BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c80325_g1_i1 len=3199 path=[1:0-3198]

Length=3199
                                                                      Score     E

ref|XP_009618264.1|  PREDICTED: protein TOO MANY MOUTHS                 647   0.0      
ref|XP_009762257.1|  PREDICTED: protein TOO MANY MOUTHS                 635   0.0      
ref|XP_004252485.1|  PREDICTED: protein TOO MANY MOUTHS                 612   0.0      
ref|XP_006346651.1|  PREDICTED: protein TOO MANY MOUTHS-like            610   0.0      
emb|CDP13043.1|  unnamed protein product                                591   0.0      
ref|XP_006369311.1|  hypothetical protein POPTR_0001s20940g             569   0.0      
ref|XP_006427297.1|  hypothetical protein CICLE_v10025464mg             565   0.0      
gb|EYU24634.1|  hypothetical protein MIMGU_mgv11b004345mg               561   0.0      
ref|XP_007023220.1|  Leucine-rich repeat (LRR) family protein           559   0.0      
ref|XP_006465479.1|  PREDICTED: protein TOO MANY MOUTHS-like            559   0.0      
ref|XP_011008000.1|  PREDICTED: protein TOO MANY MOUTHS                 558   0.0      
ref|XP_002265327.1|  PREDICTED: protein TOO MANY MOUTHS                 557   0.0      Vitis vinifera
ref|XP_010250165.1|  PREDICTED: protein TOO MANY MOUTHS                 554   0.0      
ref|XP_010097213.1|  Protein TOO MANY MOUTHS                            550   0.0      
ref|XP_011081419.1|  PREDICTED: protein TOO MANY MOUTHS                 549   0.0      
ref|XP_008373971.1|  PREDICTED: protein TOO MANY MOUTHS                 545   3e-180   
ref|XP_007150758.1|  hypothetical protein PHAVU_005G178400g             545   1e-179   
ref|XP_002517648.1|  serine-threonine protein kinase, plant-type,...    533   3e-175   Ricinus communis
gb|KHN44184.1|  Protein TOO MANY MOUTHS                                 530   7e-174   
ref|XP_003597912.1|  Leucine-rich repeat receptor-like protein ki...    529   3e-173   
ref|XP_004303296.1|  PREDICTED: protein TOO MANY MOUTHS-like            526   4e-173   
ref|XP_004486661.1|  PREDICTED: protein TOO MANY MOUTHS-like            523   5e-171   
ref|XP_007217237.1|  hypothetical protein PRUPE_ppa006269mg             520   8e-171   
ref|XP_008228729.1|  PREDICTED: protein TOO MANY MOUTHS                 516   6e-169   
ref|XP_010417752.1|  PREDICTED: protein TOO MANY MOUTHS                 506   2e-164   
emb|CDY57686.1|  BnaA07g38270D                                          505   4e-164   
ref|NP_178125.1|  transmembrane leucine-repeat containing recepto...    504   2e-163   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002887846.1|  hypothetical protein ARALYDRAFT_895990             503   2e-163   
ref|XP_010691095.1|  PREDICTED: protein TOO MANY MOUTHS                 503   4e-163   
ref|XP_010538000.1|  PREDICTED: protein TOO MANY MOUTHS                 501   1e-162   
ref|XP_009104444.1|  PREDICTED: protein TOO MANY MOUTHS isoform X1      502   1e-162   
emb|CDY54307.1|  BnaC06g43050D                                          501   2e-162   
gb|KFK42412.1|  hypothetical protein AALP_AA2G252800                    501   2e-162   
dbj|BAC43164.1|  GPI-anchored protein                                   500   3e-162   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006301858.1|  hypothetical protein CARUB_v10022328mg             495   3e-160   
ref|XP_006389750.1|  hypothetical protein EUTSA_v10019584mg             490   3e-158   
emb|CDO98162.1|  unnamed protein product                                483   2e-157   
ref|XP_010033969.1|  PREDICTED: protein TOO MANY MOUTHS                 483   1e-155   
ref|XP_009350764.1|  PREDICTED: protein TOO MANY MOUTHS-like            478   1e-155   
ref|XP_009347412.1|  PREDICTED: protein TOO MANY MOUTHS-like            479   1e-155   
ref|XP_004303295.1|  PREDICTED: PTI1-like tyrosine-protein kinase...    476   7e-155   
ref|XP_008454210.1|  PREDICTED: protein TOO MANY MOUTHS                 476   2e-153   
ref|XP_009772957.1|  PREDICTED: PTI1-like tyrosine-protein kinase...    470   2e-152   
ref|XP_008228699.1|  PREDICTED: PTI1-like tyrosine-protein kinase...    468   9e-152   
ref|XP_007215581.1|  hypothetical protein PRUPE_ppa007548mg             468   2e-151   
gb|KCW53833.1|  hypothetical protein EUGRSUZ_J03069                     468   2e-151   
ref|XP_009607610.1|  PREDICTED: PTI1-like tyrosine-protein kinase...    467   2e-151   
ref|XP_006364223.1|  PREDICTED: PTI1-like tyrosine-protein kinase...    467   2e-151   
gb|KDP37071.1|  hypothetical protein JCGZ_06127                         467   3e-151   
ref|XP_010033970.1|  PREDICTED: PTI1-like tyrosine-protein kinase...    466   7e-151   
ref|XP_004235951.1|  PREDICTED: PTI1-like tyrosine-protein kinase...    466   1e-150   
ref|XP_011044847.1|  PREDICTED: PTI1-like tyrosine-protein kinase...    464   6e-150   
ref|XP_003545853.1|  PREDICTED: PTI1-like tyrosine-protein kinase...    463   1e-149   
ref|XP_010097212.1|  PTI1-like tyrosine-protein kinase                  463   1e-149   
ref|XP_007023226.1|  Brassinosteroid insensitive 1-associated rec...    460   5e-149   
ref|XP_002517653.1|  ATP binding protein, putative                      461   5e-149   Ricinus communis
ref|XP_003543684.1|  PREDICTED: PTI1-like tyrosine-protein kinase...    461   6e-149   
ref|XP_011009892.1|  PREDICTED: PTI1-like tyrosine-protein kinase...    461   7e-149   
ref|XP_007150759.1|  hypothetical protein PHAVU_005G178500g             461   9e-149   
ref|XP_004486660.1|  PREDICTED: PTI1-like tyrosine-protein kinase...    460   1e-148   
ref|XP_006427299.1|  hypothetical protein CICLE_v10025774mg             461   1e-148   
ref|XP_006465319.1|  PREDICTED: PTI1-like tyrosine-protein kinase...    461   1e-148   
ref|XP_003597913.1|  Somatic embryogenesis receptor kinase              460   2e-148   
ref|XP_007023225.1|  Brassinosteroid insensitive 1-associated rec...    460   2e-148   
ref|XP_011013943.1|  PREDICTED: PTI1-like tyrosine-protein kinase...    459   3e-148   
ref|XP_008802099.1|  PREDICTED: protein TOO MANY MOUTHS                 463   5e-148   
ref|XP_008373969.1|  PREDICTED: PTI1-like tyrosine-protein kinase...    458   8e-148   
gb|AFK40964.1|  unknown                                                 457   3e-147   
ref|XP_010241557.1|  PREDICTED: PTI1-like tyrosine-protein kinase...    456   8e-147   
ref|XP_009351272.1|  PREDICTED: PTI1-like tyrosine-protein kinase...    456   1e-146   
ref|XP_008356531.1|  PREDICTED: PTI1-like tyrosine-protein kinase...    455   2e-146   
ref|XP_004152337.1|  PREDICTED: protein TOO MANY MOUTHS-like            454   2e-145   
ref|XP_008795870.1|  PREDICTED: PTI1-like tyrosine-protein kinase...    451   3e-145   
ref|XP_010927378.1|  PREDICTED: PTI1-like tyrosine-protein kinase...    451   3e-145   
gb|ACU18280.1|  unknown                                                 449   7e-145   Glycine max [soybeans]
gb|KHG17287.1|  hypothetical protein F383_02161                         449   2e-144   
ref|XP_009607618.1|  PREDICTED: PTI1-like tyrosine-protein kinase...    447   3e-144   
ref|XP_010906578.1|  PREDICTED: PTI1-like tyrosine-protein kinase...    448   4e-144   
ref|XP_009411217.1|  PREDICTED: protein TOO MANY MOUTHS                 452   9e-144   
ref|XP_010917496.1|  PREDICTED: protein TOO MANY MOUTHS                 451   2e-143   
ref|XP_011073418.1|  PREDICTED: PTI1-like tyrosine-protein kinase...    445   7e-143   
