BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c80391_g1_i1 len=2329 path=[2307:0-2328]

Length=2329
                                                                      Score     E

ref|XP_009780972.1|  PREDICTED: primary amine oxidase                   948   0.0      
ref|XP_009595839.1|  PREDICTED: LOW QUALITY PROTEIN: primary amin...    919   0.0      
ref|XP_003635614.2|  PREDICTED: primary amine oxidase-like              908   0.0      
ref|XP_010108146.1|  Primary amine oxidase                              888   0.0      
ref|XP_006368696.1|  hypothetical protein POPTR_0001s07880g             887   0.0      
ref|XP_011018237.1|  PREDICTED: primary amine oxidase isoform X2        878   0.0      
ref|XP_011018231.1|  PREDICTED: primary amine oxidase-like isofor...    877   0.0      
ref|XP_011018236.1|  PREDICTED: primary amine oxidase isoform X1        874   0.0      
ref|XP_011018230.1|  PREDICTED: primary amine oxidase-like isofor...    873   0.0      
ref|XP_002509597.1|  Amine oxidase [copper-containing] precursor,...    872   0.0      Ricinus communis
ref|XP_010276880.1|  PREDICTED: primary amine oxidase-like              866   0.0      
ref|XP_006300795.1|  hypothetical protein CARUB_v10019874mg             859   0.0      
ref|XP_010473504.1|  PREDICTED: primary amine oxidase-like              858   0.0      
ref|XP_010430357.1|  PREDICTED: primary amine oxidase                   855   0.0      
gb|KFK40561.1|  hypothetical protein AALP_AA2G011900                    852   0.0      
ref|XP_006391818.1|  hypothetical protein EUTSA_v10023306mg             850   0.0      
ref|XP_010418280.1|  PREDICTED: primary amine oxidase-like              847   0.0      
ref|NP_176469.1|  copper amine oxidase 1                                844   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_009123407.1|  PREDICTED: primary amine oxidase isoform X2        843   0.0      
gb|AAO42785.1|  At1g62810/F23N19_18                                     842   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_010053409.1|  PREDICTED: primary amine oxidase-like              842   0.0      
ref|XP_009123405.1|  PREDICTED: primary amine oxidase isoform X1        841   0.0      
ref|XP_002886452.1|  hypothetical protein ARALYDRAFT_475070             836   0.0      
ref|XP_004147579.1|  PREDICTED: primary amine oxidase-like              831   0.0      
ref|XP_004162660.1|  PREDICTED: LOW QUALITY PROTEIN: primary amin...    824   0.0      
ref|XP_010546327.1|  PREDICTED: primary amine oxidase-like              825   0.0      
ref|XP_008437148.1|  PREDICTED: primary amine oxidase-like isofor...    824   0.0      
ref|XP_008437147.1|  PREDICTED: primary amine oxidase-like isofor...    823   0.0      
ref|XP_008788360.1|  PREDICTED: primary amine oxidase-like              818   0.0      
gb|AIE54293.1|  copper-containing amine oxidase                         817   0.0      
ref|XP_009757703.1|  PREDICTED: primary amine oxidase-like              816   0.0      
gb|KFK33857.1|  hypothetical protein AALP_AA5G069100                    814   0.0      
gb|KDP25605.1|  hypothetical protein JCGZ_20761                         814   0.0      
ref|XP_009595837.1|  PREDICTED: primary amine oxidase-like              813   0.0      
gb|ADQ37305.1|  putative copper-containing diamine oxidase              813   0.0      
ref|XP_002877298.1|  hypothetical protein ARALYDRAFT_347467             811   0.0      
ref|XP_010264175.1|  PREDICTED: primary amine oxidase-like              812   0.0      
ref|XP_006857816.1|  hypothetical protein AMTR_s00069p00020400          812   0.0      
ref|XP_006367888.1|  PREDICTED: primary amine oxidase-like              811   0.0      
ref|NP_189953.1|  putative copper amine oxidase                         809   0.0      Arabidopsis thaliana [mouse-ear cress]
gb|AAF19542.1|AC007190_10  F23N19.18                                    846   0.0      Arabidopsis thaliana [mouse-ear cress]
gb|ACN40397.1|  unknown                                                 810   0.0      Picea sitchensis
ref|XP_004245717.1|  PREDICTED: primary amine oxidase                   808   0.0      
gb|ABR16191.1|  unknown                                                 808   0.0      Picea sitchensis
ref|XP_004298688.1|  PREDICTED: primary amine oxidase-like              807   0.0      
ref|XP_002875614.1|  hypothetical protein ARALYDRAFT_484808             805   0.0      
ref|XP_010108147.1|  Primary amine oxidase                              805   0.0      
ref|XP_004298687.1|  PREDICTED: primary amine oxidase-like              803   0.0      
ref|XP_002509596.1|  Amine oxidase [copper-containing] precursor,...    803   0.0      Ricinus communis
ref|XP_004502050.1|  PREDICTED: primary amine oxidase-like              800   0.0      
gb|AAD49420.1|AF172681_1  amine oxidase                                 799   0.0      Canavalia lineata
ref|XP_010539914.1|  PREDICTED: primary amine oxidase-like isofor...    797   0.0      
ref|XP_010539922.1|  PREDICTED: primary amine oxidase-like isofor...    797   0.0      
ref|XP_002275872.1|  PREDICTED: primary amine oxidase                   795   0.0      Vitis vinifera
dbj|BAJ85075.1|  predicted protein                                      795   0.0      
ref|XP_004147578.1|  PREDICTED: primary amine oxidase-like              793   0.0      
ref|XP_003601419.1|  Primary amine oxidase                              793   0.0      
ref|XP_008437149.1|  PREDICTED: primary amine oxidase-like              792   0.0      
ref|XP_010676213.1|  PREDICTED: primary amine oxidase                   791   0.0      
ref|XP_011081127.1|  PREDICTED: primary amine oxidase-like              791   0.0      
ref|NP_192966.5|  copper amine oxidase family protein                   791   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_003546898.1|  PREDICTED: primary amine oxidase-like isofor...    791   0.0      
ref|XP_007039969.1|  Copper amine oxidase family protein                791   0.0      
emb|CAB45976.1|  copper amine oxidase-like protein                      791   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_002299418.2|  hypothetical protein POPTR_0001s07870g             790   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_006440400.1|  hypothetical protein CICLE_v10019032mg             790   0.0      
gb|KFK31964.1|  hypothetical protein AALP_AA6G182600                    789   0.0      
ref|XP_006396782.1|  hypothetical protein EUTSA_v10028460mg             789   0.0      
gb|AIS23645.1|  amine oxidase 2                                         788   0.0      
ref|XP_006477269.1|  PREDICTED: primary amine oxidase-like              787   0.0      
ref|XP_009368853.1|  PREDICTED: primary amine oxidase-like              787   0.0      
gb|EYU41414.1|  hypothetical protein MIMGU_mgv1a002006mg                786   0.0      
gb|KHG02365.1|  hypothetical protein F383_26066                         786   0.0      
ref|XP_008344454.1|  PREDICTED: primary amine oxidase-like              786   0.0      
ref|XP_011018232.1|  PREDICTED: primary amine oxidase-like              786   0.0      
ref|XP_009356469.1|  PREDICTED: primary amine oxidase-like              785   0.0      
ref|XP_007148900.1|  hypothetical protein PHAVU_005G023500g             784   0.0      
ref|XP_011018235.1|  PREDICTED: primary amine oxidase-like              783   0.0      
ref|XP_010676217.1|  PREDICTED: primary amine oxidase-like              783   0.0      
ref|XP_006287136.1|  hypothetical protein CARUB_v10000307mg             780   0.0      
ref|XP_010422197.1|  PREDICTED: primary amine oxidase-like isofor...    779   0.0      
ref|XP_008238640.1|  PREDICTED: primary amine oxidase-like              778   0.0      
ref|XP_002872650.1|  AT4g12290/T4C9_130                                 778   0.0      
ref|XP_003535840.1|  PREDICTED: primary amine oxidase-like              777   0.0      
ref|XP_007148902.1|  hypothetical protein PHAVU_005G023600g             776   0.0      
ref|XP_006289346.1|  hypothetical protein CARUB_v10002830mg             775   0.0      
ref|XP_011081126.1|  PREDICTED: primary amine oxidase-like              774   0.0      
ref|XP_010455667.1|  PREDICTED: primary amine oxidase-like              774   0.0      
gb|EPS58103.1|  primary amine oxidase                                   772   0.0      
gb|EYU30446.1|  hypothetical protein MIMGU_mgv1a002018mg                771   0.0      
ref|XP_010434239.1|  PREDICTED: primary amine oxidase-like              772   0.0      
ref|XP_004952288.1|  PREDICTED: primary amine oxidase-like              770   0.0      
emb|CDX97351.1|  BnaA02g21420D                                          770   0.0      
ref|XP_009144486.1|  PREDICTED: primary amine oxidase                   768   0.0      
ref|XP_002872648.1|  AT4g12290/T4C9_130                                 764   0.0      
emb|CDY04409.1|  BnaC02g28390D                                          766   0.0      
gb|EEC76903.1|  hypothetical protein OsI_15134                          766   0.0      Oryza sativa Indica Group [Indian rice]
ref|XP_008663089.1|  PREDICTED: primary amine oxidase-like              758   0.0      
gb|KDP25604.1|  hypothetical protein JCGZ_20760                         753   0.0      
ref|XP_002446210.1|  hypothetical protein SORBIDRAFT_06g004290          756   0.0      Sorghum bicolor [broomcorn]
ref|XP_010676221.1|  PREDICTED: primary amine oxidase-like              748   0.0      
ref|XP_003581494.1|  PREDICTED: primary amine oxidase-like              741   0.0      
ref|XP_009411535.1|  PREDICTED: primary amine oxidase-like              739   0.0      
gb|KGN50201.1|  hypothetical protein Csa_5G158570                       735   0.0      
gb|KHG18383.1|  hypothetical protein F383_06941                         729   0.0      
gb|AER93284.1|  copper amine oxidase                                    733   0.0      
emb|CDY32205.1|  BnaA03g54620D                                          723   0.0      
emb|CAI39243.1|  copper-containing amine oxidase                        718   0.0      Solanum lycopersicum
gb|EEE60637.1|  hypothetical protein OsJ_14075                          711   0.0      Oryza sativa Japonica Group [Japonica rice]
ref|XP_007210486.1|  hypothetical protein PRUPE_ppa003650mg             704   0.0      
ref|NP_001052338.2|  Os04g0269600                                       708   0.0      Oryza sativa Japonica Group [Japonica rice]
emb|CDY25701.1|  BnaC03g69740D                                          701   0.0      
gb|KDO38677.1|  hypothetical protein CISIN_1g046592mg                   698   0.0      
ref|XP_001772536.1|  predicted protein                                  684   0.0      
ref|XP_010920221.1|  PREDICTED: LOW QUALITY PROTEIN: primary amin...    670   0.0      
gb|EPS58276.1|  hypothetical protein M569_16538                         671   0.0      
gb|AAN60277.1|  unknown                                                 647   0.0      Arabidopsis thaliana [mouse-ear cress]
gb|EMT31865.1|  Primary amine oxidase                                   623   0.0      
ref|XP_011092662.1|  PREDICTED: primary amine oxidase-like              629   0.0      
ref|XP_007224149.1|  hypothetical protein PRUPE_ppa016301mg             622   0.0      
ref|XP_006419908.1|  hypothetical protein CICLE_v10006554mg             620   0.0      
ref|XP_008224539.1|  PREDICTED: primary amine oxidase-like              621   0.0      
ref|XP_006489585.1|  PREDICTED: primary amine oxidase-like              621   0.0      
ref|XP_002278327.1|  PREDICTED: primary amine oxidase isoform X1        621   0.0      Vitis vinifera
ref|XP_002312527.2|  copper/topa quinone amine oxidase precursor ...    622   0.0      Populus trichocarpa [western balsam poplar]
gb|KDO74632.1|  hypothetical protein CISIN_1g006113mg                   620   0.0      
ref|XP_010649890.1|  PREDICTED: primary amine oxidase isoform X2        620   0.0      
ref|XP_007034731.1|  Copper amine oxidase family protein                625   0.0      
ref|XP_009412472.1|  PREDICTED: primary amine oxidase-like              617   0.0      
ref|XP_010256009.1|  PREDICTED: primary amine oxidase                   617   0.0      
ref|XP_011026340.1|  PREDICTED: primary amine oxidase-like              616   0.0      
ref|XP_007034741.1|  Primary amine oxidase                              615   0.0      
ref|XP_011021538.1|  PREDICTED: primary amine oxidase-like isofor...    615   0.0      
ref|XP_009417163.1|  PREDICTED: primary amine oxidase-like              615   0.0      
gb|KHF98565.1|  Primary amine oxidase                                   614   0.0      
gb|KGN44255.1|  Primary amine oxidase                                   614   0.0      
ref|XP_006419910.1|  hypothetical protein CICLE_v10004473mg             614   0.0      
emb|CDO99047.1|  unnamed protein product                                614   0.0      
ref|XP_002278244.1|  PREDICTED: primary amine oxidase                   613   0.0      Vitis vinifera
ref|XP_004305594.1|  PREDICTED: primary amine oxidase-like              612   0.0      
ref|XP_006489375.1|  PREDICTED: primary amine oxidase-like              613   0.0      
gb|KDO74628.1|  hypothetical protein CISIN_1g005872mg                   612   0.0      
ref|XP_002314703.1|  copper/topa quinone amine oxidase precursor ...    612   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_008449548.1|  PREDICTED: primary amine oxidase-like              610   0.0      
ref|XP_004159052.1|  PREDICTED: LOW QUALITY PROTEIN: primary amin...    610   0.0      
ref|XP_002516782.1|  Amine oxidase [copper-containing] precursor,...    609   0.0      Ricinus communis
emb|CDO99048.1|  unnamed protein product                                608   0.0      
ref|XP_010935528.1|  PREDICTED: primary amine oxidase                   605   0.0      
dbj|BAJ94038.1|  predicted protein                                      606   0.0      
ref|XP_010026970.1|  PREDICTED: primary amine oxidase-like              605   0.0      
dbj|BAJ88040.1|  predicted protein                                      604   0.0      
dbj|BAJ88544.1|  predicted protein                                      604   0.0      
ref|XP_009366962.1|  PREDICTED: LOW QUALITY PROTEIN: primary amin...    603   0.0      
gb|EMS66410.1|  Primary amine oxidase                                   594   0.0      
ref|XP_006606051.1|  PREDICTED: primary amine oxidase-like              602   0.0      
gb|KCW60783.1|  hypothetical protein EUGRSUZ_H03520                     602   0.0      
ref|XP_004139886.1|  PREDICTED: primary amine oxidase-like              601   0.0      
dbj|BAJ97208.1|  predicted protein                                      602   0.0      
ref|XP_010532535.1|  PREDICTED: primary amine oxidase-like              599   0.0      
ref|XP_010923394.1|  PREDICTED: primary amine oxidase-like              595   0.0      
ref|XP_003555339.1|  PREDICTED: primary amine oxidase-like              595   0.0      
ref|XP_002278182.1|  PREDICTED: primary amine oxidase                   594   0.0      Vitis vinifera
ref|XP_009413330.1|  PREDICTED: primary amine oxidase-like              593   0.0      
ref|XP_004140256.1|  PREDICTED: primary amine oxidase-like              592   0.0      
ref|XP_011091042.1|  PREDICTED: primary amine oxidase-like              590   0.0      
gb|KDO74629.1|  hypothetical protein CISIN_1g005872mg                   589   0.0      
emb|CAN68223.1|  hypothetical protein VITISV_040530                     608   0.0      Vitis vinifera
ref|XP_010024341.1|  PREDICTED: primary amine oxidase-like              589   0.0      
ref|XP_011090716.1|  PREDICTED: primary amine oxidase-like              588   0.0      
ref|XP_010326883.1|  PREDICTED: LOW QUALITY PROTEIN: primary amin...    587   0.0      
ref|NP_001145964.1|  primary amine oxidase precursor                    588   0.0      Zea mays [maize]
ref|XP_007143245.1|  hypothetical protein PHAVU_007G056200g             586   0.0      
ref|XP_004958095.1|  PREDICTED: primary amine oxidase-like              587   0.0      
gb|KDP27003.1|  hypothetical protein JCGZ_22065                         585   0.0      
ref|XP_003556043.1|  PREDICTED: primary amine oxidase-like isofor...    585   0.0      
ref|XP_010024343.1|  PREDICTED: primary amine oxidase-like              583   0.0      
ref|XP_009108111.1|  PREDICTED: primary amine oxidase                   583   0.0      
ref|XP_010478585.1|  PREDICTED: primary amine oxidase-like              583   0.0      
ref|XP_006306889.1|  hypothetical protein CARUB_v10008452mg             584   0.0      
ref|XP_010026971.1|  PREDICTED: primary amine oxidase-like              582   0.0      
ref|XP_006415313.1|  hypothetical protein EUTSA_v10006982mg             582   0.0      
gb|KFK44949.1|  hypothetical protein AALP_AA1G323600                    581   0.0      
emb|CAN73878.1|  hypothetical protein VITISV_029120                     579   0.0      Vitis vinifera
ref|XP_011021542.1|  PREDICTED: primary amine oxidase-like              578   0.0      
ref|XP_002452575.1|  hypothetical protein SORBIDRAFT_04g028410          579   0.0      Sorghum bicolor [broomcorn]
ref|XP_003516418.1|  PREDICTED: primary amine oxidase-like              578   0.0      
ref|XP_002460889.1|  hypothetical protein SORBIDRAFT_02g036990          578   0.0      Sorghum bicolor [broomcorn]
ref|XP_006415312.1|  hypothetical protein EUTSA_v10007005mg             577   0.0      
ref|XP_010478584.1|  PREDICTED: primary amine oxidase                   577   0.0      
ref|NP_001265996.1|  primary amine oxidase-like precursor               576   0.0      
ref|XP_006354449.1|  PREDICTED: primary amine oxidase-like              575   0.0      
ref|XP_007225158.1|  hypothetical protein PRUPE_ppa002377mg             576   0.0      
gb|EEC80539.1|  hypothetical protein OsI_22833                          576   0.0      Oryza sativa Indica Group [Indian rice]
ref|NP_001057559.1|  Os06g0338200                                       575   0.0      Oryza sativa Japonica Group [Japonica rice]
ref|XP_002461776.1|  hypothetical protein SORBIDRAFT_02g007930          575   0.0      Sorghum bicolor [broomcorn]
ref|XP_010024340.1|  PREDICTED: primary amine oxidase-like              573   0.0      
ref|XP_002890944.1|  hypothetical protein ARALYDRAFT_313750             573   0.0      
ref|XP_010460990.1|  PREDICTED: primary amine oxidase-like              573   0.0      
ref|XP_010460986.1|  PREDICTED: primary amine oxidase-like              572   0.0      
ref|XP_010108022.1|  Primary amine oxidase                              572   0.0      
ref|XP_006354536.1|  PREDICTED: primary amine oxidase-like              571   0.0      
emb|CAN76699.1|  hypothetical protein VITISV_012123                     571   0.0      Vitis vinifera
ref|XP_009366963.1|  PREDICTED: primary amine oxidase-like              570   0.0      
ref|NP_174450.2|  copper amine oxidase family protein                   570   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|NP_174452.2|  copper amine oxidase 2                                570   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_004508349.1|  PREDICTED: primary amine oxidase-like              568   0.0      
ref|XP_010229636.1|  PREDICTED: primary amine oxidase-like              569   0.0      
ref|XP_006306925.1|  hypothetical protein CARUB_v10008490mg             568   0.0      
ref|XP_007034740.1|  Amine oxidase 1                                    566   0.0      
gb|EEC82302.1|  hypothetical protein OsI_26556                          568   0.0      Oryza sativa Indica Group [Indian rice]
ref|XP_003592404.1|  Primary amine oxidase                              566   0.0      
ref|XP_002516777.1|  Amine oxidase [copper-containing] precursor,...    566   0.0      Ricinus communis
ref|XP_010108018.1|  Primary amine oxidase                              566   0.0      
gb|KEH32232.1|  copper amine oxidase, enzyme domain protein             565   0.0      
ref|XP_002516781.1|  Amine oxidase [copper-containing] precursor,...    562   0.0      Ricinus communis
gb|EEE67447.1|  hypothetical protein OsJ_24815                          563   0.0      Oryza sativa Japonica Group [Japonica rice]
ref|XP_007153494.1|  hypothetical protein PHAVU_003G040500g             561   0.0      
ref|XP_010666931.1|  PREDICTED: primary amine oxidase                   560   0.0      
ref|XP_006659924.1|  PREDICTED: primary amine oxidase-like              561   0.0      
gb|KEH32230.1|  copper amine oxidase, enzyme domain protein             560   0.0      
ref|XP_002516779.1|  Amine oxidase [copper-containing] precursor,...    558   0.0      Ricinus communis
gb|KGN48007.1|  hypothetical protein Csa_6G423980                       558   0.0      
ref|XP_006489372.1|  PREDICTED: primary amine oxidase-like              558   0.0      
ref|XP_009344087.1|  PREDICTED: primary amine oxidase                   557   0.0      
ref|XP_006419907.1|  hypothetical protein CICLE_v10004511mg             557   0.0      
ref|XP_008224551.1|  PREDICTED: primary amine oxidase                   557   0.0      
dbj|BAG94696.1|  unnamed protein product                                548   0.0      Oryza sativa Japonica Group [Japonica rice]
ref|XP_007143249.1|  hypothetical protein PHAVU_007G056500g             557   0.0      
emb|CDP09892.1|  unnamed protein product                                548   0.0      
gb|KDO74637.1|  hypothetical protein CISIN_1g006085mg                   557   0.0      
ref|XP_006419904.1|  hypothetical protein CICLE_v10004484mg             557   0.0      
ref|XP_011021541.1|  PREDICTED: primary amine oxidase                   556   0.0      
ref|XP_006489371.1|  PREDICTED: primary amine oxidase-like              556   0.0      
dbj|BAA77206.1|  copper amine oxidase                                   556   0.0      Pisum sativum [garden pea]
ref|XP_004156111.1|  PREDICTED: LOW QUALITY PROTEIN: primary amin...    556   0.0      
sp|P49252.3|AMO_LENCU  RecName: Full=Primary amine oxidase; AltNa...    555   0.0      Lens culinaris
emb|CAH10210.1|  copper/topa quinone amine oxidase precursor            555   0.0      Lathyrus sativus [chickling vetch]
ref|XP_007225123.1|  hypothetical protein PRUPE_ppa002675mg             554   0.0      
ref|XP_009593546.1|  PREDICTED: primary amine oxidase-like              554   0.0      
ref|XP_004140258.1|  PREDICTED: primary amine oxidase-like              553   0.0      
ref|XP_008449551.1|  PREDICTED: primary amine oxidase-like              553   0.0      
ref|XP_009794721.1|  PREDICTED: primary amine oxidase                   551   0.0      
ref|XP_011091041.1|  PREDICTED: primary amine oxidase                   551   0.0      
ref|NP_001237211.1|  copper amino oxidase precursor                     551   0.0      
ref|XP_009614743.1|  PREDICTED: primary amine oxidase-like              551   0.0      
sp|Q43077.1|AMO_PEA  RecName: Full=Primary amine oxidase; AltName...    551   0.0      Pisum sativum [garden pea]
gb|KEH29590.1|  copper amine oxidase, enzyme domain protein             550   0.0      
ref|XP_007143248.1|  hypothetical protein PHAVU_007G056400g             549   0.0      
pdb|1W2Z|A  Chain A, Psao And Xenon                                     547   0.0      
pdb|1KSI|A  Chain A, Crystal Structure Of A Eukaryotic (Pea Seedl...    546   0.0      
gb|KHN15778.1|  Primary amine oxidase                                   542   0.0      
ref|XP_004496741.1|  PREDICTED: primary amine oxidase-like              545   1e-180   
ref|XP_006356100.1|  PREDICTED: primary amine oxidase-like              545   2e-180   
gb|AES62654.2|  copper amine oxidase, enzyme domain protein             543   6e-180   
ref|XP_002890946.1|  hypothetical protein ARALYDRAFT_890722             542   2e-179   
gb|KHN15776.1|  Primary amine oxidase                                   538   2e-179   
ref|XP_004234011.1|  PREDICTED: primary amine oxidase                   542   2e-179   
ref|NP_174448.1|  copper amine oxidase family protein                   544   4e-179   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004299127.1|  PREDICTED: primary amine oxidase-like              540   5e-179   
emb|CBI34761.3|  unnamed protein product                                538   4e-178   
ref|XP_004156112.1|  PREDICTED: primary amine oxidase-like              538   7e-178   
ref|XP_004140257.1|  PREDICTED: primary amine oxidase-like              537   9e-178   
gb|KDO74630.1|  hypothetical protein CISIN_1g005872mg                   533   1e-176   
ref|XP_008449550.1|  PREDICTED: primary amine oxidase                   534   2e-176   
ref|XP_006360808.1|  PREDICTED: primary amine oxidase-like              533   3e-176   
ref|XP_003556044.2|  PREDICTED: primary amine oxidase-like              531   5e-175   
ref|XP_007143250.1|  hypothetical protein PHAVU_007G056600g             530   1e-174   
emb|CDO99046.1|  unnamed protein product                                529   1e-174   
emb|CBI26238.3|  unnamed protein product                                529   1e-174   
gb|AGA63727.1|  diamine oxidase                                         530   1e-174   
ref|XP_011021539.1|  PREDICTED: primary amine oxidase-like isofor...    527   2e-174   
ref|XP_003535652.2|  PREDICTED: primary amine oxidase-like              529   3e-174   
ref|XP_002314704.2|  amine oxidase family protein                       525   2e-173   Populus trichocarpa [western balsam poplar]
ref|XP_010540181.1|  PREDICTED: primary amine oxidase-like              528   3e-173   
ref|XP_010525188.1|  PREDICTED: primary amine oxidase                   525   5e-173   
gb|AIS23646.1|  amine oxidase 3                                         523   1e-172   
ref|XP_003592403.1|  Primary amine oxidase                              544   6e-172   
ref|XP_008375092.1|  PREDICTED: primary amine oxidase-like              521   6e-172   
ref|XP_006359937.1|  PREDICTED: G-type lectin S-receptor-like ser...    543   4e-171   
dbj|BAC41866.1|  unknown protein                                        516   6e-171   
ref|XP_010449967.1|  PREDICTED: primary amine oxidase-like              520   7e-171   
ref|XP_009147983.1|  PREDICTED: primary amine oxidase                   513   2e-168   
gb|AAL47166.1|AF449459_1  diamine oxidase                               512   7e-168   
ref|XP_010440372.1|  PREDICTED: primary amine oxidase-like              510   2e-167   
ref|XP_006414619.1|  hypothetical protein EUTSA_v10024636mg             510   4e-167   
ref|XP_006283295.1|  hypothetical protein CARUB_v10004333mg             508   1e-166   
emb|CDY50266.1|  BnaAnng10300D                                          508   3e-166   
emb|CDY27135.1|  BnaA08g07730D                                          503   3e-166   
ref|XP_010434999.1|  PREDICTED: primary amine oxidase-like              507   3e-166   
ref|XP_006606052.1|  PREDICTED: primary amine oxidase-like isofor...    504   1e-165   
emb|CDY54865.1|  BnaC01g22650D                                          505   3e-165   
ref|XP_010326653.1|  PREDICTED: uncharacterized protein LOC101254423    537   5e-165   
ref|NP_193230.1|  amine oxidase 1                                       503   1e-164   
ref|XP_003636670.1|  Primary amine oxidase                              501   6e-164   
ref|XP_007034732.1|  Primary amine oxidase isoform 1                    493   2e-163   
ref|XP_007154292.1|  hypothetical protein PHAVU_003G106200g             500   2e-163   
gb|AAD51007.2|  amine oxidase precursor                                 501   3e-163   
gb|AAB87690.1|  copper amine oxidase                                    498   2e-162   
gb|KDO74636.1|  hypothetical protein CISIN_1g006085mg                   495   6e-162   
ref|XP_007034733.1|  Primary amine oxidase isoform 2                    489   8e-162   
ref|XP_002870271.1|  hypothetical protein ARALYDRAFT_493397             495   2e-161   
gb|KDP33042.1|  hypothetical protein JCGZ_13628                         488   9e-161   
gb|KHN03425.1|  Primary amine oxidase                                   487   3e-160   
gb|KEH32233.1|  amine oxidase [copper containing] protein, putative     489   1e-159   
gb|KHN39725.1|  Primary amine oxidase                                   484   2e-159   
ref|NP_001057560.1|  Os06g0338700                                       477   3e-155   
gb|AFK34729.1|  unknown                                                 472   8e-155   
ref|XP_006657867.1|  PREDICTED: primary amine oxidase-like              466   3e-153   
gb|KFK24357.1|  hypothetical protein AALP_AAs60756U000100               467   7e-153   
gb|KHN29967.1|  Primary amine oxidase                                   464   8e-152   
ref|XP_008364907.1|  PREDICTED: primary amine oxidase-like              463   2e-149   
ref|XP_009366960.1|  PREDICTED: primary amine oxidase-like              458   8e-149   
gb|AAG60148.1|AC074360_13  copper amine oxidase, putative               452   7e-148   
ref|XP_007143247.1|  hypothetical protein PHAVU_007G056400g             454   7e-148   
gb|EYU41510.1|  hypothetical protein MIMGU_mgv1a0028492mg               447   5e-146   
gb|EAZ36885.1|  hypothetical protein OsJ_21228                          446   1e-145   
gb|AAG60142.1|AC074360_7  copper amine oxidase, putative                446   1e-145   
ref|XP_011021540.1|  PREDICTED: primary amine oxidase-like isofor...    439   2e-143   
ref|XP_009108149.1|  PREDICTED: primary amine oxidase-like              439   7e-143   
gb|EAZ00805.1|  hypothetical protein OsI_22834                          444   2e-142   
emb|CAA45526.1|  amine oxidase (copper-containing)                      441   3e-141   
gb|KCW60789.1|  hypothetical protein EUGRSUZ_H03525                     435   1e-140   
ref|NP_001060056.1|  Os07g0572100                                       433   3e-140   
ref|XP_010650035.1|  PREDICTED: primary amine oxidase                   432   4e-139   
ref|WP_029060038.1|  tyramine oxidase                                   437   1e-138   
ref|XP_010108023.1|  Primary amine oxidase                              424   2e-137   
gb|KCW77696.1|  hypothetical protein EUGRSUZ_D01996                     431   2e-137   
ref|WP_018700133.1|  hypothetical protein                               428   2e-135   
ref|XP_006368101.1|  PREDICTED: primary amine oxidase-like              417   2e-135   
gb|KDO74638.1|  hypothetical protein CISIN_1g040402mg                   422   2e-134   
emb|CDP09893.1|  unnamed protein product                                410   5e-133   
gb|KHG18384.1|  hypothetical protein F383_06942                         408   5e-133   
ref|NP_192965.1|  copper amine oxidase family protein                   408   9e-133   
ref|WP_027538452.1|  tyramine oxidase                                   418   1e-131   
gb|KHN02711.1|  Primary amine oxidase                                   409   7e-131   
ref|WP_013567041.1|  Copper amine oxidase domain-containing protein     415   2e-130   
gb|EPS62725.1|  primary amine oxidase                                   404   1e-129   
ref|XP_009123408.1|  PREDICTED: primary amine oxidase isoform X3        399   6e-129   
ref|XP_010108024.1|  Primary amine oxidase                              403   3e-128   
ref|WP_025029174.1|  tyramine oxidase                                   409   4e-128   
ref|WP_007007039.1|  tyramine oxidase                                   409   5e-128   
gb|EKF18109.1|  tyramine oxidase                                        407   3e-127   
ref|WP_040678026.1|  tyramine oxidase                                   406   3e-127   
gb|ETX29902.1|  tyramine oxidase                                        404   2e-126   
ref|WP_026442375.1|  hypothetical protein                               404   5e-126   
emb|CDY27138.1|  BnaA08g07760D                                          392   2e-125   
ref|XP_009801884.1|  PREDICTED: LOW QUALITY PROTEIN: primary amin...    392   2e-124   
ref|WP_026345313.1|  tyramine oxidase                                   399   4e-124   
ref|WP_037129846.1|  tyramine oxidase                                   396   2e-123   
ref|NP_192964.1|  copper amine oxidase family protein                   387   2e-122   
ref|WP_035356538.1|  hypothetical protein                               394   2e-122   
ref|XP_002315777.2|  hypothetical protein POPTR_0010s09920g             383   6e-122   
emb|CDP21719.1|  unnamed protein product                                385   1e-120   
ref|WP_037408857.1|  tyramine oxidase                                   388   5e-120   
gb|EYR78768.1|  primary amine oxidase MaoA                              388   5e-120   
gb|EOD79606.1|  Monoamine oxidase                                       388   5e-120   
ref|WP_039850031.1|  tyramine oxidase                                   388   7e-120   
ref|WP_026620791.1|  tyramine oxidase                                   387   1e-119   
ref|WP_037215007.1|  tyramine oxidase                                   387   1e-119   
ref|WP_029065798.1|  tyramine oxidase                                   386   2e-119   
ref|WP_018855294.1|  tyramine oxidase                                   385   4e-119   
ref|WP_016558032.1|  tyramine oxidase                                   385   6e-119   
ref|WP_040701343.1|  tyramine oxidase                                   384   1e-118   
gb|EDQ04452.1|  tyramine oxidase, copper-requiring                      384   1e-118   
ref|WP_037074971.1|  tyramine oxidase                                   384   2e-118   
emb|CCM79208.1|  tyramine oxidase, copper-requiring                     384   2e-118   
ref|WP_040678641.1|  tyramine oxidase                                   384   2e-118   
ref|WP_037414469.1|  tyramine oxidase                                   383   3e-118   
ref|WP_009468823.1|  tyramine oxidase                                   383   4e-118   
ref|WP_026356008.1|  tyramine oxidase                                   382   9e-118   
ref|WP_026849317.1|  hypothetical protein                               380   2e-117   
ref|WP_037170941.1|  tyramine oxidase                                   381   2e-117   
ref|WP_007797112.1|  tyramine oxidase                                   380   4e-117   
ref|WP_004111255.1|  hypothetical protein                               377   6e-116   
ref|WP_037118995.1|  tyramine oxidase                                   377   7e-116   
ref|WP_014290440.1|  tyramine oxidase                                   373   2e-114   
gb|EMS66689.1|  Primary amine oxidase                                   368   3e-114   
gb|KFK43727.1|  hypothetical protein AALP_AA1G164700                    362   4e-114   
ref|WP_008551005.1|  tyramine oxidase                                   370   4e-113   
ref|WP_035976750.1|  hypothetical protein                               369   5e-113   
ref|WP_037257202.1|  tyramine oxidase                                   363   8e-111   
ref|XP_009413786.1|  PREDICTED: primary amine oxidase-like              355   1e-110   
ref|WP_035634384.1|  hypothetical protein                               360   9e-110   
ref|WP_028331393.1|  hypothetical protein                               360   1e-109   
ref|WP_029878877.1|  hypothetical protein                               359   2e-109   
ref|WP_038379656.1|  hypothetical protein                               358   3e-109   
gb|ETW13387.1|  tyramine oxidase                                        358   1e-108   
ref|WP_035653101.1|  hypothetical protein                               357   1e-108   
gb|ERF79999.1|  hypothetical protein C207_06798                         357   3e-108   
ref|WP_038596400.1|  hypothetical protein                               356   4e-108   
gb|AHV95396.1|  tyramine oxidase                                        357   7e-108   
ref|WP_038382039.1|  hypothetical protein                               352   1e-106   
ref|WP_036735803.1|  hypothetical protein                               352   1e-106   
ref|WP_036050081.1|  hypothetical protein                               351   3e-106   
ref|WP_036637887.1|  hypothetical protein                               347   8e-105   
ref|WP_011682691.1|  tyramine oxidase                                   345   4e-104   
ref|XP_004164167.1|  PREDICTED: primary amine oxidase-like              333   1e-101   
ref|WP_036725804.1|  hypothetical protein                               337   5e-101   
gb|KCW60787.1|  hypothetical protein EUGRSUZ_H03523                     334   2e-100   
ref|WP_028553548.1|  tyramine oxidase                                   337   9e-100   
emb|CDY04405.1|  BnaC02g28430D                                          320   2e-99    
ref|WP_034329515.1|  tyramine oxidase                                   336   3e-99    
ref|WP_030071974.1|  tyramine oxidase                                   333   2e-98    
ref|WP_035445718.1|  tyramine oxidase                                   333   3e-98    
gb|KCW60784.1|  hypothetical protein EUGRSUZ_H03521                     327   9e-98    
ref|WP_026348798.1|  tyramine oxidase                                   329   8e-97    
ref|WP_008957173.1|  tyramine oxidase                                   328   1e-96    
ref|WP_008317043.1|  Cu2+-containing amine oxidase                      323   5e-96    
gb|ELR97052.1|  Cu2+-containing amine oxidase                           323   1e-95    
ref|WP_003350826.1|  tyramine oxidase                                   323   2e-95    
ref|WP_011611069.1|  tyramine oxidase                                   323   2e-95    
ref|WP_009633550.1|  Cu2+-containing amine oxidase                      322   3e-95    
ref|WP_008056272.1|  tyramine oxidase                                   325   4e-95    
ref|WP_034937376.1|  tyramine oxidase                                   320   6e-95    
ref|WP_012772711.1|  tyramine oxidase                                   324   7e-95    
ref|WP_027977591.1|  tyramine oxidase                                   323   1e-94    
ref|WP_003651972.1|  tyramine oxidase                                   323   2e-94    
ref|WP_008021650.1|  tyramine oxidase                                   323   2e-94    
ref|WP_017388271.1|  tyramine oxidase                                   323   2e-94    
ref|WP_036480875.1|  tyramine oxidase                                   319   4e-94    
ref|WP_008025287.1|  tyramine oxidase                                   322   4e-94    
ref|WP_027416719.1|  tyramine oxidase                                   319   4e-94    
ref|WP_039728302.1|  tyramine oxidase                                   318   5e-94    
ref|WP_027820829.1|  tyramine oxidase                                   319   5e-94    
ref|WP_005040204.1|  hypothetical protein                               322   6e-94    
ref|WP_008038302.1|  tyramine oxidase                                   322   6e-94    
ref|WP_004642986.1|  hypothetical protein                               322   6e-94    
ref|WP_032010561.1|  tyramine oxidase                                   322   7e-94    
ref|WP_008374366.1|  tyramine oxidase                                   321   7e-94    
ref|WP_039762409.1|  tyramine oxidase                                   321   9e-94    
ref|WP_015306289.1|  Cu2+-containing amine oxidase                      318   2e-93    
ref|WP_014462800.1|  tyramine oxidase                                   318   2e-93    
ref|WP_034149297.1|  tyramine oxidase                                   320   2e-93    
ref|WP_019458824.1|  tyramine oxidase                                   320   2e-93    
ref|WP_005074159.1|  hypothetical protein                               320   2e-93    
ref|WP_001231357.1|  tyramine oxidase                                   320   2e-93    
ref|WP_001231343.1|  tyramine oxidase                                   320   3e-93    
ref|WP_032041619.1|  tyramine oxidase                                   320   3e-93    
ref|WP_039785488.1|  tyramine oxidase                                   320   3e-93    
ref|WP_017391439.1|  tyramine oxidase                                   320   3e-93    
ref|WP_001231342.1|  tyramine oxidase                                   320   3e-93    
ref|WP_001231345.1|  tyramine oxidase                                   320   3e-93    
ref|WP_032036869.1|  tyramine oxidase                                   320   3e-93    
ref|WP_031996751.1|  tyramine oxidase                                   320   3e-93    
gb|EYU41496.1|  hypothetical protein MIMGU_mgv1a025706mg                309   3e-93    
ref|WP_017394035.1|  MULTISPECIES: tyramine oxidase                     320   4e-93    
ref|WP_032068990.1|  tyramine oxidase                                   320   4e-93    
ref|WP_032053848.1|  tyramine oxidase                                   320   4e-93    
ref|WP_031984568.1|  tyramine oxidase                                   320   4e-93    
ref|WP_002132720.1|  primary amine oxidase                              320   4e-93    
ref|WP_002047613.1|  primary amine oxidase                              319   4e-93    
dbj|GAM30363.1|  copper amine oxidase                                   319   4e-93    
ref|WP_005110651.1|  hypothetical protein                               319   4e-93    
ref|WP_001231352.1|  tyramine oxidase                                   319   5e-93    
ref|WP_033853132.1|  tyramine oxidase                                   319   5e-93    
ref|WP_002061859.1|  primary amine oxidase                              319   5e-93    
ref|WP_004747023.1|  hypothetical protein                               319   5e-93    
ref|WP_004708588.1|  hypothetical protein                               319   5e-93    
ref|WP_032038471.1|  tyramine oxidase                                   319   5e-93    
ref|WP_005131598.1|  hypothetical protein                               319   5e-93    
ref|WP_032014978.1|  hypothetical protein                               318   5e-93    
ref|WP_032003744.1|  tyramine oxidase                                   319   5e-93    
ref|WP_031988479.1|  tyramine oxidase                                   319   5e-93    
ref|WP_017398319.1|  tyramine oxidase                                   319   5e-93    
emb|CDH42147.1|  tyramine oxidase                                       319   5e-93    
ref|WP_039252219.1|  tyramine oxidase                                   319   5e-93    
ref|WP_011859377.1|  tyramine oxidase                                   318   5e-93    
ref|WP_001231346.1|  tyramine oxidase                                   319   5e-93    
ref|WP_005305968.1|  hypothetical protein                               319   6e-93    
ref|WP_008314860.1|  Cu2+-containing amine oxidase                      316   6e-93    
ref|WP_032051364.1|  tyramine oxidase                                   319   6e-93    
ref|WP_017816123.1|  tyramine oxidase                                   319   6e-93    
ref|WP_005123941.1|  hypothetical protein                               319   6e-93    
ref|WP_031977907.1|  tyramine oxidase                                   319   6e-93    
ref|WP_031960621.1|  tyramine oxidase                                   319   6e-93    
ref|WP_032061672.1|  tyramine oxidase                                   319   6e-93    
ref|WP_019767734.1|  MULTISPECIES: tyramine oxidase                     319   6e-93    
ref|WP_032031217.1|  tyramine oxidase                                   319   7e-93    
ref|WP_001231353.1|  tyramine oxidase                                   319   7e-93    
ref|WP_038405594.1|  tyramine oxidase                                   319   7e-93    
ref|WP_013197695.1|  tyramine oxidase                                   319   7e-93    
ref|WP_030425565.1|  tyramine oxidase                                   317   7e-93    
ref|WP_025468610.1|  tyramine oxidase                                   319   7e-93    
gb|KHE39422.1|  tyramine oxidase                                        318   7e-93    
ref|WP_041038062.1|  tyramine oxidase                                   316   7e-93    
ref|WP_031380423.1|  tyramine oxidase                                   319   7e-93    
ref|WP_032045458.1|  tyramine oxidase                                   319   7e-93    
ref|WP_009392082.1|  primary amine oxidase                              319   7e-93    
ref|WP_032027488.1|  tyramine oxidase                                   319   7e-93    
ref|WP_024433469.1|  tyramine oxidase                                   319   8e-93    
ref|WP_004887045.1|  MULTISPECIES: tyramine oxidase                     319   8e-93    
ref|WP_001231350.1|  tyramine oxidase                                   319   8e-93    
ref|WP_017481030.1|  tyramine oxidase                                   319   8e-93    
ref|WP_032006289.1|  tyramine oxidase                                   319   8e-93    
ref|WP_001986604.1|  tyramine oxidase                                   319   8e-93    
gb|EMU05628.1|  tyramine oxidase                                        319   8e-93    
ref|WP_024437530.1|  tyramine oxidase                                   318   8e-93    
ref|WP_032038992.1|  tyramine oxidase                                   318   8e-93    
ref|WP_032026010.1|  tyramine oxidase                                   318   8e-93    
ref|WP_001231356.1|  tyramine oxidase                                   318   9e-93    



>ref|XP_009780972.1| PREDICTED: primary amine oxidase [Nicotiana sylvestris]
Length=713

 Score =   948 bits (2451),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 457/719 (64%), Positives = 556/719 (77%), Gaps = 18/719 (3%)
 Frame = -1

Query  2260  MAASSIFCLFYMASSMLIFLQVNSCLSFES-------SNASINNLESLLGIHDFKIQNNH  2102
             M +SS+F L +  S +++FL  NS L F S       S        S+L    FK+ NN 
Sbjct  1     MDSSSLFRLTFFFS-IVVFLLANS-LFFSSKTYFQPTSKTRKTKFGSILETPIFKV-NNT  57

Query  2101  FADRPMHPLDPLTIQEIERTRSILSSYQPFSGSSLRIHSLSLDEPDKSEVLRWKRGNPLP  1922
             F   P HPLDPLTIQEI + + I+SSY+PF GS   I SLSLDEP+K +VL WK GNPLP
Sbjct  58    FDSSPSHPLDPLTIQEINKAQIIISSYKPFLGSFPSIRSLSLDEPEKIQVLNWKYGNPLP  117

Query  1921  TRKAFVVALSNGQAHLLVVDLGSGRVSSHTRNPASGYPPMSADDASTALEATFSNSVFRE  1742
              R+AFV+A +N Q HLL+VDL  G+V SH +NP SGYPP+S DD   A+ AT SN  F +
Sbjct  118   PRRAFVIAWANDQVHLLIVDLNLGQVISHVQNPGSGYPPISIDDVRVAIRATLSNEEFNK  177

Query  1741  AISTRGVEINDVVCSAAAPGWFGPEEEGRRITKVKCYTAQNTPNYYMRPIEGLLLTVDLD  1562
             +I  RGV  +D+VC+  + GWFGPEEEG+RI KV+CY++Q TP++YMRPIEGL++ VD+D
Sbjct  178   SIVARGVNFSDLVCTTPSSGWFGPEEEGKRIMKVRCYSSQGTPSFYMRPIEGLVVIVDID  237

Query  1561  SGKVINVYDTHSPIPIPKAQGTDYRRDGIEHRAPGVEPLKPISMEQPNGQSFRVEDGYIV  1382
              G+VI + DT   IPIP  + TDYR    +   P +EPL PIS+EQP G SF +E+G+ V
Sbjct  238   KGEVIKILDTSPKIPIPNGENTDYRYTS-QDMPPQMEPLNPISIEQPKGPSFTIENGHNV  296

Query  1381  KWASWEFHVKADQRAGIIISQATVFDPEAGKRRSVMYKGFASELFVPYMDVDEGWYFRAF  1202
             KWA+W+FH+KADQRAGI+IS+A + D E G+ RSVMYKGFASELFVPYMD+DE WYFR++
Sbjct  297   KWANWDFHLKADQRAGIVISRARIRDSETGEPRSVMYKGFASELFVPYMDIDENWYFRSY  356

Query  1201  MDAGEFGLGATAMELVPLNDCPRHSHYIDGLFVDPDGRPVSQPNVICVFERYSGDIAWRH  1022
             MDAGEFGLGATAM LVPLNDCPR+S+++DGLFV  DG+P  QPN+ICVFERY+GDI+WRH
Sbjct  357   MDAGEFGLGATAMSLVPLNDCPRYSYFMDGLFVTADGKPFVQPNIICVFERYAGDISWRH  416

Query  1021  SGTG-DADDDLIREARPKVSLVVRTTATVGNYDYIFDWEFQTDGSIRVTVGLSGIILAKG  845
             S       ++ IRE+RPKV+LV R  A+VGNYDYIFDWEFQTDG IRVTVGLSG+++ KG
Sbjct  417   SDLPIHGFEERIRESRPKVTLVARMAASVGNYDYIFDWEFQTDGLIRVTVGLSGMLMVKG  476

Query  844   SPYEHINQFEIPRWDFPAGSLVSENTIGVAHDHFITFHLDMDVDGPTNSFVKVDLVKNYN  665
             +P    N+ +I       G LVSEN IGVAHDHFITFHLDMD+DGP NSFVKV LVK  N
Sbjct  477   TPQNSTNEDDI------FGPLVSENVIGVAHDHFITFHLDMDIDGPINSFVKVGLVKEEN  530

Query  664   IAGKIQRKSYWSPKRKVAKSENDAKIKLQLDKPSEFHVINPRHQSRLGNPSGYKIVPSAT  485
              + K  RKSYW  KR+V + E DA+IKL+L +PSEFH INP  +SR+GNP+GYKIVP   
Sbjct  531   PSTKTPRKSYWKAKRQVIEKEKDAQIKLKLYEPSEFHFINPLRKSRIGNPTGYKIVPKGN  590

Query  484   AASLLDLQDPPQLRAAFTNNQIWVTPYNRSEQWAGGLFTYQSHGDDTLAVWSNRNRVIEK  305
             AASLLDL DPPQ+R+AFTNNQIWVTPYN+SEQWAGGL  YQS G+DTLAVWSNRNR I++
Sbjct  591   AASLLDLDDPPQVRSAFTNNQIWVTPYNKSEQWAGGLLVYQSKGEDTLAVWSNRNREIKE  650

Query  304   QDIVLWYTLGFHHLPCQEDFPVMPTVTSTFQLKPVNFFDRNPIIQANPNFAEDLPICRA  128
             +DIVLWYTLGFHH+PCQEDFPVMPTVTSTF LKP+NFF+RNPI++A PNF EDLP+CR+
Sbjct  651   KDIVLWYTLGFHHVPCQEDFPVMPTVTSTFDLKPLNFFERNPILRARPNFDEDLPVCRS  709



>ref|XP_009595839.1| PREDICTED: LOW QUALITY PROTEIN: primary amine oxidase-like [Nicotiana 
tomentosiformis]
Length=716

 Score =   919 bits (2376),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 450/725 (62%), Positives = 550/725 (76%), Gaps = 27/725 (4%)
 Frame = -1

Query  2260  MAASSIFCLFYMASSMLIFLQVNSCLS------FESSNASI--------NNLESLLGIHD  2123
             M +SSIF L ++ S ++IFL  NS         F SSN               S+L    
Sbjct  1     MESSSIFRLAFVLS-IVIFLLTNSWFHLHKTSFFLSSNTHFPPTFKTRNTKFGSILETPI  59

Query  2122  FKIQNNHFADRPMHPLDPLTIQEIERTRSILSSYQPFSGSSLRIHSLSLDEPDKSEVLRW  1943
             FK++N  F   P HPLDPLTIQEI + + I+SSY+PF GS   I SLSLDEP+K +VL W
Sbjct  60    FKVKNT-FDSSPSHPLDPLTIQEINKAQIIISSYKPFFGSFPSIRSLSLDEPEKIQVLNW  118

Query  1942  KRGNPLPTRKAFVVALSNGQAHLLVVDLGSGRVSSHTRNPASGYPPMSADDASTALEATF  1763
             K GNPLP R+AFV+A +N Q HLL+VDL  G++ SH +NP SGYPP+S D    A+ AT 
Sbjct  119   KYGNPLPPRRAFVIAWANSQVHLLIVDLNLGQIISHVQNPGSGYPPISID---VAIRATL  175

Query  1762  SNSVFREAISTRGVEINDVVCSAAAPGWFGPEEEGRRITKVKCYTAQNTPNYYMRPIEGL  1583
             SN  F ++I  RGV  +D+VC+  + GWFGPEEEG+RI KV CY++Q TP++YMR IEGL
Sbjct  176   SNEEFNKSIVARGVNFSDLVCTTPSSGWFGPEEEGKRIMKVXCYSSQGTPSFYMRSIEGL  235

Query  1582  LLTVDLDSGKVINVYDTHSPIPIPKAQGTDYRRDGIEHRAPGVEPLKPISMEQPNGQSFR  1403
             ++ VD+D+G+VI V D     PIP  + TDYR    + R P + PL PIS+EQP G SF 
Sbjct  236   IVIVDIDNGEVIKVLDKSKNXPIPNGENTDYRYMS-QDRPPQMVPLNPISIEQPKGPSFT  294

Query  1402  VEDGYIVKWASWEFHVKADQRAGIIISQATVFDPEAGKRRSVMYKGFASELFVPYMDVDE  1223
             +++G+ VKWA+W+FH+KADQRAGI+IS+A + D E G+ RSVMYKGFASELFVPYM++DE
Sbjct  295   IKNGHNVKWANWDFHLKADQRAGIVISRARIRDSETGEPRSVMYKGFASELFVPYMEIDE  354

Query  1222  GWYFRAFMDAGEFGLGATAMELVPLNDCPRHSHYIDGLFVDPDGRPVSQPNVICVFERYS  1043
              WYF ++MDAGEFGLGATAM LVPLNDCPR+S+++DGLFV  DG+P  QPN+ICVFERY+
Sbjct  355   NWYFSSYMDAGEFGLGATAMSLVPLNDCPRYSYFMDGLFVTADGKPFVQPNIICVFERYA  414

Query  1042  GDIAWRHSGTG-DADDDLIREARPKVSLVVRTTATVGNYDYIFDWEFQTDGSIRVTVGLS  866
             GDI+WRHS       ++ IREARPKV+LV R  A+VGNYDYIFDWEFQTDG IRVTVGLS
Sbjct  415   GDISWRHSDLPIHGFEEQIREARPKVTLVARMAASVGNYDYIFDWEFQTDGLIRVTVGLS  474

Query  865   GIILAKGSPYEHINQFEIPRWDFPAGSLVSENTIGVAHDHFITFHLDMDVDGPTNSFVKV  686
             G+++ KG+P E  N+ +I       G LVSEN IGVAHDHFITFHLDMD+DGPTNSFVKV
Sbjct  475   GMLMVKGTPQESTNESDI------FGPLVSENVIGVAHDHFITFHLDMDIDGPTNSFVKV  528

Query  685   DLVKNYNIAGKIQRKSYWSPKRKVAKSENDAKIKLQLDKPSEFHVINPRHQSRLGNPSGY  506
             DLVK  N + K  RKSYW  KR+V + E DA+IKL+L +PSEFH INP  +SR+GNP+GY
Sbjct  529   DLVKEENPSVKTPRKSYWRAKRQVIEKEKDAQIKLKLYEPSEFHFINPLKKSRIGNPTGY  588

Query  505   KIVPSATAASLLDLQDPPQLRAAFTNNQIWVTPYNRSEQWAGGLFTYQSHGDDTLAVWSN  326
             KIVP   AASLLDL DPPQ+R+AFTNNQIWVTPYN+SEQWAGG   YQS G+DTLAVWSN
Sbjct  589   KIVPKGNAASLLDLDDPPQIRSAFTNNQIWVTPYNKSEQWAGGXLVYQSKGEDTLAVWSN  648

Query  325   RNRVIEKQDIVLWYTLGFHHLPCQEDFPVMPTVTSTFQLKPVNFFDRNPIIQANPNFAED  146
             RN  I+++DIVLWYTLGFHH+PCQEDFPVMPTVTS+F LKP+NFF+RNPI++A PNF  D
Sbjct  649   RNCEIKEKDIVLWYTLGFHHIPCQEDFPVMPTVTSSFDLKPLNFFERNPILRARPNFDVD  708

Query  145   LPICR  131
             L +CR
Sbjct  709   LHVCR  713



>ref|XP_003635614.2| PREDICTED: primary amine oxidase-like [Vitis vinifera]
Length=720

 Score =   908 bits (2347),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 431/658 (66%), Positives = 524/658 (80%), Gaps = 4/658 (1%)
 Frame = -1

Query  2104  HFADRPMHPLDPLTIQEIERTRSILSSYQPFSGSSLRIHSLSLDEPDKSEVLRWKRGNPL  1925
             H A+   HPLDPL+IQEI + R++LSSY PFS S   I SLSLDEP+KS VL WK+G+ L
Sbjct  62    HSAETTHHPLDPLSIQEINKVRAVLSSYGPFSSSFPAIQSLSLDEPEKSVVLGWKKGDSL  121

Query  1924  PTRKAFVVALSNGQAHLLVVDLGSGRVSSHTRNPASGYPPMSADDASTALEATFSNSVFR  1745
             P RKAFV+AL NG+  +L+VDL S RV+SH+ +  SGYP +S DD   AL    S+  F 
Sbjct  122   PPRKAFVIALLNGKTQVLLVDLDSSRVTSHSTHQGSGYPTLSMDDIQVALRVPLSDPEFN  181

Query  1744  EAISTRGVEINDVVCSAAAPGWFGPEEEGRRITKVKCYTAQNTPNYYMRPIEGLLLTVDL  1565
             ++I  RGV+++D+ C + + GWFGP+EEGRRI K++C + Q+T N+YMRPIEGL +TVD+
Sbjct  182   KSIMARGVKLSDLGCISPSSGWFGPDEEGRRIIKIQCGSIQDTANFYMRPIEGLTVTVDI  241

Query  1564  DSGKVINVYDTHSPIPIPKAQGTDYRRDGIEHRAPGVEPLKPISMEQPNGQSFRVEDGYI  1385
             D  +V+ + DT   IP+PK   TDYR    + R P +EP+ PISMEQP G SFRVEDG+I
Sbjct  242   DRKEVVRISDTGREIPVPKGTNTDYRYTA-QDRPPEMEPINPISMEQPKGPSFRVEDGHI  300

Query  1384  VKWASWEFHVKADQRAGIIISQATVFDPEAGKRRSVMYKGFASELFVPYMDVDEGWYFRA  1205
             VKWA+WEFH+KADQR G+IISQA V D E G+ RSVMYKGFASE+FVPYMD DE WYF++
Sbjct  301   VKWANWEFHLKADQRTGMIISQAKVRDSETGELRSVMYKGFASEMFVPYMDPDEAWYFKS  360

Query  1204  FMDAGEFGLGATAMELVPLNDCPRHSHYIDGLFVDPDGRPVSQPNVICVFERYSGDIAWR  1025
             +MDAGEFGLG TA+ LVPLNDCPR+S+Y+DG+FV  DG+P  Q N+ICVFERY+GD+ WR
Sbjct  361   YMDAGEFGLGGTALALVPLNDCPRNSYYMDGVFVASDGKPFIQSNMICVFERYTGDVGWR  420

Query  1024  HSGTGDADDDLIREARPKVSLVVRTTATVGNYDYIFDWEFQTDGSIRVTVGLSGIILAKG  845
             HS T     + IREARPKV+LV R  A+VGNYDYIFDWEFQTDG IRV VGLSG+++ KG
Sbjct  421   HSETFLPGFN-IREARPKVTLVARIAASVGNYDYIFDWEFQTDGLIRVKVGLSGMLMVKG  479

Query  844   SPYEHINQFEIPRWDFPAGSLVSENTIGVAHDHFITFHLDMDVDGPTNSFVKVDLVKNYN  665
             +P E+I+Q   P  D  +G+LVSEN IGV HDHFITFHLD+D+D   NSFVKV+LVK   
Sbjct  480   TPLENIHQ--APNQDDMSGTLVSENVIGVVHDHFITFHLDLDIDNTDNSFVKVNLVKEET  537

Query  664   IAGKIQRKSYWSPKRKVAKSENDAKIKLQLDKPSEFHVINPRHQSRLGNPSGYKIVPSAT  485
             + G+  RKSY   KR VA +ENDAKIKL+L  PSEFHVINP  +SRLGN +GYKIVPS T
Sbjct  538   LPGQSPRKSYLKAKRNVAATENDAKIKLKLYDPSEFHVINPLKRSRLGNSAGYKIVPSGT  597

Query  484   AASLLDLQDPPQLRAAFTNNQIWVTPYNRSEQWAGGLFTYQSHGDDTLAVWSNRNRVIEK  305
             AASLLDLQDPPQLR+AFTNNQIWVTPYNR+EQWAGGLF YQS G+DTLAVWS+RNR IE 
Sbjct  598   AASLLDLQDPPQLRSAFTNNQIWVTPYNRTEQWAGGLFVYQSKGEDTLAVWSDRNRPIEN  657

Query  304   QDIVLWYTLGFHHLPCQEDFPVMPTVTSTFQLKPVNFFDRNPIIQANPNFAEDLPICR  131
             +DIVLWYTLGFHH+PCQEDFP+MPTV+S+F LKPVNFF+ NP+++A PNF +DLP+CR
Sbjct  658   RDIVLWYTLGFHHIPCQEDFPIMPTVSSSFDLKPVNFFESNPVLRAAPNFEKDLPVCR  715



>ref|XP_010108146.1| Primary amine oxidase [Morus notabilis]
 gb|EXC17878.1| Primary amine oxidase [Morus notabilis]
Length=711

 Score =   888 bits (2295),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 421/668 (63%), Positives = 518/668 (78%), Gaps = 11/668 (2%)
 Frame = -1

Query  2122  FKIQNNHFADRPMHPLDPLTIQEIERTRSILSSYQPFSGSSLRIHSLSLDEPDKSEVLRW  1943
             FK + +HF++ P HPLDPLTI+EI+R R+IL SY+P S +   IHSL+L+EP KS+VL W
Sbjct  42    FKSKIDHFSEIPHHPLDPLTIEEIKRARAILFSYRPLSSTFPSIHSLTLEEPYKSQVLGW  101

Query  1942  KRGNPLPTRKAFVVALSNGQAHLLVVDLGSGRVSSHTRNPASGYPPMSADDASTALEATF  1763
             K G+P+P RKAFV+AL NG++HL+ VDLG GRV+ H  + +SGYP ++ DD S A+E   
Sbjct  102   KNGDPIPPRKAFVIALLNGKSHLVTVDLGLGRVTRHEISSSSGYPMLTLDDISKAVEVAL  161

Query  1762  SNSVFREAISTRGVEINDVVCSAAAPGWFGPEEEGRRITKVKCYTAQNTPNYYMRPIEGL  1583
                   E+I+ RGV ++++VC + + GW+GP EEGRRI KV+C+++ NT N+YMRPIEGL
Sbjct  162   LYPELAESIAARGVALSELVCISPSVGWYGPNEEGRRIVKVQCFSSGNTSNFYMRPIEGL  221

Query  1582  LLTVDLDSGKVINVYDTHSPIPIPKAQGTDYRRDGIEHRAPGVEPLKPISMEQPNGQSFR  1403
             +LTVDLD  +V+   DT   IP+P+A  TDYR    E + P +  L PIS+ QPNG SF 
Sbjct  222   ILTVDLDKREVVKFSDTGRAIPVPRAVNTDYRYSAQE-KPPEMRQLNPISLVQPNGPSFS  280

Query  1402  VEDGYIVKWASWEFHVKADQRAGIIISQATVFDPEAGKRRSVMYKGFASELFVPYMDVDE  1223
             VE G++VKWA+WEFH++ D RAG++IS+ATV D E G+ RSVMYKGFASE FVPYMD+DE
Sbjct  281   VEGGHVVKWANWEFHLRPDPRAGMVISRATVRDSETGELRSVMYKGFASEFFVPYMDLDE  340

Query  1222  GWYFRAFMDAGEFGLGATAMELVPLNDCPRHSHYIDGLFVDPDGRPVSQPNVICVFERYS  1043
             GWYF+ +MD GEFGLGA A  LVPLNDCP +S+Y+DG+F   DG P  QPNVIC+FERY+
Sbjct  341   GWYFKTYMDVGEFGLGALASSLVPLNDCPNYSYYMDGVFAASDGGPYIQPNVICIFERYA  400

Query  1042  GDIAWRHSGTGDADDDLIREARPKVSLVVRTTATVGNYDYIFDWEFQTDGSIRVTVGLSG  863
             GD++WRHS T     +  REAR KV+LV R  ATVGNYDY FDWEFQTDG I+V VGLSG
Sbjct  401   GDVSWRHSETLIPGLE-AREARRKVTLVARMAATVGNYDYTFDWEFQTDGLIQVKVGLSG  459

Query  862   IILAKGSPYEHI----NQFEIPRWDFPAGSLVSENTIGVAHDHFITFHLDMDVDGPTNSF  695
             +++ KGSPYE++    NQ EI      +  LVSEN IGV HDHF+TFHLDMD+DGP NSF
Sbjct  460   MLMVKGSPYENVQTMPNQEEIS-----STPLVSENVIGVVHDHFVTFHLDMDIDGPNNSF  514

Query  694   VKVDLVKNYNIAGKIQRKSYWSPKRKVAKSENDAKIKLQLDKPSEFHVINPRHQSRLGNP  515
              KVDLVK   + G+  RKSY  PKR +AK+ENDAKIKL L KPSEF++INP  +SRLGNP
Sbjct  515   AKVDLVKEETLPGESPRKSYLKPKRHIAKTENDAKIKLDLYKPSEFYLINPSRRSRLGNP  574

Query  514   SGYKIVPSATAASLLDLQDPPQLRAAFTNNQIWVTPYNRSEQWAGGLFTYQSHGDDTLAV  335
             +GYK+VP  TAASLLD  DPPQ+R+AFTNNQIWVTPYNRSEQWAGGL TYQS GDDTLAV
Sbjct  575   TGYKLVPGGTAASLLDALDPPQIRSAFTNNQIWVTPYNRSEQWAGGLLTYQSKGDDTLAV  634

Query  334   WSNRNRVIEKQDIVLWYTLGFHHLPCQEDFPVMPTVTSTFQLKPVNFFDRNPIIQANPNF  155
             WS RNR IE +DIVLWYT+GFHH+PCQEDFP+MPTVTS+F LKP NFF+RNPI++  P F
Sbjct  635   WSERNRPIENKDIVLWYTMGFHHIPCQEDFPIMPTVTSSFDLKPANFFERNPILRIPPAF  694

Query  154   AEDLPICR  131
               D P+CR
Sbjct  695   EHDFPVCR  702



>ref|XP_006368696.1| hypothetical protein POPTR_0001s07880g [Populus trichocarpa]
 gb|ERP65265.1| hypothetical protein POPTR_0001s07880g [Populus trichocarpa]
Length=725

 Score =   887 bits (2293),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 420/668 (63%), Positives = 517/668 (77%), Gaps = 7/668 (1%)
 Frame = -1

Query  2134  GIHDFKIQNNHFADRPMHPLDPLTIQEIERTRSILSSYQPFSGSSLRIHSLSLDEPDKSE  1955
             GIH  +   +H  D P HPLDPLT+QEI + R+ILS+Y P   S   IHSLSL+EP K  
Sbjct  60    GIHKPR---DHMEDVPHHPLDPLTMQEIYKVRTILSTYPPLLPSFPAIHSLSLEEPHKDL  116

Query  1954  VLRWKRGNPLPTRKAFVVALSNGQAHLLVVDLGSGRVSSHTRNPASGYPPMSADDASTAL  1775
             VL+WK G+PLP RKA V+AL NGQ+H+L VDL SG V+S+  N  SGYP ++ +D S A+
Sbjct  117   VLKWKEGDPLPPRKALVIALLNGQSHVLSVDLDSGLVTSNEINHGSGYPMLTMNDISVAI  176

Query  1774  EATFSNSVFREAISTRGVEINDVVCSAAAPGWFGPEEEGRRITKVKCYTAQNTPNYYMRP  1595
             +   S+    ++   RG+ ++D+ C   + GWFGP EEGRRI KV+C++ Q TPN+YMRP
Sbjct  177   QVALSHKELNKSTIKRGISLSDLTCITPSAGWFGPNEEGRRIIKVQCFSNQGTPNFYMRP  236

Query  1594  IEGLLLTVDLDSGKVINVYDTHSPIPIPKAQGTDYRRDGIEHRAPGVEPLKPISMEQPNG  1415
             +EGL +TVD+D  +V+   DT   IP+PK   TDYR    +   P ++P+ PIS+EQP G
Sbjct  237   LEGLTMTVDIDKKEVVKFTDTGGGIPVPKGTDTDYRFKA-QKEPPKMKPINPISIEQPLG  295

Query  1414  QSFRVEDGYIVKWASWEFHVKADQRAGIIISQATVFDPEAGKRRSVMYKGFASELFVPYM  1235
              SF VEDG+IVKWA+WEFH+KADQRAGI+IS+A V D E G  RSVMYKGF+SELFVPYM
Sbjct  296   PSFTVEDGHIVKWANWEFHLKADQRAGIVISRAMVSDSETGVPRSVMYKGFSSELFVPYM  355

Query  1234  DVDEGWYFRAFMDAGEFGLGATAMELVPLNDCPRHSHYIDGLFVDPDGRPVSQPNVICVF  1055
             D DE WYF+++MDAGEFG+GATA+ LVPLNDCPRHS+Y+DG+FV  DG+P  QP++ICVF
Sbjct  356   DPDENWYFKSYMDAGEFGMGATALSLVPLNDCPRHSYYMDGIFVSWDGKPYVQPSIICVF  415

Query  1054  ERYSGDIAWRHSGTGDADDDLIREARPKVSLVVRTTATVGNYDYIFDWEFQTDGSIRVTV  875
             ERY+GDI+WRHS     +   IREARPKVSLV R  A+VGNYDYIFDWEFQTDG I V V
Sbjct  416   ERYAGDISWRHSEI-PVNGFNIREARPKVSLVARMAASVGNYDYIFDWEFQTDGLIHVAV  474

Query  874   GLSGIILAKGSPYEHINQFEIPRWDFPAGSLVSENTIGVAHDHFITFHLDMDVDGPTNSF  695
              LSG+++ KG+P++  +Q  IP  +  +G L+SEN IGV HDHFITFHLDMD+D   N+F
Sbjct  475   SLSGMLMVKGTPHQTADQ--IPNQEAASGPLISENLIGVVHDHFITFHLDMDIDDTNNTF  532

Query  694   VKVDLVKNYNIAGKIQRKSYWSPKRKVAKSENDAKIKLQLDKPSEFHVINPRHQSRLGNP  515
             VKV+LVK   + G+  RKSY   KR  AK+E+DA+IKL+L +PSEFHVINP  +SRLGNP
Sbjct  533   VKVNLVKEETLPGQSPRKSYLKAKRNTAKTEDDARIKLKLYEPSEFHVINPSRRSRLGNP  592

Query  514   SGYKIVPSATAASLLDLQDPPQLRAAFTNNQIWVTPYNRSEQWAGGLFTYQSHGDDTLAV  335
             +GYKIVP   AASLLD  DPPQLR+AFTNNQIWVTPYNR+EQWAGGLFTYQS GDDTLA 
Sbjct  593   AGYKIVPGGNAASLLDHLDPPQLRSAFTNNQIWVTPYNRNEQWAGGLFTYQSKGDDTLAA  652

Query  334   WSNRNRVIEKQDIVLWYTLGFHHLPCQEDFPVMPTVTSTFQLKPVNFFDRNPIIQANPNF  155
             WS RNR IE +DIVLWYTLGFHH+PCQEDFPVMPTV+S+F+LKPVNFF+ NPI++A P F
Sbjct  653   WSKRNRAIENKDIVLWYTLGFHHIPCQEDFPVMPTVSSSFELKPVNFFESNPILKAAPMF  712

Query  154   AEDLPICR  131
              +DLP+CR
Sbjct  713   EKDLPVCR  720



>ref|XP_011018237.1| PREDICTED: primary amine oxidase isoform X2 [Populus euphratica]
Length=725

 Score =   878 bits (2268),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 413/659 (63%), Positives = 509/659 (77%), Gaps = 4/659 (1%)
 Frame = -1

Query  2107  NHFADRPMHPLDPLTIQEIERTRSILSSYQPFSGSSLRIHSLSLDEPDKSEVLRWKRGNP  1928
             +H  D P HPLDPLT++EI + R+ILS+Y P   S   IHSLSLDEP K  VL+WK G+P
Sbjct  66    DHMEDFPHHPLDPLTMREIYKVRTILSTYPPLLPSFPAIHSLSLDEPHKDLVLKWKEGDP  125

Query  1927  LPTRKAFVVALSNGQAHLLVVDLGSGRVSSHTRNPASGYPPMSADDASTALEATFSNSVF  1748
             LP RKA V+AL NGQ+H+L VDL  G V+S+  N  SGYP ++ +D S A++   S+   
Sbjct  126   LPPRKALVIALLNGQSHVLSVDLDLGLVTSNKINHGSGYPMLTMNDISVAMQVALSHKEL  185

Query  1747  REAISTRGVEINDVVCSAAAPGWFGPEEEGRRITKVKCYTAQNTPNYYMRPIEGLLLTVD  1568
              ++   RG+ ++D+ C   + GWFGP EEGRRI KV+C++ Q TPN+YMRP+EGL +TVD
Sbjct  186   NKSTIKRGISLSDLTCVTPSAGWFGPNEEGRRIIKVQCFSNQGTPNFYMRPLEGLTMTVD  245

Query  1567  LDSGKVINVYDTHSPIPIPKAQGTDYRRDGIEHRAPGVEPLKPISMEQPNGQSFRVEDGY  1388
             +D  +V+   DT   IP+PK   TDYR    +   P ++P+ PIS+EQP G SF VEDG+
Sbjct  246   IDQKEVVKFTDTGGGIPVPKGTDTDYRFKA-QKEPPKMKPINPISIEQPFGPSFTVEDGH  304

Query  1387  IVKWASWEFHVKADQRAGIIISQATVFDPEAGKRRSVMYKGFASELFVPYMDVDEGWYFR  1208
             IVKWA+WEFH+KADQRAGI+IS+A + D E G  RSVMYKGF+SELFVPYMD DE WYF+
Sbjct  305   IVKWANWEFHLKADQRAGIVISRAMISDSETGVPRSVMYKGFSSELFVPYMDPDENWYFK  364

Query  1207  AFMDAGEFGLGATAMELVPLNDCPRHSHYIDGLFVDPDGRPVSQPNVICVFERYSGDIAW  1028
             ++MDAGEFG+GATA+ LVPLNDCPRHS+Y+DG+FV  DG+P  QP++ICVFERY+GDI+W
Sbjct  365   SYMDAGEFGMGATALSLVPLNDCPRHSYYMDGIFVSWDGKPYVQPSIICVFERYAGDISW  424

Query  1027  RHSGTGDADDDLIREARPKVSLVVRTTATVGNYDYIFDWEFQTDGSIRVTVGLSGIILAK  848
             RHS     +   IREARPKVSLV R  A+VGNYDYIFDWEFQ DG I V V LSG+++ K
Sbjct  425   RHSEI-PVNGFNIREARPKVSLVARMAASVGNYDYIFDWEFQADGLIHVAVSLSGMLMVK  483

Query  847   GSPYEHINQFEIPRWDFPAGSLVSENTIGVAHDHFITFHLDMDVDGPTNSFVKVDLVKNY  668
             G+P++  +Q  IP  +  +G L+SEN IGV HDHFITFHLDMD+D   N+FVKVDLVK  
Sbjct  484   GTPHQTADQ--IPNQEAASGPLISENLIGVVHDHFITFHLDMDIDDTNNTFVKVDLVKEE  541

Query  667   NIAGKIQRKSYWSPKRKVAKSENDAKIKLQLDKPSEFHVINPRHQSRLGNPSGYKIVPSA  488
                G+  RKSY   KR  AK+E+DA+IKL+L +PSEFHVINP  +SRLGNP+GYKIVP  
Sbjct  542   TFPGQSPRKSYLKAKRNTAKTEDDARIKLKLYEPSEFHVINPSRRSRLGNPAGYKIVPGG  601

Query  487   TAASLLDLQDPPQLRAAFTNNQIWVTPYNRSEQWAGGLFTYQSHGDDTLAVWSNRNRVIE  308
              AASLLD  DPPQLR+AFTNNQIWVTP+NR+EQWAGGLFTYQS GDDTLA WS RNR IE
Sbjct  602   NAASLLDHLDPPQLRSAFTNNQIWVTPFNRNEQWAGGLFTYQSKGDDTLAAWSKRNRAIE  661

Query  307   KQDIVLWYTLGFHHLPCQEDFPVMPTVTSTFQLKPVNFFDRNPIIQANPNFAEDLPICR  131
              +DIVLWYTLGFHH+PCQEDFP+MPTV+S+F+LKPVNFF+ NPI++A P   EDLP+CR
Sbjct  662   NKDIVLWYTLGFHHIPCQEDFPIMPTVSSSFELKPVNFFESNPILKAAPMSEEDLPVCR  720



>ref|XP_011018231.1| PREDICTED: primary amine oxidase-like isoform X2 [Populus euphratica]
Length=725

 Score =   877 bits (2265),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 413/659 (63%), Positives = 508/659 (77%), Gaps = 4/659 (1%)
 Frame = -1

Query  2107  NHFADRPMHPLDPLTIQEIERTRSILSSYQPFSGSSLRIHSLSLDEPDKSEVLRWKRGNP  1928
             +H  D P HPLDPLT++EI + R+ILS+Y P   S   IHSLSLDEP K  VL+WK G+P
Sbjct  66    DHMEDFPHHPLDPLTMREIYKVRTILSTYPPLLPSFPAIHSLSLDEPHKDLVLKWKEGDP  125

Query  1927  LPTRKAFVVALSNGQAHLLVVDLGSGRVSSHTRNPASGYPPMSADDASTALEATFSNSVF  1748
             LP RKA V+AL NGQ+H+L VDL  G V+S+  N  SGYP +  +D S A++   S+   
Sbjct  126   LPPRKALVIALLNGQSHVLSVDLDLGLVTSNKINHGSGYPMLMMNDISVAMQVALSHKEL  185

Query  1747  REAISTRGVEINDVVCSAAAPGWFGPEEEGRRITKVKCYTAQNTPNYYMRPIEGLLLTVD  1568
              ++   RG+ ++D+ C   + GWFGP EEGRRI KV+C++ Q TPN+YMRP+EGL +TVD
Sbjct  186   NKSTIKRGISLSDLTCVTPSAGWFGPNEEGRRIIKVQCFSNQGTPNFYMRPLEGLTMTVD  245

Query  1567  LDSGKVINVYDTHSPIPIPKAQGTDYRRDGIEHRAPGVEPLKPISMEQPNGQSFRVEDGY  1388
             +D  +V+   DT   IP+PK   TDYR    +   P ++P+ PIS+EQP G SF VEDG+
Sbjct  246   IDQKEVVKFTDTGGGIPVPKGTDTDYRFKA-QKEPPKMKPINPISIEQPFGPSFTVEDGH  304

Query  1387  IVKWASWEFHVKADQRAGIIISQATVFDPEAGKRRSVMYKGFASELFVPYMDVDEGWYFR  1208
             IVKWA+WEFH+KADQRAGI+IS+A + D E G  RSVMYKGF+SELFVPYMD DE WYF+
Sbjct  305   IVKWANWEFHLKADQRAGIVISRAMISDSETGVPRSVMYKGFSSELFVPYMDPDENWYFK  364

Query  1207  AFMDAGEFGLGATAMELVPLNDCPRHSHYIDGLFVDPDGRPVSQPNVICVFERYSGDIAW  1028
             ++MDAGEFG+GATA+ LVPLNDCPRHS+Y+DG+FV  DG+P  QP++ICVFERY+GDI+W
Sbjct  365   SYMDAGEFGMGATALSLVPLNDCPRHSYYMDGIFVSWDGKPYVQPSIICVFERYAGDISW  424

Query  1027  RHSGTGDADDDLIREARPKVSLVVRTTATVGNYDYIFDWEFQTDGSIRVTVGLSGIILAK  848
             RHS     +   IREARPKVSLV R  A+VGNYDYIFDWEFQ DG I V V LSG+++ K
Sbjct  425   RHSEI-PVNGFNIREARPKVSLVARMAASVGNYDYIFDWEFQADGLIHVAVSLSGMLMVK  483

Query  847   GSPYEHINQFEIPRWDFPAGSLVSENTIGVAHDHFITFHLDMDVDGPTNSFVKVDLVKNY  668
             G+P++  +Q  IP  +  +G L+SEN IGV HDHFITFHLDMD+D   N+FVKVDLVK  
Sbjct  484   GTPHQTADQ--IPNQEAASGPLISENLIGVVHDHFITFHLDMDIDDTNNTFVKVDLVKEE  541

Query  667   NIAGKIQRKSYWSPKRKVAKSENDAKIKLQLDKPSEFHVINPRHQSRLGNPSGYKIVPSA  488
                G+  RKSY   KR  AK+E+DA+IKL+L +PSEFHVINP  +SRLGNP+GYKIVP  
Sbjct  542   TFPGQSPRKSYLKAKRNTAKTEDDARIKLKLYEPSEFHVINPSRRSRLGNPAGYKIVPGG  601

Query  487   TAASLLDLQDPPQLRAAFTNNQIWVTPYNRSEQWAGGLFTYQSHGDDTLAVWSNRNRVIE  308
              AASLLD  DPPQLR+AFTNNQIWVTP+NR+EQWAGGLFTYQS GDDTLA WS RNR IE
Sbjct  602   NAASLLDHLDPPQLRSAFTNNQIWVTPFNRNEQWAGGLFTYQSKGDDTLAAWSKRNRAIE  661

Query  307   KQDIVLWYTLGFHHLPCQEDFPVMPTVTSTFQLKPVNFFDRNPIIQANPNFAEDLPICR  131
              +DIVLWYTLGFHH+PCQEDFP+MPTV+S+F+LKPVNFF+ NPI++A P   EDLP+CR
Sbjct  662   NKDIVLWYTLGFHHIPCQEDFPIMPTVSSSFELKPVNFFESNPILKAAPMSEEDLPVCR  720



>ref|XP_011018236.1| PREDICTED: primary amine oxidase isoform X1 [Populus euphratica]
Length=726

 Score =   874 bits (2258),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 413/660 (63%), Positives = 510/660 (77%), Gaps = 5/660 (1%)
 Frame = -1

Query  2107  NHFADRPMHPLDPLTIQEIERTRSILSSYQPFSGSSLRIHSLSLDEPDKSEVLRWKRGNP  1928
             +H  D P HPLDPLT++EI + R+ILS+Y P   S   IHSLSLDEP K  VL+WK G+P
Sbjct  66    DHMEDFPHHPLDPLTMREIYKVRTILSTYPPLLPSFPAIHSLSLDEPHKDLVLKWKEGDP  125

Query  1927  LPTRKAFVVALSNGQAHLLVVDLGSGRVSSHTRNPASGYPPMSADDASTALEATFSNSVF  1748
             LP RKA V+AL NGQ+H+L VDL  G V+S+  N  SGYP ++ +D S A++   S+   
Sbjct  126   LPPRKALVIALLNGQSHVLSVDLDLGLVTSNKINHGSGYPMLTMNDISVAMQVALSHKEL  185

Query  1747  REAISTRGVEINDVVCSAAAPGWFGPEEEGRRITKVKCYTAQNTPNYYMRPIEGLLLTVD  1568
              ++   RG+ ++D+ C   + GWFGP EEGRRI KV+C++ Q TPN+YMRP+EGL +TVD
Sbjct  186   NKSTIKRGISLSDLTCVTPSAGWFGPNEEGRRIIKVQCFSNQGTPNFYMRPLEGLTMTVD  245

Query  1567  LDSGKVINVYDTHSPIPIPKAQGTDYRRDGIEHRAPGVEPLKPISMEQPNGQSFRVEDGY  1388
             +D  +V+   DT   IP+PK   TDYR    +   P ++P+ PIS+EQP G SF VEDG+
Sbjct  246   IDQKEVVKFTDTGGGIPVPKGTDTDYRFKA-QKEPPKMKPINPISIEQPFGPSFTVEDGH  304

Query  1387  IVKWASWEFHVKADQRAGIIISQATVFDPEAGKRRSVMYKGFASELFVPYMDVDEGWYFR  1208
             IVKWA+WEFH+KADQRAGI+IS+A + D E G  RSVMYKGF+SELFVPYMD DE WYF+
Sbjct  305   IVKWANWEFHLKADQRAGIVISRAMISDSETGVPRSVMYKGFSSELFVPYMDPDENWYFK  364

Query  1207  AFMDAGEFGLGATAMELVPLNDCPRHSHYIDGLFVDPDGRPVSQPNVICVFERYSGDIAW  1028
             ++MDAGEFG+GATA+ LVPLNDCPRHS+Y+DG+FV  DG+P  QP++ICVFERY+GDI+W
Sbjct  365   SYMDAGEFGMGATALSLVPLNDCPRHSYYMDGIFVSWDGKPYVQPSIICVFERYAGDISW  424

Query  1027  RHSGTGDADDDLIREARPKVSLVVRTTATVGNYDYIFDWEFQTDGSIRVTVGLSGIILAK  848
             RHS     +   IREARPKVSLV R  A+VGNYDYIFDWEFQ DG I V V LSG+++ K
Sbjct  425   RHSEI-PVNGFNIREARPKVSLVARMAASVGNYDYIFDWEFQADGLIHVAVSLSGMLMVK  483

Query  847   GSPYEHINQFEIPRWDFPAGSLVSENTIGVAHDHFITFHLDMDVDGPTNSFVKVDLVKNY  668
             G+P++  +Q  IP  +  +G L+SEN IGV HDHFITFHLDMD+D   N+FVKVDLVK  
Sbjct  484   GTPHQTADQ--IPNQEAASGPLISENLIGVVHDHFITFHLDMDIDDTNNTFVKVDLVKEE  541

Query  667   NIAGKIQRKSYWSPKRKVAKSENDAKIKLQLDKPSEFHVINPRHQSRLGNPSGYKIVPSA  488
                G+  RKSY   KR  AK+E+DA+IKL+L +PSEFHVINP  +SRLGNP+GYKIVP  
Sbjct  542   TFPGQSPRKSYLKAKRNTAKTEDDARIKLKLYEPSEFHVINPSRRSRLGNPAGYKIVPGG  601

Query  487   TAASLLDLQDPPQLRAAFTNNQIWVTPYNRSEQWAGGLFTYQSHGDDTLAVWS-NRNRVI  311
              AASLLD  DPPQLR+AFTNNQIWVTP+NR+EQWAGGLFTYQS GDDTLA WS +RNR I
Sbjct  602   NAASLLDHLDPPQLRSAFTNNQIWVTPFNRNEQWAGGLFTYQSKGDDTLAAWSKSRNRAI  661

Query  310   EKQDIVLWYTLGFHHLPCQEDFPVMPTVTSTFQLKPVNFFDRNPIIQANPNFAEDLPICR  131
             E +DIVLWYTLGFHH+PCQEDFP+MPTV+S+F+LKPVNFF+ NPI++A P   EDLP+CR
Sbjct  662   ENKDIVLWYTLGFHHIPCQEDFPIMPTVSSSFELKPVNFFESNPILKAAPMSEEDLPVCR  721



>ref|XP_011018230.1| PREDICTED: primary amine oxidase-like isoform X1 [Populus euphratica]
Length=726

 Score =   873 bits (2255),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 413/660 (63%), Positives = 509/660 (77%), Gaps = 5/660 (1%)
 Frame = -1

Query  2107  NHFADRPMHPLDPLTIQEIERTRSILSSYQPFSGSSLRIHSLSLDEPDKSEVLRWKRGNP  1928
             +H  D P HPLDPLT++EI + R+ILS+Y P   S   IHSLSLDEP K  VL+WK G+P
Sbjct  66    DHMEDFPHHPLDPLTMREIYKVRTILSTYPPLLPSFPAIHSLSLDEPHKDLVLKWKEGDP  125

Query  1927  LPTRKAFVVALSNGQAHLLVVDLGSGRVSSHTRNPASGYPPMSADDASTALEATFSNSVF  1748
             LP RKA V+AL NGQ+H+L VDL  G V+S+  N  SGYP +  +D S A++   S+   
Sbjct  126   LPPRKALVIALLNGQSHVLSVDLDLGLVTSNKINHGSGYPMLMMNDISVAMQVALSHKEL  185

Query  1747  REAISTRGVEINDVVCSAAAPGWFGPEEEGRRITKVKCYTAQNTPNYYMRPIEGLLLTVD  1568
              ++   RG+ ++D+ C   + GWFGP EEGRRI KV+C++ Q TPN+YMRP+EGL +TVD
Sbjct  186   NKSTIKRGISLSDLTCVTPSAGWFGPNEEGRRIIKVQCFSNQGTPNFYMRPLEGLTMTVD  245

Query  1567  LDSGKVINVYDTHSPIPIPKAQGTDYRRDGIEHRAPGVEPLKPISMEQPNGQSFRVEDGY  1388
             +D  +V+   DT   IP+PK   TDYR    +   P ++P+ PIS+EQP G SF VEDG+
Sbjct  246   IDQKEVVKFTDTGGGIPVPKGTDTDYRFKA-QKEPPKMKPINPISIEQPFGPSFTVEDGH  304

Query  1387  IVKWASWEFHVKADQRAGIIISQATVFDPEAGKRRSVMYKGFASELFVPYMDVDEGWYFR  1208
             IVKWA+WEFH+KADQRAGI+IS+A + D E G  RSVMYKGF+SELFVPYMD DE WYF+
Sbjct  305   IVKWANWEFHLKADQRAGIVISRAMISDSETGVPRSVMYKGFSSELFVPYMDPDENWYFK  364

Query  1207  AFMDAGEFGLGATAMELVPLNDCPRHSHYIDGLFVDPDGRPVSQPNVICVFERYSGDIAW  1028
             ++MDAGEFG+GATA+ LVPLNDCPRHS+Y+DG+FV  DG+P  QP++ICVFERY+GDI+W
Sbjct  365   SYMDAGEFGMGATALSLVPLNDCPRHSYYMDGIFVSWDGKPYVQPSIICVFERYAGDISW  424

Query  1027  RHSGTGDADDDLIREARPKVSLVVRTTATVGNYDYIFDWEFQTDGSIRVTVGLSGIILAK  848
             RHS     +   IREARPKVSLV R  A+VGNYDYIFDWEFQ DG I V V LSG+++ K
Sbjct  425   RHSEI-PVNGFNIREARPKVSLVARMAASVGNYDYIFDWEFQADGLIHVAVSLSGMLMVK  483

Query  847   GSPYEHINQFEIPRWDFPAGSLVSENTIGVAHDHFITFHLDMDVDGPTNSFVKVDLVKNY  668
             G+P++  +Q  IP  +  +G L+SEN IGV HDHFITFHLDMD+D   N+FVKVDLVK  
Sbjct  484   GTPHQTADQ--IPNQEAASGPLISENLIGVVHDHFITFHLDMDIDDTNNTFVKVDLVKEE  541

Query  667   NIAGKIQRKSYWSPKRKVAKSENDAKIKLQLDKPSEFHVINPRHQSRLGNPSGYKIVPSA  488
                G+  RKSY   KR  AK+E+DA+IKL+L +PSEFHVINP  +SRLGNP+GYKIVP  
Sbjct  542   TFPGQSPRKSYLKAKRNTAKTEDDARIKLKLYEPSEFHVINPSRRSRLGNPAGYKIVPGG  601

Query  487   TAASLLDLQDPPQLRAAFTNNQIWVTPYNRSEQWAGGLFTYQSHGDDTLAVWS-NRNRVI  311
              AASLLD  DPPQLR+AFTNNQIWVTP+NR+EQWAGGLFTYQS GDDTLA WS +RNR I
Sbjct  602   NAASLLDHLDPPQLRSAFTNNQIWVTPFNRNEQWAGGLFTYQSKGDDTLAAWSKSRNRAI  661

Query  310   EKQDIVLWYTLGFHHLPCQEDFPVMPTVTSTFQLKPVNFFDRNPIIQANPNFAEDLPICR  131
             E +DIVLWYTLGFHH+PCQEDFP+MPTV+S+F+LKPVNFF+ NPI++A P   EDLP+CR
Sbjct  662   ENKDIVLWYTLGFHHIPCQEDFPIMPTVSSSFELKPVNFFESNPILKAAPMSEEDLPVCR  721



>ref|XP_002509597.1| Amine oxidase [copper-containing] precursor, putative [Ricinus 
communis]
 gb|EEF50984.1| Amine oxidase [copper-containing] precursor, putative [Ricinus 
communis]
Length=718

 Score =   872 bits (2254),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 403/658 (61%), Positives = 508/658 (77%), Gaps = 4/658 (1%)
 Frame = -1

Query  2104  HFADRPMHPLDPLTIQEIERTRSILSSYQPFSGSSLRIHSLSLDEPDKSEVLRWKRGNPL  1925
             +F + P HPLDPLT+QEI + ++ILSSYQPF  +   IHSLSLDEPDKS VL WK G+P 
Sbjct  58    YFTETPHHPLDPLTVQEINKVKAILSSYQPFWYAFPAIHSLSLDEPDKSLVLEWKEGDPF  117

Query  1924  PTRKAFVVALSNGQAHLLVVDLGSGRVSSHTRNPASGYPPMSADDASTALEATFSNSVFR  1745
             P RKA V+AL NGQ+H+L VDL   +V +H  NP SGYP +S++D S A++   S     
Sbjct  118   PPRKALVIALFNGQSHVLAVDLDLCQVMNHEINPYSGYPMLSSEDTSAAIQVALSYQELN  177

Query  1744  EAISTRGVEINDVVCSAAAPGWFGPEEEGRRITKVKCYTAQNTPNYYMRPIEGLLLTVDL  1565
             +++  RG+  +D+ C   +PGWFGP+EEG+R+ KV+CY+ Q+T N+YMRP+EGL +TVDL
Sbjct  178   QSVMARGMSFSDLYCITPSPGWFGPDEEGKRVAKVQCYSCQDTANFYMRPLEGLTITVDL  237

Query  1564  DSGKVINVYDTHSPIPIPKAQGTDYRRDGIEHRAP-GVEPLKPISMEQPNGQSFRVEDGY  1388
             +  +V+   D    IPIPKA  TDYR    +   P  +EP+ PIS+EQP G SF +E+G+
Sbjct  238   EKKQVVKFSDIGRGIPIPKATNTDYRYAAQDKYKPIEMEPINPISIEQPKGPSFSLENGH  297

Query  1387  IVKWASWEFHVKADQRAGIIISQATVFDPEAGKRRSVMYKGFASELFVPYMDVDEGWYFR  1208
             IVKWA+W FH+KADQRAG++IS+A + D E G  RSVMYKGF+SELFVPYMD D+ WYF+
Sbjct  298   IVKWANWVFHLKADQRAGLVISRAMIKDSETGVLRSVMYKGFSSELFVPYMDPDQNWYFK  357

Query  1207  AFMDAGEFGLGATAMELVPLNDCPRHSHYIDGLFVDPDGRPVSQPNVICVFERYSGDIAW  1028
             ++MDAGEFGLG TAM LVPLNDCPR+S+Y+DG FV  DGRP+ QPN+ICVFERY+GDI+W
Sbjct  358   SYMDAGEFGLGVTAMSLVPLNDCPRYSYYMDGTFVSSDGRPIIQPNMICVFERYAGDISW  417

Query  1027  RHSGTGDADDDLIREARPKVSLVVRTTATVGNYDYIFDWEFQTDGSIRVTVGLSGIILAK  848
             RHS     +D+ IREARPKV+LV R  A++ NYDYIFDWEFQTDG IR+ V LSG+++ K
Sbjct  418   RHSQFSPNNDE-IREARPKVTLVARMAASLANYDYIFDWEFQTDGLIRIKVSLSGMLMVK  476

Query  847   GSPYEHINQFEIPRWDFPAGSLVSENTIGVAHDHFITFHLDMDVDGPTNSFVKVDLVKNY  668
             G+PY+++  ++I   +  +  L+SEN IGV HDHFI FHLDMD+D   NSFV+++LVK  
Sbjct  477   GTPYQNV--YQILNQEEMSNPLISENVIGVVHDHFINFHLDMDIDDINNSFVEINLVKEE  534

Query  667   NIAGKIQRKSYWSPKRKVAKSENDAKIKLQLDKPSEFHVINPRHQSRLGNPSGYKIVPSA  488
                G+  RKSY   KRK+AK+E +A++KL L  PSEF VINP  +SRLGNP+GYK+VP +
Sbjct  535   TFPGESPRKSYLKAKRKIAKTEEEARVKLNLYDPSEFQVINPSRRSRLGNPAGYKVVPGS  594

Query  487   TAASLLDLQDPPQLRAAFTNNQIWVTPYNRSEQWAGGLFTYQSHGDDTLAVWSNRNRVIE  308
              AASLLD  DPPQLR+AFTNNQIWVTPYNR+EQWAGGL  YQS GDDTL VWS RNR IE
Sbjct  595   NAASLLDHLDPPQLRSAFTNNQIWVTPYNRNEQWAGGLLVYQSKGDDTLDVWSQRNRDIE  654

Query  307   KQDIVLWYTLGFHHLPCQEDFPVMPTVTSTFQLKPVNFFDRNPIIQANPNFAEDLPIC  134
              +DIVLWYTLGFHH+PCQEDFPVMP V+S+F+LKPVNFF+ NPI++A P F  DLP+C
Sbjct  655   NKDIVLWYTLGFHHIPCQEDFPVMPVVSSSFELKPVNFFESNPILRAAPMFESDLPVC  712



>ref|XP_010276880.1| PREDICTED: primary amine oxidase-like [Nelumbo nucifera]
Length=726

 Score =   866 bits (2237),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 413/663 (62%), Positives = 516/663 (78%), Gaps = 6/663 (1%)
 Frame = -1

Query  2107  NHFADRPMHPLDPLTIQEIERTRSILSSYQPFSGSSLR--IHSLSLDEPDKSEVLRWKRG  1934
             +H  + P HPLDPLT QEI   R+ILSSY PF+ SS    IH ++LDEPDKS VLRWK+G
Sbjct  65    DHLTESPHHPLDPLTFQEINLVRAILSSYPPFASSSPSPSIHYVALDEPDKSIVLRWKKG  124

Query  1933  NPLPTRKAFVVALSNGQAHLLVVDLGSGRVSSHTRNPASGYPPMSADDASTALEATFSNS  1754
             +PLP RKA VVAL NGQ+H+L V L S +V+ H  NPASGYP ++ DD +  L  T +N 
Sbjct  125   DPLPPRKATVVALLNGQSHILTVCLESNQVAGHVTNPASGYPSLTVDDMAGVLNVTLANR  184

Query  1753  VFREAISTRGVEINDVVCSAAAPGWFGPEEEGRRITKVKCYTAQNTPNYYMRPIEGLLLT  1574
                  I+ RGV++++V C   + GW+G  E+GRR+ KV+C+++  T N+YMRPIEGL +T
Sbjct  185   EVGRIITARGVDLSNVACIPLSTGWYGASEDGRRVLKVQCFSSHGTANFYMRPIEGLTVT  244

Query  1573  VDLDSGKVINVYDTHSPIPIPKAQGTDYRRDGIEHRAPGVEPLKPISMEQPNGQSFRVED  1394
             VD+D+ ++I++ +T   IPIP+A GTDYR    + + P  + L PISMEQP G SF VED
Sbjct  245   VDVDAREIIHISNTGQGIPIPQAAGTDYRYQA-QKKKPLHQQLNPISMEQPRGPSFSVED  303

Query  1393  GYIVKWASWEFHVKADQRAGIIISQATVFDPEAGKRRSVMYKGFASELFVPYMDVDEGWY  1214
             G+I+KWA+WEFH+KADQRAG+I+S+A V+D +  + RSVMYKGF+SELFVPYMD  +GWY
Sbjct  304   GHIIKWANWEFHLKADQRAGVIVSRAMVWDSDRERLRSVMYKGFSSELFVPYMDPSDGWY  363

Query  1213  FRAFMDAGEFGLGATAMELVPLNDCPRHSHYIDGLFVDPDGRPVSQPNVICVFERYSGDI  1034
             F+ +MDAGE+G+G TAM LVPLNDCPR SHY+DG+FV PDG P  Q N++CVFERYSGDI
Sbjct  364   FKTYMDAGEYGMGFTAMPLVPLNDCPRQSHYMDGVFVGPDGNPYVQSNMVCVFERYSGDI  423

Query  1033  AWRHSGTGDADDDLIREARPKVSLVVRTTATVGNYDYIFDWEFQTDGSIRVTVGLSGIIL  854
             AWRHS +     + IRE+RPKV+LVVR  A+VGNYDYI DWEFQTDG IR+ V LSG+++
Sbjct  424   AWRHSESPITGME-IRESRPKVTLVVRMAASVGNYDYIIDWEFQTDGLIRIKVALSGMLM  482

Query  853   AKGSPYEHINQFEIPRWDFPAGSLVSENTIGVAHDHFITFHLDMDVDGPTNSFVKVDLVK  674
              K + Y+++NQ  +   ++ AG+LVSEN IGV HDH++TF+LDMD+DGP NSFVK++LVK
Sbjct  483   VKATAYQNLNQ--VAEQEYIAGTLVSENLIGVVHDHYVTFYLDMDIDGPDNSFVKMNLVK  540

Query  673   NYNIAGKIQRKSYWSPKRKVAKSENDAKIKLQLDKPSEFHVINPRHQSRLGNPSGYKIVP  494
                  G+  RKSY   KR V+K+E DA+IKL+L  PSEFHV+NP   SR+GNP GYKIVP
Sbjct  541   EETTPGESPRKSYLKVKRHVSKTEKDAQIKLKLYDPSEFHVVNPSRPSRVGNPVGYKIVP  600

Query  493   SATAASLLDLQDPPQLRAAFTNNQIWVTPYNRSEQWAGGLFTYQSHGDDTLAVWSNRNRV  314
               TAASLLDL DPPQ R+AFTNNQIWVTPYNRSEQWA GL  YQS GDDTLAVWS RNR 
Sbjct  601   GGTAASLLDLDDPPQKRSAFTNNQIWVTPYNRSEQWASGLLAYQSKGDDTLAVWSARNRP  660

Query  313   IEKQDIVLWYTLGFHHLPCQEDFPVMPTVTSTFQLKPVNFFDRNPIIQANPNFAEDLPIC  134
             IE +DIV+WYTLGFHH+PCQEDFP+MPTV+S+F LKPVNFF+RNPI+QA P F +DLP+C
Sbjct  661   IEDRDIVVWYTLGFHHIPCQEDFPIMPTVSSSFDLKPVNFFERNPILQAQPRFPKDLPVC  720

Query  133   RAG  125
             RA 
Sbjct  721   RAA  723



>ref|XP_006300795.1| hypothetical protein CARUB_v10019874mg [Capsella rubella]
 gb|EOA33693.1| hypothetical protein CARUB_v10019874mg [Capsella rubella]
Length=712

 Score =   859 bits (2220),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 408/667 (61%), Positives = 509/667 (76%), Gaps = 7/667 (1%)
 Frame = -1

Query  2125  DFKIQNNHFADRPMHPLDPLTIQEIERTRSILSSYQP-FSGSSLRIHSLSLDEPDKSEVL  1949
             D +++ +H  ++P HPLDPLT++EIER R++LS Y P F   S  +HS++LDEPDK+ V+
Sbjct  46    DPRVRFDHSTEKPHHPLDPLTVREIERVRTVLSGYDPGFGTGSATVHSMALDEPDKTRVV  105

Query  1948  RWKRGNPLPTRKAFVVALSNGQAHLLVVDLGSGRVSSHTRNPASGYPPMSADDASTALEA  1769
             +WK+GN LP+R+A VVA   GQ H + VDL SGRV S   NP SGYP ++ +D   A + 
Sbjct  106   QWKKGNKLPSRRAAVVAYWGGQTHEITVDLDSGRVVSDLVNPTSGYPILTVNDVYAAAQV  165

Query  1768  TFSNSVFREAISTRGVEINDVVCSAAAPGWFGPEEEGRRITKVKCYTAQNTPNYYMRPIE  1589
                +  F  +I  RGV+ +D+VC     GWFGPEEEGRR+ +V+CYT Q T NY+MRP+E
Sbjct  166   PLKSVEFNRSIEARGVKFSDLVCITPFAGWFGPEEEGRRVIRVQCYTLQGTTNYFMRPLE  225

Query  1588  GLLLTVDLDSGKVINVYDTHSPIPIPKAQGTDYRRDGIEHRAPGVEPLKPISMEQPNGQS  1409
             GL +TVDLD  +VI + D   PI IPKA GT+YR  G+ ++   ++ + PISMEQP+G S
Sbjct  226   GLHVTVDLDKLEVIKIVDK-GPITIPKASGTEYRF-GVHNKPVHMDRVNPISMEQPDGPS  283

Query  1408  FRVEDGYIVKWASWEFHVKADQRAGIIISQATVFDPEAGKRRSVMYKGFASELFVPYMDV  1229
             FRVEDG++VKWA+WEFH+KADQRAG+IISQATV D E GK RSVMYKGF SELFVPYMD 
Sbjct  284   FRVEDGHLVKWANWEFHIKADQRAGMIISQATVRDSETGKPRSVMYKGFPSELFVPYMDP  343

Query  1228  DEGWYFRAFMDAGEFGLGATAMELVPLNDCPRHSHYIDGLFVDPDGRPVSQPNVICVFER  1049
             +EGWY++ +MDAGE GLG TAM LVPLNDCPR+++YIDG+F   DGRP+ QPN+IC+FER
Sbjct  344   EEGWYYKGYMDAGEIGLGPTAMPLVPLNDCPRNAYYIDGVFASADGRPLVQPNMICLFER  403

Query  1048  YSGDIAWRHSGTGDADDDLIREARPKVSLVVRTTATVGNYDYIFDWEFQTDGSIRVTVGL  869
             Y+GDI+WRHS     D D +RE+RPKV+LV R   TVGNYDYIFDWEFQTDG IRVTV  
Sbjct  404   YAGDISWRHSEILFTDAD-VRESRPKVTLVARMATTVGNYDYIFDWEFQTDGLIRVTVAA  462

Query  868   SGIILAKGSPYEHINQFEIPRWDFPAGSLVSENTIGVAHDHFITFHLDMDVDGPTN-SFV  692
             SG+++ KG+PYE+++       D  AG L+SEN IGV HDHFITFHLDMD+DGP N S V
Sbjct  463   SGMLMVKGTPYENVDDLGDKEDD--AGPLISENVIGVVHDHFITFHLDMDIDGPANNSLV  520

Query  691   KVDLVKNYNIAGKIQRKSYWSPKRKVAKSENDAKIKLQLDKPSEFHVINPRHQSRLGNPS  512
             KV L K     GK  RKSY   K+ +AK+E DA+IKL L  P EFH++NP  +SR+GNP+
Sbjct  521   KVHLEKTRVPKGKSPRKSYLKVKKYIAKTEKDAQIKLSLYDPYEFHIVNPNRKSRVGNPA  580

Query  511   GYKIVPSATAASLLDLQDPPQLRAAFTNNQIWVTPYNRSEQWAGGLFTYQSHGDDTLAVW  332
             GY+I+P   AASLLD  DPPQ+R AFTNNQIWVTPYNRSEQ+AGG+  YQSHGDD L VW
Sbjct  581   GYRIIPGGNAASLLDHDDPPQIRGAFTNNQIWVTPYNRSEQYAGGVLIYQSHGDDNLQVW  640

Query  331   SNRNRVIEKQDIVLWYTLGFHHLPCQEDFPVMPTVTSTFQLKPVNFFDRNPIIQANPNFA  152
             S+R+R IE +DIVLWYTLGFHH+PCQED+PVMPTV ++F+LKP NFFD NPI+   P F 
Sbjct  641   SDRDRPIENKDIVLWYTLGFHHVPCQEDYPVMPTVAASFELKPANFFDSNPILGVAPFFD  700

Query  151   EDLPICR  131
             +DLP+C+
Sbjct  701   KDLPVCK  707



>ref|XP_010473504.1| PREDICTED: primary amine oxidase-like [Camelina sativa]
Length=712

 Score =   858 bits (2217),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 406/667 (61%), Positives = 511/667 (77%), Gaps = 7/667 (1%)
 Frame = -1

Query  2125  DFKIQNNHFADRPMHPLDPLTIQEIERTRSILSSYQP-FSGSSLRIHSLSLDEPDKSEVL  1949
             D +++ +H  ++P HPLDPLT++EIER R+ILS Y P F   S  IHS++LDEP+K  V+
Sbjct  46    DPRVRVDHSTEKPRHPLDPLTVREIERVRTILSGYDPGFGSGSATIHSMALDEPEKRRVV  105

Query  1948  RWKRGNPLPTRKAFVVALSNGQAHLLVVDLGSGRVSSHTRNPASGYPPMSADDASTALEA  1769
             +WK+GN LP+R+A VVA   GQAH + VDL SGRV S   NP SGYP ++ +D   A + 
Sbjct  106   KWKKGNKLPSRRAAVVAYWGGQAHEITVDLDSGRVVSDLVNPTSGYPILTLNDVFAASQV  165

Query  1768  TFSNSVFREAISTRGVEINDVVCSAAAPGWFGPEEEGRRITKVKCYTAQNTPNYYMRPIE  1589
                +  F  +I  RGV+ +D+VC     GWFGPEEEGRR+ +V+CYT Q T NY+MRP+E
Sbjct  166   PLESVEFNRSIEARGVKFSDLVCITPFAGWFGPEEEGRRVIRVQCYTLQGTTNYFMRPLE  225

Query  1588  GLLLTVDLDSGKVINVYDTHSPIPIPKAQGTDYRRDGIEHRAPGVEPLKPISMEQPNGQS  1409
             GL + VD+D  +VI + D   PI IPKA GT+YR  GI+++   ++ + PISMEQP+G S
Sbjct  226   GLYVMVDIDKLEVIKIID-KGPITIPKASGTEYRF-GIQNKPVHMDRINPISMEQPDGPS  283

Query  1408  FRVEDGYIVKWASWEFHVKADQRAGIIISQATVFDPEAGKRRSVMYKGFASELFVPYMDV  1229
             FRVEDG++VKWA+W+FH+KADQRAG+IISQATV D E G+ RSVMYKGF SELFVPYMD 
Sbjct  284   FRVEDGHLVKWANWQFHIKADQRAGMIISQATVRDSETGEPRSVMYKGFPSELFVPYMDP  343

Query  1228  DEGWYFRAFMDAGEFGLGATAMELVPLNDCPRHSHYIDGLFVDPDGRPVSQPNVICVFER  1049
             +EGWY++ +MDAGE GLG TAM LVPLNDCPR+++YIDG+F  PDG+ + QPN+IC+FER
Sbjct  344   EEGWYYKGYMDAGELGLGPTAMPLVPLNDCPRNAYYIDGVFASPDGKAIVQPNMICLFER  403

Query  1048  YSGDIAWRHSGTGDADDDLIREARPKVSLVVRTTATVGNYDYIFDWEFQTDGSIRVTVGL  869
             Y+GDI+WRH+    +D D +RE+RPKV+LV R   +VGNYDYIFDWEFQTDG IRVTV  
Sbjct  404   YAGDISWRHTEIVFSDAD-VRESRPKVTLVARMATSVGNYDYIFDWEFQTDGLIRVTVAA  462

Query  868   SGIILAKGSPYEHINQFEIPRWDFPAGSLVSENTIGVAHDHFITFHLDMDVDGPTN-SFV  692
             SG+++ KG+PYE++        D  AG L+SEN IGV HDHFITFHLDMD+DGPTN S V
Sbjct  463   SGMLMVKGTPYENVEDLGDKEDD--AGPLISENVIGVVHDHFITFHLDMDIDGPTNNSLV  520

Query  691   KVDLVKNYNIAGKIQRKSYWSPKRKVAKSENDAKIKLQLDKPSEFHVINPRHQSRLGNPS  512
             KV L K     GK  RKSY   K+ +AK+E DA+IKL L  P EFH++NP  +SR+GNP+
Sbjct  521   KVHLEKKRVPTGKSPRKSYLKVKKYIAKTEKDAQIKLSLYDPYEFHIVNPNRKSRVGNPA  580

Query  511   GYKIVPSATAASLLDLQDPPQLRAAFTNNQIWVTPYNRSEQWAGGLFTYQSHGDDTLAVW  332
             GY+I+P   AASLLD  DPPQ+R AFTNNQIWVTPYNRSEQ+AGG+  YQSHGDDTL VW
Sbjct  581   GYRIIPGGNAASLLDHDDPPQIRGAFTNNQIWVTPYNRSEQYAGGVLMYQSHGDDTLQVW  640

Query  331   SNRNRVIEKQDIVLWYTLGFHHLPCQEDFPVMPTVTSTFQLKPVNFFDRNPIIQANPNFA  152
             S+R+R IE +DIVLWYTLGFHH+PCQED+PVMPTV ++F+LKP NFFD NPI+   P F 
Sbjct  641   SDRDRPIENKDIVLWYTLGFHHVPCQEDYPVMPTVAASFELKPANFFDSNPILGLAPFFD  700

Query  151   EDLPICR  131
             +DLP+C+
Sbjct  701   KDLPVCK  707



>ref|XP_010430357.1| PREDICTED: primary amine oxidase [Camelina sativa]
Length=712

 Score =   855 bits (2209),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 403/667 (60%), Positives = 510/667 (76%), Gaps = 7/667 (1%)
 Frame = -1

Query  2125  DFKIQNNHFADRPMHPLDPLTIQEIERTRSILSSYQP-FSGSSLRIHSLSLDEPDKSEVL  1949
             D +++ +H  ++P HPLDPLT++EIER R+ILS Y P F   S  IHS++LDEP+K  V+
Sbjct  46    DPRVRVDHSTEKPRHPLDPLTVREIERVRTILSGYDPGFGSGSATIHSMALDEPEKRRVV  105

Query  1948  RWKRGNPLPTRKAFVVALSNGQAHLLVVDLGSGRVSSHTRNPASGYPPMSADDASTALEA  1769
             +WK+GN LP+R+A VVA   GQAH + VDL S RV S   N  SGYP ++ +D   A + 
Sbjct  106   KWKKGNKLPSRRAAVVAYWGGQAHEITVDLDSARVVSDLVNRTSGYPILTLNDVFAASQV  165

Query  1768  TFSNSVFREAISTRGVEINDVVCSAAAPGWFGPEEEGRRITKVKCYTAQNTPNYYMRPIE  1589
                +  F  +I  RGV+ +D+VC     GWFGPEEEGRR+ +V+CYT Q T NY+MRP+E
Sbjct  166   PLKSVEFNRSIEARGVKFSDLVCITPFAGWFGPEEEGRRVIRVQCYTLQGTTNYFMRPLE  225

Query  1588  GLLLTVDLDSGKVINVYDTHSPIPIPKAQGTDYRRDGIEHRAPGVEPLKPISMEQPNGQS  1409
             GL + VD+D  +VI + D   PI IPKA GT+YR  G++++   ++P+ PISMEQP+G S
Sbjct  226   GLYVMVDMDKLEVIKIID-KGPITIPKASGTEYRF-GVQNKPVHMDPINPISMEQPDGPS  283

Query  1408  FRVEDGYIVKWASWEFHVKADQRAGIIISQATVFDPEAGKRRSVMYKGFASELFVPYMDV  1229
             FRVEDG++V WA+W+FH+KADQRAG+IISQATV D E G+ RSVMYKGF SELFVPYMD 
Sbjct  284   FRVEDGHLVNWANWQFHIKADQRAGMIISQATVRDSETGEPRSVMYKGFPSELFVPYMDP  343

Query  1228  DEGWYFRAFMDAGEFGLGATAMELVPLNDCPRHSHYIDGLFVDPDGRPVSQPNVICVFER  1049
             +EGWY++ +MDAGE GLG TAM LVPLNDCPR+++YIDG+F  PDG+ + QPN+IC+FER
Sbjct  344   EEGWYYKGYMDAGELGLGPTAMPLVPLNDCPRNAYYIDGVFASPDGKAIVQPNMICLFER  403

Query  1048  YSGDIAWRHSGTGDADDDLIREARPKVSLVVRTTATVGNYDYIFDWEFQTDGSIRVTVGL  869
             Y+GDI+WRH+    +D D +RE+RPKV+LV R   +VGNYDYIFDWEFQTDG IRVTV  
Sbjct  404   YAGDISWRHTEILFSDAD-VRESRPKVTLVARMATSVGNYDYIFDWEFQTDGLIRVTVAA  462

Query  868   SGIILAKGSPYEHINQFEIPRWDFPAGSLVSENTIGVAHDHFITFHLDMDVDGPTN-SFV  692
             SG+++ KG+PYE+++       D  AG L+SEN IGV HDHFITFHLDMD+DGPTN S V
Sbjct  463   SGMLMVKGTPYENVDDLGDKEDD--AGPLISENVIGVVHDHFITFHLDMDIDGPTNNSLV  520

Query  691   KVDLVKNYNIAGKIQRKSYWSPKRKVAKSENDAKIKLQLDKPSEFHVINPRHQSRLGNPS  512
             KV L K     GK  RKSY   K+ +AK+E DA+IKL L  P EFH++NP  +SR+GNP+
Sbjct  521   KVHLEKKRVPTGKSPRKSYLKVKKYIAKTEKDAQIKLSLYDPYEFHIVNPNRKSRVGNPA  580

Query  511   GYKIVPSATAASLLDLQDPPQLRAAFTNNQIWVTPYNRSEQWAGGLFTYQSHGDDTLAVW  332
             GY+I+P   AASLLD  DPPQ+R AFTNNQIWVTPYNRSEQ+AGG+  YQSHGDDTL VW
Sbjct  581   GYRIIPGGNAASLLDRDDPPQIRGAFTNNQIWVTPYNRSEQYAGGILMYQSHGDDTLQVW  640

Query  331   SNRNRVIEKQDIVLWYTLGFHHLPCQEDFPVMPTVTSTFQLKPVNFFDRNPIIQANPNFA  152
             S+R+R IE +DIVLWYTLGFHH+PCQED+PVMPTV ++F+LKP NFFD NPI+   P F 
Sbjct  641   SDRDRPIENKDIVLWYTLGFHHVPCQEDYPVMPTVAASFELKPANFFDSNPILGLAPFFD  700

Query  151   EDLPICR  131
             +DLP+C+
Sbjct  701   KDLPVCK  707



>gb|KFK40561.1| hypothetical protein AALP_AA2G011900 [Arabis alpina]
Length=712

 Score =   852 bits (2202),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 404/665 (61%), Positives = 514/665 (77%), Gaps = 7/665 (1%)
 Frame = -1

Query  2119  KIQNNHFADRPMHPLDPLTIQEIERTRSILSSYQP-FSGSSLRIHSLSLDEPDKSEVLRW  1943
             ++  +H  + P HPLDPLT+ EI++ RSIL  + P FS  S  IHS++LDEPDK+ V++W
Sbjct  48    RVHVDHSTETPHHPLDPLTVLEIKKVRSILLDHDPGFSSGSATIHSMALDEPDKTRVVQW  107

Query  1942  KRGNPLPTRKAFVVALSNGQAHLLVVDLGSGRVSSHTRNPASGYPPMSADDASTALEATF  1763
             K+GN LP+R+A V+A S+GQ H+L VDL SGRV S   NP SGYP ++  +A  A E  F
Sbjct  108   KKGNRLPSRRAEVIAFSSGQTHVLTVDLDSGRVISDVVNPTSGYPILTMYEAFAASEVPF  167

Query  1762  SNSVFREAISTRGVEINDVVCSAAAPGWFGPEEEGRRITKVKCYTAQNTPNYYMRPIEGL  1583
              +  F  +I  RGV+ +D+ C     GWFGPEEEGRRI KV+CYT+++T NY+MRPIEGL
Sbjct  168   KSVEFNRSIEARGVKFSDLACITPFAGWFGPEEEGRRIIKVQCYTSEDTTNYFMRPIEGL  227

Query  1582  LLTVDLDSGKVINVYDTHSPIPIPKAQGTDYRRDGIEHRAPGVEPLKPISMEQPNGQSFR  1403
              +TVD+D  +VI V D   P+PIPKA GT+YR  G++++   ++ + PISMEQP+G SFR
Sbjct  228   YVTVDIDKLEVIKVIDK-GPVPIPKAAGTEYRF-GVQNKPVHMDRINPISMEQPDGPSFR  285

Query  1402  VEDGYIVKWASWEFHVKADQRAGIIISQATVFDPEAGKRRSVMYKGFASELFVPYMDVDE  1223
             VEDG+++KWA+W FHVKADQRAGIIISQATV D E G+ RSVMYKGF SELFVPYMD +E
Sbjct  286   VEDGHLIKWANWVFHVKADQRAGIIISQATVRDSETGEPRSVMYKGFPSELFVPYMDPEE  345

Query  1222  GWYFRAFMDAGEFGLGATAMELVPLNDCPRHSHYIDGLFVDPDGRPVSQPNVICVFERYS  1043
             GWY++ +MDAGE GLG TAM LVPLNDCPR+++YIDG+F  PDG+ + QPN+IC+FERY+
Sbjct  346   GWYYKTYMDAGELGLGPTAMSLVPLNDCPRNAYYIDGVFATPDGKAIVQPNMICLFERYA  405

Query  1042  GDIAWRHSGTGDADDDLIREARPKVSLVVRTTATVGNYDYIFDWEFQTDGSIRVTVGLSG  863
             GDI+WRHS     + D IRE+RPKV+LV R   +VGNYDYIFDWEFQTDG IRVTV  +G
Sbjct  406   GDISWRHSELFFTNAD-IRESRPKVTLVARMITSVGNYDYIFDWEFQTDGLIRVTVAATG  464

Query  862   IILAKGSPYEHINQFEIPRWDFPAGSLVSENTIGVAHDHFITFHLDMDVDGPTN-SFVKV  686
             +++ KG+PYE+++  ++   +  AG L+SEN IGV HDHFITFHLDMD+DGP+N S VKV
Sbjct  465   MLMVKGTPYENVD--DLGDKEDNAGPLISENVIGVVHDHFITFHLDMDIDGPSNNSLVKV  522

Query  685   DLVKNYNIAGKIQRKSYWSPKRKVAKSENDAKIKLQLDKPSEFHVINPRHQSRLGNPSGY  506
              L K     GK  RKSY   K+ VAK+E DA+IKL L  P EFH++NP  +SR+GNPSGY
Sbjct  523   HLEKQRVPTGKSPRKSYLKVKKYVAKTEKDAQIKLSLYDPYEFHIVNPNRRSRVGNPSGY  582

Query  505   KIVPSATAASLLDLQDPPQLRAAFTNNQIWVTPYNRSEQWAGGLFTYQSHGDDTLAVWSN  326
             +I+P   AA+LLD  DPPQ+R AFTNNQIW+T YNRSEQ+AGG+  YQSHG+DTL VWS+
Sbjct  583   RIIPGGNAANLLDHDDPPQIRGAFTNNQIWMTQYNRSEQYAGGVLIYQSHGEDTLQVWSD  642

Query  325   RNRVIEKQDIVLWYTLGFHHLPCQEDFPVMPTVTSTFQLKPVNFFDRNPIIQANPNFAED  146
             R+R IE +DIVLWYTLGFHH+PCQED+PVMPTV ++F+LKP NFF+ NP++   P F +D
Sbjct  643   RDRSIENKDIVLWYTLGFHHVPCQEDYPVMPTVAASFELKPANFFESNPVLGMAPFFDKD  702

Query  145   LPICR  131
             LP+CR
Sbjct  703   LPVCR  707



>ref|XP_006391818.1| hypothetical protein EUTSA_v10023306mg [Eutrema salsugineum]
 gb|ESQ29104.1| hypothetical protein EUTSA_v10023306mg [Eutrema salsugineum]
Length=712

 Score =   850 bits (2195),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 407/667 (61%), Positives = 510/667 (76%), Gaps = 7/667 (1%)
 Frame = -1

Query  2125  DFKIQNNHFADRPMHPLDPLTIQEIERTRSILSSYQP-FSGSSLRIHSLSLDEPDKSEVL  1949
             D K++ +H +D+P HPLDPLT++EIER RSILS + P F   S  IHS++LDEPDK+ V+
Sbjct  46    DPKLRVDHSSDKPHHPLDPLTVREIERVRSILSGHDPDFRSGSATIHSMALDEPDKARVV  105

Query  1948  RWKRGNPLPTRKAFVVALSNGQAHLLVVDLGSGRVSSHTRNPASGYPPMSADDASTALEA  1769
             RWK+GN LP+R+A VVALS G++H++ VDL SGRV S   NP+SGYP ++ DD   A + 
Sbjct  106   RWKKGNRLPSRRAEVVALSGGKSHVITVDLESGRVVSDLINPSSGYPILTMDDLIAASQV  165

Query  1768  TFSNSVFREAISTRGVEINDVVCSAAAPGWFGPEEEGRRITKVKCYTAQNTPNYYMRPIE  1589
              F +  F  +I  RGV+ +D+VC     GWFGPEEEGRRI +V+CYT+++TPNY+MRP+E
Sbjct  166   PFKSIEFNRSIEARGVKFSDLVCITPFAGWFGPEEEGRRIIRVQCYTSKDTPNYFMRPLE  225

Query  1588  GLLLTVDLDSGKVINVYDTHSPIPIPKAQGTDYRRDGIEHRAPGVEPLKPISMEQPNGQS  1409
             GL   VD++  +VI V D   P+PIPKA GT+YR   + ++   ++P+ PISMEQP G S
Sbjct  226   GLYAMVDMNKLEVIKVVDK-GPVPIPKAAGTEYRY-SVLNKPVHMDPINPISMEQPGGPS  283

Query  1408  FRVEDGYIVKWASWEFHVKADQRAGIIISQATVFDPEAGKRRSVMYKGFASELFVPYMDV  1229
             FRVE G++VKWA+W FHVKADQRAG+IISQATV D E G+ RSVMYKGF SELFVPYMD 
Sbjct  284   FRVEGGHLVKWANWVFHVKADQRAGMIISQATVRDSETGEPRSVMYKGFPSELFVPYMDP  343

Query  1228  DEGWYFRAFMDAGEFGLGATAMELVPLNDCPRHSHYIDGLFVDPDGRPVSQPNVICVFER  1049
             +E WY++ +MDAGE GLG  AM LVPLNDCPR+++YIDG+F  PDG+ + QPN+IC+FER
Sbjct  344   EELWYYKTYMDAGELGLGPPAMPLVPLNDCPRNAYYIDGIFASPDGKAIVQPNMICLFER  403

Query  1048  YSGDIAWRHSGTGDADDDLIREARPKVSLVVRTTATVGNYDYIFDWEFQTDGSIRVTVGL  869
             Y+GD++WRHS     + D I+EARPKV+LV R   +VGNYDYI DWEFQTDG IRVTV  
Sbjct  404   YAGDVSWRHSEILIPNVD-IKEARPKVTLVARMATSVGNYDYIVDWEFQTDGLIRVTVAA  462

Query  868   SGIILAKGSPYEHINQFEIPRWDFPAGSLVSENTIGVAHDHFITFHLDMDVDGPTN-SFV  692
             SG+++ KG+PYE+++       D  +G L+SEN IGV HDHFITFHLDMD+DG TN S V
Sbjct  463   SGMLMVKGTPYENVDDLGDKEDD--SGPLISENVIGVVHDHFITFHLDMDIDGHTNNSLV  520

Query  691   KVDLVKNYNIAGKIQRKSYWSPKRKVAKSENDAKIKLQLDKPSEFHVINPRHQSRLGNPS  512
             K  L K     GK  RKSY   K+ VAK+E DA+IKL L  P EFH++NP  +SR+GNP+
Sbjct  521   KFHLEKQRIPTGKSPRKSYLKVKKYVAKTEKDAQIKLNLYDPYEFHIVNPNRKSRIGNPA  580

Query  511   GYKIVPSATAASLLDLQDPPQLRAAFTNNQIWVTPYNRSEQWAGGLFTYQSHGDDTLAVW  332
             GYKIVP   AASLLD  DPPQ+R AFTNNQIWVT YNRSEQ+AGG+  YQSHGDDTL VW
Sbjct  581   GYKIVPGGNAASLLDHDDPPQIRGAFTNNQIWVTQYNRSEQFAGGVLVYQSHGDDTLQVW  640

Query  331   SNRNRVIEKQDIVLWYTLGFHHLPCQEDFPVMPTVTSTFQLKPVNFFDRNPIIQANPNFA  152
             S+R+R IE +DIVLWYTLGFHH+PCQED+PVMPTV ++F+LKP NFF+ NPI+   P   
Sbjct  641   SDRDRSIENKDIVLWYTLGFHHVPCQEDYPVMPTVAASFELKPANFFETNPILGVAPFLE  700

Query  151   EDLPICR  131
             +DLP+CR
Sbjct  701   KDLPVCR  707



>ref|XP_010418280.1| PREDICTED: primary amine oxidase-like [Camelina sativa]
Length=712

 Score =   847 bits (2188),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 400/667 (60%), Positives = 507/667 (76%), Gaps = 7/667 (1%)
 Frame = -1

Query  2125  DFKIQNNHFADRPMHPLDPLTIQEIERTRSILSSYQP-FSGSSLRIHSLSLDEPDKSEVL  1949
             D +++ +H  ++P HPLDPLT++EIER R+IL  Y P F   S  IHS++LDEP+K  V+
Sbjct  46    DPRVRVDHSTEKPRHPLDPLTVREIERVRTILLGYDPGFGSGSATIHSMALDEPEKRRVV  105

Query  1948  RWKRGNPLPTRKAFVVALSNGQAHLLVVDLGSGRVSSHTRNPASGYPPMSADDASTALEA  1769
             +WK+GN LP+R+A VVA   GQAH + VDL S RV S   N  SGYP ++ +D   A + 
Sbjct  106   KWKKGNKLPSRRAAVVAYWGGQAHEITVDLDSARVVSDLVNRTSGYPILTLNDVFAASQV  165

Query  1768  TFSNSVFREAISTRGVEINDVVCSAAAPGWFGPEEEGRRITKVKCYTAQNTPNYYMRPIE  1589
                +  F  +I  RGV+ +D+VC     GWFGPEEEGRR+ +V+CYT Q T NY+MRP+E
Sbjct  166   PLKSVEFNRSIEARGVKFSDLVCITPFAGWFGPEEEGRRVIRVQCYTLQGTTNYFMRPLE  225

Query  1588  GLLLTVDLDSGKVINVYDTHSPIPIPKAQGTDYRRDGIEHRAPGVEPLKPISMEQPNGQS  1409
             GL + VD+D  +VI + D   PI IPKA GT+YR   ++++   ++ + PISMEQP+G S
Sbjct  226   GLYVMVDIDKLEVIKIIDK-GPITIPKASGTEYRF-AVQNKPVHMDRINPISMEQPDGPS  283

Query  1408  FRVEDGYIVKWASWEFHVKADQRAGIIISQATVFDPEAGKRRSVMYKGFASELFVPYMDV  1229
             FRVEDG++V WA+W+FH+KADQRAG+IISQATV D E G+ RSVMYKGF SELFVPYMD 
Sbjct  284   FRVEDGHLVNWANWQFHIKADQRAGMIISQATVRDSETGEARSVMYKGFPSELFVPYMDP  343

Query  1228  DEGWYFRAFMDAGEFGLGATAMELVPLNDCPRHSHYIDGLFVDPDGRPVSQPNVICVFER  1049
             +EGWY++ +MDAGE GLG TAM LVPLNDCPR+++YIDG+F  PDG+ + QPN+IC+FER
Sbjct  344   EEGWYYKGYMDAGELGLGPTAMPLVPLNDCPRNAYYIDGVFASPDGKAIVQPNMICLFER  403

Query  1048  YSGDIAWRHSGTGDADDDLIREARPKVSLVVRTTATVGNYDYIFDWEFQTDGSIRVTVGL  869
             Y+GDI+WRH+    +D D +RE+RPKV+LV R   +VGNYDYIFDWEFQTDG IRVTV  
Sbjct  404   YAGDISWRHTEIVFSDAD-VRESRPKVTLVARMATSVGNYDYIFDWEFQTDGLIRVTVAA  462

Query  868   SGIILAKGSPYEHINQFEIPRWDFPAGSLVSENTIGVAHDHFITFHLDMDVDGPTN-SFV  692
             SG+++ KG+PYE+++       D  AG L+SEN IGV HDHFITFHLDMD+DGPTN S V
Sbjct  463   SGMLMVKGTPYENVDDLGDKEDD--AGPLISENVIGVVHDHFITFHLDMDIDGPTNNSLV  520

Query  691   KVDLVKNYNIAGKIQRKSYWSPKRKVAKSENDAKIKLQLDKPSEFHVINPRHQSRLGNPS  512
             KV L K     GK  RKSY   K+ +AK+E DA+IKL L  P EFH++NP  +SR+GNP+
Sbjct  521   KVHLEKKRVHTGKSPRKSYLKVKKYIAKTEKDAQIKLSLYDPYEFHIVNPNRKSRVGNPA  580

Query  511   GYKIVPSATAASLLDLQDPPQLRAAFTNNQIWVTPYNRSEQWAGGLFTYQSHGDDTLAVW  332
             GY+I+P   AASLLD  DPPQ+R AFTNNQIWVTPYNRSEQ+AGG+  YQSHGDDTL VW
Sbjct  581   GYRIIPGGNAASLLDHDDPPQIRGAFTNNQIWVTPYNRSEQYAGGVLMYQSHGDDTLQVW  640

Query  331   SNRNRVIEKQDIVLWYTLGFHHLPCQEDFPVMPTVTSTFQLKPVNFFDRNPIIQANPNFA  152
             S+R+R IE +DIVLWYTLGFHH+PCQED+PVMPTV ++F+LKP NFFD NPI+   P F 
Sbjct  641   SDRDRPIENKDIVLWYTLGFHHVPCQEDYPVMPTVAASFELKPANFFDSNPILGLAPFFD  700

Query  151   EDLPICR  131
             +DLP+C+
Sbjct  701   KDLPVCK  707



>ref|NP_176469.1| copper amine oxidase 1 [Arabidopsis thaliana]
 sp|Q8H1H9.1|AMO_ARATH RecName: Full=Primary amine oxidase; AltName: Full=Amine oxidase 
[copper-containing]; Flags: Precursor [Arabidopsis thaliana]
 gb|AAN12916.1| At1g62810/F23N19_18 [Arabidopsis thaliana]
 gb|AEE34008.1| copper amine oxidase 1 [Arabidopsis thaliana]
Length=712

 Score =   844 bits (2180),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 403/665 (61%), Positives = 507/665 (76%), Gaps = 7/665 (1%)
 Frame = -1

Query  2119  KIQNNHFADRPMHPLDPLTIQEIERTRSILSSYQP-FSGSSLRIHSLSLDEPDKSEVLRW  1943
             ++  +H  ++P HPLDPLT++EI R R+ILS++ P F   S  IHS++LDEP+KS V++W
Sbjct  48    QVHVDHSLEKPHHPLDPLTVREINRVRTILSNHDPGFGSGSATIHSMALDEPEKSRVVQW  107

Query  1942  KRGNPLPTRKAFVVALSNGQAHLLVVDLGSGRVSSHTRNPASGYPPMSADDASTALEATF  1763
             K+GN L +R+A VVA   GQ H + VDL SGRV S   N  SGYP ++ +D   A +   
Sbjct  108   KKGNKLLSRRAAVVAYWGGQTHEITVDLDSGRVVSDVINRTSGYPILTLNDVFAASQVPL  167

Query  1762  SNSVFREAISTRGVEINDVVCSAAAPGWFGPEEEGRRITKVKCYTAQNTPNYYMRPIEGL  1583
              +  F  +I  RGV+ +D+ C     GWFG EEEGRR+ +V+C+T Q T NY+MRP+EGL
Sbjct  168   KSLEFNRSIEARGVKFSDLACITPFAGWFGSEEEGRRVIRVQCFTLQGTTNYFMRPLEGL  227

Query  1582  LLTVDLDSGKVINVYDTHSPIPIPKAQGTDYRRDGIEHRAPGVEPLKPISMEQPNGQSFR  1403
              +TVDLD  +VI + D   PIPIPKA GT+YR  G++++   ++ + PISMEQP+G SFR
Sbjct  228   YVTVDLDKLEVIKIIDK-GPIPIPKASGTEYRF-GVQNKPVHMDRINPISMEQPDGPSFR  285

Query  1402  VEDGYIVKWASWEFHVKADQRAGIIISQATVFDPEAGKRRSVMYKGFASELFVPYMDVDE  1223
             VEDG++VKWA+W FHVKADQRAG+IISQATV D E G+ RSVMYKGF SELFVPYMD +E
Sbjct  286   VEDGHLVKWANWVFHVKADQRAGMIISQATVRDSETGEPRSVMYKGFPSELFVPYMDPEE  345

Query  1222  GWYFRAFMDAGEFGLGATAMELVPLNDCPRHSHYIDGLFVDPDGRPVSQPNVICVFERYS  1043
             GWY++ +MDAGE GLG TAM LVPLNDCPR+S+YIDG+F  PDG+P+ QPN+IC+FERY+
Sbjct  346   GWYYKGYMDAGELGLGPTAMPLVPLNDCPRNSYYIDGVFASPDGKPIVQPNMICLFERYA  405

Query  1042  GDIAWRHSGTGDADDDLIREARPKVSLVVRTTATVGNYDYIFDWEFQTDGSIRVTVGLSG  863
             GDI+WRHS    A+ D IRE+RPKV+LV R   +VGNYDYIFDWEFQTDG IRVTV  SG
Sbjct  406   GDISWRHSEILFANAD-IRESRPKVTLVARMATSVGNYDYIFDWEFQTDGLIRVTVAASG  464

Query  862   IILAKGSPYEHINQFEIPRWDFPAGSLVSENTIGVAHDHFITFHLDMDVDGP-TNSFVKV  686
             +++ KG+PY++++       D  AG L+SEN IGV HDHFITFHLDMD+DGP  NS VKV
Sbjct  465   MLMVKGTPYDNVDDLGDREDD--AGPLISENVIGVVHDHFITFHLDMDIDGPMNNSLVKV  522

Query  685   DLVKNYNIAGKIQRKSYWSPKRKVAKSENDAKIKLQLDKPSEFHVINPRHQSRLGNPSGY  506
              L K     GK  RKSY   K+ +AK+E DA+IKL L  P EFH++NP  +SR+GNP+GY
Sbjct  523   HLEKQRVPTGKSPRKSYLKVKKYIAKTEKDAQIKLSLYDPYEFHIVNPNRKSRVGNPAGY  582

Query  505   KIVPSATAASLLDLQDPPQLRAAFTNNQIWVTPYNRSEQWAGGLFTYQSHGDDTLAVWSN  326
             +IVP   AASLLD  DPPQ+R AFTNNQIWVTPYNRSEQ+AGG+  YQS GDDTL VWS+
Sbjct  583   RIVPGGNAASLLDHDDPPQIRGAFTNNQIWVTPYNRSEQYAGGVLIYQSQGDDTLQVWSD  642

Query  325   RNRVIEKQDIVLWYTLGFHHLPCQEDFPVMPTVTSTFQLKPVNFFDRNPIIQANPNFAED  146
             R+R IE +DIVLWYTLGFHH+PCQED+PVMPTV ++F+LKP NFF+ NPI+ + P F +D
Sbjct  643   RDRSIENKDIVLWYTLGFHHVPCQEDYPVMPTVAASFELKPANFFESNPILGSAPFFEKD  702

Query  145   LPICR  131
             LP+CR
Sbjct  703   LPVCR  707



>ref|XP_009123407.1| PREDICTED: primary amine oxidase isoform X2 [Brassica rapa]
Length=712

 Score =   843 bits (2179),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 400/667 (60%), Positives = 510/667 (76%), Gaps = 7/667 (1%)
 Frame = -1

Query  2125  DFKIQNNHFADRPMHPLDPLTIQEIERTRSILSSYQP-FSGSSLRIHSLSLDEPDKSEVL  1949
             D K++ +H + +P HPLDPLT+QEIER R+IL  ++P F   S  IHS++LDEPDK+ V+
Sbjct  46    DPKLRVDHSSAKPHHPLDPLTVQEIERVRTILLDHEPGFGSGSATIHSMALDEPDKTLVV  105

Query  1948  RWKRGNPLPTRKAFVVALSNGQAHLLVVDLGSGRVSSHTRNPASGYPPMSADDASTALEA  1769
             +WK+GN LP+R+A V+ALS GQ+H++VVDL SGRV S   NP SGYP ++ DD   A + 
Sbjct  106   KWKKGNRLPSRRAEVLALSVGQSHVIVVDLDSGRVVSDVVNPTSGYPILTMDDLIVASQV  165

Query  1768  TFSNSVFREAISTRGVEINDVVCSAAAPGWFGPEEEGRRITKVKCYTAQNTPNYYMRPIE  1589
                +  F  ++  RGV+++D+V      GWFGPEEEGRRI KV+C+T+Q+TPNY+MRPIE
Sbjct  166   ALKSIEFNRSVEARGVKLSDLVALPTFTGWFGPEEEGRRILKVQCFTSQDTPNYFMRPIE  225

Query  1588  GLLLTVDLDSGKVINVYDTHSPIPIPKAQGTDYRRDGIEHRAPGVEPLKPISMEQPNGQS  1409
             GL  TVD+D  +VI + D    +PIPKA GT+YR + ++++   ++ + PIS+EQP G S
Sbjct  226   GLYATVDMDKLEVIKIVDK-GMVPIPKAAGTEYRYN-VQNKPVHMDRINPISIEQPEGPS  283

Query  1408  FRVEDGYIVKWASWEFHVKADQRAGIIISQATVFDPEAGKRRSVMYKGFASELFVPYMDV  1229
             F VEDG++VKWA+W FHVKAD RAG+IISQATV D E G+ RSVMYKGF SELFVPYMD 
Sbjct  284   FLVEDGHLVKWANWVFHVKADHRAGMIISQATVRDSETGEPRSVMYKGFPSELFVPYMDP  343

Query  1228  DEGWYFRAFMDAGEFGLGATAMELVPLNDCPRHSHYIDGLFVDPDGRPVSQPNVICVFER  1049
              E WY+++++DAGE GLG  AM LVPLNDCPR+++YIDG+F  PDG+ + QPN+IC+FER
Sbjct  344   GELWYYKSYLDAGEIGLGPAAMPLVPLNDCPRNAYYIDGVFASPDGKAIVQPNMICLFER  403

Query  1048  YSGDIAWRHSGTGDADDDLIREARPKVSLVVRTTATVGNYDYIFDWEFQTDGSIRVTVGL  869
             Y+GD++WRHS     + D IRE+RPKV+LV R   +VGNYDY FDWEFQTDG IRVTV  
Sbjct  404   YAGDVSWRHSEILIPNAD-IRESRPKVTLVARMATSVGNYDYTFDWEFQTDGLIRVTVAA  462

Query  868   SGIILAKGSPYEHINQFEIPRWDFPAGSLVSENTIGVAHDHFITFHLDMDVDGP-TNSFV  692
             SG+++ KG+PYE+++       D  +G L+SEN IGV HDHFITFHLDMD+DGP  NSFV
Sbjct  463   SGMLMVKGTPYENVDDLGDKEDD--SGPLISENVIGVVHDHFITFHLDMDIDGPMNNSFV  520

Query  691   KVDLVKNYNIAGKIQRKSYWSPKRKVAKSENDAKIKLQLDKPSEFHVINPRHQSRLGNPS  512
             KV L K    +GK  RKSY   K+ VAK+E DA+IKL L  P EFH++NP  +SRLGNP+
Sbjct  521   KVHLEKQRVQSGKSPRKSYLKVKKYVAKTEKDAQIKLSLYDPYEFHIVNPNRKSRLGNPA  580

Query  511   GYKIVPSATAASLLDLQDPPQLRAAFTNNQIWVTPYNRSEQWAGGLFTYQSHGDDTLAVW  332
             GY+I+P   A SLLD  DPPQ+R AF+NNQIWVT YNRSEQ+AGG+  YQSHGDDTL VW
Sbjct  581   GYRIIPGGNAVSLLDHDDPPQIRGAFSNNQIWVTRYNRSEQFAGGVLVYQSHGDDTLQVW  640

Query  331   SNRNRVIEKQDIVLWYTLGFHHLPCQEDFPVMPTVTSTFQLKPVNFFDRNPIIQANPNFA  152
             S+R+R IE  DIVLWYTLGFHH+PCQED+PVMPTV ++F+LKP NFF+ NP+I   P F 
Sbjct  641   SDRDRSIENNDIVLWYTLGFHHIPCQEDYPVMPTVAASFELKPANFFESNPVIGVAPIFE  700

Query  151   EDLPICR  131
             +DLP+CR
Sbjct  701   KDLPVCR  707



>gb|AAO42785.1| At1g62810/F23N19_18 [Arabidopsis thaliana]
Length=712

 Score =   842 bits (2176),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 402/665 (60%), Positives = 507/665 (76%), Gaps = 7/665 (1%)
 Frame = -1

Query  2119  KIQNNHFADRPMHPLDPLTIQEIERTRSILSSYQP-FSGSSLRIHSLSLDEPDKSEVLRW  1943
             ++  +H  ++P HPLDPLT++EI R R+ILS++ P F   S  IHS++LDEP+KS V++W
Sbjct  48    QVHVDHSLEKPHHPLDPLTVREINRVRTILSNHDPGFGSGSATIHSMALDEPEKSRVVQW  107

Query  1942  KRGNPLPTRKAFVVALSNGQAHLLVVDLGSGRVSSHTRNPASGYPPMSADDASTALEATF  1763
             K+GN L +R+A VVA   GQ H + VDL SGRV S   N  SGYP ++ +D   A +   
Sbjct  108   KKGNKLLSRRAAVVAYWGGQTHEITVDLDSGRVVSDVINRTSGYPILTLNDVFAASQVPL  167

Query  1762  SNSVFREAISTRGVEINDVVCSAAAPGWFGPEEEGRRITKVKCYTAQNTPNYYMRPIEGL  1583
              +  F  +I  RGV+ +D+ C     GWFG EE+GRR+ +V+C+T Q T NY+MRP+EGL
Sbjct  168   KSLEFNRSIEARGVKFSDLACITPFAGWFGSEEKGRRVIRVQCFTLQGTTNYFMRPLEGL  227

Query  1582  LLTVDLDSGKVINVYDTHSPIPIPKAQGTDYRRDGIEHRAPGVEPLKPISMEQPNGQSFR  1403
              +TVDLD  +VI + D   PIPIPKA GT+YR  G++++   ++ + PISMEQP+G SFR
Sbjct  228   YVTVDLDKLEVIKIIDK-GPIPIPKASGTEYRF-GVQNKPVHMDRINPISMEQPDGPSFR  285

Query  1402  VEDGYIVKWASWEFHVKADQRAGIIISQATVFDPEAGKRRSVMYKGFASELFVPYMDVDE  1223
             VEDG++VKWA+W FHVKADQRAG+IISQATV D E G+ RSVMYKGF SELFVPYMD +E
Sbjct  286   VEDGHLVKWANWVFHVKADQRAGMIISQATVRDSETGEPRSVMYKGFPSELFVPYMDPEE  345

Query  1222  GWYFRAFMDAGEFGLGATAMELVPLNDCPRHSHYIDGLFVDPDGRPVSQPNVICVFERYS  1043
             GWY++ +MDAGE GLG TAM LVPLNDCPR+S+YIDG+F  PDG+P+ QPN+IC+FERY+
Sbjct  346   GWYYKGYMDAGELGLGPTAMPLVPLNDCPRNSYYIDGVFASPDGKPIVQPNMICLFERYA  405

Query  1042  GDIAWRHSGTGDADDDLIREARPKVSLVVRTTATVGNYDYIFDWEFQTDGSIRVTVGLSG  863
             GDI+WRHS    A+ D IRE+RPKV+LV R   +VGNYDYIFDWEFQTDG IRVTV  SG
Sbjct  406   GDISWRHSEILFANAD-IRESRPKVTLVARMATSVGNYDYIFDWEFQTDGLIRVTVAASG  464

Query  862   IILAKGSPYEHINQFEIPRWDFPAGSLVSENTIGVAHDHFITFHLDMDVDGP-TNSFVKV  686
             +++ KG+PY++++       D  AG L+SEN IGV HDHFITFHLDMD+DGP  NS VKV
Sbjct  465   MLMVKGTPYDNVDDLGDREDD--AGPLISENVIGVVHDHFITFHLDMDIDGPMNNSLVKV  522

Query  685   DLVKNYNIAGKIQRKSYWSPKRKVAKSENDAKIKLQLDKPSEFHVINPRHQSRLGNPSGY  506
              L K     GK  RKSY   K+ +AK+E DA+IKL L  P EFH++NP  +SR+GNP+GY
Sbjct  523   HLEKQRVPTGKSPRKSYLKVKKYIAKTEKDAQIKLSLYDPYEFHIVNPNRKSRVGNPAGY  582

Query  505   KIVPSATAASLLDLQDPPQLRAAFTNNQIWVTPYNRSEQWAGGLFTYQSHGDDTLAVWSN  326
             +IVP   AASLLD  DPPQ+R AFTNNQIWVTPYNRSEQ+AGG+  YQS GDDTL VWS+
Sbjct  583   RIVPGGNAASLLDHDDPPQIRGAFTNNQIWVTPYNRSEQYAGGVLIYQSQGDDTLQVWSD  642

Query  325   RNRVIEKQDIVLWYTLGFHHLPCQEDFPVMPTVTSTFQLKPVNFFDRNPIIQANPNFAED  146
             R+R IE +DIVLWYTLGFHH+PCQED+PVMPTV ++F+LKP NFF+ NPI+ + P F +D
Sbjct  643   RDRSIENKDIVLWYTLGFHHVPCQEDYPVMPTVAASFELKPANFFESNPILGSAPFFEKD  702

Query  145   LPICR  131
             LP+CR
Sbjct  703   LPVCR  707



>ref|XP_010053409.1| PREDICTED: primary amine oxidase-like [Eucalyptus grandis]
 gb|KCW77695.1| hypothetical protein EUGRSUZ_D01995 [Eucalyptus grandis]
Length=729

 Score =   842 bits (2175),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 399/668 (60%), Positives = 504/668 (75%), Gaps = 8/668 (1%)
 Frame = -1

Query  2119  KIQNNHFADRPMHPLDPLTIQEIERTRSILSSYQPFSGSSLRIHSLSLDEPDKSEVLRWK  1940
             K +N   ++   HPLDPLT  EI R  SI+ SY PF  S   IHSL+L EP+K+EV+ W+
Sbjct  60    KTKNCPSSETVHHPLDPLTTDEIIRVGSIVRSYPPFESSPPSIHSLTLHEPEKAEVVAWR  119

Query  1939  RGNPLPTRKAFVVALSNGQAHLLVVDLGSGRVSSHTRNPASGYPPMSADDASTALEATFS  1760
             +G+PLP R+AFV+ALSN + H LVVDLGSGRV++H+    SGYPP++ D+ + A EA ++
Sbjct  120   KGDPLPPRRAFVLALSNRRTHELVVDLGSGRVAAHSVASGSGYPPLTMDELAAACEAPYT  179

Query  1759  NSVFREAISTRGVEINDVVCSAAAPGWFGPE-EEGRRITKVKCYTAQNTPNYYMRPIEGL  1583
             ++ F E+I  RGV ++DV C   + GW+G   EE RR+ KV+C+  + T N+YMRP+EG+
Sbjct  180   SAEFNESIRARGVAMSDVRCVPLSAGWYGRAVEETRRVIKVQCFDLEGTSNFYMRPLEGI  239

Query  1582  LLTVDLDSGKVINVYDTHSPIPIPKAQGTDYRRDGIEH----RAPGVEPLKPISMEQPNG  1415
              +TVDLD  +++   D+   IP+PK+ GT+YR   IE     R     PLKPISMEQP+G
Sbjct  240   TITVDLDKREILEFVDSGRGIPVPKSAGTEYRYGSIEKGEEGRGTAAPPLKPISMEQPDG  299

Query  1414  QSFRVEDGYIVKWASWEFHVKADQRAGIIISQATVFDPEAGKRRSVMYKGFASELFVPYM  1235
              SF VE+G++VKWA+WEFH++AD RAG++IS+A V DP+ G+ RSVMYKGFASELFVPYM
Sbjct  300   PSFVVENGHVVKWANWEFHLRADHRAGMVISRARVRDPDTGELRSVMYKGFASELFVPYM  359

Query  1234  DVDEGWYFRAFMDAGEFGLGATAMELVPLNDCPRHSHYIDGLFVDPDGRPVSQPNVICVF  1055
             D DEGWYF+ +MDAGE+G+G TAM LVPLNDCPR+++Y+DG+F   DG P  + N+IC+F
Sbjct  360   DPDEGWYFKTYMDAGEYGMGVTAMSLVPLNDCPRNAYYMDGIFAASDGTPYVESNMICLF  419

Query  1054  ERYSGDIAWRHSGTGDADDDLIREARPKVSLVVRTTATVGNYDYIFDWEFQTDGSIRVTV  875
             ERY+GD++WRHS    +  + IRE+RPKV+LV R  ++VGNYDYIFDWEFQTDG IRV V
Sbjct  420   ERYAGDVSWRHSEIPISGLE-IRESRPKVTLVARMASSVGNYDYIFDWEFQTDGLIRVKV  478

Query  874   GLSGIILAKGSPYEHINQFEIPRWDFPAGSLVSENTIGVAHDHFITFHLDMDVDGPTNSF  695
              LSG+++ KG+P+E  N  ++P      G LVSEN IGV HDH++TFHLDMD+DG  NSF
Sbjct  479   SLSGMLMVKGAPFE--NTKDVPEEYEMTGPLVSENVIGVVHDHYMTFHLDMDIDGSNNSF  536

Query  694   VKVDLVKNYNIAGKIQRKSYWSPKRKVAKSENDAKIKLQLDKPSEFHVINPRHQSRLGNP  515
             V V + K     G   RKSY   KR+VA++E DA+IKL+L  PSEFHVINP   SR+GNP
Sbjct  537   VDVHIEKEKTPPGSSPRKSYLKAKRRVARTEGDARIKLKLYDPSEFHVINPSRLSRVGNP  596

Query  514   SGYKIVPSATAASLLDLQDPPQLRAAFTNNQIWVTPYNRSEQWAGGLFTYQSHGDDTLAV  335
             SGYK+VP    ASLLD  DPPQLR A+TNNQIWVTPYNRSEQWAGGL  YQS GDDTLA 
Sbjct  597   SGYKVVPGGNGASLLDHDDPPQLRNAYTNNQIWVTPYNRSEQWAGGLLAYQSKGDDTLAT  656

Query  334   WSNRNRVIEKQDIVLWYTLGFHHLPCQEDFPVMPTVTSTFQLKPVNFFDRNPIIQANPNF  155
             WS RNR IE +DIVLWYTLG HH+PCQEDFPVMPTV  +F LKPVNFFD NPI++A PNF
Sbjct  657   WSERNRPIEDRDIVLWYTLGTHHVPCQEDFPVMPTVILSFDLKPVNFFDSNPILRAAPNF  716

Query  154   AEDLPICR  131
              +DLP+C+
Sbjct  717   EKDLPVCK  724



>ref|XP_009123405.1| PREDICTED: primary amine oxidase isoform X1 [Brassica rapa]
 ref|XP_009123406.1| PREDICTED: primary amine oxidase isoform X1 [Brassica rapa]
Length=721

 Score =   841 bits (2173),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 400/675 (59%), Positives = 511/675 (76%), Gaps = 14/675 (2%)
 Frame = -1

Query  2125  DFKIQNNHFADRPMHPLDPLTIQEIERTRSILSSYQP-FSGSSLRIHSLSLDEPDKSEVL  1949
             D K++ +H + +P HPLDPLT+QEIER R+IL  ++P F   S  IHS++LDEPDK+ V+
Sbjct  46    DPKLRVDHSSAKPHHPLDPLTVQEIERVRTILLDHEPGFGSGSATIHSMALDEPDKTLVV  105

Query  1948  RWKRGNPLPTRKAFVVALSNGQAHLLVVDLGSGRVSSHTRNPASGYPPMSADDASTALEA  1769
             +WK+GN LP+R+A V+ALS GQ+H++VVDL SGRV S   NP SGYP ++ DD   A + 
Sbjct  106   KWKKGNRLPSRRAEVLALSVGQSHVIVVDLDSGRVVSDVVNPTSGYPILTMDDLIVASQV  165

Query  1768  TFSNSVFREAISTRGVEINDVVCSAAAPGWFGPEEEGRRITKVKCYTAQNTPNYYMRPIE  1589
                +  F  ++  RGV+++D+V      GWFGPEEEGRRI KV+C+T+Q+TPNY+MRPIE
Sbjct  166   ALKSIEFNRSVEARGVKLSDLVALPTFTGWFGPEEEGRRILKVQCFTSQDTPNYFMRPIE  225

Query  1588  GLLLTVDLDSGKVINVYDTHSPIPIPKAQGTDYRRDGIEHRAPGVEPLKPISMEQPNGQS  1409
             GL  TVD+D  +VI + D    +PIPKA GT+YR + ++++   ++ + PIS+EQP G S
Sbjct  226   GLYATVDMDKLEVIKIVDK-GMVPIPKAAGTEYRYN-VQNKPVHMDRINPISIEQPEGPS  283

Query  1408  FRVEDGYIVKWASWEFHVKADQRAGIIISQATVFDPEAGKRRSVMYKGFASELFVPYMDV  1229
             F VEDG++VKWA+W FHVKAD RAG+IISQATV D E G+ RSVMYKGF SELFVPYMD 
Sbjct  284   FLVEDGHLVKWANWVFHVKADHRAGMIISQATVRDSETGEPRSVMYKGFPSELFVPYMDP  343

Query  1228  DEGWYFRAFMDAGEFGLGATAMELVPLNDCPRHSHYIDGLFVDPDGRPVSQPNVICVFER  1049
              E WY+++++DAGE GLG  AM LVPLNDCPR+++YIDG+F  PDG+ + QPN+IC+FER
Sbjct  344   GELWYYKSYLDAGEIGLGPAAMPLVPLNDCPRNAYYIDGVFASPDGKAIVQPNMICLFER  403

Query  1048  YSGDIAWRHSGTGDADDDL--------IREARPKVSLVVRTTATVGNYDYIFDWEFQTDG  893
             Y+GD++WRHS     + D+        IRE+RPKV+LV R   +VGNYDY FDWEFQTDG
Sbjct  404   YAGDVSWRHSEILIPNADVCPFTTRKQIRESRPKVTLVARMATSVGNYDYTFDWEFQTDG  463

Query  892   SIRVTVGLSGIILAKGSPYEHINQFEIPRWDFPAGSLVSENTIGVAHDHFITFHLDMDVD  713
              IRVTV  SG+++ KG+PYE+++       D  +G L+SEN IGV HDHFITFHLDMD+D
Sbjct  464   LIRVTVAASGMLMVKGTPYENVDDLGDKEDD--SGPLISENVIGVVHDHFITFHLDMDID  521

Query  712   GP-TNSFVKVDLVKNYNIAGKIQRKSYWSPKRKVAKSENDAKIKLQLDKPSEFHVINPRH  536
             GP  NSFVKV L K    +GK  RKSY   K+ VAK+E DA+IKL L  P EFH++NP  
Sbjct  522   GPMNNSFVKVHLEKQRVQSGKSPRKSYLKVKKYVAKTEKDAQIKLSLYDPYEFHIVNPNR  581

Query  535   QSRLGNPSGYKIVPSATAASLLDLQDPPQLRAAFTNNQIWVTPYNRSEQWAGGLFTYQSH  356
             +SRLGNP+GY+I+P   A SLLD  DPPQ+R AF+NNQIWVT YNRSEQ+AGG+  YQSH
Sbjct  582   KSRLGNPAGYRIIPGGNAVSLLDHDDPPQIRGAFSNNQIWVTRYNRSEQFAGGVLVYQSH  641

Query  355   GDDTLAVWSNRNRVIEKQDIVLWYTLGFHHLPCQEDFPVMPTVTSTFQLKPVNFFDRNPI  176
             GDDTL VWS+R+R IE  DIVLWYTLGFHH+PCQED+PVMPTV ++F+LKP NFF+ NP+
Sbjct  642   GDDTLQVWSDRDRSIENNDIVLWYTLGFHHIPCQEDYPVMPTVAASFELKPANFFESNPV  701

Query  175   IQANPNFAEDLPICR  131
             I   P F +DLP+CR
Sbjct  702   IGVAPIFEKDLPVCR  716



>ref|XP_002886452.1| hypothetical protein ARALYDRAFT_475070 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH62711.1| hypothetical protein ARALYDRAFT_475070 [Arabidopsis lyrata subsp. 
lyrata]
Length=712

 Score =   836 bits (2159),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 398/665 (60%), Positives = 503/665 (76%), Gaps = 7/665 (1%)
 Frame = -1

Query  2119  KIQNNHFADRPMHPLDPLTIQEIERTRSILSSYQP-FSGSSLRIHSLSLDEPDKSEVLRW  1943
             K+  +H +++P HPLDPLT++EI R R+ILS + P F   S  IHS++LDEP+K+ V++W
Sbjct  48    KVHVDHSSEKPHHPLDPLTVREISRVRTILSGHDPGFGSGSATIHSMALDEPEKTRVVQW  107

Query  1942  KRGNPLPTRKAFVVALSNGQAHLLVVDLGSGRVSSHTRNPASGYPPMSADDASTALEATF  1763
             K+GN LP+R+A VVA   GQ H + VDL SGRV S   N  SGYP ++ +D   A +   
Sbjct  108   KKGNKLPSRRAAVVAYWGGQTHEITVDLDSGRVVSDVVNRTSGYPILTLNDVFAASQVPL  167

Query  1762  SNSVFREAISTRGVEINDVVCSAAAPGWFGPEEEGRRITKVKCYTAQNTPNYYMRPIEGL  1583
              +  F  +I  RGV+ +D+ C     GWFG EEEGRR+ +V+CYT Q T NY+MRP+EGL
Sbjct  168   KSLEFNRSIEARGVKFSDLACITPFAGWFGHEEEGRRVIRVQCYTLQGTTNYFMRPLEGL  227

Query  1582  LLTVDLDSGKVINVYDTHSPIPIPKAQGTDYRRDGIEHRAPGVEPLKPISMEQPNGQSFR  1403
              +TVDLD  +VI + D   PIPIPK+ GT+YR  G++++   ++ + PISMEQP+G SFR
Sbjct  228   YVTVDLDKLEVIKIVDK-GPIPIPKSSGTEYRF-GVQNKPVHMDRINPISMEQPDGPSFR  285

Query  1402  VEDGYIVKWASWEFHVKADQRAGIIISQATVFDPEAGKRRSVMYKGFASELFVPYMDVDE  1223
             VEDG++VKWA+W FHVKADQRAG+IISQATV D E G+ RSVMYKGF SELFVPYMD +E
Sbjct  286   VEDGHLVKWANWVFHVKADQRAGMIISQATVRDSETGEPRSVMYKGFPSELFVPYMDPEE  345

Query  1222  GWYFRAFMDAGEFGLGATAMELVPLNDCPRHSHYIDGLFVDPDGRPVSQPNVICVFERYS  1043
             GWY++ +MDAGE GLG TAM LVPLNDCPR+++YIDG+F   DG P+ QPN+IC+FERY+
Sbjct  346   GWYYKGYMDAGELGLGPTAMPLVPLNDCPRNAYYIDGVFASSDGTPIVQPNMICLFERYA  405

Query  1042  GDIAWRHSGTGDADDDLIREARPKVSLVVRTTATVGNYDYIFDWEFQTDGSIRVTVGLSG  863
             GDI+WRHS     + D IRE+RPKV+LV R   +VGNYDYIFDWEFQTDG IRVTV  SG
Sbjct  406   GDISWRHSEILFTNAD-IRESRPKVTLVARMATSVGNYDYIFDWEFQTDGLIRVTVAASG  464

Query  862   IILAKGSPYEHINQFEIPRWDFPAGSLVSENTIGVAHDHFITFHLDMDVDGP-TNSFVKV  686
             +++ KG+PY++++       D  +G L+SEN IGV HDHFITFHLDMD+DGP  NS  KV
Sbjct  465   MLMVKGTPYDNVDDLGDMEDD--SGPLISENVIGVVHDHFITFHLDMDIDGPMNNSLFKV  522

Query  685   DLVKNYNIAGKIQRKSYWSPKRKVAKSENDAKIKLQLDKPSEFHVINPRHQSRLGNPSGY  506
              L K     GK  RKSY   K+ +AK+E DA+IKL L  P EFH++NP  +SR+GN +GY
Sbjct  523   HLEKQRVPTGKSPRKSYLKIKKYIAKTEKDAQIKLSLYDPYEFHIVNPNRKSRIGNLAGY  582

