BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c80429_g1_i1 len=722 path=[700:0-721]

Length=722
                                                                      Score     E

ref|XP_009628846.1|  PREDICTED: uncharacterized protein LOC104119127  85.1    9e-18   
ref|XP_006355775.1|  PREDICTED: uncharacterized protein LOC102603203  77.4    5e-15   
ref|XP_010324696.1|  PREDICTED: uncharacterized protein LOC101249388  77.0    9e-15   
ref|XP_009803074.1|  PREDICTED: uncharacterized protein LOC104248...  73.9    9e-14   
gb|KFK38217.1|  hypothetical protein AALP_AA3G084100                  72.4    4e-13   
ref|XP_009803075.1|  PREDICTED: uncharacterized protein LOC104248...  72.0    5e-13   
ref|NP_850535.1|  uncharacterized protein                             71.2    8e-13   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010069554.1|  PREDICTED: uncharacterized protein LOC104456454  70.5    2e-12   
ref|XP_006299004.1|  hypothetical protein CARUB_v10015130mg           70.1    3e-12   
ref|XP_006407823.1|  hypothetical protein EUTSA_v10021850mg           70.1    4e-12   
emb|CDY35945.1|  BnaA05g30050D                                        68.9    6e-12   
ref|XP_009147057.1|  PREDICTED: uncharacterized protein LOC103870655  68.2    1e-11   
emb|CDY28036.1|  BnaC05g44380D                                        68.2    1e-11   
ref|XP_007049504.1|  Fanconi anemia group D2 protein, putative        68.2    1e-11   
ref|XP_010109833.1|  hypothetical protein L484_018490                 67.8    2e-11   
gb|KCW57940.1|  hypothetical protein EUGRSUZ_H00678                   67.0    4e-11   
gb|AAF13075.1|AC009176_2  unknown protein                             71.2    7e-11   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011091623.1|  PREDICTED: uncharacterized protein LOC105172004  65.5    1e-10   
ref|XP_002884658.1|  predicted protein                                70.1    2e-10   
ref|XP_007225053.1|  hypothetical protein PRUPE_ppa019087mg           65.1    2e-10   
ref|XP_008223947.1|  PREDICTED: uncharacterized protein LOC103323716  64.7    2e-10   
ref|XP_009370027.1|  PREDICTED: uncharacterized protein LOC103959401  62.8    9e-10   
ref|XP_008341146.1|  PREDICTED: uncharacterized protein LOC103404069  62.8    9e-10   
ref|XP_003608151.1|  MLP3.2 protein                                   63.2    1e-09   
ref|XP_004299765.1|  PREDICTED: uncharacterized protein LOC101305946  60.8    5e-09   
gb|AFK44314.1|  unknown                                               57.8    7e-08   
ref|XP_008447214.1|  PREDICTED: uncharacterized protein LOC103489...  57.0    1e-07   
ref|XP_006447910.1|  hypothetical protein CICLE_v10018341mg           58.2    2e-07   
ref|XP_008447216.1|  PREDICTED: uncharacterized protein LOC103489...  55.8    3e-07   
ref|XP_008447209.1|  PREDICTED: uncharacterized protein LOC103489...  56.2    4e-07   
ref|XP_004148945.1|  PREDICTED: uncharacterized protein LOC101218167  55.1    8e-07   
ref|XP_010258503.1|  PREDICTED: uncharacterized protein LOC104598247  55.1    8e-07   
ref|XP_003528807.1|  PREDICTED: uncharacterized protein LOC100500194  55.1    9e-07   
emb|CBI17690.3|  unnamed protein product                              53.9    2e-06   
emb|CDP03467.1|  unnamed protein product                              52.8    8e-06   
ref|XP_007135208.1|  hypothetical protein PHAVU_010G110100g           51.2    2e-05   
ref|XP_006375592.1|  hypothetical protein POPTR_0014s17190g           50.8    2e-05   
ref|XP_007135207.1|  hypothetical protein PHAVU_010G110100g           50.8    4e-05   
gb|KGN44712.1|  hypothetical protein Csa_7G374540                     49.3    2e-04   



>ref|XP_009628846.1| PREDICTED: uncharacterized protein LOC104119127 [Nicotiana tomentosiformis]
Length=68

 Score = 85.1 bits (209),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 42/64 (66%), Positives = 48/64 (75%), Gaps = 1/64 (2%)
 Frame = -2

