  AG++E   KPL
Sbjct  611  TRALRMMGVKTPIVALTGNALQSDKELFFEAGVNEFQTKPL  651



>ref|WP_012026539.1| histidine kinase [Flavobacterium johnsoniae]
 ref|YP_001196892.1| integral membrane sensor hybrid histidine kinase [Flavobacterium 
johnsoniae UW101]
 gb|ABQ07573.1| integral membrane sensor hybrid histidine kinase [Flavobacterium 
johnsoniae UW101]
Length=729

 Score = 71.2 bits (173),  Expect = 6e-11, Method: Composition-based stats.
 Identities = 48/129 (37%), Positives = 78/129 (60%), Gaps = 4/129 (3%)
 Frame = +2

Query  62   EMDMDSKNVGKGLTALVVEDSPILQLVHKTLLKKYgvevqvvnngeeavvLHRSGARFDL  241
            E+D+ S  + K    L+VED+ I QLV K +++K     +VV++G  A+ +     RFDL
Sbjct  597  EVDLTSSEIYK---ILIVEDNLINQLVTKKIIEKNNFVCKVVDDGFGALTILEK-ERFDL  652

Query  242  LLMDKEMPIKDGVNATKELREMGVKSMIVGATSHGPGPVRDEFLAAGLDECLVKPLRAEV  421
            +LMD  MP+ +G  ATK +R +GVK+ IV  T+     + DE L++G+++ +VKP     
Sbjct  653  ILMDINMPLMNGFEATKRIRLLGVKTPIVALTAFDKDEITDEALSSGMNDIIVKPFEPVK  712

Query  422  VLGVINKLV  448
            +  +IN L+
Sbjct  713  LFKIINYLI  721



>gb|KHG06261.1| Two-component response regulator ARR22 -like protein [Gossypium 
arboreum]
Length=156

 Score = 67.0 bits (162),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 46/116 (40%), Positives = 76/116 (66%), Gaps = 0/116 (0%)
 Frame = +2

Query  98   LTALVVEDSPILQLVHKTLLKKYgvevqvvnngeeavvLHRSGARFDLLLMDKEMPIKDG  277
            LTALVV+     +++ + LL+ YGV+ Q V+NG +AV L  SG +FDL+++D  +P+ +G
Sbjct  38   LTALVVDGDTTCRVLEQLLLRSYGVQTQGVDNGRDAVALIASGVKFDLIIIDMILPVLNG  97

Query  278  VNATKELREMGVKSMIVGATSHGPGPVRDEFLAAGLDECLVKPLRAEVVLGVINKL  445
            + AT+++R+MGV   ++G T       R  FLAAG+D  + KPL  E ++ ++ +L
Sbjct  98   LEATRQIRDMGVHCKMLGVTICSGESERQAFLAAGVDVFIEKPLDPEHLVPILREL  153



>ref|XP_001753026.1| predicted protein [Physcomitrella patens]
 gb|EDQ82067.1| predicted protein, partial [Physcomitrella patens]
Length=89

 Score = 65.9 bits (159),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 31/78 (40%), Positives = 49/78 (63%), Gaps = 0/78 (0%)
 Frame = +2

Query  212  LHRSGARFDLLLMDKEMPIKDGVNATKELREMGVKSMIVGATSHGPGPVRDEFLAAGLDE  391
             H+ G  ++L+LMDKEMP+ DG  AT++LR MGVK+ IV  T +     R+ F  AG+D+
Sbjct  12   FHKEGRTYNLVLMDKEMPVMDGHEATRQLRNMGVKTPIVALTGNALTTDRELFFKAGVDD  71

Query  392  CLVKPLRAEVVLGVINKL  445
               KPL  + ++ ++ + 
Sbjct  72   FHTKPLSRDKLVQLLARF  89



>ref|XP_002267242.1| PREDICTED: two-component response regulator ARR22 [Vitis vinifera]
 ref|XP_010652453.1| PREDICTED: two-component response regulator ARR22 [Vitis vinifera]
 emb|CBI37244.3| unnamed protein product [Vitis vinifera]
Length=145

 Score = 67.0 bits (162),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 44/116 (38%), Positives = 74/116 (64%), Gaps = 0/116 (0%)
 Frame = +2

Query  98   LTALVVEDSPILQLVHKTLLKKYgvevqvvnngeeavvLHRSGARFDLLLMDKEMPIKDG  277
            LTALVV+   I Q++ K +L+  G++ QVV +G +A+ L  SG  FDL+++   +PI +G
Sbjct  27   LTALVVDSDIICQVLEKAILESQGIQAQVVGSGRDAIDLLASGVNFDLIIIAMVLPIMNG  86

Query  278  VNATKELREMGVKSMIVGATSHGPGPVRDEFLAAGLDECLVKPLRAEVVLGVINKL  445
            V  T+++R MG++S ++G T+      R  FL AG+DE + KPL  + +  V+ ++
Sbjct  87   VETTRQIRAMGIRSKMLGVTACSYERERRAFLDAGVDEFIEKPLTPQKLASVLREI  142



>ref|WP_000376696.1| sensor histidine kinase [Vibrio mimicus]
 gb|EEW06073.1| Autoinducer 2 sensor kinase/phosphatase luxQ [Vibrio mimicus 
VM603]
Length=573

 Score = 70.1 bits (170),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 44/129 (34%), Positives = 74/129 (57%), Gaps = 0/129 (0%)
 Frame = +2

Query  71   MDSKNVGKGLTALVVEDSPILQLVHKTLLKKYgvevqvvnngeeavvLHRSGARFDLLLM  250
            +    + K    LVVED+   Q+V + LL K G +V +  NG EA+ L      FDL+LM
Sbjct  443  LQKSTIAKNYHILVVEDTKTNQMVIQLLLNKMGYDVTIAENGLEAIELLEKSNAFDLVLM  502

Query  251  DKEMPIKDGVNATKELREMGVKSMIVGATSHGPGPVRDEFLAAGLDECLVKPLRAEVVLG  430
            D  MPI DG+ AT+++R   +   I+  T+H  G  +   + AG+++ ++KP+R + ++ 
Sbjct  503  DISMPIMDGIMATRKIRSQDIDIPIIALTAHTAGSDKQNCIDAGMNDIVLKPIRGKDIMN  562

Query  431  VINKLVA*N  457
            V+N+ +  N
Sbjct  563  VVNRFLPNN  571



>ref|XP_006345288.1| PREDICTED: two-component response regulator ARR22-like [Solanum 
tuberosum]
Length=61

 Score = 64.3 bits (155),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 32/60 (53%), Positives = 39/60 (65%), Gaps = 1/60 (2%)
 Frame = +2

Query  230  RFDLLLMDKEMPIKDGVNATKELREMGVKSMIVGATSHGPG-PVRDEFLAAGLDECLVKP  406
            RFDL+LM   MPI DG+ ATK L+ MG+  MIV  T+       R EF+ AGLD+C VKP
Sbjct  2    RFDLILMSSTMPIMDGIEATKNLQSMGITMMIVRITTPDDNEEYRKEFMEAGLDDCYVKP  61



>ref|XP_002967448.1| hypothetical protein SELMODRAFT_169013 [Selaginella moellendorffii]
 gb|EFJ32047.1| hypothetical protein SELMODRAFT_169013 [Selaginella moellendorffii]
Length=628

 Score = 69.7 bits (169),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 51/113 (45%), Positives = 68/113 (60%), Gaps = 5/113 (4%)
 Frame = +2

Query  92   KGLTALVVEDSPILQLVHKTLLKKYgvevqvvnngeeavvLHRSGARFDLLLMDKEMPIK  271
            KGL  LV ED+ + Q V  TLL+K+G    +  NG EAV    S   FDL+LMD +MPI 
Sbjct  495  KGLKILVAEDNVVNQRVAMTLLQKWGHATVLACNGSEAVE-QSSKEFFDLVLMDVQMPIC  553

Query  272  DGVNATKELREM----GVKSMIVGATSHGPGPVRDEFLAAGLDECLVKPLRAE  418
            DG  AT+E+RE+    GV++ IV  T+H      D  +AAG+D  + KPL A+
Sbjct  554  DGFQATREIRELEKSSGVRTPIVAMTAHAMSGDGDRCIAAGMDGYISKPLNAK  606



>ref|WP_031840866.1| histidine kinase, partial [Vibrio parahaemolyticus]
Length=135

 Score = 65.5 bits (158),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 43/121 (36%), Positives = 67/121 (55%), Gaps = 1/121 (1%)
 Frame = +2

Query  89   GKGLTALVVEDSPILQLVHKTLLKKYgvevqvvnn-geeavvLHRSGARFDLLLMDKEMP  265
             K L  L+VED+   QLV K +L K G  V + ++  E    L  +  R D++LMD  MP
Sbjct  12   SKALNLLIVEDTQSNQLVIKLILNKLGHNVHIASHGAEALTFLEENDTRIDMILMDVSMP  71

Query  266  IKDGVNATKELREMGVKSMIVGATSHGPGPVRDEFLAAGLDECLVKPLRAEVVLGVINKL  445
            + DG+ AT+ +R+ G+   IV  T+H     +D+ L AG+D  + KP+R + +   I  L
Sbjct  72   VMDGITATRLIRKKGITIPIVALTAHALESDKDKCLDAGMDSFVSKPVRRQDIYEAIQSL  131

Query  446  V  448
            +
Sbjct  132  I  132



>ref|WP_000376697.1| sensor histidine kinase [Vibrio mimicus]
 gb|EEY38576.1| signal transduction histidine kinase [Vibrio mimicus MB-451]
Length=573

 Score = 69.3 bits (168),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 44/129 (34%), Positives = 74/129 (57%), Gaps = 0/129 (0%)
 Frame = +2

Query  71   MDSKNVGKGLTALVVEDSPILQLVHKTLLKKYgvevqvvnngeeavvLHRSGARFDLLLM  250
            +    + K    LVVED+   Q+V + LL K G +V +  NG EA+ L      FDL+LM
Sbjct  443  LKQNTIAKNHHILVVEDTKTNQMVIQLLLNKMGYDVTIAENGLEAIELLEKSNAFDLVLM  502

Query  251  DKEMPIKDGVNATKELREMGVKSMIVGATSHGPGPVRDEFLAAGLDECLVKPLRAEVVLG  430
            D  MPI DG+ AT+++R   +   I+  T+H  G  +   + AG+++ ++KP+R + ++ 
Sbjct  503  DISMPIMDGIMATRKIRSQDIDIPIIALTAHTAGSDKQNCIDAGMNDIVLKPIRGKDIMN  562

Query  431  VINKLVA*N  457
            V+N+ +  N
Sbjct  563  VVNRFLPNN  571



>ref|WP_000376698.1| MULTISPECIES: sensor histidine kinase [Vibrio]
 gb|EEW09178.1| Autoinducer 2 sensor kinase/phosphatase luxQ [Vibrio mimicus 
VM573]
 gb|EGU18611.1| sensor histidine kinase/response regulator [Vibrio mimicus SX-4]
 gb|KFE30596.1| his Kinase A domain protein [Vibrio cholerae]
Length=573

 Score = 69.3 bits (168),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 44/129 (34%), Positives = 74/129 (57%), Gaps = 0/129 (0%)
 Frame = +2

Query  71   MDSKNVGKGLTALVVEDSPILQLVHKTLLKKYgvevqvvnngeeavvLHRSGARFDLLLM  250
            +    + K    LVVED+   Q+V + LL K G +V +  NG EA+ L      FDL+LM
Sbjct  443  LKQNTIAKNHHILVVEDTKTNQMVIQLLLNKMGYDVTIAENGLEAIELLEKSNAFDLVLM  502

Query  251  DKEMPIKDGVNATKELREMGVKSMIVGATSHGPGPVRDEFLAAGLDECLVKPLRAEVVLG  430
            D  MPI DG+ AT+++R   +   I+  T+H  G  +   + AG+++ ++KP+R + ++ 
Sbjct  503  DISMPIMDGIMATRKIRSQDIDIPIIALTAHTAGSDKQNCIDAGMNDIVLKPIRGKDIMN  562

Query  431  VINKLVA*N  457
            V+N+ +  N
Sbjct  563  VVNRFLPNN  571



>ref|WP_040371066.1| hypothetical protein, partial [Desulfovibrio alkalitolerans]
Length=523

 Score = 68.9 bits (167),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 47/122 (39%), Positives = 71/122 (58%), Gaps = 5/122 (4%)
 Frame = +2

Query  98   LTALVVEDSPILQLVHKTLLKKYgvevqvvnngeeavvLHRSGARFDLLLMDKEMPIKDG  277
            +T LVV+D  + +     LL+++G  V    NG  A+   R G   D++L+D +MP+ DG
Sbjct  403  MTVLVVDDDWVNRRFTCQLLQRHGHGVIEAGNGLAALEKLRQGG-VDMVLLDMQMPVMDG  461

Query  278  VNATKELREMGVKSM----IVGATSHGPGPVRDEFLAAGLDECLVKPLRAEVVLGVINKL  445
            + AT+ +R   V+SM    I+G T++     R  FLAAG++ CL KPLR E +L V+  L
Sbjct  462  ITATRAIRGGAVRSMAQVPIIGLTAYAASEDRQRFLAAGVNACLAKPLRMERLLAVMRDL  521

Query  446  VA  451
             A
Sbjct  522  FA  523



>ref|WP_000376695.1| sensor histidine kinase [Vibrio mimicus]
 gb|EEY44070.1| signal transduction histidine kinase [Vibrio mimicus VM223]
Length=573

 Score = 68.9 bits (167),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 44/124 (35%), Positives = 73/124 (59%), Gaps = 0/124 (0%)
 Frame = +2

Query  86   VGKGLTALVVEDSPILQLVHKTLLKKYgvevqvvnngeeavvLHRSGARFDLLLMDKEMP  265
            + K    LVVED+   Q+V + LL K G +V +  NG EA+ L      FDL+LMD  MP
Sbjct  448  IAKNHHILVVEDTKTNQMVIQLLLNKMGYDVTIAENGLEAIELLEKSNAFDLVLMDISMP  507

Query  266  IKDGVNATKELREMGVKSMIVGATSHGPGPVRDEFLAAGLDECLVKPLRAEVVLGVINKL  445
            I DG+ AT+++R   +   I+  T+H  G  +   + AG+++ ++KP+R + ++ V+N+ 
Sbjct  508  IMDGIMATRKIRSQDIDIPIIALTAHTAGSDKQNCIDAGMNDIVLKPIRGKDIMNVVNRF  567

Query  446  VA*N  457
            +  N
Sbjct  568  LPNN  571



>ref|XP_011034463.1| PREDICTED: uncharacterized protein LOC105132592 isoform X1 [Populus 
euphratica]
 ref|XP_011034464.1| PREDICTED: uncharacterized protein LOC105132592 isoform X1 [Populus 
euphratica]
 ref|XP_011034465.1| PREDICTED: uncharacterized protein LOC105132592 isoform X1 [Populus 
euphratica]
Length=331

 Score = 67.8 bits (164),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 51/122 (42%), Positives = 68/122 (56%), Gaps = 9/122 (7%)
 Frame = +2

Query  89   GKGLTALVVEDSPILQLVHKTLL------KKYgvevqvvnngeeavvLHRSGARFDLLLM  250
            G   + LVV DS  L+   + LL      KK  ++V V  NG+EAV LH +GA FD+++M
Sbjct  212  GNNFSVLVVHDSRDLRETRQRLLVLLGYQKKLQMDVSVAKNGKEAVYLHLAGASFDMIIM  271

Query  251  DKEMPIKDGVNATKELREMGVKSMIVGATSHGPGPVRDEFLAAGLDECLVKPLRAEVVLG  430
            D  MP  DG+ A   LR MGV+S IVG T       R  F+ +G D C++KPL  E +  
Sbjct  272  DDLMPFMDGIEAINLLRRMGVESHIVGVTGEFK---RLAFMDSGADSCIIKPLTLEKLAA  328

Query  431  VI  436
            V 
Sbjct  329  VF  330



>gb|EPR32860.1| PAS/PAC sensor hybrid histidine kinase [Desulfovibrio alkalitolerans 
DSM 16529]
Length=936

 Score = 68.9 bits (167),  Expect = 4e-10, Method: Composition-based stats.
 Identities = 47/122 (39%), Positives = 71/122 (58%), Gaps = 5/122 (4%)
 Frame = +2

Query  98   LTALVVEDSPILQLVHKTLLKKYgvevqvvnngeeavvLHRSGARFDLLLMDKEMPIKDG  277
            +T LVV+D  + +     LL+++G  V    NG  A+   R G   D++L+D +MP+ DG
Sbjct  697  MTVLVVDDDWVNRRFTCQLLQRHGHGVIEAGNGLAALEKLRQGG-VDMVLLDMQMPVMDG  755

Query  278  VNATKELREMGVKSM----IVGATSHGPGPVRDEFLAAGLDECLVKPLRAEVVLGVINKL  445
            + AT+ +R   V+SM    I+G T++     R  FLAAG++ CL KPLR E +L V+  L
Sbjct  756  ITATRAIRGGAVRSMAQVPIIGLTAYAASEDRQRFLAAGVNACLAKPLRMERLLAVMRDL  815

Query  446  VA  451
             A
Sbjct  816  FA  817



>ref|WP_022577997.1| sensor histidine kinase [Vibrio mimicus]
 gb|ERM56616.1| sensor histidine kinase [Vibrio mimicus CAIM 1883]
 gb|ERM56800.1| sensor histidine kinase [Vibrio mimicus CAIM 1882]
Length=573

 Score = 68.6 bits (166),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 44/129 (34%), Positives = 74/129 (57%), Gaps = 0/129 (0%)
 Frame = +2

Query  71   MDSKNVGKGLTALVVEDSPILQLVHKTLLKKYgvevqvvnngeeavvLHRSGARFDLLLM  250
            +    + K    LVVED+   Q+V + LL K G +V +  NG EA+ L      FDL+LM
Sbjct  443  LQQNTMAKNHHILVVEDTKTNQMVIQLLLNKMGYDVTIAENGLEAIELLEKSNAFDLVLM  502

Query  251  DKEMPIKDGVNATKELREMGVKSMIVGATSHGPGPVRDEFLAAGLDECLVKPLRAEVVLG  430
            D  MPI DG+ AT+++R   +   I+  T+H  G  +   + AG+++ ++KP+R + ++ 
Sbjct  503  DISMPIMDGIMATRKIRSQDIDIPIIALTAHTAGSDKQNCIDAGMNDIVLKPIRGKDIMN  562

Query  431  VINKLVA*N  457
            V+N+ +  N
Sbjct  563  VVNRFLPNN  571



>ref|WP_005523014.1| Signal transduction histidine kinase [Vibrio mimicus]
 gb|EMB51300.1| Signal transduction histidine kinase [Vibrio mimicus CAIM 602]
Length=574