Query  505   KIVPSATAASLLDLQDPPQLRAAFTNNQIWVTPYNRSEQWAGGLFTYQSHGDDTLAVWSN  326
             +I+P   AASLLD  DPPQ+R AFTNNQIWVTPYNRSEQ+AGG+  YQS GDDTL VWS+
Sbjct  583   RIIPGGNAASLLDHDDPPQIRGAFTNNQIWVTPYNRSEQYAGGVLIYQSQGDDTLQVWSD  642

Query  325   RNRVIEKQDIVLWYTLGFHHLPCQEDFPVMPTVTSTFQLKPVNFFDRNPIIQANPNFAED  146
             R+R IE +DIVLWYTLGFHH+PCQED+PVMPTV ++F+LKP NFF+ NPI+ A P F +D
Sbjct  643   RDRSIENKDIVLWYTLGFHHVPCQEDYPVMPTVAASFELKPANFFESNPILGAAPFFEKD  702

Query  145   LPICR  131
             LP+CR
Sbjct  703   LPVCR  707



>ref|XP_004147579.1| PREDICTED: primary amine oxidase-like [Cucumis sativus]
Length=710

 Score =   831 bits (2146),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 399/658 (61%), Positives = 495/658 (75%), Gaps = 11/658 (2%)
 Frame = -1

Query  2089  PMHPLDPLTIQEIERTRSILSSYQPFSGSSLRIHSLSLDEPDKSEVLRWKRGNPLPTRKA  1910
             P HPLDPLT+QEI + R ILSSY+PFS S   IHSL+L+EPDKS VL W+ GNPLP R+A
Sbjct  54    PHHPLDPLTVQEINKVRDILSSYEPFSNSFPTIHSLALEEPDKSLVLSWEFGNPLPPRRA  113

Query  1909  FVVALSNGQAHLLVVDLGSGRVSSHTRNPASGYPPMSADDASTALEATFSNSVFREAIST  1730
              V+ +   Q H+L VDL   RV  HT NP SGYP ++ ++  +AL+   +NS  +++I  
Sbjct  114   AVIGILYEQVHVLSVDLELHRVIRHTANPTSGYPMITMEELLSALDVALANSNVQKSIHA  173

Query  1729  RGVEINDVVCSAAAPGWFGPEEEGRRITKVKCYTAQNTPNYYMRPIEGLLLTVDLDSGKV  1550
             RGV++ DV   + +PGWFG EEEGRRI K++ Y+ Q T NYYMRPIEGL +TVDL+  +V
Sbjct  174   RGVKLKDVRFLSPSPGWFGKEEEGRRIVKLQFYSIQGTSNYYMRPIEGLTVTVDLNKQEV  233

Query  1549  INVYDTHSPIPIPKAQGTDYRRDGIEHRAPGVEPLKPISMEQPNGQSFRVEDGYIVKWAS  1370
             + V DT   IPIP++  T+Y+ +G E   P ++ + PIS+EQP G SF VE+GYIVKW +
Sbjct  234   VKVADTGKGIPIPRSTNTEYQYNG-ETEPPEIKKINPISIEQPKGPSFTVENGYIVKWGN  292

Query  1369  WEFHVKADQRAGIIISQATVFDPEAGKRRSVMYKGFASELFVPYMDVDEGWYFRAFMDAG  1190
             WEFH+K DQRAG++IS+A V D E G+ R+VMYKG  SEL+VPYMD DE WYF+ +MDAG
Sbjct  293   WEFHIKPDQRAGMVISRAMVRDSETGELRNVMYKGLPSELYVPYMDFDEHWYFKTYMDAG  352

Query  1189  EFGLGATAMELVPLNDCPRHSHYIDGLFVDPDGRPVSQPNVICVFERYSGDIAWRHSGTG  1010
             E+GLG  +  LVPLNDCPR+S+Y+D +FVD DG+P  Q N+ICVFERY+GDI+WRH+ T 
Sbjct  353   EYGLGLLSTSLVPLNDCPRNSYYMDAVFVDGDGKPYVQENIICVFERYAGDISWRHTDTL  412

Query  1009  DADDDLIREARPKVSLVVRTTATVGNYDYIFDWEFQTDGSIRVTVGLSGIILAKGSPYEH  830
               +     EAR KV+LV R  +TVGNYDYI DWEFQTDG IRV VGLSG+++ K +P   
Sbjct  413   LPNGR--GEARQKVTLVARMVSTVGNYDYIIDWEFQTDGLIRVEVGLSGMLMIKATP---  467

Query  829   INQFEIPRWDFPAGSLVSENTIGVAHDHFITFHLDMDVDGPTNSFVKVDLVKNYNIAGK-  653
              N++ + + +     LVSEN IGV HDH+ITF+LDMDVDG  NSFV +DLVK   +  K 
Sbjct  468   -NEYAVNKDNEGFEPLVSENAIGVVHDHYITFYLDMDVDGVNNSFVNIDLVKEEQVDNKS  526

Query  652   ---IQRKSYWSPKRKVAKSENDAKIKLQLDKPSEFHVINPRHQSRLGNPSGYKIVPSATA  482
                  RKS + P +KVAK E++AKI L L  PSEFHV+NP   SRLGNPSGYKIVP+ATA
Sbjct  527   PKSTPRKSIYKPYKKVAKMEDEAKIILSLVDPSEFHVVNPSKLSRLGNPSGYKIVPTATA  586

Query  481   ASLLDLQDPPQLRAAFTNNQIWVTPYNRSEQWAGGLFTYQSHGDDTLAVWSNRNRVIEKQ  302
             ASLLDL DPPQ+R+AFTNNQIWVTPY ++EQWAGG  TYQ  GDDTLA WS RNR IE +
Sbjct  587   ASLLDLDDPPQIRSAFTNNQIWVTPYKKNEQWAGGFLTYQGRGDDTLATWSQRNRPIENR  646

Query  301   DIVLWYTLGFHHLPCQEDFPVMPTVTSTFQLKPVNFFDRNPIIQANPNFAEDLPICRA  128
             DIVLWYTLGFHH+PCQEDFPVMPTV+S+F LKPVNFFDRNPI++A P   +DLP+C A
Sbjct  647   DIVLWYTLGFHHVPCQEDFPVMPTVSSSFDLKPVNFFDRNPILRAAPASVDDLPVCNA  704



>ref|XP_004162660.1| PREDICTED: LOW QUALITY PROTEIN: primary amine oxidase-like [Cucumis 
sativus]
Length=661

 Score =   824 bits (2128),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 397/658 (60%), Positives = 494/658 (75%), Gaps = 11/658 (2%)
 Frame = -1

Query  2089  PMHPLDPLTIQEIERTRSILSSYQPFSGSSLRIHSLSLDEPDKSEVLRWKRGNPLPTRKA  1910
             P HPLDPLT+QEI + R ILSSY+PFS S   IHSL+L+EPDKS VL W+ GNPLP R+A
Sbjct  5     PHHPLDPLTVQEINKVRDILSSYEPFSNSFPTIHSLALEEPDKSLVLSWEFGNPLPPRRA  64

Query  1909  FVVALSNGQAHLLVVDLGSGRVSSHTRNPASGYPPMSADDASTALEATFSNSVFREAIST  1730
              V+ +   Q H+L VDL   RV  HT NP SGYP ++ ++  +AL+   +NS  +++I  
Sbjct  65    AVIGILYEQVHVLSVDLELHRVIRHTANPTSGYPMITMEELLSALDVALANSNVQKSIHA  124

Query  1729  RGVEINDVVCSAAAPGWFGPEEEGRRITKVKCYTAQNTPNYYMRPIEGLLLTVDLDSGKV  1550
             RGV++ DV   + +PGWFG EEEGRRI K++ Y+ Q T NYYMRPIEGL +TVDL+  +V
Sbjct  125   RGVKLKDVRFLSPSPGWFGKEEEGRRIVKLQFYSIQGTSNYYMRPIEGLTVTVDLNKQEV  184

Query  1549  INVYDTHSPIPIPKAQGTDYRRDGIEHRAPGVEPLKPISMEQPNGQSFRVEDGYIVKWAS  1370
             + V DT   IPIP++  T+Y+ +G E   P ++ + PIS+EQP G SF VE+GYIVKW +
Sbjct  185   VKVADTGKGIPIPRSTNTEYQYNG-ETEPPEIKKINPISIEQPKGPSFTVENGYIVKWGN  243

Query  1369  WEFHVKADQRAGIIISQATVFDPEAGKRRSVMYKGFASELFVPYMDVDEGWYFRAFMDAG  1190
             WEFH+K DQRAG++IS+A V D E G+ R+VMYKG  SEL+VPYMD DE WYF+ +MDAG
Sbjct  244   WEFHIKPDQRAGMVISRAMVRDSETGELRNVMYKGLPSELYVPYMDFDEHWYFKTYMDAG  303

Query  1189  EFGLGATAMELVPLNDCPRHSHYIDGLFVDPDGRPVSQPNVICVFERYSGDIAWRHSGTG  1010
             E+GLG  +  LVPLNDCPR+S+Y+D +FVD DG+P  Q N+ICVFERY+GDI+WRH+ T 
Sbjct  304   EYGLGLLSTSLVPLNDCPRNSYYMDAVFVDGDGKPYVQENIICVFERYAGDISWRHTDTL  363

Query  1009  DADDDLIREARPKVSLVVRTTATVGNYDYIFDWEFQTDGSIRVTVGLSGIILAKGSPYEH  830
               +     EAR KV+LV R  +TVGNYDYI DWEFQTDG IRV VGLSG+++ K +P   
Sbjct  364   LPNGR--GEARQKVTLVARMVSTVGNYDYIIDWEFQTDGLIRVEVGLSGMLMIKATP---  418

Query  829   INQFEIPRWDFPAGSLVSENTIGVAHDHFITFHLDMDVDGPTNSFVKVDLVKNYNIAGK-  653
              N++ + + +     LVSEN IGV HDH+ITF+LDMDVDG  NSFV +DLVK   +  K 
Sbjct  419   -NEYAVNKDNEGFEPLVSENAIGVVHDHYITFYLDMDVDGVNNSFVNIDLVKEEQVDNKS  477

Query  652   ---IQRKSYWSPKRKVAKSENDAKIKLQLDKPSEFHVINPRHQSRLGNPSGYKIVPSATA  482
                  RK+Y +  + VAK E++AKI L L  PSEFHV+NP   SRLGNPSGYKIVP+ATA
Sbjct  478   PKSTPRKAYTNHIKXVAKMEDEAKIILSLVDPSEFHVVNPSKLSRLGNPSGYKIVPTATA  537

Query  481   ASLLDLQDPPQLRAAFTNNQIWVTPYNRSEQWAGGLFTYQSHGDDTLAVWSNRNRVIEKQ  302
             ASLLDL DPPQ+R+AFTNNQIWVTPY ++EQWAGG  TYQ  GDDTLA WS RNR IE +
Sbjct  538   ASLLDLDDPPQIRSAFTNNQIWVTPYKKNEQWAGGFLTYQGRGDDTLATWSQRNRPIENR  597

Query  301   DIVLWYTLGFHHLPCQEDFPVMPTVTSTFQLKPVNFFDRNPIIQANPNFAEDLPICRA  128
             DIVLWYTLGFHH+PCQEDFPVMPTV+S+F LKPVNFFDRNPI++A P   +DLP+C A
Sbjct  598   DIVLWYTLGFHHVPCQEDFPVMPTVSSSFDLKPVNFFDRNPILRAAPASVDDLPVCNA  655



>ref|XP_010546327.1| PREDICTED: primary amine oxidase-like [Tarenaya hassleriana]
Length=706

 Score =   825 bits (2132),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 388/657 (59%), Positives = 500/657 (76%), Gaps = 7/657 (1%)
 Frame = -1

Query  2095  DRPMHPLDPLTIQEIERTRSILSSYQP-FSGSSLRIHSLSLDEPDKSEVLRWKRGNPLPT  1919
             ++P HPLDPLT +EI+R R+IL+ Y P F   S +IH+++LDEP+K+ V RW++G+ LP 
Sbjct  50    EKPRHPLDPLTAREIDRVRAILTGYNPGFGSGSAKIHAMTLDEPEKTRVTRWRKGDRLPP  109

Query  1918  RKAFVVALSNGQAHLLVVDLGSGRVSSHTRNPASGYPPMSADDASTALEATFSNSVFREA  1739
             R A VVA+ NG+ H++ V L SGRV S   NP SGYP +++++   A +  F +  F  +
Sbjct  110   RTAEVVAMWNGETHVMTVHLDSGRVVSDRVNPTSGYPILTSNEIMAASQVPFKSIEFNNS  169

Query  1738  ISTRGVEINDVVCSAAAPGWFGPEEEGRRITKVKCYTAQNTPNYYMRPIEGLLLTVDLDS  1559
             I  RG+   D+ C   + GWFGP+EEGRR+ K++C++ Q TPN++MRPIEGL +TVD+D 
Sbjct  170   IKARGIPYADLKCITPSAGWFGPDEEGRRVIKIQCFSQQGTPNFFMRPIEGLYMTVDIDR  229

Query  1558  GKVINVYDTHSPIPIPKAQGTDYRRDGIEHRAPGVEPLKPISMEQPNGQSFRVEDGYIVK  1379
              +VI + D   P+P+PK  GTDYR   ++++   ++ + PIS+EQP G SFRVEDG++VK
Sbjct  230   LEVIKIVD-KGPVPVPKGAGTDYRFK-VQNKPAQMDRINPISIEQPEGPSFRVEDGHLVK  287

Query  1378  WASWEFHVKADQRAGIIISQATVFDPEAGKRRSVMYKGFASELFVPYMDVDEGWYFRAFM  1199
             WA+W FH++ DQRAG+IISQATV D E G+ RSVMYKGFASE+FVPYMD +EGWYF+++M
Sbjct  288   WANWVFHIRPDQRAGLIISQATVRDSETGEPRSVMYKGFASEMFVPYMDPEEGWYFKSYM  347

Query  1198  DAGEFGLGATAMELVPLNDCPRHSHYIDGLFVDPDGRPVSQPNVICVFERYSGDIAWRHS  1019
             D GEFGLG TAM LVPLNDCPR+++Y+DG+F  PDG P  Q N+IC+FERY+GD++WRHS
Sbjct  348   DVGEFGLGPTAMPLVPLNDCPRNAYYLDGVFSSPDGIPYIQSNMICLFERYAGDVSWRHS  407

Query  1018  GTGDADDDLIREARPKVSLVVRTTATVGNYDYIFDWEFQTDGSIRVTVGLSGIILAKGSP  839
                  +   IRE+R KV+LV R   +VGNYDYIFDWEFQTDG IRVTV  SG+++ KG+P
Sbjct  408   EILLPEQG-IRESRAKVTLVARMAVSVGNYDYIFDWEFQTDGLIRVTVSASGMLMVKGTP  466

Query  838   YEHINQFEIPRWDFPAGSLVSENTIGVAHDHFITFHLDMDVDGPTN-SFVKVDLVKNYNI  662
             Y++++       D  +G L+SEN IGV HDHF+TFHLDMD+DG TN SFVKV L K    
Sbjct  467   YQNVDDLGDKEDD--SGPLISENVIGVVHDHFVTFHLDMDIDGSTNNSFVKVHLEKQRVP  524

Query  661   AGKIQRKSYWSPKRKVAKSENDAKIKLQLDKPSEFHVINPRHQSRLGNPSGYKIVPSATA  482
              GK  RKSY   K+ VAK+E DA+IKL L  P EFHV+NP  +SRLGNP+GYKIVP   +
Sbjct  525   KGKSPRKSYLKVKKYVAKTEKDAQIKLNLYDPYEFHVVNPNRRSRLGNPAGYKIVPGGNS  584

Query  481   ASLLDLQDPPQLRAAFTNNQIWVTPYNRSEQWAGGLFTYQSHGDDTLAVWSNRNRVIEKQ  302
             ASLLD  DPPQ+R AFTNNQIWVT YNRSEQWAGG+  YQS GDDTL VWS+R+R IE +
Sbjct  585   ASLLDHDDPPQIRGAFTNNQIWVTRYNRSEQWAGGVLMYQSQGDDTLQVWSDRDRSIENK  644

Query  301   DIVLWYTLGFHHLPCQEDFPVMPTVTSTFQLKPVNFFDRNPIIQANPNFAEDLPICR  131
             DIVLWYTLGFHH+PCQED+PVMPTV+++F+LKPVNFF+ NPI+   P F +DLP+CR
Sbjct  645   DIVLWYTLGFHHIPCQEDYPVMPTVSASFELKPVNFFESNPILGVEPFFEKDLPVCR  701



>ref|XP_008437148.1| PREDICTED: primary amine oxidase-like isoform X2 [Cucumis melo]
Length=709

 Score =   824 bits (2129),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 395/655 (60%), Positives = 493/655 (75%), Gaps = 10/655 (2%)
 Frame = -1

Query  2089  PMHPLDPLTIQEIERTRSILSSYQPFSGSSLRIHSLSLDEPDKSEVLRWKRGNPLPTRKA  1910
             P HPLDPLT+QEI + R ILSSY+PFS S   IHSL+L+EPDKS VL W+ G+PLP R+A
Sbjct  54    PHHPLDPLTVQEINKVRDILSSYEPFSNSFPTIHSLALEEPDKSLVLSWEFGDPLPPRRA  113

Query  1909  FVVALSNGQAHLLVVDLGSGRVSSHTRNPASGYPPMSADDASTALEATFSNSVFREAIST  1730
              VV + + Q H+L +DL   RV  HT NP  GYP ++ ++  +A +   +NS  +++I  
Sbjct  114   AVVGILHEQVHVLSIDLELHRVIRHTANPTRGYPMITIEELLSAFDVALANSNVQKSILA  173

Query  1729  RGVEINDVVCSAAAPGWFGPEEEGRRITKVKCYTAQNTPNYYMRPIEGLLLTVDLDSGKV  1550
             RGV++ DV   + +PGWFG EEEGRR  K++ YT Q T NYYMRPIEGL +TVDL+  +V
Sbjct  174   RGVKLKDVKFLSPSPGWFGKEEEGRRFAKLQFYTLQGTSNYYMRPIEGLTVTVDLNKQEV  233

Query  1549  INVYDTHSPIPIPKAQGTDYRRDGIEHRAPGVEPLKPISMEQPNGQSFRVEDGYIVKWAS  1370
             I + DT   IPIP++  TDY  +G E   P ++ + PIS+EQP G SF VE+G+IVKW  
Sbjct  234   IKIADTGKGIPIPRSANTDYIYNG-EKEPPEIKQINPISIEQPKGPSFTVENGHIVKWGR  292

Query  1369  WEFHVKADQRAGIIISQATVFDPEAGKRRSVMYKGFASELFVPYMDVDEGWYFRAFMDAG  1190
             WEFH+K DQRAG++IS+  V D E G+ R+VMYKGF SEL+VPYMD DE WYF+ +MDAG
Sbjct  293   WEFHIKPDQRAGMVISRVMVRDSETGELRNVMYKGFPSELYVPYMDFDEHWYFKTYMDAG  352

Query  1189  EFGLGATAMELVPLNDCPRHSHYIDGLFVDPDGRPVSQPNVICVFERYSGDIAWRHSGTG  1010
             E+GLG  +  LVPLNDCPR+S+Y+DG+FVD +G+P  Q N+ICVFERY+GDI+WRH+ T 
Sbjct  353   EYGLGLLSTSLVPLNDCPRNSYYMDGVFVDGNGKPYVQENIICVFERYAGDISWRHTDT-  411

Query  1009  DADDDLIREARPKVSLVVRTTATVGNYDYIFDWEFQTDGSIRVTVGLSGIILAKGSPYEH  830
                 ++  EAR KV+LV R T+T+GNYDYI DWEFQTDG IRV VGLSG+++ K +P E+
Sbjct  412   -LLPNVRGEARQKVTLVARMTSTLGNYDYIIDWEFQTDGLIRVEVGLSGMLMIKATPKEY  470

Query  829   INQFEIPRWDFPAGSLVSENTIGVAHDHFITFHLDMDVDGPTNSFVKVDLVKNYNIAGKI  650
                 +   ++     LVSEN IGV HDH+ITF+LDMDVDG  NSFV +DLVK   +    
Sbjct  471   TENKDNEGFE----PLVSENAIGVVHDHYITFYLDMDVDGVNNSFVNIDLVKEEQVNKSP  526

Query  649   Q---RKSYWSPKRKVAKSENDAKIKLQLDKPSEFHVINPRHQSRLGNPSGYKIVPSATAA  479
             +   RKS + P +KVAK E++AKI L L  PSEFHV+NP   SRLGNPSGYKIVP+ATAA
Sbjct  527   KSSPRKSIYKPYKKVAKMEDEAKIILSLVDPSEFHVVNPTKLSRLGNPSGYKIVPTATAA  586

Query  478   SLLDLQDPPQLRAAFTNNQIWVTPYNRSEQWAGGLFTYQSHGDDTLAVWSNRNRVIEKQD  299
             SLLDL DPPQ+R+AFTNNQIWVTPYN++EQWAGG   YQS GDDTLA WS RNR IE +D
Sbjct  587   SLLDLDDPPQIRSAFTNNQIWVTPYNKNEQWAGGFLAYQSRGDDTLATWSQRNRPIENRD  646

Query  298   IVLWYTLGFHHLPCQEDFPVMPTVTSTFQLKPVNFFDRNPIIQANPNFAEDLPIC  134
             IVLWYTLGFHH+PCQEDFPVMP V+S+F LKPVNFFDRNPI++A P F +DLP+C
Sbjct  647   IVLWYTLGFHHVPCQEDFPVMPIVSSSFDLKPVNFFDRNPILRAAPAFVDDLPVC  701



>ref|XP_008437147.1| PREDICTED: primary amine oxidase-like isoform X1 [Cucumis melo]
Length=710

 Score =   823 bits (2126),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 395/655 (60%), Positives = 492/655 (75%), Gaps = 9/655 (1%)
 Frame = -1

Query  2089  PMHPLDPLTIQEIERTRSILSSYQPFSGSSLRIHSLSLDEPDKSEVLRWKRGNPLPTRKA  1910
             P HPLDPLT+QEI + R ILSSY+PFS S   IHSL+L+EPDKS VL W+ G+PLP R+A
Sbjct  54    PHHPLDPLTVQEINKVRDILSSYEPFSNSFPTIHSLALEEPDKSLVLSWEFGDPLPPRRA  113

Query  1909  FVVALSNGQAHLLVVDLGSGRVSSHTRNPASGYPPMSADDASTALEATFSNSVFREAIST  1730
              VV + + Q H+L +DL   RV  HT NP  GYP ++ ++  +A +   +NS  +++I  
Sbjct  114   AVVGILHEQVHVLSIDLELHRVIRHTANPTRGYPMITIEELLSAFDVALANSNVQKSILA  173

Query  1729  RGVEINDVVCSAAAPGWFGPEEEGRRITKVKCYTAQNTPNYYMRPIEGLLLTVDLDSGKV  1550
             RGV++ DV   + +PGWFG EEEGRR  K++ YT Q T NYYMRPIEGL +TVDL+  +V
Sbjct  174   RGVKLKDVKFLSPSPGWFGKEEEGRRFAKLQFYTLQGTSNYYMRPIEGLTVTVDLNKQEV  233

Query  1549  INVYDTHSPIPIPKAQGTDYRRDGIEHRAPGVEPLKPISMEQPNGQSFRVEDGYIVKWAS  1370
             I + DT   IPIP++  TDY  +G E   P ++ + PIS+EQP G SF VE+G+IVKW  
Sbjct  234   IKIADTGKGIPIPRSANTDYIYNG-EKEPPEIKQINPISIEQPKGPSFTVENGHIVKWGR  292

Query  1369  WEFHVKADQRAGIIISQATVFDPEAGKRRSVMYKGFASELFVPYMDVDEGWYFRAFMDAG  1190
             WEFH+K DQRAG++IS+  V D E G+ R+VMYKGF SEL+VPYMD DE WYF+ +MDAG
Sbjct  293   WEFHIKPDQRAGMVISRVMVRDSETGELRNVMYKGFPSELYVPYMDFDEHWYFKTYMDAG  352

Query  1189  EFGLGATAMELVPLNDCPRHSHYIDGLFVDPDGRPVSQPNVICVFERYSGDIAWRHSGTG  1010
             E+GLG  +  LVPLNDCPR+S+Y+DG+FVD +G+P  Q N+ICVFERY+GDI+WRH+ T 
Sbjct  353   EYGLGLLSTSLVPLNDCPRNSYYMDGVFVDGNGKPYVQENIICVFERYAGDISWRHTDTL  412

Query  1009  DADDDLIREARPKVSLVVRTTATVGNYDYIFDWEFQTDGSIRVTVGLSGIILAKGSPYEH  830
               +     EAR KV+LV R T+T+GNYDYI DWEFQTDG IRV VGLSG+++ K +P E+
Sbjct  413   LPNAK-SGEARQKVTLVARMTSTLGNYDYIIDWEFQTDGLIRVEVGLSGMLMIKATPKEY  471

Query  829   INQFEIPRWDFPAGSLVSENTIGVAHDHFITFHLDMDVDGPTNSFVKVDLVKNYNIAGKI  650
                 +   ++     LVSEN IGV HDH+ITF+LDMDVDG  NSFV +DLVK   +    
Sbjct  472   TENKDNEGFE----PLVSENAIGVVHDHYITFYLDMDVDGVNNSFVNIDLVKEEQVNKSP  527

Query  649   Q---RKSYWSPKRKVAKSENDAKIKLQLDKPSEFHVINPRHQSRLGNPSGYKIVPSATAA  479
             +   RKS + P +KVAK E++AKI L L  PSEFHV+NP   SRLGNPSGYKIVP+ATAA
Sbjct  528   KSSPRKSIYKPYKKVAKMEDEAKIILSLVDPSEFHVVNPTKLSRLGNPSGYKIVPTATAA  587

Query  478   SLLDLQDPPQLRAAFTNNQIWVTPYNRSEQWAGGLFTYQSHGDDTLAVWSNRNRVIEKQD  299
             SLLDL DPPQ+R+AFTNNQIWVTPYN++EQWAGG   YQS GDDTLA WS RNR IE +D
Sbjct  588   SLLDLDDPPQIRSAFTNNQIWVTPYNKNEQWAGGFLAYQSRGDDTLATWSQRNRPIENRD  647

Query  298   IVLWYTLGFHHLPCQEDFPVMPTVTSTFQLKPVNFFDRNPIIQANPNFAEDLPIC  134
             IVLWYTLGFHH+PCQEDFPVMP V+S+F LKPVNFFDRNPI++A P F +DLP+C
Sbjct  648   IVLWYTLGFHHVPCQEDFPVMPIVSSSFDLKPVNFFDRNPILRAAPAFVDDLPVC  702



>ref|XP_008788360.1| PREDICTED: primary amine oxidase-like [Phoenix dactylifera]
Length=742

 Score =   818 bits (2114),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 389/662 (59%), Positives = 493/662 (74%), Gaps = 8/662 (1%)
 Frame = -1

Query  2098  ADRPMHPLDPLTIQEIERTRSIL--SSYQPFSGSSLRIHSLSLDEPDKSEVLRWKRGNPL  1925
             +D P HPLDPLT+QEI   RSIL        S SSL IHSLSLDEP K  VL W+ G+ L
Sbjct  82    SDVPRHPLDPLTVQEINAARSILHSYPPFSSSPSSLTIHSLSLDEPPKPAVLNWRPGDTL  141

Query  1924  PTRKAFVVALSNGQAHLLVVDLGSGRVSSHTRNPASGYPPMSADDASTALEATFSNSVFR  1745
             P R+A V A   G +++L VDL S  V+ H   PASG+P M+ DD ++++ A  ++  F 
Sbjct  142   PPRRAAVTARFRGDSYVLSVDLSSRNVTRHPV-PASGFPTMTVDDMTSSVWAPLADPAFN  200

Query  1744  EAISTRGVEINDVVCSAAAPGWFGPEEEGRRITKVKCYTAQNTPNYYMRPIEGLLLTVDL  1565
              ++  RGV ++D+ C   + GWFG +EEGRR+ KV+CY+A+ T N+YMRPIEGL + +D+
Sbjct  201   RSVLARGVRLSDLACLPISLGWFGGKEEGRRLIKVQCYSAEGTANFYMRPIEGLTVLLDM  260

Query  1564  DSGKVINVYDTHSPIPIPKAQGTDYRRDGIEHR--APGVEPLKPISMEQPNGQSFRVEDG  1391
             D+ +V+++ D    IPIPK+  TDYR D +  +  AP ++PLKPIS+EQP G SF VE G
Sbjct  261   DTKEVVDISDVGRDIPIPKSADTDYRYDVVAAQSGAPKIQPLKPISIEQPAGPSFVVEGG  320

Query  1390  YIVKWASWEFHVKADQRAGIIISQATVFDPEAGKRRSVMYKGFASELFVPYMDVDEGWYF  1211
             ++VKWA WEFH+KAD RAG+++S  +  DPE GK+R+VMYKGFASELFVPYMD  + WYF
Sbjct  321   HVVKWAGWEFHLKADARAGLVVSAVSAMDPETGKKRTVMYKGFASELFVPYMDPTDAWYF  380

Query  1210  RAFMDAGEFGLGATAMELVPLNDCPRHSHYIDGLFVDPDGRPVSQPNVICVFERYSGDIA  1031
             + +MDAGE+G G  AM LVPLNDCPR+++Y+DG+F   DGRP  +PN++C+FERY+GDI 
Sbjct  381   KTYMDAGEYGFGLQAMPLVPLNDCPRNAYYMDGVFPAADGRPYVRPNMVCLFERYAGDIG  440

Query  1030  WRHSGTGDADDDLIREARPKVSLVVRTTATVGNYDYIFDWEFQTDGSIRVTVGLSGIILA  851
             WRHS +       IRE RPKV+LV R  A+V NYDYI DWEFQTDG IRV VGLSGI++ 
Sbjct  441   WRHSESPITGMQ-IREVRPKVTLVARMAASVANYDYIVDWEFQTDGLIRVKVGLSGILMV  499

Query  850   KGSPYEHINQFEIPRWDFPAGSLVSENTIGVAHDHFITFHLDMDVDGPTNSFVKVDLVKN  671
             KG+PY H+NQ   P  D   G+L+SEN IGV HDH+ITFHLDMDVDG  NSFVKVD+ + 
Sbjct  500   KGTPYSHLNQVSAPE-DM-HGTLLSENVIGVIHDHYITFHLDMDVDGVENSFVKVDIARQ  557

Query  670   YNIAGKIQRKSYWSPKRKVAKSENDAKIKLQLDKPSEFHVINPRHQSRLGNPSGYKIVPS  491
                 G+  R SY    R VAK+E DA+I+L+L  P E+H+INP   +++GNP GYK+VP+
Sbjct  558   DTDPGESPRTSYLKATRHVAKTEKDAQIRLKLYAPKEYHIINPSKTTKVGNPVGYKVVPA  617

Query  490   ATAASLLDLQDPPQLRAAFTNNQIWVTPYNRSEQWAGGLFTYQSHGDDTLAVWSNRNRVI  311
              TAASLLD  DPPQLR AFTNNQIWVTPYN+SE+WAGGLF YQS GDDTLAVWS R+R I
Sbjct  618   GTAASLLDPNDPPQLRGAFTNNQIWVTPYNKSEEWAGGLFVYQSKGDDTLAVWSERDRPI  677

Query  310   EKQDIVLWYTLGFHHLPCQEDFPVMPTVTSTFQLKPVNFFDRNPIIQANPNFAEDLPICR  131
             E +DIV+WYT+GFHH+PCQEDFP+MPTV S+F LKPVNFF+RNPI++  PN  +DLP+C 
Sbjct  678   ENKDIVVWYTMGFHHVPCQEDFPIMPTVFSSFDLKPVNFFERNPILRVPPNMEKDLPVCT  737

Query  130   AG  125
             A 
Sbjct  738   AA  739



>gb|AIE54293.1| copper-containing amine oxidase [Nicotiana tabacum]
Length=723

 Score =   817 bits (2111),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 394/664 (59%), Positives = 488/664 (73%), Gaps = 11/664 (2%)
 Frame = -1

Query  2104  HFADRPMHPLDPLTIQEIERTRSILSSYQPFS-GSSLRIHSLSLDEPDKSEVLRWKRGNP  1928
             H+AD P HPLDPLTIQEI++ + I++S   F    S  +HS+ L+EP+K  VL W++G  
Sbjct  64    HYADFPNHPLDPLTIQEIQKVKKIINSLDDFKVKGSYVLHSVVLEEPEKEVVLNWRKGQR  123

Query  1927  LPTRKAFVVALSNGQAHLLVVDLGSGRVSSHTRNPASGYPPMSADDASTALEATFSNSVF  1748
             LP+RKA VVA ++G  H+L VD+ + RV+    +  SGYP ++ +D  TA  A   NS F
Sbjct  124   LPSRKASVVARAHGDVHVLTVDIEADRVTHREMDHLSGYPILTIEDMITATAAPLGNSDF  183

Query  1747  REAISTRGVEINDVVCSAAAPGWFGPEEEGRRITKVKCYTAQNTPNYYMRPIEGLLLTVD  1568
                I  RGV++ D+ C   + GW+G  EE RR+ KV+CYT ++T N+YMRPIEGL + +D
Sbjct  184   NRTIIQRGVDLGDLACLPISTGWYGKVEEKRRVIKVQCYTMKDTINFYMRPIEGLTVLLD  243

Query  1567  LDSGKVINVYDTHSPIPIPKAQGTDYRRDGIEHRAPGVEPLKPISMEQPNGQSFRVEDGY  1388
             LD+ +VI + D    IPIPKA  TDYR    +     +  LKPIS+EQPNG SF +ED +
Sbjct  244   LDTKQVIEILDEGKNIPIPKAADTDYRF-STQKNTQALNLLKPISIEQPNGPSFTIEDNH  302

Query  1387  IVKWASWEFHVKADQRAGIIISQATVFDPEAGKRRSVMYKGFASELFVPYMDVDEGWYFR  1208
             IVKWA+WEFH+K D RAG+IIS+  V DP+ GK R+VMYKGF SELFVPYMD  + WYF+
Sbjct  303   IVKWANWEFHLKPDPRAGVIISRVMVQDPDTGKMRNVMYKGFTSELFVPYMDPSDAWYFK  362

Query  1207  AFMDAGEFGLGATAMELVPLNDCPRHSHYIDGLFVDPDGRPVSQPNVICVFERYSGDIAW  1028
              +MDAGE+G G  AM L PLNDCPR+++Y+DG+FV  DG P  + N+ICVFE Y+GDI W
Sbjct  363   TYMDAGEYGFGLQAMPLDPLNDCPRNAYYMDGVFVAADGTPYVRSNMICVFESYAGDIGW  422

Query  1027  RHSG---TGDADDDLIREARPKVSLVVRTTATVGNYDYIFDWEFQTDGSIRVTVGLSGII  857
             RH+    TG      IRE RPKV+LVVR  A+V NYDYI DWEFQTDG IRV VGLSGI+
Sbjct  423   RHAESPITGLP----IREVRPKVTLVVRMAASVANYDYIVDWEFQTDGLIRVKVGLSGIL  478

Query  856   LAKGSPYEHINQFEIPRWDFPAGSLVSENTIGVAHDHFITFHLDMDVDGPTNSFVKVDLV  677
             + KGSPY ++NQ  + + ++  G+L+SEN IGV HDH+ITFHLDMD+DG  NSFVKV+L 
Sbjct  479   MVKGSPYVNMNQ--VNQNEYLYGTLLSENIIGVIHDHYITFHLDMDIDGSNNSFVKVNLQ  536

Query  676   KNYNIAGKIQRKSYWSPKRKVAKSENDAKIKLQLDKPSEFHVINPRHQSRLGNPSGYKIV  497
             K     G+  RKSY    R VAK+E DA+IKL+L  PSEFHVINP  +SR+GNP GYKIV
Sbjct  537   KAMTSPGESPRKSYLKAVRNVAKTEKDAQIKLKLYDPSEFHVINPNKKSRVGNPVGYKIV  596

Query  496   PSATAASLLDLQDPPQLRAAFTNNQIWVTPYNRSEQWAGGLFTYQSHGDDTLAVWSNRNR  317
             P  TAASLLDL DPPQ R AFTNNQIWVTPYN SEQWA GLF YQS GDDTLAVWSNR+R
Sbjct  597   PGGTAASLLDLDDPPQKRGAFTNNQIWVTPYNESEQWAAGLFVYQSQGDDTLAVWSNRDR  656

Query  316   VIEKQDIVLWYTLGFHHLPCQEDFPVMPTVTSTFQLKPVNFFDRNPIIQANPNFAEDLPI  137
              IE +DIVLWYTLGFHH+PCQEDFP+MPTV+S+F++KPVNFF+ NPI+   PN   DLPI
Sbjct  657   PIENKDIVLWYTLGFHHIPCQEDFPIMPTVSSSFEIKPVNFFESNPILXIPPNSPNDLPI  716

Query  136   CRAG  125
             C+A 
Sbjct  717   CKAA  720



>ref|XP_009757703.1| PREDICTED: primary amine oxidase-like [Nicotiana sylvestris]
Length=723

 Score =   816 bits (2109),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 393/664 (59%), Positives = 490/664 (74%), Gaps = 11/664 (2%)
 Frame = -1

Query  2104  HFADRPMHPLDPLTIQEIERTRSILSSYQPFS-GSSLRIHSLSLDEPDKSEVLRWKRGNP  1928
             H+AD P HPLDPLTIQEI++ + I++S   F    S  +HS+ L+EP+K  VL W++G  
Sbjct  64    HYADFPNHPLDPLTIQEIQKVKKIINSLDDFKVKGSYVLHSVVLEEPEKEVVLNWRKGQR  123

Query  1927  LPTRKAFVVALSNGQAHLLVVDLGSGRVSSHTRNPASGYPPMSADDASTALEATFSNSVF  1748
             LP+RKA VVA ++G  H+L VD+ + RV+    +  SGYP ++ +D  TA  A   NS F
Sbjct  124   LPSRKASVVARAHGDVHVLTVDIEADRVTHREMDHLSGYPILTIEDMITATAAPLGNSDF  183

Query  1747  REAISTRGVEINDVVCSAAAPGWFGPEEEGRRITKVKCYTAQNTPNYYMRPIEGLLLTVD  1568
                I  RGV++ D+ C   + GW+G  EE RR+ KV+CYT ++T N+YMRPIEGL + +D
Sbjct  184   NRTIIQRGVDLGDLACLPISTGWYGKVEEKRRVIKVQCYTMKDTINFYMRPIEGLTVLLD  243

Query  1567  LDSGKVINVYDTHSPIPIPKAQGTDYRRDGIEHRAPGVEPLKPISMEQPNGQSFRVEDGY  1388
             LD+ +VI + D    IPIPKA  TDYR    +     +  LKPIS+EQPNG SF +ED +
Sbjct  244   LDTKQVIQILDEGKNIPIPKAADTDYRF-STQKNTQKLNLLKPISIEQPNGPSFTIEDNH  302

Query  1387  IVKWASWEFHVKADQRAGIIISQATVFDPEAGKRRSVMYKGFASELFVPYMDVDEGWYFR  1208
             IVKWA+WEFH+K D RAG+IIS+  V DP+ GK R+VMYKGF SELFVPYMD  + WYF+
Sbjct  303   IVKWANWEFHLKPDPRAGVIISRVMVQDPDTGKMRNVMYKGFTSELFVPYMDPSDAWYFK  362

Query  1207  AFMDAGEFGLGATAMELVPLNDCPRHSHYIDGLFVDPDGRPVSQPNVICVFERYSGDIAW  1028
              +MDAGE+G G  AM L PLNDCPR+++Y+DG+FV  DG P  + N+ICVFE Y+GDI W
Sbjct  363   TYMDAGEYGFGLQAMPLDPLNDCPRNAYYMDGVFVAADGTPYVRSNMICVFESYAGDIGW  422

Query  1027  RHSG---TGDADDDLIREARPKVSLVVRTTATVGNYDYIFDWEFQTDGSIRVTVGLSGII  857
             RH+    TG      IRE RPKV+L+VR  A+V NYDYI DWEFQTDG IRV VGLSGI+
Sbjct  423   RHAESPITGLP----IREVRPKVTLMVRMAASVANYDYIVDWEFQTDGLIRVKVGLSGIL  478

Query  856   LAKGSPYEHINQFEIPRWDFPAGSLVSENTIGVAHDHFITFHLDMDVDGPTNSFVKVDLV  677
             + KGSPY ++NQ  + + ++  G+L+SEN IGV HDH+ITFHLDMD+DG  NSFVKV+L 
Sbjct  479   MVKGSPYVNMNQ--VNQNEYLYGTLLSENIIGVIHDHYITFHLDMDIDGSNNSFVKVNLQ  536

Query  676   KNYNIAGKIQRKSYWSPKRKVAKSENDAKIKLQLDKPSEFHVINPRHQSRLGNPSGYKIV  497
             K     G+  RKSY    R VAK+E DA+IKL+L  PSEFHVINP  +SR+GNP+GYKIV
Sbjct  537   KATTSPGESPRKSYLKAVRNVAKTEKDAQIKLKLYDPSEFHVINPNKKSRVGNPAGYKIV  596

Query  496   PSATAASLLDLQDPPQLRAAFTNNQIWVTPYNRSEQWAGGLFTYQSHGDDTLAVWSNRNR  317
             P  TAASLLDL DPPQ R AFTNNQIWVTPYN SEQWA GLF YQS GDDTLAVWSNR+R
Sbjct  597   PGGTAASLLDLDDPPQKRGAFTNNQIWVTPYNESEQWAAGLFVYQSQGDDTLAVWSNRDR  656

Query  316   VIEKQDIVLWYTLGFHHLPCQEDFPVMPTVTSTFQLKPVNFFDRNPIIQANPNFAEDLPI  137
              IE +DIVLWYTLGFHH+PCQEDFP+MPTV+S+F++KPVNFF+ NPI++  PN   DLPI
Sbjct  657   PIENKDIVLWYTLGFHHIPCQEDFPIMPTVSSSFEIKPVNFFESNPILRIPPNSPNDLPI  716

Query  136   CRAG  125
             C+A 
Sbjct  717   CKAA  720



>gb|KFK33857.1| hypothetical protein AALP_AA5G069100 [Arabis alpina]
Length=694

 Score =   814 bits (2102),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 389/664 (59%), Positives = 498/664 (75%), Gaps = 7/664 (1%)
 Frame = -1

Query  2119  KIQNNHFADRPMHPLDPLTIQEIERTRSILSSY-QPFSGSSLRIHSLSLDEPDKSEVLRW  1943
             K + ++ +++P HPLDPLT  EIER ++ILS +   F   S  IHS++LDEP+K  V++W
Sbjct  36    KTRFDYSSEKPHHPLDPLTAPEIERVQAILSGHDSAFGSGSAMIHSMALDEPNKQRVVQW  95

Query  1942  KRGNPLPTRKAFVVALSNGQAHLLVVDLGSGRVSSHTRNPASGYPPMSADDASTALEATF  1763
             K+G+ +P RKA V+A+SNG++ +L VDL SGRV S   +P SGYP ++ DD     +  F
Sbjct  96    KKGDRIPPRKAEVLAMSNGESRVLTVDLNSGRVVSDLTSPTSGYPMLTMDDTIAVSQVPF  155

Query  1762  SNSVFREAISTRGVEINDVVCSAAAPGWFGPEEEGRRITKVKCYTAQNTPNYYMRPIEGL  1583
              +  F  +I  RG+  + +VC     GWFGP+EEGRR+ K++CY+ Q+T N YMRPIEGL
Sbjct  156   KSVEFNRSIEARGIPFSSLVCLTPFAGWFGPDEEGRRVIKIQCYSKQDTVNIYMRPIEGL  215

Query  1582  LLTVDLDSGKVINVYDTHSPIPIPKAQGTDYRRDGIEHRAPGVEPLKPISMEQPNGQSFR  1403
              LTVD+D  ++I + D   P+P+P + GT+YR  G   +   ++ + P+SMEQP+G SFR
Sbjct  216   YLTVDMDKLEIIKIIDK-GPVPVPSSIGTEYRY-GFLDKPVHMDRVNPMSMEQPDGVSFR  273

Query  1402  VEDGYIVKWASWEFHVKADQRAGIIISQATVFDPEAGKRRSVMYKGFASELFVPYMDVDE  1223
             VEDGY V+WA+W FH+K D RAG+IISQATV D E G+ RSVMYKGFASEL+VPYMD +E
Sbjct  274   VEDGYSVEWANWVFHIKPDLRAGMIISQATVRDSETGEARSVMYKGFASELYVPYMDPEE  333

Query  1222  GWYFRAFMDAGEFGLGATAMELVPLNDCPRHSHYIDGLFVDPDGRPVSQPNVICVFERYS  1043
             GWY RA+MDAGEFGLG ++M LVPLNDCPR+++YIDGLFV P G PV QP +IC+FERY+
Sbjct  334   GWYSRAYMDAGEFGLGPSSMPLVPLNDCPRNAYYIDGLFVSPQGNPVLQPKMICLFERYA  393

Query  1042  GDIAWRHSGTGDADDDLIREARPKVSLVVRTTATVGNYDYIFDWEFQTDGSIRVTVGLSG  863
             G+I+WRHS       D IRE+RPKV+LV R  ++VGNYDYIFDWEFQ DG IRVTV  SG
Sbjct  394   GEISWRHSEILLPGVD-IRESRPKVTLVARMASSVGNYDYIFDWEFQMDGLIRVTVAASG  452

Query  862   IILAKGSPYEHINQFEIPRWDFPAGSLVSENTIGVAHDHFITFHLDMDVDGP-TNSFVKV  686
             +++ KG+ YE+++       D  +G L+SENTIGV HDHFI+FHLDMD+DG   NSFVKV
Sbjct  453   MLMVKGTAYENVHDLGEKEDD--SGPLISENTIGVVHDHFISFHLDMDIDGSENNSFVKV  510

Query  685   DLVKNYNIAGKIQRKSYWSPKRKVAKSENDAKIKLQLDKPSEFHVINPRHQSRLGNPSGY  506
              L K     GK +RKSY   K+ VAK+E DA+IKL +  P EFH++N   QSRLGNP GY
Sbjct  511   HLEKQRLPPGKSRRKSYLKVKKYVAKTEKDAQIKLSMYDPYEFHLVNTNRQSRLGNPPGY  570

Query  505   KIVPSATAASLLDLQDPPQLRAAFTNNQIWVTPYNRSEQWAGGLFTYQSHGDDTLAVWSN  326
             K+VP   AASLLD  DPPQ+R AFTNNQIWVT YNRSEQWAGGL  YQS G+DTL VWS+
Sbjct  571   KLVPGGNAASLLDHDDPPQIRGAFTNNQIWVTRYNRSEQWAGGLLMYQSRGEDTLQVWSD  630

Query  325   RNRVIEKQDIVLWYTLGFHHLPCQEDFPVMPTVTSTFQLKPVNFFDRNPIIQANPNFAED  146
             R+R IE +DIV+WYTLGFHH+PCQEDFPVMPT++++F+LKPVNFF+ NP++   P F +D
Sbjct  631   RDRSIENKDIVMWYTLGFHHVPCQEDFPVMPTISASFELKPVNFFESNPVLGIAPYFEKD  690

Query  145   LPIC  134
             LP+C
Sbjct  691   LPVC  694



>gb|KDP25605.1| hypothetical protein JCGZ_20761 [Jatropha curcas]
Length=734

 Score =   814 bits (2103),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 387/662 (58%), Positives = 495/662 (75%), Gaps = 5/662 (1%)
 Frame = -1

Query  2113  QNNHFADRPMHPLDPLTIQEIERTRSILSSYQPF-SGSSLRIHSLSLDEPDKSEVLRWKR  1937
             Q+NH +D P HPLDPLTI+E+ + R+ILSS+Q F S SS  +HS+ L+EPDKS VLRW++
Sbjct  72    QHNHDSDVPHHPLDPLTIKELNKVRTILSSHQLFKSSSSFALHSVVLEEPDKSLVLRWRK  131

Query  1936  GNPLPTRKAFVVALSNGQAHLLVVDLGSGRVSSHTRNPASGYPPMSADDASTALEATFSN  1757
             G+P+  RKA VVA  NGQ+H+L VDL +  V     NP SGYP M+ +D +TA  A  SN
Sbjct  132   GDPMLPRKAAVVARVNGQSHVLTVDLTTSEVDIQETNPLSGYPTMTIEDMTTATWAPLSN  191

Query  1756  SVFREAISTRGVEINDVVCSAAAPGWFGPEEEGRRITKVKCYTAQNTPNYYMRPIEGLLL  1577
             + F   I  RGV + D+ C   + GW+G  EE RR+ KV+CY+ + T N+YMRPIEGL +
Sbjct  192   ADFNRTIIQRGVALKDLACLPISLGWYGKNEENRRLIKVQCYSMKGTANFYMRPIEGLTV  251

Query  1576  TVDLDSGKVINVYDTHSPIPIPKAQGTDYRRDGIEHRAPGVEPLKPISMEQPNGQSFRVE  1397
              +D+D+ +V+ + D    IPIPKA  TDY    ++     ++ + PIS+EQP G SF VE
Sbjct  252   LLDMDTKEVVEISDKGRNIPIPKAANTDYLYSTVKVNQ-QMKLVNPISIEQPKGPSFTVE  310

Query  1396  DGYIVKWASWEFHVKADQRAGIIISQATVFDPEAGKRRSVMYKGFASELFVPYMDVDEGW  1217
             D ++VKWA+WEFH+K D RAG+IIS A V DP+ G+ R+VMYKGF SELFVPYMD  + W
Sbjct  311   DNHLVKWANWEFHLKPDPRAGVIISGAKVQDPDTGETRNVMYKGFTSELFVPYMDPTDAW  370

Query  1216  YFRAFMDAGEFGLGATAMELVPLNDCPRHSHYIDGLFVDPDGRPVSQPNVICVFERYSGD  1037
             YF+ +MDAGE+G G  AM L PLNDCPR+++Y+DG+F   DG P  + N+ICVFE Y+GD
Sbjct  371   YFKTYMDAGEYGFGLQAMPLDPLNDCPRNAYYMDGVFPAGDGTPYIRSNMICVFESYTGD  430

Query  1036  IAWRHSGTGDADDDLIREARPKVSLVVRTTATVGNYDYIFDWEFQTDGSIRVTVGLSGII  857
             I WRHS +     + IRE RPKV+LVVR  A+V NYDYI DWEFQ DG IR+ VGLSGI+
Sbjct  431   IGWRHSESPITGME-IREVRPKVTLVVRMAASVANYDYIVDWEFQIDGLIRIKVGLSGIL  489

Query  856   LAKGSPYEHINQFEIPRWDFPAGSLVSENTIGVAHDHFITFHLDMDVDGPTNSFVKVDLV  677
             + KG+ YE++NQ  +   +   G+L+SEN IGV HDH+ITF+LDMDVDG  NSFVK+++ 
Sbjct  490   MVKGTSYENMNQ--VAGKENLYGTLLSENVIGVIHDHYITFYLDMDVDGSDNSFVKLNVQ  547

Query  676   KNYNIAGKIQRKSYWSPKRKVAKSENDAKIKLQLDKPSEFHVINPRHQSRLGNPSGYKIV  497
             K     G+  R+SY + KR VAK+E DA+I+L+L  PSEFHVINP  ++R+GNP GYK+V
Sbjct  548   KKRTSPGESPRRSYLTAKRNVAKTEKDAQIQLKLYDPSEFHVINPNKKTRVGNPVGYKVV  607

Query  496   PSATAASLLDLQDPPQLRAAFTNNQIWVTPYNRSEQWAGGLFTYQSHGDDTLAVWSNRNR  317
             P  TAASLLDL DPPQ R AFTNNQIWVTPYNRSEQWAGGLF YQS G+DTLAVWS+R+R
Sbjct  608   PGGTAASLLDLDDPPQKRGAFTNNQIWVTPYNRSEQWAGGLFVYQSQGEDTLAVWSDRDR  667

Query  316   VIEKQDIVLWYTLGFHHLPCQEDFPVMPTVTSTFQLKPVNFFDRNPIIQANPNFAEDLPI  137
              IE +DIV+WYTLGFHH+PCQEDFP+MPTV+++F LKPVNFF+ NPI++  PN  +DLP+
Sbjct  668   PIENKDIVVWYTLGFHHIPCQEDFPIMPTVSASFDLKPVNFFESNPILRIPPNVEKDLPV  727

Query  136   CR  131
             CR
Sbjct  728   CR  729



>ref|XP_009595837.1| PREDICTED: primary amine oxidase-like [Nicotiana tomentosiformis]
Length=722

 Score =   813 bits (2101),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 391/667 (59%), Positives = 490/667 (73%), Gaps = 11/667 (2%)
 Frame = -1

Query  2113  QNNHFADRPMHPLDPLTIQEIERTRSILSSYQPFS-GSSLRIHSLSLDEPDKSEVLRWKR  1937
             ++   AD P HPLDPLTIQEI++ + I++S + F    S  +HS+ L+EP+K  VL W++
Sbjct  60    KDKKHADFPNHPLDPLTIQEIQKVKKIINSLEGFKIKGSYVLHSVVLEEPEKKVVLNWRK  119

Query  1936  GNPLPTRKAFVVALSNGQAHLLVVDLGSGRVSSHTRNPASGYPPMSADDASTALEATFSN  1757
             G  LP+RKA V+A ++G  H+L VD+ +GRV+    +  SGYP ++ +D  TA  A   N
Sbjct  120   GQRLPSRKASVIARAHGDVHVLTVDIATGRVTRREMDHLSGYPILTIEDMITARVAPLGN  179

Query  1756  SVFREAISTRGVEINDVVCSAAAPGWFGPEEEGRRITKVKCYTAQNTPNYYMRPIEGLLL  1577
             S F   I  RGV++ D+ C   + GW+G  EE RR+ KV+CYT ++T N+YMRPIEGL +
Sbjct  180   SDFNRTIIQRGVDLADLACLPISTGWYGKVEEKRRVIKVQCYTMKDTINFYMRPIEGLTV  239

Query  1576  TVDLDSGKVINVYDTHSPIPIPKAQGTDYRRDGIEHRAPGVEPLKPISMEQPNGQSFRVE  1397
              +DLD+ +VI + D    IPIPKA  TDYR    +     +  LKPIS+EQPNG SF +E
Sbjct  240   LLDLDTKQVIEILDEGKNIPIPKAADTDYRF-STQKNTQALNLLKPISIEQPNGPSFTIE  298

Query  1396  DGYIVKWASWEFHVKADQRAGIIISQATVFDPEAGKRRSVMYKGFASELFVPYMDVDEGW  1217
             D +IVKWA+WEFH+K D RAG+IIS+  V DP+ GK R+VMYKGF SELFVPYMD  + W
Sbjct  299   DNHIVKWANWEFHLKPDPRAGVIISRVMVQDPDTGKMRNVMYKGFTSELFVPYMDPSDAW  358

Query  1216  YFRAFMDAGEFGLGATAMELVPLNDCPRHSHYIDGLFVDPDGRPVSQPNVICVFERYSGD  1037
             YF+ +MDAGE+G G  AM L PLNDCPR+++Y+DG+FV  DG P  + N+ICVFE Y+GD
Sbjct  359   YFKTYMDAGEYGFGLQAMPLDPLNDCPRNAYYMDGVFVAADGTPYVRSNMICVFESYAGD  418

Query  1036  IAWRHSG---TGDADDDLIREARPKVSLVVRTTATVGNYDYIFDWEFQTDGSIRVTVGLS  866
             I WRH+    TG      IRE RPKV+LVVR  A+V NYDYI DWEFQTDG IRV VGLS
Sbjct  419   IGWRHAESPITGLP----IREVRPKVTLVVRMAASVANYDYIVDWEFQTDGLIRVKVGLS  474

Query  865   GIILAKGSPYEHINQFEIPRWDFPAGSLVSENTIGVAHDHFITFHLDMDVDGPTNSFVKV  686
             GI++ KGSPY ++NQ  + + ++  G+L+SEN IGV HDH+ITFHLDMD+DG  NSFVKV
Sbjct  475   GILMVKGSPYVNMNQ--VNQNEYLYGTLLSENIIGVIHDHYITFHLDMDIDGSNNSFVKV  532

Query  685   DLVKNYNIAGKIQRKSYWSPKRKVAKSENDAKIKLQLDKPSEFHVINPRHQSRLGNPSGY  506
             +L K     G+  RKSY    R VAK+E DA+IKL+L  PSEFHVINP  +SR+GNP+GY
Sbjct  533   NLQKAMTSPGESPRKSYLKAVRNVAKTEKDAQIKLKLYDPSEFHVINPSKKSRVGNPAGY  592

Query  505   KIVPSATAASLLDLQDPPQLRAAFTNNQIWVTPYNRSEQWAGGLFTYQSHGDDTLAVWSN  326
             KIVP  TAASLLDL DPPQ R AFTNNQIWVTPYN SEQWA GLF YQS GDDTLA+WSN
Sbjct  593   KIVPGGTAASLLDLDDPPQKRGAFTNNQIWVTPYNESEQWAAGLFVYQSQGDDTLAIWSN  652

Query  325   RNRVIEKQDIVLWYTLGFHHLPCQEDFPVMPTVTSTFQLKPVNFFDRNPIIQANPNFAED  146
             R+R IE +DIVLWYTLGFHH+PCQEDFP+MPTV+S+F++KPVNFF+ NPI+   PN   D
Sbjct  653   RDRPIENKDIVLWYTLGFHHIPCQEDFPIMPTVSSSFEIKPVNFFESNPILSIPPNSPND  712

Query  145   LPICRAG  125
             LP C+A 
Sbjct  713   LPNCKAA  719



>gb|ADQ37305.1| putative copper-containing diamine oxidase [Pinus sylvestris]
Length=729

 Score =   813 bits (2100),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 374/660 (57%), Positives = 491/660 (74%), Gaps = 6/660 (1%)
 Frame = -1

Query  2107  NHFADRPMHPLDPLTIQEIERTRSILSSYQPFSGSSLRIHSLSLDEPDKSEVLRWKRGNP  1928
             +H  +   HPLDPLT+QEI++ + I+     F+     +HS+ L+EP K +VL WK G+ 
Sbjct  73    DHEKEVAKHPLDPLTVQEIKKVQKIVQQSSIFNHGKFTLHSVVLEEPPKEQVLLWKAGSS  132

Query  1927  LPTRKAFVVALSNGQAHLLVVDLGSGRVSSHTRNPASGYPPMSADDASTALEATFSNSVF  1748
             LP+RKA ++A +NG A+ L+VDL SG++  +  +  +GYP M+ +D ++A++    +  F
Sbjct  133   LPSRKAEIIAWANGHAYKLIVDLASGKIVDNQISHENGYPAMTMEDMTSAVKVPLKSKQF  192

Query  1747  REAISTRGVEINDVVCSAAAPGWFGPEEEGRRITKVKCYTAQNTPNYYMRPIEGLLLTVD  1568
              E I  RGV ++D+ C   + GWFG +EEGRR+ KV+CY++  T N+YMRPIEGL + VD
Sbjct  193   LEIIGKRGVNVSDLSCLPISLGWFGADEEGRRLIKVQCYSSAGTANFYMRPIEGLTVLVD  252

Query  1567  LDSGKVINVYDTHSPIPIPKAQGTDYRRDGIEHRAPGVEPLKPISMEQPNGQSFRVEDGY  1388
             +DS +V+ + D    IP+PKA+GTDYR      + P + PL PIS+EQP G SF+V DG+
Sbjct  253   MDSNEVLKITDKGKDIPLPKAEGTDYRLSA--QKYPLLPPLNPISIEQPKGPSFKV-DGH  309

Query  1387  IVKWASWEFHVKADQRAGIIISQATVFDPEAGKRRSVMYKGFASELFVPYMDVDEGWYFR  1208
              VKW SWEFH+K D RAG+IISQA + DP+ GK R V+YKGF SELFVPYMD  + WYF+
Sbjct  310   QVKWGSWEFHLKPDPRAGVIISQAAIKDPDTGKLRRVLYKGFTSELFVPYMDPSDAWYFK  369

Query  1207  AFMDAGEFGLGATAMELVPLNDCPRHSHYIDGLFVDPDGRPVSQPNVICVFERYSGDIAW  1028
              +MDAGE+G G TAM L PLNDCPR+++Y+DG+    DG P  +PN++C+FERY GDIAW
Sbjct  370   TYMDAGEYGFGLTAMSLDPLNDCPRNAYYMDGVMASADGAPYVRPNMVCIFERYEGDIAW  429

Query  1027  RHSGTGDADDDLIREARPKVSLVVRTTATVGNYDYIFDWEFQTDGSIRVTVGLSGIILAK  848
             RH+    +  + IRE RPKV+LV R  A+V NYDYI DWEFQTDG IR+ VGLSGI++ K
Sbjct  430   RHTECPISGME-IREVRPKVTLVARMAASVANYDYIVDWEFQTDGLIRIKVGLSGILMIK  488

Query  847   GSPYEHINQFEIPRWDFPAGSLVSENTIGVAHDHFITFHLDMDVDGPTNSFVKVDLVKNY  668
             G+ YE++NQ  I   D   G+L+++N IGV HDH++TF+LDMDVDG  NSFV+V + K  
Sbjct  489   GTKYENVNQ--IRSQDELHGTLLAQNIIGVIHDHYVTFYLDMDVDGTDNSFVQVKMAKQT  546

Query  667   NIAGKIQRKSYWSPKRKVAKSENDAKIKLQLDKPSEFHVINPRHQSRLGNPSGYKIVPSA  488
                G+  RKS+W  +R VA++E DA+IKL L +PSEFHVINP  ++++GNP GYK+VP  
Sbjct  547   VKNGQTPRKSFWKAERHVAQTEKDAQIKLSLYQPSEFHVINPSKKTKIGNPVGYKVVPGG  606

Query  487   TAASLLDLQDPPQLRAAFTNNQIWVTPYNRSEQWAGGLFTYQSHGDDTLAVWSNRNRVIE  308
             TAASLLD  DPPQLR AFTNNQIWVTPYN+SE+WAGGL+ YQS GDDTL+VWSNRNR IE
Sbjct  607   TAASLLDHNDPPQLRGAFTNNQIWVTPYNKSEEWAGGLYVYQSKGDDTLSVWSNRNRNIE  666

Query  307   KQDIVLWYTLGFHHLPCQEDFPVMPTVTSTFQLKPVNFFDRNPIIQANPNFAEDLPICRA  128
             K+DIVLWYTLGFHHLPCQED+P+MPTV+S+F LKP NFF+ NPI++  PN+ +DLP C A
Sbjct  667   KKDIVLWYTLGFHHLPCQEDYPIMPTVSSSFDLKPTNFFESNPILRTAPNYEKDLPTCAA  726



>ref|XP_002877298.1| hypothetical protein ARALYDRAFT_347467 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH53557.1| hypothetical protein ARALYDRAFT_347467 [Arabidopsis lyrata subsp. 
lyrata]
Length=687

 Score =   811 bits (2094),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 383/661 (58%), Positives = 497/661 (75%), Gaps = 17/661 (3%)
 Frame = -1

Query  2095  DRPMHPLDPLTIQEIERTRSILSSYQP-FSGSSLRIHSLSLDEPDKSEVLRWKRGNPLPT  1919
             ++P HPLDPLT  EI+R R+ILS + P F   S  IH+++LDEP+K  V+RWK+G+ LP 
Sbjct  37    EKPHHPLDPLTSHEIKRVRTILSGHDPGFGSGSAIIHAMALDEPEKQRVVRWKKGDRLPP  96

Query  1918  RKAFVVALSNGQAHLLVVDLGSGRVSSHTRNPASGYPPMSADDASTALEATFSNSVFREA  1739
             R+A V+A+SNG++H+L VDL SGRV S   NP  GYP ++ +D   A +  F +  F  +
Sbjct  97    RRAEVLAMSNGESHVLTVDLKSGRVVSDLVNPTFGYPILTMNDIVAASQVPFKSVEFNRS  156

Query  1738  ISTRGVEINDVVCSAAAPGWFGPEEEGRRITKVKCYTAQNTPNYYMRPIEGLLLTVDLDS  1559
             I  RG+  +D++C   A GWFGP+EEGRR+ K++C++ ++T N+YMRPIEGL LTVD+D 
Sbjct  157   IEARGIPSSDLICITPAAGWFGPDEEGRRVIKIQCFSKKDTVNFYMRPIEGLYLTVDMDK  216

Query  1558  GKVINVYDTHSPIPIPKAQGTDYRRDGIEHRAPGVEPLKPISMEQPNGQSFRVEDGYIVK  1379
              ++I + D +  +P+PK+ GT+YR  G  +    ++ + P+SMEQP+G SF+VEDGY+VK
Sbjct  217   LEIIKIVD-NGLVPVPKSTGTEYRH-GFLNETVHMDRVNPMSMEQPDGPSFKVEDGYLVK  274

Query  1378  WASWEFHVKADQRAGIIISQATVFDPEAGKRRSVMYKGFASELFVPYMDVDEGWYFRAFM  1199
             WA+W+FH+K DQRAG+IISQA+V D + G+ RSVMYKGFASEL+VPYMD +EGWY +AFM
Sbjct  275   WANWKFHIKPDQRAGMIISQASVRDSKTGEARSVMYKGFASELYVPYMDPEEGWYSKAFM  334

Query  1198  DAGEFGLGATAMELVPLNDCPRHSHYIDGLFVDPDGRPVSQPNVICVFERYSGDIAWRHS  1019
             DAGEFGLG T+M LVPLNDCPR+++YIDG+F  P G P+ QPN+IC+FERY+GD +WRHS
Sbjct  335   DAGEFGLGPTSMPLVPLNDCPRNAYYIDGVFASPKGDPILQPNMICLFERYAGDTSWRHS  394

Query  1018  -----GTGDADDDLIREARPKVSLVVRTTATVGNYDYIFDWEFQTDGSIRVTVGLSGIIL  854
                  GT       IRE+R KV+LV R   +VGNYDY FDWEFQ DG IRVTV  SG+++
Sbjct  395   EILLPGTN------IRESRAKVTLVARMACSVGNYDYTFDWEFQMDGLIRVTVAASGMLM  448

Query  853   AKGSPYEHINQFEIPRWDFPAGSLVSENTIGVAHDHFITFHLDMDVDGPTN-SFVKVDLV  677
              KG+PY ++        D  +G L+SEN IGV HDHFITFHLD+D+D P N SFVKV L 
Sbjct  449   VKGTPYTNVQDLGEKEAD--SGPLISENVIGVVHDHFITFHLDIDIDEPANNSFVKVHLE  506

Query  676   KNYNIAGKIQRKSYWSPKRKVAKSENDAKIKLQLDKPSEFHVINPRHQSRLGNPSGYKIV  497
             K     G+ +RKSY   K+ VAK+E DA+IKL +  P EFH++NP  +SRLGNP+GYK+V
Sbjct  507   KQRLPPGESRRKSYLKAKKYVAKTEKDAQIKLSMYDPYEFHLVNPTRRSRLGNPAGYKLV  566

Query  496   PSATAASLLDLQDPPQLRAAFTNNQIWVTPYNRSEQWAGGLFTYQSHGDDTLAVWSNRNR  317
               A AASLLD  DPPQ+R AFTNN+IWVT YNRSEQWAGGL  YQS G+DTL VWS+R+R
Sbjct  567   HGANAASLLDHDDPPQIRGAFTNNRIWVTRYNRSEQWAGGLLMYQSRGEDTLQVWSDRDR  626

Query  316   VIEKQDIVLWYTLGFHHLPCQEDFPVMPTVTSTFQLKPVNFFDRNPIIQANPNFAEDLPI  137
              IE +DIVLWYTLGFHH+PCQEDFP+MPT+ ++F+LKPVNFF+ NPI+   P F +DL +
Sbjct  627   SIENEDIVLWYTLGFHHVPCQEDFPIMPTIAASFELKPVNFFESNPILGITPFFEKDLQV  686

Query  136   C  134
             C
Sbjct  687   C  687



>ref|XP_010264175.1| PREDICTED: primary amine oxidase-like [Nelumbo nucifera]
Length=732

 Score =   812 bits (2097),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 388/690 (56%), Positives = 501/690 (73%), Gaps = 8/690 (1%)
 Frame = -1

Query  2188  CLSFESSNASINNLES----LLGIHDFKIQNNHFADRPMHPLDPLTIQEIERTRSILSSY  2021
             C S+     S N  +S    +    + K+Q NH A  P HPLDPLTIQEI +  +I  SY
Sbjct  42    CSSYSPWCTSKNRFQSKPHLIRNPENTKLQRNHNAQVPHHPLDPLTIQEINKVLTIFLSY  101

Query  2020  QPFSGSSLRIHSLSLDEPDKSEVLRWKRGNPLPTRKAFVVALSNGQAHLLVVDLGSGRVS  1841
                S SS  IHSL L EP+K  VL WK+G+PL  R+A VVAL NG++H+L VDL S +V 
Sbjct  102   PLISSSSFTIHSLVLQEPEKPLVLSWKKGDPLLPRRASVVALVNGKSHVLTVDLDSSQVI  161

Query  1840  SHTRNPASGYPPMSADDASTALEATFSNSVFREAISTRGVEINDVVCSAAAPGWFGPEEE  1661
              H      GYP M+ +D ++A  A  +++ F   I  RG+ + D+ C   + GW+G +EE
Sbjct  162   RHDLGSPFGYPMMTIEDMNSATWAPLADANFNRTILNRGINLADLACLPISTGWYGKKEE  221

Query  1660  GRRITKVKCYTAQNTPNYYMRPIEGLLLTVDLDSGKVINVYDTHSPIPIPKAQGTDYRRD  1481
              RR+ KV+CY+ + T N+YMRPIEGL + +D+D+ +V+ + D    IPIP+A  TDYR  
Sbjct  222   NRRLIKVQCYSMEGTANFYMRPIEGLTVLLDMDTREVVEISDKGQHIPIPQAANTDYRY-  280

Query  1480  GIEHRAPGVEPLKPISMEQPNGQSFRVEDGYIVKWASWEFHVKADQRAGIIISQATVFDP  1301
               +++   ++PL PIS+EQP G SF +E+ ++VKWA+WEFH+K D RAG+IIS+A V D 
Sbjct  281   AAQNKPLRMKPLNPISIEQPKGPSFSIENEHMVKWANWEFHLKPDPRAGVIISRAMVRDS  340

Query  1300  EAGKRRSVMYKGFASELFVPYMDVDEGWYFRAFMDAGEFGLGATAMELVPLNDCPRHSHY  1121
             E G+ RSVMYKG  SELFVPYMD  + WYF+ +MDAGE+G G  AM L PLNDCPR+++Y
Sbjct  341   ETGELRSVMYKGLTSELFVPYMDPTDAWYFKTYMDAGEYGFGLQAMPLDPLNDCPRNAYY  400

Query  1120  IDGLFVDPDGRPVSQPNVICVFERYSGDIAWRHSGTGDADDDLIREARPKVSLVVRTTAT  941
             +DG+F   DG+P  + N+ICVFE Y+GDI WRHS +     + IRE RPKV+LVVR  A+
Sbjct  401   MDGVFAAADGKPYVRSNMICVFESYAGDIGWRHSESPITGME-IREVRPKVTLVVRMAAS  459

Query  940   VGNYDYIFDWEFQTDGSIRVTVGLSGIILAKGSPYEHINQFEIPRWDFPAGSLVSENTIG  761
             V NYDYI DWEFQTDG IR+ VGLSGI++ KG+PY ++N+  +P+ +   G+L+SEN IG
Sbjct  460   VANYDYIVDWEFQTDGLIRIKVGLSGILMVKGTPYGNMNK--VPQEEDLYGTLLSENVIG  517

Query  760   VAHDHFITFHLDMDVDGPTNSFVKVDLVKNYNIAGKIQRKSYWSPKRKVAKSENDAKIKL  581
             V HDH+ITF+LDMD+DG  NSFVKV+L +   + G+  RKSY    R VAK+E DA+IKL
Sbjct  518   VIHDHYITFYLDMDIDGSDNSFVKVNLARQDTLPGESPRKSYLKATRHVAKTEKDAQIKL  577

Query  580   QLDKPSEFHVINPRHQSRLGNPSGYKIVPSATAASLLDLQDPPQLRAAFTNNQIWVTPYN  401
             +L  PSEFHVIN   ++R+GNP GYK+VP  TAASLLD QDPPQLR AFTNNQIWVT YN
Sbjct  578   KLYDPSEFHVINSNKKTRVGNPVGYKVVPGGTAASLLDHQDPPQLRGAFTNNQIWVTRYN  637

Query  400   RSEQWAGGLFTYQSHGDDTLAVWSNRNRVIEKQDIVLWYTLGFHHLPCQEDFPVMPTVTS  221
             RSEQWAGG+F YQS G+DTLAVWS RNR IE +DIVLWYTLGFHH+PCQEDFP+MPTV+S
Sbjct  638   RSEQWAGGVFVYQSQGEDTLAVWSERNRPIENKDIVLWYTLGFHHIPCQEDFPIMPTVSS  697

Query  220   TFQLKPVNFFDRNPIIQANPNFAEDLPICR  131
             +F LKPVNFF+ NP+++  PN+ +DLP+CR
Sbjct  698   SFDLKPVNFFESNPVLRMPPNYEKDLPVCR  727



>ref|XP_006857816.1| hypothetical protein AMTR_s00069p00020400 [Amborella trichopoda]
 gb|ERN19283.1| hypothetical protein AMTR_s00069p00020400 [Amborella trichopoda]
Length=745

 Score =   812 bits (2097),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 398/679 (59%), Positives = 494/679 (73%), Gaps = 27/679 (4%)
 Frame = -1

Query  2122  FKIQNNHFADRPMHPLDPLTIQEIERTRSILSSYQPFSGSSLRIHSLSLDEPDKSEVLRW  1943
             F  Q +H  + P HPLDPLTIQE  + + ILS+Y P + SS  IHSL L+EP+K EVL W
Sbjct  68    FFEQVDHQKEVPHHPLDPLTIQEFSKVKRILSNYNPDTSSS--IHSLVLEEPEKGEVLAW  125

Query  1942  KRG-NPLPTRKAFVVALSNGQAHLLVVDLGSGRVSSHTRNPASGYPPMSADDASTALEAT  1766
              +G NPLPTRKA VV L  G++H L +DL SG V     +  SGYPPM+ +D + A    
Sbjct  126   NKGKNPLPTRKASVVTLVGGRSHQLSIDLSSGHVVQDKVSTTSGYPPMTIEDMTAATAIP  185

Query  1765  FSNSVFREAISTRGVEINDVVCSAAAPGWFG-PEEEGRRITKVKCYTAQNTPNYYMRPIE  1589
              +++ F   I +RGVE+ D+ C     GW+G PEE+GRR+ KV+CY+ + T N+YMRPIE
Sbjct  186   LADAEFNRTIRSRGVELADLACLPLTGGWYGGPEEDGRRLVKVQCYSMEGTANFYMRPIE  245

Query  1588  GLLLTVDLDSGKVINVYDTHSPIPIPKAQGTDYR----RDGIEHRAPGVEPLKPISMEQP  1421
             GL + VDLD+ KV+ + D    IP+PKA GTDYR    +    H+A G   L PISMEQ 
Sbjct  246   GLTVLVDLDTKKVVKISDVGRGIPVPKAGGTDYRYESQKKNQHHKAGGQRLLNPISMEQH  305

Query  1420  NGQSFRVEDGYIVKWASWEFHVKADQRAGIIISQATVFDPEAGKRRSVMYKGFASELFVP  1241
              G SF+V +G+ V+W SW+FH+KAD RAG+IISQA+  DP +G+ RSV+YKG  SELFVP
Sbjct  306   KGPSFKVVEGHQVRWGSWDFHLKADPRAGVIISQASFRDPVSGEPRSVLYKGSVSELFVP  365

Query  1240  YMDVDEGWYFRAFMDAGEFGLGATAMELVPLNDCPRHSHYIDGLFVDPDGRPVSQPNVIC  1061
             YMD  + WYF+ +MDAGE+G G  AM L PLNDCPR+S+Y+DG+F   DG P  + N+IC
Sbjct  366   YMDPSDAWYFKTYMDAGEYGFGLLAMPLDPLNDCPRNSYYMDGVFASSDGTPYVRANMIC  425

Query  1060  VFERYSGDIAWRHSG---TGDADDDLIREARPKVSLVVRTTATVGNYDYIFDWEFQTDGS  890
             +FE Y GDIAWRH+    TG      IRE RPKV+LVVR  A+V NYDYI DWEFQTDG 
Sbjct  426   IFESYGGDIAWRHTECPITGMQ----IREVRPKVTLVVRMAASVANYDYIVDWEFQTDGL  481

Query  889   IRVTVGLSGIILAKGSPYEHI-------NQFEIPRWDFPAGSLVSENTIGVAHDHFITFH  731
             IR  VGLSGI++ KGS +E +       N+ E    D   G+L+SEN IGV HDHFITF+
Sbjct  482   IRGKVGLSGILMIKGSSHESVPMSRGGGNEEE----DL-HGTLLSENVIGVIHDHFITFY  536

Query  730   LDMDVDGPTNSFVKVDLVKNYNIAGKIQRKSYWSPKRKVAKSENDAKIKLQLDKPSEFHV  551
             LDMDVDG  NSFVKV+LVK    AG+  RKSY   +R VAK+E DA+IKL L +PSEFH+
Sbjct  537   LDMDVDGSNNSFVKVELVKQATEAGESPRKSYLKARRSVAKTEKDAQIKLGLYQPSEFHL  596

Query  550   INPRHQSRLGNPSGYKIVPSATAASLLDLQDPPQLRAAFTNNQIWVTPYNRSEQWAGGLF  371
             +NP  ++R+GNP GYK+VP+ATAASLLD +DPPQ+R +FTNNQIWVTPYN+SE+WAGGL 
Sbjct  597   VNPTKKTRVGNPVGYKVVPAATAASLLDHEDPPQMRGSFTNNQIWVTPYNKSEEWAGGLL  656

Query  370   TYQSHGDDTLAVWSNRNRVIEKQDIVLWYTLGFHHLPCQEDFPVMPTVTSTFQLKPVNFF  191
              YQSHGDDTLAVWS RNR IE +DIVLWYTLGFHH+PCQEDFP+MPTV+++F LKPVNFF
Sbjct  657   VYQSHGDDTLAVWSERNREIENRDIVLWYTLGFHHIPCQEDFPIMPTVSASFDLKPVNFF  716

Query  190   DRNPIIQANPNFAEDLPIC  134
             + NPI+   PNF  DLP+C
Sbjct  717   EANPILGMPPNFEMDLPVC  735



>ref|XP_006367888.1| PREDICTED: primary amine oxidase-like [Solanum tuberosum]
Length=721

 Score =   811 bits (2094),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 387/665 (58%), Positives = 492/665 (74%), Gaps = 10/665 (2%)
 Frame = -1

Query  2107  NHFADRPMHPLDPLTIQEIERTRSILSSYQPFSGSSLRIHSLSLDEPDKSEVLRWKRGNP  1928
             NH+AD P HPLDPLTI EI++ + I++S   F      +HS+ L+EP+K  VL W++G+ 
Sbjct  60    NHYADFPNHPLDPLTIGEIQKVKKIVNSIAEFRMKGCVLHSVVLEEPEKEVVLNWRKGHR  119

Query  1927  LPTRKAFVVALSNGQAHLLVVDLGSGRVSSHTRNPASGYPPMSADDASTALEATFSNSVF  1748
             LP RKA VVA + G  H+L VD+ +GRV+       SGYP M+ +D  TA  A F++S F
Sbjct  120   LPPRKAAVVARALGVVHVLSVDIETGRVTRRETGSYSGYPIMTIEDMITATSAPFASSDF  179

Query  1747  REAISTRGVEINDVVCSAAAPGWFGPEEEGRRITKVKCYTAQNTPNYYMRPIEGLLLTVD  1568
               +I  RGV++ D+ C   + GW+G  EE RR+ KV+CYT ++T N+YMRPIEGL + +D
Sbjct  180   NRSIIQRGVDLADLACLPISTGWYGKIEEKRRVIKVQCYTLKDTINFYMRPIEGLTVLLD  239

Query  1567  LDSGKVINVYDTHSPIPIPKAQGTDYRRDGIEHRAPGVEPLKPISMEQPNGQSFRVEDGY  1388
             LD+ +V+ + D    IPIPKA  TDYR   I+     +  LKPIS+EQPNG SF +E+ +
Sbjct  240   LDTQQVMEIIDEGKSIPIPKAANTDYRYSRIKKNTQKINLLKPISIEQPNGPSFTIENNH  299

Query  1387  IVKWASWEFHVKADQRAGIIISQATVFDPEAGKRRSVMYKGFASELFVPYMDVDEGWYFR  1208
             +VKWA+WEFH+K D RAG+IIS+A V DP+ GK R+VMYKGF SELFVPYMD  + WYF+
Sbjct  300   LVKWANWEFHLKPDPRAGVIISRAMVQDPDTGKMRNVMYKGFTSELFVPYMDPSDAWYFK  359

Query  1207  AFMDAGEFGLGATAMELVPLNDCPRHSHYIDGLFVDPDGRPVSQPNVICVFERYSGDIAW  1028
              +MDAGE+G G  AM L PLNDCPR+++Y+DG+FV  DG P  + N+ICVFERY+GDI W
Sbjct  360   TYMDAGEYGFGLQAMPLDPLNDCPRNAYYMDGVFVAADGTPYVRSNMICVFERYAGDIGW  419

Query  1027  RHSG---TGDADDDLIREARPKVSLVVRTTATVGNYDYIFDWEFQTDGSIRVTVGLSGII  857
             RH+    TG      IRE RPKV+LVVR  A+V NYDYI DWEFQ DG IR  VGLSGI+
Sbjct  420   RHAECPITGLP----IREVRPKVTLVVRMAASVANYDYIVDWEFQNDGLIRPKVGLSGIL  475

Query  856   LAKGSPYEHINQFEIPRWDFPAGSLVSENTIGVAHDHFITFHLDMDVDGPT-NSFVKVDL  680
             + KGSPY ++NQ  + + ++  G+L+SEN IGV HDH++TFHL+MD+DGP+ NSFVKV+L
Sbjct  476   MVKGSPYVNMNQ--VNQNEYLYGTLLSENIIGVIHDHYVTFHLNMDIDGPSNNSFVKVNL  533

Query  679   VKNYNIAGKIQRKSYWSPKRKVAKSENDAKIKLQLDKPSEFHVINPRHQSRLGNPSGYKI  500
              K     G+  R+SY    R VAK+E DA+IKL+L  PSEFHVIN   +SR+GNP GYK+
Sbjct  534   QKEMTSPGESPRRSYLKAVRNVAKTEKDAQIKLKLYDPSEFHVINSNKKSRVGNPVGYKV  593

Query  499   VPSATAASLLDLQDPPQLRAAFTNNQIWVTPYNRSEQWAGGLFTYQSHGDDTLAVWSNRN  320
             VP  TAASLLD  DPPQ RAAFTNNQIWVTPYN SEQWA GLF YQS GDDTLAVWS+R+
Sbjct  594   VPGGTAASLLDHDDPPQKRAAFTNNQIWVTPYNESEQWAAGLFVYQSQGDDTLAVWSDRD  653

Query  319   RVIEKQDIVLWYTLGFHHLPCQEDFPVMPTVTSTFQLKPVNFFDRNPIIQANPNFAEDLP  140
             R IE +DIV+WYTLGFHH+PCQEDFP+MPTV+S+F++KPVNFF+ NPI+   PN  +DLP
Sbjct  654   RAIENKDIVVWYTLGFHHIPCQEDFPIMPTVSSSFEIKPVNFFESNPILNIPPNSPKDLP  713

Query  139   ICRAG  125
             IC+A 
Sbjct  714   ICKAA  718



>ref|NP_189953.1| putative copper amine oxidase [Arabidopsis thaliana]
 emb|CAB83068.1| amine oxidase-like protein [Arabidopsis thaliana]
 gb|AAM19946.1| AT3g43670/F23N14_50 [Arabidopsis thaliana]
 gb|AAO64752.1| At3g43670/F23N14_50 [Arabidopsis thaliana]
 gb|AEE77817.1| putative copper amine oxidase [Arabidopsis thaliana]
Length=687

 Score =   809 bits (2089),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 381/656 (58%), Positives = 493/656 (75%), Gaps = 7/656 (1%)
 Frame = -1

Query  2095  DRPMHPLDPLTIQEIERTRSILSSYQP-FSGSSLRIHSLSLDEPDKSEVLRWKRGNPLPT  1919
             ++P HPLDPLT  EI+R ++ILS + P F   S  IH+++LDEPDK  V+RWK+G+ LP 
Sbjct  37    EKPHHPLDPLTTPEIKRVQTILSGHDPGFGSGSTIIHAMALDEPDKQRVIRWKKGDRLPP  96

Query  1918  RKAFVVALSNGQAHLLVVDLGSGRVSSHTRNPASGYPPMSADDASTALEATFSNSVFREA  1739
             R+A ++A+SNG++H+L VDL SGRV S   NP  GYP ++  D     +  + +  F  +
Sbjct  97    RRAEILAMSNGESHVLTVDLKSGRVVSDLVNPTFGYPILTMKDIIAVSQVPYKSVEFNRS  156

Query  1738  ISTRGVEINDVVCSAAAPGWFGPEEEGRRITKVKCYTAQNTPNYYMRPIEGLLLTVDLDS  1559
             I  RG+  + ++C     GW+GP+EEGRR+ K++C++ Q+T N+YMRPIEGL LTVD+D 
Sbjct  157   IEARGIPFSGLICITPFAGWYGPDEEGRRVIKIQCFSKQDTVNFYMRPIEGLYLTVDMDK  216

Query  1558  GKVINVYDTHSPIPIPKAQGTDYRRDGIEHRAPGVEPLKPISMEQPNGQSFRVEDGYIVK  1379
              ++I + D + P+P+PK+ GT+YR  G  +    ++ + P+SMEQP+G SF+VEDGY+VK
Sbjct  217   LEIIKIVD-NGPVPVPKSTGTEYRY-GFLNETVYMDRVNPMSMEQPDGPSFQVEDGYLVK  274

Query  1378  WASWEFHVKADQRAGIIISQATVFDPEAGKRRSVMYKGFASELFVPYMDVDEGWYFRAFM  1199
             WA+W+FH+K DQRAG+IISQATV D + G+ RSVMYKGFASELFVP MD  EGWY +A+M
Sbjct  275   WANWKFHIKPDQRAGMIISQATVRDSKTGEARSVMYKGFASELFVPNMDPGEGWYSKAYM  334

Query  1198  DAGEFGLGATAMELVPLNDCPRHSHYIDGLFVDPDGRPVSQPNVICVFERYSGDIAWRHS  1019
             DAGEFGLG ++M LVPLNDCPR+++YIDG F  P+G P+ QPN+IC+FERY+GD +WRHS
Sbjct  335   DAGEFGLGPSSMPLVPLNDCPRNAYYIDGFFASPEGIPILQPNMICLFERYAGDTSWRHS  394

Query  1018  GTGDADDDLIREARPKVSLVVRTTATVGNYDYIFDWEFQTDGSIRVTVGLSGIILAKGSP  839
                    D IRE+R KV+LV R   +VGNYDYIFDWEFQ DG IRVTV  SG+++ KG+ 
Sbjct  395   EILLPGVD-IRESRAKVTLVARMACSVGNYDYIFDWEFQMDGVIRVTVAASGMLMVKGTA  453

Query  838   YEHINQFEIPRWDFPAGSLVSENTIGVAHDHFITFHLDMDVDG-PTNSFVKVDLVKNYNI  662
             YE++        D  +G L+SEN IGV HDHFI+FHLDMD+DG   NSFVKV L K    
Sbjct  454   YENVEDLGEKEDD--SGPLISENVIGVVHDHFISFHLDMDIDGSANNSFVKVHLEKQRLP  511

Query  661   AGKIQRKSYWSPKRKVAKSENDAKIKLQLDKPSEFHVINPRHQSRLGNPSGYKIVPSATA  482
              G+ +RKSY   K+ VAK+E DA+IK+ L  P EFH++NP   SRLGNP+GYK+VP   A
Sbjct  512   PGESRRKSYLKVKKYVAKTEKDAQIKMSLYDPYEFHLVNPNRLSRLGNPAGYKLVPGGNA  571

Query  481   ASLLDLQDPPQLRAAFTNNQIWVTPYNRSEQWAGGLFTYQSHGDDTLAVWSNRNRVIEKQ  302
             ASLLD  DPPQ+R AFTNNQIWVT YNRSEQWAGGL  YQS G+DTL VWS+R+R IE +
Sbjct  572   ASLLDHDDPPQMRGAFTNNQIWVTRYNRSEQWAGGLLMYQSRGEDTLQVWSDRDRSIENK  631

Query  301   DIVLWYTLGFHHLPCQEDFPVMPTVTSTFQLKPVNFFDRNPIIQANPNFAEDLPIC  134
             DIVLWYTLGFHH+PCQEDFPVMPT+ S+F+LKPVNFF+ NP++  +P F +DLP+C
Sbjct  632   DIVLWYTLGFHHVPCQEDFPVMPTIASSFELKPVNFFESNPVLGISPFFEKDLPVC  687



>gb|AAF19542.1|AC007190_10 F23N19.18 [Arabidopsis thaliana]
Length=1794

 Score =   846 bits (2185),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 410/708 (58%), Positives = 520/708 (73%), Gaps = 8/708 (1%)
 Frame = -1

Query  2242  FCLFYMASSMLIFLQVNSCLSFESSNASINNLESLLGIHDFKIQNNHFADRPMHPLDPLT  2063
             F    +A+ +LIF   +     +S       +   LG  + ++  +H  ++P HPLDPLT
Sbjct  1012  FIARMVANFLLIFATYSWVFGPDSGFLFGTRVRKTLG-SNRQVHVDHSLEKPHHPLDPLT  1070

Query  2062  IQEIERTRSILSSYQP-FSGSSLRIHSLSLDEPDKSEVLRWKRGNPLPTRKAFVVALSNG  1886
             ++EI R R+ILS++ P F   S  IHS++LDEP+KS V++WK+GN L +R+A VVA   G
Sbjct  1071  VREINRVRTILSNHDPGFGSGSATIHSMALDEPEKSRVVQWKKGNKLLSRRAAVVAYWGG  1130

Query  1885  QAHLLVVDLGSGRVSSHTRNPASGYPPMSADDASTALEATFSNSVFREAISTRGVEINDV  1706
             Q H + VDL SGRV S   N  SGYP ++ +D   A +    +  F  +I  RGV+ +D+
Sbjct  1131  QTHEITVDLDSGRVVSDVINRTSGYPILTLNDVFAASQVPLKSLEFNRSIEARGVKFSDL  1190

Query  1705  VCSAAAPGWFGPEEEGRRITKVKCYTAQNTPNYYMRPIEGLLLTVDLDSGKVINVYDTHS  1526
              C     GWFG EEEGRR+ +V+C+T Q T NY+MRP+EGL +TVDLD  +VI + D   
Sbjct  1191  ACITPFAGWFGSEEEGRRVIRVQCFTLQGTTNYFMRPLEGLYVTVDLDKLEVIKIID-KG  1249

Query  1525  PIPIPKAQGTDYRRDGIEHRAPGVEPLKPISMEQPNGQSFRVEDGYIVKWASWEFHVKAD  1346
             PIPIPKA GT+YR  G++++   ++ + PISMEQP+G SFRVEDG++VKWA+W FHVKAD
Sbjct  1250  PIPIPKASGTEYRF-GVQNKPVHMDRINPISMEQPDGPSFRVEDGHLVKWANWVFHVKAD  1308

Query  1345  QRAGIIISQATVFDPEAGKRRSVMYKGFASELFVPYMDVDEGWYFRAFMDAGEFGLGATA  1166
             QRAG+IISQATV D E G+ RSVMYKGF SELFVPYMD +EGWY++ +MDAGE GLG TA
Sbjct  1309  QRAGMIISQATVRDSETGEPRSVMYKGFPSELFVPYMDPEEGWYYKGYMDAGELGLGPTA  1368

Query  1165  MELVPLNDCPRHSHYIDGLFVDPDGRPVSQPNVICVFERYSGDIAWRHSGTGDADDDLIR  986
             M LVPLNDCPR+S+YIDG+F  PDG+P+ QPN+IC+FERY+GDI+WRHS    A+ D IR
Sbjct  1369  MPLVPLNDCPRNSYYIDGVFASPDGKPIVQPNMICLFERYAGDISWRHSEILFANAD-IR  1427

Query  985   EARPKVSLVVRTTATVGNYDYIFDWEFQTDGSIRVTVGLSGIILAKGSPYEHINQFEIPR  806
             E+RPKV+LV R   +VGNYDYIFDWEFQTDG IRVTV  SG+++ KG+PY++++      
Sbjct  1428  ESRPKVTLVARMATSVGNYDYIFDWEFQTDGLIRVTVAASGMLMVKGTPYDNVDDLGDRE  1487

Query  805   WDFPAGSLVSENTIGVAHDHFITFHLDMDVDGP-TNSFVKVDLVKNYNIAGKIQRKSYWS  629
              D  AG L+SEN IGV HDHFITFHLDMD+DGP  NS VKV L K     GK  RKSY  
Sbjct  1488  DD--AGPLISENVIGVVHDHFITFHLDMDIDGPMNNSLVKVHLEKQRVPTGKSPRKSYLK  1545

Query  628   PKRKVAKSENDAKIKLQLDKPSEFHVINPRHQSRLGNPSGYKIVPSATAASLLDLQDPPQ  449
              K+ +AK+E DA+IKL L  P EFH++NP  +SR+GNP+GY+IVP   AASLLD  DPPQ
Sbjct  1546  VKKYIAKTEKDAQIKLSLYDPYEFHIVNPNRKSRVGNPAGYRIVPGGNAASLLDHDDPPQ  1605

Query  448   LRAAFTNNQIWVTPYNRSEQWAGGLFTYQSHGDDTLAVWSNRNRVIEKQDIVLWYTLGFH  269
             +R AFTNNQIWVTPYNRSEQ+AGG+  YQS GDDTL VWS+R+R IE +DIVLWYTLGFH
Sbjct  1606  IRGAFTNNQIWVTPYNRSEQYAGGVLIYQSQGDDTLQVWSDRDRSIENKDIVLWYTLGFH  1665

Query  268   HLPCQEDFPVMPTVTSTFQLKPVNFFDRNPIIQANPNFAEDLPICRAG  125
             H+PCQED+PVMPTV ++F+LKP NFF+ NPI+ + P F +DLP    G
Sbjct  1666  HVPCQEDYPVMPTVAASFELKPANFFESNPILGSAPFFEKDLPSQHTG  1713



>gb|ACN40397.1| unknown [Picea sitchensis]
Length=731

 Score =   810 bits (2091),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 372/660 (56%), Positives = 493/660 (75%), Gaps = 6/660 (1%)
 Frame = -1

Query  2107  NHFADRPMHPLDPLTIQEIERTRSILSSYQPFSGSSLRIHSLSLDEPDKSEVLRWKRGNP  1928
             +H  +   HPLDPLT+QEI++ + IL     F+     +HS+ L+EP K +VL WK GN 
Sbjct  75    DHDTEVAKHPLDPLTVQEIKKVQRILQKSSIFNHGKFTLHSVVLEEPPKEKVLLWKAGNS  134

Query  1927  LPTRKAFVVALSNGQAHLLVVDLGSGRVSSHTRNPASGYPPMSADDASTALEATFSNSVF  1748
             LP+RKA ++A +NG A+ ++VDL   ++  +  +  +GYP M+ +D ++A++A   +  F
Sbjct  135   LPSRKASIIAWANGHAYQIIVDLALSQIVENQISHENGYPAMTMEDMTSAIKAPLKSKKF  194

Query  1747  REAISTRGVEINDVVCSAAAPGWFGPEEEGRRITKVKCYTAQNTPNYYMRPIEGLLLTVD  1568
              E I  RGV ++D+ C   + GWFGP EEGRR+ KV+CY++  T N+YMRPIEGL + VD
Sbjct  195   VEIIGKRGVNVSDLACLPISLGWFGPGEEGRRLIKVQCYSSAGTANFYMRPIEGLTVLVD  254

Query  1567  LDSGKVINVYDTHSPIPIPKAQGTDYRRDGIEHRAPGVEPLKPISMEQPNGQSFRVEDGY  1388
             +DS +V+ + D    IP+PK +GTDYR      + P + PL PIS+EQPNG SF+V DG+
Sbjct  255   MDSKEVLKITDKGKDIPLPKPEGTDYRLSA--QKFPMMPPLNPISIEQPNGPSFKV-DGH  311

Query  1387  IVKWASWEFHVKADQRAGIIISQATVFDPEAGKRRSVMYKGFASELFVPYMDVDEGWYFR  1208
              VKW SWEFH+K D RAG+IISQA + DP+ GK R V+YKGF SELFVPYMD  + WYF+
Sbjct  312   QVKWGSWEFHLKPDPRAGVIISQAAIKDPDTGKMRRVLYKGFTSELFVPYMDPSDAWYFK  371

Query  1207  AFMDAGEFGLGATAMELVPLNDCPRHSHYIDGLFVDPDGRPVSQPNVICVFERYSGDIAW  1028
              +MDAGE+G G TAM L PLNDCPR+++Y+DG+    DG P  +PN++C+FERY+GDIAW
Sbjct  372   TYMDAGEYGFGLTAMSLDPLNDCPRNAYYMDGVLASDDGTPYVRPNMVCIFERYAGDIAW  431

Query  1027  RHSGTGDADDDLIREARPKVSLVVRTTATVGNYDYIFDWEFQTDGSIRVTVGLSGIILAK  848
             RH+    +  + IRE RPKV+LVVR  A+V NYDYI DWEFQTDG IR+ VGLSGI++ K
Sbjct  432   RHTECPISGME-IREVRPKVTLVVRMAASVANYDYIVDWEFQTDGLIRLKVGLSGILMIK  490

Query  847   GSPYEHINQFEIPRWDFPAGSLVSENTIGVAHDHFITFHLDMDVDGPTNSFVKVDLVKNY  668
             G+ Y++++Q   P  D   G+L++EN IGV HDH+ITF+LDMD+DG  NSFV+V + K  
Sbjct  491   GTKYQNVDQIS-PEDDL-HGTLLAENIIGVIHDHYITFYLDMDIDGTDNSFVQVKMAKQT  548

Query  667   NIAGKIQRKSYWSPKRKVAKSENDAKIKLQLDKPSEFHVINPRHQSRLGNPSGYKIVPSA  488
                G+  RKS+W  +R +A++E DA+IKL L +PSEFHVINP  ++++GNP GYK+VP  
Sbjct  549   VKNGQTPRKSFWKAERHIAQTEKDAQIKLSLIQPSEFHVINPSKKTKIGNPVGYKVVPGG  608

Query  487   TAASLLDLQDPPQLRAAFTNNQIWVTPYNRSEQWAGGLFTYQSHGDDTLAVWSNRNRVIE  308
             TAASLLD +DPPQLR AFTNNQIWVTPYN+SE+WAGGL+ YQS GDDTL+VWSNR+R IE
Sbjct  609   TAASLLDQKDPPQLRGAFTNNQIWVTPYNKSEEWAGGLYVYQSKGDDTLSVWSNRDRSIE  668

Query  307   KQDIVLWYTLGFHHLPCQEDFPVMPTVTSTFQLKPVNFFDRNPIIQANPNFAEDLPICRA  128
             K+DIVLWYTLGFHHLPCQED+P+MPTV+S+F LKP NFF+ NPI++  P++ +DLP C A
Sbjct  669   KKDIVLWYTLGFHHLPCQEDYPIMPTVSSSFDLKPTNFFESNPILRTAPHYEKDLPTCVA  728



>ref|XP_004245717.1| PREDICTED: primary amine oxidase [Solanum lycopersicum]
Length=721

 Score =   808 bits (2088),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 386/665 (58%), Positives = 490/665 (74%), Gaps = 10/665 (2%)
 Frame = -1

Query  2107  NHFADRPMHPLDPLTIQEIERTRSILSSYQPFSGSSLRIHSLSLDEPDKSEVLRWKRGNP  1928
             NH+AD P HPLDPLTI EI++ + I+ S   F      +HS+ L+EP+K  VL W+RG+ 
Sbjct  60    NHYADFPNHPLDPLTIGEIQKVKKIVHSIAEFRIKGCVLHSVVLEEPEKEVVLNWRRGHR  119

Query  1927  LPTRKAFVVALSNGQAHLLVVDLGSGRVSSHTRNPASGYPPMSADDASTALEATFSNSVF  1748
             LP RKA VVA + G  H+L VD+ +GRV+       SGYP ++ +D  +A  A F+NS F
Sbjct  120   LPPRKAAVVARALGVVHVLSVDIETGRVTRRETGSYSGYPILTIEDMISATSAPFANSDF  179

Query  1747  REAISTRGVEINDVVCSAAAPGWFGPEEEGRRITKVKCYTAQNTPNYYMRPIEGLLLTVD  1568
               +I  RGV++ D+ C   A GW+G  EE RR+ KV+ +T ++T N+YMRPIEGL + +D
Sbjct  180   NRSIIQRGVDLADLACLPVAAGWYGKIEEKRRVIKVQSFTLKDTINFYMRPIEGLTVLLD  239

Query  1567  LDSGKVINVYDTHSPIPIPKAQGTDYRRDGIEHRAPGVEPLKPISMEQPNGQSFRVEDGY  1388
             LD+ +VI ++D    IPIPKA  TDYR   I+     +  LKPIS+EQPNG SF +E+ +
Sbjct  240   LDTQQVIEIFDEGESIPIPKAANTDYRYSRIKKNKQKINLLKPISIEQPNGPSFTIENNH  299

Query  1387  IVKWASWEFHVKADQRAGIIISQATVFDPEAGKRRSVMYKGFASELFVPYMDVDEGWYFR  1208
             +VKWA+WEFH+K D RAG+IIS+    DP+ GK R+VMYKGF SELFVPYMD  + WYF+
Sbjct  300   LVKWANWEFHLKPDPRAGVIISRVMFEDPDTGKMRNVMYKGFTSELFVPYMDPSDAWYFK  359

Query  1207  AFMDAGEFGLGATAMELVPLNDCPRHSHYIDGLFVDPDGRPVSQPNVICVFERYSGDIAW  1028
              +MDAGE+G G  AM L PLNDCPR+++Y+DG+FV  DG P  + N+ICVFERY+GDI W
Sbjct  360   TYMDAGEYGFGLQAMPLDPLNDCPRNAYYMDGVFVAADGTPYVRSNMICVFERYAGDIGW  419

Query  1027  RHSG---TGDADDDLIREARPKVSLVVRTTATVGNYDYIFDWEFQTDGSIRVTVGLSGII  857
             RH+    TG      IRE RPKV+LVVR  A+V NYDYI DWEFQ DG IR  VGLSGI+
Sbjct  420   RHAECPITGLP----IREVRPKVTLVVRMAASVANYDYIVDWEFQNDGLIRPKVGLSGIL  475

Query  856   LAKGSPYEHINQFEIPRWDFPAGSLVSENTIGVAHDHFITFHLDMDVDGPT-NSFVKVDL  680
             + KGSPY ++N  E+ + ++  G+L+SEN +GV HDH++TFHLDMD+DGP+ NSFVKV+L
Sbjct  476   MVKGSPYVNMN--EVNQNEYLYGTLLSENIVGVIHDHYVTFHLDMDIDGPSNNSFVKVNL  533

Query  679   VKNYNIAGKIQRKSYWSPKRKVAKSENDAKIKLQLDKPSEFHVINPRHQSRLGNPSGYKI  500
              K    +G+  R+SY    R VAK+E DA+IKL+L  PSEFHVIN   +SR+GNP GYK+
Sbjct  534   QKEMTSSGESPRRSYLKAVRNVAKTEKDAQIKLKLYDPSEFHVINSNKKSRVGNPVGYKV  593

Query  499   VPSATAASLLDLQDPPQLRAAFTNNQIWVTPYNRSEQWAGGLFTYQSHGDDTLAVWSNRN  320
             VP  TAASLLD  DPPQ RAAFTNNQIWVTPYN SEQWA GLF YQS GDDTLAVWS+R+
Sbjct  594   VPGGTAASLLDHNDPPQKRAAFTNNQIWVTPYNESEQWAAGLFVYQSQGDDTLAVWSDRD  653

Query  319   RVIEKQDIVLWYTLGFHHLPCQEDFPVMPTVTSTFQLKPVNFFDRNPIIQANPNFAEDLP  140
             R IE +DIVLWYTLGFHH+PCQEDFP+MPTV+S+F++KPVNFF+ NPI+   PN  +DLP
Sbjct  654   RAIENKDIVLWYTLGFHHIPCQEDFPIMPTVSSSFEIKPVNFFESNPILNIPPNSPKDLP  713

Query  139   ICRAG  125
             IC+A 
Sbjct  714   ICKAA  718



>gb|ABR16191.1| unknown [Picea sitchensis]
Length=730

 Score =   808 bits (2088),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 375/662 (57%), Positives = 493/662 (74%), Gaps = 6/662 (1%)
 Frame = -1

Query  2113  QNNHFADRPMHPLDPLTIQEIERTRSILSSYQPFSGSSLRIHSLSLDEPDKSEVLRWKRG  1934
             + +H ++   HPLDPLT++EI+R +SI+     F+     +HS+ L+EP K EVL WK G
Sbjct  73    KADHESEVAKHPLDPLTLREIQRVQSIMQKTSIFNQGKFALHSVVLEEPLKEEVLSWKAG  132

Query  1933  NPLPTRKAFVVALSNGQAHLLVVDLGSGRVSSHTRNPASGYPPMSADDASTALEATFSNS  1754
             + LPTRKA V+A ++G A+ L+VDL  G++  +  +  +GYP M+ +D ++A++    + 
Sbjct  133   SNLPTRKASVIAWADGHAYKLIVDLVLGQIVENQISHENGYPAMTMEDMTSAVQVPLKSK  192

Query  1753  VFREAISTRGVEINDVVCSAAAPGWFGPEEEGRRITKVKCYTAQNTPNYYMRPIEGLLLT  1574
              F E +  R V ++D+ C   + GWFG  EEG R+ KV C+++  T NY+MRPIEGL++ 
Sbjct  193   EFVEIVEKRKVNMSDLACGPISSGWFGAGEEGLRLIKVMCFSSAGTANYFMRPIEGLVVL  252

Query  1573  VDLDSGKVINVYDTHSPIPIPKAQGTDYRRDGIEHRAPGVEPLKPISMEQPNGQSFRVED  1394
             VD+D+ KV+ + D    IP+PKA+GTDYR      + P + PL PIS+EQP G SF++ D
Sbjct  253   VDMDAKKVLKIIDDGKDIPLPKAEGTDYRLSA--QKYPLIPPLNPISIEQPQGPSFKI-D  309

Query  1393  GYIVKWASWEFHVKADQRAGIIISQATVFDPEAGKRRSVMYKGFASELFVPYMDVDEGWY  1214
             G+ VKW SWEFHVK D RAG+IIS ATV DPE GK R V+YKGF SELFVPYMD  EGWY
Sbjct  310   GHQVKWGSWEFHVKPDPRAGMIISVATVKDPETGKMRRVLYKGFTSELFVPYMDTSEGWY  369

Query  1213  FRAFMDAGEFGLGATAMELVPLNDCPRHSHYIDGLFVDPDGRPVSQPNVICVFERYSGDI  1034
             F+ ++DAGE+G+G TAM L PLNDCPR+++Y+DGLF   DG P  + N++C+FERY+G+I
Sbjct  370   FKTYLDAGEYGIGLTAMSLDPLNDCPRNAYYMDGLFATADGTPYVRSNMVCIFERYAGEI  429

Query  1033  AWRHSGTGDADDDLIREARPKVSLVVRTTATVGNYDYIFDWEFQTDGSIRVTVGLSGIIL  854
             AWRH+     D   IRE RPKV+LVVR  A+VGNYDYI DWEFQTDG IR  VGLSGI++
Sbjct  430   AWRHTECPITDMQ-IREVRPKVTLVVRMAASVGNYDYIVDWEFQTDGLIRAKVGLSGILM  488

Query  853   AKGSPYEHINQFEIPRWDFPAGSLVSENTIGVAHDHFITFHLDMDVDGPTNSFVKVDLVK  674
              KG+ YE+++Q  I   D   G+L++EN IGV+HDH+ITF+LDMD+DG  NSFV+V++ K
Sbjct  489   IKGTKYENVDQ--ISSTDELHGTLLAENIIGVSHDHYITFYLDMDIDGKDNSFVQVEMAK  546

Query  673   NYNIAGKIQRKSYWSPKRKVAKSENDAKIKLQLDKPSEFHVINPRHQSRLGNPSGYKIVP  494
                  G   RKS+W  ++ +A++E DA+IKL L +P+EFHVINP  ++ +GNP GYK+VP
Sbjct  547   KTVKNGPTPRKSFWKAEKHIAQTEKDAQIKLSLYQPAEFHVINPSRKTNIGNPVGYKLVP  606

Query  493   SATAASLLDLQDPPQLRAAFTNNQIWVTPYNRSEQWAGGLFTYQSHGDDTLAVWSNRNRV  314
              ATAASLLD  DPPQLRAAFTNNQIWVTPYNRSE+WAGG + YQS GDDTLAVWS+R+R 
Sbjct  607   GATAASLLDHDDPPQLRAAFTNNQIWVTPYNRSEEWAGGQYVYQSKGDDTLAVWSDRDRP  666

Query  313   IEKQDIVLWYTLGFHHLPCQEDFPVMPTVTSTFQLKPVNFFDRNPIIQANPNFAEDLPIC  134
             IE +DIV+WYTLGFHHLPCQED+P+MPTV+S+F LKP NFFDRNPI++  P + +DLP C
Sbjct  667   IENKDIVIWYTLGFHHLPCQEDYPIMPTVSSSFDLKPTNFFDRNPIMRTTPCYEKDLPTC  726

Query  133   RA  128
              A
Sbjct  727   AA  728



>ref|XP_004298688.1| PREDICTED: primary amine oxidase-like [Fragaria vesca subsp. 
vesca]
Length=729

 Score =   807 bits (2084),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 379/659 (58%), Positives = 488/659 (74%), Gaps = 5/659 (1%)
 Frame = -1

Query  2107  NHFADRPMHPLDPLTIQEIERTRSILSSYQPFSGSS-LRIHSLSLDEPDKSEVLRWKRGN  1931
             +H +D P HPLDPLT+QE+ + R+ILSS+  FS S+   +HS+ L+EP+K  VL W +G+
Sbjct  69    DHASDTPHHPLDPLTVQELNKIRTILSSHPIFSTSAGYALHSIELEEPEKPLVLTWNKGD  128

Query  1930  PLPTRKAFVVALSNGQAHLLVVDLGSGRVSSHTRNPASGYPPMSADDASTALEATFSNSV  1751
             PL  RKA VVA   G++H+L VDL +  V  H     SGYP M+ +D +TA  A  +++ 
Sbjct  129   PLLPRKASVVARVKGESHVLTVDLATSVVIVHQTGSHSGYPMMTMEDMTTATWAPLADAT  188

Query  1750  FREAISTRGVEINDVVCSAAAPGWFGPEEEGRRITKVKCYTAQNTPNYYMRPIEGLLLTV  1571
             F   I  RGV++ D+ C   + GW+G  EE RR+ KV+CY+ ++T N+YMRPIEGL + +
Sbjct  189   FNRTIIERGVDLTDLACLPISTGWYGKTEENRRLIKVQCYSMKDTVNFYMRPIEGLTVLL  248

Query  1570  DLDSGKVINVYDTHSPIPIPKAQGTDYRRDGIEHRAPGVEPLKPISMEQPNGQSFRVEDG  1391
             DLD+ +V+ + D  + IPIP A  TDYR    +H    ++ LKPIS+EQP G SF VED 
Sbjct  249   DLDTKQVVEISDKGANIPIPNAANTDYRFSAQKHNQ-VIKLLKPISIEQPKGPSFTVEDD  307

Query  1390  YIVKWASWEFHVKADQRAGIIISQATVFDPEAGKRRSVMYKGFASELFVPYMDVDEGWYF  1211
             ++VKWA+WEFHVK D RAG+I+S+A V DP+ G  R VMYKGF SELFVPYMD  + WYF
Sbjct  308   HLVKWANWEFHVKPDARAGVIVSRAKVRDPDTGVLRDVMYKGFTSELFVPYMDPTDAWYF  367

Query  1210  RAFMDAGEFGLGATAMELVPLNDCPRHSHYIDGLFVDPDGRPVSQPNVICVFERYSGDIA  1031
             + +MDAGE+G G  +M L PLNDCPR++HY+DG+FV  DG P  + N+IC+FE Y+GDI 
Sbjct  368   KTYMDAGEYGFGLQSMPLEPLNDCPRNAHYMDGVFVAADGTPYVRSNMICIFESYAGDIG  427

Query  1030  WRHSGTGDADDDLIREARPKVSLVVRTTATVGNYDYIFDWEFQTDGSIRVTVGLSGIILA  851
             WRH+ +     + +RE RPKV+LVVR  A+V NYDYI DWEFQTDG IR+ VGLSGI++ 
Sbjct  428   WRHTESPITGME-VREVRPKVTLVVRMAASVANYDYIVDWEFQTDGLIRIKVGLSGILMV  486

Query  850   KGSPYEHINQFEIPRWDFPAGSLVSENTIGVAHDHFITFHLDMDVDGPTNSFVKVDLVKN  671
             KG+PY+++NQ  +   +   G+L+SEN IGV HDH+ITFHLDMDVDG  NSFVKV+L + 
Sbjct  487   KGTPYQNVNQ--VSGQESLYGTLLSENVIGVIHDHYITFHLDMDVDGSDNSFVKVNLQRE  544

Query  670   YNIAGKIQRKSYWSPKRKVAKSENDAKIKLQLDKPSEFHVINPRHQSRLGNPSGYKIVPS  491
              N   +  RKS+    R VAK+E DA++KL+L  PSEFHVINP  ++R+GNP GYK+VP 
Sbjct  545   QNSPSESPRKSFLKATRNVAKTEKDAQVKLKLYDPSEFHVINPSKKTRVGNPVGYKVVPG  604

Query  490   ATAASLLDLQDPPQLRAAFTNNQIWVTPYNRSEQWAGGLFTYQSHGDDTLAVWSNRNRVI  311
              TAASLLDL DPPQ R AFTNNQIWVT YNRSEQWAGGLF YQS G+DTLAVWSNR+R I
Sbjct  605   GTAASLLDLDDPPQKRGAFTNNQIWVTQYNRSEQWAGGLFVYQSQGEDTLAVWSNRDREI  664

Query  310   EKQDIVLWYTLGFHHLPCQEDFPVMPTVTSTFQLKPVNFFDRNPIIQANPNFAEDLPIC  134
             E +DIV+WYTLGFHH+PCQEDFP+MPTV+++F LKPVNFF+ NPI++  PN   DLP+C
Sbjct  665   ENKDIVVWYTLGFHHIPCQEDFPIMPTVSASFDLKPVNFFESNPILRTPPNVETDLPVC  723



>ref|XP_002875614.1| hypothetical protein ARALYDRAFT_484808 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH51873.1| hypothetical protein ARALYDRAFT_484808 [Arabidopsis lyrata subsp. 
lyrata]
Length=687

 Score =   805 bits (2079),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 389/698 (56%), Positives = 505/698 (72%), Gaps = 20/698 (3%)
 Frame = -1

Query  2218  SMLIFLQVNSCLSFESSNASINNLESLLGIHDFKIQNNHFADRPMHPLDPLTIQEIERTR  2039
             S L+ L +N    F +  +S             K +  +  ++P HPLDPLT  EI+R +
Sbjct  7     SQLLVLFINLLFLFTTLGSSA------------KTRFKYSLEKPHHPLDPLTTPEIKRVQ  54

Query  2038  SILSSYQP-FSGSSLRIHSLSLDEPDKSEVLRWKRGNPLPTRKAFVVALSNGQAHLLVVD  1862
             +ILS + P F   S  IH+++LDEP+K  V+RWK+G+ LP R+A V+A+SNG++H+L VD
Sbjct  55    TILSGHDPGFGSGSAIIHAMALDEPEKQRVVRWKKGDRLPPRRAEVLAMSNGESHVLTVD  114

Query  1861  LGSGRVSSHTRNPASGYPPMSADDASTALEATFSNSVFREAISTRGVEINDVVCSAAAPG  1682
             L SGRV S   +P  GYP ++  D     +  + +  F  +I  RG+  + ++C     G
Sbjct  115   LNSGRVVSDLVSPTFGYPILTMKDIIAVSQVPYKSMEFNRSIEGRGIPFSGLICITPFAG  174

Query  1681  WFGPEEEGRRITKVKCYTAQNTPNYYMRPIEGLLLTVDLDSGKVINVYDTHSPIPIPKAQ  1502
             W+GP+EEGRR+ K++C++ Q+T N+YMRPIEGL LTVD+D  ++I + D + P+P+PK+ 
Sbjct  175   WYGPDEEGRRVIKIQCFSKQDTVNFYMRPIEGLYLTVDMDKLEIIKIVD-NGPVPVPKST  233

Query  1501  GTDYRRDGIEHRAPGVEPLKPISMEQPNGQSFRVEDGYIVKWASWEFHVKADQRAGIIIS  1322
             GT+YR  G  +    ++ + P+SMEQP+G SF+VEDGY+VKWA+W+FH+K DQRAG+IIS
Sbjct  234   GTEYRY-GFLNETVHMDRVNPMSMEQPDGPSFQVEDGYLVKWANWKFHIKPDQRAGMIIS  292

Query  1321  QATVFDPEAGKRRSVMYKGFASELFVPYMDVDEGWYFRAFMDAGEFGLGATAMELVPLND  1142
             QATV D + G+ RSVMYKGFASELFVPYMD   GWY +A+MDAGEFGLG ++M LVPLND
Sbjct  293   QATVRDSKTGEARSVMYKGFASELFVPYMDPGTGWYSKAYMDAGEFGLGPSSMPLVPLND  352

Query  1141  CPRHSHYIDGLFVDPDGRPVSQPNVICVFERYSGDIAWRHSGTGDADDDLIREARPKVSL  962
             CPR+++YIDG F  P G PV QPN+IC+FERY+GDI+WRHS       D I+E+R KV+L
Sbjct  353   CPRNAYYIDGFFASPQGIPVLQPNMICLFERYAGDISWRHSEILLPGTD-IKESRAKVTL  411

Query  961   VVRTTATVGNYDYIFDWEFQTDGSIRVTVGLSGIILAKGSPYEHINQFEIPRWDFPAGSL  782
             V R   +VGNYDYIFDWEFQ DG IRVTV  SG+++ KG+ Y+++        D  +G L
Sbjct  412   VARMACSVGNYDYIFDWEFQMDGLIRVTVAASGMLMVKGTAYQNVEDLGEKEED--SGPL  469

Query  781   VSENTIGVAHDHFITFHLDMDVDG-PTNSFVKVDLVKNYNIAGKIQRKSYWSPKRKVAKS  605
             +SEN IGV HDHFI+FHLDMD+DG   NSFVKV L K     GK +RKSY   K+ VAK+
Sbjct  470   ISENVIGVVHDHFISFHLDMDIDGSANNSFVKVHLEKQRVPPGKSRRKSYLKVKKYVAKT  529

Query  604   ENDAKIKLQLDKPSEFHVINPRHQSRLGNPSGYKIVPSATAASLLDLQDPPQLRAAFTNN  425
             E DA+IKL L  P EFH +NP   SRLGNP+GYK+VP   AASLLD  DPPQ+R AFTNN
Sbjct  530   EKDAQIKLSLYDPYEFHFVNPNRLSRLGNPAGYKLVPGGNAASLLDHDDPPQIRGAFTNN  589

Query  424   QIWVTPYNRSEQWAGGLFTYQSHGDDTLAVWSNRNRVIEKQDIVLWYTLGFHHLPCQEDF  245
             QIWVT YNRSEQWAGGL  YQS G+DTL VWS+R+R IE +DIVLWYTLGFHH+PCQEDF
Sbjct  590   QIWVTRYNRSEQWAGGLLMYQSRGEDTLQVWSDRDRSIENKDIVLWYTLGFHHVPCQEDF  649

Query  244   PVMPTVTSTFQLKPVNFFDRNPIIQANPNFAEDL-PIC  134
             PVMPT+ S+F+LKPVNFF+ NP++  +P F +DL P+C
Sbjct  650   PVMPTIASSFELKPVNFFESNPVLGISPFFEKDLPPVC  687



>ref|XP_010108147.1| Primary amine oxidase [Morus notabilis]
 gb|EXC17879.1| Primary amine oxidase [Morus notabilis]
Length=730

 Score =   805 bits (2080),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 385/662 (58%), Positives = 489/662 (74%), Gaps = 7/662 (1%)
 Frame = -1

Query  2107  NHFADRPMHPLDPLTIQEIERTRSILSSYQPF-SGSSLRIHSLSLDEPDKSEVLRWKRGN  1931
             +H  D P HPLDPLT+ EI R ++ILSS+  F S     +H++ L+EP+KS VL W+RGN
Sbjct  70    SHERDTPRHPLDPLTVGEINRVKAILSSHALFQSPGPHSLHTVELEEPEKSRVLEWERGN  129

Query  1930  PLPTRKAFVVALSNGQAHLLVVDLGSGRVSSHTRNPASGYPPMSADDASTALEATFSNSV  1751
             PL  RKA VVA + G +H+L+VDL +  V      P SGYP M+ +D +TA  A  +++ 
Sbjct  130   PLFPRKASVVARARGVSHVLIVDLTTSEVIVQRTGPHSGYPTMTVEDMTTATVAPLASAE  189

Query  1750  FREAISTRGVEINDVVCSAAAPGWFGPEEEGRRITKVKCYTAQNTPNYYMRPIEGLLLTV  1571
             F   I+ RGV++ D+ C   + GW+G  EEGRR+ KV+CY+ ++T N+YMRPIEGL + V
Sbjct  190   FNRTIAGRGVDLTDLACLPISTGWYGAAEEGRRLIKVQCYSMKDTVNFYMRPIEGLTVIV  249

Query  1570  DLDSGKVINVYDTHSPIPIPKAQGTDYRRDGIE-HRAPGVEPLKPISMEQPNGQSFRVED  1394
             DLD+ +V+ + D  + IPIPKA  TDYR   +E +R   ++ L PIS+EQP G SF VED
Sbjct  250   DLDTKQVVELSDKGANIPIPKAANTDYRFSSVEPNRV--MDILNPISIEQPKGPSFTVED  307

Query  1393  GYIVKWASWEFHVKADQRAGIIISQATVFDPEAGKRRSVMYKGFASELFVPYMDVDEGWY  1214
              ++VKWA+WEFH+KAD RAG+IIS+A V DP+ GK R VMYKG  SELFVPYMD  + WY
Sbjct  308   DHLVKWANWEFHLKADARAGVIISRARVRDPDTGKFRDVMYKGLVSELFVPYMDPTDAWY  367

Query  1213  FRAFMDAGEFGLGATAMELVPLNDCPRHSHYIDGLFVDPDGRPVSQPNVICVFERYSGDI  1034
             F+ +MDAGE+G G  AM L PLNDCPR+++Y+DG+F   DG P  Q N+ICVFE Y+GDI
Sbjct  368   FKTYMDAGEYGFGLQAMPLDPLNDCPRNAYYMDGVFAAADGTPYVQSNMICVFESYAGDI  427

Query  1033  AWRHSGTGDADDDLIREARPKVSLVVRTTATVGNYDYIFDWEFQTDGSIRVTVGLSGIIL  854
              WRHS +       IRE RPKV+LVVR  A+V NYDYI DWEFQ DG IR+ VGLSGI++
Sbjct  428   GWRHSESPITGMQ-IREVRPKVTLVVRMAASVANYDYIVDWEFQIDGLIRIKVGLSGILM  486

Query  853   AKGSPYEHINQFEIPRWDFPAGSLVSENTIGVAHDHFITFHLDMDVDGPTNSFVKVDLVK  674
              KG+ Y++ NQ  +P  +   G+L+SEN IGV HDH+ITF+LDMDVDG  NSF KV L +
Sbjct  487   VKGTQYDNTNQ--VPNQENLYGTLLSENVIGVIHDHYITFYLDMDVDGSDNSFAKVHLQR  544

Query  673   NYNIAGKIQRKSYWSPKRKVAKSENDAKIKLQLDKPSEFHVINPRHQSRLGNPSGYKIVP  494
                  G+ +R+SY    R VAK+E +A+IKL+L  PSEFHV NP  ++R+GNP GYK+VP
Sbjct  545   EKTSPGESRRRSYLKATRNVAKTEKEAQIKLKLYDPSEFHVFNPTKKTRVGNPVGYKVVP  604

Query  493   SATAASLLDLQDPPQLRAAFTNNQIWVTPYNRSEQWAGGLFTYQSHGDDTLAVWSNRNRV  314
               TAASLLDL DPPQ R  FTNNQIWVTPYNRSEQWAGGLF YQSHG+DTLAVWS R+R 
Sbjct  605   GGTAASLLDLDDPPQRRGGFTNNQIWVTPYNRSEQWAGGLFVYQSHGEDTLAVWSERDRP  664

Query  313   IEKQDIVLWYTLGFHHLPCQEDFPVMPTVTSTFQLKPVNFFDRNPIIQANPNFAEDLPIC  134
             IE +DIVLWYTLGFHH+PCQEDFP+MPTV+S+F LKPVNFF+ NPI++  PN  +DLP+C
Sbjct  665   IENKDIVLWYTLGFHHVPCQEDFPIMPTVSSSFDLKPVNFFESNPILRIPPNVEKDLPVC  724

Query  133   RA  128
             ++
Sbjct  725   KS  726



>ref|XP_004298687.1| PREDICTED: primary amine oxidase-like [Fragaria vesca subsp. 
vesca]
Length=732

 Score =   803 bits (2075),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 380/659 (58%), Positives = 489/659 (74%), Gaps = 4/659 (1%)
 Frame = -1

Query  2107  NHFADRPMHPLDPLTIQEIERTRSILSSYQPFSGSSLRIHSLSLDEPDKSEVLRWKRGNP  1928
             NH +D P HPLDPLT+QE+ + R+ILSS+  F+ S+  +HS+ L EPDK  VLRWK+G+P
Sbjct  71    NHASDTPHHPLDPLTVQELNKIRTILSSHALFNSSAYALHSIELKEPDKPLVLRWKKGDP  130

Query  1927  LPTRKAFVVALSNGQAHLLVVDLGSGRVSSHTRNPASGYPPMSADDASTALEATFSNSVF  1748
             L  RKA V++ + G+ H++ +DL +G VS H     SGYP ++ ++ + A     +++ F
Sbjct  131   LFPRKASVISRAAGKTHVMTIDLATGEVSEHQTGNHSGYPMLTIEEITAASLVPLASAKF  190

Query  1747  REAISTRGVEINDVVCSAAAPGWFGPEEEGRR-ITKVKCYTAQNTPNYYMRPIEGLLLTV  1571
                I  RGV++ D+ C   + GWF   E+ RR + KV+C++ ++T N+YMRPIEGL + V
Sbjct  191   NRTIIQRGVDLADLACLPISSGWFDEYEKNRRRLIKVQCFSMKDTVNFYMRPIEGLTVLV  250

Query  1570  DLDSGKVINVYDTHSPIPIPKAQGTDYRRDGIEHRAPGVEPLKPISMEQPNGQSFRVEDG  1391
             DLD+ +V+ + D    IPIPKA  TDYR    +     +  + PIS+EQP G SF VEDG
Sbjct  251   DLDAKQVVEISDKGGNIPIPKATNTDYRYSTSQELRRVIRLVNPISIEQPKGPSFTVEDG  310

Query  1390  YIVKWASWEFHVKADQRAGIIISQATVFDPEAGKRRSVMYKGFASELFVPYMDVDEGWYF  1211
             ++VKWA+WEFHVK D RAG+IISQA V DP+ G  R VMYKGF SELFVPYMD  +GWYF
Sbjct  311   HLVKWANWEFHVKPDARAGVIISQARVRDPDTGDLRDVMYKGFPSELFVPYMDPSDGWYF  370

Query  1210  RAFMDAGEFGLGATAMELVPLNDCPRHSHYIDGLFVDPDGRPVSQPNVICVFERYSGDIA  1031
             + +MDAGE+G G  AM L PLNDCPR++++IDG+F   DG P  + ++ICVFE Y GDI 
Sbjct  371   KTYMDAGEYGFGLQAMPLDPLNDCPRNAYFIDGVFATSDGTPYVRSDMICVFESYGGDIG  430

Query  1030  WRHSGTGDADDDLIREARPKVSLVVRTTATVGNYDYIFDWEFQTDGSIRVTVGLSGIILA  851
             WRH+ +     + +RE RPKV+LVVR  A+VGNYDYI DWEFQTDG IRV VGLSGI++ 
Sbjct  431   WRHTESLITGME-VREVRPKVTLVVRMAASVGNYDYIVDWEFQTDGLIRVKVGLSGILMV  489

Query  850   KGSPYEHINQFEIPRWDFPAGSLVSENTIGVAHDHFITFHLDMDVDGPTNSFVKVDLVKN  671
             KG+PYE++NQ  +   +   G+L+SEN +GV HDH+ITF+LDMDVDG  NSFVKV+L + 
Sbjct  490   KGTPYENMNQ--VFDGEDLYGTLLSENVVGVIHDHYITFYLDMDVDGSDNSFVKVNLQRQ  547

Query  670   YNIAGKIQRKSYWSPKRKVAKSENDAKIKLQLDKPSEFHVINPRHQSRLGNPSGYKIVPS  491
                  +  RKS+    R VAK+E DA++KL+L  PSEFHVINP  ++R+GNP GYK+VP 
Sbjct  548   QTSPHESPRKSFLIATRTVAKTEKDAQVKLKLYDPSEFHVINPSKKTRVGNPVGYKVVPG  607

Query  490   ATAASLLDLQDPPQLRAAFTNNQIWVTPYNRSEQWAGGLFTYQSHGDDTLAVWSNRNRVI  311
             ATAASLLD +DPPQ RAAFTNNQIWVT YNRSE+WAGGLF YQSHGDDTLAVWSNR+R I
Sbjct  608   ATAASLLDPEDPPQKRAAFTNNQIWVTQYNRSEKWAGGLFAYQSHGDDTLAVWSNRDREI  667

Query  310   EKQDIVLWYTLGFHHLPCQEDFPVMPTVTSTFQLKPVNFFDRNPIIQANPNFAEDLPIC  134
             E +DIV+WYTLGFHH+PCQEDFP+MPTV+S+F LKPVNFF+RNPI++  PN   DLP+C
Sbjct  668   ENKDIVIWYTLGFHHIPCQEDFPIMPTVSSSFDLKPVNFFERNPILRTPPNVESDLPVC  726



>ref|XP_002509596.1| Amine oxidase [copper-containing] precursor, putative [Ricinus 
communis]
 gb|EEF50983.1| Amine oxidase [copper-containing] precursor, putative [Ricinus 
communis]
Length=730

 Score =   803 bits (2073),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 373/661 (56%), Positives = 491/661 (74%), Gaps = 4/661 (1%)
 Frame = -1

Query  2113  QNNHFADRPMHPLDPLTIQEIERTRSILSSYQPFSGSSLRIHSLSLDEPDKSEVLRWKRG  1934
             ++ H +D P HPLDPLTIQE  + R+IL S+  F  S   +HS+ L+EP+K+ VL+W++G
Sbjct  69    RHRHESDLPTHPLDPLTIQEFNKVRTILKSHDLFKSSPFSLHSVVLEEPEKTLVLKWRKG  128

Query  1933  NPLPTRKAFVVALSNGQAHLLVVDLGSGRVSSHTRNPASGYPPMSADDASTALEATFSNS  1754
             +P+  RKA V+A  NGQ+H+L VD+ +  V+    NP SGYP M+ +D +TA  A  SN+
Sbjct  129   DPMLPRKAEVIARVNGQSHVLTVDINTSDVAVQETNPLSGYPTMTIEDMTTATWAPLSNA  188

Query  1753  VFREAISTRGVEINDVVCSAAAPGWFGPEEEGRRITKVKCYTAQNTPNYYMRPIEGLLLT  1574
              F   I  RGV++ D+ C   + GWFG  EE +R+ KV+CY+ + T N+YMRPIEGL + 
Sbjct  189   DFNRTIIDRGVDLKDLACLPISLGWFGKNEENKRLIKVQCYSMKGTANFYMRPIEGLTVL  248

Query  1573  VDLDSGKVINVYDTHSPIPIPKAQGTDYRRDGIEHRAPGVEPLKPISMEQPNGQSFRVED  1394
             +D+D+ +V+ + D    IPIPKA  TDYR   ++      + + PIS+EQP G SF VED
Sbjct  249   LDMDTKEVVEISDKGKNIPIPKAANTDYRYSSVDVNQEK-QLINPISIEQPKGPSFTVED  307

Query  1393  GYIVKWASWEFHVKADQRAGIIISQATVFDPEAGKRRSVMYKGFASELFVPYMDVDEGWY  1214
              ++VKWA+WEFH+K D RAG+IIS A V DP++G+ R+VMYKGF SELFVPYMD  + WY
Sbjct  308   EHMVKWANWEFHLKPDPRAGVIISSARVKDPDSGEIRNVMYKGFTSELFVPYMDPTDAWY  367

Query  1213  FRAFMDAGEFGLGATAMELVPLNDCPRHSHYIDGLFVDPDGRPVSQPNVICVFERYSGDI  1034
             F+ +MDAGE+G G  AM L PLNDCPR+++Y+DG+F   DG P  + N++C+FE Y+GDI
Sbjct  368   FKTYMDAGEYGFGLQAMPLDPLNDCPRNAYYMDGVFAAGDGTPYVRSNMVCIFESYAGDI  427

Query  1033  AWRHSGTGDADDDLIREARPKVSLVVRTTATVGNYDYIFDWEFQTDGSIRVTVGLSGIIL  854
              WRH+ +     + IRE RPKV+LVVR  A+V NYDYI DWEFQTDG IR+ VGLSGI++
Sbjct  428   GWRHAESPITGME-IREVRPKVTLVVRMAASVANYDYIVDWEFQTDGLIRIKVGLSGILM  486

Query  853   AKGSPYEHINQFEIPRWDFPAGSLVSENTIGVAHDHFITFHLDMDVDGPTNSFVKVDLVK  674
              KG+ YE++NQ  +   +   G+L++EN IGV HDH+ITF+LDMD+DG  NSFVKV++ +
Sbjct  487   VKGTSYENMNQ--VTGQENLYGTLLAENVIGVIHDHYITFYLDMDIDGSDNSFVKVNIHR  544

Query  673   NYNIAGKIQRKSYWSPKRKVAKSENDAKIKLQLDKPSEFHVINPRHQSRLGNPSGYKIVP  494
                  G+  R+SY    R VAK+E DA+IKL+L  PSEFHVINP  ++R+GNP GYK+VP
Sbjct  545   QQTSPGESPRRSYLKATRNVAKTEKDAQIKLKLYDPSEFHVINPTKKTRVGNPVGYKVVP  604

Query  493   SATAASLLDLQDPPQLRAAFTNNQIWVTPYNRSEQWAGGLFTYQSHGDDTLAVWSNRNRV  314
               TAASLL+  DPPQ R AFTNNQIWVTPYNR+EQWAGGLF YQSHG+DTLAVWS+R+R 
Sbjct  605   GGTAASLLNHDDPPQKRGAFTNNQIWVTPYNRTEQWAGGLFVYQSHGEDTLAVWSDRDRP  664

Query  313   IEKQDIVLWYTLGFHHLPCQEDFPVMPTVTSTFQLKPVNFFDRNPIIQANPNFAEDLPIC  134
             IE +DIV+WYTLGFHH+PCQEDFP+MPTV+S+F LKPVNFF+ NPI++  PN  +DLP+C
Sbjct  665   IENKDIVVWYTLGFHHIPCQEDFPIMPTVSSSFDLKPVNFFESNPILRIPPNVEKDLPVC  724

Query  133   R  131
             R
Sbjct  725   R  725



>ref|XP_004502050.1| PREDICTED: primary amine oxidase-like [Cicer arietinum]
Length=735

 Score =   800 bits (2067),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 383/686 (56%), Positives = 498/686 (73%), Gaps = 7/686 (1%)
 Frame = -1

Query  2179  FESSNASINNLESLLGIHDFKIQNNHFADRPMHPLDPLTIQEIERTRSILSSYQPF-SGS  2003
             F SS++  N +       +   Q  H  D P HPLDPLTIQE    R++LS++  F S +
Sbjct  51    FHSSSSDPNPINKPTTFSNHHQQLKHEFDVPRHPLDPLTIQEFNEVRAVLSTHPLFKSSN  110

Query  2002  SLRIHSLSLDEPDKSEVLRWKRGNPLPTRKAFVVALSNGQAHLLVVDLGSGRVSSHTRNP  1823
             S  ++SL L+EPDK  VL+WK+G PL  RKA +VAL  G  H L VDL + ++++H  +P
Sbjct  111   SYTLNSLVLEEPDKELVLKWKKGQPLLPRKASIVALVKGVTHTLTVDLNTNQITNHETSP  170

Query  1822  ASGYPPMSADDASTALEATFSNSVFREAISTRGVEINDVVCSAAAPGWFG-PEEEGRRIT  1646
             A+GYP M+ ++  + L+    N+ F   I+  GV++ D+VC   + GW+G P EE  R+ 
Sbjct  171   AAGYPTMTIEEMMSVLDVPLKNNEFNNTITKHGVDLADLVCLPLSSGWYGTPVEENIRLI  230

Query  1645  KVKCYTAQNTPNYYMRPIEGLLLTVDLDSGKVINVYDTHSPIPIPKAQGTDYRRDGIEHR  1466
             KV+CY+ + + N+YM+PIEG+ + VD+D  +V+++ D    IPI     TDYR   ++  
Sbjct  231   KVQCYSRKGSVNFYMKPIEGVTVLVDMDKKEVVSITDNGQNIPIANGVDTDYRY-SVQKL  289

Query  1465  APGVEPLKPISMEQPNGQSFRVEDGYIVKWASWEFHVKADQRAGIIISQATVFDPEAGKR  1286
                ++ + PIS+EQP G SF V DG+IVKWA+WEFH+K D RAGIIISQA V DP+  + 
Sbjct  290   NKELKLINPISLEQPKGPSFTV-DGHIVKWANWEFHLKPDPRAGIIISQAKVRDPDTSEL  348

Query  1285  RSVMYKGFASELFVPYMDVDEGWYFRAFMDAGEFGLGATAMELVPLNDCPRHSHYIDGLF  1106
             RSV+YKGF SELFVPYMD  +GWYF+ +MDAGE+G G  AM L PLNDCPR+++Y+DG+F
Sbjct  349   RSVIYKGFTSELFVPYMDPTDGWYFKTYMDAGEYGFGLQAMPLDPLNDCPRNAYYMDGVF  408

Query  1105  VDPDGRPVSQPNVICVFERYSGDIAWRHSGTGDADDDLIREARPKVSLVVRTTATVGNYD  926
                DG P  QPN+IC+FE Y+GDIAWRH+      D  + E RPKV+LVVR  A V NYD
Sbjct  409   ASADGTPFIQPNMICIFESYAGDIAWRHAECP-ITDMRVTEVRPKVTLVVRMAAAVANYD  467

Query  925   YIFDWEFQTDGSIRVTVGLSGIILAKGSPYEHINQFEIPRWDFPAGSLVSENTIGVAHDH  746
             YI DWEFQTDG IR  VGLSGI++ KG+ YE++NQ  +P  ++  G+L+SEN IGV HDH
Sbjct  468   YIMDWEFQTDGLIRSKVGLSGILMVKGTTYENMNQ--VPDQEYLYGTLLSENIIGVIHDH  525

Query  745   FITFHLDMDVDGPTNSFVKVDLVKNYNIAGKIQRKSYWSPKRKVAKSENDAKIKLQLDKP  566
             FIT++LDMDVDG  NSFVKV++ +     G+  RKSY    RKVAK+E DA+IKLQL  P
Sbjct  526   FITYYLDMDVDGSDNSFVKVNIKRQETSPGESPRKSYLKAVRKVAKTEKDAQIKLQLYDP  585

Query  565   SEFHVINPRHQSRLGNPSGYKIVPSATAASLLDLQDPPQLRAAFTNNQIWVTPYNRSEQW  386
             SEFHV+N   ++++GNP GYK+VP ATAASLLD +DPPQ RAAFTNNQIWVTPYN+SEQW
Sbjct  586   SEFHVVNSLKKTKVGNPVGYKLVPGATAASLLDPEDPPQKRAAFTNNQIWVTPYNKSEQW  645

Query  385   AGGLFTYQSHGDDTLAVWSNRNRVIEKQDIVLWYTLGFHHLPCQEDFPVMPTVTSTFQLK  206
             AGGL  YQS GDDTL VWSNR+R IE +DIVLWYT+GFHH+PCQED+P+MPTV+S+F LK
Sbjct  646   AGGLLVYQSQGDDTLQVWSNRDRPIENKDIVLWYTVGFHHVPCQEDYPIMPTVSSSFDLK  705

Query  205   PVNFFDRNPIIQANPNFAEDLPICRA  128
             PVNFF+RNPI++  PNF +DLP+C+A
Sbjct  706   PVNFFERNPILRMPPNFKDDLPVCKA  731



>gb|AAD49420.1|AF172681_1 amine oxidase [Canavalia lineata]
Length=735

 Score =   799 bits (2063),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 387/670 (58%), Positives = 487/670 (73%), Gaps = 10/670 (1%)
 Frame = -1

Query  2122  FKIQNNHFADRPMHPLDPLTIQEIERTRSILSSYQPF-SGSSLRIHSLSLDEPDKSEVLR  1946
             F  QNNH ++ P HPLDPLTIQE  + R+ILS++  F S SS  +HS+ LDEPDK  VL+
Sbjct  67    FTYQNNHESEVPQHPLDPLTIQEFNKVRNILSTHPLFKSPSSYILHSIVLDEPDKKLVLK  126

Query  1945  WKRGNPLPTRKAFVVALSNGQAHLLVVDLGSGRVSSHTRN--PASGYPPMSADDASTALE  1772
             WK+G+PL  RKA V+A  N  A++L VDL +G V+   R+    SGYP M+ ++    LE
Sbjct  127   WKKGDPLLPRKASVIARVNRVAYVLTVDLSTGEVTGGERDLGSVSGYPTMTLEEMVGVLE  186

Query  1771  ATFSNSVFREAISTRGVEINDVVCSAAAPGWFGP--EEEGRRITKVKCYTAQNTPNYYMR  1598
                 +  F + IS RGV + D+ C   A GW+G   EEE  R+ KV+CY+ + T N+YM+
Sbjct  187   VPLKSPEFNKTISKRGVNLADLTCIPVASGWYGTQVEEENGRLIKVQCYSHKGTVNFYMK  246

Query  1597  PIEGLLLTVDLDSGKVINVYDTHSPIPIPKAQGTDYRRDGIEHRAPGVEPLKPISMEQPN  1418
             PIEG+   VD+D  KV+ + D    IP+     TDYR   I+     +    PIS+EQP 
Sbjct  247   PIEGVNALVDMDRKKVLAILDNGQNIPVSSGINTDYRY-SIQKLNGELSLFNPISLEQPK  305

Query  1417  GQSFRVEDGYIVKWASWEFHVKADQRAGIIISQATVFDPEAGKRRSVMYKGFASELFVPY  1238
             G SF V DG++VKWA+WEFHVK D RAG IISQ  V DP+  K R+VMYKGF SELFVPY
Sbjct  306   GPSFTV-DGHLVKWANWEFHVKPDPRAGTIISQVKVRDPDTSKLRNVMYKGFTSELFVPY  364

Query  1237  MDVDEGWYFRAFMDAGEFGLGATAMELVPLNDCPRHSHYIDGLFVDPDGRPVSQPNVICV  1058
             MD  EGWYF+ +MDAGE+G G  AM L PLNDCPR+++Y+DG+F   DG P  QPN+ICV
Sbjct  365   MDPTEGWYFKTYMDAGEYGFGLQAMPLDPLNDCPRNAYYMDGVFASADGTPYLQPNMICV  424

Query  1057  FERYSGDIAWRHSGTGDADDDLIREARPKVSLVVRTTATVGNYDYIFDWEFQTDGSIRVT  878
             FE Y+GD+AWRH+     +   + EARPKV+LVVR  A V NYDYI DWEFQTDG IR  
Sbjct  425   FESYAGDVAWRHAECPITNMK-VTEARPKVTLVVRMAAAVANYDYIVDWEFQTDGLIRSK  483

Query  877   VGLSGIILAKGSPYEHINQFEIPRWDFPAGSLVSENTIGVAHDHFITFHLDMDVDGPTNS  698
             VGLSGI++ KGS YE++NQ  +P  +   G+L+SEN+IGV HDHF+T++LD+D+DG  NS
Sbjct  484   VGLSGILMVKGSSYENMNQ--VPEQEDLYGTLLSENSIGVIHDHFLTYYLDIDIDGSQNS  541

Query  697   FVKVDLVKNYNIAGKIQRKSYWSPKRKVAKSENDAKIKLQLDKPSEFHVINPRHQSRLGN  518
             FVKV+L K     G+  RKSY    RKVAK+E DA+I+L+L  P EFH++NP  ++++GN
Sbjct  542   FVKVNLKKQETSPGESPRKSYLKAVRKVAKTEKDAQIRLKLYDPCEFHLVNPLKKTKVGN  601

Query  517   PSGYKIVPSATAASLLDLQDPPQLRAAFTNNQIWVTPYNRSEQWAGGLFTYQSHGDDTLA  338
             P GYKIVP  TAASLLD +DPPQ RAAFTNNQIWVTPYN++EQWAGGLF YQS GDDTL 
Sbjct  602   PVGYKIVPGGTAASLLDAEDPPQKRAAFTNNQIWVTPYNKTEQWAGGLFVYQSKGDDTLQ  661

Query  337   VWSNRNRVIEKQDIVLWYTLGFHHLPCQEDFPVMPTVTSTFQLKPVNFFDRNPIIQANPN  158
             VWSNRNR IE +DIVLWYTLGFHH+PCQED+P+MPTV+S+F LKPVNFF+RNPI++  PN
Sbjct  662   VWSNRNRPIENKDIVLWYTLGFHHIPCQEDYPIMPTVSSSFDLKPVNFFERNPILRVPPN  721

Query  157   FAEDLPICRA  128
             F +DLP+C+A
Sbjct  722   FEDDLPVCKA  731



>ref|XP_010539914.1| PREDICTED: primary amine oxidase-like isoform X1 [Tarenaya hassleriana]
Length=740

 Score =   797 bits (2059),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 388/671 (58%), Positives = 492/671 (73%), Gaps = 20/671 (3%)
 Frame = -1

Query  2113  QNNHFADRPMHPLDPLTIQEIERTRSILSSYQPFSGSSLR-IHSLSLDEPDKSEVLRWKR  1937
             + +H +D P HPLDPLT+ EI R +S+LS++  FS  +   +HS+ L+EPDK+ V +W++
Sbjct  76    RRDHVSDVPRHPLDPLTVGEINRVKSLLSTHALFSSRAPHALHSVVLEEPDKNLVKKWEK  135

Query  1936  GNPLPTRKAFVVALSNGQAHLLVVDLGSGRVSSHTRNPA--SGYPPMSADDASTALEATF  1763
             G+PLP RKA V+A      H+L+VDL SGRV      P   SG+P M+ ++ + A  A F
Sbjct  136   GDPLPPRKASVIARVGVDYHVLIVDLSSGRVE-EVEGPGRGSGFPTMTLEEMNDATWAPF  194

Query  1762  SNSVFREAISTRGVEINDVVCSAAAPGWFGPEEEGRRITKVKCYTAQNTPNYYMRPIEGL  1583
             S++ F   I +RGV+++DV C   + GWFG  EE RR+ KV+CY++Q T N+YMRPIEGL
Sbjct  195   SSADFNRTIVSRGVDLSDVACLPLSSGWFGKSEENRRVMKVQCYSSQGTANFYMRPIEGL  254

Query  1582  LLTVDLDSGKVINVYDTHSPIPIPKAQGTDYRRDGIEHRAPGVEP---LKPISMEQPNGQ  1412
              + +DLD+ +VI + DT   IP+P +  TDYR      RA   E    L PIS+EQP G 
Sbjct  255   TVLLDLDTMEVIEISDTGRVIPVPGSTNTDYRY----ARASNPEETRLLNPISIEQPRGP  310

Query  1411  SFRVEDGYIVKWASWEFHVKADQRAGIIISQATVFDPEAGKRRSVMYKGFASELFVPYMD  1232
             SF +EDG++V+WA+WEFH+K D RAG++IS+A V DPE  + R VMYKGF SELFVPYMD
Sbjct  311   SFVIEDGHLVRWANWEFHLKPDPRAGVVISRARVRDPETRELREVMYKGFVSELFVPYMD  370

Query  1231  VDEGWYFRAFMDAGEFGLGATAMELVPLNDCPRHSHYIDGLFVDPDGRPVSQPNVICVFE  1052
               + WYF+ +MDAGE+G G  AM LVPLNDCPR++ Y+DG+F   DG P  + N++CVFE
Sbjct  371   PTDAWYFKTYMDAGEYGFGLQAMPLVPLNDCPRNAEYMDGVFTAADGTPYVRENMVCVFE  430

Query  1051  RYSGDIAWRHSG---TGDADDDLIREARPKVSLVVRTTATVGNYDYIFDWEFQTDGSIRV  881
              Y+GDIAWRHS    TG      IRE RPKV+LVVR  A+V NYDYI DWEFQTDG IR 
Sbjct  431   SYAGDIAWRHSESPITGLP----IREVRPKVTLVVRMAASVANYDYIIDWEFQTDGLIRA  486

Query  880   TVGLSGIILAKGSPYEHINQFEIPRWDFPAGSLVSENTIGVAHDHFITFHLDMDVDGPTN  701
              VGLSGI++ KG+ YE+ NQ  +   +   G+L+SEN IGV HDHF+TFHLD+DVDG  N
Sbjct  487   KVGLSGILMVKGTAYENKNQ--VKEQEELHGTLLSENVIGVIHDHFVTFHLDLDVDGSNN  544

Query  700   SFVKVDLVKNYNIAGKIQRKSYWSPKRKVAKSENDAKIKLQLDKPSEFHVINPRHQSRLG  521
             SFVKV+L K     G+  RKSY    R VAK+E D +IKL+L  PSEFHVIN    +R+G
Sbjct  545   SFVKVNLKKEETSPGESPRKSYLKAVRNVAKTEKDGQIKLKLYDPSEFHVINAGKTTRVG  604

Query  520   NPSGYKIVPSATAASLLDLQDPPQLRAAFTNNQIWVTPYNRSEQWAGGLFTYQSHGDDTL  341
             NP+GYK+VPS TAASLLD  DPPQ R  FTNNQIWVTPYN+SEQWAGGLFTYQS G+DTL
Sbjct  605   NPTGYKVVPSGTAASLLDHDDPPQKRGGFTNNQIWVTPYNKSEQWAGGLFTYQSKGEDTL  664

Query  340   AVWSNRNRVIEKQDIVLWYTLGFHHLPCQEDFPVMPTVTSTFQLKPVNFFDRNPIIQANP  161
             AVWS+R+R IE +DIV+WYTLGFHH+PCQEDFP+MPTV+S+F LKPVNFF+RNPI++  P
Sbjct  665   AVWSDRDRDIENKDIVVWYTLGFHHIPCQEDFPIMPTVSSSFDLKPVNFFERNPILRVAP  724

Query  160   NFAEDLPICRA  128
             NF +DLP+CR+
Sbjct  725   NFEQDLPVCRS  735



>ref|XP_010539922.1| PREDICTED: primary amine oxidase-like isoform X2 [Tarenaya hassleriana]
Length=741

 Score =   797 bits (2059),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 388/671 (58%), Positives = 492/671 (73%), Gaps = 20/671 (3%)
 Frame = -1

Query  2113  QNNHFADRPMHPLDPLTIQEIERTRSILSSYQPFSGSSLR-IHSLSLDEPDKSEVLRWKR  1937
             + +H +D P HPLDPLT+ EI R +S+LS++  FS  +   +HS+ L+EPDK+ V +W++
Sbjct  77    RRDHVSDVPRHPLDPLTVGEINRVKSLLSTHALFSSRAPHALHSVVLEEPDKNLVKKWEK  136

Query  1936  GNPLPTRKAFVVALSNGQAHLLVVDLGSGRVSSHTRNPA--SGYPPMSADDASTALEATF  1763
             G+PLP RKA V+A      H+L+VDL SGRV      P   SG+P M+ ++ + A  A F
Sbjct  137   GDPLPPRKASVIARVGVDYHVLIVDLSSGRVE-EVEGPGRGSGFPTMTLEEMNDATWAPF  195

Query  1762  SNSVFREAISTRGVEINDVVCSAAAPGWFGPEEEGRRITKVKCYTAQNTPNYYMRPIEGL  1583
             S++ F   I +RGV+++DV C   + GWFG  EE RR+ KV+CY++Q T N+YMRPIEGL
Sbjct  196   SSADFNRTIVSRGVDLSDVACLPLSSGWFGKSEENRRVMKVQCYSSQGTANFYMRPIEGL  255

Query  1582  LLTVDLDSGKVINVYDTHSPIPIPKAQGTDYRRDGIEHRAPGVEP---LKPISMEQPNGQ  1412
              + +DLD+ +VI + DT   IP+P +  TDYR      RA   E    L PIS+EQP G 
Sbjct  256   TVLLDLDTMEVIEISDTGRVIPVPGSTNTDYRY----ARASNPEETRLLNPISIEQPRGP  311

Query  1411  SFRVEDGYIVKWASWEFHVKADQRAGIIISQATVFDPEAGKRRSVMYKGFASELFVPYMD  1232
             SF +EDG++V+WA+WEFH+K D RAG++IS+A V DPE  + R VMYKGF SELFVPYMD
Sbjct  312   SFVIEDGHLVRWANWEFHLKPDPRAGVVISRARVRDPETRELREVMYKGFVSELFVPYMD  371

Query  1231  VDEGWYFRAFMDAGEFGLGATAMELVPLNDCPRHSHYIDGLFVDPDGRPVSQPNVICVFE  1052
               + WYF+ +MDAGE+G G  AM LVPLNDCPR++ Y+DG+F   DG P  + N++CVFE
Sbjct  372   PTDAWYFKTYMDAGEYGFGLQAMPLVPLNDCPRNAEYMDGVFTAADGTPYVRENMVCVFE  431

Query  1051  RYSGDIAWRHSG---TGDADDDLIREARPKVSLVVRTTATVGNYDYIFDWEFQTDGSIRV  881
              Y+GDIAWRHS    TG      IRE RPKV+LVVR  A+V NYDYI DWEFQTDG IR 
Sbjct  432   SYAGDIAWRHSESPITGLP----IREVRPKVTLVVRMAASVANYDYIIDWEFQTDGLIRA  487

Query  880   TVGLSGIILAKGSPYEHINQFEIPRWDFPAGSLVSENTIGVAHDHFITFHLDMDVDGPTN  701
              VGLSGI++ KG+ YE+ NQ  +   +   G+L+SEN IGV HDHF+TFHLD+DVDG  N
Sbjct  488   KVGLSGILMVKGTAYENKNQ--VKEQEELHGTLLSENVIGVIHDHFVTFHLDLDVDGSNN  545

Query  700   SFVKVDLVKNYNIAGKIQRKSYWSPKRKVAKSENDAKIKLQLDKPSEFHVINPRHQSRLG  521
             SFVKV+L K     G+  RKSY    R VAK+E D +IKL+L  PSEFHVIN    +R+G
Sbjct  546   SFVKVNLKKEETSPGESPRKSYLKAVRNVAKTEKDGQIKLKLYDPSEFHVINAGKTTRVG  605

Query  520   NPSGYKIVPSATAASLLDLQDPPQLRAAFTNNQIWVTPYNRSEQWAGGLFTYQSHGDDTL  341
             NP+GYK+VPS TAASLLD  DPPQ R  FTNNQIWVTPYN+SEQWAGGLFTYQS G+DTL
Sbjct  606   NPTGYKVVPSGTAASLLDHDDPPQKRGGFTNNQIWVTPYNKSEQWAGGLFTYQSKGEDTL  665

Query  340   AVWSNRNRVIEKQDIVLWYTLGFHHLPCQEDFPVMPTVTSTFQLKPVNFFDRNPIIQANP  161
             AVWS+R+R IE +DIV+WYTLGFHH+PCQEDFP+MPTV+S+F LKPVNFF+RNPI++  P
Sbjct  666   AVWSDRDRDIENKDIVVWYTLGFHHIPCQEDFPIMPTVSSSFDLKPVNFFERNPILRVAP  725

Query  160   NFAEDLPICRA  128
             NF +DLP+CR+
Sbjct  726   NFEQDLPVCRS  736



>ref|XP_002275872.1| PREDICTED: primary amine oxidase [Vitis vinifera]
Length=727

 Score =   795 bits (2053),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 377/667 (57%), Positives = 482/667 (72%), Gaps = 17/667 (3%)
 Frame = -1

Query  2113  QNNHFADRPMHPLDPLTIQEIERTRSILSSYQPFSGSS-LRIHSLSLDEPDKSEVLRWKR  1937
             + +H +D P HPLDPLT+QEI R R+ILSS+ P   S    IH++ L+EP K  VLRWK+
Sbjct  67    RRHHSSDVPHHPLDPLTVQEINRVRTILSSHAPLKASKRYTIHAVDLEEPAKPLVLRWKK  126

Query  1936  GNPLPTRKAFVVALSNGQAHLLVVDLGSGRVSSHTRNPASGYPPMSADDASTALEATFSN  1757
             GNP+  R+A V+AL  G++HLL VDL + +V+     P SGYP M+ +D +TA +A   +
Sbjct  127   GNPMLPRRASVIALVGGESHLLTVDLATSQVTRDDVLPPSGYPTMTVEDMTTATKAPLVD  186

Query  1756  SVFREAISTRGVEINDVVCSAAAPGWFGPEEEGRRITKVKCYTAQNTPNYYMRPIEGLLL  1577
               F   I  RG+++ D+ C   + GWFG  EE RR+ KV+CY+ ++T N+YMRPIEGL +
Sbjct  187   GNFNRTIIERGIDLADLACLPLSTGWFGKSEEKRRLIKVQCYSLKDTVNFYMRPIEGLTV  246

Query  1576  TVDLDSGKVINVYDTHSPIPIPKAQGTDYRRDGIEHRAPGVEPLKPISMEQPNGQSFRVE  1397
              VDLDS +V+ + D    IPIP A  TDYR      ++     L PIS+EQP G SF VE
Sbjct  247   LVDLDSKQVVEISDRGQNIPIPNAANTDYRYSA---QSKPTNLLNPISIEQPKGPSFTVE  303

Query  1396  DGYIVKWASWEFHVKADQRAGIIISQATVFDPEAGKRRSVMYKGFASELFVPYMDVDEGW  1217
             + +++KWA+WEFH+KA+ RAG+IIS+    DP+ G  R+VMYKG  SE FVPYMD  + W
Sbjct  304   NDHLIKWANWEFHLKAESRAGVIISRVMFRDPDTGLLRNVMYKGLTSEFFVPYMDPTDAW  363

Query  1216  YFRAFMDAGEFGLGATAMELVPLNDCPRHSHYIDGLFVDPDGRPVSQPNVICVFERYSGD  1037
             YF+ +MDAGE+G G  AM L PLNDCPR+++Y+DG+F   DG P  Q N+IC+FE Y+GD
Sbjct  364   YFKTYMDAGEYGFGLQAMPLDPLNDCPRNAYYMDGVFAAADGTPFVQSNMICIFESYAGD  423

Query  1036  IAWRH-----SGTGDADDDLIREARPKVSLVVRTTATVGNYDYIFDWEFQTDGSIRVTVG  872
             I WRH     +G G      IRE RPKV+LVVR  A+V NYDYI DW FQTDG IR+ VG
Sbjct  424   IGWRHAESPITGMG------IREVRPKVTLVVRMAASVANYDYIVDWVFQTDGLIRIKVG  477

Query  871   LSGIILAKGSPYEHINQFEIPRWDFPAGSLVSENTIGVAHDHFITFHLDMDVDGPTNSFV  692
             LSGI++ KG+PY ++NQ  +P  ++  G+L+SEN IGV HDH++TF+LDMDVDG  NSFV
Sbjct  478   LSGILMVKGTPYVNMNQ--VPGQEYLYGTLLSENVIGVIHDHYLTFYLDMDVDGSDNSFV  535

Query  691   KVDLVKNYNIAGKIQRKSYWSPKRKVAKSENDAKIKLQLDKPSEFHVINPRHQSRLGNPS  512
             KV+L K     G+  R+S+    RKVAK+E DA+IK +L +P+EFHVINP  ++R+GNP 
Sbjct  536   KVNLEKQMTANGESPRRSFLKATRKVAKTEKDAQIKFKLYEPAEFHVINPSKKTRVGNPV  595

Query  511   GYKIVPSATAASLLDLQDPPQLRAAFTNNQIWVTPYNRSEQWAGGLFTYQSHGDDTLAVW  332
             GYK+V   TAASLLD +DPPQ R AFTNNQIWVTPYNRSEQWAGGL   QS GDD LAVW
Sbjct  596   GYKVVAGGTAASLLDHEDPPQKRGAFTNNQIWVTPYNRSEQWAGGLLVSQSQGDDNLAVW  655

Query  331   SNRNRVIEKQDIVLWYTLGFHHLPCQEDFPVMPTVTSTFQLKPVNFFDRNPIIQANPNFA  152
             S+RNR IE +DIV+WYTLGFHH+PCQEDFPVMPTV+S+F LKPVNFF+ NPI++  PN  
Sbjct  656   SDRNRPIENKDIVVWYTLGFHHIPCQEDFPVMPTVSSSFDLKPVNFFESNPILRMPPNVE  715

Query  151   EDLPICR  131
              DLPIC+
Sbjct  716   NDLPICK  722



>dbj|BAJ85075.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=734

 Score =   795 bits (2052),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 379/674 (56%), Positives = 486/674 (72%), Gaps = 25/674 (4%)
 Frame = -1

Query  2107  NHFADRPMHPLDPLTIQEIERTRSILSSYQPFSG--SSLRIHSLSLDEPDKSEVLRWKRG  1934
             +H  D P HPLDPLT+ EI R R IL ++ PF+   S+L +H+L+LDEPDK  V RW++G
Sbjct  70    SHETDVPRHPLDPLTVTEISRAREILRAHPPFASAPSALVVHALALDEPDKPAVRRWRKG  129

Query  1933  -NPLPTRKAFVVALSNGQAHLLVVDLGSGRVSSHTRNPASGYPPMSADDASTALEATFSN  1757
              + LP R+A  V    G++++L +DL +G V+     PASGYP M+ D+ +    A FS+
Sbjct  130   AHALPPRRAVAVVRFRGESYVLALDLATGSVAP-LPTPASGYPTMTMDEMTALCAAPFSD  188