Query  592  FLWFTLGFSSASALMAQFVFRDLLIDRTLLSSQLKEKFSALEGRVSSLETVLQDNPEPHQ  413
             LWFT+G +S SA M  F+F+DL  DR  LSSQLKEKFS LE RVSSLE VL+D+P P Q
Sbjct  6    LLWFTIGLTSVSATMTHFIFKDLWADRLSLSSQLKEKFSVLETRVSSLE-VLRDSPNPQQ  64

Query  412  GEGN  401
             EGN
Sbjct  65   DEGN  68



>ref|XP_006355775.1| PREDICTED: uncharacterized protein LOC102603203 [Solanum tuberosum]
Length=69

 Score = 77.4 bits (189),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 38/64 (59%), Positives = 45/64 (70%), Gaps = 0/64 (0%)
 Frame = -2

Query  592  FLWFTLGFSSASALMAQFVFRDLLIDRTLLSSQLKEKFSALEGRVSSLETVLQDNPEPHQ  413
             +WFTLGF+SASA M+QF+FRDL   +  LSSQL+EKF  L  RVS+LE  L D P   Q
Sbjct  6    LVWFTLGFTSASAAMSQFIFRDLWAHQLSLSSQLEEKFGVLGTRVSNLELALHDTPNTQQ  65

Query  412  GEGN  401
             EGN
Sbjct  66   DEGN  69



>ref|XP_010324696.1| PREDICTED: uncharacterized protein LOC101249388 [Solanum lycopersicum]
Length=69

 Score = 77.0 bits (188),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 37/64 (58%), Positives = 46/64 (72%), Gaps = 0/64 (0%)
 Frame = -2

Query  592  FLWFTLGFSSASALMAQFVFRDLLIDRTLLSSQLKEKFSALEGRVSSLETVLQDNPEPHQ  413
             +WFT+GF+SASA M+QF+FRDL   +  LSSQL+EKF  L  RVS+LE+ L D P   Q
Sbjct  6    LVWFTIGFTSASAAMSQFIFRDLWAHQLSLSSQLEEKFGVLGTRVSNLESALHDIPNTQQ  65

Query  412  GEGN  401
             EGN
Sbjct  66   DEGN  69



>ref|XP_009803074.1| PREDICTED: uncharacterized protein LOC104248505 isoform X1 [Nicotiana 
sylvestris]
Length=70

 Score = 73.9 bits (180),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 38/64 (59%), Positives = 45/64 (70%), Gaps = 1/64 (2%)
 Frame = -2

Query  592  FLWFTLGFSSASALMAQFVFRDLLIDRTLLSSQLKEKFSALEGRVSSLETVLQDNPEPHQ  413
             LWFT+G +S SA M  F+F+DL  DR  LSSQLKEK S LE RVSSLE VL+ +P P Q
Sbjct  6    LLWFTIGLTSVSATMTHFIFKDLWADRFSLSSQLKEKCSVLETRVSSLE-VLRGSPNPQQ  64

Query  412  GEGN  401
             + N
Sbjct  65   VDPN  68



>gb|KFK38217.1| hypothetical protein AALP_AA3G084100 [Arabis alpina]
Length=79

 Score = 72.4 bits (176),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 34/60 (57%), Positives = 42/60 (70%), Gaps = 0/60 (0%)
 Frame = -2

Query  592  FLWFTLGFSSASALMAQFVFRDLLIDRTLLSSQLKEKFSALEGRVSSLETVLQDNPEPHQ  413
             LWFTLGFS + A +A  V+RDL  +R  +SS +KEKF ALEGRVS LE+   +NP P Q
Sbjct  6    LLWFTLGFSVSGASIAHLVWRDLYAERYAISSDMKEKFHALEGRVSGLESASYENPSPAQ  65



>ref|XP_009803075.1| PREDICTED: uncharacterized protein LOC104248505 isoform X2 [Nicotiana 
sylvestris]
Length=66

 Score = 72.0 bits (175),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 37/60 (62%), Positives = 43/60 (72%), Gaps = 1/60 (2%)
 Frame = -2

Query  592  FLWFTLGFSSASALMAQFVFRDLLIDRTLLSSQLKEKFSALEGRVSSLETVLQDNPEPHQ  413
             LWFT+G +S SA M  F+F+DL  DR  LSSQLKEK S LE RVSSLE VL+ +P P Q
Sbjct  6    LLWFTIGLTSVSATMTHFIFKDLWADRFSLSSQLKEKCSVLETRVSSLE-VLRGSPNPQQ  64