 Score = 68.6 bits (166),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 42/130 (32%), Positives = 75/130 (58%), Gaps = 1/130 (1%)
 Frame = +2

Query  71   MDSKNVGKGLTALVVEDSPILQLVHKTLLKKYgvevqvvnn-geeavvLHRSGARFDLLL  247
            +    + K    LVVED+   Q+V + LL K G +V +  N  E   +L ++   FDL+L
Sbjct  443  LQQSTIAKNHHILVVEDTKTNQMVIQLLLNKMGYDVTIAENGLEAIELLEKNNNAFDLVL  502

Query  248  MDKEMPIKDGVNATKELREMGVKSMIVGATSHGPGPVRDEFLAAGLDECLVKPLRAEVVL  427
            MD  MPI DG+ AT+++R   +   I+  T+H  G  +   + AG+++ ++KP+R++ ++
Sbjct  503  MDISMPIMDGIMATRKIRSQDIDIPIIALTAHTAGSDKQNCIDAGMNDIVLKPIRSKDIM  562

Query  428  GVINKLVA*N  457
             V+N+ +  N
Sbjct  563  NVVNRFLPNN  572



>ref|XP_010467996.1| PREDICTED: two-component response regulator ARR22-like [Camelina 
sativa]
Length=130

 Score = 64.7 bits (156),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 50/122 (41%), Positives = 72/122 (59%), Gaps = 9/122 (7%)
 Frame = +2

Query  92   KGLTALVVEDSPILQLVHKTLLKKYgvevqvvnngeeavvLHRSGARFDLLLMD-KEMPI  268
            K LT L+V++ P     +  +++  G    +  N EEAV LH +G  ++L++MD  +M +
Sbjct  11   KKLTVLIVDEDPYRCGAYMGIIQMAGGFPYMARNAEEAVNLHLNGDYYNLIIMDMNDMSL  70

Query  269  KDGVNATKELREMGVKSMIVGATSHGPGPVRDE---FLAAGLDECLVKPLRAEVVLGVIN  439
             DGV   K+LR+M V SMIVG TSH      DE   F+ AG+D CLVKPL    +  +IN
Sbjct  71   IDGVPLIKKLRDMKVTSMIVGVTSH-----EDENRAFMNAGVDHCLVKPLTFGKMDPIIN  125

Query  440  KL  445
            +L
Sbjct  126  QL  127



>ref|XP_002297820.1| hypothetical protein POPTR_0001s14380g [Populus trichocarpa]
 gb|EEE82625.1| hypothetical protein POPTR_0001s14380g [Populus trichocarpa]
Length=336

 Score = 67.8 bits (164),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 51/122 (42%), Positives = 68/122 (56%), Gaps = 9/122 (7%)
 Frame = +2

Query  89   GKGLTALVVEDSPILQLVHKTLL------KKYgvevqvvnngeeavvLHRSGARFDLLLM  250
            G   + LVV DS  L+   + LL      KK  ++V V  NG+EAV LH +GA FD+++M
Sbjct  211  GNNFSVLVVHDSRDLRETRQRLLVLLGYQKKLQMDVSVAKNGKEAVYLHLAGASFDMIIM  270

Query  251  DKEMPIKDGVNATKELREMGVKSMIVGATSHGPGPVRDEFLAAGLDECLVKPLRAEVVLG  430
            D  MP  DG+ A   LR MGV+S IVG T       R  F+ +G D C++KPL  E +  
Sbjct  271  DDLMPFMDGIEAINLLRRMGVESRIVGVTGEFK---RLAFMDSGADSCIIKPLTLEKLAA  327

Query  431  VI  436
            V 
Sbjct  328  VF  329



>gb|EKL09623.1| histidine kinase-, DNA gyrase B-, and HSP90-like ATPase family 
protein, partial [Vibrio cholerae HC-50A2]
Length=152

 Score = 65.1 bits (157),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 43/114 (38%), Positives = 71/114 (62%), Gaps = 0/114 (0%)
 Frame = +2

Query  107  LVVEDSPILQLVHKTLLKKYgvevqvvnngeeavvLHRSGARFDLLLMDKEMPIKDGVNA  286
            LVVED+   Q+V + LL K G +V +  NG +AV L      FDL+LMD  MPI DG+ A
Sbjct  37   LVVEDTKTNQMVIQLLLNKLGYDVTIAENGLQAVELLEKNHVFDLVLMDISMPIMDGIAA  96

Query  287  TKELREMGVKSMIVGATSHGPGPVRDEFLAAGLDECLVKPLRAEVVLGVINKLV  448
            TK LR+  ++  I+  T+H  G  +   + AG+++ ++KP+R++ ++ V+ + +
Sbjct  97   TKILRDKHIEIPIIALTAHTAGSDKQNCIDAGMNDIVLKPIRSKDIMEVVKRFL  150



>ref|WP_038179338.1| histidine kinase [Vibrio rhizosphaerae]
Length=579

 Score = 68.2 bits (165),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 42/117 (36%), Positives = 69/117 (59%), Gaps = 0/117 (0%)
 Frame = +2

Query  107  LVVEDSPILQLVHKTLLKKYgvevqvvnngeeavvLHRSGARFDLLLMDKEMPIKDGVNA  286
            LVVED+   Q+V + LL++ G  V +  +G+E + +      FDL+LMD  MP+ DG+ A
Sbjct  462  LVVEDTKTNQMVIQILLEQLGYSVTIAGHGQECLDIIAKHPDFDLILMDISMPVMDGIEA  521

Query  287  TKELREMGVKSMIVGATSHGPGPVRDEFLAAGLDECLVKPLRAEVVLGVINKLVA*N  457
            T+ LR   + + ++  T+H     R+E L AG+D+ +VKP R   +  ++NK +  N
Sbjct  522  TQRLRHHNILTPVIALTAHSTPEDREECLLAGMDDFIVKPFRKHQIQAMVNKYLNEN  578



>ref|WP_007805290.1| histidine kinase [Flavobacterium sp. CF136]
 gb|EJL65745.1| signal transduction histidine kinase [Flavobacterium sp. CF136]
Length=726

 Score = 68.6 bits (166),  Expect = 5e-10, Method: Composition-based stats.
 Identities = 42/129 (33%), Positives = 79/129 (61%), Gaps = 4/129 (3%)
 Frame = +2

Query  62   EMDMDSKNVGKGLTALVVEDSPILQLVHKTLLKKYgvevqvvnngeeavvLHRSGARFDL  241
            E+D +S N+ K    L+VED+ I QL+ + +++K   +  VVN+G  A+ L +    FD+
Sbjct  594  EIDFESNNLYK---ILIVEDNIINQLITRKIIEKNNYKCSVVNDGFSAIDLLKK-EEFDV  649

Query  242  LLMDKEMPIKDGVNATKELREMGVKSMIVGATSHGPGPVRDEFLAAGLDECLVKPLRAEV  421
            +LMD  MP+ +G   T+ +R +G+ + IV  T+     + DE +++G+++ ++KP  +E 
Sbjct  650  VLMDINMPLMNGFETTRRIRSIGILTPIVALTAFDKDEIADEAISSGMNDIIIKPFESEK  709

Query  422  VLGVINKLV  448
            +  +IN L+
Sbjct  710  LFKIINNLI  718



>gb|KCW80642.1| hypothetical protein EUGRSUZ_C02019 [Eucalyptus grandis]
Length=124

 Score = 64.3 bits (155),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 44/124 (35%), Positives = 68/124 (55%), Gaps = 9/124 (7%)
 Frame = +2

Query  86   VGKGLTALVVEDSPILQLVHKTLLKKYgvevqvvnngee----avvLHRSGARFDLLLMD  253
            +GK L+ L+++D  +++ +H+ L+    V  QV          A+ LH SG+ FD++L+D
Sbjct  2    IGK-LSVLIIDDDALIRKIHEKLMSNAKVAKQVQTQTATNGKEALDLHLSGSSFDIILVD  60

Query  254  KEMPIKDGVNATKELREMGVKSMIVGATSHGPGPVRDEFLAAGLDECLVKPLRAEVVLGV  433
             EMPI DG         +G +    G TS  P   ++ F+AAGLDECL KPL  E +  +
Sbjct  61   MEMPILDGPEVFLVFAHVGGE----GVTSRNPEAHKEAFVAAGLDECLEKPLTVEKIKSL  116

Query  434  INKL  445
            +  L
Sbjct  117  VETL  120



>ref|XP_003566425.2| PREDICTED: LOW QUALITY PROTEIN: two-component response regulator 
ARR2-like [Brachypodium distachyon]
Length=133

 Score = 64.3 bits (155),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 43/127 (34%), Positives = 73/127 (57%), Gaps = 3/127 (2%)
 Frame = +2

Query  71   MDSKNVGKGLTALVVEDSPILQLVHKTLLKKYgvevqvvnngeeavvLHRSGARFDLLLM  250
            MDSK  G  L  LV+EDS +  ++   +L++   E     NG+EAV L+  G  FD++L 
Sbjct  1    MDSKTQGSSLKVLVIEDSELQSMILLAMLRRCNCETARAENGKEAVDLYLEGKTFDIILC  60

Query  251  DKEMPIKDGVNATKELREMGVKSM-IVGATSHGPGPVRDEFLAAGLDECLVKPLRAEVVL  427
            DK+MPI +G  A  ++R MG   + IVG ++       +EF++ G D  + KP++ E + 
Sbjct  61   DKQMPIMNGPEAIVKIRSMGATEVKIVGLSADSDAT--EEFISDGADMFVAKPMKLEXLK  118

Query  428  GVINKLV  448
             ++ +++
Sbjct  119  DIVREVI  125



>ref|WP_022963217.1| sensor histidine kinase [Pseudomonas pelagia]
Length=922

 Score = 67.8 bits (164),  Expect = 8e-10, Method: Composition-based stats.
 Identities = 47/135 (35%), Positives = 80/135 (59%), Gaps = 6/135 (4%)
 Frame = +2

Query  62   EMDMDSKNVGKGLTALVVEDSPILQLVHKTLLKKYgvevqvvnngeeavvLHRSGA-RFD  238
            ++D+    +G+ L+ LV ED+P+ Q+V + LL+     V++V NG EA+  + +   +F 
Sbjct  782  DLDVLPNPIGRPLSVLVAEDNPVNQMVVRGLLETRSCLVKLVPNGAEALATYCANPDQFQ  841

Query  239  LLLMDKEMPIKDGVNATKELREMGVKSM-----IVGATSHGPGPVRDEFLAAGLDECLVK  403
            L+LMD EMP+ DG  AT+++R    + +     IV  T+H     R   + AG+++ L K
Sbjct  842  LILMDGEMPVMDGFEATRQIRAFESQHLLPAVTIVALTAHILDSHRQAGVDAGMNDYLAK  901

Query  404  PLRAEVVLGVINKLV  448
            PLR E +  V++KL+
Sbjct  902  PLRREALYAVLDKLI  916



>ref|WP_025519761.1| hypothetical protein, partial [Vibrio parahaemolyticus]
Length=223

 Score = 65.1 bits (157),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 43/121 (36%), Positives = 67/121 (55%), Gaps = 1/121 (1%)
 Frame = +2

Query  89   GKGLTALVVEDSPILQLVHKTLLKKYgvevqvvnn-geeavvLHRSGARFDLLLMDKEMP  265
             K L  L+VED+   QLV K +L K G  V + ++  E    L  +  R D++LMD  MP
Sbjct  100  SKALNLLIVEDTQSNQLVIKLILNKLGHNVHIASHGAEALTFLEENDTRIDMILMDVSMP  159

Query  266  IKDGVNATKELREMGVKSMIVGATSHGPGPVRDEFLAAGLDECLVKPLRAEVVLGVINKL  445
            + DG+ AT+ +R+ G+   IV  T+H     +D+ L AG+D  + KP+R + +   I  L
Sbjct  160  VMDGITATRLIRKKGITIPIVALTAHALESDKDKCLDAGMDSFVSKPVRRQDIYEAIQSL  219

Query  446  V  448
            +
Sbjct  220  I  220



>ref|XP_007049951.1| Response regulator 24, putative [Theobroma cacao]
 gb|EOX94108.1| Response regulator 24, putative [Theobroma cacao]
Length=122

 Score = 63.5 bits (153),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 40/104 (38%), Positives = 70/104 (67%), Gaps = 0/104 (0%)
 Frame = +2

Query  134  QLVHKTLLKKYgvevqvvnngeeavvLHRSGARFDLLLMDKEMPIKDGVNATKELREMGV  313
            ++V   LL+ YGVE Q V++G  AV +  SGA F+L+++D  +P+ +G+  T+++R MGV
Sbjct  16   RMVELGLLQAYGVETQAVDSGMAAVEIIASGANFNLIVIDMVLPVLNGLVTTRQIRAMGV  75

Query  314  KSMIVGATSHGPGPVRDEFLAAGLDECLVKPLRAEVVLGVINKL  445
            +  ++G T+H     R  FLAAG+DE + KPL  ++++ ++ +L
Sbjct  76   RCKMLGVTAHFYERERQAFLAAGVDEFIEKPLTPDILVPILREL  119



>ref|WP_001914345.1| signal transduction histidine kinase [Vibrio cholerae]
 gb|EEY51510.1| signal transduction histidine kinase [Vibrio cholerae CT 5369-93]
Length=226

 Score = 65.1 bits (157),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 43/114 (38%), Positives = 72/114 (63%), Gaps = 0/114 (0%)
 Frame = +2

Query  107  LVVEDSPILQLVHKTLLKKYgvevqvvnngeeavvLHRSGARFDLLLMDKEMPIKDGVNA  286
            LVVED+   Q+V + LL K G +V +  NG++AV L      FDL+LMD  MPI DG+ A
Sbjct  111  LVVEDTKTNQMVIQLLLNKLGYDVTIAENGQQAVELLDRNHAFDLVLMDISMPIMDGIAA  170

Query  287  TKELREMGVKSMIVGATSHGPGPVRDEFLAAGLDECLVKPLRAEVVLGVINKLV  448
            TK LR+  ++  I+  T+H  G  +   + AG+++ ++KP+R++ ++ V+ + +
Sbjct  171  TKILRDKHIEIPIIALTAHTAGSDKQNCIDAGMNDIVLKPIRSKDIMEVVKRFL  224



>ref|WP_035683166.1| histidine kinase [Flavobacterium reichenbachii]
 gb|KFF05596.1| histidine kinase [Flavobacterium reichenbachii]
Length=728

 Score = 67.8 bits (164),  Expect = 9e-10, Method: Composition-based stats.
 Identities = 41/129 (32%), Positives = 77/129 (60%), Gaps = 4/129 (3%)
 Frame = +2

Query  62   EMDMDSKNVGKGLTALVVEDSPILQLVHKTLLKKYgvevqvvnngeeavvLHRSGARFDL  241
            E+D+ S+ + K    L+VED+ I Q+V + +++K      VV+ G  A+ +  +   FDL
Sbjct  597  EVDLTSEKICK---ILIVEDNLINQMVTRKIIEKNNYICTVVDEGFSALRILET-ETFDL  652

Query  242  LLMDKEMPIKDGVNATKELREMGVKSMIVGATSHGPGPVRDEFLAAGLDECLVKPLRAEV  421
            +LMD  MP+ +G   TK +R+ G+K+ IV  T+     ++DE +A+G+++ ++KP     
Sbjct  653  ILMDINMPLMNGFETTKRIRQQGIKTPIVALTAFDKDEIKDEAMASGINDIIIKPFEPIK  712

Query  422  VLGVINKLV  448
            +  ++N L+
Sbjct  713  LFSILNYLI  721



>ref|NP_001051227.1| Os03g0742300 [Oryza sativa Japonica Group]
 gb|AAR87285.1| putative response regulator protein(receiver component) [Oryza 
sativa Japonica Group]
 gb|ABF98802.1| Response regulator receiver domain containing protein, expressed 
[Oryza sativa Japonica Group]
 gb|ABF98803.1| Response regulator receiver domain containing protein, expressed 
[Oryza sativa Japonica Group]
 dbj|BAF13141.1| Os03g0742300 [Oryza sativa Japonica Group]
 gb|EAY91816.1| hypothetical protein OsI_13457 [Oryza sativa Indica Group]
 gb|EAZ28539.1| hypothetical protein OsJ_12520 [Oryza sativa Japonica Group]
Length=127

 Score = 63.5 bits (153),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 49/119 (41%), Positives = 66/119 (55%), Gaps = 6/119 (5%)
 Frame = +2

Query  92   KGLTALVVEDSPILQLVHKTLLKKYgvevqvvnngeeavvLHR---SGARFDLLLMDKEM  262
            K +  L+VED  I ++V +  LK  G    V       V + R   + A +DL+LMDK+M
Sbjct  4    KMIRVLLVEDEEINRVVARAALKAAGGGDVVDEAENGEVAVQRVRDAAAPYDLVLMDKQM  63

Query  263  PIKDGVNATKELREMGVKSMIVGATSHG-PGPVRDEFLAAGLDECLVKPLRAEVVLGVI  436
            P+ DG  AT+ +R MGV + IV  +S G P  V D F+ AG D+   KPL  E  LGVI
Sbjct  64   PVMDGHEATRRIRGMGVTTPIVAVSSDGLPADV-DAFITAGADDFTSKPLSKE-KLGVI  120



>ref|XP_011020984.1| PREDICTED: oxidative stress response two-component system protein 
SSK1-like [Populus euphratica]
Length=486

 Score = 67.0 bits (162),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 34/65 (52%), Positives = 45/65 (69%), Gaps = 3/65 (5%)
 Frame = +2

Query  212  LHRSGARFDLLLMDKEMPIKDGVNATKELREMGVKSMIVGATSHGPGPVRDEFLAAGLDE  391
            LH +GA F L++MD +MPIK G+ AT+ LR+MGVKS IVG TS      +  F+ AGL+ 
Sbjct  421  LHLAGASFVLIIMDDQMPIKTGIQATQLLRKMGVKSQIVGVTSESD---QQAFIHAGLNT  477

Query  392  CLVKP  406
            C+ KP
Sbjct  478  CIRKP  482



>gb|ADE77088.1| unknown [Picea sitchensis]
Length=252

 Score = 65.5 bits (158),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 40/101 (40%), Positives = 62/101 (61%), Gaps = 0/101 (0%)
 Frame = +2

Query  107  LVVEDSPILQLVHKTLLKKYgvevqvvnngeeavvLHRSGARFDLLLMDKEMPIKDGVNA  286
            L+VED+ + +++   +L+   +  +   NG+ AV   + G  +DL+LMDKEMP+ DG  A
Sbjct  129  LLVEDTELNRIILGKVLQTLNLHCEEAENGKVAVDYFKQGRTYDLVLMDKEMPVMDGHEA  188