ref|XP_010250169.1|  PREDICTED: PTI1-like tyrosine-protein kinase...    445   9e-143   
ref|XP_006385306.1|  hypothetical protein POPTR_0003s02650g             442   2e-142   
ref|XP_011081421.1|  PREDICTED: PTI1-like tyrosine-protein kinase...    444   2e-142   
ref|XP_008454209.1|  PREDICTED: PTI1-like tyrosine-protein kinase...    441   2e-141   
ref|XP_004152193.1|  PREDICTED: PTI1-like tyrosine-protein kinase...    441   2e-141   
ref|XP_002265603.1|  PREDICTED: PTI1-like tyrosine-protein kinase...    440   7e-141   Vitis vinifera
emb|CAN66493.1|  hypothetical protein VITISV_019852                     439   2e-140   Vitis vinifera
ref|XP_003566899.1|  PREDICTED: protein TOO MANY MOUTHS                 442   4e-140   
ref|XP_002298210.2|  hypothetical protein POPTR_0001s21090g             437   4e-140   Populus trichocarpa [western balsam poplar]
ref|XP_006427300.1|  hypothetical protein CICLE_v10025774mg             428   3e-136   
gb|KCW53834.1|  hypothetical protein EUGRSUZ_J03069                     423   1e-135   
ref|XP_009407376.1|  PREDICTED: PTI1-like tyrosine-protein kinase...    426   2e-135   
gb|EYU24637.1|  hypothetical protein MIMGU_mgv1a009016mg                424   4e-135   
ref|XP_002458184.1|  hypothetical protein SORBIDRAFT_03g028355          429   1e-134   Sorghum bicolor [broomcorn]
ref|XP_009398667.1|  PREDICTED: PTI1-like tyrosine-protein kinase...    420   1e-133   
ref|XP_008676352.1|  PREDICTED: protein TOO MANY MOUTHS-like            425   4e-133   
gb|EAY75013.1|  hypothetical protein OsI_02912                          424   9e-133   Oryza sativa Indica Group [Indian rice]
ref|XP_004951644.1|  PREDICTED: PTI1-like tyrosine-protein kinase...    419   1e-132   
ref|XP_006584559.1|  PREDICTED: uncharacterized protein LOC100791...    417   2e-132   
dbj|BAJ86094.1|  predicted protein                                      420   1e-131   
ref|XP_008793949.1|  PREDICTED: PTI1-like tyrosine-protein kinase...    416   2e-131   
ref|NP_001242499.1|  uncharacterized protein LOC100791193               415   2e-131   
ref|XP_010911937.1|  PREDICTED: PTI1-like tyrosine-protein kinase...    414   4e-131   
ref|XP_006646119.1|  PREDICTED: protein TOO MANY MOUTHS-like            418   7e-131   
ref|XP_006856498.1|  hypothetical protein AMTR_s00046p00085030          413   2e-130   
ref|XP_009413674.1|  PREDICTED: PTI1-like tyrosine-protein kinase...    412   2e-130   
ref|XP_006855160.1|  hypothetical protein AMTR_s00051p00071560          414   2e-129   
ref|NP_001148756.1|  BRASSINOSTEROID INSENSITIVE 1-associated rec...    409   4e-129   Zea mays [maize]
ref|XP_010691096.1|  PREDICTED: PTI1-like tyrosine-protein kinase...    409   8e-129   
gb|ABR17823.1|  unknown                                                 407   1e-128   Picea sitchensis
ref|XP_009418509.1|  PREDICTED: PTI1-like tyrosine-protein kinase...    408   2e-128   
ref|XP_003528313.1|  PREDICTED: PTI1-like tyrosine-protein kinase...    407   2e-128   
ref|XP_006583120.1|  PREDICTED: PTI1-like tyrosine-protein kinase...    407   2e-128   
ref|XP_002453424.1|  hypothetical protein SORBIDRAFT_04g005810          406   5e-128   Sorghum bicolor [broomcorn]
gb|EPS59499.1|  hypothetical protein M569_15303                         405   6e-128   
ref|NP_001046121.1|  Os02g0186500                                       405   1e-127   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006647017.1|  PREDICTED: PTI1-like tyrosine-protein kinase...    404   4e-127   
ref|NP_001241751.1|  BRASSINOSTEROID INSENSITIVE 1-associated rec...    402   2e-126   
ref|XP_008676673.1|  PREDICTED: uncharacterized LOC100216921 isof...    402   2e-126   
gb|KHN37992.1|  PTI1-like tyrosine-protein kinase                       395   3e-124   
ref|XP_007135761.1|  hypothetical protein PHAVU_010G156500g             394   1e-123   
ref|XP_010545758.1|  PREDICTED: PTI1-like tyrosine-protein kinase...    392   6e-123   
gb|KDP37072.1|  hypothetical protein JCGZ_06128                         392   8e-123   
gb|EPS62996.1|  hypothetical protein M569_11790                         389   4e-121   
ref|XP_003570874.1|  PREDICTED: PTI1-like tyrosine-protein kinase...    385   7e-120   
ref|XP_002983581.1|  hypothetical protein SELMODRAFT_118274             382   2e-119   
ref|XP_002973814.1|  hypothetical protein SELMODRAFT_149289             382   4e-119   
gb|KHN01323.1|  PTI1-like tyrosine-protein kinase                       384   7e-119   
ref|XP_006406905.1|  hypothetical protein EUTSA_v10020984mg             378   2e-117   
ref|XP_006305213.1|  hypothetical protein CARUB_v10009580mg             374   4e-116   
ref|XP_010465584.1|  PREDICTED: PTI1-like tyrosine-protein kinase...    373   7e-116   
ref|XP_010465583.1|  PREDICTED: PTI1-like tyrosine-protein kinase...    374   7e-116   
gb|AAD55610.1|AC008016_20  Contains PF|00069 Eukaryotic protein k...    371   5e-115   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002882968.1|  hypothetical protein ARALYDRAFT_479045             371   9e-115   
ref|NP_564609.3|  protein kinase superfamily protein                    370   1e-114   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002894383.1|  hypothetical protein ARALYDRAFT_337406             370   1e-114   
gb|EMT24605.1|  Somatic embryogenesis receptor kinase 2                 378   2e-114   
gb|EAZ12736.1|  hypothetical protein OsJ_02654                          373   8e-114   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010487434.1|  PREDICTED: PTI1-like tyrosine-protein kinase...    366   2e-113   
ref|XP_001782162.1|  predicted protein                                  366   2e-113   
ref|XP_010479762.1|  PREDICTED: PTI1-like tyrosine-protein kinase...    366   4e-113   
ref|XP_010487433.1|  PREDICTED: PTI1-like tyrosine-protein kinase...    365   5e-113   
ref|XP_006584166.1|  PREDICTED: PTI1-like tyrosine-protein kinase...    365   8e-113   
ref|XP_010500854.1|  PREDICTED: PTI1-like tyrosine-protein kinase...    365   1e-112   
ref|XP_002980938.1|  hypothetical protein SELMODRAFT_113448             363   3e-112   
ref|XP_002989320.1|  hypothetical protein SELMODRAFT_129596             363   4e-112   
ref|XP_010503560.1|  PREDICTED: PTI1-like tyrosine-protein kinase...    362   7e-112   
ref|XP_010503552.1|  PREDICTED: PTI1-like tyrosine-protein kinase...    361   2e-111   
ref|XP_006392910.1|  hypothetical protein EUTSA_v10011602mg             362   3e-111   
gb|KFK35800.1|  hypothetical protein AALP_AA4G038100                    358   3e-110   
ref|XP_010462090.1|  PREDICTED: PTI1-like tyrosine-protein kinase...    358   3e-110   
ref|XP_006297987.1|  hypothetical protein CARUB_v10014029mg             357   2e-109   
ref|XP_006655827.1|  PREDICTED: PTI1-like tyrosine-protein kinase...    355   6e-109   
ref|NP_001056916.2|  Os06g0166900                                       355   1e-108   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004964746.1|  PREDICTED: PTI1-like tyrosine-protein kinase...    355   1e-108   
ref|NP_566530.1|  PTI1-like tyrosine-protein kinase                     354   2e-108   Arabidopsis thaliana [mouse-ear cress]
gb|KFK38942.1|  hypothetical protein AALP_AA3G180100                    354   2e-108   
gb|AAM65900.1|  protein kinase, putative                                354   2e-108   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002436553.1|  hypothetical protein SORBIDRAFT_10g004600          353   5e-108   Sorghum bicolor [broomcorn]
ref|XP_004964747.1|  PREDICTED: PTI1-like tyrosine-protein kinase...    352   1e-107   