Query  1756  SVFREAISTRGVEINDVVCSAAAPGWFGPEEE--GRRITKVKCYTAQNTPNYYMRPIEGL  1583
               F   I  RGV ++DV C   +PGW+GP E+  GRR+ K +CY+ + T N+YMRPIEGL
Sbjct  189   PAFNATILRRGVRLSDVACLPISPGWYGPAEDDGGRRLIKSQCYSTEGTANFYMRPIEGL  248

Query  1582  LLTVDLDSGKVINVYDTHSPIPIPKAQGTDYRRDGIEH---------RAPGVEPLKPISM  1430
              + +D+D+GKV++V D  + IPIP A+ TDYR    +          RAP +EP      
Sbjct  249   TVLIDMDTGKVVHVSDRGAGIPIPAAKNTDYRHAANDDADKFGYQTVRAPSMEP------  302

Query  1429  EQPNGQSFRVEDGYIVKWASWEFHVKADQRAGIIISQATVFDPEAGKRRSVMYKGFASEL  1250
               P G  F V DG+ V+WA WEFH+KAD RAG+I+S+ATV DP  G RR VMYKG ASEL
Sbjct  303   -APGGPGFEVSDGHTVRWAGWEFHLKADARAGLIVSRATVQDPATGARREVMYKGMASEL  361

Query  1249  FVPYMDVDEGWYFRAFMDAGEFGLGATAMELVPLNDCPRHSHYIDGLFVDPDGRPVSQPN  1070
             FVPYMD  E WYF+ +MDAGE+G G  AM LVPLNDCPRH+ Y+DG+FV  DGRP  +  
Sbjct  362   FVPYMDPTEAWYFKTYMDAGEYGFGLQAMPLVPLNDCPRHARYMDGVFVAADGRPYVREK  421

Query  1069  VICVFERYSGDIAWRHSGTGDADDDLIREARPKVSLVVRTTATVGNYDYIFDWEFQTDGS  890
             +ICVFERY+GDIAWRHS +     D IRE+R KV+LV R  A+V NYDYI DWEFQTDG 
Sbjct  422   MICVFERYAGDIAWRHSESPITGMD-IRESRAKVTLVARMAASVANYDYIVDWEFQTDGL  480

Query  889   IRVTVGLSGIILAKGSPYEHINQFEIPRWDFPAGSLVSENTIGVAHDHFITFHLDMDVDG  710
             IR+ VGLSGI++ KGSPY H+NQ  + + +   G+L+SEN IGV HDH++TF LDMDVDG
Sbjct  481   IRIKVGLSGILMVKGSPYSHMNQ--VRQNEEMHGTLLSENIIGVIHDHYVTFRLDMDVDG  538

Query  709   PTNSFVKVDLVKNYNIAGKIQRKSYWSPKRKVAKSENDAKIKLQLDKPSEFHVINPRHQS  530
               NSFV+VD+ +     G+  R+SY    R VA +E DAK++L+L +P+EFHVINP  ++
Sbjct  539   VDNSFVRVDMARQDTAPGESPRRSYLKATRHVASTEKDAKVRLKLYEPAEFHVINPTKKT  598

Query  529   RLGNPSGYKIVPSATAASLLDLQDPPQLRAAFTNNQIWVTPYNRSEQWAGGLFTYQSHGD  350
             R+GNP GYK+VP+ TAASLLD +DPPQ R AFTNNQIWVTPYN+SE+WAGGLF YQS G+
Sbjct  599   RVGNPVGYKVVPAGTAASLLDPEDPPQKRGAFTNNQIWVTPYNKSEEWAGGLFVYQSKGE  658

Query  349   DTLAVWSNRNRVIEKQDIVLWYTLGFHHLPCQEDFPVMPTVTSTFQLKPVNFFDRNPIIQ  170
             DTLA W+ R+R IE +D+VLWYTLGFHH+PCQEDFP+MPTV+S+F LKPVNFF+ NPI++
Sbjct  659   DTLATWTERDRPIENKDLVLWYTLGFHHIPCQEDFPIMPTVSSSFDLKPVNFFESNPILK  718

Query  169   ANPNFAEDLPICRA  128
               P   +DLP+C A
Sbjct  719   QRPTMEKDLPVCVA  732



>ref|XP_004147578.1| PREDICTED: primary amine oxidase-like [Cucumis sativus]
 ref|XP_004162659.1| PREDICTED: primary amine oxidase-like [Cucumis sativus]
 gb|KGN50202.1| Primary amine oxidase [Cucumis sativus]
Length=725

 Score =   793 bits (2047),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 386/723 (53%), Positives = 505/723 (70%), Gaps = 10/723 (1%)
 Frame = -1

Query  2290  KELIHSF-SMKMAASSIFCLFYMASSMLIFLQVNSCLSFESSNASINNLESLLGIHDFKI  2114
             K L+ SF S+  A +  F   +++S      ++  C ++    +S ++  +L    +   
Sbjct  5     KYLLSSFLSLTTAFALFFTWLHLSSPPPNVAELLDCAAYSPWCSSKSHPTNLGRDQNPTR  64

Query  2113  QNNHFADRPMHPLDPLTIQEIERTRSILSSYQPFSGSSLRIHSLSLDEPDKSEVLRWKRG  1934
             +++H +D P HPLDPLT+ EI + RSILSS+  F  S   IHSL L+EP+KS VL+WK G
Sbjct  65    RHDHSSDTPHHPLDPLTVTEINKARSILSSHPLFKSSPFSIHSLVLEEPNKSIVLKWKIG  124

Query  1933  NPLPTRKAFVVALSNGQAHLLVVDLGSGRVSSHTRNPASGYPPMSADDASTALEATFSNS  1754
             +PLP RKA V+A  N  +H+L VDL +  V      P SGYP M+ ++ + A      + 
Sbjct  125   DPLPPRKAVVIARVNENSHVLTVDLTTANVVIRETGPHSGYPTMTVEEMNGATWVPLKSE  184

Query  1753  VFREAISTRGVEINDVVCSAAAPGWFGPEEEGRRITKVKCYTAQNTPNYYMRPIEGLLLT  1574
              F + I  RG+ ++D+ C   + GWFG  EE RR+ KV+CY+ ++T N+YMRPIEGL + 
Sbjct  185   SFNQTILNRGIALSDLACLPISTGWFGAAEENRRLIKVQCYSMKDTANFYMRPIEGLTVL  244

Query  1573  VDLDSGKVINVYDTHSPIPIPKAQGTDYRRDGIEHRAPG--VEPLKPISMEQPNGQSFRV  1400
             VDLD+ +VI + D    IPIPKA  TDYR      + P   ++ L PIS+EQP G SF V
Sbjct  245   VDLDTQEVIEISDKGKNIPIPKAANTDYRYSA---QPPNKVMKILNPISIEQPKGPSFSV  301

Query  1399  EDGYIVKWASWEFHVKADQRAGIIISQATVFDPEAGKRRSVMYKGFASELFVPYMDVDEG  1220
             ED Y+VKW +WEFH+K D RAG +I  A + DPE G  R V+YKG+ SELFVPYMD  + 
Sbjct  302   EDNYLVKWGNWEFHLKPDPRAGSVIYGAKIRDPETGDLRDVIYKGYTSELFVPYMDPTDA  361

Query  1219  WYFRAFMDAGEFGLGATAMELVPLNDCPRHSHYIDGLFVDPDGRPVSQPNVICVFERYSG  1040
             WYF+ +MDAGE+G G  AM L PLNDCPR+++Y+DG+F   DG+P  + N+IC+FE Y+G
Sbjct  362   WYFKTYMDAGEYGFGLQAMSLDPLNDCPRNAYYMDGVFAAADGKPYVRRNMICLFESYAG  421

Query  1039  DIAWRHSGTGDADDDLIREARPKVSLVVRTTATVGNYDYIFDWEFQTDGSIRVTVGLSGI  860
             DI WRH+ +     D I E RPKV+LV R  A+V NYDYI DWEFQTDG IR+ VGLSGI
Sbjct  422   DIGWRHAESPITGMD-ITEVRPKVTLVARMAASVANYDYIVDWEFQTDGLIRIKVGLSGI  480

Query  859   ILAKGSPYEHINQFEIPRWDFPAGSLVSENTIGVAHDHFITFHLDMDVDGPTNSFVKVDL  680
             ++ KG+ YE+ NQF  P  D   G+L+SEN IGV HDH+ITF+LDMD+DG  NSFVKV+L
Sbjct  481   LMVKGTSYENTNQF--PGEDL-HGTLLSENVIGVIHDHYITFYLDMDIDGSDNSFVKVNL  537

Query  679   VKNYNIAGKIQRKSYWSPKRKVAKSENDAKIKLQLDKPSEFHVINPRHQSRLGNPSGYKI  500
              +     G+  RKSY    +KVAK+E +A+IKL L  PSEFHV+NP  ++R+GNP GYK+
Sbjct  538   QRQRTSKGESPRKSYLKAVKKVAKTEKEAQIKLSLYDPSEFHVVNPSVKTRVGNPVGYKV  597

Query  499   VPSATAASLLDLQDPPQLRAAFTNNQIWVTPYNRSEQWAGGLFTYQSHGDDTLAVWSNRN  320
             VP+ATA +LLDL DPPQ R AFTNNQIWVTPYNRSE+WAGG F YQSHG+DTL  WS+R+
Sbjct  598   VPAATAGNLLDLDDPPQRRGAFTNNQIWVTPYNRSEEWAGGQFVYQSHGEDTLQSWSDRD  657

Query  319   RVIEKQDIVLWYTLGFHHLPCQEDFPVMPTVTSTFQLKPVNFFDRNPIIQANPNFAEDLP  140
             R IE +DIV+WYTLGFHH+PCQEDFP+MPTV+++F LKPVNFF+ NPI+   PN  EDLP
Sbjct  658   REIENKDIVVWYTLGFHHIPCQEDFPIMPTVSASFDLKPVNFFESNPILSFPPNTFEDLP  717

Query  139   ICR  131
             +C+
Sbjct  718   VCK  720



>ref|XP_003601419.1| Primary amine oxidase [Medicago truncatula]
 gb|AES71670.1| copper amine oxidase, enzyme domain protein [Medicago truncatula]
Length=731

 Score =   793 bits (2048),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 392/732 (54%), Positives = 511/732 (70%), Gaps = 17/732 (2%)
 Frame = -1

Query  2299  NTHKELIHSFSMKMAASSIFCLFYMASSMLIFLQVNSCLSFESSNASINNLESLLGIHD-  2123
             N  K L+ SF + +   + +  F++ SS     +   C  F     S N  +S   IH  
Sbjct  5     NLLKFLVFSFGIALVILATW--FHLPSSF--NKEALDCNIFSGWCTSKNRFQSSNPIHKP  60

Query  2122  ----FKIQNNHFADRPMHPLDPLTIQEIERTRSILSSYQPF-SGSSLRIHSLSLDEPDKS  1958
                  + Q NH +D P HPLDPLTIQE  + R+ILS++  F S +S  ++S+ L+EPDK 
Sbjct  61    SFSTRRQQPNHESDEPRHPLDPLTIQEFNKVRAILSTHPLFKSSNSYTLNSIVLEEPDKE  120

Query  1957  EVLRWKRGNPLPTRKAFVVALSNGQAHLLVVDLGSGRVSSH-TRNPASGYPPMSADDAST  1781
              VL+WK G PL  RKA VVAL     H L VDL +  +++H TR  +SGYP M+ ++   
Sbjct  121   LVLKWKNGQPLLPRKASVVALDKRVTHTLTVDLSTSEITNHETRPGSSGYPTMTLEEMVA  180

Query  1780  ALEATFSNSVFREAISTRGVEINDVVCSAAAPGWFG-PEEEGRRITKVKCYTAQNTPNYY  1604
              L+    +  F   I  RGV + D+ C   A GW+G P EE RR+ KV+CY+++ T N+Y
Sbjct  181   VLDVPLKSGEFNSTIRKRGVNLADLACLPVASGWYGTPVEENRRLIKVQCYSSKGTVNFY  240

Query  1603  MRPIEGLLLTVDLDSGKVINVYDTHSPIPIPKAQGTDYRRDGIEHRAPGVEPLKPISMEQ  1424
             M+PIEGL + VD+D  +V+++ D    IP+     TDYR   ++     +  + PIS+EQ
Sbjct  241   MKPIEGLTVLVDMDKREVVSITDNGLNIPVANGIDTDYRY-SVQKLNGELNLINPISLEQ  299

Query  1423  PNGQSFRVEDGYIVKWASWEFHVKADQRAGIIISQATVFDPEAGKRRSVMYKGFASELFV  1244
             P G SF V DG++VKWA+WEFH+K D RAG IISQA V DP+  + R+V+YKGF SELFV
Sbjct  300   PKGPSFTV-DGHLVKWANWEFHLKPDPRAGTIISQAKVRDPDTLEMRNVIYKGFTSELFV  358

Query  1243  PYMDVDEGWYFRAFMDAGEFGLGATAMELVPLNDCPRHSHYIDGLFVDPDGRPVSQPNVI  1064
             PYMD  +GWYF+ +MDAGE+G G  AM L PLNDCPR+++Y+DG+F   DG P  QPN+I
Sbjct  359   PYMDPTDGWYFKTYMDAGEYGFGLQAMPLDPLNDCPRNAYYMDGVFTSADGTPYVQPNMI  418

Query  1063  CVFERYSGDIAWRHSGTGDADDDLIREARPKVSLVVRTTATVGNYDYIFDWEFQTDGSIR  884
             C+FE Y+GDIAWRH+     D   + E RPKV+LVVR  A V NYDYI DWEFQTDG IR
Sbjct  419   CIFESYAGDIAWRHAECPITDIK-VTEVRPKVTLVVRMAAAVANYDYIMDWEFQTDGLIR  477

Query  883   VTVGLSGIILAKGSPYEHINQFEIPRWDFPAGSLVSENTIGVAHDHFITFHLDMDVDGPT  704
               VGLSGI++ KG+ Y+H+NQ  +P  ++  G+L+SEN IGV HDH++T++LDMD+DG  
Sbjct  478   SKVGLSGILMVKGTTYDHMNQ--VPDQEYLYGTLLSENIIGVIHDHYVTYYLDMDIDGSD  535

Query  703   NSFVKVDLVKNYNIAGKIQRKSYWSPKRKVAKSENDAKIKLQLDKPSEFHVINPRHQSRL  524
             NSFVKV++ K     G+  RKSY    RKVAK+E DA+IKLQL  PSEFH++NP  ++R+
Sbjct  536   NSFVKVNIKKQETSPGESPRKSYLKAVRKVAKTEKDAQIKLQLYNPSEFHMVNPSKKTRV  595

Query  523   GNPSGYKIVPSATAASLLDLQDPPQLRAAFTNNQIWVTPYNRSEQWAGGLFTYQSHGDDT  344
             GNP GYK+VP ATAASLLD  DPPQ RAAFTNNQIWVTPYN+SE+WAGGL  YQS GDDT
Sbjct  596   GNPVGYKLVPGATAASLLDHDDPPQKRAAFTNNQIWVTPYNKSEEWAGGLLVYQSQGDDT  655

Query  343   LAVWSNRNRVIEKQDIVLWYTLGFHHLPCQEDFPVMPTVTSTFQLKPVNFFDRNPIIQAN  164
             L VWS+R+R IE +DIVLWYT+GFHH+PCQED+P+MPTV+S+F LKPVNFF+RNPI++  
Sbjct  656   LQVWSDRDRPIENKDIVLWYTVGFHHVPCQEDYPIMPTVSSSFDLKPVNFFERNPILRMP  715

Query  163   PNFAEDLPICRA  128
             PNF +DLP+C+A
Sbjct  716   PNFQDDLPVCKA  727



>ref|XP_008437149.1| PREDICTED: primary amine oxidase-like [Cucumis melo]
Length=724

 Score =   792 bits (2045),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 377/673 (56%), Positives = 485/673 (72%), Gaps = 9/673 (1%)
 Frame = -1

Query  2143  SLLGIHDFKIQNNHFADRPMHPLDPLTIQEIERTRSILSSYQPFSGSSLRIHSLSLDEPD  1964
             + LG      +++H +D P HPLDPLT+ EI +  SILSS+  F  S   IHSL L+EP+
Sbjct  54    TTLGRQSPTRRHDHSSDTPHHPLDPLTVTEINKAHSILSSHPLFKSSPFSIHSLVLEEPN  113

Query  1963  KSEVLRWKRGNPLPTRKAFVVALSNGQAHLLVVDLGSGRVSSHTRNPASGYPPMSADDAS  1784
             KS VL+WK G+PLP RKAFV+A  NG +H+L VDL +  V      P SGYP M+ ++ +
Sbjct  114   KSIVLKWKIGDPLPPRKAFVIARVNGNSHVLTVDLTTANVVIRETGPHSGYPVMTVEEMN  173

Query  1783  TALEATFSNSVFREAISTRGVEINDVVCSAAAPGWFGPEEEGRRITKVKCYTAQNTPNYY  1604
             +A     ++  F + I  RG+ ++D+ C   + GWFG  EE RR+ KV+CY+ ++T N+Y
Sbjct  174   SATFVPLTSESFNQTILNRGIALSDLACLPISTGWFGAAEENRRLIKVQCYSMKDTANFY  233

Query  1603  MRPIEGLLLTVDLDSGKVINVYDTHSPIPIPKAQGTDYRRDGIEHRAPG--VEPLKPISM  1430
             MRPIEGL + VDLDS +VI + D    IPIPKA  TDYR      + P   ++ L PIS+
Sbjct  234   MRPIEGLTVLVDLDSLEVIEISDKGKNIPIPKAANTDYRYSA---QPPNKVMKVLNPISI  290

Query  1429  EQPNGQSFRVEDGYIVKWASWEFHVKADQRAGIIISQATVFDPEAGKRRSVMYKGFASEL  1250
             EQP G SF VE+ Y+VKW +WEFH+K D RAGI+I  A + DPE G  R V+YKG+ SEL
Sbjct  291   EQPKGPSFTVEENYLVKWGNWEFHLKPDPRAGIVIYGAKIRDPETGDLRDVIYKGYTSEL  350

Query  1249  FVPYMDVDEGWYFRAFMDAGEFGLGATAMELVPLNDCPRHSHYIDGLFVDPDGRPVSQPN  1070
             FVPYMD  + WYF+ +MDAGE+G G  AM L PLNDCPR+++Y+DG+F   DG+P  + N
Sbjct  351   FVPYMDPTDAWYFKTYMDAGEYGFGLQAMSLDPLNDCPRNAYYMDGVFAAVDGKPYLRRN  410

Query  1069  VICVFERYSGDIAWRHSGTGDADDDLIREARPKVSLVVRTTATVGNYDYIFDWEFQTDGS  890
             +IC+FE Y+GDI WRH+ +     D I E RPKV+LV R  A+V NYDYI DWEFQTDG 
Sbjct  411   MICLFESYAGDIGWRHAESPITGMD-ITEVRPKVTLVARMAASVANYDYIVDWEFQTDGL  469

Query  889   IRVTVGLSGIILAKGSPYEHINQFEIPRWDFPAGSLVSENTIGVAHDHFITFHLDMDVDG  710
             IR+ VGLSGI++ KG+ YE+ NQF     +   G+L+SEN IGV HDH+ITF+LDMD+DG
Sbjct  470   IRIKVGLSGILMVKGTSYENTNQFA---GEDLHGTLLSENVIGVIHDHYITFYLDMDIDG  526

Query  709   PTNSFVKVDLVKNYNIAGKIQRKSYWSPKRKVAKSENDAKIKLQLDKPSEFHVINPRHQS  530
               NSFVKV+L +     G+  RKSY    RKVAK+E +A++KL L  PSEFHV+NP  ++
Sbjct  527   SDNSFVKVNLQRQRTSKGESPRKSYLKAVRKVAKTEKEAQVKLSLYDPSEFHVVNPSVKT  586

Query  529   RLGNPSGYKIVPSATAASLLDLQDPPQLRAAFTNNQIWVTPYNRSEQWAGGLFTYQSHGD  350
             R+GNP GYK+VP+ATA +LLDL DPPQ R AFTNNQIWVTPYNRSE+WAGG F YQSHG+
Sbjct  587   RVGNPVGYKVVPAATAGNLLDLDDPPQRRGAFTNNQIWVTPYNRSEEWAGGQFVYQSHGE  646

Query  349   DTLAVWSNRNRVIEKQDIVLWYTLGFHHLPCQEDFPVMPTVTSTFQLKPVNFFDRNPIIQ  170
             DTL  WS+R+R IE +DIV+WYTLGFHH+PCQEDFP+MPTV+++F LKPVNFF+ NPI+ 
Sbjct  647   DTLQTWSDRDREIENKDIVVWYTLGFHHIPCQEDFPIMPTVSASFDLKPVNFFESNPILS  706

Query  169   ANPNFAEDLPICR  131
               PN  EDLP+C+
Sbjct  707   FPPNTFEDLPVCK  719



>ref|XP_010676213.1| PREDICTED: primary amine oxidase [Beta vulgaris subsp. vulgaris]
Length=721

 Score =   791 bits (2043),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 368/659 (56%), Positives = 484/659 (73%), Gaps = 4/659 (1%)
 Frame = -1

Query  2104  HFADRPMHPLDPLTIQEIERTRSILSSYQPFSGSSL-RIHSLSLDEPDKSEVLRWKRGNP  1928
             H +D   HPLDPLT+QE+ + RS+++S+  F G+     HS+ L+EP K+ V+RWK G+P
Sbjct  60    HESDVAHHPLDPLTVQELNQVRSMITSHVLFKGAKYYAFHSVVLEEPLKTRVIRWKEGDP  119

Query  1927  LPTRKAFVVALSNGQAHLLVVDLGSGRVSSHTRNPASGYPPMSADDASTALEATFSNSVF  1748
             LP+RKA V+A  +G  H+L V L SGRV        SGYP M+ +D +TA      ++ F
Sbjct  120   LPSRKASVIARVDGVTHVLRVGLSSGRVEKVDVGKLSGYPTMTIEDMNTATFTPLVSAEF  179

Query  1747  REAISTRGVEINDVVCSAAAPGWFGPEEEGRRITKVKCYTAQNTPNYYMRPIEGLLLTVD  1568
              + +  RGV++ D+ C   + GW+G +EE RR+ KV+CY+ ++T N+YMRPIEGL + VD
Sbjct  180   NQTVKERGVDLKDLACLPISLGWYGKKEENRRLIKVQCYSMEDTANFYMRPIEGLTVIVD  239

Query  1567  LDSGKVINVYDTHSPIPIPKAQGTDYRRDGIEHRAPGVEPLKPISMEQPNGQSFRVEDGY  1388
             +D+ +V+ + D    IPIPKA  T+YR    +     ++P+ PIS+EQ  G SF VE+G+
Sbjct  240   MDTNQVVEISDNGRDIPIPKAANTEYRFSAQKKLRQKLKPINPISIEQSKGPSFTVENGH  299

Query  1387  IVKWASWEFHVKADQRAGIIISQATVFDPEAGKRRSVMYKGFASELFVPYMDVDEGWYFR  1208
             +VKWA+WEFH+K D RAG+IIS+A   DP+ G+ R+VMYKG  SELFVPYMD  + WYF+
Sbjct  300   MVKWANWEFHLKPDPRAGVIISRAMFRDPDNGELRNVMYKGMTSELFVPYMDPSDAWYFK  359

Query  1207  AFMDAGEFGLGATAMELVPLNDCPRHSHYIDGLFVDPDGRPVSQPNVICVFERYSGDIAW  1028
              +MDAGE+G G  AM L PLNDCPR+++Y+DG+F   DGRP  + N++CVFE Y+GDI W
Sbjct  360   TYMDAGEYGFGLEAMPLDPLNDCPRNAYYMDGVFAAGDGRPYVRSNMVCVFESYTGDIGW  419

Query  1027  RHSGTGDADDDLIREARPKVSLVVRTTATVGNYDYIFDWEFQTDGSIRVTVGLSGIILAK  848
             RHS +     + IREARPKV+LVVR  A+V NYDYI DWEFQ+DG I++ VGLSGI++ K
Sbjct  420   RHSESPITGLE-IREARPKVTLVVRMAASVANYDYIVDWEFQSDGLIKIKVGLSGILMVK  478

Query  847   GSPYEHINQFEIPRWDFPAGSLVSENTIGVAHDHFITFHLDMDVDGPTNSFVKVDLVKNY  668
             G+PY + NQ  +   +   G+L+SEN IGV HDH+ITF+LDMDVDG  NSFVKV+L +  
Sbjct  479   GTPYTNTNQ--VSNQEDLYGTLLSENVIGVIHDHYITFYLDMDVDGSDNSFVKVNLQRQQ  536

Query  667   NIAGKIQRKSYWSPKRKVAKSENDAKIKLQLDKPSEFHVINPRHQSRLGNPSGYKIVPSA  488
                G+  R SY    R VAK+E +A+IKL+L  P EFHV+NP  ++RLGNP GYK+VP+ 
Sbjct  537   TSPGESPRTSYLKATRSVAKTEKEAQIKLKLYDPYEFHVVNPNKKTRLGNPVGYKVVPAG  596

Query  487   TAASLLDLQDPPQLRAAFTNNQIWVTPYNRSEQWAGGLFTYQSHGDDTLAVWSNRNRVIE  308
             TAASLLD  DPPQ R AFTNNQIWVTPYNRSE+WAGGLF YQ+ G+D LA WS R+R IE
Sbjct  597   TAASLLDHDDPPQRRGAFTNNQIWVTPYNRSEEWAGGLFAYQNQGEDNLATWSERDREIE  656

Query  307   KQDIVLWYTLGFHHLPCQEDFPVMPTVTSTFQLKPVNFFDRNPIIQANPNFAEDLPICR  131
              +DIVLWYTLGFHH+PCQEDFP+MPTV+S+F LKPVNFF+RNPI++  PNF +DLP+C+
Sbjct  657   NKDIVLWYTLGFHHIPCQEDFPIMPTVSSSFSLKPVNFFERNPILEIPPNFEKDLPVCQ  715



>ref|XP_011081127.1| PREDICTED: primary amine oxidase-like [Sesamum indicum]
Length=728

 Score =   791 bits (2042),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 370/659 (56%), Positives = 476/659 (72%), Gaps = 6/659 (1%)
 Frame = -1

Query  2104  HFADRPMHPLDPLTIQEIERTRSILSSYQPFSGSSLRIHSLSLDEPDKSEVLRWKRGNPL  1925
             H  D P HPLDPLT+ E+   R I+ +   F   +  +HS+ L+EPDK  VLRWK+G+PL
Sbjct  72    HSVDVPHHPLDPLTVTELNTVRKIIQTLDFFKNKAYALHSVVLEEPDKKVVLRWKKGDPL  131

Query  1924  PTRKAFVVALSNGQAHLLVVDLGSGRVSSHTRNPASGYPPMSADDASTALEATFSNSVFR  1745
             P RKA VVA   G +H+L VDLGSG V+ H     SGYP M+ +D ++   A  +++ F 
Sbjct  132   PPRKAAVVARVGGASHVLTVDLGSGEVTRHETGHMSGYPTMTVEDMTSVTWAPLASADFN  191

Query  1744  EAISTRGVEINDVVCSAAAPGWFGPEEEGRRITKVKCYTAQNTPNYYMRPIEGLLLTVDL  1565
               +  RGV++ D+ C   + GWFG  EE RR+ KV+CY+ ++T N+YMRPIEGL + VDL
Sbjct  192   RTVVERGVDLADLACLPISLGWFGKSEENRRLIKVQCYSMKDTANFYMRPIEGLTVLVDL  251

Query  1564  DSGKVINVYDTHSPIPIPKAQGTDYRRDGIEHRAPGVEPLKPISMEQPNGQSFRVEDGYI  1385
             D+ +V+++ D    IPIP A  TDYR          V    PIS+EQP G SF ++D ++
Sbjct  252   DTKEVVHITDKGKNIPIPNAANTDYRFAAQNSYQSLV---NPISIEQPKGPSFTIQDDHL  308

Query  1384  VKWASWEFHVKADQRAGIIISQATVFDPEAGKRRSVMYKGFASELFVPYMDVDEGWYFRA  1205
             VKWA+WEFH+K D RAG+I+S+A V D   G+ R+VMYKG  SELFVPYMD  + WYF+ 
Sbjct  309   VKWANWEFHLKPDPRAGVIVSRAMVRDSGTGEMRNVMYKGLTSELFVPYMDPTDAWYFKT  368

Query  1204  FMDAGEFGLGATAMELVPLNDCPRHSHYIDGLFVDPDGRPVSQPNVICVFERYSGDIAWR  1025
             +MDAGE+G G  AM L PLNDCPR+++Y+DG+F   DG P  + N++CV+E Y+GDI WR
Sbjct  369   YMDAGEYGFGLQAMPLDPLNDCPRNAYYMDGVFAAADGTPYVRSNMVCVYESYAGDIGWR  428

Query  1024  HSGTGDADDDLIREARPKVSLVVRTTATVGNYDYIFDWEFQTDGSIRVTVGLSGIILAKG  845
             HS +     + IRE RPKV+LVVR  A+V NYDYI DWEFQTDG IR+ VGLSGI++ KG
Sbjct  429   HSESPITGME-IREVRPKVTLVVRMAASVANYDYIVDWEFQTDGLIRIKVGLSGILMVKG  487

Query  844   SPYEHINQFEIPRWDFPAGSLVSENTIGVAHDHFITFHLDMDVDGPTNSFVKVDLVKNYN  665
             +PY ++NQ       +  G+L+SEN IGV HDHFITF+LDMDVDG  NSFVKV+L + Y 
Sbjct  488   TPYANMNQVNDQESLY--GTLLSENVIGVIHDHFITFYLDMDVDGSDNSFVKVNLQRAYT  545

Query  664   IAGKIQRKSYWSPKRKVAKSENDAKIKLQLDKPSEFHVINPRHQSRLGNPSGYKIVPSAT  485
                +  R SY    R VAK+E DA+IKL+L  PSEFHV+NP  ++R+GNP GYK+VP+ T
Sbjct  546   SPEESPRMSYLKAVRNVAKTEKDAQIKLKLYDPSEFHVVNPTKKTRVGNPVGYKVVPAGT  605

Query  484   AASLLDLQDPPQLRAAFTNNQIWVTPYNRSEQWAGGLFTYQSHGDDTLAVWSNRNRVIEK  305
             AA+LLD+ DPPQ R AFTNNQIWVTPYN +EQWAGGLF YQSHG+DTL VW+NR+R IE 
Sbjct  606   AANLLDVNDPPQKRGAFTNNQIWVTPYNETEQWAGGLFVYQSHGEDTLEVWANRDREIEN  665

Query  304   QDIVLWYTLGFHHLPCQEDFPVMPTVTSTFQLKPVNFFDRNPIIQANPNFAEDLPICRA  128
             +DIV+WYTLGFHH+PCQEDFP+MPTV+++F LKPVNFF+ NPI++  PN   DLPIC+A
Sbjct  666   KDIVVWYTLGFHHVPCQEDFPIMPTVSASFDLKPVNFFESNPILKIPPNVESDLPICKA  724



>ref|NP_192966.5| copper amine oxidase family protein [Arabidopsis thaliana]
 gb|AAM98089.1| AT4g12290/T4C9_130 [Arabidopsis thaliana]
 gb|AAO42784.1| AT4g12290/T4C9_130 [Arabidopsis thaliana]
 gb|AEE83111.1| copper amine oxidase family protein [Arabidopsis thaliana]
Length=741

 Score =   791 bits (2043),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 379/668 (57%), Positives = 484/668 (72%), Gaps = 13/668 (2%)
 Frame = -1

Query  2113  QNNHFADRPMHPLDPLTIQEIERTRSILSSYQPF-SGSSLRIHSLSLDEPDKSEVLRWKR  1937
              ++H +D P HPLDPLT+ EI + RSILSS+  F SG+   +H++ L+EP+K+ V  W++
Sbjct  72    NHDHVSDTPNHPLDPLTVSEINKIRSILSSHALFTSGTPHALHTVVLEEPEKNLVRHWEK  131

Query  1936  GNPLPTRKAFVVALSNGQAHLLVVDLGSGRV-SSHTRNPASGYPPMSADDASTALEATFS  1760
             GNPLP RKA V+A      H+L VD+ +GRV S ++    SGYP M+ ++ +      FS
Sbjct  132   GNPLPPRKASVIARVGADTHVLTVDISTGRVDSENSPVRVSGYPMMTIEEMNDITVVPFS  191

Query  1759  NSVFREAISTRGVEINDVVCSAAAPGWFGPEEEGRRITKVKCYTAQNTPNYYMRPIEGLL  1580
             N+ F   I +RGV + DV+C   + GWFG +EE  R+ K +C+  Q TPN+YMRPIEGL 
Sbjct  192   NADFNRTIISRGVNLTDVICFPISCGWFGNKEENARVIKSQCFMTQGTPNFYMRPIEGLT  251

Query  1579  LTVDLDSGKVINVYDTHSPIPIPKAQGTDYRRDGIEHRAPGVEPLKPISMEQPNGQSFRV  1400
             + +DLD+ +VI + DT   IPIP +  TDYR   +        PL PIS+EQP G SF +
Sbjct  252   ILIDLDTKQVIEITDTGRAIPIPGSTNTDYRFQKLA-TTDKTRPLNPISIEQPRGPSFVI  310

Query  1399  EDGYIVKWASWEFHVKADQRAGIIISQATVFDPEAGKRRSVMYKGFASELFVPYMDVDEG  1220
             ED ++VKWA+WEFH+K D RAG++IS+  V DP+  + R VMYKGF SELFVPYMD  + 
Sbjct  311   EDNHLVKWANWEFHLKPDPRAGVVISRVRVHDPDTHETRDVMYKGFVSELFVPYMDPSDA  370

Query  1219  WYFRAFMDAGEFGLGATAMELVPLNDCPRHSHYIDGLFVDPDGRPVSQPNVICVFERYSG  1040
             WYF+ +MDAGE+G G  AM LVPLNDCPR++ Y+DG+F   DG P  + N++C+FE Y+G
Sbjct  371   WYFKTYMDAGEYGFGLQAMPLVPLNDCPRNAAYMDGVFAAADGTPFVRENMVCIFESYAG  430

Query  1039  DIAWRHSG---TGDADDDLIREARPKVSLVVRTTATVGNYDYIFDWEFQTDGSIRVTVGL  869
             DI WRHS    TG      IRE RPKV+LVVR  A+VGNYDYI D+EFQTDG I+  VGL
Sbjct  431   DIGWRHSESPITGIP----IREVRPKVTLVVRMAASVGNYDYIIDYEFQTDGLIKAKVGL  486

Query  868   SGIILAKGSPYEHINQFEIPR---WDFPAGSLVSENTIGVAHDHFITFHLDMDVDGPTNS  698
             SGI++ KG+ Y++ NQ E  +    +   G+L+SEN IGV HDH++TF+LD+DVDGP NS
Sbjct  487   SGILMVKGTTYQNKNQVEKDKDGNEEELHGTLLSENVIGVIHDHYVTFYLDLDVDGPDNS  546

Query  697   FVKVDLVKNYNIAGKIQRKSYWSPKRKVAKSENDAKIKLQLDKPSEFHVINPRHQSRLGN  518
             FVKV+L +     G+  RKSY    R +AK+E D +IKL L  PSEFHVIN    +R+GN
Sbjct  547   FVKVNLKRQETEPGESPRKSYLKAVRNIAKTEKDGQIKLSLYDPSEFHVINSGKTTRVGN  606

Query  517   PSGYKIVPSATAASLLDLQDPPQLRAAFTNNQIWVTPYNRSEQWAGGLFTYQSHGDDTLA  338
             P+GYK+VP  TAASLLD  DPPQ R AFTNNQIWVTPYN+SEQWAGGLFTYQSHGDDTLA
Sbjct  607   PTGYKVVPRTTAASLLDHDDPPQKRGAFTNNQIWVTPYNKSEQWAGGLFTYQSHGDDTLA  666

Query  337   VWSNRNRVIEKQDIVLWYTLGFHHLPCQEDFPVMPTVTSTFQLKPVNFFDRNPIIQANPN  158
             VWS+R+R IE +DIV+WYTLGFHH+PCQEDFP+MPTV+S+F LKPVNFF+RNPI+ A PN
Sbjct  667   VWSDRDRDIENKDIVVWYTLGFHHIPCQEDFPIMPTVSSSFDLKPVNFFERNPILSAAPN  726

Query  157   FAEDLPIC  134
             F  DLP+C
Sbjct  727   FEHDLPVC  734



>ref|XP_003546898.1| PREDICTED: primary amine oxidase-like isoform X1 [Glycine max]
 ref|XP_006598271.1| PREDICTED: primary amine oxidase-like isoform X2 [Glycine max]
 ref|XP_006598272.1| PREDICTED: primary amine oxidase-like isoform X3 [Glycine max]
 gb|KHN45082.1| Primary amine oxidase [Glycine soja]
Length=732

 Score =   791 bits (2042),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 380/665 (57%), Positives = 489/665 (74%), Gaps = 8/665 (1%)
 Frame = -1

Query  2113  QNNHFADRPMHPLDPLTIQEIERTRSILSSYQPF-SGSSLRIHSLSLDEPDKSEVLRWKR  1937
             Q++  ++ P HPLDPLTIQE  + R+ILS++  F S S+  ++S+ L+EPDK  VL+WK+
Sbjct  69    QHHDESEIPEHPLDPLTIQEFNKVRTILSNHPLFKSSSTYTLNSVVLEEPDKKLVLKWKK  128

Query  1936  GNPLPTRKAFVVALSNGQAHLLVVDLGSGRVSSH-TRNPASGYPPMSADDASTALEATFS  1760
             G+P   RKA VVA   G +H+L VDL +G+V+SH T    SGYP M+ +D    LE    
Sbjct  129   GDPPLPRKASVVAYVKGDSHVLTVDLETGQVASHKTTGSVSGYPTMTMEDMVGVLEVPLK  188

Query  1759  NSVFREAISTRGVEINDVVCSAAAPGWFG-PEEEGRRITKVKCYTAQNTPNYYMRPIEGL  1583
             ++ F  +I+ RGV + D+ C   + GW+G P EE RR+ KV+CY+ + T N+YM+PIEG+
Sbjct  189   STEFNRSITKRGVNLADLACLPISSGWYGTPVEENRRLIKVQCYSKEGTVNFYMKPIEGV  248

Query  1582  LLTVDLDSGKVINVYDTHSPIPIPKAQGTDYRRDGIEHRAPGVEPLKPISMEQPNGQSFR  1403
                VD+D  +V+ + D    IP+     TDYR   I+     +  L PIS+EQP G SF 
Sbjct  249   TALVDMDRKEVLAISDNGQNIPVANGINTDYRY-SIQKLNGELRLLNPISLEQPKGPSFT  307

Query  1402  VEDGYIVKWASWEFHVKADQRAGIIISQATVFDPEAGKRRSVMYKGFASELFVPYMDVDE  1223
             +E G++VKWA+WEFH++ D RAG IISQA V DP+  K RSVMYKGF SELFVPYMD  E
Sbjct  308   IE-GHLVKWANWEFHLRPDPRAGTIISQAKVRDPDTSKLRSVMYKGFTSELFVPYMDPTE  366

Query  1222  GWYFRAFMDAGEFGLGATAMELVPLNDCPRHSHYIDGLFVDPDGRPVSQPNVICVFERYS  1043
             GWYF+ +MDAGE+G G  AM L PLNDCPR+++Y+DG+F   DG P  QPN+IC+FE Y+
Sbjct  367   GWYFKTYMDAGEYGFGLQAMPLDPLNDCPRNAYYMDGVFASSDGTPYLQPNMICIFESYA  426

Query  1042  GDIAWRHSGTGDADDDLIREARPKVSLVVRTTATVGNYDYIFDWEFQTDGSIRVTVGLSG  863
             GDIAWRH+     D   + E RPKV+LVVR  A V NYDYI DWEFQTDG IR  VGLSG
Sbjct  427   GDIAWRHAECPITDLK-VTEVRPKVTLVVRMAAAVANYDYIVDWEFQTDGLIRAKVGLSG  485

Query  862   IILAKGSPYEHINQFEIPRWDFPAGSLVSENTIGVAHDHFITFHLDMDVDGPTNSFVKVD  683
             I++ KG+  E+++Q  +P  ++  G+L+SEN IGV HDHFIT++LDMDVDG  NSFVKV+
Sbjct  486   ILMVKGTTNENMDQ--VPNQEYLYGTLLSENIIGVIHDHFITYYLDMDVDGSDNSFVKVN  543

Query  682   LVKNYNIAGKIQRKSYWSPKRKVAKSENDAKIKLQLDKPSEFHVINPRHQSRLGNPSGYK  503
             + K     G+  RKSY    +KVAK+E DA+I+LQL +PSEFHV+NP  ++R+GNP GYK
Sbjct  544   IKKQETSRGESPRKSYLKAVKKVAKTEKDAQIRLQLYEPSEFHVVNPLKKTRVGNPVGYK  603

Query  502   IVPSATAASLLDLQDPPQLRAAFTNNQIWVTPYNRSEQWAGGLFTYQSHGDDTLAVWSNR  323
             +VP ATAASLLD +DPPQ RAAFTNNQ+WVTPYN+SEQWAGGLF YQS GDDTL VWSNR
Sbjct  604   LVPGATAASLLDPEDPPQKRAAFTNNQLWVTPYNKSEQWAGGLFVYQSKGDDTLQVWSNR  663

Query  322   NRVIEKQDIVLWYTLGFHHLPCQEDFPVMPTVTSTFQLKPVNFFDRNPIIQANPNFAEDL  143
             +R IE +DIVLWYT+GFHH+PCQED+P+MPTV+S+F LKP NFF+RNPI+   PNF +DL
Sbjct  664   DRPIENKDIVLWYTIGFHHIPCQEDYPIMPTVSSSFDLKPANFFERNPILGVPPNFEDDL  723

Query  142   PICRA  128
             P+C+A
Sbjct  724   PVCKA  728



>ref|XP_007039969.1| Copper amine oxidase family protein [Theobroma cacao]
 gb|EOY24470.1| Copper amine oxidase family protein [Theobroma cacao]
Length=734

 Score =   791 bits (2042),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 375/659 (57%), Positives = 485/659 (74%), Gaps = 5/659 (1%)
 Frame = -1

Query  2104  HFADRPMHPLDPLTIQEIERTRSILSSYQPFSGS-SLRIHSLSLDEPDKSEVLRWKRGNP  1928
             H +  P HPLDPLTIQE  + R+ILSS+  F  S +  +HS+ L+EPDK  VLRW +G P
Sbjct  75    HESAVPRHPLDPLTIQEFNKVRTILSSHPLFKSSKNYALHSVVLEEPDKDLVLRWTKGQP  134

Query  1927  LPTRKAFVVALSNGQAHLLVVDLGSGRVSSHTRNPASGYPPMSADDASTALEATFSNSVF  1748
             L  R A V+A +NG++H+L V+L +  V+     P +GYP M+ +D ++A  A  SN  F
Sbjct  135   LFPRIASVIARANGESHVLTVNLETNEVNVLNTAPPTGYPMMTMEDMTSATWAPLSNPKF  194

Query  1747  REAISTRGVEINDVVCSAAAPGWFGPEEEGRRITKVKCYTAQNTPNYYMRPIEGLLLTVD  1568
                I  +GV ++DV C   + GWFG  EE RR+ KV+CY+ ++T N+YMRPIEGL + +D
Sbjct  195   NRTIIEQGVNLDDVACLPISLGWFGENEENRRLIKVQCYSMKDTANFYMRPIEGLTVLLD  254

Query  1567  LDSGKVINVYDTHSPIPIPKAQGTDYRRDGIEHRAPGVEPLKPISMEQPNGQSFRVEDGY  1388
             LD+ +V+ + DT   IP+PKA  TDYR    +     +  + PIS+EQP G SF +ED +
Sbjct  255   LDTKEVVEISDTGRAIPVPKATNTDYRYSE-QKMQQELNLINPISIEQPKGPSFVIEDEH  313

Query  1387  IVKWASWEFHVKADQRAGIIISQATVFDPEAGKRRSVMYKGFASELFVPYMDVDEGWYFR  1208
             +VKWA+WEFH+KAD RAG+++S A V+DP++G  R VMYKGF SELFVPYMD  + WYF+
Sbjct  314   LVKWANWEFHLKADPRAGVVVSGAKVWDPDSGVMRDVMYKGFTSELFVPYMDPTDAWYFK  373

Query  1207  AFMDAGEFGLGATAMELVPLNDCPRHSHYIDGLFVDPDGRPVSQPNVICVFERYSGDIAW  1028
              +MDAGE+G G  AM L PLNDCPR+++Y+DG+F   DG P  + N+ICVFE Y+GDI W
Sbjct  374   TYMDAGEYGFGLQAMPLDPLNDCPRNAYYMDGVFAAGDGVPYVRSNMICVFESYTGDIGW  433

Query  1027  RHSGTGDADDDLIREARPKVSLVVRTTATVGNYDYIFDWEFQTDGSIRVTVGLSGIILAK  848
             RHS +     + I+E RPKV+LVVR  A+V NYDYI DWEFQTDG IR+ VGLSGI++ K
Sbjct  434   RHSESPITGME-IKEVRPKVTLVVRMAASVANYDYILDWEFQTDGLIRIKVGLSGILMVK  492

Query  847   GSPYEHINQFEIPRWDFPAGSLVSENTIGVAHDHFITFHLDMDVDGPTNSFVKVDLVKNY  668
             G+ YE++ Q E     F  G+L+SEN IGV HDH+ITF+LDMD+DG  NSFVKV++ K  
Sbjct  493   GTTYENMKQVEGQEHLF--GTLLSENVIGVIHDHYITFYLDMDIDGSDNSFVKVNIKKQD  550

Query  667   NIAGKIQRKSYWSPKRKVAKSENDAKIKLQLDKPSEFHVINPRHQSRLGNPSGYKIVPSA  488
                G+  RKSY    R VAK+E DA+++L+L  PSEFHVINP  ++R+GNP GYK+VP  
Sbjct  551   TSPGESPRKSYLKAVRNVAKTEKDAQVQLKLYDPSEFHVINPTKKTRVGNPVGYKVVPGG  610

Query  487   TAASLLDLQDPPQLRAAFTNNQIWVTPYNRSEQWAGGLFTYQSHGDDTLAVWSNRNRVIE  308
             TAASLLD +DPPQ R AFTNNQIWVTPYN+SEQWAGGLF YQS G+DTLAVWS+R+R IE
Sbjct  611   TAASLLDHEDPPQRRGAFTNNQIWVTPYNKSEQWAGGLFVYQSQGEDTLAVWSDRDRSIE  670

Query  307   KQDIVLWYTLGFHHLPCQEDFPVMPTVTSTFQLKPVNFFDRNPIIQANPNFAEDLPICR  131
              +DIVLWYTLGFHH+PCQEDFP+MPTV+S+F LKPVNFF+ NPI++  PN  +DLP+C+
Sbjct  671   NKDIVLWYTLGFHHIPCQEDFPIMPTVSSSFDLKPVNFFESNPILRIPPNVEKDLPVCK  729



>emb|CAB45976.1| copper amine oxidase-like protein [Arabidopsis thaliana]
 emb|CAB78272.1| copper amine oxidase-like protein [Arabidopsis thaliana]
Length=756

 Score =   791 bits (2043),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 379/668 (57%), Positives = 484/668 (72%), Gaps = 13/668 (2%)
 Frame = -1

Query  2113  QNNHFADRPMHPLDPLTIQEIERTRSILSSYQPF-SGSSLRIHSLSLDEPDKSEVLRWKR  1937
              ++H +D P HPLDPLT+ EI + RSILSS+  F SG+   +H++ L+EP+K+ V  W++
Sbjct  87    NHDHVSDTPNHPLDPLTVSEINKIRSILSSHALFTSGTPHALHTVVLEEPEKNLVRHWEK  146

Query  1936  GNPLPTRKAFVVALSNGQAHLLVVDLGSGRV-SSHTRNPASGYPPMSADDASTALEATFS  1760
             GNPLP RKA V+A      H+L VD+ +GRV S ++    SGYP M+ ++ +      FS
Sbjct  147   GNPLPPRKASVIARVGADTHVLTVDISTGRVDSENSPVRVSGYPMMTIEEMNDITVVPFS  206

Query  1759  NSVFREAISTRGVEINDVVCSAAAPGWFGPEEEGRRITKVKCYTAQNTPNYYMRPIEGLL  1580
             N+ F   I +RGV + DV+C   + GWFG +EE  R+ K +C+  Q TPN+YMRPIEGL 
Sbjct  207   NADFNRTIISRGVNLTDVICFPISCGWFGNKEENARVIKSQCFMTQGTPNFYMRPIEGLT  266

Query  1579  LTVDLDSGKVINVYDTHSPIPIPKAQGTDYRRDGIEHRAPGVEPLKPISMEQPNGQSFRV  1400
             + +DLD+ +VI + DT   IPIP +  TDYR   +        PL PIS+EQP G SF +
Sbjct  267   ILIDLDTKQVIEITDTGRAIPIPGSTNTDYRFQKLA-TTDKTRPLNPISIEQPRGPSFVI  325

Query  1399  EDGYIVKWASWEFHVKADQRAGIIISQATVFDPEAGKRRSVMYKGFASELFVPYMDVDEG  1220
             ED ++VKWA+WEFH+K D RAG++IS+  V DP+  + R VMYKGF SELFVPYMD  + 
Sbjct  326   EDNHLVKWANWEFHLKPDPRAGVVISRVRVHDPDTHETRDVMYKGFVSELFVPYMDPSDA  385

Query  1219  WYFRAFMDAGEFGLGATAMELVPLNDCPRHSHYIDGLFVDPDGRPVSQPNVICVFERYSG  1040
             WYF+ +MDAGE+G G  AM LVPLNDCPR++ Y+DG+F   DG P  + N++C+FE Y+G
Sbjct  386   WYFKTYMDAGEYGFGLQAMPLVPLNDCPRNAAYMDGVFAAADGTPFVRENMVCIFESYAG  445

Query  1039  DIAWRHSG---TGDADDDLIREARPKVSLVVRTTATVGNYDYIFDWEFQTDGSIRVTVGL  869
             DI WRHS    TG      IRE RPKV+LVVR  A+VGNYDYI D+EFQTDG I+  VGL
Sbjct  446   DIGWRHSESPITGIP----IREVRPKVTLVVRMAASVGNYDYIIDYEFQTDGLIKAKVGL  501

Query  868   SGIILAKGSPYEHINQFEIPR---WDFPAGSLVSENTIGVAHDHFITFHLDMDVDGPTNS  698
             SGI++ KG+ Y++ NQ E  +    +   G+L+SEN IGV HDH++TF+LD+DVDGP NS
Sbjct  502   SGILMVKGTTYQNKNQVEKDKDGNEEELHGTLLSENVIGVIHDHYVTFYLDLDVDGPDNS  561

Query  697   FVKVDLVKNYNIAGKIQRKSYWSPKRKVAKSENDAKIKLQLDKPSEFHVINPRHQSRLGN  518
             FVKV+L +     G+  RKSY    R +AK+E D +IKL L  PSEFHVIN    +R+GN
Sbjct  562   FVKVNLKRQETEPGESPRKSYLKAVRNIAKTEKDGQIKLSLYDPSEFHVINSGKTTRVGN  621

Query  517   PSGYKIVPSATAASLLDLQDPPQLRAAFTNNQIWVTPYNRSEQWAGGLFTYQSHGDDTLA  338
             P+GYK+VP  TAASLLD  DPPQ R AFTNNQIWVTPYN+SEQWAGGLFTYQSHGDDTLA
Sbjct  622   PTGYKVVPRTTAASLLDHDDPPQKRGAFTNNQIWVTPYNKSEQWAGGLFTYQSHGDDTLA  681

Query  337   VWSNRNRVIEKQDIVLWYTLGFHHLPCQEDFPVMPTVTSTFQLKPVNFFDRNPIIQANPN  158
             VWS+R+R IE +DIV+WYTLGFHH+PCQEDFP+MPTV+S+F LKPVNFF+RNPI+ A PN
Sbjct  682   VWSDRDRDIENKDIVVWYTLGFHHIPCQEDFPIMPTVSSSFDLKPVNFFERNPILSAAPN  741

Query  157   FAEDLPIC  134
             F  DLP+C
Sbjct  742   FEHDLPVC  749



>ref|XP_002299418.2| hypothetical protein POPTR_0001s07870g [Populus trichocarpa]
 gb|EEE84223.2| hypothetical protein POPTR_0001s07870g [Populus trichocarpa]
Length=738

 Score =   790 bits (2040),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 376/662 (57%), Positives = 486/662 (73%), Gaps = 5/662 (1%)
 Frame = -1

Query  2113  QNNHFADRPMHPLDPLTIQEIERTRSILSSYQPFSGSS-LRIHSLSLDEPDKSEVLRWKR  1937
              +NH +D P HPLDPLTI EI + R+IL S+  F  SS    HS+ L+EPDK+ VL+WK+
Sbjct  76    HHNHESDTPHHPLDPLTISEINKVRTILKSHTLFKSSSPCAFHSIVLEEPDKTLVLKWKK  135

Query  1936  GNPLPTRKAFVVALSNGQAHLLVVDLGSGRVSSHTRNPASGYPPMSADDASTALEATFSN  1757
             G+ +  RKA VVA   G++H+L VD+ SG V+       SGYP M+ +D +++  A  SN
Sbjct  136   GDSMLPRKAAVVARVAGKSHVLTVDISSGEVAVQETGSRSGYPTMTIEDMTSSTWAPLSN  195

Query  1756  SVFREAISTRGVEINDVVCSAAAPGWFGPEEEGRRITKVKCYTAQNTPNYYMRPIEGLLL  1577
             + F   I  RGV++ D+ C   + GWFG  EE RR+ KV+CY+ + T N+YMRPIEGL +
Sbjct  196   ADFNRTIIERGVDLQDLACLPISLGWFGENEENRRLIKVQCYSMKGTANFYMRPIEGLTV  255

Query  1576  TVDLDSGKVINVYDTHSPIPIPKAQGTDYRRDGIEHRAPGVEPLKPISMEQPNGQSFRVE  1397
              +D+DS +V+ + D    IPIPKA  TDYR   ++   P +  + PIS+EQP G SF VE
Sbjct  256   LLDMDSKEVVEISDKGRDIPIPKAANTDYRY-SVQEINPEMMFVNPISIEQPKGPSFTVE  314

Query  1396  DGYIVKWASWEFHVKADQRAGIIISQATVFDPEAGKRRSVMYKGFASELFVPYMDVDEGW  1217
             D ++VKWA+WEFH+K D RAG+IIS+A V DP++G+ R+VMYKG+ SELFVPYMD  + W
Sbjct  315   DEHLVKWANWEFHLKPDPRAGVIISRAKVRDPDSGEMRNVMYKGYTSELFVPYMDPTDAW  374

Query  1216  YFRAFMDAGEFGLGATAMELVPLNDCPRHSHYIDGLFVDPDGRPVSQPNVICVFERYSGD  1037
             YF+ +MDAGE+G G  AM L PLNDCPR+++Y+DG+F   DG P  + +++CVFE Y+GD
Sbjct  375   YFKTYMDAGEYGFGLQAMPLDPLNDCPRNAYYMDGVFAAGDGTPYVRSHMVCVFESYAGD  434

Query  1036  IAWRHSGTGDADDDLIREARPKVSLVVRTTATVGNYDYIFDWEFQTDGSIRVTVGLSGII  857
             I WRHS +     + IRE RPKV+LVVR  A+V NYDYI DWEFQTDG IR+ VGLSGI+
Sbjct  435   IGWRHSESPITGME-IREVRPKVTLVVRMAASVANYDYIVDWEFQTDGLIRIKVGLSGIL  493

Query  856   LAKGSPYEHINQFEIPRWDFPAGSLVSENTIGVAHDHFITFHLDMDVDGPTNSFVKVDLV  677
             + KG+ Y + NQ  +P      G+L+SEN IGV HDH+ITF+LDMD+DG  NSFVKV++ 
Sbjct  494   MVKGTSYVNTNQ--VPGQQNLYGTLLSENVIGVIHDHYITFYLDMDIDGSDNSFVKVNIQ  551

Query  676   KNYNIAGKIQRKSYWSPKRKVAKSENDAKIKLQLDKPSEFHVINPRHQSRLGNPSGYKIV  497
             K     G+  R+SY    R VAK+E DA+I+L+L  PSEFHV+NP  ++R+GNP GYK+V
Sbjct  552   KQRTSPGESPRRSYLKAIRNVAKTEKDAQIQLKLYDPSEFHVVNPMKRTRVGNPVGYKLV  611

Query  496   PSATAASLLDLQDPPQLRAAFTNNQIWVTPYNRSEQWAGGLFTYQSHGDDTLAVWSNRNR  317
             P  TAASLLD  DPPQ R AFTNNQIWVTPYN+SEQWAGGLF YQS G+DTLAVWS R+R
Sbjct  612   PGGTAASLLDHDDPPQKRGAFTNNQIWVTPYNQSEQWAGGLFVYQSQGEDTLAVWSERDR  671

Query  316   VIEKQDIVLWYTLGFHHLPCQEDFPVMPTVTSTFQLKPVNFFDRNPIIQANPNFAEDLPI  137
              IE +DIVLWYTLGFHH+PCQEDFP+MPTV+S+F LKPVNFF+ NPI++  PN  +DLP+
Sbjct  672   PIENKDIVLWYTLGFHHVPCQEDFPIMPTVSSSFDLKPVNFFESNPILRIPPNVEKDLPV  731

Query  136   CR  131
             C+
Sbjct  732   CK  733



>ref|XP_006440400.1| hypothetical protein CICLE_v10019032mg [Citrus clementina]
 gb|ESR53640.1| hypothetical protein CICLE_v10019032mg [Citrus clementina]
Length=731

 Score =   790 bits (2039),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 374/671 (56%), Positives = 490/671 (73%), Gaps = 18/671 (3%)
 Frame = -1

Query  2113  QNNHFADRPMHPLDPLTIQEIERTRSILSSYQPFSGS-SLRIHSLSLDEPDKSEVLRWKR  1937
              ++H +D P HPLDPLT++EI R R+IL+S++ F  S     HS++L EP KS VL W +
Sbjct  68    HHDHASDTPHHPLDPLTVKEINRVRTILTSHELFKNSFPYAFHSITLQEPKKSLVLNWNK  127

Query  1936  GNPLPTRKAFVVALSNGQAHLLVVDLGSGRVSSHTRNPASGYPPMSADDASTALEATFSN  1757
             G+ L  RKA VVA     +++L VDL +  V+ H  + +SGYP M+ +D +++  A  ++
Sbjct  128   GDSLLPRKASVVARVKNISYVLAVDLTTEEVTVHETDSSSGYPAMTIEDMTSSTWAPLAD  187

Query  1756  SVFREAISTRGVEINDVVCSAAAPGWFGPEEEGRRITKVKCYTAQNTPNYYMRPIEGLLL  1577
               F   I  RGV++ D+ C   + GW+G +EE RR+ KV+CY+ ++T N+YMRPIEGL +
Sbjct  188   EEFNRTILERGVDLKDLACLPISLGWYGEKEENRRLIKVQCYSMKDTANFYMRPIEGLTI  247

Query  1576  TVDLDSGKVINVYDTHSPIPIPKAQGTDYR--RDGIEHRAPGVEPLKPISMEQPNGQSFR  1403
              +D+D+ +V+ + D    IPIPKA  TDYR    G+  R   ++ + PIS+EQP G SF 
Sbjct  248   LLDMDTKEVLEITDKGKNIPIPKAVNTDYRYSAQGLHQR---MKLINPISLEQPEGPSFV  304

Query  1402  VEDGYIVKWASWEFHVKADQRAGIIISQATVFDPEAGKRRSVMYKGFASELFVPYMDVDE  1223
             +ED ++VKWA+WEFH+K D RAG I+SQA V DP++G+ R+VMYKGF SELFVPYMD  +
Sbjct  305   IEDEHLVKWANWEFHLKPDPRAGAIVSQARVRDPDSGEIRNVMYKGFTSELFVPYMDPTD  364

Query  1222  GWYFRAFMDAGEFGLGATAMELVPLNDCPRHSHYIDGLFVDPDGRPVSQPNVICVFERYS  1043
              WYF+ +MDAGE+G G  AM L PLNDCPR++HY+DG+F   DGRP  + N+IC+FE Y+
Sbjct  365   AWYFKTYMDAGEYGFGLQAMPLDPLNDCPRNAHYMDGVFPAADGRPYVRSNMICIFESYA  424

Query  1042  GDIAWRH-----SGTGDADDDLIREARPKVSLVVRTTATVGNYDYIFDWEFQTDGSIRVT  878
             GDI WRH     +G G      I+E RPKV+LVVR  A+V NYDYI DWEFQTDG IR+ 
Sbjct  425   GDIGWRHAESPITGMG------IKEVRPKVTLVVRMAASVANYDYIVDWEFQTDGLIRIK  478

Query  877   VGLSGIILAKGSPYEHINQFEIPRWDFPAGSLVSENTIGVAHDHFITFHLDMDVDGPTNS  698
             VGLSGI++ KG+ YE++NQ      +   G+L+SEN IGV HDHFITF+LDMD+DG  NS
Sbjct  479   VGLSGILMVKGTAYENMNQISNQAENL-FGTLLSENVIGVIHDHFITFYLDMDIDGSDNS  537

Query  697   FVKVDLVKNYNIAGKIQRKSYWSPKRKVAKSENDAKIKLQLDKPSEFHVINPRHQSRLGN  518
             FVKV++ +     G+  R+SY    R VAK+E DA+IKL+L  P+EFHVINP  ++R+GN
Sbjct  538   FVKVNIKRQETSPGESPRRSYLKAVRNVAKTEKDAQIKLKLYDPAEFHVINPTKKTRVGN  597

Query  517   PSGYKIVPSATAASLLDLQDPPQLRAAFTNNQIWVTPYNRSEQWAGGLFTYQSHGDDTLA  338
             P GYK+VP  TAASLLD +DPPQ R AFTNNQIWVTPYN SEQWAGGLF YQS G+DTLA
Sbjct  598   PVGYKVVPGGTAASLLDREDPPQKRGAFTNNQIWVTPYNESEQWAGGLFVYQSKGEDTLA  657

Query  337   VWSNRNRVIEKQDIVLWYTLGFHHLPCQEDFPVMPTVTSTFQLKPVNFFDRNPIIQANPN  158
             VWS+R+R IE +DIVLWYTLGFHH+PCQEDFP+MPTV+S+F LKPVNFF+ NPI++  PN
Sbjct  658   VWSDRDRSIENKDIVLWYTLGFHHIPCQEDFPIMPTVSSSFDLKPVNFFESNPILRIPPN  717

Query  157   FAEDLPICRAG  125
               +DLP+C+A 
Sbjct  718   VEKDLPVCKAA  728



>gb|KFK31964.1| hypothetical protein AALP_AA6G182600 [Arabis alpina]
Length=747

 Score =   789 bits (2038),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 384/671 (57%), Positives = 483/671 (72%), Gaps = 16/671 (2%)
 Frame = -1

Query  2110  NNHFADRPMHPLDPLTIQEIERTRSILSSYQPFSGSSLR-IHSLSLDEPDKSEVLRWKRG  1934
             ++H +D P HPLDPLTI E+ + RSILSS+  F+  +   +HS+ L+EPDK  V +W++G
Sbjct  78    HDHVSDTPNHPLDPLTITELNKVRSILSSHALFASRAPHALHSVVLEEPDKDLVKKWEKG  137

Query  1933  NPLPTRKAFVVALSNGQAHLLVVDLGSGRVS---SHTRNPASGYPPMSADDASTALEATF  1763
             N LP RKA V+AL     H+L VD+ SGRV    S  R   SGYP M+ ++ +    A F
Sbjct  138   NTLPPRKASVIALVGLDTHVLTVDITSGRVELEDSPVR--VSGYPMMTLEEMNQVTLAPF  195

Query  1762  SNSVFREAISTRGVEINDVVCSAAAPGWFGPEEEGRRITKVKCYTAQNTPNYYMRPIEGL  1583
             SN  F   I +RGV I +V C   + GW+G +EE  R+ K +CY+ Q T N+YMRPIEGL
Sbjct  196   SNDDFNRTIISRGVNITEVNCFPLSSGWYGKKEENIRVIKSQCYSNQGTVNFYMRPIEGL  255

Query  1582  LLTVDLDSGKVINVYDTHSPIPIPKAQGTDYRRDGIEHRAPGVEPLKPISMEQPNGQSFR  1403
              + +DLD+ +VI + DT   IPIP +  TDYR + +  +     PL PIS+EQP G SF 
Sbjct  256   TILIDLDTKQVIEIVDTGPAIPIPGSTNTDYRFENLATKPDKTRPLNPISLEQPRGPSFV  315

Query  1402  VEDGYIVKWASWEFHVKADQRAGIIISQATVFDPEAGKRRSVMYKGFASELFVPYMDVDE  1223
             +ED Y+VKWA+WEFH+K D RAG+I+SQ  V DP+  + R VMYKGF SELFVPYMD  +
Sbjct  316   IEDNYLVKWANWEFHLKPDPRAGVILSQVRVHDPDTRETRDVMYKGFVSELFVPYMDPSD  375

Query  1222  GWYFRAFMDAGEFGLGATAMELVPLNDCPRHSHYIDGLFVDPDGRPVSQPNVICVFERYS  1043
              WYF+ +MDAGE+G G  AM LVPLNDCPR++ Y+DG+F   DG P  + N+ICVFE Y+
Sbjct  376   AWYFKTYMDAGEYGFGLQAMPLVPLNDCPRNAVYMDGVFAAADGTPFVRDNMICVFESYA  435

Query  1042  GDIAWRHSG---TGDADDDLIREARPKVSLVVRTTATVGNYDYIFDWEFQTDGSIRVTVG  872
             GDI WRHS    TG      IRE RPKV+LVVR  A+VGNYDYI D+EFQTDG I+  VG
Sbjct  436   GDIGWRHSESPITGLP----IREVRPKVTLVVRMAASVGNYDYIIDYEFQTDGLIKAKVG  491

Query  871   LSGIILAKGSPYEHINQFEIPR---WDFPAGSLVSENTIGVAHDHFITFHLDMDVDGPTN  701
             LSGI++ KG+ Y++ NQ +  +    +   G L+SEN IGV HDH++TF+LD+DVDGP N
Sbjct  492   LSGILMVKGTTYQNKNQVKKDKNGNEEELHGILLSENVIGVIHDHYVTFYLDLDVDGPEN  551

Query  700   SFVKVDLVKNYNIAGKIQRKSYWSPKRKVAKSENDAKIKLQLDKPSEFHVINPRHQSRLG  521
             SFVKV+L +     G+  RKSY    R VAK+E D +IKL L  PSEFH+IN    +R+G
Sbjct  552   SFVKVNLKRQETEPGESPRKSYMKTVRNVAKTEKDGQIKLSLYDPSEFHIINSNKTTRVG  611

Query  520   NPSGYKIVPSATAASLLDLQDPPQLRAAFTNNQIWVTPYNRSEQWAGGLFTYQSHGDDTL  341
             NP+GYK+VP ATAASLLD  DPPQ R AFTNNQIWVTPYN+SEQWAGGL TYQSHGDDTL
Sbjct  612   NPTGYKVVPRATAASLLDHDDPPQKRGAFTNNQIWVTPYNKSEQWAGGLLTYQSHGDDTL  671

Query  340   AVWSNRNRVIEKQDIVLWYTLGFHHLPCQEDFPVMPTVTSTFQLKPVNFFDRNPIIQANP  161
             AVWS+R+R IE +DIV+WYTLGFHH+PCQEDFP+MPTV+S+F LKP NFF+RNPI++A+P
Sbjct  672   AVWSDRDRDIENKDIVVWYTLGFHHVPCQEDFPIMPTVSSSFDLKPTNFFERNPILRASP  731

Query  160   NFAEDLPICRA  128
             NF  DLP C A
Sbjct  732   NFEHDLPRCGA  742



>ref|XP_006396782.1| hypothetical protein EUTSA_v10028460mg [Eutrema salsugineum]
 gb|ESQ38235.1| hypothetical protein EUTSA_v10028460mg [Eutrema salsugineum]
Length=744

 Score =   789 bits (2038),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 376/667 (56%), Positives = 484/667 (73%), Gaps = 6/667 (1%)
 Frame = -1

Query  2113  QNNHFADRPMHPLDPLTIQEIERTRSILSSYQPFSGSSLR-IHSLSLDEPDKSEVLRWKR  1937
              ++H +D+P HPLDPLT+ EI + RSILSS+  FS  +    HS+ L+EP+K+ V+ W++
Sbjct  74    NHDHSSDKPNHPLDPLTVVEINKVRSILSSHALFSSRAPHAFHSIVLEEPEKNLVISWEK  133

Query  1936  GNPLPTRKAFVVALSNGQAHLLVVDLGSGRVS-SHTRNPASGYPPMSADDASTALEATFS  1760
             GNPLP RKA V+A      H+L+VDL SGRV    T    SGYP M+ ++ +    A FS
Sbjct  134   GNPLPPRKASVIARVGPNTHVLIVDLSSGRVDLEDTPVRVSGYPMMTLEEMNEVTFAPFS  193

Query  1759  NSVFREAISTRGVEINDVVCSAAAPGWFGPEEEGRRITKVKCYTAQNTPNYYMRPIEGLL  1580
             ++     I +RGV + DV C   + GW+G +EE +R+ K +CY+ Q T N+YMRPIEGL 
Sbjct  194   SADANRTIVSRGVNLTDVSCFPLSSGWYGKKEENKRVIKSQCYSCQGTANFYMRPIEGLT  253

Query  1579  LTVDLDSGKVINVYDTHSPIPIPKAQGTDYRRDGIEHRAPGVEPLKPISMEQPNGQSFRV  1400
             + +DLD+ +VI + DT   IPIP +  T+YR   +         L PIS+EQP G SF +
Sbjct  254   ILIDLDTKQVIEIVDTGPTIPIPGSTNTEYRFQNLATTTDKTRLLNPISIEQPRGPSFVI  313

Query  1399  EDGYIVKWASWEFHVKADQRAGIIISQATVFDPEAGKRRSVMYKGFASELFVPYMDVDEG  1220
             ED ++VKWA+WEFH+K D RAG++IS+  V DP+  + R VMY+GF SELFVPYMD  + 
Sbjct  314   EDNHLVKWANWEFHLKPDPRAGVVISRVKVHDPDTQQTRDVMYRGFVSELFVPYMDPSDA  373

Query  1219  WYFRAFMDAGEFGLGATAMELVPLNDCPRHSHYIDGLFVDPDGRPVSQPNVICVFERYSG  1040
             WYF+ +MDAGE+G G  AM LVPLNDCPR++ Y+DG+F   DG P  + N++CVFERY+G
Sbjct  374   WYFKTYMDAGEYGFGLQAMPLVPLNDCPRNAAYMDGVFAAADGTPFVRENMVCVFERYAG  433

Query  1039  DIAWRHSGTGDADDDLIREARPKVSLVVRTTATVGNYDYIFDWEFQTDGSIRVTVGLSGI  860
             DI WRHS +  +    IRE RPKV+LVVR  A+VGNYDYI D+EFQTDG I+  VGLSGI
Sbjct  434   DIGWRHSESPISGLP-IREVRPKVTLVVRMAASVGNYDYIVDYEFQTDGLIKAKVGLSGI  492

Query  859   ILAKGSPYE---HINQFEIPRWDFPAGSLVSENTIGVAHDHFITFHLDMDVDGPTNSFVK  689
             ++ KG+PY+   HI + +    +   G+L+SEN IGV HDH++TF+LD+DVDG  NSFVK
Sbjct  493   LMVKGTPYQNKNHIKKDKEGNEEELHGTLLSENIIGVIHDHYVTFYLDLDVDGTDNSFVK  552

Query  688   VDLVKNYNIAGKIQRKSYWSPKRKVAKSENDAKIKLQLDKPSEFHVINPRHQSRLGNPSG  509
             V+L +     G+  RKSY    R +AK+E D +IKL +  PSEFHVIN    +R+GNP+G
Sbjct  553   VNLKRQETEPGESPRKSYMKAVRNIAKTEKDGQIKLSMYDPSEFHVINSAKTTRVGNPTG  612

Query  508   YKIVPSATAASLLDLQDPPQLRAAFTNNQIWVTPYNRSEQWAGGLFTYQSHGDDTLAVWS  329
             YKIVP ATAASLLD  DPPQ R AFTNNQIWVTPYN+SEQWAGGLFTYQSHGDDTLAVWS
Sbjct  613   YKIVPRATAASLLDHDDPPQKRGAFTNNQIWVTPYNKSEQWAGGLFTYQSHGDDTLAVWS  672

Query  328   NRNRVIEKQDIVLWYTLGFHHLPCQEDFPVMPTVTSTFQLKPVNFFDRNPIIQANPNFAE  149
             +R+R IE +DIV+WYTLGFHH+PCQEDFP+MPTV+S+F LKP NFF+RNPI++A PNF  
Sbjct  673   DRDRDIENKDIVVWYTLGFHHVPCQEDFPIMPTVSSSFDLKPTNFFERNPILKAAPNFEH  732

Query  148   DLPICRA  128
             DLP+C A
Sbjct  733   DLPVCGA  739



>gb|AIS23645.1| amine oxidase 2 [Malus domestica]
Length=727

 Score =   788 bits (2036),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 377/663 (57%), Positives = 486/663 (73%), Gaps = 6/663 (1%)
 Frame = -1

Query  2107  NHFADRPMHPLDPLTIQEIERTRSILSSYQPF-SGSSLRIHSLSLDEPDKSEVLRWKRGN  1931
             +H +D P HPLDPLTIQE+   R+IL+S+  F S SS  +HS+ L EPDKS VL WK G+
Sbjct  66    DHSSDTPHHPLDPLTIQELNAVRTILNSHALFTSTSSYALHSIELQEPDKSLVLGWKHGD  125

Query  1930  PLPTRKAFVVALSNGQAHLLVVDLGSGRVSSHTRNPASGYPPMSADDASTALEATFSNSV  1751
             PL  RKA +VA  + ++ +L VDL +  V+ H      GYP M+ ++ + A  +   N+ 
Sbjct  126   PLFPRKASIVARVDSKSLVLTVDLTTSEVTVHETGSHYGYPTMTLEELAAATFSPLKNAD  185

Query  1750  FREAISTRGVEINDVVCSAAAPGWFGPEEEGRRITKVKCYTAQNTPNYYMRPIEGLLLTV  1571
             F   I  RGV++ D+ C   + GW+G  +E RR+ KV+CY+ ++T N+YMRPIE L + V
Sbjct  186   FNRTIVERGVDLADLGCLPLSTGWYGGADENRRLIKVQCYSTKDTVNFYMRPIERLTVLV  245

Query  1570  DLDSGKVINVYDTHSPIPIPKAQGTDYRRDGIEHRAPGVEPL-KPISMEQPNGQSFRVED  1394
             DLD+ +V+ + D    IPIPKA  TDYR      R   V+ L KPIS+EQP+G SF VE+
Sbjct  246   DLDTQQVVEISDKGRGIPIPKAANTDYRYSA--QRPNQVKKLIKPISIEQPDGPSFTVEN  303

Query  1393  GYIVKWASWEFHVKADQRAGIIISQATVFDPEAGKRRSVMYKGFASELFVPYMDVDEGWY  1214
              ++VKWA+WEFH+K D RAG+I+S+A V+DPE G+ R VMYKGF SELFVPYMD  + WY
Sbjct  304   DHLVKWANWEFHLKPDARAGVIVSRAKVWDPETGELRDVMYKGFTSELFVPYMDPTDAWY  363

Query  1213  FRAFMDAGEFGLGATAMELVPLNDCPRHSHYIDGLFVDPDGRPVSQPNVICVFERYSGDI  1034
             F+ +MDAGE+G G  AM L PLNDCPR+++Y+DG+F   DG+P  + N++C+FERY+GDI
Sbjct  364   FKTYMDAGEYGFGLQAMPLEPLNDCPRNAYYMDGVFAAADGKPYVRSNMVCIFERYTGDI  423

Query  1033  AWRHSGTGDADDDLIREARPKVSLVVRTTATVGNYDYIFDWEFQTDGSIRVTVGLSGIIL  854
              WRH+       + +RE RPKV+LVVR  A+V NYDYI DWEFQTDG IRV VGLSGI++
Sbjct  424   GWRHTECPITGME-VREVRPKVTLVVRMAASVANYDYIVDWEFQTDGLIRVKVGLSGILM  482

Query  853   AKGSPYEHINQFEIPRWDFPAGSLVSENTIGVAHDHFITFHLDMDVDGPTNSFVKVDLVK  674
              KG+ YE++NQ    + +   G+L+SEN IGV HDH++TFHLDMDVDG  NSF+KV+L +
Sbjct  483   VKGTSYENMNQVSSSQENL-YGTLLSENVIGVIHDHYVTFHLDMDVDGSDNSFMKVNLQR  541

Query  673   NYNIAGKIQRKSYWSPKRKVAKSENDAKIKLQLDKPSEFHVINPRHQSRLGNPSGYKIVP  494
               N   +  RKSY    + VAK+E DA+IKL+L  PSEFHVINP  ++R+GNP GYK+VP
Sbjct  542   QSNSPTESPRKSYLKATKTVAKTEKDAQIKLKLYDPSEFHVINPSKKTRVGNPVGYKLVP  601

Query  493   SATAASLLDLQDPPQLRAAFTNNQIWVTPYNRSEQWAGGLFTYQSHGDDTLAVWSNRNRV  314
               TAASLLDL DPPQ R AFTNNQIWVTPYN+SEQWAGGLF  QS G+DTLAVWSNR+R 
Sbjct  602   GGTAASLLDLDDPPQKRGAFTNNQIWVTPYNKSEQWAGGLFVDQSTGEDTLAVWSNRDRP  661

Query  313   IEKQDIVLWYTLGFHHLPCQEDFPVMPTVTSTFQLKPVNFFDRNPIIQANPNFAEDLPIC  134
             IE +DIV+WYTLGFHH+PCQEDFP+MPTV+S+F +KPVNFF+ NPI++  PN A DLP+C
Sbjct  662   IENKDIVVWYTLGFHHIPCQEDFPIMPTVSSSFDIKPVNFFESNPILRTPPNVATDLPVC  721

Query  133   RAG  125
              A 
Sbjct  722   TAA  724



>ref|XP_006477269.1| PREDICTED: primary amine oxidase-like [Citrus sinensis]
Length=731

 Score =   787 bits (2033),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 373/671 (56%), Positives = 489/671 (73%), Gaps = 18/671 (3%)
 Frame = -1

Query  2113  QNNHFADRPMHPLDPLTIQEIERTRSILSSYQPFSGS-SLRIHSLSLDEPDKSEVLRWKR  1937
              ++H +D P HPLDPLT++EI R R+IL+S++ F  S     HS++L EP KS VL W +
Sbjct  68    HHDHASDTPHHPLDPLTVKEINRVRTILTSHELFKNSFPYAFHSITLQEPKKSLVLNWNK  127

Query  1936  GNPLPTRKAFVVALSNGQAHLLVVDLGSGRVSSHTRNPASGYPPMSADDASTALEATFSN  1757
             G+ L  RKA VVA     +++L VDL +  V+ H  + +SGYP M+ +D +++  A  ++
Sbjct  128   GDSLLPRKASVVARVQNISYVLAVDLTTEEVTVHETDSSSGYPAMTIEDMTSSTWAPLAD  187

Query  1756  SVFREAISTRGVEINDVVCSAAAPGWFGPEEEGRRITKVKCYTAQNTPNYYMRPIEGLLL  1577
               F   I  RGV++ D+ C   + GW+G +EE RR+ KV+CY+ ++T N+YMRPIEGL +
Sbjct  188   EEFNRTILERGVDLKDLACLPISLGWYGEKEENRRLIKVQCYSMKDTANFYMRPIEGLTI  247

Query  1576  TVDLDSGKVINVYDTHSPIPIPKAQGTDYR--RDGIEHRAPGVEPLKPISMEQPNGQSFR  1403
              +D+D+ +V+ + D    IPIPKA  TDYR    G+  R   ++ + PIS+EQP G SF 
Sbjct  248   LLDMDTKEVLEITDKGKNIPIPKAVNTDYRYSAQGLHQR---MKLINPISLEQPEGPSFV  304

Query  1402  VEDGYIVKWASWEFHVKADQRAGIIISQATVFDPEAGKRRSVMYKGFASELFVPYMDVDE  1223
             +ED ++VKWA+WEFH+K D RAG I+SQA V DP++G+ R+VMYKGF SELFVPYMD  +
Sbjct  305   IEDEHLVKWANWEFHLKPDPRAGAIVSQARVRDPDSGEIRNVMYKGFTSELFVPYMDPTD  364

Query  1222  GWYFRAFMDAGEFGLGATAMELVPLNDCPRHSHYIDGLFVDPDGRPVSQPNVICVFERYS  1043
              WYF+ +MDAGE+G G  AM L PLNDCPR++HY+DG+F   DG P  + N+IC+FE Y+
Sbjct  365   AWYFKTYMDAGEYGFGLQAMPLDPLNDCPRNAHYMDGVFPAADGTPYVRSNMICIFESYA  424

Query  1042  GDIAWRH-----SGTGDADDDLIREARPKVSLVVRTTATVGNYDYIFDWEFQTDGSIRVT  878
             GDI WRH     +G G      I+E RPKV+LVVR  A+V NYDYI DWEFQTDG IR+ 
Sbjct  425   GDIGWRHAESPITGMG------IKEVRPKVTLVVRMAASVANYDYIVDWEFQTDGLIRIK  478

Query  877   VGLSGIILAKGSPYEHINQFEIPRWDFPAGSLVSENTIGVAHDHFITFHLDMDVDGPTNS  698
             VGLSGI++ KG+ YE++NQ      +   G+L+SEN IGV HDHFITF+LDMD+DG  NS
Sbjct  479   VGLSGILMVKGTAYENMNQISNQAENL-FGTLLSENVIGVIHDHFITFYLDMDIDGSDNS  537

Query  697   FVKVDLVKNYNIAGKIQRKSYWSPKRKVAKSENDAKIKLQLDKPSEFHVINPRHQSRLGN  518
             FVKV++ +     G+  R+SY    R VAK+E DA+IKL+L  P+EFHVINP  ++R+GN
Sbjct  538   FVKVNIKRQETSPGESPRRSYLKADRNVAKTEKDAQIKLKLYDPAEFHVINPTKKTRVGN  597

Query  517   PSGYKIVPSATAASLLDLQDPPQLRAAFTNNQIWVTPYNRSEQWAGGLFTYQSHGDDTLA  338
             P GYK+VP  TAASLLD +DPPQ R AFTNNQIWVTPYN SEQWAGGLF YQS G+DTLA
Sbjct  598   PVGYKVVPGGTAASLLDREDPPQKRGAFTNNQIWVTPYNESEQWAGGLFVYQSKGEDTLA  657

Query  337   VWSNRNRVIEKQDIVLWYTLGFHHLPCQEDFPVMPTVTSTFQLKPVNFFDRNPIIQANPN  158
             VWS+R+R IE +DIVLWYTLGFHH+PCQEDFP+MPTV+S+F LKPVNFF+ NPI++  PN
Sbjct  658   VWSDRDRSIENKDIVLWYTLGFHHIPCQEDFPIMPTVSSSFDLKPVNFFESNPILRIPPN  717

Query  157   FAEDLPICRAG  125
               +DLP+C+A 
Sbjct  718   VEKDLPVCKAA  728



>ref|XP_009368853.1| PREDICTED: primary amine oxidase-like [Pyrus x bretschneideri]
Length=727

 Score =   787 bits (2032),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 379/690 (55%), Positives = 498/690 (72%), Gaps = 7/690 (1%)
 Frame = -1

Query  2188  CLSFESSNASINNLESLLGIHDFKIQNNHFADRPMHPLDPLTIQEIERTRSILSSYQPF-  2012
             C +  +  +S N ++S   I   ++++ H +D P HPLDPLTIQE+   R+IL+S++ F 
Sbjct  40    CTTNSAWCSSKNRIQSKPPIPTRRLKD-HSSDTPHHPLDPLTIQELNAVRTILNSHELFT  98

Query  2011  SGSSLRIHSLSLDEPDKSEVLRWKRGNPLPTRKAFVVALSNGQAHLLVVDLGSGRVSSHT  1832
             S SS  +HS+ L EPDKS VL WK G+PL  RKA +VA  + ++ +L VDL +  V+ H 
Sbjct  99    STSSYALHSVELQEPDKSLVLGWKHGDPLFPRKASIVARVDSKSLVLTVDLTTSEVTVHE  158

Query  1831  RNPASGYPPMSADDASTALEATFSNSVFREAISTRGVEINDVVCSAAAPGWFGPEEEGRR  1652
                  GYP M+ ++ + A      ++ F   I  RGV++ D+ C   + GW+G  +E RR
Sbjct  159   TGSHYGYPTMTLEELAAATFGPLKDADFNRTIVERGVDLADLRCLPLSTGWYGGADENRR  218

Query  1651  ITKVKCYTAQNTPNYYMRPIEGLLLTVDLDSGKVINVYDTHSPIPIPKAQGTDYRRDGIE  1472
             + KV+CY+ ++T N+YMRPIEGL + +DLD+ +V+ + D    IPIPKA  TDYR     
Sbjct  219   LIKVQCYSTKDTVNFYMRPIEGLTVLIDLDTKQVVEISDKGRSIPIPKAANTDYRYSA--  276

Query  1471  HRAPGVEPL-KPISMEQPNGQSFRVEDGYIVKWASWEFHVKADQRAGIIISQATVFDPEA  1295
              R   V+ L KPIS+EQP+G SF VE+ ++VKWA+WEFH+K D RAG+I+S+A V+DP+ 
Sbjct  277   QRPNQVKKLIKPISIEQPDGPSFTVENDHLVKWANWEFHLKPDARAGVIVSRAKVWDPDT  336

Query  1294  GKRRSVMYKGFASELFVPYMDVDEGWYFRAFMDAGEFGLGATAMELVPLNDCPRHSHYID  1115
             G+ R VMYKGF SELFVPYMD  + WYF+ +MDAGE+G G  AM L PLNDCPR+++Y+D
Sbjct  337   GEPRDVMYKGFTSELFVPYMDPTDAWYFKTYMDAGEYGFGLQAMPLEPLNDCPRNAYYMD  396

Query  1114  GLFVDPDGRPVSQPNVICVFERYSGDIAWRHSGTGDADDDLIREARPKVSLVVRTTATVG  935
              +F   DG+P  + N++C+FE Y+GDI WRH+       + +RE RPKV+LVVR  A+V 
Sbjct  397   AVFAAADGKPYVRSNMVCIFESYAGDIGWRHTECPITGME-VREVRPKVTLVVRMAASVA  455

Query  934   NYDYIFDWEFQTDGSIRVTVGLSGIILAKGSPYEHINQFEIPRWDFPAGSLVSENTIGVA  755
             NYDYI DWEFQTDG IRV VGLSGI++ KG+ YE++NQ    + +   G+L+SEN IGV 
Sbjct  456   NYDYIIDWEFQTDGLIRVKVGLSGILMVKGTSYENMNQVSSSQENL-YGTLLSENVIGVI  514

Query  754   HDHFITFHLDMDVDGPTNSFVKVDLVKNYNIAGKIQRKSYWSPKRKVAKSENDAKIKLQL  575
             HDH++TFHLDMDVDG  NSF+KV+L +  N   +  RKSY    + VAK+E DA+IKL+L
Sbjct  515   HDHYVTFHLDMDVDGSDNSFMKVNLQRQSNSPTESPRKSYLKATKTVAKTEKDAQIKLKL  574

Query  574   DKPSEFHVINPRHQSRLGNPSGYKIVPSATAASLLDLQDPPQLRAAFTNNQIWVTPYNRS  395
               PSEFHVINP  ++R+GNP GYK+VP  TAASLLDL DPPQ R AFTNNQIWVTPYNRS
Sbjct  575   YDPSEFHVINPSKKTRVGNPVGYKLVPGGTAASLLDLDDPPQKRGAFTNNQIWVTPYNRS  634

Query  394   EQWAGGLFTYQSHGDDTLAVWSNRNRVIEKQDIVLWYTLGFHHLPCQEDFPVMPTVTSTF  215
             EQWAGGLF  QS G+DTLAVWSNR+R IE +DIV+WYTLGFHH+PCQEDFP+MPTV+S+F
Sbjct  635   EQWAGGLFVDQSTGEDTLAVWSNRDRPIENKDIVVWYTLGFHHIPCQEDFPIMPTVSSSF  694

Query  214   QLKPVNFFDRNPIIQANPNFAEDLPICRAG  125
              +KPVNFF+ NPI++  PN A DLP+C A 
Sbjct  695   DIKPVNFFESNPILRTPPNVATDLPVCTAA  724



>gb|EYU41414.1| hypothetical protein MIMGU_mgv1a002006mg [Erythranthe guttata]
Length=727

 Score =   786 bits (2031),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 373/689 (54%), Positives = 491/689 (71%), Gaps = 8/689 (1%)
 Frame = -1

Query  2188  CLSFESSNASINNLESLL--GIHDFKIQNNHFADRPMHPLDPLTIQEIERTRSILSSYQP  2015
             C ++     S N ++S     +H+   +  H AD P HPLDPLT+ E+ + +SI+  Y  
Sbjct  40    CAAYSPWCTSKNRIQSKKPDSLHNPTRRRRHSADVPRHPLDPLTVTELNKVQSIIKKYDL  99

Query  2014  FSGSSLRIHSLSLDEPDKSEVLRWKRGNPLPTRKAFVVALSNGQAHLLVVDLGSGRVSSH  1835
             F  ++  +HS+ L+EP+K  VL WK+G+ LP RKA VVA + G +H+L VDLGSG V+ H
Sbjct  100   FKNTAYALHSVVLEEPEKKVVLGWKKGDALPPRKAAVVARAGGASHVLTVDLGSGEVTRH  159

Query  1834  TRNPASGYPPMSADDASTALEATFSNSVFREAISTRGVEINDVVCSAAAPGWFGPEEEGR  1655
               +  SGYP M+ ++ ++   A  +++ F   +  RGV++ D+ C   + GWFG  EE R
Sbjct  160   EESRTSGYPTMTLEEMTSVTWAPLASADFNRTVVDRGVDLADLACLPISTGWFGKSEEKR  219

Query  1654  RITKVKCYTAQNTPNYYMRPIEGLLLTVDLDSGKVINVYDTHSPIPIPKAQGTDYRRDGI  1475
             R+ KV+CY+ ++T N+YMRPIEGL + VDLD+ +V+ + D    IPIP A  TDYR    
Sbjct  220   RLIKVQCYSTKDTANFYMRPIEGLTVLVDLDTKQVVEITDQGKNIPIPNAANTDYR---F  276

Query  1474  EHRAPGVEPLKPISMEQPNGQSFRVEDGYIVKWASWEFHVKADQRAGIIISQATVFDPEA  1295
               +      + PIS+EQP G SF +ED ++VKWA+WEFH+K D RAG+++SQ    DP  
Sbjct  277   SAQNSYQRLINPISIEQPKGPSFTIEDDHLVKWANWEFHLKPDPRAGVVVSQVRAVDPGT  336

Query  1294  GKRRSVMYKGFASELFVPYMDVDEGWYFRAFMDAGEFGLGATAMELVPLNDCPRHSHYID  1115
             G+ R VMYKG  SELFVPYMD  + WYF+ +MDAGE+G G  AM L PLNDCPR+++Y+D
Sbjct  337   GEMRDVMYKGLTSELFVPYMDPTDAWYFKTYMDAGEYGFGLQAMPLDPLNDCPRNAYYMD  396

Query  1114  GLFVDPDGRPVSQPNVICVFERYSGDIAWRHSGTGDADDDLIREARPKVSLVVRTTATVG  935
             G+F   DG P  + +++CVFE Y GDI WRHS +     + IRE RPKV+LVVR  A+V 
Sbjct  397   GVFAAGDGTPYVRSDMVCVFESYGGDIGWRHSESPITGME-IREVRPKVTLVVRMAASVA  455

Query  934   NYDYIFDWEFQTDGSIRVTVGLSGIILAKGSPYEHINQFEIPRWDFPAGSLVSENTIGVA  755
             NYDYI DWEFQTDG IR+ VGLSGI++ KG+PY +++Q       +  G+L+SEN IGV 
Sbjct  456   NYDYIVDWEFQTDGLIRIKVGLSGILMVKGTPYSNMDQINTQETLY--GTLLSENVIGVI  513

Query  754   HDHFITFHLDMDVDGPTNSFVKVDLVKNYNIAGKIQRKSYWSPKRKVAKSENDAKIKLQL  575
             HDH+ITF+LDM++DG  NSFVKV+L + Y   G+  R SY    R+VAK+E DA+IKL+L
Sbjct  514   HDHYITFYLDMEIDGSDNSFVKVNLEREYTSPGESPRMSYLKAVREVAKTEKDAQIKLKL  573

Query  574   DKPSEFHVINPRHQSRLGNPSGYKIVPSATAASLLDLQDPPQLRAAFTNNQIWVTPYNRS  395
               PSEFHVINP  ++R+GNP GYK+VP  TAASL+D+ DPPQ R AFTNNQIWVTPYN +
Sbjct  574   YDPSEFHVINPAKKTRVGNPVGYKVVPGGTAASLIDVNDPPQKRGAFTNNQIWVTPYNDT  633

Query  394   EQWAGGLFTYQSHGDDTLAVWSNRNRVIEKQDIVLWYTLGFHHLPCQEDFPVMPTVTSTF  215
             EQWAGGLF YQSHG+DTL  WSNR+R IE +DIV+WYTLGFHH+PCQEDFP+MPTV+S+F
Sbjct  634   EQWAGGLFVYQSHGEDTLQEWSNRDREIENKDIVVWYTLGFHHIPCQEDFPIMPTVSSSF  693

Query  214   QLKPVNFFDRNPIIQANPNFAEDLPICRA  128
              LKPVNFF+RNPI++  PNF  DLPIC+A
Sbjct  694   DLKPVNFFERNPILKIPPNFENDLPICKA  722



>gb|KHG02365.1| hypothetical protein F383_26066 [Gossypium arboreum]
Length=735

 Score =   786 bits (2030),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 374/662 (56%), Positives = 485/662 (73%), Gaps = 5/662 (1%)
 Frame = -1

Query  2113  QNNHFADRPMHPLDPLTIQEIERTRSILSSYQPF-SGSSLRIHSLSLDEPDKSEVLRWKR  1937
             + +H +  P HPLDPLTIQE  + R ILSS+  F S ++  +HS+ L+EP+K  VL+WK+
Sbjct  73    RRHHESAVPRHPLDPLTIQEFNKVRKILSSHALFKSSNNYALHSVVLEEPNKELVLKWKK  132

Query  1936  GNPLPTRKAFVVALSNGQAHLLVVDLGSGRVSSHTRNPASGYPPMSADDASTALEATFSN  1757
             G PL  R A V+A +NG +H+L V+L +  V+     P +GYP M+ +D ++A  A  SN
Sbjct  133   GQPLFPRIASVIARANGVSHVLTVNLETDNVTVLNTAPPTGYPTMTIEDMTSATWAPLSN  192

Query  1756  SVFREAISTRGVEINDVVCSAAAPGWFGPEEEGRRITKVKCYTAQNTPNYYMRPIEGLLL  1577
             + F   I  RGV + DV C   + GWFG +EE RR+ KV+CY+ ++T N+YMRPIEGL +
Sbjct  193   AKFNRTIIERGVNLKDVACLPISLGWFGKKEENRRLIKVQCYSMEDTANFYMRPIEGLTV  252

Query  1576  TVDLDSGKVINVYDTHSPIPIPKAQGTDYRRDGIEHRAPGVEPLKPISMEQPNGQSFRVE  1397
              +D+D+ +V+ V DT   IPIPKA  TDYR    +     +  + PIS+EQP G SF +E
Sbjct  253   LLDMDTKEVVEVSDTGRSIPIPKATNTDYRFSE-QKLQQDLNSINPISIEQPKGPSFVIE  311

Query  1396  DGYIVKWASWEFHVKADQRAGIIISQATVFDPEAGKRRSVMYKGFASELFVPYMDVDEGW  1217
             D ++VKWA+WEFH+K D RA +++S+A V D E+G  R VMYKGF SELFVPYMD  + W
Sbjct  312   DEHLVKWANWEFHLKPDPRAAVVVSRAKVRDLESGVLRDVMYKGFTSELFVPYMDPTDAW  371

Query  1216  YFRAFMDAGEFGLGATAMELVPLNDCPRHSHYIDGLFVDPDGRPVSQPNVICVFERYSGD  1037
             YF+ +MDAGE+G G  AM L PLNDCPR+++Y+DG+F   DG P  + N++C+FERY+GD
Sbjct  372   YFKTYMDAGEYGFGLQAMPLDPLNDCPRNAYYMDGVFAAGDGVPYVRSNMVCMFERYTGD  431

Query  1036  IAWRHSGTGDADDDLIREARPKVSLVVRTTATVGNYDYIFDWEFQTDGSIRVTVGLSGII  857
             I WRH+ +     + I+E RPKV+LVVR  A+V NYDYI DWEFQTDG IR+ VGLSGI+
Sbjct  432   IGWRHAESPITGME-IKEVRPKVTLVVRMAASVANYDYIVDWEFQTDGLIRIKVGLSGIL  490

Query  856   LAKGSPYEHINQFEIPRWDFPAGSLVSENTIGVAHDHFITFHLDMDVDGPTNSFVKVDLV  677
             + KG+ YE++NQ E     F  G+L+SEN IGV HDH+ITF+LDMD+DG  NSFV V++ 
Sbjct  491   MVKGTAYENMNQVEGQENLF--GTLLSENVIGVIHDHYITFYLDMDIDGSDNSFVNVNIK  548

Query  676   KNYNIAGKIQRKSYWSPKRKVAKSENDAKIKLQLDKPSEFHVINPRHQSRLGNPSGYKIV  497
             +     G+  RKSY    R VAK+E DA+I+L+L  PSEFHVINP  ++R+GNP GYK+V
Sbjct  549   RQETSPGESPRKSYLKAVRNVAKTEKDAQIQLKLYDPSEFHVINPTKKTRVGNPVGYKVV  608

Query  496   PSATAASLLDLQDPPQLRAAFTNNQIWVTPYNRSEQWAGGLFTYQSHGDDTLAVWSNRNR  317
             P  TAASLLD  DPPQ R AFTNNQIWVTPYNRSEQWAGGLF YQSHG+DTL VWS R+R
Sbjct  609   PGGTAASLLDHDDPPQKRGAFTNNQIWVTPYNRSEQWAGGLFVYQSHGEDTLDVWSERDR  668

Query  316   VIEKQDIVLWYTLGFHHLPCQEDFPVMPTVTSTFQLKPVNFFDRNPIIQANPNFAEDLPI  137
              IE +DIV+WYTLGFHH+PCQEDFP+MPTV+S+F LKPVNFF+ NPI++A P F +DLP+
Sbjct  669   PIENKDIVVWYTLGFHHIPCQEDFPIMPTVSSSFDLKPVNFFESNPILRAPPYFEKDLPV  728

Query  136   CR  131
             CR
Sbjct  729   CR  730



>ref|XP_008344454.1| PREDICTED: primary amine oxidase-like [Malus domestica]
Length=727

 Score =   786 bits (2029),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 375/663 (57%), Positives = 483/663 (73%), Gaps = 6/663 (1%)
 Frame = -1

Query  2107  NHFADRPMHPLDPLTIQEIERTRSILSSYQPF-SGSSLRIHSLSLDEPDKSEVLRWKRGN  1931
             +H +D P HPLDPLTIQE+   R+IL+S+  F S SS  +HS+ L EPDKS VL WK G+
Sbjct  66    DHSSDTPHHPLDPLTIQELNAVRTILNSHALFTSTSSYALHSIELQEPDKSLVLGWKHGD  125

Query  1930  PLPTRKAFVVALSNGQAHLLVVDLGSGRVSSHTRNPASGYPPMSADDASTALEATFSNSV  1751
             PL  RKA +VA  + ++ +L VDL +  V+ H      GYP M+ ++ + A  +   N+ 
Sbjct  126   PLFPRKASIVARVDSKSLVLTVDLTTSEVTVHETGSHYGYPTMTLEELAAATFSPLKNAD  185

Query  1750  FREAISTRGVEINDVVCSAAAPGWFGPEEEGRRITKVKCYTAQNTPNYYMRPIEGLLLTV  1571
             F   I  RGV++ D+ C   + GW+G  +E RR+ KV+CY+ ++T N+YMRPIEGL + V
Sbjct  186   FNRTIVERGVDLADLGCLPLSTGWYGGADENRRLIKVQCYSTKDTVNFYMRPIEGLTVLV  245

Query  1570  DLDSGKVINVYDTHSPIPIPKAQGTDYRRDGIEHRAPGVEPL-KPISMEQPNGQSFRVED  1394
             DLD+ +V+ + D    IPIPKA  TDYR      R   V+ L KPIS+EQP G SF VE+
Sbjct  246   DLDTQQVVEISDKGRGIPIPKAANTDYRYSA--QRPNQVKKLIKPISIEQPEGPSFTVEN  303

Query  1393  GYIVKWASWEFHVKADQRAGIIISQATVFDPEAGKRRSVMYKGFASELFVPYMDVDEGWY  1214
              ++VKWA+WEFH+K D RAG+I+S+A V+DPE G+ R VMYKGF SELFVPYMD  + WY
Sbjct  304   DHLVKWANWEFHLKPDARAGVIVSRAKVWDPETGELRDVMYKGFTSELFVPYMDPTDAWY  363

Query  1213  FRAFMDAGEFGLGATAMELVPLNDCPRHSHYIDGLFVDPDGRPVSQPNVICVFERYSGDI  1034
             F+ +MDAGE+G G  AM L PLNDCPR+++Y+DG+F   DG+P  + N++C+FE Y+GDI
Sbjct  364   FKTYMDAGEYGFGLQAMPLEPLNDCPRNAYYMDGVFAAADGKPYVRSNMVCIFESYTGDI  423

Query  1033  AWRHSGTGDADDDLIREARPKVSLVVRTTATVGNYDYIFDWEFQTDGSIRVTVGLSGIIL  854
              WRH+       + +RE RPKV+LVVR  A+V NYDYI DWEFQTDG IRV VGLSGI++
Sbjct  424   GWRHTECPITGME-VREVRPKVTLVVRMAASVANYDYIVDWEFQTDGLIRVKVGLSGILM  482

Query  853   AKGSPYEHINQFEIPRWDFPAGSLVSENTIGVAHDHFITFHLDMDVDGPTNSFVKVDLVK  674
              KG+ YE++NQ    + +   G+L+SEN IGV  DH++TFHLDMDVDG  NSF+KV+L +
Sbjct  483   VKGTSYENMNQVSSSQENL-YGTLLSENVIGVIXDHYVTFHLDMDVDGSDNSFMKVNLQR  541

Query  673   NYNIAGKIQRKSYWSPKRKVAKSENDAKIKLQLDKPSEFHVINPRHQSRLGNPSGYKIVP  494
               N   +  RKSY    + VAK+E DA+IKL+L  PSEFHVINP  ++R+GNP GYK+VP
Sbjct  542   QSNSPTESPRKSYLKATKTVAKTEKDAQIKLKLYDPSEFHVINPSKKTRVGNPVGYKLVP  601

Query  493   SATAASLLDLQDPPQLRAAFTNNQIWVTPYNRSEQWAGGLFTYQSHGDDTLAVWSNRNRV  314
               TAASLLDL DPPQ R AFTNNQIWVTPYN+SEQWAGGLF  QS G+DTLAVWSNR+R 
Sbjct  602   GGTAASLLDLDDPPQKRGAFTNNQIWVTPYNKSEQWAGGLFVDQSTGEDTLAVWSNRDRP  661

Query  313   IEKQDIVLWYTLGFHHLPCQEDFPVMPTVTSTFQLKPVNFFDRNPIIQANPNFAEDLPIC  134
             IE +DIV+WYTLGFHH+PCQEDFP+MPTV+S+F +KPVNFF+ NPI++  PN A D P+C
Sbjct  662   IENKDIVVWYTLGFHHIPCQEDFPIMPTVSSSFDIKPVNFFESNPILRTPPNVATDJPVC  721

Query  133   RAG  125
              A 
Sbjct  722   TAA  724



>ref|XP_011018232.1| PREDICTED: primary amine oxidase-like [Populus euphratica]
Length=738

 Score =   786 bits (2029),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 372/662 (56%), Positives = 485/662 (73%), Gaps = 5/662 (1%)
 Frame = -1

Query  2113  QNNHFADRPMHPLDPLTIQEIERTRSILSSYQPFSGSS-LRIHSLSLDEPDKSEVLRWKR  1937
              +NH +D P HPLDPLTI EI + R+IL S+  F  SS    HS+ L+EPDK+ VL+WK+
Sbjct  76    HHNHESDTPHHPLDPLTISEINKVRTILKSHTLFKSSSPCAFHSIVLEEPDKTLVLKWKK  135

Query  1936  GNPLPTRKAFVVALSNGQAHLLVVDLGSGRVSSHTRNPASGYPPMSADDASTALEATFSN  1757
             G+ +  RKA VVA   G++++L VD+ +G V+       SGYP M+ +D +++  A  SN
Sbjct  136   GDSMLPRKAAVVARVAGKSYVLTVDISTGEVAVQETGSRSGYPTMTIEDMTSSTWAPLSN  195

Query  1756  SVFREAISTRGVEINDVVCSAAAPGWFGPEEEGRRITKVKCYTAQNTPNYYMRPIEGLLL  1577
             + F   I  RGV++ D+ C   + GWFG  EE RR+ KV+CY+ + T N+YMRPIEGL +
Sbjct  196   ADFNRTIIERGVDLQDLACLPISLGWFGENEENRRLIKVQCYSMKGTANFYMRPIEGLTV  255

Query  1576  TVDLDSGKVINVYDTHSPIPIPKAQGTDYRRDGIEHRAPGVEPLKPISMEQPNGQSFRVE  1397
              +D+DS +V+ + D    IPIPKA  TDYR   ++   P +  + PIS+EQP G SF VE
Sbjct  256   LLDMDSKEVVEISDKGKDIPIPKAANTDYRY-SVQEINPEMMFVNPISIEQPKGPSFTVE  314

Query  1396  DGYIVKWASWEFHVKADQRAGIIISQATVFDPEAGKRRSVMYKGFASELFVPYMDVDEGW  1217
             D ++VKWA+WEFH+K D RAG+IIS+A V DP++G+ R+VMYKG+ SELFVPYMD  + W
Sbjct  315   DEHLVKWANWEFHLKPDPRAGVIISRAKVRDPDSGEMRNVMYKGYTSELFVPYMDPTDAW  374

Query  1216  YFRAFMDAGEFGLGATAMELVPLNDCPRHSHYIDGLFVDPDGRPVSQPNVICVFERYSGD  1037
             YF+ +MDAGE+G G  AM L PLNDCPR+++Y+DG+F   DG P  + +++CVFE Y+GD
Sbjct  375   YFKTYMDAGEYGFGLQAMPLDPLNDCPRNAYYMDGVFAAGDGTPYVRSHMVCVFESYAGD  434

Query  1036  IAWRHSGTGDADDDLIREARPKVSLVVRTTATVGNYDYIFDWEFQTDGSIRVTVGLSGII  857
             I WRHS +     + IRE RPKV+LV R  A+V NYDYI DWEFQTDG IR+ VGLSGI+
Sbjct  435   IGWRHSESPITGME-IREVRPKVTLVARMAASVANYDYIVDWEFQTDGLIRIKVGLSGIL  493

Query  856   LAKGSPYEHINQFEIPRWDFPAGSLVSENTIGVAHDHFITFHLDMDVDGPTNSFVKVDLV  677
             + KG+ Y + NQ  +P      G+L+SEN IGV HDH++TF+LDMD+DG  NSFVKV++ 
Sbjct  494   MVKGTSYVNTNQ--VPGQQNLYGTLLSENVIGVVHDHYVTFYLDMDIDGSDNSFVKVNIQ  551

Query  676   KNYNIAGKIQRKSYWSPKRKVAKSENDAKIKLQLDKPSEFHVINPRHQSRLGNPSGYKIV  497
             K     G+  R+SY    R VAK+E DA+I+L+L  PSEFHV+NP  ++R+GNP GYK+V
Sbjct  552   KQRTSPGESPRRSYLKAIRNVAKTEKDAQIQLKLYDPSEFHVVNPMKRTRVGNPVGYKLV  611

Query  496   PSATAASLLDLQDPPQLRAAFTNNQIWVTPYNRSEQWAGGLFTYQSHGDDTLAVWSNRNR  317
             P  TAASLLD  DPPQ R AFTNNQIWVTPYN+SEQWAGGLF YQS G+DTLAVWS R+R
Sbjct  612   PGGTAASLLDHDDPPQKRGAFTNNQIWVTPYNQSEQWAGGLFAYQSQGEDTLAVWSERDR  671

Query  316   VIEKQDIVLWYTLGFHHLPCQEDFPVMPTVTSTFQLKPVNFFDRNPIIQANPNFAEDLPI  137
              IE +DIVLWYTLGFHH+PCQEDFP+MPTV+S+F LKPVNFF+ NPI++  PN  +DLP+
Sbjct  672   PIENKDIVLWYTLGFHHVPCQEDFPIMPTVSSSFDLKPVNFFESNPILRIPPNVEKDLPV  731

Query  136   CR  131
             C+
Sbjct  732   CK  733



>ref|XP_009356469.1| PREDICTED: primary amine oxidase-like [Pyrus x bretschneideri]
Length=727

 Score =   785 bits (2028),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 379/690 (55%), Positives = 496/690 (72%), Gaps = 7/690 (1%)
 Frame = -1

Query  2188  CLSFESSNASINNLESLLGIHDFKIQNNHFADRPMHPLDPLTIQEIERTRSILSSYQPF-  2012
             C +  +  +S N ++S   I   ++++ H +D P HPLDPLTIQE+   R+IL+S+  F 
Sbjct  40    CTTNSAWCSSKNRIQSKPHIPTRRLKD-HSSDTPHHPLDPLTIQELNAVRTILNSHALFT  98

Query  2011  SGSSLRIHSLSLDEPDKSEVLRWKRGNPLPTRKAFVVALSNGQAHLLVVDLGSGRVSSHT  1832
             S SS  +HS+ L EPDKS VL WK G+PL  RKA ++A  + ++ +L VDL +  V+ H 
Sbjct  99    STSSYALHSVELQEPDKSLVLGWKHGDPLFPRKASIIARVDSKSLVLTVDLTTSEVTVHG  158

Query  1831  RNPASGYPPMSADDASTALEATFSNSVFREAISTRGVEINDVVCSAAAPGWFGPEEEGRR  1652
                  GYP M+ ++ + A  +   N+ F   I  RGV++ D+ C   + GW+G  +E RR
Sbjct  159   TGSHYGYPTMTLEELTAATFSPLKNADFNRTIVERGVDLADLRCLPLSTGWYGVADENRR  218

Query  1651  ITKVKCYTAQNTPNYYMRPIEGLLLTVDLDSGKVINVYDTHSPIPIPKAQGTDYRRDGIE  1472
             + KV+CY+ ++T N+YMRPIEGL + VDLD+ +V+ + D    IPIPKA  TDYR     
Sbjct  219   LIKVQCYSTKDTVNFYMRPIEGLTVLVDLDTKQVLEISDKGRSIPIPKAANTDYRYSA--  276

Query  1471  HRAPGVEP-LKPISMEQPNGQSFRVEDGYIVKWASWEFHVKADQRAGIIISQATVFDPEA  1295
              R   V+  +KPIS+EQP+G SF VE+ ++VKWA+WEFH+K D RAG+I+S+A V DP+ 
Sbjct  277   QRPDQVKKVIKPISIEQPDGPSFTVENDHLVKWANWEFHLKPDARAGVIVSRAKVRDPDT  336

Query  1294  GKRRSVMYKGFASELFVPYMDVDEGWYFRAFMDAGEFGLGATAMELVPLNDCPRHSHYID  1115
             G+ R VMYKGF SELFVPYMD  + WYF+ +MDAGE+G G   M L PLNDCPR+++Y+D
Sbjct  337   GELRDVMYKGFTSELFVPYMDPTDAWYFKTYMDAGEYGFGLQGMPLEPLNDCPRNAYYMD  396

Query  1114  GLFVDPDGRPVSQPNVICVFERYSGDIAWRHSGTGDADDDLIREARPKVSLVVRTTATVG  935
             G+F   DG+P  + N++C+FE Y+GDI WRH+       + +RE RPKV+LVVR  A+V 
Sbjct  397   GVFAAADGKPYVRSNMVCIFESYTGDIGWRHTECPITGME-VREVRPKVTLVVRMAASVA  455

Query  934   NYDYIFDWEFQTDGSIRVTVGLSGIILAKGSPYEHINQFEIPRWDFPAGSLVSENTIGVA  755
             NYDYI DWEFQTDG IRV VGLSGI++ KG+ YE++NQ      +   G+L+SEN IGV 
Sbjct  456   NYDYIVDWEFQTDGLIRVKVGLSGILMVKGTSYENMNQVSSSPENL-YGTLLSENVIGVI  514

Query  754   HDHFITFHLDMDVDGPTNSFVKVDLVKNYNIAGKIQRKSYWSPKRKVAKSENDAKIKLQL  575
             HDH++TFHLDMDVDG  NSF+KV+L +  N   +  RKSY    + VAK+E DA+IKL+L
Sbjct  515   HDHYVTFHLDMDVDGSDNSFMKVNLQRQSNPPTESPRKSYLKATKTVAKTEKDAQIKLKL  574

Query  574   DKPSEFHVINPRHQSRLGNPSGYKIVPSATAASLLDLQDPPQLRAAFTNNQIWVTPYNRS  395
               PSEFHVINP  ++R+GNP GYK+VP  TAASLLDL DPPQ R AFTNNQIWVTPYNRS
Sbjct  575   YDPSEFHVINPSKKTRIGNPVGYKLVPGGTAASLLDLDDPPQKRGAFTNNQIWVTPYNRS  634

Query  394   EQWAGGLFTYQSHGDDTLAVWSNRNRVIEKQDIVLWYTLGFHHLPCQEDFPVMPTVTSTF  215
             EQWAGGLF  QS G+DTLAVWSNR+R IE +DIV+WYTLGFHH+PCQEDFP+MPTV+S+F
Sbjct  635   EQWAGGLFVDQSTGEDTLAVWSNRDRPIENKDIVVWYTLGFHHIPCQEDFPIMPTVSSSF  694

Query  214   QLKPVNFFDRNPIIQANPNFAEDLPICRAG  125
              +KPVNFF+ NPI++  PN A DLP+C A 
Sbjct  695   DIKPVNFFESNPILRTPPNVATDLPVCTAA  724



>ref|XP_007148900.1| hypothetical protein PHAVU_005G023500g [Phaseolus vulgaris]
 ref|XP_007148901.1| hypothetical protein PHAVU_005G023500g [Phaseolus vulgaris]
 gb|ESW20894.1| hypothetical protein PHAVU_005G023500g [Phaseolus vulgaris]
 gb|ESW20895.1| hypothetical protein PHAVU_005G023500g [Phaseolus vulgaris]
Length=727

 Score =   784 bits (2025),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 375/666 (56%), Positives = 485/666 (73%), Gaps = 13/666 (2%)
 Frame = -1

Query  2110  NNHFADRPMHPLDPLTIQEIERTRSILSSYQPF-SGSSLRIHSLSLDEPDKSEVLRWKRG  1934
             ++H ++ P HPLDPLT+QE  R R+ILSS+  F S SS  ++S+ L+EPDK  V +W++G
Sbjct  66    SDHQSEIPQHPLDPLTVQEFNRVRTILSSHPLFKSSSSYTLNSVVLEEPDKKLVQKWRKG  125

Query  1933  NPLPTRKAFVVALSNGQAHLLVVDLGSGRVSSHTRNPASGYPPMSADDASTALEATFSNS  1754
             +P   RKA VVA+  G +H+L VDL    V SH    +SGYP M+ +D    LE    +S
Sbjct  126   DPPLPRKASVVAVVKGVSHVLTVDLEISMVVSHETGSSSGYPIMTMEDMVGVLEVPLKSS  185

Query  1753  VFREAISTRGVEINDVVCSAAAPGWFG-PEEEGRRITKVKCYTAQNTPNYYMRPIEGLLL  1577
              F  +I+ RGV + D+ C   + GW+G P EE RR+ KV+CY+ + T N+YM+PIEG+  
Sbjct  186   EFNRSITKRGVNLADLACLPISSGWYGTPVEENRRLIKVQCYSKEGTVNFYMKPIEGVTA  245

Query  1576  TVDLDSGKVINVYDTHSPIPIPKAQGTDYRRDGIEHRAPGVEPLKPISMEQPNGQSFRVE  1397
              VD+D  +V+ + D    IP+     TDYR   I+     +  L PIS+EQP G SF V 
Sbjct  246   LVDMDRKEVVAISDDGQNIPVASGANTDYRY-SIQKLNGELRLLNPISLEQPQGPSFSV-  303

Query  1396  DGYIVKWASWEFHVKADQRAGIIISQATVFDPEAGKRRSVMYKGFASELFVPYMDVDEGW  1217
             DG++VKWA+WEFH++ D RAG I+SQ  V DP+  K R+VMYKGF SELFVPYMD  EGW
Sbjct  304   DGHLVKWANWEFHLRPDPRAGTIVSQVKVRDPDTSKLRNVMYKGFTSELFVPYMDPTEGW  363

Query  1216  YFRAFMDAGEFGLGATAMELVPLNDCPRHSHYIDGLFVDPDGRPVSQPNVICVFERYSGD  1037
             YF+ +MDAGE+G G  AM L PLNDCPR+++Y+DG+F   DG P  QPN+IC+FE Y+GD
Sbjct  364   YFKTYMDAGEYGFGLQAMPLDPLNDCPRNAYYMDGVFASSDGTPYLQPNMICIFESYAGD  423

Query  1036  IAWRHSG---TGDADDDLIREARPKVSLVVRTTATVGNYDYIFDWEFQTDGSIRVTVGLS  866
             IAWRH+    TG      + E RPKV+LVVR  A V NYDYI DWEFQTDG IR  VGLS
Sbjct  424   IAWRHAECPITGLK----VTEVRPKVTLVVRMAAAVANYDYIVDWEFQTDGLIRAKVGLS  479

Query  865   GIILAKGSPYEHINQFEIPRWDFPAGSLVSENTIGVAHDHFITFHLDMDVDGPTNSFVKV  686
             GI++ KG+ YE+++Q  +P  D+  G+L+SEN IGV HDH++T++LDMDVDG  NSFVKV
Sbjct  480   GILMVKGTTYENMDQ--VPEKDYLYGTLLSENIIGVIHDHYVTYYLDMDVDGSENSFVKV  537

Query  685   DLVKNYNIAGKIQRKSYWSPKRKVAKSENDAKIKLQLDKPSEFHVINPRHQSRLGNPSGY  506
             ++ K    +G+  RKSY    ++VAK+E DA+I+L+L +PSEFHV+NP  ++R+GNP GY
Sbjct  538   NIKKEETSSGESPRKSYLKAVKEVAKTEKDAQIRLKLYEPSEFHVVNPLKKTRVGNPVGY  597

Query  505   KIVPSATAASLLDLQDPPQLRAAFTNNQIWVTPYNRSEQWAGGLFTYQSHGDDTLAVWSN  326
             K+VP  TAASLLD +DPPQ RAAFTNNQIWVTPYN++EQWAGG F YQS GDDTL VWSN
Sbjct  598   KLVPGGTAASLLDPEDPPQKRAAFTNNQIWVTPYNKTEQWAGGSFVYQSKGDDTLQVWSN  657

Query  325   RNRVIEKQDIVLWYTLGFHHLPCQEDFPVMPTVTSTFQLKPVNFFDRNPIIQANPNFAED  146
             R+R IE +DIVLWYT+GFHH+PCQED+P+MPTV+S+F LKPVNFF+RNPI+   PN  ED
Sbjct  658   RDRPIENKDIVLWYTIGFHHIPCQEDYPIMPTVSSSFDLKPVNFFERNPILGVPPNLDED  717

Query  145   LPICRA  128
             LP+C+A
Sbjct  718   LPVCKA  723



>ref|XP_011018235.1| PREDICTED: primary amine oxidase-like [Populus euphratica]
Length=738

 Score =   783 bits (2023),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 371/662 (56%), Positives = 485/662 (73%), Gaps = 5/662 (1%)
 Frame = -1

Query  2113  QNNHFADRPMHPLDPLTIQEIERTRSILSSYQPFSGSS-LRIHSLSLDEPDKSEVLRWKR  1937
              +NH +D P HPLDPLTI EI + R+IL S+  F  SS    HS+ L+EPDK+ VL+WK+
Sbjct  76    HHNHESDTPHHPLDPLTISEINKVRTILKSHTLFKSSSPCAFHSIVLEEPDKTLVLKWKK  135

Query  1936  GNPLPTRKAFVVALSNGQAHLLVVDLGSGRVSSHTRNPASGYPPMSADDASTALEATFSN  1757
             G+ +  RKA VVA   G++++L VD+ +G V+       SGYP M+ +D +++  A  SN
Sbjct  136   GDSMLPRKAAVVARVAGKSYVLTVDISTGEVAVQETGSRSGYPTMTIEDMTSSTWAPLSN  195

Query  1756  SVFREAISTRGVEINDVVCSAAAPGWFGPEEEGRRITKVKCYTAQNTPNYYMRPIEGLLL  1577
             + F   I  RGV++ D+ C   + GWFG  EE RR+ KV+CY+ + T N+YMRPIEGL +
Sbjct  196   ADFNRTIIERGVDLQDLACLPISLGWFGENEENRRLIKVQCYSMKGTANFYMRPIEGLTV  255

Query  1576  TVDLDSGKVINVYDTHSPIPIPKAQGTDYRRDGIEHRAPGVEPLKPISMEQPNGQSFRVE  1397
              +D+DS +V+ + D    IPIPKA  TDYR   ++   P +  + PIS+EQP G SF VE
Sbjct  256   LLDMDSKEVVEISDKGKDIPIPKAANTDYRY-SVQEINPEMMFVNPISIEQPKGPSFTVE  314

Query  1396  DGYIVKWASWEFHVKADQRAGIIISQATVFDPEAGKRRSVMYKGFASELFVPYMDVDEGW  1217
             D ++VKWA+WEFH+K D RAG+IIS+A V DP++G+ R+VMYKG+ SELFVPYMD  + W
Sbjct  315   DEHLVKWANWEFHLKPDPRAGVIISRAKVRDPDSGEMRNVMYKGYTSELFVPYMDPTDAW  374

Query  1216  YFRAFMDAGEFGLGATAMELVPLNDCPRHSHYIDGLFVDPDGRPVSQPNVICVFERYSGD  1037
             YF+ +MDAGE+G G  AM L PLNDCPR+++Y+DG+F   DG P  + +++CVFE Y+GD
Sbjct  375   YFKTYMDAGEYGFGLQAMPLDPLNDCPRNAYYMDGVFAAGDGTPYVRSHMVCVFESYAGD  434

Query  1036  IAWRHSGTGDADDDLIREARPKVSLVVRTTATVGNYDYIFDWEFQTDGSIRVTVGLSGII  857
             I WRHS +     + IRE RPKV+LV R  A+V NYDYI DWEFQTDG IR+ VGLSGI+
Sbjct  435   IGWRHSESPITGME-IREVRPKVTLVARMAASVANYDYIVDWEFQTDGLIRIKVGLSGIL  493

Query  856   LAKGSPYEHINQFEIPRWDFPAGSLVSENTIGVAHDHFITFHLDMDVDGPTNSFVKVDLV  677
             + KG+ Y + NQ  +P      G+L+SEN IGV HDH++TF+LDMD+DG  NSFVKV++ 
Sbjct  494   MVKGTSYVNTNQ--VPGQQNLYGTLLSENVIGVVHDHYVTFYLDMDIDGSDNSFVKVNIQ  551

Query  676   KNYNIAGKIQRKSYWSPKRKVAKSENDAKIKLQLDKPSEFHVINPRHQSRLGNPSGYKIV  497
             K     G+  R+SY      VAK+E DA+I+L+L  PSEFHV+NP  ++R+GNP GYK+V
Sbjct  552   KQRTSPGESPRRSYLKAITNVAKTEKDAQIQLKLYDPSEFHVVNPMKRTRVGNPVGYKLV  611

Query  496   PSATAASLLDLQDPPQLRAAFTNNQIWVTPYNRSEQWAGGLFTYQSHGDDTLAVWSNRNR  317
             P  TAASLLD  DPPQ R AFTNNQIWVTPYN+SEQWAGGLF YQS G+DTLAVWS+R+R
Sbjct  612   PGGTAASLLDHDDPPQKRGAFTNNQIWVTPYNQSEQWAGGLFAYQSQGEDTLAVWSDRDR  671

Query  316   VIEKQDIVLWYTLGFHHLPCQEDFPVMPTVTSTFQLKPVNFFDRNPIIQANPNFAEDLPI  137
              IE +DIVLWYTLGFHH+PCQEDFP+MPTV+S+F LKPVNFF+ NPI++  PN  +DLP+
Sbjct  672   PIENKDIVLWYTLGFHHVPCQEDFPIMPTVSSSFDLKPVNFFESNPILRIPPNVEKDLPV  731

Query  136   CR  131
             C+
Sbjct  732   CK  733



>ref|XP_010676217.1| PREDICTED: primary amine oxidase-like [Beta vulgaris subsp. vulgaris]
Length=721

 Score =   783 bits (2021),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 365/660 (55%), Positives = 480/660 (73%), Gaps = 5/660 (1%)
 Frame = -1

Query  2098  ADRPMHPLDPLTIQEIERTRSILSSYQPF-SGSSLRIHSLSLDEPDKSEVLRWKRGNPLP  1922
              D P HPLDPLT+QE+ R ++ILS++  F S  +  +HS+ L+EP K  V+RW  GNPLP
Sbjct  62    TDIPCHPLDPLTVQEMNRVQAILSTHLLFVSAKAYALHSVVLEEPLKPRVMRWMEGNPLP  121

Query  1921  TRKAFVVALSNGQAHLLVVDLGSGRVSSHTRNPASGYPPMSADDASTALEATFSNSVFRE  1742
              RKA V+A  +G +H+L VDLG+GRV+     P SGYP M+ +D +         S    
Sbjct  122   PRKASVIARVDGVSHVLSVDLGTGRVNRVDTGPLSGYPMMTIEDTNMTKYTQLVGSQLNR  181

Query  1741  AISTRGVEINDVVCSAAAPGWFGPEEEGRRITKVKCYTAQNTPNYYMRPIEGLLLTVDLD  1562
              I  RGV++ D+ C   + GW+G +EE RR+ K++C++ + T N+YMRPIEGL + VD+D
Sbjct  182   TILERGVDLADLACVPLSTGWYGKKEENRRLIKIQCFSMKGTANFYMRPIEGLTVVVDMD  241

Query  1561  SGKVINVYDTHSPIPIPKAQGTDYRRDGIEHRAPGVEPLKPISMEQPNGQSFRVEDGYIV  1382
             + +++ V D    IPIPKA  TDYR    +     ++P+ P+S+EQP G SF +E+G++V
Sbjct  242   TNQILEVSDNGKTIPIPKATNTDYRLSAQKKAHNKIKPINPMSIEQPKGPSFTIENGHMV  301

Query  1381  KWASWEFHVKADQRAGIIISQATVFDPEAGKRRSVMYKGFASELFVPYMDVDEGWYFRAF  1202
             KWA+WEFH+K D RAG+IIS+A V D   GK R+VMYKG ASELFVPYMD  + WYF+ +
Sbjct  302   KWANWEFHLKPDPRAGVIISRAMVRDTGTGKLRNVMYKGMASELFVPYMDPTDAWYFKTY  361

Query  1201  MDAGEFGLGATAMELVPLNDCPRHSHYIDGLFVDPDGRPVSQPNVICVFERYSGDIAWRH  1022
             MDAGE+G G  +M L PLNDCPR++HY+DG+F   DG P  + N++CVFERY+GDIAWRH
Sbjct  362   MDAGEYGFGLQSMPLEPLNDCPRNAHYMDGVFAASDGTPYVRSNMVCVFERYAGDIAWRH  421

Query  1021  SGTGDADDDLIREARPKVSLVVRTTATVGNYDYIFDWEFQTDGSIRVTVGLSGIILAKGS  842
             S +   +   IRE RPKV+LVVR  A+V NYDYI DWEFQ+DG I++ VGLSGI++ K +
Sbjct  422   SESPITNMK-IREVRPKVTLVVRMAASVANYDYIVDWEFQSDGLIKIKVGLSGIVIVKAT  480

Query  841   PYEHINQFEIPRWDFPAGSLVSENTIGVAHDHFITFHLDMDVDGPTNSFVKVDLVKNYNI  662
              ++++NQ  IP  +   G L++EN IGV HDH+ITF+LDMDVDG  NSFVKV++ +    
Sbjct  481   QHKNLNQ--IPNQETLNGILLAENVIGVIHDHYITFYLDMDVDGSDNSFVKVNMQRQLTS  538

Query  661   AGKIQRKSYWSPKRKVAKSENDAKIKLQLDKPSEFHVINPRHQSRLGNPSGYKIVPSATA  482
              G+  R+SY   KR VAK+E DA+IK +L  P EFH++NP   +++GNP GYK+VP+ TA
Sbjct  539   PGESPRQSYMKAKRNVAKTEKDAQIKFKLYDPYEFHMVNPNKYTQVGNPVGYKLVPAGTA  598

Query  481   ASLLDLQDPPQLRAAFTNNQIWVTPYNRSEQWAGGLFTYQSHGDDTLAVWSNRNRVIEKQ  302
              SLL+ +D PQ RAAFTNNQIWVTPYNRSE+WAGGLF  QSHG+DTLA WS R+R IE +
Sbjct  599   GSLLEPEDSPQKRAAFTNNQIWVTPYNRSEEWAGGLFVCQSHGEDTLAKWSERDRPIENK  658

Query  301   DIVLWYTLGFHHLPCQEDFPVMPTVTSTFQLKPVNFFDRNPIIQANPNFAE-DLPICRAG  125
             DIVLWYTLGFHH+PCQEDFP+MPTV+S+F LKPVNFFD NPI+     ++E DLPIC+A 
Sbjct  659   DIVLWYTLGFHHIPCQEDFPIMPTVSSSFDLKPVNFFDENPILGMQQPYSEKDLPICQAA  718



>ref|XP_006287136.1| hypothetical protein CARUB_v10000307mg [Capsella rubella]
 gb|EOA20034.1| hypothetical protein CARUB_v10000307mg [Capsella rubella]
Length=738

 Score =   780 bits (2014),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 376/671 (56%), Positives = 484/671 (72%), Gaps = 15/671 (2%)
 Frame = -1

Query  2119  KIQNNHFADRPMHPLDPLTIQEIERTRSILSSYQPF-SGSSLRIHSLSLDEPDKSEVLRW  1943
             K  ++H +D P HPLDPLT+ EI + RSIL S+  F SG+   +H++ L+EPDK+ V  W
Sbjct  67    KNHHDHASDTPNHPLDPLTVMEINKVRSILFSHALFTSGTPHALHTVVLEEPDKNLVRLW  126

Query  1942  KRGNPLPTRKAFVVALSNGQAHLLVVDLGSGRVSSHTRNPA--SGYPPMSADDASTALEA  1769
             ++GNPLP RKA V+A      H+L VD+ +GRV S   +P   SGYP M+ ++ +     
Sbjct  127   EKGNPLPPRKASVIARVGLDTHVLTVDISTGRVESEN-SPVNVSGYPMMTIEEMNDITVV  185

Query  1768  TFSNSVFREAISTRGVEINDVVCSAAAPGWFGPEEEGRRITKVKCYTAQNTPNYYMRPIE  1589
              FSN+ F   I +RGV + DV+C   + GWFG +EE  R+ K +C+  Q T N+YMRPIE
Sbjct  186   PFSNADFNRTILSRGVNLTDVICFPISCGWFGNKEENVRVIKSQCFLTQGTANFYMRPIE  245

Query  1588  GLLLTVDLDSGKVINVYDTHSPIPIPKAQGTDYRRDGIEHRAPGVEPLKPISMEQPNGQS  1409
             GL + +DLD+ +VI + DT   IPIP +  TDYR + +         L PIS+EQP G S
Sbjct  246   GLTILIDLDTKQVIEISDTGRAIPIPGSTNTDYRFEKLVTTG-KTRVLNPISIEQPRGPS  304

Query  1408  FRVEDGYIVKWASWEFHVKADQRAGIIISQATVFDPEAGKRRSVMYKGFASELFVPYMDV  1229
             F +ED ++VKWA+WEFH+K D RAG+++S+  V DP+  + R VMYKGF SELFVPYMD 
Sbjct  305   FVIEDNHMVKWANWEFHLKPDPRAGVVLSRVRVHDPDTQETRDVMYKGFVSELFVPYMDP  364

Query  1228  DEGWYFRAFMDAGEFGLGATAMELVPLNDCPRHSHYIDGLFVDPDGRPVSQPNVICVFER  1049
              + WYF+ +MDAGE+G G  AM LVPLNDCPR++ Y+DG+F   DG P  + N++C+FE 
Sbjct  365   SDAWYFKTYMDAGEYGFGLQAMPLVPLNDCPRNAVYMDGIFAAADGTPFVRENMVCIFES  424

Query  1048  YSGDIAWRHSG---TGDADDDLIREARPKVSLVVRTTATVGNYDYIFDWEFQTDGSIRVT  878
             Y+GDI WRHS    TG      IRE RPKV+LVVR  A+VGNYDYI D+EFQTDG I+  
Sbjct  425   YAGDIGWRHSESPITGLP----IREVRPKVTLVVRMVASVGNYDYIIDYEFQTDGLIKAK  480

Query  877   VGLSGIILAKGSPYEHINQFEIPR---WDFPAGSLVSENTIGVAHDHFITFHLDMDVDGP  707
             VGLSGI++ KG+ Y++ NQ E  +    +   G+L+SEN IGV HDH++TF+LD+DVDGP
Sbjct  481   VGLSGILMVKGTTYQNKNQVEKDKDGNEEELHGTLLSENVIGVIHDHYVTFYLDLDVDGP  540

Query  706   TNSFVKVDLVKNYNIAGKIQRKSYWSPKRKVAKSENDAKIKLQLDKPSEFHVINPRHQSR  527
              NSFVKV+L +     G+  RKSY    R +AK+E D +IKL L  PSE+HVIN    +R
Sbjct  541   DNSFVKVNLKRQETEPGESPRKSYLKAVRNIAKTEKDGQIKLSLYDPSEYHVINSGKTTR  600

Query  526   LGNPSGYKIVPSATAASLLDLQDPPQLRAAFTNNQIWVTPYNRSEQWAGGLFTYQSHGDD  347
             +GNP+GYK+VP ATAASLLD  DPPQ R AFTNNQIWVTPYN+SEQWAGGLFTYQSHGDD
Sbjct  601   VGNPTGYKVVPRATAASLLDHDDPPQKRGAFTNNQIWVTPYNKSEQWAGGLFTYQSHGDD  660

Query  346   TLAVWSNRNRVIEKQDIVLWYTLGFHHLPCQEDFPVMPTVTSTFQLKPVNFFDRNPIIQA  167
             TLAVWS+R+R IE +DIV+WYTLGFHH+PCQEDFP+MPTV+S+F LKP NFF+RNPI++A
Sbjct  661   TLAVWSDRDRDIENKDIVVWYTLGFHHIPCQEDFPIMPTVSSSFDLKPTNFFERNPILRA  720

Query  166   NPNFAEDLPIC  134
              PN+  DLP+C
Sbjct  721   APNYEHDLPVC  731



>ref|XP_010422197.1| PREDICTED: primary amine oxidase-like isoform X1 [Camelina sativa]
 ref|XP_010422198.1| PREDICTED: primary amine oxidase-like isoform X2 [Camelina sativa]
Length=741

 Score =   779 bits (2012),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 374/668 (56%), Positives = 481/668 (72%), Gaps = 13/668 (2%)
 Frame = -1

Query  2113  QNNHFADRPMHPLDPLTIQEIERTRSILSSYQPF-SGSSLRIHSLSLDEPDKSEVLRWKR  1937
              ++H +D P HPLDPLT+ EI + RSIL+S+  F SG+    H++ L+EPDK+ V  W++
Sbjct  72    NHDHASDTPNHPLDPLTVVEINKVRSILTSHALFTSGTPHAFHTVVLEEPDKNLVRLWEK  131

Query  1936  GNPLPTRKAFVVALSNGQAHLLVVDLGSGRVSS-HTRNPASGYPPMSADDASTALEATFS  1760
             GNPLP RKA V+A      H+L VD+ +G+V S +     SGYP M+ ++ +      FS
Sbjct  132   GNPLPPRKASVIARVGTDTHVLTVDISTGKVESENIPVNVSGYPMMTIEEMNDMTVLPFS  191

Query  1759  NSVFREAISTRGVEINDVVCSAAAPGWFGPEEEGRRITKVKCYTAQNTPNYYMRPIEGLL  1580
             N+ F   I +RGV + DV+C   + GWFG +E+  R+ K +C+  Q T N+YMRPIEGL 
Sbjct  192   NADFNRTILSRGVNLTDVICYPISCGWFGGKEDNARVIKNQCFLTQGTANFYMRPIEGLT  251

Query  1579  LTVDLDSGKVINVYDTHSPIPIPKAQGTDYRRDGIEHRAPGVEPLKPISMEQPNGQSFRV  1400
             + +DLD+ KVI + DT   +PIP +  TDYR + +         L PIS+EQP G SF +
Sbjct  252   ILIDLDTKKVIEISDTGRAVPIPGSTNTDYRFEKLV-TTDKTRRLNPISIEQPRGPSFVI  310

Query  1399  EDGYIVKWASWEFHVKADQRAGIIISQATVFDPEAGKRRSVMYKGFASELFVPYMDVDEG  1220
             ED ++VKWA+WEFH+K D RAG+++S+  V DP+  + R VMYKGF SELFVPYMD  + 
Sbjct  311   EDNHLVKWANWEFHLKPDPRAGVVLSRVRVHDPDTQETRDVMYKGFVSELFVPYMDPSDA  370

Query  1219  WYFRAFMDAGEFGLGATAMELVPLNDCPRHSHYIDGLFVDPDGRPVSQPNVICVFERYSG  1040
             WYF+ +MDAGE+G G  AM LVPLNDCPR++ Y+DG+F   DG P  + N++C+FE Y+G
Sbjct  371   WYFKTYMDAGEYGFGLQAMPLVPLNDCPRNAAYMDGVFAAADGTPFVRENMVCIFESYAG  430

Query  1039  DIAWRHSG---TGDADDDLIREARPKVSLVVRTTATVGNYDYIFDWEFQTDGSIRVTVGL  869
             DI WRHS    TG      IRE RPKV+LVVR  A+VGNYDYI D+EFQTDG I+  VGL
Sbjct  431   DIGWRHSESPITGLP----IREVRPKVTLVVRMAASVGNYDYIIDYEFQTDGLIKAKVGL  486

Query  868   SGIILAKGSPYEHINQFEIPRW---DFPAGSLVSENTIGVAHDHFITFHLDMDVDGPTNS  698
             SGI++ KG+PY++ NQ E  +    +   G+L+SEN IGV HDH++TF+LD+DVDGP NS
Sbjct  487   SGILMVKGTPYQNKNQVEKDKEGNEEELHGTLLSENVIGVIHDHYVTFYLDLDVDGPDNS  546

Query  697   FVKVDLVKNYNIAGKIQRKSYWSPKRKVAKSENDAKIKLQLDKPSEFHVINPRHQSRLGN  518
             FVKV+L +     G+  RKSY    R +AK+E D +IKL L  PSEFHVIN    +R+GN
Sbjct  547   FVKVNLKRQETEPGESPRKSYLKAVRNIAKTEKDGQIKLSLYDPSEFHVINSGKTTRVGN  606

Query  517   PSGYKIVPSATAASLLDLQDPPQLRAAFTNNQIWVTPYNRSEQWAGGLFTYQSHGDDTLA  338
             P+GYK+VP ATAASLLD  DPPQ R AFTNNQIWVTPYN+SEQWAGGLFTYQSHGDDTL 
Sbjct  607   PTGYKVVPRATAASLLDHDDPPQKRGAFTNNQIWVTPYNKSEQWAGGLFTYQSHGDDTLE  666

Query  337   VWSNRNRVIEKQDIVLWYTLGFHHLPCQEDFPVMPTVTSTFQLKPVNFFDRNPIIQANPN  158
             VWS+R+R IE +DIV+WYTLGFHH+PCQEDFP+MPTV+S+F LKP NFF+RNPI+ A PN
Sbjct  667   VWSDRDRDIENKDIVVWYTLGFHHIPCQEDFPIMPTVSSSFDLKPTNFFERNPILGAAPN  726

Query  157   FAEDLPIC  134
             F  DLP+C
Sbjct  727   FEHDLPVC  734



>ref|XP_008238640.1| PREDICTED: primary amine oxidase-like [Prunus mume]
Length=726

 Score =   778 bits (2009),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 380/666 (57%), Positives = 479/666 (72%), Gaps = 13/666 (2%)
 Frame = -1

Query  2107  NHFADRPMHPLDPLTIQEIERTRSILSSYQPFSGSSLRIHS-LSLDEPDKSEVLRWKRGN  1931
             +H +D P HPLDPLT+ EI   RSIL S+  F+ SS      + L EPDKS VLRW+ G+
Sbjct  66    DHASDAPHHPLDPLTLPEITAVRSILYSHALFASSSSHALHSVDLQEPDKSLVLRWQHGD  125

Query  1930  PLPTRKAFVVALSNGQAHLLVVDLGSGRVSSHTRNPASGYPPMSADDASTALEATFSNSV  1751
             PL  RKA VVA  +  +H+L VDL +  V+       +GYP M+ ++ + A      N+ 
Sbjct  126   PLFPRKATVVARVDDMSHVLTVDLTTREVTVEDTASHTGYPTMTLEEMTAATWVPLMNAD  185

Query  1750  FREAISTRGVEINDVVCSAAAPGWFGPEEEGRRITKVKCYTAQNTPNYYMRPIEGLLLTV  1571
             F   I  RGV++ D+ C   + GW+G  EE RR+ KV+CY+ ++T N+YMRPIEGL + V
Sbjct  186   FNRTIVQRGVDLTDLACLPLSTGWYGKVEEKRRLIKVQCYSTKDTVNFYMRPIEGLTVLV  245

Query  1570  DLDSGKVINVYDTHSPIPIPKAQGTDYRRDGIEHRAPGV-EPLKPISMEQPNGQSFRVED  1394
             DLD+ +V+ + D    IPIPKA  TDYR     H+   V + LKPIS+EQPNG+SF VED
Sbjct  246   DLDTKQVLEISDKGRSIPIPKAANTDYRYSA--HKPNEVLKLLKPISIEQPNGRSFTVED  303

Query  1393  GYIVKWASWEFHVKADQRAGIIISQATVFDPEAGKRRSVMYKGFASELFVPYMDVDEGWY  1214
              ++VKWA+WEFH+K D RAG+I+S+A V DP  G+ R VMYKGF SELFVPYMD  + WY
Sbjct  304   DHLVKWANWEFHLKPDARAGVIVSRAKVRDPNTGEFRDVMYKGFTSELFVPYMDPTDAWY  363

Query  1213  FRAFMDAGEFGLGATAMELVPLNDCPRHSHYIDGLFVDPDGRPVSQPNVICVFERYSGDI  1034
             F+ +MDAGE+G G  AM L PLNDCPR+++Y+DG+F   DG P  + N++CVFE Y+GDI
Sbjct  364   FKTYMDAGEYGFGLQAMPLEPLNDCPRNAYYMDGVFAAADGTPYVRSNMVCVFESYAGDI  423

Query  1033  AWRHSG---TGDADDDLIREARPKVSLVVRTTATVGNYDYIFDWEFQTDGSIRVTVGLSG  863
             AWRH+    TG      IRE RPKV+LVVR  A+V NYDYI DWEFQTDG IR  VGLSG
Sbjct  424   AWRHTECPITGMQ----IREVRPKVTLVVRMAASVANYDYIIDWEFQTDGLIRAKVGLSG  479

Query  862   IILAKGSPYEHINQFEIPRWDFPAGSLVSENTIGVAHDHFITFHLDMDVDGPTNSFVKVD  683
             I++ KG+ YE++NQ   P  +   G+L+SEN IGV HDH++TF+LDMDVDG  NSF+KV+
Sbjct  480   ILMVKGTSYENVNQVSSP--ENLHGTLLSENVIGVIHDHYVTFYLDMDVDGSDNSFLKVN  537

Query  682   LVKNYNIAGKIQRKSYWSPKRKVAKSENDAKIKLQLDKPSEFHVINPRHQSRLGNPSGYK  503
             L +  N   +  RKSY    + VAK+E DA++KL+L  PSEFHVINP  ++R+GNP GYK
Sbjct  538   LQREQNSPNESPRKSYLKATKTVAKTEKDAQVKLKLYDPSEFHVINPTKRTRVGNPVGYK  597

Query  502   IVPSATAASLLDLQDPPQLRAAFTNNQIWVTPYNRSEQWAGGLFTYQSHGDDTLAVWSNR  323
             +VP  TAASLLDL DPPQ R AFTNNQIWVTPYNRSEQWAGGL   QS G+DTLAVWS+R
Sbjct  598   LVPGGTAASLLDLDDPPQKRGAFTNNQIWVTPYNRSEQWAGGLLVCQSQGEDTLAVWSDR  657

Query  322   NRVIEKQDIVLWYTLGFHHLPCQEDFPVMPTVTSTFQLKPVNFFDRNPIIQANPNFAEDL  143
             +R IE +DIVLWYTLGFHH+PCQEDFP+MPTV+S+F LKPVNFF+ NPI++  PN   DL
Sbjct  658   DRPIENKDIVLWYTLGFHHIPCQEDFPIMPTVSSSFDLKPVNFFESNPILRTPPNVETDL  717

Query  142   PICRAG  125
             P+C A 
Sbjct  718   PVCVAA  723



>ref|XP_002872650.1| AT4g12290/T4C9_130 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH48909.1| AT4g12290/T4C9_130 [Arabidopsis lyrata subsp. lyrata]
Length=751

 Score =   778 bits (2009),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 377/675 (56%), Positives = 485/675 (72%), Gaps = 20/675 (3%)
 Frame = -1

Query  2113  QNNHFADRPMHPLDPLTIQEIERTRSILSSYQPF-SGSSLRIHSLSLDEPDKSEVLRWKR  1937
              ++HF+D P HPLDPLT+ EI + RSIL+++  F SG+   +H++ L+EPDK+ V  W++
Sbjct  75    NHDHFSDTPNHPLDPLTVVEINKVRSILNTHALFTSGTPHALHTVVLEEPDKNLVRHWEK  134

Query  1936  GNPLPTRKAFVVALSNGQAHLLVVDLGSGRV-SSHTRNPASGYPPMSADDASTALEATFS  1760
             GNPLP RKA V+A      H+L VD+ +GRV S ++    SGYP M+ ++ +      F+
Sbjct  135   GNPLPPRKASVIARVGPDTHVLTVDISTGRVDSENSPVSVSGYPMMTIEEMNAMTVVPFA  194

Query  1759  NSVFREAISTRGVEINDVVCSAAAPGWFGPEEEGRRITKVKCYTAQNTPNYYMRPIEGLL  1580
             N+ F   I +RG+ + DV+C   + GWFG +EE  R+ K +C+  Q TPN+YMRPIEGL 
Sbjct  195   NADFNRTIISRGINLTDVICFPISSGWFGNKEENARVIKSQCFLTQGTPNFYMRPIEGLT  254

Query  1579  LTVDLDSGKVINVYDTHSPIPIPKAQGTDYRRDGIEHRAPGVEPLKPISMEQPNGQSFRV  1400
             + VDLD+ +VI + DT   IPIP +  TDYR + +         L PIS+EQP G SF +
Sbjct  255   ILVDLDTKQVIEISDTGRAIPIPGSTNTDYRFEKLV-TTDKTRLLNPISIEQPRGPSFVI  313

Query  1399  EDGYIVKWASWEFHVKADQRAGIIISQATVFDPEAGKRRSVMYKGFASELFVPYMDVDEG  1220
             ED ++VKWA+WEFH+K D RAG++IS+  V DP+  + R VMYKGF SELFVPYMD  + 
Sbjct  314   EDNHLVKWANWEFHLKPDPRAGVVISRVRVHDPDTQETREVMYKGFVSELFVPYMDPSDA  373

Query  1219  WYFRAFMDAGEFGLGATAMELVPLNDCPRHSHYIDGLFVDPDGRPVSQPNVICVFERYSG  1040
             WYF+ +MDAGE+G G  AM LVPLNDCPR++ Y+DG+F   DG P  + N++C+FE Y+G
Sbjct  374   WYFKTYMDAGEYGFGLQAMPLVPLNDCPRNAAYMDGVFAAADGTPFVRENMVCIFESYAG  433

Query  1039  DIAWRHSG---TGDADDDLIREARPKVSLVVRTTATVGNYDYIFDWEFQTDGSIRVTVGL  869
             DI WRHS    TG      IRE RPKV+LVVR  A+VGNYDYI D+EFQTDG I+  VGL
Sbjct  434   DIGWRHSESPITGIP----IREVRPKVTLVVRMAASVGNYDYIIDYEFQTDGLIKAKVGL  489

Query  868   SGIILAKGSPYEHINQFEIPRW---DFPAGSLVSENTIGVAHDHFITFHLDMDVDGPTNS  698
             SGI++ KG+ Y++ NQ E  R    +   G+L+SEN IGV HDH++TF+LD+DVDGP NS
Sbjct  490   SGILMVKGTTYQNKNQVEKDREGNEEELHGTLLSENVIGVIHDHYVTFYLDLDVDGPDNS  549

Query  697   FVKVDLVKNYNIAGKIQRKSYWSPKRKVAKSENDAKIKLQLDKPSEFHVINPRHQSRLGN  518
             FVKV+L +     G+  RKSY    R +AK+E D +IKL L  PSEFHVIN    +R+GN
Sbjct  550   FVKVNLKRQETEPGESPRKSYLKAVRNIAKTEKDGQIKLSLYDPSEFHVINSGKTTRVGN  609

Query  517   PSGYKIVPSATAASLLDLQDPPQLRAAFTNNQIWVTPYNRSEQWAGGLFTYQSHGDDTLA  338
             P+GYK+VP  TAASLLD  DPPQ R AFTNNQIWVTPYN+SEQWAGGLFTYQSHGDDTLA
Sbjct  610   PTGYKVVPRTTAASLLDHDDPPQKRGAFTNNQIWVTPYNKSEQWAGGLFTYQSHGDDTLA  669

Query  337   VW----SNRNRV---IEKQDIVLWYTLGFHHLPCQEDFPVMPTVTSTFQLKPVNFFDRNP  179
             VW     N++ V   IE +DIV+WYTLGFHH+PCQEDFP+MPTV+S+F LKPVNFF+RNP
Sbjct  670   VWDRDIENKDIVVWYIENKDIVVWYTLGFHHIPCQEDFPIMPTVSSSFDLKPVNFFERNP  729

Query  178   IIQANPNFAEDLPIC  134
             I++A PNF  DLP+C
Sbjct  730   ILRAAPNFEHDLPVC  744



>ref|XP_003535840.1| PREDICTED: primary amine oxidase-like [Glycine max]
 gb|KHM99192.1| Primary amine oxidase [Glycine soja]
Length=734

 Score =   777 bits (2007),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 379/672 (56%), Positives = 488/672 (73%), Gaps = 11/672 (2%)
 Frame = -1

Query  2128  HDFKIQNNHFADRPMHPLDPLTIQEIERTRSILSSYQPF-SGSSLRIHSLSLDEPDKSEV  1952
             H  K Q+ H ++ P HPLDPLTIQE  + R+IL +Y  F S SS  ++S+ L+EPDK  V
Sbjct  65    HHHKNQH-HESEIPQHPLDPLTIQEFNKVRTILLNYPLFKSSSSYTLNSVVLEEPDKKLV  123

Query  1951  LRWKRGN-PLPTRKAFVVALSNGQAHLLVVDLGSGRVSSHTRN--PASGYPPMSADDAST  1781
             L+WK+G+ PLP RKA VVA   G +H+L VDL +G+V S        SGYP M+ +D   
Sbjct  124   LKWKKGDLPLP-RKASVVAYVKGDSHVLTVDLETGQVVSQEAITWSVSGYPTMTLEDMVG  182

Query  1780  ALEATFSNSVFREAISTRGVEINDVVCSAAAPGWFGPE-EEGRRITKVKCYTAQNTPNYY  1604
              LE    ++ F  +I+ RGV + D+ C   + GW+G + EE  R+ KV+CY+ + T N+Y
Sbjct  183   VLEVPLKSTEFNRSITKRGVNLADLACLPISSGWYGTQVEENTRLIKVQCYSKEGTVNFY  242

Query  1603  MRPIEGLLLTVDLDSGKVINVYDTHSPIPIPKAQGTDYRRDGIEHRAPGVEPLKPISMEQ  1424
             M+PIEG+   VD++  +V+++ D    IP+     TDYR    +     +  L PIS+EQ
Sbjct  243   MKPIEGVTALVDMNKKEVLSISDNGQNIPVANGINTDYRYSIQKLNGGELRMLNPISLEQ  302

Query  1423  PNGQSFRVEDGYIVKWASWEFHVKADQRAGIIISQATVFDPEAGKRRSVMYKGFASELFV  1244
             P G SF + +G++VKWA+WEFH++ D RAGIIISQA V DP+  K RSVMYKGF SELFV
Sbjct  303   PKGPSFTI-NGHLVKWANWEFHLRPDPRAGIIISQAKVRDPDTSKLRSVMYKGFTSELFV  361

Query  1243  PYMDVDEGWYFRAFMDAGEFGLGATAMELVPLNDCPRHSHYIDGLFVDPDGRPVSQPNVI  1064
             PYMD  + WYF+ +MDAGE+G G  AM L PLNDCP++++Y+DG+F   DG P  QPN+I
Sbjct  362   PYMDPTQDWYFKTYMDAGEYGFGLQAMPLDPLNDCPKNAYYMDGVFASSDGTPYLQPNMI  421

Query  1063  CVFERYSGDIAWRHSGTGDADDDLIREARPKVSLVVRTTATVGNYDYIFDWEFQTDGSIR  884
             C+FE Y+GDIAWRH+     D   + E RPKV+LVVR  A V NYDYI DWEFQTDG IR
Sbjct  422   CIFESYAGDIAWRHAECPITDLK-VTEVRPKVTLVVRMAAAVANYDYIVDWEFQTDGLIR  480

Query  883   VTVGLSGIILAKGSPYEHINQFEIPRWDFPAGSLVSENTIGVAHDHFITFHLDMDVDGPT  704
               VGLSGI++ KG+ YE+++Q  +P  ++  G+L+SEN IGV HDHFIT++LDMDVDG  
Sbjct  481   AKVGLSGILMVKGTTYENMDQ--VPNQEYLYGTLLSENIIGVIHDHFITYYLDMDVDGSD  538

Query  703   NSFVKVDLVKNYNIAGKIQRKSYWSPKRKVAKSENDAKIKLQLDKPSEFHVINPRHQSRL  524
             NSFV+V++ K     G+  RKSY    +KVAK+E DA+I+LQL  PSEFHV+NP  ++R+
Sbjct  539   NSFVEVNIKKQETSPGESPRKSYLKAVKKVAKTEKDAQIRLQLYDPSEFHVVNPLKKTRI  598

Query  523   GNPSGYKIVPSATAASLLDLQDPPQLRAAFTNNQIWVTPYNRSEQWAGGLFTYQSHGDDT  344
             GNP GYK+VP ATAASLLD +DPPQ RAAFTNNQIWVTPYN+SEQWAGGLF YQS GDDT
Sbjct  599   GNPVGYKLVPGATAASLLDPEDPPQKRAAFTNNQIWVTPYNKSEQWAGGLFAYQSKGDDT  658

Query  343   LAVWSNRNRVIEKQDIVLWYTLGFHHLPCQEDFPVMPTVTSTFQLKPVNFFDRNPIIQAN  164
             L VWSNR+R IE +DIVLWYT+GFHH+PCQED+PVMPTV+S+F LKP NFF+RNPI+   
Sbjct  659   LQVWSNRDRPIENKDIVLWYTIGFHHIPCQEDYPVMPTVSSSFDLKPANFFERNPILGVP  718

Query  163   PNFAEDLPICRA  128
             PNF +DLP+C+A
Sbjct  719   PNFEDDLPVCKA  730



>ref|XP_007148902.1| hypothetical protein PHAVU_005G023600g [Phaseolus vulgaris]
 gb|ESW20896.1| hypothetical protein PHAVU_005G023600g [Phaseolus vulgaris]
Length=731

 Score =   776 bits (2004),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 376/664 (57%), Positives = 485/664 (73%), Gaps = 15/664 (2%)
 Frame = -1

Query  2104  HFADRPMHPLDPLTIQEIERTRSILSSYQPFSGSS-LRIHSLSLDEPDKSEVLRWKRGNP  1928
             H +  P HPLDPLTIQE    R+ILSS   F+ SS   ++S+ L EPDK  V +WK+G+P
Sbjct  74    HESQTPQHPLDPLTIQEFNNIRTILSSIPLFNSSSPYTLNSIVLQEPDKKLVQKWKQGDP  133

Query  1927  LPTRKAFVVALSNGQAHLLVVDLGSGRVSSHTRNPASGYPPMSADDASTALEATFSNSVF  1748
             L  RKA VVAL  G +H+L VDL + +V+SH     SGYP ++A+D    LEA   +  F
Sbjct  134   LLPRKASVVALVKGVSHVLTVDLETDKVTSHETGSVSGYPIVTAEDLLGVLEAPLRSPQF  193

Query  1747  REAISTRGVEINDVVCSAAAPGWF-GPEEEGRRITKVKCYTAQNTPNYYMRPIEGLLLTV  1571
                 + RGV++ ++VC   + GW+   EEE RR+ KV+CY+ + T N+YM+PIEG+   V
Sbjct  194   NSLFTKRGVDLAELVCLPISSGWYEKAEEENRRLMKVQCYSKEGTVNFYMKPIEGVTALV  253

Query  1570  DLDSGKVINVYDTHSPIPIPKAQGTDYRRDGIEHRAPGVEPLKPISMEQPNGQSFRVEDG  1391
             D+D  +V+ + D    IP+     TDYR   I+     +  L PIS+EQP G SF V DG
Sbjct  254   DMDRKEVVAISDDGQNIPVANGSNTDYRY-SIQKLNGELRLLNPISLEQPKGPSFSV-DG  311

Query  1390  YIVKWASWEFHVKADQRAGIIISQATVFDPEAGKRRSVMYKGFASELFVPYMDVDEGWYF  1211
             ++VKWA+WEFHV+ D RAG IISQ  V DP+  K R+VMYKGF SELFVPYMD  EGWYF
Sbjct  312   HLVKWANWEFHVRPDPRAGTIISQVKVRDPDTSKLRNVMYKGFTSELFVPYMDPTEGWYF  371

Query  1210  RAFMDAGEFGLGATAMELVPLNDCPRHSHYIDGLFVDPDGRPVSQPNVICVFERYSGDIA  1031
             + +MDAGE+GL   AM L PLNDCPR+++Y+DG+F   DG P  QPN+IC+FE Y+GDIA
Sbjct  372   KTYMDAGEYGL--QAMPLNPLNDCPRNAYYMDGVFASSDGTPYLQPNMICIFESYAGDIA  429

Query  1030  WRHSG---TGDADDDLIREARPKVSLVVRTTATVGNYDYIFDWEFQTDGSIRVTVGLSGI  860
             WRH+    TG      + E+RPKV+LVVR  AT+GNYDYI DWEFQTDG IR  VGLSG+
Sbjct  430   WRHAECPITGLR----VTESRPKVTLVVRMAATLGNYDYIMDWEFQTDGLIRAKVGLSGM  485

Query  859   ILAKGSPYEHINQFEIPRWDFPAGSLVSENTIGVAHDHFITFHLDMDVDGPTNSFVKVDL  680
             ++ KG+ YE+++Q  +P  D+  G+L+SEN IGV HDH++T++LDMDVDG  NSFV+V +
Sbjct  486   LMVKGTTYENMDQ--VPENDYLYGTLLSENIIGVIHDHYVTYYLDMDVDGSDNSFVRVKM  543

Query  679   VKNYNIAGKIQRKSYWSPKRKVAKSENDAKIKLQLDKPSEFHVINPRHQSRLGNPSGYKI  500
              K    +G+  RKSY    ++VAK+E +A+I+L+L +PSEFHV+NP  ++R+GNP GYK+
Sbjct  544   KKEETSSGESPRKSYLKAVKEVAKTEKEAQIRLKLYEPSEFHVVNPLKKTRVGNPVGYKL  603

Query  499   VPSATAASLLDLQDPPQLRAAFTNNQIWVTPYNRSEQWAGGLFTYQSHGDDTLAVWSNRN  320
             VP  TAASLLD +DPPQ RAAFTNNQIWVTPYN++EQWAGGLF YQS GDDTL VWS+R+
Sbjct  604   VPGGTAASLLDPEDPPQKRAAFTNNQIWVTPYNKTEQWAGGLFVYQSKGDDTLQVWSDRD  663

Query  319   RVIEKQDIVLWYTLGFHHLPCQEDFPVMPTVTSTFQLKPVNFFDRNPIIQANPNFAEDLP  140
             R IE +DIVLWYT+GFHH+PCQED+PVMPTV+S+F LKPVNFF+RNPI+   PNF  DLP
Sbjct  664   RPIENKDIVLWYTIGFHHIPCQEDYPVMPTVSSSFDLKPVNFFERNPILSVPPNFKNDLP  723

Query  139   ICRA  128
             +C+A
Sbjct  724   VCKA  727



>ref|XP_006289346.1| hypothetical protein CARUB_v10002830mg [Capsella rubella]
 gb|EOA22244.1| hypothetical protein CARUB_v10002830mg [Capsella rubella]
Length=740

 Score =   775 bits (2001),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 373/669 (56%), Positives = 479/669 (72%), Gaps = 8/669 (1%)
 Frame = -1

Query  2113  QNNHFADRPMHPLDPLTIQEIERTRSILSSYQPF-SGSSLRIHSLSLDEPDKSEVLRWKR  1937
              ++H +D P HPLDPLT+ EI + RSILSS+  F S +    HS+ L+EPDK+ V +W++
Sbjct  70    NHDHVSDTPNHPLDPLTVMEINKVRSILSSHALFASPAPHSFHSIVLEEPDKNLVRQWEK  129

Query  1936  GNPLPTRKAFVVALSNGQAHLLVVDLGSGRVSSHTRNP--ASGYPPMSADDASTALEATF  1763
             G  LP RKA V+A     +H+L VD+ +  V     +P  A GYP M+ ++ ++A  A F
Sbjct  130   GTTLPPRKASVIARVGADSHVLTVDISTSYVDL-VDSPVHAPGYPIMTLEEMASATWAPF  188