>ref|NP_850535.1| uncharacterized protein [Arabidopsis thaliana]
 gb|AAL32855.1| Unknown protein [Arabidopsis thaliana]
 gb|AAM10196.1| unknown protein [Arabidopsis thaliana]
 gb|AAM63127.1| unknown [Arabidopsis thaliana]
 gb|AEE74566.1| uncharacterized protein AT3G07568 [Arabidopsis thaliana]
Length=68

 Score = 71.2 bits (173),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 35/62 (56%), Positives = 42/62 (68%), Gaps = 0/62 (0%)
 Frame = -2

Query  592  FLWFTLGFSSASALMAQFVFRDLLIDRTLLSSQLKEKFSALEGRVSSLETVLQDNPEPHQ  413
             LWFTLGFS     +A  V+RDL  +R  +SS +KEKFSALEGRVS LE+   +NP P Q
Sbjct  6    LLWFTLGFSVTGGSIAHIVWRDLYAERFAISSDMKEKFSALEGRVSGLESGGYENPNPAQ  65

Query  412  GE  407
             E
Sbjct  66   VE  67



>ref|XP_010069554.1| PREDICTED: uncharacterized protein LOC104456454 [Eucalyptus grandis]
 gb|KCW57939.1| hypothetical protein EUGRSUZ_H00678 [Eucalyptus grandis]
Length=68

 Score = 70.5 bits (171),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 32/63 (51%), Positives = 44/63 (70%), Gaps = 0/63 (0%)
 Frame = -2

Query  592  FLWFTLGFSSASALMAQFVFRDLLIDRTLLSSQLKEKFSALEGRVSSLETVLQDNPEPHQ  413
             LWF LGF++  A ++Q V+RDL +DR  LS+++KEKF ALE R+S LE+V     +P Q
Sbjct  6    LLWFGLGFAATGAAISQLVWRDLWVDRYALSAEMKEKFDALEARISHLESVPSSESKPAQ  65

Query  412  GEG  404
             EG
Sbjct  66   VEG  68



>ref|XP_006299004.1| hypothetical protein CARUB_v10015130mg [Capsella rubella]
 gb|EOA31902.1| hypothetical protein CARUB_v10015130mg [Capsella rubella]
Length=73

 Score = 70.1 bits (170),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 32/60 (53%), Positives = 43/60 (72%), Gaps = 0/60 (0%)
 Frame = -2

Query  592  FLWFTLGFSSASALMAQFVFRDLLIDRTLLSSQLKEKFSALEGRVSSLETVLQDNPEPHQ  413
             LWFT+GFS + A +A  V+RDL  +R  ++S +KEKF+ALEGRVS LE+   +NP P Q
Sbjct  6    LLWFTVGFSVSGASIAHLVWRDLYAERFAITSDMKEKFNALEGRVSGLESAGYENPSPAQ  65



>ref|XP_006407823.1| hypothetical protein EUTSA_v10021850mg [Eutrema salsugineum]
 gb|ESQ49276.1| hypothetical protein EUTSA_v10021850mg [Eutrema salsugineum]
Length=88

 Score = 70.1 bits (170),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 35/62 (56%), Positives = 42/62 (68%), Gaps = 0/62 (0%)
 Frame = -2

Query  592  FLWFTLGFSSASALMAQFVFRDLLIDRTLLSSQLKEKFSALEGRVSSLETVLQDNPEPHQ  413
             LWFTLGFS   A +A  V+RDL  +R  +SS +KEKFSALEGRVS LE+   + P P Q
Sbjct  26   LLWFTLGFSVTGASVAHLVWRDLYAERFAISSDMKEKFSALEGRVSGLESSGIEKPSPAQ  85

Query  412  GE  407
             E
Sbjct  86   VE  87



>emb|CDY35945.1| BnaA05g30050D [Brassica napus]
Length=79

 Score = 68.9 bits (167),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 33/60 (55%), Positives = 40/60 (67%), Gaps = 0/60 (0%)
 Frame = -2

Query  592  FLWFTLGFSSASALMAQFVFRDLLIDRTLLSSQLKEKFSALEGRVSSLETVLQDNPEPHQ  413
             LWFTLGFS   A +A  V+RDL  +R  +SS +KEKF ALE RVS LE+   +NP P Q
Sbjct  6    LLWFTLGFSVTGASVAHLVWRDLYAERFAISSDMKEKFGALESRVSGLESAGHENPSPAQ  65