ref|XP_002975616.1|  hypothetical protein SELMODRAFT_103981             349   3e-107   
ref|XP_002973593.1|  hypothetical protein SELMODRAFT_99707              349   4e-107   
ref|XP_003564264.1|  PREDICTED: PTI1-like tyrosine-protein kinase...    349   1e-106   
ref|XP_001781813.1|  predicted protein                                  348   2e-106   
ref|XP_010479764.1|  PREDICTED: PTI1-like tyrosine-protein kinase...    343   2e-105   
emb|CDY49913.1|  BnaA05g14800D                                          346   2e-105   
ref|XP_008647456.1|  PREDICTED: uncharacterized LOC100216997 isof...    350   4e-105   
ref|XP_009144835.1|  PREDICTED: PTI1-like tyrosine-protein kinase...    345   4e-105   
emb|CDX87914.1|  BnaC06g09760D                                          345   6e-105   
ref|XP_007014100.1|  LRR receptor-like serine/threonine-protein k...    345   9e-105   
gb|KCW53831.1|  hypothetical protein EUGRSUZ_J03068                     346   1e-104   
ref|XP_011069876.1|  PREDICTED: PTI1-like tyrosine-protein kinase...    343   4e-104   
ref|XP_008223625.1|  PREDICTED: PTI1-like tyrosine-protein kinase...    343   5e-104   
gb|KDP43800.1|  hypothetical protein JCGZ_23008                         343   5e-104   
ref|XP_003610194.1|  Receptor-like kinase                               342   7e-104   
gb|KDO48605.1|  hypothetical protein CISIN_1g0368652mg                  337   7e-104   
gb|KDO62428.1|  hypothetical protein CISIN_1g037869mg                   342   7e-104   
ref|XP_006474623.1|  PREDICTED: PTI1-like tyrosine-protein kinase...    342   8e-104   
gb|KHG24034.1|  hypothetical protein F383_31684                         343   1e-103   
dbj|BAK03243.1|  predicted protein                                      343   2e-103   
ref|XP_007227655.1|  hypothetical protein PRUPE_ppa015042mg             341   3e-103   
ref|XP_006381846.1|  hypothetical protein POPTR_0006s18780g             339   1e-102   
ref|XP_009344789.1|  PREDICTED: PTI1-like tyrosine-protein kinase...    339   1e-102   
ref|XP_011012682.1|  PREDICTED: PTI1-like tyrosine-protein kinase...    339   2e-102   
ref|XP_002534343.1|  serine-threonine protein kinase, plant-type,...    339   2e-102   Ricinus communis
gb|KHN17562.1|  PTI1-like tyrosine-protein kinase                       338   3e-102   
ref|XP_004296427.1|  PREDICTED: PTI1-like tyrosine-protein kinase...    338   4e-102   
ref|XP_003550671.1|  PREDICTED: PTI1-like tyrosine-protein kinase...    337   5e-102   
ref|XP_007154803.1|  hypothetical protein PHAVU_003G149200g             337   7e-102   
ref|XP_002271881.1|  PREDICTED: PTI1-like tyrosine-protein kinase...    337   8e-102   Vitis vinifera
ref|XP_009608070.1|  PREDICTED: PTI1-like tyrosine-protein kinase...    337   1e-101   
ref|XP_004242669.1|  PREDICTED: PTI1-like tyrosine-protein kinase...    337   1e-101   
ref|XP_006343699.1|  PREDICTED: PTI1-like tyrosine-protein kinase...    337   2e-101   
ref|XP_009799766.1|  PREDICTED: PTI1-like tyrosine-protein kinase...    335   3e-101   
gb|KCW81052.1|  hypothetical protein EUGRSUZ_C02427                     335   3e-101   
ref|XP_008782087.1|  PREDICTED: PTI1-like tyrosine-protein kinase...    336   4e-101   
ref|XP_010051007.1|  PREDICTED: PTI1-like tyrosine-protein kinase...    335   4e-101   
ref|XP_004508236.1|  PREDICTED: PTI1-like tyrosine-protein kinase...    335   7e-101   
ref|XP_010913840.1|  PREDICTED: PTI1-like tyrosine-protein kinase...    334   1e-100   
ref|XP_008658224.1|  PREDICTED: uncharacterized LOC100272420 isof...    333   1e-100   
ref|XP_008341188.1|  PREDICTED: PTI1-like tyrosine-protein kinase...    333   2e-100   
gb|ACG32332.1|  BRASSINOSTEROID INSENSITIVE 1-associated receptor...    333   2e-100   Zea mays [maize]
ref|NP_001140369.1|  uncharacterized LOC100272420                       333   3e-100   Zea mays [maize]
ref|XP_009379508.1|  PREDICTED: PTI1-like tyrosine-protein kinase...    333   4e-100   
ref|XP_008785783.1|  PREDICTED: PTI1-like tyrosine-protein kinase...    327   6e-100   
gb|EYU42447.1|  hypothetical protein MIMGU_mgv1a024689mg                332   6e-100   
ref|XP_009386921.1|  PREDICTED: PTI1-like tyrosine-protein kinase...    332   1e-99    
ref|XP_008376715.1|  PREDICTED: PTI1-like tyrosine-protein kinase...    328   4e-99    
gb|EMT07880.1|  BRASSINOSTEROID INSENSITIVE 1-associated receptor...    329   6e-99    
ref|XP_002437390.1|  hypothetical protein SORBIDRAFT_10g026050          331   7e-99    Sorghum bicolor [broomcorn]
ref|XP_004965690.1|  PREDICTED: PTI1-like tyrosine-protein kinase...    330   8e-99    
ref|XP_004972015.1|  PREDICTED: protein TOO MANY MOUTHS-like            327   1e-98    
ref|XP_011076498.1|  PREDICTED: PTI1-like tyrosine-protein kinase...    328   2e-98    
gb|KHN34788.1|  PTI1-like tyrosine-protein kinase                       329   2e-98    
ref|XP_009630948.1|  PREDICTED: PTI1-like tyrosine-protein kinase...    327   2e-98    
ref|XP_008376494.1|  PREDICTED: PTI1-like tyrosine-protein kinase...    326   3e-98    
ref|XP_008376495.1|  PREDICTED: PTI1-like tyrosine-protein kinase...    326   3e-98    
ref|XP_008659880.1|  PREDICTED: PTI1-like tyrosine-protein kinase...    328   3e-98    
ref|XP_006595207.1|  PREDICTED: PTI1-like tyrosine-protein kinase...    328   4e-98    
gb|AFW87652.1|  putative protein kinase superfamily protein             328   6e-98    
ref|XP_002981460.1|  hypothetical protein SELMODRAFT_114199             323   1e-97    
ref|XP_007143343.1|  hypothetical protein PHAVU_007G064500g             325   2e-97    
ref|XP_003535634.1|  PREDICTED: PTI1-like tyrosine-protein kinase...    325   2e-97    
ref|XP_002969992.1|  hypothetical protein SELMODRAFT_146686             323   2e-97    
ref|XP_009774043.1|  PREDICTED: PTI1-like tyrosine-protein kinase...    326   2e-97    
ref|XP_002989166.1|  hypothetical protein SELMODRAFT_129339             326   3e-97    
gb|AES62624.2|  Pti1-like kinase                                        324   4e-97    
ref|XP_006362706.1|  PREDICTED: PTI1-like tyrosine-protein kinase...    324   5e-97    
ref|XP_006845569.1|  hypothetical protein AMTR_s00019p00191440          321   6e-97    
ref|XP_002987334.1|  hypothetical protein SELMODRAFT_125817             325   6e-97    
ref|XP_008234480.1|  PREDICTED: PTI1-like tyrosine-protein kinase...    320   1e-96    
ref|XP_006490459.1|  PREDICTED: PTI1-like tyrosine-protein kinase...    322   1e-96    
ref|XP_003592373.1|  Somatic embryogenesis receptor kinase              324   1e-96    
ref|XP_011041654.1|  PREDICTED: PTI1-like tyrosine-protein kinase...    321   4e-96    
ref|XP_006829142.1|  hypothetical protein AMTR_s00001p00269270          320   5e-96    
gb|ACM89573.1|  receptor protein kinase                                 315   1e-95    Glycine max [soybeans]
ref|XP_011041653.1|  PREDICTED: PTI1-like tyrosine-protein kinase...    320   1e-95    
ref|XP_004150305.1|  PREDICTED: PTI1-like tyrosine-protein kinase...    319   2e-95    
ref|XP_004496638.1|  PREDICTED: PTI1-like tyrosine-protein kinase...    319   2e-95    
ref|XP_009408721.1|  PREDICTED: PTI1-like tyrosine-protein kinase...    317   5e-95    
ref|XP_004234145.1|  PREDICTED: PTI1-like tyrosine-protein kinase...    318   6e-95    
gb|KHN02777.1|  PTI1-like tyrosine-protein kinase                       318   6e-95    
ref|XP_004160904.1|  PREDICTED: LOW QUALITY PROTEIN: PTI1-like ty...    317   7e-95    
ref|XP_008439143.1|  PREDICTED: PTI1-like tyrosine-protein kinase...    317   8e-95    