Query  1762  SNSVFREAISTRGVEINDVVCSAAAPGWFGPEEEGRRITKVKCYTAQNTPNYYMRPIEGL  1583
             +N  F   I +RGV++ DV+C   + GWF  +E  RR+ K++C++ Q T N+YMRPIEGL
Sbjct  189   TNEDFNRTILSRGVDLTDVICFPISSGWFDNKEGNRRLIKIQCFSTQGTVNFYMRPIEGL  248

Query  1582  LLTVDLDSGKVINVYDTHSPIPIPKAQGTDYRRDGIEHRAPGVEPLKPISMEQPNGQSFR  1403
              L  DLD  +++   DT   IPIP +  TDYR   + +R     PL PIS+EQP G SF 
Sbjct  249   TLLFDLDIKQILETTDTGRSIPIPGSTNTDYRFSNLPNRD-KTRPLNPISIEQPRGPSFV  307

Query  1402  VEDGYIVKWASWEFHVKADQRAGIIISQATVFDPEAGKRRSVMYKGFASELFVPYMDVDE  1223
             +ED ++VKWA+WEFH+K D RAG++IS   V DP+    R VMYKGF SELFVPYMD  E
Sbjct  308   IEDNHLVKWANWEFHLKPDPRAGLVISTVKVHDPDTEVSREVMYKGFVSELFVPYMDPSE  367

Query  1222  GWYFRAFMDAGEFGLGATAMELVPLNDCPRHSHYIDGLFVDPDGRPVSQPNVICVFERYS  1043
              WYF+ +MDAGE+G G  AM L PLNDCPR++ Y+DG+F   DG P  + N+ICVFERY+
Sbjct  368   AWYFKTYMDAGEYGFGLQAMPLEPLNDCPRNAVYMDGIFAAADGTPYVRENMICVFERYA  427

Query  1042  GDIAWRHSGTGDADDDLIREARPKVSLVVRTTATVGNYDYIFDWEFQTDGSIRVTVGLSG  863
             GDI WRHS         +RE RPKV+LVVR  ++VGNYDYI D+EFQTDG +R  VGLSG
Sbjct  428   GDIGWRHSENPVTGMPPLREVRPKVTLVVRMVSSVGNYDYIIDYEFQTDGLMRAKVGLSG  487

Query  862   IILAKGSPYEHINQFEIPRW---DFPAGSLVSENTIGVAHDHFITFHLDMDVDGPTNSFV  692
             I++ KG+ Y++ NQ +  +    +   G+++SEN IGV HDH++TF+LD+DVDGP NSFV
Sbjct  488   ILMVKGTTYKNKNQVKKDKEGNEEELYGTILSENVIGVIHDHYVTFYLDLDVDGPNNSFV  547

Query  691   KVDLVKNYNIAGKIQRKSYWSPKRKVAKSENDAKIKLQLDKPSEFHVINPRHQSRLGNPS  512
             KV+L +     G+  RKSY +  +  AK+E D +IKL L  PSE+HVIN    +R+GNP+
Sbjct  548   KVNLKRQQTEPGESPRKSYMNVVKNTAKTEKDGQIKLSLYDPSEYHVINSGKTTRVGNPT  607

Query  511   GYKIVPSATAASLLDLQDPPQLRAAFTNNQIWVTPYNRSEQWAGGLFTYQSHGDDTLAVW  332
             GYK+VP ATAASLLD  D PQ R AFTNNQIWVTPYN+SEQWAGGLFTYQSHGDDTLAVW
Sbjct  608   GYKVVPRATAASLLDRDDLPQKRGAFTNNQIWVTPYNKSEQWAGGLFTYQSHGDDTLAVW  667

Query  331   SNRNRVIEKQDIVLWYTLGFHHLPCQEDFPVMPTVTSTFQLKPVNFFDRNPIIQANPNFA  152
             SNR+R IE +DIV+WYTLGFHH+PCQEDFP+MPTV+S+F LKPVNFF+RNPI+ A PNF 
Sbjct  668   SNRDRDIENKDIVVWYTLGFHHIPCQEDFPIMPTVSSSFDLKPVNFFERNPILSATPNFE  727

Query  151   EDLPICRAG  125
              DLP+C AG
Sbjct  728   HDLPVCGAG  736



>ref|XP_011081126.1| PREDICTED: primary amine oxidase-like [Sesamum indicum]
Length=720

 Score =   774 bits (1998),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 371/720 (52%), Positives = 508/720 (71%), Gaps = 26/720 (4%)
 Frame = -1

Query  2239  CLFYMASSMLIFL--------------QVNSCLSFESSNASINNLESLLGIHDFKIQNNH  2102
             CLF++ S +L+ L              ++  C +  +   + N +  L   +   ++++H
Sbjct  9     CLFFICSVVLLLLFTAFNLTSPPSDKSELLECATNSAWCTAKNRI--LRHPNPAPLRHDH  66

Query  2101  FADRPMHPLDPLTIQEIERTRSILSSYQPFSGSSLRIHSLSLDEPDKSEVLRWKRGNPLP  1922
              AD P HPLDPLTIQE+ + + ++ S+  F  S   +HSL L++P+K  VL+W++G+PLP
Sbjct  67    TADVPHHPLDPLTIQEMNKVQKVIKSF--FGKSVYSVHSLVLEDPEKQVVLKWQKGDPLP  124

Query  1921  TRKAFVVALSNGQAHLLVVDLGSGRVSSHTRNPASGYPPMSADDASTALEATFSNSVFRE  1742
              RKA V+A ++ + +LL VD+ SG V  H  +  SG+P ++ +D    + A  SN+ F  
Sbjct  125   PRKASVIARASAKNYLLTVDVESGEVVEHDTSHISGFPLVTLEDMQNVIFAPLSNAHFNR  184

Query  1741  AISTRGVEINDVVCSAAAPGWFGPEEEGRRITKVKCYTAQNTPNYYMRPIEGLLLTVDLD  1562
              I  RGV++NDV C   +PGWFG  E+GRR+ K++C+T ++T N+YMRPIEG+++  DLD
Sbjct  185   TILERGVDLNDVACLPFSPGWFGKAEDGRRLVKLECFTMKDTANFYMRPIEGIIVITDLD  244

Query  1561  SGKVINVYDTHSPIPIPKAQGTDYRRDGIEHRAPGVEPL-KPISMEQPNGQSFRVEDGYI  1385
             + +VI + D    IPIPKA GTDYR   +     GV  L  PISMEQPNG +F VED ++
Sbjct  245   TSEVIEIIDKGKHIPIPKAAGTDYR---LSAENGGVIKLPNPISMEQPNGPNFVVEDEHL  301

Query  1384  VKWASWEFHVKADQRAGIIISQATVFDPEAGKRRSVMYKGFASELFVPYMDVDEGWYFRA  1205
             VKWA+WEFH+K D RAG++IS+A V DPE G  R+VMY+GF+SELFVPYMD +E WYF+ 
Sbjct  302   VKWANWEFHLKPDPRAGVMISRARVRDPETGDLRNVMYQGFSSELFVPYMDPEEAWYFKT  361

Query  1204  FMDAGEFGLGATAMELVPLNDCPRHSHYIDGLFVDPDGRPVSQPNVICVFERYSGDIAWR  1025
             +MDAGE+G G  A+ L PLNDCPR++ ++D +F   DG P  + N++C+FERY+GD AWR
Sbjct  362   YMDAGEYGFGLQALSLDPLNDCPRNAKFMDAIFAASDGTPYVRSNMVCIFERYAGDAAWR  421

Query  1024  HSGTGDADDDLIREARPKVSLVVRTTATVGNYDYIFDWEFQTDGSIRVTVGLSGIILAKG  845
             H+ +      LI EARPKVSLVVR  A++ NYDYI DWEF  DG I V V L+GI++ KG
Sbjct  422   HTES-PITGKLILEARPKVSLVVRMVASLANYDYIVDWEFHADGLIHVKVSLTGIVIVKG  480

Query  844   SPYEHINQFEIPRWDFPAGSLVSENTIGVAHDHFITFHLDMDVDGPTNSFVKVDLVKNYN  665
             + Y ++NQ  +   +   G+L+++N IGV HDH+I F+LDMD+DG  NSFV V L + Y 
Sbjct  481   TSYVNMNQ--VKENEDIYGTLLADNIIGVVHDHYINFYLDMDIDGLDNSFVNVHLQREYT  538

Query  664   IAGKIQRKSYWSPKRKVAKSENDAKIKLQLDKPSEFHVINPRHQSRLGNPSGYKIVPSAT  485
               G   RKSY    + VAK+E +A+IKL+L  PSEFHVINP  ++++GNP GYK+VP+ T
Sbjct  539   -HGTSPRKSYMKVNKTVAKTEKEAQIKLKLYDPSEFHVINPNKKTKVGNPVGYKVVPAGT  597

Query  484   AASLLDLQDPPQLRAAFTNNQIWVTPYNRSEQWAGGLFTYQSHGDDTLAVWSNRNRVIEK  305
             AASLLD +DPPQ R+AFTNNQIWVT YN+SE+W+GGLF YQSHG+DT+ VWS+R+R IE 
Sbjct  598   AASLLDPEDPPQKRSAFTNNQIWVTRYNKSEKWSGGLFAYQSHGEDTIQVWSDRDRPIEN  657

Query  304   QDIVLWYTLGFHHLPCQEDFPVMPTVTSTFQLKPVNFFDRNPIIQANPNFAEDLPICRAG  125
             +DIVLWYTLGFHH+PCQEDFP+MPTV+S F LKPVNFF+RNP+++  P    +LP+C+A 
Sbjct  658   KDIVLWYTLGFHHVPCQEDFPIMPTVSSGFDLKPVNFFERNPVLRIAPYVENELPVCKAA  717



>ref|XP_010455667.1| PREDICTED: primary amine oxidase-like [Camelina sativa]
Length=741

 Score =   774 bits (1999),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 372/668 (56%), Positives = 480/668 (72%), Gaps = 13/668 (2%)
 Frame = -1

Query  2113  QNNHFADRPMHPLDPLTIQEIERTRSILSSYQPF-SGSSLRIHSLSLDEPDKSEVLRWKR  1937
              ++H +D P HPLDPLT+ E+ + RSIL+S+  F SG+    H++ L+EPDK+ V  W++
Sbjct  72    NHDHASDTPNHPLDPLTVVELNKVRSILTSHALFTSGTPHAFHTVVLEEPDKNLVRLWEK  131

Query  1936  GNPLPTRKAFVVALSNGQAHLLVVDLGSGRVSS-HTRNPASGYPPMSADDASTALEATFS  1760
             GNPLP RKA V+A      H+L VD+ +G+V S +     SGYP M+ ++ +      FS
Sbjct  132   GNPLPPRKASVIARVGTDTHVLTVDISTGKVESENIPVNVSGYPMMTIEEMNGMTVLPFS  191

Query  1759  NSVFREAISTRGVEINDVVCSAAAPGWFGPEEEGRRITKVKCYTAQNTPNYYMRPIEGLL  1580
             N+ F   I +RGV + DV+C   + GW+G +E+  R+ K +C+  Q T N+YMRPIEGL 
Sbjct  192   NAEFNRTILSRGVNLTDVICFPISCGWYGSKEDNARVIKNQCFLTQGTANFYMRPIEGLT  251

Query  1579  LTVDLDSGKVINVYDTHSPIPIPKAQGTDYRRDGIEHRAPGVEPLKPISMEQPNGQSFRV  1400
             + ++LD+ KVI + DT   IPIP +  TDYR + +         L PIS+EQP G SF +
Sbjct  252   ILINLDTKKVIEISDTGRAIPIPGSTNTDYRFEKLV-TTDKTRRLNPISIEQPRGPSFVI  310

Query  1399  EDGYIVKWASWEFHVKADQRAGIIISQATVFDPEAGKRRSVMYKGFASELFVPYMDVDEG  1220
             ED ++VKWA+WEFH+K D RAG+++S+  V DP+  + R VMYKGF SELFVPYMD  + 
Sbjct  311   EDNHLVKWANWEFHLKPDPRAGVVLSRVRVHDPDTQETRDVMYKGFVSELFVPYMDPSDA  370

Query  1219  WYFRAFMDAGEFGLGATAMELVPLNDCPRHSHYIDGLFVDPDGRPVSQPNVICVFERYSG  1040
             WYF+ +MDAGE+G G  AM LVPLNDCPR++ Y+DG+F   DG P  + N++C+FE Y+G
Sbjct  371   WYFKTYMDAGEYGFGLQAMPLVPLNDCPRNAAYMDGVFTAADGTPFVRENMVCIFESYAG  430

Query  1039  DIAWRHSG---TGDADDDLIREARPKVSLVVRTTATVGNYDYIFDWEFQTDGSIRVTVGL  869
             DI WRHS    TG      IRE RPKV+LVVR  A+VGNYDYI D+EFQTDG I V VGL
Sbjct  431   DIGWRHSESPITGLP----IREVRPKVTLVVRMAASVGNYDYIIDYEFQTDGLIEVKVGL  486

Query  868   SGIILAKGSPYEHINQFEIPR---WDFPAGSLVSENTIGVAHDHFITFHLDMDVDGPTNS  698
             SGI++ KG+ Y++  Q E  +    +   G+L+SEN IGV HDH++TF+LD+DVDGP NS
Sbjct  487   SGILMVKGTTYQNKKQVEKDKDGNEEELHGTLLSENVIGVIHDHYVTFYLDLDVDGPDNS  546

Query  697   FVKVDLVKNYNIAGKIQRKSYWSPKRKVAKSENDAKIKLQLDKPSEFHVINPRHQSRLGN  518
             FVKV+L +     G+  RKSY    R +AK+E D +IKL L  PSEFHVIN    +R+GN
Sbjct  547   FVKVNLKRQETEPGESPRKSYLKAVRNIAKTEKDGQIKLSLYDPSEFHVINSGKTTRVGN  606

Query  517   PSGYKIVPSATAASLLDLQDPPQLRAAFTNNQIWVTPYNRSEQWAGGLFTYQSHGDDTLA  338
             P+GYK+VP ATAASLLD  DPPQ R AFTNNQIWVTPYN+SEQWAGGLFTYQSHGDDTLA
Sbjct  607   PTGYKVVPRATAASLLDHDDPPQKRGAFTNNQIWVTPYNKSEQWAGGLFTYQSHGDDTLA  666

Query  337   VWSNRNRVIEKQDIVLWYTLGFHHLPCQEDFPVMPTVTSTFQLKPVNFFDRNPIIQANPN  158
             VWS+R+R IE +DIV+WYTLGFHH+PCQEDFP+MPTV+S+F LKP NFF+RNPI+ A PN
Sbjct  667   VWSDRDRDIENKDIVVWYTLGFHHIPCQEDFPIMPTVSSSFDLKPTNFFERNPILGAAPN  726

Query  157   FAEDLPIC  134
             F  DLP+C
Sbjct  727   FEHDLPVC  734



>gb|EPS58103.1| primary amine oxidase [Genlisea aurea]
Length=722

 Score =   772 bits (1994),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 367/666 (55%), Positives = 480/666 (72%), Gaps = 10/666 (2%)
 Frame = -1

Query  2116  IQNNHFADRPMHPLDPLTIQEIERTRSILSSYQPFSGSSLRIHSLSLDEPDKSEVLRWKR  1937
             +  NH +D   HPLDPLT+ EI   R  L S+  F GS   +HSL LDEPDK  V RWK+
Sbjct  61    LSANHSSDVAGHPLDPLTLTEIAGVRDRLVSF--FGGSGFSVHSLVLDEPDKDAVRRWKK  118

Query  1936  GNPLPTRKAFVVALSNGQAHLLVVDLGSGRVSSHTRNPASGYPPMSADDASTALEATFSN  1757
             G+PLP R+A V+A + G+ +LL VDL SG VS    +  SG+P ++ ++    + A F N
Sbjct  119   GDPLPQRQAAVIARAAGKNYLLTVDLESGAVSEQDSSHVSGFPLIALEEMQAVIWAPFKN  178

Query  1756  SVFREAISTRGVEINDVVCSAAAPGWFGPEEEGRRITKVKCYTAQNTPNYYMRPIEGLLL  1577
               F  +I  RG+++NDVVC   +PGWFG +E+G+R+ K++C+T ++T N+YMRPIEG++ 
Sbjct  179   PDFNNSIIERGLDLNDVVCLPFSPGWFGDKEDGKRLVKLECFTTKDTANFYMRPIEGIIA  238

Query  1576  TVDLDSGKVINVYD--THSPIPIPKAQGTDYRRDGIEHRAPGVEPLKPISMEQPNGQSFR  1403
               D+D  +V+   D      IPIPKA GTDYR       +P  +   P+SMEQPNG +F 
Sbjct  239   VTDIDENEVVEFIDRGKKKHIPIPKADGTDYRLSS--DNSPVFKLPNPVSMEQPNGPNFV  296

Query  1402  VEDGYIVKWASWEFHVKADQRAGIIISQATVFDPEAGKRRSVMYKGFASELFVPYMDVDE  1223
             +E  ++VKWA+WEFH+K D RAG+++SQA V DP+ G  R+VMYKGFASELFVPYMD +E
Sbjct  297   IEGNHLVKWANWEFHLKPDPRAGVVVSQARVRDPDTGLLRNVMYKGFASELFVPYMDPEE  356

Query  1222  GWYFRAFMDAGEFGLGATAMELVPLNDCPRHSHYIDGLFVDPDGRPVSQPNVICVFERYS  1043
              WYF+ +MDAGE+G G  A+ L PLNDCPR++ Y+D +F   DG P  + N+IC+FERY+
Sbjct  357   AWYFKTYMDAGEYGFGLQALALDPLNDCPRNAVYMDAVFAASDGSPYVRSNMICIFERYA  416

Query  1042  GDIAWRHSGTGDADDDLIREARPKVSLVVRTTATVGNYDYIFDWEFQTDGSIRVTVGLSG  863
             GD AWRH+       D+IREARPK+SLV R  A++ NYDYI DWEF  DG I V V L+G
Sbjct  417   GDAAWRHT-EAPIVGDMIREARPKISLVARMVASLANYDYIIDWEFHADGLIHVKVSLTG  475

Query  862   IILAKGSPYEHINQFEIPRWDFPAGSLVSENTIGVAHDHFITFHLDMDVDGPTNSFVKVD  683
             I++ KG+ Y + NQ  +   +   G+L+S+N IGV HDH++ FHLDMDVDGP NSF+ V 
Sbjct  476   IVIVKGTSYVNTNQ--VNENEDVYGTLLSDNIIGVVHDHYVNFHLDMDVDGPDNSFLNVH  533

Query  682   LVKNYNIAGKIQRKSYWSPKRKVAKSENDAKIKLQLDKPSEFHVINPRHQSRLGNPSGYK  503
             L + Y   GK  RKSY   +++VAK+E +A+IKL+L  PSEFHVINP  ++++GNP GYK
Sbjct  534   LKRAYT-DGKSPRKSYMKVEKQVAKTEKEAQIKLKLYDPSEFHVINPNKRTKVGNPVGYK  592

Query  502   IVPSATAASLLDLQDPPQLRAAFTNNQIWVTPYNRSEQWAGGLFTYQSHGDDTLAVWSNR  323
             IVP+ TAASLLD +DPPQ RAAFTNNQIWVT YNRS+QW+GGLF YQSHG+DTL VWS+R
Sbjct  593   IVPAGTAASLLDPEDPPQKRAAFTNNQIWVTGYNRSQQWSGGLFAYQSHGEDTLQVWSDR  652

Query  322   NRVIEKQDIVLWYTLGFHHLPCQEDFPVMPTVTSTFQLKPVNFFDRNPIIQANPNFAEDL  143
             +  IE +DIVLWYTLGFHH+PCQEDFP+MPTV+S F LKPVNFF+RNP+++  P     L
Sbjct  653   DGPIENRDIVLWYTLGFHHVPCQEDFPIMPTVSSGFDLKPVNFFERNPVLRVAPYDDNQL  712

Query  142   PICRAG  125
             P+C+A 
Sbjct  713   PVCKAA  718



>gb|EYU30446.1| hypothetical protein MIMGU_mgv1a002018mg [Erythranthe guttata]
Length=726

 Score =   771 bits (1990),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 351/664 (53%), Positives = 479/664 (72%), Gaps = 8/664 (1%)
 Frame = -1

Query  2116  IQNNHFADRPMHPLDPLTIQEIERTRSILSSYQPFSGSSLRIHSLSLDEPDKSEVLRWKR  1937
             ++NNH  D P HPLDPLTI E+ + + ++ S   F GS   +HSL L++PDKS V  W +
Sbjct  68    LRNNHTEDVPHHPLDPLTITEMNKVQKVIKS--KFDGSVYSVHSLVLEDPDKSVVRAWTK  125

Query  1936  GNPLPTRKAFVVALSNGQAHLLVVDLGSGRVSSHTRNPASGYPPMSADDASTALEATFSN  1757
             G+ LPTRKA V+A S G  +LL VD+ SG V  H  +  SG+P ++ +D    +   F+N
Sbjct  126   GDALPTRKASVMARSAGTNYLLTVDVESGDVVEHDTSGISGFPLVTLEDMQNVMSVPFTN  185

Query  1756  SVFREAISTRGVEINDVVCSAAAPGWFGPEEEGRRITKVKCYTAQNTPNYYMRPIEGLLL  1577
             + F   I  RGV++N+V C   +PGWFG  E+GRR+ K++C+T ++T N+YMRPIEG+++
Sbjct  186   AHFNRTIVERGVDLNEVACLPFSPGWFGKNEDGRRLVKLECFTTKDTANFYMRPIEGIII  245

Query  1576  TVDLDSGKVINVYDTHSPIPIPKAQGTDYRRDGIEHRAPGVEPLKPISMEQPNGQSFRVE  1397
               DLD+ +V+ + D    IPIPKA G+DYR +     +  ++   PISMEQPNG +F +E
Sbjct  246   VTDLDAMEVVEIVDKGKHIPIPKAAGSDYRLNA--ENSATIKLASPISMEQPNGPNFVIE  303

Query  1396  DGYIVKWASWEFHVKADQRAGIIISQATVFDPEAGKRRSVMYKGFASELFVPYMDVDEGW  1217
             + ++VKWA+WEFH++ D R+G++IS+A + DP+ G  R +MY+GFASELFVPYMD +E W
Sbjct  304   NDHLVKWANWEFHLRPDPRSGVMISEAKMRDPDTGVLRDIMYQGFASELFVPYMDPEEAW  363

Query  1216  YFRAFMDAGEFGLGATAMELVPLNDCPRHSHYIDGLFVDPDGRPVSQPNVICVFERYSGD  1037
             YF+ +MDAGE+G G  A+ L PLNDCPR++ Y+D +F   DG P  + N++C+FERYSGD
Sbjct  364   YFKTYMDAGEYGFGLQALALDPLNDCPRNAEYMDAVFAASDGTPYVRENMVCIFERYSGD  423

Query  1036  IAWRHSGTGDADDDLIREARPKVSLVVRTTATVGNYDYIFDWEFQTDGSIRVTVGLSGII  857
              AWRH+ +      LIREARPKV+LV R  A++ NYDY+ DWEF  DG I + V L+GI+
Sbjct  424   AAWRHTES-PITGKLIREARPKVTLVARYVASLANYDYVMDWEFHADGLIHIKVSLTGIV  482

Query  856   LAKGSPYEHINQFEIPRWDFPAGSLVSENTIGVAHDHFITFHLDMDVDGPTNSFVKVDLV  677
             + KG+ Y ++NQ       +  G+L+S+N IGV HDH++ F+LDMD+DG  NSFV V L 
Sbjct  483   IVKGTSYVNMNQVNADEELY--GTLLSDNIIGVVHDHYVNFYLDMDIDGSDNSFVNVHLQ  540

Query  676   KNYNIAGKIQRKSYWSPKRKVAKSENDAKIKLQLDKPSEFHVINPRHQSRLGNPSGYKIV  497
             + Y   GK  R SY    + VAK+E +A+IKL+L  PSEFHV+NP   +++GNP GYK+V
Sbjct  541   REYT-KGKSPRMSYMKVNKTVAKTEKEAQIKLKLSDPSEFHVVNPNKHTKVGNPVGYKVV  599

Query  496   PSATAASLLDLQDPPQLRAAFTNNQIWVTPYNRSEQWAGGLFTYQSHGDDTLAVWSNRNR  317
             P+ TAASLLD  DPPQ R+AFTNNQIWVT YN+SE+W+GGLF YQSHG+DTL VWS+R+R
Sbjct  600   PAGTAASLLDPADPPQKRSAFTNNQIWVTQYNKSEKWSGGLFAYQSHGEDTLQVWSDRDR  659

Query  316   VIEKQDIVLWYTLGFHHLPCQEDFPVMPTVTSTFQLKPVNFFDRNPIIQANPNFAEDLPI  137
              IE +DIVLWYTLGFHH+PCQED+P+MPTV++ F LKPVNFF+RNP+++  P    DLP+
Sbjct  660   SIENKDIVLWYTLGFHHVPCQEDYPIMPTVSAGFDLKPVNFFERNPVLRIAPYVESDLPV  719

Query  136   CRAG  125
             C+A 
Sbjct  720   CKAA  723



>ref|XP_010434239.1| PREDICTED: primary amine oxidase-like [Camelina sativa]
Length=759

 Score =   772 bits (1993),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 371/667 (56%), Positives = 476/667 (71%), Gaps = 10/667 (1%)
 Frame = -1

Query  2113  QNNHFADRPMHPLDPLTIQEIERTRSILSSYQPF-SGSSLRIHSLSLDEPDKSEVLRWKR  1937
              ++H +D P HPLDPLT+ E  + RSIL+S+  F SG+    H++ L+EPDK+ V  W++
Sbjct  89    NHDHASDTPNHPLDPLTVVEFNKVRSILTSHALFTSGTPHAFHTIVLEEPDKNLVRLWEK  148

Query  1936  GNPLPTRKAFVVALSNGQAHLLVVDLGSGRVSSHTRNPA--SGYPPMSADDASTALEATF  1763
             GN LP RKA V+A      H+L VD+ +G+V S   +P   SGYP M+ ++ +      F
Sbjct  149   GNSLPPRKASVIARVGTNTHVLTVDISTGKVESEN-SPVNVSGYPMMTIEEMNDMTVLPF  207

Query  1762  SNSVFREAISTRGVEINDVVCSAAAPGWFGPEEEGR-RITKVKCYTAQNTPNYYMRPIEG  1586
             SN+ F   I +RGV + DV+C   + GW+G +E+   R+ K +C+  Q T N+YMRPIEG
Sbjct  208   SNAEFNRTILSRGVNLTDVICYPISCGWYGSKEDNNARVIKNQCFLTQGTANFYMRPIEG  267

Query  1585  LLLTVDLDSGKVINVYDTHSPIPIPKAQGTDYRRDGIEHRAPGVEPLKPISMEQPNGQSF  1406
             L + +DLD  KVI + DT   IPIP +  TDYR + +         L PIS+EQP G SF
Sbjct  268   LTILIDLDKKKVIEISDTGRAIPIPGSTNTDYRFEKLV-TTDKTRRLNPISIEQPRGPSF  326

Query  1405  RVEDGYIVKWASWEFHVKADQRAGIIISQATVFDPEAGKRRSVMYKGFASELFVPYMDVD  1226
              +ED ++VKWA+WEFH+K D RAG+++S+  V DP+  + R VMYKGF SELFVPYMD  
Sbjct  327   VIEDNHLVKWANWEFHLKPDPRAGVVLSRVRVHDPDTQETRDVMYKGFVSELFVPYMDPS  386

Query  1225  EGWYFRAFMDAGEFGLGATAMELVPLNDCPRHSHYIDGLFVDPDGRPVSQPNVICVFERY  1046
             + WYF+ +MDAGE+G G  AM LVPLNDCPR++ Y+DG+F   DG P  + N++C+FE Y
Sbjct  387   DAWYFKTYMDAGEYGFGLQAMPLVPLNDCPRNAAYMDGVFAAADGTPFVRENMVCIFESY  446

Query  1045  SGDIAWRHSGTGDADDDLIREARPKVSLVVRTTATVGNYDYIFDWEFQTDGSIRVTVGLS  866
             +GDI WRHS +       IRE RPKV+LVVR  A+VGNYDYI D+EFQTDG I+  VGLS
Sbjct  447   AGDIGWRHSES-PITGLRIREVRPKVTLVVRMAASVGNYDYIIDYEFQTDGLIKAKVGLS  505

Query  865   GIILAKGSPYEHINQFEIPRWDFPA---GSLVSENTIGVAHDHFITFHLDMDVDGPTNSF  695
             GI++ KG+ Y++ NQ E  +        G+L+SEN IGV HDH++TF+LD+DVDGP NSF
Sbjct  506   GILMVKGTTYQNKNQVEKDKEGNEKELHGTLLSENVIGVIHDHYVTFYLDLDVDGPDNSF  565

Query  694   VKVDLVKNYNIAGKIQRKSYWSPKRKVAKSENDAKIKLQLDKPSEFHVINPRHQSRLGNP  515
             VKV+L +     G+  RKSY    R +AK+E D +IKL L  PSEFHVIN    +R+GNP
Sbjct  566   VKVNLKRQETEPGESPRKSYLKAVRNIAKTEKDGQIKLSLYDPSEFHVINSGKTTRVGNP  625

Query  514   SGYKIVPSATAASLLDLQDPPQLRAAFTNNQIWVTPYNRSEQWAGGLFTYQSHGDDTLAV  335
             +GYK+VP ATAASLLD  DPPQ R AFTNNQIWVTPYN+SEQWAGGLFTYQSHGDDTL V
Sbjct  626   TGYKVVPRATAASLLDHDDPPQKRGAFTNNQIWVTPYNKSEQWAGGLFTYQSHGDDTLEV  685

Query  334   WSNRNRVIEKQDIVLWYTLGFHHLPCQEDFPVMPTVTSTFQLKPVNFFDRNPIIQANPNF  155
             WS+RNR IE +DIV+WYTLGFHH+PCQEDFP+MPTV+S+F LKP NFF+RNPI+ A PNF
Sbjct  686   WSDRNRDIENKDIVVWYTLGFHHIPCQEDFPIMPTVSSSFDLKPTNFFERNPILGAAPNF  745

Query  154   AEDLPIC  134
               DLP+C
Sbjct  746   EHDLPVC  752



>ref|XP_004952288.1| PREDICTED: primary amine oxidase-like [Setaria italica]
Length=738

 Score =   770 bits (1989),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 369/668 (55%), Positives = 481/668 (72%), Gaps = 11/668 (2%)
 Frame = -1

Query  2107  NHFADRPMHPLDPLTIQEIERTRSILSSYQPF--SGSSLRIHSLSLDEPDKSEVLRWKRG  1934
             +H  D P HPLDPLTI EI R R +L ++ PF  S SSL +HSL+LDEP+K+ VL W++G
Sbjct  73    SHEDDVPRHPLDPLTIGEINRARELLRAHPPFASSPSSLFVHSLALDEPEKAVVLGWRKG  132

Query  1933  NPLPTRKAFVVALSNGQAHLLVVDLGSGRVSSHTRNPASGYPPMSADDASTALEATFSNS  1754
             +PLP R A  V    G+A +L VDL +G   +    PASGYP M+ D+  +   A F++ 
Sbjct  133   DPLPPRHAVAVVRFRGEASVLAVDL-AGSAVTPLPVPASGYPTMTMDEQVSLCFAPFADP  191

Query  1753  VFREAISTRGVEINDVVCSAAAPGWFGPEEEGRRITKVKCYTAQNTPNYYMRPIEGLLLT  1574
              F   I  RGV ++DV C   + GW+GP EE RR+ KV+C++A+ T N+YMRPIEGL + 
Sbjct  192   KFNATIRRRGVRMSDVACLPISLGWYGPTEENRRLIKVQCFSAEGTANFYMRPIEGLTVL  251

Query  1573  VDLDSGKVINVYDTHSPIPIPKAQGTDYR--RDGIEHRAPGV--EPLKPISME-QPNGQS  1409
             VD+D+ +V+++ D  + IPIP A  TDYR  R   E +  G+  + ++  SME  P+G  
Sbjct  252   VDMDTSEVVHISDRGAGIPIPDAANTDYRLARHMQERQDAGLGYQKVRAPSMEPAPSGPG  311

Query  1408  FRVEDGYIVKWASWEFHVKADQRAGIIISQATVFDPEAGKRRSVMYKGFASELFVPYMDV  1229
               + DG+ V+W  WE H+KAD RAG+++S+A V DP  G  R VMYKG ASELFVPYMD 
Sbjct  312   VELVDGHTVRWGGWELHLKADARAGMVVSRARVQDPGTGAHREVMYKGMASELFVPYMDP  371

Query  1228  DEGWYFRAFMDAGEFGLGATAMELVPLNDCPRHSHYIDGLFVDPDGRPVSQPNVICVFER  1049
              E WYF+ +MDAGE+G G  AM LVPLNDCPRH+ Y+DG+FV  DGRP  + N+ICVFER
Sbjct  372   SEAWYFKTYMDAGEYGFGLQAMPLVPLNDCPRHAQYVDGVFVAADGRPYVRGNMICVFER  431

Query  1048  YSGDIAWRHSGTGDADDDLIREARPKVSLVVRTTATVGNYDYIFDWEFQTDGSIRVTVGL  869
             Y+GD+AWRHS +     D IRE+RPKV+LV R  A+V NYDYI DWEFQ DG +R+ VGL
Sbjct  432   YAGDVAWRHSESPITGMD-IRESRPKVTLVARMVASVANYDYIMDWEFQMDGLVRIKVGL  490

Query  868   SGIILAKGSPYEHINQFEIPRWDFPAGSLVSENTIGVAHDHFITFHLDMDVDGPTNSFVK  689
             SGI++ KG+ Y H++  E    +   G+L+SEN IGV HDH++TF LDMDVDG  NSFV+
Sbjct  491   SGILMVKGTAYSHLS--EASENEDMHGTLLSENVIGVIHDHYVTFRLDMDVDGTDNSFVR  548

Query  688   VDLVKNYNIAGKIQRKSYWSPKRKVAKSENDAKIKLQLDKPSEFHVINPRHQSRLGNPSG  509
             V++ +     G+  R+SY    R VA++E DA+++L+L +P EFHVINP  ++R+GNP G
Sbjct  549   VEMARQETGPGESPRRSYLKATRHVAQTEKDAQVRLKLYQPEEFHVINPTKKTRVGNPVG  608

Query  508   YKIVPSATAASLLDLQDPPQLRAAFTNNQIWVTPYNRSEQWAGGLFTYQSHGDDTLAVWS  329
             YK+VP+ TAASLLD +DPPQ R AFTNNQIWVTPYN+SE+WAGGLF YQS G+DTLA WS
Sbjct  609   YKVVPAGTAASLLDPEDPPQKRGAFTNNQIWVTPYNKSEEWAGGLFVYQSKGEDTLATWS  668

Query  328   NRNRVIEKQDIVLWYTLGFHHLPCQEDFPVMPTVTSTFQLKPVNFFDRNPIIQANPNFAE  149
              R+R IE +D+VLWYTLGFHH+PCQEDFP+MPTV+S+F LKPVNFF+ NPI++  P   +
Sbjct  669   ERDRPIENRDLVLWYTLGFHHIPCQEDFPIMPTVSSSFDLKPVNFFESNPILKQRPTEDD  728

Query  148   DLPICRAG  125
             DLP+C A 
Sbjct  729   DLPVCAAA  736



>emb|CDX97351.1| BnaA02g21420D [Brassica napus]
Length=743

 Score =   770 bits (1989),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 369/669 (55%), Positives = 481/669 (72%), Gaps = 11/669 (2%)
 Frame = -1

Query  2113  QNNHFADRPMHPLDPLTIQEIERTRSILSSYQPFS-GSSLRIHSLSLDEPDKSEVLRWKR  1937
              ++H +D   HPLDPLT+ E  + RS+LSS   FS G+    HS+ L+EP+K+ V  W++
Sbjct  74    NHDHLSDTLNHPLDPLTVMEFNKVRSLLSSDALFSSGAPHAFHSIVLEEPEKNLVRAWEK  133

Query  1936  GNPLPTRKAFVVALSNGQAHLLVVDLGSGRVS-SHTRNPASGYPPMSADDASTALEATFS  1760
             GNPLP RKA V+A      H+L VDL SGRV    +  P SGYP M+ ++ +    A FS
Sbjct  134   GNPLPPRKATVIARVGPDTHVLTVDLSSGRVDIVDSPVPVSGYPMMTLEEMNEVTFAPFS  193

Query  1759  NSVFREAISTRGVEINDVVCSAAAPGWFGPEEEGRRITKVKCYTAQNTPNYYMRPIEGLL  1580
             ++     I +RGV + DV C   + GW+G +EE +R+ K +CY++Q T N+YMRPIEGL 
Sbjct  194   SADVNRTIVSRGVNLTDVYCFPLSSGWYGRKEENKRVIKSQCYSSQGTANFYMRPIEGLT  253

Query  1579  LTVDLDSGKVINVYDTHSPIPIPKAQGTDYRRD--GIEHRAPGVEPLKPISMEQPNGQSF  1406
             + +DLD+ +VI + DT   IPIP +  T+YR    G   +  G   L PIS+EQP G SF
Sbjct  254   ILIDLDTKQVIEIVDTGPNIPIPGSANTEYRFKNLGTTDKTRG---LNPISIEQPRGPSF  310

Query  1405  RVEDGYIVKWASWEFHVKADQRAGIIISQATVFDPEAGKRRSVMYKGFASELFVPYMDVD  1226
              +ED ++VKWA+WEFH+K D RAG+++SQ  V DP+  + R VMY+GF SELFVPYMD  
Sbjct  311   VIEDNHLVKWANWEFHLKPDPRAGVVLSQVRVHDPDTQETREVMYQGFVSELFVPYMDPS  370

Query  1225  EGWYFRAFMDAGEFGLGATAMELVPLNDCPRHSHYIDGLFVDPDGRPVSQPNVICVFERY  1046
             + WYF+ +MDAGE+G G  AM LVPLNDCPR++ Y+DG+F   DG P  + N+IC+FERY
Sbjct  371   DAWYFKTYMDAGEYGFGLQAMPLVPLNDCPRNAAYMDGVFTTADGTPFVRENMICIFERY  430

Query  1045  SGDIAWRHSGTGDADDDLIREARPKVSLVVRTTATVGNYDYIFDWEFQTDGSIRVTVGLS  866
             +GDI WRHS +  +    I+E RPKV+LVVR  A+VGNYDYI D+EFQTDG I+  VGLS
Sbjct  431   AGDIGWRHSESPISGLP-IKEVRPKVTLVVRMAASVGNYDYIIDYEFQTDGLIKAKVGLS  489

Query  865   GIILAKGSPYEHINQFEIPRW---DFPAGSLVSENTIGVAHDHFITFHLDMDVDGPTNSF  695
             GI++ KG+ Y++ NQ    +    +   G+L++EN IGV HDH++TF+LD+DVDGP NSF
Sbjct  490   GILMVKGTSYQNKNQVNKDKEGNEEELHGTLLAENIIGVIHDHYVTFYLDLDVDGPDNSF  549

Query  694   VKVDLVKNYNIAGKIQRKSYWSPKRKVAKSENDAKIKLQLDKPSEFHVINPRHQSRLGNP  515
             +KV+L +     G+  RKSY    + + K+E DA+IKL L  PSEFHV+N    +R+GNP
Sbjct  550   LKVNLKRQMTEPGESPRKSYMKAVKNIVKTEKDAQIKLSLYDPSEFHVVNSAKTTRVGNP  609

Query  514   SGYKIVPSATAASLLDLQDPPQLRAAFTNNQIWVTPYNRSEQWAGGLFTYQSHGDDTLAV  335
             +GYKIVP ATAASLLD  DPPQ RAAFTNNQIWVTPYN++E+WA GLFTYQSHGDDTLAV
Sbjct  610   TGYKIVPRATAASLLDHDDPPQKRAAFTNNQIWVTPYNKTEKWAAGLFTYQSHGDDTLAV  669

Query  334   WSNRNRVIEKQDIVLWYTLGFHHLPCQEDFPVMPTVTSTFQLKPVNFFDRNPIIQANPNF  155
             WS+R+R IE  DIV+WYTLGFHH+PCQEDFP+MPTV+S+F LKP NFF+RNPI++A PNF
Sbjct  670   WSDRDRDIENTDIVVWYTLGFHHVPCQEDFPIMPTVSSSFDLKPANFFERNPILRAAPNF  729

Query  154   AEDLPICRA  128
               DLP+C  
Sbjct  730   EHDLPVCEV  738



>ref|XP_009144486.1| PREDICTED: primary amine oxidase [Brassica rapa]
Length=743

 Score =   768 bits (1982),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 368/669 (55%), Positives = 480/669 (72%), Gaps = 11/669 (2%)
 Frame = -1

Query  2113  QNNHFADRPMHPLDPLTIQEIERTRSILSSYQPFS-GSSLRIHSLSLDEPDKSEVLRWKR  1937
              ++H +D   HPLDPLT+ E  + RS+LSS   FS G+    HS+ L+EP+K+ V  W++
Sbjct  74    NHDHLSDTLNHPLDPLTVMEFNKVRSLLSSDALFSTGAPHAFHSIVLEEPEKNLVRAWEK  133

Query  1936  GNPLPTRKAFVVALSNGQAHLLVVDLGSGRVS-SHTRNPASGYPPMSADDASTALEATFS  1760
             GNPLP RKA V+A      H+L VDL SGRV    +  P SGYP M+ ++ +    A FS
Sbjct  134   GNPLPPRKASVIARVGPDTHVLTVDLSSGRVDIVDSPVPVSGYPMMTLEEMNEVTFAPFS  193

Query  1759  NSVFREAISTRGVEINDVVCSAAAPGWFGPEEEGRRITKVKCYTAQNTPNYYMRPIEGLL  1580
             ++     I + GV + DV C   + GW+G +EE +R+ K +CY++Q T N+YMRPIEGL 
Sbjct  194   SADVNRTIVSGGVNLTDVYCFPLSSGWYGRKEENKRVIKSQCYSSQGTANFYMRPIEGLT  253

Query  1579  LTVDLDSGKVINVYDTHSPIPIPKAQGTDYRRD--GIEHRAPGVEPLKPISMEQPNGQSF  1406
             + +DLD+ +VI + DT   IPIP +  T+YR    G   +  G   L PIS+EQP G SF
Sbjct  254   ILIDLDTKQVIEIVDTGPNIPIPGSANTEYRFKNLGTTDKTRG---LNPISIEQPRGPSF  310

Query  1405  RVEDGYIVKWASWEFHVKADQRAGIIISQATVFDPEAGKRRSVMYKGFASELFVPYMDVD  1226
              +ED ++VKWA+WEFH+K D RAG+++SQ  V DP+  + R VMY+GF SELFVPYMD  
Sbjct  311   VIEDNHLVKWANWEFHLKPDPRAGVVLSQVRVHDPDTQETREVMYQGFVSELFVPYMDPS  370

Query  1225  EGWYFRAFMDAGEFGLGATAMELVPLNDCPRHSHYIDGLFVDPDGRPVSQPNVICVFERY  1046
             + WYF+ +MDAGE+G G  AM LVPLNDCPR++ Y+DG+F   DG P  + N+IC+FERY
Sbjct  371   DAWYFKTYMDAGEYGFGLQAMPLVPLNDCPRNAAYMDGVFTTADGTPFVRENMICIFERY  430

Query  1045  SGDIAWRHSGTGDADDDLIREARPKVSLVVRTTATVGNYDYIFDWEFQTDGSIRVTVGLS  866
             +GDI WRHS +  +    I+E RPKV+LVVR  A+VGNYDYI D+EFQTDG I+  VGLS
Sbjct  431   AGDIGWRHSESPISGLP-IKEVRPKVTLVVRMAASVGNYDYIIDYEFQTDGLIKAKVGLS  489

Query  865   GIILAKGSPYEHINQFEIPRW---DFPAGSLVSENTIGVAHDHFITFHLDMDVDGPTNSF  695
             GI++ KG+ Y++ NQ    +    +   G+L++EN IGV HDH++TF+LD+DVDGP NSF
Sbjct  490   GILMVKGTSYQNKNQVNKDKEGNEEELHGTLLAENIIGVIHDHYVTFYLDLDVDGPDNSF  549

Query  694   VKVDLVKNYNIAGKIQRKSYWSPKRKVAKSENDAKIKLQLDKPSEFHVINPRHQSRLGNP  515
             +KV+L +     G+  RKSY    + + K+E DA+IKL L  PSEFHV+N    +R+GNP
Sbjct  550   LKVNLKRQMTEPGESPRKSYMKAVKNIVKTEKDAQIKLSLYDPSEFHVVNSAKTTRVGNP  609

Query  514   SGYKIVPSATAASLLDLQDPPQLRAAFTNNQIWVTPYNRSEQWAGGLFTYQSHGDDTLAV  335
             +GYKIVP ATAASLLD  DPPQ RAAFTNNQIWVTPYN++E+WA GLFTYQSHGDDTLAV
Sbjct  610   TGYKIVPRATAASLLDHDDPPQKRAAFTNNQIWVTPYNKTEKWAAGLFTYQSHGDDTLAV  669

Query  334   WSNRNRVIEKQDIVLWYTLGFHHLPCQEDFPVMPTVTSTFQLKPVNFFDRNPIIQANPNF  155
             WS+R+R IE  DIV+WYTLGFHH+PCQEDFP+MPTV+S+F LKP NFF+RNPI++A PNF
Sbjct  670   WSDRDRDIENTDIVVWYTLGFHHVPCQEDFPIMPTVSSSFDLKPANFFERNPILRAAPNF  729

Query  154   AEDLPICRA  128
               DLP+C  
Sbjct  730   EHDLPVCEV  738



>ref|XP_002872648.1| AT4g12290/T4C9_130 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH48907.1| AT4g12290/T4C9_130 [Arabidopsis lyrata subsp. lyrata]
Length=653

 Score =   764 bits (1972),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 364/648 (56%), Positives = 472/648 (73%), Gaps = 6/648 (1%)
 Frame = -1

Query  2056  EIERTRSILSSYQPF-SGSSLRIHSLSLDEPDKSEVLRWKRGNPLPTRKAFVVALSNGQA  1880
             EI + RSILSS+  F S + L ++S+ L+EPDK+ V +W +G+ LPTRKA V+A   G +
Sbjct  2     EINKVRSILSSHALFASRAPLTLNSVVLEEPDKNLVRQWDKGDQLPTRKASVIARLGGDS  61

Query  1879  HLLVVDLGSGRVS-SHTRNPASGYPPMSADDASTALEATFSNSVFREAISTRGVEINDVV  1703
             H+L VDL +  V    +  P SGYP +++++  +A  A FSN+ F   I +RG+ + DVV
Sbjct  62    HVLTVDLSTNLVDLVDSPVPKSGYPIVTSEEMDSAASAPFSNADFNRTILSRGINLTDVV  121

Query  1702  CSAAAPGWFGPEEEGRRITKVKCYTAQNTPNYYMRPIEGLLLTVDLDSGKVINVYDTHSP  1523
             C   + GWFG +E+ +R+TK++C+++Q TPN+YMRPIEGL L  DLD+ +++ + DT   
Sbjct  122   CIPMSSGWFGNKEDNKRVTKIQCFSSQGTPNFYMRPIEGLTLLFDLDTKQILEITDTGQS  181

Query  1522  IPIPKAQGTDYRRDGIEHRAPGVEPLKPISMEQPNGQSFRVEDGYIVKWASWEFHVKADQ  1343
             IPIP +  TDYR      +     PL PIS+EQP+G SF +ED +IVKWA+WEFH+K D 
Sbjct  182   IPIPGSTNTDYRYSNFPSQD-KTRPLNPISIEQPHGPSFVIEDNHIVKWANWEFHLKPDP  240

Query  1342  RAGIIISQATVFDPEAGKRRSVMYKGFASELFVPYMDVDEGWYFRAFMDAGEFGLGATAM  1163
             RAG+IIS+  V DP+  + R VMYKGF SELF+PYMD  E WYF+ +MDAGE+GLG   M
Sbjct  241   RAGLIISRVRVHDPDTEETREVMYKGFVSELFIPYMDPSEAWYFKTYMDAGEYGLGLQTM  300

Query  1162  ELVPLNDCPRHSHYIDGLFVDPDGRPVSQPNVICVFERYSGDIAWRHSGTGDADDDLIRE  983
              L PLNDCPR++ Y+DG+F   DG P  + N+ICVFE Y+GDIAWRH+         +RE
Sbjct  301   SLEPLNDCPRNAVYMDGIFAAADGTPFVRENMICVFESYAGDIAWRHTEYPVPGMPPLRE  360

Query  982   ARPKVSLVVRTTATVGNYDYIFDWEFQTDGSIRVTVGLSGIILAKGSPYEHINQFEIPRW  803
              RPKV+LVVR  A+VGNYD+I D+EFQTDG +R  VGLSGI++ KG+ Y + NQ +  + 
Sbjct  361   VRPKVTLVVRMVASVGNYDFIIDYEFQTDGLMRAKVGLSGILMVKGTSYVNKNQVKKDKE  420

Query  802   ---DFPAGSLVSENTIGVAHDHFITFHLDMDVDGPTNSFVKVDLVKNYNIAGKIQRKSYW  632
                +   G+++SEN IGV HDH++TF+ D+DVDGP NSF+KV+L +     G+  RKSY 
Sbjct  421   GNEEELYGTILSENVIGVIHDHYVTFYFDLDVDGPDNSFLKVNLKRQETALGESPRKSYM  480

Query  631   SPKRKVAKSENDAKIKLQLDKPSEFHVINPRHQSRLGNPSGYKIVPSATAASLLDLQDPP  452
                R + K+E D KIKL L  PSE+HVINP   +R+GNP GYKIVP ATAASLLD  DPP
Sbjct  481   KAVRNIVKTEKDGKIKLSLYDPSEYHVINPSKTTRVGNPRGYKIVPRATAASLLDHDDPP  540

Query  451   QLRAAFTNNQIWVTPYNRSEQWAGGLFTYQSHGDDTLAVWSNRNRVIEKQDIVLWYTLGF  272
             Q R AFTNNQIWVTPYN+SEQWAGGLFTYQSHGDDTLAVWS+R+R IE  DIV+WYTLGF
Sbjct  541   QKRGAFTNNQIWVTPYNKSEQWAGGLFTYQSHGDDTLAVWSDRDRDIENNDIVVWYTLGF  600

Query  271   HHLPCQEDFPVMPTVTSTFQLKPVNFFDRNPIIQANPNFAEDLPICRA  128
             HH+PCQEDFP+MPTV+S+F LKP NFF+R+PI++A PNF  DL +C A
Sbjct  601   HHIPCQEDFPIMPTVSSSFDLKPANFFERSPILKAAPNFEYDLQVCGA  648



>emb|CDY04409.1| BnaC02g28390D [Brassica napus]
Length=743

 Score =   766 bits (1978),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 367/669 (55%), Positives = 479/669 (72%), Gaps = 11/669 (2%)
 Frame = -1

Query  2113  QNNHFADRPMHPLDPLTIQEIERTRSILSSYQPFS-GSSLRIHSLSLDEPDKSEVLRWKR  1937
              ++H +D   HPLDPLT+ E  + RS+LSS   FS G+    HS+ L+EP+K+ V  W++
Sbjct  74    NHDHLSDTLNHPLDPLTVMEFNKVRSLLSSDALFSSGAPHAFHSIVLEEPEKNLVRAWEK  133

Query  1936  GNPLPTRKAFVVALSNGQAHLLVVDLGSGRVS-SHTRNPASGYPPMSADDASTALEATFS  1760
             GNPLP RKA V+A      H+L VDL S RV    +  P SGYP M+ ++ +    A FS
Sbjct  134   GNPLPPRKASVIARVGPDTHVLTVDLSSSRVDIVDSPVPVSGYPMMTLEEMNEVTFAPFS  193

Query  1759  NSVFREAISTRGVEINDVVCSAAAPGWFGPEEEGRRITKVKCYTAQNTPNYYMRPIEGLL  1580
             ++     I +RGV + DV C   + GW+G +E  +R+ K +CY++Q T N+YMRPIEGL 
Sbjct  194   SADVNRTIVSRGVNLTDVYCFPLSSGWYGRKEGNKRVIKSQCYSSQGTANFYMRPIEGLT  253

Query  1579  LTVDLDSGKVINVYDTHSPIPIPKAQGTDYRRD--GIEHRAPGVEPLKPISMEQPNGQSF  1406
             + +DLD+ +VI + DT   IPIP +  T+YR    G   +  G   L PIS+EQP G SF
Sbjct  254   ILIDLDTKQVIEIVDTGPNIPIPGSANTEYRFKNLGTTDKTRG---LNPISIEQPRGPSF  310

Query  1405  RVEDGYIVKWASWEFHVKADQRAGIIISQATVFDPEAGKRRSVMYKGFASELFVPYMDVD  1226
              +ED ++VKWA+WEFH+K D RAG+++SQ  V DP+  + R VMY+GF SELFVPYMD  
Sbjct  311   VIEDNHLVKWANWEFHLKPDSRAGVVLSQVRVHDPDTQETREVMYQGFVSELFVPYMDPS  370

Query  1225  EGWYFRAFMDAGEFGLGATAMELVPLNDCPRHSHYIDGLFVDPDGRPVSQPNVICVFERY  1046
             + WYF+ +MDAGE+G G  AM LVPLNDCPR++ Y+DG+F   DG P  + N+IC+FERY
Sbjct  371   DAWYFKTYMDAGEYGFGLQAMPLVPLNDCPRNAAYMDGVFTTADGTPFVRENMICIFERY  430

Query  1045  SGDIAWRHSGTGDADDDLIREARPKVSLVVRTTATVGNYDYIFDWEFQTDGSIRVTVGLS  866
             +GDI WRHS +  +    I+E RPKV+LVVR  A+VGNYDYI D+EFQTDG I+  VGLS
Sbjct  431   AGDIGWRHSESPISGLP-IKEVRPKVTLVVRMAASVGNYDYIIDYEFQTDGLIKTKVGLS  489

Query  865   GIILAKGSPYEHINQFEIPRW---DFPAGSLVSENTIGVAHDHFITFHLDMDVDGPTNSF  695
             GI++ KG+ Y++ NQ    +    +   G+L++EN IGV HDH++TF+LD+DVDGP NSF
Sbjct  490   GILMVKGTSYQNKNQVNKDKEGNEEELHGTLLAENIIGVIHDHYVTFYLDLDVDGPDNSF  549

Query  694   VKVDLVKNYNIAGKIQRKSYWSPKRKVAKSENDAKIKLQLDKPSEFHVINPRHQSRLGNP  515
             +KV+L +     G+  RKSY    + + K+E DA+IKL L  PSEFHV+N    +R+GNP
Sbjct  550   LKVNLKRQMTEPGESPRKSYMKAVKNIVKTEKDAQIKLSLYDPSEFHVVNSAKTTRVGNP  609

Query  514   SGYKIVPSATAASLLDLQDPPQLRAAFTNNQIWVTPYNRSEQWAGGLFTYQSHGDDTLAV  335
             +GYKIVP ATAASLLD  DPPQ R AFTNNQIWVTPYN++E+WA GLFTYQSHGDDTLAV
Sbjct  610   TGYKIVPRATAASLLDHDDPPQKRGAFTNNQIWVTPYNKTEKWAAGLFTYQSHGDDTLAV  669

Query  334   WSNRNRVIEKQDIVLWYTLGFHHLPCQEDFPVMPTVTSTFQLKPVNFFDRNPIIQANPNF  155
             WS+R+R IE  DIV+WYTLGFHH+PCQEDFP+MPTV+S+F LKP NFF+RNPI++A PNF
Sbjct  670   WSDRDRDIENTDIVVWYTLGFHHVPCQEDFPIMPTVSSSFDLKPANFFERNPILRAAPNF  729

Query  154   AEDLPICRA  128
               DLP+C A
Sbjct  730   EHDLPVCEA  738



>gb|EEC76903.1| hypothetical protein OsI_15134 [Oryza sativa Indica Group]
Length=750

 Score =   766 bits (1977),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 370/678 (55%), Positives = 482/678 (71%), Gaps = 24/678 (4%)
 Frame = -1

Query  2107  NHFADRPMHPLDPLTIQEIERTRSILSSYQPFSG--SSLRIHSLSLDEPDKSEVLRWKRG  1934
             +H +D P HPLDPLT++E+ R R +L ++  F+   SSL +HSL LDEP+KS V  W++G
Sbjct  76    SHESDVPRHPLDPLTVREVNRVRELLRAHPLFASAPSSLFVHSLELDEPEKSVVKSWRKG  135

Query  1933  -NPLPTRKAFVVALSNGQAHLLVVDL--GSGRVSSHTRNPASGYPPMSADDASTALEATF  1763
              +PLP R+A  V    G++H+L VDL  G G V+     PASGYP M+ D+ ++   A F
Sbjct  136   ADPLPPRRAVAVVRFRGESHVLGVDLSEGDGAVTP-LPVPASGYPMMNMDEQTSLCFAPF  194

Query  1762  SNSVFREAISTRGVEINDVVCSAAAPGWFGPEEEGRRITKVKCYTAQNTPNYYMRPIEGL  1583
              ++ F  ++  RGV  +DV C   + GW+GP EE RR+ K +C++ + T N+YMRPIEGL
Sbjct  195   KDAAFNASLLRRGVRASDVACLPISLGWYGPAEENRRLIKSQCFSTEGTANFYMRPIEGL  254

Query  1582  LLTVDLDSGKVINVYDTHSPIPIPKAQGTDYRRDGIEHRAP-----------GVEPLKPI  1436
              + VD+D+ +V++V D  + IPIP A  TDYR     H AP           G + ++  
Sbjct  255   TVLVDMDTAEVLHVSDRGAGIPIPAAANTDYRHG---HSAPTPAEAQAQGRHGYQTVRVP  311

Query  1435  SMEQP-NGQSFRVEDGYIVKWASWEFHVKADQRAGIIISQATVFDPEAGKRRSVMYKGFA  1259
             SME P  G  F + DG+ V+W  WEFH+K D RAG+++S+A V DP  G+ R VMYKG A
Sbjct  312   SMEPPAGGPEFELVDGHTVRWGGWEFHLKPDARAGMVVSRARVQDPATGEHRDVMYKGMA  371

Query  1258  SELFVPYMDVDEGWYFRAFMDAGEFGLGATAMELVPLNDCPRHSHYIDGLFVDPDGRPVS  1079
             SELFVPYMD  E WYF+ +MDAGE+G G  AM LVPLNDCPRH+ Y+D +FV  DGRP  
Sbjct  372   SELFVPYMDPTEAWYFKTYMDAGEYGFGLQAMPLVPLNDCPRHARYLDAVFVAADGRPYV  431

Query  1078  QPNVICVFERYSGDIAWRHSGTGDADDDLIREARPKVSLVVRTTATVGNYDYIFDWEFQT  899
             + N+ICVFERY+GDIAWRHS +     D IRE+RPKV+LV R  A+V NYDYI DWEFQ 
Sbjct  432   RENMICVFERYAGDIAWRHSESPITGMD-IRESRPKVTLVARMAASVANYDYIVDWEFQM  490

Query  898   DGSIRVTVGLSGIILAKGSPYEHINQFEIPRWDFPAGSLVSENTIGVAHDHFITFHLDMD  719
             DG +R+ VGLSGI++ KG+ Y H+NQ  + + D   G+L+SEN IGV HDHF+TF LDMD
Sbjct  491   DGLVRIKVGLSGILMVKGTQYSHMNQ--VHQNDNMYGTLLSENVIGVIHDHFVTFRLDMD  548

Query  718   VDGPTNSFVKVDLVKNYNIAGKIQRKSYWSPKRKVAKSENDAKIKLQLDKPSEFHVINPR  539
             +DG  NSFVKV + +    AG+  RKSY    R VA++E DA+++L+L +PSEFH++NP 
Sbjct  549   IDGADNSFVKVAMARQNTGAGESPRKSYLKATRHVARTEKDAQVRLKLYEPSEFHIVNPT  608

Query  538   HQSRLGNPSGYKIVPSATAASLLDLQDPPQLRAAFTNNQIWVTPYNRSEQWAGGLFTYQS  359
              ++R+GNP GYK+VP+ TAASLLD +DPPQ R AFTNNQIWVTPYN++E+WAGGLF YQS
Sbjct  609   KKTRVGNPVGYKVVPAGTAASLLDPEDPPQKRGAFTNNQIWVTPYNKTEEWAGGLFVYQS  668

Query  358   HGDDTLAVWSNRNRVIEKQDIVLWYTLGFHHLPCQEDFPVMPTVTSTFQLKPVNFFDRNP  179
              G+DTLA WS R+R IE +D+VLWYTLGFHH+PCQEDFP+MPTV+S+F LKPVNFF+ NP
Sbjct  669   KGEDTLATWSERDRPIENKDLVLWYTLGFHHVPCQEDFPIMPTVSSSFDLKPVNFFESNP  728

Query  178   IIQANPNFAEDLPICRAG  125
             I+   P    DLP+C A 
Sbjct  729   ILGQRPTQENDLPVCAAA  746



>ref|XP_008663089.1| PREDICTED: primary amine oxidase-like [Zea mays]
 gb|AFW57926.1| hypothetical protein ZEAMMB73_908656 [Zea mays]
Length=744

 Score =   758 bits (1957),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 363/672 (54%), Positives = 475/672 (71%), Gaps = 15/672 (2%)
 Frame = -1

Query  2107  NHFADRPMHPLDPLTIQEIERTRSILSSYQPF--SGSSLRIHSLSLDEPDKSEVLRWKRG  1934
             +H  D P HPLDPLTI E+ R R +L ++ PF  S SS+ +HSL+LDEPDK  VL W++G
Sbjct  72    SHENDVPRHPLDPLTISEVNRARELLRAHPPFASSPSSMFVHSLALDEPDKPVVLSWRKG  131

Query  1933  -NPLPTRKAFVVALSNGQAHLLVVDLGSGRVSSHTRNPASGYPPMSADDASTALEATFSN  1757
              +PLP R+A  V    G+A +L +DL SG V+     PASGYP M+ D+        F +
Sbjct  132   VDPLPPRRAVAVVRFRGEAFVLAIDLASGAVTP-LPVPASGYPTMTMDEQVLLCYTPFRD  190

Query  1756  SVFREAISTRGVEINDVVCSAAAPGWFGPEEEGRRITKVKCYTAQNTPNYYMRPIEGLLL  1577
               F   I   GV ++DV C   + GW+GP EE RR+ K++C++A+ T N+YMRPIEGL +
Sbjct  191   PAFNATIQRHGVRLSDVACLPISLGWYGPSEENRRLIKIQCFSAEGTANFYMRPIEGLTV  250

Query  1576  TVDLDSGKVINVYDTHSPIPIPKAQGTDYR------RDGIEHRAPGVEPLKPISMEQPNG  1415
              VD+D+ +V+ + D  + IPIP A  TDYR       +G + +  G + ++  SME    
Sbjct  251   LVDMDTREVVRISDRGAGIPIPPAANTDYRYSRHMQDEGDDQQTAGFQKVRAPSMEPGPS  310

Query  1414  QSFRVE--DGYIVKWASWEFHVKADQRAGIIISQATVFDPEAGKRRSVMYKGFASELFVP  1241
                RVE  DG+ V+W  WEFH+KAD RAG+++S+A V DP  G  R V+YKG ASELFVP
Sbjct  311   SGPRVELVDGHTVRWGGWEFHLKADARAGMVVSRARVQDPGTGAHREVLYKGMASELFVP  370

Query  1240  YMDVDEGWYFRAFMDAGEFGLGATAMELVPLNDCPRHSHYIDGLFVDPDGRPVSQPNVIC  1061
             YMD  E WYF+ +MDAGE+G G  AM LVPLNDCPRH+ Y+DG+FV  DGRP  +  +IC
Sbjct  371   YMDPTEAWYFKTYMDAGEYGFGLQAMPLVPLNDCPRHARYLDGVFVAADGRPYVREKMIC  430

Query  1060  VFERYSGDIAWRHSGTGDADDDLIREARPKVSLVVRTTATVGNYDYIFDWEFQTDGSIRV  881
             VFERY+G++AWRHS +     D IRE+RPKV+LV R  A+V NYDYI DWEFQ DG +R+
Sbjct  431   VFERYAGEVAWRHSESPITGLD-IRESRPKVTLVARMVASVANYDYIMDWEFQMDGLVRI  489

Query  880   TVGLSGIILAKGSPYEHINQFEIPRWDFPAGSLVSENTIGVAHDHFITFHLDMDVDGPTN  701
              VGLSGI++ KG+ Y H+++      D   G+L+SEN IGV HDH++TF LDMDVDG  N
Sbjct  490   KVGLSGILMVKGTSYSHLSEARGNEGDM-HGTLLSENVIGVIHDHYVTFRLDMDVDGADN  548

Query  700   SFVKVDLVKNYNIAG-KIQRKSYWSPKRKVAKSENDAKIKLQLDKPSEFHVINPRHQSRL  524
             SFV+V++ +     G +  R+SY    R+VA++E DA+++L L  P+EFHV+NP  ++R+
Sbjct  549   SFVRVEMARQETGPGDESPRRSYLRATRRVAETEKDARVRLSLYHPAEFHVVNPAKKTRV  608

Query  523   GNPSGYKIVPSATAASLLDLQDPPQLRAAFTNNQIWVTPYNRSEQWAGGLFTYQSHGDDT  344
             GNP GYK+VP+ TAASLLD +DPPQ R AFTNNQIWVTPYN+SE+WAGGLF YQS G+DT
Sbjct  609   GNPVGYKVVPAGTAASLLDPEDPPQKRGAFTNNQIWVTPYNKSEEWAGGLFVYQSKGEDT  668

Query  343   LAVWSNRNRVIEKQDIVLWYTLGFHHLPCQEDFPVMPTVTSTFQLKPVNFFDRNPIIQAN  164
             L  WS R+R IE +D+VLWYTLGFHH+PCQEDFP+MPTV+S+F LKPVNFF+ NPI++  
Sbjct  669   LDTWSERDRPIENKDLVLWYTLGFHHIPCQEDFPIMPTVSSSFDLKPVNFFESNPILKQR  728

Query  163   PNFAEDLPICRA  128
             P   +DLPIC A
Sbjct  729   PTKEDDLPICTA  740



>gb|KDP25604.1| hypothetical protein JCGZ_20760 [Jatropha curcas]
Length=666

 Score =   753 bits (1945),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 371/633 (59%), Positives = 460/633 (73%), Gaps = 11/633 (2%)
 Frame = -1

Query  2191  SCLSFESSNASINNLESLLGIH---DFKIQNNHFADRPMHPLDPLTIQEIERTRSILSS-  2024
             S  SF S N   +   S+L      + KI N++    P HPLDPLTIQEI + R+IL S 
Sbjct  29    SSYSFTSKNRIYSKFGSVLETQIPRNPKI-NDYSGPTPKHPLDPLTIQEINKVRAILLSF  87

Query  2023  YQPFSGSSL--RIHSLSLDEPDKSEVLRWKRGNPLPTRKAFVVALSNGQAHLLVVDLGSG  1850
             Y+PF  S+    IHSLSLDEP+KS V  WK+G+P P RK  V+A+ NGQ HLL VDL  G
Sbjct  88    YKPFLSSNKFPTIHSLSLDEPEKSLVSEWKQGDPFPPRKGLVIAVLNGQTHLLNVDLALG  147

Query  1849  RVSSHTRNPASGYPPMSADDASTALEATFSNSVFREAISTRGVEINDVVCSAAAPGWFGP  1670
             +V++H  N ASGYP +S +D S A++   S     ++   RGV ++D+ C   +PGWFG 
Sbjct  148   QVTAHEINSASGYPMLSMEDISAAVQVALSYKELNQSAIARGVHLSDLSCITPSPGWFGS  207

Query  1669  EEEGRRITKVKCYTAQNTPNYYMRPIEGLLLTVDLDSGKVINVYDTHSPIPIPKAQGTDY  1490
              EEGRR+ KV+C+++Q TPN++MRP+EGL +TVDLD  +V+   DT   IPIPK   TDY
Sbjct  208   HEEGRRVIKVQCFSSQGTPNFFMRPLEGLTMTVDLDKKEVVKFSDTGRGIPIPKETNTDY  267

Query  1489  RRDGIEHRAPGVEPLKPISMEQPNGQSFRVEDGYIVKWASWEFHVKADQRAGIIISQATV  1310
             R    E R   ++P+ PISMEQP G SF VE+G++VKWA+W FH+KADQR G++IS+A V
Sbjct  268   RYIEQEKRIE-MDPINPISMEQPKGPSFTVENGHLVKWANWVFHLKADQREGMVISRAMV  326

Query  1309  FDPEAGKRRSVMYKGFASELFVPYMDVDEGWYFRAFMDAGEFGLGATAMELVPLNDCPRH  1130
              D E G  RSVMYKGF SE+FVPYMD DE WYF+++MDAGEFGLGATAM LVPLNDCPR 
Sbjct  327   KDSETGVLRSVMYKGFCSEMFVPYMDPDENWYFKSYMDAGEFGLGATAMPLVPLNDCPRF  386

Query  1129  SHYIDGLFVDPDGRPVSQPNVICVFERYSGDIAWRHSGTGDADDDLIREARPKVSLVVRT  950
             SHY+D +FV  +G P  QP++IC+FERY+GDI WRHS     +   IRE+RPKV+LV R 
Sbjct  387   SHYMDAVFVSSEGTPYVQPDMICLFERYAGDIGWRHSEI-PVNGFKIRESRPKVTLVARM  445

Query  949   TATVGNYDYIFDWEFQTDGSIRVTVGLSGIILAKGSPYEHINQFEIPRWDFPAGSLVSEN  770
              A++GNYDYIFDWEFQTDG IR+ V LSG+++ KG+P+++++Q  IP  +  +  LVSEN
Sbjct  446   AASIGNYDYIFDWEFQTDGLIRIKVSLSGMLMVKGTPHQNVHQ--IPNEEEMSSPLVSEN  503

Query  769   TIGVAHDHFITFHLDMDVDGPTNSFVKVDLVKNYNIAGKIQRKSYWSPKRKVAKSENDAK  590
              IGV HDHFITFHLDMD+D   N+FVKV LVK     G+  RKSY   KR+  K+E DAK
Sbjct  504   VIGVVHDHFITFHLDMDIDDTNNTFVKVRLVKEQKFPGETPRKSYLKAKRETVKTEEDAK  563

Query  589   IKLQLDKPSEFHVINPRHQSRLGNPSGYKIVPSATAASLLDLQDPPQLRAAFTNNQIWVT  410
             IKL+L  PSEFHVINP  +SRLGNP+GY+IVP  TAASLLD  DPPQLR A+TNNQIWVT
Sbjct  564   IKLKLYDPSEFHVINPSRRSRLGNPAGYRIVPGGTAASLLDHLDPPQLRGAYTNNQIWVT  623

Query  409   PYNRSEQWAGGLFTYQSHGDDTLAVWSNRNRVI  311
             PYNRSEQWAGGL  YQS GDDTLAVWS R + +
Sbjct  624   PYNRSEQWAGGLLVYQSRGDDTLAVWSERYKTL  656



>ref|XP_002446210.1| hypothetical protein SORBIDRAFT_06g004290 [Sorghum bicolor]
 gb|EES10538.1| hypothetical protein SORBIDRAFT_06g004290 [Sorghum bicolor]
Length=752

 Score =   756 bits (1951),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 364/677 (54%), Positives = 477/677 (70%), Gaps = 21/677 (3%)
 Frame = -1

Query  2107  NHFADRPMHPLDPLTIQEIERTRSILSSYQPF--SGSSLRIHSLSLDEPDKSEVLRWKRG  1934
             +H  D P+HPLDPLT+ EI R R +L ++ PF  S SS+ +HSL+LDEPDK  VL W++G
Sbjct  77    SHENDVPLHPLDPLTVTEINRARELLRAHPPFASSPSSMFVHSLALDEPDKPVVLSWRKG  136

Query  1933  -NPLPTRKAFVVALSNGQAHLLVVDLGSGRVSSHTRNPASGYPPMSADDASTALEATFSN  1757
              +PLP R+A  V    G+A +L +DL SG V+     PASGYP M+ D+  +   A FS+
Sbjct  137   ADPLPPRRAVAVVRFRGEAFVLAIDLASGAVTP-LPAPASGYPTMTMDEQVSLCYAPFSD  195

Query  1756  SVFREAISTRGVEINDVVCSAAAPGWFGPEEEGRRITKVKCYTAQNTPNYYMRPIEGLLL  1577
               F   +   GV ++DV C   + GW+GP EE RR+ K++C++A+ T N+YMRPIEGL +
Sbjct  196   PAFNATVQRHGVRMSDVACLPISLGWYGPTEENRRLIKIQCFSAEGTANFYMRPIEGLTV  255

Query  1576  TVDLDSGKVINVYDTHSPIPIPKAQGTDYRR----------DGIEHRA-PGVEPLKPISM  1430
              +D+D+ +VI + D    IPIP A  TDYR           D    R+  G + ++  SM
Sbjct  256   LLDMDTREVIRISDRGGGIPIPPAANTDYRYARHMQEDVGGDQTTSRSEAGFQKVRAPSM  315

Query  1429  EQ--PNGQSFRVEDGYIVKWASWEFHVKADQRAGIIISQATVFDPEAGKRRSVMYKGFAS  1256
             E    +G    + DG+ V+W  WEFH+KAD RAG+++S+A V DP  G  R V+YKG AS
Sbjct  316   EPGPSSGPGVELVDGHTVRWGGWEFHLKADARAGMVVSRARVQDPGTGAHREVLYKGMAS  375

Query  1255  ELFVPYMDVDEGWYFRAFMDAGEFGLGATAMELVPLNDCPRHSHYIDGLFVDPDGRPVSQ  1076
             ELFVPYMD  E WYF+ +MDAGE+G G  AM LVPLNDCPRH+ Y+DG+FV  DGRP  +
Sbjct  376   ELFVPYMDPTEAWYFKTYMDAGEYGFGLQAMPLVPLNDCPRHARYLDGVFVAADGRPYVR  435

Query  1075  PNVICVFERYSGDIAWRHSGTGDADDDLIREARPKVSLVVRTTATVGNYDYIFDWEFQTD  896
               +ICVFERY+G++AWRHS +     D IRE+RPKV+LV R  A+V NYDYI DWEFQ D
Sbjct  436   EKMICVFERYAGEVAWRHSESPITGMD-IRESRPKVTLVARMVASVANYDYIMDWEFQMD  494

Query  895   GSIRVTVGLSGIILAKGSPYEHINQFEIPRWDFPAGSLVSENTIGVAHDHFITFHLDMDV  716
             G +R+ VGLSGI++ KG+ Y H+   E    +   G+L+SEN IGV HDH++TF LDMDV
Sbjct  495   GLVRIKVGLSGILMVKGTAYSHLR--EARENEDTHGTLLSENVIGVIHDHYVTFRLDMDV  552

Query  715   DGP-TNSFVKVDLVKNYNIAGKIQRKSYWSPKRKVAKSENDAKIKLQLDKPSEFHVINPR  539
             DG   NSFV+V++ +     G+  R+SY    R VA++E DA+++L+L  P+EFHV+NP 
Sbjct  553   DGADNNSFVRVEMARQETAPGESPRRSYLKATRHVARTEKDAQVRLKLYDPAEFHVVNPT  612

Query  538   HQSRLGNPSGYKIVPSATAASLLDLQDPPQLRAAFTNNQIWVTPYNRSEQWAGGLFTYQS  359
              ++R+GNP GYK+VP+ TAASLLD +DPPQ R AFTNNQIWVTPYN+SE+WAGGLF YQS
Sbjct  613   KKTRVGNPVGYKLVPAGTAASLLDPEDPPQKRGAFTNNQIWVTPYNKSEEWAGGLFVYQS  672

Query  358   HGDDTLAVWSNRNRVIEKQDIVLWYTLGFHHLPCQEDFPVMPTVTSTFQLKPVNFFDRNP  179
              G+DTLA WS R+R IE +D+VLWYTLGFHH+PCQEDFP+MPTV+S+F LKPVNFF+ NP
Sbjct  673   KGEDTLATWSERDRPIENKDLVLWYTLGFHHIPCQEDFPIMPTVSSSFDLKPVNFFESNP  732

Query  178   IIQANPNFAEDLPICRA  128
             I++  P   +DLPIC A
Sbjct  733   ILKQRPTKEDDLPICSA  749



>ref|XP_010676221.1| PREDICTED: primary amine oxidase-like [Beta vulgaris subsp. vulgaris]
Length=691

 Score =   748 bits (1930),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 356/667 (53%), Positives = 472/667 (71%), Gaps = 8/667 (1%)
 Frame = -1

Query  2110  NNHFADRPMHPLDPLTIQEIERTRSILSSYQPFSGSSLRIHSLSLDEPDKSEVLRWKRGN  1931
             NNH    P HPLDP+T +EI + R+ILSSY P    +L I+SL+LDEP KS+VL W++G+
Sbjct  29    NNHTTTVPRHPLDPVTAEEINQARTILSSYAP--NKALTIYSLTLDEPPKSKVLSWRQGD  86

Query  1930  PLPTRKAFVVA-LSNGQAHLLVVDLGSGRVSSHTRNPASGYPPMSADDASTALEATFSNS  1754
             PL  RK  V+A    G   LL VDL   RV      P SGYP  ++D+   ++ A F++ 
Sbjct  87    PLSPRKISVIARFGGGPIRLLTVDLRLRRVRRVENEPPSGYPIPTSDEIMASMSAPFTSV  146

Query  1753  VFREAISTRGVEINDVVCSAAAPGWFGPEEEGRRITKVKCYTAQNTPNYYMRPIEGLLLT  1574
              F ++I  RGV++ DV C   +PGWFG +EE RRI KV+C++ ++T N+YM+PIEGL L 
Sbjct  147   EFNKSIIKRGVDLGDVNCEPFSPGWFGKKEEKRRIIKVQCFSTKDTINFYMKPIEGLTLV  206

Query  1573  VDLDSGKVINVY--DTHSPIPIPKAQGTDYRRDGIEHRAPGVEPLKPISMEQPNGQSFRV  1400
             VDLD+ +V+ +   D  + IPIPK   +DYR    ++    ++P+ PISMEQP G SF V
Sbjct  207   VDLDTNQVVGISESDHANRIPIPKGIDSDYRFSVQKNTHKKIKPINPISMEQPKGPSFTV  266

Query  1399  EDGYIVKWASWEFHVKADQRAGIIISQATVFDPEAGKRRSVMYKGFASELFVPYMDVDEG  1220
             E+ +++KW +WEFH+K D RAG+ +S+A   DP+ G+ RSVMYKG  SELFVPYMD  E 
Sbjct  267   ENNHLIKWGNWEFHLKHDPRAGLTVSRAMFEDPDNGELRSVMYKGMVSELFVPYMDPTEA  326

Query  1219  WYFRAFMDAGEFGLGATAMELVPLNDCPRHSHYIDGLFVDPDGRPVSQPNVICVFERYSG  1040
             WYF+ ++D G++GLG +   L PLNDCP++++Y+D +     G+P  + NVIC+FERY+G
Sbjct  327   WYFKTYIDVGDYGLGLSTRSLEPLNDCPKNAYYMDAVLSTTHGKPFVRSNVICIFERYAG  386

Query  1039  DIAWRHSGTGDADDDLIREARPKVSLVVRTTATVGNYDYIFDWEFQTDGSIRVTVGLSGI  860
             DIAWRH+ TG A     RE RPKV+LV R   T+GNYDYI DW FQ DG I+  V LSGI
Sbjct  387   DIAWRHTETGIAGQQF-REVRPKVTLVARMIPTIGNYDYIIDWIFQGDGVIKTEVALSGI  445

Query  859   ILAKGSPYEHINQFEIPRWDFPAGSLVSENTIGVAHDHFITFHLDMDVDGPTNSFVKVDL  680
              + KG+ Y+  N  E+P   +  G LVSEN+IGV HDH++ F+LDMDVD P NSFVKVD+
Sbjct  446   PVIKGTTYK--NTKEVPEEKYLYGPLVSENSIGVIHDHYVAFYLDMDVDSPDNSFVKVDI  503

Query  679   VKNYNIAGKIQRKSYWSPKRKVAKSENDAKIKLQLDKPSEFHVINPRHQSRLGNPSGYKI  500
              +     G+  RKSY    R VAK+E DA+IKL + +PSE+HVINP  ++R+GNP GY++
Sbjct  504   RRQETSPGESPRKSYLKATRNVAKTEKDAQIKLNIYQPSEYHVINPNKKTRVGNPVGYRL  563

Query  499   VPSATAASLLDLQDPPQLRAAFTNNQIWVTPYNRSEQWAGGLFTYQSHGDDTLAVWSNRN  320
             +P + AASLLDL+DPPQ RAAFTNNQIWVTPYN+SE WAGGLF +QSHGDDTLA W+ R+
Sbjct  564   IPGSNAASLLDLEDPPQKRAAFTNNQIWVTPYNKSEMWAGGLFVWQSHGDDTLATWTKRD  623

Query  319   RVIEKQDIVLWYTLGFHHLPCQEDFPVMPTVTSTFQLKPVNFFDRNPIIQANPNFAEDLP  140
             R IE +DIV+WY +G HH+PCQEDFP+MP+ +  F+LKPVNF  +NPI+   P F  DLP
Sbjct  624   RAIENKDIVVWYVVGLHHIPCQEDFPIMPSESVGFRLKPVNFLSQNPILGIPPYFPNDLP  683

Query  139   ICRAGRN  119
             +C+A  +
Sbjct  684   VCQANEH  690



>ref|XP_003581494.1| PREDICTED: primary amine oxidase-like [Brachypodium distachyon]
Length=729

 Score =   741 bits (1913),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 358/670 (53%), Positives = 469/670 (70%), Gaps = 24/670 (4%)
 Frame = -1

Query  2110  NNHFADRPMHPLDPLTIQEIERTRSILSSYQPFSGS--SLRIHSLSLDEPDKSEVLRWKR  1937
             ++H +D P HPLDPLT+ EI    ++L ++ PFS S  SL IHSL+LDEP+K  V  W++
Sbjct  65    HDHNSDVPRHPLDPLTVTEINLAAALLRAHPPFSESPSSLIIHSLALDEPEKPLVRAWQK  124

Query  1936  GN------PLPTRKAFVVALSNGQAHLLVVDLGSGRVSSHTRNPASGYPPMSADDASTAL  1775
              N      PLP R+   V   +G++H+L +DLG          PASGYP M+ D+     
Sbjct  125   ANKAGLNTPLPARRVVAVVRFHGESHVLSIDLGPNGAIEALPVPASGYPTMTMDEQVALC  184

Query  1774  EATFSNSVFREAISTRGVEINDVVCSAAAPGWFGPEEEGRRITKVKCYTAQNTPNYYMRP  1595
              A F++  F  +I+ RGV I DV C   + GW+GP+EEGRR+ KV+C++ + T N+YMRP
Sbjct  185   AAPFADPAFNASIARRGVRITDVACLPISSGWYGPDEEGRRVIKVQCFSMEGTANFYMRP  244

Query  1594  IEGLLLTVDLDSGKVINVYDTHSPIPIPKAQGTDYR---RDGIEHRAPGVEPLKPISMEQ  1424
             IEGL L +D+D+ +V+++ D  + IP+P A+ TDYR     G + +       +  SME+
Sbjct  245   IEGLTLVLDMDTREVVHISDRGAGIPVPDAKNTDYRVHAGTGDDAKKKKRGAAQQASMEE  304

Query  1423  PNGQSFRVEDGYIVKWASWEFHVKADQRAGIIISQATVFDPEAGKRRSVMYKGFASELFV  1244
                  F V+ G+ VKW  WE HVKAD RAG+++S A V      + R VMYKG ASELFV
Sbjct  305   ---LGFEVK-GHKVKWGGWEMHVKADARAGMVVSMAEV------QGREVMYKGMASELFV  354

Query  1243  PYMDVDEGWYFRAFMDAGEFGLGATAMELVPLNDCPRHSHYIDGLFVDPDGRPVSQPNVI  1064
             PYMD  E WYF+ +MDAGE+G G  AM LVPLNDCPR++ Y+DG+FV  DG+P  + N+I
Sbjct  355   PYMDPTEAWYFKTYMDAGEYGFGLQAMPLVPLNDCPRNAAYLDGVFVAGDGKPYVKENII  414

Query  1063  CVFERYSGDIAWRHSGTGDADDDLIREARPKVSLVVRTTATVGNYDYIFDWEFQTDGSIR  884
             CVFERY+GD+AWRHS  G      IRE+R KV+LV R  A+V NYDYI DWEFQ DG IR
Sbjct  415   CVFERYAGDVAWRHS-EGPISGMDIRESRAKVTLVARMAASVANYDYIMDWEFQMDGLIR  473

Query  883   VTVGLSGIILAKGSPYEHINQFEIPRWDFPAGSLVSENTIGVAHDHFITFHLDMDVDGPT  704
             + VGLSGI++ KG+PY H+NQ  + R +   G+L+SEN IGV HDH++TF LDMDVDG  
Sbjct  474   IKVGLSGILMVKGTPYSHMNQ--VRRNEEMYGTLLSENVIGVIHDHYVTFRLDMDVDGAD  531

Query  703   NSFVKVDLVKNYNIAGKIQRKSYWSPKRKVAKSENDAKIKLQLDKPSEFHVINPRHQSRL  524
             NSFVKV++ ++    G+  RKSY    R VA +E DA+++L+L +PSEFH++NP  ++R+
Sbjct  532   NSFVKVEMARHNTAPGESPRKSYLKATRHVASTEKDAQVRLKLYEPSEFHLVNPTKKTRV  591

Query  523   GNPSGYKIVPSATAASLLDLQDPPQLRAAFTNNQIWVTPYNRSEQWAGGLFTYQSHGDDT  344
             GNP GYKIVP  TAASLL   DP Q R AFTNNQIWVTPYN+SE+WAGGLF YQS G+DT
Sbjct  592   GNPVGYKIVPGGTAASLLAPDDPAQKRGAFTNNQIWVTPYNKSEEWAGGLFVYQSKGEDT  651

Query  343   LAVWSNRNRVIEKQDIVLWYTLGFHHLPCQEDFPVMPTVTSTFQLKPVNFFDRNPIIQAN  164
             LA WS R+R IE +D+V+WYTLGFHH+PCQEDFP+MPTV+++F LKPVNFF+ NPI++  
Sbjct  652   LATWSERDRPIENKDLVVWYTLGFHHVPCQEDFPIMPTVSASFDLKPVNFFESNPILKQR  711

Query  163   PNFAEDLPIC  134
             P    DLP+C
Sbjct  712   PVKENDLPVC  721



>ref|XP_009411535.1| PREDICTED: primary amine oxidase-like [Musa acuminata subsp. 
malaccensis]
Length=722

 Score =   739 bits (1907),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 369/665 (55%), Positives = 468/665 (70%), Gaps = 14/665 (2%)
 Frame = -1

Query  2104  HFADRPMHPLDPLTIQEIERTRSILSSYQPFSGSSL--RIHSLSLDEPDKSEVLRWKRGN  1931
             H    P HPLDPLT  EI+  RSIL+S+  F+  +    IHSLSL EP+K+ VL W+ G+
Sbjct  57    HVHKNPYHPLDPLTYNEIKAIRSILASHPDFASPNTFPSIHSLSLLEPEKAVVLAWRPGD  116

Query  1930  PLPTRKAFVVALSNGQAHLLVVDLGSGRVSSHT-RNPASGYPPMSADDASTALEATFSNS  1754
              LP R+A VVA S    H+L VD+ S  V  H  R   +GYP ++ ++   A +A  ++ 
Sbjct  117   TLPPRRALVVAYSANHTHVLPVDIASRSVLRHVVRARPAGYPSLTPEEMERATKAAAAHP  176

Query  1753  VFREAISTRGVEIND-VVCSAAAPGWFGPEEEGRRITKVKCYTAQNTPNYYMRPIEGLLL  1577
                 A+  RG+  +  VVC   A GW+GPEEE RR+ KV+CY    +PN+YM P+EGL +
Sbjct  177   DVINAVFYRGLNPSSGVVCGPLASGWYGPEEENRRVIKVQCYA--KSPNFYMSPVEGLTV  234

Query  1576  TVDLDSGKVINVYDTHSPIPIPKAQGTDYRRDGIEHRAPGVEPL--KPISMEQPNGQSFR  1403
             TVD+D+G VI V D    IP+P+ + TDYR +  + R P  E +   P+SMEQ    S R
Sbjct  235   TVDVDTGGVIRVSDQGLGIPVPRNRDTDYRYES-QRRIPTTEAVAVNPMSMEQAGKPSMR  293

Query  1402  V-EDGYIVKWASWEFHVKADQRAGIIISQATVFDPEAGKR-RSVMYKGFASELFVPYMDV  1229
             V   G+ V+WA WE H++ D RAG+++S+A   DPE G   R VMYKG  SELFVPYMD 
Sbjct  294   VGAGGHAVQWAGWEVHIRPDARAGMVVSRARFRDPEGGGAWRDVMYKGMVSELFVPYMDP  353

Query  1228  DEGWYFRAFMDAGEFGLGATAMELVPLNDCPRHSHYIDGLFVDPDGRPVSQPNVICVFER  1049
              EGWYF+ +MDAGE+G+G  A  L+ LNDCPR++ Y+D +F   DG P  +P+V+CVFER
Sbjct  354   GEGWYFKTYMDAGEYGMGTNAFPLLRLNDCPRNAIYMDAVFAAADGTPFVRPDVVCVFER  413

Query  1048  YSGDIAWRHSGTGDADDDLIREARPKVSLVVRTTATVGNYDYIFDWEFQTDGSIRVTVGL  869
             Y GD+AWRH+    +  D IREARPKV+LV R  A+VGNYDY  DWEFQ DG IRV V L
Sbjct  414   YEGDVAWRHTENPVSGYD-IREARPKVTLVARMVASVGNYDYTVDWEFQMDGLIRVKVSL  472

Query  868   SGIILAKGSPYEHINQFEIPRWDFPAGSLVSENTIGVAHDHFITFHLDMDVDGPTNSFVK  689
             SG+++ K + Y +++Q  +P  +   G+LV++N +GV HDHF+TF+LDMDVDGP+NSFVK
Sbjct  473   SGMLMVKATRYGNLSQ--VPEGEDLYGTLVADNIVGVVHDHFVTFYLDMDVDGPSNSFVK  530

Query  688   VDLVKNYNIAGKIQRKSYWSPKRKVAKSENDAKIKLQLDKPSEFHVINPRHQSRLGNPSG  509
             V +       G+  RKSY    R+VA++E DAK+KL+L  PSEFHV+NP   S+LGNPSG
Sbjct  531   VHMETQETAPGESPRKSYMKVVREVARTEEDAKVKLKLYDPSEFHVVNPSRLSKLGNPSG  590

Query  508   YKIVPSATAASLLDLQDPPQLRAAFTNNQIWVTPYNRSEQWAGGLFTYQSHGDDTLAVWS  329
             YK+VP ATAASLLDL DPPQ RAAFTNNQIWVTPYNRSE+WAGGL  YQSHGDD LAVWS
Sbjct  591   YKLVPGATAASLLDLDDPPQKRAAFTNNQIWVTPYNRSEEWAGGLLAYQSHGDDNLAVWS  650

Query  328   NRNRVIEKQDIVLWYTLGFHHLPCQEDFPVMPTVTSTFQLKPVNFFDRNPIIQANPNFAE  149
              R+R IE +DIVLWYT+GFHH+PCQED+P+MPTV STF LKPVNFF  NPII+A P   E
Sbjct  651   KRDRKIENKDIVLWYTMGFHHVPCQEDYPIMPTVFSTFDLKPVNFFRINPIIRAAPYTEE  710

Query  148   DLPIC  134
             DLP+C
Sbjct  711   DLPVC  715



>gb|KGN50201.1| hypothetical protein Csa_5G158570 [Cucumis sativus]
Length=653

 Score =   735 bits (1898),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 367/658 (56%), Positives = 455/658 (69%), Gaps = 68/658 (10%)
 Frame = -1

Query  2089  PMHPLDPLTIQEIERTRSILSSYQPFSGSSLRIHSLSLDEPDKSEVLRWKRGNPLPTRKA  1910
             P HPLDPLT+QEI + R ILSSY+PFS S   IHSL+L+EPDKS VL W+ GNPLP R+A
Sbjct  54    PHHPLDPLTVQEINKVRDILSSYEPFSNSFPTIHSLALEEPDKSLVLSWEFGNPLPPRRA  113

Query  1909  FVVALSNGQAHLLVVDLGSGRVSSHTRNPASGYPPMSADDASTALEATFSNSVFREAIST  1730
              V+ +   Q H+L VDL   RV  HT NP SGYP ++ ++  +AL+   +NS  +++I  
Sbjct  114   AVIGILYEQVHVLSVDLELHRVIRHTANPTSGYPMITMEELLSALDVALANSNVQKSIHA  173

Query  1729  RGVEINDVVCSAAAPGWFGPEEEGRRITKVKCYTAQNTPNYYMRPIEGLLLTVDLDSGKV  1550
             RGV++ DV   + +PGWFG EEEGRRI K++ Y+ Q T NYYMRPIEGL +TVDL+  +V
Sbjct  174   RGVKLKDVRFLSPSPGWFGKEEEGRRIVKLQFYSIQGTSNYYMRPIEGLTVTVDLNKQEV  233

Query  1549  INVYDTHSPIPIPKAQGTDYRRDGIEHRAPGVEPLKPISMEQPNGQSFRVEDGYIVKWAS  1370
             + V DT   IPIP++  T+Y+ +G E   P ++ + PIS+EQP G SF VE+GYIVKW +
Sbjct  234   VKVADTGKGIPIPRSTNTEYQYNG-ETEPPEIKKINPISIEQPKGPSFTVENGYIVKWGN  292

Query  1369  WEFHVKADQRAGIIISQATVFDPEAGKRRSVMYKGFASELFVPYMDVDEGWYFRAFMDAG  1190
             WEFH+K DQRAG++IS+A                     L+VPYMD DE WYF+ +MDAG
Sbjct  293   WEFHIKPDQRAGMVISRAM--------------------LYVPYMDFDEHWYFKTYMDAG  332

Query  1189  EFGLGATAMELVPLNDCPRHSHYIDGLFVDPDGRPVSQPNVICVFERYSGDIAWRHSGTG  1010
             E+GLG  +  LVPLNDCPR+S+Y+D                               +G G
Sbjct  333   EYGLGLLSTSLVPLNDCPRNSYYMD-------------------------------AGRG  361

Query  1009  DADDDLIREARPKVSLVVRTTATVGNYDYIFDWEFQTDGSIRVTVGLSGIILAKGSPYEH  830
                     EAR KV+LV R  +TVGNYDYI DWEFQTDG IRV VGLSG+++ K +P   
Sbjct  362   --------EARQKVTLVARMVSTVGNYDYIIDWEFQTDGLIRVEVGLSGMLMIKATP---  410

Query  829   INQFEIPRWDFPAGSLVSENTIGVAHDHFITFHLDMDVDGPTNSFVKVDLVKNYNIAGK-  653
              N++ + + +     LVSEN IGV HDH+ITF+LDMDVDG  NSFV +DLVK   +  K 
Sbjct  411   -NEYAVNKDNEGFEPLVSENAIGVVHDHYITFYLDMDVDGVNNSFVNIDLVKEEQVDNKS  469

Query  652   ---IQRKSYWSPKRKVAKSENDAKIKLQLDKPSEFHVINPRHQSRLGNPSGYKIVPSATA  482
                  RKS + P +KVAK E++AKI L L  PSEFHV+NP   SRLGNPSGYKIVP+ATA
Sbjct  470   PKSTPRKSIYKPYKKVAKMEDEAKIILSLVDPSEFHVVNPSKLSRLGNPSGYKIVPTATA  529

Query  481   ASLLDLQDPPQLRAAFTNNQIWVTPYNRSEQWAGGLFTYQSHGDDTLAVWSNRNRVIEKQ  302
             ASLLDL DPPQ+R+AFTNNQIWVTPY ++EQWAGG  TYQ  GDDTLA WS RNR IE +
Sbjct  530   ASLLDLDDPPQIRSAFTNNQIWVTPYKKNEQWAGGFLTYQGRGDDTLATWSQRNRPIENR  589

Query  301   DIVLWYTLGFHHLPCQEDFPVMPTVTSTFQLKPVNFFDRNPIIQANPNFAEDLPICRA  128
             DIVLWYTLGFHH+PCQEDFPVMPTV+S+F LKPVNFFDRNPI++A P   +DLP+C A
Sbjct  590   DIVLWYTLGFHHVPCQEDFPVMPTVSSSFDLKPVNFFDRNPILRAAPASVDDLPVCNA  647



>gb|KHG18383.1| hypothetical protein F383_06941 [Gossypium arboreum]
Length=564

 Score =   729 bits (1882),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 343/566 (61%), Positives = 426/566 (75%), Gaps = 29/566 (5%)
 Frame = -1

Query  1828  NPASGYPPMSADDASTALEATFSNSVFREAISTRGVEINDVVCSAAAPGWFGPEEEGRRI  1649
             N +SGYP +S DD   A +  FSN+ F ++I+ RGV  +D++C   + GWFGP EEG+R+
Sbjct  23    NASSGYPMLSVDDILAASKVPFSNAEFNKSIAARGVSSSDLICLPPSAGWFGPNEEGKRV  82

Query  1648  TKVKCYTAQNTPNYYMRPIEGLLLTVDLDSGKVINVYDTHSPIPIPKAQGTDYRRDGIEH  1469
              KV CY+ ++TPN+YMRPIEGL++TVDLDS +++   DT   IPIPK+ GTDYR    + 
Sbjct  83    VKVLCYSKESTPNFYMRPIEGLIMTVDLDSMEMLKFSDTGRDIPIPKSSGTDYRYTA-QK  141

Query  1468  RAPGVEPLKPISMEQPNGQSFRVEDGYIVKWASWEFHVKADQRAGIIISQATVFDPEAGK  1289
             + P +EPL PIS+EQP G SF+VEDG+IVKWA+W FH+KADQRAG++IS+A V D + G+
Sbjct  142   KEPEMEPLNPISIEQPKGPSFKVEDGHIVKWANWVFHLKADQRAGLVISRAMVRDSKKGE  201

Query  1288  RRSVMYKGFASELFVPYMDVDEGWYFRAFMDAGEFGLGATAMELVPLNDCPRHSHYIDGL  1109
              R+VMYKGFASE FVPYMD+DE WYF+++MDAGEFGLG +A+ LVPLNDCPRHS+Y+DG+
Sbjct  202   LRNVMYKGFASEFFVPYMDLDESWYFKSYMDAGEFGLGMSALPLVPLNDCPRHSYYMDGV  261

Query  1108  FVDPDGRPVSQPNVICVFERYSGDIAWRHSGTGDADDDLIREARPKVSLVVRTTATVGNY  929
             F   DG P                       T   D   IRE RPKV+LV R  A+VGNY
Sbjct  262   FSTSDGHPA-------------------MPATSVGDIQKIRETRPKVTLVARMAASVGNY  302

Query  928   DYIFDWEFQTDGSIRVTVGLSGIILAKGSPYEHINQFEIPRWDFPAGSLVSENTIGVAHD  749
             DYIFDWEFQ        VGLSG+++ KGSP++ +  +++P  D  +G L+ EN IGV HD
Sbjct  303   DYIFDWEFQM-------VGLSGMLMVKGSPHQSL--YQVPNQDAMSGPLILENVIGVVHD  353

Query  748   HFITFHLDMDVDGPTNSFVKVDLVKNYNIAGKIQRKSYWSPKRKVAKSENDAKIKLQLDK  569
             HFITFHLDMD+DG  NSFV V+LVK  ++ G+  RKSYW  KRK+AK+E DA+IKL+L  
Sbjct  354   HFITFHLDMDIDGANNSFVNVNLVKQRSLPGESPRKSYWKAKRKIAKTEKDAQIKLKLYD  413

Query  568   PSEFHVINPRHQSRLGNPSGYKIVPSATAASLLDLQDPPQLRAAFTNNQIWVTPYNRSEQ  389
             PSEFH+INP   SRLGNP+GYKIVP  TAASLLD  DPPQLR+AFTNNQIWVTPYN+SEQ
Sbjct  414   PSEFHMINPSKMSRLGNPTGYKIVPGGTAASLLDHDDPPQLRSAFTNNQIWVTPYNKSEQ  473

Query  388   WAGGLFTYQSHGDDTLAVWSNRNRVIEKQDIVLWYTLGFHHLPCQEDFPVMPTVTSTFQL  209
             WA GL   QS GDDTLAVWS R+R IE +DIVLWYTLGFHH+PCQEDFPVMPTVTS F+L
Sbjct  474   WAAGLLVLQSRGDDTLAVWSERDRHIENEDIVLWYTLGFHHIPCQEDFPVMPTVTSGFEL  533

Query  208   KPVNFFDRNPIIQANPNFAEDLPICR  131
             KP+NFF+ NPI+++ P F +DLP+CR
Sbjct  534   KPINFFESNPILRSAPAFEKDLPVCR  559



>gb|AER93284.1| copper amine oxidase, partial [Huperzia serrata]
Length=681

 Score =   733 bits (1893),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 344/655 (53%), Positives = 467/655 (71%), Gaps = 11/655 (2%)
 Frame = -1

Query  2083  HPLDPLTIQEIERTRSILSSYQPFSGSSLRIHSLSLDEPDKSEVLRWKRGN-PLPTRKAF  1907
             HPLDPL   EI   RS+L +    +     +H ++L+ P+K EVL WK G  P P R+A+
Sbjct  30    HPLDPLRWDEILLARSVLLNSSLLTEGHPTVHIITLETPEKEEVLNWKPGQLPAPLRRAY  89

Query  1906  VVALSNGQAHLLVVDLGSGRVSSHTRNPASGYPPMSADDASTALEATFSNSVFREAISTR  1727
             V  +  G+ H +VVD+ +G + S   + A GYP +S++D         ++  F +++  R
Sbjct  90    VETILFGKTHKIVVDVAAGALVSDEIHHAPGYPSLSSNDILIVATLPSTHPPFLQSLKAR  149

Query  1726  GVEINDVVCSAAAPGWFG-PEEEGRRITKVKCYTAQNTPNYYMRPIEGLLLTVDLDSGKV  1550
             GV ++DVVC   +PGWFG PEEEG+R+ K  CY    + N +MRP+EG+++ +DLD  ++
Sbjct  150   GVGVSDVVCLPISPGWFGIPEEEGKRLVKALCYNKNGSANVFMRPLEGIVILLDLDRKQI  209

Query  1549  INVYDTHSPIPIPKAQGTDYRRDGIEHRAPGVEPLKPISMEQPNGQSFRVEDGYIVKWAS  1370
             +   D    +PIPK +GTDYR      + P ++PL PIS+EQP G SF+VE G +VKWA+
Sbjct  210   LKYVDDRK-VPIPKVEGTDYRL--FAQKPPLMKPLNPISLEQPLGPSFKVE-GNLVKWAN  265

Query  1369  WEFHVKADQRAGIIISQATVFDPEAGKRRSVMYKGFASELFVPYMDVDEGWYFRAFMDAG  1190
             WEFHV+ D RAG++ISQA + DPE G+ RSV+Y+GF SELFVPYMD  EGWYF+ +MD+G
Sbjct  266   WEFHVRPDFRAGMVISQAVIHDPETGEARSVLYEGFPSELFVPYMDPSEGWYFKTYMDSG  325

Query  1189  EFGLGATAMELVPLNDCPRHSHYIDGLFVDPDGRPVSQPNVICVFERYSGDIAWRHSGTG  1010
             E+GLG  A+ L PLNDCPR++HY D +F  PDG P   PN++CVFERY+GD+AWRHS   
Sbjct  326   EYGLGMLALPLQPLNDCPRNAHYFDAVFAGPDGNPYVTPNILCVFERYAGDVAWRHSEAF  385

Query  1009  DADDDLIREARPKVSLVVRTTATVGNYDYIFDWEFQTDGSIRVTVGLSGIILAKGSPYEH  830
               D + + E RPKV+LVVR   +VGNYDYIFDWEFQTDG +RV VG++G+++ K +    
Sbjct  386   VQDFE-VHEVRPKVTLVVRMVGSVGNYDYIFDWEFQTDGILRVNVGMTGLLMVKATSINS  444

Query  829   INQFEIPRWDFPAGSLVSENTIGVAHDHFITFHLDMDVDGPTNSFVKVDLVKNYNIAGKI  650
             I +  +       G+LVSENTIGV HDHFI FHLD+D+DG TN+F+K  L +   +  + 
Sbjct  445   IAENIVDL----HGTLVSENTIGVFHDHFINFHLDLDIDGLTNTFIKKILKRKNVVNNES  500

Query  649   QRKSYWSPKRKVAKSENDAKIKLQLDKPSEFHVINPRHQSRLGNPSGYKIVPSATAASLL  470
              RKSYW+ + ++A++E+DAKI+L+  +PSEFH++N + ++RLGNP GY+IVP  TA SLL
Sbjct  501   PRKSYWTTENQIAETEDDAKIRLKAFEPSEFHIVNSKKRTRLGNPVGYRIVPGFTADSLL  560

Query  469   DLQDPPQLRAAFTNNQIWVTPYNRSEQWAGGLFTYQSHGDDTLAVWSNRNRVIEKQDIVL  290
                DPPQ RAAF +NQIWVTP N+SE+WAGGLF Y+SHG+DTLAVWS RNR I+ +DIVL
Sbjct  561   SSVDPPQHRAAFIDNQIWVTPLNKSERWAGGLFVYESHGEDTLAVWSKRNRAIQGRDIVL  620

Query  289   WYTLGFHHLPCQEDFPVMPTVTSTFQLKPVNFFDRNPIIQANPNFAEDLPICRAG  125
             WYT+GFHH+PCQEDFP+MPT++ +F+LKP NF +RNPI++  PN+   LP C  G
Sbjct  621   WYTMGFHHVPCQEDFPIMPTLSGSFELKPSNFLERNPILKTLPNYPSQLPKCSIG  675



>emb|CDY32205.1| BnaA03g54620D [Brassica napus]
Length=646

 Score =   723 bits (1866),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 362/668 (54%), Positives = 462/668 (69%), Gaps = 75/668 (11%)
 Frame = -1

Query  2125  DFKIQNNHFADRPMHPLDPLTIQEIERTRSILSSYQP-FSGSSLRIHSLSLDEPDKSEVL  1949
             D K++ +H + +P HPLDPLT+QEIER R+IL  ++P F   S  IHS++LDEPDK+ V+
Sbjct  46    DPKLRVDHSSAKPHHPLDPLTVQEIERVRTILLDHEPGFGSGSATIHSMALDEPDKTLVV  105

Query  1948  RWKRGNPLPTRKAFVVALSNGQAHLLVVDLGSGRVSSHTRNPASGYPPMSADDASTALEA  1769
             +WK+GN LP+R+A V+ALS GQ+H++VVDL SGRV S   NP SGYP ++ DD   A + 
Sbjct  106   KWKKGNRLPSRRAEVLALSVGQSHVIVVDLDSGRVVSDVVNPTSGYPILTMDDLIVASQV  165

Query  1768  TFSNSVFREAISTRGVEINDVVCSAAAPGWFGPEEEGRRITKVKCYTAQNTPNYYMRPIE  1589
                +  F  ++  RGV+++D+V      GWFGPEEEGRRI KV+C+T+Q+TPNY+MRPIE
Sbjct  166   ALKSIEFNRSVEARGVKLSDLVALPTFTGWFGPEEEGRRILKVQCFTSQDTPNYFMRPIE  225

Query  1588  GLLLTVDLDSGKVINVYDTHSPIPIPKAQGTDYRRDGIEHRAPGVEPLKPISMEQPNGQS  1409
             GL  TVD+D  +VI + D    +PIPKA GT+YR + ++++   ++ + PIS+EQP G S
Sbjct  226   GLYATVDMDKLEVIKIVDK-GMVPIPKAAGTEYRYN-VQNKPVHMDRINPISIEQPEGPS  283

Query  1408  FRVEDGYIVKWASWEFHVKADQRAGIIISQATVFDPE-AGKRRSVMYKGFASELFVPYMD  1232
             F VEDG++VKWA+W FHVKAD RAGIIISQATV D E AG+ RSVMYKGF SELFVPYMD
Sbjct  284   FLVEDGHLVKWANWVFHVKADHRAGIIISQATVRDSETAGEPRSVMYKGFPSELFVPYMD  343

Query  1231  VDEGWYFRAFMDAGEFGLGATAMELVPLNDCPRHSHYIDGLFVDPDGRPVSQPNVICVFE  1052
               E WY+++++DAGE G                                           
Sbjct  344   PGELWYYKSYLDAGEIG-------------------------------------------  360

Query  1051  RYSGDIAWRHSGTGDADDDLIREARPKVSLVVRTTATVGNYDYIFDWEFQTDGSIRVTVG  872
                 D++WRHS     + D IRE+RPKV+LV R   +VGNYDY FDWEFQTDG IRVTV 
Sbjct  361   ----DVSWRHSEILIPNAD-IRESRPKVTLVARMATSVGNYDYTFDWEFQTDGLIRVTVA  415

Query  871   LSGIILAKGSPYEHINQFEIPRWDFPAGSLVSENTIGVAHDHFITFHLDMDVDGP-TNSF  695
              SG+++ KG+PYE+++       D  +G L+SEN IGV HDHFITFHLDMD+DGP  NSF
Sbjct  416   ASGMLMVKGTPYENVDDLGDKEDD--SGPLISENVIGVVHDHFITFHLDMDIDGPMNNSF  473

Query  694   VKVDLVKNYNIAGKIQRKSYWSPKRKVAKSENDAKIKLQLDKPSEFHVINPRHQSRLGNP  515
             VKV                    K+ VAK+E DA+IKL L  P EFH++NP  +SRLGNP
Sbjct  474   VKV--------------------KKYVAKTEKDAQIKLSLYDPYEFHIVNPNRKSRLGNP  513

Query  514   SGYKIVPSATAASLLDLQDPPQLRAAFTNNQIWVTPYNRSEQWAGGLFTYQSHGDDTLAV  335
             +GY+I+P   A SLLD  DPPQ+R AF+NNQIWVT YNRSEQ+AGG+  YQSHGDDTL V
Sbjct  514   AGYRIIPGGNAVSLLDHDDPPQIRGAFSNNQIWVTRYNRSEQFAGGVLVYQSHGDDTLQV  573

Query  334   WSNRNRVIEKQDIVLWYTLGFHHLPCQEDFPVMPTVTSTFQLKPVNFFDRNPIIQANPNF  155
             WS+R+R IE  DIV+WYTLGFHH+PCQED+PVMPTV ++F+LKP NFF+ NP+I   P F
Sbjct  574   WSDRDRSIENNDIVVWYTLGFHHIPCQEDYPVMPTVAASFELKPANFFESNPVIGVAPIF  633

Query  154   AEDLPICR  131
              +DLP+CR
Sbjct  634   EKDLPVCR  641



>emb|CAI39243.1| copper-containing amine oxidase [Solanum lycopersicum]
Length=563

 Score =   718 bits (1853),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 339/566 (60%), Positives = 427/566 (75%), Gaps = 10/566 (2%)
 Frame = -1

Query  1810  PPMSADDASTALEATFSNSVFREAISTRGVEINDVVCSAAAPGWFGPEEEGRRITKVKCY  1631
             P ++ +D  +A  A F+NS F  +I  RGV++ D+ C   A GW+G  EE RR+ KV+ +
Sbjct  1     PILTIEDMISATSAPFANSDFNRSIIQRGVDLADLACLPVAAGWYGKIEEKRRVIKVQSF  60

Query  1630  TAQNTPNYYMRPIEGLLLTVDLDSGKVINVYDTHSPIPIPKAQGTDYRRDGIEHRAPGVE  1451
             T ++T N+YMRPIEGL + +DLD+ +VI ++D    IPIPKA  TDYR   I+     + 
Sbjct  61    TLKDTINFYMRPIEGLTVLLDLDTQQVIEIFDEGESIPIPKAANTDYRYSRIKKNKQKIN  120

Query  1450  PLKPISMEQPNGQSFRVEDGYIVKWASWEFHVKADQRAGIIISQATVFDPEAGKRRSVMY  1271
              LKPIS+EQPNG SF +E+ ++VKWA+WEFH+K D RAG+IIS+    DP+ GK R+VMY
Sbjct  121   LLKPISIEQPNGPSFTIENNHLVKWANWEFHLKPDPRAGVIISRVMFEDPDTGKMRNVMY  180

Query  1270  KGFASELFVPYMDVDEGWYFRAFMDAGEFGLGATAMELVPLNDCPRHSHYIDGLFVDPDG  1091
             KGF SELFVPYMD  + WYF+ +MDAGE+G G  AM L PLNDCPR+++Y+DG+FV PDG
Sbjct  181   KGFTSELFVPYMDPSDAWYFKTYMDAGEYGFGLQAMPLDPLNDCPRNAYYMDGVFVAPDG  240

Query  1090  RPVSQPNVICVFERYSGDIAWRHSG---TGDADDDLIREARPKVSLVVRTTATVGNYDYI  920
              P  + N+ICVFERY+GDI WRH+    TG      IRE RPKV+LVVR  A+V NYDYI
Sbjct  241   TPYVRSNMICVFERYAGDIGWRHAECPITGLP----IREVRPKVTLVVRMAASVANYDYI  296

Query  919   FDWEFQTDGSIRVTVGLSGIILAKGSPYEHINQFEIPRWDFPAGSLVSENTIGVAHDHFI  740
              DWEFQ DG IR  VGLSGI++ KGSPY ++N  E+ + ++  G+L+SEN +GV HDH++
Sbjct  297   VDWEFQNDGLIRPKVGLSGILMVKGSPYVNMN--EVNQNEYLYGTLLSENIVGVIHDHYV  354

Query  739   TFHLDMDVDGPT-NSFVKVDLVKNYNIAGKIQRKSYWSPKRKVAKSENDAKIKLQLDKPS  563
             TFHLDMD+DGP+ NSFVKV+L K    +G+  R+SY    R VAK+E DA+IKL+L  PS
Sbjct  355   TFHLDMDIDGPSNNSFVKVNLQKEMTSSGESPRRSYLKAVRNVAKTEKDAQIKLKLYDPS  414

Query  562   EFHVINPRHQSRLGNPSGYKIVPSATAASLLDLQDPPQLRAAFTNNQIWVTPYNRSEQWA  383
             EFHVIN   +SR+GNP GYK+VP  TAASLLD  DPPQ RAAFTNNQIWVTPYN SEQWA
Sbjct  415   EFHVINSNKKSRVGNPVGYKVVPGGTAASLLDHNDPPQKRAAFTNNQIWVTPYNESEQWA  474

Query  382   GGLFTYQSHGDDTLAVWSNRNRVIEKQDIVLWYTLGFHHLPCQEDFPVMPTVTSTFQLKP  203
              GLF YQS GDDTLAVWS+R+R IE +DIVLWYTLGFHH+PCQEDFP+MPTV+S+F++KP
Sbjct  475   AGLFVYQSQGDDTLAVWSDRDRAIENKDIVLWYTLGFHHIPCQEDFPIMPTVSSSFEIKP  534

Query  202   VNFFDRNPIIQANPNFAEDLPICRAG  125
             VNFF+ NPI+   PN  +DLPIC+A 
Sbjct  535   VNFFESNPILNIPPNSPKDLPICKAA  560



>gb|EEE60637.1| hypothetical protein OsJ_14075 [Oryza sativa Japonica Group]
Length=716

 Score =   711 bits (1834),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 353/677 (52%), Positives = 456/677 (67%), Gaps = 56/677 (8%)
 Frame = -1

Query  2107  NHFADRPMHPLDPLTIQEIERTRSILSSYQPFSG--SSLRIHSLSLDEPDKSEVLRWKRG  1934
             +H +D P HPLDPLT++E+ R R +L ++  F+   SSL +HSL LDEP+KS V  W++G
Sbjct  76    SHESDVPRHPLDPLTVREVNRVRELLRAHPLFASAPSSLFVHSLELDEPEKSVVKSWRKG  135

Query  1933  -NPLPTRKAFVVALSNGQAHLLVVDL--GSGRVSSHTRNPASGYPPMSADDASTALEATF  1763
              +PLP R+A  V    G++H+L VDL  G G V+     PASGYP M+ D+ ++   A F
Sbjct  136   ADPLPPRRAVAVVRFRGESHVLGVDLSEGDGAVTP-LPVPASGYPMMNMDEQTSLCFAPF  194

Query  1762  SNSVFREAISTRGVEINDVVCSAAAPGWFGPEEEGRRITKVKCYTAQNTPNYYMRPIEGL  1583
              +  F  ++  RGV  +DV C   + GW+GP EE RR+ K +C++ + T N+YMRPIEGL
Sbjct  195   KDEAFNASLLRRGVRASDVACLPISLGWYGPAEENRRLIKSQCFSTEGTANFYMRPIEGL  254

Query  1582  LLTVDLDSGKVINVYDTHSPIPIPKAQGTDYRRDGIEHRAP-----------GVEPLKPI  1436
              + VD+D+ +V++V D  + IPIP A  TDYR     H AP           G + ++  
Sbjct  255   TVLVDMDTAEVLHVSDRGAGIPIPAAANTDYRHG---HSAPTPAEAQAQGRHGYQTVRVP  311

Query  1435  SMEQPNGQSFRVEDGYIVKWASWEFHVKADQRAGIIISQATVFDPEAGKRRSVMYKGFAS  1256
             SME P G                                    DP  G+ R VMYKG AS
Sbjct  312   SMEPPAGGPG---------------------------------DPATGEHRDVMYKGMAS  338

Query  1255  ELFVPYMDVDEGWYFRAFMDAGEFGLGATAMELVPLNDCPRHSHYIDGLFVDPDGRPVSQ  1076
             ELFVPYMD  E WYF+ +MDAGE+G G  AM LVPLNDCPRH+ Y+D +FV  DGRP  +
Sbjct  339   ELFVPYMDPTEAWYFKTYMDAGEYGFGLQAMPLVPLNDCPRHARYLDAVFVAADGRPYVR  398

Query  1075  PNVICVFERYSGDIAWRHSGTGDADDDLIREARPKVSLVVRTTATVGNYDYIFDWEFQTD  896
              N+ICVFERY+GDIAWRHS +     D IRE+RPKV+LV R  A+V NYDYI DWEFQ D
Sbjct  399   ENMICVFERYAGDIAWRHSESPITGMD-IRESRPKVTLVARMAASVANYDYIVDWEFQMD  457

Query  895   GSIRVTVGLSGIILAKGSPYEHINQFEIPRWDFPAGSLVSENTIGVAHDHFITFHLDMDV  716
             G +R+ VGLSGI++ KG+ Y H+NQ  + + D   G+L+SEN IGV HDHF+TF LDMD+
Sbjct  458   GLVRIKVGLSGILMVKGTQYSHMNQ--VHQNDNMYGTLLSENVIGVIHDHFVTFRLDMDI  515

Query  715   DGPTNSFVKVDLVKNYNIAGKIQRKSYWSPKRKVAKSENDAKIKLQLDKPSEFHVINPRH  536
             DG  NSFVKV + +    AG+  RKSY    R VA++E DA+++L+L +PSEFH++NP  
Sbjct  516   DGADNSFVKVAMARQNTGAGESPRKSYLKATRHVARTEKDAQVRLKLYEPSEFHIVNPMK  575

Query  535   QSRLGNPSGYKIVPSATAASLLDLQDPPQLRAAFTNNQIWVTPYNRSEQWAGGLFTYQSH  356
             ++R+GNP GYK+VP+ TAASLLD +DPPQ R AFTNNQIWVTPYN++E+WAGGLF YQS 
Sbjct  576   KTRVGNPVGYKVVPAGTAASLLDPEDPPQKRGAFTNNQIWVTPYNKTEEWAGGLFVYQSK  635

Query  355   GDDTLAVWSNRNRVIEKQDIVLWYTLGFHHLPCQEDFPVMPTVTSTFQLKPVNFFDRNPI  176
             G+DTLA WS R+R IE +D+VLWYTLGFHH+PCQEDFP+MPTV+S+F LKPVNFF+ NPI
Sbjct  636   GEDTLATWSERDRPIENKDLVLWYTLGFHHVPCQEDFPIMPTVSSSFDLKPVNFFESNPI  695

Query  175   IQANPNFAEDLPICRAG  125
             +   P    DLP+C A 
Sbjct  696   LGQRPTQENDLPVCAAA  712



>ref|XP_007210486.1| hypothetical protein PRUPE_ppa003650mg [Prunus persica]
 gb|EMJ11685.1| hypothetical protein PRUPE_ppa003650mg [Prunus persica]
Length=559

 Score =   704 bits (1818),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 332/563 (59%), Positives = 417/563 (74%), Gaps = 10/563 (2%)
 Frame = -1

Query  1804  MSADDASTALEATFSNSVFREAISTRGVEINDVVCSAAAPGWFGPEEEGRRITKVKCYTA  1625
             M+ ++ + A      N+ F   I  RGV++ D+ C   + GW+G  EE RR+ KV+CY+ 
Sbjct  1     MTLEEMTAATWVPLMNADFNRTIVQRGVDLTDLACLPLSTGWYGKVEEKRRLIKVQCYST  60

Query  1624  QNTPNYYMRPIEGLLLTVDLDSGKVINVYDTHSPIPIPKAQGTDYRRDGIEHRAPGVEPL  1445
             ++T N+YMRPIEGL + VDLD+ +V+ + D    IPIPKA  TDYR    +     ++ L
Sbjct  61    KDTVNFYMRPIEGLTVLVDLDTKQVLEISDKGGSIPIPKAANTDYRYSA-QKPNQVLKLL  119

Query  1444  KPISMEQPNGQSFRVEDGYIVKWASWEFHVKADQRAGIIISQATVFDPEAGKRRSVMYKG  1265
             KPIS+EQPNG+SF VED ++VKWA+WEFH+K D RAG+I+SQA V DP  G+ R VMYKG
Sbjct  120   KPISIEQPNGRSFTVEDDHLVKWANWEFHLKPDARAGVIVSQAKVRDPNTGEFRDVMYKG  179

Query  1264  FASELFVPYMDVDEGWYFRAFMDAGEFGLGATAMELVPLNDCPRHSHYIDGLFVDPDGRP  1085
             F SELFVPYMD  + WYF+ +MDAGE+G G  AM L PLNDCPR+++Y+DG+F   DG P
Sbjct  180   FTSELFVPYMDPTDAWYFKTYMDAGEYGFGLQAMSLDPLNDCPRNAYYMDGVFAAADGTP  239

Query  1084  VSQPNVICVFERYSGDIAWRHSG---TGDADDDLIREARPKVSLVVRTTATVGNYDYIFD  914
               + N++CVFE Y+GDIAWRH+    TG      IRE RPKV+LVVR  A+V NYDYI D
Sbjct  240   YVRSNMVCVFESYAGDIAWRHTECPITGMQ----IREVRPKVTLVVRMAASVANYDYIID  295

Query  913   WEFQTDGSIRVTVGLSGIILAKGSPYEHINQFEIPRWDFPAGSLVSENTIGVAHDHFITF  734
             WEFQTDG IRV VGLSGI++ KG+ YE++NQ   P  +   G+L+SEN IGV HDH++TF
Sbjct  296   WEFQTDGLIRVKVGLSGILMVKGTSYENVNQVSSP--ENLHGTLLSENVIGVIHDHYVTF  353

Query  733   HLDMDVDGPTNSFVKVDLVKNYNIAGKIQRKSYWSPKRKVAKSENDAKIKLQLDKPSEFH  554
             +LDMDVDG  NSF+KV+L +  N   +  RKSY    + VAK+E DA++KL+L  PSEFH
Sbjct  354   YLDMDVDGSDNSFLKVNLRREQNSPNESPRKSYLKATKTVAKTEKDAQVKLKLYDPSEFH  413

Query  553   VINPRHQSRLGNPSGYKIVPSATAASLLDLQDPPQLRAAFTNNQIWVTPYNRSEQWAGGL  374
             VINP  ++R+GNP GYK+VP  TAASLLDL DPPQ R AFTNNQIWVTPYNRSEQWAGGL
Sbjct  414   VINPTKRTRVGNPVGYKLVPGGTAASLLDLDDPPQKRGAFTNNQIWVTPYNRSEQWAGGL  473

Query  373   FTYQSHGDDTLAVWSNRNRVIEKQDIVLWYTLGFHHLPCQEDFPVMPTVTSTFQLKPVNF  194
                QS G+DTLAVWS+R+R IE +DIVLWYTLGFHH+PCQEDFP+MPTV+S+F LKPVNF
Sbjct  474   LVCQSQGEDTLAVWSDRDRPIENKDIVLWYTLGFHHIPCQEDFPIMPTVSSSFDLKPVNF  533

Query  193   FDRNPIIQANPNFAEDLPICRAG  125
             F+ NPI++  PN   DLP+C A 
Sbjct  534   FESNPILRTPPNVETDLPVCVAA  556



>ref|NP_001052338.2| Os04g0269600 [Oryza sativa Japonica Group]
 emb|CAD39884.2| OSJNBb0067G11.7 [Oryza sativa Japonica Group]
 dbj|BAF14252.2| Os04g0269600 [Oryza sativa Japonica Group]
Length=702

 Score =   708 bits (1827),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 350/666 (53%), Positives = 451/666 (68%), Gaps = 48/666 (7%)
 Frame = -1

Query  2107  NHFADRPMHPLDPLTIQEIERTRSILSSYQPFSG--SSLRIHSLSLDEPDKSEVLRWKRG  1934
             +H +D P HPLDPLT++E+ R R +L ++  F+   SSL +HSL LDEP+KS V  W++G
Sbjct  76    SHESDVPRHPLDPLTVREVNRVRELLRAHPLFASAPSSLFVHSLELDEPEKSVVKSWRKG  135

Query  1933  -NPLPTRKAFVVALSNGQAHLLVVDL--GSGRVSSHTRNPASGYPPMSADDASTALEATF  1763
              +PLP R+A  V    G++H+L VDL  G G V+     PASGYP M+ D+ ++   A F
Sbjct  136   ADPLPPRRAVAVVRFRGESHVLGVDLSEGDGAVTP-LPVPASGYPMMNMDEQTSLCFAPF  194

Query  1762  SNSVFREAISTRGVEINDVVCSAAAPGWFGPEEEGRRITKVKCYTAQNTPNYYMRPIEGL  1583
              +  F  ++  RGV  +DV C   + GW+GP EE RR+ K +C++ + T N+YMRPIEGL
Sbjct  195   KDEAFNASLLRRGVRASDVACLPISLGWYGPAEENRRLIKSQCFSTEGTANFYMRPIEGL  254

Query  1582  LLTVDLDSGKVINVYDTHSPIPIPKAQGTDYRRDGIEHRAPGVEPLKPISMEQPNGQSFR  1403
              + VD+D+ +V++V D  + IPIP A  TDYR     H AP            P     +
Sbjct  255   TVLVDMDTAEVLHVSDRGAGIPIPAAANTDYRHG---HSAP-----------TPAEAQAQ  300

Query  1402  VEDGYIVKWASWEFHVKADQRAGIIISQATVFDPEAGKRRSVMYKGFASELFVPYMDVDE  1223
                GY                           DP  G+ R VMYKG ASELFVPYMD  E
Sbjct  301   GRHGYQT-------------------------DPATGEHRDVMYKGMASELFVPYMDPTE  335

Query  1222  GWYFRAFMDAGEFGLGATAMELVPLNDCPRHSHYIDGLFVDPDGRPVSQPNVICVFERYS  1043
              WYF+ +MDAGE+G G  AM LVPLNDCPRH+ Y+D +FV  DGRP  + N+ICVFERY+
Sbjct  336   AWYFKTYMDAGEYGFGLQAMPLVPLNDCPRHARYLDAVFVAADGRPYVRENMICVFERYA  395

Query  1042  GDIAWRHSGTGDADDDLIREARPKVSLVVRTTATVGNYDYIFDWEFQTDGSIRVTVGLSG  863
             GDIAWRHS +     D IRE+RPKV+LV R  A+V NYDYI DWEFQ DG +R+ VGLSG
Sbjct  396   GDIAWRHSESPITGMD-IRESRPKVTLVARMAASVANYDYIVDWEFQMDGLVRIKVGLSG  454

Query  862   IILAKGSPYEHINQFEIPRWDFPAGSLVSENTIGVAHDHFITFHLDMDVDGPTNSFVKVD  683
             I++ KG+ Y H+NQ  + + D   G+L+SEN IGV HDHF+TF LDMD+DG  NSFVKV 
Sbjct  455   ILMVKGTQYSHMNQ--VHQNDNMYGTLLSENVIGVIHDHFVTFRLDMDIDGADNSFVKVA  512

Query  682   LVKNYNIAGKIQRKSYWSPKRKVAKSENDAKIKLQLDKPSEFHVINPRHQSRLGNPSGYK  503
             + +    AG+  RKSY    R VA++E DA+++L+L +PSEFH++NP  ++R+GNP GYK
Sbjct  513   MARQNTGAGESPRKSYLKATRHVARTEKDAQVRLKLYEPSEFHIVNPMKKTRVGNPVGYK  572

Query  502   IVPSATAASLLDLQDPPQLRAAFTNNQIWVTPYNRSEQWAGGLFTYQSHGDDTLAVWSNR  323
             +VP+ TAASLLD +DPPQ R AFTNNQIWVTPYN++E+WAGGLF YQS G+DTLA WS R
Sbjct  573   VVPAGTAASLLDPEDPPQKRGAFTNNQIWVTPYNKTEEWAGGLFVYQSKGEDTLATWSER  632

Query  322   NRVIEKQDIVLWYTLGFHHLPCQEDFPVMPTVTSTFQLKPVNFFDRNPIIQANPNFAEDL  143
             +R IE +D+VLWYTLGFHH+PCQEDFP+MPTV+S+F LKPVNFF+ NPI+   P    DL
Sbjct  633   DRPIENKDLVLWYTLGFHHVPCQEDFPIMPTVSSSFDLKPVNFFESNPILGQRPTQENDL  692

Query  142   PICRAG  125
             P+C A 
Sbjct  693   PVCAAA  698



>emb|CDY25701.1| BnaC03g69740D [Brassica napus]
Length=566

 Score =   701 bits (1808),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 334/566 (59%), Positives = 421/566 (74%), Gaps = 22/566 (4%)
 Frame = -1

Query  1777  LEATFSNSVFREAISTRGVEINDVVCSAAAPGWFGPEEEGRRITKVKCYTAQNTPNYYMR  1598
             ++    +  F  ++  RGV+++D+V      GWFGPEEEGRRI KV+C+T+Q+TPNY+MR
Sbjct  1     MQVALKSIEFNRSVEARGVKLSDLVALPTFTGWFGPEEEGRRILKVQCFTSQDTPNYFMR  60

Query  1597  PIEGLLLTVDLDSGKVINVYDTHSPIPIPKAQGTDYRRDGIEHRAPGVEPLKPISMEQPN  1418
             PIEGL  TVD+D  +VI + D    +PIPKA GT+YR + ++++   ++ + PIS+EQP 
Sbjct  61    PIEGLYATVDMDKLEVIKIVDK-GMVPIPKAAGTEYRYN-VQNKPVHMDRINPISIEQPE  118

Query  1417  GQSFRVEDGYIVKWASWEFHVKADQRAGIIISQATVFDPEA----------------GKR  1286
             G SF VEDG++VKWA+W FHVKAD RAG+IISQATV D E                 G+ 
Sbjct  119   GPSFLVEDGHLVKWANWVFHVKADHRAGMIISQATVRDSETEKPNSRILMFTNVERTGEP  178

Query  1285  RSVMYKGFASELFVPYMDVDEGWYFRAFMDAGEFGLGATAMELVPLNDCPRHSHYIDGLF  1106
             RSVMYKGF SELFVPYMD  E WY+++++DAGE GLG  AM LVPLNDCPR+++YIDG+F
Sbjct  179   RSVMYKGFPSELFVPYMDPGELWYYKSYLDAGEIGLGPAAMPLVPLNDCPRNAYYIDGVF  238

Query  1105  VDPDGRPVSQPNVICVFERYSGDIAWRHSGTGDADDDLIREARPKVSLVVRTTATVGNYD  926
               PDG+ + QPN+IC+FERY+GD++WRHS       D IRE+RPKV+LV R   +VGNYD
Sbjct  239   ASPDGKAIVQPNMICLFERYAGDVSWRHSEILIPSAD-IRESRPKVTLVARMATSVGNYD  297

Query  925   YIFDWEFQTDGSIRVTVGLSGIILAKGSPYEHINQFEIPRWDFPAGSLVSENTIGVAHDH  746
             Y FDWEFQTDG IRVTV  SG+++ KG+PYE+++       +  +G L+SEN IGV HDH
Sbjct  298   YTFDWEFQTDGLIRVTVAASGMLMVKGTPYENVDDLGDKHDE--SGPLISENVIGVVHDH  355

Query  745   FITFHLDMDVDGP-TNSFVKVDLVKNYNIAGKIQRKSYWSPKRKVAKSENDAKIKLQLDK  569
             FITFHLDMD+DGP  NSFVKV L K     GK  RKSY   K+ VAK+E DA+IKL L  
Sbjct  356   FITFHLDMDIDGPMNNSFVKVHLEKQRVPTGKSPRKSYLKVKKYVAKTEKDAQIKLSLYD  415

Query  568   PSEFHVINPRHQSRLGNPSGYKIVPSATAASLLDLQDPPQLRAAFTNNQIWVTPYNRSEQ  389
             P EFH++NP  +SRLGNP+GY+I+P   A SLLD  DPPQ+R AF+NNQIWVT YNRSEQ
Sbjct  416   PYEFHIVNPNRKSRLGNPAGYRIIPGGNAVSLLDHDDPPQIRGAFSNNQIWVTRYNRSEQ  475

Query  388   WAGGLFTYQSHGDDTLAVWSNRNRVIEKQDIVLWYTLGFHHLPCQEDFPVMPTVTSTFQL  209
             +AGG+  YQSHGDDTL VWS+R+R IE  DIVLWYTLGFHH+PCQED+PVMPTV ++F+L
Sbjct  476   FAGGVLVYQSHGDDTLQVWSDRDRSIENNDIVLWYTLGFHHIPCQEDYPVMPTVAASFEL  535

Query  208   KPVNFFDRNPIIQANPNFAEDLPICR  131
             KP NFF+ NP+I   P F +DLP+CR
Sbjct  536   KPANFFESNPVIGVAPIFEKDLPVCR  561



>gb|KDO38677.1| hypothetical protein CISIN_1g046592mg [Citrus sinensis]
Length=560

 Score =   698 bits (1801),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 326/567 (57%), Positives = 422/567 (74%), Gaps = 17/567 (3%)
 Frame = -1

Query  1804  MSADDASTALEATFSNSVFREAISTRGVEINDVVCSAAAPGWFGPEEEGRRITKVKCYTA  1625
             M+ +D +++  A  ++  F   I  RGV++ D+ C   + GW+G +EE RR+ KV+CY+ 
Sbjct  1     MTIEDMTSSTWAPLADEEFNRTILERGVDLKDLACLPISLGWYGEKEENRRLIKVQCYSM  60

Query  1624  QNTPNYYMRPIEGLLLTVDLDSGKVINVYDTHSPIPIPKAQGTDYR--RDGIEHRAPGVE  1451
             ++T N+YMRPIEGL + +D+D+ +V+ + D    IPIPKA  TDYR    G+  R   ++
Sbjct  61    KDTANFYMRPIEGLTILLDMDTKEVLEITDKGKNIPIPKAVNTDYRYSAQGLHQR---MK  117

Query  1450  PLKPISMEQPNGQSFRVEDGYIVKWASWEFHVKADQRAGIIISQATVFDPEAGKRRSVMY  1271
              + PIS+EQP G SF +ED ++VKWA+WEFH+K D RAG I+SQA V DP++G+ R+VMY
Sbjct  118   LINPISLEQPEGPSFVIEDEHLVKWANWEFHLKPDPRAGAIVSQARVRDPDSGEIRNVMY  177

Query  1270  KGFASELFVPYMDVDEGWYFRAFMDAGEFGLGATAMELVPLNDCPRHSHYIDGLFVDPDG  1091
             KGF SELFVPYMD  + WYF+ +MDAGE+G G  AM L PLNDCPR++HY+DG+F   DG
Sbjct  178   KGFTSELFVPYMDPTDAWYFKTYMDAGEYGFGLQAMPLDPLNDCPRNAHYMDGVFPAADG  237

Query  1090  RPVSQPNVICVFERYSGDIAWRH-----SGTGDADDDLIREARPKVSLVVRTTATVGNYD  926
              P  + N+IC+FE Y+GDI WRH     +G G      I+E RPKV+LVVR  A+V NYD
Sbjct  238   TPYVRSNMICIFESYAGDIGWRHAESPITGMG------IKEVRPKVTLVVRMAASVANYD  291

Query  925   YIFDWEFQTDGSIRVTVGLSGIILAKGSPYEHINQFEIPRWDFPAGSLVSENTIGVAHDH  746
             YI DWEFQTDG IR+ VGLSGI++ KG+ YE++NQ      +   G+L+SEN IGV HDH
Sbjct  292   YIVDWEFQTDGLIRIKVGLSGILMVKGTAYENMNQISNQAENL-FGTLLSENVIGVIHDH  350

Query  745   FITFHLDMDVDGPTNSFVKVDLVKNYNIAGKIQRKSYWSPKRKVAKSENDAKIKLQLDKP  566
             FITF+LDMD+DG  NSFVKV++ +     G+  R+SY    R VAK+E DA+IKL+L  P
Sbjct  351   FITFYLDMDIDGSDNSFVKVNIKRQETSPGESPRRSYLKADRNVAKTEKDAQIKLKLYDP  410

Query  565   SEFHVINPRHQSRLGNPSGYKIVPSATAASLLDLQDPPQLRAAFTNNQIWVTPYNRSEQW  386
             +EFHVINP  ++R+GNP GYK+VP  TAASLLD +DPPQ R AFTNNQIWVTPYN SEQW
Sbjct  411   AEFHVINPTKKTRVGNPVGYKVVPGGTAASLLDREDPPQKRGAFTNNQIWVTPYNESEQW  470

Query  385   AGGLFTYQSHGDDTLAVWSNRNRVIEKQDIVLWYTLGFHHLPCQEDFPVMPTVTSTFQLK  206
             AGGLF YQS G+DTLAVWS+R+R IE +DIVLWYTLGFHH+PCQEDFP+MPTV+S+F LK
Sbjct  471   AGGLFVYQSKGEDTLAVWSDRDRSIENKDIVLWYTLGFHHIPCQEDFPIMPTVSSSFDLK  530

Query  205   PVNFFDRNPIIQANPNFAEDLPICRAG  125
             PVNFF+ NPI++  PN  +DLP+C+A 
Sbjct  531   PVNFFESNPILRIPPNVEKDLPVCKAA  557



>ref|XP_001772536.1| predicted protein [Physcomitrella patens]
 gb|EDQ62578.1| predicted protein [Physcomitrella patens]
Length=689

 Score =   684 bits (1765),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 326/647 (50%), Positives = 451/647 (70%), Gaps = 14/647 (2%)
 Frame = -1

Query  2092  RPMHPLDPLTIQEIERTRSILSSYQPFSGSSLRIHSLSLDEPDKSEVLRWKRGNPLPTRK  1913
             R +HPLDPLT  E  R +  L + +        +HS+ LD+P+K  VL+W+ GNP+P R 
Sbjct  55    RVLHPLDPLTTSEFLRIQETLRNKKLLGREKQVLHSIELDDPEKHGVLQWETGNPIPARC  114

Query  1912  AFVVALSNGQAHLLVVDLGSGRVSSHTRNPASGYPPMSADDASTALEATFSNSVFREAIS  1733
             A V++  +G  H ++VD+ +  V  +T    +GYPP+++DD   +++   +   F ++I+
Sbjct  115   AEVISSYDGVPHRIIVDVDNRVVRENTVISTTGYPPLTSDDWKMSMQLPATYQPFLDSIA  174

Query  1732  TRGVEINDVVCSAAAPGWFG-PEEEGRRITKVKCYTAQNTPNYYMRPIEGLLLTVDLDSG  1556
               G+ + +V C   +PGWFG PEE  RR+ K+ C+    T N+Y+RPIEG+++ VDL+  
Sbjct  175   RYGLRLEEVTCLPLSPGWFGVPEEGNRRLAKLGCFVTTGTTNFYLRPIEGMIVIVDLNEN  234

Query  1555  KVINVYDTHSPIPIPKAQGTDYRRDGIEHRAPGVEPLKPISMEQPNGQSFRVEDGYIVKW  1376
             K++   D +   PIPK +GTDYR      + P    + PIS+EQP G SF + DG+ VKW
Sbjct  235   KILKFIDGNKS-PIPKNEGTDYRLS--TQKPPFFPRINPISIEQPLGPSFTI-DGHHVKW  290

Query  1375  ASWEFHVKADQRAGIIISQATVFDPEAGKRRSVMYKGFASELFVPYMDVDEGWYFRAFMD  1196
             A+WEFHV+   R G +ISQA V        RSV+Y+GF SEL+VPY   +E WYFR ++D
Sbjct  291   ANWEFHVRPHLRVGSVISQAKV------DGRSVLYQGFVSELYVPYQTAEEAWYFRTYLD  344

Query  1195  AGEFGLGATAMELVPLNDCPRHSHYIDGLFVDPDGRPVSQPNVICVFERYSGDIAWRHSG  1016
             AGE+GLG  A  L PLNDCP+++ Y+D +F  PDG P + PN++C+FERY+G+IAW+H+ 
Sbjct  345   AGEYGLGLLAHPLQPLNDCPQNAKYMDAVFAGPDGTPYTTPNMMCIFERYAGNIAWQHAE  404

Query  1015  TGDADDDLIREARPKVSLVVRTTATVGNYDYIFDWEFQTDGSIRVTVGLSGIILAKGSPY  836
             +  +D +L  E RPKVSLVVR  A+VGNYDYI DWEFQTDG +RV VG +G+++ KG+P 
Sbjct  405   SLSSDMEL-HEVRPKVSLVVRMIASVGNYDYIIDWEFQTDGVVRVEVGATGVVIVKGTPI  463

Query  835   EHINQFEIPR-WDFPAGSLVSENTIGVAHDHFITFHLDMDVDGPTNSFVKVDLVKNYNIA  659
             E + +  +    D   G L+SENTIGV HDHF+TFH+D+DVDGP+NSFV  +LVK+    
Sbjct  464   ETMKEKRMKEELDGMYGPLISENTIGVIHDHFLTFHMDLDVDGPSNSFVVGELVKHNVTT  523

Query  658   GKIQRKSYWSPKRKVAKSENDAKIKLQLDKPSEFHVINPRHQSRLGNPSGYKIVPSATAA  479
             G+  RKSYWS +++VAK+E D +IK   D PS++++ NP   +RLGN   Y+IVP +   
Sbjct  524   GESPRKSYWSIEKRVAKTEEDGRIKFSPDHPSQYYMKNPSRTTRLGNEVSYRIVPGSFIG  583

Query  478   SLLDLQDPPQLRAAFTNNQIWVTPYNRSEQWAGGLFTYQSHGDDTLAVWSNRNRVIEKQD  299
             SL+D  D PQLRAAFTNNQ+WVTPYNRSE++AGG F YQ+HGDD LA+WS RNR +E  D
Sbjct  584   SLMDPNDFPQLRAAFTNNQMWVTPYNRSEKYAGGFFPYQNHGDDGLAIWS-RNRPVEDTD  642

Query  298   IVLWYTLGFHHLPCQEDFPVMPTVTSTFQLKPVNFFDRNPIIQANPN  158
             +VLWYT GFHH+PCQEDFP+MPTVT++F++KP NFF+ NPI++  PN
Sbjct  643   VVLWYTFGFHHVPCQEDFPIMPTVTASFEIKPTNFFESNPILKLQPN  689



>ref|XP_010920221.1| PREDICTED: LOW QUALITY PROTEIN: primary amine oxidase-like [Elaeis 
guineensis]
Length=495

 Score =   670 bits (1728),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 310/495 (63%), Positives = 383/495 (77%), Gaps = 5/495 (1%)
 Frame = -1

Query  1603  MRPIEGLLLTVDLDSGKVINVYDTHSPIPIPKAQGTDYRRDGI--EHRAPGVEPLKPISM  1430
             MRPIEGL + +D+D  +V+N+ D    IPIPK+ GTDYR D +  ++ AP + PL PISM
Sbjct  1     MRPIEGLTVVLDMDKKEVVNISDVGRDIPIPKSAGTDYRYDLVAAQNGAPKIRPLNPISM  60

Query  1429  EQPNGQSFRVEDGYIVKWASWEFHVKADQRAGIIISQATVFDPEAGKRRSVMYKGFASEL  1250
             EQP G SF VE G++VKWA WEFH+KAD RAG+++S A+  DPE G++R+VMYKGF SEL
Sbjct  61    EQPAGPSFVVEGGHVVKWAGWEFHLKADARAGLVVSAASAVDPETGEKRAVMYKGFTSEL  120

Query  1249  FVPYMDVDEGWYFRAFMDAGEFGLGATAMELVPLNDCPRHSHYIDGLFVDPDGRPVSQPN  1070
             FVPYMD  + WYF+ +MDAGE+G G  AM LVPLNDCPR+++Y+D +F   DGRP  + N
Sbjct  121   FVPYMDPTDAWYFKTYMDAGEYGFGLQAMPLVPLNDCPRNAYYMDAVFPAADGRPYVRSN  180

Query  1069  VICVFERYSGDIAWRHSGTGDADDDLIREARPKVSLVVRTTATVGNYDYIFDWEFQTDGS  890
             ++C+FERY+GDI WRHS +     + IRE RPKV+LV R  A+V NYDYI DWEFQTDG 
Sbjct  181   MVCLFERYAGDIGWRHSESPITGME-IREVRPKVTLVARMAASVANYDYIVDWEFQTDGL  239

Query  889   IRVTVGLSGIILAKGSPYEHINQFEIPRWDFPAGSLVSENTIGVAHDHFITFHLDMDVDG  710
             IRV VGLSGI++ KG+ Y H+NQ   P+ D   G+L+SEN IGV HDH+ITFHLDMDVDG
Sbjct  240   IRVKVGLSGILMVKGTSYSHMNQVS-PKQDL-YGTLLSENVIGVIHDHYITFHLDMDVDG  297

Query  709   PTNSFVKVDLVKNYNIAGKIQRKSYWSPKRKVAKSENDAKIKLQLDKPSEFHVINPRHQS  530
               NSFVKVD+ +   I G+  R SY    R VAK+E DA+I+L+L  P EFH+INP   +
Sbjct  298   VENSFVKVDIARQETIPGESPRMSYLKATRHVAKTEKDAQIRLKLYAPKEFHIINPFKTT  357

Query  529   RLGNPSGYKIVPSATAASLLDLQDPPQLRAAFTNNQIWVTPYNRSEQWAGGLFTYQSHGD  350
             ++GNP GYK+VP+ TAASLLD  DPPQLR AFTNNQIWVTPYN+SE+WAGGLF YQS GD
Sbjct  358   KVGNPVGYKVVPAGTAASLLDPNDPPQLRGAFTNNQIWVTPYNKSEEWAGGLFAYQSKGD  417

Query  349   DTLAVWSNRNRVIEKQDIVLWYTLGFHHLPCQEDFPVMPTVTSTFQLKPVNFFDRNPIIQ  170
             DTLAVWS R+R IE +DIV+WYT+GFHH+PCQEDFP+MPTV S+F LKPVNFF+RNPI+ 
Sbjct  418   DTLAVWSERDRPIENKDIVVWYTMGFHHVPCQEDFPIMPTVFSSFDLKPVNFFERNPILV  477

Query  169   ANPNFAEDLPICRAG  125
             A PN  +DLP+C A 
Sbjct  478   APPNMEKDLPVCTAA  492



>gb|EPS58276.1| hypothetical protein M569_16538, partial [Genlisea aurea]
Length=587

 Score =   671 bits (1730),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 329/587 (56%), Positives = 420/587 (72%), Gaps = 10/587 (2%)
 Frame = -1

Query  1870  VVDLGSGRVSSHTRNPASGYPPMSADDASTALEATFSNSVFREAISTRGVEINDVVCSAA  1691
              VDL SG V+    +  SG P M+ +D + A  A  +++ F  +I  RGV+++D+ C   
Sbjct  1     TVDLESGDVAFRDVSHLSGSPMMTVEDMTAATRAPLNDADFNRSILDRGVDLSDLACLPI  60

Query  1690  APGWFGP--EEEGRRITKVKCYTAQNTPNYYMRPIEGLLLTVDLDSGKVINVYDTHSPIP  1517
             + GWFG   E E RR+ KV+CY+ + T N+YMRPIEGL + VDLD+ KVI + +    IP
Sbjct  61    SSGWFGKSREMEKRRLIKVQCYSMEGTANFYMRPIEGLTVVVDLDTLKVIQITERGKGIP  120

Query  1516  IPKAQGTDYRRDGIEHRAPGVEPLKPISMEQPNGQSFRVEDGYIVKWASWEFHVKADQRA  1337
             IP A  TDYR      +      + PIS+EQP G SF VEDG+ V+WA+WEFH+K D RA
Sbjct  121   IPAAANTDYR---FSAQNSYQRLVNPISLEQPKGPSFAVEDGHYVRWANWEFHLKPDSRA  177

Query  1336  GIIISQATVFDPEAGKRRSVMYKGFASELFVPYMDVDEGWYFRAFMDAGEFGLGATAMEL  1157
             G+I+S+A + DP+  + RSV+YKGF SELFVPYMD  + WYF+ +MDAGE+G G  AM L
Sbjct  178   GVIVSRAQIRDPDTAELRSVIYKGFTSELFVPYMDPTDAWYFKTYMDAGEYGFGLQAMPL  237

Query  1156  VPLNDCPRHSHYIDGLFVDPDGRPVSQPNVICVFERYSGDIAWRHSGTGDADDDLIREAR  977
              PLNDCPR+++Y+DG+F   DG P  + +++CVFE Y+GDI WRHS +     + IREAR
Sbjct  238   DPLNDCPRNAYYMDGVFAAADGTPYVRSDMVCVFESYAGDIGWRHSESPITGME-IREAR  296

Query  976   PKVSLVVRTTATVGNYDYIFDWEFQTDGSIRVTVGLSGIILAKGSPYEHINQFEIPRWDF  797
              KV+LVVR  A+V NYDYI DWEFQTDG IR+ VGLSGI++ KG+ + +  Q++      
Sbjct  297   AKVTLVVRMAASVANYDYIVDWEFQTDGVIRIKVGLSGILMVKGTSHTNTEQYDSDSSGD  356

Query  796   PAGSLVSENTIGVAHDHFITFHLDMDVDG-PTNSFVKVDLVKNYNIAGKIQ--RKSYWSP  626
               G+L+SEN IGV HDHFITF LDMDVDG   NSFVKV L +      +    R SY   
Sbjct  357   LYGTLLSENVIGVIHDHFITFRLDMDVDGHHDNSFVKVRLERRRTSPDESSSPRLSYLRA  416

Query  625   KRKVAKSENDAKIKLQLDKPSEFHVINPRHQSRLGNPSGYKIVPSATAASLLDLQDPPQL  446
              R+VA++E DA+IKL+L  P EFHV+NP  ++R+GNP GYKIVP  TAA+LLD  DPPQ 
Sbjct  417   VREVARTEGDARIKLKLYDPHEFHVVNPSKRTRVGNPVGYKIVPGGTAANLLDPDDPPQR  476

Query  445   RAAFTNNQIWVTPYNRS-EQWAGGLFTYQSHGDDTLAVWSNRNRVIEKQDIVLWYTLGFH  269
             R AFTNNQIWVTPYN S EQWAGGLF YQS G+DTL VWS+R+R IE +DIV+WYTLGFH
Sbjct  477   RGAFTNNQIWVTPYNASEEQWAGGLFAYQSRGEDTLQVWSDRDRDIENKDIVVWYTLGFH  536

Query  268   HLPCQEDFPVMPTVTSTFQLKPVNFFDRNPIIQANPNFAEDLPICRA  128
             H+PCQEDFP+MPTV+S+F LKPVNFF+RNPI++  PN  +DLP+CRA
Sbjct  537   HIPCQEDFPIMPTVSSSFDLKPVNFFERNPILRIPPNVEKDLPVCRA  583



>gb|AAN60277.1| unknown [Arabidopsis thaliana]
Length=507

 Score =   647 bits (1668),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 306/504 (61%), Positives = 378/504 (75%), Gaps = 11/504 (2%)
 Frame = -1

Query  1627  AQNTPNYYMRPIEGLLLTVDLDSGKVINVYDTHSPIPIPKAQGTDYRRDGIEHRAPGVEP  1448
              Q TPN+YMRPIEGL + +DLD+ +VI + DT   IPIP +  TDYR   +        P
Sbjct  2     TQGTPNFYMRPIEGLTILIDLDTKQVIEITDTGRAIPIPGSTNTDYRFQKLA-TTDKTRP  60

Query  1447  LKPISMEQPNGQSFRVEDGYIVKWASWEFHVKADQRAGIIISQATVFDPEAGKRRSVMYK  1268
             L PIS+EQP G SF +E+ ++VKWA+WEFH+K D RAG++IS+  V DP+  + R VMYK
Sbjct  61    LNPISIEQPRGPSFVIENNHLVKWANWEFHLKPDPRAGVVISRVRVHDPDTHETRDVMYK  120

Query  1267  GFASELFVPYMDVDEGWYFRAFMDAGEFGLGATAMELVPLNDCPRHSHYIDGLFVDPDGR  1088
             GF SELFVPYMD  + WYF+ +MDAGE+G G  AM LVP NDCPR++ Y+DG+F   DG 
Sbjct  121   GFVSELFVPYMDPSDAWYFKTYMDAGEYGFGLQAMPLVPXNDCPRNAAYMDGVFAAADGT  180

Query  1087  PVSQPNVICVFERYSGDIAWRHSG---TGDADDDLIREARPKVSLVVRTTATVGNYDYIF  917
             P  + N++C+FE Y+GDI WRHS    TG      IRE RPKV+LVVR  A+VGNYDYI 
Sbjct  181   PFVRENMVCIFESYAGDIGWRHSESPITGIP----IREVRPKVTLVVRMAASVGNYDYII  236

Query  916   DWEFQTDGSIRVTVGLSGIILAKGSPYEHINQFEIPR---WDFPAGSLVSENTIGVAHDH  746
             D+EFQTDG I+  VGLSGI++ KG+ Y++ NQ E  +    +   G+L+SEN IGV HDH
Sbjct  237   DYEFQTDGLIKAKVGLSGILMVKGTTYQNKNQVEKDKDGNEEELHGTLLSENVIGVIHDH  296

Query  745   FITFHLDMDVDGPTNSFVKVDLVKNYNIAGKIQRKSYWSPKRKVAKSENDAKIKLQLDKP  566
             ++TF+LD+DVDGP NSFVKV+L +     G+  RKSY    R +AK+E D +IKL L  P
Sbjct  297   YVTFYLDLDVDGPDNSFVKVNLKRQETEPGESPRKSYLKAVRNIAKTEKDGQIKLSLYDP  356

Query  565   SEFHVINPRHQSRLGNPSGYKIVPSATAASLLDLQDPPQLRAAFTNNQIWVTPYNRSEQW  386
             SEFHVIN    +R+GNP+GYK+VP  TAASLLD  DPPQ R AFTNNQIWVTPYN+SEQW
Sbjct  357   SEFHVINSGKTTRVGNPTGYKVVPRTTAASLLDHDDPPQKRGAFTNNQIWVTPYNKSEQW  416

Query  385   AGGLFTYQSHGDDTLAVWSNRNRVIEKQDIVLWYTLGFHHLPCQEDFPVMPTVTSTFQLK  206
             AGGLFTYQSHGDDTLAVWS+R+R IE +DIV+WYTLGFHH+PCQEDFP+MPTV+S+F LK
Sbjct  417   AGGLFTYQSHGDDTLAVWSDRDRDIENKDIVVWYTLGFHHIPCQEDFPIMPTVSSSFDLK  476

Query  205   PVNFFDRNPIIQANPNFAEDLPIC  134
             PVNFF+RNPI+ A PNF  DLP+C
Sbjct  477   PVNFFERNPILSAAPNFEHDLPVC  500



>gb|EMT31865.1| Primary amine oxidase [Aegilops tauschii]
Length=484

 Score =   623 bits (1607),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 293/492 (60%), Positives = 368/492 (75%), Gaps = 22/492 (4%)
 Frame = -1

Query  1567  LDSGKVINVYDTHSPIPIPKAQGTDYR------RDGIEH------RAPGVEPLKPISMEQ  1424
             +D+GKV+++ D  + IPIP A+ TDYR       DG +       RAP +EP        
Sbjct  1     MDTGKVVHISDRGAGIPIPAAKNTDYRGAANDDDDGTDRFGYQTVRAPSMEP-------A  53

Query  1423  PNGQSFRVEDGYIVKWASWEFHVKADQRAGIIISQATVFDPEAGKRRSVMYKGFASELFV  1244
             P G  F++EDG+ V+WA WEFH+KAD RAG+I+S+ATV DP  G RR  +YKG ASELFV
Sbjct  54    PEGPGFQIEDGHTVRWAGWEFHLKADARAGLIVSRATVQDPATGARREGIYKGMASELFV  113

Query  1243  PYMDVDEGWYFRAFMDAGEFGLGATAMELVPLNDCPRHSHYIDGLFVDPDGRPVSQPNVI  1064
             PYMD  E W F+ +MDAGE+G G  AM LVPLNDCPRH+ Y+DG+FV  DGRP  + N+I
Sbjct  114   PYMDPTEAWSFKTYMDAGEYGFGLQAMPLVPLNDCPRHARYMDGVFVAADGRPYVRENMI  173

Query  1063  CVFERYSGDIAWRHSGTGDADDDLIREARPKVSLVVRTTATVGNYDYIFDWEFQTDGSIR  884
             CVFERY+GDIAWRHS +     D IRE+RPKV+LV R  A+V NYDYI DWEFQTDG IR
Sbjct  174   CVFERYAGDIAWRHSESPITGMD-IRESRPKVTLVARMAASVANYDYIVDWEFQTDGLIR  232

Query  883   VTVGLSGIILAKGSPYEHINQFEIPRWDFPAGSLVSENTIGVAHDHFITFHLDMDVDGPT  704
             + VGLSGI++ KG+PY H+NQ  + R +   G+L+SEN IGV HDH++TF LDMDVDG  
Sbjct  233   IKVGLSGILMVKGTPYSHMNQ--VRRNEEMHGTLLSENVIGVIHDHYVTFRLDMDVDGAD  290

Query  703   NSFVKVDLVKNYNIAGKIQRKSYWSPKRKVAKSENDAKIKLQLDKPSEFHVINPRHQSRL  524
             NSFV+VD+ +     G+  R+SY    R VA +E DA+++L+L +P+EFHVINP  ++R+
Sbjct  291   NSFVRVDMARQDTAPGESPRRSYLKATRHVASTEKDARVRLKLYEPAEFHVINPTKKTRV  350

Query  523   GNPSGYKIVPSATAASLLDLQDPPQLRAAFTNNQIWVTPYNRSEQWAGGLFTYQSHGDDT  344
             GNP GYK+VP+ TA SLLD +DPPQ R AFTNNQIWVTPYN+SE+WAGGLF YQS G+DT
Sbjct  351   GNPVGYKVVPAGTAGSLLDPEDPPQKRGAFTNNQIWVTPYNKSEEWAGGLFVYQSKGEDT  410

Query  343   LAVWSNRNRVIEKQDIVLWYTLGFHHLPCQEDFPVMPTVTSTFQLKPVNFFDRNPIIQAN  164
             LA WS R+R IE +D+VLWYTLGFHH+PCQEDFP+MPTV+S+F LKPVNFF+ NPI++  
Sbjct  411   LATWSERDRPIENKDLVLWYTLGFHHIPCQEDFPIMPTVSSSFDLKPVNFFESNPILKQR  470

Query  163   PNFAEDLPICRA  128
             P   +DLP+C A
Sbjct  471   PTMEKDLPVCAA  482



>ref|XP_011092662.1| PREDICTED: primary amine oxidase-like [Sesamum indicum]
Length=681

 Score =   629 bits (1623),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 311/645 (48%), Positives = 427/645 (66%), Gaps = 20/645 (3%)
 Frame = -1

Query  2083  HPLDPLTIQEIERTRSILSS-YQPFSGSSLRIHSLSLDEPDKSEVLRW---KRGNPLPTR  1916
             HPLDPLT  E  + ++I+ S YQ     ++  H + LDEPDK+ VL W    + N +P R
Sbjct  34    HPLDPLTPFEQTQVQTIVKSLYQ-----NVTFHYVGLDEPDKAAVLSWLSSPQTNQIPDR  88

Query  1915  KAFVVALSNGQAHLLVVDLGSGRVSSHTRNPASGYPPMSADDASTALEATFSNSVFREAI  1736
             +AFV+A ++ Q+H +VV+L +  V +       GYP ++ ++ + A +   + + F  +I
Sbjct  89    QAFVIARADSQSHEIVVNLATKEVVTDKVYDGYGYPMLTFEEQAAATQLPLTYAPFLASI  148

Query  1735  STRGVEINDVVCSAAAPGWFGPEEEGRRITKVKCYTAQNTPNYYMRPIEGLLLTVDLDSG  1556
               RG+ ++ V C +   GW+G  E  +R+ ++ CY    T N+YMRPIEG+  TVDL+  
Sbjct  149   EKRGLILDQVFCGSFTVGWYG-SEASKRVVRLMCYYINGTINFYMRPIEGITFTVDLEEM  207

Query  1555  KVINVYDTHSPIPIPKAQGTDYRRDGIEHRAPGVEPLKPISMEQPNGQSFRVEDGYIVKW  1376
             K+I  +D    +P+PKA GTDYR      ++     LK I++ QP+G SF VE G+ V+W
Sbjct  208   KIIGYHD-RVVVPVPKADGTDYRE--AVQKSTFDNHLKSITILQPDGPSFTVE-GHTVRW  263

Query  1375  ASWEFHVKADQRAGIIISQATVFDPEAGKRRSVMYKGFASELFVPYMDVDEGWYFRAFMD  1196
             A+WEFHV  D R+G IIS A+++D +  + R VMY+GF SELFVPYMD+ E WY+R F+D
Sbjct  264   ANWEFHVAFDMRSGPIISLASIYDHKEDEYRRVMYRGFVSELFVPYMDLTEEWYYRTFLD  323

Query  1195  AGEFGLGATAMELVPLNDCPRHSHYIDGLFVDPDGRPVSQPNVICVFERYSGDIAWRHSG  1016
             AGEFG G +A+ L PL DCP ++ ++DG F   DG P    NV C+FERY+GDI WRH+ 
Sbjct  324   AGEFGFGQSAVPLQPLRDCPENAMFLDGYFTAQDGTPAKISNVFCLFERYAGDIMWRHT-  382

Query  1015  TGDADDDLIREARPKVSLVVRTTATVGNYDYIFDWEFQTDGSIRVTVGLSGIILAKGSPY  836
              G    DL+ E RP VSLV+R  +TV NYDY+ DWEF+  G+I+VT GL+G++  +GS Y
Sbjct  383   EGALPGDLVTEVRPDVSLVLRMVSTVANYDYVIDWEFKQTGTIKVTAGLTGLLAVRGSIY  442