>ref|XP_009147057.1| PREDICTED: uncharacterized protein LOC103870655 [Brassica rapa]
Length=68

 Score = 68.2 bits (165),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 33/62 (53%), Positives = 41/62 (66%), Gaps = 0/62 (0%)
 Frame = -2

Query  592  FLWFTLGFSSASALMAQFVFRDLLIDRTLLSSQLKEKFSALEGRVSSLETVLQDNPEPHQ  413
             LWFTLGFS   A +A  ++RDL  +R  +SS +KEKF ALE RVS LE+   +NP P Q
Sbjct  6    LLWFTLGFSVTGASVAHLLWRDLYAERFAISSDMKEKFGALESRVSGLESAGHENPSPAQ  65

Query  412  GE  407
             E
Sbjct  66   VE  67



>emb|CDY28036.1| BnaC05g44380D [Brassica napus]
Length=75

 Score = 68.2 bits (165),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 32/59 (54%), Positives = 40/59 (68%), Gaps = 0/59 (0%)
 Frame = -2

Query  589  LWFTLGFSSASALMAQFVFRDLLIDRTLLSSQLKEKFSALEGRVSSLETVLQDNPEPHQ  413
            LWFTLGFS   A +A  V+RDL  +R  +SS +KEKF ALE RV+ LE+   +NP P Q
Sbjct  7    LWFTLGFSVTGASVAHLVWRDLYAERFAISSDMKEKFGALESRVAGLESAGHENPSPAQ  65



>ref|XP_007049504.1| Fanconi anemia group D2 protein, putative [Theobroma cacao]
 gb|EOX93661.1| Fanconi anemia group D2 protein, putative [Theobroma cacao]
Length=68

 Score = 68.2 bits (165),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 31/63 (49%), Positives = 44/63 (70%), Gaps = 0/63 (0%)
 Frame = -2

Query  592  FLWFTLGFSSASALMAQFVFRDLLIDRTLLSSQLKEKFSALEGRVSSLETVLQDNPEPHQ  413
             LWFTLGFS  +A ++QF+++DL  DR  L S +K+KF +LE RV +LE++  +NP   Q
Sbjct  6    LLWFTLGFSLTAASISQFIYKDLWTDRYALKSDMKQKFDSLEARVLNLESLPPENPNSAQ  65

Query  412  GEG  404
             EG
Sbjct  66   VEG  68



>ref|XP_010109833.1| hypothetical protein L484_018490 [Morus notabilis]
 gb|EXC24776.1| hypothetical protein L484_018490 [Morus notabilis]
Length=82

 Score = 67.8 bits (164),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 33/64 (52%), Positives = 44/64 (69%), Gaps = 0/64 (0%)
 Frame = -2

Query  592  FLWFTLGFSSASALMAQFVFRDLLIDRTLLSSQLKEKFSALEGRVSSLETVLQDNPEPHQ  413
             LWFT+GFS ++A ++QFV+RDLL DR  LS+ +K KF ALE RV +LE+V   N     
Sbjct  6    LLWFTIGFSVSAATISQFVWRDLLADRYALSTDMKHKFDALEQRVLNLESVPHQNSNSSP  65

Query  412  GEGN  401
            G+ N
Sbjct  66   GKLN  69



>gb|KCW57940.1| hypothetical protein EUGRSUZ_H00678 [Eucalyptus grandis]
Length=82

 Score = 67.0 bits (162),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 30/59 (51%), Positives = 42/59 (71%), Gaps = 0/59 (0%)
 Frame = -2

Query  589  LWFTLGFSSASALMAQFVFRDLLIDRTLLSSQLKEKFSALEGRVSSLETVLQDNPEPHQ  413
            LWF LGF++  A ++Q V+RDL +DR  LS+++KEKF ALE R+S LE+V     +P Q
Sbjct  7    LWFGLGFAATGAAISQLVWRDLWVDRYALSAEMKEKFDALEARISHLESVPSSESKPAQ  65



>gb|AAF13075.1|AC009176_2 unknown protein [Arabidopsis thaliana]
Length=457

 Score = 71.2 bits (173),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 34/60 (57%), Positives = 41/60 (68%), Gaps = 0/60 (0%)
 Frame = -2