gb|EYU25031.1|  hypothetical protein MIMGU_mgv1a018166mg                316   8e-95    
ref|XP_004309246.1|  PREDICTED: PTI1-like tyrosine-protein kinase...    317   2e-94    
ref|XP_011030190.1|  PREDICTED: PTI1-like tyrosine-protein kinase...    316   2e-94    
ref|XP_010035055.1|  PREDICTED: PTI1-like tyrosine-protein kinase...    317   2e-94    
ref|XP_010035056.1|  PREDICTED: PTI1-like tyrosine-protein kinase...    316   2e-94    
ref|XP_003563351.1|  PREDICTED: PTI1-like tyrosine-protein kinase...    318   6e-94    
gb|KDP22358.1|  hypothetical protein JCGZ_26189                         313   6e-94    
ref|XP_002271284.1|  PREDICTED: PTI1-like tyrosine-protein kinase...    315   1e-93    Vitis vinifera
ref|XP_008805652.1|  PREDICTED: PTI1-like tyrosine-protein kinase...    313   1e-93    
ref|XP_010662348.1|  PREDICTED: PTI1-like tyrosine-protein kinase...    313   1e-93    
ref|XP_010905307.1|  PREDICTED: PTI1-like tyrosine-protein kinase...    313   2e-93    
ref|XP_010109063.1|  PTI1-like tyrosine-protein kinase                  315   2e-93    
ref|XP_007038522.1|  Kinase superfamily protein                         315   2e-93    
gb|KHN15699.1|  PTI1-like tyrosine-protein kinase                       314   2e-93    
ref|XP_002510877.1|  serine-threonine protein kinase, plant-type,...    313   3e-93    Ricinus communis
gb|KCW46320.1|  hypothetical protein EUGRSUZ_K00182                     311   6e-93    
ref|XP_010035057.1|  PREDICTED: PTI1-like tyrosine-protein kinase...    311   6e-93    
ref|XP_007152367.1|  hypothetical protein PHAVU_004G124100g             311   7e-93    
ref|XP_009386443.1|  PREDICTED: PTI1-like tyrosine-protein kinase...    311   1e-92    
ref|NP_001174934.1|  Os06g0654500                                       313   2e-92    
ref|XP_006600093.1|  PREDICTED: PTI1-like tyrosine-protein kinase...    308   5e-92    
ref|XP_006453445.1|  hypothetical protein CICLE_v10010513mg             310   8e-92    
gb|EPS58412.1|  hypothetical protein M569_16401                         306   2e-91    
ref|XP_004146351.1|  PREDICTED: PTI1-like tyrosine-protein kinase...    309   3e-91    
ref|XP_008453646.1|  PREDICTED: PTI1-like tyrosine-protein kinase...    309   3e-91    
emb|CDX82425.1|  BnaA03g33960D                                          306   4e-91    
gb|ACN36882.1|  unknown                                                 302   8e-91    Zea mays [maize]
ref|XP_009115182.1|  PREDICTED: PTI1-like tyrosine-protein kinase...    305   2e-90    
ref|XP_009135465.1|  PREDICTED: PTI1-like tyrosine-protein kinase...    305   3e-90    
emb|CDY20162.1|  BnaA01g28400D                                          304   3e-90    
dbj|BAD37549.1|  receptor protein kinase PERK1-like                     305   6e-90    Oryza sativa Japonica Group [Japonica rice]
emb|CDX75852.1|  BnaC03g39350D                                          303   6e-90    
emb|CDP05271.1|  unnamed protein product                                305   7e-90    
ref|XP_006588252.1|  PREDICTED: PTI1-like tyrosine-protein kinase...    305   7e-90    
emb|CDY21883.1|  BnaC01g35650D                                          303   9e-90    
ref|XP_002318854.2|  hypothetical protein POPTR_0012s14060g             300   1e-89    
ref|XP_006660881.1|  PREDICTED: PTI1-like tyrosine-protein kinase...    303   4e-89    
ref|XP_002321867.2|  hypothetical protein POPTR_0015s14040g             298   9e-89    
ref|XP_006657205.1|  PREDICTED: PTI1-like tyrosine-protein kinase...    302   1e-88    
gb|KHN31557.1|  PTI1-like tyrosine-protein kinase                       303   1e-88    
tpg|DAA62447.1|  TPA: putative protein kinase superfamily protein       300   3e-88    
ref|XP_004167378.1|  PREDICTED: PTI1-like tyrosine-protein kinase...    296   2e-87    
ref|XP_001754509.1|  predicted protein                                  295   8e-87    
emb|CDY66888.1|  BnaA06g37490D                                          294   2e-86    
ref|XP_009147680.1|  PREDICTED: PTI1-like tyrosine-protein kinase...    293   3e-86    
emb|CDY40153.1|  BnaC06g05360D                                          291   2e-85    
gb|EAZ09853.1|  hypothetical protein OsI_32145                          294   2e-85    
ref|XP_003576765.1|  PREDICTED: PTI1-like tyrosine-protein kinase...    292   3e-85    
gb|KHN10478.1|  PTI1-like tyrosine-protein kinase                       287   6e-85    
ref|XP_008376723.1|  PREDICTED: PTI1-like tyrosine-protein kinase...    284   3e-83    
gb|KDO65320.1|  hypothetical protein CISIN_1g046728mg                   284   5e-83    
gb|KGN65416.1|  hypothetical protein Csa_1G419310                       283   6e-83    
ref|XP_001751351.1|  predicted protein                                  284   1e-82    
gb|EEE66142.1|  hypothetical protein OsJ_22205                          282   1e-81    
ref|XP_002966882.1|  hypothetical protein SELMODRAFT_408118             275   7e-80    
gb|EEE70101.1|  hypothetical protein OsJ_30109                          293   1e-79    
ref|XP_002961127.1|  hypothetical protein SELMODRAFT_164191             271   8e-79    
ref|XP_001780335.1|  predicted protein                                  262   2e-75    
emb|CBI24473.3|  unnamed protein product                                259   4e-74    
gb|ACN27758.1|  unknown                                                 253   2e-73    
dbj|BAF79982.1|  receptor-like kinase                                   266   4e-73    
tpg|DAA52780.1|  TPA: putative prolin-rich extensin-like receptor...    246   3e-69    
ref|XP_002457091.1|  hypothetical protein SORBIDRAFT_03g001090          246   8e-69    
ref|XP_002887301.1|  kinase family protein                              246   1e-68    
gb|EYU28934.1|  hypothetical protein MIMGU_mgv1a025530mg                246   2e-68    
ref|XP_010927303.1|  PREDICTED: proline-rich receptor-like protei...    243   2e-68    
emb|CBI16871.3|  unnamed protein product                                246   3e-68    
ref|XP_010527207.1|  PREDICTED: LOW QUALITY PROTEIN: proline-rich...    251   3e-68    
ref|XP_009388801.1|  PREDICTED: proline-rich receptor-like protei...    251   3e-68    
gb|KCW56393.1|  hypothetical protein EUGRSUZ_I02121                     244   5e-68    
ref|XP_011072361.1|  PREDICTED: proline-rich receptor-like protei...    246   5e-68    
gb|KCW82423.1|  hypothetical protein EUGRSUZ_C03822                     245   6e-68    
gb|KCW82422.1|  hypothetical protein EUGRSUZ_C03822                     244   9e-68    
ref|XP_002279197.1|  PREDICTED: proline-rich receptor-like protei...    248   1e-67    
ref|XP_010030811.1|  PREDICTED: proline-rich receptor-like protei...    245   1e-67    
ref|XP_006656979.1|  PREDICTED: proline-rich receptor-like protei...    243   1e-67    
ref|XP_010243047.1|  PREDICTED: proline-rich receptor-like protei...    252   1e-67    
ref|XP_010925846.1|  PREDICTED: proline-rich receptor-like protei...    246   2e-67    
ref|XP_011100125.1|  PREDICTED: proline-rich receptor-like protei...    249   3e-67    
ref|XP_004512025.1|  PREDICTED: proline-rich receptor-like protei...    249   3e-67    
ref|XP_010243045.1|  PREDICTED: proline-rich receptor-like protei...    251   3e-67    
ref|XP_002514297.1|  ATP binding protein, putative                      249   3e-67    
ref|XP_002455326.1|  hypothetical protein SORBIDRAFT_03g008430          241   3e-67    
ref|XP_010051585.1|  PREDICTED: proline-rich receptor-like protei...    244   3e-67    