Query  835   EHINQFEIPRWDFPAGSLVSENTIGVAHDHFITFHLDMDVDGPTNSFVKVDLVKNYNIAG  656
              H +Q     +    G+L++EN +G  HDHFI+FHLD+D+DG TNSFVK  L +     G
Sbjct  443   THKDQIMQEEY----GTLLAENVLGPYHDHFISFHLDLDIDGETNSFVKAKLQRARVTDG  498

Query  655   KIQRKSYWSPKRKVAKSENDAKIKLQLDKPSEFHVINPRHQSRLGNPSGYKIVPSATAAS  476
             +  RKSYW    + AK E+DAKI L     +E  V NP  ++++GN  GY+++P   A+ 
Sbjct  499   RSPRKSYWRVVNETAKRESDAKINLG-SGATEILVTNPNKKTKVGNDIGYRLIPRTVASR  557

Query  475   LLDLQDPPQLRAAFTNNQIWVTPYNRSEQWAGGLFTYQSHGDDTLAVWSNRNRVIEKQDI  296
             LL   D PQ RAAFT   +WVTPYNRSE+WAGGLF  QSHGDD LA WS R+R IEK+DI
Sbjct  558   LLANDDYPQKRAAFTKYNVWVTPYNRSEKWAGGLFVDQSHGDDNLATWSLRDREIEKKDI  617

Query  295   VLWYTLGFHHLPCQEDFPVMPTVTSTFQLKPVNFFDRNPIIQANP  161
             VLWYTLGFHH+PC EDFP+MPT+T+ F+LKP NFFD NP+++  P
Sbjct  618   VLWYTLGFHHVPCSEDFPIMPTLTNGFELKPTNFFDYNPMLKFKP  662



>ref|XP_007224149.1| hypothetical protein PRUPE_ppa016301mg [Prunus persica]
 gb|EMJ25348.1| hypothetical protein PRUPE_ppa016301mg [Prunus persica]
Length=669

 Score =   622 bits (1604),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 303/644 (47%), Positives = 428/644 (66%), Gaps = 14/644 (2%)
 Frame = -1

Query  2083  HPLDPLTIQEIERTRSILSSYQPFSGSSLRIHSLSLDEPDKSEVLRW--KRGNPLPTRKA  1910
             HPLDPLT  E +  R+++    P    +L    +SLDEPDK  +  W  K  +  P R+A
Sbjct  27    HPLDPLTPSEFKLVRTLVKKSYPSPKHNLTFQYISLDEPDKPALHSWLSKPKSKPPPRRA  86

Query  1909  FVVALSNGQAHLLVVDLGSGR-VSSHTRNPASGYPPMSADDASTALEATFSNSVFREAIS  1733
             FV+   N Q+H L+VDL +   VS    N   GYP ++ D+ + A E  FS   F +++ 
Sbjct  87    FVITRLNRQSHELIVDLSNRYIVSDKVYNGNDGYPLLTLDEQTVASELPFSYKPFIDSVK  146

Query  1732  TRGVEINDVVCSAAAPGWFGPEEEGRRITKVKCYTAQNTPNYYMRPIEGLLLTVDLDSGK  1553
              R + +++VVC+  + GWFG E  GR + K+ C+  + + N Y+RP+EG+ L VDLD  K
Sbjct  147   KRRLNLSEVVCTTFSVGWFGEEHSGR-VIKILCFYVEGSANLYVRPLEGVSLLVDLDELK  205

Query  1552  VINVYDTHSPIPIPKAQGTDYRRDGIEHRAPGVEPLKPISMEQPNGQSFRVEDGYIVKWA  1373
             ++  YD  + +P+PKA+GT+YRR   + + P    L   ++EQP+G  F++ +G+ + WA
Sbjct  206   IVEYYD-RARVPVPKAEGTEYRRS--KQKPPFGPRLNRFAIEQPDGPGFKI-NGHKISWA  261

Query  1372  SWEFHVKADQRAGIIISQATVFDPEAGKRRSVMYKGFASELFVPYMDVDEGWYFRAFMDA  1193
             +WEFHV  D RAG IIS A+++D E G  R V+Y+GF SELFVPYMD  E WY++ F DA
Sbjct  262   NWEFHVGFDVRAGPIISLASMYDLEKGTYRQVLYRGFVSELFVPYMDPTEEWYYKTFFDA  321

Query  1192  GEFGLGATAMELVPLNDCPRHSHYIDGLFVDPDGRPVSQPNVICVFERYSGDIAWRHSGT  1013
             GEFG G +AM L PL DCP ++ +ID  +   DG PV   N IC+FE++SG + WRH+  
Sbjct  322   GEFGFGQSAMPLEPLADCPANAAFIDAYYAGEDGTPVKISNAICIFEQHSGSVLWRHTEI  381

Query  1012  GDADDDLIREARPKVSLVVRTTATVGNYDYIFDWEFQTDGSIRVTVGLSGIILAKGSPYE  833
                  ++I E RP+VSL+VR   T+GNYDYI DWEF+  GSI++ VGL+GI+  K + Y 
Sbjct  382   A-ISGEVITEVRPEVSLIVRMVTTIGNYDYILDWEFKPSGSIKIGVGLTGILEVKAADYT  440

Query  832   HINQFEIPRWDFPAGSLVSENTIGVAHDHFITFHLDMDVDGPTNSFVKVDLVKNYNIAGK  653
             H +Q     +    G+L+++NTIGV HDHF+T++LD+DVDG  NSFVK +LV        
Sbjct  441   HTSQITEEAY----GTLLAKNTIGVYHDHFLTYYLDLDVDGEANSFVKNNLVTKRVTDKS  496

Query  652   IQRKSYWSPKRKVAKSENDAKIKLQLDKPSEFHVINPRHQSRLGNPSGYKIVPSATAASL  473
               RKSYW+ + + AK+E++AKI+L L KPSE  V+NP  +++ GN  GY+++P + +  L
Sbjct  497   SLRKSYWTVESETAKTESNAKIQLCL-KPSELVVVNPNKKTKRGNKIGYRLIPGSISNPL  555

Query  472   LDLQDPPQLRAAFTNNQIWVTPYNRSEQWAGGLFTYQSHGDDTLAVWSNRNRVIEKQDIV  293
             L   D PQ+R AFTN  +WVTPYN+SE+WAGG +  +SHGDDTLA WS RNR IE +DIV
Sbjct  556   LSFDDFPQIRGAFTNYNVWVTPYNKSEKWAGGQYIDRSHGDDTLATWSLRNRGIENKDIV  615

Query  292   LWYTLGFHHLPCQEDFPVMPTVTSTFQLKPVNFFDRNPIIQANP  161
             LWYT+GFHH+P QEDFP+MPT++  F+L+P NFF+ NP+++  P
Sbjct  616   LWYTMGFHHVPSQEDFPIMPTLSGGFELRPTNFFESNPVLKTKP  659



>ref|XP_006419908.1| hypothetical protein CICLE_v10006554mg, partial [Citrus clementina]
 gb|ESR33148.1| hypothetical protein CICLE_v10006554mg, partial [Citrus clementina]
Length=638

 Score =   620 bits (1599),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 310/644 (48%), Positives = 421/644 (65%), Gaps = 14/644 (2%)
 Frame = -1

Query  2083  HPLDPLTIQEIERTRSILSSYQPFSGSSLRIHSLSLDEPDKSEVLRWKRGNPL--PTRKA  1910
             HPLD LT  E  + +SI++   P S  +L    + L EP K  VL W R      P R+A
Sbjct  4     HPLDSLTPSEFTQIQSIVTKAYPKSTYNLTFQYVGLKEPTKQTVLSWLRNETTTNPPRQA  63

Query  1909  FVVALSNGQAHLLVVDLGSGRVSSHTRNPASGYPPMSADDASTALEATFSNSVFREAIST  1730
             FVVA  + Q H ++VDL    ++S       GYP ++ ++   A +   +  +F  +IS 
Sbjct  64    FVVARIDHQTHEIIVDLSLQGITSKKTYNGYGYPLLTGEEQEDANKLASTYPLFVASISK  123

Query  1729  RGVEINDVVCSAAAPGWFGPEEEGRRITKVKCYTAQNTPNYYMRPIEGLLLTVDLDSGKV  1550
             RG+++ +VVC +   GWFG E + +RI K+ CY    T N  MRPIEG+ +TVDLD  K+
Sbjct  124   RGLKLEEVVCGSFTVGWFGEERKNKRIVKMMCYYLDGTLNADMRPIEGITMTVDLDEMKI  183

Query  1549  INVYDTHSPIPIPKAQGTDYRRDGIEHRAPGVEPLKPISMEQPNGQSFRVEDGYIVKWAS  1370
             I   D    +P+PK+ GT+YR   +  + P    LK  ++ QP+G SF +  G  ++WA 
Sbjct  184   IQFRD-RIIVPVPKSDGTEYRESKL--KPPFRPSLKRTTVVQPDGPSFNIV-GSQIRWAD  239

Query  1369  WEFHVKADQRAGIIISQATVFDPEAGKRRSVMYKGFASELFVPYMDVDEGWYFRAFMDAG  1190
             WEFH+  D RAG+IIS A+++DPE  + R V+YKG  SELFVPYMD+ E WY+R+F D G
Sbjct  240   WEFHLSFDARAGMIISVASIYDPEKQQSRQVLYKGHVSELFVPYMDLTEEWYYRSFFDVG  299

Query  1189  EFGLGATAMELVPLNDCPRHSHYIDGLFVDPDGRPVSQPNVICVFERYSGDIAWRHSGTG  1010
             E+G G +++ L PL DCP ++ ++D  F   DG P+  PNV C+FERY+GD+ WRH+   
Sbjct  300   EYGYGLSSLPLEPLRDCPPNAVFMDAYFAKNDGMPLKMPNVFCIFERYAGDVMWRHTEAT  359

Query  1009  DADDDLIREARPKVSLVVRTTATVGNYDYIFDWEFQTDGSIRVTVGLSGIILAKGSPYEH  830
             D +  LIRE RP+VSLVVRT +TVGNYDYI DWEF+  GSI+VTVGL+G++  +G+ Y H
Sbjct  360   DPEK-LIREVRPEVSLVVRTVSTVGNYDYINDWEFKQSGSIKVTVGLTGMLEVRGTNYTH  418

Query  829   INQFEIPRWDFPAGSLVSENTIGVAHDHFITFHLDMDVDGPTNSFVKVDL-VKNYNIAGK  653
              +Q E   +    G+L++ENTIGV HDHF+T+ LD+DVDG  NSFVK  L     N  G 
Sbjct  419   KDQIEEDVY----GTLIAENTIGVRHDHFLTYRLDLDVDGDANSFVKSKLRTVRVNDHGS  474

Query  652   IQRKSYWSPKRKVAKSENDAKIKLQLDKPSEFHVINPRHQSRLGNPSGYKIVPSATAASL  473
               RKSYW+  R+ A++E+ A+IKL   +P +   +NP  ++++GN  GY++VP      L
Sbjct  475   -PRKSYWTVDRETARTESAARIKLG-SEPVDLLFVNPNKKTKMGNLIGYRLVPYGVVGPL  532

Query  472   LDLQDPPQLRAAFTNNQIWVTPYNRSEQWAGGLFTYQSHGDDTLAVWSNRNRVIEKQDIV  293
             L   D PQ+RAAFTN   WVT YN SE+WAGGL+  QS GDDTL+VWS RNR IE +DIV
Sbjct  533   LSDDDYPQIRAAFTNYNAWVTAYNISEKWAGGLYADQSRGDDTLSVWSKRNRSIENKDIV  592

Query  292   LWYTLGFHHLPCQEDFPVMPTVTSTFQLKPVNFFDRNPIIQANP  161
             LWYTLGFHH+PCQEDFPVMPT    F+L+P NFF+ NP+++  P
Sbjct  593   LWYTLGFHHVPCQEDFPVMPTFNGGFELRPSNFFESNPVLKVVP  636



>ref|XP_008224539.1| PREDICTED: primary amine oxidase-like [Prunus mume]
Length=669

 Score =   621 bits (1602),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 304/644 (47%), Positives = 428/644 (66%), Gaps = 14/644 (2%)
 Frame = -1

Query  2083  HPLDPLTIQEIERTRSILSSYQPFSGSSLRIHSLSLDEPDKSEVLRW--KRGNPLPTRKA  1910
             HPLDPLT  E +  R+++    P    +L    +SLDEPDK  +  W  K  +  P R+A
Sbjct  27    HPLDPLTPSEFKVVRTLVKKSYPSPKHNLTFQYISLDEPDKPALHSWLSKPKSKPPPRRA  86

Query  1909  FVVALSNGQAHLLVVDLGSGR-VSSHTRNPASGYPPMSADDASTALEATFSNSVFREAIS  1733
             FV+   N Q+H L+VDL +   VS    N   GYP ++ D+ + A E  FS   F +++ 
Sbjct  87    FVITRLNRQSHELIVDLSNRYIVSDKVYNGNDGYPLLTLDEQTVASELPFSYKPFIDSVK  146

Query  1732  TRGVEINDVVCSAAAPGWFGPEEEGRRITKVKCYTAQNTPNYYMRPIEGLLLTVDLDSGK  1553
              R + +++VVCS  + GWFG E  GR + K+ C+  + + N Y+RP+EG+ L VDLD  K
Sbjct  147   KRRLNLSEVVCSTFSVGWFGEEHSGR-VIKILCFYIEGSANLYVRPLEGVSLLVDLDELK  205

Query  1552  VINVYDTHSPIPIPKAQGTDYRRDGIEHRAPGVEPLKPISMEQPNGQSFRVEDGYIVKWA  1373
             ++  YD  + +P+PKA+GT+YRR   + + P    L   ++EQP+G  F++ +G+ + WA
Sbjct  206   IVEYYD-RARVPVPKAEGTEYRRS--KQKPPFGPRLNRFAIEQPDGPGFKI-NGHKISWA  261

Query  1372  SWEFHVKADQRAGIIISQATVFDPEAGKRRSVMYKGFASELFVPYMDVDEGWYFRAFMDA  1193
             +WEFHV  D RAG IIS A+++D E G  R V+Y+GF SELFVPYMD  E WY++ F DA
Sbjct  262   NWEFHVGFDVRAGPIISLASIYDLEKGTYRQVLYRGFVSELFVPYMDPTEEWYYKTFFDA  321

Query  1192  GEFGLGATAMELVPLNDCPRHSHYIDGLFVDPDGRPVSQPNVICVFERYSGDIAWRHSGT  1013
             GEFG G +A+ L PL DCP ++ +ID  +   DG PV   N IC+FE++SG + WRH+  
Sbjct  322   GEFGFGQSALPLEPLADCPANAAFIDAYYAGEDGTPVKISNAICIFEQHSGSVLWRHTEI  381

Query  1012  GDADDDLIREARPKVSLVVRTTATVGNYDYIFDWEFQTDGSIRVTVGLSGIILAKGSPYE  833
                  ++I E RP+VSL+VR   T+GNYDYI +WEF+  GSI++ VGL+GI+  K   Y 
Sbjct  382   A-IPGEVITEVRPEVSLIVRMVTTIGNYDYILNWEFKPSGSIKIGVGLTGILEVKAVDYT  440

Query  832   HINQFEIPRWDFPAGSLVSENTIGVAHDHFITFHLDMDVDGPTNSFVKVDLVKNYNIAGK  653
             H +Q +   +    G+L+++NTIGV HDHF+T++LD+DVDG  NSFVK +LV        
Sbjct  441   HTSQIKEEAY----GTLLAKNTIGVYHDHFLTYYLDLDVDGEANSFVKNNLVTKRVTDKS  496

Query  652   IQRKSYWSPKRKVAKSENDAKIKLQLDKPSEFHVINPRHQSRLGNPSGYKIVPSATAASL  473
               RKSYW+ +  +AK E+DAKI+L L KPSE  V+NP  +++ GN  GY+++P + +  L
Sbjct  497   SLRKSYWTVESDIAKIESDAKIQLGL-KPSELVVVNPNKKTKPGNNIGYRLIPGSISNPL  555

Query  472   LDLQDPPQLRAAFTNNQIWVTPYNRSEQWAGGLFTYQSHGDDTLAVWSNRNRVIEKQDIV  293
             L   D PQ+R AFTN  +WVTPYN+SE+WAGG +  +SHGDDTLA WS RNR IE +DIV
Sbjct  556   LSSDDFPQIRGAFTNYNVWVTPYNKSEKWAGGQYIDRSHGDDTLATWSLRNRGIENKDIV  615

Query  292   LWYTLGFHHLPCQEDFPVMPTVTSTFQLKPVNFFDRNPIIQANP  161
             LWYT+GFHH+PCQEDFP+MPT++  F+L+P NFF+ NP+++  P
Sbjct  616   LWYTMGFHHVPCQEDFPIMPTLSGGFELRPTNFFESNPVLKTKP  659



>ref|XP_006489585.1| PREDICTED: primary amine oxidase-like [Citrus sinensis]
Length=660

 Score =   621 bits (1601),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 310/644 (48%), Positives = 421/644 (65%), Gaps = 14/644 (2%)
 Frame = -1

Query  2083  HPLDPLTIQEIERTRSILSSYQPFSGSSLRIHSLSLDEPDKSEVLRWKRGNPL--PTRKA  1910
             HPLD LT  E  + +SI++   P S  +L    + L EP K  VL W R      P R+A
Sbjct  26    HPLDSLTPSEFTQIQSIVTKAYPKSTYNLTFQYVGLKEPTKQTVLSWLRNETTTNPPRQA  85

Query  1909  FVVALSNGQAHLLVVDLGSGRVSSHTRNPASGYPPMSADDASTALEATFSNSVFREAIST  1730
             FVVA  + Q H ++VDL    ++S       GYP ++ ++   A +   +  +F  +IS 
Sbjct  86    FVVARIDHQTHEIIVDLSLQGITSKKTYNGYGYPLLTGEEQEDANKLASTYPLFVASISK  145

Query  1729  RGVEINDVVCSAAAPGWFGPEEEGRRITKVKCYTAQNTPNYYMRPIEGLLLTVDLDSGKV  1550
             RG+++ +VVC +   GWFG E + +RI K+ CY    T N  MRPIEG+ +TVDLD  K+
Sbjct  146   RGLKLEEVVCGSFTVGWFGEERKNKRIVKMMCYYLDGTLNADMRPIEGITMTVDLDEMKI  205

Query  1549  INVYDTHSPIPIPKAQGTDYRRDGIEHRAPGVEPLKPISMEQPNGQSFRVEDGYIVKWAS  1370
             I   D    +P+PK+ GT+YR   +  + P    LK  ++ QP+G SF +  G  ++WA 
Sbjct  206   IQFRD-RIIVPVPKSDGTEYRESKL--KPPFRPSLKRTTVVQPDGPSFNIV-GSQIRWAD  261

Query  1369  WEFHVKADQRAGIIISQATVFDPEAGKRRSVMYKGFASELFVPYMDVDEGWYFRAFMDAG  1190
             WEFH+  D RAG+IIS A+++DPE  + R V+YKG  SELFVPYMD+ E WY+R+F D G
Sbjct  262   WEFHLSFDARAGMIISVASIYDPEKQQSRQVLYKGHVSELFVPYMDLTEEWYYRSFFDVG  321

Query  1189  EFGLGATAMELVPLNDCPRHSHYIDGLFVDPDGRPVSQPNVICVFERYSGDIAWRHSGTG  1010
             E+G G +++ L PL DCP ++ ++D  F   DG P+  PNV C+FERY+GD+ WRH+   
Sbjct  322   EYGYGLSSLPLEPLRDCPPNAVFMDAYFAKNDGMPLKMPNVFCIFERYAGDVMWRHTEAT  381

Query  1009  DADDDLIREARPKVSLVVRTTATVGNYDYIFDWEFQTDGSIRVTVGLSGIILAKGSPYEH  830
             D +  LIRE RP+VSLVVRT +TVGNYDYI DWEF+  GSI+VTVGL+G++  +G+ Y H
Sbjct  382   DPEK-LIREVRPEVSLVVRTVSTVGNYDYINDWEFKQSGSIKVTVGLTGMLEVRGTNYTH  440

Query  829   INQFEIPRWDFPAGSLVSENTIGVAHDHFITFHLDMDVDGPTNSFVKVDL-VKNYNIAGK  653
              +Q E   +    G+L++ENTIGV HDHF+T+ LD+DVDG  NSFVK  L     N  G 
Sbjct  441   KDQIEEDVY----GTLIAENTIGVRHDHFLTYRLDLDVDGDANSFVKSKLRTVRVNDHGS  496

Query  652   IQRKSYWSPKRKVAKSENDAKIKLQLDKPSEFHVINPRHQSRLGNPSGYKIVPSATAASL  473
               RKSYW+  R+ A++E+ A+IKL   +P +   +NP  ++++GN  GY++VP      L
Sbjct  497   -PRKSYWTVDRETARTESAARIKLG-SEPVDLLFVNPNKKTKMGNLIGYRLVPYGVVGPL  554

Query  472   LDLQDPPQLRAAFTNNQIWVTPYNRSEQWAGGLFTYQSHGDDTLAVWSNRNRVIEKQDIV  293
             L   D PQ+RAAFTN   WVT YN SE+WAGGL+  QS GDDTL+VWS RNR IE +DIV
Sbjct  555   LSDDDYPQIRAAFTNYNAWVTAYNISEKWAGGLYADQSRGDDTLSVWSKRNRSIENKDIV  614

Query  292   LWYTLGFHHLPCQEDFPVMPTVTSTFQLKPVNFFDRNPIIQANP  161
             LWYTLGFHH+PCQEDFPVMPT    F+L+P NFF+ NP+++  P
Sbjct  615   LWYTLGFHHVPCQEDFPVMPTFNGGFELRPSNFFESNPVLKVVP  658



>ref|XP_002278327.1| PREDICTED: primary amine oxidase isoform X1 [Vitis vinifera]
 emb|CBI26239.3| unnamed protein product [Vitis vinifera]
Length=676

 Score =   621 bits (1602),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 304/653 (47%), Positives = 431/653 (66%), Gaps = 17/653 (3%)
 Frame = -1

Query  2083  HPLDPLTIQEIERTRSILSSYQPFSGSSLRIHSLSLDEPDKSEVLRW---KRGNPLPTRK  1913
             HPLDPLT+QE+++ R+I+++    S  +L  H + LDEPDKS V+ W   +     P R+
Sbjct  30    HPLDPLTLQELDQVRTIITA----SHHNLTFHYVGLDEPDKSIVVSWLAHRTTAKTPPRR  85

Query  1912  AFVVALSNGQAHLLVVDLGSGRVSSHTRNPASGYPPMSADDASTALEATFSNSVFREAIS  1733
             A V+A  N Q H  +VDL +  + S      SG+P ++ ++ + A     +++ FR ++ 
Sbjct  86    ALVIARLNHQTHQFIVDLSTHSIVSDEIYSGSGFPMLTFEEQTAANSLALTHAPFRASVG  145

Query  1732  TRGVEINDVVCSAAAPGWFGPEEEGRRITKVKCYTAQNTPNYYMRPIEGLLLTVDLDSGK  1553
              RG+++ ++V  +   GW+G E   RRI KV       T N YMRPIEG+ +TVDLD  K
Sbjct  146   RRGLKMEEIVGLSYTVGWYGEEGTSRRIVKVMFCYLDGTVNLYMRPIEGITVTVDLDEMK  205

Query  1552  VINVYDTHSPIPIPKAQGTDYRRDGIEHRAPGVEPLKPISMEQPNGQSFRVEDGYIVKWA  1373
             VI  +D    +P+PKA GTD+R    + + P    LK I++ QP+G SF +  G+ + WA
Sbjct  206   VIAYHD-RLMVPVPKADGTDFRES--KQKPPFGPRLKGITVVQPDGPSFTIH-GHQISWA  261

Query  1372  SWEFHVKADQRAGIIISQATVFDPEAGKRRSVMYKGFASELFVPYMDVDEGWYFRAFMDA  1193
             +W+FH+  D RAG IIS A+++D E  ++R V+Y+G+ SELFVPYMD+ E WYFR F DA
Sbjct  262   NWDFHLAFDMRAGPIISVASIYDVEKKEQRRVLYRGYISELFVPYMDLTEEWYFRTFFDA  321

Query  1192  GEFGLGATAMELVPLNDCPRHSHYIDGLFVDPDGRPVSQPNVICVFERYSGDIAWRHSGT  1013
             GE+G G  AM L PL DCP ++ ++DG     +G PV+  NV C+FERY+GDI WRH+  
Sbjct  322   GEYGFGLCAMPLQPLTDCPENAVFMDGYVTGQNGTPVNMTNVFCIFERYAGDIMWRHT-E  380

Query  1012  GDADDDLIREARPKVSLVVRTTATVGNYDYIFDWEFQTDGSIRVTVGLSGIILAKGSPYE  833
              +    LI E+RP+VSLVVR  + VGNYDYI DWEF   GSI+++VGLSG++  +G+ Y 
Sbjct  381   AEIPGKLITESRPEVSLVVRMVSAVGNYDYIIDWEFLQSGSIKLSVGLSGVLEVRGTTYT  440

Query  832   HINQFEIPRWDFPAGSLVSENTIGVAHDHFITFHLDMDVDGPTNSFVKVDLVKNYNIAGK  653
             H++Q     +    G+L+++NT+G  HDHF+T+HLD+DVDG TNSFVK +L K      +
Sbjct  441   HVDQIHEEVY----GTLLADNTLGAYHDHFLTYHLDLDVDGDTNSFVKSNLRKTLVSGNR  496

Query  652   IQRKSYWSPKRKVAKSENDAKIKLQLDKPSEFHVINPRHQSRLGNPSGYKIVPSATAASL  473
               R+SYW+   + AK E+DAKI+L L KP+E  V+NP  ++++GN  GY+++P +    L
Sbjct  497   SPRRSYWTVVSETAKRESDAKIQLGL-KPAELLVVNPNKRTKVGNYVGYRLIPGSVVGPL  555

Query  472   LDLQDPPQLRAAFTNNQIWVTPYNRSEQWAGGLFTYQSHGDDTLAVWSNRNRVIEKQDIV  293
             L   D  Q R AFT   +WVTPYN+SE+W GGL+T QS GDDTLA WS R+R IE +DIV
Sbjct  556   LTDDDYSQRRGAFTRYNVWVTPYNKSEKWVGGLYTDQSRGDDTLAQWSLRDREIENKDIV  615

Query  292   LWYTLGFHHLPCQEDFPVMPTVTSTFQLKPVNFFDRNPIIQANPNFAEDLPIC  134
             +WYT+GFHH+P QEDFP+MPT++  F+L+P NFFD NP+++  P      P C
Sbjct  616   MWYTMGFHHVPYQEDFPLMPTISGGFELRPSNFFDSNPVLKVKPPRQVKWPSC  668



>ref|XP_002312527.2| copper/topa quinone amine oxidase precursor family protein [Populus 
trichocarpa]
 gb|EEE89894.2| copper/topa quinone amine oxidase precursor family protein [Populus 
trichocarpa]
Length=684

 Score =   622 bits (1603),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 300/643 (47%), Positives = 425/643 (66%), Gaps = 12/643 (2%)
 Frame = -1

Query  2083  HPLDPLTIQEIERTRSILSSYQPFSGSSLRIHSLSLDEPDKSEVLRWKRGNPL--PTRKA  1910
             HPLDPLT  E  + +SI+ +  P S  S+  H + L+EP K+ +L W  G     P R+A
Sbjct  40    HPLDPLTPTEFTKIQSIVHNSYPKSNHSIAFHYVGLEEPTKTAILSWLEGTATRTPPRQA  99

Query  1909  FVVALSNGQAHLLVVDLGSGRVSSHTRNPASGYPPMSADDASTALEATFSNSVFREAIST  1730
             F++A  N   H ++ DL    + S       GYP ++ ++  TA    F  + F E+I  
Sbjct  100   FIIARINQITHEIIADLSVRNIVSDRVYGGYGYPLLTFEEQGTANALPFKYTPFLESIRK  159

Query  1729  RGVEINDVVCSAAAPGWFGPEEEGRRITKVKCYTAQNTPNYYMRPIEGLLLTVDLDSGKV  1550
             RG+++ +VVC++ A GW+G +   +R+ +V C     T N YMRPIEG+ +TVDL+  K+
Sbjct  160   RGLKVEEVVCTSFAIGWYGEKRRSKRVVRVLCNYLDGTVNLYMRPIEGITVTVDLEEMKI  219

Query  1549  INVYDTHSPIPIPKAQGTDYRRDGIEHRAPGVEPLKPISMEQPNGQSFRVEDGYIVKWAS  1370
             +   D  S +P+PKA GTDYR      + P   PLK ISM Q +G SF + DG+ ++WA+
Sbjct  220   LGFKD-RSTVPMPKADGTDYRESS--QKPPFGSPLKGISMHQSDGPSFTI-DGHAIRWAN  275

Query  1369  WEFHVKADQRAGIIISQATVFDPEAGKRRSVMYKGFASELFVPYMDVDEGWYFRAFMDAG  1190
             W+FH+  D RAG +IS A++FD +  K R V+Y+GF SE+FVPYMD++E WY+R F DAG
Sbjct  276   WDFHLSFDARAGPVISLASIFDLQKQKFRKVLYQGFLSEVFVPYMDLNEEWYYRVFFDAG  335

Query  1189  EFGLGATAMELVPLNDCPRHSHYIDGLFVDPDGRPVSQPNVICVFERYSGDIAWRHSGTG  1010
             E+G G  A+ L PL DCP ++ ++D    D +G PV+ PN+ C+FERY+GD+ WRH+   
Sbjct  336   EYGYGLCAVPLEPLRDCPENAVFMDAYVADHNGTPVNMPNIFCIFERYAGDVMWRHTEAA  395

Query  1009  DADDDLIREARPKVSLVVRTTATVGNYDYIFDWEFQTDGSIRVTVGLSGIILAKGSPYEH  830
                  +IRE RP+V+LVVR  +TVGNYDY+ DWEF+  GSI+VTVGL+G++  +GS Y H
Sbjct  396   -IPGKVIREVRPEVTLVVRMVSTVGNYDYVNDWEFKQSGSIKVTVGLTGLLEVRGSMYTH  454

Query  829   INQFEIPRWDFPAGSLVSENTIGVAHDHFITFHLDMDVDGPTNSFVKVDLVKNYNIAGKI  650
              +Q +   +    G+L++ENT+G  HDHF T+HLD+DVDG  NSFV+  L+       + 
Sbjct  455   KDQIKEEAY----GTLLAENTLGANHDHFFTYHLDLDVDGDANSFVRSQLLMTPVTDHRS  510

Query  649   QRKSYWSPKRKVAKSENDAKIKLQLDKPSEFHVINPRHQSRLGNPSGYKIVPSATAASLL  470
              R+SYW    + AK+E+DA+IKL + +  +  VINP  ++ +GN  GY+++P + AA LL
Sbjct  511   PRRSYWRVVSETAKTESDARIKLGVAQ-EDLLVINPNKRTNIGNFIGYRLIPGSVAAPLL  569

Query  469   DLQDPPQLRAAFTNNQIWVTPYNRSEQWAGGLFTYQSHGDDTLAVWSNRNRVIEKQDIVL  290
                D  Q+R AFT   +W+TPYN+SE+WAGGL+  QS GDDTLA WS RNR IE +DIVL
Sbjct  570   SDDDYAQIRGAFTKYNLWITPYNKSEKWAGGLYVDQSRGDDTLARWSLRNREIENKDIVL  629

Query  289   WYTLGFHHLPCQEDFPVMPTVTSTFQLKPVNFFDRNPIIQANP  161
             WYTLGFHH+P QEDFPVM T++S F+L+P NFF+ NP+++  P
Sbjct  630   WYTLGFHHVPYQEDFPVMTTLSSGFELRPANFFESNPVLKVRP  672



>gb|KDO74632.1| hypothetical protein CISIN_1g006113mg [Citrus sinensis]
Length=660

 Score =   620 bits (1600),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 310/644 (48%), Positives = 421/644 (65%), Gaps = 14/644 (2%)
 Frame = -1

Query  2083  HPLDPLTIQEIERTRSILSSYQPFSGSSLRIHSLSLDEPDKSEVLRWKRGNPL--PTRKA  1910
             HPLD LT  E  + +SI++   P S  +L    + L EP K  VL W R      P R+A
Sbjct  26    HPLDSLTPSEFTQIQSIVTKAYPKSTYNLTFQYVGLKEPTKQTVLSWLRNETTTNPPRQA  85

Query  1909  FVVALSNGQAHLLVVDLGSGRVSSHTRNPASGYPPMSADDASTALEATFSNSVFREAIST  1730
             FVVA  + Q H ++VDL    ++S       GYP ++ ++   A +   +  +F  +IS 
Sbjct  86    FVVARIDHQTHEIIVDLSLQGITSKKTYNGYGYPLLTGEEQEDANKLASTYPLFVASISK  145

Query  1729  RGVEINDVVCSAAAPGWFGPEEEGRRITKVKCYTAQNTPNYYMRPIEGLLLTVDLDSGKV  1550
             RG+++ +VVC +   GWFG E + +RI K+ CY    T N  MRPIEG+ +TVDLD  K+
Sbjct  146   RGLKLEEVVCGSFTVGWFGEERKNKRIVKMMCYYLDGTLNADMRPIEGITMTVDLDEMKI  205

Query  1549  INVYDTHSPIPIPKAQGTDYRRDGIEHRAPGVEPLKPISMEQPNGQSFRVEDGYIVKWAS  1370
             I   D    +P+PK+ GT+YR   +  + P    LK  ++ QP+G SF +  G  ++WA 
Sbjct  206   IQFRD-RIIVPVPKSDGTEYRESKL--KPPFRPSLKRTTVVQPDGPSFNIV-GSQIRWAD  261

Query  1369  WEFHVKADQRAGIIISQATVFDPEAGKRRSVMYKGFASELFVPYMDVDEGWYFRAFMDAG  1190
             WEFH+  D RAG+IIS A+++DPE  + R V+YKG  SELFVPYMD+ E WY+R+F D G
Sbjct  262   WEFHLSFDARAGMIISVASIYDPEKQQSRQVLYKGHVSELFVPYMDLTEEWYYRSFFDVG  321

Query  1189  EFGLGATAMELVPLNDCPRHSHYIDGLFVDPDGRPVSQPNVICVFERYSGDIAWRHSGTG  1010
             E+G G +++ L PL DCP ++ ++D  F   DG P+  PNV C+FERY+GD+ WRH+   
Sbjct  322   EYGYGLSSLPLEPLRDCPPNAVFMDAYFAKNDGMPLKMPNVFCIFERYAGDVMWRHTEAT  381

Query  1009  DADDDLIREARPKVSLVVRTTATVGNYDYIFDWEFQTDGSIRVTVGLSGIILAKGSPYEH  830
             D +  LIRE RP+VSLVVRT +TVGNYDYI DWEF+  GSI+VTVGL+G++  +G+ Y H
Sbjct  382   DPEK-LIREVRPEVSLVVRTVSTVGNYDYINDWEFKQSGSIKVTVGLTGMLEVRGTNYTH  440

Query  829   INQFEIPRWDFPAGSLVSENTIGVAHDHFITFHLDMDVDGPTNSFVKVDL-VKNYNIAGK  653
              +Q E   +    G+L++ENTIGV HDHF+T+ LD+DVDG  NSFVK  L     N  G 
Sbjct  441   KDQIEEDVY----GTLIAENTIGVRHDHFLTYRLDLDVDGDANSFVKSKLRTVRVNDHGS  496

Query  652   IQRKSYWSPKRKVAKSENDAKIKLQLDKPSEFHVINPRHQSRLGNPSGYKIVPSATAASL  473
               RKSYW+  R+ A++E+ A+IKL   +P +   +NP  ++++GN  GY++VP      L
Sbjct  497   -PRKSYWTVDRETARTESAARIKLG-SEPVDLLFVNPNKKTKMGNLIGYRLVPYGVVGPL  554

Query  472   LDLQDPPQLRAAFTNNQIWVTPYNRSEQWAGGLFTYQSHGDDTLAVWSNRNRVIEKQDIV  293
             L   D PQ+RAAFTN   WVT YN SE+WAGGL+  QS GDDTL+VWS RNR IE +DIV
Sbjct  555   LSDDDYPQIRAAFTNYNAWVTAYNISEKWAGGLYADQSRGDDTLSVWSKRNRSIENKDIV  614

Query  292   LWYTLGFHHLPCQEDFPVMPTVTSTFQLKPVNFFDRNPIIQANP  161
             LWYTLGFHH+PCQEDFPVMPT    F+L+P NFF+ NP+++  P
Sbjct  615   LWYTLGFHHVPCQEDFPVMPTFNGGFELRPSNFFESNPVLKVVP  658



>ref|XP_010649890.1| PREDICTED: primary amine oxidase isoform X2 [Vitis vinifera]
Length=661

 Score =   620 bits (1599),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 302/644 (47%), Positives = 429/644 (67%), Gaps = 17/644 (3%)
 Frame = -1

Query  2083  HPLDPLTIQEIERTRSILSSYQPFSGSSLRIHSLSLDEPDKSEVLRW---KRGNPLPTRK  1913
             HPLDPLT+QE+++ R+I+++    S  +L  H + LDEPDKS V+ W   +     P R+
Sbjct  30    HPLDPLTLQELDQVRTIITA----SHHNLTFHYVGLDEPDKSIVVSWLAHRTTAKTPPRR  85

Query  1912  AFVVALSNGQAHLLVVDLGSGRVSSHTRNPASGYPPMSADDASTALEATFSNSVFREAIS  1733
             A V+A  N Q H  +VDL +  + S      SG+P ++ ++ + A     +++ FR ++ 
Sbjct  86    ALVIARLNHQTHQFIVDLSTHSIVSDEIYSGSGFPMLTFEEQTAANSLALTHAPFRASVG  145

Query  1732  TRGVEINDVVCSAAAPGWFGPEEEGRRITKVKCYTAQNTPNYYMRPIEGLLLTVDLDSGK  1553
              RG+++ ++V  +   GW+G E   RRI KV       T N YMRPIEG+ +TVDLD  K
Sbjct  146   RRGLKMEEIVGLSYTVGWYGEEGTSRRIVKVMFCYLDGTVNLYMRPIEGITVTVDLDEMK  205

Query  1552  VINVYDTHSPIPIPKAQGTDYRRDGIEHRAPGVEPLKPISMEQPNGQSFRVEDGYIVKWA  1373
             VI  +D    +P+PKA GTD+R    + + P    LK I++ QP+G SF +  G+ + WA
Sbjct  206   VIAYHD-RLMVPVPKADGTDFRES--KQKPPFGPRLKGITVVQPDGPSFTIH-GHQISWA  261

Query  1372  SWEFHVKADQRAGIIISQATVFDPEAGKRRSVMYKGFASELFVPYMDVDEGWYFRAFMDA  1193
             +W+FH+  D RAG IIS A+++D E  ++R V+Y+G+ SELFVPYMD+ E WYFR F DA
Sbjct  262   NWDFHLAFDMRAGPIISVASIYDVEKKEQRRVLYRGYISELFVPYMDLTEEWYFRTFFDA  321

Query  1192  GEFGLGATAMELVPLNDCPRHSHYIDGLFVDPDGRPVSQPNVICVFERYSGDIAWRHSGT  1013
             GE+G G  AM L PL DCP ++ ++DG     +G PV+  NV C+FERY+GDI WRH+  
Sbjct  322   GEYGFGLCAMPLQPLTDCPENAVFMDGYVTGQNGTPVNMTNVFCIFERYAGDIMWRHT-E  380

Query  1012  GDADDDLIREARPKVSLVVRTTATVGNYDYIFDWEFQTDGSIRVTVGLSGIILAKGSPYE  833
              +    LI E+RP+VSLVVR  + VGNYDYI DWEF   GSI+++VGLSG++  +G+ Y 
Sbjct  381   AEIPGKLITESRPEVSLVVRMVSAVGNYDYIIDWEFLQSGSIKLSVGLSGVLEVRGTTYT  440

Query  832   HINQFEIPRWDFPAGSLVSENTIGVAHDHFITFHLDMDVDGPTNSFVKVDLVKNYNIAGK  653
             H++Q     +    G+L+++NT+G  HDHF+T+HLD+DVDG TNSFVK +L K      +
Sbjct  441   HVDQIHEEVY----GTLLADNTLGAYHDHFLTYHLDLDVDGDTNSFVKSNLRKTLVSGNR  496

Query  652   IQRKSYWSPKRKVAKSENDAKIKLQLDKPSEFHVINPRHQSRLGNPSGYKIVPSATAASL  473
               R+SYW+   + AK E+DAKI+L L KP+E  V+NP  ++++GN  GY+++P +    L
Sbjct  497   SPRRSYWTVVSETAKRESDAKIQLGL-KPAELLVVNPNKRTKVGNYVGYRLIPGSVVGPL  555

Query  472   LDLQDPPQLRAAFTNNQIWVTPYNRSEQWAGGLFTYQSHGDDTLAVWSNRNRVIEKQDIV  293
             L   D  Q R AFT   +WVTPYN+SE+W GGL+T QS GDDTLA WS R+R IE +DIV
Sbjct  556   LTDDDYSQRRGAFTRYNVWVTPYNKSEKWVGGLYTDQSRGDDTLAQWSLRDREIENKDIV  615

Query  292   LWYTLGFHHLPCQEDFPVMPTVTSTFQLKPVNFFDRNPIIQANP  161
             +WYT+GFHH+P QEDFP+MPT++  F+L+P NFFD NP+++  P
Sbjct  616   MWYTMGFHHVPYQEDFPLMPTISGGFELRPSNFFDSNPVLKVKP  659



>ref|XP_007034731.1| Copper amine oxidase family protein [Theobroma cacao]
 gb|EOY05657.1| Copper amine oxidase family protein [Theobroma cacao]
Length=858

 Score =   625 bits (1612),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 308/655 (47%), Positives = 421/655 (64%), Gaps = 19/655 (3%)
 Frame = -1

Query  2083  HPLDPLTIQEIERTRSILSSYQPFSGSSLRIHSLSLDEPDKSEVLRW--KRGNPLPTRKA  1910
             HPLD LT  E+ + R+I+    P S   L    + L+EPDK  +L W  K  +  P R+A
Sbjct  216   HPLDSLTPAELHQVRAIVHKSYPSSKYKLTFQYVGLEEPDKPAMLSWLSKPTSKAPPRRA  275

Query  1909  FVVALSNGQAHLLVVDLGSGRVSSHTRNPASGYPPMSADDASTALEATFSNSVFREAIST  1730
             FV+A  N Q+H ++VDL    + S      SGYP ++ ++   A++    +  F  ++  
Sbjct  276   FVIARLNKQSHEIIVDLSERSIISDEVYDGSGYPLLTIEEQEAAIDLAVKHEPFLASLKK  335

Query  1729  RGVEINDVVCSAAAPGWFGPEEEGRRITKVKCYTAQNTPNYYMRPIEGLLLTVDLDSGKV  1550
             RG+  ++VVCS    GWFG E++ +R  K+ CY    T N Y+RPIEG+ +TVDL+  K 
Sbjct  336   RGLNASEVVCSTQTIGWFG-EKKSKRELKIPCYYLDGTVNMYLRPIEGISVTVDLEEMK-  393

Query  1549  INVYDTHSPIPIPKAQGTDYRRDGIEHRAPGVEPLKPISMEQPNGQSFRVE---DGYIVK  1379
             I+ Y       +PKA+GT+YR   +        P  P+    P  Q  R     DG  V+
Sbjct  394   ISQYTDRFVAAMPKAEGTEYRASMV------TPPFGPLLNGAPASQPGRTGLKIDGNTVR  447

Query  1378  WASWEFHVKADQRAGIIISQATVFDPEAGKRRSVMYKGFASELFVPYMDVDEGWYFRAFM  1199
             WA+W FH+  D RAG +IS A+++D E  K R V+Y+GF SELF+PY D  E WY   F+
Sbjct  448   WANWRFHLGFDARAGAVISLASIYDSEQRKYRQVLYRGFISELFIPYQDTTEEWYHITFL  507

Query  1198  DAGEFGLGATAMELVPLNDCPRHSHYIDGLFVDPDGRPVSQPNVICVFERYSGDIAWRHS  1019
             D GEFG G +A+ L PLNDCP ++ + DG + D DG+PV   + +C+FER+ GDI WRH+
Sbjct  508   DCGEFGFGLSAVSLEPLNDCPANAVFFDGYYADQDGKPVKVEDAMCIFERHPGDIMWRHT  567

Query  1018  GTGDADDDLIREARPKVSLVVRTTATVGNYDYIFDWEFQTDGSIRVTVGLSGIILAKGSP  839
                +  +  IRE RP+VSLVVR  ATVGNYDYI DWEF+  GSI+  VGL+G++  K +P
Sbjct  568   -EAEIPNLEIREVRPEVSLVVRMVATVGNYDYILDWEFKPSGSIKFGVGLTGVLEVKAAP  626

Query  838   YEHINQFEIPRWDFPAGSLVSENTIGVAHDHFITFHLDMDVDGPTNSFVKVDLVKNYNIA  659
             Y H +Q +   +    G+L+++NTIGV HDHFIT+HLD+D+DG  NS VK +LV      
Sbjct  627   YTHTDQIKEEAY----GTLLADNTIGVHHDHFITYHLDLDIDGDANSLVKTNLVTKRVTD  682

Query  658   GKIQRKSYWSPKRKVAKSENDAKIKLQLDKPSEFHVINPRHQSRLGNPSGYKIVPSATAA  479
               + RKSYW+ + + AK+E DA+IKL L KP E  V+NP  +++ GN  GY+++P + A 
Sbjct  683   KSMPRKSYWTVEHETAKTEADARIKLGL-KPEELVVVNPNKRTKPGNKVGYRLLPGSAAG  741

Query  478   SLLDLQDPPQLRAAFTNNQIWVTPYNRSEQWAGGLFTYQSHGDDTLAVWSNRNRVIEKQD  299
              LL L D PQ+RAAFTN  +WVTPYN+SE+WAGGLF  QS GDDTLAVWS+RNR IE +D
Sbjct  742   PLLTLDDYPQIRAAFTNYNVWVTPYNKSEKWAGGLFADQSRGDDTLAVWSSRNRNIENKD  801

Query  298   IVLWYTLGFHHLPCQEDFPVMPTVTSTFQLKPVNFFDRNPIIQANPNFAEDLPIC  134
             IVLWYT+GFHH+PCQEDFPVMPT++  F+L+P NFF+ NP+++  P      P C
Sbjct  802   IVLWYTMGFHHVPCQEDFPVMPTLSGGFELRPTNFFEYNPVLKTRPPLHASWPNC  856



>ref|XP_009412472.1| PREDICTED: primary amine oxidase-like [Musa acuminata subsp. 
malaccensis]
Length=677

 Score =   617 bits (1590),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 311/656 (47%), Positives = 426/656 (65%), Gaps = 17/656 (3%)
 Frame = -1

Query  2083  HPLDPLTIQEIERTRSILSSYQPFSGSSLRIHSLSLDEPDKSEVLRWKRG---NPLPTRK  1913
             HPLDPLT  EI   R ++ S    +  SL  H + LDEPDK++V  W           R+
Sbjct  29    HPLDPLTAAEISTIRRVIQSSHLGASKSLAFHYVGLDEPDKTDVQAWAESATRGRRQRRR  88

Query  1912  AFVVALSNGQAHLLVVDLGSGRVSSHTRNPASGYPPMSADDASTALEATFSNSVFREAIS  1733
             AFVVA S G+ H +VVD+    V S      SGYP  + D+   A     + + F E+  
Sbjct  89    AFVVARSGGETHEIVVDVADASVVSDRVYRGSGYPIQTLDELEAAAALPLNYTPFVESAR  148

Query  1732  TRGVEINDVVCSAAAPGWFGPEEEGRRITKVKCYTAQNTPNYYMRPIEGLLLTVDLDSGK  1553
              RGV ++DVVCS    GWFG    GRR  K++C  A  T N+YMRP+EG+ + VDLD  +
Sbjct  149   RRGVALSDVVCSPLTAGWFGEPGRGRRRLKLQCCVAGETANFYMRPMEGITVVVDLDEMR  208

Query  1552  VINVYDTHSPIPIPKAQGTDYRRDGIEHRAPGVEPLKPISMEQPNGQSFRVEDGYIVKWA  1373
             +I  Y     +P+PKA+GTDYR    + R P     KP  + QP G+ FR+ DG++++W+
Sbjct  209   IIG-YRDRVVVPVPKAEGTDYR--AAKQRPPFALETKPGVVVQPAGKGFRI-DGHVIRWS  264

Query  1372  SWEFHVKADQRAGIIISQATVFDPEAGKRRSVMYKGFASELFVPYMDVDEGWYFRAFMDA  1193
             +W+FH+  D RAG++IS A+V+D + G RR V+Y+G+ SE+FVPYMD  E WYFR F DA
Sbjct  265   NWDFHLSYDARAGLVISLASVYDAQKGARRRVLYRGYVSEVFVPYMDPAEEWYFRTFFDA  324

Query  1192  GEFGLGATAMELVPLNDCPRHSHYIDGLFVDPDGRPVSQPNVICVFERYSGDIAWRHSGT  1013
             GE+G G  A  L P+ DCP ++ ++DG +   DG PV  PNV CVFERYSGD AWRH+  
Sbjct  325   GEYGFGLWASPLEPMTDCPANAEFMDGYYATQDGEPVKLPNVFCVFERYSGDAAWRHTEL  384

Query  1012  GDADDDLIREARPKVSLVVRTTATVGNYDYIFDWEFQTDGSIRVTVGLSGIILAKGSPYE  833
             G     +IRE RP+VSLVVR    +GNYDY+ DWEF+T GSI+V V L+GI+  KG+PY 
Sbjct  385   G-IPGQMIREVRPEVSLVVRMVGALGNYDYVTDWEFKTSGSIKVGVSLTGILEVKGTPYT  443

Query  832   HINQFEIPRWDFPAGSLVSENTIGVAHDHFITFHLDMDVDGPTNSFVKVDLVKNYNIA--  659
             H +Q          GSL++ENTI V HDHF+T++LD+D+DG  N+F+K  L K   +A  
Sbjct  444   HTDQITTD----VHGSLLAENTIAVYHDHFVTYYLDLDIDGLNNTFIKSKL-KTARVADG  498

Query  658   GKIQRKSYWSPKRKVAKSENDAKIKLQLDKPSEFHVINPRHQSRLGNPSGYKIVPS-ATA  482
             G + R+SYW+  R+VAK E DA++++    P+E  ++NP  ++++GN  GY+++ + A A
Sbjct  499   GDVPRRSYWTVTREVAKMEADARVEIG-SVPAELLIVNPNKKTKMGNHVGYRLITNGAPA  557

Query  481   ASLLDLQDPPQLRAAFTNNQIWVTPYNRSEQWAGGLFTYQSHGDDTLAVWSNRNRVIEKQ  302
             ASLL   D PQ+RA++   Q+WVTPYN+SE+WA GL+   S GDD LA WS RNR IE  
Sbjct  558   ASLLSDDDYPQMRASYGKKQVWVTPYNKSEKWAAGLYVDNSRGDDNLAAWSLRNRAIENV  617

Query  301   DIVLWYTLGFHHLPCQEDFPVMPTVTSTFQLKPVNFFDRNPIIQANPNFAEDLPIC  134
             DIV+W+T+GFHH+P QEDFP+MP ++S F+L+P NFF+ NP+I+  P     LP C
Sbjct  618   DIVVWHTVGFHHIPYQEDFPLMPMLSSGFELRPSNFFEINPLIRLRPTKHTHLPNC  673



>ref|XP_010256009.1| PREDICTED: primary amine oxidase [Nelumbo nucifera]
Length=680

 Score =   617 bits (1590),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 302/652 (46%), Positives = 424/652 (65%), Gaps = 14/652 (2%)
 Frame = -1

Query  2077  LDPLTIQEIERTRSILSSYQPFSGSSLRIHSLSLDEPDKSEVLRWKRGNPL----PTRKA  1910
             LDPL+  E+    +I+    P S   L    + LD+PDKS V+ W          P R+A
Sbjct  34    LDPLSPSELANVSAIIKRSNPSSTHKLTFQYIGLDDPDKSTVISWLSNQTTTTTTPPRRA  93

Query  1909  FVVALSNGQAHLLVVDLGSGRVSSHTRNPASGYPPMSADDASTALEATFSNSVFREAIST  1730
             FV+A  + Q+H + VDL +  + S       GYP ++ ++ + A E     + F+ +I  
Sbjct  94    FVIARIDQQSHEITVDLSTNSIVSDRVYTGYGYPLLTLEEQAEADELPMKYAPFQASIRK  153

Query  1729  RGVEINDVVCSAAAPGWFGPEEEGRRITKVKCYTAQNTPNYYMRPIEGLLLTVDLDSGKV  1550
             RG+++++VVC   + GWFG  ++G+R+ K+ C+    T N YMRPIEG+ + VDLD  KV
Sbjct  154   RGLKLSEVVCQTFSVGWFGERKQGKRLLKILCFYLDGTVNLYMRPIEGITVVVDLDEMKV  213

Query  1549  INVYDTHSPIPIPKAQGTDYRRDGIEHRAPGVEPLKPISMEQPNGQSFRVEDGYIVKWAS  1370
              N YD  + +P+PKA GT+YR    + + P       +S+ Q +G  F++ DG+ ++WA+
Sbjct  214   ANYYDRFT-VPVPKADGTEYRAS--KQKPPFGPSHNGMSVVQSDGPGFKI-DGHTIRWAN  269

Query  1369  WEFHVKADQRAGIIISQATVFDPEAGKRRSVMYKGFASELFVPYMDVDEGWYFRAFMDAG  1190
             W FH+  D RAG IIS A+++D +  K R VMYKG+ SELFVPYMD    WY++ F DAG
Sbjct  270   WVFHLGFDARAGPIISLASIYDVDKQKFRRVMYKGYVSELFVPYMDPTFEWYYKTFFDAG  329

Query  1189  EFGLGATAMELVPLNDCPRHSHYIDGLFVDPDGRPVSQPNVICVFERYSGDIAWRHSGTG  1010
             EFG G  ++ L P  DCP H+ ++DG F   DG+P+   NVICVF+RYSGDI WRH+  G
Sbjct  330   EFGFGLCSLSLEPFTDCPAHAEFMDGYFAGRDGQPIKISNVICVFQRYSGDIMWRHTEAG  389

Query  1009  DADDDLIREARPKVSLVVRTTATVGNYDYIFDWEFQTDGSIRVTVGLSGIILAKGSPYEH  830
                  +IRE RP+V+LVVR  +TVGNYDYI DWEF+  GSI+  VGLSG++  KG  Y H
Sbjct  390   -IPGKVIREVRPEVNLVVRMVSTVGNYDYIIDWEFKQSGSIKFGVGLSGLLEVKGVTYTH  448

Query  829   INQFEIPRWDFPAGSLVSENTIGVAHDHFITFHLDMDVDGPTNSFVKVDLVKNYNIAGKI  650
              +Q +    +   G+L++ENT+GV HDHF+T++LD+DVDG  NSFV+  L          
Sbjct  449   RDQIK----ENVYGTLLAENTVGVYHDHFVTYYLDLDVDGEDNSFVQGKLKTMKITDNSS  504

Query  649   QRKSYWSPKRKVAKSENDAKIKLQLDKPSEFHVINPRHQSRLGNPSGYKIVPSATAASLL  470
              RKSYW+   + A++E+DA+++L L +P+EF V+NP  ++++GN  GY+I+P + A  LL
Sbjct  505   PRKSYWTVVSETARTESDARVQLGL-QPAEFLVVNPNEKTKVGNQVGYRILPGSLAGPLL  563

Query  469   DLQDPPQLRAAFTNNQIWVTPYNRSEQWAGGLFTYQSHGDDTLAVWSNRNRVIEKQDIVL  290
                D  Q+RA FT  Q+WVTPYN+SE+WAGGL+  QS G D L+VWS+RNR IE +DIVL
Sbjct  564   SDDDYSQIRAGFTKYQLWVTPYNKSEKWAGGLYADQSRGGDGLSVWSSRNREIENKDIVL  623

Query  289   WYTLGFHHLPCQEDFPVMPTVTSTFQLKPVNFFDRNPIIQANPNFAEDLPIC  134
             WYTLGFHH+P QEDFPVMPT++  F+L+P NFFD NP+++A P      P C
Sbjct  624   WYTLGFHHVPYQEDFPVMPTLSGGFELRPANFFDNNPVLKAQPPKRVSWPNC  675



>ref|XP_011026340.1| PREDICTED: primary amine oxidase-like [Populus euphratica]
Length=668

 Score =   616 bits (1588),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 297/652 (46%), Positives = 430/652 (66%), Gaps = 12/652 (2%)
 Frame = -1

Query  2083  HPLDPLTIQEIERTRSILSSYQPFSGSSLRIHSLSLDEPDKSEVLRWKRGNPL--PTRKA  1910
             HPLDPLT  E  + +SI+ +  P S  S+  H + L+EP K+ +L W  G     P R+A
Sbjct  24    HPLDPLTPTEFTQIQSIVHNSYPKSSHSIAFHYVGLEEPTKTAILSWLEGTATKTPPRQA  83

Query  1909  FVVALSNGQAHLLVVDLGSGRVSSHTRNPASGYPPMSADDASTALEATFSNSVFREAIST  1730
             FV+A  +   H ++ DL   ++ S       GYP ++ ++   A    F  + F E+I  
Sbjct  84    FVIARIDQITHEIIADLSVRKIVSDRVYGGYGYPLLTFEEQGAANALPFKYTPFLESIRK  143

Query  1729  RGVEINDVVCSAAAPGWFGPEEEGRRITKVKCYTAQNTPNYYMRPIEGLLLTVDLDSGKV  1550
             RG+++ +V+C++ A GW+G +   +R+ +V C     T N YMRPIEG+ +TVDL++ ++
Sbjct  144   RGLKVEEVLCTSFAIGWYGEKRRNKRVVRVLCNYLDGTVNLYMRPIEGITVTVDLEAMEI  203

Query  1549  INVYDTHSPIPIPKAQGTDYRRDGIEHRAPGVEPLKPISMEQPNGQSFRVEDGYIVKWAS  1370
             +   D  S +P+PKA GTDYR      + P   PLK ISM Q +G SF + DG+ ++WA+
Sbjct  204   LGFQD-RSNVPVPKADGTDYRES--LQKLPFGSPLKGISMHQSDGPSFTI-DGHTIRWAN  259

Query  1369  WEFHVKADQRAGIIISQATVFDPEAGKRRSVMYKGFASELFVPYMDVDEGWYFRAFMDAG  1190
             W+FH+  D RAG +IS A++FD +  K R V+Y+GF SE+FVPYMD++E WY+R F DAG
Sbjct  260   WDFHLSFDARAGPVISLASIFDLQKQKFREVLYQGFLSEVFVPYMDLNEEWYYRVFFDAG  319

Query  1189  EFGLGATAMELVPLNDCPRHSHYIDGLFVDPDGRPVSQPNVICVFERYSGDIAWRHSGTG  1010
             E+G G  A+ L PL DCP ++ ++D    D +G PV+ PN+ C+FERY+GD+ WRH+   
Sbjct  320   EYGYGLCAVPLEPLRDCPENAVFMDAYVADHNGTPVNMPNIFCIFERYAGDVMWRHTEAA  379

Query  1009  DADDDLIREARPKVSLVVRTTATVGNYDYIFDWEFQTDGSIRVTVGLSGIILAKGSPYEH  830
                  +IRE RP+V+LVVR  +TVGNYDY+ DWEF+  GSI+VTVGL+G++  +GS Y H
Sbjct  380   -IPGKVIREVRPEVTLVVRMVSTVGNYDYVNDWEFKQSGSIKVTVGLTGLLEVRGSMYTH  438

Query  829   INQFEIPRWDFPAGSLVSENTIGVAHDHFITFHLDMDVDGPTNSFVKVDLVKNYNIAGKI  650
              +Q +   +    G+L++ENT+G  HDHF T+HLD+DVDG  NSFV+  L+K      + 
Sbjct  439   KDQIKEEVY----GTLLAENTLGANHDHFFTYHLDLDVDGDANSFVRSQLLKTPVTDHRS  494

Query  649   QRKSYWSPKRKVAKSENDAKIKLQLDKPSEFHVINPRHQSRLGNPSGYKIVPSATAASLL  470
              R+SYW    + AK+E+DA+IKL + +  +  V+NP  ++ +GN  GY+++P + AA LL
Sbjct  495   PRRSYWRVVSETAKTESDARIKLGVAQ-EDLLVVNPNKRTNIGNFIGYRLIPGSFAAPLL  553

Query  469   DLQDPPQLRAAFTNNQIWVTPYNRSEQWAGGLFTYQSHGDDTLAVWSNRNRVIEKQDIVL  290
                D  Q+R AFT   +W+TPYN+SE+WAGGL+  QS GDDTLA WS R+R IE +DIVL
Sbjct  554   SDDDYAQIRGAFTKYNLWITPYNKSEKWAGGLYVDQSRGDDTLARWSLRSREIENKDIVL  613

Query  289   WYTLGFHHLPCQEDFPVMPTVTSTFQLKPVNFFDRNPIIQANPNFAEDLPIC  134
             WYTLGFHH+P QEDFPVM T++  F+L+P NFF+ NP+++  P   ++  IC
Sbjct  614   WYTLGFHHVPYQEDFPVMTTLSGGFELRPANFFESNPVLKVKPPQPDNRSIC  665



>ref|XP_007034741.1| Primary amine oxidase [Theobroma cacao]
 gb|EOY05667.1| Primary amine oxidase [Theobroma cacao]
Length=670

 Score =   615 bits (1586),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 311/651 (48%), Positives = 426/651 (65%), Gaps = 13/651 (2%)
 Frame = -1

Query  2101  FADRPMHPLDPLTIQEIERTRSILSSYQPFSGSSLRIHSLSLDEPDKSEVLRWKRGNPL-  1925
             F+ +  HPLD LT  E  + +SI++   P S  +L    + L+EP+K  V+ W   +   
Sbjct  21    FSHQLQHPLDSLTPNEFIQVQSIVNRSYPGSSHNLTFQYVGLEEPNKQVVVSWLENSSTT  80

Query  1924  -PTRKAFVVALSNGQAHLLVVDLGSGRVSSHTRNPASGYPPMSADDASTALEATFSNSVF  1748
              P R+A V+A  N + H + VDL S  + S       GYP ++ ++ + A +  F  + F
Sbjct  81    PPPRQALVIARINHRTHEISVDLSSVGIISDRIYDGYGYPLLTFEEQTAANQLPFKYAPF  140

Query  1747  REAISTRGVEINDVVCSAAAPGWFGPEEEGRRITKVKCYTAQNTPNYYMRPIEGLLLTVD  1568
               +IS RG++I +VVC +   GW G E++ RRI KV CY    T N YMRPIE + +TVD
Sbjct  141   LASISKRGLKIEEVVCGSFTVGWHGEEKKNRRIVKVMCYYLDGTVNLYMRPIEAITVTVD  200

Query  1567  LDSGKVINVYDTHSPIPIPKAQGTDYRRDGIEHRAPGVEPLKPISMEQPNGQSFRVEDGY  1388
             L+  K+I+  D    IP+PKA GTDYR    E RAP    LK I++ QP+G SF + DG 
Sbjct  201   LEEMKIIHFQDRFM-IPVPKAAGTDYRES--EQRAPFGPQLKGITVMQPDGPSFTI-DGN  256

Query  1387  IVKWASWEFHVKADQRAGIIISQATVFDPEAGKRRSVMYKGFASELFVPYMDVDEGWYFR  1208
              V+WA+W+FH+  D R G IIS A+++D E  K R VMY+G+ SELFVPYMD+ E WY+R
Sbjct  257   RVRWANWDFHLSFDARVGPIISLASIYDIERQKFRRVMYRGYLSELFVPYMDLTEEWYYR  316

Query  1207  AFMDAGEFGLGATAMELVPLNDCPRHSHYIDGLFVDPDGRPVSQPNVICVFERYSGDIAW  1028
              F DAGE+G G  A+ L PL DCP ++ ++       DG P+  PNV C+FER +GD+ W
Sbjct  317   TFFDAGEYGYGLCAVPLEPLRDCPANAVFMGAFVAGQDGMPIEMPNVFCIFERNAGDVMW  376

Query  1027  RHSGTGDADDDLIREARPKVSLVVRTTATVGNYDYIFDWEFQTDGSIRVTVGLSGIILAK  848
             RH+ T    + L+ E RP+VSLVVR  +TVGNYDYI DWEF+  GSI+VTVGL+G++  +
Sbjct  377   RHTETM-IPETLVTEVRPEVSLVVRMVSTVGNYDYINDWEFKRIGSIKVTVGLTGLLEVR  435

Query  847   GSPYEHINQFEIPRWDFPAGSLVSENTIGVAHDHFITFHLDMDVDGPTNSFVKVDLVKNY  668
             GS Y H +Q     +    G+L++ENT+G  HDHF+T++LD+DVDG +NSFVK  L    
Sbjct  436   GSKYTHKDQINEEAY----GTLLAENTLGARHDHFLTYYLDLDVDGDSNSFVKSKLKTTR  491

Query  667   NIAGKIQRKSYWSPKRKVAKSENDAKIKLQLDKPSEFHVINPRHQSRLGNPSGYKIVPSA  488
                    RKSYW    + AK+E+DAKIKL L+  ++   +NP  ++++GN  GY+++P +
Sbjct  492   VTDQSSPRKSYWKVVSETAKTESDAKIKLGLES-ADLLFVNPNKKTKMGNLVGYRLIPGS  550

Query  487   TAASLLDLQDPPQLRAAFTNNQIWVTPYNRSEQWAGGLFTYQSHGDDTLAVWSNRNRVIE  308
                 LL   D  Q+RAAFT   +WVTPYNRSE+WAGGL+T QS GDDTLA WS+RNR IE
Sbjct  551   VTGPLLTDDDYSQVRAAFTKYNVWVTPYNRSEKWAGGLYTDQSRGDDTLATWSSRNRKIE  610

Query  307   KQDIVLWYTLGFHHLPCQEDFPVMPTVTSTFQLKPVNFFDRNPIIQAN-PN  158
              +DIVLWYTLGFHH+P QEDFP+MPT++S F+L+P NFF+ NP+++   PN
Sbjct  611   NKDIVLWYTLGFHHVPYQEDFPLMPTLSSGFELRPANFFEYNPVLKVKAPN  661



>ref|XP_011021538.1| PREDICTED: primary amine oxidase-like isoform X1 [Populus euphratica]
Length=673

 Score =   615 bits (1587),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 302/649 (47%), Positives = 431/649 (66%), Gaps = 14/649 (2%)
 Frame = -1

Query  2098  ADRPMHPLDPLTIQEIERTRSILSSYQPFSGSSLRIHSLSLDEPDKSEVLRWKRGN--PL  1925
             A +  HPLD LT  E  + R+I+ S  P    +   H + L++P+K  VL W +      
Sbjct  22    AHQHQHPLDSLTPAEFSKVRAIVHSSYPIPSHATAFHYVGLEDPNKLTVLSWLKDQTAKT  81

Query  1924  PTRKAFVVALSNGQAHLLVVDLGSGRVSSHTRNPASGYPPMSADDASTALEATFSNSVFR  1745
             P R+AFV+A  N   H + VDL   ++ S       GYP ++ ++   A       + F 
Sbjct  82    PPRQAFVIARINQTTHEITVDLTVNKIVSDKLYDGYGYPLLTFEEQIAANALPLKYAPFL  141

Query  1744  EAISTRGVEINDVVCSAAAPGWFGPEEEGRRITKVKCYTAQNTPNYYMRPIEGLLLTVDL  1565
             E+I  RG++I +VVC     GW+G E   +RI +V CY    T N Y RP+EG+ +TVDL
Sbjct  142   ESIRKRGLKIEEVVCGGFTVGWYGEERRKKRIVRVMCYYLDGTVNAYTRPVEGVTVTVDL  201

Query  1564  DSGKVINVYDTHSPIPIPKAQGTDYRRDGIEHRAPGVEPLKPISMEQPNGQSFRVEDGYI  1385
             +  K+I   D  + +PIPK +GTDYR  G +   P +  LK I+M QP+G SF + DG+ 
Sbjct  202   EETKIIGFKDRLT-VPIPKGEGTDYR--GSKQSPPFLAQLKGITMVQPDGPSFTI-DGHR  257

Query  1384  VKWASWEFHVKADQRAGIIISQATVFDPEAGKRRSVMYKGFASELFVPYMDVDEGWYFRA  1205
             ++WA+W+FH+  D RAG IIS A+++D +  K R V+YKGF SELFVPYMD+ E WY+R 
Sbjct  258   IRWANWDFHLSFDSRAGPIISLASIYDLQKQKFRQVLYKGFVSELFVPYMDLTEEWYYRT  317

Query  1204  FMDAGEFGLGATAMELVPLNDCPRHSHYIDGLFVDPDGRPVSQPNVICVFERYSGDIAWR  1025
             F DAGE+G G  A+ L P +DCP ++ ++D  F   +G PV+ P+V C+FE+++GDI WR
Sbjct  318   FFDAGEYGYGLCAVPLEPFSDCPENAVFMDAYFAGQNGMPVNMPDVFCIFEKHAGDITWR  377

Query  1024  HSGTGDADDDLIREARPKVSLVVRTTATVGNYDYIFDWEFQTDGSIRVTVGLSGIILAKG  845
             H+ T    ++ IRE RP+V+LVVR  +TVGNYDYI DWEF+  GSI+VTVGL+G++  +G
Sbjct  378   HTETIKPGEE-IREVRPEVTLVVRMVSTVGNYDYINDWEFKQSGSIKVTVGLTGLLEVRG  436

Query  844   SPYEHINQFEIPRWDFPAGSLVSENTIGVAHDHFITFHLDMDVDGPTNSFVKVDLVKNYN  665
             + Y H +Q +   +    G+L++ENT+G  HDHF+T+HLD+DVDG  NSFVK +L +   
Sbjct  437   TVYTHNDQIKEEVY----GTLLAENTVGAHHDHFLTYHLDLDVDGDANSFVKSNL-QMTR  491

Query  664   IAGKIQ-RKSYWSPKRKVAKSENDAKIKLQLDKPSEFHVINPRHQSRLGNPSGYKIVPSA  488
             +A ++  RKS+W    + AK+E+DA+I+L +++ ++  V+NP  ++ +GN  GY+++P +
Sbjct  492   VADQMSPRKSFWRVVSETAKTESDARIRLGVEQ-ADLLVVNPNKRTDMGNSIGYRLIPGS  550

Query  487   TAASLLDLQDPPQLRAAFTNNQIWVTPYNRSEQWAGGLFTYQSHGDDTLAVWSNRNRVIE  308
                 +L   D  Q+R AFTN  +WVTPYN+SE+WAGGL+  QS GDDTLA WS RNRVIE
Sbjct  551   LTRPVLSDDDYSQIRGAFTNYNVWVTPYNKSEKWAGGLYADQSRGDDTLARWSLRNRVIE  610

Query  307   KQDIVLWYTLGFHHLPCQEDFPVMPTVTSTFQLKPVNFFDRNPIIQANP  161
              +DIVLWYTLGFHH+P QEDFPVMPTV+S F+L+P NFF+ NP+++  P
Sbjct  611   NKDIVLWYTLGFHHVPYQEDFPVMPTVSSGFELRPANFFESNPVLKVKP  659



>ref|XP_009417163.1| PREDICTED: primary amine oxidase-like [Musa acuminata subsp. 
malaccensis]
Length=670

 Score =   615 bits (1585),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 303/657 (46%), Positives = 422/657 (64%), Gaps = 17/657 (3%)
 Frame = -1

Query  2083  HPLDPLTIQEIERTRSILSSYQPFSGSSLRIHSLSLDEPDKSEVLRWKRGN------PLP  1922
             HPLDPLT  EI    S++ +    S  SL  H + LDEPDK ++L W  G+       LP
Sbjct  20    HPLDPLTPSEISIVSSVIKTSHFGSSKSLSFHYVGLDEPDKPDLLEWSLGHRRSKEKALP  79

Query  1921  TRKAFVVALSNGQAHLLVVDLGSGRVSSHTRNPASGYPPMSADDASTALEATFSNSVFRE  1742
              R+AFV+A S G+ H + VD+ S  V S       GYP ++ ++   A    F+   F  
Sbjct  80    PRRAFVIARSEGKTHEIYVDIASRSVVSDEVYEGFGYPMLTFEEEEAASALPFNYPPFVA  139

Query  1741  AISTRGVEINDVVCSAAAPGWFGPEEEGRRITKVKCYTAQNTPNYYMRPIEGLLLTVDLD  1562
             +++ R + + DV+C+  + GWFG  ++GRR  K+ CY   +T N+Y RP+EG+ + VDLD
Sbjct  140   SVAKRRLALEDVLCTPLSVGWFGEAKQGRRRVKIACYLTGDTVNFYARPLEGVTVVVDLD  199

Query  1561  SGKVINVYDTHSPIPIPKAQGTDYRRDGIEHRAPGVEPLKPISMEQPNGQSFRVEDGYIV  1382
             +  ++  Y+    +P+P++ GTDYR    + R P     KP ++ QP G+ F V DG+++
Sbjct  200   ALAIVE-YEDRVVVPVPESAGTDYR--AAKQRPPFGPQTKPGAVVQPEGKGFEV-DGHMI  255

Query  1381  KWASWEFHVKADQRAGIIISQATVFDPEAGKRRSVMYKGFASELFVPYMDVDEGWYFRAF  1202
             +WA+WEFH+  D RAG +IS A+V D E G  R V+++GF SELF+PYMD  E WY++ F
Sbjct  256   RWANWEFHLGFDVRAGTVISVASVKDSEVGTPRRVLHRGFVSELFIPYMDPSEEWYYKTF  315

Query  1201  MDAGEFGLGATAMELVPLNDCPRHSHYIDGLFVDPDGRPVSQPNVICVFERYSGDIAWRH  1022
              DAGE G G +A  L P  DCP ++ ++D  F   DG P   PN +CVFERY+GD +WRH
Sbjct  316   FDAGENGFGLSAAPLEPNADCPANAAFMDAHFAGRDGAPGRIPNALCVFERYAGDASWRH  375

Query  1021  SGTGDADDDLIREARPKVSLVVRTTATVGNYDYIFDWEFQTDGSIRVTVGLSGIILAKGS  842
             +  G     +I E RP VSLVVR  + VGNYDY+ DWEF+T GSI++ V L+GI+  KG+
Sbjct  376   TEFG-FPGQVITEVRPDVSLVVRMVSAVGNYDYVIDWEFKTSGSIKIGVSLTGILEVKGT  434

Query  841   PYEHINQFEIPRWDFPAGSLVSENTIGVAHDHFITFHLDMDVDGPTNSFVKVDLVKNYNI  662
              Y H +Q          G+L++ NTIGV HDHF+TFHLD+DVDGP NS V+  L      
Sbjct  435   RYTHADQIAGDE----HGTLLARNTIGVYHDHFVTFHLDLDVDGPANSIVRSKLKTVRVT  490

Query  661   AGKIQRKSYWSPKRKVAKSENDAKIKLQLDKPSEFHVINPRHQSRLGNPSGYKIVP-SAT  485
              G  +R+SYW+  ++ AK+E DA+++L  D+P E  V+NP  ++R+GN  GY+++   AT
Sbjct  491   DGSSRRRSYWTVAKETAKTEADARVELG-DEPGELLVVNPSKRTRMGNLVGYRVISHGAT  549

Query  484   AASLLDLQDPPQLRAAFTNNQIWVTPYNRSEQWAGGLFTYQSHGDDTLAVWSNRNRVIEK  305
             A SLL   D PQ+RA+++ NQ+WVT YN+SE+WA GL+T +S GDD LA WS RN  IE 
Sbjct  550   ATSLLSDDDYPQIRASYSKNQVWVTAYNKSEKWAAGLYTDESRGDDNLAAWSRRNAGIED  609

Query  304   QDIVLWYTLGFHHLPCQEDFPVMPTVTSTFQLKPVNFFDRNPIIQANPNFAEDLPIC  134
              DIVLWYT GFHH+PCQEDFP+MP ++  F+L+P NFF+ NP+I+  PN    LP C
Sbjct  610   TDIVLWYTAGFHHVPCQEDFPLMPLLSGGFELRPANFFESNPLIKTRPNGPVLLPNC  666



>gb|KHF98565.1| Primary amine oxidase [Gossypium arboreum]
Length=677

 Score =   614 bits (1584),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 306/646 (47%), Positives = 425/646 (66%), Gaps = 14/646 (2%)
 Frame = -1

Query  2083  HPLDPLTIQEIERTRSILSSYQPFSGSSLRIHSLSLDEPDKSEVLRWKRGNPL---PTRK  1913
             HPLD LT +E  R ++I++   P S ++L    + L+EPDK  VL W + +P    P R+
Sbjct  27    HPLDSLTAKEFIRVQAIVNQSHPTSTTNLTFQYIGLNEPDKQAVLSWLKNHPTTTPPPRQ  86

Query  1912  AFVVALSNGQAHLLVVDLGSGRVSSHTRNPASGYPPMSADDASTALEATFSNSVFREAIS  1733
             AFVVA  N Q H L++DL      S   +   GYP ++  +   A +   +++ F  A++
Sbjct  87    AFVVARINHQTHELIIDLSRDDTVSDRIHHGFGYPSLTFQEQIDADQLVSNHAPFLAALN  146

Query  1732  TRGVEINDVVCSAAAPGWFGPEEEGRRITKVKCYTAQNTPNYYMRPIEGLLLTVDLDSGK  1553
              RG++   VVC +   GWFG  ++  R+ K+ CY    T N YMRPIE + +TVDL++ K
Sbjct  147   KRGLKAEKVVCGSFTVGWFGETKQNGRVVKIMCYYLDGTVNLYMRPIEAITVTVDLEAMK  206

Query  1552  VINVYDTHSPIPIPKAQGTDYRRDGIEHRAPGVEPLKPISMEQPNGQSFRVEDGYIVKWA  1373
             +I+  D    +P+PKA GTDYR    + + P    LK I++ QP+G SF + DG  V+WA
Sbjct  207   IIHFQD-RLVVPVPKAAGTDYRES--KQKPPFGPELKGITVVQPDGPSFTI-DGSRVRWA  262

Query  1372  SWEFHVKADQRAGIIISQATVFDPEAGKRRSVMYKGFASELFVPYMDVDEGWYFRAFMDA  1193
             +W+FH+  D R G I+S A+++D E  + R VMY+GF SELFVPYMD+ E WY+R F DA
Sbjct  263   NWDFHLSFDARVGPIVSLASIYDTEKQEFRRVMYRGFVSELFVPYMDLTEEWYYRTFFDA  322

Query  1192  GEFGLGATAMELVPLNDCPRHSHYIDGLFVDPDGRPVSQPNVICVFERYSGDIAWRHSGT  1013
             GE+G G  A+ L PL DCP ++ Y+       +G P+  PNV C+FER +GD+ WRH+ T
Sbjct  323   GEYGYGLCAVPLEPLRDCPANAVYMGAFVAAQNGMPIEMPNVFCIFERNAGDVMWRHTET  382

Query  1012  GDADDDLIREARPKVSLVVRTTATVGNYDYIFDWEFQTDGSIRVTVGLSGIILAKGSPYE  833
                  DLI E RP +SLVVR  +TVGNYDYI DWEF+  GSI+VTVGL+G++  +GS Y 
Sbjct  383   M-IPPDLITEVRPDMSLVVRMVSTVGNYDYINDWEFKQIGSIKVTVGLTGLLEVRGSKYT  441

Query  832   HINQFEIPRWDFPAGSLVSENTIGVAHDHFITFHLDMDVDGPTNSFVKVDLVKNYNIAGK  653
             H +Q +   +    G+L++ENT+G  HDHFIT+HLD+DVDG  NSFVK  L         
Sbjct  442   HKDQIDEEVY----GTLLAENTLGTYHDHFITYHLDLDVDGEPNSFVKSKLQTVKVTDQT  497

Query  652   IQRKSYWSPKRKVAKSENDAKIKLQLDKPSEFHVINPRHQSRLGNPSGYKIVPSATAASL  473
               RKSYW    + AK+E+DAKIKL  D  +E  V+NP  ++ +GN  GY+++P + A+ L
Sbjct  498   SPRKSYWKVVSETAKTESDAKIKLGPDS-AEVLVVNPNKRTNMGNFVGYRLIPGSVASPL  556

Query  472   LDLQDPPQLRAAFTNNQIWVTPYNRSEQWAGGLFTYQSHGDDTLAVWSNRNRVIEKQDIV  293
             +   D PQ+RAAFT   +WVTPYN+SE+WAGG++T QS GDDTLA W++RNR IE +DIV
Sbjct  557   MTDDDYPQIRAAFTEYNVWVTPYNKSEKWAGGVYTDQSRGDDTLATWTSRNRRIENKDIV  616

Query  292   LWYTLGFHHLPCQEDFPVMPTVTSTFQLKPVNFFDRNPIIQAN-PN  158
             LWYTLGFHH+P QEDFP+MPT+++ F+L+P NFF+ NP+++   PN
Sbjct  617   LWYTLGFHHVPYQEDFPLMPTISTGFELRPANFFEYNPVLKVKGPN  662



>gb|KGN44255.1| Primary amine oxidase [Cucumis sativus]
Length=678

 Score =   614 bits (1583),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 305/669 (46%), Positives = 430/669 (64%), Gaps = 17/669 (3%)
 Frame = -1

Query  2155  NNLESLLGIHDFKIQNNHFADRPMHPLDPLTIQEIERTRSILSSYQPFSGSSLRIHSLSL  1976
             N +E LL      I     A    HPLDPL+  E E  RS++++  P   +++    ++L
Sbjct  7     NKMEKLLFFLPLIIPLLSVAATCRHPLDPLSSSEFEIIRSLITNSNP--STNITFQYVAL  64

Query  1975  DEPDKSEVLRWKRGNPL---PTRKAFVVALSNGQAHLLVVDLGSGRVSSHTRNPASGYPP  1805
              +P K  VL W   NP    P R+A      N   H +++DL    + S+     +GY P
Sbjct  65    ADPTKQSVLSW-LANPKTRPPPRRATATIRFNKATHEILIDLEKKTMISNRVYSGTGYAP  123

Query  1804  MSADDASTALEATFSNSVFREAISTRGVEINDVVCSAAAPGWFGPEEE-GRRITKVKCYT  1628
              + ++   A     S+  F  A+  RG+++ +VVC+  + GWFG + +  +RI KV+CY 
Sbjct  124   FTFEEQFAAAALPASHPPFVAAMKKRGLKLEEVVCACFSVGWFGEKRKVEQRIVKVQCYY  183

Query  1627  AQNTPNYYMRPIEGLLLTVDLDSGKVINVYDTHSPIPIPKAQGTDYRRDGIEHRAPGVEP  1448
                + N YMRP+EG+ +TVDLD  K+I   D +  +PIPKA GT+YR   +  + P + P
Sbjct  184   LDGSVNLYMRPVEGVTVTVDLDEMKIIGFRDRYV-VPIPKAGGTEYRESML--KPPFLPP  240

Query  1447  LKPISMEQPNGQSFRVEDGYIVKWASWEFHVKADQRAGIIISQATVFDPEAGKRRSVMYK  1268
             L  + M QP+G SF++ +G+ V WA+W FHV  D+RAG IIS A+++D +  KRR VMY+
Sbjct  241   LNGMKMVQPDGPSFQI-NGHSVSWANWNFHVSLDERAGPIISLASIYDIQKQKRRQVMYR  299

Query  1267  GFASELFVPYMDVDEGWYFRAFMDAGEFGLGATAMELVPLNDCPRHSHYIDGLFVDPDGR  1088
             GF SELFVPYMD++E WY+R F DAGE+G G  A+ L PL DCP ++ ++D      DGR
Sbjct  300   GFISELFVPYMDLNEEWYYRTFFDAGEYGFGQCAVPLQPLRDCPENAVFMDTYMAAGDGR  359

Query  1087  PVSQPNVICVFERYSGDIAWRHSGTGDADDDLIREARPKVSLVVRTTATVGNYDYIFDWE  908
             P+   N  C+FER+ GDI WRH+  G   + LIRE R ++SLVVR  A VGNYDYI DWE
Sbjct  360   PMKMSNTFCIFERHGGDIMWRHT-EGTIPNTLIRETRAEISLVVRMVAAVGNYDYIVDWE  418

Query  907   FQTDGSIRVTVGLSGIILAKGSPYEHINQFEIPRWDFPAGSLVSENTIGVAHDHFITFHL  728
             F+  GSI   VGL+G++  + S Y H +Q +   +    G L++ENTIGV HDHF+T+HL
Sbjct  419   FKQSGSIIANVGLTGLLEVRASKYTHKDQIKEEVY----GPLLAENTIGVRHDHFLTYHL  474

Query  727   DMDVDGPTNSFVKVDLVKNYNIAGKIQRKSYWSPKRKVAKSENDAKIKLQLDKPSEFHVI  548
             D+D+DG  NSF+K +L    +      R+SYW+   + AK+E DA+IK    +  E  V+
Sbjct  475   DLDIDGDANSFLKSNLRTIRSQDPDYPRRSYWTVVTETAKTEADARIKFGFQQ-DELVVV  533

Query  547   NPRHQSRLGNPSGYKIVPSATAASLLDLQDPPQLRAAFTNNQIWVTPYNRSEQWAGGLFT  368
             NP  ++R+GNP GY+++P +T + LL   D PQ+R AF+N  +WVTPYNRSE+WA GL+T
Sbjct  534   NPNQRTRMGNPVGYRLIPKSTTSPLLSADDYPQIRGAFSNYNVWVTPYNRSEKWASGLYT  593

Query  367   YQSHGDDTLAVWSNRNRVIEKQDIVLWYTLGFHHLPCQEDFPVMPTVTSTFQLKPVNFFD  188
              QSHGDDTLA WS R+R IE +DIV+WYT+GFHH+PCQEDFP+MPT++S F+L+P NFF+
Sbjct  594   DQSHGDDTLATWSLRDREIEDKDIVMWYTMGFHHVPCQEDFPLMPTLSSGFELRPTNFFE  653

Query  187   RNPIIQANP  161
              NP+++  P
Sbjct  654   SNPVLKVTP  662



>ref|XP_006419910.1| hypothetical protein CICLE_v10004473mg [Citrus clementina]
 gb|ESR33150.1| hypothetical protein CICLE_v10004473mg [Citrus clementina]
Length=678

 Score =   614 bits (1583),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 304/647 (47%), Positives = 416/647 (64%), Gaps = 17/647 (3%)
 Frame = -1

Query  2083  HPLDPLTIQEIERTRSILSSYQPFSGS-SLRIHSLSLDEPDKSEVLRWKRGNPL--PTRK  1913
             HPLD LT  E  + RSI++   P S +  L    + L+EP K  V+ W +      P R+
Sbjct  34    HPLDSLTPSEFSQIRSIVTKAYPESSTHKLTFQYVGLEEPSKQTVISWVKNETTTNPPRQ  93

Query  1912  AFVVALSNGQAHLLVVDLGSGRVSSHTRNPASGYPPMSADDASTALEATFSNSVFREAIS  1733
             AFV+A  + Q H L+VDL    ++S       GYP  + +D   A +  F+   F  +I 
Sbjct  94    AFVIARIDHQTHELIVDLSLQEIASKRIYSGYGYPMFTFEDQENADKLAFTYPPFVASIR  153

Query  1732  TRGVEINDVVCSAAAPGWFGPEEE----GRRITKVKCYTAQNTPNYYMRPIEGLLLTVDL  1565
              RG+++ +VVC + + GW+G EEE     +RI KV CY    T N +MRPIEG+ +TVDL
Sbjct  154   RRGLKLEEVVCESFSVGWYGAEEEEGKNKKRIVKVMCYYMNGTVNLFMRPIEGISMTVDL  213

Query  1564  DSGKVINVYDTHSPIPIPKAQGTDYRRDGIEHRAPGVEPLKPISMEQPNGQSFRVEDGYI  1385
             D  K+I   D    +P+PKA  T++R   I  + P  + LK I++ QP+G SF + DG++
Sbjct  214   DEMKIIGFQD-RVTVPVPKADETEFRESKI--KPPFRQSLKAITVVQPDGPSFTI-DGHM  269

Query  1384  VKWASWEFHVKADQRAGIIISQATVFDPEAGKRRSVMYKGFASELFVPYMDVDEGWYFRA  1205
             ++WA WEFH+  D RAG+IIS A+++D E  + R V+YKG  SE+FVPYMD+ E W  R 
Sbjct  270   IRWADWEFHLSFDVRAGMIISLASIYDLEKQQSRRVLYKGHVSEMFVPYMDLTEEWQRRT  329

Query  1204  FMDAGEFGLGATAMELVPLNDCPRHSHYIDGLFVDPDGRPVSQPNVICVFERYSGDIAWR  1025
             F DAGE+G G  +M L PL DCP ++ ++D  F   DG P   P   C+FERY+GDI WR
Sbjct  330   FFDAGEYGYGLCSMTLEPLRDCPPNAVFMDAYFSKQDGMPRKIPKAFCIFERYAGDIMWR  389

Query  1024  HSGTGDADDDLIREARPKVSLVVRTTATVGNYDYIFDWEFQTDGSIRVTVGLSGIILAKG  845
             H+         +RE R  VSLVVRT +T GNYDY+ DWEF+  GSI+VTVGL+G++  +G
Sbjct  390   HT-EATIPGKTVREVRQDVSLVVRTVSTFGNYDYVNDWEFKQSGSIKVTVGLTGMVQVRG  448

Query  844   SPYEHINQFEIPRWDFPAGSLVSENTIGVAHDHFITFHLDMDVDGPTNSFVKVDLVKNYN  665
             + Y H +  E   +    G+LV+EN+I + HDHF+T+ LD+DVDG  NSFVK  L     
Sbjct  449   TTYTHKDHMEEDVY----GTLVAENSIAIHHDHFLTYRLDLDVDGDANSFVKSKLRTTRV  504

Query  664   IAGKIQRKSYWSPKRKVAKSENDAKIKLQLDKPSEFHVINPRHQSRLGNPSGYKIVPSAT  485
                +  RKSYW+   K AK+E+DA+IKL   +P+E   +NP  ++++GN  GY+++P   
Sbjct  505   NDRRSSRKSYWTVDSKTAKTESDARIKLG-SEPAELLFVNPNKKTKMGNLIGYRLIPEGV  563

Query  484   AASLLDLQDPPQLRAAFTNNQIWVTPYNRSEQWAGGLFTYQSHGDDTLAVWSNRNRVIEK  305
               +LL   D PQ+RAAFTN  +WVT YN+SE+WAGGL+  QSHGDDTLAVWSNRNR IE 
Sbjct  564   TGALLSSDDHPQIRAAFTNYNVWVTAYNKSEKWAGGLYADQSHGDDTLAVWSNRNRSIEN  623

Query  304   QDIVLWYTLGFHHLPCQEDFPVMPTVTSTFQLKPVNFFDRNPIIQAN  164
             +DIVLWYTLGFHH+P QEDFPVMPT+   F+L+P NFF+ NP+++  
Sbjct  624   KDIVLWYTLGFHHVPYQEDFPVMPTLNGGFELRPSNFFESNPVLKVK  670



>emb|CDO99047.1| unnamed protein product [Coffea canephora]
Length=679

 Score =   614 bits (1583),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 304/642 (47%), Positives = 417/642 (65%), Gaps = 13/642 (2%)
 Frame = -1

Query  2086  MHPLDPLTIQEIERTRSIL-SSYQPFSGSSLRIHSLSLDEPDKSEVLRWKRGNP-LPTRK  1913
             +HPLD L+  E+ +  +IL S+    S  +L  H + L EPDK  VL W   N  +P R+
Sbjct  26    LHPLDALSTTELTQVHTILKSTICSTSCHNLSYHYVGLAEPDKPIVLAWIDDNAKVPPRQ  85

Query  1912  AFVVALSNGQAHLLVVDLGSGRVSSHTRNPASGYPPMSADDASTALEATFSNSVFREAIS  1733
             AFV+A  N Q H ++VDL +  + S+  +   GYP ++ D+ + A +  FS S F ++I 
Sbjct  86    AFVLARINQQNHEIIVDLTASAIISNKVHDGHGYPLLTLDEQTAANKLPFSYSPFIKSIE  145

Query  1732  TRGVEINDVVCSAAAPGWFGPEEEGRRITKVKCYTAQNTPNYYMRPIEGLLLTVDLDSGK  1553
              RG++  +VVC +   GWFG +++ +RI +V CY    T N YMRPIEG+ +TVDLD  K
Sbjct  146   KRGLKKEEVVCQSYTIGWFG-DKKTKRIIRVTCYYLDGTINLYMRPIEGITVTVDLDQMK  204

Query  1552  VINVYDTHSPIPIPKAQGTDYRRDGIEHRAPGVEPLKPISMEQPNGQSFRVEDGYIVKWA  1373
             +   Y   + +P+PKA GTDYR   ++ + P   P+KPI+M QP+G SF + DG+IV+WA
Sbjct  205   ITG-YQDRAIVPVPKADGTDYRE--VKQKQPVSSPIKPITMLQPHGPSFTI-DGHIVRWA  260

Query  1372  SWEFHVKADQRAGIIISQATVFDPEAGKRRSVMYKGFASELFVPYMDVDEGWYFRAFMDA  1193
              W+FH+  D R G IIS A+V D +    R V+Y+GF SELFVPYMD+ E WY+R + DA
Sbjct  261   DWKFHLAFDMRVGPIISLASVRDHDKDAYRDVLYRGFVSELFVPYMDITEEWYYRTYFDA  320

Query  1192  GEFGLGATAMELVPLNDCPRHSHYIDGLFVDPDGRPVSQPNVICVFERYSGDIAWRHSGT  1013
             GEFG G  A  L P  DCP ++ ++DG ++  +G P    NVICVFERY GD+ WRH+ T
Sbjct  321   GEFGFGLCATSLFPSKDCPENAAFLDGYYISQNGTPTKIHNVICVFERYGGDVLWRHTET  380

Query  1012  GDADDDLIREARPKVSLVVRTTATVGNYDYIFDWEFQTDGSIRVTVGLSGIILAKGSPYE  833
                   +  E RP VSLVVR  + +GNYDYI DWEF+  GSI+V +GLSG++  K S Y 
Sbjct  381   A-IPGKVYTEVRPDVSLVVRMVSIIGNYDYIVDWEFRQAGSIKVNIGLSGLLEIKASTYI  439

Query  832   HINQFEIPRWDFPAGSLVSENTIGVAHDHFITFHLDMDVDGPTNSFVKVDLVKNYNIAGK  653
             H +Q      D   G+LVS+NT+G  HDHF+ FHLD+DVDG  NSF+K  L        +
Sbjct  440   HKDQIR----DEVYGTLVSQNTVGTYHDHFLNFHLDLDVDGYDNSFIKTKLQTRRVTDKR  495

Query  652   IQRKSYWSPKRKVAKSENDAKIKLQLDKPSEFHVINPRHQSRLGNPSGYKIVPSATAASL  473
               R+SYW+   + AK+E+DA+I L     +E  V+NP  ++++GN  GY+++P +   +L
Sbjct  496   SPRRSYWTAVTETAKTESDARINLG-SGAAELLVVNPNKKTKVGNYVGYRLLPGSFVHNL  554

Query  472   LDLQDPPQLRAAFTNNQIWVTPYNRSEQWAGGLFTYQSHGDDTLAVWSNRNRVIEKQDIV  293
             L   D P +RA F    +WVTPYN+SE+WAGG F  QS GDDTLAVWS RNR IE +DIV
Sbjct  555   LTNDDYPSIRAGFAKYNVWVTPYNKSEKWAGGTFVDQSQGDDTLAVWSLRNREIENKDIV  614

Query  292   LWYTLGFHHLPCQEDFPVMPTVTSTFQLKPVNFFDRNPIIQA  167
             LWYTLG HH+P QEDFP+MPTV + F+L+P NFF+ NP+++ 
Sbjct  615   LWYTLGLHHVPIQEDFPIMPTVNNGFELRPANFFEHNPVLKV  656



>ref|XP_002278244.1| PREDICTED: primary amine oxidase [Vitis vinifera]
 emb|CBI26235.3| unnamed protein product [Vitis vinifera]
Length=674

 Score =   613 bits (1582),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 302/655 (46%), Positives = 428/655 (65%), Gaps = 17/655 (3%)
 Frame = -1

Query  2083  HPLDPLTIQEIERTRSILSSYQPFSGSSLRIHSLSLDEPDKSEVLRWKRGNP-----LPT  1919
             HPLD LT  E  + ++I++   P S  ++    + LDEPDK  +L W   NP      P 
Sbjct  28    HPLDSLTPSEFRQVQAIVNGSNPGSSHNVTFQYVGLDEPDKPALLSW-LSNPNSTTLPPP  86

Query  1918  RKAFVVALSNGQAHLLVVDLGSGRVSSHTRNPASGYPPMSADDASTALEATFSNSVFREA  1739
             R+AFV+   + Q H ++VDL +  + S       GYP +++++ + A E   +   F  +
Sbjct  87    RRAFVITRLHSQTHEIIVDLSTQSIVSDKVYSGHGYPLLTSEEQTAASELPLTYPPFIAS  146

Query  1738  ISTRGVEINDVVCSAAAPGWFGPEEEGRRITKVKCYTAQNTPNYYMRPIEGLLLTVDLDS  1559
             I  R ++++DVVCS    GWFG EE+ RR+ K+ C+    T N YMRPIEG+ + VDLD 
Sbjct  147   IRKRKLKLSDVVCSTFTVGWFG-EEKSRRVLKILCFYTDGTANLYMRPIEGVTIVVDLDE  205

Query  1558  GKVINVYDTHSPIPIPKAQGTDYRRDGIEHRAPGVEPLKPISMEQPNGQSFRVEDGYIVK  1379
              K+   +D  + +P+P+A+GT+YR    + + P    L  +S  QP+G  F++ DG+ ++
Sbjct  206   MKITEYHDRLT-VPMPEAEGTEYRLS--KQKPPFGPRLNGVSSMQPDGPGFKI-DGHNIR  261

Query  1378  WASWEFHVKADQRAGIIISQATVFDPEAGKRRSVMYKGFASELFVPYMDVDEGWYFRAFM  1199
             WA+W+FHV  D RAG+IIS A+++D +    R V+Y+G+ SELFVPYMD  E WY++ F 
Sbjct  262   WANWDFHVSFDARAGLIISLASIYDLQKRTFRRVLYRGYLSELFVPYMDPTEEWYYKTFF  321

Query  1198  DAGEFGLGATAMELVPLNDCPRHSHYIDGLFVDPDGRPVSQPNVICVFERYSGDIAWRHS  1019
             D GEFG G   + L PL DCP ++ ++DG +   DG+PV   N  C+FE+ +G I WRH+
Sbjct  322   DLGEFGFGLCTVPLQPLADCPSNAVFMDGYYAGQDGKPVKISNAFCIFEQQAGRIMWRHT  381

Query  1018  GTGDADDDLIREARPKVSLVVRTTATVGNYDYIFDWEFQTDGSIRVTVGLSGIILAKGSP  839
                +   + IRE RP+VSLVVR  ATVGNYDYI DWEF+  GSI++ VGL+GI+  KG  
Sbjct  382   EV-EIPGEEIREVRPEVSLVVRMVATVGNYDYILDWEFKPSGSIKLGVGLTGILEVKGVS  440

Query  838   YEHINQFEIPRWDFPAGSLVSENTIGVAHDHFITFHLDMDVDGPTNSFVKVDLVKNYNIA  659
             Y H +Q +   +    G+L++ NTIGV HDHF+T+HLD+DVDG  NSFVK +L       
Sbjct  441   YTHTSQIKEDVY----GTLLAHNTIGVNHDHFLTYHLDLDVDGDANSFVKANLETKRVKD  496

Query  658   GKIQRKSYWSPKRKVAKSENDAKIKLQLDKPSEFHVINPRHQSRLGNPSGYKIVPSATAA  479
                 RKSYW+   + AK+E+DA+I+L L KP+E  V+NP  +++LGN  GY+++P + ++
Sbjct  497   NISPRKSYWTVVSETAKTESDAQIQLGL-KPAELIVVNPNKKTKLGNYVGYRLIPGSLSS  555

Query  478   SLLDLQDPPQLRAAFTNNQIWVTPYNRSEQWAGGLFTYQSHGDDTLAVWSNRNRVIEKQD  299
              LL   D PQ+R AFT   +W+TPYN+SE+WAGGL+  QS GDDTLAVWS RNR IE +D
Sbjct  556   PLLSDDDYPQIRGAFTKYDVWITPYNKSEKWAGGLYMDQSRGDDTLAVWSQRNREIENKD  615

Query  298   IVLWYTLGFHHLPCQEDFPVMPTVTSTFQLKPVNFFDRNPIIQANPNFAEDLPIC  134
             IVLWYT+GFHH+PCQEDFPVMPT++  F+L+P NFF+RNP+++  P      P C
Sbjct  616   IVLWYTIGFHHVPCQEDFPVMPTLSGGFELRPTNFFERNPVLKTKPPTYGHWPNC  670



>ref|XP_004305594.1| PREDICTED: primary amine oxidase-like [Fragaria vesca subsp. 
vesca]
Length=670

 Score =   612 bits (1579),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 307/655 (47%), Positives = 424/655 (65%), Gaps = 19/655 (3%)
 Frame = -1

Query  2083  HPLDPLTIQEIERTRSILSSYQPFSGSSLRIHSLSLDEPDKSEVLRW-----KRGNPLPT  1919
             HPLDPLT  E  R R+I+    P S  +L    ++LDEPDKS V  W      +   LP 
Sbjct  28    HPLDPLTQSEFTRVRTIVRKSYPSSIHNLTFQYIALDEPDKSLVKSWLSKPKPKPKTLP-  86

Query  1918  RKAFVVALSNGQAHLLVVDLGSGRVSSHTRNPASGYPPMSADDASTALEATFSNSVFREA  1739
             R+AFV+   +  +H +VVDL +  V S       GYP ++ D+ + A E   S   F  +
Sbjct  87    RRAFVITRLDKHSHEMVVDLSTRSVVSDKVYGGHGYPLLTFDEQTVASELPLSYKPFINS  146

Query  1738  ISTRGVEINDVVCSAAAPGWFGPEEEGRRITKVKCYTAQNTPNYYMRPIEGLLLTVDLDS  1559
             +  RG  +++VVC+  + GWFG EE  +R+ KV CY  + TPN YMRP+EG+ L VDLD 
Sbjct  147   VKKRGHNLSEVVCTTFSVGWFG-EEHKKRVIKVLCYYIEGTPNLYMRPLEGISLVVDLDE  205

Query  1558  GKVINVYDTHSPIPIPKAQGTDYRRDGIEHRAPGVEPLKPISMEQPNGQSFRVEDGYIVK  1379
              K+   YD    +P+PKAQGT+YR    + + P        ++ QP+G  F++ DG+ + 
Sbjct  206   LKIAEYYD-RDRVPVPKAQGTEYRLS--KQKPPFGPRFNGFAIVQPDGPGFKI-DGHTIS  261

Query  1378  WASWEFHVKADQRAGIIISQATVFDPEAGKRRSVMYKGFASELFVPYMDVDEGWYFRAFM  1199
             WA+W FH+  D RAG +IS A++FD E    R V+Y+ F SELFVPYMD  E WY++ F 
Sbjct  262   WANWVFHLGFDVRAGPVISTASIFDVEKATYRQVLYRSFISELFVPYMDPTEEWYYKTFF  321

Query  1198  DAGEFGLGATAMELVPLNDCPRHSHYIDGLFVDPDGRPVSQPNVICVFERYSGDIAWRHS  1019
             DAGEFG G +A  L PL DCP ++ ++D  + + DG PV+  N  C+FE+++G   WRH+
Sbjct  322   DAGEFGFGQSASPLEPLTDCPENAVFMDAHYANSDGTPVNITNAFCIFEQHAGSALWRHT  381

Query  1018  GTGDADDDLIREARPKVSLVVRTTATVGNYDYIFDWEFQTDGSIRVTVGLSGIILAKGSP  839
              T       I E RP+V+L+VR  +TVGNYDY+ DWEF+  GSI+  VGL+GI+  KG+P
Sbjct  382   ETVIPG---ITEVRPEVNLIVRMVSTVGNYDYVLDWEFKPSGSIKFGVGLTGILEVKGAP  438

Query  838   YEHINQFEIPRWDFPAGSLVSENTIGVAHDHFITFHLDMDVDGPTNSFVKVDLVKNYNIA  659
             Y H +Q +   +    G+L+++ T+GV HDHF+T++LD+DVDG  NSFVK +LV      
Sbjct  439   YTHTDQIKEDAY----GTLLADYTLGVYHDHFLTYYLDLDVDGEANSFVKNNLVTKRVTD  494

Query  658   GKIQRKSYWSPKRKVAKSENDAKIKLQLDKPSEFHVINPRHQSRLGNPSGYKIVPSATAA  479
                 RKSYW+   + AK+E+DAKI+L L KP++  +INP  +++ GN  GY+++P + + 
Sbjct  495   HSSPRKSYWTVVSETAKTESDAKIQLGL-KPADLVLINPNKKTKPGNNIGYRLIPGSVSN  553

Query  478   SLLDLQDPPQLRAAFTNNQIWVTPYNRSEQWAGGLFTYQSHGDDTLAVWSNRNRVIEKQD  299
              LL   D PQ+R AFTN  +WVTPYN+SE+WAGG F  QS GDDTLA WS RNR IE +D
Sbjct  554   PLLSHDDYPQIRGAFTNYNVWVTPYNKSEKWAGGQFMDQSRGDDTLATWSLRNREIENKD  613

Query  298   IVLWYTLGFHHLPCQEDFPVMPTVTSTFQLKPVNFFDRNPIIQANPNFAEDLPIC  134
             IVLWYT+GFHH+PCQEDFPVMPT++  F+L+P NFF+ NP+++A P   E LP C
Sbjct  614   IVLWYTMGFHHVPCQEDFPVMPTLSGGFELRPTNFFESNPVLKAIPPKHEHLPNC  668



>ref|XP_006489375.1| PREDICTED: primary amine oxidase-like [Citrus sinensis]
Length=678

 Score =   613 bits (1580),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 303/647 (47%), Positives = 417/647 (64%), Gaps = 17/647 (3%)
 Frame = -1

Query  2083  HPLDPLTIQEIERTRSILSSYQPFSGS-SLRIHSLSLDEPDKSEVLRWKRGNPL--PTRK  1913
             HPLD LT  E  + RSI++   P S +  L    + L+EP K  V+ W +      P R+
Sbjct  34    HPLDSLTPSEFSQIRSIVTKAYPESSTHKLTFQYVGLEEPSKQTVISWLKNETTTNPPRQ  93

Query  1912  AFVVALSNGQAHLLVVDLGSGRVSSHTRNPASGYPPMSADDASTALEATFSNSVFREAIS  1733
             AFV+A  + Q H L+VDL    ++S       GYP  + +D   A +  F+   F  +I 
Sbjct  94    AFVIARIDHQTHELIVDLSLQEIASKRIYSGYGYPMFTFEDQENADKLAFTYPPFVASIR  153

Query  1732  TRGVEINDVVCSAAAPGWFGPEEE----GRRITKVKCYTAQNTPNYYMRPIEGLLLTVDL  1565
              RG+++ +VVC + + GW+G EEE     +RI KV CY    T N +MRPIEG+ +TVDL
Sbjct  154   RRGLKLEEVVCESFSVGWYGAEEEEGKNKKRIVKVMCYYMNGTVNLFMRPIEGISMTVDL  213

Query  1564  DSGKVINVYDTHSPIPIPKAQGTDYRRDGIEHRAPGVEPLKPISMEQPNGQSFRVEDGYI  1385
             D  K+I   D  + +P+PKA  T++R   I  + P  + LK I++ QP+G SF + DG++
Sbjct  214   DEMKIIGFQDRVT-VPVPKADETEFRESKI--KPPFRQSLKAITVVQPDGPSFTI-DGHM  269

Query  1384  VKWASWEFHVKADQRAGIIISQATVFDPEAGKRRSVMYKGFASELFVPYMDVDEGWYFRA  1205
             ++WA WEFH+  D RAG+IIS A+++D E  + R V+YKG  SE+FVPYMD+ E W  R 
Sbjct  270   IRWADWEFHLSFDVRAGMIISLASIYDLEKQQSRRVLYKGHVSEMFVPYMDLTEEWQRRT  329

Query  1204  FMDAGEFGLGATAMELVPLNDCPRHSHYIDGLFVDPDGRPVSQPNVICVFERYSGDIAWR  1025
             F DAGE+G G  +M L PL DCP ++ ++D  F   DG P   P   C+FERY+GDI WR
Sbjct  330   FFDAGEYGYGLCSMTLEPLRDCPPNAVFMDAYFSKQDGMPRKIPKAFCIFERYAGDIMWR  389

Query  1024  HSGTGDADDDLIREARPKVSLVVRTTATVGNYDYIFDWEFQTDGSIRVTVGLSGIILAKG  845
             H+         +RE R  VSLVVRT +T GNYDY+ DWEF+  GSI+VTVGL+G++  +G
Sbjct  390   HT-EATIPGKTVREVRQDVSLVVRTVSTFGNYDYVNDWEFKQSGSIKVTVGLTGMVQVRG  448

Query  844   SPYEHINQFEIPRWDFPAGSLVSENTIGVAHDHFITFHLDMDVDGPTNSFVKVDLVKNYN  665
             + Y H +  E   +    G+LV+EN+I + HDHF+T+ LD+DVDG  NSFV+  L     
Sbjct  449   TTYTHKDHMEEDVY----GTLVAENSIAIHHDHFLTYRLDLDVDGDANSFVRSKLRTTRV  504

Query  664   IAGKIQRKSYWSPKRKVAKSENDAKIKLQLDKPSEFHVINPRHQSRLGNPSGYKIVPSAT  485
                +  RKSYW+   K AK+E+DA+IKL   +P+E   +NP  ++++GN  GY+++P   
Sbjct  505   NDRRSSRKSYWTVDSKTAKTESDARIKLG-SEPAELLFVNPNKKTKMGNLIGYRLIPEGV  563

Query  484   AASLLDLQDPPQLRAAFTNNQIWVTPYNRSEQWAGGLFTYQSHGDDTLAVWSNRNRVIEK  305
               +LL   D PQ+RAAFTN  +WVT YN+SE+WAGGL+  QSHGDDTLAVWSNRNR IE 
Sbjct  564   TGALLSSDDHPQIRAAFTNYNVWVTAYNKSEKWAGGLYADQSHGDDTLAVWSNRNRSIEN  623

Query  304   QDIVLWYTLGFHHLPCQEDFPVMPTVTSTFQLKPVNFFDRNPIIQAN  164
             +DIVLWYTLGFHH+P QEDFPVMPT+   F+L+P NFF+ NP+++  
Sbjct  624   KDIVLWYTLGFHHVPYQEDFPVMPTLNGGFELRPSNFFESNPVLKVK  670



>gb|KDO74628.1| hypothetical protein CISIN_1g005872mg [Citrus sinensis]
Length=672

 Score =   612 bits (1579),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 303/647 (47%), Positives = 416/647 (64%), Gaps = 17/647 (3%)
 Frame = -1

Query  2083  HPLDPLTIQEIERTRSILSSYQPFSGS-SLRIHSLSLDEPDKSEVLRWKRGNPL--PTRK  1913
             HPLD LT  E  + RSI++   P S +  L    + L+EP K  V+ W +      P R+
Sbjct  28    HPLDSLTPSEFSQIRSIVTKAYPESSTHKLTFQYVGLEEPSKQTVISWLKNETTTNPPRQ  87

Query  1912  AFVVALSNGQAHLLVVDLGSGRVSSHTRNPASGYPPMSADDASTALEATFSNSVFREAIS  1733
             AFV+A  + Q H L+VDL    ++S       GYP  + +D   A +  F+   F  +I 
Sbjct  88    AFVIARIDHQTHELIVDLSLQEIASKRIYSGYGYPMFTFEDQENADKLAFTYPPFVASIR  147

Query  1732  TRGVEINDVVCSAAAPGWFGPEEE----GRRITKVKCYTAQNTPNYYMRPIEGLLLTVDL  1565
              RG+++ +VVC + + GW+G EEE     +RI KV CY    T N +MRPIEG+ +TVDL
Sbjct  148   RRGLKLEEVVCESFSVGWYGAEEEEGKNKKRIVKVMCYYMNGTVNLFMRPIEGISMTVDL  207

Query  1564  DSGKVINVYDTHSPIPIPKAQGTDYRRDGIEHRAPGVEPLKPISMEQPNGQSFRVEDGYI  1385
             D  K+I   D    +P+PKA  T++R   I  + P  + LK I++ QP+G SF + DG++
Sbjct  208   DEMKIIGFQD-RVTVPVPKADETEFRESKI--KPPFRQSLKAITVVQPDGPSFTI-DGHM  263

Query  1384  VKWASWEFHVKADQRAGIIISQATVFDPEAGKRRSVMYKGFASELFVPYMDVDEGWYFRA  1205
             ++WA WEFH+  D RAG+IIS A+++D E  + R V+YKG  SE+FVPYMD+ E W  R 
Sbjct  264   IRWADWEFHLSFDVRAGMIISLASIYDLEKQQSRRVLYKGHVSEMFVPYMDLTEEWQRRT  323

Query  1204  FMDAGEFGLGATAMELVPLNDCPRHSHYIDGLFVDPDGRPVSQPNVICVFERYSGDIAWR  1025
             F DAGE+G G  +M L PL DCP ++ ++D  F   DG P   P   C+FERY+GDI WR
Sbjct  324   FFDAGEYGYGLCSMTLEPLRDCPPNAVFMDAYFSKQDGMPRKIPKAFCIFERYAGDIMWR  383

Query  1024  HSGTGDADDDLIREARPKVSLVVRTTATVGNYDYIFDWEFQTDGSIRVTVGLSGIILAKG  845
             H+         +RE R  VSLVVRT +T GNYDY+ DWEF+  GSI+VTVGL+G++  +G
Sbjct  384   HT-EATIPGKTVREVRQDVSLVVRTVSTFGNYDYVNDWEFKQSGSIKVTVGLTGMVQVRG  442

Query  844   SPYEHINQFEIPRWDFPAGSLVSENTIGVAHDHFITFHLDMDVDGPTNSFVKVDLVKNYN  665
             + Y H +  E   +    G+LV+EN+I + HDHF+T+ LD+DVDG  NSFV+  L     
Sbjct  443   TTYTHKDHMEEDVY----GTLVAENSIAIHHDHFLTYRLDLDVDGDANSFVRSKLRTTRV  498

Query  664   IAGKIQRKSYWSPKRKVAKSENDAKIKLQLDKPSEFHVINPRHQSRLGNPSGYKIVPSAT  485
                +  RKSYW+   K AK+E+DA+IKL   +P+E   +NP  ++++GN  GY+++P   
Sbjct  499   NDRRSSRKSYWTVDSKTAKTESDARIKLG-SEPAELLFVNPNKKTKMGNLIGYRLIPEGV  557

Query  484   AASLLDLQDPPQLRAAFTNNQIWVTPYNRSEQWAGGLFTYQSHGDDTLAVWSNRNRVIEK  305
               +LL   D PQ+RAAFTN  +WVT YN+SE+WAGGL+  QSHGDDTLAVWSNRNR IE 
Sbjct  558   TGALLSSDDHPQIRAAFTNYNVWVTAYNKSEKWAGGLYADQSHGDDTLAVWSNRNRSIEN  617

Query  304   QDIVLWYTLGFHHLPCQEDFPVMPTVTSTFQLKPVNFFDRNPIIQAN  164
             +DIVLWYTLGFHH+P QEDFPVMPT+   F+L+P NFF+ NP+++  
Sbjct  618   KDIVLWYTLGFHHVPYQEDFPVMPTLNGGFELRPSNFFESNPVLKVK  664



>ref|XP_002314703.1| copper/topa quinone amine oxidase precursor family protein [Populus 
trichocarpa]
 gb|EEF00874.1| copper/topa quinone amine oxidase precursor family protein [Populus 
trichocarpa]
Length=673

 Score =   612 bits (1577),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 301/642 (47%), Positives = 419/642 (65%), Gaps = 12/642 (2%)
 Frame = -1

Query  2083  HPLDPLTIQEIERTRSILSSYQPFSGSSLRIHSLSLDEPDKSEVLRWKRG--NPLPTRKA  1910
             HPLD LT  E  + R+I+ S  P    +   H + L++P+K  VL W +      P R+A
Sbjct  27    HPLDSLTPAEFSKIRAIVHSSYPIPSHTTAFHYVGLEDPNKLTVLSWLKDPTTKTPPRQA  86

Query  1909  FVVALSNGQAHLLVVDLGSGRVSSHTRNPASGYPPMSADDASTALEATFSNSVFREAIST  1730
             FV+A  N   H + VDL   ++ S       GYP ++ ++   A       + F E+I  
Sbjct  87    FVIARINQTTHEITVDLTINKIVSDKLYDGYGYPLLTFEEQIAANALPLKYAPFLESIRK  146

Query  1729  RGVEINDVVCSAAAPGWFGPEEEGRRITKVKCYTAQNTPNYYMRPIEGLLLTVDLDSGKV  1550
             RG++I +VVC     GW+G E   +RI +V CY    T N YMRP+EG+ +TVDL+  K+
Sbjct  147   RGLKIEEVVCGGFTVGWYGEERRKKRIVRVMCYYLDGTVNAYMRPVEGVTVTVDLEETKI  206

Query  1549  INVYDTHSPIPIPKAQGTDYRRDGIEHRAPGVEPLKPISMEQPNGQSFRVEDGYIVKWAS  1370
             I   D  + +PIPK  GTDYR  G +   P +  LK I+M QP+G SF + DG+ ++WA+
Sbjct  207   IGFKDRLT-VPIPKGDGTDYR--GSKQNPPFLAQLKGITMVQPDGPSFTI-DGHRIRWAN  262

Query  1369  WEFHVKADQRAGIIISQATVFDPEAGKRRSVMYKGFASELFVPYMDVDEGWYFRAFMDAG  1190
             W+FH+  D RAG IIS A++FD +  K R V+YKGF SELFVPYMD+ E WY+R F DAG
Sbjct  263   WDFHLSFDSRAGPIISLASIFDLQKQKFRQVLYKGFVSELFVPYMDLTEEWYYRTFFDAG  322

Query  1189  EFGLGATAMELVPLNDCPRHSHYIDGLFVDPDGRPVSQPNVICVFERYSGDIAWRHSGTG  1010
             E+G G  A+ L P  DCP ++ ++D  F   +G PV+ P+V C+FE+Y+GDI WRH+ T 
Sbjct  323   EYGYGLCAVPLEPFRDCPENAVFMDAYFAGQNGMPVNMPDVFCIFEKYAGDITWRHTETL  382

Query  1009  DADDDLIREARPKVSLVVRTTATVGNYDYIFDWEFQTDGSIRVTVGLSGIILAKGSPYEH  830
                ++ IRE RP+V+LVVR  +TVGNYDYI DWEF+  GSI+VTVGL+G++  +GS Y H
Sbjct  383   KPGEE-IREVRPEVTLVVRMVSTVGNYDYINDWEFKQSGSIKVTVGLTGLLEVRGSVYTH  441

Query  829   INQFEIPRWDFPAGSLVSENTIGVAHDHFITFHLDMDVDGPTNSFVKVDLVKNYNIAGKI  650
              +Q +   +    G+L++ENT+G  HDHF+T+HLD+DVDG  NS VK +L          
Sbjct  442   NDQIKEEVY----GTLLAENTVGAHHDHFLTYHLDLDVDGDANSLVKSNLQMTRVADQMS  497

Query  649   QRKSYWSPKRKVAKSENDAKIKLQLDKPSEFHVINPRHQSRLGNPSGYKIVPSATAASLL  470
              RKSYW    + AK+E+DA+I+L +++ ++  V+NP  ++ LGN  GY+++P +    +L
Sbjct  498   PRKSYWRVVSETAKTESDARIRLGVEQ-ADLLVVNPNKRTDLGNSIGYRLIPGSLTHPVL  556

Query  469   DLQDPPQLRAAFTNNQIWVTPYNRSEQWAGGLFTYQSHGDDTLAVWSNRNRVIEKQDIVL  290
                D  Q+R AFT   +WVTPYN+SE+WAGGL+  QS GDDTLA WS RNR IE +DIVL
Sbjct  557   SDDDYSQIRGAFTKYNVWVTPYNKSEKWAGGLYADQSRGDDTLARWSLRNRGIENKDIVL  616

Query  289   WYTLGFHHLPCQEDFPVMPTVTSTFQLKPVNFFDRNPIIQAN  164
             WYTLGFHH+P QEDFPVMPT++S F+L+P NFF+ NP+++  
Sbjct  617   WYTLGFHHVPYQEDFPVMPTISSGFELRPANFFESNPVLKVK  658



>ref|XP_008449548.1| PREDICTED: primary amine oxidase-like [Cucumis melo]
Length=668

 Score =   610 bits (1574),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 298/645 (46%), Positives = 418/645 (65%), Gaps = 15/645 (2%)
 Frame = -1

Query  2083  HPLDPLTIQEIERTRSILSSYQPFSGSSLRIHSLSLDEPDKSEVLRWKRG--NPLPTRKA  1910
             HPLD L+  E E TRS++++  P   +++    ++L +P K  VL W      P P R+A
Sbjct  25    HPLDSLSPNEFELTRSLITNSNP--STNITFQYVALADPTKQSVLSWLSNPKTPPPPRRA  82

Query  1909  FVVALSNGQAHLLVVDLGSGRVSSHTRNPASGYPPMSADDASTALEATFSNSVFREAIST  1730
               +   N   H +++DL    + S       GY P + ++   A     S+  F  A+  
Sbjct  83    TAIVRFNKATHEILIDLVKKTILSDQVYSGPGYAPFTFEEQFAAAALPLSHPPFAAAVKK  142

Query  1729  RGVEINDVVCSAAAPGWFGPEEE-GRRITKVKCYTAQNTPNYYMRPIEGLLLTVDLDSGK  1553
             RG++I  VVC   + GWFG E +  +RI KV+C+    + NYYMRP+EG+++ VDLD  K
Sbjct  143   RGLKIEKVVCVCFSVGWFGEERKMEKRIVKVQCFYLDGSLNYYMRPVEGVIVIVDLDEMK  202

Query  1552  VINVYDTHSPIPIPKAQGTDYRRDGIEHRAPGVEPLKPISMEQPNGQSFRVEDGYIVKWA  1373
             ++  +D +  +P+PKA GT+YR   +  + P + PL  I M QP+G SF++ DG  + WA
Sbjct  203   IVGFHDRYR-VPMPKASGTEYRPSKL--KPPFLPPLNGIKMLQPDGPSFKI-DGQSISWA  258

Query  1372  SWEFHVKADQRAGIIISQATVFDPEAGKRRSVMYKGFASELFVPYMDVDEGWYFRAFMDA  1193
             +W FH+  D+RAG IIS A+++D E  KRR VMY+GF SELFVPYMD++E WY+R F DA
Sbjct  259   NWNFHLSLDERAGPIISLASIYDLEKQKRRQVMYRGFISELFVPYMDLNEEWYYRTFFDA  318

Query  1192  GEFGLGATAMELVPLNDCPRHSHYIDGLFVDPDGRPVSQPNVICVFERYSGDIAWRHS-G  1016
             GE+ LG  A+ L PL DCP ++ ++D      DGRP+   N  C+FER++GDI WRH+ G
Sbjct  319   GEYALGQCAVSLQPLRDCPENAVFMDTYTAAGDGRPMKMSNTFCIFERHAGDIMWRHTEG  378

Query  1015  TGDADDDLIREARPKVSLVVRTTATVGNYDYIFDWEFQTDGSIRVTVGLSGIILAKGSPY  836
               +  +  I E R ++SLVVR  ATV NYDYI DWEF+  GSI V +GL+G++  K S Y
Sbjct  379   NKNVPNTPITETRAEMSLVVRMVATVANYDYILDWEFKQSGSIVVDIGLTGLLAVKASKY  438

Query  835   EHINQFEIPRWDFPAGSLVSENTIGVAHDHFITFHLDMDVDGPTNSFVKVDLVKNYNIAG  656
              H +Q +   +    G L++ENTIGV HDHF+TFHLD+D+DG  NS VK +L    +   
Sbjct  439   THNDQIKEEVY----GPLLAENTIGVHHDHFVTFHLDLDMDGIANSAVKSNLRTVRSRDA  494

Query  655   KIQRKSYWSPKRKVAKSENDAKIKLQLDKPSEFHVINPRHQSRLGNPSGYKIVPSATAAS  476
                R SYW+   + AK+E DA IKL+ ++  EF ++NP  ++++GNP GY+++P + A  
Sbjct  495   NSPRLSYWTVIAETAKTEADAMIKLR-NQELEFSIVNPNQKTKMGNPVGYRLIPRSMAGP  553

Query  475   LLDLQDPPQLRAAFTNNQIWVTPYNRSEQWAGGLFTYQSHGDDTLAVWSNRNRVIEKQDI  296
             LL   D PQ R AFTNN +WVTPYN SE+WA GLFT QSHGDDTLA W+ RNR IE +DI
Sbjct  554   LLSPDDYPQRRGAFTNNDVWVTPYNSSEKWASGLFTDQSHGDDTLATWTLRNRKIENRDI  613

Query  295   VLWYTLGFHHLPCQEDFPVMPTVTSTFQLKPVNFFDRNPIIQANP  161
             V+WYT+GFHH+PCQED+P+MPT+   F+L+P NFF+ NP+++  P
Sbjct  614   VMWYTMGFHHVPCQEDYPLMPTLRRGFELRPTNFFESNPVLKVTP  658



>ref|XP_004159052.1| PREDICTED: LOW QUALITY PROTEIN: primary amine oxidase-like [Cucumis 
sativus]
Length=678

 Score =   610 bits (1573),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 304/669 (45%), Positives = 429/669 (64%), Gaps = 17/669 (3%)
 Frame = -1

Query  2155  NNLESLLGIHDFKIQNNHFADRPMHPLDPLTIQEIERTRSILSSYQPFSGSSLRIHSLSL  1976
             N +E LL      I     A    HPLDPL+  E E  RS++++  P   +++    ++L
Sbjct  7     NKMEKLLFFLPLIIPLLSVAATCRHPLDPLSSSEFEIIRSLITNSNP--STNITFQYVAL  64

Query  1975  DEPDKSEVLRWKRGNPL---PTRKAFVVALSNGQAHLLVVDLGSGRVSSHTRNPASGYPP  1805
              +P K  VL W   NP    P R+A      N   H +++DL    + S+     +GY P
Sbjct  65    ADPTKQSVLSW-LANPKTRPPPRRATATIRFNKATHEILIDLEXKTMISNRVYSGTGYAP  123

Query  1804  MSADDASTALEATFSNSVFREAISTRGVEINDVVCSAAAPGWFGPEEE-GRRITKVKCYT  1628
              + ++   A     S+  F  A+  RG+++ +VVC+  + GWFG + +  +RI KV+C  
Sbjct  124   FTFEEQFAAAALPASHPPFVAAMXKRGLKLEEVVCACFSVGWFGEKRKVEQRIVKVQCNY  183

Query  1627  AQNTPNYYMRPIEGLLLTVDLDSGKVINVYDTHSPIPIPKAQGTDYRRDGIEHRAPGVEP  1448
                + N YMRP+EG+ +TVDLD  K+I   D +  +PIPKA GT+YR   +  + P + P
Sbjct  184   LDGSVNLYMRPVEGVTVTVDLDEMKIIGFRDRYV-VPIPKAGGTEYRESML--KPPFLPP  240

Query  1447  LKPISMEQPNGQSFRVEDGYIVKWASWEFHVKADQRAGIIISQATVFDPEAGKRRSVMYK  1268
             L  + M QP+G SF++ +G+ V WA+W FHV  D+RAG IIS A+++D +  KRR VMY+
Sbjct  241   LNGMKMVQPDGPSFQI-NGHSVSWANWNFHVSLDERAGPIISLASIYDIQKQKRRQVMYR  299

Query  1267  GFASELFVPYMDVDEGWYFRAFMDAGEFGLGATAMELVPLNDCPRHSHYIDGLFVDPDGR  1088
             GF SELFVPYMD++E WY+R F DAGE+G G  A+ L PL DCP ++ ++D      DGR
Sbjct  300   GFISELFVPYMDLNEEWYYRTFFDAGEYGFGQCAVPLQPLRDCPENAVFMDTYMAAGDGR  359

Query  1087  PVSQPNVICVFERYSGDIAWRHSGTGDADDDLIREARPKVSLVVRTTATVGNYDYIFDWE  908
             P+   N  C+FER+ GDI WRH+  G   + LIRE R ++SLVVR  A VGNYDYI DWE
Sbjct  360   PMKMSNTFCIFERHGGDIMWRHT-EGTIPNTLIRETRAEISLVVRMVAAVGNYDYIVDWE  418

Query  907   FQTDGSIRVTVGLSGIILAKGSPYEHINQFEIPRWDFPAGSLVSENTIGVAHDHFITFHL  728
             F+  GSI   VGL+G++  + S Y H +Q +   +    G L++ENTIGV HDHF+T+HL
Sbjct  419   FKQSGSIIANVGLTGLLEVRASKYTHKDQIKEEVY----GPLLAENTIGVRHDHFLTYHL  474

Query  727   DMDVDGPTNSFVKVDLVKNYNIAGKIQRKSYWSPKRKVAKSENDAKIKLQLDKPSEFHVI  548
             D+D+DG  NSF+K +L    +      R+SYW+   + AK+E DA+IK    +  E  V+
Sbjct  475   DLDIDGDANSFLKSNLRTIRSQDPDYPRRSYWTVVTETAKTEADARIKFGFQQ-DELVVV  533

Query  547   NPRHQSRLGNPSGYKIVPSATAASLLDLQDPPQLRAAFTNNQIWVTPYNRSEQWAGGLFT  368
             NP  ++R+GNP GY+++P +T + LL   D PQ+R AF+N  +WVTPYNRSE+WA GL+T
Sbjct  534   NPNQRTRMGNPVGYRLIPKSTTSPLLSADDYPQIRGAFSNYNVWVTPYNRSEKWASGLYT  593

Query  367   YQSHGDDTLAVWSNRNRVIEKQDIVLWYTLGFHHLPCQEDFPVMPTVTSTFQLKPVNFFD  188
              QSHGDDTLA WS R+R IE +DIV+WYT+GFHH+PCQEDFP+MPT++S F+L+P NFF+
Sbjct  594   DQSHGDDTLATWSLRDREIEDKDIVMWYTMGFHHVPCQEDFPLMPTLSSGFELRPTNFFE  653

Query  187   RNPIIQANP  161
              NP+++  P
Sbjct  654   SNPVLKVTP  662



>ref|XP_002516782.1| Amine oxidase [copper-containing] precursor, putative [Ricinus 
communis]
 gb|EEF45396.1| Amine oxidase [copper-containing] precursor, putative [Ricinus 
communis]
Length=689

 Score =   609 bits (1571),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 301/644 (47%), Positives = 423/644 (66%), Gaps = 14/644 (2%)
 Frame = -1

Query  2083  HPLDPLTIQEIERTRSILSSYQPFSGSSLRIHSLSLDEPDKSEVLRWKRGNPL---PTRK  1913
             HPLDPLT +E+   +SIL    P S  +L  H + L EP K  ++ W + NP    P R+
Sbjct  38    HPLDPLTPKELTLIQSILQYAYPNSSHTLAFHYVGLQEPPKPLIISWVQ-NPSTRDPPRQ  96

Query  1912  AFVVALSNGQAHLLVVDLGSGRVSSHTRNPASGYPPMSADDASTALEATFSNSVFREAIS  1733
             +FV+A  +   H ++VDL   ++ S       GYP ++ ++ + A       + F E+++
Sbjct  97    SFVIARIDQSTHEIIVDLSLNKIISDQVYDGYGYPILTLEELNAAHSLPLVYAPFLESVN  156

Query  1732  TRGVEINDVVCSAAAPGWFGPEEEGRRITKVKCYTAQNTPNYYMRPIEGLLLTVDLDSGK  1553
              RG++I +VVC + + GW+G  +  +R  KV CY    T N YMRP+EG+ +TVDL+  K
Sbjct  157   RRGLKIKEVVCGSLSIGWYGEVKMKKRTVKVTCYYLDGTVNLYMRPVEGVTMTVDLEDMK  216

Query  1552  VINVYDTHSPIPIPKAQGTDYRRDGIEHRAPGVEPLKPISMEQPNGQSFRVEDGYIVKWA  1373
             +I   D  + +P+PKA GTDYR    +H  P V+ LK I++ QP+G SF + DG+ V+WA
Sbjct  217   IIGFNDRLT-VPMPKADGTDYRETKQKH--PSVQSLKGITVVQPDGPSFTI-DGHRVRWA  272

Query  1372  SWEFHVKADQRAGIIISQATVFDPEAGKRRSVMYKGFASELFVPYMDVDEGWYFRAFMDA  1193
             +W FHV  DQRAG IIS A+++D +  K R V+YKGF SELFVPYMD++E WY+R F D 
Sbjct  273   NWNFHVSFDQRAGPIISLASIYDVKRQKFRQVLYKGFVSELFVPYMDLNEEWYYRTFFDV  332

Query  1192  GEFGLGATAMELVPLNDCPRHSHYIDGLFVDPDGRPVSQPNVICVFERYSGDIAWRHSGT  1013
             GE+G G   + L PL DCP ++ ++D  + + +G PV   N+ C++E+ +G I WRH+ T
Sbjct  333   GEYGYGMRGVPLEPLRDCPENAIFMDAYYANQNGIPVKMTNIFCIYEKLAGGIMWRHTET  392

Query  1012  GDADDDLIREARPKVSLVVRTTATVGNYDYIFDWEFQTDGSIRVTVGLSGIILAKGSPYE  833
                   + RE RP++SLVVR  +TVGNYDYI DWEF   GSI+VTVGL+G++  +G+ Y 
Sbjct  393   S-IPGKVEREVRPEISLVVRMVSTVGNYDYINDWEFLQSGSIKVTVGLTGLLGVRGTAYA  451

Query  832   HINQFEIPRWDFPAGSLVSENTIGVAHDHFITFHLDMDVDGPTNSFVKVDLVKNYNIAGK  653
             H +Q     +    G+L++ENT+G  HDHF+T+HLD+DVDG  NSFVK  L K      K
Sbjct  452   HKDQIHEEVY----GTLLAENTMGAHHDHFVTYHLDLDVDGDANSFVKSKLQKTRVANDK  507

Query  652   IQRKSYWSPKRKVAKSENDAKIKLQLDKPSEFHVINPRHQSRLGNPSGYKIVPSATAASL  473
               RKSYW    + AK+E+DAKIKL L++ ++  V+NP  ++ +GN  GY+++P + A  L
Sbjct  508   SPRKSYWRVVSETAKTESDAKIKLGLEQ-ADLLVVNPNKRTNMGNFIGYRLIPGSVAGPL  566

Query  472   LDLQDPPQLRAAFTNNQIWVTPYNRSEQWAGGLFTYQSHGDDTLAVWSNRNRVIEKQDIV  293
             L   D PQ+R AFT   +WVTPYN+SE+WA GL+  QS GDDTLA W+ R+R IE +DIV
Sbjct  567   LSEDDYPQIRGAFTEYNVWVTPYNKSEKWASGLYVDQSRGDDTLATWTLRDRKIENKDIV  626

Query  292   LWYTLGFHHLPCQEDFPVMPTVTSTFQLKPVNFFDRNPIIQANP  161
             LWYTLGFHH+P QEDFPVMPT++S F+L+P NFF+ NP +   P
Sbjct  627   LWYTLGFHHVPYQEDFPVMPTLSSGFELRPANFFESNPALNVIP  670



>emb|CDO99048.1| unnamed protein product [Coffea canephora]
Length=700

 Score =   608 bits (1567),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 295/648 (46%), Positives = 423/648 (65%), Gaps = 15/648 (2%)
 Frame = -1

Query  2098  ADRPMHPLDPLTIQEIERTRSILS-SYQPFSGSSLRIHSLSLDEPDKSEVLRW---KRGN  1931
             +D  +HPLD LT  E+ + ++I++ S    S  SL  H + L EPDK  VL W   K   
Sbjct  37    SDHEIHPLDSLTASELTQVQTIVNNSICSTSCQSLSFHYVGLHEPDKPIVLSWLSDKDST  96

Query  1930  PLPTRKAFVVALSNGQAHLLVVDLGSGRVSSHTRNPASGYPPMSADDASTALEATFSNSV  1751
              +P R+AFV+A  N + H L+VDL +  + S+  +   GYP ++  + S A     + + 
Sbjct  97    KVPPRQAFVLARINFKNHELIVDLNASAIISNKVHDGHGYPLLNFAEQSAANRLPLTYAP  156

Query  1750  FREAISTRGVEINDVVCSAAAPGWFGPEEEGRRITKVKCYTAQNTPNYYMRPIEGLLLTV  1571
             F  +I  RG+++ +V+C +   GWFG E++ +RI +  CY    T N YMRPIEG+ LTV
Sbjct  157   FIASIKKRGLKLEEVICQSFTIGWFG-EQKTKRIVREMCYYLDGTINLYMRPIEGITLTV  215

Query  1570  DLDSGKVINVYDTHSPIPIPKAQGTDYRRDGIEHRAPGVEPLKPISMEQPNGQSFRVEDG  1391
             DLD  K+I  Y     +P+PKA+GTDYR   ++ + P   P+KPI+M QP+G SF +E G
Sbjct  216   DLDEMKIIG-YRDRLIVPVPKAEGTDYRE--VKQKQPVSSPIKPITMLQPHGPSFNIE-G  271

Query  1390  YIVKWASWEFHVKADQRAGIIISQATVFDPEAGKRRSVMYKGFASELFVPYMDVDEGWYF  1211
             ++V WA W+FH+  D R G I+S A+++D E  + RSVMY+GF SELFVPYMD+ E WY+
Sbjct  272   HVVSWADWKFHLDFDMRVGPILSLASIYDLEKDESRSVMYRGFISELFVPYMDLTEEWYY  331

Query  1210  RAFMDAGEFGLGATAMELVPLNDCPRHSHYIDGLFVDPDGRPVSQPNVICVFERYSGDIA  1031
             R + D+GE+G G  A  L+P +DCP ++ + DG  +  DG P   PN+IC+FERY+GDI 
Sbjct  332   RTYFDSGEYGFGLCAAPLLPSSDCPENAVFFDGYSMSQDGTPRKLPNIICIFERYAGDIL  391

Query  1030  WRHSGTGDADDDLIREARPKVSLVVRTTATVGNYDYIFDWEFQTDGSIRVTVGLSGIILA  851
             WRH+  G     +  E RP+VSL+VR  + VGNYDYI DWEF+  G+I+V +GL+G++  
Sbjct  392   WRHT-EGAIPGKVFTEVRPEVSLIVRMVSAVGNYDYIVDWEFRQTGTIKVNIGLTGLLEV  450

Query  850   KGSPYEHINQFEIPRWDFPAGSLVSENTIGVAHDHFITFHLDMDVDGPTNSFVKVDLVKN  671
             +   Y + +Q     +    G+L++ENT+G  HDHF+ FHLD+DVD P NSFVK  L   
Sbjct  451   RAEAYTYKDQIGEEVY----GTLLAENTLGSYHDHFLNFHLDLDVDNPANSFVKTKLQTT  506

Query  670   YNIAGKIQRKSYWSPKRKVAKSENDAKIKLQLDKPSEFHVINPRHQSRLGNPSGYKIVPS  491
               +  +  R+SYW+   + +K+E+DA+I L     +E  V+NP  ++ +GN  GY+++P 
Sbjct  507   AVMDKRSPRRSYWTVVSETSKTESDARINLG-SGAAELLVVNPNKKTEMGNYVGYRLLPG  565

Query  490   ATAASLLDLQDPPQLRAAFTNNQIWVTPYNRSEQWAGGLFTYQSHGDDTLAVWSNRNRVI  311
             +   +LL   D P++RA FT   +WVTPYN+SE+WAGG +  QS GDD LAVWS RNR I
Sbjct  566   SVVNTLLSDDDYPEVRAGFTKYNVWVTPYNKSEKWAGGTYADQSRGDDNLAVWSLRNREI  625

Query  310   EKQDIVLWYTLGFHHLPCQEDFPVMPTVTSTFQLKPVNFFDRNPIIQA  167
             E +DIV+WYTLGFHH+P QEDFPVMPT+ + F+L+P NFF+ NP+++ 
Sbjct  626   ENKDIVIWYTLGFHHVPYQEDFPVMPTINNGFELRPTNFFEHNPVLKV  673



>ref|XP_010935528.1| PREDICTED: primary amine oxidase [Elaeis guineensis]
Length=667

 Score =   605 bits (1560),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 292/652 (45%), Positives = 423/652 (65%), Gaps = 11/652 (2%)
 Frame = -1

Query  2086  MHPLDPLTIQEIERTRSILSSYQPFSGSSLRIHSLSLDEPDKSEVLRWKRGNPLPTRKAF  1907
             +HPLDPLT  EI   R I+ +    S  SL    + LDEPDK EV  W  G+  P R+AF
Sbjct  22    LHPLDPLTPSEISTIRRIIKNSSLGSSKSLTFQYVGLDEPDKPEVFSWLSGHAAPPRRAF  81

Query  1906  VVALSNGQAHLLVVDLGSGRVSSHTRNPASGYPPMSADDASTALEATFSNSVFREAISTR  1727
             V+A S+ Q H + VD+ +  ++S       GYP ++ ++   A         F E++  R
Sbjct  82    VIARSDRQTHEIYVDITNHSIASDKVYNGFGYPMLNLEEQGEASALPLKYEPFIESVKKR  141

Query  1726  GVEINDVVCSAAAPGWFGPEEEGRRITKVKCYTAQNTPNYYMRPIEGLLLTVDLDSGKVI  1547
             G ++ DVVC+  + GWFG  ++G+R+ K+ C+   +T N+Y RP+EG+ + VDLD+ +++
Sbjct  142   GEDLKDVVCTTFSVGWFGEVKQGKRLLKILCFMEGDTVNFYARPLEGITVVVDLDAMEIV  201

Query  1546  NVYDTHSPIPIPKAQGTDYRRDGIEHRAPGVEPLKPISMEQPNGQSFRVEDGYIVKWASW  1367
                D  S +P+PK+ GTDYR    + + P     KP  + QP G+ F + DG+ ++WA+W
Sbjct  202   EYEDRFS-VPVPKSVGTDYRAS--KQKPPFGPKTKPGVVVQPEGKGFEI-DGHTIRWANW  257

Query  1366  EFHVKADQRAGIIISQATVFDPEAGKRRSVMYKGFASELFVPYMDVDEGWYFRAFMDAGE  1187
              FH+  D RAG IIS A++ + +    R V+Y+G+ SELFVPYMD  E WY++ F DAGE
Sbjct  258   AFHLSYDVRAGSIISLASIQENDNETHRRVLYRGYVSELFVPYMDPSEEWYYKTFFDAGE  317

Query  1186  FGLGATAMELVPLNDCPRHSHYIDGLFVDPDGRPVSQPNVICVFERYSGDIAWRHSGTGD  1007
             FG G +   L P+ DCP ++ ++D  F   DG P+   N +CVFERY+GD +WRH+ T +
Sbjct  318   FGFGLSMSSLEPMADCPSNAAFMDVYFAHQDGEPIPIKNALCVFERYAGDASWRHTET-E  376

Query  1006  ADDDLIREARPKVSLVVRTTATVGNYDYIFDWEFQTDGSIRVTVGLSGIILAKGSPYEHI  827
                ++I E R  VSLVVR  +TVGNYDY+ DWEF+TDGSIR+ V L+GI+  + +P+ H+
Sbjct  377   IPKEVITEVRQDVSLVVRMVSTVGNYDYVIDWEFKTDGSIRLGVSLTGILEVRAAPFTHV  436

Query  826   NQFEIPRWDFPAGSLVSENTIGVAHDHFITFHLDMDVDGPTNSFVKVDLVKNYNIAGKIQ  647
             +Q      +   G+L++ENTIGV HDHFIT +LD+D+DG  NSF+K  L       G+  
Sbjct  437   DQI----INDEHGTLIAENTIGVYHDHFITSYLDLDIDGSNNSFIKSKLKTVRVTDGETP  492

Query  646   RKSYWSPKRKVAKSENDAKIKLQLDKPSEFHVINPRHQSRLGNPSGYKIVPS-ATAASLL  470
             RKSYW+  ++ AK+E DA+I +   + +E  ++NP  +++LGN  GY+++ + ATAASLL
Sbjct  493   RKSYWTIIKETAKTEADARIDIG-SESAELLIVNPNKKTKLGNSVGYRLISNGATAASLL  551

Query  469   DLQDPPQLRAAFTNNQIWVTPYNRSEQWAGGLFTYQSHGDDTLAVWSNRNRVIEKQDIVL  290
                D PQ+RA+++  Q+WVT YN+SE+WA GL+  +S G+D LAVWS RNRVIE  DIVL
Sbjct  552   TDDDYPQIRASYSKKQVWVTAYNKSEKWAAGLYADESRGNDNLAVWSQRNRVIEDTDIVL  611

Query  289   WYTLGFHHLPCQEDFPVMPTVTSTFQLKPVNFFDRNPIIQANPNFAEDLPIC  134
             WYT+GFHH+P QEDFP+MP ++   +L+P NFF+ NP+I+  PN     P C
Sbjct  612   WYTVGFHHIPYQEDFPLMPMLSGGLELRPSNFFESNPLIKTKPNKHFQWPNC  663



>dbj|BAJ94038.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=703

 Score =   606 bits (1562),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 305/662 (46%), Positives = 430/662 (65%), Gaps = 23/662 (3%)
 Frame = -1

Query  2083  HPLDPLTIQEIERTRSILSSYQPFSGSSLRIHSLSLDEPDKSEVLRWKRGNPLPT-----  1919
             HP DPL+  E+   R  + +        L  H + LDEPDK +VL +  GN   +     
Sbjct  44    HPFDPLSPAELTAVRDAVLASPLVPARPLTFHYVGLDEPDKPDVLFYAYGNSTSSSRAAL  103

Query  1918  -RKAFVVALSNGQAHLLVVDLGSG---RVSSHTRNPASGYPPMSADDASTALEATFSNSV  1751
              R+AFV+A + G++H L VD+ +     V +H  +  +G+P ++ ++   A+    ++  
Sbjct  104   PRRAFVIARAGGESHELRVDVTNAAAPSVLAHAIHHGAGFPILTLEEQFAAVALPPAHPP  163

Query  1750  FREAISTRGVEINDVVCSAAAPGWFG--PEEEGRRITKVKCYTAQNTPNYYMRPIEGLLL  1577
             F E++  RGV++ DV+C+A   GWFG  P EE RR+ K+ C+ A  T N+Y RP+EG+ L
Sbjct  164   FIESVRRRGVDMADVLCAAFPVGWFGDLPGEE-RRVVKLLCFVAGATANFYARPLEGVTL  222

Query  1576  TVDLDSGKVINVYDTHSPIPIPKAQGTDYRRDGIEHRAPGVEPLKPISMEQPNGQSFRVE  1397
              VDLD   ++   D    +P+PKA+GTDYR         G  P  P  + QP G+ F++ 
Sbjct  223   VVDLDRMAIVGYMDK-VVVPVPKAKGTDYRTGKTGPPYAGRTP-APGVVVQPEGRGFQI-  279

Query  1396  DGYIVKWASWEFHVKADQRAGIIISQATVFDPEAGKRRSVMYKGFASELFVPYMDVDEGW  1217
             DG+ V+WA+WEFHV  D RAG +IS AT+ D EAG RR V+Y+GF SE+FVPYMD  E W
Sbjct  280   DGHFVRWANWEFHVGFDMRAGTVISLATIHDAEAGGRRRVLYRGFVSEVFVPYMDPAEEW  339

Query  1216  YFRAFMDAGEFGLGATAMELVPLNDCPRHSHYIDGLFVDPDGRPVSQPNVICVFERYSGD  1037
             Y+R F+DAGE+GLG +A  L P  DCP ++ Y+DG +   DG+PV + N+ICVFERY+GD
Sbjct  340   YYRTFLDAGEYGLGLSAFPLQPGADCPANAAYLDGYYAGQDGKPVEKKNIICVFERYAGD  399

Query  1036  IAWRHSGTGDADDDLIREARPKVSLVVRTTATVGNYDYIFDWEFQTDGSIRVTVGLSGII  857
             +AWRH+  G   D LI E RP VSLVVR   + GNYDYI DWEF+T GSI+ TV L+G++
Sbjct  400   VAWRHTEAG-FPDRLITEVRPDVSLVVRMVVSSGNYDYILDWEFKTSGSIKFTVSLTGLL  458

Query  856   LAKGSPYEHINQFEIPRWDFPAGSLVSENTIGVAHDHFITFHLDMDVDGPTNSFVKVDLV  677
               KG+ Y H +Q      +   G+LV+ENT+ V HDH+IT+HLD+DVDG  NSFVK  + 
Sbjct  459   EVKGTAYTHADQIT----EDAHGTLVAENTLAVYHDHYITYHLDLDVDGTNNSFVKNTIA  514

Query  676   KNYNIAGKIQRKSYWSPKRKVAKSENDAKIKLQLDKPSEFHVINPRHQSRLGNPSGYKIV  497
                N+AG   R+SYW+ +R VA++E DA++ +    P++  V+NP  ++R+GN  GY+++
Sbjct  515   TKRNVAGT-PRRSYWTVRRDVAETEADAQVDVNA-APADLLVVNPNKRTRMGNEVGYRVI  572

Query  496   P-SATAASLLDLQDPPQLRAAFTNNQIWVTPYNRSEQWAGGLFTYQSHGDDTLAVWSNRN  320
             P  ATAAS+LD  D PQ RA++   Q+ VTPY ++E+WA GL+  QS GDD L  WS +N
Sbjct  573   PGGATAASVLDDDDYPQRRASYCKKQVRVTPYRKAEKWAPGLYADQSTGDDGLVAWSEKN  632

Query  319   RVIEKQDIVLWYTLGFHHLPCQEDFPVMPTVTSTFQLKPVNFFDRNPIIQANPNFAEDLP  140
             R +  +DIVLWYT+G HH+P Q+DFPVMPTV+  F+L+P NFF+RNP++   P   +  P
Sbjct  633   RAVRNEDIVLWYTVGIHHIPYQDDFPVMPTVSGGFELRPANFFERNPLLTTRPPGLDQPP  692

Query  139   IC  134
             + 
Sbjct  693   LV  694



>ref|XP_010026970.1| PREDICTED: primary amine oxidase-like [Eucalyptus grandis]
Length=687

 Score =   605 bits (1560),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 305/655 (47%), Positives = 418/655 (64%), Gaps = 16/655 (2%)
 Frame = -1

Query  2083  HPLDPLTIQEIERTRSILSSYQPFSG-SSLRIHSLSLDEPDKSEVLRWKRGNPLPT---R  1916
             HPLDPLT  E+E  R+I S   P S   +L  H + LDEPDK  +L W     L     R
Sbjct  38    HPLDPLTPSELELARAIASDSFPGSPPRNLTFHYVGLDEPDKPLLLSWLSAPSLSPPPPR  97

Query  1915  KAFVVALSNGQAHLLVVDLGSGRVSSHTRNPASGYPPMSADDASTALEATFSNSVFREAI  1736
             +A V+  ++ + H L VDL +GRV S   +   G+P ++  + + +      +  F E++
Sbjct  98    RALVIVRADKRTHELTVDLSAGRVDSARVHTGHGFPILTFAELAASSSLARQHPPFLESM  157

Query  1735  STRGVEINDVVCSAAAPGWFGPE-EEGRRITKVKCYTAQNTPNYYMRPIEGLLLTVDLDS  1559
               RG++  ++VC +   GW+G E  +  R  KV CY    T N YMRP+EG+ +TVDLD 
Sbjct  158   RKRGLKAEEIVCGSFTVGWYGQEARKVGRTVKVMCYYLDGTVNLYMRPVEGVTVTVDLDE  217

Query  1558  GKVINVYDTHSPIPIPKAQGTDYRRDGIEHRAPGVEPLKPISMEQPNGQSFRVEDGYIVK  1379
              +++   D    +P+PKA GTDY     E   P    LK I + QP G SF V DG++++
Sbjct  218   MRIVGFMD-RVRVPVPKADGTDYSGSN-ERVGPA---LKRIGVVQPEGPSFTV-DGHMIR  271

Query  1378  WASWEFHVKADQRAGIIISQATVFDPEAGKRRSVMYKGFASELFVPYMDVDEGWYFRAFM  1199
             WA+WEFH+  D RAG IIS A+++D +  K R VMY+GF SELFVPYMD+ E WY+R F 
Sbjct  272   WANWEFHLSFDVRAGPIISLASIYDAQKQKFRQVMYRGFISELFVPYMDLTEEWYYRTFF  331

Query  1198  DAGEFGLGATAMELVPLNDCPRHSHYIDGLFVDPDGRPVSQPNVICVFERYSGDIAWRHS  1019
             DAG++G G  A++L PL DCP ++ ++D     PDG+P+   NV CVFERY+GDI WRH+
Sbjct  332   DAGDYGFGLCAVQLEPLRDCPENAVFMDAYIAGPDGKPIKMSNVFCVFERYAGDIMWRHT  391

Query  1018  GTGDADDDLIREARPKVSLVVRTTATVGNYDYIFDWEFQTDGSIRVTVGLSGIILAKGSP  839
               G     +IRE RP+V+LVVR  +TVGNYDYI DWEF+  GSI+ TVGL+G++  +GS 
Sbjct  392   ELG-IPGKVIREVRPEVNLVVRMVSTVGNYDYIVDWEFKQSGSIKATVGLTGLLEVRGSK  450

Query  838   YEHINQFEIPRWDFPAGSLVSENTIGVAHDHFITFHLDMDVDGPTNSFVKVDLVKNYNIA  659
             Y H +Q +    D   G L++ENT+G  HDHF+ FHLD+D+DG +NSFVK    +     
Sbjct  451   YTHNDQID----DEEYGVLLAENTLGSRHDHFLIFHLDLDIDGDSNSFVKSVFRQTPVAD  506

Query  658   GKIQRKSYWSPKRKVAKSENDAKIKLQLDKPSEFHVINPRHQSRLGNPSGYKIVPSATAA  479
              +  RKSYWS   + AK+E+D KI L   + +E  V+NP  ++ +GN  GY+++P +   
Sbjct  507   HRSPRKSYWSVVSETAKTESDGKINLLSSEQAELLVVNPGKKTNVGNMVGYRLIPGSITG  566

Query  478   SLLDLQDPPQLRAAFTNNQIWVTPYNRSEQWAGGLFTYQSHGDDTLAVWSNRNRVIEKQD  299
              LL   D  Q+R AFT   +WVTPYN+SE+WAGGL+T +S+GDDTLA W+ RNR IE +D
Sbjct  567   PLLSDDDYAQIRGAFTKYNVWVTPYNKSEKWAGGLYTDRSYGDDTLATWAQRNRAIENKD  626

Query  298   IVLWYTLGFHHLPCQEDFPVMPTVTSTFQLKPVNFFDRNPIIQANPNFAEDLPIC  134
             IVLWYTLGFHH P QEDFP+MPT++S F+L+P NFF+ NP++   P      P C
Sbjct  627   IVLWYTLGFHHAPYQEDFPLMPTLSSGFELRPANFFESNPVLTVVPPEVVTWPNC  681



>dbj|BAJ88040.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=682

 Score =   604 bits (1557),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 304/661 (46%), Positives = 427/661 (65%), Gaps = 23/661 (3%)
 Frame = -1

Query  2083  HPLDPLTIQEIERTRSILSSYQPFSGSSLRIHSLSLDEPDKSEVLRWKRGNPLPT-----  1919
             HP DPL+  E+   R  + +        L  H + LDEPDK +VL +  GNP  +     
Sbjct  23    HPFDPLSPAELTAVRDAVLASPLVPAGPLTFHYVGLDEPDKPDVLSYAYGNPTSSSRSAL  82

Query  1918  -RKAFVVALSNGQAHLLVVDLGSGRVSSHTR---NPASGYPPMSADDASTALEATFSNSV  1751
              R+AFVVA + GQ+H L VD+      +      +  +G+P ++ D+   A+    ++  
Sbjct  83    PRRAFVVARAGGQSHELRVDVTDAAAPAVLAHAVHRGAGFPTLTLDEQFAAVALPPAHPP  142

Query  1750  FREAISTRGVEINDVVCSAAAPGWFG--PEEEGRRITKVKCYTAQNTPNYYMRPIEGLLL  1577
             F E++  RGV++ DV+C+    GWFG  P +E RR+ K+ C+ A  T N+Y RP+EG+ L
Sbjct  143   FVESVRRRGVDMADVLCAVFPVGWFGDLPAKE-RRVVKLLCFVAGATANFYARPLEGVTL  201

Query  1576  TVDLDSGKVINVYDTHSPIPIPKAQGTDYRRDGIEHRAPGVEPLKPISMEQPNGQSFRVE  1397
              VDLD   ++  Y     +P+PKA+GTDYR         G  P  P ++ QP+G+ F + 
Sbjct  202   VVDLDRMAIVE-YKDRVVLPVPKAEGTDYRAGKAGPPYAGRAP-APGTVVQPDGRGFDI-  258

Query  1396  DGYIVKWASWEFHVKADQRAGIIISQATVFDPEAGKRRSVMYKGFASELFVPYMDVDEGW  1217
             DG+ V+WA+WEFHV  D RAG +IS A++ D EAG RR V+Y+GF SE+FVPYMD  E W
Sbjct  259   DGHFVRWATWEFHVGFDVRAGTVISLASIHDAEAGARRRVLYRGFVSEVFVPYMDPAEEW  318

Query  1216  YFRAFMDAGEFGLGATAMELVPLNDCPRHSHYIDGLFVDPDGRPVSQPNVICVFERYSGD  1037
             Y+R F+DAGE+GLG  A  L P  DCP ++ Y+DG +   DG+PV   N+ICVFERY+GD
Sbjct  319   YYRTFLDAGEYGLGLWAFPLQPGADCPANAAYLDGYYAGQDGKPVENKNMICVFERYAGD  378

Query  1036  IAWRHSGTGDADDDLIREARPKVSLVVRTTATVGNYDYIFDWEFQTDGSIRVTVGLSGII  857
             +AWRH+  G   D LI E RP VSLVVR   + GNYDY+ DWEF+T GSI+ TV L+G++
Sbjct  379   VAWRHTEAG-FPDRLITEVRPDVSLVVRMVVSCGNYDYVLDWEFKTSGSIKFTVSLTGLL  437

Query  856   LAKGSPYEHINQFEIPRWDFPAGSLVSENTIGVAHDHFITFHLDMDVDGPTNSFVKVDLV  677
               KG+ Y H +Q      +   G+LV+ENT+ V HDH++T+HLD+DVDG  NSFVK  + 
Sbjct  438   EVKGTAYTHADQIT----EDAHGTLVAENTLAVYHDHYVTYHLDLDVDGTNNSFVKNTVA  493

Query  676   KNYNIAGKIQRKSYWSPKRKVAKSENDAKIKLQLDKPSEFHVINPRHQSRLGNPSGYKIV  497
                N+AG   R+SYW+ +R VA++E DA++ +    P++  V+NP  ++R+GN  GY+++
Sbjct  494   TKRNVAG-TPRRSYWTVRRDVAETEADAQVDVNT-APADLLVVNPNKRTRMGNEVGYRVI  551

Query  496   P-SATAASLLDLQDPPQLRAAFTNNQIWVTPYNRSEQWAGGLFTYQSHGDDTLAVWSNRN  320
             P  ATAAS+LD  D PQ RA++   Q+ VTPY ++E+WA GL+  QS GDD LA WS RN
Sbjct  552   PGGATAASVLDDDDYPQRRASYCKKQVRVTPYRKAEKWAPGLYADQSTGDDGLAAWSERN  611

Query  319   RVIEKQDIVLWYTLGFHHLPCQEDFPVMPTVTSTFQLKPVNFFDRNPIIQANPNFAEDLP  140
             R +  +DIVLWYT+G HH+P Q+DFPVMPTV+  F+L+P NFF+RNP++   P   +  P
Sbjct  612   RAVRNEDIVLWYTVGIHHIPYQDDFPVMPTVSGGFELRPANFFERNPLLTTRPPGLDQPP  671

Query  139   I  137
             +
Sbjct  672   L  672



>dbj|BAJ88544.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ97065.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=704

 Score =   604 bits (1558),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 304/661 (46%), Positives = 427/661 (65%), Gaps = 23/661 (3%)
 Frame = -1

Query  2083  HPLDPLTIQEIERTRSILSSYQPFSGSSLRIHSLSLDEPDKSEVLRWKRGNPLPT-----  1919
             HP DPL+  E+   R  + +        L  H + LDEPDK +VL +  GNP  +     
Sbjct  45    HPFDPLSPAELTAVRDAVLASPLVPAGPLTFHYVGLDEPDKPDVLSYAYGNPTSSSRSAL  104

Query  1918  -RKAFVVALSNGQAHLLVVDLGSGRVSSHTR---NPASGYPPMSADDASTALEATFSNSV  1751
              R+AFVVA + GQ+H L VD+      +      +  +G+P ++ D+   A+    ++  
Sbjct  105   PRRAFVVARAGGQSHELRVDVTDAAAPAVLAHAVHRGAGFPTLTLDEQFAAVALPPAHPP  164

Query  1750  FREAISTRGVEINDVVCSAAAPGWFG--PEEEGRRITKVKCYTAQNTPNYYMRPIEGLLL  1577
             F E++  RGV++ DV+C+    GWFG  P +E RR+ K+ C+ A  T N+Y RP+EG+ L
Sbjct  165   FVESVRRRGVDMADVLCAVFPVGWFGDLPAKE-RRVVKLLCFVAGATANFYARPLEGVTL  223

Query  1576  TVDLDSGKVINVYDTHSPIPIPKAQGTDYRRDGIEHRAPGVEPLKPISMEQPNGQSFRVE  1397
              VDLD   ++  Y     +P+PKA+GTDYR         G  P  P ++ QP+G+ F + 
Sbjct  224   VVDLDRMAIVE-YKDRVVLPVPKAEGTDYRAGKAGPPYAGRAP-APGTVVQPDGRGFDI-  280

Query  1396  DGYIVKWASWEFHVKADQRAGIIISQATVFDPEAGKRRSVMYKGFASELFVPYMDVDEGW  1217
             DG+ V+WA+WEFHV  D RAG +IS A++ D EAG RR V+Y+GF SE+FVPYMD  E W
Sbjct  281   DGHFVRWATWEFHVGFDVRAGTVISLASIHDAEAGARRRVLYRGFVSEVFVPYMDPAEEW  340

Query  1216  YFRAFMDAGEFGLGATAMELVPLNDCPRHSHYIDGLFVDPDGRPVSQPNVICVFERYSGD  1037
             Y+R F+DAGE+GLG  A  L P  DCP ++ Y+DG +   DG+PV   N+ICVFERY+GD
Sbjct  341   YYRTFLDAGEYGLGLWAFPLQPGADCPANAAYLDGYYAGQDGKPVENKNMICVFERYAGD  400

