BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c80428_g1_i1 len=731 path=[709:0-730]

Length=731
                                                                      Score     E

gb|ADP05506.1|  serine proteinase inhibitor 2c-R2                     59.3    7e-08   
gb|AFN85539.1|  proteinase inhibitor type-2                           57.8    9e-08   
ref|XP_007226788.1|  hypothetical protein PRUPE_ppa017948mg           50.4    4e-05   
ref|XP_008244980.1|  PREDICTED: proteinase inhibitor type-2 CEVI57    49.7    8e-05   
gb|AAW71990.1|  proteinase inhibitor IIb                              47.0    8e-04   Solanum americanum
ref|XP_006368155.1|  PREDICTED: proteinase inhibitor type-2 CEVI5...  47.8    8e-04   
emb|CDP17880.1|  unnamed protein product                              47.0    8e-04   



>gb|ADP05506.1| serine proteinase inhibitor 2c-R2 [Solanum nigrum]
Length=155

 Score = 59.3 bits (142),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 29/68 (43%), Positives = 45/68 (66%), Gaps = 3/68 (4%)
 Frame = -3

Query  591  IIVVFGIQVKHANAQQKPCTKECDLRAKYKICPATSEVSKVDN-CTNCCVEQNHGCILYN  415
            ++++FG+ V  +NA  KPCT+ECD R  Y ICP  SE  +++  CTNCC  +  GC+ ++
Sbjct  8    LLLLFGMIVLGSNADGKPCTRECDTRIAYGICP-LSETKRINQICTNCCAGK-KGCMYFS  65

Query  414  HNGTAFCR  391
            ++GT  C 
Sbjct  66   NDGTFICE  73



>gb|AFN85539.1| proteinase inhibitor type-2, partial [Olea europaea]
Length=78

 Score = 57.8 bits (138),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 34/77 (44%), Positives = 43/77 (56%), Gaps = 2/77 (3%)
 Frame = -3

Query  624  KIGLVTLLLCGIIVVFGIQVKHANAQQKPCTKECDLRAKYKICPATSEVSKVDNCTNCCV  445
            K+G+ TLLL   +   G  V +A A+ K CTKEC L   Y ICP++       +CTNCC 
Sbjct  3    KVGIFTLLLICGLFFLGSNVNYAEAETKICTKEC-LNVGYMICPSSGPQKLHPSCTNCCR  61

Query  444  EQNHGCILYNHNGTAFC  394
             Q  GC LY  +GT  C
Sbjct  62   AQ-KGCKLYRSDGTLIC  77



>ref|XP_007226788.1| hypothetical protein PRUPE_ppa017948mg [Prunus persica]
 gb|EMJ27987.1| hypothetical protein PRUPE_ppa017948mg [Prunus persica]
Length=81

 Score = 50.4 bits (119),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 31/85 (36%), Positives = 43/85 (51%), Gaps = 6/85 (7%)
 Frame = -3

Query  639  MATTRKIG-LVTLLLCGIIVVFGIQVKHANAQQKPCTKECDLRAKYKICPATSEVSKVDN  463
            MA  + IG +V LL+CG I++  I    A    K C K C   A Y  CP++   +++D 
Sbjct  1    MAADKNIGAMVLLLVCGSILLLAINPTEA----KVCNKICYGAAAYMTCPSSGS-TQLDP  55

Query  462  CTNCCVEQNHGCILYNHNGTAFCRK  388
              NCC+    GC LY  +GT  C  
Sbjct  56   VCNCCLAPALGCTLYESDGTPICTS  80



>ref|XP_008244980.1| PREDICTED: proteinase inhibitor type-2 CEVI57 [Prunus mume]
Length=81

 Score = 49.7 bits (117),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 32/83 (39%), Positives = 42/83 (51%), Gaps = 6/83 (7%)
 Frame = -3

Query  639  MATTRKIG-LVTLLLCGIIVVFGIQVKHANAQQKPCTKECDLRAKYKICPATSEVSKVDN  463
            MA  + IG +V LL+CG I++  I    A    K C K C   A Y  CP +S   ++D 
Sbjct  1    MAADKNIGAMVLLLVCGSILLLAINPTEA----KVCNKICYGAAAYMTCP-SSGSKQLDP  55

Query  462  CTNCCVEQNHGCILYNHNGTAFC  394
              NCC+    GC LY  +GT  C
Sbjct  56   VCNCCLAPALGCTLYESDGTPIC  78



>gb|AAW71990.1| proteinase inhibitor IIb [Solanum americanum]
Length=81

 Score = 47.0 bits (110),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 32/84 (38%), Positives = 44/84 (52%), Gaps = 5/84 (6%)
 Frame = -3

Query  639  MATTRKIG-LVTLLLCGIIVVFGIQVKHANAQQKPCTKECDLRAKYKICPATSEVSKVDN  463
            MA  +++  L  LL+ G++ +    VKH +A  KPCT+EC     Y ICP +    +   
Sbjct  1    MAVHKEVSSLAYLLVLGLMFLHVSAVKHVDA--KPCTRECG-NLGYGICPRSEGSPENPI  57

Query  462  CTNCCVEQNHGCILYNHNGTAFCR  391
            CTNCC     GC  Y+ NGT  C 
Sbjct  58   CTNCC-SGYKGCNYYSANGTFICE  80



>ref|XP_006368155.1| PREDICTED: proteinase inhibitor type-2 CEVI57-like, partial [Solanum 
tuberosum]
Length=122

 Score = 47.8 bits (112),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 23/59 (39%), Positives = 30/59 (51%), Gaps = 1/59 (2%)
 Frame = -3

Query  549  QQKPCTKECDLRAKYKICPATSEVSKVDNCTNCCVEQNHGCILYNHNGTAFCRKRPSLS  373
            + K CT+ECD R  Y  CP++      + C NCC     GC LY H+G+  C   P  S
Sbjct  63   EPKGCTQECDPRVAYMTCPSSGLAKLNEVCVNCCT-AGEGCKLYEHDGSLLCTGEPQTS  120



>emb|CDP17880.1| unnamed protein product [Coffea canephora]
Length=86

 Score = 47.0 bits (110),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 29/78 (37%), Positives = 43/78 (55%), Gaps = 7/78 (9%)
 Frame = -3

Query  624  KIGLVTLLLCGIIVVFG-IQVKHA-NAQQKPCTKECDLRAKYKICPATSEVSKVDNCTNC  451
            KIG + +L CG+I++   I+VK    A  +PC + C     YK+C  T   +   +CTNC
Sbjct  5    KIGAMAILFCGMILLGANIEVKAVRQAPLRPCPRNCIGGTVYKVCNGTKTYT---DCTNC  61

Query  450  CVEQNHGCILYNHNGTAF  397
            CV    GC LY  +G++ 
Sbjct  62   CVSD--GCTLYFEDGSSL  77



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1210457312932