Query  287  TKELREMGVKSMIVGATSHGPGPVRDEFLAAGLDECLVKPL  409
            T++LR MGVK+ IV  T +     +D F  AG+D+   KPL
Sbjct  189  TRQLRSMGVKTPIVALTGNTLQSDKDLFFEAGVDDFQTKPL  229



>ref|XP_010417616.1| PREDICTED: two-component response regulator ARR22-like [Camelina 
sativa]
Length=130

 Score = 63.5 bits (153),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 50/122 (41%), Positives = 71/122 (58%), Gaps = 9/122 (7%)
 Frame = +2

Query  92   KGLTALVVEDSPILQLVHKTLLKKYgvevqvvnngeeavvLHRSGARFDLLLMD-KEMPI  268
            K LT L+V++ P     +  +++  G    +  N EEAV LHR G  ++L++MD  +M +
Sbjct  11   KKLTVLIVDEDPYRCGDYMGIIQMAGGFAYMTRNAEEAVKLHRDGDYYNLIIMDMNDMSL  70

Query  269  KDGVNATKELREMGVKSMIVGATSHGPGPVRDE---FLAAGLDECLVKPLRAEVVLGVIN  439
             DGV   K+L +M V SMIVG TSH      DE   F+ AG+D CLVKPL    +  +IN
Sbjct  71   IDGVPLIKKLGDMKVTSMIVGVTSH-----EDENKAFMEAGVDHCLVKPLTFGKMDPIIN  125

Query  440  KL  445
            +L
Sbjct  126  QL  127



>ref|WP_025640115.1| hypothetical protein, partial [Vibrio parahaemolyticus]
Length=280

 Score = 65.5 bits (158),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 43/121 (36%), Positives = 67/121 (55%), Gaps = 1/121 (1%)
 Frame = +2

Query  89   GKGLTALVVEDSPILQLVHKTLLKKYgvevqvvnn-geeavvLHRSGARFDLLLMDKEMP  265
             K L  L+VED+   QLV K +L K G  V + ++  E    L  +  R D++LMD  MP
Sbjct  157  SKALNLLIVEDTQSNQLVIKLILNKLGHNVHIASHGAEALTFLEENDTRIDMILMDVSMP  216

Query  266  IKDGVNATKELREMGVKSMIVGATSHGPGPVRDEFLAAGLDECLVKPLRAEVVLGVINKL  445
            + DG+ AT+ +R+ G+   IV  T+H     +D+ L AG+D  + KP+R + +   I  L
Sbjct  217  VMDGITATRLIRKKGITIPIVALTAHALESDKDKCLDAGMDSFVSKPVRRQDIYEAIQSL  276

Query  446  V  448
            +
Sbjct  277  I  277



>ref|WP_033908231.1| histidine kinase, partial [Vibrio parahaemolyticus]
 gb|KED27023.1| hypothetical protein EN08_06705, partial [Vibrio parahaemolyticus]
Length=258

 Score = 65.1 bits (157),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 43/121 (36%), Positives = 67/121 (55%), Gaps = 1/121 (1%)
 Frame = +2

Query  89   GKGLTALVVEDSPILQLVHKTLLKKYgvevqvvnn-geeavvLHRSGARFDLLLMDKEMP  265
             K L  L+VED+   QLV K +L K G  V + ++  E    L  +  R D++LMD  MP
Sbjct  135  SKALNLLIVEDTQSNQLVIKLILNKLGHNVHIASHGAEALTFLEENDTRIDMILMDVSMP  194

Query  266  IKDGVNATKELREMGVKSMIVGATSHGPGPVRDEFLAAGLDECLVKPLRAEVVLGVINKL  445
            + DG+ AT+ +R+ G+   IV  T+H     +D+ L AG+D  + KP+R + +   I  L
Sbjct  195  VMDGITATRLIRKKGITIPIVALTAHALESDKDKCLDAGMDSFVSKPVRRQDIYEAIQSL  254

Query  446  V  448
            +
Sbjct  255  I  255



>ref|WP_007063811.1| histidine kinase [Clostridium carboxidivorans]
 gb|EET84626.1| histidine kinase [Clostridium carboxidivorans P7]
 gb|EFG87969.1| response regulator receiver domain protein [Clostridium carboxidivorans 
P7]
Length=393

 Score = 66.2 bits (160),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 52/134 (39%), Positives = 78/134 (58%), Gaps = 5/134 (4%)
 Frame = +2

Query  80   KNVGKGLTALVVEDSPILQLVHKTLLKKYgvevqvvnngeeavvLHRSGARFDLLLMDKE  259
            K + K L  L+VED    Q+V   L KKYG    + NNG+EA+ + ++  ++DL+LMD +
Sbjct  242  KRINKKLNILIVEDDKASQIVMYNLFKKYGHICDIANNGQEALNVLKT-KQYDLILMDIQ  300

Query  260  MPIKDGVNATKELR---EMGVKSM-IVGATSHGPGPVRDEFLAAGLDECLVKPLRAEVVL  427
            MPI DGV ATK +R   E   K + I+  T++     ++ FL  G+DE + KP   E +L
Sbjct  301  MPIMDGVQATKFIRKSEEGNDKHIPIIALTAYALKGDKEHFLGLGMDEYISKPFNVEELL  360

Query  428  GVINKLVA*NEFDL  469
              + K+V  +E DL
Sbjct  361  QTVYKIVKKDESDL  374



>gb|ETY66475.1| response regulator [Vibrio parahaemolyticus EKP-028]
 gb|EWM39413.1| response regulator [Vibrio parahaemolyticus EKP-021]
Length=355

 Score = 65.9 bits (159),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 43/121 (36%), Positives = 67/121 (55%), Gaps = 1/121 (1%)
 Frame = +2

Query  89   GKGLTALVVEDSPILQLVHKTLLKKYgvevqvvnn-geeavvLHRSGARFDLLLMDKEMP  265
             K L  L+VED+   QLV K +L K G  V + ++  E    L  +  R D++LMD  MP
Sbjct  232  SKALNLLIVEDTQSNQLVIKLILNKLGHNVHIASHGAEALTFLEENDTRIDMILMDVSMP  291

Query  266  IKDGVNATKELREMGVKSMIVGATSHGPGPVRDEFLAAGLDECLVKPLRAEVVLGVINKL  445
            + DG+ AT+ +R+ G+   IV  T+H     +D+ L AG+D  + KP+R + +   I  L
Sbjct  292  VMDGITATRLIRKKGITIPIVALTAHALESDKDKCLDAGMDSFVSKPVRRQDIYEAIQSL  351

Query  446  V  448
            +
Sbjct  352  I  352



>ref|WP_031839876.1| histidine kinase, partial [Vibrio parahaemolyticus]
Length=362

 Score = 65.9 bits (159),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 43/121 (36%), Positives = 67/121 (55%), Gaps = 1/121 (1%)
 Frame = +2

Query  89   GKGLTALVVEDSPILQLVHKTLLKKYgvevqvvnn-geeavvLHRSGARFDLLLMDKEMP  265
             K L  L+VED+   QLV K +L K G  V + ++  E    L  +  R D++LMD  MP
Sbjct  239  SKALNLLIVEDTQSNQLVIKLILNKLGHNVHIASHGAEALTFLEENDTRIDMILMDVSMP  298

Query  266  IKDGVNATKELREMGVKSMIVGATSHGPGPVRDEFLAAGLDECLVKPLRAEVVLGVINKL  445
            + DG+ AT+ +R+ G+   IV  T+H     +D+ L AG+D  + KP+R + +   I  L
Sbjct  299  VMDGITATRLIRKKGITIPIVALTAHALESDKDKCLDAGMDSFVSKPVRRQDIYEAIQSL  358

Query  446  V  448
            +
Sbjct  359  I  359



>gb|ETJ87884.1| response regulator [Vibrio parahaemolyticus EKP-008]
Length=119

 Score = 62.8 bits (151),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 41/115 (36%), Positives = 65/115 (57%), Gaps = 1/115 (1%)
 Frame = +2

Query  107  LVVEDSPILQLVHKTLLKKYgvevqvvnn-geeavvLHRSGARFDLLLMDKEMPIKDGVN  283
            L+VED+   QLV K +L K G  V + ++  E    L  +  R D++LMD  MP+ DG+ 
Sbjct  2    LIVEDTQSNQLVIKLILNKLGHNVHIASHGAEALTFLEENDTRIDMILMDVSMPVMDGIT  61

Query  284  ATKELREMGVKSMIVGATSHGPGPVRDEFLAAGLDECLVKPLRAEVVLGVINKLV  448
            AT+ +R+ G+   IV  T+H     +D+ L AG+D  + KP+R + +   I  L+
Sbjct  62   ATRLIRKKGITIPIVALTAHALESDKDKCLDAGMDSFVSKPVRRQDIYEAIQSLI  116



>ref|XP_003063001.1| predicted protein, partial [Micromonas pusilla CCMP1545]
 gb|EEH52940.1| predicted protein, partial [Micromonas pusilla CCMP1545]
Length=116

 Score = 62.8 bits (151),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 40/107 (37%), Positives = 68/107 (64%), Gaps = 6/107 (6%)
 Frame = +2

Query  107  LVVEDSPILQLVHKTLLKKYgvevqvvnngeeavvLHRSGARFDLLLMDKEMPIKDGVNA  286
            L+VED+ + Q V + ++K  G+   + NNG+EAV + R GAR+D +LMD +MP+ DG++A
Sbjct  1    LIVEDNVMNQKVARVVVKHCGMSSDLANNGKEAVDILRGGARYDAILMDVQMPVMDGLDA  60

Query  287  TKELREMGV------KSMIVGATSHGPGPVRDEFLAAGLDECLVKPL  409
            T+++REM        ++ I+  +++       E  AAG+DE + KP+
Sbjct  61   TRKIREMEASGELPERNFILATSANATAENHQEGFAAGMDEYITKPI  107



>ref|WP_031782574.1| histidine kinase, partial [Vibrio parahaemolyticus]
 gb|KEE87331.1| hypothetical protein EM82_23700, partial [Vibrio parahaemolyticus]
Length=245

 Score = 64.7 bits (156),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 43/121 (36%), Positives = 67/121 (55%), Gaps = 1/121 (1%)
 Frame = +2

Query  89   GKGLTALVVEDSPILQLVHKTLLKKYgvevqvvnn-geeavvLHRSGARFDLLLMDKEMP  265
             K L  L+VED+   QLV K +L K G  V + ++  E    L  +  R D++LMD  MP
Sbjct  122  SKALNLLIVEDTQSNQLVIKLILNKLGHNVHIASHGAEALTFLEENDNRIDMILMDVSMP  181

Query  266  IKDGVNATKELREMGVKSMIVGATSHGPGPVRDEFLAAGLDECLVKPLRAEVVLGVINKL  445
            + DG+ AT+ +R+ G+   IV  T+H     +D+ L AG+D  + KP+R + +   I  L
Sbjct  182  VMDGITATRLIRKKGITIPIVALTAHALESDKDKCLDAGMDSFVSKPVRRQDIYEAIQSL  241

Query  446  V  448
            +
Sbjct  242  I  242



>ref|WP_040949150.1| hypothetical protein [Paenibacillaceae bacterium G5]
Length=107

 Score = 62.4 bits (150),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 29/74 (39%), Positives = 49/74 (66%), Gaps = 3/74 (4%)
 Frame = +2

Query  233  FDLLLMDKEMPIKDGVNATKELREM---GVKSMIVGATSHGPGPVRDEFLAAGLDECLVK  403
            FD++LMD  MP+ DG++ATK +R +   GV+  IV  +++     R+ +LAAGLD+C+ K
Sbjct  29   FDIILMDIRMPVLDGLDATKAIRGLTAGGVRPYIVAVSANALKGDRESYLAAGLDDCISK  88

Query  404  PLRAEVVLGVINKL  445
            P+R + +  +I+  
Sbjct  89   PVRTDTLNAIIHHF  102



>gb|KFY11975.1| hypothetical protein V491_06970 [Pseudogymnoascus pannorum VKM 
F-3775]
Length=152

 Score = 63.2 bits (152),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 28/60 (47%), Positives = 39/60 (65%), Gaps = 0/60 (0%)
 Frame = +2

Query  233  FDLLLMDKEMPIKDGVNATKELREMGVKSMIVGATSHGPGPVRDEFLAAGLDECLVKPLR  412
            + L+LMD  MPI  G+ ATKE+R+MG+  +I+  T+H     RD +L  G D CL KP+R
Sbjct  80   YSLILMDTSMPIMSGLEATKEIRDMGLDVLIIALTAHALKVDRDSYLTRGFDGCLSKPVR  139



>ref|WP_032078483.1| histidine kinase [Clostridium drakei]
Length=393

 Score = 65.9 bits (159),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 52/134 (39%), Positives = 79/134 (59%), Gaps = 5/134 (4%)
 Frame = +2

Query  80   KNVGKGLTALVVEDSPILQLVHKTLLKKYgvevqvvnngeeavvLHRSGARFDLLLMDKE  259
            K + K L  L+VED    Q+V   L KKYG    +VNNG+EA+ + ++  ++DL+LMD +
Sbjct  242  KRINKKLNILIVEDDKASQIVMYNLFKKYGHICDIVNNGQEALNVLKT-KQYDLILMDIQ  300

Query  260  MPIKDGVNATKELR---EMGVKSM-IVGATSHGPGPVRDEFLAAGLDECLVKPLRAEVVL  427
            MPI DG+ ATK +R   E   K + I+  T++     ++ FL  G+DE + KP   E +L
Sbjct  301  MPIMDGIQATKFIRKSEEGNDKHIPIIALTAYALKGDKEHFLGLGMDEYISKPFNVEELL  360

Query  428  GVINKLVA*NEFDL  469
              + K+V  +E DL
Sbjct  361  QTVYKIVKKDESDL  374



>ref|WP_023275854.1| hypothetical protein [Mucispirillum schaedleri]
 gb|ESJ98028.1| hypothetical protein N508_01011 [Mucispirillum schaedleri ASF457]
Length=1106

 Score = 66.6 bits (161),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 45/114 (39%), Positives = 72/114 (63%), Gaps = 1/114 (1%)
 Frame = +2

Query  68    DMDSKNVGKGLTALVVEDSPILQLVHKTLLKKYgvevqvvnngeeavvLHRSGARFDLLL  247
             D+D++ + KG   LVVED+P+ Q +    L+K G  V V  NG+EAV +  SG  FD++ 
Sbjct  979   DIDNQVMLKG-NVLVVEDNPVNQKLMVIFLEKTGFNVTVAGNGQEAVDIVSSGKEFDIIF  1037

Query  248   MDKEMPIKDGVNATKELREMGVKSMIVGATSHGPGPVRDEFLAAGLDECLVKPL  409
             MD  MP+ DGV++TKE+R  G+   I+  T++      D F+A+G+++ + KP+
Sbjct  1038  MDIHMPVMDGVSSTKEIRAKGINIPIIALTANVIKEDMDNFIASGMNKHVAKPI  1091



>ref|WP_031838574.1| histidine kinase, partial [Vibrio parahaemolyticus]
Length=428

 Score = 65.9 bits (159),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 43/121 (36%), Positives = 67/121 (55%), Gaps = 1/121 (1%)
 Frame = +2

Query  89   GKGLTALVVEDSPILQLVHKTLLKKYgvevqvvnn-geeavvLHRSGARFDLLLMDKEMP  265
             K L  L+VED+   QLV K +L K G  V + ++  E    L  +  R D++LMD  MP
Sbjct  305  SKALNLLIVEDTQSNQLVIKLILNKLGHNVHIASHGAEALTFLEENDTRIDMILMDVSMP  364

Query  266  IKDGVNATKELREMGVKSMIVGATSHGPGPVRDEFLAAGLDECLVKPLRAEVVLGVINKL  445
            + DG+ AT+ +R+ G+   IV  T+H     +D+ L AG+D  + KP+R + +   I  L
Sbjct  365  VMDGITATRLIRKKGITIPIVALTAHALESDKDKCLDAGMDSFVSKPVRRQDIYEAIQSL  424

Query  446  V  448
            +
Sbjct  425  I  425



>emb|CAN61539.1| hypothetical protein VITISV_030743 [Vitis vinifera]
Length=157

 Score = 62.8 bits (151),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 44/104 (42%), Positives = 67/104 (64%), Gaps = 0/104 (0%)
 Frame = +2

Query  98   LTALVVEDSPILQLVHKTLLKKYgvevqvvnngeeavvLHRSGARFDLLLMDKEMPIKDG  277
            LTALVV+   I Q++ K +L+  GVE QVV +G +A+ L  SGA F+L+++   +PI +G
Sbjct  32   LTALVVDSDRICQILEKAILESQGVETQVVGSGRDALDLLASGATFNLIIIAMVLPIMNG  91

Query  278  VNATKELREMGVKSMIVGATSHGPGPVRDEFLAAGLDECLVKPL  409
            V  T+ +R MG+ S ++G T+      +  FL AG+DE + KPL
Sbjct  92   VETTRRIRAMGICSKMLGVTACSYEREKQAFLDAGVDEFIEKPL  135



>ref|WP_031380921.1| histidine kinase [Vibrio parahaemolyticus]
Length=576

 Score = 65.9 bits (159),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 43/121 (36%), Positives = 67/121 (55%), Gaps = 1/121 (1%)
 Frame = +2

Query  89   GKGLTALVVEDSPILQLVHKTLLKKYgvevqvvnn-geeavvLHRSGARFDLLLMDKEMP  265
             K L  L+VED+   QLV K +L K G  V + ++  E    L  +  R D++LMD  MP
Sbjct  453  NKALNLLIVEDTQSNQLVIKLILNKLGHNVHITSHGAEALTFLEENDTRIDMILMDVSMP  512

Query  266  IKDGVNATKELREMGVKSMIVGATSHGPGPVRDEFLAAGLDECLVKPLRAEVVLGVINKL  445
            + DG+ AT+ +R+ G+   IV  T+H     +D+ L AG+D  + KP+R + +   I  L
Sbjct  513  VMDGITATRLIRKKGITIPIVALTAHALESDKDKCLDAGMDSFVSKPVRRQDIYEAIQSL  572

Query  446  V  448
            +
Sbjct  573  I  573



>ref|WP_026110111.1| histidine kinase [Flavobacterium sp. WG21]
Length=729

 Score = 66.2 bits (160),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 42/129 (33%), Positives = 77/129 (60%), Gaps = 4/129 (3%)
 Frame = +2

Query  62   EMDMDSKNVGKGLTALVVEDSPILQLVHKTLLKKYgvevqvvnngeeavvLHRSGARFDL  241
            E+D+ S  V K    L+VED+ I QLV K +++K+    +VV++G  A+ +  S   FDL
Sbjct  598  EVDLSSNEVYK---ILIVEDNLINQLVTKKIIEKHNYVCKVVDDGFAALKMLES-ENFDL  653