Query  1036  IAWRHSGTGDADDDLIREARPKVSLVVRTTATVGNYDYIFDWEFQTDGSIRVTVGLSGII  857
             +AWRH+  G   D LI E RP VSLVVR   + GNYDY+ DWEF+T GSI+ TV L+G++
Sbjct  401   VAWRHTEAG-FPDRLITEVRPDVSLVVRMVVSCGNYDYVLDWEFKTSGSIKFTVSLTGLL  459

Query  856   LAKGSPYEHINQFEIPRWDFPAGSLVSENTIGVAHDHFITFHLDMDVDGPTNSFVKVDLV  677
               KG+ Y H +Q      +   G+LV+ENT+ V HDH++T+HLD+DVDG  NSFVK  + 
Sbjct  460   EVKGTAYTHADQIT----EDAHGTLVAENTLAVYHDHYVTYHLDLDVDGTNNSFVKNTVA  515

Query  676   KNYNIAGKIQRKSYWSPKRKVAKSENDAKIKLQLDKPSEFHVINPRHQSRLGNPSGYKIV  497
                N+AG   R+SYW+ +R VA++E DA++ +    P++  V+NP  ++R+GN  GY+++
Sbjct  516   TKRNVAG-TPRRSYWTVRRDVAETEADAQVDVNT-APADLLVVNPNKRTRMGNEVGYRVI  573

Query  496   P-SATAASLLDLQDPPQLRAAFTNNQIWVTPYNRSEQWAGGLFTYQSHGDDTLAVWSNRN  320
             P  ATAAS+LD  D PQ RA++   Q+ VTPY ++E+WA GL+  QS GDD LA WS RN
Sbjct  574   PGGATAASVLDDDDYPQRRASYCKKQVRVTPYRKAEKWAPGLYADQSTGDDGLAAWSERN  633

Query  319   RVIEKQDIVLWYTLGFHHLPCQEDFPVMPTVTSTFQLKPVNFFDRNPIIQANPNFAEDLP  140
             R +  +DIVLWYT+G HH+P Q+DFPVMPTV+  F+L+P NFF+RNP++   P   +  P
Sbjct  634   RAVRNEDIVLWYTVGIHHIPYQDDFPVMPTVSGGFELRPANFFERNPLLTTRPPGLDQPP  693

Query  139   I  137
             +
Sbjct  694   L  694



>ref|XP_009366962.1| PREDICTED: LOW QUALITY PROTEIN: primary amine oxidase-like [Pyrus 
x bretschneideri]
Length=676

 Score =   603 bits (1554),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 300/648 (46%), Positives = 420/648 (65%), Gaps = 17/648 (3%)
 Frame = -1

Query  2083  HPLDPLTIQEIERTRSILS-SYQPFSGSSLRIHSLSLDEPDKSEVLRW----KRGNPLPT  1919
             HPLDPLT  E ++ R+I+  SY      +L    + LDEPDK  +  W     + NP P 
Sbjct  27    HPLDPLTPSEFKKVRTIVKKSYPSGLKHNLTFQYIGLDEPDKPVLQSWLSSKTKSNP-PP  85

Query  1918  RKAFVVALSNGQAHLLVVDLGSGRV-SSHTRNPASGYPPMSADDASTALEATFSNSVFRE  1742
             R+AFV+A  + + H LVVDL +  + S        GYP ++ D+ + A    FS   F +
Sbjct  86    RRAFVIARLHKETHELVVDLSNRYIISDKVYGGNDGYPMLTNDEQTAASALPFSYQPFLD  145

Query  1741  AISTRGVEINDVVCSAAAPGWFGPEEEGRRITKVKCYTAQNTPNYYMRPIEGLLLTVDLD  1562
             ++  R + ++DVVC+    GWFG E+  RR  K+  +  + T N YMRP+EG+ L VDLD
Sbjct  146   SVKKRELNLSDVVCTTFTVGWFG-EKHSRRAIKILSFYKEGTANLYMRPLEGVSLLVDLD  204

Query  1561  SGKVINVYDTHSPIPIPKAQGTDYRRDGIEHRAPGV-EPLKPISMEQPNGQSFRVEDGYI  1385
               K++  YD  S +P+PKA+GT+YR        P    PL    +EQPNG  F++ DG+ 
Sbjct  205   EMKIVEYYD-RSRLPMPKAEGTEYRLGXXXXXXPPFGPPLNGFVIEQPNGPGFKI-DGHK  262

Query  1384  VKWASWEFHVKADQRAGIIISQATVFDPEAGKRRSVMYKGFASELFVPYMDVDEGWYFRA  1205
             + WA+W+FH+  D RAG IIS A+++D E    R V+Y+ F SELFVPYMD  E WY++ 
Sbjct  263   ISWANWDFHLGFDVRAGPIISLASIYDLEKATYRQVLYRAFVSELFVPYMDPTEEWYYKT  322

Query  1204  FMDAGEFGLGATAMELVPLNDCPRHSHYIDGLFVDPDGRPVSQPNVICVFERYSGDIAWR  1025
             F DAGEFG G  AM L PL DCP ++ ++D  +   DG PV   N  C+FE+ SG + WR
Sbjct  323   FFDAGEFGFGQLAMPLEPLTDCPANAEFLDAYYAGEDGTPVKISNAFCIFEQQSGSVMWR  382

Query  1024  HSGTGDADDDLIREARPKVSLVVRTTATVGNYDYIFDWEFQTDGSIRVTVGLSGIILAKG  845
             H+       +LI E  P++SL+VR  ATV NYDYI DWEF+  GSI++ VGL+GI+  K 
Sbjct  383   HTEYA-IPGELITEVMPELSLIVRMVATVCNYDYILDWEFKPSGSIKIGVGLTGILEVKA  441

Query  844   SPYEHINQFEIPRWDFPAGSLVSENTIGVAHDHFITFHLDMDVDGPTNSFVKVDLVKNYN  665
             + Y H +Q +   +    G+L+++ TIGV HDHF+T++LD+DVDG  NSFVK +LV    
Sbjct  442   ADYTHTSQIKEDAY----GTLLADYTIGVYHDHFLTYYLDLDVDGEANSFVKNNLVTKRV  497

Query  664   IAGKIQRKSYWSPKRKVAKSENDAKIKLQLDKPSEFHVINPRHQSRLGNPSGYKIVPSAT  485
                   RKSYW+ + + AK+E+DAKI+L L K SE  V+NP  +++ GN  GY+++P + 
Sbjct  498   TDKNSPRKSYWTVESETAKTESDAKIQLGL-KASELVVVNPNKKTKPGNSIGYRLIPGSI  556

Query  484   AASLLDLQDPPQLRAAFTNNQIWVTPYNRSEQWAGGLFTYQSHGDDTLAVWSNRNRVIEK  305
             + +LL+  D PQ+R AFTN  +WVTPYN+SE+WAGGL+  +SHG++TLA WS RNR IE 
Sbjct  557   SKALLNDDDYPQIRGAFTNYNVWVTPYNKSEKWAGGLYADRSHGEETLATWSLRNREIEN  616

Query  304   QDIVLWYTLGFHHLPCQEDFPVMPTVTSTFQLKPVNFFDRNPIIQANP  161
             +DIVLWYT+GFHH+PCQEDFP+MPT++  F+L+P NFF+ NP+++  P
Sbjct  617   KDIVLWYTVGFHHVPCQEDFPIMPTLSGGFELRPTNFFESNPVLKTKP  664



>gb|EMS66410.1| Primary amine oxidase [Triticum urartu]
Length=453

 Score =   594 bits (1531),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 271/449 (60%), Positives = 341/449 (76%), Gaps = 19/449 (4%)
 Frame = -1

Query  1423  PNGQSFRVEDGYIVKWASWEFHVKADQRAGIIISQATVFDPEAGKRRSVMYKGFASELFV  1244
             P G  F++EDG+ V+WA WEFH+KAD RAG+++S ATV DP+ G RR VMYKG ASELFV
Sbjct  5     PEGPGFQIEDGHTVRWAGWEFHLKADARAGLVVSGATVQDPDTGARREVMYKGMASELFV  64

Query  1243  PYMDVDEGWYFRAFMDAGEFGLGATAMELVPLNDCPRHSHYIDGLFVDPDGRPVSQPNVI  1064
             PYMD  E WYF+ +MDAGE+G G  AM LVPLNDCPRH+ Y+DG+FV  DGRP  + N+I
Sbjct  65    PYMDPTEAWYFKTYMDAGEYGFGLQAMPLVPLNDCPRHARYMDGVFVAADGRPYVRENMI  124

Query  1063  CVFERYSGDIAWRHSGTGDADDDL-----------------IREARPKVSLVVRTTATVG  935
             CVFERY+GDIAWRHS +     D+                 IRE+RPKV+LV R  A+V 
Sbjct  125   CVFERYAGDIAWRHSESPITGMDVSSTPLPHTHTYPPPCYVIRESRPKVTLVARMAASVA  184

Query  934   NYDYIFDWEFQTDGSIRVTVGLSGIILAKGSPYEHINQFEIPRWDFPAGSLVSENTIGVA  755
             NYDYI DWEFQTDG IR+ VGLSGI++ KG+PY H+NQ  + + +   G+L+SEN IGV 
Sbjct  185   NYDYIVDWEFQTDGLIRIKVGLSGILMVKGTPYSHMNQ--VRQNEEMHGTLLSENVIGVI  242

Query  754   HDHFITFHLDMDVDGPTNSFVKVDLVKNYNIAGKIQRKSYWSPKRKVAKSENDAKIKLQL  575
             HDH++TF LDMDVDG  NSFV+V++ +     G+  R+SY    R +A +E DA+++L+L
Sbjct  243   HDHYVTFRLDMDVDGGDNSFVRVEMARQDTAPGESPRRSYLKATRHIASTEKDARVRLKL  302

Query  574   DKPSEFHVINPRHQSRLGNPSGYKIVPSATAASLLDLQDPPQLRAAFTNNQIWVTPYNRS  395
              +P+EFHVINP  ++R+GNP GYK+VP+ TA SLLD +DPPQ R AFTNNQIWVTPYN+S
Sbjct  303   YEPAEFHVINPTKKTRVGNPVGYKVVPAGTAGSLLDPEDPPQKRGAFTNNQIWVTPYNKS  362

Query  394   EQWAGGLFTYQSHGDDTLAVWSNRNRVIEKQDIVLWYTLGFHHLPCQEDFPVMPTVTSTF  215
             E+WAGGLF YQS G+DTLA WS R+R IE +D+VLWYTLGFHH+PCQEDFP+MPTV+S+F
Sbjct  363   EEWAGGLFVYQSKGEDTLATWSERDRPIENKDLVLWYTLGFHHIPCQEDFPIMPTVSSSF  422

Query  214   QLKPVNFFDRNPIIQANPNFAEDLPICRA  128
              LKPVNFF+ NPI++  P   +DLP+C A
Sbjct  423   DLKPVNFFESNPILKQRPTMEKDLPVCAA  451



>ref|XP_006606051.1| PREDICTED: primary amine oxidase-like [Glycine max]
Length=675

 Score =   602 bits (1553),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 296/658 (45%), Positives = 424/658 (64%), Gaps = 17/658 (3%)
 Frame = -1

Query  2083  HPLDPLTIQEIERTRSILSSYQPFSGSSLRIHSLSLDEPDKSEVLRWKRGNP------LP  1922
             HPLDPLT  E +  R+I+      S  +L    + LDEPDK+ VL W+  +P      LP
Sbjct  27    HPLDPLTPSEFKLVRTIVQKKYQASPPTLTFQYIGLDEPDKAIVLSWQYSDPKTKATTLP  86

Query  1921  TRKAFVVALSNGQAHLLVVDLGSGRVSSHTRNPASGYPPMSADDASTALEATFSNSVFRE  1742
              R+AFVVA    Q+  + VDL    + S       G+P ++ D+     E  F    F E
Sbjct  87    PRRAFVVARFKKQSLEITVDLSKRSIVSTNVYIGHGFPMLTFDEQDFVAELPFKYKPFIE  146

Query  1741  AISTRGVEINDVVCSAAAPGWFGPEEEGRRITKVKCYTAQNTPNYYMRPIEGLLLTVDLD  1562
             +++ RG+ I++VVCS A+ GW+G E + +R  K++C+  Q + N +  P+EG+ +  DLD
Sbjct  147   SVNKRGLNISEVVCSTASVGWYG-EIKSKRTLKLQCFHTQGSTNLFAMPLEGITVVADLD  205

Query  1561  SGKVINVYDTHSPIPIPKAQGTDYRRDGIEHRAPGVEPLKPISMEQPNGQSFRVEDGYIV  1382
               K++  +D+   +P+PKA+GT+Y     + + P        +  QPNG  F++ +G+ +
Sbjct  206   ERKLVAYFDSKI-VPVPKAEGTEYVAS--KQKPPFGPTFIGAAFVQPNGPGFKI-NGHSI  261

Query  1381  KWASWEFHVKADQRAGIIISQATVFDPEAGKRRSVMYKGFASELFVPYMDVDEGWYFRAF  1202
              WA+WEFH+  D RAG +IS A+++D +  + R V+Y+G+ SE FVPYMD    WYF+ F
Sbjct  262   SWANWEFHLGYDIRAGPVISLASIYDIQQQRYRRVLYRGYISEFFVPYMDPTSSWYFKTF  321

Query  1201  MDAGEFGLGATAMELVPLNDCPRHSHYIDGLFVDPDGRPVSQPNVICVFERYSGDIAWRH  1022
             +D+GEFG G + + L P  DCP ++ ++D  F   DG PV   N  CVFE+Y+GDI WRH
Sbjct  322   LDSGEFGFGQSMVSLEPFADCPSNAAFLDAYFAGEDGVPVKIANAFCVFEKYAGDIMWRH  381

Query  1021  SGTGDADDDLIREARPKVSLVVRTTATVGNYDYIFDWEFQTDGSIRVTVGLSGIILAKGS  842
             + + +  D+ IRE RP VSLVVRT +TVGNYDYI DWEF+  GSI++ VGL+GI+  K +
Sbjct  382   TES-EIHDEEIREVRPDVSLVVRTVSTVGNYDYIVDWEFKPSGSIKMGVGLTGILGIKAT  440

Query  841   PYEHINQFEIPRWDFPAGSLVSENTIGVAHDHFITFHLDMDVDGPTNSFVKVDLVKNYNI  662
              Y H++Q +   +    G+L+++NTIGV HDH++T+HLD+D+DG  NSFVK +L      
Sbjct  441   AYTHVDQIKEDAF----GTLLTDNTIGVHHDHYLTYHLDLDIDGEANSFVKTNLETVRVT  496

Query  661   AGKIQRKSYWSPKRKVAKSENDAKIKLQLDKPSEFHVINPRHQSRLGNPSGYKIVPSATA  482
                  RKSYW+  R+ AK+E DA+IKL L KPSE  V+NP  +++ GN  GY++ P   A
Sbjct  497   DHSSPRKSYWTVVRETAKTEADARIKLGL-KPSELAVVNPNKETKPGNKMGYRLFPFTVA  555

Query  481   ASLLDLQDPPQLRAAFTNNQIWVTPYNRSEQWAGGLFTYQSHGDDTLAVWSNRNRVIEKQ  302
               LL   D PQLR +FTN  ++VTPYN+SE+WAGGL+  QS G+DTLAVWS RNR IE +
Sbjct  556   NPLLAPDDYPQLRGSFTNYNVFVTPYNKSEKWAGGLYADQSRGEDTLAVWSLRNRSIENK  615

Query  301   DIVLWYTLGFHHLPCQEDFPVMPTVTSTFQLKPVNFFDRNPIIQANPNFAEDLPICRA  128
             DIVLW+T+G HH+PCQED+P+MPT++  F+LKP NFF+ NP+++A       LP C +
Sbjct  616   DIVLWHTVGIHHVPCQEDYPIMPTLSGGFELKPTNFFESNPVLKAKAPKPVHLPKCNS  673



>gb|KCW60783.1| hypothetical protein EUGRSUZ_H03520 [Eucalyptus grandis]
Length=687

 Score =   602 bits (1552),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 304/655 (46%), Positives = 417/655 (64%), Gaps = 16/655 (2%)
 Frame = -1

Query  2083  HPLDPLTIQEIERTRSILSSYQPFSG-SSLRIHSLSLDEPDKSEVLRWKRGNPLPT---R  1916
             HPLDPLT  E+E  R+I S   P S   +L  H + LDEPDK  +L W     L     R
Sbjct  38    HPLDPLTPSELELARAIASDSFPGSPPRNLTFHYVGLDEPDKPLLLSWLSAPSLSPPPPR  97

Query  1915  KAFVVALSNGQAHLLVVDLGSGRVSSHTRNPASGYPPMSADDASTALEATFSNSVFREAI  1736
             +A V+  ++ + H L VDL +GRV S   +   G+P ++  + + +      +  F E++
Sbjct  98    RALVIVRADKRTHELTVDLSAGRVDSARVHTGHGFPILTFAELAASSSLARQHPPFLESM  157

Query  1735  STRGVEINDVVCSAAAPGWFGPE-EEGRRITKVKCYTAQNTPNYYMRPIEGLLLTVDLDS  1559
               RG++  ++VC +   GW+G E  +  R  KV CY    T N YMRP+EG+ +TVDLD 
Sbjct  158   RKRGLKAEEIVCGSFTVGWYGQEARKVGRTVKVMCYYLDGTVNLYMRPVEGVTVTVDLDE  217

Query  1558  GKVINVYDTHSPIPIPKAQGTDYRRDGIEHRAPGVEPLKPISMEQPNGQSFRVEDGYIVK  1379
              +++   D    +P+PKA GTDY     E   P    LK I + QP G SF V DG++++
Sbjct  218   MRIVGFMD-RVRVPVPKADGTDYSGSN-ERVGPA---LKRIGVVQPEGPSFTV-DGHMIR  271

Query  1378  WASWEFHVKADQRAGIIISQATVFDPEAGKRRSVMYKGFASELFVPYMDVDEGWYFRAFM  1199
             WA+WEFH+  D RAG IIS A+++D +  K R VMY+GF SELFVPYMD+ E WY+R F 
Sbjct  272   WANWEFHLSFDVRAGPIISLASIYDAQKQKFRQVMYRGFISELFVPYMDLTEEWYYRTFF  331

Query  1198  DAGEFGLGATAMELVPLNDCPRHSHYIDGLFVDPDGRPVSQPNVICVFERYSGDIAWRHS  1019
             DAG++G G  A++L PL DCP ++ ++D     PDG+P+   NV CVFERY+GDI WRH+
Sbjct  332   DAGDYGFGLCAVQLEPLRDCPENAVFMDAYIAGPDGKPIKMSNVFCVFERYAGDIMWRHT  391

Query  1018  GTGDADDDLIREARPKVSLVVRTTATVGNYDYIFDWEFQTDGSIRVTVGLSGIILAKGSP  839
               G     +IRE RP+V+LVVR  +TVGNYDYI DWEF+  GSI+ TV L+G++  +GS 
Sbjct  392   ELG-IPGKVIREVRPEVNLVVRMVSTVGNYDYIVDWEFKQSGSIKATVRLTGLLEVRGSK  450

Query  838   YEHINQFEIPRWDFPAGSLVSENTIGVAHDHFITFHLDMDVDGPTNSFVKVDLVKNYNIA  659
             Y H +Q +    D   G L++ENT+G  HDHF+ FHLD+D+DG +NSFVK    +     
Sbjct  451   YTHNDQID----DEEYGVLLAENTLGSRHDHFLIFHLDLDIDGDSNSFVKSVFRQTPVAD  506

Query  658   GKIQRKSYWSPKRKVAKSENDAKIKLQLDKPSEFHVINPRHQSRLGNPSGYKIVPSATAA  479
              +  RKSYWS   + AK+E+D KI L   + +E  V+NP  ++ +GN  GY+++P +   
Sbjct  507   HRSPRKSYWSVVSETAKTESDGKINLLSSEQAELLVVNPGKKTNVGNMVGYRLIPGSITG  566

Query  478   SLLDLQDPPQLRAAFTNNQIWVTPYNRSEQWAGGLFTYQSHGDDTLAVWSNRNRVIEKQD  299
              LL   D  Q+R AFT   +WVTPYN+SE+WAGGL+T +S+GDDTLA W+ RNR IE +D
Sbjct  567   PLLSDDDYAQIRGAFTKYNVWVTPYNKSEKWAGGLYTDRSYGDDTLATWAQRNRAIENKD  626

Query  298   IVLWYTLGFHHLPCQEDFPVMPTVTSTFQLKPVNFFDRNPIIQANPNFAEDLPIC  134
             IVLWYTLGFHH P QEDFP+MPT++S F+L+P NFF+ NP++   P      P C
Sbjct  627   IVLWYTLGFHHAPYQEDFPLMPTLSSGFELRPANFFESNPVLTVVPPEVVTWPNC  681



>ref|XP_004139886.1| PREDICTED: primary amine oxidase-like [Cucumis sativus]
Length=681

 Score =   601 bits (1550),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 305/673 (45%), Positives = 428/673 (64%), Gaps = 22/673 (3%)
 Frame = -1

Query  2155  NNLESLLGIHDFKIQNNHFADRPMHPLDPLTIQEIERTRSILSSYQPFSGSSLRIHSLSL  1976
             N +E LL      I     A    HPLDPL+  E E  RS++++  P   +++    ++L
Sbjct  7     NKMEKLLFFLPLIIPLLSVAATCRHPLDPLSSSEFEIIRSLITNSNP--STNITFQYVAL  64

Query  1975  DEPDKSEVLRWKRGNPL---PTRKAFVVALSNGQAHLLVVDLGSGRVSSHTRNPASGYPP  1805
              +P K  VL W   NP    P R+A      N   H +++DL    + S+     +GY P
Sbjct  65    ADPTKQSVLSW-LANPKTRPPPRRATATIRFNKATHEILIDLEKKTMISNRVYSGTGYAP  123

Query  1804  MSADDASTALEATFSNSVFREAISTRGVEINDVVCSAAAPGWFGPEEE-GRRITKVKCYT  1628
              + ++   A     S+  F  A+  RG+++ +VVC+  + GWFG + +  +RI KV+CY 
Sbjct  124   FTFEEQFAAAALPASHPPFVAAMKKRGLKLEEVVCACFSVGWFGEKRKVEQRIVKVQCYY  183

Query  1627  AQNTPNYYMRPIEGLLLTVDLDSGKVINVYDTHSPIPIPKAQGTDYRRDGIEHRAPGVEP  1448
                + N YMRP+EG+ +TVDLD  K+I   D +  +PIPKA GT+YR   +  + P + P
Sbjct  184   LDGSVNLYMRPVEGVTVTVDLDEMKIIGFRDRYV-VPIPKAGGTEYRESML--KPPFLPP  240

Query  1447  LKPISMEQPNGQSFRVEDGYIVKWASWEFHVKADQRAGIIISQATVFDPEAGKRRSVMYK  1268
             L  + M QP+G SF++ +G+ V WA+W FHV  D+RAG IIS A+++D +  KRR VMY+
Sbjct  241   LNGMKMVQPDGPSFQI-NGHSVSWANWNFHVSLDERAGPIISLASIYDIQKQKRRQVMYR  299

Query  1267  GFASELFVPYMDVDEGWYFRAFMDAGEFGLGATAMELVPLNDCPRHSHYIDGLFVDPDGR  1088
             GF SELFVPYMD++E WY+R F DAGE+G G  A+ L PL DCP ++ ++D      DGR
Sbjct  300   GFISELFVPYMDLNEEWYYRTFFDAGEYGFGQCAVPLQPLRDCPENAVFMDTYMAAGDGR  359

Query  1087  PVSQPNVICVFERYSGDIAWRHSGTGDADDDLIREARPKVSLVVRTTATVGNYDYIFDWE  908
             P+   N  C+FER+ GDI WRH+  G   + LIRE R ++SLVVR  A VGNYDYI DWE
Sbjct  360   PMKMSNTFCIFERHGGDIMWRHT-EGTIPNTLIRETRAEISLVVRMVAAVGNYDYIVDWE  418

Query  907   FQTDGSIRVTVGLSGIILA----KGSPYEHINQFEIPRWDFPAGSLVSENTIGVAHDHFI  740
             F+  GSI   V   G +LA    + S Y H +Q +   +    G L++ENTIGV HDHF+
Sbjct  419   FKQSGSIIANV-FYGPLLAENTIRASKYTHKDQIKEEVY----GPLLAENTIGVRHDHFL  473

Query  739   TFHLDMDVDGPTNSFVKVDLVKNYNIAGKIQRKSYWSPKRKVAKSENDAKIKLQLDKPSE  560
             T+HLD+D+DG  NSF+K +L    +      R+SYW+   + AK+E DA+IK    +  E
Sbjct  474   TYHLDLDIDGDANSFLKSNLRTIRSQDPDYPRRSYWTVVTETAKTEADARIKFGFQQ-DE  532

Query  559   FHVINPRHQSRLGNPSGYKIVPSATAASLLDLQDPPQLRAAFTNNQIWVTPYNRSEQWAG  380
               V+NP  ++R+GNP GY+++P +T + LL   D PQ+R AF+N  +WVTPYNRSE+WA 
Sbjct  533   LVVVNPNQRTRMGNPVGYRLIPKSTTSPLLSADDYPQIRGAFSNYNVWVTPYNRSEKWAS  592

Query  379   GLFTYQSHGDDTLAVWSNRNRVIEKQDIVLWYTLGFHHLPCQEDFPVMPTVTSTFQLKPV  200
             GL+T QSHGDDTLA WS R+R IE +DIV+WYT+GFHH+PCQEDFP+MPT++S F+L+P 
Sbjct  593   GLYTDQSHGDDTLATWSLRDREIEDKDIVMWYTMGFHHVPCQEDFPLMPTLSSGFELRPT  652

Query  199   NFFDRNPIIQANP  161
             NFF+ NP+++  P
Sbjct  653   NFFESNPVLKVTP  665



>dbj|BAJ97208.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=704

 Score =   602 bits (1551),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 303/661 (46%), Positives = 426/661 (64%), Gaps = 23/661 (3%)
 Frame = -1

Query  2083  HPLDPLTIQEIERTRSILSSYQPFSGSSLRIHSLSLDEPDKSEVLRWKRGNPLPT-----  1919
             HP DPL+  E+   R  + +        L  H + LDEPDK +VL +  GNP  +     
Sbjct  45    HPFDPLSPAELTAVRDAVLASPLVPAGPLTFHYVGLDEPDKPDVLSYAYGNPTSSSRSAL  104

Query  1918  -RKAFVVALSNGQAHLLVVDLGSGRVSSHTR---NPASGYPPMSADDASTALEATFSNSV  1751
              R+AFVVA + GQ+H L VD+      +      +  +G+P ++ D+   A+    ++  
Sbjct  105   PRRAFVVARAGGQSHELRVDVTDAAAPAVLAHAVHRGAGFPTLTLDEQFAAVALPPAHPP  164

Query  1750  FREAISTRGVEINDVVCSAAAPGWFG--PEEEGRRITKVKCYTAQNTPNYYMRPIEGLLL  1577
             F E++  RGV++ DV+C+    GWFG  P +E RR+ K+ C+ A  T N+Y RP+EG+ L
Sbjct  165   FVESVRRRGVDMADVLCAVFPVGWFGDLPAKE-RRVVKLLCFVAGATANFYARPLEGVTL  223

Query  1576  TVDLDSGKVINVYDTHSPIPIPKAQGTDYRRDGIEHRAPGVEPLKPISMEQPNGQSFRVE  1397
              VDLD   ++  Y     +P+PKA+GTDYR         G  P  P ++ QP+G+ F + 
Sbjct  224   VVDLDRMAIVE-YKDRVVLPVPKAEGTDYRAGKAGPPYAGRAP-APGTVVQPDGRGFDI-  280

Query  1396  DGYIVKWASWEFHVKADQRAGIIISQATVFDPEAGKRRSVMYKGFASELFVPYMDVDEGW  1217
             DG+ V+WA+WEFHV  D RAG +IS A++ D EAG RR V+Y+GF SE+FVPYMD  E W
Sbjct  281   DGHFVRWATWEFHVGFDVRAGTVISLASIHDAEAGARRRVLYRGFVSEVFVPYMDPAEEW  340

Query  1216  YFRAFMDAGEFGLGATAMELVPLNDCPRHSHYIDGLFVDPDGRPVSQPNVICVFERYSGD  1037
             Y+  F+DAGE+GLG  A  L P  DCP ++ Y+DG +   DG+PV   N+ICVFERY+GD
Sbjct  341   YYHTFLDAGEYGLGLWAFPLQPGADCPANAAYLDGYYAGQDGKPVENKNMICVFERYAGD  400

Query  1036  IAWRHSGTGDADDDLIREARPKVSLVVRTTATVGNYDYIFDWEFQTDGSIRVTVGLSGII  857
             +AWRH+  G   D LI E RP VSLVVR   + GNYDY+ DWEF+T GSI+ TV L+G++
Sbjct  401   VAWRHTEAG-FPDRLITEVRPDVSLVVRMVVSCGNYDYVLDWEFKTSGSIKFTVSLTGLL  459

Query  856   LAKGSPYEHINQFEIPRWDFPAGSLVSENTIGVAHDHFITFHLDMDVDGPTNSFVKVDLV  677
               KG+ Y H +Q      +   G+LV+ENT+ V HDH++T+HLD+DVDG  NSFVK  + 
Sbjct  460   EVKGTAYTHADQIT----EDAHGTLVAENTLAVYHDHYVTYHLDLDVDGTNNSFVKNTVA  515

Query  676   KNYNIAGKIQRKSYWSPKRKVAKSENDAKIKLQLDKPSEFHVINPRHQSRLGNPSGYKIV  497
                N+AG   R+SYW+ +R VA++E DA++ +    P++  V+NP  ++R+GN  GY+++
Sbjct  516   TKRNVAG-TPRRSYWTVRRDVAETEADAQVDVNT-APADLLVVNPNKRTRMGNEVGYRVI  573

Query  496   P-SATAASLLDLQDPPQLRAAFTNNQIWVTPYNRSEQWAGGLFTYQSHGDDTLAVWSNRN  320
             P  ATAAS+LD  D PQ RA++   Q+ VTPY ++E+WA GL+  QS GDD LA WS RN
Sbjct  574   PGGATAASVLDDDDYPQRRASYCKKQVRVTPYRKAEKWAPGLYADQSTGDDGLAAWSERN  633

Query  319   RVIEKQDIVLWYTLGFHHLPCQEDFPVMPTVTSTFQLKPVNFFDRNPIIQANPNFAEDLP  140
             R +  +DIVLWYT+G HH+P Q+DFPVMPTV+  F+L+P NFF+RNP++   P   +  P
Sbjct  634   RAVRNEDIVLWYTVGIHHIPYQDDFPVMPTVSGGFELRPANFFERNPLLTTRPPGLDQPP  693

Query  139   I  137
             +
Sbjct  694   L  694



>ref|XP_010532535.1| PREDICTED: primary amine oxidase-like [Tarenaya hassleriana]
Length=679

 Score =   599 bits (1544),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 299/651 (46%), Positives = 422/651 (65%), Gaps = 22/651 (3%)
 Frame = -1

Query  2083  HPLDPLTIQEIERTRSILSSYQPFSGSSLRIHSLSLDEPDKSEVLRW---KRGNPLPTRK  1913
             HPLDPLT  EI R +SI++++   S  +L  H ++LDEP+K  VL+W         P R+
Sbjct  27    HPLDPLTPSEITRIQSIINNHFGDSKRNLNFHYVALDEPEKPAVLKWLSSPSATLPPPRR  86

Query  1912  AFVVALSNGQAHLLVVDLGSGRVSSHTRNPASGYPPMSADDASTALEATFSNSVFREAIS  1733
             A  +   N Q   L +DL SG + S   +   GY  M+ D+ + A++ T     F ++++
Sbjct  87    ATAIVRLNKQNLELTIDLSSGTILSKKTHSGFGYQMMTIDEQNLAVKITKKYVPFVKSMT  146

Query  1732  TRGVEINDVVCSAAAPGWFGPEEEGR----RITKVKCYTAQNTPNYYMRPIEGLLLTVDL  1565
              RG+ ++ V CS    GW+G   E R    R+TK+ C+ ++ T N YMRPI+GL++ VDL
Sbjct  147   QRGLNMSHVECSTFTGGWYGQTYEAREDEPRVTKILCFYSEGTSNLYMRPIDGLIIGVDL  206

Query  1564  DSGKVINVYDTHSPIPIPKAQGTDYRRDGIEHRAPGVEPLKPISMEQPNGQSFRVEDGYI  1385
             D+ K++   DT    P+PKA+GTDYR + +  R P    LK  ++ Q +G  F++ DG++
Sbjct  207   DAMKIVEYKDT-GKAPMPKAEGTDYRDESL--RVPVGLDLKDTAISQSDGPGFKI-DGHV  262

Query  1384  VKWASWEFHVKADQRAGIIISQATVFDPEAGKRRSVMYKGFASELFVPYMDVDEGWYFRA  1205
             V+WA+W+FHV  D R G +IS A+V+D +  ++R V+YKG+ SELFV Y D  E WY++ 
Sbjct  263   VRWANWKFHVGYDMRVGPVISLASVYDVDQKRQRLVLYKGYVSELFVSYQDPSEEWYYKT  322

Query  1204  FMDAGEFGLGATAMELVPLNDCPRHSHYIDGLFVDP-DGRPVSQPNVICVFERYSGDIAW  1028
             F D GE+G G +A  L P +DCP ++ ++D  F  P  G  V  PN  CVFERY+GD  W
Sbjct  323   FFDCGEWGCGQSATSLAPFSDCPPNAVFMDAFFSGPPRGSVVKIPNAFCVFERYTGDTMW  382

Query  1027  RHSGTGDADDDLIREARPKVSLVVRTTATVGNYDYIFDWEFQTDGSIRVTVGLSGIILAK  848
             RH+ T   + D   EAR  VSLVVR  AT+GNYDYI DWEF+  GSI+V +GLSG++  +
Sbjct  383   RHAET---EFDEFTEARQGVSLVVRMAATLGNYDYIMDWEFKPTGSIKVEIGLSGVLEVR  439

Query  847   GSPYEHINQFEIPRWDFPAGSLVSENTIGVAHDHFITFHLDMDVDGPTNSFVKVDLVKNY  668
             G+ Y H +Q +    D   G+L+ +NTIG  HDHF+ + LD+DVDGP NSFVK  LV   
Sbjct  440   GTSYTHKDQIK----DDQHGTLIVDNTIGTYHDHFLNYRLDLDVDGPINSFVKTKLVTKR  495

Query  667   --NIAGKIQRKSYWSPKRKVAKSENDAKIKLQLDKPSEFHVINPRHQSRLGNPSGYKIVP  494
               + A ++ RKSYW+ + + A +E DA+ ++   +P+EF V+NP  ++R GN  GY +VP
Sbjct  496   ISDTAHRVPRKSYWTVQHETAATELDARTRVG-SQPAEFTVVNPEKRTRPGNTVGYSLVP  554

Query  493   SATAASLLDLQDPPQLRAAFTNNQIWVTPYNRSEQWAGGLFTYQSHGDDTLAVWSNRNRV  314
                   LL   D PQ RAAFTN  +WVTPYN+SE++A GL+ +QS GDDTLAVW+++NR 
Sbjct  555   GTATVPLLSGDDYPQTRAAFTNYNLWVTPYNKSERFASGLYAFQSRGDDTLAVWTDKNRE  614

Query  313   IEKQDIVLWYTLGFHHLPCQEDFPVMPTVTSTFQLKPVNFFDRNPIIQANP  161
             IEK+DIV+WYT+G HH+PCQEDFP+MP +   F+LKP NFF+RNP + A P
Sbjct  615   IEKRDIVVWYTMGIHHVPCQEDFPIMPLLKGGFELKPTNFFERNPYVYAKP  665



>ref|XP_010923394.1| PREDICTED: primary amine oxidase-like [Elaeis guineensis]
Length=661

 Score =   595 bits (1535),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 293/645 (45%), Positives = 415/645 (64%), Gaps = 13/645 (2%)
 Frame = -1

Query  2083  HPLDPLTIQEIERTRSILSSYQPFSGSSLRIHSLSLDEPDKSEVLRWKRGNPLPT-RKAF  1907
             HPLDPLT  EI      + S    S  SL  H + LDEPDK +VL W+ G      R+AF
Sbjct  27    HPLDPLTPSEISTICRTIKSSHLASSKSLAFHYVGLDEPDKPDVLAWQSGRRAALHRRAF  86

Query  1906  VVALSNGQAHLLVVDLGSGR-VSSHTRNPASGYPPMSADDASTALEATFSNSVFREAIST  1730
             V+A ++GQ H L +D+ +   ++S       GYP ++ ++ + A    F+++ F E++  
Sbjct  87    VIARADGQTHELYIDISNNNSITSDKIYDGFGYPRVNVEEQAAASALPFNHTPFVESVRK  146

Query  1729  RGVEINDVVCSAAAPGWFGPEEEGRRITKVKCYTAQNTPNYYMRPIEGLLLTVDLDSGKV  1550
             RG+E+ +VVC A+  GWFG   +GRR+  + C+   +T N Y RP+EG+ + VDLD+ ++
Sbjct  147   RGLELKEVVCLASTVGWFGEGRQGRRLVNLLCFVTGDTVNLYTRPLEGVTILVDLDAMEI  206

Query  1549  INVYDTHSPIPIPKAQGTDYRRDGIEHRAPGVEPLKPISMEQPNGQSFRVEDGYIVKWAS  1370
             +  Y     +P+PKA GTDYR    +   P     KP  + QP G+ F + DG+IV W++
Sbjct  207   VE-YKDRKVVPVPKAAGTDYRAS--KQEPPFGPQTKPGVVVQPQGKGFTI-DGHIVSWSN  262

Query  1369  WEFHVKADQRAGIIISQATVFDPEAGKRRSVMYKGFASELFVPYMDVDEGWYFRAFMDAG  1190
             W FH+  D RAG+IIS A+V + E    RSV+Y+G  SELFVPYM+  E WY+R F DAG
Sbjct  263   WVFHLSFDARAGVIISLASVQETENWTHRSVLYRGHVSELFVPYMNPSEEWYYRTFFDAG  322

Query  1189  EFGLGATAMELVPLNDCPRHSHYIDGLFVDPDGRPVSQPNVICVFERYSGDIAWRHSGTG  1010
             E+G G  A  L P+ DCP  + ++D  +   DG+PV  PN +CVFERY+GD +WRHS   
Sbjct  323   EYGFGLCASPLEPMMDCPADATFMDACYAGQDGKPVVIPNALCVFERYAGDPSWRHS-EF  381

Query  1009  DADDDLIREARPKVSLVVRTTATVGNYDYIFDWEFQTDGSIRVTVGLSGIILAKGSPYEH  830
             +    ++ E R   SLVVR   T+ NYDY+ DWEF+  GSI++ V  +G++  K +PY H
Sbjct  382   EIPGKVVTEGRADASLVVRMVGTIANYDYVMDWEFKISGSIKLGVQTTGVVQVKATPYAH  441

Query  829   INQFEIPRWDFPAGSLVSENTIGVAHDHFITFHLDMDVDGPTNSFVKVDLVKNYNIAGKI  650
             ++Q      +   G+LV+ENT+GV HDH+IT++LD+D+DG  NSFV   L       G  
Sbjct  442   VDQIT----EDEHGTLVAENTMGVYHDHYITYYLDLDIDGSNNSFVNSKLKTVRVTDGGT  497

Query  649   QRKSYWSPKRKVAKSENDAKIKLQLDKPSEFHVINPRHQSRLGNPSGYKIVPS-ATAASL  473
              RKSYW+   + AK+E D ++ L   +P+   V+NP  +++LGN  GY+++ + ATA SL
Sbjct  498   PRKSYWTVVGETAKTEADGRVALG-SEPAYQLVVNPNKRTKLGNNVGYRLISNGATATSL  556

Query  472   LDLQDPPQLRAAFTNNQIWVTPYNRSEQWAGGLFTYQSHGDDTLAVWSNRNRVIEKQDIV  293
             L   D PQ+RA++T  Q+WVT YN+SE+WA GL+T QS GDD LAVWS RNRVIE +DIV
Sbjct  557   LSDDDYPQIRASYTKKQLWVTAYNKSERWAAGLYTDQSRGDDNLAVWSQRNRVIEDRDIV  616

Query  292   LWYTLGFHHLPCQEDFPVMPTVTSTFQLKPVNFFDRNPIIQANPN  158
             LWYT+GFHH+PCQEDFP+MPT+   F+L+P NFF+ NP+I+  P+
Sbjct  617   LWYTVGFHHIPCQEDFPLMPTLAGGFELRPYNFFESNPLIKIRPH  661



>ref|XP_003555339.1| PREDICTED: primary amine oxidase-like [Glycine max]
Length=677

 Score =   595 bits (1533),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 299/648 (46%), Positives = 414/648 (64%), Gaps = 21/648 (3%)
 Frame = -1

Query  2083  HPLDPLTIQEIERTRSILSSYQPFSGSSLRIHSLSLDEPDKSEVLRWKRGNPLPT-----  1919
             HP DPLT  E    R+I+ +  P S  +L  H ++LDEP+KSE+L W   NP        
Sbjct  27    HPQDPLTPSEFNDVRTIVQNAYPTS-HNLTFHYVALDEPNKSELLSWLSSNPKTKPTPSS  85

Query  1918  ----RKAFVVALSNGQAHLLVVDLGSGRVSSHTRNPASGYPPMSADDASTALEATFSNSV  1751
                 R+AF +  S  Q+H + VDL +  + S      +GYP ++  + + A    FS   
Sbjct  86    PPPPRRAFAIVRSQKQSHEITVDLSTRSIVSTKVYEGNGYPMLTLGEIAVATRLPFSYEP  145

Query  1750  FREAISTRGVEINDVVCSAAAPGWFGPEEEGRRITKVKCYTAQNTPNYYMRPIEGLLLTV  1571
             F+E+++ RG+ I+ V C+A + GWFG E +  R  K+KC+    T N+Y RP+EG+ + V
Sbjct  146   FKESVTKRGLNISLVRCNAYSFGWFG-EAKTVRSVKIKCHYRNGTTNFYARPLEGVAVLV  204

Query  1570  DLDSGKVINVYDTHSPIPIPKAQGTDYRRDGIEHRAPGVEPLKPISMEQPNGQSFRVEDG  1391
             D D+ K++  Y+    +P+PKA+GT+YR   +E   P    LK I+ +Q  G  F + DG
Sbjct  205   DFDNMKIVG-YNDRYVVPVPKAEGTEYRASKLE--PPFGPKLKGIAFKQDGGPGFTI-DG  260

Query  1390  YIVKWASWEFHVKADQRAGIIISQATVFDPEAGKRRSVMYKGFASELFVPYMDVDEGWYF  1211
             + V WA+W FHV  D RAG++ISQA+++D +  K R V+YKGF SELFVPY D  E WY+
Sbjct  261   HSVSWANWVFHVGFDIRAGLVISQASIYDLQKQKYRPVLYKGFVSELFVPYQDPSEEWYY  320

Query  1210  RAFMDAGEFGLGATAMELVPLNDCPRHSHYIDGLFVDPDGRPVSQPNVICVFERYSGDIA  1031
               F D+GE+GLG     L PL DCP ++ +ID  +   DG PV   N  C+FE+Y+GDI 
Sbjct  321   ATFFDSGEYGLGQYMSSLQPLTDCPPNAEFIDAYYASSDGTPVKISNAFCIFEKYAGDIM  380

Query  1030  WRHSGTGDADDDLIREARPKVSLVVRTTATVGNYDYIFDWEFQTDGSIRVTVGLSGIILA  851
             WRH+  G   D++I E R  VSLVVR  +TV NYDY+ DWEF+  GSI+  VGL+GI+  
Sbjct  381   WRHTEVG-IPDEVITEVRSDVSLVVRMVSTVANYDYVIDWEFKPSGSIKSVVGLTGILGL  439

Query  850   KGSPYEHINQFEIPRWDFPAGSLVSENTIGVAHDHFITFHLDMDVDGPTNSFVKVDLVKN  671
             K   Y + +Q +   +    G+L+++NTIG+ HDHF T++LD+D+DG  NSFVK +L   
Sbjct  440   KAGTYTNTDQIKEDIY----GTLIADNTIGIYHDHFFTYYLDLDIDGEANSFVKSNLETV  495

Query  670   YNIAGKIQRKSYWSPKRKVAKSENDAKIKLQLDKPSEFHVINPRHQSRLGNPSGYKIVPS  491
                     RKSYW+   + AK+E DAKI L   KPS+  V+NP  +S+ GN  GY+++P 
Sbjct  496   RVKDDTTPRKSYWTVVSETAKTEADAKINLG-SKPSQLLVVNPNKKSKQGNKIGYRLLPG  554

Query  490   ATAASLLDLQDPPQLRAAFTNNQIWVTPYNRSEQWAGGLFTYQSHGDDTLAVWSNRNRVI  311
               A  LL   D PQ+RAAFTN  +WVTPYN+SE+W GGL+  +S GDDTLAVWS RNR I
Sbjct  555   PAARPLLLNDDYPQIRAAFTNYDVWVTPYNKSEKWVGGLYVDRSRGDDTLAVWSRRNRKI  614

Query  310   EKQDIVLWYTLGFHHLPCQEDFPVMPTVTSTFQLKPVNFFDRNPIIQA  167
             E +DIVLWYT+GFHH+PCQEDFPVMPT++  F+L+P NFF+ NP+++ 
Sbjct  615   ENKDIVLWYTMGFHHVPCQEDFPVMPTLSGGFELRPTNFFESNPVLKT  662



>ref|XP_002278182.1| PREDICTED: primary amine oxidase [Vitis vinifera]
 emb|CBI26233.3| unnamed protein product [Vitis vinifera]
Length=667

 Score =   594 bits (1531),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 297/654 (45%), Positives = 418/654 (64%), Gaps = 15/654 (2%)
 Frame = -1

Query  2083  HPLDPLTIQEIERTRSILSSYQPFSGSSLRIHSLSLDEPDKSEVLRW----KRGNPLPTR  1916
             HPLD LT  E  + ++I+    P S  ++    + LDEPDKS VL W        P P R
Sbjct  23    HPLDSLTPSEFHQVQAIVKGSNPGSSLNMTFQYVGLDEPDKSIVLSWLSNPNSTTPPPPR  82

Query  1915  KAFVVALSNGQAHLLVVDLGSGRVSSHTRNPASGYPPMSADDASTALEATFSNSVFREAI  1736
             +AFV+   + Q H ++VDL +  + S       GYP +++++ + A     +   F  +I
Sbjct  83    RAFVITRLHSQTHEIIVDLSTQSIISDEVYGGHGYPLLTSEEQTAASVLPLTYPPFIASI  142

Query  1735  STRGVEINDVVCSAAAPGWFGPEEEGRRITKVKCYTAQNTPNYYMRPIEGLLLTVDLDSG  1556
             + R ++++DVVCS    GWFG E++ RR+ K+ C+    T N YMRPIEG+ + VDLD  
Sbjct  143   TKRSLKLSDVVCSTFTVGWFG-EDKSRRVLKIPCFYTDGTANLYMRPIEGVTIVVDLDDM  201

Query  1555  KVINVYDTHSPIPIPKAQGTDYRRDGIEHRAPGVEPLKPISMEQPNGQSFRVEDGYIVKW  1376
             K+I  YD    +P+P+A+GT+ R    +   P   PL  +S   P+G  F++ DG+ V+W
Sbjct  202   KIIEYYDRLM-VPVPEAEGTECRLS--KQNPPFGPPLNGVSAMPPDGPGFKI-DGHNVRW  257

Query  1375  ASWEFHVKADQRAGIIISQATVFDPEAGKRRSVMYKGFASELFVPYMDVDEGWYFRAFMD  1196
             A+W+FH+  D RAG+IIS A+++D + G  R V+Y+G  SELFVPYMD  E WY+R + D
Sbjct  258   ANWDFHISFDARAGLIISLASIYDLQKGTFRQVLYRGHVSELFVPYMDPTEEWYYRTYFD  317

Query  1195  AGEFGLGATAMELVPLNDCPRHSHYIDGLFVDPDGRPVSQPNVICVFERYSGDIAWRHSG  1016
              GEFGLG   + L P+ DCP ++ + DG +   DG+P+S  N  CV+E+ +G I WRH+ 
Sbjct  318   EGEFGLGICTVPLQPMLDCPPNAVFTDGYYASQDGKPMSISNAFCVYEQEAGRIMWRHTE  377

Query  1015  TGDADDDLIREARPKVSLVVRTTATVGNYDYIFDWEFQTDGSIRVTVGLSGIILAKGSPY  836
             T D   + I+E RP+VSLVVR    + NYDYI DWEF+  GSI+  VGL+GI   KG  Y
Sbjct  378   T-DIPGEEIKEVRPEVSLVVRMVVALTNYDYILDWEFKPSGSIKFGVGLTGIPAVKGVSY  436

Query  835   EHINQFEIPRWDFPAGSLVSENTIGVAHDHFITFHLDMDVDGPTNSFVKVDLVKNYNIAG  656
              H +Q +   +    G+L++ N IGV HDHF T+ LD+DVDG  NSFVK +L        
Sbjct  437   THTDQIKEDVY----GTLLAPNAIGVNHDHFFTYRLDLDVDGDANSFVKANLETKRVTDN  492

Query  655   KIQRKSYWSPKRKVAKSENDAKIKLQLDKPSEFHVINPRHQSRLGNPSGYKIVPSATAAS  476
                RKSYW+   + AK+E+DA+I+L+L KP E  V+NP  +++LGN  GY+++P + ++ 
Sbjct  493   SSPRKSYWTVVSETAKTESDAQIQLRL-KPVEQIVVNPNKKTKLGNYVGYRLIPGSLSSP  551

Query  475   LLDLQDPPQLRAAFTNNQIWVTPYNRSEQWAGGLFTYQSHGDDTLAVWSNRNRVIEKQDI  296
             LL   D PQ+R AFT   +W+TPYN+SE+WAGGL+  QS GDDTLAVWS RNR IE +DI
Sbjct  552   LLSDDDYPQIRGAFTKYDVWITPYNKSEKWAGGLYMDQSRGDDTLAVWSQRNREIENKDI  611

Query  295   VLWYTLGFHHLPCQEDFPVMPTVTSTFQLKPVNFFDRNPIIQANPNFAEDLPIC  134
             VLWYT+GFHH+PCQEDFPVMPT++  F+L+P NFF+ NP+++  P      P C
Sbjct  612   VLWYTIGFHHVPCQEDFPVMPTLSGGFELRPTNFFENNPVLKTKPPTPVSWPNC  665



>ref|XP_009413330.1| PREDICTED: primary amine oxidase-like [Musa acuminata subsp. 
malaccensis]
Length=679

 Score =   593 bits (1529),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 292/655 (45%), Positives = 417/655 (64%), Gaps = 15/655 (2%)
 Frame = -1

Query  2083  HPLDPLTIQEIERTRSILSSYQPFSGSSLRIHSLSLDEPDKSEVLRW----KRGNPLPTR  1916
             HPLDPLT  EI    +I+ S    S  SL  H + LDE DK +VL W    +     P R
Sbjct  31    HPLDPLTPSEISAVSNIIKSSHLGSSKSLSFHYVGLDELDKPDVLAWASTHRWNKAAPPR  90

Query  1915  KAFVVALSNGQAHLLVVDLGSGRVSSHTRNPASGYPPMSADDASTALEATFSNSVFREAI  1736
             +AFV+  S  + H + VD+ +  + S       GYP ++ ++   A    F  + F E++
Sbjct  91    RAFVIVRSEKKTHEIYVDITNHSIVSDKVYEGFGYPMLNFEEQEAASALPFDYAPFVESV  150

Query  1735  STRGVEINDVVCSAAAPGWFGPEEEGRRITKVKCYTAQNTPNYYMRPIEGLLLTVDLDSG  1556
               RG+E  DV+C+  + GWFG  ++GRR+ K++C+   +T N+Y RP+EG+ + VDLD+ 
Sbjct  151   KKRGLEPEDVLCTTFSVGWFGERKQGRRLLKIQCFLTGDTVNFYARPLEGVTVVVDLDAM  210

Query  1555  KVINVYDTHSPIPIPKAQGTDYRRDGIEHRAPGVEPLKPISMEQPNGQSFRVEDGYIVKW  1376
             +++  Y+    +P+P + GTDYR    + + P     KP  + QP G+ F V DG++++W
Sbjct  211   EIVE-YEDRMVVPVPGSTGTDYR--AAKQKPPLGPRTKPGIIVQPEGKGFEV-DGHMIRW  266

Query  1375  ASWEFHVKADQRAGIIISQATVFDPEAGKRRSVMYKGFASELFVPYMDVDEGWYFRAFMD  1196
             A+WEFH+  D RAG +IS A+V D E G  R V+++G+ SE+FVPYMD  E WY++ F D
Sbjct  267   ANWEFHLGYDVRAGTVISLASVKDSEKGIFRRVLHRGYVSEIFVPYMDPSEEWYYKTFFD  326

Query  1195  AGEFGLGATAMELVPLNDCPRHSHYIDGLFVDPDGRPVSQPNVICVFERYSGDIAWRHSG  1016
              GEFG G  A  L P+ DCP ++ ++D    D DG P+ Q N  CVFERYSGD +WRH+ 
Sbjct  327   VGEFGFGLLAAPLEPMTDCPANAAFMDAYITDRDGLPIKQSNAFCVFERYSGDASWRHTE  386

Query  1015  TGDADDDLIREARPKVSLVVRTTATVGNYDYIFDWEFQTDGSIRVTVGLSGIILAKGSPY  836
              G     +I E RP+VSLVVR  + +GNYDY+ DWEF+T GSI++ V L+GI+  KG+ Y
Sbjct  387   FG-IPGQVITEVRPEVSLVVRMVSAIGNYDYVIDWEFKTSGSIKLGVSLTGILEMKGTQY  445

Query  835   EHINQFEIPRWDFPAGSLVSENTIGVAHDHFITFHLDMDVDGPTNSFVKVDLVKNYNIAG  656
              H +Q    +     G+L++ NT+GV HDHF+TFHLD+DVDGP NSFVK  L        
Sbjct  446   THADQISGDQ----HGTLLAANTMGVYHDHFVTFHLDLDVDGPDNSFVKSKLKTVRVTDD  501

Query  655   KIQRKSYWSPKRKVAKSENDAKIKLQLDKPSEFHVINPRHQSRLGNPSGYKIVP-SATAA  479
                R+SYW+  ++ A++E DA ++L  + P+E  V+NP  ++++GN  GY+++   ATAA
Sbjct  502   SSPRRSYWTVAKETARTEADALVELGAE-PAELLVVNPSKKTKMGNDVGYRLISHGATAA  560

Query  478   SLLDLQDPPQLRAAFTNNQIWVTPYNRSEQWAGGLFTYQSHGDDTLAVWSNRNRVIEKQD  299
             SLL   D PQ+RA+++  Q+ VT YN+SE+WA GL+  +S GDD LA W+ RNRVIE  D
Sbjct  561   SLLSDDDYPQIRASYSKKQVRVTAYNKSEKWAAGLYADESRGDDNLAAWTARNRVIENTD  620

Query  298   IVLWYTLGFHHLPCQEDFPVMPTVTSTFQLKPVNFFDRNPIIQANPNFAEDLPIC  134
             IVLWYT+G HH+P QEDFPVMP ++  F+L+P NFF+ NP+I+   N    LP C
Sbjct  621   IVLWYTVGVHHVPYQEDFPVMPLLSGGFELRPANFFESNPLIKTPANKLVHLPNC  675



>ref|XP_004140256.1| PREDICTED: primary amine oxidase-like [Cucumis sativus]
 gb|KGN48005.1| hypothetical protein Csa_6G423470 [Cucumis sativus]
Length=668

 Score =   592 bits (1527),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 297/654 (45%), Positives = 417/654 (64%), Gaps = 15/654 (2%)
 Frame = -1

Query  2083  HPLDPLTIQEIERTRSILSSYQPFSGSSLRIHSLSLDEPDKSEVLRWKRG--NPLPTRKA  1910
             HP D L+  E E TRS++++  P   +++    ++L +P K  VL W      P P R+A
Sbjct  25    HPHDSLSPDEFELTRSLITNSNP--STNVTFQYVALADPPKQSVLAWLSNPKTPPPPRRA  82

Query  1909  FVVALSNGQAHLLVVDLGSGRVSSHTRNPASGYPPMSADDASTALEATFSNSVFREAIST  1730
               +   N   H +++DL    + S       GY P + ++   A     S+  F  A+  
Sbjct  83    TAIVRLNKATHEILIDLVKKSILSDQVYSGPGYAPFTFEEQFAAAALPLSHPPFEAAVKK  142

Query  1729  RGVEINDVVCSAAAPGWFGPEEE-GRRITKVKCYTAQNTPNYYMRPIEGLLLTVDLDSGK  1553
             RG++I  VVC   + GWFG + +  +RI KV+C+    + NYYMRP+EG+++ VDLD  K
Sbjct  143   RGLKIEKVVCICFSVGWFGEKRKMEKRIVKVQCFDLDGSLNYYMRPVEGVIVIVDLDEMK  202

Query  1552  VINVYDTHSPIPIPKAQGTDYRRDGIEHRAPGVEPLKPISMEQPNGQSFRVEDGYIVKWA  1373
             ++   D +  +P+PKA GT+YR   ++     + PL  I M QP+G SF++ DG+ + WA
Sbjct  203   IVGFRDRYR-VPMPKASGTEYRASKLKPPL--LPPLNGIKMVQPDGPSFKI-DGHSISWA  258

Query  1372  SWEFHVKADQRAGIIISQATVFDPEAGKRRSVMYKGFASELFVPYMDVDEGWYFRAFMDA  1193
             +W FH+  D+RAG IIS A+++D E  KRR VMY+GF SELFVPYMD++E WY+R F DA
Sbjct  259   NWNFHLSLDERAGPIISLASIYDIEKQKRRQVMYRGFISELFVPYMDLNEEWYYRTFFDA  318

Query  1192  GEFGLGATAMELVPLNDCPRHSHYIDGLFVDPDGRPVSQPNVICVFERYSGDIAWRHS-G  1016
             GE+ LG  A+ L PL DCP ++ ++D      DGRPV   N  C+FER++GDI WRH+ G
Sbjct  319   GEYALGQCAVSLQPLQDCPENAVFMDTYTAAGDGRPVKMSNTFCIFERHAGDIMWRHTEG  378

Query  1015  TGDADDDLIREARPKVSLVVRTTATVGNYDYIFDWEFQTDGSIRVTVGLSGIILAKGSPY  836
               +  +  I E R + SLVVR  ATV NYDYI DWEF+  GSI V +GL+G++  K S Y
Sbjct  379   NKNVPNTPITETRTETSLVVRMVATVANYDYIVDWEFKQSGSIAVDIGLTGLLAVKASKY  438

Query  835   EHINQFEIPRWDFPAGSLVSENTIGVAHDHFITFHLDMDVDGPTNSFVKVDLVKNYNIAG  656
              H +Q +   +    G L++ENTIGV HDHF+TFHLD+D+DG  NS VK +L    +   
Sbjct  439   THNDQIKEEVY----GPLLAENTIGVHHDHFVTFHLDLDMDGVANSAVKSNLRTVRSRDP  494

Query  655   KIQRKSYWSPKRKVAKSENDAKIKLQLDKPSEFHVINPRHQSRLGNPSGYKIVPSATAAS  476
                R SYW+   + AK+E+DA IKL   +  E  ++NP  ++++GNP GY+++P +TA  
Sbjct  495   NSPRLSYWTVIAETAKTEDDAMIKLG-HQEVEVSIVNPNQKTKVGNPVGYRLIPRSTAGP  553

Query  475   LLDLQDPPQLRAAFTNNQIWVTPYNRSEQWAGGLFTYQSHGDDTLAVWSNRNRVIEKQDI  296
             LL   D PQ+R AFTN  +WVTPYN SE+WA GLFT QSHGDDTLA W+ RNR IE +DI
Sbjct  554   LLSPDDYPQIRGAFTNYDVWVTPYNSSEKWASGLFTDQSHGDDTLATWTLRNRKIENEDI  613

Query  295   VLWYTLGFHHLPCQEDFPVMPTVTSTFQLKPVNFFDRNPIIQANPNFAEDLPIC  134
             V+WYT+GFHH+PCQED+P+MPT+   F+L+P NFF+ NP+++  P    +L  C
Sbjct  614   VMWYTMGFHHVPCQEDYPLMPTLKRGFELRPTNFFESNPVLKVTPPRIVNLTNC  667



>ref|XP_011091042.1| PREDICTED: primary amine oxidase-like [Sesamum indicum]
Length=669

 Score =   590 bits (1521),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 293/639 (46%), Positives = 419/639 (66%), Gaps = 17/639 (3%)
 Frame = -1

Query  2083  HPLDPLTIQEIERTRSILSSYQPFSGSSLRIHSLSLDEPDKSEVLRWKRG-NPLPTRKAF  1907
             HPL+PLT  E+ + ++I+ ++      S+  H + LDEP+KS +L W+   +  P R+AF
Sbjct  27    HPLNPLTPSELIQVQTIVKNHFSSPYHSVSFHYVGLDEPEKSIILLWQSNLDHTPPRRAF  86

Query  1906  VVALSNGQAHLLVVDLGSGRVSSHTRNPASGYPPMSADDASTALEATFSNSVFREAISTR  1727
             V+A  + ++H L+VDL +  +         GYP  +  +   A E  +S + F  +I  R
Sbjct  87    VIARFDQKSHELIVDLLTNSIVLDRVYDGHGYPIQNFQEEKAASELAYSYAPFIASIMRR  146

Query  1726  GVEINDVVCSAAAPGWFGPEEEGRRITKVKCYTAQNTPNYYMRPIEGLLLTVDLDSGKVI  1547
              +++ +V+C +   GWFG EE  RRI +V CY    T N+YMRPIEG+ +TVDLD  K+I
Sbjct  147   RLKLEEVLCMSFTVGWFG-EETSRRIVRVMCYYLDGTVNFYMRPIEGITVTVDLDEMKII  205

Query  1546  NVYDTHSPIPIPKAQGTDYRRDGIEHRAPGVEPLKPISMEQPNGQSFRVEDGYIVKWASW  1367
               Y     +P+PK+ GT+YR  G    AP    LK  +  +P   SF++E G++++W  W
Sbjct  206   G-YRDRIMVPVPKSDGTEYR--GSMQSAPPDSTLKGSASLEP---SFKLE-GHVLRWEDW  258

Query  1366  EFHVKADQRAGIIISQATVFDPEAGKRRSVMYKGFASELFVPYMDVDEGWYFRAFMDAGE  1187
               H+  D RAG+IIS A+++DPE  + R V+Y+GF SELFVPYMD+ E WY+R F DAGE
Sbjct  259   VLHLSFDMRAGLIISLASIYDPEKNEYRRVLYRGFISELFVPYMDLTEEWYYRTFFDAGE  318

Query  1186  FGLGATAMELVPLNDCPRHSHYIDGLFVDPDGRPVSQPNVICVFERYSGDIAWRHSGTGD  1007
              G G  A+ LVPL DCP ++ ++DG F   DG P   PNV C+FER +G++ WRH+  G 
Sbjct  319   NGFGLCAVPLVPLKDCPENAVFMDGYFTSQDGTPGYIPNVFCIFERQAGNVMWRHTELG-  377

Query  1006  ADDDLIREARPKVSLVVRTTATVGNYDYIFDWEFQTDGSIRVTVGLSGIILAKGSPYEHI  827
                 ++ E RP+ +LVVR  +TVGNYDYI DWEF+  G+I+VTVG++G++  +GS Y H 
Sbjct  378   IPGQMVTEVRPETTLVVRMVSTVGNYDYIVDWEFKQTGTIKVTVGMTGLLEVRGSMYTHK  437

Query  826   NQFEIPRWDFPAGSLVSENTIGVAHDHFITFHLDMDVDGPTNSFVKVDLVKNYNIAGKIQ  647
             +Q +   +    G++++ENTIG  HDHF+ F LD+DVDG  NSFVK +L +   + G I 
Sbjct  438   DQIQEEVY----GTILAENTIGAHHDHFLIFSLDLDVDGDANSFVKSNL-ETSRVNGDIS  492

Query  646   -RKSYWSPKRKVAKSENDAKIKLQLDKPSEFHVINPRHQSRLGNPSGYKIVPSATAASLL  470
              RKSYW    + AK+E+DA+I+L     +E  V+NP  ++++GN  GY++ P + A  LL
Sbjct  493   PRKSYWRVSSETAKTESDARIQLG-SGATELLVVNPNKKTKVGNHVGYRLFPGSAARPLL  551

Query  469   DLQDPPQLRAAFTNNQIWVTPYNRSEQWAGGLFTYQSHGDDTLAVWSNRNRVIEKQDIVL  290
                +  Q+R AFT   +WVTPYN++E+WAGGL+  QS GDD LA WS RNR IE +DIVL
Sbjct  552   SDDEYAQIRGAFTKYNVWVTPYNKTEKWAGGLYADQSRGDDNLASWSLRNRDIENKDIVL  611

Query  289   WYTLGFHHLPCQEDFPVMPTVTSTFQLKPVNFFDRNPII  173
             WYT+GFHH+PCQEDFPVMPT+T +F+L+P NFF+ NP++
Sbjct  612   WYTVGFHHVPCQEDFPVMPTLTESFELRPTNFFEHNPML  650



>gb|KDO74629.1| hypothetical protein CISIN_1g005872mg [Citrus sinensis]
Length=663

 Score =   589 bits (1518),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 297/647 (46%), Positives = 410/647 (63%), Gaps = 26/647 (4%)
 Frame = -1

Query  2083  HPLDPLTIQEIERTRSILSSYQPFSGS-SLRIHSLSLDEPDKSEVLRWKRGNPL--PTRK  1913
             HPLD LT  E  + RSI++   P S +  L    + L+EP K  V+ W +      P R+
Sbjct  28    HPLDSLTPSEFSQIRSIVTKAYPESSTHKLTFQYVGLEEPSKQTVISWLKNETTTNPPRQ  87

Query  1912  AFVVALSNGQAHLLVVDLGSGRVSSHTRNPASGYPPMSADDASTALEATFSNSVFREAIS  1733
             AFV+A  + Q H L+VDL    ++S       GYP  + +D   A +  F+   F  +I 
Sbjct  88    AFVIARIDHQTHELIVDLSLQEIASKRIYSGYGYPMFTFEDQENADKLAFTYPPFVASIR  147

Query  1732  TRGVEINDVVCSAAAPGWFGPEEE----GRRITKVKCYTAQNTPNYYMRPIEGLLLTVDL  1565
              RG+++ +VVC + + GW+G EEE     +RI KV CY    T N +MRPIEG+ +TVDL
Sbjct  148   RRGLKLEEVVCESFSVGWYGAEEEEGKNKKRIVKVMCYYMNGTVNLFMRPIEGISMTVDL  207

Query  1564  DSGKVINVYDTHSPIPIPKAQGTDYRRDGIEHRAPGVEPLKPISMEQPNGQSFRVEDGYI  1385
             D  K+I   D  + +P+PKA  T++R   I  + P  + LK I++ QP+G SF + DG++
Sbjct  208   DEMKIIGFQDRVT-VPVPKADETEFRESKI--KPPFRQSLKAITVVQPDGPSFTI-DGHM  263

Query  1384  VKWASWEFHVKADQRAGIIISQATVFDPEAGKRRSVMYKGFASELFVPYMDVDEGWYFRA  1205
             + +         D RAG+IIS A+++D E  + R V+YKG  SE+FVPYMD+ E W  R 
Sbjct  264   ISF---------DVRAGMIISLASIYDLEKQQSRRVLYKGHVSEMFVPYMDLTEEWQRRT  314

Query  1204  FMDAGEFGLGATAMELVPLNDCPRHSHYIDGLFVDPDGRPVSQPNVICVFERYSGDIAWR  1025
             F DAGE+G G  +M L PL DCP ++ ++D  F   DG P   P   C+FERY+GDI WR
Sbjct  315   FFDAGEYGYGLCSMTLEPLRDCPPNAVFMDAYFSKQDGMPRKIPKAFCIFERYAGDIMWR  374

Query  1024  HSGTGDADDDLIREARPKVSLVVRTTATVGNYDYIFDWEFQTDGSIRVTVGLSGIILAKG  845
             H+         +RE R  VSLVVRT +T GNYDY+ DWEF+  GSI+VTVGL+G++  +G
Sbjct  375   HT-EATIPGKTVREVRQDVSLVVRTVSTFGNYDYVNDWEFKQSGSIKVTVGLTGMVQVRG  433

Query  844   SPYEHINQFEIPRWDFPAGSLVSENTIGVAHDHFITFHLDMDVDGPTNSFVKVDLVKNYN  665
             + Y H +  E   +    G+LV+EN+I + HDHF+T+ LD+DVDG  NSFV+  L     
Sbjct  434   TTYTHKDHMEEDVY----GTLVAENSIAIHHDHFLTYRLDLDVDGDANSFVRSKLRTTRV  489

Query  664   IAGKIQRKSYWSPKRKVAKSENDAKIKLQLDKPSEFHVINPRHQSRLGNPSGYKIVPSAT  485
                +  RKSYW+   K AK+E+DA+IKL   +P+E   +NP  ++++GN  GY+++P   
Sbjct  490   NDRRSSRKSYWTVDSKTAKTESDARIKLG-SEPAELLFVNPNKKTKMGNLIGYRLIPEGV  548

Query  484   AASLLDLQDPPQLRAAFTNNQIWVTPYNRSEQWAGGLFTYQSHGDDTLAVWSNRNRVIEK  305
               +LL   D PQ+RAAFTN  +WVT YN+SE+WAGGL+  QSHGDDTLAVWSNRNR IE 
Sbjct  549   TGALLSSDDHPQIRAAFTNYNVWVTAYNKSEKWAGGLYADQSHGDDTLAVWSNRNRSIEN  608

Query  304   QDIVLWYTLGFHHLPCQEDFPVMPTVTSTFQLKPVNFFDRNPIIQAN  164
             +DIVLWYTLGFHH+P QEDFPVMPT+   F+L+P NFF+ NP+++  
Sbjct  609   KDIVLWYTLGFHHVPYQEDFPVMPTLNGGFELRPSNFFESNPVLKVK  655



>emb|CAN68223.1| hypothetical protein VITISV_040530 [Vitis vinifera]
Length=1265

 Score =   608 bits (1568),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 300/654 (46%), Positives = 427/654 (65%), Gaps = 27/654 (4%)
 Frame = -1

Query  2083  HPLDPLTIQEIERTRSILSSYQPFSGSSLRIHSLSLDEPDKSEVLRW---KRGNPLPTRK  1913
             HPLDPLT+QE+++ R+I+++    S  +L  H + LDEPDKS V+ W   +     P R+
Sbjct  30    HPLDPLTLQELDQVRTIITA----SHHNLTFHYVGLDEPDKSIVVSWLAHRTTAKTPPRR  85

Query  1912  AFVVALSNGQAHLLVVDLGSGRVSSHTRNPASGYPPMSADDASTALEATFSNSVFREAIS  1733
             A V+A  N Q H  +VDL +  + S      SG+P ++ ++ + A     +++ FR ++ 
Sbjct  86    ALVIARLNHQTHQFIVDLSTHSIVSDEIYSGSGFPMLTFEEQTAANSLALTHAPFRASVG  145

Query  1732  TRGVEINDVVCSAAAPGWFGPEEEGRRITKVKCYTAQNTPNYYMRPIEGLLLTVDLDSGK  1553
              RG+++ ++V  +   GW+G E   RRI KV       T N YMRPIEG+ +TVDLD  K
Sbjct  146   RRGLKMEEIVGLSYTVGWYGEEGTSRRIVKVMFCYLDGTVNLYMRPIEGITVTVDLDEMK  205

Query  1552  VINVYDTHSPIPIPKAQGTDYRRDGIEHRAPGVEPLKPISMEQPNGQSFRVEDGYIVKWA  1373
             VI  +D    +P+PKA GTD+R    + + P    LK I++ QP G SF +  G+ + WA
Sbjct  206   VIAYHD-RLMVPVPKADGTDFRES--KQKPPFGPRLKGITVVQPEGPSFTIH-GHQISWA  261

Query  1372  SWEFHVKADQRAGIIISQATVFDPEAGKRRSVMYKGFASELFVPYMDVDEGWYFRAFMDA  1193
             +W+FH+  D RAG IIS A+++D E  ++R V+Y+G+ SELFVPYMD+ E WYFR F DA
Sbjct  262   NWDFHLAFDMRAGPIISVASIYDVEKKEQRRVLYRGYISELFVPYMDLTEEWYFRTFFDA  321

Query  1192  GEFGLGATAMELVPLNDCPRHSHYIDGLFVDPDGRPVSQPNVICVFERYSGDIAWRHSGT  1013
             GE+G G  AM L PL DCP ++ ++DG     +G PV+  NV C+FERY+GDI WRH+  
Sbjct  322   GEYGFGLCAMPLQPLTDCPENAVFMDGYVTGQNGTPVNMTNVFCIFERYAGDIMWRHT-E  380

Query  1012  GDADDDL----------IREARPKVSLVVRTTATVGNYDYIFDWEFQTDGSIRVTVGLSG  863
              +    L          I E+RP+VSLVVR  + VGNYDYI DWEF   GSI+++VG SG
Sbjct  381   AEIPGKLVSVFSRLISDITESRPEVSLVVRMVSAVGNYDYIIDWEFLQSGSIKLSVGSSG  440

Query  862   IILAKGSPYEHINQFEIPRWDFPAGSLVSENTIGVAHDHFITFHLDMDVDGPTNSFVKVD  683
             ++  +G+ Y H++Q     +    G+L+++NT+G  HDHF+T+HLD+DVDG TNSFVK +
Sbjct  441   VLEVRGTAYTHVDQIHEEVY----GTLLADNTLGAYHDHFLTYHLDLDVDGDTNSFVKSN  496

Query  682   LVKNYNIAGKIQRKSYWSPKRKVAKSENDAKIKLQLDKPSEFHVINPRHQSRLGNPSGYK  503
             L K      +  R+SYW+   + AK E+DAKI+L L KP+E  V+NP  ++++GN  GY+
Sbjct  497   LRKTLVSGNRSPRRSYWTVVSETAKRESDAKIQLGL-KPAELLVVNPNKRTKVGNYVGYR  555

Query  502   IVPSATAASLLDLQDPPQLRAAFTNNQIWVTPYNRSEQWAGGLFTYQSHGDDTLAVWSNR  323
             ++P +    LL   D  Q R AFT   +W+TPYN+SE+W GGL+T QS GDDTLA WS R
Sbjct  556   LIPGSVVGPLLTDDDYSQRRGAFTRYNVWITPYNKSEKWVGGLYTDQSRGDDTLAQWSLR  615

Query  322   NRVIEKQDIVLWYTLGFHHLPCQEDFPVMPTVTSTFQLKPVNFFDRNPIIQANP  161
             +R IE +DIV+WYT+GFHH+P QEDFP+MPT++  F+L+P NFFD NP+++  P
Sbjct  616   DREIENKDIVMWYTMGFHHVPYQEDFPLMPTISGGFELRPSNFFDSNPVLKVKP  669


 Score =   506 bits (1303),  Expect = 1e-158, Method: Compositional matrix adjust.
 Identities = 258/608 (42%), Positives = 373/608 (61%), Gaps = 25/608 (4%)
 Frame = -1

Query  1975  DEPDKSEVLRW----KRGNPLPTRKAFVVALSNGQAHLLVVDLGSGRVSSHTRNPASGYP  1808
             ++P+K +VL+W    K     P R+A VV  + G+   LVVDL +  ++S       GYP
Sbjct  677   NDPEKRDVLKWLSSNKHNESFP-RRAKVVVRAGGETRELVVDLATNSITSEHVYRGHGYP  735

Query  1807  PMSADDASTALEATFSNSVFREAISTRGVEINDVVCSAAAPGWFGPEEEGRRITKVKCYT  1628
             P +  +   A +    +  F+ +I  RG+ +++V C     GWFG E   +R  K+  + 
Sbjct  736   PFTYQELYQASQLPKKDPRFKNSILRRGLNLSEVSCIPLTVGWFG-ELVAKRALKIASFY  794

Query  1627  AQNTPNYYMRPIEGLLLTVDLDSGKVINVYDTHSPIPIPKAQGTDYRRDGIEHRAPGVEP  1448
                T N Y RPI G+ + +D+++ ++I   D    + +P A+G+DY+             
Sbjct  795   RGGTVNIYARPIGGISILIDVETMQIIEYIDRFKTV-VPPAKGSDYQS----------TK  843

Query  1447  LKPISMEQPNGQSFRVEDGYIVKWASWEFHVKADQRAGIIISQATVFDPEAGKRRSVMYK  1268
              KP S      +     +G+ V+W +W FHV  + RAG+IIS A+V+D +  + R V+Y+
Sbjct  844   QKPSSFPCNETERGFTMEGHKVRWGNWMFHVGFNARAGVIISTASVYDAKQKRFRRVLYR  903

Query  1267  GFASELFVPYMDVDEGWYFRAFMDAGEFGLGATAMELVPLNDCPRHSHYIDGLFVDPDGR  1088
             G  SE FVPYMD    WYFR FMD GE+G G +A  L PL DCP ++ Y+DG     DGR
Sbjct  904   GHVSETFVPYMDPTSEWYFRTFMDMGEYGFGRSADTLEPLADCPGNAVYMDGYMAGADGR  963

Query  1087  PVSQPNVICVFERYSGDIAWRHSGTGDADDDLIREARPKVSLVVRTTATVGNYDYIFDWE  908
             P      IC+FER+SGD+AWRH+  G      IR   P+V+LVVR  ATVGNYDY+ DWE
Sbjct  964   PQKVDRAICIFERHSGDVAWRHTEIG-VPGRTIRRVEPEVNLVVRMVATVGNYDYVLDWE  1022

Query  907   FQTDGSIRVTVGLSGIILAKGSPYEHINQFEIPRWDFPAGSLVSENTIGVAHDHFITFHL  728
             FQ  GSI+V VGL+G++  K + Y + +Q    R D   G+L++++ + V HDHF+T++L
Sbjct  1023  FQQSGSIKVGVGLTGVLEMKATSYTNTDQI---RKDV-FGTLLADDIVAVNHDHFLTYYL  1078

Query  727   DMDVDGPTNSFVKVDL--VKNYNIAGKIQRKSYWSPKRKVAKSENDAKIKLQLDKPSEFH  554
             D+DVDG  NSF+K  L   K  ++  K  RKSYWS  +K+AK+E + +I+L   KP+E  
Sbjct  1079  DLDVDGMDNSFIKAKLGTRKTTSVGIKSPRKSYWSVVKKMAKTEAEGRIRLG-SKPAELL  1137

Query  553   VINPRHQSRLGNPSGYKIVPSATAASLLDLQDPPQLRAAFTNNQIWVTPYNRSEQWAGGL  374
             V+N   +++ GN  GY+++      SLL   D PQ+R A+T  Q+WVT YN+SE+WAGG 
Sbjct  1138  VVNTNKKTKTGNYVGYRLIAGQPVYSLLSDDDYPQIRVAYTKYQMWVTAYNKSERWAGGF  1197

Query  373   FTYQSHGDDTLAVWSNRNRVIEKQDIVLWYTLGFHHLPCQEDFPVMPTVTSTFQLKPVNF  194
             +  +S GDD LAVWSNRNR I  +D+V+WYT+GFHH+P QED+P MPT+   FQL+P NF
Sbjct  1198  YADRSRGDDELAVWSNRNRSIANKDVVVWYTVGFHHIPYQEDYPAMPTLHDGFQLRPANF  1257

Query  193   FDRNPIIQ  170
             F+RNP+++
Sbjct  1258  FERNPLLR  1265



>ref|XP_010024341.1| PREDICTED: primary amine oxidase-like [Eucalyptus grandis]
Length=674

 Score =   589 bits (1518),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 296/667 (44%), Positives = 429/667 (64%), Gaps = 20/667 (3%)
 Frame = -1

Query  2143  SLLGIHDFKIQNNHFADRPMHPLDPLTIQEIERTR-SILSSYQPFSGSSLRIHSLSLDEP  1967
             SLL I  F    +  +    HPLDPLT +E    R +++ SY   S  ++  H + LDEP
Sbjct  10    SLLSITLFSFLISPASSLHEHPLDPLTPEEFSLIRHAVMRSYGA-SSENVTFHYVGLDEP  68

Query  1966  DKSEVLRW---KRGNPLPTRKAFVVALSNGQAHLLVVDLGSGR--VSSHTRNPASGYPPM  1802
             DK  +  W   +     P R+A VV   + Q H L+VDL S R  + S      +G+P +
Sbjct  69    DKPLIYSWMLNQTDKMPPPRRASVVLRFHEQTHELIVDLSSHRPSIVSKEVYHGNGFPML  128

Query  1801  SADDASTALEATFSNSVFREAISTRGVEINDVVCSAAAPGWFGPEEEGRRITKVKCYTAQ  1622
             + ++ + A +   ++  F  +I  RG+ ++DVVC+    GW+G E   RR+ KV  Y   
Sbjct  129   TLEEQTAASDLPRTHDQFIRSIEKRGLNMSDVVCACYTVGWYG-EPRSRRVMKVLAYYTN  187

Query  1621  NTPNYYMRPIEGLLLTVDLDSGKVINVYDTHSPIPIPKAQGTDYRRDGIEHRAPGVEP-L  1445
              T N+YMRPIEG+++ VDL+  K++  +D  +   +P A+ T+YR   +E + P   P L
Sbjct  188   GTVNFYMRPIEGIVMVVDLELMKIVKYHDRFATT-VPTAEDTEYR---LEKQNPPFGPHL  243

Query  1444  KPISMEQPNGQSFRVEDGYIVKWASWEFHVKADQRAGIIISQATVFDPEAGKRRSVMYKG  1265
             K  ++ QP+G  F ++ G+ + WA+W+FH+  D R G IIS A+++D E  K R V+Y+ 
Sbjct  244   KGAAIVQPHGPGFEIK-GHTISWANWKFHIGFDSRVGPIISLASIYDLEKDKYRQVLYRA  302

Query  1264  FASELFVPYMDVDEGWYFRAFMDAGEFGLGATAMELVPLNDCPRHSHYIDGLFVDPDGRP  1085
             + SE+FVPYMD  E WY++ + D GEFG G +A+ L P  DCP ++ ++DG +   DG P
Sbjct  303   YVSEVFVPYMDPTEEWYYKTYFDCGEFGFGLSAVSLQPGVDCPNNAIFMDGFYAGQDGTP  362

Query  1084  VSQPNVICVFERYSGDIAWRHSGTGDADDDLIREARPKVSLVVRTTATVGNYDYIFDWEF  905
             V   NV CVFE+Y+G+I WRH+ TG   D+ IRE R  VSLVVR+ +TVGNYDYI DWEF
Sbjct  363   VKISNVTCVFEKYAGNIMWRHTETG-IPDETIREVRSDVSLVVRSVSTVGNYDYILDWEF  421

Query  904   QTDGSIRVTVGLSGIILAKGSPYEHINQFEIPRWDFPAGSLVSENTIGVAHDHFITFHLD  725
             +  GSI+  VGL+G++  K   Y   +Q +   +    G++V  NTI   HDHF+T+HLD
Sbjct  422   KPSGSIKFEVGLTGLLEVKAVNYTQASQIKEDEY----GTMVGANTIATHHDHFLTYHLD  477

Query  724   MDVDGPTNSFVKVDLVKNYNIAGKIQRKSYWSPKRKVAKSENDAKIKLQLDKPSEFHVIN  545
             +DVDG  NSFVK +L+        + RKSYW+   K A++E++A++ L L+ P +  V+N
Sbjct  478   LDVDGAPNSFVKTNLITKPVAEEGVPRKSYWTVSSKTARTESEAQLHLGLE-PCDLIVVN  536

Query  544   PRHQSRLGNPSGYKIVPSATAASLLDLQDPPQLRAAFTNNQIWVTPYNRSEQWAGGLFTY  365
             P  Q+++GN  GY+++P   A+++L   D PQ+RAAFT+N +WVTPYN+SE+WAGG +  
Sbjct  537   PNKQTKVGNNVGYRLIPGPLASTILFRDDYPQIRAAFTDNNLWVTPYNKSEKWAGGRYVD  596

Query  364   QSHGDDTLAVWSNRNRVIEKQDIVLWYTLGFHHLPCQEDFPVMPTVTSTFQLKPVNFFDR  185
             QS GDDTLAVW+ RNR IE +DIVLWYTLGFHH+PCQEDFP+MPT+++ F+L+P NFFDR
Sbjct  597   QSRGDDTLAVWAKRNRRIENEDIVLWYTLGFHHVPCQEDFPIMPTLSAGFELRPSNFFDR  656

Query  184   NPIIQAN  164
             NP+++  
Sbjct  657   NPVLKTK  663



>ref|XP_011090716.1| PREDICTED: primary amine oxidase-like [Sesamum indicum]
Length=669

 Score =   588 bits (1516),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 296/644 (46%), Positives = 407/644 (63%), Gaps = 20/644 (3%)
 Frame = -1

Query  2086  MHPLDPLTIQEIERTRSILSSYQPFSGSSLRIHSLSLDEPDKSEVLRWKRGNPLPT----  1919
             +HPLDPLT  E+ + R++++     S   +  H + LDEPDK +VL W   N  P     
Sbjct  29    VHPLDPLTPSELNQVRTLITK----SHQDVTFHYVGLDEPDKPKVLSWLSRNQPPNFFHH  84

Query  1918  RKAFVVALSNGQAHLLVVDLGSGRVSSHTRNPASGYPPMSADDASTALEATFSNSVFREA  1739
             R AF +  +N Q H + +DL S  + S       GYP ++ ++ + A E       F  +
Sbjct  85    RIAFAIVRTNSQTHEIKIDLSSNLILSDKVYDGDGYPMLNNEEQTAAGELPLKYPPFIAS  144

Query  1738  ISTRGVEINDVVCSAAAPGWFGPEEEGRRITKVKCYTAQNTPNYYMRPIEGLLLTVDLDS  1559
             I  RG+ +++V+C     GW+G E+  +R   V CY    T N+YMRPI+G++ TVDLD 
Sbjct  145   IKKRGLNLSEVLCEVFTIGWYG-EKNTKRAVAVMCYYVDGTVNFYMRPIDGIMATVDLDK  203

Query  1558  GKVINVYDTHSPIPIPKAQGTDYRRDGIEHRAPGVEPLKPISMEQPNGQSFRVEDGYIVK  1379
              K+I  Y     IP+PKA  TDYR    +        +K +++ QPNG SF + DG  V+
Sbjct  204   MKIIQ-YRDRLMIPVPKADDTDYRESKQDTHFD--TRIKSMTISQPNGPSFTI-DGNNVR  259

Query  1378  WASWEFHVKADQRAGIIISQATVFDPEAGKRRSVMYKGFASELFVPYMDVDEGWYFRAFM  1199
             WA+W+FH+  D R G IIS A+++D +  K R VMY+G+ SELFVPY D+ E WYFR F+
Sbjct  260   WANWKFHLAFDMRVGPIISLASIYDHDMHKYRKVMYRGYISELFVPYQDLSEEWYFRTFL  319

Query  1198  DAGEFGLGATAMELVPLNDCPRHSHYIDGLFVDPDGRPVSQPNVICVFERYSGDIAWRHS  1019
             DAGEFG G  A+ L P  DCP ++ ++DG +   DG P    NV CVFERY+GDI WRHS
Sbjct  320   DAGEFGFGICAVPLQPSTDCPPNAVFMDGYYTTRDGTPAKTSNVFCVFERYAGDIMWRHS  379

Query  1018  GTGDADDDLIREARPKVSLVVRTTATVGNYDYIFDWEFQTDGSIRVTVGLSGIILAKGSP  839
              T    D +  E RP V+LV+R  +TV NYDYI DWEF+  GSI+VT  LSG++  KGS 
Sbjct  380   ETILPGDTV--EVRPDVTLVIRMVSTVANYDYIIDWEFKQSGSIKVTTSLSGMLAVKGSA  437

Query  838   YEHINQFEIPRWDFPAGSLVSENTIGVAHDHFITFHLDMDVDGPTNSFVKVDLVKNYNIA  659
             Y H +Q +    + P G++V+ENTIG  H HF++FHLD+D+DG  NS VK  L       
Sbjct  438   YTHKDQIQ----EEPYGTIVAENTIGTRHSHFLSFHLDLDIDGDANSLVKAHLQTVRLTN  493

Query  658   GKIQRKSYWSPKRKVAKSENDAKIKLQLDKPSEFHVINPRHQSRLGNPSGYKIVPSATAA  479
             G   RKSYW    +VAK+E+DAKI+L     +E  V+NP  ++++GN  GY+++P + A 
Sbjct  494   GSSPRKSYWKVVEEVAKTESDAKIRLGTGA-TEIIVVNPNKKTKVGNNIGYRLIPGSLAG  552

Query  478   SLLDLQDPPQLRAAFTNNQIWVTPYNRSEQWAGGLFTYQSHGDDTLAVWSNRNRVIEKQD  299
              LL   D  Q+R AF+N  +WVTPYN+SE+WA G++  Q+ GDDTLA W+ RNR IE +D
Sbjct  553   PLLWEDDHEQIRGAFSNYNVWVTPYNKSEKWAAGVYIDQAPGDDTLAKWTLRNRDIENKD  612

Query  298   IVLWYTLGFHHLPCQEDFPVMPTVTSTFQLKPVNFFDRNPIIQA  167
             IVLWYTLGFHH P QED+P+MPT++  F+L+P NFFDRNP+++ 
Sbjct  613   IVLWYTLGFHHAPQQEDYPIMPTLSGGFELRPANFFDRNPVLKV  656



>ref|XP_010326883.1| PREDICTED: LOW QUALITY PROTEIN: primary amine oxidase-like [Solanum 
lycopersicum]
Length=657

 Score =   587 bits (1514),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 302/644 (47%), Positives = 418/644 (65%), Gaps = 20/644 (3%)
 Frame = -1

Query  2083  HPLDPLTIQEIERTRSIL-SSYQPFSGSSLRIHSLSLDEPDKSEVLRWKRGNPLPT--RK  1913
             HPL+ LT+ E+ +  +I+ +SY P +   +  H + L+EP+K  VL W      P+  R+
Sbjct  27    HPLESLTLFELTQVTNIVKNSYFPLN---VTFHYVGLNEPNKQLVLSWLSSTHHPSLPRE  83

Query  1912  AFVVALSNGQAHLLVVDLGSGRVSSHTRNPASGYPPMSADDASTALEATFSNSVFREAIS  1733
             A V+   + + H ++VDL S  + S       GYP ++  + + A E   S   F  +I 
Sbjct  84    AIVITRIDQKTHEIIVDLSSVSILSDKIYNGHGYPMLTLQEQTAANELPLSYPPFISSIK  143

Query  1732  TRGVEINDVVCSAAAPGWFGPEEEG-RRITKVKCYTAQNTPNYYMRPIEGLLLTVDLDSG  1556
              R +++ +V C     GW+G E++   R+ KV CY    T N YMRPIEG+ + V LD  
Sbjct  144   KRRLKLKEVACQGYPVGWYGEEKKSTNRMVKVICYYLDGTVNLYMRPIEGITIIVLLDQM  203

Query  1555  KVINVYDTHSPIPIPKAQGTDYRRDGIEHRAPGVEPLKPISMEQPNGQSFRVEDGYIVKW  1376
              + +  D    +P+PKA GTDY   G + R    E    I + QP+G SF ++DG  V+W
Sbjct  204   TIASYID-RLIVPVPKANGTDYM--GSKRRRSSHES-NSIKIVQPDGPSFTLDDGNTVRW  259

Query  1375  ASWEFHVKADQRAGIIISQATVFDPEAGKRRSVMYKGFASELFVPYMDVDEGWYFRAFMD  1196
               W+FHV  D RAGIIIS A++FD + G+ RSVMY+GFASE+FVPYMD+ E WY+R + +
Sbjct  260   VDWKFHVAYDMRAGIIISLASMFDDDKGEFRSVMYRGFASEVFVPYMDLTEEWYYRTYFN  319

Query  1195  AGEFGLGATAMELVPLNDCPRHSHYIDGLFVDPDGRPVSQPNVICVFERYSGDIAWRHSG  1016
             AGEFG G  A+EL P  DCP ++ +IDG F+  DG P   PNVIC+FERY+GDI WRH  
Sbjct  320   AGEFGFGLCAVELEPSKDCPENAKFIDGYFISQDGTPGKMPNVICIFERYAGDIMWRH--  377

Query  1015  TGDA-DDDLIREARPKVSLVVRTTATVGNYDYIFDWEFQTDGSIRVTVGLSGIILAKGSP  839
             T DA   + IR+ RP+VSLVVR  +TVGNYDYI D+EF+  G+I+VTVGL+G++  +GS 
Sbjct  378   TEDAIPGEKIRKIRPEVSLVVRMVSTVGNYDYITDYEFKXSGTIKVTVGLTGLLEVRGSI  437

Query  838   YEHINQFEIPRWDFPAGSLVSENTIGVAHDHFITFHLDMDVDGPTNSFVKVDLVKNYNIA  659
             Y H +Q +   +    G+L++ENT+G  HDHF T+HLD+DVDG  NSFVK +L     I 
Sbjct  438   YTHSDQIKEEVY----GTLIAENTLGAYHDHFFTYHLDLDVDGHENSFVKNNLKTRRVIH  493

Query  658   GKIQRKSYWSPKRKVAKSENDAKIKLQLDKPS-EFHVINPRHQSRLGNPSGYKIVPSATA  482
                 RKSYW+   + A++E+DAKI+L   + + E  V+NP  ++ +GN  GY ++P  +A
Sbjct  494   KSSPRKSYWTVVSETAETESDAKIQLGSSRGAFEMVVVNPNKKTEIGNEIGYCLIPGGSA  553

Query  481   AS-LLDLQDPPQLRAAFTNNQIWVTPYNRSEQWAGGLFTYQSHGDDTLAVWSNRNRVIEK  305
              S LL   D PQ R  FT   +WVTPYN+SE+WAGGL+T QSHGDDTLAVWS R+R I+ 
Sbjct  554   TSPLLSDNDYPQARGGFTKYNVWVTPYNKSEKWAGGLYTDQSHGDDTLAVWSLRDRKIKN  613

Query  304   QDIVLWYTLGFHHLPCQEDFPVMPTVTSTFQLKPVNFFDRNPII  173
             +DI+LWYT G HH+P QEDFP+MPT+++ F+LKP NFF  NP++
Sbjct  614   KDIILWYTFGVHHVPKQEDFPIMPTLSTGFELKPTNFFQHNPVL  657



>ref|NP_001145964.1| primary amine oxidase precursor [Zea mays]
 gb|ACL52946.1| unknown [Zea mays]
 tpg|DAA41168.1| TPA: primary amine oxidase [Zea mays]
Length=708

 Score =   588 bits (1516),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 302/657 (46%), Positives = 415/657 (63%), Gaps = 35/657 (5%)
 Frame = -1

Query  2077  LDPLTIQEIERTRSILSSYQPFSGSSLRIHSLSLDEPDKSEVLRWKRGN------PLPTR  1916
             LDPLT  EI   R+ + +        L  H + LDEPDK +VL +  G       PL  R
Sbjct  47    LDPLTPDEITAVRAAVLASPRVPARPLTFHYVGLDEPDKPDVLAYAYGGSGSSSRPLLPR  106

Query  1915  KAFVVALSNGQAHLLVVDLGSGRVS----SHTRNPASGYPPMSADDASTALEATFSNSVF  1748
             +A V+A + GQ+H L V + S   S    SH  +  +G+P ++ ++   A+    +   F
Sbjct  107   RALVIARAGGQSHELRVSVASNGTSAAVLSHAVHSGAGFPVLTLEEQFAAVALPQAYPPF  166

Query  1747  REAISTRGVEINDVVCSAAAPGWFGPEE--EGRRITKVKCYTAQNTPNYYMRPIEGLLLT  1574
              E++  RGV+++DV+C+    GWFG       +R+ K+ C+ A  T N+Y RPIEG+ + 
Sbjct  167   VESVRRRGVDMDDVLCAVFPVGWFGGRAGTTAKRVAKMLCFVAGPTANFYARPIEGITMV  226

Query  1573  VDLDSGKVINVYDTHSPIPIPKAQGTDYRRDGIEHRAPGVEPLKPISMEQPNGQSFRVED  1394
             VDLD+  ++  Y      P+PKA+GTDYR            PL P    QP G+ F + D
Sbjct  227   VDLDAMAIVG-YRDRVTYPVPKAEGTDYRAGKTG------PPLAPGVAVQPEGRGFHI-D  278

Query  1393  GYIVKWASWEFHVKADQRAGIIISQATVFD--PEAGKRRSVMYKGFASELFVPYMDVDEG  1220
             G++V+WA+WEFHV  D RAG +IS A+V D   +AG RR V+Y+GF SE+FVPYMD  E 
Sbjct  279   GHVVRWANWEFHVGFDMRAGTVISLASVHDHDADAGTRRRVLYRGFVSEIFVPYMDPVEE  338

Query  1219  WYFRAFMDAGEFGLGATAMELVPLNDCPRHSHYIDGLFVDPDGRPVSQPNVICVFERYSG  1040
             WY+R F+DAGE+GLG  A  L P  DCP ++ Y+DG +   DG+PV   N ICVFERY+G
Sbjct  339   WYYRTFLDAGEYGLGLWAFPLQPGADCPANAAYLDGSYAGQDGKPVGGENRICVFERYAG  398

Query  1039  DIAWRHSGTGDADDDLIREARPKVSLVVRTTATVGNYDYIFDWEFQTDGSIRVTVGLSGI  860
             D+AWRH+  G   D LI E RP V+LVVR   + GNYDYI DWEF+T GSI+  V L+G+
Sbjct  399   DVAWRHTEAG-FPDRLITEVRPDVTLVVRMVVSPGNYDYILDWEFKTSGSIKFVVSLTGL  457

Query  859   ILAKGSPYEHINQFEIPRWDFPAGSLVSENTIGVAHDHFITFHLDMDVDGPTNSFVKVDL  680
             +  KG+ Y H ++  +       GSLVSENTI V HDH++T+HLD+D+DG  NSFVK  +
Sbjct  458   LEVKGTSYTHADEITVD----AHGSLVSENTIAVYHDHYVTYHLDLDIDGTNNSFVKNII  513

Query  679   VKNYNIA------GKIQRKSYWSPKRKVAKSENDAKIKLQLDKPSEFHVINPRHQSRLGN  518
                 N            R+SYW+ +R+VA++E D +  +    P++  ++NP  ++R+GN
Sbjct  514   TAKRNTGDPATGGAGTPRRSYWTVRREVAETEADGQADVNA-APADLLLVNPGKKTRMGN  572

Query  517   PSGYKIVPS-ATAASLLDLQDPPQLRAAFTNNQIWVTPYNRSEQWAGGLFTYQSHGDDTL  341
               GY+++PS ATAAS+L   D PQ RA++T  Q+WVTPY++SE+WA GLF  QS G D+L
Sbjct  573   EVGYRLIPSGATAASVLADDDYPQRRASYTKKQVWVTPYSKSEKWASGLFADQSTGADSL  632

Query  340   AVWSNRNRVIEKQDIVLWYTLGFHHLPCQEDFPVMPTVTSTFQLKPVNFFDRNPIIQ  170
               WS RNR I  QDIVLWYTLG HH+P QEDFPVMPT++  F+L+P NFF+RNPI++
Sbjct  633   TAWSRRNRGIRDQDIVLWYTLGLHHIPYQEDFPVMPTLSGGFELRPSNFFERNPILK  689



>ref|XP_007143245.1| hypothetical protein PHAVU_007G056200g [Phaseolus vulgaris]
 gb|ESW15239.1| hypothetical protein PHAVU_007G056200g [Phaseolus vulgaris]
Length=670

 Score =   586 bits (1511),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 291/655 (44%), Positives = 422/655 (64%), Gaps = 14/655 (2%)
 Frame = -1

Query  2083  HPLDPLTIQEIERTRSILSSYQPFSGSSLRIHSLSLDEPDKSEVLRWKRGNP---LPTRK  1913
             HPLDPLT  E++  RS +      S  +L    + LDEP+K+ VL W+  N     P R+
Sbjct  25    HPLDPLTPSELKLVRSTVQKTYKASSPTLTFQYIGLDEPEKALVLSWQSSNAKTKAPPRR  84

Query  1912  AFVVALSNGQAHLLVVDLGSGRVSSHTRNPASGYPPMSADDASTALEATFSNSVFREAIS  1733
             A V+A    Q   + V+L    + S       G+P  + D+    +E  F  + F E++ 
Sbjct  85    ALVIARFKNQTLEITVNLSKRSIVSTKVYTGHGFPMTTFDEQDFVVELLFKYTPFIESVH  144

Query  1732  TRGVEINDVVCSAAAPGWFGPEEEGRRITKVKCYTAQNTPNYYMRPIEGLLLTVDLDSGK  1553
              RG+ I+ VVCS ++ GW+G E + +R  K++C+ +Q + N + RP+EG+ +  DLD  K
Sbjct  145   KRGLNISHVVCSVSSVGWYG-EIKSKRTLKLQCFYSQGSSNLFARPLEGITVVADLDQRK  203

Query  1552  VINVYDTHSPIPIPKAQGTDYRRDGIEHRAPGVEPLKPISMEQPNGQSFRVEDGYIVKWA  1373
             ++  +D  + IP+PKA+GT++     + + P    L   +  QPNG  F++ DG+ + WA
Sbjct  204   IVEYFD-RANIPVPKAEGTEFVAS--KQKPPFGPTLTGAAFVQPNGPGFKI-DGHSISWA  259

Query  1372  SWEFHVKADQRAGIIISQATVFDPEAGKRRSVMYKGFASELFVPYMDVDEGWYFRAFMDA  1193
             +WEFHV  D RAG +IS A+++D +  + R V+Y+G+ SE FVPYMD    WYF+ F+D+
Sbjct  260   NWEFHVGYDIRAGPMISLASIYDLQQQRYRRVLYRGYISEFFVPYMDPTANWYFKTFLDS  319

Query  1192  GEFGLGATAMELVPLNDCPRHSHYIDGLFVDPDGRPVSQPNVICVFERYSGDIAWRHSGT  1013
             GEFG G + + L PL DCP ++ ++D  F   DG PV   N IC+FE+Y+GDI WRH+ T
Sbjct  320   GEFGFGQSMVSLDPLADCPANAAFLDAYFAGEDGLPVKIDNAICIFEKYAGDIMWRHTET  379

Query  1012  GDADDDLIREARPKVSLVVRTTATVGNYDYIFDWEFQTDGSIRVTVGLSGIILAKGSPYE  833
                D + IRE RP VSLVVRT +TVGNYDYI DWEF+  GSI++ VGL+GI+  KG+ Y 
Sbjct  380   ELIDKE-IREVRPDVSLVVRTVSTVGNYDYIIDWEFKPSGSIKMGVGLTGILGIKGTSYT  438

Query  832   HINQFEIPRWDFPAGSLVSENTIGVAHDHFITFHLDMDVDGPTNSFVKVDLVKNYNIAGK  653
             H++Q +   +    G+L+++NTIGV HDH++T+HLD+D+DG  NSF+K +L         
Sbjct  439   HVDQIKEDVF----GTLLADNTIGVHHDHYLTYHLDLDIDGEANSFMKTNLESVRVTDDN  494

Query  652   IQRKSYWSPKRKVAKSENDAKIKLQLDKPSEFHVINPRHQSRLGNPSGYKIVPSATAASL  473
               RKSYW+  R+ AK+E DA+IKL L K SE  ++NP  +++ GN  GY++ P   A  L
Sbjct  495   SPRKSYWTVVRETAKTEGDARIKLGL-KASELAIVNPNKKTKAGNKMGYRLFPGTVAHPL  553

Query  472   LDLQDPPQLRAAFTNNQIWVTPYNRSEQWAGGLFTYQSHGDDTLAVWSNRNRVIEKQDIV  293
             L   D PQ+R AF N  ++VTPYN+SE+WAGGL+  QS G+DTLAVWS RNR IE +DIV
Sbjct  554   LLSDDYPQIRGAFINYNVFVTPYNKSEKWAGGLYADQSRGEDTLAVWSLRNRSIENKDIV  613

Query  292   LWYTLGFHHLPCQEDFPVMPTVTSTFQLKPVNFFDRNPIIQANPNFAEDLPICRA  128
             LW+T+G HH+PCQED+P+MPT++  F+++P NFF+ NP+++A       LP C +
Sbjct  614   LWHTVGIHHVPCQEDYPIMPTLSGGFEIRPTNFFEINPVLKAKTPKPVRLPKCNS  668



>ref|XP_004958095.1| PREDICTED: primary amine oxidase-like [Setaria italica]
Length=699

 Score =   587 bits (1512),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 296/667 (44%), Positives = 425/667 (64%), Gaps = 31/667 (5%)
 Frame = -1

Query  2098  ADRPMHPLDPLTIQEIERTRSILSSYQPFSGSSLRIHSLSLDEPDKSEVLRWKRGNPLPT  1919
             + RP HPLDPL+  EI   R+ + +        +  H + LDEPDK +VL +  G   P 
Sbjct  27    SSRP-HPLDPLSPAEITAVRAAVLASPLVPARPITFHYVGLDEPDKPDVLAYAYGGSTPR  85

Query  1918  RKAF---------VVALSNGQAHLLVVDL-----GSGRVSSHTRNPASGYPPMSADDAST  1781
             R+           V+A + GQ+H L V++      +  V SH  +  +G+P ++ ++   
Sbjct  86    RRQLLRLLPRRALVIARAGGQSHELRVEVTTNASSAATVLSHAVHRGAGFPILTLEEQFA  145

Query  1780  ALEATFSNSVFREAISTRGVEINDVVCSAAAPGWFGPEEEGRRITKVKCYTAQNTPNYYM  1601
             A+    +   F +++  RG+++ DV+C+    GWFG      R+ K+ C+ A  T N+Y 
Sbjct  146   AVALPPAYPPFVDSVRRRGLDMGDVLCAVFPVGWFGDTGPPERVAKMLCFLAGATANFYA  205

Query  1600  RPIEGLLLTVDLDSGKVINVYDTHSPIPIPKAQGTDYRRDGIEHRAPGVEPLKPISMEQP  1421
             RPIEG+ +TVDLD   ++  Y      P+PKA+GTDYR         G +P  P  + QP
Sbjct  206   RPIEGVTMTVDLDRMAIV-AYRDRVAYPVPKAEGTDYRAGKTGPPLAGPQP-APGVVVQP  263

Query  1420  NGQSFRVEDGYIVKWASWEFHVKADQRAGIIISQATVFDPEAGKRRSVMYKGFASELFVP  1241
              G+ F + DG IV+WA+WEFHV  D RAG +IS A+V+D +AG RR V+Y+GF SE+FVP
Sbjct  264   EGRGFHI-DGNIVRWANWEFHVGFDMRAGTVISLASVYDADAGTRRRVLYRGFVSEVFVP  322

Query  1240  YMDVDEGWYFRAFMDAGEFGLGATAMELVPLNDCPRHSHYIDGLFVDPDGRPVSQPNVIC  1061
             YMD  E WY+R F+DAGE+GLG  A  L P  DCP ++ Y+DG +   DG+PV+  N IC
Sbjct  323   YMDPVEEWYYRTFLDAGEYGLGLWAFPLQPGADCPANAAYLDGYYAGQDGKPVAGANRIC  382

Query  1060  VFERYSGDIAWRHSGTGDADDDLIREARPKVSLVVRTTATVGNYDYIFDWEFQTDGSIRV  881
             VFERY+GD+AWRH+  G     LI E RP V+LVVR   ++GNYDYI DWEF+T GSI+ 
Sbjct  383   VFERYAGDVAWRHTEAG-FPGQLITEVRPDVTLVVRMVMSLGNYDYILDWEFKTSGSIKF  441

Query  880   TVGLSGIILAKGSPYEHINQFEIPRWDFPAGSLVSENTIGVAHDHFITFHLDMDVDGPTN  701
              V L+G++  KG+PY H ++          G+LVSENT+ + HDH++T+HLD+D+DG  N
Sbjct  442   VVSLTGLLEVKGTPYTHADEITADA----HGTLVSENTLAIYHDHYVTYHLDLDIDGTNN  497

Query  700   SFVKVDLVKNYNI------AGKIQRKSYWSPKRKVAKSENDAKIKLQLDKPSEFHVINPR  539
             SFVK  +    N            R+SYW+ +R+VA++E D ++++    P++   +NP 
Sbjct  498   SFVKNVITARRNTGNPATGGAATPRRSYWTVRREVAETEADGQVEVDA-GPADLLFVNPG  556

Query  538   HQSRLGNPSGYKIVPS-ATAASLLDLQDPPQLRAAFTNNQIWVTPYNRSEQWAGGLFTYQ  362
              ++R+GN  GY+++P+ ATAAS+L   D PQ RA++T  Q+WVTPY+++E+WA G++  Q
Sbjct  557   KKTRMGNEVGYRLIPAGATAASVLADDDYPQRRASYTKKQVWVTPYSKAEKWAPGMYADQ  616

Query  361   SHGDDTLAVWSNRNRVIEKQDIVLWYTLGFHHLPCQEDFPVMPTVTSTFQLKPVNFFDRN  182
             S GDD LA WS RNR I  +DIVLWYT+G HH+P QEDFPVMPT++  F+L+P NFF+RN
Sbjct  617   STGDDGLAAWSRRNRGIRDEDIVLWYTVGLHHIPYQEDFPVMPTLSGGFELRPSNFFERN  676

Query  181   PIIQANP  161
             PI++A+P
Sbjct  677   PILRASP  683



>gb|KDP27003.1| hypothetical protein JCGZ_22065 [Jatropha curcas]
Length=673

 Score =   585 bits (1508),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 282/655 (43%), Positives = 416/655 (64%), Gaps = 14/655 (2%)
 Frame = -1

Query  2083  HPLDPLTIQEIERTRSILSSYQPFSGSSLRIHSLSLDEPDKSEVLRW---KRGNPLPTRK  1913
             HPLD L+ +E+   ++I+++    S ++L  H + LDEP+K+ +L W        LP R+
Sbjct  27    HPLDSLSPEELILIKTIINNSLSSSTNTLNFHYVGLDEPEKTVLLSWLSKPTNQTLPPRR  86

Query  1912  AFVVALSNGQAHLLVVDLGSGRVSSHTRNPASGYPPMSADDASTALEATFSNSVFREAIS  1733
             A  +   N Q H  ++DL    + S      +GYP ++ D+   A++       F+E++ 
Sbjct  87    ALAITRINKQTHEFIIDLTKRSIISEQVYNGNGYPTLALDEQVEAIQLPLEYEAFKESVR  146

Query  1732  TRGVEINDVVCSAAAPGWFGPEEEGRRITKVKCYTAQNTPNYYMRPIEGLLLTVDLDSGK  1553
             TRG+ ++ V CS    GWFG +    R+ K++C+    T N Y+ PIEG+ + VDL+  K
Sbjct  147   TRGLNLSAVACSPFTVGWFG-KVRNARVVKLQCFHMDATVNMYLLPIEGIKIVVDLEEMK  205

Query  1552  VINVYDTHSPIPIPKAQGTDYRRDGIEHRAPGVEPLKPISMEQPNGQSFRVEDGYIVKWA  1373
             ++  Y     IP+PK++GTDYR    + + P    +   ++ QP+G  F + DG+ ++W 
Sbjct  206   IVE-YSDRLKIPVPKSEGTDYRLS--KQKPPFGPRMNRAAIMQPDGPGFEI-DGHTIRWL  261

Query  1372  SWEFHVKADQRAGIIISQATVFDPEAGKRRSVMYKGFASELFVPYMDVDEGWYFRAFMDA  1193
             +W FH+  D R G IIS A+++DP+ GK RSV+Y+G  SELFVPY D  E +YF+ F D 
Sbjct  262   NWNFHLSFDARVGPIISLASIYDPDKGKHRSVLYRGHISELFVPYQDPTEEYYFKTFFDC  321

Query  1192  GEFGLGATAMELVPLNDCPRHSHYIDGLFVDPDGRPVSQPNVICVFERYSGDIAWRHSGT  1013
             GEFG G +++ LVPL DCP ++ ++DG +   DG+PV  PNV C+FER+SGDI WRH+  
Sbjct  322   GEFGFGQSSVSLVPLADCPNNAVFMDGYYAGQDGKPVKVPNVFCIFERHSGDIMWRHTEL  381

Query  1012  GDADDDLIREARPKVSLVVRTTATVGNYDYIFDWEFQTDGSIRVTVGLSGIILAKGSPYE  833
             G    ++I E+RP+VSLVVR  AT+GNYD+  DWE +  GSI V VGLSGI+  K + Y 
Sbjct  382   G-IPGEVITESRPEVSLVVRMVATIGNYDHTLDWELKPSGSIHVKVGLSGILEVKATAYT  440

Query  832   HINQFEIPRWDFPAGSLVSENTIGVAHDHFITFHLDMDVDGPTNSFVKVDLVKNYNIAGK  653
             H ++ +   +    G+ + EN IG+ HDHF+T+ LD+D+DG  NS +K +LV    +   
Sbjct  441   HSDEVKEEIY----GTFLGENMIGLYHDHFLTYRLDLDIDGVENSLIKKNLVTKTVMENS  496

Query  652   IQRKSYWSPKRKVAKSENDAKIKLQLDKPSEFHVINPRHQSRLGNPSGYKIVPSATAASL  473
               RKSYW+   + AK+E++AKI+L ++ P+E  ++NP  +++ GN  GY+++P   A  L
Sbjct  497   TPRKSYWTVVSETAKTESEAKIQLGME-PAELVIVNPNKKTKPGNSHGYRLIPDHAAHPL  555

Query  472   LDLQDPPQLRAAFTNNQIWVTPYNRSEQWAGGLFTYQSHGDDTLAVWSNRNRVIEKQDIV  293
             L   D PQ+R AFT   +WVT YN+SE+WAGG +  QSHG+DTLAVWS+ NR IE +DIV
Sbjct  556   LLEDDYPQVRGAFTKYNVWVTAYNKSEKWAGGKYVDQSHGEDTLAVWSSMNREIENKDIV  615

Query  292   LWYTLGFHHLPCQEDFPVMPTVTSTFQLKPVNFFDRNPIIQANPNFAEDLPICRA  128
             LW  LG HHLPCQED PVMPT++S F+L+P NFF+R+ +++  P      P C A
Sbjct  616   LWCVLGIHHLPCQEDLPVMPTLSSGFELRPTNFFERSLVLKVIPPKPVTSPNCSA  670



>ref|XP_003556043.1| PREDICTED: primary amine oxidase-like isoform X1 [Glycine max]
 gb|KHN15777.1| Primary amine oxidase [Glycine soja]
Length=675

 Score =   585 bits (1507),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 297/681 (44%), Positives = 424/681 (62%), Gaps = 23/681 (3%)
 Frame = -1

Query  2149  LESLLGIHDFKIQNNHFADRPMHPLDPLTIQEIERTRSILSSYQPFSGSSLRIHSLSLDE  1970
             L S+L +     + NH     +HPLDPLT  E+   R+I+ ++ P S  +L  H + LDE
Sbjct  9     LFSILMLFWSHAECNHL----LHPLDPLTPSELNLVRTIVQNFYPTS-QNLTFHYVGLDE  63

Query  1969  PDKSEVLRWKRGN-------PLPTRKAFVVALSNGQAHLLVVDLGSGRVSSHTRNPASGY  1811
             P+K E+L+W   N       P P R+AF V     Q+H + VDL +  + S      +G 
Sbjct  64    PNKPEILKWLSSNNSKIKPKPRPPRRAFAVVRFQKQSHEITVDLSTHSIVSTKDCEGNGN  123

Query  1810  PPMSADDASTALEATFSNSVFREAISTRGVEINDVVCSAAAPGWFGPEEEGRRITKVKCY  1631
             P ++  + + A +  FS   F+E++  RG+  + VVC+    GWFG E + +R  KVKCY
Sbjct  124   PMLTFGEQAVASQLPFSYEPFKESLKKRGLNTSQVVCACFTIGWFG-EGKTKRNVKVKCY  182

Query  1630  TAQNTPNYYMRPIEGLLLTVDLDSGKVINVYDTHSPIPIPKAQGTDYRRDGIEHRAPGVE  1451
              A +T N Y RP+EG+   VDLD  K++  Y+    +P+PKA+GT+YR   +  + P   
Sbjct  183   YANDTANLYARPLEGVAAVVDLDDMKIVG-YNDRYVVPVPKAEGTEYRASKL--KPPFGP  239

Query  1450  PLKPISMEQPNGQSFRVEDGYIVKWASWEFHVKADQRAGIIISQATVFDPEAGKRRSVMY  1271
               K I++ Q  G  F  +DG+ V WA+W FHV  D RAG IIS A+++D +  + R V+Y
Sbjct  240   KHKGIAVTQDGGPGF-TKDGHSVSWANWNFHVGFDIRAGPIISLASIYDLQKQRHRRVLY  298

Query  1270  KGFASELFVPYMDVDEGWYFRAFMDAGEFGLGATAMELVPLNDCPRHSHYIDGLFVDPDG  1091
             KGF  ELFVPY D  E WY+  + D+GE+G G +   L PLNDCP ++ +ID  +   DG
Sbjct  299   KGFIPELFVPYQDPTEEWYYTTYFDSGEYGFGQSMSSLQPLNDCPPNAAFIDAYYAGSDG  358

Query  1090  RPVSQPNVICVFERYSGDIAWRHSGTGDADDDLIREARPKVSLVVRTTATVGNYDYIFDW  911
              PV   N  C+FE+Y+GDI WRH+      +++I EAR  VSLVVR  +TVGNYDY+ DW
Sbjct  359   TPVKIANAFCIFEKYAGDIMWRHTEIS-IPNEVITEARSDVSLVVRIVSTVGNYDYVIDW  417

Query  910   EFQTDGSIRVTVGLSGIILAKGSPYEHINQFEIPRWDFPAGSLVSENTIGVAHDHFITFH  731
             EF+ +G I++ VGL+GI+  K   Y + +Q +   +    G+L+++NTIG+ HDHF T++
Sbjct  418   EFKPNGCIKIGVGLTGILGLKAGTYTNTDQIKEDIY----GTLIADNTIGIYHDHFFTYY  473

Query  730   LDMDVDGPTNSFVKVDLVKNYNIAGKIQRKSYWSPKRKVAKSENDAKIKLQLDKPSEFHV  551
             LD+D+DG  NSFVK +L           RKSYW+   + AK+E DAKI L   KPSE  V
Sbjct  474   LDLDIDGEANSFVKSNLETVRVKDDTTPRKSYWTVVSETAKTEADAKINLG-SKPSELLV  532

Query  550   INPRHQSRLGNPSGYKIVPSATAASLLDLQDPPQLRAAFTNNQIWVTPYNRSEQWAGGLF  371
             +NP  +++ GN  GY+++P   A  LL   D PQ+RAAFTN  +WVTPYN+SE+W GG +
Sbjct  533   VNPNKKTKQGNKIGYRLLPGPVAHPLLLNDDYPQIRAAFTNYNVWVTPYNKSEKWVGGSY  592

Query  370   TYQSHGDDTLAVWSNRNRVIEKQDIVLWYTLGFHHLPCQEDFPVMPTVTSTFQLKPVNFF  191
               +S GDDT+A+WS R+R IE +DIVLWYT+GFHH+P QED+P+MPT++  F+L+P NFF
Sbjct  593   VDRSRGDDTIAIWSLRDREIENKDIVLWYTMGFHHVPSQEDYPIMPTLSGGFELRPTNFF  652

Query  190   DRNPIIQANPNFAEDLPICRA  128
             +RNP+++         P C +
Sbjct  653   ERNPVLKTKSPKPVHFPNCTS  673



>ref|XP_010024343.1| PREDICTED: primary amine oxidase-like [Eucalyptus grandis]
Length=674

 Score =   583 bits (1504),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 292/666 (44%), Positives = 426/666 (64%), Gaps = 18/666 (3%)
 Frame = -1

Query  2143  SLLGIHDFKIQNNHFADRPMHPLDPLTIQEIERTRSILSSYQPFSGSSLRIHSLSLDEPD  1964
             SLL I  F    +  + +  HPLDPLT +E    R+ +      S  ++  H + LDEPD
Sbjct  10    SLLSITLFSFLISPASSQHEHPLDPLTPEEFSLIRNAVMWSYGASSENVTFHYVGLDEPD  69

Query  1963  KSEVLRW---KRGNPLPTRKAFVVALSNGQAHLLVVDLGSGRVSSHTRNP--ASGYPPMS  1799
             K  +  W   +     P R+A VV   + Q H L+VDL S R S  ++     +G+P ++
Sbjct  70    KPLIYSWMLNQTDKIPPPRRASVVLRFHEQTHELIVDLSSSRTSIVSKEVYHGNGFPMLT  129

Query  1798  ADDASTALEATFSNSVFREAISTRGVEINDVVCSAAAPGWFGPEEEGRRITKVKCYTAQN  1619
              ++ + A +   ++  F  +I  RG+ ++DVVC+    GW+G E   RR  KV  Y    
Sbjct  130   LEEQTAASDLPRTHDQFIRSIEKRGLNMSDVVCACYTVGWYG-EPRSRRAMKVLAYYTNG  188

Query  1618  TPNYYMRPIEGLLLTVDLDSGKVINVYDTHSPIPIPKAQGTDYRRDGIEHRAPGVEP-LK  1442
             T N+YMRPIEG+++ VDL+  K++  +D  +   +P A+ T+YR   +E + P   P L+
Sbjct  189   TVNFYMRPIEGIVMVVDLELMKIVKYHDRFTTT-VPTAEDTEYR---LEKQNPPFGPHLE  244

Query  1441  PISMEQPNGQSFRVEDGYIVKWASWEFHVKADQRAGIIISQATVFDPEAGKRRSVMYKGF  1262
               ++ QP+G  F ++ G+ + WA+W+FH+  D R G IIS A+++D E GK R V+Y+ +
Sbjct  245   GAAIVQPHGPGFEIK-GHTISWANWKFHIGFDARVGPIISLASIYDLEKGKYRQVLYRAY  303

Query  1261  ASELFVPYMDVDEGWYFRAFMDAGEFGLGATAMELVPLNDCPRHSHYIDGLFVDPDGRPV  1082
              SE+FVPYMD  E WY++ + D GEFG G +A+ L P  DCP ++ ++DG +   DG PV
Sbjct  304   VSEVFVPYMDPTEEWYYKTYFDCGEFGFGLSAVSLQPGVDCPNNAIFMDGFYAGQDGTPV  363

Query  1081  SQPNVICVFERYSGDIAWRHSGTGDADDDLIREARPKVSLVVRTTATVGNYDYIFDWEFQ  902
                NV CVFE+Y+G+I WRH+  G AD+  IRE R  VSLVVR+ +TVGNYDYI DWE +
Sbjct  364   KISNVTCVFEKYAGNIMWRHTEIGIADET-IREVRSDVSLVVRSVSTVGNYDYILDWELK  422

Query  901   TDGSIRVTVGLSGIILAKGSPYEHINQFEIPRWDFPAGSLVSENTIGVAHDHFITFHLDM  722
               GSI+  VGL+G++  K   Y H +Q +   +    G++V  NTI   HDHF+T+HLD+
Sbjct  423   PSGSIKFEVGLTGLLEVKAVNYTHASQIKEDEY----GTMVGANTIATHHDHFLTYHLDL  478

Query  721   DVDGPTNSFVKVDLVKNYNIAGKIQRKSYWSPKRKVAKSENDAKIKLQLDKPSEFHVINP  542
             DVDG  NSFVK +L+        + RKSYW+   K A++E++A++ L L+ P +  V+NP
Sbjct  479   DVDGAPNSFVKTNLITKPVAEEGVPRKSYWTVSSKTARTESEAQLHLGLE-PCDLVVVNP  537

Query  541   RHQSRLGNPSGYKIVPSATAASLLDLQDPPQLRAAFTNNQIWVTPYNRSEQWAGGLFTYQ  362
               ++++GN  GY+++P   A+ +L   D PQ+RAAFT+N +WVTPYN+SE+WAGG +  Q
Sbjct  538   NKRTKVGNNVGYRLIPGPIASPILFRDDYPQIRAAFTDNNLWVTPYNKSEKWAGGRYVDQ  597

Query  361   SHGDDTLAVWSNRNRVIEKQDIVLWYTLGFHHLPCQEDFPVMPTVTSTFQLKPVNFFDRN  182
             S GDDTLAVW+ RNR IE +DIVLWYTLGFHH+P QEDFP+MPT+++ F+L+P NFFDRN
Sbjct  598   SRGDDTLAVWAKRNRKIENEDIVLWYTLGFHHIPYQEDFPIMPTLSAGFELRPSNFFDRN  657

Query  181   PIIQAN  164
             P+++  
Sbjct  658   PVLKTK  663



>ref|XP_009108111.1| PREDICTED: primary amine oxidase [Brassica rapa]
Length=680

 Score =   583 bits (1502),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 291/650 (45%), Positives = 419/650 (64%), Gaps = 16/650 (2%)
 Frame = -1

Query  2089  PMHPLDPLTIQEIERTRSILSSYQPFSGS-SLRIHSLSLDEPDKSEVLRW----KRGNPL  1925
             P HP DPLT  E++  ++I++   P   S       + L+EPDKS VL W    K     
Sbjct  26    PRHPFDPLTETELKLVQTIINKTYPIGPSHKFTFQYVGLNEPDKSLVLSWYSSPKHNIKP  85

Query  1924  PTRKAFVVALSNGQAHLLVVDLGSGRVSSHTRNPASGYPPMSADDASTALEATFSNSVFR  1745
             P R+AFV+A  NG++  +VVD  S  + S   +  +GYP ++ D+   A E       F 
Sbjct  86    PPRQAFVIARDNGKSREIVVDFSSRAIVSDKIHVGNGYPMLTNDEQEAATELVLKFKPFL  145

Query  1744  EAISTRGVEINDVVCSAAAPGWFGPEE-EGRRITKVKCYTAQNTPNYYMRPIEGLLLTVD  1568
             ++++ RG+ ++++V + +  GW+G  E E  R+ ++  +    T N Y+RPIEG+ + V+
Sbjct  146   DSVTKRGLNVSEIVFTTSTVGWYGESEAETERVIRMMPFYLDGTINMYLRPIEGMTILVN  205

Query  1567  LDSGKVINVYDTHSPIPIPKAQGTDYRRDGIEHRAPGVEPLKPISMEQPNGQSFRVEDGY  1388
             LD  KV    D  + I +PKA GT+YR    E + P    L+     QP+G  F++ DG+
Sbjct  206   LDVMKVTEFTDRLTVI-MPKANGTEYRIS--ELKPPFGPTLQNAVFMQPDGPGFKI-DGH  261

Query  1387  IVKWASWEFHVKADQRAGIIISQATVFDPEAGKRRSVMYKGFASELFVPYMDVDEGWYFR  1208
             +V+WA+WEFH+  D RAGI+IS A++FD +  K R V+YKG  SE+F+PYMD  + WYF 
Sbjct  262   VVRWANWEFHISFDARAGIVISLASMFDMDVKKYRQVLYKGHLSEMFIPYMDPSDDWYFI  321

Query  1207  AFMDAGEFGLGATAMELVPLNDCPRHSHYIDGLFVDPDGRPVSQPNVICVFERYSGDIAW  1028
              ++D G+FG G  A+ L P  DCP  + ++DG+F   DG P   PNV+C+FE+Y+GDI W
Sbjct  322   TYLDCGDFGCGQCAVSLEPYRDCPAGAVFMDGVFAGQDGTPAKIPNVMCIFEKYAGDIMW  381

Query  1027  RHSGTGDADDDLIREARPKVSLVVRTTATVGNYDYIFDWEFQTDGSIRVTVGLSGIILAK  848
             RH+   +  +  I E RP VSLV R   TVGNYDYI D+EF+  GSI++ VGL+G++  K
Sbjct  382   RHT-EAEIPNLEITEVRPDVSLVARIVTTVGNYDYIVDYEFKPSGSIKMGVGLTGVLEVK  440

Query  847   GSPYEHINQFEIPRWDFPAGSLVSENTIGVAHDHFITFHLDMDVDGPTNSFVKVDLV-KN  671
                Y HI++    + D   G++V++NTIGV HDHF+TF LD+D+DG  NSFV+ +LV K 
Sbjct  441   PVEYTHISEI---KEDDIHGTIVADNTIGVNHDHFVTFRLDLDIDGSPNSFVRNELVTKR  497

Query  670   YNIAGKIQRKSYWSPKRKVAKSENDAKIKLQLDKPSEFHVINPRHQSRLGNPSGYKIVPS  491
                +    RKSYW+   K AK+E +A++KL L K  E  V+NP  +++ GN  GY+++ S
Sbjct  498   TAKSVNTPRKSYWTTSPKTAKTETEARVKLGL-KAEELVVVNPNRKTKHGNEVGYRLLSS  556

Query  490   ATAASLLDLQDPPQLRAAFTNNQIWVTPYNRSEQWAGGLFTYQSHGDDTLAVWSNRNRVI  311
               +  LL   D PQ+RAAFTN  +W+TPYNR+E WAGGL+  +SHGDDTLAVWS RNR I
Sbjct  557   PPSGPLLVQDDYPQIRAAFTNYNVWITPYNRTEVWAGGLYADRSHGDDTLAVWSQRNREI  616

Query  310   EKQDIVLWYTLGFHHLPCQEDFPVMPTVTSTFQLKPVNFFDRNPIIQANP  161
             E +DIV+WYT+GFHH+P QEDFP MPT++  F+L+P NFF++NP++++ P
Sbjct  617   ENKDIVMWYTIGFHHVPSQEDFPTMPTLSGGFELRPTNFFEQNPVLKSKP  666



>ref|XP_010478585.1| PREDICTED: primary amine oxidase-like [Camelina sativa]
Length=676

 Score =   583 bits (1502),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 290/649 (45%), Positives = 417/649 (64%), Gaps = 15/649 (2%)
 Frame = -1

Query  2092  RPMHPLDPLTIQEIERTRSILSSYQPFSGS-SLRIHSLSLDEPDKSEVLRWK----RGNP  1928
             RP HP DPLT  E++  R+++    P     +     + L+EPDKS VL W     +   
Sbjct  24    RPPHPFDPLTRTELKLVRNVIKKTYPVGPKYNFTFQYVGLNEPDKSLVLSWHSSPDQNVK  83

Query  1927  LPTRKAFVVALSNGQAHLLVVDLGSGRVSSHTRNPASGYPPMSADDASTALEATFSNSVF  1748
              P R+AF++A  +G+   +VVD  S  + S   +   G P ++ D+   A E       F
Sbjct  84    PPPRQAFIIARDSGKTREIVVDFSSRAIISDKIHVGKGNPMLTIDEQEAATELVHKFKPF  143

Query  1747  REAISTRGVEINDVVCSAAAPGWFGPEEEGRRITKVKCYTAQNTPNYYMRPIEGLLLTVD  1568
             R++I  RG+++++VV +++  GWFG E +  R+ K   +    + N Y+RPIEGL + V+
Sbjct  144   RDSIRRRGLKLSEVVVTSSTMGWFG-ETKTERLIKTIPFYLNGSVNTYLRPIEGLTIIVN  202

Query  1567  LDSGKVINVYDTHSPIPIPKAQGTDYRRDGIEHRAPGVEPLKPISMEQPNGQSFRVEDGY  1388
             LD  KV    D  +  P+PKA GT++R   +    P    L+   + QPNG  F++E G+
Sbjct  203   LDKMKVTKFKDRFTS-PLPKANGTEFRFSKLN--PPFGPALRNAVLFQPNGPGFKIE-GH  258

Query  1387  IVKWASWEFHVKADQRAGIIISQATVFDPEAGKRRSVMYKGFASELFVPYMDVDEGWYFR  1208
             IV+WA+WEFH+  D RAG++IS A++FD +  K R V+YKG  SE+FVPYMD    WYF 
Sbjct  259   IVRWANWEFHMSFDVRAGLVISLASIFDMDMNKYRQVLYKGHVSEIFVPYMDPSADWYFI  318

Query  1207  AFMDAGEFGLGATAMELVPLNDCPRHSHYIDGLFVDPDGRPVSQPNVICVFERYSGDIAW  1028
              ++D GEFG G +A+ L P NDCP  + ++DG+F    G P    NV+C+FE+++GDI W
Sbjct  319   TYLDCGEFGCGQSAVSLEPYNDCPAGAAFMDGIFAGQYGTPTKISNVMCIFEKHAGDIMW  378

Query  1027  RHSGTGDADDDLIREARPKVSLVVRTTATVGNYDYIFDWEFQTDGSIRVTVGLSGIILAK  848
             RH+   +     I E RP VSLV R   TVGNYDYI D+EF+  GSI++ VGL+G++  K
Sbjct  379   RHTEV-EVPGLEITEVRPDVSLVARMVTTVGNYDYIIDYEFKPSGSIKMEVGLTGVLEVK  437

Query  847   GSPYEHINQFEIPRWDFPAGSLVSENTIGVAHDHFITFHLDMDVDGPTNSFVKVDLVKNY  668
               P E+++  EI   D   G+L+++NT+GV HDHF+TF LD+D+DG  NSFV+ +LV   
Sbjct  438   --PVEYVHTSEIKEDDI-HGTLIADNTVGVNHDHFVTFRLDLDIDGTNNSFVRTELVTKA  494

Query  667   NIAGKIQRKSYWSPKRKVAKSENDAKIKLQLDKPSEFHVINPRHQSRLGNPSGYKIVPSA  488
               +    RKSYW+ K+K AK+E +A++KL L+   EF V+N   +++ GN  GY++ P  
Sbjct  495   PKSVNTPRKSYWTTKQKTAKTEAEARVKLGLNV-EEFVVVNADRRTKHGNEVGYRLFPGP  553

Query  487   TAASLLDLQDPPQLRAAFTNNQIWVTPYNRSEQWAGGLFTYQSHGDDTLAVWSNRNRVIE  308
              + +LL   D PQ+RAAFTN  +W+TPYN+SE W  GL+T +S GDDTLAVWS RNR IE
Sbjct  554   VSGTLLTQDDYPQIRAAFTNYNMWITPYNKSEMWTSGLYTDRSQGDDTLAVWSQRNREIE  613

Query  307   KQDIVLWYTLGFHHLPCQEDFPVMPTVTSTFQLKPVNFFDRNPIIQANP  161
             K+DIV+WYT+GFHH+PCQEDFP MPT++S F+L+P NFF++NP+++  P
Sbjct  614   KKDIVMWYTVGFHHVPCQEDFPTMPTLSSGFELRPANFFEQNPVLKVKP  662



>ref|XP_006306889.1| hypothetical protein CARUB_v10008452mg [Capsella rubella]
 gb|EOA39787.1| hypothetical protein CARUB_v10008452mg [Capsella rubella]
Length=712

 Score =   584 bits (1505),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 294/661 (44%), Positives = 428/661 (65%), Gaps = 18/661 (3%)
 Frame = -1

Query  2089  PMHPLDPLTIQEIERTRSILSSYQPFS-GSSLRIHSLSLDEPDKSEVLRWKR--GNPL--  1925
             P HP DPLT  E++  R+I+++  P           + L+EPDKS+VL W    G+ +  
Sbjct  60    PPHPFDPLTETELKLVRTIINNSYPIGHNHKFTFQYVGLNEPDKSQVLSWHSSPGHNVKP  119

Query  1924  PTRKAFVVALSNGQAHLLVVDLGSGRVSSHTRNPASGYPPMSADDASTALEATFSNSVFR  1745
             P R+AFV+A   G+   +VVD  +  + S   +  +G P ++ D+   A         FR
Sbjct  120   PPRQAFVIARDKGKNREIVVDFSTRAIVSDKIHVGNGNPMLTVDEQRAATALVHKFKPFR  179

Query  1744  EAISTRGVEINDVVCSAAAPGWFGPEEEGRRITKVKCYTAQNTPNYYMRPIEGLLLTVDL  1565
             ++I  RG+ +++VV +++  GWFG  +  R I  +  Y    + N Y+RPIEG+ + VDL
Sbjct  180   DSIMKRGLNLSEVVVTSSTMGWFGEAKPERFIRTIPFY-LNGSVNTYLRPIEGMTIIVDL  238

Query  1564  DSGKVINVYDTHSPIPIPKAQGTDYRRDGIEHRAPGVEP-LKPISMEQPNGQSFRVEDGY  1388
             D+ KV    D  +  P+PKA G +YR   I +  P   P L+   + QP+G  F++ DG+
Sbjct  239   DNMKVAQFKDRFTG-PMPKADGREYR---ISNLKPPFGPSLRNAVVFQPDGPGFKI-DGH  293

Query  1387  IVKWASWEFHVKADQRAGIIISQATVFDPEAGKRRSVMYKGFASELFVPYMDVDEGWYFR  1208
             IV+WA+WEFH+  D RAG++IS A++FD +  K R V+YKG  SE+FVPYMD  + WYF 
Sbjct  294   IVRWANWEFHMSFDVRAGLVISLASIFDMDVNKYRQVLYKGHLSEMFVPYMDPHDDWYFI  353

Query  1207  AFMDAGEFGLGATAMELVPLNDCPRHSHYIDGLFVDPDGRPVSQPNVICVFERYSGDIAW  1028
             +++D GE+G G +A+ L P  DCP ++ ++DG++   DG P    NV+C+FE+Y+GDI W
Sbjct  354   SYLDCGEYGCGQSAVSLEPYTDCPPNAAFMDGIYAGQDGTPTKVSNVMCIFEKYAGDIMW  413

Query  1027  RHSGTGDADDDLIREARPKVSLVVRTTATVGNYDYIFDWEFQTDGSIRVTVGLSGIILAK  848
             RH+ + +     I EARP VSLV R   TVGNYDYI ++EF+  GSI++ VGL+G++  K
Sbjct  414   RHTES-EVPGMEITEARPDVSLVARMVTTVGNYDYIIEYEFKPSGSIKMGVGLTGVLEVK  472

Query  847   GSPYEHINQFEIPRWDFPAGSLVSENTIGVAHDHFITFHLDMDVDGPTNSFVKVDLV-KN  671
               P E+++  EI   D   G++V++NT+GV HDHF+TF LD+D+DG  NSFV+ +LV K 
Sbjct  473   --PIEYVHTSEIKEDDI-YGTIVADNTVGVNHDHFVTFRLDLDIDGTDNSFVRTELVTKR  529

Query  670   YNIAGKIQRKSYWSPKRKVAKSENDAKIKLQLDKPSEFHVINPRHQSRLGNPSGYKIVPS  491
                +    RKSYW+ KR  AK+E +A++KL L KP E  V+NP  +++ GN  GY+++P 
Sbjct  530   TPKSVNTPRKSYWTTKRNTAKTETEARVKLGL-KPEELVVVNPNKKTKHGNEVGYRLIPG  588

Query  490   ATAASLLDLQDPPQLRAAFTNNQIWVTPYNRSEQWAGGLFTYQSHGDDTLAVWSNRNRVI  311
                 SLL   D PQ+RAAFTN  +W+TPYN+SE W  GL+  +S GDD LAVWS R+R I
Sbjct  589   PATGSLLSQDDYPQIRAAFTNYNVWITPYNKSEVWTSGLYADRSQGDDALAVWSKRDREI  648

Query  310   EKQDIVLWYTLGFHHLPCQEDFPVMPTVTSTFQLKPVNFFDRNPIIQANPNFAEDLPICR  131
             EK+DIV+WYT+GFHH+PCQEDFP MPT++  F+L+P NFF++NP+++A P    ++P C 
Sbjct  649   EKKDIVMWYTVGFHHVPCQEDFPTMPTMSGGFELRPTNFFEQNPVLKAKPMNLTNIPKCT  708

Query  130   A  128
             A
Sbjct  709   A  709



>ref|XP_010026971.1| PREDICTED: primary amine oxidase-like [Eucalyptus grandis]
Length=674

 Score =   582 bits (1500),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 295/667 (44%), Positives = 428/667 (64%), Gaps = 22/667 (3%)
 Frame = -1

Query  2143  SLLGIHDFKIQNNHFADRPMHPLDPLTIQEIERTR-SILSSYQPFSGSSLRIHSLSLDEP  1967
             SLL I  F    +  + +  HPLDPLT +E    R +++ SY   S  ++  H + LDEP
Sbjct  10    SLLSITLFSFLISPASSQHEHPLDPLTPEEFSLIRHAVMRSYGA-SSENVTFHYVGLDEP  68

Query  1966  DKSEVLRW---KRGNPLPTRKAFVVALSNGQAHLLVVDLGSGR---VSSHTRNPASGYPP  1805
             DK  +  W   +     P R+A VV   + Q H L+VDL S R   VS    N  +G+P 
Sbjct  69    DKPLIYSWMLNQTDKIPPPRRASVVLRFHEQTHELIVDLSSHRPSIVSKEVYN-GNGFPM  127

Query  1804  MSADDASTALEATFSNSVFREAISTRGVEINDVVCSAAAPGWFGPEEEGRRITKVKCYTA  1625
             ++ ++ + A +   ++  F  +I  RG+ ++DVVC+    GW+G E   RR+ KV  Y  
Sbjct  128   LTLEEQTAASDLPRTHDQFIRSIGKRGLNMSDVVCACYTVGWYG-EPRSRRVMKVLAYYT  186

Query  1624  QNTPNYYMRPIEGLLLTVDLDSGKVINVYDTHSPIPIPKAQGTDYRRDGIEHRAPGVEP-  1448
                 N+YMRPIEG+++ VDL+  K++  +D  +   +P A+ T+YR   +E + P   P 
Sbjct  187   NGMVNFYMRPIEGIVMVVDLELMKIVKYHDRFATT-VPTAEDTEYR---LEKQNPPFGPH  242

Query  1447  LKPISMEQPNGQSFRVEDGYIVKWASWEFHVKADQRAGIIISQATVFDPEAGKRRSVMYK  1268
             LK  ++ QP+G  F ++ G+ + WA+W+FH+  D R G IIS A+++D E GK R V+Y+
Sbjct  243   LKGTAIVQPDGPGFEIK-GHTISWANWKFHIGFDARVGPIISLASIYDLERGKYRQVLYR  301

Query  1267  GFASELFVPYMDVDEGWYFRAFMDAGEFGLGATAMELVPLNDCPRHSHYIDGLFVDPDGR  1088
              + SE+FVPYMD  E WY++ + D+GEFG G +A+ L    DCP ++ ++DG +   DG 
Sbjct  302   AYVSEVFVPYMDPTEEWYYKTYFDSGEFGFGLSAVSLQSGVDCPNNAIFMDGFYAGQDGT  361

Query  1087  PVSQPNVICVFERYSGDIAWRHSGTGDADDDLIREARPKVSLVVRTTATVGNYDYIFDWE  908
             PV   NV CVFE+Y+G+I WRH+  G   D+ IRE R  VSLVVR+ +TVGNYDYI DWE
Sbjct  362   PVKISNVTCVFEKYAGNIMWRHTEIG-ISDETIREVRSDVSLVVRSVSTVGNYDYILDWE  420

Query  907   FQTDGSIRVTVGLSGIILAKGSPYEHINQFEIPRWDFPAGSLVSENTIGVAHDHFITFHL  728
             F+  GSI+  VGL+G++  K   Y   +Q +   +    G++V  NTI   HDHF+T+HL
Sbjct  421   FKPSGSIKFEVGLTGLLEVKAVNYTQASQIKAGEY----GTMVGANTIATHHDHFLTYHL  476

Query  727   DMDVDGPTNSFVKVDLVKNYNIAGKIQRKSYWSPKRKVAKSENDAKIKLQLDKPSEFHVI  548
             D+DVDG  NSFVK +L+        + RKSYW+   K A++E++A++ L L+ P +  V+
Sbjct  477   DLDVDGAPNSFVKTNLITKPVAEEGVPRKSYWTVSSKTARTESEAQLHLGLE-PCDLIVV  535

Query  547   NPRHQSRLGNPSGYKIVPSATAASLLDLQDPPQLRAAFTNNQIWVTPYNRSEQWAGGLFT  368
             NP  Q+++GN  GY+++P   A+++L   D PQ+RAAFTNN +WVTPYN+SE+WAGG + 
Sbjct  536   NPNKQTKVGNNVGYRLIPGPIASTILFRDDYPQIRAAFTNNNLWVTPYNKSEKWAGGRYV  595

Query  367   YQSHGDDTLAVWSNRNRVIEKQDIVLWYTLGFHHLPCQEDFPVMPTVTSTFQLKPVNFFD  188
              QS GDDTLAVW+ RNR IE +DIVLWYTLGFHH+P QEDFP+M T+++ F+L+P NFFD
Sbjct  596   DQSRGDDTLAVWTKRNRKIENEDIVLWYTLGFHHVPYQEDFPIMLTLSAGFELRPSNFFD  655

Query  187   RNPIIQA  167
             RNP+++ 
Sbjct  656   RNPVLKT  662



>ref|XP_006415313.1| hypothetical protein EUTSA_v10006982mg [Eutrema salsugineum]
 gb|ESQ33666.1| hypothetical protein EUTSA_v10006982mg [Eutrema salsugineum]
Length=679

 Score =   582 bits (1499),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 293/651 (45%), Positives = 419/651 (64%), Gaps = 18/651 (3%)
 Frame = -1

Query  2089  PMHPLDPLTIQEIERTRSILSSYQPFS-GSSLRIHSLSLDEPDKSEVLRWKRG-----NP  1928
             P HP DPLT  E++  R+I++   P           + L+EPDKS VL W         P
Sbjct  26    PGHPFDPLTETELKLVRTIINKSYPIGPNHKFTFQYVGLNEPDKSLVLSWHSSVNHTVKP  85

Query  1927  LPTRKAFVVALSNGQAHLLVVDLGSGRVSSHTRNPASGYPPMSADDASTALEATFSNSVF  1748
              P R+AFV+A  NG++  +VVD  S  + S   +  +GYP +S+ +   A+E  F    F
Sbjct  86    -PPRQAFVIARDNGKSREIVVDFSSRAIVSDKIHVGNGYPMLSSYEQEAAIELVFKFKPF  144

Query  1747  REAISTRGVEINDVVCSAAAPGWFGPEE-EGRRITKVKCYTAQNTPNYYMRPIEGLLLTV  1571
              +A++ RG+ ++++V + +  GW+G  E E  R+ ++  +    + N Y+RPIEG+ + V
Sbjct  145   HDAVTKRGLNVSEIVFTTSTIGWYGESEAETERVVRMLPFYLDGSVNMYLRPIEGMTILV  204

Query  1570  DLDSGKVINVYDTHSPIPIPKAQGTDYRRDGIEHRAPGVEPLKPISMEQPNGQSFRVEDG  1391
             +LD  KV    D  + + +PKA G +YR   +  + P    L+   + QP+G  F V DG
Sbjct  205   NLDVMKVTEFKDRLT-VTMPKANGKEYRLSKL--KPPFGPTLQNAVVLQPDGPGFNV-DG  260

Query  1390  YIVKWASWEFHVKADQRAGIIISQATVFDPEAGKRRSVMYKGFASELFVPYMDVDEGWYF  1211
             +IV+WA+WEFH+  D RAGIIIS A++FD +  K R V+YKG  SE+F+PYMD  + WYF
Sbjct  261   HIVRWANWEFHLSFDVRAGIIISLASIFDMDVNKYRQVLYKGHLSEIFIPYMDPSDDWYF  320

Query  1210  RAFMDAGEFGLGATAMELVPLNDCPRHSHYIDGLFVDPDGRPVSQPNVICVFERYSGDIA  1031
               + D G+FG G  A+ L P  DCP  + ++DG+F    G P   PNV+C+FE+Y+GDI 
Sbjct  321   ATYFDCGDFGCGKCAVSLKPYTDCPAGAVFMDGIFAGQYGTPTKIPNVMCIFEKYAGDIM  380

Query  1030  WRHSGTGDADDDLIREARPKVSLVVRTTATVGNYDYIFDWEFQTDGSIRVTVGLSGIILA  851
             WRH+   +  +  I E RP VSL+ R   TVGNYDYI D+EF+  GSI++ VGL+G++  
Sbjct  381   WRHT-EAEIPNLEITEVRPDVSLIARIVTTVGNYDYIVDYEFKPSGSIKIGVGLTGVLEV  439

Query  850   KGSPYEHINQFEIPRWDFPAGSLVSENTIGVAHDHFITFHLDMDVDGPTNSFVKVDLV-K  674
             K  P E+I++ EI   D   G++V++NT+GV HDHF+TF LD+D+DG  NSFV+ +LV K
Sbjct  440   K--PVEYIHKSEIGEEDI-QGTIVTDNTVGVNHDHFVTFRLDLDIDGTQNSFVRNELVTK  496

Query  673   NYNIAGKIQRKSYWSPKRKVAKSENDAKIKLQLDKPSEFHVINPRHQSRLGNPSGYKIVP  494
                 +    RKSYW+ + K AK+E +A++KL L K  E  V+NP  +++ GN +GY+I+ 
Sbjct  497   RTAKSVNTPRKSYWTTRPKTAKTEAEARVKLGL-KAEELVVVNPNRKTKHGNEAGYRILS  555

Query  493   SATAASLLDLQDPPQLRAAFTNNQIWVTPYNRSEQWAGGLFTYQSHGDDTLAVWSNRNRV  314
              A    LL   D PQ+RAAFTN  +W+T YNRSE WAGGL+  QSHGDDTLAVWS RNR 
Sbjct  556   GAATGPLLAQDDYPQIRAAFTNYNVWITLYNRSEVWAGGLYADQSHGDDTLAVWSQRNRE  615

Query  313   IEKQDIVLWYTLGFHHLPCQEDFPVMPTVTSTFQLKPVNFFDRNPIIQANP  161
             IE +DIV+WYT+GFHH+P QEDFP MPT++  F+L+P NFF++NP++++ P
Sbjct  616   IENKDIVMWYTVGFHHVPSQEDFPTMPTLSGGFELRPTNFFEQNPVLKSKP  666



>gb|KFK44949.1| hypothetical protein AALP_AA1G323600 [Arabis alpina]
Length=682

 Score =   581 bits (1497),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 287/648 (44%), Positives = 420/648 (65%), Gaps = 15/648 (2%)
 Frame = -1

Query  2083  HPLDPLTIQEIERTRSILSSYQPFS-GSSLRIHSLSLDEPDKSEVLRW--KRGNPL--PT  1919
             HP DPLT  E++  R+I++   P           + L+EPDKS VL W   R + +  P 
Sbjct  29    HPFDPLTETELKLVRTIVNKSYPIGPDHKFTFQYVGLNEPDKSLVLSWHSSRNHTIKPPP  88

Query  1918  RKAFVVALSNGQAHLLVVDLGSGRVSSHTRNPASGYPPMSADDASTALEATFSNSVFREA  1739
             R+AFV+A   G++  LVVD  S  + S   +  +GYP ++ D+   A +       FR++
Sbjct  89    RQAFVIARDKGKSRELVVDFSSRAIVSDKIHVGNGYPMLTNDEQEAATDIVLKFKAFRDS  148

Query  1738  ISTRGVEINDVVCSAAAPGWFGPEE-EGRRITKVKCYTAQNTPNYYMRPIEGLLLTVDLD  1562
             ++ RG+ ++++V +++  GW+G  E E  R+ ++  +    T N Y+RPIEG+ + V+LD
Sbjct  149   VTKRGLNVSEIVFTSSTVGWYGESEAETERVIRMMPFYLDGTVNMYLRPIEGMTIIVNLD  208

Query  1561  SGKVINVYDTHSPIPIPKAQGTDYRRDGIEHRAPGVEPLKPISMEQPNGQSFRVEDGYIV  1382
               KV    D  S + +PKA GT+YR   +  + P    L+   + QP+G  F+V DG++V
Sbjct  209   EMKVSEFKD-RSTVTMPKANGTEYRFSKL--KPPFGPALRNAVVLQPDGPGFKV-DGHVV  264

Query  1381  KWASWEFHVKADQRAGIIISQATVFDPEAGKRRSVMYKGFASELFVPYMDVDEGWYFRAF  1202
             +WA+WEFH+  D RAG++IS A++FD +  K R V+YKG  SE+F+PYMD  E WYF  +
Sbjct  265   RWANWEFHLSFDVRAGVVISLASIFDMDVNKYRQVLYKGHLSEMFIPYMDPTEDWYFITY  324

Query  1201  MDAGEFGLGATAMELVPLNDCPRHSHYIDGLFVDPDGRPVSQPNVICVFERYSGDIAWRH  1022
             +D G+FG G  A+ L P  DCP  + ++DG+F   DG P   PN IC+FE+Y+GDI WRH
Sbjct  325   LDCGDFGCGQCAVSLEPYTDCPAGAIFMDGIFAGQDGTPAKIPNAICIFEKYAGDIMWRH  384

Query  1021  SGTGDADDDLIREARPKVSLVVRTTATVGNYDYIFDWEFQTDGSIRVTVGLSGIILAKGS  842
             +   +  +  I E RP VSLV R   TVGNYDYI D+EF+  GSI++ VGL+G++  K  
Sbjct  385   T-EAEIPNLEITEVRPDVSLVARIVTTVGNYDYIVDYEFKPSGSIKMGVGLTGVLEVK--  441

Query  841   PYEHINQFEIPRWDFPAGSLVSENTIGVAHDHFITFHLDMDVDGPTNSFVKVDLV-KNYN  665
             P E+++  E+   +   G++V++NT+GV HDHF+TF LD+D+DG  NSFV+ +LV K   
Sbjct  442   PVEYVHTSEVKDNEDLHGTIVADNTVGVNHDHFVTFRLDLDIDGTDNSFVRNELVTKRTA  501

Query  664   IAGKIQRKSYWSPKRKVAKSENDAKIKLQLDKPSEFHVINPRHQSRLGNPSGYKIVPSAT  485
              +    RKSYW+   K AK+E DA++KL   K  E  V+NP  +++ GN  GY+++P + 
Sbjct  502   KSVNTPRKSYWTTSPKTAKTEADARVKLG-QKAEELVVVNPNKKTKHGNEVGYRLLPGSV  560

Query  484   AASLLDLQDPPQLRAAFTNNQIWVTPYNRSEQWAGGLFTYQSHGDDTLAVWSNRNRVIEK  305
             +  +L   D PQ+RAAFTN  +W+TPYNRSE WAGGL+  +S GDDTLAVWS +NR IEK
Sbjct  561   SNPILFQDDYPQIRAAFTNYNVWITPYNRSEIWAGGLYADRSRGDDTLAVWSQKNRKIEK  620

Query  304   QDIVLWYTLGFHHLPCQEDFPVMPTVTSTFQLKPVNFFDRNPIIQANP  161
             +DIV+WYT+GFHH+P QEDFP MPT++  F+L+P NFF++NP+++  P
Sbjct  621   KDIVMWYTVGFHHVPSQEDFPTMPTMSGGFELRPTNFFEKNPVLKTKP  668



>emb|CAN73878.1| hypothetical protein VITISV_029120 [Vitis vinifera]
Length=644

 Score =   579 bits (1493),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 292/655 (45%), Positives = 411/655 (63%), Gaps = 47/655 (7%)
 Frame = -1

Query  2083  HPLDPLTIQEIERTRSILSSYQPFSGSSLRIHSLSLDEPDKSEVLRWKRGNP-----LPT  1919
             HPLD LT  E  + ++I++   P S  ++    + LDEPDK  +L W   NP      P 
Sbjct  28    HPLDSLTPSEFRQVQAIVNGSNPGSSHNVTFQYVGLDEPDKPALLSW-LSNPNSTTLPPP  86

Query  1918  RKAFVVALSNGQAHLLVVDLGSGRVSSHTRNPASGYPPMSADDASTALEATFSNSVFREA  1739
             R+AFV+   + Q H ++VDL +  + S       GYP +++++ + A E   +   F  +
Sbjct  87    RRAFVITRLHSQTHEIIVDLSTQSIVSDKVYSGHGYPLLTSEEQTAASELPLTYPPFIAS  146

Query  1738  ISTRGVEINDVVCSAAAPGWFGPEEEGRRITKVKCYTAQNTPNYYMRPIEGLLLTVDLDS  1559
             I  R ++++DVVCS    GWFG EE+ RR+ K+ C+    T N YMRPIEG+ + VDLD 
Sbjct  147   IRKRKLKLSDVVCSTFTVGWFG-EEKSRRVLKILCFYTDGTANLYMRPIEGVTIVVDLDE  205

Query  1558  GKVINVYDTHSPIPIPKAQGTDYRRDGIEHRAPGVEPLKPISMEQPNGQSFRVEDGYIVK  1379
              K+   +D  + +P+P+A+GT+YR    + + P    L  +S  QP+G  F++ DG+ ++
Sbjct  206   MKITEYHDRLT-VPMPEAEGTEYRLS--KQKPPFGPRLNGVSSMQPDGPGFKI-DGHNIR  261

Query  1378  WASWEFHVKADQRAGIIISQATVFDPEAGKRRSVMYKGFASELFVPYMDVDEGWYFRAFM  1199
             WA+W+FHV  D RAG+IIS A+++D +    R V+Y+G+ SELFVPYMD  E WY++ F 
Sbjct  262   WANWDFHVSFDARAGLIISLASIYDLQKRTFRRVLYRGYLSELFVPYMDPTEEWYYKTFF  321

Query  1198  DAGEFGLGATAMELVPLNDCPRHSHYIDGLFVDPDGRPVSQPNVICVFERYSGDIAWRHS  1019
             D GEFG G   + L PL DCP ++ ++DG +   DG+P                      
Sbjct  322   DLGEFGFGLCTVPLQPLADCPSNAVFMDGYYAGQDGKP----------------------  359

Query  1018  GTGDADDDLIREARPKVSLVVRTTATVGNYDYIFDWEFQTDGSIRVTVGLSGIILAKGSP  839
                      IRE RP+VSLVVR  ATVGNYDYI DWEF+  GSI++ VGL+GI+  KG  
Sbjct  360   ---------IREVRPEVSLVVRMVATVGNYDYILDWEFKPSGSIKLGVGLTGILEVKGVS  410

Query  838   YEHINQFEIPRWDFPAGSLVSENTIGVAHDHFITFHLDMDVDGPTNSFVKVDLVKNYNIA  659
             Y H +Q +   +    G+L++ NTIGV HDHF+T+HLD+DVDG  NSFVK +L       
Sbjct  411   YTHTSQIKEDVY----GTLLAHNTIGVNHDHFLTYHLDLDVDGDANSFVKANLETKRVKD  466

Query  658   GKIQRKSYWSPKRKVAKSENDAKIKLQLDKPSEFHVINPRHQSRLGNPSGYKIVPSATAA  479
                 RKSYW+   + AK+E+DA+I+L L KP+E  V+NP   ++LGN  GY+++P + ++
Sbjct  467   NISPRKSYWTVVSETAKTESDAQIQLGL-KPAELIVVNPNKXTKLGNYVGYRLIPGSLSS  525

Query  478   SLLDLQDPPQLRAAFTNNQIWVTPYNRSEQWAGGLFTYQSHGDDTLAVWSNRNRVIEKQD  299
              LL   D PQ+R AFT   +W+TPYN+SE+WAGGL+  QS GDDTLAVWS RNR IE +D
Sbjct  526   PLLSDDDYPQIRGAFTKYDVWITPYNKSEKWAGGLYMDQSRGDDTLAVWSQRNREIENKD  585

Query  298   IVLWYTLGFHHLPCQEDFPVMPTVTSTFQLKPVNFFDRNPIIQANPNFAEDLPIC  134
             IVLWYT+GFHH+PCQEDFPVMPT++  F+L+P NFF+RNP+++  P      P C
Sbjct  586   IVLWYTIGFHHVPCQEDFPVMPTLSGGFELRPTNFFERNPVLKTKPPTYGHWPNC  640



>ref|XP_011021542.1| PREDICTED: primary amine oxidase-like [Populus euphratica]
Length=675

 Score =   578 bits (1491),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 294/682 (43%), Positives = 417/682 (61%), Gaps = 13/682 (2%)
 Frame = -1

Query  2164  ASINNLESLLGIHDFKIQNNHFADRPMHPLDPLTIQEIERTRSILS-SYQPFSGSSLRIH  1988
             AS   +  LL    F I          HPLDPL+ +E+   ++I+  SY P S +S+  H
Sbjct  2     ASTLKVVLLLLFSSFTISPISCYKGAQHPLDPLSPKELTLVQTIVKKSYNPSSNNSISFH  61

Query  1987  SLSLDEPDKSEVLRW--KRGNPLPTRKAFVVALSNGQAHLLVVDLGSGRVSSHTRNPASG  1814
              + LDEP+K  VL W  K       R+A V    N Q H ++VDL    +         G
Sbjct  62    YVGLDEPEKPTVLSWLSKPSTKTLPRRALVFTRVNEQTHEIIVDLSKRIIVYDEVYKGLG  121

Query  1813  YPPMSADDASTALEATFSNSVFREAISTRGVEINDVVCSAAAPGWFGPEEEGRRITKVKC  1634
             YP ++AD+   A++       F E+   R + ++ VVCS    GWFG  E  +R+ KV+C
Sbjct  122   YPLLTADEQIAAIQLPLKYGPFIESTKKRDLNVSYVVCSTFTVGWFGGVERTKRVVKVQC  181

Query  1633  YTAQNTPNYYMRPIEGLLLTVDLDSGKVINVYDTHSPIPIPKAQGTDYRRDGIEHRAPGV  1454
             +  + T N Y+RPIEG+ + VDLD  K++   D    IP+PKA+GTDYR    +   P  
Sbjct  182   FYNKGTVNLYLRPIEGIRIVVDLDKMKIVEYSDAFK-IPVPKAEGTDYRFS--KQHPPFG  238

Query  1453  EPLKPISMEQPNGQSFRVEDGYIVKWASWEFHVKADQRAGIIISQATVFDPEAGKRRSVM  1274
               +   ++ Q NG  F + DG+ ++W +W FH+  D R G IIS A+++DPE    RSV+
Sbjct  239   PRINGAAIMQTNGPGFEI-DGHTIRWVNWVFHLAFDVRVGPIISLASIYDPEKHTYRSVL  297

Query  1273  YKGFASELFVPYMDVDEGWYFRAFMDAGEFGLGATAMELVPLNDCPRHSHYIDGLFVDPD  1094
             Y+G  SELFVPYMD  E +Y++ F D GEFG G  A  LVPL DCP ++ ++DG +   D
Sbjct  298   YRGHISELFVPYMDPTEEYYYKTFFDCGEFGFGQNAASLVPLADCPNNAVFMDGYYAAHD  357

Query  1093  GRPVSQPNVICVFERYSGDIAWRHSGTGDADDDLIREARPKVSLVVRTTATVGNYDYIFD  914
             G  V   N  C+FER++GDI WRH+  G   + +I EARP+VSLVVR  AT+GNYD+I D
Sbjct  358   GSAVKVANAFCIFERHAGDIMWRHTELG-IPNRVITEARPEVSLVVRMVATIGNYDHIID  416

Query  913   WEFQTDGSIRVTVGLSGIILAKGSPYEHINQFEIPRWDFPAGSLVSENTIGVAHDHFITF  734
             WEF+  GSI+  VGLSGI+  K + + +++Q     +    G+L+ +NTIG+ HDHF+T+
Sbjct  417   WEFKPSGSIKAQVGLSGILEVKSTTFTNVDQINEEVY----GTLLGDNTIGLNHDHFLTY  472