Query  592  FLWFTLGFSSASALMAQFVFRDLLIDRTLLSSQLKEKFSALEGRVSSLETVLQDNPEPHQ  413
             LWFTLGFS     +A  V+RDL  +R  +SS +KEKFSALEGRVS LE+   +NP P Q
Sbjct  383  LLWFTLGFSVTGGSIAHIVWRDLYAERFAISSDMKEKFSALEGRVSGLESGGYENPNPAQ  442



>ref|XP_011091623.1| PREDICTED: uncharacterized protein LOC105172004 [Sesamum indicum]
Length=71

 Score = 65.5 bits (158),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 31/64 (48%), Positives = 44/64 (69%), Gaps = 0/64 (0%)
 Frame = -2

Query  592  FLWFTLGFSSASALMAQFVFRDLLIDRTLLSSQLKEKFSALEGRVSSLETVLQDNPEPHQ  413
            FLWF+LG +S S  +AQF+ +DL +D   L+ Q+KEKF++LE RVS+LE+ +   P   Q
Sbjct  6    FLWFSLGLASTSGAIAQFILKDLFVDLESLAFQVKEKFNSLETRVSNLESDIPRRPTSSQ  65

Query  412  GEGN  401
              GN
Sbjct  66   DGGN  69



>ref|XP_002884658.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH60917.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=467

 Score = 70.1 bits (170),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 33/60 (55%), Positives = 41/60 (68%), Gaps = 0/60 (0%)
 Frame = -2

Query  592  FLWFTLGFSSASALMAQFVFRDLLIDRTLLSSQLKEKFSALEGRVSSLETVLQDNPEPHQ  413
             LWFTLGFS   A +   V+RDL  +R  +SS +KEKF+ALEGRVS LE+   +NP P Q
Sbjct  391  LLWFTLGFSVTGASICHIVWRDLYAERFAISSDMKEKFNALEGRVSGLESGGYENPNPAQ  450



>ref|XP_007225053.1| hypothetical protein PRUPE_ppa019087mg [Prunus persica]
 gb|EMJ26252.1| hypothetical protein PRUPE_ppa019087mg [Prunus persica]
Length=72

 Score = 65.1 bits (157),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 31/60 (52%), Positives = 42/60 (70%), Gaps = 1/60 (2%)
 Frame = -2

Query  592  FLWFTLGFSSASALMAQFVFRDLLIDRTLLSSQLKEKFSALEGRVSSLETVLQDNPEPHQ  413
             LWF LGFS   A ++  V++DLL+DR +LSS +K+KF ALEGR+ +LE  L + P P Q
Sbjct  6    LLWFGLGFSLTGAAISHLVWKDLLVDRCVLSSDVKQKFDALEGRIVNLERSLSE-PNPAQ  64



>ref|XP_008223947.1| PREDICTED: uncharacterized protein LOC103323716 [Prunus mume]
Length=67

 Score = 64.7 bits (156),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 32/62 (52%), Positives = 42/62 (68%), Gaps = 1/62 (2%)
 Frame = -2

Query  592  FLWFTLGFSSASALMAQFVFRDLLIDRTLLSSQLKEKFSALEGRVSSLETVLQDNPEPHQ  413
             LWF LGFS   A ++  V++DLL+DR  LSS +K+KF ALEGR+ +LE  L + P P Q
Sbjct  6    LLWFGLGFSLTGAAISHLVWKDLLVDRCALSSDVKQKFDALEGRIVNLERSLSE-PNPAQ  64

Query  412  GE  407
             E
Sbjct  65   VE  66



>ref|XP_009370027.1| PREDICTED: uncharacterized protein LOC103959401 [Pyrus x bretschneideri]
Length=70

 Score = 62.8 bits (151),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 28/62 (45%), Positives = 41/62 (66%), Gaps = 0/62 (0%)
 Frame = -2

Query  592  FLWFTLGFSSASALMAQFVFRDLLIDRTLLSSQLKEKFSALEGRVSSLETVLQDNPEPHQ  413
             +WF +GFS   A ++  V++DLL+DR  LSS +K+KF ALEGR+ +LE  L  +P  H 
Sbjct  6    LVWFGVGFSLTGAAISHLVWKDLLVDRFALSSDVKQKFDALEGRIVNLERSLSPDPNHHP  65

Query  412  GE  407
             +
Sbjct  66   AQ  67



>ref|XP_008341146.1| PREDICTED: uncharacterized protein LOC103404069 [Malus domestica]
Length=70

 Score = 62.8 bits (151),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 28/62 (45%), Positives = 41/62 (66%), Gaps = 0/62 (0%)
 Frame = -2