Query  242  LLMDKEMPIKDGVNATKELREMGVKSMIVGATSHGPGPVRDEFLAAGLDECLVKPLRAEV  421
            +LMD  MP+ +G   T+ +R  G+K+ I+  T+     + DE +++G+++ ++KP     
Sbjct  654  ILMDINMPLMNGFETTRRIRSKGLKTPIIALTAFDKDEITDEAISSGINDIIIKPFEPVR  713

Query  422  VLGVINKLV  448
            +  ++N L+
Sbjct  714  LFKIMNYLI  722



>ref|XP_007754164.1| hypothetical protein A1O7_01938 [Cladophialophora yegresii CBS 
114405]
 gb|EXJ61510.1| hypothetical protein A1O7_01938 [Cladophialophora yegresii CBS 
114405]
Length=1159

 Score = 66.2 bits (160),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 34/77 (44%), Positives = 46/77 (60%), Gaps = 0/77 (0%)
 Frame = +2

Query  221   SGARFDLLLMDKEMPIKDGVNATKELREMGVKSMIVGATSHGPGPVRDEFLAAGLDECLV  400
             SG RFDL+ MD +MP  DG+ +TK +REMG  S IV  T+       DE +A+G+D  L 
Sbjct  1034  SGQRFDLVFMDVQMPNLDGIQSTKLIREMGFTSPIVALTAFAEKSNEDECMASGMDYFLA  1093

Query  401   KPLRAEVVLGVINKLVA  451
             KP+R   +  V+ K  A
Sbjct  1094  KPIRRPALKQVLKKYCA  1110



>emb|CEM61310.1| ATPase/histidine kinase/DNA gyrase B/HSP90 domain protein (modular 
protein) [Treponema phagedenis]
Length=651

 Score = 66.2 bits (160),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 42/116 (36%), Positives = 71/116 (61%), Gaps = 1/116 (1%)
 Frame = +2

Query  95   GLTALVVEDSPILQLVHKTLLKKYgvevqvvnngeeavvLHRSGARFDLLLMDKEMPIKD  274
            GL  LVVED P+ + + K LL+K G  V  V +G++AV +  +   FDL+ MD ++P  +
Sbjct  532  GLKILVVEDHPVNRQLIKALLEKSGCIVTAVEDGKKAVEIACTKP-FDLIFMDIQLPFLN  590

Query  275  GVNATKELREMGVKSMIVGATSHGPGPVRDEFLAAGLDECLVKPLRAEVVLGVINK  442
            G  AT ++RE+G+K++I+  T+       D +LA G+++ L KP   E ++ ++ K
Sbjct  591  GYEATAKIRELGIKTVIIACTASAQENEEDSYLACGMNDVLTKPFNRETLIKLLKK  646



>ref|WP_025610937.1| histidine kinase [Vibrio parahaemolyticus]
Length=576

 Score = 65.9 bits (159),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 43/121 (36%), Positives = 67/121 (55%), Gaps = 1/121 (1%)
 Frame = +2

Query  89   GKGLTALVVEDSPILQLVHKTLLKKYgvevqvvnn-geeavvLHRSGARFDLLLMDKEMP  265
             K L  L+VED+   QLV K +L K G  V + ++  E    L  +  R D++LMD  MP
Sbjct  453  NKALNLLIVEDTQSNQLVIKLILNKLGHNVHIASHGAEALTFLEENDTRIDMILMDVSMP  512

Query  266  IKDGVNATKELREMGVKSMIVGATSHGPGPVRDEFLAAGLDECLVKPLRAEVVLGVINKL  445
            + DG+ AT+ +R+ G+   IV  T+H     +D+ L AG+D  + KP+R + +   I  L
Sbjct  513  VMDGITATRLIRKKGITIPIVALTAHALESDKDKCLDAGMDSFVSKPVRRQDIYEAIQSL  572

Query  446  V  448
            +
Sbjct  573  I  573



>gb|EVU18666.1| his Kinase A domain protein [Vibrio parahaemolyticus V-223/04]
Length=485

 Score = 65.9 bits (159),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 43/121 (36%), Positives = 67/121 (55%), Gaps = 1/121 (1%)
 Frame = +2

Query  89   GKGLTALVVEDSPILQLVHKTLLKKYgvevqvvnn-geeavvLHRSGARFDLLLMDKEMP  265
             K L  L+VED+   QLV K +L K G  V + ++  E    L  +  R D++LMD  MP
Sbjct  362  SKALNLLIVEDTQSNQLVIKLILNKLGHNVHIASHGAEALTFLEENDTRIDMILMDVSMP  421

Query  266  IKDGVNATKELREMGVKSMIVGATSHGPGPVRDEFLAAGLDECLVKPLRAEVVLGVINKL  445
            + DG+ AT+ +R+ G+   IV  T+H     +D+ L AG+D  + KP+R + +   I  L
Sbjct  422  VMDGITATRLIRKKGITIPIVALTAHALESDKDKCLDAGMDSFVSKPVRRQDIYEAIQSL  481

Query  446  V  448
            +
Sbjct  482  I  482



>ref|WP_024752999.1| hypothetical protein [Treponema phagedenis]
Length=651

 Score = 65.9 bits (159),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 42/116 (36%), Positives = 71/116 (61%), Gaps = 1/116 (1%)
 Frame = +2

Query  95   GLTALVVEDSPILQLVHKTLLKKYgvevqvvnngeeavvLHRSGARFDLLLMDKEMPIKD  274
            GL  LVVED P+ + + K LL+K G  V  V +G++AV +  +   FDL+ MD ++P  +
Sbjct  532  GLKILVVEDHPVNRQLIKALLEKSGCIVTAVEDGKKAVEIACTKP-FDLIFMDIQLPFLN  590

Query  275  GVNATKELREMGVKSMIVGATSHGPGPVRDEFLAAGLDECLVKPLRAEVVLGVINK  442
            G  AT ++RE+G+K++I+  T+       D +LA G+++ L KP   E ++ ++ K
Sbjct  591  GYEATAKIRELGIKTVIIACTASAQENEEDSYLACGMNDVLTKPFNRETLIKLLKK  646



>ref|XP_002280692.1| PREDICTED: two-component response regulator ARR22-like [Vitis 
vinifera]
Length=150

 Score = 62.8 bits (151),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 44/116 (38%), Positives = 73/116 (63%), Gaps = 0/116 (0%)
 Frame = +2

Query  98   LTALVVEDSPILQLVHKTLLKKYgvevqvvnngeeavvLHRSGARFDLLLMDKEMPIKDG  277
            LTALVV+   I Q++ K +L+  GVE QVV +G +A+ L  SGA F+L+++   +PI +G
Sbjct  32   LTALVVDSDRICQILEKAILESQGVETQVVGSGRDALDLLASGATFNLIIIAMVLPIMNG  91

Query  278  VNATKELREMGVKSMIVGATSHGPGPVRDEFLAAGLDECLVKPLRAEVVLGVINKL  445
            V  T+ +R MG+ S ++G T+      +  FL AG+DE + KPL  + +  ++ ++
Sbjct  92   VETTRRIRAMGICSKMLGVTACSYEREKQAFLDAGVDEFIEKPLTPQKLASILREM  147



>ref|WP_029858136.1| histidine kinase, partial [Vibrio parahaemolyticus]
Length=467

 Score = 65.9 bits (159),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 43/121 (36%), Positives = 67/121 (55%), Gaps = 1/121 (1%)
 Frame = +2

Query  89   GKGLTALVVEDSPILQLVHKTLLKKYgvevqvvnn-geeavvLHRSGARFDLLLMDKEMP  265
             K L  L+VED+   QLV K +L K G  V + ++  E    L  +  R D++LMD  MP
Sbjct  344  SKALNLLIVEDTQSNQLVIKLILNKLGHNVHIASHGAEALTFLEENDTRIDMILMDVSMP  403

Query  266  IKDGVNATKELREMGVKSMIVGATSHGPGPVRDEFLAAGLDECLVKPLRAEVVLGVINKL  445
            + DG+ AT+ +R+ G+   IV  T+H     +D+ L AG+D  + KP+R + +   I  L
Sbjct  404  VMDGITATRLIRKKGITIPIVALTAHALESDKDKCLDAGMDSFVSKPVRRQDIYEAIQSL  463

Query  446  V  448
            +
Sbjct  464  I  464



>ref|WP_029864963.1| histidine kinase [Vibrio parahaemolyticus]
Length=576

 Score = 65.9 bits (159),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 43/121 (36%), Positives = 67/121 (55%), Gaps = 1/121 (1%)
 Frame = +2

Query  89   GKGLTALVVEDSPILQLVHKTLLKKYgvevqvvnn-geeavvLHRSGARFDLLLMDKEMP  265
             K L  L+VED+   QLV K +L K G  V + ++  E    L  +  R D++LMD  MP
Sbjct  453  NKALNLLIVEDTQSNQLVIKLILNKLGHNVHIASHGAEALTFLEENDTRIDMILMDVSMP  512

Query  266  IKDGVNATKELREMGVKSMIVGATSHGPGPVRDEFLAAGLDECLVKPLRAEVVLGVINKL  445
            + DG+ AT+ +R+ G+   IV  T+H     +D+ L AG+D  + KP+R + +   I  L
Sbjct  513  VMDGITATRLIRKKGITIPIVALTAHALESDKDKCLDAGMDSFVSKPVRRQDIYEAIQSL  572

Query  446  V  448
            +
Sbjct  573  I  573



>ref|WP_005457375.1| signal transduction histidine kinase [Vibrio parahaemolyticus]
 ref|NP_797926.1| sensor histidine kinase/response regulator [Vibrio parahaemolyticus 
RIMD 2210633]
 dbj|BAC59810.1| sensor histidine kinase/response regulator [Vibrio parahaemolyticus 
RIMD 2210633]
 gb|EDM58035.1| sensor histidine kinase/response regulator [Vibrio parahaemolyticus 
AQ3810]
 gb|EFO37555.1| sensor histidine kinase/response regulator [Vibrio parahaemolyticus 
Peru-466]
 gb|EFO40837.1| sensor histidine kinase/response regulator [Vibrio parahaemolyticus 
AN-5034]
 gb|EFO52078.1| sensor histidine kinase/response regulator [Vibrio parahaemolyticus 
K5030]
 gb|EQL95032.1| his Kinase A domain protein [Vibrio parahaemolyticus VP250]
 gb|EQM03080.1| his Kinase A domain protein [Vibrio parahaemolyticus NIHCB0603]
 gb|EQM04504.1| his Kinase A domain protein [Vibrio parahaemolyticus VP232]
 gb|EQM10453.1| his Kinase A domain protein [Vibrio parahaemolyticus VP-NY4]
 gb|EQM37972.1| his Kinase A domain protein [Vibrio parahaemolyticus 949]
 gb|ETS23180.1| his Kinase A domain protein [Vibrio parahaemolyticus B-265]
 gb|ETT09900.1| his Kinase A domain protein [Vibrio parahaemolyticus 605]
 gb|ETX22658.1| his Kinase A domain protein [Vibrio parahaemolyticus IDH02640]
 gb|ETX59391.1| his Kinase A domain protein [Vibrio parahaemolyticus IDH02189]
 gb|ETX73527.1| his Kinase A domain protein [Vibrio parahaemolyticus Peru-288]
 gb|EUC25977.1| his Kinase A domain protein [Vibrio parahaemolyticus 861]
 gb|EUD17336.1| his Kinase A domain protein [Vibrio parahaemolyticus EKP-026]
 gb|EVT78430.1| his Kinase A domain protein [Vibrio parahaemolyticus V14/01]
 gb|EXF70924.1| his Kinase A domain protein [Vibrio parahaemolyticus AQ3810]
 gb|EXJ38817.1| his Kinase A domain protein [Vibrio parahaemolyticus VP-48]
 gb|KED78736.1| histidine kinase [Vibrio parahaemolyticus]
 gb|KED86862.1| histidine kinase [Vibrio parahaemolyticus]
Length=576

 Score = 65.9 bits (159),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 43/121 (36%), Positives = 67/121 (55%), Gaps = 1/121 (1%)
 Frame = +2

Query  89   GKGLTALVVEDSPILQLVHKTLLKKYgvevqvvnn-geeavvLHRSGARFDLLLMDKEMP  265
             K L  L+VED+   QLV K +L K G  V + ++  E    L  +  R D++LMD  MP
Sbjct  453  SKALNLLIVEDTQSNQLVIKLILNKLGHNVHIASHGAEALTFLEENDTRIDMILMDVSMP  512

Query  266  IKDGVNATKELREMGVKSMIVGATSHGPGPVRDEFLAAGLDECLVKPLRAEVVLGVINKL  445
            + DG+ AT+ +R+ G+   IV  T+H     +D+ L AG+D  + KP+R + +   I  L
Sbjct  513  VMDGITATRLIRKKGITIPIVALTAHALESDKDKCLDAGMDSFVSKPVRRQDIYEAIQSL  572

Query  446  V  448
            +
Sbjct  573  I  573



>ref|WP_021486647.1| his Kinase A domain protein [Vibrio parahaemolyticus]
 gb|EQM46487.1| his Kinase A domain protein [Vibrio parahaemolyticus VPCR-2010]
Length=576

 Score = 65.9 bits (159),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 43/121 (36%), Positives = 67/121 (55%), Gaps = 1/121 (1%)
 Frame = +2

Query  89   GKGLTALVVEDSPILQLVHKTLLKKYgvevqvvnn-geeavvLHRSGARFDLLLMDKEMP  265
             K L  L+VED+   QLV K +L K G  V + ++  E    L  +  R D++LMD  MP
Sbjct  453  SKALNLLIVEDTQSNQLVIKLILNKLGHNVHIASHGAEALTFLEENDTRIDMILMDVSMP  512

Query  266  IKDGVNATKELREMGVKSMIVGATSHGPGPVRDEFLAAGLDECLVKPLRAEVVLGVINKL  445
            + DG+ AT+ +R+ G+   IV  T+H     +D+ L AG+D  + KP+R + +   I  L
Sbjct  513  VMDGITATRLIRKKGITIPIVALTAHALESDKDKCLDAGMDSFVSKPVRRQDIYEAIQSL  572

Query  446  V  448
            +
Sbjct  573  I  573



>ref|WP_021450929.1| his Kinase A domain protein [Vibrio parahaemolyticus]
 gb|EQL83130.1| his Kinase A domain protein [Vibrio parahaemolyticus VP2007-095]
 gb|KED10811.1| histidine kinase [Vibrio parahaemolyticus]
 gb|KED18238.1| histidine kinase [Vibrio parahaemolyticus]
 gb|KED21457.1| histidine kinase [Vibrio parahaemolyticus]
 gb|KED22628.1| histidine kinase [Vibrio parahaemolyticus]
 gb|KED31554.1| histidine kinase [Vibrio parahaemolyticus]
 gb|KED34379.1| histidine kinase [Vibrio parahaemolyticus]
Length=576

 Score = 65.9 bits (159),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 43/121 (36%), Positives = 67/121 (55%), Gaps = 1/121 (1%)
 Frame = +2

Query  89   GKGLTALVVEDSPILQLVHKTLLKKYgvevqvvnn-geeavvLHRSGARFDLLLMDKEMP  265
             K L  L+VED+   QLV K +L K G  V + ++  E    L  +  R D++LMD  MP
Sbjct  453  SKALNLLIVEDTQSNQLVIKLILNKLGHNVHIASHGAEALTFLEENDTRIDMILMDVSMP  512

Query  266  IKDGVNATKELREMGVKSMIVGATSHGPGPVRDEFLAAGLDECLVKPLRAEVVLGVINKL  445
            + DG+ AT+ +R+ G+   IV  T+H     +D+ L AG+D  + KP+R + +   I  L
Sbjct  513  VMDGITATRLIRKKGITIPIVALTAHALESDKDKCLDAGMDSFVSKPVRRQDIYEAIQSL  572

Query  446  V  448
            +
Sbjct  573  I  573



>ref|WP_025532585.1| histidine kinase [Vibrio parahaemolyticus]
Length=576

 Score = 65.9 bits (159),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 43/121 (36%), Positives = 67/121 (55%), Gaps = 1/121 (1%)
 Frame = +2

Query  89   GKGLTALVVEDSPILQLVHKTLLKKYgvevqvvnn-geeavvLHRSGARFDLLLMDKEMP  265
             K L  L+VED+   QLV K +L K G  V + ++  E    L  +  R D++LMD  MP
Sbjct  453  SKALNLLIVEDTQSNQLVIKLILNKLGHNVHIASHGAEALTFLEENDTRIDMILMDVSMP  512

Query  266  IKDGVNATKELREMGVKSMIVGATSHGPGPVRDEFLAAGLDECLVKPLRAEVVLGVINKL  445
            + DG+ AT+ +R+ G+   IV  T+H     +D+ L AG+D  + KP+R + +   I  L
Sbjct  513  VMDGITATRLIRKKGITIPIVALTAHALESDKDKCLDAGMDSFVSKPVRRQDIYEAIQSL  572

Query  446  V  448
            +
Sbjct  573  I  573



>ref|WP_021454137.1| his Kinase A domain protein [Vibrio parahaemolyticus]
 gb|EQM14206.1| his Kinase A domain protein [Vibrio parahaemolyticus 3259]
Length=576

 Score = 65.9 bits (159),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 43/121 (36%), Positives = 67/121 (55%), Gaps = 1/121 (1%)
 Frame = +2

Query  89   GKGLTALVVEDSPILQLVHKTLLKKYgvevqvvnn-geeavvLHRSGARFDLLLMDKEMP  265
             K L  L+VED+   QLV K +L K G  V + ++  E    L  +  R D++LMD  MP
Sbjct  453  SKALNLLIVEDTQSNQLVIKLILNKLGHNVHIASHGAEALTFLEENDTRIDMILMDVSMP  512

Query  266  IKDGVNATKELREMGVKSMIVGATSHGPGPVRDEFLAAGLDECLVKPLRAEVVLGVINKL  445
            + DG+ AT+ +R+ G+   IV  T+H     +D+ L AG+D  + KP+R + +   I  L
Sbjct  513  VMDGITATRLIRKKGITIPIVALTAHALESDKDKCLDAGMDSFVSKPVRRQDIYEAIQSL  572

Query  446  V  448
            +
Sbjct  573  I  573



>ref|WP_029829896.1| histidine kinase [Vibrio parahaemolyticus]
Length=573

 Score = 65.9 bits (159),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 43/121 (36%), Positives = 67/121 (55%), Gaps = 1/121 (1%)
 Frame = +2

Query  89   GKGLTALVVEDSPILQLVHKTLLKKYgvevqvvnn-geeavvLHRSGARFDLLLMDKEMP  265
             K L  L+VED+   QLV K +L K G  V + ++  E    L  +  R D++LMD  MP
Sbjct  453  SKALNLLIVEDTQSNQLVIKLILNKLGHNVHIASHGAEALTFLEENDTRIDMILMDVSMP  512