ref|XP_009600094.1|  PREDICTED: proline-rich receptor-like protei...    249   4e-67    
emb|CDO97062.1|  unnamed protein product                                244   4e-67    
gb|KDP33677.1|  hypothetical protein JCGZ_07248                         248   5e-67    
gb|EYU40150.1|  hypothetical protein MIMGU_mgv1a002653mg                248   5e-67    
ref|XP_010262824.1|  PREDICTED: putative serine/threonine-protein...    240   5e-67    
ref|NP_001237102.1|  putative receptor protein kinase PERK1             243   5e-67    
emb|CAN75405.1|  hypothetical protein VITISV_010509                     247   5e-67    
gb|KHN45639.1|  Proline-rich receptor-like protein kinase PERK1         242   6e-67    
ref|XP_009601269.1|  PREDICTED: proline-rich receptor-like protei...    246   6e-67    
ref|XP_008790437.1|  PREDICTED: putative proline-rich receptor-li...    243   6e-67    
ref|XP_007046970.1|  Roline-rich extensin-like receptor kinase 4        246   7e-67    
ref|XP_010265346.1|  PREDICTED: proline-rich receptor-like protei...    249   8e-67    
ref|XP_010034845.1|  PREDICTED: proline-rich receptor-like protei...    243   8e-67    
ref|XP_010249724.1|  PREDICTED: proline-rich receptor-like protei...    247   8e-67    
ref|XP_010034744.1|  PREDICTED: proline-rich receptor-like protei...    240   8e-67    
gb|AES76893.2|  receptor-like kinase                                    241   9e-67    
ref|XP_009421422.1|  PREDICTED: proline-rich receptor-like protei...    241   9e-67    
ref|XP_011077496.1|  PREDICTED: proline-rich receptor-like protei...    249   9e-67    
ref|XP_003620675.1|  Receptor protein kinase PERK1                      241   1e-66    
ref|XP_008781703.1|  PREDICTED: proline-rich receptor-like protei...    247   1e-66    
ref|XP_011077492.1|  PREDICTED: proline-rich receptor-like protei...    249   1e-66    
gb|AAO72646.1|  putative receptor protein kinase                        240   1e-66    
ref|NP_001054941.1|  Os05g0218400                                       240   1e-66    
ref|XP_010229848.1|  PREDICTED: proline-rich receptor-like protei...    241   1e-66    
gb|KHN20676.1|  Proline-rich receptor-like protein kinase PERK1         243   1e-66    
ref|XP_008673227.1|  PREDICTED: uncharacterized protein LOC100383...    246   1e-66    
ref|XP_007033397.1|  Proline-rich receptor protein kinase PERK10 ...    249   1e-66    
gb|KHN07732.1|  Proline-rich receptor-like protein kinase PERK9         240   1e-66    
gb|KHN36118.1|  Proline-rich receptor-like protein kinase PERK4         239   1e-66    
ref|XP_004304153.1|  PREDICTED: proline-rich receptor-like protei...    248   1e-66    
ref|XP_011072360.1|  PREDICTED: proline-rich receptor-like protei...    244   1e-66    
gb|ACF86764.1|  unknown                                                 240   1e-66    
ref|XP_007153734.1|  hypothetical protein PHAVU_003G060600g             244   2e-66    
ref|XP_009769580.1|  PREDICTED: proline-rich receptor-like protei...    247   2e-66    
emb|CDO98035.1|  unnamed protein product                                244   2e-66    
ref|XP_010939267.1|  PREDICTED: proline-rich receptor-like protei...    246   2e-66    
ref|XP_002978931.1|  hypothetical protein SELMODRAFT_109804             239   2e-66    
ref|XP_004232101.1|  PREDICTED: proline-rich receptor-like protei...    247   2e-66    
ref|XP_009416804.1|  PREDICTED: proline-rich receptor-like protei...    246   2e-66    
gb|KHG22016.1|  Proline-rich receptor-like protein kinase PERK1         239   3e-66    
gb|AFW77530.1|  putative prolin-rich extensin-like receptor prote...    240   3e-66    
gb|KDP46243.1|  hypothetical protein JCGZ_10083                         242   3e-66    
ref|XP_004967426.1|  PREDICTED: proline-rich receptor-like protei...    245   3e-66    
ref|XP_007026740.1|  Kinase superfamily protein isoform 3               236   4e-66    
ref|XP_009802342.1|  PREDICTED: proline-rich receptor-like protei...    244   4e-66    
ref|XP_010520632.1|  PREDICTED: proline-rich receptor-like protei...    244   4e-66    
ref|XP_007026739.1|  Kinase superfamily protein isoform 2               238   4e-66    
gb|EEC78728.1|  hypothetical protein OsI_18915                          239   5e-66    
ref|XP_002468135.1|  hypothetical protein SORBIDRAFT_01g040190          238   5e-66    
emb|CDM82387.1|  unnamed protein product                                239   5e-66    
gb|KDO48899.1|  hypothetical protein CISIN_1g014904mg                   238   6e-66    
ref|XP_006300899.1|  hypothetical protein CARUB_v10021266mg             246   6e-66    
ref|XP_007217642.1|  hypothetical protein PRUPE_ppa002001mg             247   6e-66    
ref|XP_011099296.1|  PREDICTED: proline-rich receptor-like protei...    246   6e-66    
gb|KHN41988.1|  Proline-rich receptor-like protein kinase PERK4         239   6e-66    
gb|EPS63150.1|  hypothetical protein M569_11637                         248   6e-66    
ref|XP_003565837.1|  PREDICTED: proline-rich receptor-like protei...    246   6e-66    
ref|XP_001773277.1|  predicted protein                                  235   6e-66    
ref|XP_008337381.1|  PREDICTED: LOW QUALITY PROTEIN: proline-rich...    245   6e-66    
ref|XP_004298569.1|  PREDICTED: proline-rich receptor-like protei...    246   7e-66    
gb|KDO48900.1|  hypothetical protein CISIN_1g014904mg                   238   7e-66    
ref|XP_010103058.1|  Proline-rich receptor-like protein kinase PERK1    240   8e-66    
ref|XP_008795084.1|  PREDICTED: proline-rich receptor-like protei...    241   8e-66    
ref|XP_002279468.1|  PREDICTED: proline-rich receptor-like protei...    246   9e-66    
ref|XP_004156667.1|  PREDICTED: probable LRR receptor-like serine...    237   9e-66    
ref|XP_010270709.1|  PREDICTED: proline-rich receptor-like protei...    239   1e-65    
ref|XP_010415724.1|  PREDICTED: proline-rich receptor-like protei...    246   1e-65    
gb|EPS57738.1|  hypothetical protein M569_17078                         234   1e-65    
ref|XP_010033701.1|  PREDICTED: proline-rich receptor-like protei...    241   1e-65    
ref|XP_004137905.1|  PREDICTED: probable LRR receptor-like serine...    237   1e-65    
ref|XP_006366995.1|  PREDICTED: putative proline-rich receptor-li...    241   1e-65    
ref|XP_006654162.1|  PREDICTED: proline-rich receptor-like protei...    238   1e-65    
ref|XP_009411248.1|  PREDICTED: proline-rich receptor-like protei...    246   1e-65    
ref|XP_002988273.1|  hypothetical protein SELMODRAFT_159261             236   1e-65    
emb|CDM80036.1|  unnamed protein product                                244   1e-65    
ref|XP_010936757.1|  PREDICTED: proline-rich receptor-like protei...    245   1e-65    
gb|AAV25281.1|  putative protein kinase                                 239   1e-65    
ref|XP_009127796.1|  PREDICTED: proline-rich receptor-like protei...    244   1e-65    
ref|XP_010471037.1|  PREDICTED: proline-rich receptor-like protei...    246   1e-65    
ref|XP_009407036.1|  PREDICTED: proline-rich receptor-like protei...    244   1e-65    
ref|XP_006338285.1|  PREDICTED: proline-rich receptor-like protei...    244   2e-65    
ref|XP_010034842.1|  PREDICTED: proline-rich receptor-like protei...    241   2e-65    
ref|XP_009399289.1|  PREDICTED: proline-rich receptor-like protei...    242   2e-65    
ref|XP_006383219.1|  kinase family protein                              243   2e-65    
ref|XP_007156929.1|  hypothetical protein PHAVU_002G029200g             243   2e-65    
ref|XP_006409147.1|  hypothetical protein EUTSA_v10022596mg             243   2e-65    