Query  592  FLWFTLGFSSASALMAQFVFRDLLIDRTLLSSQLKEKFSALEGRVSSLETVLQDNPEPHQ  413
             +WF +GFS   A ++  V++DLL+DR  LSS +K+KF ALEGR+ +LE  L  +P  H 
Sbjct  6    LVWFGVGFSLTGAAISHLVWKDLLVDRFALSSDVKQKFDALEGRIVNLERSLSPDPNHHP  65

Query  412  GE  407
             +
Sbjct  66   AQ  67



>ref|XP_003608151.1| MLP3.2 protein [Medicago truncatula]
 gb|KEH18723.1| transmembrane protein, putative [Medicago truncatula]
Length=88

 Score = 63.2 bits (152),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 25/55 (45%), Positives = 45/55 (82%), Gaps = 0/55 (0%)
 Frame = -2

Query  592  FLWFTLGFSSASALMAQFVFRDLLIDRTLLSSQLKEKFSALEGRVSSLETVLQDN  428
             LWF+LGF++++A+++ FV++DL +DR  LSS + ++F AL+ R+S+LE+ LQ++
Sbjct  6    LLWFSLGFTTSAAVVSHFVWKDLWVDRHALSSHVTQQFDALQTRISNLESNLQNH  60



>ref|XP_004299765.1| PREDICTED: uncharacterized protein LOC101305946 [Fragaria vesca 
subsp. vesca]
Length=68

 Score = 60.8 bits (146),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 27/62 (44%), Positives = 41/62 (66%), Gaps = 0/62 (0%)
 Frame = -2

Query  592  FLWFTLGFSSASALMAQFVFRDLLIDRTLLSSQLKEKFSALEGRVSSLETVLQDNPEPHQ  413
             LWF LGFSS  A ++  +++DL++DR+ LSS + +KF+ALE R+ +LE   Q+     Q
Sbjct  6    LLWFGLGFSSTGAAISHLIWKDLIVDRSALSSDVMQKFAALESRIVNLEHSYQNRNPASQ  65

Query  412  GE  407
             E
Sbjct  66   AE  67



>gb|AFK44314.1| unknown [Lotus japonicus]
Length=69

 Score = 57.8 bits (138),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 26/64 (41%), Positives = 42/64 (66%), Gaps = 1/64 (2%)
 Frame = -2

Query  592  FLWFTLGFSSASALMAQFVFRDLLIDRTLLSSQLKEKFSALEGRVSSLETVLQDN-PEPH  416
             LWF  GF++A A+++ F+++DL +DR  L+S +  KF  L+ R+S LE+ L ++ P   
Sbjct  6    LLWFGAGFTTAGAVVSHFIWKDLWVDRHALNSHITHKFDPLQARISILESSLPNHTPASD  65

Query  415  QGEG  404
            Q EG
Sbjct  66   QVEG  69



>ref|XP_008447214.1| PREDICTED: uncharacterized protein LOC103489712 isoform X2 [Cucumis 
melo]
 ref|XP_008447215.1| PREDICTED: uncharacterized protein LOC103489712 isoform X2 [Cucumis 
melo]
Length=70

 Score = 57.0 bits (136),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 26/62 (42%), Positives = 41/62 (66%), Gaps = 0/62 (0%)
 Frame = -2

Query  586  WFTLGFSSASALMAQFVFRDLLIDRTLLSSQLKEKFSALEGRVSSLETVLQDNPEPHQGE  407
            WF++GF++ +A ++QFV+RDLL  R+ L S ++  F ALE R+S+LE+V   N      +
Sbjct  8    WFSIGFATTAASISQFVWRDLLAHRSALLSDMERNFDALEARISNLESVRNRNSISSAEQ  67

Query  406  GN  401
             N
Sbjct  68   AN  69



>ref|XP_006447910.1| hypothetical protein CICLE_v10018341mg [Citrus clementina]
 gb|ESR61150.1| hypothetical protein CICLE_v10018341mg [Citrus clementina]
Length=135

 Score = 58.2 bits (139),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 28/53 (53%), Positives = 37/53 (70%), Gaps = 0/53 (0%)
 Frame = -2

Query  592  FLWFTLGFSSASALMAQFVFRDLLIDRTLLSSQLKEKFSALEGRVSSLETVLQ  434
             LWFT GFS   A + QF+++DL  DR  LS+  K+KF ALE RVS+LE+ L+
Sbjct  6    LLWFTAGFSLTGAAIGQFLWKDLWSDRYALSADAKQKFDALEARVSNLESNLR  58