Query  266  IKDGVNATKELREMGVKSMIVGATSHGPGPVRDEFLAAGLDECLVKPLRAEVVLGVINKL  445
            + DG+ AT+ +R+ G+   IV  T+H     +D+ L AG+D  + KP+R + +   I  L
Sbjct  513  VMDGITATRLIRKKGITIPIVALTAHALESDKDKCLDAGMDSFVSKPVRRQDIYEAIQSL  572

Query  446  V  448
            +
Sbjct  573  I  573



>ref|WP_025510282.1| histidine kinase [Vibrio parahaemolyticus]
 gb|ETJ89021.1| his Kinase A domain protein [Vibrio parahaemolyticus 970107]
Length=576

 Score = 65.9 bits (159),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 43/121 (36%), Positives = 67/121 (55%), Gaps = 1/121 (1%)
 Frame = +2

Query  89   GKGLTALVVEDSPILQLVHKTLLKKYgvevqvvnn-geeavvLHRSGARFDLLLMDKEMP  265
             K L  L+VED+   QLV K +L K G  V + ++  E    L  +  R D++LMD  MP
Sbjct  453  SKALNLLIVEDTQSNQLVIKLILNKLGHNVHIASHGAEALTFLEENDTRIDMILMDVSMP  512

Query  266  IKDGVNATKELREMGVKSMIVGATSHGPGPVRDEFLAAGLDECLVKPLRAEVVLGVINKL  445
            + DG+ AT+ +R+ G+   IV  T+H     +D+ L AG+D  + KP+R + +   I  L
Sbjct  513  VMDGITATRLIRKKGITIPIVALTAHALESDKDKCLDAGMDSFVSKPVRRQDIYEAIQSL  572

Query  446  V  448
            +
Sbjct  573  I  573



>ref|WP_031846544.1| histidine kinase [Vibrio parahaemolyticus]
 gb|KEE91929.1| histidine kinase [Vibrio parahaemolyticus]
Length=576

 Score = 65.9 bits (159),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 43/121 (36%), Positives = 67/121 (55%), Gaps = 1/121 (1%)
 Frame = +2

Query  89   GKGLTALVVEDSPILQLVHKTLLKKYgvevqvvnn-geeavvLHRSGARFDLLLMDKEMP  265
             K L  L+VED+   QLV K +L K G  V + ++  E    L  +  R D++LMD  MP
Sbjct  453  NKALNLLIVEDTQSNQLVIKLILNKLGHNVHIASHGAEALTFLEENDTRIDMILMDVSMP  512

Query  266  IKDGVNATKELREMGVKSMIVGATSHGPGPVRDEFLAAGLDECLVKPLRAEVVLGVINKL  445
            + DG+ AT+ +R+ G+   IV  T+H     +D+ L AG+D  + KP+R + +   I  L
Sbjct  513  VMDGITATRLIRKKGITIPIVALTAHALESDKDKCLDAGMDSFVSKPVRRQDIYEAIQSL  572

Query  446  V  448
            +
Sbjct  573  I  573



>ref|WP_029796120.1| histidine kinase [Vibrio parahaemolyticus]
Length=576

 Score = 65.9 bits (159),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 43/121 (36%), Positives = 67/121 (55%), Gaps = 1/121 (1%)
 Frame = +2

Query  89   GKGLTALVVEDSPILQLVHKTLLKKYgvevqvvnn-geeavvLHRSGARFDLLLMDKEMP  265
             K L  L+VED+   QLV K +L K G  V + ++  E    L  +  R D++LMD  MP
Sbjct  453  SKALNLLIVEDTQSNQLVIKLILNKLGHNVHIASHGAEALTFLEENDTRIDMILMDVSMP  512

Query  266  IKDGVNATKELREMGVKSMIVGATSHGPGPVRDEFLAAGLDECLVKPLRAEVVLGVINKL  445
            + DG+ AT+ +R+ G+   IV  T+H     +D+ L AG+D  + KP+R + +   I  L
Sbjct  513  VMDGITATRLIRKKGITIPIVALTAHALESDKDKCLDAGMDSFVSKPVRRQDIYEAIQSL  572

Query  446  V  448
            +
Sbjct  573  I  573



>ref|WP_031778244.1| histidine kinase [Vibrio parahaemolyticus]
 gb|KED97623.1| histidine kinase [Vibrio parahaemolyticus]
Length=576

 Score = 65.9 bits (159),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 43/121 (36%), Positives = 67/121 (55%), Gaps = 1/121 (1%)
 Frame = +2

Query  89   GKGLTALVVEDSPILQLVHKTLLKKYgvevqvvnn-geeavvLHRSGARFDLLLMDKEMP  265
             K L  L+VED+   QLV K +L K G  V + ++  E    L  +  R D++LMD  MP
Sbjct  453  NKALNLLIVEDTQSNQLVIKLILNKLGHNVHIASHGAEALTFLEENDTRIDMILMDVSMP  512

Query  266  IKDGVNATKELREMGVKSMIVGATSHGPGPVRDEFLAAGLDECLVKPLRAEVVLGVINKL  445
            + DG+ AT+ +R+ G+   IV  T+H     +D+ L AG+D  + KP+R + +   I  L
Sbjct  513  VMDGITATRLIRKKGITIPIVALTAHALESDKDKCLDAGMDSFVSKPVRRQDIYEAIQSL  572

Query  446  V  448
            +
Sbjct  573  I  573



>ref|WP_032472251.1| histidine kinase [Vibrio cholerae]
Length=570

 Score = 65.9 bits (159),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 43/114 (38%), Positives = 71/114 (62%), Gaps = 0/114 (0%)
 Frame = +2

Query  107  LVVEDSPILQLVHKTLLKKYgvevqvvnngeeavvLHRSGARFDLLLMDKEMPIKDGVNA  286
            LVVED+   Q+V + LL K G +V +  NG +AV L      FDL+LMD  MPI DG+ A
Sbjct  455  LVVEDTKTNQMVIQLLLNKLGYDVTIAENGLQAVELLEKNHVFDLVLMDISMPIMDGIAA  514

Query  287  TKELREMGVKSMIVGATSHGPGPVRDEFLAAGLDECLVKPLRAEVVLGVINKLV  448
            TK LR+  ++  I+  T+H  G  +   + AG+++ ++KP+R++ ++ V+ + +
Sbjct  515  TKILRDKHIEIXIIALTAHTAGSDKQNCIDAGMNDIVLKPIRSKDIMEVVKRFL  568



>ref|WP_029862342.1| histidine kinase [Vibrio parahaemolyticus]
Length=576

 Score = 65.9 bits (159),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 43/121 (36%), Positives = 67/121 (55%), Gaps = 1/121 (1%)
 Frame = +2

Query  89   GKGLTALVVEDSPILQLVHKTLLKKYgvevqvvnn-geeavvLHRSGARFDLLLMDKEMP  265
             K L  L+VED+   QLV K +L K G  V + ++  E    L  +  R D++LMD  MP
Sbjct  453  SKALNLLIVEDTQSNQLVIKLILNKLGHNVHIASHGAEALTFLEENDTRIDMILMDVSMP  512

Query  266  IKDGVNATKELREMGVKSMIVGATSHGPGPVRDEFLAAGLDECLVKPLRAEVVLGVINKL  445
            + DG+ AT+ +R+ G+   IV  T+H     +D+ L AG+D  + KP+R + +   I  L
Sbjct  513  VMDGITATRLIRKKGITIPIVALTAHALESDKDKCLDAGMDSFVSKPVRRQDIYEAIQSL  572

Query  446  V  448
            +
Sbjct  573  I  573



>ref|WP_025505233.1| histidine kinase [Vibrio parahaemolyticus]
Length=576

 Score = 65.9 bits (159),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 43/121 (36%), Positives = 67/121 (55%), Gaps = 1/121 (1%)
 Frame = +2

Query  89   GKGLTALVVEDSPILQLVHKTLLKKYgvevqvvnn-geeavvLHRSGARFDLLLMDKEMP  265
             K L  L+VED+   QLV K +L K G  V + ++  E    L  +  R D++LMD  MP
Sbjct  453  NKALNLLIVEDTQSNQLVIKLILNKLGHNVHIASHGAEALTFLEENDTRIDMILMDVSMP  512

Query  266  IKDGVNATKELREMGVKSMIVGATSHGPGPVRDEFLAAGLDECLVKPLRAEVVLGVINKL  445
            + DG+ AT+ +R+ G+   IV  T+H     +D+ L AG+D  + KP+R + +   I  L
Sbjct  513  VMDGITATRLIRKKGITIPIVALTAHALESDKDKCLDAGMDSFVSKPVRRQDIYEAIQSL  572

Query  446  V  448
            +
Sbjct  573  I  573



>gb|EFK09048.1| ATPase/histidine kinase/DNA gyrase B/HSP90 domain protein [delta 
proteobacterium NaphS2]
Length=545

 Score = 65.9 bits (159),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 40/114 (35%), Positives = 63/114 (55%), Gaps = 2/114 (2%)
 Frame = +2

Query  107  LVVEDSPILQ-LVHKTLLKKYgvevqvvnngeeavvLHRSGARFDLLLMDKEMPIKDGVN  283
            L+ ED+ + Q L+   L K+        N  E    L  S   FDL+LMD +MP+KDG  
Sbjct  425  LIAEDNKVNQKLIKMMLTKEGFQVDIAANGQEAVDKLQESPENFDLVLMDIQMPVKDGFE  484

Query  284  ATKELREMGVKSM-IVGATSHGPGPVRDEFLAAGLDECLVKPLRAEVVLGVINK  442
            ATK +RE G  ++ I+  T+H     R++ LA+G+D+ + KP++   V+  I +
Sbjct  485  ATKAIREAGFHNLPIIAITAHALKGYREKCLASGMDDYVTKPIKKNEVISAIER  538



>ref|XP_008723969.1| hypothetical protein G647_09754 [Cladophialophora carrionii CBS 
160.54]
 gb|ETI27072.1| hypothetical protein G647_09754 [Cladophialophora carrionii CBS 
160.54]
Length=1161

 Score = 66.2 bits (160),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 34/77 (44%), Positives = 46/77 (60%), Gaps = 0/77 (0%)
 Frame = +2

Query  221   SGARFDLLLMDKEMPIKDGVNATKELREMGVKSMIVGATSHGPGPVRDEFLAAGLDECLV  400
             SG RFDL+ MD +MP  DG+ +TK +REMG  S IV  T+       DE +A+G+D  L 
Sbjct  1036  SGQRFDLVFMDVQMPNLDGIQSTKLIREMGFTSPIVALTAFAEKSNEDECMASGMDYFLA  1095

Query  401   KPLRAEVVLGVINKLVA  451
             KP+R   +  V+ K  A
Sbjct  1096  KPIRRPALKQVLKKYCA  1112



>gb|EDN15718.1| sensor histidine kinase/response regulator [Vibrio cholerae AM-19226]
Length=572

 Score = 65.9 bits (159),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 43/114 (38%), Positives = 71/114 (62%), Gaps = 0/114 (0%)
 Frame = +2

Query  107  LVVEDSPILQLVHKTLLKKYgvevqvvnngeeavvLHRSGARFDLLLMDKEMPIKDGVNA  286
            LVVED+   Q+V + LL K G +V +  NG +AV L      FDL+LMD  MPI DG+ A
Sbjct  457  LVVEDTKTNQMVIQLLLNKLGYDVTIAENGLQAVELLEKNHVFDLVLMDISMPIMDGIAA  516

Query  287  TKELREMGVKSMIVGATSHGPGPVRDEFLAAGLDECLVKPLRAEVVLGVINKLV  448
            TK LR+  ++  I+  T+H  G  +   + AG+++ ++KP+R++ ++ V+ + +
Sbjct  517  TKILRDKHIEIXIIALTAHTAGSDKQNCIDAGMNDIVLKPIRSKDIMEVVKRFL  570



>ref|WP_005505361.1| chemotaxis protein CheY [Grimontia hollisae]
 gb|EEY70860.1| hypothetical protein VHA_002719 [Grimontia hollisae CIP 101886]
Length=690

 Score = 65.9 bits (159),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 49/120 (41%), Positives = 74/120 (62%), Gaps = 1/120 (1%)
 Frame = +2

Query  92   KGLTALVVEDSPILQLVHKTLLKKYgvevqvvnngeeavvL-HRSGARFDLLLMDKEMPI  268
            + L  LV EDS   Q+V K +L+K G  V V NNG+EA+ L H S  +FD++LMD  MP+
Sbjct  570  RSLNILVAEDSKANQMVVKLMLEKAGHYVVVANNGKEAIDLFHGSHVQFDVILMDMSMPV  629

Query  269  KDGVNATKELREMGVKSMIVGATSHGPGPVRDEFLAAGLDECLVKPLRAEVVLGVINKLV  448
              G++ATK+LRE G +  I+  T++     +   L AG+D+ + KP+RA V+   + + V
Sbjct  630  LCGIDATKQLREEGYQLPIIALTANAMSEDKKRCLDAGMDDFVTKPIRAVVLKKTLQRHV  689



>ref|WP_040042771.1| hypothetical protein, partial [Herbaspirillum sp. TSA66]
Length=575

 Score = 65.5 bits (158),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 43/107 (40%), Positives = 69/107 (64%), Gaps = 1/107 (1%)
 Frame = +2

Query  107  LVVEDSPILQLVHKTLLKKYgvevqvvnngeeavvLHRSGARFDLLLMDKEMPIKDGVNA  286
            L+VED+ + +    T+L+K G  V  V NG++AV L  S ARFDL+LMD +MP+ DG+ A
Sbjct  467  LLVEDNEVNRKFALTVLQKAGHRVAAVTNGKDAVDLLES-ARFDLILMDVQMPVMDGLEA  525

Query  287  TKELREMGVKSMIVGATSHGPGPVRDEFLAAGLDECLVKPLRAEVVL  427
             + +R +G+ + ++  T+H     RD  +AAG+++ L KP+R   +L
Sbjct  526  ARRIRALGIDTPMIALTAHAMAGYRDIVIAAGMNDYLAKPIRGRALL  572



>ref|WP_033407406.1| hypothetical protein, partial [Uliginosibacterium gangwonense]
Length=387

 Score = 65.1 bits (157),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 38/101 (38%), Positives = 57/101 (56%), Gaps = 0/101 (0%)
 Frame = +2

Query  107  LVVEDSPILQLVHKTLLKKYgvevqvvnngeeavvLHRSGARFDLLLMDKEMPIKDGVNA  286
            LVVED+ +  LV   LL+K G     V    +  +      RFD++LMD  MP+ DG+ A
Sbjct  263  LVVEDNQVNVLVISKLLRKLGASNITVAYHGKEALQRCEAQRFDVILMDTHMPVLDGLAA  322

Query  287  TKELREMGVKSMIVGATSHGPGPVRDEFLAAGLDECLVKPL  409
            T+ LRE GV++ I+G ++      R   LA G+D+ + KP+
Sbjct  323  TRALREQGVRTHIIGVSADAMADDRSTALAIGMDDYITKPV  363



>ref|WP_025628536.1| histidine kinase, partial [Vibrio parahaemolyticus]
Length=501

 Score = 65.5 bits (158),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 43/121 (36%), Positives = 67/121 (55%), Gaps = 1/121 (1%)
 Frame = +2

Query  89   GKGLTALVVEDSPILQLVHKTLLKKYgvevqvvnn-geeavvLHRSGARFDLLLMDKEMP  265
             K L  L+VED+   QLV K +L K G  V + ++  E    L  +  R D++LMD  MP
Sbjct  378  NKALNLLIVEDTQSNQLVIKLILNKLGHNVHITSHGAEALTFLEENDNRIDMILMDVSMP  437

Query  266  IKDGVNATKELREMGVKSMIVGATSHGPGPVRDEFLAAGLDECLVKPLRAEVVLGVINKL  445
            + DG+ AT+ +R+ G+   IV  T+H     +D+ L AG+D  + KP+R + +   I  L
Sbjct  438  VMDGITATRLIRKKGITIPIVALTAHALESDKDKCLDAGMDSFVSKPVRRQDIYEAIQSL  497

Query  446  V  448
            +
Sbjct  498  I  498



>ref|XP_007748924.1| hypothetical protein A1O5_10156 [Cladophialophora psammophila 
CBS 110553]
 gb|EXJ66487.1| hypothetical protein A1O5_10156 [Cladophialophora psammophila 
CBS 110553]
Length=1160

 Score = 65.9 bits (159),  Expect = 4e-09, Method: Composition-based stats.
 Identities = 33/76 (43%), Positives = 46/76 (61%), Gaps = 0/76 (0%)
 Frame = +2

Query  224   GARFDLLLMDKEMPIKDGVNATKELREMGVKSMIVGATSHGPGPVRDEFLAAGLDECLVK  403
             G RFDL+ MD +MP  DG+ +T+ +REMG KS IV  T+       DE +A+G+D  L K
Sbjct  1036  GQRFDLVFMDVQMPNLDGIQSTRLIREMGFKSPIVALTAFAEKSNEDECMASGMDYFLAK  1095

Query  404   PLRAEVVLGVINKLVA  451
             P+R   +  V+ K  A
Sbjct  1096  PIRRPALKQVLKKYCA  1111



>ref|WP_029857309.1| histidine kinase [Vibrio parahaemolyticus]
Length=576

 Score = 65.5 bits (158),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 43/121 (36%), Positives = 67/121 (55%), Gaps = 1/121 (1%)
 Frame = +2

Query  89   GKGLTALVVEDSPILQLVHKTLLKKYgvevqvvnn-geeavvLHRSGARFDLLLMDKEMP  265
             K L  L+VED+   QLV K +L K G  V + ++  E    L  +  R D++LMD  MP
Sbjct  453  NKALNLLIVEDTQSNQLVIKLILNKLGHNVHITSHGAEALTFLEENDNRIDMILMDVSMP  512

Query  266  IKDGVNATKELREMGVKSMIVGATSHGPGPVRDEFLAAGLDECLVKPLRAEVVLGVINKL  445
            + DG+ AT+ +R+ G+   IV  T+H     +D+ L AG+D  + KP+R + +   I  L
Sbjct  513  VMDGITATRLIRKKGITIPIVALTAHALESDKDKCLDAGMDSFVSKPVRRQDIYEAIQSL  572

Query  446  V  448
            +
Sbjct  573  I  573



>ref|WP_025536070.1| histidine kinase [Vibrio parahaemolyticus]
Length=576

 Score = 65.5 bits (158),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 43/121 (36%), Positives = 67/121 (55%), Gaps = 1/121 (1%)
 Frame = +2

Query  89   GKGLTALVVEDSPILQLVHKTLLKKYgvevqvvnn-geeavvLHRSGARFDLLLMDKEMP  265
             K L  L+VED+   QLV K +L K G  V + ++  E    L  +  R D++LMD  MP
Sbjct  453  NKALNLLIVEDTQSNQLVIKLILNKLGHNVHITSHGAEALTFLEENDNRIDMILMDVSMP  512