Query  733   HLDMDVDGPTNSFVKVDLVKNYNIAGKIQRKSYWSPKRKVAKSENDAKIKLQLDKPSEFH  554
              LD+D+DG  NSFVK +LV  +       RKS+W+   + AK+E++AKI+L +  PS+  
Sbjct  473   RLDLDIDGVANSFVKQNLVTKHVKDNVSPRKSFWTVVSETAKTESEAKIRLGM-TPSDLV  531

Query  553   VINPRHQSRLGNPSGYKIVPSATAASLLDLQDPPQLRAAFTNNQIWVTPYNRSEQWAGGL  374
             ++NP  +++ GN  GY+++P      LL   D PQ+R AF+   +WVTPYN+SE WAGG 
Sbjct  532   IVNPNKKTKPGNYHGYRLIPGTATHPLLLEDDYPQIRGAFSKYNVWVTPYNKSEIWAGGK  591

Query  373   FTYQSHGDDTLAVWSNRNRVIEKQDIVLWYTLGFHHLPCQEDFPVMPTVTSTFQLKPVNF  194
             +  QS G DTLAVW+ R+R IE +DIVLW+ LG+HH PCQEDFPVMPT+++ F+L+P NF
Sbjct  592   YVDQSQGQDTLAVWTLRDRKIENEDIVLWHVLGYHHSPCQEDFPVMPTLSAGFELRPANF  651

Query  193   FDRNPIIQANPNFAEDLPICRA  128
             F+ NP+++  P      P C A
Sbjct  652   FESNPVLKVLPPKPVRWPNCTA  673



>ref|XP_002452575.1| hypothetical protein SORBIDRAFT_04g028410 [Sorghum bicolor]
 gb|EES05551.1| hypothetical protein SORBIDRAFT_04g028410 [Sorghum bicolor]
Length=696

 Score =   579 bits (1492),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 300/681 (44%), Positives = 419/681 (62%), Gaps = 42/681 (6%)
 Frame = -1

Query  2083  HPLDPLTIQEIERTRSILSSYQPFSGSSLRIHSLSLDEPDKSEVLRWK--RGNPLPTRKA  1910
             HPLDPL+  E+   R+ + +        L  H + LDEP+K EVL +       L  R+A
Sbjct  26    HPLDPLSAAELTAVRAAVLASPFVPARPLHFHYVGLDEPEKPEVLSYSYASATALLPRRA  85

Query  1909  FVVALSNGQAHLLVVDLGSGR---VSSHTRNPASGYPPMSADDASTALEATFSNSVFREA  1739
              V+A ++GQ+H L+VD+       V SH  +  +G+P M+ +D   A+    +   F ++
Sbjct  86    LVIARADGQSHELLVDVTDASAPSVLSHAVHRGAGFPMMTTEDQVAAMALPPTYPPFVDS  145

Query  1738  ISTRGVEINDVVCSAAAPGWFG---PEEEGRRITKVKCYTAQNTPNYYMRPIEGLLLTVD  1568
             +  RG+ ++DV C   + GWFG   P   G R+ K++C+    + N+Y RP+EG+ L VD
Sbjct  146   VRRRGLNVSDVGCGVISRGWFGASQPAYGGGRVAKMQCFVTAGSANFYARPLEGVTLVVD  205

Query  1567  LDSGKVINVYDTHSPIPIPKAQGTDYRRDGI------EHRAPGVEPLKPISMEQPNGQSF  1406
             LD   ++  Y      P+PKA GTDYR + +         APGV       + QP G+ F
Sbjct  206   LDRVAIVG-YRDRVVEPVPKADGTDYRAEKLGPPFTGPATAPGV-------VVQPEGRGF  257

Query  1405  RVEDGYIVKWASWEFHVKADQRAGIIISQATVFD-----PEAGKRRSVMYKGFASELFVP  1241
              + DG +V+WA+WEFHV  D RAG++IS A++ D     P   +RR V+Y+GF SE+FVP
Sbjct  258   HI-DGRVVRWANWEFHVGFDMRAGMVISLASIQDADDAAPGGQRRRRVLYRGFVSEVFVP  316

Query  1240  YMDVDEGWYFRAFMDAGEFGLGATAMELVPLNDCPRHSHYIDGLFVDPDGRPVSQPNVIC  1061
             YMD  E WYF  F+DAG++GLG +A  L+   DCP ++ Y  G + D DG+PV   +VIC
Sbjct  317   YMDPAEEWYFHTFIDAGDYGLGVSASPLLRGADCPTNAAYFGGYYADADGKPVEAMDVIC  376

Query  1060  VFERYSGDIAWRHSGTGDADDDLIREARPKVSLVVRTTATVGNYDYIFDWEFQTDGSIRV  881
             +FERY+GD+AWRH+  G     +  E RP V+LV RT  TVGNYDY  DWEF+T GSI+ 
Sbjct  377   LFERYAGDVAWRHTEFG-TRGRVETEVRPDVTLVARTVVTVGNYDYTLDWEFKTMGSIKC  435

Query  880   TVGLSGIILAKGSPYEHINQFEIPRWDFPAGSLVSENTIGVAHDHFITFHLDMDVDGPTN  701
              V LSGI+  K + Y H+ Q +        G+LV+ENT+GV HDHFIT+HLD+DVDG  N
Sbjct  436   VVSLSGILEMKATSYTHVEQIK----SDAHGTLVAENTVGVYHDHFITYHLDLDVDGTNN  491

Query  700   SFVKVDLVKNYNIA------GKIQRKSYWSPKRKVAKSENDAKIKLQLDKP-SEFHVINP  542
             SFVK  +V   N            R+SYW+ +R VA++E D ++ +    P ++   +NP
Sbjct  492   SFVKNTMVPERNTGDPATGGADTPRRSYWTVRRDVAETEADGQVNVDGGGPPADLLFVNP  551

Query  541   RHQSRLGNPSGYKIVPS-ATAASLLDLQDPPQLRAAFTNNQIWVTPYNRSEQWAGGLFTY  365
               ++++GN  GY++VP+ AT ASLL   D PQ RA++T  Q+WVTPY+RSE+WA GL+  
Sbjct  552   SKETKVGNEVGYRLVPAGATGASLLADDDYPQRRASYTKRQVWVTPYDRSEKWATGLYAE  611

Query  364   QSHGDDTLAVWSNRNRVIEKQDIVLWYTLGFHHLPCQEDFPVMPTVTSTFQLKPVNFFDR  185
             Q  G+D+L  WS RNR I  +DIVLWYT+G HH+P QEDFPVMPT++  FQL+P NFFDR
Sbjct  612   QGTGEDSLGAWSKRNRGIRDRDIVLWYTVGLHHIPYQEDFPVMPTLSGGFQLRPANFFDR  671

Query  184   NPIIQANPNFAE-DLPICRAG  125
             NP+I+  P     + P C  G
Sbjct  672   NPLIRTRPPADHNNYPNCSCG  692



>ref|XP_003516418.1| PREDICTED: primary amine oxidase-like [Glycine max]
Length=672

 Score =   578 bits (1489),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 289/653 (44%), Positives = 406/653 (62%), Gaps = 16/653 (2%)
 Frame = -1

Query  2083  HPLDPLTIQEIERTRSILSSYQPFSGSSLRIHSLSLDEPDKSEVLRWKRGNPLPTRKAFV  1904
             HPLDPLT QEI   ++I+    P   + +  H + LD+PDK+ VL+W        R AF 
Sbjct  32    HPLDPLTQQEITLVKTIVLKKYPKPANRVFFHYVGLDDPDKAAVLKWLSSGARTPRNAFS  91

Query  1903  VALSNGQAHLLVVDLGSGR-VSSHTRNPASGYPPMSADDASTALEATFSNSVFREAISTR  1727
             +AL NGQ H L V+L S R V     +  +G+P ++ ++ + ALE       F E++  R
Sbjct  92    IALINGQIHELTVNLLSPRNVVLDKIHTGNGFPTLTEEEQTEALELLPKYGPFLESLKKR  151

Query  1726  GVEINDVVCSAAAPGWFGPEEEGRRITKVKCYTAQNTPNYYMRPIEGLLLTVDLDSGKVI  1547
             G  ++ V C+  + GWFG E +  R  K++C+    +PN Y+RPI G+ +  DL++ K++
Sbjct  152   GFNVSQVACTTFSVGWFG-ETKSTRTVKMECFLQDGSPNIYVRPISGITIVADLETMKIV  210

Query  1546  NVYDTHSPIPIPKAQGTDYRRDGIEHRAPGVEP-LKPISMEQPNGQSFRVEDGYIVKWAS  1370
               +D      +PKA+ T+YR     H  P   P L   S  QP+G  + + DG+ + WA+
Sbjct  211   EYHD-ELITTVPKAENTEYRAS---HLKPPFGPKLHSWSSRQPDGPGYTL-DGHSISWAN  265

Query  1369  WEFHVKADQRAGIIISQATVFDPEAGKRRSVMYKGFASELFVPYMDVDEGWYFRAFMDAG  1190
             W+FH+  D+RAG +IS A+++DPE  K RSV+Y+G+ SELFVPY D  E WY++ F DAG
Sbjct  266   WKFHIGFDERAGAVISTASIYDPELHKSRSVLYRGYISELFVPYQDPTEEWYYKTFFDAG  325

Query  1189  EFGLGATAMELVPLNDCPRHSHYIDGLFVDPDGRPVSQPNVICVFERYSGDIAWRHSGTG  1010
             EF  G + + LVPL DCP H+ ++D  F   DG P    N ICVFE+Y G I+WRH+ TG
Sbjct  326   EFAFGKSMVSLVPLEDCPPHAQFLDAYFAATDGSPQHLENAICVFEQYGG-ISWRHTETG  384

Query  1009  DADDDLIREARPKVSLVVRTTATVGNYDYIFDWEFQTDGSIRVTVGLSGIILAKGSPYEH  830
                D++  E R  VSL+VR+  TVGNYD I DWEF+T GSI+ ++ LSGI+  K     H
Sbjct  385   L--DEIFTEVRTDVSLIVRSIVTVGNYDNIVDWEFKTSGSIKPSISLSGILEVKPVDITH  442

Query  829   INQFEIPRWDFPAGSLVSENTIGVAHDHFITFHLDMDVDGPTNSFVKVDLVKNYNIAGKI  650
              +Q +  +     G+LVS N+IGV HDHF  FHLD D+DG  NSFVK  L          
Sbjct  443   TDQIKEDQ----HGTLVSANSIGVYHDHFYIFHLDFDIDGVENSFVKTSLKTLQVTDNSS  498

Query  649   QRKSYWSPKRKVAKSENDAKIKLQLDKPSEFHVINPRHQSRLGNPSGYKIVPSATAASLL  470
             +RKSYW+   +V K+E+DAK KL    P+E  ++NP  ++  GN  GY++V +A    LL
Sbjct  499   KRKSYWTTSNEVVKTESDAKTKLGF-SPAEIVIVNPNKKTSTGNEVGYRLVSNAAVHPLL  557

Query  469   DLQDPPQLRAAFTNNQIWVTPYNRSEQWAGGLFTYQSHGDDTLAVWSNRNRVIEKQDIVL  290
                D PQ R AFT+  +WVTPYN++E+WAGGL+  QS GDDTLAVW+ +NR IE +DIV+
Sbjct  558   TDDDYPQTRGAFTSYNVWVTPYNKTEKWAGGLYVDQSRGDDTLAVWTKQNRGIENKDIVM  617

Query  289   WYTLGFHHLPCQEDFPVMPTVTSTFQLKPVNFFDRNPIIQANPNFAEDLPICR  131
             WY +G HH+PCQEDFP+MP +++ F+L+P NFF+RNP+++         P C 
Sbjct  618   WYVVGIHHVPCQEDFPIMPLLSTGFELRPTNFFERNPVLKTLSPGIVKFPGCE  670



>ref|XP_002460889.1| hypothetical protein SORBIDRAFT_02g036990 [Sorghum bicolor]
 gb|EER97410.1| hypothetical protein SORBIDRAFT_02g036990 [Sorghum bicolor]
Length=710

 Score =   578 bits (1491),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 298/668 (45%), Positives = 420/668 (63%), Gaps = 35/668 (5%)
 Frame = -1

Query  2083  HPLDPLTIQEIERTRSILSSYQPFSGSSLRIHSLSLDEPDKSEVLRWKRG--------NP  1928
             HPLDPLT +EI   R  + +        L  H + LDEPDK +VL +  G         P
Sbjct  35    HPLDPLTPEEITAVRDAVLASPLVPARPLTFHYVGLDEPDKPDVLAYAYGGGGGSSSPRP  94

Query  1927  LPTRKAFVVALSNGQAHLLVVDLGS-------GRVSSHTRNPASGYPPMSADDASTALEA  1769
             L  R+A V+A +  Q+H L VD+ S         V SH  +  +G+P ++ ++   A+  
Sbjct  95    LLPRRALVIARAGEQSHELRVDIASSSNGTTSATVLSHAIHRGAGFPILTLEEQFAAVAL  154

Query  1768  TFSNSVFREAISTRGVEINDVVCSA-----AAPGWFGPEEEGRRITKVKCYTAQNTPNYY  1604
               +   F +++  RGV+++DV+C+         G  G     +R+ K+ C+ A  T N+Y
Sbjct  155   PPAYPPFVDSVRRRGVDMDDVLCAVFPVGWFGGGGGGDGTANKRVAKMLCFVAGPTANFY  214

Query  1603  MRPIEGLLLTVDLDSGKVINVYDTHSPIPIPKAQGTDYRRDGIEHRAPGVEPLKPISMEQ  1424
              RPIEG+ + VDLD+  ++  Y      P+PKA+GTDYR         G++P   +++ Q
Sbjct  215   ARPIEGVTMVVDLDAMAIVG-YRDRVTYPVPKAEGTDYRAGKTGPPLAGLQPAPGVAV-Q  272

Query  1423  PNGQSFRVEDGYIVKWASWEFHVKADQRAGIIISQATVFDPEAGKRRSVMYKGFASELFV  1244
             P G+ F + DG++V+WA+WEFHV  D RAG +IS A+V D +AG RR VMY+GF SE+FV
Sbjct  273   PEGRGFHI-DGHVVRWANWEFHVGFDMRAGTVISLASVDDADAGTRRRVMYRGFVSEVFV  331

Query  1243  PYMDVDEGWYFRAFMDAGEFGLGATAMELVPLNDCPRHSHYIDGLFVDPDGRPVSQPNVI  1064
             PYMD  E WY+R F+DAGE+GLG  A  L P  DCP ++ Y DG +   DG+PVS  N I
Sbjct  332   PYMDPVEEWYYRTFLDAGEYGLGLWAFPLQPGADCPANAAYFDGSYAGQDGKPVSGENRI  391

Query  1063  CVFERYSGDIAWRHSGTGDADDDLIREARPKVSLVVRTTATVGNYDYIFDWEFQTDGSIR  884
             CVFERY+GD+AWRH+  G   D LI E RP V+LVVR   + GNYDYI DWEF+T GSI+
Sbjct  392   CVFERYAGDVAWRHTEAG-FPDRLITEVRPDVTLVVRMVVSPGNYDYILDWEFKTSGSIK  450

Query  883   VTVGLSGIILAKGSPYEHINQFEIPRWDFPAGSLVSENTIGVAHDHFITFHLDMDVDGPT  704
               V L+G++  KG+ Y H ++        P GSLVSENT+ + HDH++T+HLD+D+DG  
Sbjct  451   FVVSLTGLLEVKGTSYTHADEITAD----PHGSLVSENTLAIYHDHYVTYHLDLDIDGTN  506

Query  703   NSFVKVDLVKNYNI------AGKIQRKSYWSPKRKVAKSENDAKIKLQLDKPSEFHVINP  542
             NSFVK  +    N            R+SYW+ +R+VA++E+D +  +  D P++   +NP
Sbjct  507   NSFVKNIITARRNTGDPATGGADTPRRSYWTVRREVAETESDGQADVNADGPADLLFVNP  566

Query  541   RHQSRLGNPSGYKIVPS-ATAASLLDLQDPPQLRAAFTNNQIWVTPYNRSEQWAGGLFTY  365
               ++R+G+  GY+++PS ATAAS+L   D PQ RA++T  Q+WVTPY+++E+WA GL+  
Sbjct  567   GKKTRMGHEVGYRLIPSGATAASVLADDDYPQRRASYTKKQVWVTPYSKAEKWASGLYAD  626

Query  364   QSHGDDTLAVWSNRNRVIEKQDIVLWYTLGFHHLPCQEDFPVMPTVTSTFQLKPVNFFDR  185
             QS G D+L  W  RNR I  +DIVLWYTLG HH+P QEDFPVMPT++  F+L+P NFF+R
Sbjct  627   QSTGGDSLTAWRRRNRGIRDEDIVLWYTLGLHHIPYQEDFPVMPTLSGGFELRPSNFFER  686

Query  184   NPIIQANP  161
             NPI++  P
Sbjct  687   NPILRIRP  694



>ref|XP_006415312.1| hypothetical protein EUTSA_v10007005mg [Eutrema salsugineum]
 gb|ESQ33665.1| hypothetical protein EUTSA_v10007005mg [Eutrema salsugineum]
Length=666

 Score =   577 bits (1486),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 290/650 (45%), Positives = 415/650 (64%), Gaps = 30/650 (5%)
 Frame = -1

Query  2089  PMHPLDPLTIQEIERTRSILSSYQPFS-GSSLRIHSLSLDEPDKSEVLRWKRGN----PL  1925
             P HP DP+T  E++  R+I++   P           + L+EPDKS VL W          
Sbjct  26    PRHPFDPMTETELKLVRTIINKSYPIGPNHKFTFQYVGLNEPDKSLVLSWHSSANHTVKP  85

Query  1924  PTRKAFVVALSNGQAHLLVVDLGSGRVSSHTRNPASGYPPMSADDASTALEATFSNSVFR  1745
             P R+AFV+A  NG++  +VVD  S  + S   +  +GYP ++ D+   A E       FR
Sbjct  86    PPRQAFVIARDNGKSREIVVDFYSRAIVSDKIHVGNGYPMLTNDEQEAATELVLKFKQFR  145

Query  1744  EAISTRGVEINDVVCSAAAPGWFGPEE-EGRRITKVKCYTAQNTPNYYMRPIEGLLLTVD  1568
             +A++ RG+ ++++V + +  GW+G  E E  R+ ++  +    T N Y+RPIEG+ + V+
Sbjct  146   DAVTKRGLNVSEIVFTTSTVGWYGESEAETERVMRLMPFYLDGTVNMYLRPIEGMTILVN  205

Query  1567  LDSGKVINVYDTHSPIPIPKAQGTDYRRDGIEHRAPGVEPLKPISMEQPNGQSFRVEDGY  1388
             LD  KV    D  + + +PKA GT+YR   +  + P    L+   + QP+G  F+  DG+
Sbjct  206   LDVMKVTEFKDRLT-VTMPKANGTEYRFSKL--KPPFGPTLQNAVVLQPDGPGFKF-DGH  261

Query  1387  IVKWASWEFHVKADQRAGIIISQATVFDPEAGKRRSVMYKGFASELFVPYMDVDEGWYFR  1208
             IV+WA+WEFH+  D RAGI+IS A++FD +  K + V+YKG  SE+F+PYMD  + WYF 
Sbjct  262   IVRWANWEFHLSFDVRAGIVISLASIFDMDVNKSKQVLYKGHLSEMFIPYMDPSDDWYFI  321

Query  1207  AFMDAGEFGLGATAMELVPLNDCPRHSHYIDGLFVDPDGRPVSQPNVICVFERYSGDIAW  1028
              ++D G+FG G  A+ L P  DCP  + ++DGLF   DG P   PNV+C+FE+Y+GDI W
Sbjct  322   TYLDCGDFGCGQCAVSLEPYTDCPAGAVFMDGLFAGQDGTPAKIPNVMCIFEKYAGDIMW  381

Query  1027  RHSGTGDADDDLIREARPKVSLVVRTTATVGNYDYIFDWEFQTDGSIRVTVGLSGIILAK  848
             RH+   +  +  I E RP VSLVVR   TVGNYDYI D+EF+  GSI++ VGL+G++  K
Sbjct  382   RHT-EAEIPNLEITEVRPDVSLVVRIVTTVGNYDYIIDYEFKPSGSIKMGVGLTGVLEVK  440

Query  847   GSPYEHINQFEIPRWDFPAGSLVSENTIGVAHDHFITFHLDMDVDGPTNSFVKVDLV-KN  671
               P E+I+  E+   D   G++V++NT+GV HDHF+TF LD+D+DG  NSFV+ +LV K 
Sbjct  441   --PVEYIHTSEVGEEDI-HGTIVADNTVGVNHDHFVTFRLDLDIDGTDNSFVRNELVTKR  497

Query  670   YNIAGKIQRKSYWSPKRKVAKSENDAKIKLQLDKPSEFHVINPRHQSRLGNPSGYKIVPS  491
                +    RKSYW+ + K AK+E +A++KL L K  E  V+NP  +++ GN +GY     
Sbjct  498   TAKSVNTPRKSYWTTRPKTAKTEAEARVKLGL-KAEELVVVNPNRKTKHGNEAGY-----  551

Query  490   ATAASLLDLQDPPQLRAAFTNNQIWVTPYNRSEQWAGGLFTYQSHGDDTLAVWSNRNRVI  311
                       D PQ+RAAFTN  +W+TPYNRSE WAGGL+  QSHGDDTLAVWS RNR I
Sbjct  552   ---------HDYPQIRAAFTNYNVWITPYNRSEVWAGGLYADQSHGDDTLAVWSQRNREI  602

Query  310   EKQDIVLWYTLGFHHLPCQEDFPVMPTVTSTFQLKPVNFFDRNPIIQANP  161
             E +DIV+WYT+GFHH+P QEDFP MPT++  F+L+P NFF++NP++++ P
Sbjct  603   ENKDIVMWYTIGFHHVPSQEDFPTMPTLSGGFELRPTNFFEQNPVLKSKP  652



>ref|XP_010478584.1| PREDICTED: primary amine oxidase [Camelina sativa]
Length=681

 Score =   577 bits (1487),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 290/651 (45%), Positives = 418/651 (64%), Gaps = 17/651 (3%)
 Frame = -1

Query  2089  PMHPLDPLTIQEIERTRSILSSYQPFS-GSSLRIHSLSLDEPDKSEVLRW--KRGNPL--  1925
             P HP DPLT  E++  R+I++   P           + L+EPDKS VL W   R + +  
Sbjct  26    PRHPFDPLTETELKLVRTIINKSYPVGPNHKFTFQHVGLNEPDKSLVLSWYSSRNHTIKP  85

Query  1924  PTRKAFVVALSNGQAHLLVVDLGSGRVSSHTRNPASGYPPMSADDASTALEATFSNSVFR  1745
             P R+AFV+A  NG+   +VVD  S  + S   +  +GYP +S D+   + E       F 
Sbjct  86    PPRQAFVIARDNGKTREIVVDFSSQAIVSDKIHVGNGYPTLSNDEQEASSEVVVKFKPFL  145

Query  1744  EAISTRGVEINDVVCSAAAPGWFGPEE-EGRRITKVKCYTAQNTPNYYMRPIEGLLLTVD  1568
             ++++ RG+ ++++V + +  GW+G  + E  R+ ++  +    T N Y++PIEG+ + V+
Sbjct  146   DSVARRGLNVSEIVFTTSTIGWYGETKAETERVIRLMPFYLDGTVNMYLKPIEGMTIIVN  205

Query  1567  LDSGKVINVYDTHSPIPIPKAQGTDYRRDGIEHRAPGVEP-LKPISMEQPNGQSFRVEDG  1391
             LD  KV    D  + + +PKA  T+YR   I    P   P L+   + QP+G  F+V DG
Sbjct  206   LDKMKVTEFKDRLT-VTMPKANETEYR---ISKLNPPFGPTLRNAVLLQPDGPGFKV-DG  260

Query  1390  YIVKWASWEFHVKADQRAGIIISQATVFDPEAGKRRSVMYKGFASELFVPYMDVDEGWYF  1211
             +IV+WA+WEFH+  D RAGI+IS A++FD +  K R V+YKG  SE+F+PYMD  + WYF
Sbjct  261   HIVRWANWEFHLSFDVRAGIVISLASIFDMDVNKYRQVLYKGHLSEMFIPYMDPSDDWYF  320

Query  1210  RAFMDAGEFGLGATAMELVPLNDCPRHSHYIDGLFVDPDGRPVSQPNVICVFERYSGDIA  1031
               ++D G+FG G  A+ L P  DCP  + +IDG+F   DG P   PN IC+FE+Y+GDI 
Sbjct  321   ITYLDCGDFGCGQCAVSLEPYTDCPAGAVFIDGIFAGQDGTPAKIPNAICIFEKYAGDIM  380

Query  1030  WRHSGTGDADDDLIREARPKVSLVVRTTATVGNYDYIFDWEFQTDGSIRVTVGLSGIILA  851
             WRH+   +  +  I E RP VSLV R   TVGNYDYI D+EF+  GSI++ VGL+G++  
Sbjct  381   WRHT-EAEIPNLEITEVRPDVSLVARIVTTVGNYDYIVDYEFKPSGSIKMGVGLTGVLEI  439

Query  850   KGSPYEHINQFEIPRWDFPAGSLVSENTIGVAHDHFITFHLDMDVDGPTNSFVKVDLV-K  674
             K  P E+I+  EI   +   G++V++NT+GV HDHF+TF LD+D+DG  NSFV+ +LV K
Sbjct  440   K--PVEYIHNSEIKEGEDIHGTIVADNTVGVNHDHFVTFRLDLDIDGSENSFVRNELVTK  497

Query  673   NYNIAGKIQRKSYWSPKRKVAKSENDAKIKLQLDKPSEFHVINPRHQSRLGNPSGYKIVP  494
                 +    R+SYW+ + K AK+E +A++KL L K  E  V+NP  +++ GN  GY+++ 
Sbjct  498   RAPESVNTPRRSYWTSRPKTAKTEAEARVKLGL-KAEELVVVNPNRKTKHGNEVGYRLLH  556

Query  493   SATAASLLDLQDPPQLRAAFTNNQIWVTPYNRSEQWAGGLFTYQSHGDDTLAVWSNRNRV  314
              + A  LL   D PQ+RAAFTN  +W+TPYNRSE WAGGL+  +S GDDTLAVWS RNR 
Sbjct  557   GSAAGPLLAQDDYPQIRAAFTNYNVWITPYNRSEVWAGGLYADRSQGDDTLAVWSERNRK  616

Query  313   IEKQDIVLWYTLGFHHLPCQEDFPVMPTVTSTFQLKPVNFFDRNPIIQANP  161
             IE +DIV+WYT+GFHH+P QED+P MPT++  F+L+P NFF+RNP+++  P
Sbjct  617   IENKDIVMWYTIGFHHVPSQEDYPTMPTLSGGFELRPTNFFERNPVLKTKP  667



>ref|NP_001265996.1| primary amine oxidase-like precursor [Cicer arietinum]
 emb|CAA08855.1| copper amine oxidase [Cicer arietinum]
Length=670

 Score =   576 bits (1485),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 295/701 (42%), Positives = 432/701 (62%), Gaps = 47/701 (7%)
 Frame = -1

Query  2260  MAASSIFCLFYMASSMLIFLQVNSCLSFESSNASINNLESLLGIHDFKIQNNHFADRPMH  2081
             MA+++I   F+ A + LIFLQ  + L+ +                              H
Sbjct  1     MASTTIKLSFFFAIT-LIFLQAVTPLNLQ------------------------------H  29

Query  2080  PLDPLTIQEIERTRSILSSYQPFSGSSLRIHSLSLDEPDKSEVLRWKRGNPLPT--RKAF  1907
             PLDPLT +E    ++++    P S +S+  H + LD+PDK +VL+++    L T  RK+F
Sbjct  30    PLDPLTKEEFSIVQTVVLHKYPTSKNSVAFHYIGLDDPDKDDVLKYETQPTLITIPRKSF  89

Query  1906  VVALSNGQAHLLVVDLGSGRVSSHTRNPASGYPPMSADDASTALEATFSNSVFREAISTR  1727
             VVA+ N Q H +V+DL    + S   +   G+P +SAD+   A++       F  +++ R
Sbjct  90    VVAIINSQNHEIVIDLRLKTIVSDNIHKGYGFPILSADEQGVAIKLPLKYPPFIASVNKR  149

Query  1726  GVEINDVVCSAAAPGWFGPEEEGRRITKVKCYTAQNTPNYYMRPIEGLLLTVDLDSGKVI  1547
             G+ ++++VCS  + GWFG EE+  R  +V C+  +NT N Y+RPI G+ + VDL   K++
Sbjct  150   GLNLSEIVCSTFSMGWFG-EEKNSRTVRVDCFMKENTVNIYVRPISGITIVVDLQLMKIV  208

Query  1546  NVYDTHSPIPIPKAQGTDYRRDGIEHRAPGVEP-LKPISMEQPNGQSFRVEDGYIVKWAS  1370
               Y+      +P A+ TDYR     H+ P   P L  +   QP G    + +GY V WA+
Sbjct  209   E-YNDRGIEAVPTAEKTDYR---FSHQNPPFGPKLNSLVSHQPQGSGAHI-NGYSVSWAN  263

Query  1369  WEFHVKADQRAGIIISQATVFDPEAGKRRSVMYKGFASELFVPYMDVDEGWYFRAFMDAG  1190
             W FH+  D RAGI+IS A+++D E  K R V+YKG+ SELFVPY D  E +YF+ F D+G
Sbjct  264   WRFHIGFDARAGIVISLASIYDLEKHKSRRVLYKGYISELFVPYQDPTEEFYFKTFFDSG  323

Query  1189  EFGLGATAMELVPLNDCPRHSHYIDGLFVDPDGRPVSQPNVICVFERYSGDIAWRHSGTG  1010
             EFG G + + L+P  DCP H+ +ID      DG P+   N ICVFE+Y G+I WRH+ TG
Sbjct  324   EFGFGLSTVSLIPNRDCPSHAQFIDTYIHSADGSPILLKNAICVFEQY-GNIMWRHTETG  382

Query  1009  DADDDLIREARPKVSLVVRTTATVGNYDYIFDWEFQTDGSIRVTVGLSGIILAKGSPYEH  830
                ++   E+R +V+L+VRT  TVGNYD + DWEF+T GSI+  + LSGI+  KG+  +H
Sbjct  383   -IPNEFPEESRTEVNLIVRTVVTVGNYDNVLDWEFKTSGSIKPAIALSGILEIKGANIKH  441

Query  829   INQFEIPRWDFPAGSLVSENTIGVAHDHFITFHLDMDVDGPTNSFVKVDLVKNYNIAGKI  650
              ++ +  ++    G+LVS N+IG+ HDHF  ++LD DVDG  NSF K  L       G  
Sbjct  442   KDEIKEDQY----GTLVSANSIGIYHDHFYMYYLDFDVDGVNNSFEKTSLKTVRITDGSS  497

Query  649   QRKSYWSPKRKVAKSENDAKIKLQLDKPSEFHVINPRHQSRLGNPSGYKIVPSATAASLL  470
             +RKSYW+ + + AK+E+DAKI + L  P+E  V+NP  ++ +GN  GY+++P+  A  LL
Sbjct  498   KRKSYWTTETQTAKTESDAKITIGL-SPAELVVVNPNKKTAVGNDVGYRLIPAIPAHPLL  556

Query  469   DLQDPPQLRAAFTNNQIWVTPYNRSEQWAGGLFTYQSHGDDTLAVWSNRNRVIEKQDIVL  290
                D PQ+R AFTN  +WVTPYNR+E+WAGGL+   S GDDTLAVW+ +NR IE +DIVL
Sbjct  557   TEDDYPQIRGAFTNYNVWVTPYNRTEKWAGGLYVDHSRGDDTLAVWTQKNRDIENKDIVL  616

Query  289   WYTLGFHHLPCQEDFPVMPTVTSTFQLKPVNFFDRNPIIQA  167
             W+ +G HH+P QEDFP+MP ++++F+L+P NFF+RNP++  
Sbjct  617   WHVVGIHHVPAQEDFPIMPLLSTSFELRPTNFFERNPVLNT  657



>ref|XP_006354449.1| PREDICTED: primary amine oxidase-like [Solanum tuberosum]
Length=657

 Score =   575 bits (1482),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 291/643 (45%), Positives = 413/643 (64%), Gaps = 18/643 (3%)
 Frame = -1

Query  2083  HPLDPLTIQEIERTRSIL-SSYQPFSGSSLRIHSLSLDEPDKSEVLRWKRGNPLPT--RK  1913
             HPL+ L + E+ +  +I+ +SY P +   +  H + L+EP+K  VL W      P   R+
Sbjct  27    HPLESLALFELTQVTNIVKNSYFPLN---VTFHYVGLNEPNKQLVLSWLSSTHHPALPRE  83

Query  1912  AFVVALSNGQAHLLVVDLGSGRVSSHTRNPASGYPPMSADDASTALEATFSNSVFREAIS  1733
             A V+   + + H ++VDL S  + S       GYP ++  + + A E   S   F  +I 
Sbjct  84    AIVITRIDQKTHEIIVDLSSVSILSDKIYNGHGYPMLTLQEQTAADELPLSYPPFISSIK  143

Query  1732  TRGVEINDVVCSAAAPGWFGPEEEG-RRITKVKCYTAQNTPNYYMRPIEGLLLTVDLDSG  1556
              R +++ +VVC   A GW+G + +   R+ KV CY    T N YMRPIEG+ +TV LD  
Sbjct  144   KRRLKLKEVVCQGFAVGWYGEKRKSTNRMVKVMCYYLDGTVNLYMRPIEGITITVLLDQM  203

Query  1555  KVINVYDTHSPIPIPKAQGTDYRRDGIEHRAPGVEPLKPISMEQPNGQSFRVEDGYIVKW  1376
              + +  D    +P+PKA GTDY   G + R    E    I + QP+G SF +++G  V W
Sbjct  204   TIASYID-RLIVPVPKANGTDYM--GSKRRRSSHES-NSIKIVQPDGPSFTLDNGNTVWW  259

Query  1375  ASWEFHVKADQRAGIIISQATVFDPEAGKRRSVMYKGFASELFVPYMDVDEGWYFRAFMD  1196
               W+FHV  D RAG+IIS A++FD E  + RSVMY+GF SE+FVPY+D+ E WY+R + D
Sbjct  260   GDWKFHVAYDMRAGMIISLASIFDAEKEEFRSVMYRGFVSEVFVPYIDLTEEWYYRTYFD  319

Query  1195  AGEFGLGATAMELVPLNDCPRHSHYIDGLFVDPDGRPVSQPNVICVFERYSGDIAWRHSG  1016
             AGE+G G  A+EL    DCP ++ +IDG F+  DG P   PNVIC+FERY+GDI WRH+ 
Sbjct  320   AGEYGFGLCAVELEASKDCPENAKFIDGYFISQDGTPGKMPNVICIFERYAGDIMWRHTE  379

Query  1015  TGDADDDLIREARPKVSLVVRTTATVGNYDYIFDWEFQTDGSIRVTVGLSGIILAKGSPY  836
                    +IR+ RP+VSLVVR  +TVGNYDYI D+EF+  G+I+VTVGL+G++  +GS Y
Sbjct  380   LA-IPGKVIRKVRPEVSLVVRMVSTVGNYDYITDYEFKQSGTIKVTVGLTGLLEVRGSIY  438

Query  835   EHINQFEIPRWDFPAGSLVSENTIGVAHDHFITFHLDMDVDGPTNSFVKVDLVKNYNIAG  656
              H +Q +   +    G+L++ENT+G  HDHF T+HLD+D+DG  NSFVK +L     +  
Sbjct  439   THNDQIKEEVY----GTLIAENTLGAYHDHFFTYHLDLDIDGHENSFVKNNLKTRRVVNK  494

Query  655   KIQRKSYWSPKRKVAKSENDAKIKLQLDKPS-EFHVINPRHQSRLGNPSGYKIVPSATAA  479
                RKSYW+   + A++E+DA+I+L   + + E  V+NP  ++ +GN  GY ++P  +A 
Sbjct  495   SSPRKSYWAVVSETAETESDARIQLGSSRGALEMVVVNPNKKTEVGNEIGYCLIPGGSAT  554

Query  478   S-LLDLQDPPQLRAAFTNNQIWVTPYNRSEQWAGGLFTYQSHGDDTLAVWSNRNRVIEKQ  302
             + LL   D PQ+R  FT   +WVTPYN+SE+WAGGL+T QSHGDDTLA+WS R+R I+ +
Sbjct  555   NPLLSDDDYPQIRGGFTKYNVWVTPYNKSEKWAGGLYTDQSHGDDTLAMWSLRDREIKNK  614

Query  301   DIVLWYTLGFHHLPCQEDFPVMPTVTSTFQLKPVNFFDRNPII  173
             DIVLWYT G HH+P QEDFP+MPT+++ F+LKP NFF  NP++
Sbjct  615   DIVLWYTFGVHHVPKQEDFPIMPTLSTGFELKPTNFFQHNPVL  657



>ref|XP_007225158.1| hypothetical protein PRUPE_ppa002377mg [Prunus persica]
 gb|EMJ26357.1| hypothetical protein PRUPE_ppa002377mg [Prunus persica]
Length=679

 Score =   576 bits (1484),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 290/659 (44%), Positives = 414/659 (63%), Gaps = 26/659 (4%)
 Frame = -1

Query  2083  HPLDPLTIQEIERTRSILSSYQPFSGSSLRIHSLSLDEPDKSEVLRWKRGNPLPT-----  1919
             HPLD LT  E    ++I+  ++ +   +L    + LDEP+K  VL W+  +   T     
Sbjct  30    HPLDALTPSEFIHIKAII--HKAYPAQNLTFQYVGLDEPEKYTVLSWQSKSTTTTKSPPP  87

Query  1918  -RKAFVVALSNGQAHLLVVDLGS-GRVSSHTRNPASGYPPMSADDASTALEATFSNSVFR  1745
              R+A VV   N + H ++VDL +   VSS   N A+G P ++ D+ + A E  F +  F 
Sbjct  88    PRRALVVTRLNKETHEIIVDLSTRSIVSSKVHNGANGLPVLTLDEQTYANELPFKHEPFI  147

Query  1744  EAISTRGVEINDVVCSAAAPGWFGPEEEGRRITKVKCYTAQNTPNYYMRPIEGLLLTVDL  1565
             ++I  RG++I+ V+CS  + GWFG E + RR  K+ C+    T N Y+RP+EG+ L VDL
Sbjct  148   KSIRKRGLDISQVLCSGFSVGWFG-EAKSRRTLKINCFYTNGTVNLYVRPVEGIALVVDL  206

Query  1564  DSGKVINVYDTHSPIPIPKAQGTDYRRDGIEHRAPGVEPL---KPISMEQPNGQSFRVED  1394
             D  ++I  Y     +P+PK +GT+Y+      + P   PL    P+   Q  G S    +
Sbjct  207   DEMEIIK-YSDRFIVPVPKGEGTEYQAS---KQKPPFGPLLHGAPVVQSQEEGFSL---E  259

Query  1393  GYIVKWASWEFHVKADQRAGIIISQATVFDPEAGKRRSVMYKGFASELFVPYMDVDEGWY  1214
             G+ ++WA+W FH+  D R G IIS A+++D    K R V+Y+GF SELFVPYM+  E WY
Sbjct  260   GHTIRWANWVFHLGFDVRTGTIISLASIYDLAKHKYRRVLYRGFVSELFVPYMNPTEDWY  319

Query  1213  FRAFMDAGEFGLGATAMELVPLNDCPRHSHYIDGLFVDPDGRPVSQPNVICVFERYSGDI  1034
             F+ F D GEFG G +A+ L PL DCP ++ ++D  +   DG PV   N  C+FER++G+I
Sbjct  320   FKTFFDCGEFGFGQSAVSLEPLTDCPANAKFMDAYYAGQDGTPVKISNAFCIFERHAGNI  379

Query  1033  AWRHSGTGDADDDLIREARPKVSLVVRTTATVGNYDYIFDWEFQTDGSIRVTVGLSGIIL  854
              WRH+      + +I E RP+V+LVVR  A VGNYDYI DW F+  GSI++ VGL+G++ 
Sbjct  380   LWRHTEV-TIPNKVITEVRPEVTLVVRMVAVVGNYDYIIDWVFKPSGSIKLEVGLTGVLE  438

Query  853   AKGSPYEHINQFEIPRWDFPAGSLVSENTIGVAHDHFITFHLDMDVDGPTNSFVKVDLVK  674
              +G  Y   N+ E   +    G+LV++NTI V HDHF+T+HLD+DVDG  NSFVK  +V 
Sbjct  439   TEGVKYTKTNEIEKEVY----GTLVADNTIAVNHDHFLTYHLDLDVDGEANSFVKNKMVT  494

Query  673   NYNIAGKIQRKSYWSPKRKVAKSENDAKIKLQLDKPSEFHVINPRHQSRLGNPSGYKIVP  494
                    I RKSYW+ + + AK+E+DAK+ L L KPS+  V+NP  +++ GNP GY+++P
Sbjct  495   KRVKDPNIPRKSYWTVESETAKTESDAKLHLGL-KPSDLVVVNPNKRTKPGNPIGYRLIP  553

Query  493   SATAASLLDLQDPPQLRAAFTNNQIWVTPYNRSEQWAGGLFTYQSHGDDTLAVWSNRNRV  314
              + A  LL   D PQ+R AFT   +WVTPYN+SE+WAGG +  QS G DTLA WS RNR 
Sbjct  554   GSVAGPLLLEDDYPQIRGAFTKYNVWVTPYNKSEKWAGGQYVDQSRGGDTLATWSLRNRE  613

Query  313   IEKQDIVLWYTLGFHHLPCQEDFPVMPTVTSTFQLKPVNFFDRNPIIQANPNFAEDLPI  137
             IE +DIVLWYT+GFHH PCQEDFP+MPT++  F+L+P NFF+ +P+++      + +P+
Sbjct  614   IENKDIVLWYTIGFHHAPCQEDFPMMPTLSGGFELRPTNFFESSPVLKVRTISPKHVPL  672



>gb|EEC80539.1| hypothetical protein OsI_22833 [Oryza sativa Indica Group]
Length=698

 Score =   576 bits (1485),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 301/676 (45%), Positives = 423/676 (63%), Gaps = 39/676 (6%)
 Frame = -1

Query  2083  HPLDPLTIQEIERTRSILSSYQPFSGSSLRIHSLSLDEPDKSEVLRWKRGN---------  1931
             HPLDPLT  EI   R+ + +        L  H + LDEPDK +VL +  G          
Sbjct  28    HPLDPLTATEITAIRAAVLASPLVPARPLFFHYVGLDEPDKPDVLSYAYGAADAAATSSQ  87

Query  1930  -PLPTRKAFVVALSNGQAHLLVVDLGSGRVS--SHTRNPASGYPPMSADDASTALEATFS  1760
               LP R+AFV+A + GQ+H   VD+ +   S  SH  +   G+P  + +D   A+   ++
Sbjct  88    MTLP-RRAFVIARAGGQSHEFTVDIAADNASVLSHAVHRGPGFPMFTDEDQIAAMALPYT  146

Query  1759  NSVFREAISTRGVEINDVVCSAAAPGWFGPEEE---GRRITKVKCYTA--QNTPNYYMRP  1595
                F E++  RG+++ +V C   + GWFG E+    G R+ K+KC       T N Y RP
Sbjct  147   YPPFVESVRRRGLDVGEVGCGVLSRGWFGAEQPAYGGARVVKMKCVVVDYNATANIYARP  206

Query  1594  IEGLLLTVDLDSGKVINVYDTHSPIPIPKAQGTDYRRDGIEHRAPGVEPLKPISME-QPN  1418
             +EG+++ VDLD   +I  Y   +   +PKA+GTDYR D +    P   P  P  +  QP 
Sbjct  207   VEGVVMVVDLDRMAIIG-YRDRAVFTVPKAEGTDYRADKVG--PPFTGPAAPPGVVVQPE  263

Query  1417  GQSFRVEDGYIVKWASWEFHVKADQRAGIIISQATVFDPEAGK-RRSVMYKGFASELFVP  1241
             G+ F V  G++VKWA+WEFHV  D RAG +IS A+V D +AG  +R V+Y+GF SE+FVP
Sbjct  264   GRGFHVH-GHLVKWANWEFHVGFDMRAGTVISLASVNDTDAGGLKRRVLYRGFVSEIFVP  322

Query  1240  YMDVDEGWYFRAFMDAGEFGLGATAMELVPLNDCPRHSHYIDGLFVDPDGRPVSQPNVIC  1061
             YMD +E WYF  F DAGE+GLGA A +L    DCP ++ Y+DG +   DG+PV   +VIC
Sbjct  323   YMDPEEEWYFHTFTDAGEYGLGALASQLQRGADCPANAVYMDGYYAGSDGKPVKAEDVIC  382

Query  1060  VFERYSGDIAWRHSGTGDADDDLIREARPKVSLVVRTTATVGNYDYIFDWEFQTDGSIRV  881
             +FERY+GD+AWRH+  G     L  E RP V+LVVR   TVGNYDY  DWEF+T GSI++
Sbjct  383   LFERYAGDVAWRHT-NGIGLGGLFSEVRPDVTLVVRMVVTVGNYDYTLDWEFKTVGSIKI  441

Query  880   TVGLSGIILAKGSPYEHINQFEIPRWDFPAGSLVSENTIGVAHDHFITFHLDMDVDGPTN  701
              V LSGI+  K   Y H++Q      +   G+L++ENTIGV HDHF+T+HLD+D+DG  N
Sbjct  442   VVSLSGILEMKAINYTHVDQIR----EDTHGTLITENTIGVYHDHFVTYHLDLDIDGTRN  497

Query  700   SFVKVDLVKNYNIAGKIQ------RKSYWSPKRKVAKSENDAKIKLQLDKPSEFHVINPR  539
             SF+K ++V   N   +        R+SYW+   +VA++E + ++ +    P++   +NP 
Sbjct  498   SFIKNNIVPKRNTGVRATGGAPTPRRSYWTVLYEVAETEAEGQVNIN-SAPADLLFVNPS  556

Query  538   HQSRLGNPSGYKIVPS-ATAASLLDLQDPPQLRAAFTNNQIWVTPYNRSEQWAGGLFTYQ  362
              ++++GN  GY+++P+ ATA SLL   D P+ RA++T  Q+WVTPYN+SE+WA GL+  Q
Sbjct  557   KKTKIGNEVGYRLIPTGATATSLLADDDYPERRASYTKKQVWVTPYNKSEKWASGLYAEQ  616

Query  361   SHGDDTLAVWSNRNRVIEKQDIVLWYTLGFHHLPCQEDFPVMPTVTSTFQLKPVNFFDRN  182
             S GDD LA WS RNR I+ +DIVLWYT+G HH+P QEDFPVMPT++   +++P NFF+RN
Sbjct  617   STGDDNLAAWSKRNRSIKDEDIVLWYTVGLHHVPYQEDFPVMPTISGALEVRPSNFFERN  676

Query  181   PIIQANPNFAEDLPIC  134
             P+I+  P   E+ P C
Sbjct  677   PLIRTKP--PENSPNC  690



>ref|NP_001057559.1| Os06g0338200 [Oryza sativa Japonica Group]
 dbj|BAD61919.1| putative copper amine oxidase [Oryza sativa Japonica Group]
 dbj|BAF19473.1| Os06g0338200 [Oryza sativa Japonica Group]
Length=698

 Score =   575 bits (1481),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 301/676 (45%), Positives = 422/676 (62%), Gaps = 39/676 (6%)
 Frame = -1

Query  2083  HPLDPLTIQEIERTRSILSSYQPFSGSSLRIHSLSLDEPDKSEVLRWKRGN---------  1931
             HPLDPLT  EI   R+ + +        L  H + LDEPDK +VL +  G          
Sbjct  28    HPLDPLTATEITAIRAAVLASPLVPARPLFFHYVGLDEPDKPDVLSYAYGAADAAATSSQ  87

Query  1930  -PLPTRKAFVVALSNGQAHLLVVDLGSGRVS--SHTRNPASGYPPMSADDASTALEATFS  1760
               LP R+AFV+A + GQ+H   VD+ +   S  SH  +   G+P  + +D   A+   ++
Sbjct  88    MTLP-RRAFVIARAGGQSHEFTVDIAADNASVLSHAVHRGPGFPMFTDEDQIAAMALPYT  146

Query  1759  NSVFREAISTRGVEINDVVCSAAAPGWFGPEEE---GRRITKVKCYTA--QNTPNYYMRP  1595
                F E++  RG+++ +V C   + GWFG E+    G R+ K+KC       T N Y RP
Sbjct  147   YPPFVESVRRRGLDVGEVGCGVLSRGWFGAEQPAYGGARVAKMKCVVVDYNATANIYARP  206

Query  1594  IEGLLLTVDLDSGKVINVYDTHSPIPIPKAQGTDYRRDGIEHRAPGVEPLKPISM-EQPN  1418
             +EG+++ VDLD   +I  Y   +   +PKA+GTDYR D +    P   P  P  +  QP 
Sbjct  207   VEGVVMVVDLDRMAIIG-YRDRAVFTVPKAEGTDYRADKVG--PPFTGPAAPPGVVMQPE  263

Query  1417  GQSFRVEDGYIVKWASWEFHVKADQRAGIIISQATVFDPEAGK-RRSVMYKGFASELFVP  1241
             G+ F V  G++VKWA+WEFHV  D RAG +IS A+V D +AG  +R V+Y+GF SE+FVP
Sbjct  264   GRGFHVH-GHLVKWANWEFHVGFDMRAGTVISLASVNDTDAGGLKRRVLYRGFVSEIFVP  322

Query  1240  YMDVDEGWYFRAFMDAGEFGLGATAMELVPLNDCPRHSHYIDGLFVDPDGRPVSQPNVIC  1061
             YMD +E WYF  F DAGE+GLGA A +L    DCP ++ Y+DG +   DG+PV   +VIC
Sbjct  323   YMDPEEEWYFHTFTDAGEYGLGALASQLQRGADCPANAVYMDGYYAGSDGKPVKAEDVIC  382

Query  1060  VFERYSGDIAWRHSGTGDADDDLIREARPKVSLVVRTTATVGNYDYIFDWEFQTDGSIRV  881
             +FERY+GD+AWRH+  G     L  E RP V+LVVR   TVGNYDY  DWEF+T GSI++
Sbjct  383   LFERYAGDVAWRHT-NGIGLGGLFSEVRPDVTLVVRMVVTVGNYDYTLDWEFKTVGSIKI  441

Query  880   TVGLSGIILAKGSPYEHINQFEIPRWDFPAGSLVSENTIGVAHDHFITFHLDMDVDGPTN  701
              V LSGI+  K   Y H++Q      +   G+L++ENTIGV HDHF+T+HLD+D+DG  N
Sbjct  442   VVSLSGILEMKAINYTHVDQIR----EDTHGTLITENTIGVYHDHFVTYHLDLDIDGTRN  497

Query  700   SFVKVDLVKNYNIAGKIQ------RKSYWSPKRKVAKSENDAKIKLQLDKPSEFHVINPR  539
             SF+K ++V   N   +        R+SYW+   +VA++E + ++ +    P++   +NP 
Sbjct  498   SFIKNNIVPKCNTGVRATGGAPTPRRSYWTVLYEVAETEAEGQVNIN-SAPADLLFVNPS  556

Query  538   HQSRLGNPSGYKIVPS-ATAASLLDLQDPPQLRAAFTNNQIWVTPYNRSEQWAGGLFTYQ  362
              + ++GN  GY+++P+ ATA SLL   D P+ RA++T  Q+WVTPYN+SE+WA GL+  Q
Sbjct  557   KKMKIGNEVGYRLIPTGATATSLLADDDYPERRASYTKKQVWVTPYNKSEKWASGLYAEQ  616

Query  361   SHGDDTLAVWSNRNRVIEKQDIVLWYTLGFHHLPCQEDFPVMPTVTSTFQLKPVNFFDRN  182
             S GDD LA WS RNR I+ +DIVLWYT+G HH+P QEDFPVMPT++   +++P NFF+RN
Sbjct  617   STGDDNLAAWSKRNRSIKDEDIVLWYTVGLHHVPYQEDFPVMPTISGALEVRPSNFFERN  676

Query  181   PIIQANPNFAEDLPIC  134
             P+I+  P   E+ P C
Sbjct  677   PLIRTKP--PENSPNC  690



>ref|XP_002461776.1| hypothetical protein SORBIDRAFT_02g007930 [Sorghum bicolor]
 gb|EER98297.1| hypothetical protein SORBIDRAFT_02g007930 [Sorghum bicolor]
Length=712

 Score =   575 bits (1482),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 308/688 (45%), Positives = 417/688 (61%), Gaps = 56/688 (8%)
 Frame = -1

Query  2098  ADRPMHPLDPLTIQEIERTRSILSSYQPFSGSSLRIHSLSLDEPDKSEVLRW------KR  1937
             + RP HPLDPL+  E+   R+ + +        L  H + LDEPDK EVL +        
Sbjct  22    SSRP-HPLDPLSASELTAVRAAVLASPAVPAHPLHFHYVGLDEPDKPEVLSYYASGADTT  80

Query  1936  GNPLPTRKAFVVALSNGQAHLLVVDLGSGR---VSSHTRNPASGYPPMSADD--ASTALE  1772
              +P   R+AFV+A + GQ+H  +VD+       + SH  +   G+P +++ D  A+TAL 
Sbjct  81    SSPTLRRRAFVIARAGGQSHEFIVDVTDASAPSILSHAIHHDPGFPMLTSQDQAAATALL  140

Query  1771  ATFSNSV--------------FREAISTRGVEINDVVCSAAAPGWFG---PEEEGRRITK  1643
               +                  F E++  RG+   DV C   + GWFG   P   G R+ K
Sbjct  141   PQYPEPALWEGQQGRRCQYPPFVESLRRRGLNAGDVGCGLFSMGWFGDGEPTYGGARLAK  200

Query  1642  VKCYT------AQNTPNYYMRPIEGLLLTVDLDSGKVINVYDTHSPIPIPKAQGTDYRRD  1481
             ++C+       A  T N + RP++G+ L VDLD   ++  Y      P+PKA+GTDYR D
Sbjct  201   MQCFVRHMDGDATTTANVFARPLDGVTLVVDLDRVAIVG-YKDRVVKPVPKAEGTDYRAD  259

Query  1480  GIEHRAPGVEPLKPISMEQPNGQSFRVEDGYIVKWASWEFHVKADQRAGIIISQATVFDP  1301
              +     G + + P  + QP G    V DG++V+WA+WE H+  D RAG +IS A+V D 
Sbjct  260   KLGPPFTGPDTV-PGVVVQPEGSGICV-DGHLVRWANWELHIGFDMRAGTVISLASVLDI  317

Query  1300  EAGKRRSVMYKGFASELFVPYMDVDEGWYFRAFMDAGEFGLGATAMELVPLNDCPR-HSH  1124
             +AG RR V+Y+GF SE+FVPYMD +E WYF  F+DAG +GLG +A  L    DCP  ++ 
Sbjct  318   DAGHRRRVLYRGFVSEIFVPYMDPEEEWYFHTFLDAGGYGLGVSASSLQRGADCPAGNAV  377

Query  1123  YIDGLFVDPDGRPVSQPNVICVFERYSGDIAWRHSGTGDADDDLIREARPKVSLVVRTTA  944
             Y DG + DPDGRPV   +VICVFERYSGDIAWRH+G  +      +E RP V+LVVR  A
Sbjct  378   YFDGYYSDPDGRPVKAEDVICVFERYSGDIAWRHTGIAE------QEVRPDVTLVVRMVA  431

Query  943   TVGNYDYIFDWEFQTDGSIRVTVGLSGIILAKGSPYEHINQFEIPRWDFPAGSLVSENTI  764
             T+GNYDYI DWEF+T G+I+  V L+GI++ K + Y  + Q      +   G+LV+ENT+
Sbjct  432   TIGNYDYILDWEFKTSGTIKCVVSLTGILVMKATSYTRVEQIR----EDAHGTLVAENTV  487

Query  763   GVAHDHFITFHLDMDVDGPTNSFVKVDLVKNYNIA------GKIQRKSYWSPKRKVAKSE  602
             GV HDHFIT+HLD+DVDG  NSFVK  +    N            RKSYW+ +R+V ++E
Sbjct  488   GVYHDHFITYHLDIDVDGTRNSFVKKTITPVRNTGNPATGGADTPRKSYWTVRREVVETE  547

Query  601   NDAKIKLQLDKPSEFHVINPRHQSRLGNPSGYKIVPS-ATAASLLDLQDPPQLRAAFTNN  425
              D + KL    P E   INP  ++ +GN  GY++VP+ ATAASLL   D PQ RA++   
Sbjct  548   VDGQAKLNGALPVELLFINPGKKTNVGNEVGYRLVPAGATAASLLADDDYPQRRASYAKK  607

Query  424   QIWVTPYNRSEQWAGGLFTYQSHGDDTLAVWSNRNRVIEKQDIVLWYTLGFHHLPCQEDF  245
             Q+WVTPYN+SE+W  GL+  QS GDD LA WS  NR I  +DIVLWYT+G HH+P QEDF
Sbjct  608   QVWVTPYNKSEKWVPGLYAEQSTGDDNLAAWSRSNRRIMDEDIVLWYTVGLHHIPYQEDF  667

Query  244   PVMPTVTSTFQLKPVNFFDRNPIIQANP  161
             PVMPTV+  F+L+P NFFDRNP+++  P
Sbjct  668   PVMPTVSGAFELRPSNFFDRNPLLRTRP  695



>ref|XP_010024340.1| PREDICTED: primary amine oxidase-like [Eucalyptus grandis]
 gb|KCW60785.1| hypothetical protein EUGRSUZ_H03521 [Eucalyptus grandis]
Length=674

 Score =   573 bits (1478),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 286/646 (44%), Positives = 414/646 (64%), Gaps = 18/646 (3%)
 Frame = -1

Query  2083  HPLDPLTIQEIERTRSILSSYQPFSGSSLRIHSLSLDEPDKSEVLRW---KRGNPLPTRK  1913
             HPLDPL+  E    R  +      SG ++    + LDEPDKS V  W   +     P R+
Sbjct  30    HPLDPLSPVEFSLIRDAVKRSYGASGENVTFQYVGLDEPDKSLVHSWMSSQASKKPPPRR  89

Query  1912  AFVVALSNGQAHLLVVDLGSGR--VSSHTRNPASGYPPMSADDASTALEATFSNSVFREA  1739
             A VV   +GQ H LVVDL S +  + S       G+P ++ ++ + A+E   ++  F ++
Sbjct  90    ASVVVRLHGQTHELVVDLSSHQPSIVSKEVYHGHGFPMLTIEEQTDAIELPRTHDEFIQS  149

Query  1738  ISTRGVEINDVVCSAAAPGWFGPEEEGRRITKVKCYTAQNTPNYYMRPIEGLLLTVDLDS  1559
             I  RG++++ VVCS  A GW+G E   RR+ KV  +    T N+YMRPIEG+++ VDLD 
Sbjct  150   IKNRGLDMSSVVCSTFAVGWYG-ELRSRRVVKVLAFYTNGTVNFYMRPIEGIVVVVDLDL  208

Query  1558  GKVINVYDTHSPIPIPKAQGTDYRRDGIEHRAPGVEP-LKPISMEQPNGQSFRVEDGYIV  1382
              K++  +D  +   +P A+ T+YR   +E + P   P L+  ++ QP+G  F ++ G+ +
Sbjct  209   MKIVKYHDRFATT-VPTAEDTEYR---LEKQNPPFGPHLRGAAIVQPHGLGFDIK-GHTI  263

Query  1381  KWASWEFHVKADQRAGIIISQATVFDPEAGKRRSVMYKGFASELFVPYMDVDEGWYFRAF  1202
              WA+W+ H+  D R G IIS A+++D E  K R V+Y+ + SE+FVPYMD  E WY++ +
Sbjct  264   SWANWKLHLGFDVRVGPIISLASIYDLEKDKYRQVLYRAYVSEVFVPYMDPTEEWYYKIY  323

Query  1201  MDAGEFGLGATAMELVPLNDCPRHSHYIDGLFVDPDGRPVSQPNVICVFERYSGDIAWRH  1022
              D+GE+G G +A+ L P  DCP ++ ++DG F   +G  V  PNV CVFE+Y+G+I WRH
Sbjct  324   FDSGEYGFGLSAVSLQPRVDCPDNAVFVDGFFAGQNGSAVQIPNVTCVFEKYAGNIMWRH  383

Query  1021  SGTGDADDDLIREARPKVSLVVRTTATVGNYDYIFDWEFQTDGSIRVTVGLSGIILAKGS  842
             +  G  D   I E R  VSLVVR+ +TVGNYDYI DWEF+  G+I+  VGL+G++  K  
Sbjct  384   TEVGIPDVK-INEVRSDVSLVVRSVSTVGNYDYILDWEFKPSGAIKFEVGLTGVLEVKAV  442

Query  841   PYEHINQFEIPRWDFPAGSLVSENTIGVAHDHFITFHLDMDVDGPTNSFVKVDLVKNYNI  662
              Y H +Q +   +    G++V  NTI   HDHF T+HLD+DVDG  NSFVK +L+     
Sbjct  443   NYTHASQIKEDEY----GTMVGANTIATHHDHFFTYHLDLDVDGAPNSFVKTNLITKPVA  498

Query  661   AGKIQRKSYWSPKRKVAKSENDAKIKLQLDKPSEFHVINPRHQSRLGNPSGYKIVPSATA  482
                + RKSYW+   K A++E++A++ L L+ P +  V+NP  Q+++GN  GY+++P   A
Sbjct  499   EEGVPRKSYWTVSSKTARTESEAQLHLGLE-PCDLIVVNPNKQTKVGNNVGYRLIPGPIA  557

Query  481   ASLLDLQDPPQLRAAFTNNQIWVTPYNRSEQWAGGLFTYQSHGDDTLAVWSNRNRVIEKQ  302
             + +L   D PQ+R+AFTNN +WVTPYN+SE+WA G +  QS GDDTLAVW+ RNR IE +
Sbjct  558   SPILFRDDYPQIRSAFTNNNLWVTPYNKSEKWASGRYVDQSRGDDTLAVWTKRNRKIENE  617

Query  301   DIVLWYTLGFHHLPCQEDFPVMPTVTSTFQLKPVNFFDRNPIIQAN  164
             DIVLWYTLGFHH+P QEDFP+MPT++  F+L+P NFFDRNP+++  
Sbjct  618   DIVLWYTLGFHHVPYQEDFPIMPTLSGGFELRPTNFFDRNPVLKTK  663



>ref|XP_002890944.1| hypothetical protein ARALYDRAFT_313750 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH67203.1| hypothetical protein ARALYDRAFT_313750 [Arabidopsis lyrata subsp. 
lyrata]
Length=678

 Score =   573 bits (1478),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 290/662 (44%), Positives = 425/662 (64%), Gaps = 18/662 (3%)
 Frame = -1

Query  2083  HPLDPLTIQEIERTRSILSSYQPFS-GSSLRIHSLSLDEPDKSEVLRWKR--GNPL--PT  1919
             HP DPLT  E++  R+I++   P           + L+E DKS VL W    G+ +  P 
Sbjct  27    HPFDPLTETELKLVRTIINKSYPIGHNHKFTFQYVGLNELDKSLVLSWHSSPGHNVKPPP  86

Query  1918  RKAFVVALSNGQAHLLVVDLGSGRVSSHTRNPASGYPPMSADDASTALEATFSNSVFREA  1739
             R+AFV+A   G++  +VVD  +  + S+  +  +G P ++ D+   A         F ++
Sbjct  87    RQAFVIARDKGKSREIVVDFSTRAIISNKIHVGNGNPKLTIDEQQAATALVLKFKPFCDS  146

Query  1738  ISTRGVEINDVVCSAAAPGWFGPEEEGRRITKVKCYTAQNTPNYYMRPIEGLLLTVDLDS  1559
             I  RG+ +++VV +++  GWFG E++ +R+ +   +    + N Y+RPIEG+ + V+LD 
Sbjct  147   IVKRGLNLSEVVVTSSTMGWFG-EKKTKRLIRTIPFYLNGSVNTYLRPIEGMTIIVNLDQ  205

Query  1558  GKVINVYDTHSPIPIPKAQGTDYRRDGIEHRAPGVEP-LKPISMEQPNGQSFRVEDGYIV  1382
              KV    D  +  P+PKA G +YR   I    P   P L+     QP+G  F++ DG++V
Sbjct  206   MKVAEFKDRFTG-PMPKADGREYR---ISKLKPPFGPSLRSAVFYQPDGPGFKI-DGHVV  260

Query  1381  KWASWEFHVKADQRAGIIISQATVFDPEAGKRRSVMYKGFASELFVPYMDVDEGWYFRAF  1202
             +WA+WEFH+  D RAG++IS A++FD +  K R V+YKG  SE+FVPYMD ++ WYF ++
Sbjct  261   RWANWEFHMSFDVRAGLVISLASIFDMDMNKYRQVLYKGHLSEMFVPYMDPNDDWYFISY  320

Query  1201  MDAGEFGLGATAMELVPLNDCPRHSHYIDGLFVDPDGRPVSQPNVICVFERYSGDIAWRH  1022
             +D GEFG G +A+ L P  DCP ++ +IDG+F   DG P    NV+C+FE+Y+GDI WRH
Sbjct  321   LDCGEFGCGQSAVSLEPYTDCPPNAAFIDGVFAGQDGTPTKVSNVMCIFEKYAGDIMWRH  380

Query  1021  SGTGDADDDLIREARPKVSLVVRTTATVGNYDYIFDWEFQTDGSIRVTVGLSGIILAKGS  842
             +   +     I E RP VSLV R   TVGNYDYI ++EF+  GSI++ VGL+G++  K  
Sbjct  381   T-EAEVPGLKITEVRPDVSLVARMVTTVGNYDYIIEYEFKPSGSIKMGVGLTGVLEVK--  437

Query  841   PYEHINQFEIPRWDFPAGSLVSENTIGVAHDHFITFHLDMDVDGPTNSFVKVDLV-KNYN  665
             P E+++  EI   D   G++V++NT+GV HDHF+TF LD+D+DG  NSFV+ +LV K   
Sbjct  438   PVEYVHTSEINEDDI-YGTIVADNTVGVNHDHFVTFRLDLDIDGTDNSFVRNELVTKRTP  496

Query  664   IAGKIQRKSYWSPKRKVAKSENDAKIKLQLDKPSEFHVINPRHQSRLGNPSGYKIVPSAT  485
              +    RKSYW+ KR  AK+E +A++KL L +  E  V+NP  +++ GN  GY+++P   
Sbjct  497   KSVNTPRKSYWTTKRNTAKTEAEARVKLGL-RAEELVVVNPNKKTKHGNEVGYRLLPGPA  555

Query  484   AASLLDLQDPPQLRAAFTNNQIWVTPYNRSEQWAGGLFTYQSHGDDTLAVWSNRNRVIEK  305
             ++SLL   D PQ+RAAFTN  +W+TPYN+SE W  GL+  +S GDDTLAVWS R+R IEK
Sbjct  556   SSSLLAQDDYPQIRAAFTNYNVWITPYNKSEVWTSGLYADRSQGDDTLAVWSQRDREIEK  615

Query  304   QDIVLWYTLGFHHLPCQEDFPVMPTVTSTFQLKPVNFFDRNPIIQANPNFAEDLPICRAG  125
             +DIV+WYT+GFHH+PCQEDFP MPT+   F+L+P NFF++NP+++A P     +P C   
Sbjct  616   KDIVMWYTVGFHHVPCQEDFPTMPTMFGGFELRPTNFFEQNPVLKAKPINLTTIPKCTTK  675

Query  124   RN  119
             RN
Sbjct  676   RN  677



>ref|XP_010460990.1| PREDICTED: primary amine oxidase-like [Camelina sativa]
Length=681

 Score =   573 bits (1477),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 287/651 (44%), Positives = 418/651 (64%), Gaps = 17/651 (3%)
 Frame = -1

Query  2089  PMHPLDPLTIQEIERTRSILSSYQPFS-GSSLRIHSLSLDEPDKSEVLRW--KRGNPL--  1925
             P HP DPLT  E++  R+I++   P           + L+EPDKS VL W   R + +  
Sbjct  26    PRHPFDPLTETELKLVRTIINKSYPVGPNHKFTFQHVGLNEPDKSLVLSWYSSRNHTIKP  85

Query  1924  PTRKAFVVALSNGQAHLLVVDLGSGRVSSHTRNPASGYPPMSADDASTALEATFSNSVFR  1745
             P R+AFV+A  NG+   +VVD  S  + S   +  +GYP +S D+   + E       F 
Sbjct  86    PPRQAFVIARDNGKTREIVVDFSSRAIVSDKIHVGNGYPTLSNDEQEASSEVVVKFKSFL  145

Query  1744  EAISTRGVEINDVVCSAAAPGWFG-PEEEGRRITKVKCYTAQNTPNYYMRPIEGLLLTVD  1568
             ++++ RG+ ++++V + +  GW+G  + E  R+ ++  +    T N Y++PIEG+ + V+
Sbjct  146   DSVARRGLNVSEIVFTTSTIGWYGETKAETERVIRLMPFYLDGTVNMYLKPIEGMTIIVN  205

Query  1567  LDSGKVINVYDTHSPIPIPKAQGTDYRRDGIEHRAPGVEP-LKPISMEQPNGQSFRVEDG  1391
             LD  KV    D  + + +PKA  T+YR   I    P   P L+   + QP+G  F+V DG
Sbjct  206   LDKMKVAEFKDRLT-VTMPKANETEYR---ISKLNPPFGPTLRNAVLLQPDGPGFKV-DG  260

Query  1390  YIVKWASWEFHVKADQRAGIIISQATVFDPEAGKRRSVMYKGFASELFVPYMDVDEGWYF  1211
             +IV+WA+WEFH+  D RAGI+IS A++FD +  K R V+YKG  SE+F+PYMD  + WYF
Sbjct  261   HIVRWANWEFHLSFDVRAGIVISLASIFDMDVNKYRQVLYKGHLSEMFIPYMDPTDDWYF  320

Query  1210  RAFMDAGEFGLGATAMELVPLNDCPRHSHYIDGLFVDPDGRPVSQPNVICVFERYSGDIA  1031
               ++D G+FG G  A+ L P  DCP  + ++DG+F   DG P   PN IC+FE+Y+GDI 
Sbjct  321   ITYLDCGDFGCGQCAVSLEPYTDCPAGAVFMDGIFAGQDGTPAKIPNAICIFEKYAGDIM  380

Query  1030  WRHSGTGDADDDLIREARPKVSLVVRTTATVGNYDYIFDWEFQTDGSIRVTVGLSGIILA  851
             WRH+   +  +  I E RP VSLV R   TVGNYDYI D+EF+  GSI++ VGL+G++  
Sbjct  381   WRHT-EAEIPNLEITEVRPDVSLVARIVTTVGNYDYIVDYEFKPSGSIKMGVGLTGVLEI  439

Query  850   KGSPYEHINQFEIPRWDFPAGSLVSENTIGVAHDHFITFHLDMDVDGPTNSFVKVDLV-K  674
             K  P E+I+  EI + +   G++V++NT+GV HDHF+ F LD+D+DG  NSFV+ +LV K
Sbjct  440   K--PVEYIHTSEIKKGEDIHGTIVADNTVGVNHDHFVIFRLDLDIDGSDNSFVRNELVTK  497

Query  673   NYNIAGKIQRKSYWSPKRKVAKSENDAKIKLQLDKPSEFHVINPRHQSRLGNPSGYKIVP  494
                 +    R+SYW+ + K AK+E +A++KL L K  E  V+NP  +++ GN  GY+++ 
Sbjct  498   RAPESVNTPRRSYWTSRPKTAKTEAEARVKLGL-KAEELVVVNPNRKTKHGNEVGYRLLH  556

Query  493   SATAASLLDLQDPPQLRAAFTNNQIWVTPYNRSEQWAGGLFTYQSHGDDTLAVWSNRNRV  314
              + A  LL   D PQ+RAAFTN  +W+TPYNRSE WAGGL+  +S GDDTLAVWS RNR 
Sbjct  557   GSAAGPLLAQDDYPQIRAAFTNYNVWITPYNRSEVWAGGLYADRSQGDDTLAVWSERNRK  616

Query  313   IEKQDIVLWYTLGFHHLPCQEDFPVMPTVTSTFQLKPVNFFDRNPIIQANP  161
             IE +D+V+WYT+GFHH+P QED+P MPT++  F+L+P NFF+RNP+++  P
Sbjct  617   IENKDLVMWYTIGFHHVPSQEDYPTMPTLSGGFELRPTNFFERNPVLKTKP  667



>ref|XP_010460986.1| PREDICTED: primary amine oxidase-like [Camelina sativa]
Length=677

 Score =   572 bits (1475),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 288/664 (43%), Positives = 417/664 (63%), Gaps = 18/664 (3%)
 Frame = -1

Query  2089  PMHPLDPLTIQEIERTRSILSSYQPFS-GSSLRIHSLSLDEPDKSEVLRWK----RGNPL  1925
             P HP DPLT  E+   R+I++   P           + L+EPDKS VL W         L
Sbjct  25    PPHPFDPLTETELNLVRTIVNKSYPIGHNHKFTFQYVGLNEPDKSLVLSWHSSPDHNVKL  84

Query  1924  PTRKAFVVALSNGQAHLLVVDLGSGRVSSHTRNPASGYPPMSADDASTALEATFSNSVFR  1745
             P R+AFV+A   G+   +VVD  +  + S   +  +G P ++ D+   A         F 
Sbjct  85    PPRQAFVIARDKGKNREMVVDFSTRAIVSDKIHVGNGNPMLTLDEQHAATALVLKFKPFC  144

Query  1744  EAISTRGVEINDVVCSAAAPGWFGPEEEGRRITKVKCYTAQNTPNYYMRPIEGLLLTVDL  1565
             ++I  RG+ +++VV +++  GWFG E + +R  +   +    + N Y+RPIEG+ + VDL
Sbjct  145   DSIMKRGLNLSEVVVTSSTMGWFG-EAQTKRFIRTIPFYLNGSVNTYLRPIEGMTIIVDL  203

Query  1564  DSGKVINVYDTHSPIPIPKAQGTDYRRDGIEHRAPGVEP-LKPISMEQPNGQSFRVEDGY  1388
             D  KV    D  +  P+PK  G +YR   I +  P   P L+   + QP+G  F++ DG+
Sbjct  204   DKMKVAEFKDRFTG-PMPKPNGREYR---ISNLKPPFGPSLRDAVVFQPDGPGFKI-DGH  258

Query  1387  IVKWASWEFHVKADQRAGIIISQATVFDPEAGKRRSVMYKGFASELFVPYMDVDEGWYFR  1208
             +V+WA+WEFH+  + RAG++IS A++FD +  K R V+YKG  SE+FVPYMD  + WYF 
Sbjct  259   VVRWANWEFHMSFNVRAGLVISLASIFDMDVNKYRQVLYKGHLSEMFVPYMDPHDDWYFI  318

Query  1207  AFMDAGEFGLGATAMELVPLNDCPRHSHYIDGLFVDPDGRPVSQPNVICVFERYSGDIAW  1028
             +++D GEFG G +A+ L P  DCP ++ ++DG++   DG P    NV+C+FE+Y+GDI W
Sbjct  319   SYLDCGEFGCGQSAVSLEPYTDCPPNAAFMDGIYAGQDGTPTKVSNVMCIFEKYAGDIMW  378

Query  1027  RHSGTGDADDDLIREARPKVSLVVRTTATVGNYDYIFDWEFQTDGSIRVTVGLSGIILAK  848
             RH+ + +     I E RP VSLV R   TVGNYDYI ++EF+  GSI++ VGL+G++  K
Sbjct  379   RHTES-EVPGMKITEVRPDVSLVARMVTTVGNYDYIIEYEFKPSGSIKMGVGLTGVLEVK  437

Query  847   GSPYEHINQFEIPRWDFPAGSLVSENTIGVAHDHFITFHLDMDVDGPTNSFVKVDLV-KN  671
               P E+++  EI   D   G++V++NT+GV HDH++TF LD+D+DG  NSFV+ +LV K 
Sbjct  438   --PVEYVHTSEIKEDDI-YGTIVADNTVGVNHDHYVTFRLDLDIDGTDNSFVRTELVTKR  494

Query  670   YNIAGKIQRKSYWSPKRKVAKSENDAKIKLQLDKPSEFHVINPRHQSRLGNPSGYKIVPS  491
                +    RKSYW+ KR  AK+E +A++KL L KP E  V+NP   ++ GN  GY+++P 
Sbjct  495   TPKSVNTPRKSYWTTKRNTAKTETEARVKLGL-KPEELVVVNPTKTTKHGNEIGYRLIPG  553

Query  490   ATAASLLDLQDPPQLRAAFTNNQIWVTPYNRSEQWAGGLFTYQSHGDDTLAVWSNRNRVI  311
                +SLL   D PQ+RAAFTN  +W+TPYNRSE W  G +  +S GDD LAVW  RNR I
Sbjct  554   PATSSLLAQDDYPQIRAAFTNYNVWITPYNRSEVWTSGSYADRSQGDDALAVWCKRNRKI  613

Query  310   EKQDIVLWYTLGFHHLPCQEDFPVMPTVTSTFQLKPVNFFDRNPIIQANPNFAEDLPICR  131
             EK+DIV+WYT+GFHH+PCQEDFP MPT++  F+L+P NFF++NP+++A P     +P C 
Sbjct  614   EKKDIVMWYTVGFHHVPCQEDFPTMPTMSGGFELRPTNFFEQNPVLKAKPMNLTTVPKCT  673

Query  130   AGRN  119
                N
Sbjct  674   PKSN  677



>ref|XP_010108022.1| Primary amine oxidase [Morus notabilis]
 gb|EXC17587.1| Primary amine oxidase [Morus notabilis]
Length=652

 Score =   572 bits (1473),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 297/646 (46%), Positives = 404/646 (63%), Gaps = 24/646 (4%)
 Frame = -1

Query  2083  HPLDPLTIQEIERTRSILSSYQPFSGSSLRIHSLSLDEPDKSEVLRW----KRGNPLPTR  1916
             HPLDPLT  E  RTR I+   +  S  +L  H + ++EP+K +VL+W     + NP P R
Sbjct  25    HPLDPLTPTEFNRTRDIIQKSRLGSLPNLTFHYVDVEEPEKEDVLKWLSSNHKQNPFPHR  84

Query  1915  KAFVVALSNGQAHLLVVDLGSGRVSSHTRNPASGYPPMSADDASTALEATFSNSVFREAI  1736
             +A VV  + GQ H LVVDL S  + S       G+PP +  + S A +   S + F+E+I
Sbjct  85    QAKVVVRAGGQTHELVVDLASSSIKSDHIYTGHGFPPFTYAELSRASKLPLSYTKFKESI  144

Query  1735  STRGVEINDVVCSAAAPGWFGPEEEGRRITKVKCYTAQNTPNYYMRPIEGLLLTVDLDSG  1556
             + RG+ I++V C     GWFG E   RR  KV C     T N + RPIEG+ + VD+D  
Sbjct  145   TLRGLNISEVSCVPFTVGWFG-EHVTRRALKVTCLYRGGTFNVFSRPIEGITMEVDVDDM  203

Query  1555  KVINVYDTHSPIPIPKAQGTDYRRDGIEHRAPGVEPLKPISMEQPNGQSFRVEDGYIVKW  1376
             K+I  Y      P+PKA+GTD++       A G    K  S+   +  +    +G+ VKW
Sbjct  204   KII-TYKDRFIAPLPKAEGTDFQT------AKG----KSSSLSGNSSNTGWAINGHTVKW  252

Query  1375  ASWEFHVKADQRAGIIISQATVFDPEAGKRRSVMYKGFASELFVPYMDVDEGWYFRAFMD  1196
              +WEFHV  + RAG+IIS A+VFD   GK R VMY+G  SE FVPYMD  + WYFR FMD
Sbjct  253   RNWEFHVAFNARAGVIISTASVFDARKGKFRRVMYRGHVSETFVPYMDTTKEWYFRTFMD  312

Query  1195  AGEFGLGATAMELVPLNDCPRHSHYIDGLFVDPDGRPVSQPNVICVFERYSGDIAWRHSG  1016
              GEFG G +A  L PL DCP ++ ++DG      G+P      IC+FERYSGDIA RH+ 
Sbjct  313   IGEFGFGRSADSLQPLVDCPENAEFLDGFMAGSGGQPQKVERAICIFERYSGDIAMRHTE  372

Query  1015  TGDADDDLIREARPKVSLVVRTTATVGNYDYIFDWEFQTDGSIRVTVGLSGIILAKGSPY  836
               +    ++R  +P+ SLVVR  ATVGNYDY+ DWEF+  G+I+V V L+GI+  K +PY
Sbjct  373   I-NIPGKVVRGGQPESSLVVRMVATVGNYDYVLDWEFKQSGTIKVGVDLTGILEMKATPY  431

Query  835   EHINQFEIPRWDFPAGSLVSENTIGVAHDHFITFHLDMDVDGPTNSFVKVDL-VKNYNIA  659
                +      +    G+LVSENT+ V HDH++T++LD+DVDG  NSF+K  L       A
Sbjct  432   TKNDNIIGNVY----GTLVSENTVAVNHDHYLTYYLDLDVDGSDNSFLKSKLQTTRATTA  487

Query  658   GKIQ-RKSYWSPKRKVAKSENDAKIKLQLDKPSEFHVINPRHQSRLGNPSGYKIVPSATA  482
               +  R+SYW   ++ AK+E DA+I+L L+ P+E  V+NP  ++RLGN  GY+++     
Sbjct  488   NPLSPRRSYWRVVKETAKTEADARIRLGLE-PAELLVVNPNKRTRLGNQVGYRLITGQPV  546

Query  481   ASLLDLQDPPQLRAAFTNNQIWVTPYNRSEQWAGGLFTYQSHGDDTLAVWSNRNRVIEKQ  302
              SLL   D PQ+RAA+T +Q+WVT YN+SE+WAGG ++ +S GDD LAVWS RNR IE +
Sbjct  547   NSLLADDDYPQIRAAYTKHQVWVTAYNKSERWAGGFYSDRSRGDDGLAVWSQRNRAIENK  606

Query  301   DIVLWYTLGFHHLPCQEDFPVMPTVTSTFQLKPVNFFDRNPIIQAN  164
             DIVLWYT+GFHH+P QEDFP MPT+   F+L+P NFF+ NP++  N
Sbjct  607   DIVLWYTVGFHHIPYQEDFPAMPTIHGGFELRPANFFESNPLLSQN  652



>ref|XP_006354536.1| PREDICTED: primary amine oxidase-like [Solanum tuberosum]
Length=654

 Score =   571 bits (1472),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 289/643 (45%), Positives = 413/643 (64%), Gaps = 18/643 (3%)
 Frame = -1

Query  2083  HPLDPLTIQEIERTRSIL-SSYQPFSGSSLRIHSLSLDEPDKSEVLRWKRGNPLPT--RK  1913
             HPL+ LT+ E+ +  +I+ +SY P +   +  H + L+EP+K  VL W      P   R+
Sbjct  24    HPLESLTLFELTQVTNIVKNSYFPLN---VTFHYVGLNEPNKQLVLSWLSSTHHPALPRE  80

Query  1912  AFVVALSNGQAHLLVVDLGSGRVSSHTRNPASGYPPMSADDASTALEATFSNSVFREAIS  1733
             A V+   + + H ++VDL S  + S       GYP ++  + + A E   S   F  +I 
Sbjct  81    AIVITRIDQKTHEIIVDLSSVSILSDKIYNGHGYPMLTLQEQTAADELPLSYPPFISSIK  140

Query  1732  TRGVEINDVVCSAAAPGWFGPEEEG-RRITKVKCYTAQNTPNYYMRPIEGLLLTVDLDSG  1556
              R +++ +V C     GW+G +++   R+ KV CY    T N YMRPIEG+ + V LD  
Sbjct  141   KRRLKLKEVACQGYPVGWYGEKKKSTNRMVKVICYYLDGTINLYMRPIEGITIIVLLDQM  200

Query  1555  KVINVYDTHSPIPIPKAQGTDYRRDGIEHRAPGVEPLKPISMEQPNGQSFRVEDGYIVKW  1376
              + +  D    +P+PKA GTDY   G + R    E    I + QP+G SF +++G  V+W
Sbjct  201   TIASYID-RLIVPVPKANGTDYM--GSKRRRSSHES-NSIKIVQPDGPSFTLDNGNTVRW  256

Query  1375  ASWEFHVKADQRAGIIISQATVFDPEAGKRRSVMYKGFASELFVPYMDVDEGWYFRAFMD  1196
               W+FHV  D RAGIIIS A++FD +  + RSVMY+GF SE+FVPY+D+ E WY+R + D
Sbjct  257   GDWKFHVAYDMRAGIIISLASMFDADKREFRSVMYRGFVSEVFVPYIDLTEEWYYRTYFD  316

Query  1195  AGEFGLGATAMELVPLNDCPRHSHYIDGLFVDPDGRPVSQPNVICVFERYSGDIAWRHSG  1016
             AGE+G G  A+EL    DCP ++ +IDG F+  DG P   PNVIC+FERY+GDI WRH+ 
Sbjct  317   AGEYGFGLCAVELEASKDCPENAKFIDGYFISQDGTPGKMPNVICIFERYAGDIMWRHTE  376

Query  1015  TGDADDDLIREARPKVSLVVRTTATVGNYDYIFDWEFQTDGSIRVTVGLSGIILAKGSPY  836
                    +IR+ RP+VSLVVR  +TVGNYDYI D+EF+  G+I+VTVGL+G++  +GS Y
Sbjct  377   LA-IPGKVIRKVRPEVSLVVRMVSTVGNYDYITDYEFKQSGTIKVTVGLTGLLEVRGSIY  435

Query  835   EHINQFEIPRWDFPAGSLVSENTIGVAHDHFITFHLDMDVDGPTNSFVKVDLVKNYNIAG  656
              H +Q +   +    G+L++ENT+G  HDHF T+HLD+D+DG  NSFVK +L     +  
Sbjct  436   THNDQIKEEVY----GTLIAENTLGAYHDHFFTYHLDLDIDGHENSFVKNNLKTRRVVNK  491

Query  655   KIQRKSYWSPKRKVAKSENDAKIKLQLDKPS-EFHVINPRHQSRLGNPSGYKIVPSATAA  479
                RKSYW+   + A++E+DA+I+L   + + E  V+NP  ++ +GN  GY ++P  +A 
Sbjct  492   SSPRKSYWAVVSETAETESDARIQLGSSRGALEMVVVNPNKKTEVGNEIGYCLIPGGSAT  551

Query  478   S-LLDLQDPPQLRAAFTNNQIWVTPYNRSEQWAGGLFTYQSHGDDTLAVWSNRNRVIEKQ  302
             + LL   D PQ+R  FT   +WVTPYN+SE+WAGGL+T QSHGDDTLA+WS R+R I+ +
Sbjct  552   NPLLSDDDYPQIRGGFTKYNVWVTPYNKSEKWAGGLYTDQSHGDDTLAMWSLRDREIKNK  611

Query  301   DIVLWYTLGFHHLPCQEDFPVMPTVTSTFQLKPVNFFDRNPII  173
             DIVLWYT G HH+P QEDFP+MPT+++ F+LKP NFF  NP++
Sbjct  612   DIVLWYTFGVHHVPKQEDFPIMPTLSTGFELKPTNFFQHNPVL  654



>emb|CAN76699.1| hypothetical protein VITISV_012123 [Vitis vinifera]
Length=654

 Score =   571 bits (1471),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 287/654 (44%), Positives = 410/654 (63%), Gaps = 28/654 (4%)
 Frame = -1

Query  2083  HPLDPLTIQEIERTRSILSSYQPFSGSSLRIHSLSLDEPDKSEVLRW----KRGNPLPTR  1916
             HPLD LT  E  + ++I+    P S  ++    + LDEPDKS VL W        P P R
Sbjct  23    HPLDSLTPSEFHQVQAIVKGSNPGSSLNMTFQYVGLDEPDKSIVLSWLSNPNSTTPPPPR  82

Query  1915  KAFVVALSNGQAHLLVVDLGSGRVSSHTRNPASGYPPMSADDASTALEATFSNSVFREAI  1736
             +AFV+   + Q H ++VDL +  + S       GYP +++++ + A     +   F  +I
Sbjct  83    RAFVITRLHSQTHEIIVDLSTQSIISDEVYGGHGYPLLTSEEQTAASVLPLTYPPFIASI  142

Query  1735  STRGVEINDVVCSAAAPGWFGPEEEGRRITKVKCYTAQNTPNYYMRPIEGLLLTVDLDSG  1556
             + R ++++DVVCS    GWFG E++ RR+ K+ C+    T N YMRPIEG+ + VDLD  
Sbjct  143   TKRSLKLSDVVCSTFTVGWFG-EDKSRRVLKIPCFYTDGTANLYMRPIEGVTIVVDLDDM  201

Query  1555  KVINVYDTHSPIPIPKAQGTDYRRDGIEHRAPGVEPLKPISMEQPNGQSFRVEDGYIVKW  1376
             K+I  YD    +P+P+A+GT+YR    +   P   PL  +S   P+G  F++ DG+ V+W
Sbjct  202   KIIEYYDRLM-VPVPEAEGTEYRLS--KQNPPFGPPLNGVSAMPPDGPGFKI-DGHNVRW  257

Query  1375  ASWEFHVKADQRAGIIISQATVFDPEAGKRRSVMYKGFASELFVPYMDVDEGWYFRAFMD  1196
             A+W+FH+  D RAG+IIS A+++D + G  R V+Y+G               WY+R + D
Sbjct  258   ANWDFHISFDARAGLIISLASIYDLQKGTFRQVLYRGHE-------------WYYRTYFD  304

Query  1195  AGEFGLGATAMELVPLNDCPRHSHYIDGLFVDPDGRPVSQPNVICVFERYSGDIAWRHSG  1016
              GEFGLG   + L P+ DCP ++ ++DG +   DG+P+S  N  C++E+ +G I WRH+ 
Sbjct  305   EGEFGLGXCTVPLQPMLDCPPNAVFMDGYYASQDGKPMSISNAFCIYEQEAGRIMWRHTE  364

Query  1015  TGDADDDLIREARPKVSLVVRTTATVGNYDYIFDWEFQTDGSIRVTVGLSGIILAKGSPY  836
             T D   + I+E RP+VSLVVR    + NYDYI DWEF+  GSI+  VGL+GI   KG  Y
Sbjct  365   T-DIPGEEIKEVRPEVSLVVRMVVALSNYDYILDWEFKPSGSIKFGVGLTGIPAVKGVSY  423

Query  835   EHINQFEIPRWDFPAGSLVSENTIGVAHDHFITFHLDMDVDGPTNSFVKVDLVKNYNIAG  656
              H +Q +   +    G+L++ N IGV HDHF T+ LD+DVDG  NSFVK +L        
Sbjct  424   THTDQIKEDVY----GTLLAPNAIGVNHDHFFTYRLDLDVDGDANSFVKANLETKRVTDN  479

Query  655   KIQRKSYWSPKRKVAKSENDAKIKLQLDKPSEFHVINPRHQSRLGNPSGYKIVPSATAAS  476
                RKSYW+   + AK+E+DA+I+L+L KP E  V+NP  +++LGN  GY+++P + ++ 
Sbjct  480   SSPRKSYWTVVSETAKTESDAQIQLRL-KPVEXIVVNPNKKTKLGNYVGYRLIPGSLSSP  538

Query  475   LLDLQDPPQLRAAFTNNQIWVTPYNRSEQWAGGLFTYQSHGDDTLAVWSNRNRVIEKQDI  296
             LL   D PQ+R AFT   +W+TPYN+SE+WAGGL+  QS GDDTLAVWS RNR IE +DI
Sbjct  539   LLSDDDYPQIRGAFTKYDVWITPYNKSEKWAGGLYMDQSRGDDTLAVWSQRNREIENKDI  598

Query  295   VLWYTLGFHHLPCQEDFPVMPTVTSTFQLKPVNFFDRNPIIQANPNFAEDLPIC  134
             VLWYT+GFHH+PCQEDFPVMPT++  F+L+P NFF+ NP+++  P      P C
Sbjct  599   VLWYTIGFHHVPCQEDFPVMPTLSGGFELRPTNFFENNPVLKTKPPTPVSWPNC  652



>ref|XP_009366963.1| PREDICTED: primary amine oxidase-like [Pyrus x bretschneideri]
Length=671

 Score =   570 bits (1468),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 284/644 (44%), Positives = 409/644 (64%), Gaps = 19/644 (3%)
 Frame = -1

Query  2083  HPLDPLTIQEIERTRSILSSYQPFSGSSLRIHSLSLDEPDKSEVLRWKRGNPLPT----R  1916
             HPLDPLT  E    ++++    P    +L    + LDEP+KS VL W+           R
Sbjct  26    HPLDPLTPSEFIHVKTVVQKSYP--SQNLSFQYVGLDEPEKSTVLSWQSKPTKTPPPLPR  83

Query  1915  KAFVVALSNGQAHLLVVDLGSGRVSSHTR-NPASGYPPMSADDASTALEATFSNSVFREA  1739
             +A VV     +   L+VD+ +  + S T  +   GYP ++ ++ S A E  F    F ++
Sbjct  84    RALVVLRLKMKTLELIVDISTRSIVSKTEFDNKHGYPLLNNEEQSVAAELPFKYKPFIQS  143

Query  1738  ISTRGVEINDVVCSAAAPGWFGPEEEGRRITKVKCYTAQNTPNYYMRPIEGLLLTVDLDS  1559
             I  RG+ +++VVCS  + GWFG E + +R  K+ C+  +++ N Y+RP+EG+ + VDLD 
Sbjct  144   IKKRGLNMSEVVCSTFSVGWFG-EAKTKRTIKINCFYKKDSVNLYVRPVEGITVAVDLDE  202

Query  1558  GKVINVYDTHSPIPIPKAQGTDYRRDGIEHRAPGVEPLKPISMEQPNGQSFRVEDGYIVK  1379
              K++   D     P+PKA+GT+YR     ++ P   P    +      + F++ DG  V+
Sbjct  203   LKIVEYIDRFVA-PVPKAEGTEYRAS---NQKPPFGPRLNGAPVTSGDEGFKL-DGNTVR  257

Query  1378  WASWEFHVKADQRAGIIISQATVFDPEAGKRRSVMYKGFASELFVPYMDVDEGWYFRAFM  1199
             WA+W FH+  D R G+IISQA+++D E  + R V+Y+GF SELFVPYMD  E WY++ F 
Sbjct  258   WANWIFHLGFDVRTGVIISQASIYDLEMHEYRRVLYRGFVSELFVPYMDPTEEWYYKTFF  317

Query  1198  DAGEFGLGATAMELVPLNDCPRHSHYIDGLFVDPDGRPVSQPNVICVFERYSGDIAWRHS  1019
             D GEFG G + + L PL DCP ++  +D  +   DG PV   N  C+FER++G+I WRH+
Sbjct  318   DCGEFGFGLSTVSLKPLTDCPANAQLMDAYYAAQDGTPVKISNAYCIFERHAGNILWRHT  377

Query  1018  GTGDADDDLIREARPKVSLVVRTTATVGNYDYIFDWEFQTDGSIRVTVGLSGIILAKGSP  839
                   D +I E R +V+LVVRT +T+GNYDYI DWEF+  GSI++ VGL+G++  +   
Sbjct  378   EL-TIPDIVITEVRAEVTLVVRTVSTIGNYDYIIDWEFKPSGSIKMEVGLTGVLEIEAVN  436

Query  838   YEHINQFEIPRWDFPAGSLVSENTIGVAHDHFITFHLDMDVDGPTNSFVKVDLVKNYNIA  659
             Y  I+Q E   +    G+LV++N+I V HDHF+T+HLD+DVDG TNSFVK + V      
Sbjct  437   YTQIDQIEEEVF----GTLVADNSIAVNHDHFLTYHLDLDVDGETNSFVKNNFVTKQATG  492

Query  658   GKIQRKSYWSPKRKVAKSENDAKIKLQLDKPSEFHVINPRHQSRLGNPSGYKIVPSATAA  479
                 RKSYW+   + AK+E DA+I+L L KP++  V+NP  +++ GNP GY+++P A A 
Sbjct  493   HNTPRKSYWNIVSETAKTELDARIRLGL-KPADLVVVNPIKKTKAGNPFGYRLIPGAVAG  551

Query  478   SLLDLQDPPQLRAAFTNNQIWVTPYNRSEQWAGGLFTYQSHGDDTLAVWSNRNRVIEKQD  299
              LL   D PQ+R AFT   +WVTPYN+SE+WAGG    QS G+DTL VWS+RNR IE +D
Sbjct  552   PLLLEDDYPQIRGAFTKYNVWVTPYNKSEKWAGGRHVDQSRGEDTLDVWSSRNRKIENKD  611

Query  298   IVLWYTLGFHHLPCQEDFPVMPTVTSTFQLKPVNFFDRNPIIQA  167
             IVLWYT+GFHH PCQEDFP+MPT++  F+L+P NFF+R+P+++ 
Sbjct  612   IVLWYTIGFHHNPCQEDFPMMPTLSGGFELRPTNFFERSPVLKV  655



>ref|NP_174450.2| copper amine oxidase family protein [Arabidopsis thaliana]
 gb|AEE31383.1| putative copper amine oxidase [Arabidopsis thaliana]
Length=677

 Score =   570 bits (1468),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 287/659 (44%), Positives = 420/659 (64%), Gaps = 18/659 (3%)
 Frame = -1

Query  2089  PMHPLDPLTIQEIERTRSILSSYQPFS-GSSLRIHSLSLDEPDKSEVLRWK----RGNPL  1925
             P HP DPLT  E++  R+I++   P           + L+EP+KS VL W     R    
Sbjct  25    PPHPFDPLTETELKLVRNIINKSYPIGHNHKFTFQYVGLNEPEKSLVLSWHSSPDRNVKP  84

Query  1924  PTRKAFVVALSNGQAHLLVVDLGSGRVSSHTRNPASGYPPMSADDASTALEATFSNSVFR  1745
             P R+AFV+A   G +  +V+D  +  + S+  +  +G P ++ D+   A         F 
Sbjct  85    PPRQAFVIARDKGMSREIVIDFSTRAIVSNKIHVGNGNPMLTIDEQQAATAVVQKYKPFC  144

Query  1744  EAISTRGVEINDVVCSAAAPGWFGPEEEGRRITKVKCYTAQNTPNYYMRPIEGLLLTVDL  1565
             ++I  RG+ +++VV +++  GWFG E + +R  +   +    + N Y+RPIEG+ + V+L
Sbjct  145   DSIIKRGLNLSEVVVTSSTMGWFG-ETKTKRFIRTIPFYLNGSVNTYLRPIEGMTIIVNL  203

Query  1564  DSGKVINVYDTHSPIPIPKAQGTDYRRDGIEHRAPGVEP-LKPISMEQPNGQSFRVEDGY  1388
             D  KV    D  +  P+PKA G +YR   I    P   P L+   + QP+G  F++ DG+
Sbjct  204   DQMKVTGFKDRFTG-PMPKANGREYR---ISKLKPPFGPSLRSAVVFQPDGPGFKI-DGH  258

Query  1387  IVKWASWEFHVKADQRAGIIISQATVFDPEAGKRRSVMYKGFASELFVPYMDVDEGWYFR  1208
             +V+WA+WEFH+  D RAG++IS A++FD +  + R V+YKG  SE+FVPYMD ++ WYF 
Sbjct  259   VVRWANWEFHMSFDVRAGLVISLASIFDMDMNRYRQVLYKGHLSEMFVPYMDPNDDWYFI  318

Query  1207  AFMDAGEFGLGATAMELVPLNDCPRHSHYIDGLFVDPDGRPVSQPNVICVFERYSGDIAW  1028
             +++D GEFG G TA+ L P  DCP ++ ++DG+F   DG P    NV+C+FE+Y+GDI W
Sbjct  319   SYLDCGEFGCGQTAVSLEPYTDCPPNAAFMDGIFPGQDGTPTKISNVMCIFEKYAGDIMW  378

Query  1027  RHSGTGDADDDLIREARPKVSLVVRTTATVGNYDYIFDWEFQTDGSIRVTVGLSGIILAK  848
             RH+   +     I E RP VSLV R   TVGNYDYI ++EF+  GSI++ VGL+G++  K
Sbjct  379   RHT-EAEVPGLKITEVRPDVSLVARMVTTVGNYDYIIEYEFKPSGSIKMGVGLTGVLEVK  437

Query  847   GSPYEHINQFEIPRWDFPAGSLVSENTIGVAHDHFITFHLDMDVDGPTNSFVKVDLV-KN  671
               P E+++  EI   D   G++V++NT+GV HDHF+TF LD+D+DG  NSFV+ +LV K 
Sbjct  438   --PVEYVHTSEIKEDDI-YGTIVADNTVGVNHDHFVTFRLDLDIDGTENSFVRTELVTKR  494

Query  670   YNIAGKIQRKSYWSPKRKVAKSENDAKIKLQLDKPSEFHVINPRHQSRLGNPSGYKIVPS  491
                +    RKSYW+ KR  AK+E DA++KL L +  E  V+NP  +++ GN  GY+++P 
Sbjct  495   TPKSVNTPRKSYWTTKRNTAKTEADARVKLGL-RAEELVVVNPTKKTKHGNEVGYRLLPG  553

Query  490   ATAASLLDLQDPPQLRAAFTNNQIWVTPYNRSEQWAGGLFTYQSHGDDTLAVWSNRNRVI  311
               ++ LL   D PQ+RAAFTN  +W+TPYN+SE WA GL+  +S GDDTLAVWS R+R I
Sbjct  554   PASSPLLVQDDYPQIRAAFTNYNVWITPYNKSEVWASGLYADRSQGDDTLAVWSQRDREI  613

Query  310   EKQDIVLWYTLGFHHLPCQEDFPVMPTVTSTFQLKPVNFFDRNPIIQANPNFAEDLPIC  134
             E +DIV+WYT+GFHH+PCQEDFP MPT+   F+L+P NFF++NP+++A P     +P C
Sbjct  614   ENKDIVMWYTVGFHHVPCQEDFPTMPTMFGGFELRPTNFFEQNPVLKAKPFNLTTIPKC  672



>ref|NP_174452.2| copper amine oxidase 2 [Arabidopsis thaliana]
 gb|AEE31384.1| putative copper amine oxidase [Arabidopsis thaliana]
Length=681

 Score =   570 bits (1468),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 288/652 (44%), Positives = 414/652 (63%), Gaps = 19/652 (3%)
 Frame = -1

Query  2089  PMHPLDPLTIQEIERTRSILSSYQPFS-GSSLRIHSLSLDEPDKSEVLRWKRG-----NP  1928
             P HP DPLT  E++  R+I++   P           + L+EP+KS VL W         P
Sbjct  26    PRHPFDPLTETELKLVRTIINKSYPVGPNHKFTFQYVGLNEPNKSLVLSWYSSPNHTIKP  85

Query  1927  LPTRKAFVVALSNGQAHLLVVDLGSGRVSSHTRNPASGYPPMSADDASTALEATFSNSVF  1748
              P R+AFV+A  NG+   +V+D  S  + S   +  +GYP +S D+   + E       F
Sbjct  86    -PPRQAFVIARDNGKTREIVLDFSSRAIVSDKIHVGNGYPMLSNDEQEASTELVVKFKPF  144

Query  1747  REAISTRGVEINDVVCSAAAPGWFG-PEEEGRRITKVKCYTAQNTPNYYMRPIEGLLLTV  1571
              ++++ RG+ ++++V + +  GW+G  + E  R+ ++  +    T N Y+RPIEG+ + V
Sbjct  145   IDSVAKRGLNVSEIVFTTSTIGWYGETKAEAERVIRLMPFYLDGTVNMYLRPIEGMTIIV  204

Query  1570  DLDSGKVINVYDTHSPIPIPKAQGTDYRRDGIEHRAPGVEP-LKPISMEQPNGQSFRVED  1394
             +LD  KV    D  S + +P A GT+YR   I    P   P L    + QP+G  F+V D
Sbjct  205   NLDEMKVSEFKD-RSVVTMPIANGTEYR---ISKLNPPFGPTLHNAVLLQPDGPGFKV-D  259

Query  1393  GYIVKWASWEFHVKADQRAGIIISQATVFDPEAGKRRSVMYKGFASELFVPYMDVDEGWY  1214
             G+IV+WA+WEFH+  D RAGI+IS A++FD +  K R V+YKG  SE+F+PYMD  + WY
Sbjct  260   GHIVRWANWEFHISFDVRAGIVISLASLFDTDVNKYRQVLYKGHLSEMFIPYMDPSDDWY  319

Query  1213  FRAFMDAGEFGLGATAMELVPLNDCPRHSHYIDGLFVDPDGRPVSQPNVICVFERYSGDI  1034
             F  ++D G+FG G  A+ L P  DCP  + ++DG+F   DG P   P V+C+FE+Y+GDI
Sbjct  320   FITYLDCGDFGCGQCAVSLQPYTDCPAGAVFMDGIFAGQDGTPAKIPKVMCIFEKYAGDI  379

Query  1033  AWRHSGTGDADDDLIREARPKVSLVVRTTATVGNYDYIFDWEFQTDGSIRVTVGLSGIIL  854
              WRH+   +  +  I E RP VSLV R   TVGNYDYI D+EF+  GSI++ VGL+G++ 
Sbjct  380   MWRHT-EAEIPNLEITEVRPDVSLVARIVTTVGNYDYIVDYEFKPSGSIKMGVGLTGVLE  438

Query  853   AKGSPYEHINQFEIPRWDFPAGSLVSENTIGVAHDHFITFHLDMDVDGPTNSFVKVDLVK  674
              K  P E+I+  EI   +   G++V++NT+GV HDHF+TF L +D+DG  NSFV+ +LV 
Sbjct  439   VK--PVEYIHTSEIKLGEDIHGTIVADNTVGVNHDHFVTFRLHLDIDGTENSFVRNELVT  496

Query  673   NYNIAG-KIQRKSYWSPKRKVAKSENDAKIKLQLDKPSEFHVINPRHQSRLGNPSGYKIV  497
               +       RK+YW+ K K AK+E +A++KL L K  E  V+NP  +++ GN  GY+++
Sbjct  497   TRSPKSVNTPRKTYWTTKPKTAKTEAEARVKLGL-KAEELVVVNPNRKTKHGNEVGYRLL  555

Query  496   PSATAASLLDLQDPPQLRAAFTNNQIWVTPYNRSEQWAGGLFTYQSHGDDTLAVWSNRNR  317
               + A  LL   D PQ+RAAFTN  +W+TPYNRSE WAGGL+  +S GDDTLAVWS RNR
Sbjct  556   HGSAAGPLLAQDDFPQIRAAFTNYNVWITPYNRSEVWAGGLYADRSQGDDTLAVWSQRNR  615

Query  316   VIEKQDIVLWYTLGFHHLPCQEDFPVMPTVTSTFQLKPVNFFDRNPIIQANP  161
              IEK+DIV+WYT+GFHH+P QED+P MPT++  F+L+P NFF+RNP+++  P
Sbjct  616   KIEKEDIVMWYTVGFHHVPSQEDYPTMPTLSGGFELRPTNFFERNPVLKTKP  667



>ref|XP_004508349.1| PREDICTED: primary amine oxidase-like [Cicer arietinum]
Length=671

 Score =   568 bits (1464),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 287/677 (42%), Positives = 428/677 (63%), Gaps = 28/677 (4%)
 Frame = -1

Query  2188  CLSFESSNASINNLESLLGIHDFKIQNNHFADRPMHPLDPLTIQEIERTRSILSSYQPFS  2009
             C+ F +   S+  + SL  +H F+           HPLDPLT +E    ++++    P S
Sbjct  7     CVIFFALTLSLQVVVSLASLH-FQ-----------HPLDPLTKEEFSIVQTVVLHKYPTS  54

Query  2008  GSSLRIHSLSLDEPDKSEVLRWKRGNPLPT--RKAFVVALSNGQAHLLVVDLGSGRVSSH  1835
              + +  H + LD+PDK  VL+++    L T  RK+FV+A+ N Q+H +V+DL    + S 
Sbjct  55    KNRISFHYIGLDDPDKDVVLKYETKPTLITIPRKSFVIAIINSQSHEIVIDLRLRSIVSD  114

Query  1834  TRNPASGYPPMSADDASTALEATFSNSVFREAISTRGVEINDVVCSAAAPGWFGPEEEGR  1655
                       +S  + + A+E       F  +++ RG+ +++VVCS  + GWFG EE+ R
Sbjct  115   KVYTGXXXXTLSLKEQTVAIELPLKYPPFIASVNKRGLNLSEVVCSTFSMGWFG-EEKSR  173

Query  1654  RITKVKCYTAQNTPNYYMRPIEGLLLTVDLDSGKVINVYDTHSPIPIPKAQGTDYRRDGI  1475
             R  ++ C+  +NT N Y+RPI G+ + VDL+  K++  +DT   + +P  + T+YR    
Sbjct  174   RTVRIDCFMKENTVNIYVRPISGIKIVVDLELMKIVEYHDT-DIVAVPTDKNTEYRA---  229

Query  1474  EHRAPGVEPLK-PISMEQPNGQSFRVEDGYIVKWASWEFHVKADQRAGIIISQATVFDPE  1298
              H++P   P +  +   QP G  F++ +G+ V WA+W+FH+  D RAG+IIS A+++D E
Sbjct  230   SHQSPPFGPKQHSLVSHQPKGPGFQI-NGHSVSWANWKFHIGFDVRAGVIISLASIYDLE  288

Query  1297  AGKRRSVMYKGFASELFVPYMDVDEGWYFRAFMDAGEFGLGATAMELVPLNDCPRHSHYI  1118
               K RSV+YKGF SELFVPY D  + + ++ F DAGEFG G + + L+P  DCP H+ +I
Sbjct  289   KHKSRSVLYKGFISELFVPYQDPADDFNYKTFFDAGEFGFGLSTVPLIPNRDCPSHAQFI  348

Query  1117  DGLFVDPDGRPVSQPNVICVFERYSGDIAWRHSGTGDADDDLIREARPKVSLVVRTTATV  938
             D      DG PV   N +CVFE+Y G+I WRH+ TG   ++ I E+R +V+L+VR+  TV
Sbjct  349   DSYTHSADGSPVLLKNAVCVFEQY-GNIMWRHTETG-IPNEFIEESRTEVNLIVRSVVTV  406

Query  937   GNYDYIFDWEFQTDGSIRVTVGLSGIILAKGSPYEHINQFEIPRWDFPAGSLVSENTIGV  758
             GNYD I DWEF+T GSI+  + LSGI+  KG+  +H ++ +    + P G+LVS N+IGV
Sbjct  407   GNYDNIVDWEFKTSGSIKPAIALSGILEIKGTNIKHKDEIK----EDPHGTLVSANSIGV  462

Query  757   AHDHFITFHLDMDVDGPTNSFVKVDLVKNYNIAGKIQRKSYWSPKRKVAKSENDAKIKLQ  578
              HDHF  ++LD+D+DG  NSF K  L       G  +RKSYW+ + + AK+E+DAKI + 
Sbjct  463   YHDHFYIYYLDLDIDGTHNSFEKTSLKTVRITDGSSKRKSYWTTETQTAKTESDAKITIG  522

Query  577   LDKPSEFHVINPRHQSRLGNPSGYKIVPSATAASLLDLQDPPQLRAAFTNNQIWVTPYNR  398
             L  PSE  V+N   ++ +GN  GY+++P+  A  LL   D PQ+R AFTN  +WVTPYNR
Sbjct  523   L-APSELTVVNTNKKTAVGNDVGYRLIPAIPAHPLLTEDDYPQIRGAFTNYNVWVTPYNR  581

Query  397   SEQWAGGLFTYQSHGDDTLAVWSNRNRVIEKQDIVLWYTLGFHHLPCQEDFPVMPTVTST  218
             +E+WAGGLF   SHGDDTLAVW+ +NR I  +DIV+W+ +G HH+P QEDFP+MP +++ 
Sbjct  582   TEKWAGGLFVDHSHGDDTLAVWTKKNRDIVNKDIVMWHVVGIHHVPAQEDFPIMPLLSTA  641

Query  217   FQLKPVNFFDRNPIIQA  167
             F+L+P NFF+RNP+++ 
Sbjct  642   FELRPTNFFERNPVLKT  658



>ref|XP_010229636.1| PREDICTED: primary amine oxidase-like [Brachypodium distachyon]
Length=698

 Score =   569 bits (1466),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 302/663 (46%), Positives = 422/663 (64%), Gaps = 30/663 (5%)
 Frame = -1

Query  2101  FADRPM---HPLDPLTIQEIERTRSILSSYQPFSGSSLRIHSLSLDEPDKSEVLRWKRGN  1931
             FA  P+   HPLDP +  E+   R+ + +        L  H + LD+PDK  ++ +   N
Sbjct  18    FAAGPVACAHPLDPFSPAELTAIRAAVLASPLVPARPLTFHYVGLDDPDKPALISYANNN  77

Query  1930  ---PLPTRKAFVVALSNGQAHLLVVDLGSGRVS----SHTRNPASGYPPMSADDASTALE  1772
                 +  R+A V+A + G++H L+V +     S    SH  +  +G+P ++ ++   A+ 
Sbjct  78    NASAIIPRRALVIARAGGESHELLVSVSGFSSSASVISHAVHRGAGFPTLTLEEQFAAVA  137

Query  1771  ATFSNSVFREAISTRGVEINDVVCSAAAPGWFG---PEEEGRRITKVKCYTA-QNTPNYY  1604
                 +  F E++  RGV+++DV+C+    GWFG   P    RR+ K+ C+ A  +T N+Y
Sbjct  138   LPPRHPPFVESVRARGVDMDDVLCAVFPVGWFGGDDPSVRQRRVVKLLCFVAGADTANFY  197

Query  1603  MRPIEGLLLTVDLDSGKVINVYDTHSPIPIPKAQGTDYRRDGIEHRAPGVEPLKPISMEQ  1424
              RPIEG+ L VDLD   ++  Y      P+PKA+GTDYR  G  H  P   P      +Q
Sbjct  198   ARPIEGVTLVVDLDRMAIVG-YRDRVEYPVPKAEGTDYRWAG--HVGP---PAPGAVGQQ  251

Query  1423  PNGQSFRVEDGYIVKWASWEFHVKADQRAGIIISQATVFDP--EAG--KRRSVMYKGFAS  1256
             P G+ FR+ DG++V+WA WEFHV  D RAG +IS A++ D   + G  +RR V+Y+GF S
Sbjct  252   PEGRGFRI-DGHLVRWADWEFHVGFDMRAGTVISLASIHDAALQGGTRRRRPVLYRGFVS  310

Query  1255  ELFVPYMDVDEGWYFRAFMDAGEFGLGATAMELVPLNDCPRHSHYIDGLFVDPDGRPVSQ  1076
             E+FVPYMD  E WY+R F+DAGE+GLG  A  L P  DCP  + Y+DG +   DG PV  
Sbjct  311   EVFVPYMDPAEEWYYRTFLDAGEYGLGLWAFPLQPGADCPHGAAYLDGYYAGQDGMPVQN  370

Query  1075  PNVICVFERY-SGDIAWRHSGTGDADDDLIREARPKVSLVVRTTATVGNYDYIFDWEFQT  899
              N+ICVFER  +GD+AWRH+  G   + LI E  P VSLVVR   + GNYDYI DWEF+T
Sbjct  371   KNMICVFERRGAGDVAWRHTEAG-FPNRLITEVWPDVSLVVRMVVSAGNYDYILDWEFKT  429

Query  898   DGSIRVTVGLSGIILAKGSPYEHINQFEIPRWDFPAGSLVSENTIGVAHDHFITFHLDMD  719
              GSI+VTV L+G++  KG+ Y H +Q  IP  +   G+LV+ENTI V HDHF+T+HLD+D
Sbjct  430   SGSIKVTVSLTGLLEVKGTGYTHKDQ--IPPSEDAHGTLVAENTIAVYHDHFVTYHLDLD  487

Query  718   VDGPTNSFVKVDLVKNYNIAGKIQRKSYWSPKRKVAKSENDAKIKLQLDKPSEFHVINPR  539
             VDG  NSFVK  +    N      RKSYW+ +R+VA++E DA+I L    P++  V+NP 
Sbjct  488   VDGTRNSFVKNTITTTKNNGTTTPRKSYWTVRREVAETETDAQIDLNAGAPADLLVVNPG  547

Query  538   HQSRLGNPSGYKIVP-SATAASLLDLQDPPQLRAAFTNNQIWVTPYNRSEQWAGGLFTYQ  362
              ++R+GN +GY+++P  ATAAS++   D PQ RA++   Q+ VTPYN+SE+WA G++  Q
Sbjct  548   KRTRMGNEAGYRVIPDGATAASVMADDDFPQRRASYCKKQVRVTPYNKSEKWAPGVYADQ  607

Query  361   SHGDDTLAVWSNRNRVIEKQDIVLWYTLGFHHLPCQEDFPVMPTVTSTFQLKPVNFFDRN  182
             S GDD L VWS R+R +  +DIVLWYT+G HH+P QEDFPVMPTV+  F+L+P NFFDRN
Sbjct  608   STGDDGLGVWSGRDRSVRDEDIVLWYTVGVHHIPYQEDFPVMPTVSGGFELRPANFFDRN  667

Query  181   PII  173
             P++
Sbjct  668   PLL  670



>ref|XP_006306925.1| hypothetical protein CARUB_v10008490mg [Capsella rubella]
 gb|EOA39823.1| hypothetical protein CARUB_v10008490mg [Capsella rubella]
Length=683

 Score =   568 bits (1463),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 287/649 (44%), Positives = 414/649 (64%), Gaps = 17/649 (3%)
 Frame = -1

Query  2083  HPLDPLTIQEIERTRSILSSYQPFSGS-SLRIHSLSLDEPDKSEVLRW--KRGNPL--PT  1919
             HP DPLT  E++  R+I++   P   S       + L+EPDKS VL W   R + +  P 
Sbjct  30    HPFDPLTETELKLVRTIINKSYPVGPSHKFTFQYVGLNEPDKSLVLSWYSSRNHAIKPPP  89

Query  1918  RKAFVVALSNGQAHLLVVDLGSGRVSSHTRNPASGYPPMSADDASTALEATFSNSVFREA  1739
             R+AFV+A   G+   +VVD  S  + S      +GYP ++ D+  T+ +  F    F  +
Sbjct  90    RQAFVIARDKGKTREIVVDFSSRAIVSDKIRVGNGYPMLTNDEQETSSDIVFKFKPFLHS  149

Query  1738  ISTRGVEINDVVCSAAAPGWFGPEE-EGRRITKVKCYTAQNTPNYYMRPIEGLLLTVDLD  1562
             ++ R + ++++V + +  GW+G  + +  R+ ++  +    T N Y++PIEG+ + V+LD
Sbjct  150   VARRRLNVSEIVFTTSTIGWYGESKAKTERVIRMMPFYLDGTVNMYLKPIEGMTIIVNLD  209

Query  1561  SGKVINVYDTHSPIPIPKAQGTDYRRDGIEHRAPGVEP-LKPISMEQPNGQSFRVEDGYI  1385
               KV    D    + +PKA  T+YR   I    P   P L+   + QPNG  F++ DG+ 
Sbjct  210   QMKVTEFKD-RLIVTMPKANETEYR---ISKLKPPFGPTLRNAVLVQPNGPGFKI-DGHT  264

Query  1384  VKWASWEFHVKADQRAGIIISQATVFDPEAGKRRSVMYKGFASELFVPYMDVDEGWYFRA  1205
             V+WA+WEFH+  D RAGI+IS A++FD E  K R V+YKG  SE+F+PYMD  + WYF  
Sbjct  265   VRWANWEFHLSFDVRAGIVISLASIFDTEVNKYRQVLYKGHLSEMFIPYMDPTDDWYFIT  324

Query  1204  FMDAGEFGLGATAMELVPLNDCPRHSHYIDGLFVDPDGRPVSQPNVICVFERYSGDIAWR  1025
             ++D G+FG G  A+ L P  DCP  + ++DG+F   DG P   PN IC+FE+Y+GDI WR
Sbjct  325   YLDCGDFGCGQCAVSLEPYTDCPAGAVFMDGVFAGQDGTPAKIPNAICIFEKYAGDIMWR  384

Query  1024  HSGTGDADDDLIREARPKVSLVVRTTATVGNYDYIFDWEFQTDGSIRVTVGLSGIILAKG  845
             H+   +  +  I E RP VSLV R   TVGNYDYI D+EF+  GSI++ VGL+G++  K 
Sbjct  385   HT-EAEIPNLEITEVRPDVSLVARIVTTVGNYDYIVDYEFKPSGSIKMGVGLTGVLEVK-  442

Query  844   SPYEHINQFEIPRWDFPAGSLVSENTIGVAHDHFITFHLDMDVDGPTNSFVKVDLV-KNY  668
              P ++I+  EI   +   G++V++NT+GV HDHF+TF LD+D+DG  NSFV+ +LV K  
Sbjct  443   -PVKYIHTSEIKVGEDIHGTIVADNTVGVNHDHFVTFRLDLDIDGKDNSFVRNELVTKRT  501

Query  667   NIAGKIQRKSYWSPKRKVAKSENDAKIKLQLDKPSEFHVINPRHQSRLGNPSGYKIVPSA  488
               +    RKSYWS + K AK+E +A++KL L K  E  V+NP  +++ GN  GY+++  +
Sbjct  502   PKSVNTPRKSYWSSRPKTAKTEAEARVKLGL-KTEELVVVNPNRKTKHGNEVGYRLLHGS  560

Query  487   TAASLLDLQDPPQLRAAFTNNQIWVTPYNRSEQWAGGLFTYQSHGDDTLAVWSNRNRVIE  308
              A  LL   D PQ+RAAFTN  +W+TPYNRSE WAGGL+  +S GDDTLAVWS RNR IE
Sbjct  561   AAGPLLAQDDFPQIRAAFTNYNVWITPYNRSEVWAGGLYADRSQGDDTLAVWSQRNRKIE  620

Query  307   KQDIVLWYTLGFHHLPCQEDFPVMPTVTSTFQLKPVNFFDRNPIIQANP  161
              +DIV+WYT+GFHH+P QED+P MPT++  F+L+P NFF+RNP+++  P
Sbjct  621   NKDIVMWYTVGFHHVPSQEDYPTMPTLSGGFELRPTNFFERNPVLKTKP  669



>ref|XP_007034740.1| Amine oxidase 1 [Theobroma cacao]
 gb|EOY05666.1| Amine oxidase 1 [Theobroma cacao]
Length=644

 Score =   566 bits (1458),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 292/646 (45%), Positives = 409/646 (63%), Gaps = 32/646 (5%)
 Frame = -1

Query  2083  HPLDPLTIQEIERTRSILSSYQPFSGSSLRIHSLSLDEPDKSEVLRW-----KRGNPLPT  1919
             HPLDPLT  EI + + I+   +  S  +L  H + L+EPDK +VL W     +  N LP 
Sbjct  22    HPLDPLTPAEINQAKLIIDKSKLGSLPNLTFHFVDLEEPDKKDVLNWISSNKQTRNALP-  80

Query  1918  RKAFVVALSNGQAHLLVVDLGSGRVSSHTRNPASGYPPMSADDASTALEATFSNSVFREA  1739
             R+A VV  + G+   L+VDL  G + S+      GYPP + ++   A         F+ +
Sbjct  81    RQAKVVVRAGGETRELLVDLAYGSIRSNHVYTGQGYPPFTFNELFQASRLPLQYPKFKNS  140

Query  1738  ISTRGVEINDVVCSAAAPGWFGPEEEGRRITKVKCYTAQNTPNYYMRPIEGLLLTVDLDS  1559
             I  RG+ +++V C     GW+G E   +R  +V CY    + N Y RPIEG+ + VD+DS
Sbjct  141   ILKRGLNLSEVSCVPLTVGWYG-ENVTKRALRVTCYYRGGSVNVYARPIEGISIFVDVDS  199

Query  1558  GKVINVYDTHSPIPIPKAQGTDYRRDGIEHRAPGVEPLKPISMEQPNGQSFRVEDGYIVK  1379
              + I +Y     +P+PKA+GTD+R +         +    ++     G+ F++E G  V 
Sbjct  200   MQ-ITMYLDRFRVPLPKAEGTDFRSN---------QKTDSVTCNL-KGEGFKIE-GNNVN  247

Query  1378  WASWEFHVKADQRAGIIISQATVFDPEAGKRRSVMYKGFASELFVPYMDVDEGWYFRAFM  1199
             WA+W+FHV  D +AGI+IS A++FD +  K R V+Y+G  SE FVPYMD +  WYFR FM
Sbjct  248   WANWKFHVGFDPQAGIVISTASIFDAKTKKTRQVLYRGHVSETFVPYMDPESEWYFRTFM  307

Query  1198  DAGEFGLGATAMELVPLNDCPRHSHYIDGLFVDPDGRPVSQPNVICVFERYSGDIAWRHS  1019
             D GEFG G +A  L PL DCP+++ Y+DG +   DG+      VIC+FERYSGDIAWRH+
Sbjct  308   DIGEFGFGRSASSLQPLIDCPQNAVYLDGYWAGADGQAQKMQRVICIFERYSGDIAWRHA  367

Query  1018  GTGDADDDLIREARPKVSLVVRTTATVGNYDYIFDWEFQTDGSIRVTVGLSGIILAKGSP  839
                +    +IR  + + SLV R  ATVGNYDY+ DWEF   G+I+V V L+GI+L KG+P
Sbjct  368   EI-NVPGKVIRSGQTEKSLVARMVATVGNYDYVLDWEFTNSGTIKVGVCLTGILLMKGTP  426

Query  838   YEHINQFEIPRWDFPAGSLVSENTIGVAHDHFITFHLDMDVDGPTNSFVKVDL----VKN  671
             Y  IN   I    +  G+LV+ NT+ V HDHF+T++LD+DVDG  NSFVK  L    V +
Sbjct  427   Y--INNDHIKSNVY--GTLVAVNTVAVNHDHFLTYYLDLDVDGQGNSFVKAKLQTARVTD  482

Query  670   YNIAGKIQRKSYWSPKRKVAKSENDAKIKLQLDKPSEFHVINPRHQSRLGNPSGYKIVPS  491
             +N++    RKSYW   R+ AK E DA+++L   +P++  ++NP  +++LGN  GY+++P 
Sbjct  483   FNVS---PRKSYWKVVRETAKKEADARVQLG-SEPADLLIVNPNKETKLGNQVGYRLIPG  538

Query  490   ATAASLLDLQDPPQLRAAFTNNQIWVTPYNRSEQWAGGLFTYQSHGDDTLAVWSNRNRVI  311
                 SLLD  D PQ+RAA+T  Q+WVT YN+SE+WAGG +  +SHGDD LAVWS RNRVI
Sbjct  539   QPVTSLLDDDDYPQIRAAYTKYQVWVTAYNKSERWAGGFYADRSHGDDGLAVWSKRNRVI  598

Query  310   EKQDIVLWYTLGFHHLPCQEDFPVMPTVTSTFQLKPVNFFDRNPII  173
             E +D+VLWYT+GFHH+P QE+FPVMPT    F+L+P NFF+ NP++
Sbjct  599   ENKDLVLWYTVGFHHIPYQEEFPVMPTFHGGFELRPANFFESNPLL  644



>gb|EEC82302.1| hypothetical protein OsI_26556 [Oryza sativa Indica Group]
Length=703

 Score =   568 bits (1463),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 301/664 (45%), Positives = 417/664 (63%), Gaps = 32/664 (5%)
 Frame = -1

Query  2083  HPLDPLTIQEIERTRSILSSYQPFSGSSLRIHSLSLDEPDKSEVLRWKRG-------NPL  1925
             HPLDPL+  E+   R+ + +        L  H + LDEPDK +VL +  G       + L
Sbjct  29    HPLDPLSAAELIAVRAAVLASPLVPARPLTFHYVGLDEPDKPDVLSYAYGGGGGASRHAL  88

Query  1924  PTRKAFVVALSNGQAHLLVVDLG---SGRVSSHTRNPASGYPPMSADDASTALEATFSNS  1754
             P R+AFV+A + G++H L VD+    S  V SH  +  +G+P ++ ++   A+     + 
Sbjct  89    P-RRAFVIARAGGESHELRVDVANASSPSVLSHAVHRGAGFPTLTLEEQFAAVALPPKHP  147

Query  1753  VFREAISTRGVEINDVVCSAAAPGWFGPEEEGRR--ITKVKCYTAQNTPNYYMRPIEGLL  1580
              F E++  RGV+++DV+C+    GWFG + E RR  + KV C+ A  T N+Y RP+EG+ 
Sbjct  148   PFVESVRRRGVDMDDVLCAVFPVGWFGGDGEPRRSRVAKVLCFVAGATANFYARPLEGVT  207

Query  1579  LTVDLDSGKVINVYDTHSPIPIPKAQGTDYRRDGIEHRAPGVEPLKPISMEQPNGQSFRV  1400
             L VDLD   ++  Y      P+PKA+GTDYR  G            P  + QP G+ F +
Sbjct  208   LVVDLDRMAIVG-YRDRVAYPVPKAEGTDYRA-GKAGPPYAGPAPAPGVVVQPEGRGFHI  265

Query  1399  EDGYIVKWASWEFHVKADQRAGIIISQATVFDPEAG-----KRRSVMYKGFASELFVPYM  1235
              DG++V+WA+WEFHV  D RAG +IS A+V D +A      +RR V+Y+GF SE+FVPYM
Sbjct  266   -DGHVVRWANWEFHVGFDMRAGTVISLASVHDADADAGGARRRRQVLYRGFVSEIFVPYM  324

Query  1234  DVDEGWYFRAFMDAGEFGLGATAMELVPLNDCPRHSHYIDGLFVDPDGRPVSQPNVICVF  1055
             D  E WY+R F+DAGE+GLG  A  L P  DCP ++ Y+DG +   DGRPV   N+ICVF
Sbjct  325   DPVEEWYYRTFLDAGEYGLGLWAFPLQPGGDCPANAAYLDGHYSGQDGRPVEARNMICVF  384

Query  1054  ERYSGDIAWRHSGTGDADDDLIREARPKVSLVVRTTATVGNYDYIFDWEFQTDGSIRVTV  875
             ERYSGD+AWRH+  G   + LI E RP VSLV R   + GNYDYI DWEF+T GSI++ V
Sbjct  385   ERYSGDVAWRHTEAG-FPNQLITEVRPDVSLVARMVVSAGNYDYILDWEFKTSGSIKLVV  443

Query  874   GLSGIILAKGSPYEHINQFEIPRWDFPAGSLVSENTIGVAHDHFITFHLDMDVDGPTNSF  695
              L+G++  K + Y H ++          G+LV+ENTI V HDH++T+HLD+DVDG  NSF
Sbjct  444   SLTGLLEVKATAYAHADEVA----QDAHGTLVAENTIAVYHDHYVTYHLDLDVDGTNNSF  499

Query  694   VK-----VDLVKNYNIAGKIQRKSYWSPKRKVAKSENDAKIKLQLDKPSEFHVINPRHQS  530
             VK     V    + + A    R+SYW+ +R+VA+ E D ++ L    P++   +NP  ++
Sbjct  500   VKNIVTAVVRDADADAAADTPRRSYWTVRREVAEREADGQVDLGGGAPADLVFVNPGKKT  559

Query  529   RLGNPSGYKIVPS-ATAASLLDLQDPPQLRAAFTNNQIWVTPYNRSEQWAGGLFTYQSHG  353
             R+GN  GY++VP  ATAAS+L   D PQ RAA+   Q+ VTPY+RSE+WA GL+  QS G
Sbjct  560   RMGNEVGYRVVPGGATAASVLADDDFPQRRAAYCKKQVRVTPYSRSEKWASGLYADQSTG  619

Query  352   DDTLAVWSNRNRVIEKQDIVLWYTLGFHHLPCQEDFPVMPTVTSTFQLKPVNFFDRNPII  173
              D LA WS R+R I  +DIVLWYT+G HH+P QEDFPVMPT++   +L+P NFF+RNP++
Sbjct  620   GDGLAAWSERDRAIRGEDIVLWYTVGLHHVPYQEDFPVMPTLSGGLELRPSNFFERNPLL  679

Query  172   QANP  161
                P
Sbjct  680   TTMP  683



>ref|XP_003592404.1| Primary amine oxidase [Medicago truncatula]
 gb|AES62655.1| copper amine oxidase, enzyme domain protein [Medicago truncatula]
Length=675

 Score =   566 bits (1460),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 285/657 (43%), Positives = 409/657 (62%), Gaps = 19/657 (3%)
 Frame = -1

Query  2083  HPLDPLTIQEIERTRSI-LSSYQPFSGSSLRIHSLSLDEPDKSEVLRWKRGNPL------  1925
             HPLDPLT  EI   R+I L SYQ     +L  H + L EPDK  +  W   N        
Sbjct  27    HPLDPLTPSEINLVRNIILKSYQT-KHYNLTFHYVGLQEPDKPLIQSWLSSNTKTKTLLP  85

Query  1924  PTRKAFVVALSNGQAHLLVVDLGSGRVSSHTRNPASGYPPMSADDASTALEATFSNSVFR  1745
             P R+AFV+     Q+  ++VD  +  + S       GYP ++  + + A +  F+   F+
Sbjct  86    PPRQAFVIVRFQKQSLEIIVDFSTRSIISTKLYKGQGYPILTFGEQTIASQLPFTYEPFK  145

Query  1744  EAISTRGVEINDVVCSAAAPGWFGPEEEGRRITKVKCYTAQNTPNYYMRPIEGLLLTVDL  1565
              +++ R + I++V+C+A   GWFG EE+ +R  KVKCY    + N Y RP+EG+   VDL
Sbjct  146   HSLNKRNINISNVLCAAFTVGWFG-EEKSKRTVKVKCYYKNGSANLYARPLEGVAAVVDL  204

Query  1564  DSGKVINVYDTHSPIPIPKAQGTDYRRDGIEHRAPGVEPLKPISMEQPNGQSFRVEDGYI  1385
             D  K++   D H  IP+PKA+GT+YR   +  + P    LK I++ Q +G  F ++ G+ 
Sbjct  205   DEMKIVGYSDRHV-IPVPKAEGTEYRASKM--KPPFGPMLKGIAVSQHDGPGFTIQ-GHS  260

Query  1384  VKWASWEFHVKADQRAGIIISQATVFDPEAGKRRSVMYKGFASELFVPYMDVDEGWYFRA  1205
             V WA+W FH+  D + G IIS A+++D E  K R V+YKG  SE+FVPY D  E WY+  
Sbjct  261   VSWANWVFHIGFDIQVGPIISLASIYDLENQKYREVLYKGLISEVFVPYQDPSEEWYYTT  320

Query  1204  FMDAGEFGLGATAMELVPLNDCPRHSHYIDGLFVDPDGRPVSQPNVICVFERYSGDIAWR  1025
             + D GE+G G T   L P  DCP ++ ++D  +   DG PV   N  C+FE+Y+GDI WR
Sbjct  321   YFDCGEYGFGQTMSSLQPFTDCPANAVFLDAYYSASDGTPVKISNAFCIFEKYAGDIMWR  380

Query  1024  HSGTGDADDDLIREARPKVSLVVRTTATVGNYDYIFDWEFQTDGSIRVTVGLSGIILAKG  845
             H+      +++I E R  VSLVVR+ +TVGNYDY+ DWEF+  GSI++ VGL+GI+  K 
Sbjct  381   HTEIA-IPNEVITEVRSDVSLVVRSVSTVGNYDYVIDWEFKPSGSIKLGVGLTGILGIKA  439

Query  844   SPYEHINQFEIPRWDFPAGSLVSENTIGVAHDHFITFHLDMDVDGPTNSFVKVDLVKNYN  665
               Y + +Q +    +   G+L+++NTIG+ HDHF T++LD+D+DG  NSFVK +L     
Sbjct  440   GTYTNTDQIK----EDIHGTLLADNTIGIYHDHFFTYYLDLDIDGEANSFVKTNLETVRV  495

Query  664   IAGKIQRKSYWSPKRKVAKSENDAKIKLQLDKPSEFHVINPRHQSRLGNPSGYKIVPSAT  485
                 I RKSYW+  ++ A++E DA++ + + KPSE  V+NP  +++ GN  GY+++P   
Sbjct  496   KDQTIPRKSYWTVVKETARTEADARVNIGI-KPSELLVVNPSKKTKQGNQIGYRLLPGPI  554

Query  484   AASLLDLQDPPQLRAAFTNNQIWVTPYNRSEQWAGGLFTYQSHGDDTLAVWSNRNRVIEK  305
                LL   D PQ+R AFTN  +WVTPYN++E+WAGGL+   S GDDTLAVWS R+R IE 
Sbjct  555   VHPLLLTDDYPQIRGAFTNYNVWVTPYNKTEKWAGGLYVDHSRGDDTLAVWSLRDRKIEN  614

Query  304   QDIVLWYTLGFHHLPCQEDFPVMPTVTSTFQLKPVNFFDRNPIIQANPNFAEDLPIC  134
             +DIVLW+T+GFHH+P QEDFPVMPT++  F+L+P NFF+ NP+++     A   P C
Sbjct  615   KDIVLWHTMGFHHVPSQEDFPVMPTLSGGFELRPTNFFESNPVLKTKSPKAVHWPNC  671



>ref|XP_002516777.1| Amine oxidase [copper-containing] precursor, putative [Ricinus 
communis]
 gb|EEF45391.1| Amine oxidase [copper-containing] precursor, putative [Ricinus 
communis]
Length=666

 Score =   566 bits (1459),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 280/646 (43%), Positives = 411/646 (64%), Gaps = 18/646 (3%)
 Frame = -1

Query  2083  HPLDPLTIQEIERTRSILSSYQPFSGSSL-RIHSLSLDEPDKSEVLRWKRGNPL---PTR  1916
             HPLDPL+ +E+   ++I+ +    + +SL   H +  DEP+K  +L W   NP    P R
Sbjct  30    HPLDPLSPKELTLVQAIVRNSLSATNTSLVTFHYVGFDEPEKPLILSW-LSNPETKPPPR  88

Query  1915  KAFVVALSNGQAHLLVVDLGSGRVSSHTRNPASGYPPMSADDASTALEATFSNSVFREAI  1736
             +A  +   N Q H  +VDL +  +         GYP ++AD+   A E   +   F E++
Sbjct  89    RALAITRYNKQTHEFIVDLSTSSIVGTQVYNDYGYPTLAADEQVAANELPLTYGPFIESV  148

Query  1735  STRGVEINDVVCSAAAPGWFGPEEEGRRITKVKCYTAQNTPNYYMRPIEGLLLTVDLDSG  1556
              +RG+ ++ VVCS    GWFG ++  RR+ KV+C+   +T N Y+ PIEG+ + VDLD  
Sbjct  149   KSRGLNLSAVVCSTFTVGWFG-KDVNRRVVKVQCFHMNDTINLYLLPIEGIKIVVDLDEM  207

Query  1555  KVINVYDTHSPIPIPKAQGTDYRRDGIEHRAPGVEP-LKPISMEQPNGQSFRVEDGYIVK  1379
             K++  Y+ +  +P+P ++GTDYR   +  + P + P +   ++ QP+G  F++ DG+ +K
Sbjct  208   KIVE-YNDNEKVPVPNSEGTDYR---LSKQKPPLGPRINRAAILQPDGPGFQI-DGHTIK  262

Query  1378  WASWEFHVKADQRAGIIISQATVFDPEAGKRRSVMYKGFASELFVPYMDVDEGWYFRAFM  1199
             W +W FH+  D R G +IS A+++D E  K RSV+Y+G  SELFVPY D  + +YF+ F 
Sbjct  263   WLNWVFHIAFDARVGPVISLASIYDQEKHKHRSVLYRGHISELFVPYQDPTQDYYFKTFF  322

Query  1198  DAGEFGLGATAMELVPLNDCPRHSHYIDGLFVDPDGRPVSQPNVICVFERYSGDIAWRHS  1019
             D GEFG G +A+ L PL DCP ++ Y+DG     DG PV  PN+ C+FER++GDI WRH+
Sbjct  323   DCGEFGFGLSAVSLAPLADCPNNAVYMDGYHAGQDGTPVQVPNLFCIFERHAGDIMWRHT  382

Query  1018  GTGDADDDLIREARPKVSLVVRTTATVGNYDYIFDWEFQTDGSIRVTVGLSGIILAKGSP  839
               G   D+ I EARP+VSLVVR  AT+GNYD++ DWEF+  GSI + VGLSGI+  + + 
Sbjct  383   ELG-IPDETITEARPEVSLVVRMVATIGNYDHVLDWEFKPSGSINIQVGLSGILEVRATK  441

Query  838   YEHINQFEIPRWDFPAGSLVSENTIGVAHDHFITFHLDMDVDGPTNSFVKVDLVKNYNIA  659
             Y + ++     +    G+L++ NTIG+ HDHF+ + LD+D+DG  NS VK  LV      
Sbjct  442   YTYSDEINEEVY----GTLLANNTIGLYHDHFLMYRLDLDIDGVDNSLVKQKLVTKTVTN  497

Query  658   GKIQRKSYWSPKRKVAKSENDAKIKLQLDKPSEFHVINPRHQSRLGNPSGYKIVPSATAA  479
                 RKSYW+   + AK+E+DAKIKL    P+E  V+NP  +++LGN  GY+++  +   
Sbjct  498   KTTPRKSYWTVVSETAKTESDAKIKLG-QAPAELVVVNPNKKTKLGNSHGYRLITRSEVH  556

Query  478   SLLDLQDPPQLRAAFTNNQIWVTPYNRSEQWAGGLFTYQSHGDDTLAVWSNRNRVIEKQD  299
              LL   D PQ+R AFT   +W+TPYN+SE WAGG +  QSHG DTL VWS RNR I+ +D
Sbjct  557   PLLLEDDYPQIRGAFTKYNVWITPYNKSEIWAGGRYVDQSHGQDTLDVWSLRNRDIDNKD  616

Query  298   IVLWYTLGFHHLPCQEDFPVMPTVTSTFQLKPVNFFDRNPIIQANP  161
             IVLW+ +G HH+PCQEDFP+MPT+T+ F+L+P NFF+ + +++  P
Sbjct  617   IVLWHVIGIHHVPCQEDFPMMPTLTTGFELRPTNFFEFSRVLKVIP  662



>ref|XP_010108018.1| Primary amine oxidase [Morus notabilis]
 gb|EXC17583.1| Primary amine oxidase [Morus notabilis]
Length=678

 Score =   566 bits (1459),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 279/647 (43%), Positives = 411/647 (64%), Gaps = 21/647 (3%)
 Frame = -1

Query  2083  HPLDPLTIQEIERTRSILSSYQPFSGSSLRIHSLSLDEPDKSEVLRW--KRGNPLPTRKA  1910
             HPLDPL+  E    ++I+      S  +L    + LDEP+KS +L W  K     P R+A
Sbjct  29    HPLDPLSPSEFILIKTIVHKAYSTSNHNLTFQYVGLDEPEKSTILSWQTKPATKPPPRRA  88

Query  1909  FVVALSNGQAHLLVVDLGSGRVSSHTRNPASGYPPMSADDASTALEATFSNSVFREAIST  1730
              V A  N +   ++VDL +  + S  ++  SG+P ++ ++ + A           +++  
Sbjct  89    LVHARLNKETLEIIVDLSTRSIFSQQKHLGSGFPMLTLEEQTNANILVLKYGPLIKSVKD  148

Query  1729  RGVEINDVVCSAAAPGWFGPEEEGRRITKVKCYTAQNTPNYYMRPIEGLLLTVDLDSGKV  1550
             RG++++ V CS+   GW+G E++  R+ K++C+    T N Y+RP+EG+LL V+LD  K+
Sbjct  149   RGLDMSQVYCSSFTAGWYG-EKKAERVIKIQCFYTNGTANLYVRPLEGILLVVNLDEMKI  207

Query  1549  INVYDTHSPIPIPKAQGTDYRRDGIEHRAPGVEPLKPISMEQPNGQSFRVEDGYIVKWAS  1370
             +  +D    IP+PKA+GT++R   +  R P    L  +++ Q  G      DG+ + WA+
Sbjct  208   VEYHDRLR-IPLPKAEGTEFRASWL--RPPFGPWLNGVAVAQEPGFEM---DGHTISWAN  261

Query  1369  WEFHVKADQRAGIIISQATVFDPEAGKRRSVMYKGFASELFVPYMDVDEGWYFRAFMDAG  1190
             W+FH+  D R G+++SQA++FD +  K R V+Y+ + SELFVPYMD  +  YF+ F D G
Sbjct  262   WKFHLAFDARVGVVLSQASIFDLDKNKYRRVLYRAYVSELFVPYMDPTDEVYFKTFFDCG  321

Query  1189  EFGLGATAMELVPLNDCPRHSHYIDGLFVDPDGRPVSQPNVICVFERYSGDIAWRHSGTG  1010
             EFG+G +A+ LV   DCP ++ +ID  +  PDG PV+  N IC+FER++G+I WRH+ T 
Sbjct  322   EFGVGQSAVPLVTSADCPANAKFIDAYYAAPDGTPVNISNAICIFERHAGNILWRHTETA  381

Query  1009  DADDDLIREARPKVSLVVRTTATVGNYDYIFDWEFQTDGSIRVTVGLSGIILAKGSPYEH  830
                + +I EAR  VSLVVR  +TVGNYDYI DWEF+  GSI+  VGL+G++  KG  Y H
Sbjct  382   ILGE-VITEARADVSLVVRMVSTVGNYDYILDWEFKPAGSIKFGVGLTGVLEIKGVTYTH  440

Query  829   INQFEIPRWDFPAGSLVSENTIGVAHDHFITFHLDMDVDGPTNSFVKVDLV------KNY  668
              +Q +   +    G L++EN++ + HDHF+T+HLD+DVDG  NS +K  LV       N 
Sbjct  441   KDQIKEDVY----GPLLAENSVAIHHDHFLTYHLDLDVDGEANSIMKTTLVTKRQSRNNI  496

Query  667   NIAGKIQRKSYWSPKRKVAKSENDAKIKLQLDKPSEFHVINPRHQSRLGNPSGYKIVPSA  488
             N      RKSYW+ + ++ K+E+DAK+KL L +P E  VINP  ++++GN  GY+++P  
Sbjct  497   NAKHITPRKSYWTTETEIVKTESDAKLKLGL-RPLELAVINPNKRTKVGNHIGYRLLPGP  555

Query  487   TAASLLDLQDPPQLRAAFTNNQIWVTPYNRSEQWAGGLFTYQSHGDDTLAVWSNRNRVIE  308
              A  LL   D PQ RA FTN  +WVTPYN+SE+WAGG F  QS GDD L  W +RNR IE
Sbjct  556   AAIPLLSNDDYPQTRAPFTNYDVWVTPYNKSEKWAGGKFVDQSRGDDNLETWCHRNRNIE  615

Query  307   KQDIVLWYTLGFHHLPCQEDFPVMPTVTSTFQLKPVNFFDRNPIIQA  167
              +DIVLW+T+GFHH+P QE+FPVMPT+T  F+L+P NFF+ NP+++ 
Sbjct  616   NKDIVLWHTIGFHHVPSQEEFPVMPTLTGGFELRPTNFFESNPVLKV  662



>gb|KEH32232.1| copper amine oxidase, enzyme domain protein [Medicago truncatula]
Length=675

 Score =   565 bits (1457),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 276/657 (42%), Positives = 420/657 (64%), Gaps = 23/657 (4%)
 Frame = -1

Query  2122  FKIQNNHFADRPMHPLDPLTIQEIERTRSILSSYQPFSGSSLRIHSLSLDEPDKSEVLRW  1943
             F +   HF     HPLDPLT +E    ++++ +  P S +++  H + LD+P+K  +L+W
Sbjct  24    FSVTPLHF----QHPLDPLTKEEFLTVQTLVHNKYPTSKNTVSFHYIGLDDPEKDAILKW  79

Query  1942  KRGNP----LPTRKAFVVALSNGQAHLLVVDLGSGRVSSHTRNPASGYPPMSADDASTAL  1775
             +   P    +P RKAF++A+ NGQ H +++DL   R+        +G+P ++ D+ + A+
Sbjct  80    ETLKPSVITIP-RKAFIIAIINGQNHEILIDLRLKRIVYDNVYKGNGFPTLTVDEQAIAI  138

Query  1774  EATFSNSVFREAISTRGVEINDVVCSAAAPGWFGPEEEGRRITKVKCYTAQNTPNYYMRP  1595
             E       F  ++  RG+ +++VVCS+   GWFG E+E RR  +V C+  ++T N Y+RP
Sbjct  139   ELPKKYPPFIASVQKRGLNLSEVVCSSFTMGWFG-EKENRRTVRVDCFMKESTVNIYVRP  197

Query  1594  IEGLLLTVDLDSGKVINVYDTHSPIPIPKAQGTDYRRDGIEHRAPGVEPLK-PISMEQPN  1418
             I G+ +  DL   K++  +D      +P A+ TDYR   +  ++P   P +  ++  QP 
Sbjct  198   ITGITMVADLSLMKIVEYHDRDVE-AVPTAENTDYR---VSKQSPPFGPKQHSLASYQPQ  253

Query  1417  GQSFRVEDGYIVKWASWEFHVKADQRAGIIISQATVFDPEAGKRRSVMYKGFASELFVPY  1238
             G  F++ +G+ V WA+W+FH+  D RAGI+IS A+++D E  K R V+YKG+ SELFVPY
Sbjct  254   GPGFQI-NGHSVSWANWKFHIGFDVRAGIVISLASIYDLEKHKSRRVLYKGYISELFVPY  312

Query  1237  MDVDEGWYFRAFMDAGEFGLGATAMELVPLNDCPRHSHYIDGLFVDPDGRPVSQPNVICV  1058
              D  E +YF+ F D+GEFG G + + L+P  DCP H+ +ID      DG P    N ICV
Sbjct  313   QDPTEEFYFKTFFDSGEFGFGLSTVSLIPNRDCPPHAQFIDTYIHSADGTPSLLKNAICV  372

Query  1057  FERYSGDIAWRHSGTGDADDDLIREARPKVSLVVRTTATVGNYDYIFDWEFQTDGSIRVT  878
             FE+Y G+I WRH+ TG   ++ + E+R +V+L+VRT  TVGNYD + DWEF+  GSI+  
Sbjct  373   FEQY-GNIMWRHTETG-IPNEFVEESRTEVNLIVRTVVTVGNYDNVLDWEFKASGSIKPA  430

Query  877   VGLSGIILAKGSPYEHINQFEIPRWDFPAGSLVSENTIGVAHDHFITFHLDMDVDGPTNS  698
             + LSGI+  KG+  +H ++ +    +   G LVS N+IG+ HDHF  ++LD D+DG  NS
Sbjct  431   IALSGILEIKGTNIKHKDEIK----EDLHGKLVSANSIGIYHDHFYMYYLDFDIDGVQNS  486

Query  697   FVKVDLVKNYNIAGKIQRKSYWSPKRKVAKSENDAKIKLQLDKPSEFHVINPRHQSRLGN  518
             F K  L       G  +RKSYW+ + ++AK+E+DAKI L L  P E  ++NP  ++ +GN
Sbjct  487   FEKTSLKTVKITDGSSKRKSYWTTETQIAKTESDAKITLGL-APGELAIVNPNKKTIVGN  545

Query  517   PSGYKIVPSATAASLLDLQDPPQLRAAFTNNQIWVTPYNRSEQWAGGLFTYQSHGDDTLA  338
               GY+++P+  A  LL   D PQ+R AFTN  +WVTPYNR+E+WAGGL+   S G+DTLA
Sbjct  546   DVGYRLIPAIPAHPLLTEDDYPQIRGAFTNYNVWVTPYNRTEKWAGGLYVDHSRGEDTLA  605

Query  337   VWSNRNRVIEKQDIVLWYTLGFHHLPCQEDFPVMPTVTSTFQLKPVNFFDRNPIIQA  167
             VW+ +NR I  +DIV+W+ +G HH+P QEDFP+MP ++++F+L+P NFF+RNP+++ 
Sbjct  606   VWTKKNRDIVNKDIVMWHVVGIHHVPAQEDFPIMPLLSTSFELRPTNFFERNPVLKT  662



>ref|XP_002516781.1| Amine oxidase [copper-containing] precursor, putative [Ricinus 
communis]
 gb|EEF45395.1| Amine oxidase [copper-containing] precursor, putative [Ricinus 
communis]
Length=648

 Score =   562 bits (1449),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 284/652 (44%), Positives = 407/652 (62%), Gaps = 25/652 (4%)
 Frame = -1

Query  2101  FADRPMHPLDPLTIQEIERTRSILSSYQPFSGSSLRIHSLSLDEPDKSEVLRW----KRG  1934
             F     HPLDPL   EI +   ++      + S+L  H L + EPDK++VL+W       
Sbjct  16    FVASLYHPLDPLNPDEINQVCLVVQKSSLGNLSNLTFHFLDIQEPDKADVLKWLSSPNLN  75

Query  1933  NPLPTRKAFVVALSNGQAHLLVVDLGSGRVSSHTRNPASGYPPMSADDASTALEATFSNS  1754
               +P R+A VV  + G+ + L+VDL +G + S+  +   GYPP++  +   A +      
Sbjct  76    KSVPPRQAKVVVRAGGETYELIVDLATGSIISNHVHTGHGYPPLTFIELFQASKLPLKYP  135

Query  1753  VFREAISTRGVEINDVVCSAAAPGWFGPEEEGRRITKVKCYTAQNTPNYYMRPIEGLLLT  1574
              F ++I+ RG+ I++V C     GW+G E   +R  +V C+    + N + RPIEG+ + 
Sbjct  136   KFIKSIARRGLNISEVSCIPFTVGWYG-EHVTKRALRVSCFYRGGSVNVFARPIEGISIL  194

Query  1573  VDLDSGKVINVYDTHSPIPIPKAQGTDYRRDGIEHRAPGVEPLKPISMEQPNGQSFRVED  1394
             VD+DS ++    D     P+PKA+GTD+R  G           KP S+      S    +
Sbjct  195   VDVDSMQITAYLDRFRA-PLPKAEGTDFRLSG-----------KPKSIIYNVSDSGFTIN  242

Query  1393  GYIVKWASWEFHVKADQRAGIIISQATVFDPEAGKRRSVMYKGFASELFVPYMDVDEGWY  1214
             G+ VKWA+W+FH+  D RAGI+IS A++FD +  K RSV+Y+G  SE FVPYMD    WY
Sbjct  243   GHKVKWANWDFHLAFDARAGIVISTASIFDAKVKKYRSVLYRGHISETFVPYMDPTSEWY  302

Query  1213  FRAFMDAGEFGLGATAMELVPLNDCPRHSHYIDGLFVDPDGRPVSQPNVICVFERYSGDI  1034
             FR FMD GEFG G  A+ L PL DCP ++ Y+DG     DG+P    NVIC+FERYSGD+
Sbjct  303   FRTFMDVGEFGFGRAAVTLQPLIDCPANAVYLDGYVAGADGQPQKMSNVICIFERYSGDV  362

Query  1033  AWRHSGTGDADDDLIREARPKVSLVVRTTATVGNYDYIFDWEFQTDGSIRVTVGLSGIIL  854
             A+RH+   +    +I+   P++SL+VR  AT+GNYDYI +WEF+  GSI+V V L+GI+ 
Sbjct  363   AFRHTEI-NVPGIVIQSGEPEISLMVRMIATLGNYDYILNWEFKKSGSIKVGVSLTGILE  421

Query  853   AKGSPYEHINQFEIPRWDFPAGSLVSENTIGVAHDHFITFHLDMDVDGPTNSFVKV--DL  680
              K +PY + +Q     +    G+L++EN + V HDHFIT++LD+D+DG  NSFVK     
Sbjct  422   MKATPYTNSDQITKDVY----GTLITENAVAVNHDHFITYYLDLDIDGNDNSFVKAKQQT  477

Query  679   VKNYNIAGKIQRKSYWSPKRKVAKSENDAKIKLQLDKPSEFHVINPRHQSRLGNPSGYKI  500
              +   I   + RKSYW   R+ AK+E++A+I L L+ P+E  ++NP  ++RLGN  GY++
Sbjct  478   ARVPAINAHLPRKSYWRVVRETAKTEDEARILLGLE-PTELLIMNPNKKTRLGNQVGYRL  536

Query  499   VPSATAASLLDLQDPPQLRAAFTNNQIWVTPYNRSEQWAGGLFTYQSHGDDTLAVWSNRN  320
             +     +SLL   D PQ+R A+   Q+WVT YN+SE+WAGG +  +SHGDD LA+WS RN
Sbjct  537   ITGQPVSSLLSYDDYPQIRTAYLKYQMWVTAYNKSERWAGGFYADRSHGDDGLALWSCRN  596

Query  319   RVIEKQDIVLWYTLGFHHLPCQEDFPVMPTVTSTFQLKPVNFFDRNPIIQAN  164
             RVIE +DIVLWYT+GFHH PCQEDFPVM T+   F+L+P NFF+ NP+++ +
Sbjct  597   RVIENRDIVLWYTVGFHHSPCQEDFPVMSTLHDGFELRPTNFFESNPLLKQD  648



>gb|EEE67447.1| hypothetical protein OsJ_24815 [Oryza sativa Japonica Group]
Length=703

 Score =   563 bits (1451),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 299/665 (45%), Positives = 416/665 (63%), Gaps = 34/665 (5%)
 Frame = -1

Query  2083  HPLDPLTIQEIERTRSILSSYQPFSGSSLRIHSLSLDEPDKSEVLRWKRG-------NPL  1925
             HPLDPL+  E+   R+ + +        L  H + LDEPDK +VL +  G       + L
Sbjct  29    HPLDPLSAAELTAVRAAVLASPLVPARPLTFHYVGLDEPDKPDVLSYAYGGGGGASRHAL  88

Query  1924  PTRKAFVVALSNGQAHLLVVDLG---SGRVSSHTRNPASGYPPMSADDASTALEATFSNS  1754
             P R+AFV+A + G++H L VD+    S  V SH  +  +G+P ++ ++   A+     + 
Sbjct  89    P-RRAFVIARAGGESHELRVDVANASSPSVLSHAVHRGAGFPTLTLEEQFAAVALPPKHP  147

Query  1753  VFREAISTRGVEINDVVCSAAAPGWFGPEEEGRR--ITKVKCYTAQNTPNYYMRPIEGLL  1580
              F E++  RGV+++DV+C+    GWFG + E RR  + KV C+ A  T N+Y RP+EG+ 
Sbjct  148   PFVESVRRRGVDMDDVLCAVFPVGWFGGDGEPRRSRVAKVLCFVAGATANFYARPLEGVT  207

Query  1579  LTVDLDSGKVINVYDTHSPIPIPKAQGTDYRRDGIEHRAPGVEPLKPISMEQPNGQSFRV  1400
             L VDLD   ++  Y      P+PKA+GTDYR  G            P  + QP G+ F +
Sbjct  208   LVVDLDRMAIVG-YRDRVAYPVPKAEGTDYRA-GKAGPPYAGPAPAPGVVVQPEGRGFHI  265

Query  1399  EDGYIVKWASWEFHVKADQRAGIIISQATVFDPEAG-----KRRSVMYKGFASELFVPYM  1235
              DG++V+WA+WEFHV  D RAG +IS A+V D +A      +RR V+Y+GF SE+FVPYM
Sbjct  266   -DGHVVRWANWEFHVGFDMRAGTVISLASVHDADADAGGARRRRQVLYRGFVSEIFVPYM  324

Query  1234  DVDEGWYFRAFMDAGEFGLGATAMELVPLNDCPRHSHYIDGLFVDPDGRPVSQPNVICVF  1055
             D  E WY+R F+DAGE+GLG  A  L P  DCP ++ Y+DG +   DGRPV   N+ICVF
Sbjct  325   DPVEEWYYRTFLDAGEYGLGLWAFPLQPGGDCPANAAYLDGHYSGQDGRPVEARNMICVF  384

Query  1054  ERYSGDIAWRHSGTGDADDDLIREARPKVSLVVRTTATVGNYDYIFDWEFQTDGSIRVTV  875
             ERYSGD+AWRH+  G   + LI E RP VSLV R   + GNYDYI DWEF+T GSI++ V
Sbjct  385   ERYSGDVAWRHTEAG-FPNQLITEVRPDVSLVARMVVSAGNYDYILDWEFKTSGSIKLVV  443

Query  874   GLSGIILAKGSPYEHINQFEIPRWDFPAGSLVSENTIGVAHDHFITFHLDMDVDGPTNSF  695
              L+G++  K + Y H ++          G+LV+ENTI V HDH++T+HLD+D DG   SF
Sbjct  444   SLTGLLEVKATAYAHADEVA----QDAHGTLVAENTIAVYHDHYVTYHLDLDFDGTNKSF  499

Query  694   VKVDLVK------NYNIAGKIQRKSYWSPKRKVAKSENDAKIKLQLDKPSEFHVINPRHQ  533
             VK D+V       + + A    R+SYW+ +R+VA+ E D ++ L    P++   +NP  +
Sbjct  500   VK-DIVTAVVRDADADAAADTPRRSYWTVRREVAEREADGQVDLGGGAPADLVFVNPGKK  558

Query  532   SRLGNPSGYKIVPS-ATAASLLDLQDPPQLRAAFTNNQIWVTPYNRSEQWAGGLFTYQSH  356
             +R+GN  GY++VP  A AAS+L   D PQ RAA+   Q+ VTPY+RSE+WA GL+  QS 
Sbjct  559   TRMGNEVGYRVVPGGAMAASVLADDDFPQRRAAYCKKQVRVTPYSRSEKWASGLYADQST  618

Query  355   GDDTLAVWSNRNRVIEKQDIVLWYTLGFHHLPCQEDFPVMPTVTSTFQLKPVNFFDRNPI  176
             G D LA WS R+R I  +DIVLWYT+G HH+P QEDFPVMPT++   +L+P NFF+RNP+
Sbjct  619   GGDGLAAWSERDRAIRGEDIVLWYTVGLHHVPYQEDFPVMPTLSGGLELRPSNFFERNPL  678

Query  175   IQANP  161
             +   P
Sbjct  679   LTTMP  683



>ref|XP_007153494.1| hypothetical protein PHAVU_003G040500g [Phaseolus vulgaris]
 gb|ESW25488.1| hypothetical protein PHAVU_003G040500g [Phaseolus vulgaris]
Length=642

 Score =   561 bits (1445),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 280/653 (43%), Positives = 406/653 (62%), Gaps = 47/653 (7%)
 Frame = -1

Query  2083  HPLDPLTIQEIERTRSILSSYQPFSGSSLRIHSLSLDEPDKSEVLRWKRGNPLPTRKAFV  1904
             HPLDPLT QEI   ++I+ S  P   +++  H + LD+PDK+ VL+W       +R AFV
Sbjct  33    HPLDPLTKQEITLIQTIILSKYPTKTNTVNFHYVGLDDPDKATVLKWLSTAARTSRNAFV  92