>ref|XP_008447216.1| PREDICTED: uncharacterized protein LOC103489712 isoform X3 [Cucumis 
melo]
 ref|XP_008447217.1| PREDICTED: uncharacterized protein LOC103489712 isoform X3 [Cucumis 
melo]
Length=69

 Score = 55.8 bits (133),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 25/54 (46%), Positives = 39/54 (72%), Gaps = 0/54 (0%)
 Frame = -2

Query  586  WFTLGFSSASALMAQFVFRDLLIDRTLLSSQLKEKFSALEGRVSSLETVLQDNP  425
            WF++GF++ +A ++QFV+RDLL  R+ L S ++  F ALE R+S+LE+V   N 
Sbjct  8    WFSIGFATTAASISQFVWRDLLAHRSALLSDMERNFDALEARISNLESVRNRNS  61



>ref|XP_008447209.1| PREDICTED: uncharacterized protein LOC103489712 isoform X1 [Cucumis 
melo]
 ref|XP_008447210.1| PREDICTED: uncharacterized protein LOC103489712 isoform X1 [Cucumis 
melo]
 ref|XP_008447211.1| PREDICTED: uncharacterized protein LOC103489712 isoform X1 [Cucumis 
melo]
 ref|XP_008447213.1| PREDICTED: uncharacterized protein LOC103489712 isoform X1 [Cucumis 
melo]
Length=79

 Score = 56.2 bits (134),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 25/54 (46%), Positives = 39/54 (72%), Gaps = 0/54 (0%)
 Frame = -2

Query  589  LWFTLGFSSASALMAQFVFRDLLIDRTLLSSQLKEKFSALEGRVSSLETVLQDN  428
             WF++GF++ +A ++QFV+RDLL  R+ L S ++  F ALE R+S+LE+V   N
Sbjct  7    FWFSIGFATTAASISQFVWRDLLAHRSALLSDMERNFDALEARISNLESVRNRN  60



>ref|XP_004148945.1| PREDICTED: uncharacterized protein LOC101218167 [Cucumis sativus]
Length=69

 Score = 55.1 bits (131),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 25/54 (46%), Positives = 37/54 (69%), Gaps = 0/54 (0%)
 Frame = -2

Query  586  WFTLGFSSASALMAQFVFRDLLIDRTLLSSQLKEKFSALEGRVSSLETVLQDNP  425
            WF+LGF++ +A ++ FV+RDLL  R  LSS ++  F ALE R+S+LE+    N 
Sbjct  8    WFSLGFATTAASISHFVWRDLLAYRCALSSDMERSFDALEARISNLESARNRNS  61



>ref|XP_010258503.1| PREDICTED: uncharacterized protein LOC104598247 [Nelumbo nucifera]
Length=68

 Score = 55.1 bits (131),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 27/48 (56%), Positives = 35/48 (73%), Gaps = 0/48 (0%)
 Frame = -2

Query  583  FTLGFSSASALMAQFVFRDLLIDRTLLSSQLKEKFSALEGRVSSLETV  440
            F LGFS A A ++ FV+RDL  DR  LSS +KE+F  LE RVS+LE++
Sbjct  9    FALGFSVAGAAISHFVWRDLWADRHSLSSDMKERFDILEARVSNLESL  56



>ref|XP_003528807.1| PREDICTED: uncharacterized protein LOC100500194 [Glycine max]
 gb|ACU15170.1| unknown [Glycine max]
 gb|KHN27254.1| hypothetical protein glysoja_041812 [Glycine soja]
Length=75

 Score = 55.1 bits (131),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 27/64 (42%), Positives = 41/64 (64%), Gaps = 1/64 (2%)
 Frame = -2

Query  592  FLWFTLGFSSASALMAQFVFRDLLIDRTLLSSQLKEKFSALEGRVSSLETVLQDNPEP-H  416
            FLWFT GF+S  A+++Q V +DL+++R  L+S ++  F  LE R+S++E      P P  
Sbjct  6    FLWFTFGFASTYAVLSQVVLKDLMLERHALTSHMERDFRILEARLSNIEESSSSVPLPID  65

Query  415  QGEG  404
            Q EG
Sbjct  66   QVEG  69



>emb|CBI17690.3| unnamed protein product [Vitis vinifera]
Length=71

 Score = 53.9 bits (128),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 26/64 (41%), Positives = 36/64 (56%), Gaps = 0/64 (0%)
 Frame = -2