Query  266  IKDGVNATKELREMGVKSMIVGATSHGPGPVRDEFLAAGLDECLVKPLRAEVVLGVINKL  445
            + DG+ AT+ +R+ G+   IV  T+H     +D+ L AG+D  + KP+R + +   I  L
Sbjct  513  VMDGITATRLIRKKGITIPIVALTAHALESDKDKCLDAGMDSFVSKPVRRQDIYEAIQSL  572

Query  446  V  448
            +
Sbjct  573  I  573



>ref|WP_024700059.1| histidine kinase [Vibrio parahaemolyticus]
 gb|KCV74443.1| histidine kinase [Vibrio parahaemolyticus VP49]
Length=576

 Score = 65.5 bits (158),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 43/121 (36%), Positives = 67/121 (55%), Gaps = 1/121 (1%)
 Frame = +2

Query  89   GKGLTALVVEDSPILQLVHKTLLKKYgvevqvvnn-geeavvLHRSGARFDLLLMDKEMP  265
             K L  L+VED+   QLV K +L K G  V + ++  E    L  +  R D++LMD  MP
Sbjct  453  NKALNLLIVEDTQSNQLVIKLILNKLGHNVHITSHGAEALTFLEENDNRIDMILMDVSMP  512

Query  266  IKDGVNATKELREMGVKSMIVGATSHGPGPVRDEFLAAGLDECLVKPLRAEVVLGVINKL  445
            + DG+ AT+ +R+ G+   IV  T+H     +D+ L AG+D  + KP+R + +   I  L
Sbjct  513  VMDGITATRLIRKKGITIPIVALTAHALESDKDKCLDAGMDSFVSKPVRRQDIYEAIQSL  572

Query  446  V  448
            +
Sbjct  573  I  573



>ref|WP_031821357.1| histidine kinase [Vibrio parahaemolyticus]
 gb|EXJ28329.1| his Kinase A domain protein [Vibrio parahaemolyticus VPCR-2009]
Length=576

 Score = 65.5 bits (158),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 43/121 (36%), Positives = 67/121 (55%), Gaps = 1/121 (1%)
 Frame = +2

Query  89   GKGLTALVVEDSPILQLVHKTLLKKYgvevqvvnn-geeavvLHRSGARFDLLLMDKEMP  265
             K L  L+VED+   QLV K +L K G  V + ++  E    L  +  R D++LMD  MP
Sbjct  453  NKALNLLIVEDTQSNQLVIKLILNKLGHNVHITSHGAEALTFLEENDNRIDMILMDVSMP  512

Query  266  IKDGVNATKELREMGVKSMIVGATSHGPGPVRDEFLAAGLDECLVKPLRAEVVLGVINKL  445
            + DG+ AT+ +R+ G+   IV  T+H     +D+ L AG+D  + KP+R + +   I  L
Sbjct  513  VMDGITATRLIRKKGITIPIVALTAHALESDKDKCLDAGMDSFVSKPVRRQDIYEAIQSL  572

Query  446  V  448
            +
Sbjct  573  I  573



>ref|WP_023585872.1| signal transduction histidine kinase [Vibrio parahaemolyticus]
 gb|AHI99606.1| Signal transduction histidine kinase [Vibrio parahaemolyticus 
UCM-V493]
Length=576

 Score = 65.5 bits (158),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 43/121 (36%), Positives = 67/121 (55%), Gaps = 1/121 (1%)
 Frame = +2

Query  89   GKGLTALVVEDSPILQLVHKTLLKKYgvevqvvnn-geeavvLHRSGARFDLLLMDKEMP  265
             K L  L+VED+   QLV K +L K G  V + ++  E    L  +  R D++LMD  MP
Sbjct  453  NKALNLLIVEDTQSNQLVIKLILNKLGHNVHITSHGAEALTFLEENDNRIDMILMDVSMP  512

Query  266  IKDGVNATKELREMGVKSMIVGATSHGPGPVRDEFLAAGLDECLVKPLRAEVVLGVINKL  445
            + DG+ AT+ +R+ G+   IV  T+H     +D+ L AG+D  + KP+R + +   I  L
Sbjct  513  VMDGITATRLIRKKGITIPIVALTAHALESDKDKCLDAGMDSFVSKPVRRQDIYEAIQSL  572

Query  446  V  448
            +
Sbjct  573  I  573



>ref|WP_029847584.1| histidine kinase [Vibrio parahaemolyticus]
Length=576

 Score = 65.5 bits (158),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 43/121 (36%), Positives = 67/121 (55%), Gaps = 1/121 (1%)
 Frame = +2

Query  89   GKGLTALVVEDSPILQLVHKTLLKKYgvevqvvnn-geeavvLHRSGARFDLLLMDKEMP  265
             K L  L+VED+   QLV K +L K G  V + ++  E    L  +  R D++LMD  MP
Sbjct  453  NKALNLLIVEDTQSNQLVIKLILNKLGHNVHITSHGAEALTFLEENDNRIDMILMDVSMP  512

Query  266  IKDGVNATKELREMGVKSMIVGATSHGPGPVRDEFLAAGLDECLVKPLRAEVVLGVINKL  445
            + DG+ AT+ +R+ G+   IV  T+H     +D+ L AG+D  + KP+R + +   I  L
Sbjct  513  VMDGITATRLIRKKGITIPIVALTAHALESDKDKCLDAGMDSFVSKPVRRQDIYEAIQSL  572

Query  446  V  448
            +
Sbjct  573  I  573



>ref|WP_025523756.1| histidine kinase [Vibrio parahaemolyticus]
Length=576

 Score = 65.5 bits (158),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 43/121 (36%), Positives = 67/121 (55%), Gaps = 1/121 (1%)
 Frame = +2

Query  89   GKGLTALVVEDSPILQLVHKTLLKKYgvevqvvnn-geeavvLHRSGARFDLLLMDKEMP  265
             K L  L+VED+   QLV K +L K G  V + ++  E    L  +  R D++LMD  MP
Sbjct  453  NKALNLLIVEDTQSNQLVIKLILNKLGHNVHITSHGAEALTFLEENDNRIDMILMDVSMP  512

Query  266  IKDGVNATKELREMGVKSMIVGATSHGPGPVRDEFLAAGLDECLVKPLRAEVVLGVINKL  445
            + DG+ AT+ +R+ G+   IV  T+H     +D+ L AG+D  + KP+R + +   I  L
Sbjct  513  VMDGITATRLIRKKGITIPIVALTAHALESDKDKCLDAGMDSFVSKPVRRQDIYEAIQSL  572

Query  446  V  448
            +
Sbjct  573  I  573



>ref|WP_029806345.1| histidine kinase [Vibrio parahaemolyticus]
Length=576

 Score = 65.5 bits (158),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 43/121 (36%), Positives = 67/121 (55%), Gaps = 1/121 (1%)
 Frame = +2

Query  89   GKGLTALVVEDSPILQLVHKTLLKKYgvevqvvnn-geeavvLHRSGARFDLLLMDKEMP  265
             K L  L+VED+   QLV K +L K G  V + ++  E    L  +  R D++LMD  MP
Sbjct  453  NKALNLLIVEDTQSNQLVIKLILNKLGHNVHITSHGAEALTFLEENDNRIDMILMDVSMP  512

Query  266  IKDGVNATKELREMGVKSMIVGATSHGPGPVRDEFLAAGLDECLVKPLRAEVVLGVINKL  445
            + DG+ AT+ +R+ G+   IV  T+H     +D+ L AG+D  + KP+R + +   I  L
Sbjct  513  VMDGITATRLIRKKGITIPIVALTAHALESDKDKCLDAGMDSFVSKPVRRQDIYEAIQSL  572

Query  446  V  448
            +
Sbjct  573  I  573



>ref|XP_009401157.1| PREDICTED: uncharacterized protein LOC103985239 [Musa acuminata 
subsp. malaccensis]
Length=323

 Score = 64.7 bits (156),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 44/112 (39%), Positives = 67/112 (60%), Gaps = 0/112 (0%)
 Frame = +2

Query  107  LVVEDSPILQLVHKTLLKKYgvevqvvnngeeavvLHRSGARFDLLLMDKEMPIKDGVNA  286
            L+VED+ + ++V + L ++ G+ ++   NG  AV L R G  +DL+LMDKEMP+ DG  A
Sbjct  206  LLVEDNEVNRVVVRRLTREMGMGLEEAENGRVAVELIRQGRAYDLILMDKEMPVMDGHEA  265

Query  287  TKELREMGVKSMIVGATSHGPGPVRDEFLAAGLDECLVKPLRAEVVLGVINK  442
            T++LR +GV + IV  + +     RD FL AG D    KPL     + ++ K
Sbjct  266  TRQLRSLGVTTPIVALSGNTLQSDRDSFLEAGADHFEAKPLSRGQFMKILTK  317



>ref|WP_025548472.1| histidine kinase [Vibrio parahaemolyticus]
 gb|KEE46283.1| histidine kinase [Vibrio parahaemolyticus]
 gb|KEE85951.1| histidine kinase [Vibrio parahaemolyticus]
Length=576

 Score = 65.5 bits (158),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 43/121 (36%), Positives = 67/121 (55%), Gaps = 1/121 (1%)
 Frame = +2

Query  89   GKGLTALVVEDSPILQLVHKTLLKKYgvevqvvnn-geeavvLHRSGARFDLLLMDKEMP  265
             K L  L+VED+   QLV K +L K G  V + ++  E    L  +  R D++LMD  MP
Sbjct  453  NKALNLLIVEDTQSNQLVIKLILNKLGHNVHITSHGAEALTFLEENDNRIDMILMDVSMP  512

Query  266  IKDGVNATKELREMGVKSMIVGATSHGPGPVRDEFLAAGLDECLVKPLRAEVVLGVINKL  445
            + DG+ AT+ +R+ G+   IV  T+H     +D+ L AG+D  + KP+R + +   I  L
Sbjct  513  VMDGITATRLIRKKGITIPIVALTAHALESDKDKCLDAGMDSFVSKPVRRQDIYEAIQSL  572

Query  446  V  448
            +
Sbjct  573  I  573



>ref|WP_025976484.1| histidine kinase [Brevundimonas naejangsanensis]
Length=510

 Score = 65.5 bits (158),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 46/119 (39%), Positives = 71/119 (60%), Gaps = 1/119 (1%)
 Frame = +2

Query  92   KGLTALVVEDSPILQLVHKTLLKKYgvevqvvnngeeavvLHRSGARFDLLLMDKEMPIK  271
            KG+  L+VED+P+  L+ +TLL++ G  VQ   +G EA+   ++ ARFDL+ MD  MP  
Sbjct  382  KGVRVLLVEDNPVGALLARTLLRREGCVVQTAADGHEALEAMKA-ARFDLVFMDMRMPRL  440

Query  272  DGVNATKELREMGVKSMIVGATSHGPGPVRDEFLAAGLDECLVKPLRAEVVLGVINKLV  448
            DG  AT+ LR  G ++ I+  T++     R   LAAG+D+ L KPL A+ +   + +  
Sbjct  441  DGPGATRALRARGDQTPIIALTANAFAEDRAACLAAGMDDHLSKPLEADALRSALARWT  499



>gb|KHF07045.1| histidine kinase [Vibrio parahaemolyticus]
Length=576

 Score = 65.5 bits (158),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 43/121 (36%), Positives = 67/121 (55%), Gaps = 1/121 (1%)
 Frame = +2

Query  89   GKGLTALVVEDSPILQLVHKTLLKKYgvevqvvnn-geeavvLHRSGARFDLLLMDKEMP  265
             K L  L+VED+   QLV K +L K G  V + ++  E    L  +  R D++LMD  MP
Sbjct  453  NKALNLLIVEDTQSNQLVIKLILNKLGHNVHITSHGAEALTFLEENDNRIDMILMDVSMP  512

Query  266  IKDGVNATKELREMGVKSMIVGATSHGPGPVRDEFLAAGLDECLVKPLRAEVVLGVINKL  445
            + DG+ AT+ +R+ G+   IV  T+H     +D+ L AG+D  + KP+R + +   I  L
Sbjct  513  VMDGITATRLIRKKGITIPIVALTAHALESDKDKCLDAGMDSFVSKPVRRQDIYEAIQSL  572

Query  446  V  448
            +
Sbjct  573  I  573



>ref|WP_025501792.1| histidine kinase [Vibrio parahaemolyticus]
Length=576

 Score = 65.5 bits (158),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 43/121 (36%), Positives = 67/121 (55%), Gaps = 1/121 (1%)
 Frame = +2

Query  89   GKGLTALVVEDSPILQLVHKTLLKKYgvevqvvnn-geeavvLHRSGARFDLLLMDKEMP  265
             K L  L+VED+   QLV K +L K G  V + ++  E    L  +  R D++LMD  MP
Sbjct  453  NKALNLLIVEDTQSNQLVIKLILNKLGHNVHITSHGAEALTFLEENDNRIDMILMDVSMP  512

Query  266  IKDGVNATKELREMGVKSMIVGATSHGPGPVRDEFLAAGLDECLVKPLRAEVVLGVINKL  445
            + DG+ AT+ +R+ G+   IV  T+H     +D+ L AG+D  + KP+R + +   I  L
Sbjct  513  VMDGITATRLIRKKGITIPIVALTAHALESDKDKCLDAGMDSFVSKPVRRQDIYEAIQSL  572

Query  446  V  448
            +
Sbjct  573  I  573



>ref|WP_031819035.1| histidine kinase [Vibrio parahaemolyticus]
Length=576

 Score = 65.5 bits (158),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 43/121 (36%), Positives = 67/121 (55%), Gaps = 1/121 (1%)
 Frame = +2

Query  89   GKGLTALVVEDSPILQLVHKTLLKKYgvevqvvnn-geeavvLHRSGARFDLLLMDKEMP  265
             K L  L+VED+   QLV K +L K G  V + ++  E    L  +  R D++LMD  MP
Sbjct  453  NKALNLLIVEDTQSNQLVIKLILNKLGHNVHITSHGAEALTFLEENDNRIDMILMDVSMP  512

Query  266  IKDGVNATKELREMGVKSMIVGATSHGPGPVRDEFLAAGLDECLVKPLRAEVVLGVINKL  445
            + DG+ AT+ +R+ G+   IV  T+H     +D+ L AG+D  + KP+R + +   I  L
Sbjct  513  VMDGITATRLIRKKGITIPIVALTAHALESDKDKCLDAGMDSFVSKPVRRQDIYEAIQSL  572

Query  446  V  448
            +
Sbjct  573  I  573



>ref|WP_021822969.1| his Kinase A domain protein [Vibrio parahaemolyticus]
 gb|EQM39851.1| his Kinase A domain protein [Vibrio parahaemolyticus NIHCB0757]
Length=576

 Score = 65.5 bits (158),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 43/121 (36%), Positives = 67/121 (55%), Gaps = 1/121 (1%)
 Frame = +2

Query  89   GKGLTALVVEDSPILQLVHKTLLKKYgvevqvvnn-geeavvLHRSGARFDLLLMDKEMP  265
             K L  L+VED+   QLV K +L K G  V + ++  E    L  +  R D++LMD  MP
Sbjct  453  NKALNLLIVEDTQSNQLVIKLILNKLGHNVHITSHGAEALTFLEENDNRIDMILMDVSMP  512

Query  266  IKDGVNATKELREMGVKSMIVGATSHGPGPVRDEFLAAGLDECLVKPLRAEVVLGVINKL  445
            + DG+ AT+ +R+ G+   IV  T+H     +D+ L AG+D  + KP+R + +   I  L
Sbjct  513  VMDGITATRLIRKKGITIPIVALTAHALESDKDKCLDAGMDSFVSKPVRRQDIYEAIQSL  572

Query  446  V  448
            +
Sbjct  573  I  573



>ref|WP_025796359.1| histidine kinase [Vibrio parahaemolyticus]
Length=576

 Score = 65.5 bits (158),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 43/121 (36%), Positives = 67/121 (55%), Gaps = 1/121 (1%)
 Frame = +2

Query  89   GKGLTALVVEDSPILQLVHKTLLKKYgvevqvvnn-geeavvLHRSGARFDLLLMDKEMP  265
             K L  L+VED+   QLV K +L K G  V + ++  E    L  +  R D++LMD  MP
Sbjct  453  NKALNLLIVEDTQSNQLVIKLILNKLGHNVHIASHGAEALTFLEENDNRIDMILMDVSMP  512

Query  266  IKDGVNATKELREMGVKSMIVGATSHGPGPVRDEFLAAGLDECLVKPLRAEVVLGVINKL  445
            + DG+ AT+ +R+ G+   IV  T+H     +D+ L AG+D  + KP+R + +   I  L
Sbjct  513  VMDGITATRLIRKKGITIPIVALTAHALESDKDKCLDAGMDSFVSKPVRRQDIYEAIQSL  572

Query  446  V  448
            +
Sbjct  573  I  573



>ref|WP_029810757.1| histidine kinase [Vibrio parahaemolyticus]
 gb|KFE93748.1| histidine kinase [Vibrio parahaemolyticus]
Length=576

 Score = 65.5 bits (158),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 43/121 (36%), Positives = 67/121 (55%), Gaps = 1/121 (1%)
 Frame = +2

Query  89   GKGLTALVVEDSPILQLVHKTLLKKYgvevqvvnn-geeavvLHRSGARFDLLLMDKEMP  265
             K L  L+VED+   QLV K +L K G  V + ++  E    L  +  R D++LMD  MP
Sbjct  453  NKALNLLIVEDTQSNQLVIKLILNKLGHNVHITSHGAEALTFLEENDNRIDMILMDVSMP  512

Query  266  IKDGVNATKELREMGVKSMIVGATSHGPGPVRDEFLAAGLDECLVKPLRAEVVLGVINKL  445
            + DG+ AT+ +R+ G+   IV  T+H     +D+ L AG+D  + KP+R + +   I  L
Sbjct  513  VMDGITATRLIRKKGITIPIVALTAHALESDKDKCLDAGMDSFVSKPVRRQDIYEAIQSL  572

Query  446  V  448
            +
Sbjct  573  I  573



>ref|WP_025559315.1| histidine kinase [Vibrio parahaemolyticus]
Length=576

 Score = 65.5 bits (158),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 43/121 (36%), Positives = 67/121 (55%), Gaps = 1/121 (1%)
 Frame = +2

Query  89   GKGLTALVVEDSPILQLVHKTLLKKYgvevqvvnn-geeavvLHRSGARFDLLLMDKEMP  265
             K L  L+VED+   QLV K +L K G  V + ++  E    L  +  R D++LMD  MP
Sbjct  453  NKALNLLIVEDTQSNQLVIKLILNKLGHNVHITSHGAEALTFLEENDNRIDMILMDVSMP  512