Query  1903  VALSNGQAHLLVVDLGSGRVSSHTRNPASGYPPMSADDASTALEATFSNSVFREAISTRG  1724
             +A+ N Q H L ++L + +V S   +  +G+P ++ ++ S AL+  F +  F E+I  RG
Sbjct  93    IAIVNSQVHELTINLRTSQVVSDNIHRGNGFPTLTVEEQSEALQLPFKHGPFVESIEKRG  152

Query  1723  VEINDVVCSAAAPGWFGPEEEGRRITKVKCYTAQNTPNYYMRPIEGLLLTVDLDSGKVIN  1544
             V +++VVCS  + GW+G E + +R+ +++C+  + T N Y+RPI G+ +  DL+  K++ 
Sbjct  153   VNLSEVVCSGFSVGWYG-ETQSKRVLRIECFLKEGTVNIYVRPINGITIVADLEQMKIVE  211

Query  1543  VYDTHSPIPIPKAQGTDYRRDGIEHRAPGVEP-LKPISMEQPNGQSFRVEDGYIVKWASW  1367
              +D H  +P+PK + T+YR     H  P   P L   +  QP G  F ++ G+ V WA+W
Sbjct  212   YHD-HFVVPVPKVENTEYRAS---HLQPPFGPKLHSFASHQPQGPGFSIK-GHSVSWANW  266

Query  1366  EFHVKADQRAGIIISQATVFDPEAGKRRSVMYKGFASELFVPYMDVDEGWYFRAFMDAGE  1187
             +FH+  D RAG+IIS A+++DPE  K RSV+Y+G+ SELFVPY D  E WY++ F DAGE
Sbjct  267   KFHIGYDVRAGVIISTASIYDPEVHKSRSVLYRGYISELFVPYQDPSEDWYYKTFFDAGE  326

Query  1186  FGLGATAMELVPLNDCPRHSHYIDGLFVDPDGRPVSQPNVICVFERYSGDIAWRHSGTGD  1007
             FG G + + L PL+DCP  + ++D                + V                 
Sbjct  327   FGFGQSMVSLEPLHDCPPQAQFLD----------------VTV-----------------  353

Query  1006  ADDDLIREARPKVSLVVRTTATVGNYDYIFDWEFQTDGSIRVTVGLSGIILAKGSPYEHI  827
             A+ DLIRE R  V+L+VR+  TVGNYD + DWEF+T GSI+  + LSG++  K     H 
Sbjct  354   AECDLIREVRSDVTLIVRSVVTVGNYDNVLDWEFKTSGSIKPAISLSGMLEVKAVNITHN  413

Query  826   NQFEIPRWDFPAGSLVSENTIGVAHDHFITFHLDMDVDGPTNSFVKVDLVKNYNIAGKIQ  647
             ++ +    +   G LVSE++IGV HDHF  +HLD D+DG  NSF K  L          +
Sbjct  414   DEIK----EEQHGILVSEHSIGVYHDHFYIYHLDFDIDGVDNSFEKTSLKSVQVSDNSSK  469

Query  646   RKSYWSPKRKVAKSENDAKIKLQLDKPSEFHVINPRHQSRLGNPSGYKIVPSATAASLLD  467
             RKSYW+   ++ KSE+DAKIKL    P+E  ++NP  ++  GN  GY++VP+A A  LL 
Sbjct  470   RKSYWTTSSEILKSESDAKIKLGFS-PAELVLVNPNKKTSTGNNVGYRLVPNAAAHPLLT  528

Query  466   LQDPPQLRAAFTNNQIWVTPYNRSEQWAGGLFTYQSHGDDTLAVWSNRNRVIEKQDIVLW  287
               D PQ R AFTN  +WVTPYN++E+WAGGL+  QS GDDTLAVW+ +NR IE +DIVLW
Sbjct  529   EDDYPQKRGAFTNYNVWVTPYNKTEKWAGGLYVDQSRGDDTLAVWTQQNRGIENKDIVLW  588

Query  286   YTLGFHHLPCQEDFPVMPTVTSTFQLKPVNFFDRNPIIQA-NPNFAEDLPICR  131
             Y +G HH+PCQEDFP+MP +++ F+L+P NFF+RNP+++  +P F E  P C 
Sbjct  589   YVVGIHHVPCQEDFPIMPLLSTGFELRPTNFFERNPVLKTLSPGFVE-WPGCE  640



>ref|XP_010666931.1| PREDICTED: primary amine oxidase [Beta vulgaris subsp. vulgaris]
Length=651

 Score =   560 bits (1444),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 285/641 (44%), Positives = 397/641 (62%), Gaps = 22/641 (3%)
 Frame = -1

Query  2083  HPLDPLTIQEIERTRSILSSYQPFSGSSLRIHSLSLDEPDKSEVLRW----KRGNPLPTR  1916
             HPLDPL+ +EI + R+I+ +    + S+L  H L ++EP+K +VL W    +R     +R
Sbjct  26    HPLDPLSPKEINKIRTIIQNSHLKTLSNLTYHFLDVEEPNKDDVLHWLSSSERKENRFSR  85

Query  1915  KAFVVALSNGQAHLLVVDLGSGRVSSHTRNPASGYPPMSADDASTALEATFSNSVFREAI  1736
             +A VV +   Q H L+VDL  G + S+  +   GYP ++ ++   A   +  +  F  +I
Sbjct  86    RAKVVVIGGRQTHELIVDLSKGLIESNHVHNGHGYPSLTFEELLQASLLSQKDPKFLNSI  145

Query  1735  STRGVEINDVVCSAAAPGWFGPEEEGRRITKVKCYTAQNTPNYYMRPIEGLLLTVDLDSG  1556
             + R + I+ V C     GWFG E   RR  K+ C+    T N Y RPI G+ +  DL+S 
Sbjct  146   TRRNLNISQVSCLPLTKGWFG-EVMSRREVKITCFYRNGTTNIYARPINGITIVFDLESM  204

Query  1555  KVINVYDTHSPIPIPKAQGTDYRRDGIEHRAPGVEPLKPISMEQPNGQSFRVEDGYIVKW  1376
             KV    D +   P+P A+GT++    +E   PG  P  P          F ++ G +++W
Sbjct  205   KVTKYMDRYRA-PLPTAEGTEFHARRLE---PG--PTYP----NTTNSKFSIQ-GNVIRW  253

Query  1375  ASWEFHVKADQRAGIIISQATVFDPEAGKRRSVMYKGFASELFVPYMDVDEGWYFRAFMD  1196
               W+FHV  + RAG+IIS A+++D +  + R V+Y+G  SE FVPYMD  E WY+R FMD
Sbjct  254   GDWKFHVAFNSRAGMIISTASIYDSKEKRYRRVLYRGHVSETFVPYMDPTEDWYYRTFMD  313

Query  1195  AGEFGLGATAMELVPLNDCPRHSHYIDGLFVDPDGRPVSQPNVICVFERYSGDIAWRHSG  1016
              GEFG G  A  L P  DCP ++ +IDG  +D  G P   P  IC+FERYSGD+AWRH+ 
Sbjct  314   VGEFGFGKAADSLQPFIDCPGNAKFIDGYLIDALGMPNKLPRAICLFERYSGDVAWRHTE  373

Query  1015  TGDADDDLIREARPKVSLVVRTTATVGNYDYIFDWEFQTDGSIRVTVGLSGIILAKGSPY  836
              G     +IR   P+V+LV R  ATVGNYDYI DWEF+  GSI V VGL+G++  K + Y
Sbjct  374   IG-VPGKVIRNGEPEVTLVARMIATVGNYDYILDWEFRQTGSITVGVGLTGVLEMKATSY  432

Query  835   EHINQFEIPRWDFPAGSLVSENTIGVAHDHFITFHLDMDVDGPTNSFVKVDLVKNYNIAG  656
                +Q     +    G+LV+ NTI V HDHF+T++LD+DV+G  NSFV+  L        
Sbjct  433   TSTDQITEDVY----GTLVAPNTIAVHHDHFVTYYLDLDVNGSENSFVRSSLQTERVRGF  488

Query  655   KIQRKSYWSPKRKVAKSENDAKIKLQLDKPSEFHVINPRHQSRLGNPSGYKIVPSATAAS  476
                RKSYWS K+KV K E DAKI+L   +P+E  ++NP  ++ +GNP GY+++    A S
Sbjct  489   PSPRKSYWSIKKKVLKREADAKIRLG-SEPAELIMVNPNKKTNVGNPVGYRLITGQPAYS  547

Query  475   LLDLQDPPQLRAAFTNNQIWVTPYNRSEQWAGGLFTYQSHGDDTLAVWSNRNRVIEKQDI  296
             LL   D PQ+R A+T  Q+WVTPYN+SE+WAGG +  QSHG D LAVW+ RNR IE +DI
Sbjct  548   LLADDDYPQMRNAYTKYQVWVTPYNKSERWAGGYYADQSHGLDGLAVWTRRNRRIENEDI  607

Query  295   VLWYTLGFHHLPCQEDFPVMPTVTSTFQLKPVNFFDRNPII  173
             VLWYT+GFHH+PCQEDFP+M T+ S+F+L+P NFFD++ I+
Sbjct  608   VLWYTMGFHHVPCQEDFPIMATLQSSFELRPTNFFDKSTIL  648



>ref|XP_006659924.1| PREDICTED: primary amine oxidase-like [Oryza brachyantha]
Length=695

 Score =   561 bits (1447),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 298/667 (45%), Positives = 411/667 (62%), Gaps = 34/667 (5%)
 Frame = -1

Query  2083  HPLDPLTIQEI-ERTRSILSSYQPF---SGSSLRIHSLSLDEPDKSEVL----RWKRGNP  1928
             HPLDPL+  E+   T ++L+S  P     G  +  H + LDEPDK +V+    R      
Sbjct  24    HPLDPLSPLELTAATSAVLAS--PLLHGHGRPVSFHYVGLDEPDKPDVVSRRHRAAAHAL  81

Query  1927  LPTRKAFVVALSNGQAHLL---VVDLGSGRVSSHTRNPASGYPPMSADDASTALEATFSN  1757
             L  R+AFV+A + G +H L   V D  +  V SH  +   G+P  + ++   A       
Sbjct  82    LLPRRAFVIARAGGASHELRVDVTDTAAPSVVSHGVHRGPGFPMFTTEEQVAASAVAGRY  141

Query  1756  SVFREAISTRGVEINDVVCSAAAPGWFGPEEEG-----RRITKVKCYTAQN--TPNYYMR  1598
                 E++  RG+ + DV C   + GWFG   +G      R+ K++C+      T N+Y R
Sbjct  142   PPLAESVRRRGLAMGDVGCGVFSMGWFGDSGDGDGEAATRLAKMQCFVTGGGATANFYAR  201

Query  1597  PIEGLLLTVDLDSGKVINVYDTHSPIPIPKAQGTDYRRDGIEHRAPGVEPLKPISMEQPN  1418
             P+EG+ + VDL+   ++   D  +   +PKA GTDYR         G  P   + + QP 
Sbjct  202   PLEGVTMVVDLERMAIVGFRD-RAVYAVPKADGTDYRAGKAGPPFNGAVPAAGVVV-QPE  259

Query  1417  GQSFRVEDGYIVKWASWEFHVKADQRAGIIISQATVFDPEAGKRRSVMYKGFASELFVPY  1238
             G+ F + DG++V+WA+WEFHV  D RAG +IS A+V D +AG  R V+ +GF SE+FVPY
Sbjct  260   GKGFHI-DGHVVRWANWEFHVGFDMRAGTVISAASVRDADAGAWRRVLSRGFVSEVFVPY  318

Query  1237  MDVDEGWYFRAFMDAGEFGLGATAMELVPLNDCP-RHSHYIDGLFVDPDGRPVSQPNVIC  1061
             MD +E WYF  FMDAGE+GLG +A+ L P  DCP   + Y+D  +   DG PV   N IC
Sbjct  319   MDPEEEWYFHTFMDAGEYGLGVSAVPLQPGADCPPSGAGYMDAYYASADGSPVRSGNAIC  378

Query  1060  VFERYSGDIAWRHSGTGDADDDLIREARPKVSLVVRTTATVGNYDYIFDWEFQTDGSIRV  881
             VFERY+GD+AWRH+     D   + E RP V+LVVR  ATVGNYDY FDWEF+T GSI+ 
Sbjct  379   VFERYAGDVAWRHTEVAGPDAP-VTEVRPDVTLVVRMVATVGNYDYTFDWEFKTSGSIKT  437

Query  880   TVGLSGIILAKGSPYEHINQFEIPRWDFPAGSLVSENTIGVAHDHFITFHLDMDVDGPTN  701
              V LSGI+  K + Y H++Q  I   D   G+LV+ENT+GV HDHF+T+HLD+D+DG  N
Sbjct  438   VVSLSGILEMKATNYTHVSQ--IRSADDAHGTLVAENTVGVYHDHFVTYHLDLDIDGTNN  495

Query  700   SFVKVDLVKNYNIA------GKIQRKSYWSPKRKVAKSENDAKIKLQLDKPSEFHVINPR  539
             SFVK  +V   N            R+SYW+  R+VA++E   ++ +    P+E   +NP 
Sbjct  496   SFVKNTIVPRRNSGVPATGGAPTPRRSYWTVLREVAETEAQGQVDVVNGAPAELLFVNPS  555

Query  538   HQSRLGNPSGYKIVPS-ATAASLLDLQDPPQLRAAFTNNQIWVTPYNRSEQWAGGLFTYQ  362
              ++++GN  GY++ P  ATAASLL   D PQ RA +T  Q+WVTPYN+SE+WA GL+  +
Sbjct  556   KKTKIGNEVGYRLDPGGATAASLLADDDYPQRRAGYTKKQVWVTPYNKSEKWASGLYADR  615

Query  361   SHGDDTLAVWSNRNRVIEKQDIVLWYTLGFHHLPCQEDFPVMPTVTSTFQLKPVNFFDRN  182
             S GDD LA WS RNR I+ +DIV+WYT+G HH+P QEDFPVMPT+++ F+L+P NFF+RN
Sbjct  616   STGDDNLAAWSKRNRRIKDEDIVVWYTVGLHHIPYQEDFPVMPTLSAAFELRPANFFERN  675

Query  181   PIIQANP  161
             P+I+A P
Sbjct  676   PLIRAAP  682



>gb|KEH32230.1| copper amine oxidase, enzyme domain protein [Medicago truncatula]
Length=668

 Score =   560 bits (1442),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 275/643 (43%), Positives = 413/643 (64%), Gaps = 18/643 (3%)
 Frame = -1

Query  2083  HPLDPLTIQEIERTRSILSSYQPFSGSSLRIHSLSLDEPDKSEVLRWKRGNPLPT---RK  1913
             HPLDPLT +E    ++++ +  P S + +  H + LD+P K  +  ++R + +P    RK
Sbjct  27    HPLDPLTNEEFLTVQTLVHNKYPTSKNKVAFHYIGLDDPAKDYIAIYER-SLIPVVIRRK  85

Query  1912  AFVVALSNGQAHLLVVDLGSGRVSSHTRNPASGYPPMSADDASTALEATFSNSVFREAIS  1733
             +FV+A+ NGQ+H +V+D+    + S   +   G+P +S ++   A+E       F  ++ 
Sbjct  86    SFVLAIINGQSHEIVIDIRLKTIDSDNVHKGYGFPILSVEEQGVAIELPLKYPAFIASVK  145

Query  1732  TRGVEINDVVCSAAAPGWFGPEEEGRRITKVKCYTAQNTPNYYMRPIEGLLLTVDLDSGK  1553
              RG+ +++VVCS  + GWFG EEE +R  +V C+  +N+ N Y+RPI GL + VDL   K
Sbjct  146   KRGLNLSEVVCSTFSMGWFG-EEESKRTVRVDCFMKENSVNIYVRPISGLTIVVDLGLQK  204

Query  1552  VINVYDTHSPIPIPKAQGTDYRRDGIEHRAPGVEPLK-PISMEQPNGQSFRVEDGYIVKW  1376
             ++  +D      +P A+ T+Y+   +  ++P   P +  ++  QP G  F+++ G+ V W
Sbjct  205   IVEYHDREIET-VPTAENTEYQ---VSKQSPPFGPNQHSLTSHQPQGPGFQIK-GHSVSW  259

Query  1375  ASWEFHVKADQRAGIIISQATVFDPEAGKRRSVMYKGFASELFVPYMDVDEGWYFRAFMD  1196
             A+W+FH+  D RAGI+IS A+++D E    R V+YKG+ SELFVPY D  E +YF+ F D
Sbjct  260   ANWKFHIGFDVRAGIVISLASIYDLEKHIYRRVLYKGYISELFVPYQDPTEEFYFKTFFD  319

Query  1195  AGEFGLGATAMELVPLNDCPRHSHYIDGLFVDPDGRPVSQPNVICVFERYSGDIAWRHSG  1016
             +GEFG G + + L+P  DCP H+ +ID      DG P    N ICVFE+Y   I WRH+ 
Sbjct  320   SGEFGFGLSTVSLIPNRDCPPHAQFIDTYIHSDDGTPSILKNAICVFEQYDS-IMWRHTE  378

Query  1015  TGDADDDLIREARPKVSLVVRTTATVGNYDYIFDWEFQTDGSIRVTVGLSGIILAKGSPY  836
             TG   D+ I E+R +V+L+VRT  TVGNYD + DWEF+T GSI+ ++ LSGI+  KG+  
Sbjct  379   TG-IPDEFIEESRTEVNLIVRTVVTVGNYDNVLDWEFKTSGSIKPSIALSGILEIKGTNI  437

Query  835   EHINQFEIPRWDFPAGSLVSENTIGVAHDHFITFHLDMDVDGPTNSFVKVDLVKNYNIAG  656
             +H N+ +   +    G LVS N+IGV HDHF  ++LD D+DGP NSF K  L       G
Sbjct  438   KHTNEIKGELY----GKLVSANSIGVYHDHFYMYYLDFDIDGPENSFEKTSLKTVRITDG  493

Query  655   KIQRKSYWSPKRKVAKSENDAKIKLQLDKPSEFHVINPRHQSRLGNPSGYKIVPSATAAS  476
               +RKSYW+ + + AK+E+DAKI +    P+E  VINP  ++ +GN  GY+++P+  A  
Sbjct  494   SSKRKSYWTTETQTAKTESDAKITIG-PTPAELVVINPNKKTAIGNHIGYRLIPAIPAHP  552

Query  475   LLDLQDPPQLRAAFTNNQIWVTPYNRSEQWAGGLFTYQSHGDDTLAVWSNRNRVIEKQDI  296
             LL   D PQ+R AFTN  +W+TPYNR+E+WAGGL+   S GDDTLAVW+ +NR I  +DI
Sbjct  553   LLTEDDYPQIRGAFTNYNVWITPYNRTEKWAGGLYVDHSRGDDTLAVWTKQNRNIVNKDI  612

Query  295   VLWYTLGFHHLPCQEDFPVMPTVTSTFQLKPVNFFDRNPIIQA  167
             V+W+ +G HH+P QEDFP+MP ++++F+L+P NFF+RNP+++ 
Sbjct  613   VMWHVVGIHHVPAQEDFPIMPLLSTSFELRPTNFFERNPVLKT  655



>ref|XP_002516779.1| Amine oxidase [copper-containing] precursor, putative [Ricinus 
communis]
 gb|EEF45393.1| Amine oxidase [copper-containing] precursor, putative [Ricinus 
communis]
Length=639

 Score =   558 bits (1438),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 278/623 (45%), Positives = 398/623 (64%), Gaps = 15/623 (2%)
 Frame = -1

Query  2017  PFSGSSLR--IHSLSLDEPDKSEVLRW--KRGNPLPTRKAFVVALSNGQAHLLVVDLGSG  1850
             P S S+ +  +  L LDEP+K+ +L W  K     P R+A V+   N Q+H  +VDL + 
Sbjct  22    PISSSTTQHPLDPLRLDEPNKAHILSWLSKPQTEPPPRRALVITRYNKQSHEFIVDLSTS  81

Query  1849  RVSSHTRNPASGYPPMSADDASTALEATFSNSVFREAISTRGVEINDVVCSAAAPGWFGP  1670
              +         GYP ++AD+   A +   +   F E++ +RG+ ++ VVC++   GWFG 
Sbjct  82    SIVGTQVYNDYGYPTLAADEQVAANKLPLTYGPFIESVKSRGLNLSAVVCASFTVGWFG-  140

Query  1669  EEEGRRITKVKCYTAQNTPNYYMRPIEGLLLTVDLDSGKVINVYDTHSPIPIPKAQGTDY  1490
             ++  RR+ KV+C+   +T N ++ PIE + + VDLD  K+I  Y+ +  IP+PKA+GTDY
Sbjct  141   KDRNRRVVKVQCFHMNDTVNLFLLPIEEIKMIVDLDEMKIIE-YNDNERIPVPKAEGTDY  199

Query  1489  RRDGIEHRAPGVEPLKPISMEQPNGQSFRVEDGYIVKWASWEFHVKADQRAGIIISQATV  1310
             R    + + P    +   ++ QP+G  F++ DG+ +KW +W FH+  D R G++IS A++
Sbjct  200   RLS--KQKPPFGPRINRAAILQPDGPGFKI-DGHTIKWLNWVFHLAFDARVGLVISLASI  256

Query  1309  FDPEAGKRRSVMYKGFASELFVPYMDVDEGWYFRAFMDAGEFGLGATAMELVPLNDCPRH  1130
              D E  K RSV+Y+G  SELFVPY D  + +YF+ F D GE+G G  A  LVPL DCP +
Sbjct  257   CDQEKHKHRSVLYRGHISELFVPYQDPTQDYYFKTFFDCGEYGFGFLAASLVPLADCPNN  316

Query  1129  SHYIDGLFVDPDGRPVSQPNVICVFERYSGDIAWRHSGTGDADDDLIREARPKVSLVVRT  950
             + ++DG     DG PV  P V C+FER++GDI WRH+      D+ I EARP+VSLVVR 
Sbjct  317   AVFMDGYHAGQDGTPVQVPKVFCIFERHAGDIMWRHTELA-IPDETITEARPEVSLVVRM  375

Query  949   TATVGNYDYIFDWEFQTDGSIRVTVGLSGIILAKGSPYEHINQFEIPRWDFPAGSLVSEN  770
              AT+GNYD+I DWEF+  GSI V VGLSGI+  K S Y +  + +   +    G+L++ N
Sbjct  376   VATIGNYDHILDWEFKPSGSINVQVGLSGILEVKSSTYTYSEEIDEEVY----GTLLANN  431

Query  769   TIGVAHDHFITFHLDMDVDGPTNSFVKVDLVKNYNIAGKIQRKSYWSPKRKVAKSENDAK  590
             TIG+ HDHF+T+ LD+D+DG  NS VK  LV          RKSYW+   + AK+E+DAK
Sbjct  432   TIGLYHDHFLTYRLDLDIDGVDNSLVKQKLVTKTVTNKTTPRKSYWTVVSETAKTESDAK  491

Query  589   IKLQLDKPSEFHVINPRHQSRLGNPSGYKIVPSATAASLLDLQDPPQLRAAFTNNQIWVT  410
             IKL    P+E  V+NP  +++ GN  GY+++P   A  LL   D PQ+R AFT   +W+T
Sbjct  492   IKLG-QAPAELVVVNPNKKTKPGNIHGYRLIPGPVAQPLLLEDDYPQIRGAFTKYNVWIT  550

Query  409   PYNRSEQWAGGLFTYQSHGDDTLAVWSNRNRVIEKQDIVLWYTLGFHHLPCQEDFPVMPT  230
             PYN+SE WAGG +  QSHG DTL VW+ RNR I+ +DIVLW+ +G HH+PCQEDFP+MPT
Sbjct  551   PYNKSEIWAGGRYVDQSHGQDTLDVWTLRNRKIDNKDIVLWHVIGIHHVPCQEDFPLMPT  610

Query  229   VTSTFQLKPVNFFDRNPIIQANP  161
             ++S F+L+P NFF+ NP+++  P
Sbjct  611   LSSGFELRPTNFFEFNPVLKVIP  633



>gb|KGN48007.1| hypothetical protein Csa_6G423980 [Cucumis sativus]
Length=660

 Score =   558 bits (1438),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 281/645 (44%), Positives = 413/645 (64%), Gaps = 21/645 (3%)
 Frame = -1

Query  2083  HPLDPLTIQEIERTRSILSSYQPFSGSSLRIHSLSLDEPDKSEVLRW---KRGNPLPTRK  1913
             HP DPL+  EI+   S + S        L  H + +++P+K +VL W    R  PLP R+
Sbjct  26    HPFDPLSSLEIQIVTSTVKSKFTNIAQRLTFHYVGIEDPNKPDVLSWVANPRSPPLP-RQ  84

Query  1912  AFVVALSNGQAHLLVVDLGSGR---VSSHTRNPASGYPPMSADDASTALEATFSNSVFRE  1742
             AFVV  +N Q H  +V L +G+   VS H     +G+P ++  +   A+E +  +  F  
Sbjct  85    AFVVVRANKQTHEFIVSLANGKGSIVSEHVYQ-GTGFPTLTLQEQEEAIEVSLKHQPFIS  143

Query  1741  AISTRGVEINDVVCSAAAPGWFG-PEEEGRRITKVKCYTAQNTPNYYMRPIEGLLLTVDL  1565
             +I  RG+ I+DVV SA + GW+G  + E +RI KV  +  ++T N ++RPIEG+  TVDL
Sbjct  144   SIEKRGLNISDVVGSAFSIGWYGEAQSETKRIVKVLFFYKESTVNVWLRPIEGIETTVDL  203

Query  1564  DSGKVINVYDTHSPIPIPKAQGTDYRRDGIEHRAPGVEPLKPISMEQPNGQSFRVEDGYI  1385
             D   +  + D H  + +PK++GT+Y+   +  R P +   KPI + QP+G SF V  G+ 
Sbjct  204   DDMVLTELKDIHVSV-MPKSEGTEYQASTM--RPPFLAETKPILVNQPHGPSFVVR-GHT  259

Query  1384  VKWASWEFHVKADQRAGIIISQATVFDPEAGKRRSVMYKGFASELFVPYMDVDEGWYFRA  1205
             V WA+W+FH+  D R G++IS A+++D +  K+R V+Y+G  SELFVPY D  E WY+R 
Sbjct  260   VSWANWDFHLSFDMRVGVVISTASIYDIDQQKKRQVLYRGQISELFVPYQDPTEEWYYRT  319

Query  1204  FMDAGEFGLGATAMELVPLNDCPRHSHYIDGLFVDPDGRPVSQPNVICVFERYSGDIAWR  1025
             FMDAGEFG+G++A+ L P +DCP ++ + D      DG PV   N  C+FE+Y+GDIAWR
Sbjct  320   FMDAGEFGMGSSAVALEPHHDCPSNAMFFDAYHAGQDGTPVKLENAYCMFEKYAGDIAWR  379

Query  1024  HSGTGDADDDLIREARPKVSLVVRTTATVGNYDYIFDWEFQTDGSIRVTVGLSGIILAKG  845
             H+       +LIRE R +VSLV+RT   +GNYDYI DWE +  G+I+++V L+GI+  K 
Sbjct  380   HT-EAVIPGELIREVRREVSLVIRTITVIGNYDYILDWELKKCGTIKLSVSLTGIMEGKT  438

Query  844   SPYEHINQFEIPRWDFPAGSLVSENTIGVAHDHFITFHLDMDVDGPTNSFVKVDLVKNYN  665
             + Y+H ++ +   +    G LV+ NTIG+ HDHFIT++LD+D+DG  NSF K+ L K++ 
Sbjct  439   TTYKHESEVKEEIY----GLLVAPNTIGINHDHFITYYLDLDIDGQENSFQKLKL-KSFR  493

Query  664   IAGKIQRKSYWSPKRKVAKSENDAKIKLQLDKPSEFHVINPRHQSRLGNPSGYKIVPSAT  485
               G   RKSYWS   +  K E DA+  L+  +P E H++NP  ++ +GN  GY+++P   
Sbjct  494   TDGSTPRKSYWSVVSEEVKKELDAR--LRPTEPVELHIVNPNKKTAVGNKVGYRLIPGPM  551

Query  484   AASLLDLQDPPQLRAAFTNNQIWVTPYNRSEQWAGGLFTYQSHGDDTLAVWSNRNRVIEK  305
             A  LL   D PQ+R +  +  IWVTPYN+SE+WAGG++  + HGD TL   + +NR I  
Sbjct  552   AIPLLSEDDYPQIRGSLCDYDIWVTPYNKSEKWAGGMYVDRGHGDKTLTQITEQNRDINN  611

Query  304   QDIVLWYTLGFHHLPCQEDFPVMPTVTSTFQLKPVNFFDRNPIIQ  170
             +DIVLW+T+GFHH P Q++FP+MPT+T  F+L+P NFFDRNPI++
Sbjct  612   KDIVLWHTIGFHHHPSQDEFPIMPTLTGGFELRPTNFFDRNPILK  656



>ref|XP_006489372.1| PREDICTED: primary amine oxidase-like [Citrus sinensis]
 gb|KDO74633.1| hypothetical protein CISIN_1g006235mg [Citrus sinensis]
Length=655

 Score =   558 bits (1437),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 288/653 (44%), Positives = 403/653 (62%), Gaps = 25/653 (4%)
 Frame = -1

Query  2098  ADRPMHPLDPLTIQEIERTRSILSSYQPFSGSSLRIHSLSLDEPDKSEVLRW----KRGN  1931
             A+   HPLDPL   EI + + I+   +  +  +L  HS+ L+EPDK  VL W    KRG 
Sbjct  19    ANSLYHPLDPLNPSEINQAKLIVQKSKLGTLPNLTFHSVDLEEPDKVHVLEWLSKQKRGK  78

Query  1930  PLPTRKAFVVALSNGQAHLLVVDLGSGRVSSHTRNPASGYPPMSADDASTALEATFSNSV  1751
                 R+A VV  +  + H L+VDL  G ++SH      GYPP +  +   A +   +   
Sbjct  79    LNLHRQAKVVLRAGAETHELIVDLAIGSITSHNIYKGHGYPPFAFIEFFRASKLPLTYPK  138

Query  1750  FREAISTRGVEINDVVCSAAAPGWFGPEEEGRRITKVKCYTAQNTPNYYMRPIEGLLLTV  1571
             FRE+I  RG+ +++V C     GW+G E    R  KV C+    +PN + RPIEG+ + V
Sbjct  139   FRESIRHRGLNLSEVSCLPFTVGWYG-EHVTNRALKVVCFYRGGSPNIFARPIEGISMLV  197

Query  1570  DLDSGKVINVYDTHSPIPIPKAQGTDYRRDGIEHRAPGVEPLKPISMEQPNGQSFRVEDG  1391
             D+D  ++I  Y     +P+P+A+GTDY        +    P   I      G  F +E G
Sbjct  198   DVDKMQIIK-YTDRLRLPLPRAEGTDYT-------SAKTNPDSVICNVTKGG--FTIE-G  246

Query  1390  YIVKWASWEFHVKADQRAGIIISQATVFDPEAGKRRSVMYKGFASELFVPYMDVDEGWYF  1211
             + VKWA+W+FHV  D RAGI+IS A++FD +  K R V+YKG  SE FVPYMD    WYF
Sbjct  247   HKVKWANWDFHVSFDARAGIVISTASIFDDKINKFRRVLYKGHVSETFVPYMDPTNEWYF  306

Query  1210  RAFMDAGEFGLGATAMELVPLNDCPRHSHYIDGLFVDPDGRPVSQPNVICVFERYSGDIA  1031
             + FMD GEFG G  A  L P+ DCP ++ Y+DG     DG+P     VIC+FER+SG++A
Sbjct  307   KTFMDLGEFGFGRAAGSLQPVIDCPSNAEYLDGYVAGADGQPQQFSRVICIFERFSGNVA  366

Query  1030  WRHSGTGDADDDLIREARPKVSLVVRTTATVGNYDYIFDWEFQTDGSIRVTVGLSGIILA  851
             WRH+   +    +IR   P+VSLVVR   TVGNYDY+ DWEF   G+I++ V L+GI+  
Sbjct  367   WRHTEI-NVPGKVIRSGEPEVSLVVRMVTTVGNYDYVLDWEFDKSGTIKIGVALTGILEM  425

Query  850   KGSPYEHINQFEIPRWDFPAGSLVSENTIGVAHDHFITFHLDMDVDGPTNSFVKVDL--V  677
             K + Y + +Q      +   G+LV+EN + V HDHF+T++LD+DVDG  NSFVK  L   
Sbjct  426   KATSYTNNDQIT----ENVYGTLVAENAVAVNHDHFVTYYLDLDVDGNGNSFVKSKLKTA  481

Query  676   KNYNIAGKIQRKSYWSPKRKVAKSENDAKIKLQLDKPSEFHVINPRHQSRLGNPSGYKIV  497
             +  N+     RKSYW+  ++ AK+E +A+I+L ++ P+E  V+N   +++LGN  GY+++
Sbjct  482   RVSNVRAS-PRKSYWTVVKETAKTEAEARIRLGVE-PAELLVVNANQKTKLGNHVGYRLI  539

Query  496   PSATAASLLDLQDPPQLRAAFTNNQIWVTPYNRSEQWAGGLFTYQSHGDDTLAVWSNRNR  317
                   SLL   D PQ+RA++T  Q+WVT YN+SE+WAGG +T QS GDD LAVWS+RNR
Sbjct  540   TGQPVTSLLSDDDYPQIRASYTKYQVWVTAYNKSERWAGGFYTDQSRGDDGLAVWSSRNR  599

Query  316   VIEKQDIVLWYTLGFHHLPCQEDFPVMPTVTSTFQLKPVNFFDRNPIIQANPN  158
              IE +DIVLWYT+GFHH+P QEDFP+MPT+   F+L+P NFF+ NP++    N
Sbjct  600   EIENKDIVLWYTVGFHHIPYQEDFPLMPTIHGGFELRPSNFFESNPLLLRQEN  652



>ref|XP_009344087.1| PREDICTED: primary amine oxidase [Pyrus x bretschneideri]
Length=646

 Score =   557 bits (1436),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 289/649 (45%), Positives = 393/649 (61%), Gaps = 24/649 (4%)
 Frame = -1

Query  2101  FADRPMHPLDPLTIQEIERTRSILSSYQPFSGSSLRIHSLSLDEPDKSEVLRW----KRG  1934
             F     HPLDPLT  EI + R  +      +  +L  H +  +EP+K+EVL+W     + 
Sbjct  16    FTATSSHPLDPLTPTEINKARLTIQKSHIGNLPNLTFHFVDTEEPEKAEVLKWLSSSNQK  75

Query  1933  NPLPTRKAFVVALSNGQAHLLVVDLGSGRVSSHTRNPASGYPPMSADDASTALEATFSNS  1754
                P R+A VVA + GQ H L+VDL  G V S   +   G PP++  +   A +   S+S
Sbjct  76    RSTPPRQAKVVARAGGQTHELIVDLAIGSVISDHVHTGHGNPPLTFTELFLASKLPLSHS  135

Query  1753  VFREAISTRGVEINDVVCSAAAPGWFGPEEEGRRITKVKCYTAQNTPNYYMRPIEGLLLT  1574
              F  +IS RG+ +++V C   + GW+G EE  +R  K++C+    + N + RPIEG+ + 
Sbjct  136   KFINSISARGLNLSEVSCLPFSIGWYG-EEITKRAVKIQCFYRGGSVNVFTRPIEGITML  194

Query  1573  VDLDSGKVINVYDTHSPIPIPKAQGTDYRRDGIEHRAPGVEPLKPISMEQPNGQSFRVED  1394
             VDLD  K I VY      P+PKAQGTD++       +   +  K           F V  
Sbjct  195   VDLDLMK-ITVYTDRFRAPLPKAQGTDFQTPKENSNSAPCDKTK---------SGFTV-S  243

Query  1393  GYIVKWASWEFHVKADQRAGIIISQATVFDPEAGKRRSVMYKGFASELFVPYMDVDEGWY  1214
             G+ VKW +W FHV  + RAG +IS A+VFD    K RSV+YKG  SE FVPYMD    WY
Sbjct  244   GHEVKWENWVFHVGFNARAGSVISTASVFDSRKKKYRSVLYKGHVSETFVPYMDPTSEWY  303

Query  1213  FRAFMDAGEFGLGATAMELVPLNDCPRHSHYIDGLFVDPDGRPVSQPNVICVFERYSGDI  1034
             FR FMD GEFG G +A  L PL DCP ++ Y+DG     DG+P      IC+FERYSGD+
Sbjct  304   FRTFMDIGEFGFGRSADSLQPLIDCPENAEYVDGFMAGADGKPQKVERAICIFERYSGDV  363

Query  1033  AWRHSGTGDADDDLIREARPKVSLVVRTTATVGNYDYIFDWEFQTDGSIRVTVGLSGIIL  854
             A RH+   +    LI   +   SLVVR  ATVGNYDY+ DWEFQ  G+I+V VGL+G++ 
Sbjct  364   AMRHTEI-NVPGKLITSGQQDKSLVVRMVATVGNYDYVLDWEFQQSGTIKVGVGLTGVLE  422

Query  853   AKGSPYEHINQFEIPRWDFPAGSLVSENTIGVAHDHFITFHLDMDVDGPTNSFVKVDL--  680
              K + Y   +Q     +    G+LVSENT+ V HDHF+T+ LD+DVDG  NSFVK     
Sbjct  423   VKATSYTSNDQITKNVY----GTLVSENTVAVNHDHFLTYMLDLDVDGNANSFVKAKFQT  478

Query  679   VKNYNIAGKIQRKSYWSPKRKVAKSENDAKIKLQLDKPSEFHVINPRHQSRLGNPSGYKI  500
              +   +     RKSYW   R++ ++E +A+I+L L+ P+E  ++NP  ++RLGN  GY++
Sbjct  479   ARASTVNPTSPRKSYWKVFREIVRTEAEARIRLGLE-PAELLIVNPNSKTRLGNQVGYRL  537

Query  499   VPSATAASLLDLQDPPQLRAAFTNNQIWVTPYNRSEQWAGGLFTYQSHGDDTLAVWSNRN  320
             +      SLL   D PQ+RA++T  Q+WVT YN+SE+WAGG +  +SHGDD LAVWS RN
Sbjct  538   ITGQPVTSLLADDDYPQIRASYTKYQVWVTAYNKSEKWAGGFYADRSHGDDGLAVWSQRN  597

Query  319   RVIEKQDIVLWYTLGFHHLPCQEDFPVMPTVTSTFQLKPVNFFDRNPII  173
             R IE +DIVLWYT+GFHH+P QEDFP M T+   F+L+P NFF+ NP++
Sbjct  598   RAIENKDIVLWYTVGFHHIPYQEDFPAMATLNGGFELRPANFFESNPLL  646



>ref|XP_006419907.1| hypothetical protein CICLE_v10004511mg [Citrus clementina]
 gb|ESR33147.1| hypothetical protein CICLE_v10004511mg [Citrus clementina]
Length=653

 Score =   557 bits (1436),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 288/653 (44%), Positives = 403/653 (62%), Gaps = 25/653 (4%)
 Frame = -1

Query  2098  ADRPMHPLDPLTIQEIERTRSILSSYQPFSGSSLRIHSLSLDEPDKSEVLRW----KRGN  1931
             A+   HPLDPL   EI + + I+   +  +  +L  HS+ L+EPDK  VL W    KRG 
Sbjct  17    ANSLYHPLDPLNPSEINQAKLIVQKSKLGTLPNLTFHSVDLEEPDKVHVLEWLSKQKRGK  76

Query  1930  PLPTRKAFVVALSNGQAHLLVVDLGSGRVSSHTRNPASGYPPMSADDASTALEATFSNSV  1751
                 R+A VV  +  + H L+VDL  G ++SH      GYPP +  +   A +   +   
Sbjct  77    LNLHRQAKVVLRAGAETHELIVDLAIGSITSHNIYKGHGYPPFAFIEFFRASKLPLTYPK  136

Query  1750  FREAISTRGVEINDVVCSAAAPGWFGPEEEGRRITKVKCYTAQNTPNYYMRPIEGLLLTV  1571
             FRE+I  RG+ +++V C     GW+G E    R  KV C+    +PN + RPIEG+ + V
Sbjct  137   FRESIRHRGLNLSEVSCLPFTVGWYG-EHVTNRALKVVCFYRGGSPNIFARPIEGISMLV  195

Query  1570  DLDSGKVINVYDTHSPIPIPKAQGTDYRRDGIEHRAPGVEPLKPISMEQPNGQSFRVEDG  1391
             D+D  ++I  Y     +P+P+A+GTDY        +    P   I      G  F +E G
Sbjct  196   DVDKMQIIK-YTDRLRLPLPRAEGTDYT-------SAKTNPDSVICNVTKGG--FTIE-G  244

Query  1390  YIVKWASWEFHVKADQRAGIIISQATVFDPEAGKRRSVMYKGFASELFVPYMDVDEGWYF  1211
             + VKWA+W+FHV  D RAGI+IS A++FD +  K R V+YKG  SE FVPYMD    WYF
Sbjct  245   HKVKWANWDFHVSFDARAGIVISTASIFDDKINKFRRVLYKGHVSETFVPYMDPTNEWYF  304

Query  1210  RAFMDAGEFGLGATAMELVPLNDCPRHSHYIDGLFVDPDGRPVSQPNVICVFERYSGDIA  1031
             + FMD GEFG G  A  L P+ DCP ++ Y+DG     DG+P     VIC+FER+SG++A
Sbjct  305   KTFMDLGEFGFGRAAGSLQPVIDCPSNAEYLDGYVAGADGQPQQFSRVICIFERFSGNVA  364

Query  1030  WRHSGTGDADDDLIREARPKVSLVVRTTATVGNYDYIFDWEFQTDGSIRVTVGLSGIILA  851
             WRH+   +    +IR   P+VSLVVR   TVGNYDY+ DWEF   G+I++ V L+GI+  
Sbjct  365   WRHTEI-NVPGKVIRSGEPEVSLVVRMVTTVGNYDYVLDWEFDKSGTIKIGVALTGILEM  423

Query  850   KGSPYEHINQFEIPRWDFPAGSLVSENTIGVAHDHFITFHLDMDVDGPTNSFVKVDL--V  677
             K + Y + +Q      +   G+LV+EN + V HDHF+T++LD+DVDG  NSFVK  L   
Sbjct  424   KATSYTNNDQIT----ENVYGTLVAENAVAVNHDHFVTYYLDLDVDGNGNSFVKSKLKTA  479

Query  676   KNYNIAGKIQRKSYWSPKRKVAKSENDAKIKLQLDKPSEFHVINPRHQSRLGNPSGYKIV  497
             +  N+     RKSYW+  ++ AK+E +A+I+L ++ P+E  V+N   +++LGN  GY+++
Sbjct  480   RVSNVRAS-PRKSYWTVVKETAKTEAEARIRLGVE-PAELLVVNANQKTKLGNHVGYRLI  537

Query  496   PSATAASLLDLQDPPQLRAAFTNNQIWVTPYNRSEQWAGGLFTYQSHGDDTLAVWSNRNR  317
                   SLL   D PQ+RA++T  Q+WVT YN+SE+WAGG +T QS GDD LAVWS+RNR
Sbjct  538   TGQPVTSLLSDDDYPQIRASYTKYQVWVTAYNKSERWAGGFYTDQSRGDDGLAVWSSRNR  597

Query  316   VIEKQDIVLWYTLGFHHLPCQEDFPVMPTVTSTFQLKPVNFFDRNPIIQANPN  158
              IE +DIVLWYT+GFHH+P QEDFP+MPT+   F+L+P NFF+ NP++    N
Sbjct  598   EIENKDIVLWYTVGFHHIPYQEDFPLMPTIHGGFELRPSNFFESNPLLLRQEN  650



>ref|XP_008224551.1| PREDICTED: primary amine oxidase [Prunus mume]
Length=646

 Score =   557 bits (1436),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 288/650 (44%), Positives = 401/650 (62%), Gaps = 26/650 (4%)
 Frame = -1

Query  2101  FADRPMHPLDPLTIQEIERTRSILSSYQPFSGSSLRIHSLSLDEPDKSEVLRW----KRG  1934
             F+    HPLD L   EI + R  +      S  +L  H +  +EP+KS+VL+W    ++ 
Sbjct  16    FSASASHPLDTLNPTEINKIRLTVQKSHLGSLPNLTFHFVDTEEPEKSDVLKWLSSSEKK  75

Query  1933  NPLPTRKAFVVALSNGQAHLLVVDLGSGRVSSHTRNPASGYPPMSADDASTALEATFSNS  1754
              P P R A VVA + GQ H L+VDL +G V S       GYPP+S  +     +   S+ 
Sbjct  76    RPTPPRLAKVVARAGGQTHELIVDLATGSVISDHVYTGHGYPPLSFTELFQVSKLPLSHP  135

Query  1753  VFREAISTRGVEINDVVCSAAAPGWFGPEEEGRRITKVKCYTAQNTPNYYMRPIEGLLLT  1574
              F+ +ISTRG+ +++V C   + GW+G E   +R  KV+C+    + N + RPIEG+ + 
Sbjct  136   KFKRSISTRGLNLSEVSCLPFSIGWYG-EHTTKRAVKVQCFYRGGSVNVFTRPIEGITML  194

Query  1573  VDLDSGKVINVYDTHSPIPIPKAQGTDYRR-DGIEHRAPGVEPLKPISMEQPNGQSFRVE  1397
             VD+D  + I +Y      P+PKA+GTD++   G  + A         S  + N   F + 
Sbjct  195   VDIDLMQ-ITMYTDRLRAPLPKAEGTDFQTPKGNSNSA---------SCNKTN-SGFTIS  243

Query  1396  DGYIVKWASWEFHVKADQRAGIIISQATVFDPEAGKRRSVMYKGFASELFVPYMDVDEGW  1217
              G+ VKWA+W FHV  + RAG++IS A+VFD    K RSV+YKG  SE FVPYMD    W
Sbjct  244   -GHKVKWANWVFHVGFNARAGVVISTASVFDSRKKKYRSVLYKGHVSETFVPYMDPTSEW  302

Query  1216  YFRAFMDAGEFGLGATAMELVPLNDCPRHSHYIDGLFVDPDGRPVSQPNVICVFERYSGD  1037
             YF+ FMD GEFG G +A  L PL DCP ++ Y+DG     DG+P      IC+FER+SGD
Sbjct  303   YFKTFMDLGEFGFGRSADSLQPLIDCPENAKYVDGYMAGADGKPQKVQRAICIFERFSGD  362

Query  1036  IAWRHSGTGDADDDLIREARPKVSLVVRTTATVGNYDYIFDWEFQTDGSIRVTVGLSGII  857
             +A RH+   +    LIR  + + +LVVR  ATVGNYDY+ DWEF+  G+I+V VGL+G++
Sbjct  363   VAMRHTEI-NVPGKLIRSGQQETTLVVRMVATVGNYDYVLDWEFEQSGTIKVGVGLTGVL  421

Query  856   LAKGSPYEHINQFEIPRWDFPAGSLVSENTIGVAHDHFITFHLDMDVDGPTNSFVKVDL-  680
               K + Y + +Q     +    G+LVSENT+ V HDHF+T+ LD+DVDG  NSFVK  L 
Sbjct  422   EMKATSYTNNDQITESVY----GTLVSENTVAVNHDHFLTYFLDLDVDGNDNSFVKSKLQ  477

Query  679   -VKNYNIAGKIQRKSYWSPKRKVAKSENDAKIKLQLDKPSEFHVINPRHQSRLGNPSGYK  503
               +   +     RKSYW   ++ AK+E +A+I+L L+ P+E  ++NP   +RLGN  GY+
Sbjct  478   TARTNPVNATSPRKSYWRVVKETAKTEAEARIRLGLE-PAELLIVNPSRMTRLGNVVGYR  536

Query  502   IVPSATAASLLDLQDPPQLRAAFTNNQIWVTPYNRSEQWAGGLFTYQSHGDDTLAVWSNR  323
             ++      SLL   D PQ+RAA+T  Q+WVT YN+SE+WAGG +  +SHGDD LAVWS R
Sbjct  537   LITGQPVTSLLADDDYPQIRAAYTKYQVWVTAYNKSERWAGGFYADRSHGDDGLAVWSKR  596

Query  322   NRVIEKQDIVLWYTLGFHHLPCQEDFPVMPTVTSTFQLKPVNFFDRNPII  173
             NR IE +DIV+WYT+GFHH+P QEDFP MP +   F+L+P NFF+ NP++
Sbjct  597   NRAIENKDIVVWYTVGFHHIPYQEDFPAMPALHGGFELRPANFFESNPLL  646



>dbj|BAG94696.1| unnamed protein product [Oryza sativa Japonica Group]
Length=404

 Score =   548 bits (1412),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 250/403 (62%), Positives = 312/403 (77%), Gaps = 3/403 (1%)
 Frame = -1

Query  1333  IIISQATVFDPEAGKRRSVMYKGFASELFVPYMDVDEGWYFRAFMDAGEFGLGATAMELV  1154
             +++S+A V DP  G+ R VMYKG ASELFVPYMD  E WYF+ +MDAGE+G G  AM LV
Sbjct  1     MVVSRARVQDPATGEHRDVMYKGMASELFVPYMDPTEAWYFKTYMDAGEYGFGLQAMPLV  60

Query  1153  PLNDCPRHSHYIDGLFVDPDGRPVSQPNVICVFERYSGDIAWRHSGTGDADDDLIREARP  974
             PLNDCPRH+ Y+D +FV  DGRP  + N+ICVFERY+GDIAWRHS +     D IRE+RP
Sbjct  61    PLNDCPRHARYLDAVFVAADGRPYVRENMICVFERYAGDIAWRHSESPITGMD-IRESRP  119

Query  973   KVSLVVRTTATVGNYDYIFDWEFQTDGSIRVTVGLSGIILAKGSPYEHINQFEIPRWDFP  794
             KV+LV R  A+V NYDYI DWEFQ DG +R+ VGLSGI++ KG+ Y H+NQ  + + D  
Sbjct  120   KVTLVARMAASVANYDYIVDWEFQMDGLVRIKVGLSGILMVKGTQYSHMNQ--VHQNDNM  177

Query  793   AGSLVSENTIGVAHDHFITFHLDMDVDGPTNSFVKVDLVKNYNIAGKIQRKSYWSPKRKV  614
              G+L+SEN IGV HDHF+TF LDMD+DG  NSFVKV + +    AG+  RKSY    R V
Sbjct  178   YGTLLSENVIGVIHDHFVTFRLDMDIDGADNSFVKVAMARQNTGAGESPRKSYLKATRHV  237

Query  613   AKSENDAKIKLQLDKPSEFHVINPRHQSRLGNPSGYKIVPSATAASLLDLQDPPQLRAAF  434
             A++E DA+++L+L +PSEFH++NP  ++R+GNP GYK+VP+ TAASLLD +DPPQ R AF
Sbjct  238   ARTEKDAQVRLKLYEPSEFHIVNPMKKTRVGNPVGYKVVPAGTAASLLDPEDPPQKRGAF  297

Query  433   TNNQIWVTPYNRSEQWAGGLFTYQSHGDDTLAVWSNRNRVIEKQDIVLWYTLGFHHLPCQ  254
             TNNQIWVTPYN++E+WAGGLF YQS G+DTLA WS R+R IE +D+VLWYTLGFHH+PCQ
Sbjct  298   TNNQIWVTPYNKTEEWAGGLFVYQSKGEDTLATWSERDRPIENKDLVLWYTLGFHHVPCQ  357

Query  253   EDFPVMPTVTSTFQLKPVNFFDRNPIIQANPNFAEDLPICRAG  125
             EDFP+MPTV+S+F LKPVNFF+ NPI+   P    DLP+C A 
Sbjct  358   EDFPIMPTVSSSFDLKPVNFFESNPILGQRPTQENDLPVCAAA  400



>ref|XP_007143249.1| hypothetical protein PHAVU_007G056500g [Phaseolus vulgaris]
 gb|ESW15243.1| hypothetical protein PHAVU_007G056500g [Phaseolus vulgaris]
Length=656

 Score =   557 bits (1436),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 288/650 (44%), Positives = 405/650 (62%), Gaps = 27/650 (4%)
 Frame = -1

Query  2083  HPLDPLTIQEIERTRSILSSYQPFSGSS---LRIHSLSLDEPDKSEVLRWKRGNPLPT--  1919
             HPLDPLT  EI   ++I+    P S ++   L  + + LDEP+K ++L W+  NP     
Sbjct  22    HPLDPLTPSEINLVQTIVQKAYPTSNTTDHNLIFNYVGLDEPNKLQILSWQSSNPKTKPK  81

Query  1918  ------RKAFVVALSNGQAHLLVVDLGSGRVSSHTRNPASGYPPMSADDASTALEATFSN  1757
                   R+AFV+     Q+H ++VDL    + S      +GYPP++  +   A +   S 
Sbjct  82    PSPPPPRRAFVIVRFQKQSHEIIVDLSKSSIVSTKVYEGNGYPPLTLGEIEVATQLPLSY  141

Query  1756  SVFREAISTRGVEINDVVCSAAAPGWFGPEEEGRRITKVKCYTAQNTPNYYMRPIEGLLL  1577
               F++++  RG+ +++V C A   GWFG E + RR+ ++KC+    T N+Y RP+EG+ +
Sbjct  142   EPFKKSLRKRGLNVSEVQCVAFTFGWFG-EAKPRRLVQIKCHYRNGTANFYARPLEGVEI  200

Query  1576  TVDLDSGKVINVYDTHSPIPIPKAQGTDYRRDGIEHRAPGVEPLKPISMEQPNGQSFRVE  1397
              VD D  K++  Y+    + +PKA+GT+YR       A  ++P     ++Q +G  F + 
Sbjct  201   LVDFDDMKIVG-YNDRYVVALPKAEGTEYR-------ASKLKPPSAPKLKQHDGPGFTI-  251

Query  1396  DGYIVKWASWEFHVKADQRAGIIISQATVFDPEAGKRRSVMYKGFASELFVPYMDVDEGW  1217
             DG+ V W SW FHV  D R G +IS A+ +D +  K R V+YKG  SELFVPY D  + W
Sbjct  252   DGHTVSWGSWVFHVGYDSRNGPVISLASYYDLQKKKHRPVLYKGLISELFVPYQDPTQEW  311

Query  1216  YFRAFMDAGEFGLGATAMELVPLNDCPRHSHYIDGLFVDPDGRPVSQPNVICVFERYSGD  1037
             Y+R F D+GE+GLG     L P  DCP ++ +ID      DG PV  PN  C+F++Y+G 
Sbjct  312   YYRTFFDSGEYGLGQYMSSLQPFTDCPSNASFIDAYRASSDGTPVKIPNAFCIFQKYAGG  371

Query  1036  IAWRHSGTGDADDDLIREARPKVSLVVRTTATVGNYDYIFDWEFQTDGSIRVTVGLSGII  857
             I WRH+      +  I E+R + +LVVRT  TV NYDYI DWEF+  GSI+  VGL+GI+
Sbjct  372   IMWRHTEAA-IPNQTITESRSEETLVVRTVTTVANYDYITDWEFKQSGSIKSVVGLTGIL  430

Query  856   LAKGSPYEHINQFEIPRWDFPAGSLVSENTIGVAHDHFITFHLDMDVDGPTNSFVKVDLV  677
               K + Y + ++ +   +    G+LV+ENTIGV HDHF T++LD+DVDG  NSFVK +L 
Sbjct  431   ALKATNYTNTDEIKKDIY----GTLVAENTIGVNHDHFFTYYLDLDVDGVENSFVKSNLE  486

Query  676   KNYNIAGKIQRKSYWSPKRKVAKSENDAKIKLQLDKPSEFHVINPRHQSRLGNPSGYKIV  497
                   G I RKSYW    + AK+E DA+IKL L KPSE  V+NP  +++ GN  GY+++
Sbjct  487   TVRVKDGSIPRKSYWRVVSETAKTEGDARIKLGL-KPSELAVVNPNKKTKQGNKIGYRLL  545

Query  496   PSATAASLLDLQDPPQLRAAFTNNQIWVTPYNRSEQWAGGLFTYQSHGDDTLAVWSNRNR  317
             P   A  LL   D PQ+RAAFTN  +WVTPYNRSE+W  G +  +S GDDTLAVWS R+R
Sbjct  546   PGPMAQPLLLNDDFPQIRAAFTNYDVWVTPYNRSEKWVAGTYVDRSRGDDTLAVWSERDR  605

Query  316   VIEKQDIVLWYTLGFHHLPCQEDFPVMPTVTSTFQLKPVNFFDRNPIIQA  167
              IE +DIVLWYT+GFHH+PCQEDFPVMPT++  F+L+P NFF+ NP+++ 
Sbjct  606   KIENKDIVLWYTMGFHHVPCQEDFPVMPTLSGGFELRPTNFFESNPVLKT  655



>emb|CDP09892.1| unnamed protein product [Coffea canephora]
Length=411

 Score =   548 bits (1411),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 265/410 (65%), Positives = 316/410 (77%), Gaps = 11/410 (3%)
 Frame = -1

Query  1333  IIISQATVFDPEAGKRRSVMYKGFASELFVPYMDVDEGWYFRAFMDAGEFGLGATAMELV  1154
             ++IS+A V D E G+ RSVMYKGFASE+FVPYMD  + WYF++FMDAGEFGLGA A+ LV
Sbjct  1     MVISKAMVLDSETGEFRSVMYKGFASEVFVPYMDYRQNWYFKSFMDAGEFGLGAMALALV  60

Query  1153  PLNDCPRHSHYIDGLFVDPDGRPVSQPNVICVFERYSGDIAWRHSGTGDADDDLIREARP  974
             PLNDCPR+S+Y+DG+FV  DGRP  QPN+IC+FE+Y+GDI WRHS       D   +ARP
Sbjct  61    PLNDCPRYSYYLDGVFVYADGRPYIQPNMICIFEKYAGDIDWRHSEPPVNGFDH-NQARP  119

Query  973   KVSLVVRTTATVGNYDYIFDWEFQTDGSIRVTVGLSGIILAKGSPYEHINQFEIPRWDFP  794
             ++++V R  A+VGNYDYIFDWEFQ DG IRV V LSG+++ KG+PYE+ NQ  +P     
Sbjct  120   RITVVARMAASVGNYDYIFDWEFQMDGLIRVQVSLSGMLMVKGTPYENPNQ--VPSNVEM  177

Query  793   AGSLVSENTIGVAHDHFITFHLDMDVDGPTNSFVKVDLVKNYNIAGKIQRKSYWSPKRKV  614
             +  LVSEN +GV HDHFITFHLDMD+D   NSFV ++LVK  N+ G+  RKS    KR+V
Sbjct  178   STPLVSENVLGVVHDHFITFHLDMDIDSSNNSFVNINLVKEENLGGQSPRKSILKAKRQV  237

Query  613   AKSENDAKIKLQLDKPSEFHVINPRHQSRLGNPSGYKIVPSATAASLLDLQDPPQLRAAF  434
             AK+E DA+IKL+L  PSEFH INP   SRLG P+GYK+VP ATAASLLDL DPPQLRAAF
Sbjct  238   AKNEEDARIKLKLYDPSEFHFINPSRFSRLGKPTGYKLVPRATAASLLDLDDPPQLRAAF  297

Query  433   TNNQIWVTPY--------NRSEQWAGGLFTYQSHGDDTLAVWSNRNRVIEKQDIVLWYTL  278
             TNNQ+ V           NRSE WAGG   YQS G+DTLAVWS+RNR IE +DIVLWYTL
Sbjct  298   TNNQVPVIGLFSIQMLFCNRSEPWAGGFLVYQSKGEDTLAVWSDRNRPIENKDIVLWYTL  357

Query  277   GFHHLPCQEDFPVMPTVTSTFQLKPVNFFDRNPIIQANPNFAEDLPICRA  128
             GFHHLPCQEDFPVMPTV+S+F LKPVNFF+ NPI+   PNF +DLPIC A
Sbjct  358   GFHHLPCQEDFPVMPTVSSSFDLKPVNFFESNPILGVMPNFEKDLPICWA  407



>gb|KDO74637.1| hypothetical protein CISIN_1g006085mg [Citrus sinensis]
Length=662

 Score =   557 bits (1436),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 277/643 (43%), Positives = 401/643 (62%), Gaps = 17/643 (3%)
 Frame = -1

Query  2083  HPLDPLTIQEIERTRSILSSYQPFSGSSLRIHSLSLDEPDKSEVLRWKRGNPLP-TRKAF  1907
             HPLD L   E  R ++I+ +  P   ++L  H + +DEPDK+ V  W   +     R+A 
Sbjct  22    HPLDSLRPSEFTRVQTIVKTSYP--SNNLSFHYVGMDEPDKAVVYSWLSNSKTKFPRRAI  79

Query  1906  VVALSNGQAHLLVVDLGSGRVSSHTRNPASGYPPMSADDASTALEATFSNSVFREAISTR  1727
             V+A  N Q H ++VDL    + S       G+P ++ ++         +   F+ ++  R
Sbjct  80    VIARHNHQTHEIIVDLSKRSIVSDKVYTGHGFPLLTLEEQHAGAALVLAYEPFKASVKKR  139

Query  1726  GVEINDVVCSAAAPGWFGPEEEGRRITKVKC-YTAQNTPNYYMRPIEGLLLTVDLDSGKV  1550
             G+ I+DVVCSA+  GW+G E++ +R+ K  C YT Q T N ++RPIEG+ + VD++  KV
Sbjct  140   GLNISDVVCSASTVGWYG-EKKSKRVLKFPCFYTDQGTINMFLRPIEGITIVVDIEEMKV  198

Query  1549  INVYDTHSPIPIPKAQGTDYRRDGIEHRAPGVEPLKPISMEQPNGQSFRVEDGYIVKWAS  1370
                Y+     PIPK + T+YR   ++   P   P             F++ +G  VKWA+
Sbjct  199   TE-YNDREVAPIPKPEPTEYRLSKLK---PPFGPRLNSVATSSTRPGFKI-NGNTVKWAN  253

Query  1369  WEFHVKADQRAGIIISQATVFDPEAGKRRSVMYKGFASELFVPYMDVDEGWYFRAFMDAG  1190
             W F+V  D R G IIS A+++D    K R V+Y+GF SELF+PY D  EGWY   + D G
Sbjct  254   WVFNVGFDARVGTIISTASIYDINMHKYRRVLYRGFISELFIPYQDPSEGWYHITYFDNG  313

Query  1189  EFGLGATAMELVPLNDCPRHSHYIDGLFVDPDGRPVSQPNVICVFERYSGDIAWRHSGTG  1010
             EFG G TA+ L  LNDCP ++ ++DG F   DG PV  PN +C+FER++GD+ WRH  T 
Sbjct  314   EFGFGLTAVPLERLNDCPANAVFMDGYFASQDGTPVKTPNAVCIFERHAGDVMWRH--TE  371

Query  1009  DADDDLIREARPKVSLVVRTTATVGNYDYIFDWEFQTDGSIRVTVGLSGIILAKGSPYEH  830
                   +RE RP+VSLVVR  ATVGNYDYI DWEF+  GSI++ VGLSG++  K   Y +
Sbjct  372   AEMPGHVREVRPEVSLVVRMVATVGNYDYIIDWEFKPSGSIKMGVGLSGVLEVKPVEYTY  431

Query  829   INQFEIPRWDFPAGSLVSENTIGVAHDHFITFHLDMDVDGPTNSFVKVDLVKNYNIAGKI  650
             ++Q +    +   G+LV++N+I + HDHF+ ++LD+D+DG  NSF K  LV   N     
Sbjct  432   VDQIK----EDQHGTLVADNSIAINHDHFLNYYLDLDIDGYANSFEKTKLVTRRNTNVNT  487

Query  649   QRKSYWSPKRKVAKSENDAKIKLQLDKPSEFHVINPRHQSRLGNPSGYKIVPSATAASLL  470
              RKSYW+ +++ AK+E +A++ L   KP EF ++NP  ++++G+P GY+++P +    +L
Sbjct  488   PRKSYWTVEKETAKTEFEARLNLD-TKPMEFALVNPSKKTKIGHPVGYRLLPGSIIGPML  546

Query  469   DLQDPPQLRAAFTNNQIWVTPYNRSEQWAGGLFTYQSHGDDTLAVWSNRNRVIEKQDIVL  290
                D PQ+RA FTN  +WVTPY +SE+++GG +  QSHGDDTL  W++ NR IE  DIVL
Sbjct  547   MEDDYPQIRAGFTNYNVWVTPYKKSEKYSGGNYVDQSHGDDTLLQWTDGNREIENTDIVL  606

Query  289   WYTLGFHHLPCQEDFPVMPTVTSTFQLKPVNFFDRNPIIQANP  161
             WYT+G HH PCQEDFPVMPTV+  F+L+P NFF+ NP+++  P
Sbjct  607   WYTMGIHHAPCQEDFPVMPTVSCGFELRPTNFFEYNPVLKVIP  649



>ref|XP_006419904.1| hypothetical protein CICLE_v10004484mg [Citrus clementina]
 gb|ESR33144.1| hypothetical protein CICLE_v10004484mg [Citrus clementina]
Length=668

 Score =   557 bits (1436),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 277/643 (43%), Positives = 401/643 (62%), Gaps = 17/643 (3%)
 Frame = -1

Query  2083  HPLDPLTIQEIERTRSILSSYQPFSGSSLRIHSLSLDEPDKSEVLRWKRGNPLP-TRKAF  1907
             HPLD L   E  R ++I+ +  P   ++L  H + +DEPDK+ V  W   +     R+A 
Sbjct  28    HPLDSLRPSEFTRVQTIVKTSYP--SNNLSFHYVGMDEPDKAVVYSWLSNSKTKFPRRAI  85

Query  1906  VVALSNGQAHLLVVDLGSGRVSSHTRNPASGYPPMSADDASTALEATFSNSVFREAISTR  1727
             V+A  N Q H ++VDL    + S       G+P ++ ++         +   F+ ++  R
Sbjct  86    VIARHNHQTHEIIVDLSKRSIVSDKVYTGHGFPLLTLEEQHAGAALVLAYEPFKASVKKR  145

Query  1726  GVEINDVVCSAAAPGWFGPEEEGRRITKVKC-YTAQNTPNYYMRPIEGLLLTVDLDSGKV  1550
             G+ I+DVVCSA+  GW+G E++ +R+ K  C YT Q T N ++RPIEG+ + VD++  KV
Sbjct  146   GLNISDVVCSASTVGWYG-EKKSKRVLKFPCFYTDQGTINMFLRPIEGITIVVDIEEMKV  204

Query  1549  INVYDTHSPIPIPKAQGTDYRRDGIEHRAPGVEPLKPISMEQPNGQSFRVEDGYIVKWAS  1370
                Y+     PIPK + T+YR   ++   P   P             F++ +G  VKWA+
Sbjct  205   TE-YNDREVAPIPKPEPTEYRLSKLK---PPFGPRLNSVATSSTRPGFKI-NGNTVKWAN  259

Query  1369  WEFHVKADQRAGIIISQATVFDPEAGKRRSVMYKGFASELFVPYMDVDEGWYFRAFMDAG  1190
             W F+V  D R G IIS A+++D    K R V+Y+GF SELF+PY D  EGWY   + D G
Sbjct  260   WVFNVGFDARVGTIISTASIYDINMHKYRRVLYRGFISELFIPYQDPSEGWYHITYFDNG  319

Query  1189  EFGLGATAMELVPLNDCPRHSHYIDGLFVDPDGRPVSQPNVICVFERYSGDIAWRHSGTG  1010
             EFG G TA+ L  LNDCP ++ ++DG F   DG PV  PN +C+FER++GD+ WRH  T 
Sbjct  320   EFGFGLTAVPLERLNDCPANAVFMDGYFASQDGTPVKTPNAVCIFERHAGDVMWRH--TE  377

Query  1009  DADDDLIREARPKVSLVVRTTATVGNYDYIFDWEFQTDGSIRVTVGLSGIILAKGSPYEH  830
                   +RE RP+VSLVVR  ATVGNYDYI DWEF+  GSI++ VGLSG++  K   Y +
Sbjct  378   AEMPGHVREVRPEVSLVVRMVATVGNYDYIIDWEFKPSGSIKMGVGLSGVLEVKPVEYTY  437

Query  829   INQFEIPRWDFPAGSLVSENTIGVAHDHFITFHLDMDVDGPTNSFVKVDLVKNYNIAGKI  650
             ++Q +    +   G+LV++N+I + HDHF+ ++LD+D+DG  NSF K  LV   N     
Sbjct  438   VDQIK----EDQHGTLVADNSIAINHDHFLNYYLDLDIDGYANSFEKTKLVTRRNTNVNT  493

Query  649   QRKSYWSPKRKVAKSENDAKIKLQLDKPSEFHVINPRHQSRLGNPSGYKIVPSATAASLL  470
              RKSYW+ +++ AK+E +A++ L   KP EF ++NP  ++++G+P GY+++P +    +L
Sbjct  494   PRKSYWTVEKETAKTEFEARLNLD-TKPMEFALVNPSKKTKIGHPVGYRLLPGSIIGPML  552

Query  469   DLQDPPQLRAAFTNNQIWVTPYNRSEQWAGGLFTYQSHGDDTLAVWSNRNRVIEKQDIVL  290
                D PQ+RA FTN  +WVTPY +SE+++GG +  QSHGDDTL  W++ NR IE  DIVL
Sbjct  553   MEDDYPQIRAGFTNYNVWVTPYKKSEKYSGGNYVDQSHGDDTLLQWTDGNREIENTDIVL  612

Query  289   WYTLGFHHLPCQEDFPVMPTVTSTFQLKPVNFFDRNPIIQANP  161
             WYT+G HH PCQEDFPVMPTV+  F+L+P NFF+ NP+++  P
Sbjct  613   WYTMGIHHAPCQEDFPVMPTVSCGFELRPTNFFEYNPVLKVIP  655



>ref|XP_011021541.1| PREDICTED: primary amine oxidase [Populus euphratica]
Length=665

 Score =   556 bits (1434),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 283/646 (44%), Positives = 398/646 (62%), Gaps = 29/646 (4%)
 Frame = -1

Query  2083  HPLDPLTIQEIERTRSILSSYQPFSGSSLRIHSLSLDEPDKSEVLRW----KRGNPLPTR  1916
             HPLDPL   EI+R R I+ +    +  +L  H + L+EP+K +VL+W    ++   +P R
Sbjct  39    HPLDPLNPNEIDRIRLIIQNSSLGNLRNLTFHFVDLEEPEKGDVLKWLSSSEQNKSIPPR  98

Query  1915  KAFVVALSNGQAHLLVVDLGSGRVSSHTRNPASGYPPMSADDASTALEATFSNSVFREAI  1736
              A VV     + H L+VDL +G ++S       GYPP++  +   A +       F E+I
Sbjct  99    HAKVVIRVRRETHELIVDLATGNITSDRLYSGHGYPPLAFIELFRASKLPLKYPKFIESI  158

Query  1735  STRGVEINDVVCSAAAPGWFGPEEEGRRITKVKCYTAQNTPNYYMRPIEGLLLTVDLDSG  1556
               RG+ ++ V C     GW+G +   +R  ++ C+    + N + RPIEG+ + VD+DS 
Sbjct  159   MKRGLNLSQVSCVPFTVGWYG-QNVTKRALRIACFYRGGSVNVFARPIEGISMLVDVDSM  217

Query  1555  KVINVYDTHSPIPIPKAQGTDYRRDGIEHRAPGVEPLKPISMEQPNGQSFRVEDGYIVKW  1376
             + I +Y      P+PKA+GTD+R              +P S+     +S    DG+ V+W
Sbjct  218   Q-ITMYTDRFKAPLPKAEGTDFRSKK-----------QPQSIASNVSESGFTVDGHRVRW  265

Query  1375  ASWEFHVKADQRAGIIISQATVFDPEAGKRRSVMYKGFASELFVPYMDVDEGWYFRAFMD  1196
             A+W+FHV  D RAGI IS A++FD +  K R V+YKG  SE FVPYMD    WYFR FMD
Sbjct  266   ANWDFHVAFDARAGITISTASIFDAKVKKFRRVLYKGHVSETFVPYMDPTSDWYFRTFMD  325

Query  1195  AGEFGLGATAMELVPLNDCPRHSHYIDGLFVDPDGRPVSQPNVICVFERYSGDIAWRHSG  1016
              GEFG G +A  L PL DCP ++ Y+DG     DG+    PNVIC+FERYSGDIAWRH+ 
Sbjct  326   IGEFGFGRSADTLQPLVDCPANAFYLDGYVTGADGQAQKMPNVICIFERYSGDIAWRHTE  385

Query  1015  TGDADDDLIREARPKVSLVVRTTATVGNYDYIFDWEFQTDGSIRVTVGLSGIILAKGSPY  836
               +    +IR   P++SLVVR  ATVGNYDY+ DWEF+  GSI+V V L+GI+  K + Y
Sbjct  386   I-NVPGKVIRSGEPEISLVVRMVATVGNYDYVLDWEFKKSGSIKVGVDLTGILEMKATSY  444

Query  835   EHINQFEIPRWDFPAGSLVSENTIGVAHDHFITFHLDMDVDGPTNSFVKVD----LVKNY  668
              +  Q     +    G+LV+ENTI V HDHF+T++LD+DVDG  NSFVK       V  +
Sbjct  445   TNNQQITEEVY----GTLVTENTIAVNHDHFLTYYLDLDVDGDGNSFVKAKQQTARVPAF  500

Query  667   NIAGKIQRKSYWSPKRKVAKSENDAKIKLQLDKPSEFHVINPRHQSRLGNPSGYKIVPSA  488
             N   +  RKSYW   R+ AK+E + +I+L L+ P++  + NP  ++RLGN  GY+++   
Sbjct  501   N--ARSPRKSYWMVVRETAKTEAEGRIQLGLE-PADLLIANPNKKTRLGNQVGYRLITGQ  557

Query  487   TAASLLDLQDPPQLRAAFTNNQIWVTPYNRSEQWAGGLFTYQSHGDDTLAVWSNRNRVIE  308
                SLL   D PQ+R A+T  Q+WVT YN+SE+WAGG +  ++ G++ LAVW+ RNR IE
Sbjct  558   PVNSLLSDDDYPQIRNAYTKYQVWVTAYNKSERWAGGFYADRNRGEEGLAVWTRRNRAIE  617

Query  307   KQDIVLWYTLGFHHLPCQEDFPVMPTVTSTFQLKPVNFFDRNPIIQ  170
              +DIVLWY +GFHH+PCQEDFPVMP +   F+L+P NFF+ NP+++
Sbjct  618   NKDIVLWYIVGFHHIPCQEDFPVMPALHGGFELRPANFFESNPLLR  663



>ref|XP_006489371.1| PREDICTED: primary amine oxidase-like [Citrus sinensis]
Length=668

 Score =   556 bits (1433),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 277/643 (43%), Positives = 401/643 (62%), Gaps = 17/643 (3%)
 Frame = -1

Query  2083  HPLDPLTIQEIERTRSILSSYQPFSGSSLRIHSLSLDEPDKSEVLRWKRGNPLP-TRKAF  1907
             HPLD L   E  R ++I+ +  P   ++L  H + +DEPDK+ V  W   +     R+A 
Sbjct  28    HPLDSLRPSEFTRVQTIVKTSYP--SNNLSFHYVGMDEPDKAVVYSWLSNSKTKFPRRAI  85

Query  1906  VVALSNGQAHLLVVDLGSGRVSSHTRNPASGYPPMSADDASTALEATFSNSVFREAISTR  1727
             V+A  N Q H ++VDL    + S       G+P ++ ++         +   F+ ++  R
Sbjct  86    VIARHNHQTHEIIVDLSKRSIVSDKVYTGHGFPLLTLEEQHAGAALVLAYEPFKASVKKR  145

Query  1726  GVEINDVVCSAAAPGWFGPEEEGRRITKVKC-YTAQNTPNYYMRPIEGLLLTVDLDSGKV  1550
             G+ I+DVVCSA+  GW+G E++ +R+ K  C YT Q T N ++RPIEG+ + VD++  KV
Sbjct  146   GLNISDVVCSASTVGWYG-EKKSKRVLKFPCFYTDQGTINMFLRPIEGITIVVDIEEMKV  204

Query  1549  INVYDTHSPIPIPKAQGTDYRRDGIEHRAPGVEPLKPISMEQPNGQSFRVEDGYIVKWAS  1370
                Y+     PIPK + T+YR   ++   P   P             F++ +G  VKWA+
Sbjct  205   TE-YNDREVAPIPKPEPTEYRLSKLK---PPFGPRLNSVATSSTRPGFKI-NGNTVKWAN  259

Query  1369  WEFHVKADQRAGIIISQATVFDPEAGKRRSVMYKGFASELFVPYMDVDEGWYFRAFMDAG  1190
             W F+V  D R G IIS A+++D    K R V+Y+GF SELF+PY D  EGWY   + D G
Sbjct  260   WVFNVGFDARVGTIISTASIYDINMHKYRRVLYRGFISELFIPYQDPSEGWYHITYFDNG  319

Query  1189  EFGLGATAMELVPLNDCPRHSHYIDGLFVDPDGRPVSQPNVICVFERYSGDIAWRHSGTG  1010
             EFG G TA+ L  LNDCP ++ ++DG F   DG PV  PN +C+FER++GD+ WRH  T 
Sbjct  320   EFGFGLTAVPLERLNDCPANAVFMDGYFASQDGTPVKTPNAVCIFERHAGDVMWRH--TE  377

Query  1009  DADDDLIREARPKVSLVVRTTATVGNYDYIFDWEFQTDGSIRVTVGLSGIILAKGSPYEH  830
                   +RE RP+VSLVVR  ATVGNYDYI DWEF+  GSI++ VGLSG++  K   Y +
Sbjct  378   AEMPGHVREVRPEVSLVVRMVATVGNYDYIIDWEFKPSGSIKMGVGLSGVLEVKPVEYTY  437

Query  829   INQFEIPRWDFPAGSLVSENTIGVAHDHFITFHLDMDVDGPTNSFVKVDLVKNYNIAGKI  650
             ++Q +    +   G+LV++N+I + HDHF+ ++LD+D+DG  NSF K  LV   N     
Sbjct  438   VDQIK----EDQHGTLVADNSIAINHDHFLNYYLDLDIDGYANSFEKTKLVTRRNTNVNT  493

Query  649   QRKSYWSPKRKVAKSENDAKIKLQLDKPSEFHVINPRHQSRLGNPSGYKIVPSATAASLL  470
              RKSYW+ +++ AK+E +A++ L   KP EF ++NP  ++++G+P GY+++P +    +L
Sbjct  494   PRKSYWTVEKETAKTEFEARLNLD-TKPMEFALVNPSKKTKIGHPVGYRLLPGSIIGPML  552

Query  469   DLQDPPQLRAAFTNNQIWVTPYNRSEQWAGGLFTYQSHGDDTLAVWSNRNRVIEKQDIVL  290
                D PQ+RA FTN  +WVTPY +SE+++GG +  QSHGDDTL  W++ NR IE  DIVL
Sbjct  553   MDDDYPQIRAGFTNYNVWVTPYKKSEKYSGGNYVDQSHGDDTLLQWTDGNREIENTDIVL  612

Query  289   WYTLGFHHLPCQEDFPVMPTVTSTFQLKPVNFFDRNPIIQANP  161
             WYT+G HH PCQEDFPVMPTV+  F+L+P NFF+ NP+++  P
Sbjct  613   WYTMGIHHAPCQEDFPVMPTVSCGFELRPTNFFEYNPVLKVIP  655



>dbj|BAA77206.1| copper amine oxidase [Pisum sativum]
 dbj|BAH28262.1| diamine oxidase [Pisum sativum]
Length=674

 Score =   556 bits (1433),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 273/642 (43%), Positives = 413/642 (64%), Gaps = 16/642 (2%)
 Frame = -1

Query  2083  HPLDPLTIQEIERTRSILSSYQPFSGSSLRIHSLSLDEPDKSEVLRWKRGNPLPT--RKA  1910
             HPLDPLT +E    ++I+ +  P S + L  H + LD+P+K  VLR++    L +  RK+
Sbjct  33    HPLDPLTKEEFLAVQTIVQNKYPISKNKLAFHYIGLDDPEKDHVLRYETHPTLVSIPRKS  92

Query  1909  FVVALSNGQAHLLVVDLGSGRVSSHTRNPASGYPPMSADDASTALEATFSNSVFREAIST  1730
             FVVA+ N Q H +++DL    + S   +   G+P +S D+ S A+E       F +++  
Sbjct  93    FVVAIINSQTHEILIDLRIRSIVSDNIHNGYGFPILSVDEQSLAIELPLKYPPFIDSVKK  152

Query  1729  RGVEINDVVCSAAAPGWFGPEEEGRRITKVKCYTAQNTPNYYMRPIEGLLLTVDLDSGKV  1550
             RG+ ++++VCS+   GWFG EE+  R  ++ C+  ++T N Y+RPI G+ +  DLD  K+
Sbjct  153   RGLNLSEIVCSSFTMGWFG-EEKNVRTVRLDCFMKESTVNIYVRPITGITIVADLDLMKI  211

Query  1549  INVYDTHSPIPIPKAQGTDYRRDGIEHRAPGVEPLK-PISMEQPNGQSFRVEDGYIVKWA  1373
             +  +D      +P A+ T+Y+   +  ++P   P +  ++  QP G  F++E G+ V WA
Sbjct  212   VEYHDRDIE-AVPTAENTEYQ---VSKQSPPFGPKQHSLTSHQPQGPGFQIE-GHSVSWA  266

Query  1372  SWEFHVKADQRAGIIISQATVFDPEAGKRRSVMYKGFASELFVPYMDVDEGWYFRAFMDA  1193
             +W+FH+  D RAGI+IS A+++D E  K R V+YKG+ SELFVPY D  E +YF+ F D+
Sbjct  267   NWKFHIGFDVRAGIVISLASIYDLEKHKSRRVLYKGYISELFVPYQDPTEEFYFKTFFDS  326

Query  1192  GEFGLGATAMELVPLNDCPRHSHYIDGLFVDPDGRPVSQPNVICVFERYSGDIAWRHSGT  1013
             GEFG G + + L+P  DCP H+ +ID      +G P+   N ICVFE+Y G+I WRH+  
Sbjct  327   GEFGFGLSTVSLIPNRDCPPHAQFIDTYIHSANGTPILLKNAICVFEQY-GNIMWRHTEN  385

Query  1012  GDADDDLIREARPKVSLVVRTTATVGNYDYIFDWEFQTDGSIRVTVGLSGIILAKGSPYE  833
             G  ++  I E+R +V+L+VRT  TVGNYD + DWEF+  GSI+  + LSGI+  KG+  +
Sbjct  386   GIPNES-IEESRTEVNLIVRTIVTVGNYDNVIDWEFKASGSIKPAIALSGILEIKGTNIK  444

Query  832   HINQFEIPRWDFPAGSLVSENTIGVAHDHFITFHLDMDVDGPTNSFVKVDLVKNYNIAGK  653
             H ++ +    +   G LVS N+IG+ HDHF  ++LD D+DG  NSF K  L       G 
Sbjct  445   HKDEIK----EDLHGKLVSANSIGIYHDHFYIYYLDFDIDGTHNSFEKTSLKTVRIKDGS  500

Query  652   IQRKSYWSPKRKVAKSENDAKIKLQLDKPSEFHVINPRHQSRLGNPSGYKIVPSATAASL  473
              +RKSYW+ + + AK+E+DAKI + L  P+E  V+NP  ++ +GN  GY+++P+  A  L
Sbjct  501   SKRKSYWTTETQTAKTESDAKITIGL-APAELVVVNPNIKTAVGNEVGYRLIPAIPAHPL  559

Query  472   LDLQDPPQLRAAFTNNQIWVTPYNRSEQWAGGLFTYQSHGDDTLAVWSNRNRVIEKQDIV  293
             L   D PQ+R AFTN  +WVT YNR+E+WAGGL+   S GDDTLAVW+ +NR I  +DIV
Sbjct  560   LTEDDYPQIRGAFTNYNVWVTAYNRTEKWAGGLYVDHSRGDDTLAVWTKQNREIVNKDIV  619

Query  292   LWYTLGFHHLPCQEDFPVMPTVTSTFQLKPVNFFDRNPIIQA  167
             +W+ +G HH+P QEDFP+MP ++++F+L+P NFF+RNP+++ 
Sbjct  620   MWHVVGIHHVPAQEDFPIMPLLSTSFELRPTNFFERNPVLKT  661



>ref|XP_004156111.1| PREDICTED: LOW QUALITY PROTEIN: primary amine oxidase-like [Cucumis 
sativus]
Length=675

 Score =   556 bits (1432),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 281/653 (43%), Positives = 413/653 (63%), Gaps = 28/653 (4%)
 Frame = -1

Query  2083  HPLDPLTIQEIERTRSILSSYQPFSGSSLRIHSLSLDEPDKSEVLRW---KRGNPLPTRK  1913
             HP DPL+  EI+   S + S        L  H + +++P+K +VL W    R  PLP R+
Sbjct  26    HPFDPLSSLEIQIVTSTVKSKFTNIAQRLTFHYVGIEDPNKPDVLSWVANPRSPPLP-RQ  84

Query  1912  AFVVALSNGQAHLLVVDLGSGR---VSSHTRNPASGYPPMSADDASTALEATFSNSVFRE  1742
             AFVV  +N Q H  +V L +G+   VS H     +G+P ++  +   A+E +  +  F  
Sbjct  85    AFVVVRANKQTHEFIVSLANGKGSIVSEHVYQ-GTGFPTLTLQEQEEAIEVSLKHQPFIS  143

Query  1741  AISTRGVEINDVVCSAAAPGWFG-PEEEGRRITKVKCYTAQNTPNYYMRPIEGLLLTVDL  1565
             +I  RG+ I+DVV SA + GW+G  + E +RI KV  +  ++T N ++RPIEG+  TVDL
Sbjct  144   SIEKRGLNISDVVGSAFSIGWYGEAQSETKRIVKVXVFYKESTVNVWLRPIEGIETTVDL  203

Query  1564  DSGKVINVYDTHSPIPIPKAQGTDYRRDGIEHRAPGVEPLKPISMEQPNGQSFRV-----  1400
             D   +  + D H  + +PK++GT+Y+   +  R P +   KPI + QP+G SF V     
Sbjct  204   DDMVLTELKDIHVSV-MPKSEGTEYQASTM--RPPFLAETKPILVNQPHGPSFVVRGHTV  260

Query  1399  ---EDGYIVKWASWEFHVKADQRAGIIISQATVFDPEAGKRRSVMYKGFASELFVPYMDV  1229
                E   +V WA+W+FH+  D R G++IS A+++D +  K+R V+Y+G  SELFVPY D 
Sbjct  261   RFEEKVALVTWANWDFHLSFDMRVGVVISTASIYDIDQQKKRQVLYRGQISELFVPYQDP  320

Query  1228  DEGWYFRAFMDAGEFGLGATAMELVPLNDCPRHSHYIDGLFVDPDGRPVSQPNVICVFER  1049
              E WY+R FMDAGEFG+G++A+ L P +DCP ++ + D      DG PV   N  C+FE+
Sbjct  321   TEEWYYRTFMDAGEFGMGSSAVALEPHHDCPSNAMFFDAYHAGQDGTPVKLENAYCMFEK  380

Query  1048  YSGDIAWRHSGTGDADDDLIREARPKVSLVVRTTATVGNYDYIFDWEFQTDGSIRVTVGL  869
             Y+GDIAWRH+       +LIRE R +VSLV+RT   +GNYDYI DWE +  G+I+++V L
Sbjct  381   YAGDIAWRHT-EAVIPGELIREVRREVSLVIRTITVIGNYDYILDWELKKCGTIKLSVSL  439

Query  868   SGIILAKGSPYEHINQFEIPRWDFPAGSLVSENTIGVAHDHFITFHLDMDVDGPTNSFVK  689
             +GI+  K + Y+H ++ +   +    G LV+ NTIG+ HDHFIT++LD+D+DG  NSF K
Sbjct  440   TGIMEGKTTTYKHESEVKEEIY----GLLVAPNTIGINHDHFITYYLDLDIDGQENSFQK  495

Query  688   VDLVKNYNIAGKIQRKSYWSPKRKVAKSENDAKIKLQLDKPSEFHVINPRHQSRLGNPSG  509
             + L K++   G   RKSYWS   +  K E DA+  L+  +P E H++NP  ++ +GN  G
Sbjct  496   LKL-KSFRTDGSTPRKSYWSVVSEEVKKELDAR--LRPTEPVELHIVNPNKKTAVGNKVG  552

Query  508   YKIVPSATAASLLDLQDPPQLRAAFTNNQIWVTPYNRSEQWAGGLFTYQSHGDDTLAVWS  329
             Y+++P   A  LL   D PQ+R +  +  IWVTPYN+SE+WAGG++  + HGD TL   +
Sbjct  553   YRLIPGPMAIPLLSEDDYPQIRGSLCDYDIWVTPYNKSEKWAGGMYVDRGHGDKTLTQIT  612

Query  328   NRNRVIEKQDIVLWYTLGFHHLPCQEDFPVMPTVTSTFQLKPVNFFDRNPIIQ  170
              +NR I  +DIVLW+T+GFHH P Q++FP+MPT+T  F+L+P NFFDRNPI++
Sbjct  613   EQNRDINNKDIVLWHTIGFHHHPSQDEFPIMPTLTGGFELRPTNFFDRNPILK  665



>sp|P49252.3|AMO_LENCU RecName: Full=Primary amine oxidase; AltName: Full=Amine oxidase 
[copper-containing]; Flags: Precursor, partial [Lens culinaris]
 gb|AAB34918.3| copper amine oxidase, partial [Lens culinaris]
Length=667

 Score =   555 bits (1431),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 271/644 (42%), Positives = 414/644 (64%), Gaps = 16/644 (2%)
 Frame = -1

Query  2083  HPLDPLTIQEIERTRSILSSYQPFSGSSLRIHSLSLDEPDKSEVLRWKRGNPLPT--RKA  1910
             HPLDP+T +E    ++I+ +  P S + L  H + +D+P+K  VL+++    L +  RK 
Sbjct  26    HPLDPITKEEFLAVQTIVQNKYPISNNKLAFHYIGVDDPEKDLVLKYETSPTLISIPRKI  85

Query  1909  FVVALSNGQAHLLVVDLGSGRVSSHTRNPASGYPPMSADDASTALEATFSNSVFREAIST  1730
             FVVA+ N Q H +++DL    + S   +   G+P +SA +   A++       F  +++ 
Sbjct  86    FVVAIINSQTHEILIDLTIKSIVSDNIHNGYGFPVLSAAEQFLAIDLPLKYPPFIASVNK  145

Query  1729  RGVEINDVVCSAAAPGWFGPEEEGRRITKVKCYTAQNTPNYYMRPIEGLLLTVDLDSGKV  1550
             RG+ I+++VCS+   GWFG EE+  R  +V C+  ++T N Y+RPI G+ +  DLD  K+
Sbjct  146   RGLNISEIVCSSFTMGWFG-EEKNSRTVRVDCFMKESTVNIYVRPITGITIVADLDLMKI  204

Query  1549  INVYDTHSPIPIPKAQGTDYRRDGIEHRAPGVEPLK-PISMEQPNGQSFRVEDGYIVKWA  1373
             +  +D  +   +P A+ T+Y+   +  ++P   P +  ++  QP G  F++ +G  V WA
Sbjct  205   VEYHDRDTE-AVPTAENTEYQ---VSKQSPPFGPKQHSLTSHQPQGPGFQI-NGTSVSWA  259

Query  1372  SWEFHVKADQRAGIIISQATVFDPEAGKRRSVMYKGFASELFVPYMDVDEGWYFRAFMDA  1193
             +W+FH+  D RAGI+IS A+++D E  K R V+YKG+ SELFVPY D  E +YF+ F D+
Sbjct  260   NWKFHIGFDVRAGIVISLASIYDLEKHKSRRVLYKGYISELFVPYQDPTEEFYFKTFFDS  319

Query  1192  GEFGLGATAMELVPLNDCPRHSHYIDGLFVDPDGRPVSQPNVICVFERYSGDIAWRHSGT  1013
             GEFG G + + L+P  DCP H+ +ID      DG P+   N ICVFE+Y G+I WRH+ T
Sbjct  320   GEFGFGLSTVSLIPNRDCPPHAQFIDTYIHSADGTPIFLENAICVFEQY-GNIMWRHTET  378

Query  1012  GDADDDLIREARPKVSLVVRTTATVGNYDYIFDWEFQTDGSIRVTVGLSGIILAKGSPYE  833
             G  ++  I E+R +V L +RT  TVGNYD + DWEF+T G ++ ++ LSGI+  KG+  +
Sbjct  379   GIPNES-IEESRTEVDLAIRTVVTVGNYDNVLDWEFKTSGWMKPSIALSGILEIKGTNIK  437

Query  832   HINQFEIPRWDFPAGSLVSENTIGVAHDHFITFHLDMDVDGPTNSFVKVDLVKNYNIAGK  653
             H ++ +    +   G LVS N+IG+ HDHF  ++LD D+DG  NSF K  L     + G 
Sbjct  438   HKDEIK----EEIHGKLVSANSIGIYHDHFYIYYLDFDIDGTQNSFEKTSLKTVRIVDGG  493

Query  652   IQRKSYWSPKRKVAKSENDAKIKLQLDKPSEFHVINPRHQSRLGNPSGYKIVPSATAASL  473
              +RKSYW+ + + AK+E+DAKI + L  P+E  V+NP  ++ +GN  GY+++P+  A  L
Sbjct  494   SKRKSYWTTETQTAKTESDAKITIGL-APAELVVVNPNIKTAVGNEVGYRLIPAIPAHPL  552

Query  472   LDLQDPPQLRAAFTNNQIWVTPYNRSEQWAGGLFTYQSHGDDTLAVWSNRNRVIEKQDIV  293
             L   D PQ+R AFTN  +WVTPYNR+E+WAGGL+   S GDDTLAVW+ +NR I  +DIV
Sbjct  553   LTEDDYPQIRGAFTNYNVWVTPYNRTEKWAGGLYVDHSRGDDTLAVWTKKNREIVNKDIV  612

Query  292   LWYTLGFHHLPCQEDFPVMPTVTSTFQLKPVNFFDRNPIIQANP  161
             +W+ +G HH+P QEDFP+MP ++++F+L+P NFF+RNP+++  P
Sbjct  613   MWHVVGIHHVPAQEDFPIMPLLSTSFELRPTNFFERNPVLKTLP  656



>emb|CAH10210.1| copper/topa quinone amine oxidase precursor [Lathyrus sativus]
Length=649

 Score =   555 bits (1429),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 275/642 (43%), Positives = 413/642 (64%), Gaps = 16/642 (2%)
 Frame = -1

Query  2083  HPLDPLTIQEIERTRSILSSYQPFSGSSLRIHSLSLDEPDKSEVLRWKRGNPLPT--RKA  1910
             HPLDPLT +E    ++I+ +  P S + L  H + LD+P+K  VLR++    L +  RK 
Sbjct  8     HPLDPLTKEEFLAVQTIVQNKYPISKNKLAFHYIGLDDPEKDLVLRYETHPTLVSIPRKI  67

Query  1909  FVVALSNGQAHLLVVDLGSGRVSSHTRNPASGYPPMSADDASTALEATFSNSVFREAIST  1730
             FVVA+ N Q H ++++L    + S   +   G+P +SA + + A+E       F  ++  
Sbjct  68    FVVAIINSQTHEILINLRIRSIVSDNIHNGYGFPVLSAAEQTLAIELPLKYPPFIASVKK  127

Query  1729  RGVEINDVVCSAAAPGWFGPEEEGRRITKVKCYTAQNTPNYYMRPIEGLLLTVDLDSGKV  1550
             RG+ ++++VCS+   GWFG EE+  R  +V C+  ++T N Y+RPI G+ +  DLD  K+
Sbjct  128   RGLNLSEIVCSSFTMGWFG-EEKNVRTVRVDCFMKESTVNIYVRPITGITIVADLDLMKI  186

Query  1549  INVYDTHSPIPIPKAQGTDYRRDGIEHRAPGVEPLK-PISMEQPNGQSFRVEDGYIVKWA  1373
             +  +D      +P A+ T+Y+   +  ++P   P +  ++  QP G  F++ +G+ V WA
Sbjct  187   VEYHDRDIE-AVPTAENTEYQ---VSKQSPPFGPKQHSLTSHQPQGPGFQI-NGHSVSWA  241

Query  1372  SWEFHVKADQRAGIIISQATVFDPEAGKRRSVMYKGFASELFVPYMDVDEGWYFRAFMDA  1193
             +W+FH+  D RAGI+IS A+++D E  K R V+YKG+ SELFVPY D  E +YF+ F D+
Sbjct  242   NWKFHIGFDVRAGIVISLASIYDLEKHKSRRVLYKGYISELFVPYQDPTEEFYFKTFFDS  301

Query  1192  GEFGLGATAMELVPLNDCPRHSHYIDGLFVDPDGRPVSQPNVICVFERYSGDIAWRHSGT  1013
             GEFG G + + L+P  DCP H+ +ID      DG P    N ICVFE+Y G+I WRH+ T
Sbjct  302   GEFGFGQSTVPLIPNRDCPPHAQFIDTYIHLADGTPNLLKNAICVFEQY-GNIMWRHTET  360

Query  1012  GDADDDLIREARPKVSLVVRTTATVGNYDYIFDWEFQTDGSIRVTVGLSGIILAKGSPYE  833
             G   ++ I E+R +V+L+VRT  TVGNYD + DWEF+  GSI+  + LSGI+  KG+  +
Sbjct  361   G-IPNEFIEESRTEVNLIVRTIVTVGNYDNVIDWEFKASGSIKPAIALSGILEIKGTNIK  419

Query  832   HINQFEIPRWDFPAGSLVSENTIGVAHDHFITFHLDMDVDGPTNSFVKVDLVKNYNIAGK  653
             H ++ +    +   G LVS N+IG+ HDHF  ++LD D+DG  NSF K  L       G 
Sbjct  420   HKDEIK----EDIHGKLVSANSIGIYHDHFYIYYLDFDIDGTHNSFEKTSLKTVRITDGS  475

Query  652   IQRKSYWSPKRKVAKSENDAKIKLQLDKPSEFHVINPRHQSRLGNPSGYKIVPSATAASL  473
              +RKSYW+ + + AK+E+DAKI + L  P+E  V+NP  ++ +GN  GY+++P+  A  L
Sbjct  476   SKRKSYWTTETQTAKTESDAKITIGL-APAELVVVNPNIKTAVGNEVGYRLMPAIPAHPL  534

Query  472   LDLQDPPQLRAAFTNNQIWVTPYNRSEQWAGGLFTYQSHGDDTLAVWSNRNRVIEKQDIV  293
             L   D PQ+R AFTN  +WVTPYNR+E+WAGGL+   S GDDTLAVW+ +NR IE +DIV
Sbjct  535   LTEDDYPQVRGAFTNYNVWVTPYNRTEKWAGGLYVDHSRGDDTLAVWTKQNREIENKDIV  594

Query  292   LWYTLGFHHLPCQEDFPVMPTVTSTFQLKPVNFFDRNPIIQA  167
             +W+ +G HH+P QEDFP+MP ++++F+L+P NFF+RNP+++ 
Sbjct  595   MWHVVGIHHVPAQEDFPIMPLLSTSFELRPTNFFERNPVLKT  636



>ref|XP_007225123.1| hypothetical protein PRUPE_ppa002675mg [Prunus persica]
 gb|EMJ26322.1| hypothetical protein PRUPE_ppa002675mg [Prunus persica]
Length=646

 Score =   554 bits (1427),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 286/650 (44%), Positives = 401/650 (62%), Gaps = 26/650 (4%)
 Frame = -1

Query  2101  FADRPMHPLDPLTIQEIERTRSILSSYQPFSGSSLRIHSLSLDEPDKSEVLRW----KRG  1934
             F+    HPLD L   EI + R  +      S  +L  H +  +EP+KS+VL+W    ++ 
Sbjct  16    FSASTSHPLDTLNPTEINKIRLTVQKSHLGSLPNLTFHFVDTEEPEKSDVLKWLSSSEKK  75

Query  1933  NPLPTRKAFVVALSNGQAHLLVVDLGSGRVSSHTRNPASGYPPMSADDASTALEATFSNS  1754
                P R A VVA + GQ H L+VDL +G V S       GYPP+S  +     +   S+ 
Sbjct  76    RSTPPRHAKVVARAGGQTHELIVDLATGSVISDHVYTGHGYPPLSFTELFQVSKLPLSHP  135

Query  1753  VFREAISTRGVEINDVVCSAAAPGWFGPEEEGRRITKVKCYTAQNTPNYYMRPIEGLLLT  1574
              F+ +IS RG+ +++V C   + GW+G E   +R  KV+C+    + N + RPIEG+ + 
Sbjct  136   KFKRSISARGLNLSEVSCLPFSIGWYG-EHTTKRAVKVQCFYRGGSVNVFTRPIEGITML  194

Query  1573  VDLDSGKVINVYDTHSPIPIPKAQGTDYRR-DGIEHRAPGVEPLKPISMEQPNGQSFRVE  1397
             VD+D  + I +Y      P+PKA+GTD++   G  + A         S  + N   F + 
Sbjct  195   VDIDLMQ-ITMYTDRLRAPLPKAEGTDFQTPKGNSNSA---------SCNKTN-SGFTIS  243

Query  1396  DGYIVKWASWEFHVKADQRAGIIISQATVFDPEAGKRRSVMYKGFASELFVPYMDVDEGW  1217
              G+ VKWA+W FHV  + RAG++IS A+VFD    K RSV+Y+G  SE FVPYMD    W
Sbjct  244   -GHKVKWANWVFHVGFNARAGVVISTASVFDSRKKKYRSVLYRGHVSETFVPYMDPTSEW  302

Query  1216  YFRAFMDAGEFGLGATAMELVPLNDCPRHSHYIDGLFVDPDGRPVSQPNVICVFERYSGD  1037
             YF+ FMD GEFG G +A  L PL DCP ++ Y+DG     DG+P      IC+FER+SGD
Sbjct  303   YFKTFMDLGEFGFGRSADSLQPLIDCPENAKYVDGYMAGADGKPQKVQRAICIFERFSGD  362

Query  1036  IAWRHSGTGDADDDLIREARPKVSLVVRTTATVGNYDYIFDWEFQTDGSIRVTVGLSGII  857
             +A RH+   +    LIR  + + +LVVR  ATVGNYDY+ DWEF+  G+I+V VGL+G++
Sbjct  363   VAMRHTEI-NVPGKLIRSGQQEKTLVVRMVATVGNYDYVLDWEFEQSGTIKVGVGLTGVL  421

Query  856   LAKGSPYEHINQFEIPRWDFPAGSLVSENTIGVAHDHFITFHLDMDVDGPTNSFVKVDL-  680
               K + Y + +Q     +    G+LVSENT+ V HDHF+T+ LD+DVDG  NSFVK +L 
Sbjct  422   EMKATSYTNNDQITESVY----GTLVSENTVAVNHDHFLTYFLDLDVDGNDNSFVKSNLQ  477

Query  679   -VKNYNIAGKIQRKSYWSPKRKVAKSENDAKIKLQLDKPSEFHVINPRHQSRLGNPSGYK  503
               +   +     RKSYW   ++ AK+E +A+I+L L+ P+E  ++NP   +RLGN  GY+
Sbjct  478   TARTNPVNATSPRKSYWRVVKETAKTEAEARIRLGLE-PAELLIVNPSRMTRLGNVVGYR  536

Query  502   IVPSATAASLLDLQDPPQLRAAFTNNQIWVTPYNRSEQWAGGLFTYQSHGDDTLAVWSNR  323
             ++      SLL   D PQ+RAA+T  Q+WVT YN+SE+WAGG +  +SHGDD LAVWS R
Sbjct  537   LITGQPVTSLLADDDYPQIRAAYTKYQVWVTAYNKSEKWAGGFYADRSHGDDGLAVWSKR  596

Query  322   NRVIEKQDIVLWYTLGFHHLPCQEDFPVMPTVTSTFQLKPVNFFDRNPII  173
             NR IE +DIV+WYT+GFHH+P QEDFP MPT+   F+L+P NFF+ NP++
Sbjct  597   NRAIENKDIVVWYTVGFHHIPYQEDFPAMPTLHGGFELRPANFFESNPLL  646



>ref|XP_009593546.1| PREDICTED: primary amine oxidase-like [Nicotiana tomentosiformis]
Length=654

 Score =   554 bits (1427),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 280/647 (43%), Positives = 405/647 (63%), Gaps = 31/647 (5%)
 Frame = -1

Query  2083  HPLDPLTIQEIERTRSILSSYQPFSGSSLRIHSLSLDEPDKSEVLRW----KRGNP-LPT  1919
             HPLDPL   EI + R I+ +    S S+L  H + L+EP+K +VL W    K  N   P 
Sbjct  29    HPLDPLNPAEINQIRVIIQNSHLGSLSNLTFHFVDLEEPEKKDVLHWLSLHKPNNASFPY  88

Query  1918  RKAFVVALSNGQAHLLVVDLGSGRVSSHTRNPASGYPPMSADDASTALEATFSNSVFREA  1739
             R+A VV  ++G+ H + +DL +  + S       G+PP + ++   +   T ++  F+++
Sbjct  89    RRARVVVRASGETHEVTLDLAASSIISQKLYSGHGFPPFTLNELIQSSILTLTSPKFQDS  148

Query  1738  ISTRGVEINDVVCSAAAPGWFGPEEEGRRITKVKCYTAQNTPNYYMRPIEGLLLTVDLDS  1559
             I TRG+ I++V C   + GWFG + + RR+  V C+    T N++ RPIEG+ + VD++S
Sbjct  149   ILTRGLNISEVSCIPLSVGWFG-QLKTRRLLSVPCFYRGGTTNFWARPIEGITILVDVES  207

Query  1558  GKVINVYDTHSPIPIPKAQGTDYRRDGIEHRAPGVEPLKPISMEQPNGQSFRVEDGYIVK  1379
              K+I   D     P+P+A+ +++             P +          S     G+ V+
Sbjct  208   MKIIKYVDRFRA-PLPEAKDSNFN-----------SPSQGSVTCNDTVPSMLNIQGHEVR  255

Query  1378  WASWEFHVKADQRAGIIISQATVFDPEAGKRRSVMYKGFASELFVPYMDVDEGWYFRAFM  1199
             WA+W+FHV  + RAG+IIS A++FD    K R V+Y+G  SE FVPYMD    WY+R F+
Sbjct  256   WANWKFHVGFNTRAGMIISTASIFDSARNKYRRVLYRGHVSETFVPYMDPTSEWYYRTFL  315

Query  1198  DAGEFGLGATAMELVPLNDCPRHSHYIDGLFVDPDGRPVSQPNVICVFERYSGDIAWRHS  1019
             D GEFG G +A  LVP  DCP ++ Y+DG   D +G+ V  P  IC+FERY+GD AWRH+
Sbjct  316   DVGEFGFGRSASTLVPSLDCPNNAVYMDGYMADSEGQVVQVPQAICIFERYAGDAAWRHT  375

Query  1018  GTGDADDDLIREARPKVSLVVRTTATVGNYDYIFDWEFQTDGSIRVTVGLSGIILAKGSP  839
               G    +L  + + +V+LVVR  ATVGNYDYI DWEF+  GSI+V V L+G++  K   
Sbjct  376   EIG-VPGNLNTKGQQEVNLVVRMVATVGNYDYILDWEFKQSGSIKVGVSLTGVMEMKAVR  434

Query  838   YEHINQFEIPRWDFPAGSLVSENTIGVAHDHFITFHLDMDVDGPTNSFVKVDL----VKN  671
             Y + NQ     +    G+LV+EN I V HDHF+T+H+D+DVDG  NSF+K +L    VK+
Sbjct  435   YTNHNQINQDVY----GTLVAENAIAVNHDHFLTYHIDLDVDGSKNSFLKANLQTARVKD  490

Query  670   YNIAGKIQRKSYWSPKRKVAKSENDAKIKLQLDKPSEFHVINPRHQSRLGNPSGYKIVPS  491
               ++    RKSYW+  +K+ K+E DAK +L L KP+E   +N   ++++GN  GYK++P 
Sbjct  491   QRMS---PRKSYWTVVKKIMKTEVDAKTQLGL-KPAELWFVNANKKTKVGNDVGYKLIPG  546

Query  490   ATAASLLDLQDPPQLRAAFTNNQIWVTPYNRSEQWAGGLFTYQSHGDDTLAVWSNRNRVI  311
               + SLL   D PQ+RAA+T  Q+WVTPYN+SE+WA G +   SHGDD L +WS RNR I
Sbjct  547   RPSMSLLSNDDYPQMRAAYTKYQLWVTPYNKSERWAAGFYADGSHGDDGLVIWSRRNRSI  606

Query  310   EKQDIVLWYTLGFHHLPCQEDFPVMPTVTSTFQLKPVNFFDRNPIIQ  170
             E +DIVLWYTLGFHH+PCQED+P+MPT+   F+L+P NFF++NP+++
Sbjct  607   ENKDIVLWYTLGFHHIPCQEDYPIMPTIYDAFELRPTNFFEKNPLLE  653



>ref|XP_004140258.1| PREDICTED: primary amine oxidase-like, partial [Cucumis sativus]
Length=663

 Score =   553 bits (1424),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 281/651 (43%), Positives = 411/651 (63%), Gaps = 28/651 (4%)
 Frame = -1

Query  2083  HPLDPLTIQEIERTRSILSSYQPFSGSSLRIHSLSLDEPDKSEVLRW---KRGNPLPTRK  1913
             HP DPL+  EI+   S + S        L  H + +++P+K +VL W    R  PLP R+
Sbjct  26    HPFDPLSSLEIQIVTSTVKSKFTNIAQRLTFHYVGIEDPNKPDVLSWVANPRSPPLP-RQ  84

Query  1912  AFVVALSNGQAHLLVVDLGSGR---VSSHTRNPASGYPPMSADDASTALEATFSNSVFRE  1742
             AFVV  +N Q H  +V L +G+   VS H     +G+P ++  +   A+E +  +  F  
Sbjct  85    AFVVVRANKQTHEFIVSLANGKGSIVSEHVYQ-GTGFPTLTLQEQEEAIEVSLKHQPFIS  143

Query  1741  AISTRGVEINDVVCSAAAPGWFG-PEEEGRRITKVKCYTAQNTPNYYMRPIEGLLLTVDL  1565
             +I  RG+ I+DVV SA + GW+G  + E +RI KV  +  ++T N ++RPIEG+  TVDL
Sbjct  144   SIEKRGLNISDVVGSAFSIGWYGEAQSETKRIVKVLFFYKESTVNVWLRPIEGIETTVDL  203

Query  1564  DSGKVINVYDTHSPIPIPKAQGTDYRRDGIEHRAPGVEPLKPISMEQPNGQSFRV-----  1400
             D   +  + D H  + +PK++GT+Y+   +  R P +   KPI + QP+G SF V     
Sbjct  204   DDMVLTELKDIHVSV-MPKSEGTEYQASTM--RPPFLAETKPILVNQPHGPSFVVRGHTV  260

Query  1399  ---EDGYIVKWASWEFHVKADQRAGIIISQATVFDPEAGKRRSVMYKGFASELFVPYMDV  1229
                E   +V WA+W+FH+  D R G++IS A+++D +  K+R V+Y+G  SELFVPY D 
Sbjct  261   RFEEKVALVTWANWDFHLSFDMRVGVVISTASIYDIDQQKKRQVLYRGQISELFVPYQDP  320

Query  1228  DEGWYFRAFMDAGEFGLGATAMELVPLNDCPRHSHYIDGLFVDPDGRPVSQPNVICVFER  1049
              E WY+R FMDAGEFG+G++A+ L P +DCP ++ + D      DG PV   N  C+FE+
Sbjct  321   TEEWYYRTFMDAGEFGMGSSAVALEPHHDCPSNAMFFDAYHAGQDGTPVKLENAYCMFEK  380

Query  1048  YSGDIAWRHSGTGDADDDLIREARPKVSLVVRTTATVGNYDYIFDWEFQTDGSIRVTVGL  869
             Y+GDIAWRH+       +LIRE R +VSLV+RT   +GNYDYI DWE +  G+I+++V L
Sbjct  381   YAGDIAWRHT-EAVIPGELIREVRREVSLVIRTITVIGNYDYILDWELKKCGTIKLSVSL  439

Query  868   SGIILAKGSPYEHINQFEIPRWDFPAGSLVSENTIGVAHDHFITFHLDMDVDGPTNSFVK  689
             +GI+  K + Y+H ++ +   +    G LV+ NTIG+ HDHFIT++LD+D+DG  NSF K
Sbjct  440   TGIMEGKTTTYKHESEVKEEIY----GLLVAPNTIGINHDHFITYYLDLDIDGQENSFQK  495

Query  688   VDLVKNYNIAGKIQRKSYWSPKRKVAKSENDAKIKLQLDKPSEFHVINPRHQSRLGNPSG  509
             + L K++   G   RKSYWS   +  K E DA+  L+  +P E H++NP  ++ +GN  G
Sbjct  496   LKL-KSFRTDGSTPRKSYWSVVSEEVKKELDAR--LRPTEPVELHIVNPNKKTAVGNKVG  552

Query  508   YKIVPSATAASLLDLQDPPQLRAAFTNNQIWVTPYNRSEQWAGGLFTYQSHGDDTLAVWS  329
             Y+++P   A  LL   D PQ+R +  +  IWVTPYN+SE+WAGG++  + HGD TL   +
Sbjct  553   YRLIPGPMAIPLLSEDDYPQIRGSLCDYDIWVTPYNKSEKWAGGMYVDRGHGDKTLTQIT  612

Query  328   NRNRVIEKQDIVLWYTLGFHHLPCQEDFPVMPTVTSTFQLKPVNFFDRNPI  176
              +NR I  +DIVLW+T+GFHH P Q++FP+MPT+T  F+L+P NFFDRNPI
Sbjct  613   EQNRDINNKDIVLWHTIGFHHHPSQDEFPIMPTLTGGFELRPTNFFDRNPI  663



>ref|XP_008449551.1| PREDICTED: primary amine oxidase-like [Cucumis melo]
Length=689

 Score =   553 bits (1425),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 280/645 (43%), Positives = 409/645 (63%), Gaps = 21/645 (3%)
 Frame = -1

Query  2083  HPLDPLTIQEIERTRSILSSYQPFSGSSLRIHSLSLDEPDKSEVLRW---KRGNPLPTRK  1913
             HP DPL+  EI+   S + S        L  H + +++P+K  VL W    R  PLP R+
Sbjct  55    HPFDPLSPLEIQIVTSTVKSKFTNIAQRLTFHYVGIEDPNKPAVLSWVANPRSPPLP-RQ  113

Query  1912  AFVVALSNGQAHLLVVDLGSGR---VSSHTRNPASGYPPMSADDASTALEATFSNSVFRE  1742
             AFVV  +N Q H  +V L +G+   VS H     +GYP ++ ++   A+E +  +  F  
Sbjct  114   AFVVVRANKQTHEFIVSLANGKGSIVSEHVYQ-GNGYPTLTLEEQEEAIEVSLKHQPFIS  172

Query  1741  AISTRGVEINDVVCSAAAPGWFG-PEEEGRRITKVKCYTAQNTPNYYMRPIEGLLLTVDL  1565
             +I  RG+ I+DVV S  + GWFG  + E +RI KV  +  ++T N ++RPIEG+  TVDL
Sbjct  173   SIEKRGLNISDVVGSVFSIGWFGEAQSETKRIVKVLFFYKESTVNVWLRPIEGIETTVDL  232

Query  1564  DSGKVINVYDTHSPIPIPKAQGTDYRRDGIEHRAPGVEPLKPISMEQPNGQSFRVEDGYI  1385
             D   +  + D H  + +P ++GT+Y+   +  R P V   KPI + QP+G SF V  G+ 
Sbjct  233   DDMVLTELKDIHVSV-MPSSEGTEYQASTM--RPPFVAETKPILVNQPHGPSFVVR-GHT  288

Query  1384  VKWASWEFHVKADQRAGIIISQATVFDPEAGKRRSVMYKGFASELFVPYMDVDEGWYFRA  1205
             V WA+W+FH+  D R G++IS A+++D +  K R V+Y+G  SELFVPY D  E WY+R 
Sbjct  289   VSWANWDFHLSFDMRVGVVISTASIYDIDQQKNRQVLYRGQISELFVPYQDPTEEWYYRT  348

Query  1204  FMDAGEFGLGATAMELVPLNDCPRHSHYIDGLFVDPDGRPVSQPNVICVFERYSGDIAWR  1025
             FMDAGEFG+G++A+ L P +DCP ++ + D      DG PV   N  C+FE+Y+GDIAWR
Sbjct  349   FMDAGEFGMGSSAVALEPHHDCPSNAVFFDAFHAGQDGTPVKLENAYCMFEKYAGDIAWR  408

Query  1024  HSGTGDADDDLIREARPKVSLVVRTTATVGNYDYIFDWEFQTDGSIRVTVGLSGIILAKG  845
             H+        LIRE R +VSLV+RT   +GNYDYI DWE +  G+I+++V L+GI+  K 
Sbjct  409   HT-EAVIPGKLIREVRREVSLVIRTITVIGNYDYILDWELKKCGTIKLSVSLTGIMEGKT  467

Query  844   SPYEHINQFEIPRWDFPAGSLVSENTIGVAHDHFITFHLDMDVDGPTNSFVKVDLVKNYN  665
             + Y+H ++ +   +    G LV+ NTIG+ HDHFIT++LD+D+DG  NSF K+ L K++ 
Sbjct  468   TTYKHESEVKEEIY----GLLVAPNTIGINHDHFITYYLDLDIDGQENSFHKLKL-KSFK  522

Query  664   IAGKIQRKSYWSPKRKVAKSENDAKIKLQLDKPSEFHVINPRHQSRLGNPSGYKIVPSAT  485
               G   RKSYWS   +  K E DA+  L+  +P E H++NP  ++ +GN  GY+++P   
Sbjct  523   TDGSTPRKSYWSVVSEEVKKELDAR--LRPTEPVELHIVNPNKKTAVGNKVGYRLIPGPM  580

Query  484   AASLLDLQDPPQLRAAFTNNQIWVTPYNRSEQWAGGLFTYQSHGDDTLAVWSNRNRVIEK  305
             A  LL   D PQ+R +  +  IWVTP+N+SE+WAGG++  + HGD T+   + +NR I  
Sbjct  581   AIPLLSEDDYPQIRGSLCDYDIWVTPFNKSEKWAGGMYVDRGHGDKTITHITQQNRDINN  640

Query  304   QDIVLWYTLGFHHLPCQEDFPVMPTVTSTFQLKPVNFFDRNPIIQ  170
             +DIVLW+T+GFHH P Q++FP+MPT+T  F+L+P NFFDRNPI++
Sbjct  641   KDIVLWHTIGFHHHPSQDEFPIMPTLTGGFELRPTNFFDRNPILK  685



>ref|XP_009794721.1| PREDICTED: primary amine oxidase [Nicotiana sylvestris]
Length=656

 Score =   551 bits (1421),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 282/645 (44%), Positives = 393/645 (61%), Gaps = 26/645 (4%)
 Frame = -1

Query  2083  HPLDPLTIQEIERTRSILSSYQPFSGSSLRIHSLSLDEPDKSEVLRW-----KRGN-PLP  1922
             HPLDPL   EI + R I+      S S+L  H + ++EP+K +VL W     K+ N   P
Sbjct  30    HPLDPLNPTEINKIRVIIQKSHLSSLSNLTFHFVDIEEPEKKDVLHWISLHYKQENVRFP  89

Query  1921  TRKAFVVALSNGQAHLLVVDLGSGRVSSHTRNPASGYPPMSADDASTALEATFSNSVFRE  1742
              R+A VV  +NG+   +VVDL +  + S       G+PP++ D+       T  N  F++
Sbjct  90    YRRAKVVVRANGETFEVVVDLATRSIISENVYTGHGFPPLTLDEIVQCSRLTLRNPKFQD  149

Query  1741  AISTRGVEINDVVCSAAAPGWFGPEEEGRRITKVKCYTAQNTPNYYMRPIEGLLLTVDLD  1562
             +I  RG+ I++V C     GWFG +   RR+  V C+    T N++ RPIEG+   VD++
Sbjct  150   SILKRGLNISEVSCIPQPVGWFG-QPRTRRVLNVPCFYRNGTTNFWARPIEGITTIVDVE  208

Query  1561  SGKVINVYDTHSPIPIPKAQGTDYRRDGIEHRAPGVEPLKPISMEQPNGQSFRVEDGYIV  1382
             S K+I   D    +P+P+A+  D++       A               G S  +  G  V
Sbjct  209   SIKIIKYMDRFR-VPLPEAESADFQSSSQRSVAC-----------NDTGTSRIIIKGNEV  256

Query  1381  KWASWEFHVKADQRAGIIISQATVFDPEAGKRRSVMYKGFASELFVPYMDVDEGWYFRAF  1202
             KW +W FHV  + RAG I+S A++FD    + R V+Y+G  SE FVPYMD    WY+R F
Sbjct  257   KWDNWIFHVGLNTRAGTIVSTASIFDHTRNEYRHVLYRGHVSETFVPYMDPTFEWYYRTF  316

Query  1201  MDAGEFGLGATAMELVPLNDCPRHSHYIDGLFVDPDGRPVSQPNVICVFERYSGDIAWRH  1022
             MD GEFG G +A  LVPL DCP ++ Y+DG   D +G  V  PN IC+FERY GD AWRH
Sbjct  317   MDIGEFGFGRSASSLVPLLDCPNNAVYMDGYMADSEGHVVQVPNAICMFERYVGDAAWRH  376

Query  1021  SGTGDADDDLIREARPKVSLVVRTTATVGNYDYIFDWEFQTDGSIRVTVGLSGIILAKGS  842
             +  G    ++  + + +V+LVVR  ATVGNYDY  DWEF+  G++RV V LSG++  K  
Sbjct  377   TENG-VPGNINTKGQQEVNLVVRMVATVGNYDYTLDWEFKQSGTLRVGVSLSGVMETKAV  435

Query  841   PYEHINQFEIPRWDFPAGSLVSENTIGVAHDHFITFHLDMDVDGPTNSFVKVDLVKNYNI  662
              Y + NQ     +    G+LV++NTI V HDHF+ ++LD+D+DG  N F+K  L      
Sbjct  436   KYTNDNQITEDVY----GTLVAKNTIAVNHDHFLIYYLDLDIDGTDNLFLKAKLKTRRVK  491

Query  661   AGKIQ-RKSYWSPKRKVAKSENDAKIKLQLDKPSEFHVINPRHQSRLGNPSGYKIVPSAT  485
               KI  RKSYW   ++  K+EN+AKI L L+ P+E  ++NP  ++++GN   Y+++PS  
Sbjct  492   DSKISPRKSYWKVVKETMKTENEAKIHLGLE-PAELLIVNPNKKTKIGNDVSYRLIPSRP  550

Query  484   AASLLDLQDPPQLRAAFTNNQIWVTPYNRSEQWAGGLFTYQSHGDDTLAVWSNRNRVIEK  305
             A SLL   D PQLRAA+T  Q+WVTPYN+SE+WAGG +  +S GDD LA+WS RNR IE 
Sbjct  551   AMSLLSYDDYPQLRAAYTKYQLWVTPYNKSERWAGGFYADRSRGDDGLAIWSRRNRPIEN  610

Query  304   QDIVLWYTLGFHHLPCQEDFPVMPTVTSTFQLKPVNFFDRNPIIQ  170
             +DIVLWYT+G HH+PCQEDFPVMP+    F+L+P NFF+RNP+++
Sbjct  611   KDIVLWYTVGLHHVPCQEDFPVMPSFYDGFELRPTNFFERNPLLK  655



>ref|XP_011091041.1| PREDICTED: primary amine oxidase [Sesamum indicum]
Length=646

 Score =   551 bits (1419),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 281/643 (44%), Positives = 395/643 (61%), Gaps = 24/643 (4%)
 Frame = -1

Query  2083  HPLDPLTIQEIERTRSILSSYQPFSGSSLRIHSLSLDEPDKSEVLRW----KRGNPLPTR  1916
             HPLDPLT +EI R +  +      S S+L  H + L+EPDK  VL+W    K     P+R
Sbjct  22    HPLDPLTPEEINRIKLTIQKSHFGSFSNLTFHFVDLEEPDKHHVLKWLSSDKHNGLFPSR  81

Query  1915  KAFVVALSNGQAHLLVVDLGSGRVSSHTRNPASGYPPMSADDASTALEATFSNSVFREAI  1736
             +A VV   NG+ H LVVDL +G + S       GYPP + ++   A         F+++I
Sbjct  82    QARVVIRVNGETHELVVDLITGLIVSDKVYRGHGYPPFTFNELLRASRFPLKYPQFQDSI  141

Query  1735  STRGVEINDVVCSAAAPGWFGPEEEGRRITKVKCYTAQNTPNYYMRPIEGLLLTVDLDSG  1556
             S RG+ +++V C     GWFG E   RR+ +  C+    T N + RPIEG+ L +D+++ 
Sbjct  142   SRRGLNLSEVTCLPLTTGWFG-ETVTRRVIRATCFYRGGTSNIWARPIEGISLLIDVEAM  200

Query  1555  KVINVYDTHSPIPIPKAQGTDYRRDGIEHRAPGVEPLKPISMEQPNGQSFRVEDGYIVKW  1376
             +VI   D  +  P+PKA+GTD++            P      E  +  + R  +   V+W
Sbjct  201   QVIKYVDRLNA-PLPKAEGTDFQSQ---------RPNSVFCNENNSKITIRKHE---VRW  247

Query  1375  ASWEFHVKADQRAGIIISQATVFDPEAGKRRSVMYKGFASELFVPYMDVDEGWYFRAFMD  1196
             A+WEFHV  D RAG+IIS A++FD    K R V+Y+G  SE FVPYMD    WY+R FMD
Sbjct  248   ANWEFHVAFDARAGLIISTASIFDNIKNKFRRVLYRGHVSETFVPYMDPTPEWYYRTFMD  307

Query  1195  AGEFGLGATAMELVPLNDCPRHSHYIDGLFVDPDGRPVSQPNVICVFERYSGDIAWRHSG  1016
              GEFG G +A  LVPL DCP ++ Y+DG     DG+    P  IC+FE Y+G+IAWRH+ 
Sbjct  308   VGEFGFGRSANTLVPLIDCPGNAVYMDGYMAGADGQAQKVPQAICMFESYAGNIAWRHTE  367

Query  1015  TGDADDDLIREARPKVSLVVRTTATVGNYDYIFDWEFQTDGSIRVTVGLSGIILAKGSPY  836
              G   + +I     +V+LVVR  ATVGNYDYI DWEF+  GSI++ V LSG++  K + Y
Sbjct  368   IG-VPEKVITSGEAEVNLVVRMVATVGNYDYILDWEFKKSGSIKIGVSLSGVLEMKATEY  426

Query  835   EHINQFEIPRWDFPAGSLVSENTIGVAHDHFITFHLDMDVDGPTNSFVKVDLVKNYNIAG  656
                +Q      D   G+LV+EN++   HDHF+T++LD+DVDG  NS VK  L  +     
Sbjct  427   TSTDQTTS---DHIYGTLVAENSVAGNHDHFLTYYLDLDVDGTDNSLVKAKLKTSRTQPT  483

Query  655   KIQ-RKSYWSPKRKVAKSENDAKIKLQLDKPSEFHVINPRHQSRLGNPSGYKIVPSATAA  479
              +  RKSYW   ++  K+E +A+I++ L+ P E  + NP  ++++GN  GY+++    A 
Sbjct  484   NVSPRKSYWKVVKETVKTEGEARIQMGLE-PVELLITNPNKKTKIGNNVGYRLITGQPAI  542

Query  478   SLLDLQDPPQLRAAFTNNQIWVTPYNRSEQWAGGLFTYQSHGDDTLAVWSNRNRVIEKQD  299
             SLL   D PQ+RAA+T  Q+WVT YN++E+WAGG +  +SHGDD LA+W +RNR IE +D
Sbjct  543   SLLADDDYPQMRAAYTKYQVWVTCYNKTERWAGGFYADRSHGDDGLAIWGHRNRAIENKD  602

Query  298   IVLWYTLGFHHLPCQEDFPVMPTVTSTFQLKPVNFFDRNPIIQ  170
             +VLWYT+GFHH P QEDFPVMPT+   F+L+P NFF++NP++Q
Sbjct  603   LVLWYTVGFHHSPQQEDFPVMPTLYDGFELRPANFFEKNPLLQ  645



>ref|NP_001237211.1| copper amino oxidase precursor [Glycine max]
 emb|CAE47488.1| copper amino oxidase [Glycine max]
Length=673

 Score =   551 bits (1421),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 275/643 (43%), Positives = 402/643 (63%), Gaps = 18/643 (3%)
 Frame = -1

Query  2083  HPLDPLTIQEIERTRSILSSYQPFSGSSLRIHSLSLDEPDKSEVLRWKRGNPLPT---RK  1913
             HPLDPLT QEI   ++I+ +  P S + L  H + LDEP+K  +L+W+   P      RK
Sbjct  32    HPLDPLTKQEISLVQTIVQNKYPSSSNRLSFHYIGLDEPEKDAILKWESIKPTVITVPRK  91

Query  1912  AFVVALSNGQAHLLVVDLGSGRVSSHTRNPASGYPPMSADDASTALEATFSNSVFREAIS  1733
             A  + + N Q H +++DL + R+ S   +  +G+P +S D+   A+E       F E+++
Sbjct  92    ALAIVIINSQTHEILIDLKARRIVSDNIHSGNGFPTLSVDEQVVAIELPLKYGPFIESVN  151

Query  1732  TRGVEINDVVCSAAAPGWFGPEEEGRRITKVKCYTAQNTPNYYMRPIEGLLLTVDLDSGK  1553
              RG+ +++VVCS    GWFG E + RR  +V+C+  +++PN ++RPI GL + VDL+  K
Sbjct  152   KRGLNLSEVVCSTFTMGWFG-ETKDRRTVRVECFMKESSPNIWVRPISGLAMVVDLELMK  210

Query  1552  VINVYDTHSPIPIPKAQGTDYRRDGIEHRAPGVEPLK-PISMEQPNGQSFRVEDGYIVKW  1376
             ++  +D    IP+P A  T+YR     H+ P   P +  ++  QP G  F++ +G+ + W
Sbjct  211   IVQYHDG-GIIPVPTADNTEYR---FSHQNPPFGPRQHSLATHQPQGPGFQI-NGHSISW  265

Query  1375  ASWEFHVKADQRAGIIISQATVFDPEAGKRRSVMYKGFASELFVPYMDVDEGWYFRAFMD  1196
             A+ +FH+  D RAGI+IS A+++D E  K R V+YKG+ SELFVPY D  + +Y++ F D
Sbjct  266   ANLKFHIGFDPRAGIVISLASIYDLEKHKSRRVLYKGYISELFVPYQDPTDDFYYKTFFD  325

Query  1195  AGEFGLGATAMELVPLNDCPRHSHYIDGLFVDPDGRPVSQPNVICVFERYSGDIAWRHSG  1016
             AGEFG G + + LVP  DCP ++ ++D      DG P+   N ICVFE+Y G I WRH+ 
Sbjct  326   AGEFGFGLSTVSLVPNRDCPSNAQFLDTYVHAADGTPLLIKNAICVFEQY-GSIMWRHTE  384

Query  1015  TGDADDDLIREARPKVSLVVRTTATVGNYDYIFDWEFQTDGSIRVTVGLSGIILAKGSPY  836
             TG   +    + R    L  +     G   YI DWEF+T GSI+ ++ LSGI+  KG   
Sbjct  385   TGIPMNR--SKKRDGSQLSGKNCCYRGQLRYIIDWEFKTSGSIKPSIALSGILEIKGVDI  442

Query  835   EHINQFEIPRWDFPAGSLVSENTIGVAHDHFITFHLDMDVDGPTNSFVKVDLVKNYNIAG  656
             +H ++ +  +     G LVS N+IGV HDHF  +HLD+D+DG  NSF K  L       G
Sbjct  443   KHKSEIKSDQ----HGILVSANSIGVYHDHFYIYHLDLDIDGVANSFEKTSLKTVRVTDG  498

Query  655   KIQRKSYWSPKRKVAKSENDAKIKLQLDKPSEFHVINPRHQSRLGNPSGYKIVPSATAAS  476
               +RKSYW+ + + AK+ENDAKI L L  P E  V+NP  ++ +GN  GY+++P+  A  
Sbjct  499   SSKRKSYWTTEVETAKTENDAKIILGLS-PGELSVVNPNKKTSVGNDVGYRLIPAIPAHP  557

Query  475   LLDLQDPPQLRAAFTNNQIWVTPYNRSEQWAGGLFTYQSHGDDTLAVWSNRNRVIEKQDI  296
             LL   D PQ+R AFTN  +WVTPYNR+E+WAGGL+   SHGDDTLAVW+ +NR I  +DI
Sbjct  558   LLTDDDYPQIRGAFTNFNVWVTPYNRTEKWAGGLYVDHSHGDDTLAVWTKKNRDINNKDI  617

Query  295   VLWYTLGFHHLPCQEDFPVMPTVTSTFQLKPVNFFDRNPIIQA  167
             VLW+ +G HH+P QEDFP+MP +++ F+L P NFF+RNP+++ 
Sbjct  618   VLWHVVGIHHVPAQEDFPIMPLLSTAFELSPTNFFERNPVLKT  660



>ref|XP_009614743.1| PREDICTED: primary amine oxidase-like [Nicotiana tomentosiformis]
Length=656

 Score =   551 bits (1419),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 280/648 (43%), Positives = 396/648 (61%), Gaps = 32/648 (5%)
 Frame = -1

Query  2083  HPLDPLTIQEIERTRSILSSYQPFSGSSLRIHSLSLDEPDKSEVLRW------KRGNPLP  1922
             HPLDPL   EI + R I+      S S+L  H + ++EP+K +VL W       +  P P
Sbjct  30    HPLDPLNPIEINKIRVIIQKSHFSSLSNLTFHFVDIEEPEKKDVLHWMYLHYKHKNVPFP  89

Query  1921  TRKAFVVALSNGQAHLLVVDLGSGRVSSHTRNPASGYPPMSADDASTALEATFSNSVFRE  1742
              R+A VV  +NG+   +VVDL +  + S       G+PP++ D+       T  N  F++
Sbjct  90    YRRARVVVRANGETFEVVVDLATRSIISENLYTGHGFPPLTLDEIVQCSRLTLRNPKFQD  149

Query  1741  AISTRGVEINDVVCSAAAPGWFGPEEEGRRITKVKCYTAQNTPNYYMRPIEGLLLTVDLD  1562
             +I  RG+ I++V C     GWFG + + RRI  V C+  + T N++ RPIEG+   VD++
Sbjct  150   SILKRGLNISEVSCIPQPVGWFG-QPKTRRILNVPCFYRRGTTNFWARPIEGITTIVDVE  208

Query  1561  SGKVINVYDTHSPIPIPKAQGTDYRRDGIEHRAPGVEPLKPISMEQPNGQSFRVEDGYIV  1382
             S K+I   D     P+P+A+  D++       A        I ++           G  V
Sbjct  209   SMKIIKYIDRFRA-PLPEAESADFQTSSQGSVACNDTDTSRIIIK-----------GNEV  256

Query  1381  KWASWEFHVKADQRAGIIISQATVFDPEAGKRRSVMYKGFASELFVPYMDVDEGWYFRAF  1202
             KW +W FHV  + RAG+I+S A++FD    + R V+Y+G  SE FVPYMD    WY+R F
Sbjct  257   KWDNWIFHVGFNTRAGMIVSTASIFDDTRNEYRRVLYRGHVSETFVPYMDPTFEWYYRTF  316

Query  1201  MDAGEFGLGATAMELVPLNDCPRHSHYIDGLFVDPDGRPVSQPNVICVFERYSGDIAWRH  1022
             MD GEFG G +A  LVPL DCP ++ Y+DG   D DG  V  PN IC+FERY GD AWRH
Sbjct  317   MDIGEFGFGRSASSLVPLLDCPNNAVYMDGYMADSDGHVVQVPNAICIFERYVGDAAWRH  376

Query  1021  SGTGDADDDLIREARPKVSLVVRTTATVGNYDYIFDWEFQTDGSIRVTVGLSGIILAKGS  842
             +  G    ++  + + +V+LVVR  ATVGNYDY  DWEF+  G++RV V LSG++  K  
Sbjct  377   TENG-VPGNINTKGQQEVNLVVRMVATVGNYDYTLDWEFKQSGTLRVGVSLSGVMETKAV  435

Query  841   PYEHINQFEIPRWDFPAGSLVSENTIGVAHDHFITFHLDMDVDGPTNSFVKVDL----VK  674
              Y + NQ     +    G+LV++NTI   HDHF+ ++LD+D+DG  NSF+K  L    VK
Sbjct  436   KYTNNNQITEDVY----GTLVAKNTIAANHDHFLIYYLDLDIDGTDNSFLKAKLKTRRVK  491

Query  673   NYNIAGKIQRKSYWSPKRKVAKSENDAKIKLQLDKPSEFHVINPRHQSRLGNPSGYKIVP  494
             +  I   + RKSYW   ++  K+EN+AK  + L+ P+E  ++NP  ++++GN   Y+++P
Sbjct  492   DSKI---LPRKSYWKAVKETMKTENEAKTHIGLE-PAELLIVNPNKKTKIGNGVSYRLIP  547

Query  493   SATAASLLDLQDPPQLRAAFTNNQIWVTPYNRSEQWAGGLFTYQSHGDDTLAVWSNRNRV  314
             S  A SLL   D PQLRAA+T  Q+WVTPYN+SE+WAGG +  +S GDD LA+WS RNR 
Sbjct  548   SRPAMSLLSYDDYPQLRAAYTKYQLWVTPYNKSERWAGGFYADRSQGDDGLAIWSRRNRH  607

Query  313   IEKQDIVLWYTLGFHHLPCQEDFPVMPTVTSTFQLKPVNFFDRNPIIQ  170
             I  +DIVLWYT+G HH+PCQEDFPVMP++   F+L+P NFF+RNP+++
Sbjct  608   IANKDIVLWYTVGLHHVPCQEDFPVMPSIYDGFELRPTNFFERNPLLK  655



>sp|Q43077.1|AMO_PEA RecName: Full=Primary amine oxidase; AltName: Full=Amine oxidase 
[copper-containing]; Flags: Precursor [Pisum sativum]
 gb|AAA62490.1| copper amine oxidase [Pisum sativum]
Length=674

 Score =   551 bits (1420),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 270/642 (42%), Positives = 413/642 (64%), Gaps = 16/642 (2%)
 Frame = -1

Query  2083  HPLDPLTIQEIERTRSILSSYQPFSGSSLRIHSLSLDEPDKSEVLRWKRGNPLPT--RKA  1910
             HPLDPLT +E    ++I+ +  P S + L  H + LD+P+K  VLR++    L +  RK 
Sbjct  33    HPLDPLTKEEFLAVQTIVQNKYPISNNRLAFHYIGLDDPEKDHVLRYETHPTLVSIPRKI  92

Query  1909  FVVALSNGQAHLLVVDLGSGRVSSHTRNPASGYPPMSADDASTALEATFSNSVFREAIST  1730
             FVVA+ N Q H ++++L    + S   +   G+P +S D+ S A++       F +++  
Sbjct  93    FVVAIINSQTHEILINLRIRSIVSDNIHNGYGFPILSVDEQSLAIKLPLKYPPFIDSVKK  152

Query  1729  RGVEINDVVCSAAAPGWFGPEEEGRRITKVKCYTAQNTPNYYMRPIEGLLLTVDLDSGKV  1550
             RG+ ++++VCS+   GWFG EE+  R  ++ C+  ++T N Y+RPI G+ +  DLD  K+
Sbjct  153   RGLNLSEIVCSSFTMGWFG-EEKNVRTVRLDCFMKESTVNIYVRPITGITIVADLDLMKI  211

Query  1549  INVYDTHSPIPIPKAQGTDYRRDGIEHRAPGVEPLK-PISMEQPNGQSFRVEDGYIVKWA  1373
             +  +D      +P A+ T+Y+   +  ++P   P +  ++  QP G  F++ +G+ V WA
Sbjct  212   VEYHDRDIE-AVPTAENTEYQ---VSKQSPPFGPKQHSLTSHQPQGPGFQI-NGHSVSWA  266

Query  1372  SWEFHVKADQRAGIIISQATVFDPEAGKRRSVMYKGFASELFVPYMDVDEGWYFRAFMDA  1193
             +W+FH+  D RAGI+IS A+++D E  K R V+YKG+ SELFVPY D  E +YF+ F D+
Sbjct  267   NWKFHIGFDVRAGIVISLASIYDLEKHKSRRVLYKGYISELFVPYQDPTEEFYFKTFFDS  326

Query  1192  GEFGLGATAMELVPLNDCPRHSHYIDGLFVDPDGRPVSQPNVICVFERYSGDIAWRHSGT  1013
             GEFG G + + L+P  DCP H+ +ID      +G P+   N ICVFE+Y G+I WRH+  
Sbjct  327   GEFGFGLSTVSLIPNRDCPPHAQFIDTYVHSANGTPILLKNAICVFEQY-GNIMWRHTEN  385

Query  1012  GDADDDLIREARPKVSLVVRTTATVGNYDYIFDWEFQTDGSIRVTVGLSGIILAKGSPYE  833
             G  ++  I E+R +V+L+VRT  TVGNYD + DWEF+  GSI+ ++ LSGI+  KG+  +
Sbjct  386   GIPNES-IEESRTEVNLIVRTIVTVGNYDNVIDWEFKASGSIKPSIALSGILEIKGTNIK  444

Query  832   HINQFEIPRWDFPAGSLVSENTIGVAHDHFITFHLDMDVDGPTNSFVKVDLVKNYNIAGK  653
             H ++ +    +   G LVS N+IG+ HDHF  ++LD D+DG  NSF K  L       G 
Sbjct  445   HKDEIK----EDLHGKLVSANSIGIYHDHFYIYYLDFDIDGTHNSFEKTSLKTVRIKDGS  500

Query  652   IQRKSYWSPKRKVAKSENDAKIKLQLDKPSEFHVINPRHQSRLGNPSGYKIVPSATAASL  473
              +RKSYW+ + + AK+E+DAKI + L  P+E  V+NP  ++ +GN  GY+++P+  A  L
Sbjct  501   SKRKSYWTTETQTAKTESDAKITIGL-APAELVVVNPNIKTAVGNEVGYRLIPAIPAHPL  559

Query  472   LDLQDPPQLRAAFTNNQIWVTPYNRSEQWAGGLFTYQSHGDDTLAVWSNRNRVIEKQDIV  293
             L   D PQ+R AFTN  +WVT YNR+E+WAGGL+   S GDDTLAVW+ +NR I  +DIV
Sbjct  560   LTEDDYPQIRGAFTNYNVWVTAYNRTEKWAGGLYVDHSRGDDTLAVWTKQNREIVNKDIV  619

Query  292   LWYTLGFHHLPCQEDFPVMPTVTSTFQLKPVNFFDRNPIIQA  167
             +W+ +G HH+P QEDFP+MP ++++F+L+P NFF+RNP+++ 
Sbjct  620   MWHVVGIHHVPAQEDFPIMPLLSTSFELRPTNFFERNPVLKT  661



>gb|KEH29590.1| copper amine oxidase, enzyme domain protein [Medicago truncatula]
Length=675

 Score =   550 bits (1418),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 270/642 (42%), Positives = 408/642 (64%), Gaps = 16/642 (2%)
 Frame = -1

Query  2083  HPLDPLTIQEIERTRSILSSYQPFSGSSLRIHSLSLDEPDKSEVLRWKRGNPLPT---RK  1913
             HPLDPLT +E    ++++ +    S + +  H + LD+PDK  + +++    +P    RK
Sbjct  32    HPLDPLTKEEFLTVQTLVHNKYHTSKNKVAFHYIGLDDPDKDYISKYEH-EKVPIVIHRK  90

Query  1912  AFVVALSNGQAHLLVVDLGSGRVSSHTRNPASGYPPMSADDASTALEATFSNSVFREAIS  1733
             +FV+A+ NGQ+H +V+D+    + S   +   G+P +S ++     +       F  ++ 
Sbjct  91    SFVIAIINGQSHEIVIDIRLKTIVSDNVHKGYGFPMLSLEEQGLVTKLPLKYPPFIASLK  150

Query  1732  TRGVEINDVVCSAAAPGWFGPEEEGRRITKVKCYTAQNTPNYYMRPIEGLLLTVDLDSGK  1553
              RG+ +++VVC+  + GWFG EEE +R  +V C+  +NT N+++RPI GL +  DL   K
Sbjct  151   KRGLNLSEVVCAPFSMGWFG-EEESKRTVRVDCFMKENTVNFFVRPISGLTMVADLGLMK  209

Query  1552  VINVYDTHSPIPIPKAQGTDYRRDGIEHRAPGVEPLKPISMEQPNGQSFRVEDGYIVKWA  1373
             ++  +D    + +P A+ T+Y+    + R P       ++  QP G  F + +G+ V WA
Sbjct  210   IVEYHDREVEV-VPTAENTEYKAS--KQRPPFGPKQHSLASHQPQGPGFLI-NGHSVSWA  265

Query  1372  SWEFHVKADQRAGIIISQATVFDPEAGKRRSVMYKGFASELFVPYMDVDEGWYFRAFMDA  1193
             +W+FH+  D RAGIIIS A+++D E  K R V+YKG+ SELFVPY D  E +YF+ F DA
Sbjct  266   NWKFHIGFDVRAGIIISLASIYDLEKHKSRRVLYKGYISELFVPYQDPTEEFYFKTFFDA  325

Query  1192  GEFGLGATAMELVPLNDCPRHSHYIDGLFVDPDGRPVSQPNVICVFERYSGDIAWRHSGT  1013
             GE+G G + + L+P  DCP HSH+ID      DG P    N ICVFE+Y G I WRH+ T
Sbjct  326   GEYGFGRSTVSLIPNRDCPPHSHFIDTYIHSVDGTPSLLKNAICVFEQY-GSIMWRHTET  384

Query  1012  GDADDDLIREARPKVSLVVRTTATVGNYDYIFDWEFQTDGSIRVTVGLSGIILAKGSPYE  833
                 ++ I E+R +V+L+VRT  TVGNYD + DWEF+T GSI+ ++ LSGI+  K +  +
Sbjct  385   S-IPNEFIEESRTEVNLIVRTVVTVGNYDNVLDWEFKTSGSIKPSIALSGILEIKATNIK  443

Query  832   HINQFEIPRWDFPAGSLVSENTIGVAHDHFITFHLDMDVDGPTNSFVKVDLVKNYNIAGK  653
             H ++ +   +    G LVS N+IG+ HDHF  ++LD D+DG  NSF K +L       G 
Sbjct  444   HNDEIKGELY----GKLVSANSIGIYHDHFYIYYLDFDIDGAENSFEKTNLKTVRITDGS  499

Query  652   IQRKSYWSPKRKVAKSENDAKIKLQLDKPSEFHVINPRHQSRLGNPSGYKIVPSATAASL  473
              +RKSYW+ + + AK+E+DAKI +    P+E  VIN   ++ +GN  GY+++P+  A SL
Sbjct  500   SKRKSYWTTETQTAKTESDAKITIG-SAPAELVVINSNKKTAVGNHIGYRLIPAIPAHSL  558

Query  472   LDLQDPPQLRAAFTNNQIWVTPYNRSEQWAGGLFTYQSHGDDTLAVWSNRNRVIEKQDIV  293
             L   D PQ+R AFTN  +WVTPYNR+E+WAGGL+   S GDDTLAVW+ +NR I  +DIV
Sbjct  559   LTEDDYPQIRGAFTNYNVWVTPYNRTEKWAGGLYVDHSRGDDTLAVWTKQNRDIVNKDIV  618

Query  292   LWYTLGFHHLPCQEDFPVMPTVTSTFQLKPVNFFDRNPIIQA  167
             +W+ +G HH+P QEDFP+MP ++++F+L+P NFF+RNP+++ 
Sbjct  619   MWHVVGIHHVPTQEDFPIMPLLSTSFELRPTNFFERNPVLKT  660



>ref|XP_007143248.1| hypothetical protein PHAVU_007G056400g [Phaseolus vulgaris]
 gb|ESW15242.1| hypothetical protein PHAVU_007G056400g [Phaseolus vulgaris]
Length=667

 Score =   549 bits (1415),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 286/665 (43%), Positives = 405/665 (61%), Gaps = 39/665 (6%)
 Frame = -1

Query  2083  HPLDPLTIQEIERTRSILSSYQPFSGSS---LRIHSLSLDEPDKSEVLRWKRGNPLPT--  1919
             HPLDPLT  E+   R+I+ +  P + ++   L  + + LDEPDK ++L+W   NP     
Sbjct  27    HPLDPLTPSELNLVRTIVQNAYPTTKTTNHNLTFNYVGLDEPDKPKILQWISSNPKTKPS  86

Query  1918  ----RKAFVVALSNGQAHLLVVDLGSGRVSSHTRNPASGYPPMSADDASTALEATFSNSV  1751
                 R+AFVV     Q+H + VDL +  + S      +GYP ++  + +   +  FS   
Sbjct  87    SPPPRRAFVVVRFQKQSHEITVDLSTRSIVSKNVYEGNGYPMLTFGEQTVVSQLPFSYEP  146

Query  1750  FREAISTRGVEINDVVCSAAAPGWFGPEEEGRRITKVKCYTAQNTPNYYMRPIEGLLLTV  1571
             F+E++  RG+  + V+               +R  KVKCY    T N Y RPIEG+   V
Sbjct  147   FKESLRKRGLNTSQVLSKT------------KRNVKVKCYYTNGTANLYARPIEGVAAVV  194

Query  1570  DLDSGKVINVYDTHSPIPIPKAQGTDYRRDGIEHRAPGVEPLKPISMEQPNGQSFRVEDG  1391
             D+D  K++   D    IP+P A+GT+YR   +  + P    LK I++ Q  G  F ++ G
Sbjct  195   DVDDMKIVGYID-RDVIPVPNAEGTEYRASKL--KPPFAPKLKGIAVTQHGGPGFTIQ-G  250

Query  1390  YIVKWASWEFHVKADQRAGIIISQATVFDPEAGKRRSVMYKGFASELFVPYMDVDEGWYF  1211
             + V W +W+FHV  D +AG IIS A+V+D +  KRR V++KGF SELFVPY D  E WY+
Sbjct  251   HSVSWGNWDFHVGFDIKAGPIISLASVYDLQKQKRRRVLHKGFISELFVPYQDPTEEWYY  310

Query  1210  RAFMDAGEFGLGATAMELVPLNDCPRHSHYIDGLFVDPDGRPVSQPNVICVFERYSGDIA  1031
               + D+GE+G G     L PL DCP ++ +ID  F   DG PV  PN  C+FE+Y+GDI 
Sbjct  311   TTYFDSGEYGFGQCMSSLQPLTDCPPNAAFIDAYFAASDGSPVKIPNAFCIFEKYAGDIM  370

Query  1030  WRHSGTGDADDDLIREARPKVSLVVRTTATVGNYDYIFDWEFQTDGSIRVTVGLSGIILA  851
             WRH+      + +I E R  VSLVVR  +TVGNYDY+ DWEF+  GSI++ VGL+GI+  
Sbjct  371   WRHTEIS-IPNQVITEVRSDVSLVVRIVSTVGNYDYVIDWEFKPSGSIKIGVGLTGILGL  429

Query  850   KGSPYEHINQFEIPRWDFPAGSLVSENTIGVAHDHFITFHLDMDVDGPTNSFVKVDL---  680
             K   Y H ++ +   +    G+L+++NTIGV HDHF  ++LD+D+DG  NSFVK +L   
Sbjct  430   KAGAYTHTDEIKEDIY----GTLIADNTIGVYHDHFFIYYLDLDIDGEINSFVKSNLETV  485

Query  679   -VKNYNIAGKIQRKSYWSPKRKVAKSENDAKIKLQLDKPSEFHVINPRHQSRLGNPSGYK  503
              VK+ NI     RKS W+   + A++E DA+I L L K SE  V+NP  +++ GN  GY+
Sbjct  486   KVKDENIP----RKSRWTVVSETARTEADARINLGL-KASELLVVNPNKRTKQGNKIGYR  540

Query  502   IVPSATAASLLDLQDPPQLRAAFTNNQIWVTPYNRSEQWAGGLFTYQSHGDDTLAVWSNR  323
             +VP +    L  L D PQ+R AFTN  +WVTPYN+SE+WA G +  +S GDDT+AVWS+R
Sbjct  541   LVPGSGVHPLSLLNDYPQIRGAFTNYNVWVTPYNKSEKWAAGSYVDRSRGDDTVAVWSSR  600

Query  322   NRVIEKQDIVLWYTLGFHHLPCQEDFPVMPTVTSTFQLKPVNFFDRNPIIQANPNFAEDL  143
             +R IEK+DIVLWY +GFHH+P QEDFPVMPT++  F+L+P NFF+ NP+++         
Sbjct  601   DREIEKKDIVLWYMMGFHHVPSQEDFPVMPTLSGGFELRPTNFFESNPVLKTKSPKLLQW  660

Query  142   PICRA  128
             P C +
Sbjct  661   PNCTS  665



>pdb|1W2Z|A Chain A, Psao And Xenon
 pdb|1W2Z|B Chain B, Psao And Xenon
 pdb|1W2Z|C Chain C, Psao And Xenon
 pdb|1W2Z|D Chain D, Psao And Xenon
Length=649

 Score =   547 bits (1410),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 269/642 (42%), Positives = 412/642 (64%), Gaps = 16/642 (2%)
 Frame = -1

Query  2083  HPLDPLTIQEIERTRSILSSYQPFSGSSLRIHSLSLDEPDKSEVLRWKRGNPLPT--RKA  1910
             HPLDPLT +E    ++I+ +  P S + L  H + LD+P+K  VLR++    L +  RK 
Sbjct  8     HPLDPLTKEEFLAVQTIVQNKYPISNNRLAFHYIGLDDPEKDHVLRYETHPTLVSIPRKI  67

Query  1909  FVVALSNGQAHLLVVDLGSGRVSSHTRNPASGYPPMSADDASTALEATFSNSVFREAIST  1730
             FVVA+ N Q H ++++L    + S   +   G+P +S D+ S A++       F +++  
Sbjct  68    FVVAIINSQTHEILINLRIRSIVSDNIHNGYGFPILSVDEQSLAIKLPLKYPPFIDSVKK  127

Query  1729  RGVEINDVVCSAAAPGWFGPEEEGRRITKVKCYTAQNTPNYYMRPIEGLLLTVDLDSGKV  1550
             RG+ ++++VCS+   GWFG EE+  R  ++ C+  ++T N Y+RPI G+ +  DLD  K+
Sbjct  128   RGLNLSEIVCSSFTMGWFG-EEKNVRTVRLDCFMKESTVNIYVRPITGITIVADLDLMKI  186

Query  1549  INVYDTHSPIPIPKAQGTDYRRDGIEHRAPGVEPLK-PISMEQPNGQSFRVEDGYIVKWA  1373
             +  +D      +P A+ T+Y+   +  ++P   P +  ++  QP G  F++ +G+ V WA
Sbjct  187   VEYHDRDIE-AVPTAENTEYQ---VSKQSPPFGPKQHSLTSHQPQGPGFQI-NGHSVSWA  241

Query  1372  SWEFHVKADQRAGIIISQATVFDPEAGKRRSVMYKGFASELFVPYMDVDEGWYFRAFMDA  1193
             +W+FH+  D RAGI+IS A+++D E  K R V+YKG+ SELFVPY D  E +YF+ F D+
Sbjct  242   NWKFHIGFDVRAGIVISLASIYDLEKHKSRRVLYKGYISELFVPYQDPTEEFYFKTFFDS  301

Query  1192  GEFGLGATAMELVPLNDCPRHSHYIDGLFVDPDGRPVSQPNVICVFERYSGDIAWRHSGT  1013
             GEFG G + + L+P  DCP H+ +ID      +G P+   N ICVFE+Y G+I WRH+  
Sbjct  302   GEFGFGLSTVSLIPNRDCPPHAQFIDTYVHSANGTPILLKNAICVFEQY-GNIMWRHTEN  360

Query  1012  GDADDDLIREARPKVSLVVRTTATVGNYDYIFDWEFQTDGSIRVTVGLSGIILAKGSPYE  833
             G  ++  I E+R +V+L+VRT  TVGN D + DWEF+  GSI+ ++ LSGI+  KG+  +
Sbjct  361   GIPNES-IEESRTEVNLIVRTIVTVGNXDNVIDWEFKASGSIKPSIALSGILEIKGTNIK  419

Query  832   HINQFEIPRWDFPAGSLVSENTIGVAHDHFITFHLDMDVDGPTNSFVKVDLVKNYNIAGK  653
             H ++ +    +   G LVS N+IG+ HDHF  ++LD D+DG  NSF K  L       G 
Sbjct  420   HKDEIK----EDLHGKLVSANSIGIYHDHFYIYYLDFDIDGTHNSFEKTSLKTVRIKDGS  475

Query  652   IQRKSYWSPKRKVAKSENDAKIKLQLDKPSEFHVINPRHQSRLGNPSGYKIVPSATAASL  473
              +RKSYW+ + + AK+E+DAKI + L  P+E  V+NP  ++ +GN  GY+++P+  A  L
Sbjct  476   SKRKSYWTTETQTAKTESDAKITIGL-APAELVVVNPNIKTAVGNEVGYRLIPAIPAHPL  534

Query  472   LDLQDPPQLRAAFTNNQIWVTPYNRSEQWAGGLFTYQSHGDDTLAVWSNRNRVIEKQDIV  293
             L   D PQ+R AFTN  +WVT YNR+E+WAGGL+   S GDDTLAVW+ +NR I  +DIV
Sbjct  535   LTEDDYPQIRGAFTNYNVWVTAYNRTEKWAGGLYVDHSRGDDTLAVWTKQNREIVNKDIV  594

Query  292   LWYTLGFHHLPCQEDFPVMPTVTSTFQLKPVNFFDRNPIIQA  167
             +W+ +G HH+P QEDFP+MP ++++F+L+P NFF+RNP+++ 
Sbjct  595   MWHVVGIHHVPAQEDFPIMPLLSTSFELRPTNFFERNPVLKT  636



>pdb|1KSI|A Chain A, Crystal Structure Of A Eukaryotic (Pea Seedling) Copper-Containing 
Amine Oxidase At 2.2a Resolution
 pdb|1KSI|B Chain B, Crystal Structure Of A Eukaryotic (Pea Seedling) Copper-Containing 
Amine Oxidase At 2.2a Resolution
Length=642

 Score =   546 bits (1407),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 269/642 (42%), Positives = 412/642 (64%), Gaps = 16/642 (2%)
 Frame = -1

Query  2083  HPLDPLTIQEIERTRSILSSYQPFSGSSLRIHSLSLDEPDKSEVLRWKRGNPLPT--RKA  1910
             HPLDPLT +E    ++I+ +  P S + L  H + LD+P+K  VLR++    L +  RK 
Sbjct  3     HPLDPLTKEEFLAVQTIVQNKYPISNNRLAFHYIGLDDPEKDHVLRYETHPTLVSIPRKI  62

Query  1909  FVVALSNGQAHLLVVDLGSGRVSSHTRNPASGYPPMSADDASTALEATFSNSVFREAIST  1730
             FVVA+ N Q H ++++L    + S   +   G+P +S D+ S A++       F +++  
Sbjct  63    FVVAIINSQTHEILINLRIRSIVSDNIHNGYGFPILSVDEQSLAIKLPLKYPPFIDSVKK  122

Query  1729  RGVEINDVVCSAAAPGWFGPEEEGRRITKVKCYTAQNTPNYYMRPIEGLLLTVDLDSGKV  1550
             RG+ ++++VCS+   GWFG EE+  R  ++ C+  ++T N Y+RPI G+ +  DLD  K+
Sbjct  123   RGLNLSEIVCSSFTMGWFG-EEKNVRTVRLDCFMKESTVNIYVRPITGITIVADLDLMKI  181

Query  1549  INVYDTHSPIPIPKAQGTDYRRDGIEHRAPGVEPLK-PISMEQPNGQSFRVEDGYIVKWA  1373
             +  +D      +P A+ T+Y+   +  ++P   P +  ++  QP G  F++ +G+ V WA
Sbjct  182   VEYHDRDIE-AVPTAENTEYQ---VSKQSPPFGPKQHSLTSHQPQGPGFQI-NGHSVSWA  236

Query  1372  SWEFHVKADQRAGIIISQATVFDPEAGKRRSVMYKGFASELFVPYMDVDEGWYFRAFMDA  1193
             +W+FH+  D RAGI+IS A+++D E  K R V+YKG+ SELFVPY D  E +YF+ F D+
Sbjct  237   NWKFHIGFDVRAGIVISLASIYDLEKHKSRRVLYKGYISELFVPYQDPTEEFYFKTFFDS  296

Query  1192  GEFGLGATAMELVPLNDCPRHSHYIDGLFVDPDGRPVSQPNVICVFERYSGDIAWRHSGT  1013
             GEFG G + + L+P  DCP H+ +ID      +G P+   N ICVFE+Y G+I WRH+  
Sbjct  297   GEFGFGLSTVSLIPNRDCPPHAQFIDTYVHSANGTPILLKNAICVFEQY-GNIMWRHTEN  355

Query  1012  GDADDDLIREARPKVSLVVRTTATVGNYDYIFDWEFQTDGSIRVTVGLSGIILAKGSPYE  833
             G  ++  I E+R +V+L+VRT  TVGN D + DWEF+  GSI+ ++ LSGI+  KG+  +
Sbjct  356   GIPNES-IEESRTEVNLIVRTIVTVGNXDNVIDWEFKASGSIKPSIALSGILEIKGTNIK  414

Query  832   HINQFEIPRWDFPAGSLVSENTIGVAHDHFITFHLDMDVDGPTNSFVKVDLVKNYNIAGK  653
             H ++ +    +   G LVS N+IG+ HDHF  ++LD D+DG  NSF K  L       G 
Sbjct  415   HKDEIK----EDLHGKLVSANSIGIYHDHFYIYYLDFDIDGTHNSFEKTSLKTVRIKDGS  470

Query  652   IQRKSYWSPKRKVAKSENDAKIKLQLDKPSEFHVINPRHQSRLGNPSGYKIVPSATAASL  473
              +RKSYW+ + + AK+E+DAKI + L  P+E  V+NP  ++ +GN  GY+++P+  A  L
Sbjct  471   SKRKSYWTTETQTAKTESDAKITIGL-APAELVVVNPNIKTAVGNEVGYRLIPAIPAHPL  529

Query  472   LDLQDPPQLRAAFTNNQIWVTPYNRSEQWAGGLFTYQSHGDDTLAVWSNRNRVIEKQDIV  293
             L   D PQ+R AFTN  +WVT YNR+E+WAGGL+   S GDDTLAVW+ +NR I  +DIV
Sbjct  530   LTEDDYPQIRGAFTNYNVWVTAYNRTEKWAGGLYVDHSRGDDTLAVWTKQNREIVNKDIV  589

Query  292   LWYTLGFHHLPCQEDFPVMPTVTSTFQLKPVNFFDRNPIIQA  167
             +W+ +G HH+P QEDFP+MP ++++F+L+P NFF+RNP+++ 
Sbjct  590   MWHVVGIHHVPAQEDFPIMPLLSTSFELRPTNFFERNPVLKT  631



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 7336104678192