Query  592  FLWFTLGFSSASALMAQFVFRDLLIDRTLLSSQLKEKFSALEGRVSSLETVLQDNPEPHQ  413
              WFT G ++  A +  F  RDL  D   LS  L++KF+ LE RVS+LE  + +N    +
Sbjct  6    LFWFTAGLATTGAAITHFSLRDLWTDFASLSYDLEQKFNNLETRVSNLEGAIGNNSTSQK  65

Query  412  GEGN  401
             EGN
Sbjct  66   DEGN  69



>emb|CDP03467.1| unnamed protein product [Coffea canephora]
Length=98

 Score = 52.8 bits (125),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 24/61 (39%), Positives = 37/61 (61%), Gaps = 0/61 (0%)
 Frame = -2

Query  586  WFTLGFSSASALMAQFVFRDLLIDRTLLSSQLKEKFSALEGRVSSLETVLQDNPEPHQGE  407
            WF  GF++ASA +  FV++DL   R    SQ  E+++ L  RV++LE V  +NP+ +   
Sbjct  33   WFAFGFTAASATIGVFVYKDLQAHRNAHFSQANEEYNVLNTRVTNLERVCLNNPKSNVQS  92

Query  406  G  404
            G
Sbjct  93   G  93



>ref|XP_007135208.1| hypothetical protein PHAVU_010G110100g [Phaseolus vulgaris]
 gb|ESW07202.1| hypothetical protein PHAVU_010G110100g [Phaseolus vulgaris]
Length=76

 Score = 51.2 bits (121),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 24/58 (41%), Positives = 38/58 (66%), Gaps = 3/58 (5%)
 Frame = -2

Query  592  FLWFTLGFSSASALMAQFVFRDLLIDRTLLSSQLKEKFSALEGRVSSLETVLQDNPEP  419
             LWFT GF+S+ A+ +Q V +DLL+    L S L+++F  L+ R+S +E+ L   P+P
Sbjct  6    LLWFTFGFASSYAVFSQCVLKDLLVQSNALYSHLEDEFGVLQTRISKIESSL---PKP  60



>ref|XP_006375592.1| hypothetical protein POPTR_0014s17190g, partial [Populus trichocarpa]
 gb|ERP53389.1| hypothetical protein POPTR_0014s17190g, partial [Populus trichocarpa]
Length=66

 Score = 50.8 bits (120),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 24/53 (45%), Positives = 34/53 (64%), Gaps = 0/53 (0%)
 Frame = -2

Query  586  WFTLGFSSASALMAQFVFRDLLIDRTLLSSQLKEKFSALEGRVSSLETVLQDN  428
            WFT+GFS ++A ++QF +RDL   R  LS  + +KF  LE RV +LE+    N
Sbjct  8    WFTVGFSVSAAAISQFAWRDLFNQRYALSYHMNQKFEDLEARVLNLESFSPQN  60



>ref|XP_007135207.1| hypothetical protein PHAVU_010G110100g [Phaseolus vulgaris]
 gb|ESW07201.1| hypothetical protein PHAVU_010G110100g [Phaseolus vulgaris]
Length=86

 Score = 50.8 bits (120),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 24/57 (42%), Positives = 38/57 (67%), Gaps = 3/57 (5%)
 Frame = -2

Query  589  LWFTLGFSSASALMAQFVFRDLLIDRTLLSSQLKEKFSALEGRVSSLETVLQDNPEP  419
            LWFT GF+S+ A+ +Q V +DLL+    L S L+++F  L+ R+S +E+ L   P+P
Sbjct  7    LWFTFGFASSYAVFSQCVLKDLLVQSNALYSHLEDEFGVLQTRISKIESSL---PKP  60



>gb|KGN44712.1| hypothetical protein Csa_7G374540 [Cucumis sativus]
Length=114

 Score = 49.3 bits (116),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 25/56 (45%), Positives = 37/56 (66%), Gaps = 3/56 (5%)
 Frame = -2

Query  586  WFTLGFSSASALMAQFVFRDLLIDRTLLSSQ---LKEKFSALEGRVSSLETVLQDN  428
            WF+LGF++ +A ++ FV+RDLL  R  LSS    ++  F ALE R+S+LE+    N
Sbjct  8    WFSLGFATTAASISHFVWRDLLAYRCALSSDASFMERSFDALEARISNLESARNRN  63



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1173402497230