ref|XP_008463394.1|  PREDICTED: proline-rich receptor-like protei...    243   2e-65    
dbj|BAJ85171.1|  predicted protein                                      244   2e-65    
ref|XP_002284430.2|  PREDICTED: proline-rich receptor-like protei...    243   2e-65    
ref|XP_004489835.1|  PREDICTED: proline-rich receptor-like protei...    237   2e-65    
ref|XP_008458364.1|  PREDICTED: proline-rich receptor-like protei...    244   2e-65    
ref|XP_011078316.1|  PREDICTED: proline-rich receptor-like protei...    244   2e-65    
ref|XP_004167146.1|  PREDICTED: proline-rich receptor-like protei...    243   2e-65    
ref|XP_008782431.1|  PREDICTED: proline-rich receptor-like protei...    245   2e-65    
ref|XP_002509476.1|  somatic embryogenesis receptor kinase, putative    239   2e-65    
ref|XP_004967974.1|  PREDICTED: proline-rich receptor-like protei...    244   2e-65    
ref|XP_004139342.1|  PREDICTED: proline-rich receptor-like protei...    244   2e-65    
ref|XP_010999977.1|  PREDICTED: proline-rich receptor-like protei...    242   2e-65    
ref|XP_004150052.1|  PREDICTED: proline-rich receptor-like protei...    243   2e-65    
ref|XP_008230372.1|  PREDICTED: proline-rich receptor-like protei...    246   2e-65    
ref|NP_177203.1|  proline-rich extensin-like receptor kinase 13         244   3e-65    
ref|XP_010254113.1|  PREDICTED: proline-rich receptor-like protei...    245   3e-65    
ref|XP_009105707.1|  PREDICTED: proline-rich receptor-like protei...    245   3e-65    
ref|XP_009374021.1|  PREDICTED: proline-rich receptor-like protei...    243   3e-65    
ref|XP_007159309.1|  hypothetical protein PHAVU_002G227300g             235   3e-65    
ref|XP_010427822.1|  PREDICTED: proline-rich receptor-like protei...    244   3e-65    
gb|KDO70152.1|  hypothetical protein CISIN_1g005443mg                   244   3e-65    
ref|XP_010097823.1|  Proline-rich receptor-like protein kinase PE...    245   3e-65    
ref|XP_010943774.1|  PREDICTED: proline-rich receptor-like protei...    237   3e-65    
ref|XP_009371020.1|  PREDICTED: proline-rich receptor-like protei...    245   4e-65    
ref|XP_008341851.1|  PREDICTED: proline-rich receptor-like protei...    244   4e-65    
ref|XP_008776736.1|  PREDICTED: proline-rich receptor-like protei...    242   4e-65    
ref|XP_006833299.1|  hypothetical protein AMTR_s00109p00039350          238   4e-65    
ref|XP_006646326.1|  PREDICTED: proline-rich receptor-like protei...    244   4e-65    
ref|XP_006380754.1|  hypothetical protein POPTR_0007s12680g             242   4e-65    
ref|XP_006340604.1|  PREDICTED: LOW QUALITY PROTEIN: proline-rich...    241   5e-65    
ref|XP_010034740.1|  PREDICTED: proline-rich receptor-like protei...    235   5e-65    
ref|XP_008340041.1|  PREDICTED: proline-rich receptor-like protei...    245   5e-65    
ref|XP_008340042.1|  PREDICTED: proline-rich receptor-like protei...    245   5e-65    
ref|XP_008361244.1|  PREDICTED: proline-rich receptor-like protei...    243   5e-65    
ref|XP_006484379.1|  PREDICTED: proline-rich receptor-like protei...    245   5e-65    
ref|XP_006437775.1|  hypothetical protein CICLE_v10030737mg             245   5e-65    
ref|XP_010262232.1|  PREDICTED: proline-rich receptor-like protei...    243   5e-65    
gb|KHN44498.1|  Proline-rich receptor-like protein kinase PERK4         239   5e-65    
gb|EPS61599.1|  hypothetical protein M569_13198                         239   6e-65    
ref|XP_006390888.1|  hypothetical protein EUTSA_v10018193mg             244   6e-65    
ref|XP_008340040.1|  PREDICTED: proline-rich receptor-like protei...    245   6e-65    
ref|XP_004234613.1|  PREDICTED: proline-rich receptor-like protei...    244   6e-65    
gb|KEH27754.1|  receptor-like kinase                                    235   6e-65    
ref|XP_007135679.1|  hypothetical protein PHAVU_010G149300g             240   6e-65    
ref|XP_009764139.1|  PREDICTED: proline-rich receptor-like protei...    240   6e-65    
ref|XP_006575795.1|  PREDICTED: proline-rich receptor-like protei...    236   6e-65    
ref|NP_001042469.1|  Os01g0227200                                       241   7e-65    
ref|XP_008442433.1|  PREDICTED: putative serine/threonine-protein...    234   7e-65    
gb|KEH27755.1|  receptor-like kinase                                    235   7e-65    
ref|XP_010688211.1|  PREDICTED: proline-rich receptor-like protei...    240   7e-65    
ref|XP_009611770.1|  PREDICTED: proline-rich receptor-like protei...    240   7e-65    
ref|XP_006356649.1|  PREDICTED: proline-rich receptor-like protei...    240   7e-65    
ref|XP_003565887.2|  PREDICTED: proline-rich receptor-like protei...    240   7e-65    
ref|XP_010468254.1|  PREDICTED: putative serine/threonine-protein...    234   7e-65    
ref|XP_009371633.1|  PREDICTED: proline-rich receptor-like protei...    242   7e-65    
gb|KCW53712.1|  hypothetical protein EUGRSUZ_J02968                     235   8e-65    
ref|XP_008338108.1|  PREDICTED: proline-rich receptor-like protei...    242   8e-65    
ref|XP_009112357.1|  PREDICTED: putative proline-rich receptor-li...    243   8e-65    
ref|XP_006602383.1|  PREDICTED: proline-rich receptor-like protei...    239   8e-65    
emb|CDY18547.1|  BnaA01g26480D                                          243   9e-65    
ref|XP_009357018.1|  PREDICTED: proline-rich receptor-like protei...    243   9e-65    
ref|XP_006423247.1|  hypothetical protein CICLE_v10029936mg             243   9e-65    
ref|XP_003528909.1|  PREDICTED: proline-rich receptor-like protei...    242   9e-65    
gb|EEC74939.1|  hypothetical protein OsI_10907                          239   1e-64    
emb|CDX95494.1|  BnaC01g33860D                                          242   1e-64    
ref|NP_001136506.1|  uncharacterized protein LOC100216621               235   1e-64    
ref|XP_004235662.1|  PREDICTED: proline-rich receptor-like protei...    240   1e-64    
gb|KFK41458.1|  hypothetical protein AALP_AA2G133300                    242   1e-64    
ref|XP_010486455.1|  PREDICTED: putative serine/threonine-protein...    234   1e-64    
ref|XP_009591207.1|  PREDICTED: proline-rich receptor-like protei...    243   1e-64    
ref|XP_006343064.1|  PREDICTED: proline-rich receptor-like protei...    240   1e-64    
ref|XP_010548337.1|  PREDICTED: proline-rich receptor-like protei...    240   1e-64    
gb|EAY73106.1|  hypothetical protein OsI_00982                          240   1e-64    
ref|XP_006586722.1|  PREDICTED: putative receptor protein kinase ...    241   1e-64    
ref|XP_009112492.1|  PREDICTED: proline-rich receptor-like protei...    240   1e-64    
ref|XP_009380343.1|  PREDICTED: proline-rich receptor-like protei...    243   1e-64    
ref|NP_001049678.1|  Os03g0269300                                       239   1e-64    
ref|XP_002439469.1|  hypothetical protein SORBIDRAFT_09g007240          237   1e-64    
ref|XP_006645667.1|  PREDICTED: proline-rich receptor-like protei...    236   1e-64    
ref|NP_001044255.1|  Os01g0750600                                       242   2e-64    
ref|XP_001769758.1|  predicted protein                                  232   2e-64    
ref|XP_010936290.1|  PREDICTED: proline-rich receptor-like protei...    241   2e-64    
ref|XP_004235663.1|  PREDICTED: proline-rich receptor-like protei...    239   2e-64    
gb|AAD56317.1|AC009326_4  putative receptor ser/thr protein kinase      233   2e-64    
ref|XP_009380552.1|  PREDICTED: proline-rich receptor-like protei...    241   2e-64    