Query  266  IKDGVNATKELREMGVKSMIVGATSHGPGPVRDEFLAAGLDECLVKPLRAEVVLGVINKL  445
            + DG+ AT+ +R+ G+   IV  T+H     +D+ L AG+D  + KP+R + +   I  L
Sbjct  513  VMDGITATRLIRKKGITIPIVALTAHALESDKDKCLDAGMDSFVSKPVRRQDIYEAIQSL  572

Query  446  V  448
            +
Sbjct  573  I  573



>ref|WP_025554755.1| histidine kinase [Vibrio parahaemolyticus]
Length=576

 Score = 65.5 bits (158),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 43/121 (36%), Positives = 67/121 (55%), Gaps = 1/121 (1%)
 Frame = +2

Query  89   GKGLTALVVEDSPILQLVHKTLLKKYgvevqvvnn-geeavvLHRSGARFDLLLMDKEMP  265
             K L  L+VED+   QLV K +L K G  V + ++  E    L  +  R D++LMD  MP
Sbjct  453  NKALNLLIVEDTQSNQLVIKLILNKLGHNVHITSHGAEALTFLEENDNRIDMILMDVSMP  512

Query  266  IKDGVNATKELREMGVKSMIVGATSHGPGPVRDEFLAAGLDECLVKPLRAEVVLGVINKL  445
            + DG+ AT+ +R+ G+   IV  T+H     +D+ L AG+D  + KP+R + +   I  L
Sbjct  513  VMDGITATRLIRKKGITIPIVALTAHALESDKDKCLDAGMDSFVSKPVRRQDIYEAIQSL  572

Query  446  V  448
            +
Sbjct  573  I  573



>ref|WP_026718661.1| hypothetical protein [Flavobacterium antarcticum]
Length=729

 Score = 65.5 bits (158),  Expect = 4e-09, Method: Composition-based stats.
 Identities = 42/124 (34%), Positives = 71/124 (57%), Gaps = 1/124 (1%)
 Frame = +2

Query  80   KNVGKGLTALVVEDSPILQLVHKTLLKKYgvevqvvnngeeavvLHRSGARFDLLLMDKE  259
            K + K L  LVVED+ I Q+V K ++++      +  +G EA+ L ++   FD++LMD  
Sbjct  603  KRMKKELHILVVEDNKINQIVTKKIIQRKNYPCTIAESGHEAIELLKTNV-FDVILMDIS  661

Query  260  MPIKDGVNATKELREMGVKSMIVGATSHGPGPVRDEFLAAGLDECLVKPLRAEVVLGVIN  439
            MPI DG   +K +RE+G+++ I+  T+   G V  +    G+ + ++KP   E++   I 
Sbjct  662  MPILDGYETSKIIRELGIETPIIALTAFERGEVEAKAKEHGISDVIIKPFNPEILFETIE  721

Query  440  KLVA  451
            KL A
Sbjct  722  KLFA  725



>ref|WP_025818353.1| histidine kinase [Vibrio parahaemolyticus]
Length=576

 Score = 65.5 bits (158),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 43/121 (36%), Positives = 67/121 (55%), Gaps = 1/121 (1%)
 Frame = +2

Query  89   GKGLTALVVEDSPILQLVHKTLLKKYgvevqvvnn-geeavvLHRSGARFDLLLMDKEMP  265
             K L  L+VED+   QLV K +L K G  V + ++  E    L  +  R D++LMD  MP
Sbjct  453  NKALNLLIVEDTQSNQLVIKLILNKLGHNVHITSHGAEALTFLEENDNRIDMILMDVSMP  512

Query  266  IKDGVNATKELREMGVKSMIVGATSHGPGPVRDEFLAAGLDECLVKPLRAEVVLGVINKL  445
            + DG+ AT+ +R+ G+   IV  T+H     +D+ L AG+D  + KP+R + +   I  L
Sbjct  513  VMDGITATRLIRKKGITIPIVALTAHALESDKDKCLDAGMDSFVSKPVRRQDIYEAIQSL  572

Query  446  V  448
            +
Sbjct  573  I  573



>ref|WP_023001225.1| MULTISPECIES: hypothetical protein [Labrenzia]
 gb|ERP91224.1| hypothetical protein Q669_32000 [Labrenzia sp. C1B10]
 gb|ERS04179.1| hypothetical protein Q675_30790 [Labrenzia sp. C1B70]
Length=866

 Score = 65.5 bits (158),  Expect = 4e-09, Method: Composition-based stats.
 Identities = 47/120 (39%), Positives = 69/120 (58%), Gaps = 4/120 (3%)
 Frame = +2

Query  65   MDMDSKNVGKGLTALVVEDSPILQLVHKTLLKKYgvevqvvnngeeavvLHRSGARFDLL  244
            +++ S + G  L  LVVED+ I + V +  L+K+   V   +NG + V L +    FDL+
Sbjct  586  VELSSLSDGMKLKVLVVEDNEINRFVARQFLEKHDSHVAEAHNGVKGVELAKQQV-FDLI  644

Query  245  LMDKEMPIKDGVNATKELREMG---VKSMIVGATSHGPGPVRDEFLAAGLDECLVKPLRA  415
            LMD  MP  DG+ A++ +R       KS+IVG T+H     +  FL AG+D+CL KPLR 
Sbjct  645  LMDISMPGMDGIEASRLIRAGSGGSSKSLIVGLTAHVSPEEQQRFLDAGMDKCLSKPLRG  704



>emb|CBI20440.3| unnamed protein product [Vitis vinifera]
Length=167

 Score = 62.4 bits (150),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 44/116 (38%), Positives = 73/116 (63%), Gaps = 0/116 (0%)
 Frame = +2

Query  98   LTALVVEDSPILQLVHKTLLKKYgvevqvvnngeeavvLHRSGARFDLLLMDKEMPIKDG  277
            LTALVV+   I Q++ K +L+  GVE QVV +G +A+ L  SGA F+L+++   +PI +G
Sbjct  32   LTALVVDSDRICQILEKAILESQGVETQVVGSGRDALDLLASGATFNLIIIAMVLPIMNG  91

Query  278  VNATKELREMGVKSMIVGATSHGPGPVRDEFLAAGLDECLVKPLRAEVVLGVINKL  445
            V  T+ +R MG+ S ++G T+      +  FL AG+DE + KPL  + +  ++ ++
Sbjct  92   VETTRRIRAMGICSKMLGVTACSYEREKQAFLDAGVDEFIEKPLTPQKLASILREM  147



>ref|WP_031850627.1| histidine kinase [Vibrio parahaemolyticus]
 gb|KED48234.1| histidine kinase [Vibrio parahaemolyticus]
Length=576

 Score = 65.5 bits (158),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 43/121 (36%), Positives = 67/121 (55%), Gaps = 1/121 (1%)
 Frame = +2

Query  89   GKGLTALVVEDSPILQLVHKTLLKKYgvevqvvnn-geeavvLHRSGARFDLLLMDKEMP  265
             K L  L+VED+   QLV K +L K G  V + ++  E    L  +  R D++LMD  MP
Sbjct  453  SKALNLLIVEDTQSNQLVIKLILNKLGHNVHIASHGAEALTFLEENDNRIDMILMDVSMP  512

Query  266  IKDGVNATKELREMGVKSMIVGATSHGPGPVRDEFLAAGLDECLVKPLRAEVVLGVINKL  445
            + DG+ AT+ +R+ G+   IV  T+H     +D+ L AG+D  + KP+R + +   I  L
Sbjct  513  VMDGITATRLIRKKGITIPIVALTAHALESDKDKCLDAGMDSFVSKPVRRQDIYEAIQSL  572

Query  446  V  448
            +
Sbjct  573  I  573



>ref|WP_020840621.1| signal transduction histidine kinase [Vibrio parahaemolyticus]
 ref|YP_008313786.1| signal transduction histidine kinase [Vibrio parahaemolyticus 
O1:Kuk str. FDA_R31]
 gb|AGQ90954.1| signal transduction histidine kinase [Vibrio parahaemolyticus 
O1:Kuk str. FDA_R31]
Length=576

 Score = 65.5 bits (158),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 43/121 (36%), Positives = 67/121 (55%), Gaps = 1/121 (1%)
 Frame = +2

Query  89   GKGLTALVVEDSPILQLVHKTLLKKYgvevqvvnn-geeavvLHRSGARFDLLLMDKEMP  265
             K L  L+VED+   QLV K +L K G  V + ++  E    L  +  R D++LMD  MP
Sbjct  453  NKALNLLIVEDTQSNQLVIKLILNKLGHNVHITSHGAEALTFLEENDNRIDMILMDVSMP  512

Query  266  IKDGVNATKELREMGVKSMIVGATSHGPGPVRDEFLAAGLDECLVKPLRAEVVLGVINKL  445
            + DG+ AT+ +R+ G+   IV  T+H     +D+ L AG+D  + KP+R + +   I  L
Sbjct  513  VMDGITATRLIRKKGITIPIVALTAHALESDKDKCLDAGMDSFVSKPVRRQDIYEAIQSL  572

Query  446  V  448
            +
Sbjct  573  I  573



>ref|WP_011261900.1| chemotaxis protein CheY [Aliivibrio fischeri]
 ref|YP_204679.1| hybrid sensory histidine kinase [Vibrio fischeri ES114]
 gb|AAW85791.1| hybrid sensory histidine kinase [Vibrio fischeri ES114]
Length=692

 Score = 65.5 bits (158),  Expect = 4e-09, Method: Composition-based stats.
 Identities = 44/112 (39%), Positives = 74/112 (66%), Gaps = 3/112 (3%)
 Frame = +2

Query  92   KGLTALVVEDSPILQLVHKTLLKKYgvevqvvnngeeavvLHR---SGARFDLLLMDKEM  262
            + L  L+ ED+   Q V + LL+K G  V +V+NGEEA+ + +   +G  FD++LMD  M
Sbjct  570  RSLNILLAEDNKANQAVLQILLEKQGHHVSIVSNGEEAISIFKHQTNGCFFDVVLMDVSM  629

Query  263  PIKDGVNATKELREMGVKSMIVGATSHGPGPVRDEFLAAGLDECLVKPLRAE  418
            P+KDG++AT ELR++G++  I+  T+H     ++  L AG+++ + KP+RA+
Sbjct  630  PVKDGISATTELRKLGIELPIIAITAHAMETEKEMCLEAGMNDFISKPIRAK  681



>ref|WP_025626820.1| histidine kinase [Vibrio parahaemolyticus]
Length=576

 Score = 65.5 bits (158),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 43/121 (36%), Positives = 67/121 (55%), Gaps = 1/121 (1%)
 Frame = +2

Query  89   GKGLTALVVEDSPILQLVHKTLLKKYgvevqvvnn-geeavvLHRSGARFDLLLMDKEMP  265
             K L  L+VED+   QLV K +L K G  V + ++  E    L  +  R D++LMD  MP
Sbjct  453  NKALNLLIVEDTQSNQLVIKLILNKLGHNVHIASHGAEALTFLEENDNRIDMILMDVSMP  512

Query  266  IKDGVNATKELREMGVKSMIVGATSHGPGPVRDEFLAAGLDECLVKPLRAEVVLGVINKL  445
            + DG+ AT+ +R+ G+   IV  T+H     +D+ L AG+D  + KP+R + +   I  L
Sbjct  513  VMDGITATRLIRKKGITIPIVALTAHALESDKDKCLDAGMDSFVSKPVRRQDIYEAIQSL  572

Query  446  V  448
            +
Sbjct  573  I  573



>ref|WP_031854743.1| histidine kinase [Vibrio parahaemolyticus]
 gb|KED48943.1| histidine kinase [Vibrio parahaemolyticus]
 gb|KED49473.1| histidine kinase [Vibrio parahaemolyticus]
 gb|KED52907.1| histidine kinase [Vibrio parahaemolyticus]
Length=576

 Score = 65.1 bits (157),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 43/121 (36%), Positives = 67/121 (55%), Gaps = 1/121 (1%)
 Frame = +2

Query  89   GKGLTALVVEDSPILQLVHKTLLKKYgvevqvvnn-geeavvLHRSGARFDLLLMDKEMP  265
             K L  L+VED+   QLV K +L K G  V + ++  E    L  +  R D++LMD  MP
Sbjct  453  SKALNLLIVEDTQSNQLVIKLILNKLGHNVHIASHGAEALTFLEENDNRIDMILMDVSMP  512

Query  266  IKDGVNATKELREMGVKSMIVGATSHGPGPVRDEFLAAGLDECLVKPLRAEVVLGVINKL  445
            + DG+ AT+ +R+ G+   IV  T+H     +D+ L AG+D  + KP+R + +   I  L
Sbjct  513  VMDGITATRLIRKKGITIPIVALTAHALESDKDKCLDAGMDSFVSKPVRRQDIYEAIQSL  572

Query  446  V  448
            +
Sbjct  573  I  573



>ref|WP_005495008.1| signal transduction histidine kinase [Vibrio parahaemolyticus]
 gb|EGF44508.1| sensor histidine kinase/response regulator [Vibrio parahaemolyticus 
10329]
 gb|EQL87729.1| his Kinase A domain protein [Vibrio parahaemolyticus 10290]
 gb|ESV69468.1| his Kinase A domain protein [Vibrio parahaemolyticus 10296]
 gb|ESW45045.1| his Kinase A domain protein [Vibrio parahaemolyticus 12310]
 gb|ETT21313.1| his Kinase A domain protein [Vibrio parahaemolyticus 3256]
 gb|ETX53899.1| his Kinase A domain protein [Vibrio parahaemolyticus SBR10290]
 gb|KEE00710.1| histidine kinase [Vibrio parahaemolyticus]
 gb|KEE04824.1| histidine kinase [Vibrio parahaemolyticus]
 gb|KEE08981.1| histidine kinase [Vibrio parahaemolyticus]
 gb|KEE14936.1| histidine kinase [Vibrio parahaemolyticus]
 gb|KEE15312.1| histidine kinase [Vibrio parahaemolyticus]
 gb|KEE19666.1| histidine kinase [Vibrio parahaemolyticus]
 gb|KEE23845.1| histidine kinase [Vibrio parahaemolyticus]
 gb|KEE24003.1| histidine kinase [Vibrio parahaemolyticus]
 gb|KEE30141.1| histidine kinase [Vibrio parahaemolyticus]
 gb|KEE31657.1| histidine kinase [Vibrio parahaemolyticus]
 gb|KEE35058.1| histidine kinase [Vibrio parahaemolyticus]
 gb|KEE36948.1| histidine kinase [Vibrio parahaemolyticus]
 gb|KEE41539.1| histidine kinase [Vibrio parahaemolyticus]
 gb|KEE51506.1| histidine kinase [Vibrio parahaemolyticus]
 gb|KEE55782.1| histidine kinase [Vibrio parahaemolyticus]
 gb|KEE59575.1| histidine kinase [Vibrio parahaemolyticus]
 gb|KEE64264.1| histidine kinase [Vibrio parahaemolyticus O4:K12 str. K1203]
 gb|KEE70129.1| histidine kinase [Vibrio parahaemolyticus]
Length=576

 Score = 65.1 bits (157),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 43/121 (36%), Positives = 67/121 (55%), Gaps = 1/121 (1%)
 Frame = +2

Query  89   GKGLTALVVEDSPILQLVHKTLLKKYgvevqvvnn-geeavvLHRSGARFDLLLMDKEMP  265
             K L  L+VED+   QLV K +L K G  V + ++  E    L  +  R D++LMD  MP
Sbjct  453  NKALNLLIVEDTQSNQLVIKLILNKLGHNVHIASHGAEALTFLEENDNRIDMILMDVSMP  512

Query  266  IKDGVNATKELREMGVKSMIVGATSHGPGPVRDEFLAAGLDECLVKPLRAEVVLGVINKL  445
            + DG+ AT+ +R+ G+   IV  T+H     +D+ L AG+D  + KP+R + +   I  L
Sbjct  513  VMDGITATRLIRKKGITIPIVALTAHALESDKDKCLDAGMDSFVSKPVRRQDIYEAIQSL  572

Query  446  V  448
            +
Sbjct  573  I  573



>ref|WP_025632234.1| histidine kinase [Vibrio parahaemolyticus]
 gb|ETT14601.1| his Kinase A domain protein [Vibrio parahaemolyticus 50]
 gb|EVT83447.1| his Kinase A domain protein [Vibrio parahaemolyticus VP2007-007]
 gb|EXJ43735.1| his Kinase A domain protein [Vibrio parahaemolyticus VPTS-2010_2]
 gb|KED68593.1| histidine kinase [Vibrio parahaemolyticus]
 gb|KEE65525.1| histidine kinase [Vibrio parahaemolyticus 98-513-F52]
Length=576

 Score = 65.1 bits (157),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 43/121 (36%), Positives = 67/121 (55%), Gaps = 1/121 (1%)
 Frame = +2

Query  89   GKGLTALVVEDSPILQLVHKTLLKKYgvevqvvnn-geeavvLHRSGARFDLLLMDKEMP  265
             K L  L+VED+   QLV K +L K G  V + ++  E    L  +  R D++LMD  MP
Sbjct  453  SKALNLLIVEDTQSNQLVIKLILNKLGHNVHIASHGAEALTFLEENDNRIDMILMDVSMP  512

Query  266  IKDGVNATKELREMGVKSMIVGATSHGPGPVRDEFLAAGLDECLVKPLRAEVVLGVINKL  445
            + DG+ AT+ +R+ G+   IV  T+H     +D+ L AG+D  + KP+R + +   I  L
Sbjct  513  VMDGITATRLIRKKGITIPIVALTAHALESDKDKCLDAGMDSFVSKPVRRQDIYEAIQSL  572

Query  446  V  448
            +
Sbjct  573  I  573



>ref|WP_033932560.1| histidine kinase [Vibrio cholerae]
Length=570

 Score = 65.1 bits (157),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 43/114 (38%), Positives = 71/114 (62%), Gaps = 0/114 (0%)
 Frame = +2

Query  107  LVVEDSPILQLVHKTLLKKYgvevqvvnngeeavvLHRSGARFDLLLMDKEMPIKDGVNA  286
            LVVED+   Q+V + LL K G +V +  NG +AV L      FDL+LMD  MPI DG+ A
Sbjct  455  LVVEDTKTNQMVIQLLLNKLGYDVTIAENGLQAVELLERNHAFDLVLMDISMPIMDGIAA  514

Query  287  TKELREMGVKSMIVGATSHGPGPVRDEFLAAGLDECLVKPLRAEVVLGVINKLV  448
            TK LR+  ++  I+  T+H  G  +   + AG+++ ++KP+R++ ++ V+ + +
Sbjct  515  TKILRDKHIEIPIIALTAHTAGSDKQNCIDAGMNDIVLKPIRSKDIMEVVKRFL  568