>ref|XP_009618264.1| PREDICTED: protein TOO MANY MOUTHS [Nicotiana tomentosiformis]
Length=493

 Score =   647 bits (1670),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 343/473 (73%), Positives = 389/473 (82%), Gaps = 3/473 (1%)
 Frame = +3

Query  342   GQCFTVIVSDSGAPSGLVDAPQTAYSLNNDHARTDAREQEAVYEVMRATGNDWATEIPDV  521
             G  FTVI++DSG PS LVDAPQT YS+NN+ ARTD RE+EAVY++MRATGNDWAT+IPDV
Sbjct  21    GWSFTVIMADSGTPSALVDAPQTGYSMNNNRARTDPREREAVYDIMRATGNDWATDIPDV  80

Query  522   CRGRWHGIECMPDKANVYHVVSLSFGALSDDTAFPTCDTAPRPFISPAVTKLLHLRTLFF  701
             CR RWHGIECMPD  NVYHVVSLSFGALSDDTAFPTCD+    FISP+VTKL HLRTLFF
Sbjct  81    CRDRWHGIECMPDYDNVYHVVSLSFGALSDDTAFPTCDST-HSFISPSVTKLPHLRTLFF  139

Query  702   YRCFTDNPQPIPTFlgqlgqtlqtlVLRENGHVGSIPNQLGNLTRLRVLDFHGNNLNGSI  881
             YRCF++NPQPIP FL QLG TLQTLVLRENG  G IPN+LGNLT LRVLD H NNLNGSI
Sbjct  140   YRCFSNNPQPIPAFLAQLGPTLQTLVLRENGFTGPIPNELGNLTSLRVLDLHKNNLNGSI  199