>ref|WP_001935056.1| sensor histidine kinase [Vibrio cholerae]
 gb|EGS69118.1| his Kinase A domain protein [Vibrio cholerae BJG-01]
Length=570

 Score = 65.1 bits (157),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 43/114 (38%), Positives = 71/114 (62%), Gaps = 0/114 (0%)
 Frame = +2

Query  107  LVVEDSPILQLVHKTLLKKYgvevqvvnngeeavvLHRSGARFDLLLMDKEMPIKDGVNA  286
            LVVED+   Q+V + LL K G +V +  NG +AV L      FDL+LMD  MPI DG+ A
Sbjct  455  LVVEDTKTNQMVIQLLLNKLGYDVTIAENGLQAVELLERNHAFDLVLMDISMPIMDGIAA  514

Query  287  TKELREMGVKSMIVGATSHGPGPVRDEFLAAGLDECLVKPLRAEVVLGVINKLV  448
            TK LR+  ++  I+  T+H  G  +   + AG+++ ++KP+R++ ++ V+ + +
Sbjct  515  TKILRDKHIEIPIIALTAHTAGSDKQNCIDAGMNDIVLKPIRSKDIMEVVKRFL  568



>ref|WP_039981209.1| histidine kinase [Vibrio sagamiensis]
Length=566

 Score = 65.1 bits (157),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 45/121 (37%), Positives = 72/121 (60%), Gaps = 2/121 (2%)
 Frame = +2

Query  89   GKGLTALVVEDSPILQLVHKTLLKKYgvevqvvnngeeavvL--HRSGARFDLLLMDKEM  262
             K +  LVVED+   Q+V K +L + G  V + +NG +A+ L  ++S ++ D++LMD  M
Sbjct  444  AKKMNFLVVEDTKSNQMVIKLILNQLGHNVFITSNGRDAIQLIENQSDSKIDMILMDVSM  503

Query  263  PIKDGVNATKELREMGVKSMIVGATSHGPGPVRDEFLAAGLDECLVKPLRAEVVLGVINK  442
            P+ DG+ AT+ LR+ G+K  I+  T+H     +   L AG+D  + KP+R + VL  I  
Sbjct  504  PVMDGITATQILRKNGIKIPIIALTAHALDDDKKNCLTAGMDSFISKPVRKQEVLKAIES  563

Query  443  L  445
            L
Sbjct  564  L  564



>ref|WP_031271708.1| hypothetical protein, partial [Clostridium sp. BL8]
Length=795

 Score = 65.1 bits (157),  Expect = 5e-09, Method: Composition-based stats.
 Identities = 45/128 (35%), Positives = 75/128 (59%), Gaps = 5/128 (4%)
 Frame = +2

Query  107  LVVEDSPILQLVHKTLLKKYgvevqvvnngeeavvLHRSGARFDLLLMDKEMPIKDGVNA  286
            L+ ED  + Q+V   +LK+ G  V + NNG EA  ++     +D++LMD +MP+ DG+ A
Sbjct  552  LLAEDDKVNQMVTARILKERGFIVDIANNGLEATGMYEK-THYDIVLMDIQMPLMDGIQA  610

Query  287  TKELREMGVKSM--IVGATSHGPGPVRDEFLAAGLDECLVKPLRAEVVLGVINK--LVA*  454
            T+++REM  K    I+  T+H     R+ FL+ G+D  + KP++ E +   IN+   +  
Sbjct  611  TRKIREMNTKRSVPIIAMTAHALKGDRERFLSQGMDGYISKPIKVEELFDTINQCLFIKN  670

Query  455  NEFDLKSI  478
            +E DLK +
Sbjct  671  SEEDLKDV  678



>ref|WP_031388740.1| hypothetical protein, partial [Desulfonatronum thiodismutans]
Length=500

 Score = 64.7 bits (156),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 52/135 (39%), Positives = 74/135 (55%), Gaps = 22/135 (16%)
 Frame = +2

Query  83   NVGKGLTALVVEDSPILQLVHKTLLKKYgvevqvvnngeeavvLHRSGARFDLLLMDKEM  262
             V  GL  L+VED+P+ QLV + +L+K G+     NNG++AV   ++ A +DL+ MD EM
Sbjct  306  QVQPGLRVLLVEDNPVNQLVARKMLQKMGILADTANNGQKAVAAMKNRA-YDLVFMDIEM  364

Query  263  PIKDGVNATKELR----EMGVKSM-----------------IVGATSHGPGPVRDEFLAA  379
            PI DG+ AT ++R    E G +S                  I+  T+H     R+ FLAA
Sbjct  365  PIMDGLEATGKIRSLESEAGSQSSDPHVSGFNPQPSHRRTPIIALTAHAVHGDRERFLAA  424

Query  380  GLDECLVKPLRAEVV  424
            G D+ L KPLR E +
Sbjct  425  GFDDYLTKPLRFETL  439



>gb|EAX61708.1| sensor histidine kinase/response regulator [Vibrio cholerae V52]
Length=406

 Score = 64.7 bits (156),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 43/114 (38%), Positives = 71/114 (62%), Gaps = 0/114 (0%)
 Frame = +2

Query  107  LVVEDSPILQLVHKTLLKKYgvevqvvnngeeavvLHRSGARFDLLLMDKEMPIKDGVNA  286
            LVVED+   Q+V + LL K G +V +  NG +AV L      FDL+LMD  MPI DG+ A
Sbjct  291  LVVEDTKTNQMVIQLLLNKLGYDVTIAENGLQAVELLEKNHVFDLVLMDISMPIMDGIAA  350

Query  287  TKELREMGVKSMIVGATSHGPGPVRDEFLAAGLDECLVKPLRAEVVLGVINKLV  448
            TK LR+  ++  I+  T+H  G  +   + AG+++ ++KP+R++ ++ V+ + +
Sbjct  351  TKILRDKHIEIPIIALTAHTAGSDKQNCIDAGMNDIVLKPIRSKDIMEVVKRFL  404



>ref|WP_017019646.1| chemotaxis protein CheY [Aliivibrio fischeri]
Length=692

 Score = 65.1 bits (157),  Expect = 6e-09, Method: Composition-based stats.
 Identities = 46/120 (38%), Positives = 78/120 (65%), Gaps = 3/120 (3%)
 Frame = +2

Query  92   KGLTALVVEDSPILQLVHKTLLKKYgvevqvvnngeeavvL--HRSGARF-DLLLMDKEM  262
            + L  L+ ED+   Q V + LL+K G  V +V+NGEEA+ +  H+   RF D++LMD  M
Sbjct  570  RNLNILLAEDNKANQAVLQILLEKQGHHVSIVSNGEEAISIFNHQPNCRFFDVILMDVSM  629

Query  263  PIKDGVNATKELREMGVKSMIVGATSHGPGPVRDEFLAAGLDECLVKPLRAEVVLGVINK  442
            P+KDG++AT ELR++G++  I+  T+H     ++  L AG+++ + KP+RA+ +  ++ K
Sbjct  630  PVKDGISATTELRKLGIELPIIAITAHAMETEKEMCLEAGMNDFISKPIRAKDLSNILIK  689



>ref|WP_033084789.1| histidine kinase, partial [Vibrio cholerae]
Length=511

 Score = 64.7 bits (156),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 43/114 (38%), Positives = 71/114 (62%), Gaps = 0/114 (0%)
 Frame = +2

Query  107  LVVEDSPILQLVHKTLLKKYgvevqvvnngeeavvLHRSGARFDLLLMDKEMPIKDGVNA  286
            LVVED+   Q+V + LL K G +V +  NG +AV L      FDL+LMD  MPI DG+ A
Sbjct  396  LVVEDTKTNQMVIQLLLNKLGYDVTIAENGLQAVELLEKNHVFDLVLMDISMPIMDGIAA  455

Query  287  TKELREMGVKSMIVGATSHGPGPVRDEFLAAGLDECLVKPLRAEVVLGVINKLV  448
            TK LR+  ++  I+  T+H  G  +   + AG+++ ++KP+R++ ++ V+ + +
Sbjct  456  TKILRDKHIEIPIIALTAHTAGSDKQNCIDAGMNDIVLKPIRSKDIMEVVKRFL  509



>ref|WP_011929406.1| sensor histidine kinase [Vibrio cholerae]
 ref|YP_001217001.1| sensor histidine kinase/response regulator [Vibrio cholerae O395]
 ref|YP_002819807.1| sensor histidine kinase/response regulator [Vibrio cholerae O395]
 gb|ABQ21032.1| sensor histidine kinase/response regulator [Vibrio cholerae O395]
 gb|ACP09571.1| sensor histidine kinase/response regulator [Vibrio cholerae O395]
Length=514

 Score = 64.7 bits (156),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 43/114 (38%), Positives = 71/114 (62%), Gaps = 0/114 (0%)
 Frame = +2

Query  107  LVVEDSPILQLVHKTLLKKYgvevqvvnngeeavvLHRSGARFDLLLMDKEMPIKDGVNA  286
            LVVED+   Q+V + LL K G +V +  NG +AV L      FDL+LMD  MPI DG+ A
Sbjct  399  LVVEDTKTNQMVIQLLLNKLGYDVTIAENGLQAVELLEKNHVFDLVLMDISMPIMDGIAA  458

Query  287  TKELREMGVKSMIVGATSHGPGPVRDEFLAAGLDECLVKPLRAEVVLGVINKLV  448
            TK LR+  ++  I+  T+H  G  +   + AG+++ ++KP+R++ ++ V+ + +
Sbjct  459  TKILRDKHIEIPIIALTAHTAGSDKQNCIDAGMNDIVLKPIRSKDIMEVVKRFL  512



>gb|EFI36125.1| histidine kinase [Desulfonatronospira thiodismutans ASO3-1]
Length=533

 Score = 64.7 bits (156),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 51/126 (40%), Positives = 70/126 (56%), Gaps = 8/126 (6%)
 Frame = +2

Query  89   GKGLTALVVEDSPILQLVHKTLLKKYgvevqvvnngeeavvLHRSGARFDLLLMDKEMPI  268
            GK L  LV ED P+ Q+  K LL K G  V +  NG EAV L +  + FD +LMD +MP+
Sbjct  396  GKALNILVAEDDPMNQIFIKNLLTKEGHNVSMAKNGREAVELVQEHS-FDCVLMDIQMPV  454

Query  269  KDGVNATKELREMG-------VKSMIVGATSHGPGPVRDEFLAAGLDECLVKPLRAEVVL  427
              GV AT+E+R +G       V+  I+  T+H     R++FL AG+D+ L KP+  E   
Sbjct  455  MTGVEATREIRNLGGNGSIRNVQIPIIAVTAHTQPGDREKFLDAGMDDYLGKPVSLEDFR  514

Query  428  GVINKL  445
             V  K 
Sbjct  515  NVFRKF  520



>gb|KFE25719.1| his Kinase A domain protein [Vibrio cholerae]
Length=514

 Score = 64.7 bits (156),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 43/114 (38%), Positives = 71/114 (62%), Gaps = 0/114 (0%)
 Frame = +2

Query  107  LVVEDSPILQLVHKTLLKKYgvevqvvnngeeavvLHRSGARFDLLLMDKEMPIKDGVNA  286
            LVVED+   Q+V + LL K G +V +  NG +AV L      FDL+LMD  MPI DG+ A
Sbjct  399  LVVEDTKTNQMVIQLLLNKLGYDVTIAENGLQAVELLEKNHVFDLVLMDISMPIMDGIAA  458

Query  287  TKELREMGVKSMIVGATSHGPGPVRDEFLAAGLDECLVKPLRAEVVLGVINKLV  448
            TK LR+  ++  I+  T+H  G  +   + AG+++ ++KP+R++ ++ V+ + +
Sbjct  459  TKILRDKHIEIPIIALTAHTAGSDKQNCIDAGMNDIVLKPIRSKDIMEVVKRFL  512



>ref|WP_035258886.1| hypothetical protein, partial [Desulfatirhabdium butyrativorans]
Length=585

 Score = 64.7 bits (156),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 48/116 (41%), Positives = 70/116 (60%), Gaps = 1/116 (1%)
 Frame = +2

Query  98   LTALVVEDSPILQLVHKTLLKKYgvevqvvnngeeavvLHRSGARFDLLLMDKEMPIKDG  277
            L  L+VED+P+ Q +   +LKK G+ V    NG EAV   R  A +DL+ MD +MPI DG
Sbjct  471  LNILLVEDNPVNQKLVCAMLKKTGINVDTAENGLEAVQKTREHA-YDLVFMDIQMPIMDG  529

Query  278  VNATKELREMGVKSMIVGATSHGPGPVRDEFLAAGLDECLVKPLRAEVVLGVINKL  445
            + AT+E+RE      I+  T+H     R+  +AAG+++ L KP+R E V+ +I K 
Sbjct  530  IQATREIREGFPNLPIIAMTAHALKGDREICIAAGMNDYLSKPIRREQVMAMIEKW  585



>ref|WP_012532959.1| chemotaxis protein CheY [Aliivibrio fischeri]
 ref|YP_002156093.1| sensor protein LuxQ [Vibrio fischeri MJ11]
 gb|ACH65300.1| sensor protein LuxQ [Vibrio fischeri MJ11]
Length=692

 Score = 65.1 bits (157),  Expect = 6e-09, Method: Composition-based stats.
 Identities = 46/120 (38%), Positives = 78/120 (65%), Gaps = 3/120 (3%)
 Frame = +2

Query  92   KGLTALVVEDSPILQLVHKTLLKKYgvevqvvnngeeavvL--HRSGARF-DLLLMDKEM  262
            + L  L+ ED+   Q V + LL+K G  V +V+NGEEA+ +  H+   RF D++LMD  M
Sbjct  570  RNLNILLAEDNKANQAVLQILLEKQGHHVSIVSNGEEAISIFKHQPNCRFFDVILMDVSM  629

Query  263  PIKDGVNATKELREMGVKSMIVGATSHGPGPVRDEFLAAGLDECLVKPLRAEVVLGVINK  442
            P+KDG++AT ELR++G++  I+  T+H     ++  L AG+++ + KP+RA+ +  ++ K
Sbjct  630  PVKDGISATTELRKLGIELPIIAITAHAMETEKEMCLEAGMNDFISKPIRAKDLSNILIK  689



>ref|WP_031852347.1| histidine kinase [Vibrio parahaemolyticus]
 gb|KED65494.1| histidine kinase [Vibrio parahaemolyticus]
Length=576

 Score = 64.7 bits (156),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 42/121 (35%), Positives = 66/121 (55%), Gaps = 1/121 (1%)
 Frame = +2

Query  89   GKGLTALVVEDSPILQLVHKTLLKKYgvevqvvnn-geeavvLHRSGARFDLLLMDKEMP  265
             K    L+VED+   QLV K +L K G  V + ++  E    L  +  R D++LMD  MP
Sbjct  453  SKAFNLLIVEDTQSNQLVIKLILNKLGHNVHIASHGAEALTFLEENDTRIDMILMDVSMP  512

Query  266  IKDGVNATKELREMGVKSMIVGATSHGPGPVRDEFLAAGLDECLVKPLRAEVVLGVINKL  445
            + DG+ AT+ +R+ G+   IV  T+H     +D+ L AG+D  + KP+R + +   I  L
Sbjct  513  VMDGITATRLIRKKGITIPIVALTAHALESDKDKCLDAGMDSFVSKPVRRQDIYEAIQSL  572

Query  446  V  448
            +
Sbjct  573  I  573



>ref|WP_001897373.1| sensor histidine kinase [Vibrio cholerae]
 gb|EAY41497.1| sensor histidine kinase/response regulator [Vibrio cholerae MZO-3]
Length=514

 Score = 64.7 bits (156),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 43/114 (38%), Positives = 71/114 (62%), Gaps = 0/114 (0%)
 Frame = +2

Query  107  LVVEDSPILQLVHKTLLKKYgvevqvvnngeeavvLHRSGARFDLLLMDKEMPIKDGVNA  286
            LVVED+   Q+V + LL K G +V +  NG +AV L      FDL+LMD  MPI DG+ A
Sbjct  399  LVVEDTKTNQMVIQLLLNKLGYDVTIAENGLQAVELLEKNHVFDLVLMDISMPIMDGIAA  458

Query  287  TKELREMGVKSMIVGATSHGPGPVRDEFLAAGLDECLVKPLRAEVVLGVINKLV  448
            TK LR+  ++  I+  T+H  G  +   + AG+++ ++KP+R++ ++ V+ + +
Sbjct  459  TKILRDKHIEIPIIALTAHTAGSDKQNCIDAGMNDIVLKPIRSKDIMEVVKRFL  512



>ref|WP_029803523.1| histidine kinase [Vibrio parahaemolyticus]
Length=576

 Score = 64.7 bits (156),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 42/121 (35%), Positives = 67/121 (55%), Gaps = 1/121 (1%)
 Frame = +2

Query  89   GKGLTALVVEDSPILQLVHKTLLKKYgvevqvvnn-geeavvLHRSGARFDLLLMDKEMP  265
             K L  L+VED+   QLV K +L K G  V + ++  E    L  +  + D++LMD  MP
Sbjct  453  SKALNLLIVEDTQSNQLVIKLILNKLGHNVHIASHGAEALTFLEENDTQIDMILMDVSMP  512

Query  266  IKDGVNATKELREMGVKSMIVGATSHGPGPVRDEFLAAGLDECLVKPLRAEVVLGVINKL  445
            + DG+ AT+ +R+ G+   IV  T+H     +D+ L AG+D  + KP+R + +   I  L
Sbjct  513  VMDGITATRLIRKKGITIPIVALTAHALESDKDKCLGAGMDSFVSKPVRRQDIYDAIQSL  572

Query  446  V  448
            +
Sbjct  573  I  573



>ref|XP_010489670.1| PREDICTED: two-component response regulator ARR22-like [Camelina 
sativa]
Length=130

 Score = 61.2 bits (147),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 49/122 (40%), Positives = 70/122 (57%), Gaps = 9/122 (7%)
 Frame = +2

Query  92   KGLTALVVEDSPILQLVHKTLLKKYgvevqvvnngeeavvLHRSGARFDLLLMD-KEMPI  268
            K LT L+V++ P     +  +++  G    +  N EEAV LHR G  ++L++MD  +M +
Sbjct  11   KKLTVLIVDEDPYRCGDYMGIIQMAGGFAYMARNAEEAVKLHRDGDYYNLIIMDMNDMSL  70

Query  269  KDGVNATKELREMGVKSMIVGATSHGPGPVRDE---FLAAGLDECLVKPLRAEVVLGVIN  439
             DGV    +LR+M V SMIVG TS       DE   F+ AG+D CLVKPL    +  +IN
Sbjct  71   IDGVPLITKLRDMKVTSMIVGVTSR-----EDENRAFMEAGVDHCLVKPLTFGKMDPIIN  125

Query  440  KL  445
            +L
Sbjct  126  QL  127



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 807801807960