Query  882   PVSLSRIDGLRSLDLSRNKLAASIPNLTFPLLQILDLNQNHLVGSIPTALINCHSLMKMD  1061
             PVSL RI GLRSLDLS NKL  SIP+LTFP L +LDLNQNHL GSIP+ L+ CH L+K+D
Sbjct  200   PVSLGRITGLRSLDLSDNKLTGSIPSLTFPQLNVLDLNQNHLAGSIPSTLMKCHWLIKLD  259

Query  1062  LSRNRLSGRIPDSIDALNNIILMDLSYNSITGPIPTTLKNLDFLQALVLSGNPMLSDTLP  1241
             LSRNRLSG IP SID LNN+ILMDLSYNS+TG  P +LK L+FLQAL+L+GNPM S TLP
Sbjct  260   LSRNRLSGSIPYSIDNLNNLILMDLSYNSLTGSFPISLKKLNFLQALILNGNPMDSATLP  319

Query  1242  EHIFLDGFKDLMILALSNMNLQGSIPESLAKLPKIRVLHLDGNQLNGSIPASFGeldsls  1421
              + F DGFKDLMILALSNMNLQGSIP SL +LPKIRVLHLDGNQ NGSIP SFG L+SLS
Sbjct  320   VNGF-DGFKDLMILALSNMNLQGSIPNSLGRLPKIRVLHLDGNQFNGSIPLSFGNLNSLS  378

Query  1422  elrldsNQLTGAVPFKREMVWRMRRKLKLSNNSGLCYDAKTGLGDDLEAISDSGISHCGS  1601
             ELRL++N L+G +PFKR+MVWRMRRK+KL+NN GLCY+ + GLGDDLE + DSGI HCG 
Sbjct  379   ELRLNNNMLSGPIPFKRDMVWRMRRKMKLANNEGLCYNNENGLGDDLETLLDSGIGHCGD  438

Query  1602  QATEPTRTVEHISAVDE-SMLRSSVKSGGTVKELSPLSCLLLAVYFL*LKVKH  1757
               TEPT+ VEHIS ++  S+ RS+  SG T+ +L  LS  L+    L L   H
Sbjct  439   SKTEPTKIVEHISTLNRGSISRSNSDSGVTLNKLQLLSKSLIQSATLVLFAFH  491



>ref|XP_009762257.1| PREDICTED: protein TOO MANY MOUTHS [Nicotiana sylvestris]
Length=493

 Score =   635 bits (1638),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 336/473 (71%), Positives = 387/473 (82%), Gaps = 3/473 (1%)
 Frame = +3

Query  342   GQCFTVIVSDSGAPSGLVDAPQTAYSLNNDHARTDAREQEAVYEVMRATGNDWATEIPDV  521
             G  FTVI+SDSGAPS LVDAPQT +S+NN+ A+TD  EQEAVY++MRATGNDWAT+IPDV
Sbjct  21    GWSFTVIMSDSGAPSALVDAPQTGFSMNNNRAQTDPHEQEAVYDIMRATGNDWATDIPDV  80

Query  522   CRGRWHGIECMPDKANVYHVVSLSFGALSDDTAFPTCDTAPRPFISPAVTKLLHLRTLFF  701
             CRGRWHGIECMPD  NVYHVVSLSFGALSDDTAFPTCD+    FIS +VTKL HLRTLFF
Sbjct  81    CRGRWHGIECMPDNDNVYHVVSLSFGALSDDTAFPTCDST-HSFISHSVTKLPHLRTLFF  139

Query  702   YRCFTDNPQPIPTFlgqlgqtlqtlVLRENGHVGSIPNQLGNLTRLRVLDFHGNNLNGSI  881
             YRCF++NPQPIP FL QLG TLQTLVLRENG  G IPN+LGNLT LRVLD H NNLNGSI
Sbjct  140   YRCFSNNPQPIPAFLAQLGPTLQTLVLRENGFTGPIPNELGNLTSLRVLDLHKNNLNGSI  199

Query  882   PVSLSRIDGLRSLDLSRNKLAASIPNLTFPLLQILDLNQNHLVGSIPTALINCHSLMKMD  1061
             PVSL RI GL+SLDLS NKL  SIP+LTF  L +LDLNQNHLVGSIP+ L+ CHSL+K+D
Sbjct  200   PVSLGRITGLKSLDLSDNKLTGSIPSLTFSQLNVLDLNQNHLVGSIPSTLMKCHSLIKLD  259

Query  1062  LSRNRLSGRIPDSIDALNNIILMDLSYNSITGPIPTTLKNLDFLQALVLSGNPMLSDTLP  1241
             LSRNRLSG IPDSID LN++ILMDLSYNS+ G  P +LK L+FLQ LVL+GNP+ S TLP
Sbjct  260   LSRNRLSGLIPDSIDNLNDLILMDLSYNSLIGQFPVSLKKLNFLQTLVLNGNPIDSATLP  319

Query  1242  EHIFLDGFKDLMILALSNMNLQGSIPESLAKLPKIRVLHLDGNQLNGSIPASFGeldsls  1421
             +++F DGF+DLMIL LSNMNLQG IP+SL +LPKIRVL LDGNQ NGSIP SFG L+SLS
Sbjct  320   DNMF-DGFRDLMILGLSNMNLQGPIPKSLGRLPKIRVLQLDGNQFNGSIPLSFGNLNSLS  378

Query  1422  elrldsNQLTGAVPFKREMVWRMRRKLKLSNNSGLCYDAKTGLGDDLEAISDSGISHCGS  1601
             ELRL++N L+G +PFKR+MVWRMRRK+KLSNN GLCY+ + GLGDDLE + DSGI HCG 
Sbjct  379   ELRLNNNMLSGPIPFKRDMVWRMRRKMKLSNNEGLCYNKENGLGDDLETLLDSGIGHCGD  438

Query  1602  QATEPTRTVEHISAVDE-SMLRSSVKSGGTVKELSPLSCLLLAVYFL*LKVKH  1757
               TEPT+ VEHIS ++  S+  S+  S  T+ +L  LS  L+    L L   H
Sbjct  439   SKTEPTKIVEHISTLNRGSIATSNSDSTVTLNKLQLLSGSLIQSTTLILFAVH  491



>ref|XP_004252485.1| PREDICTED: protein TOO MANY MOUTHS [Solanum lycopersicum]
Length=479

 Score =   612 bits (1578),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 321/460 (70%), Positives = 371/460 (81%), Gaps = 14/460 (3%)
 Frame = +3

Query  351   FTVIVSDSGAPSGLVDAPQTAYSLNNDHARTDAREQEAVYEVMRATGNDWATEIPDVCRG  530
             FTVI+SDSGA   LVDAPQT +S+NN+ ARTD REQEAVY++MRATGNDWA +IPDVCRG
Sbjct  25    FTVIMSDSGA---LVDAPQTGFSMNNNRARTDPREQEAVYDIMRATGNDWAIDIPDVCRG  81

Query  531   RWHGIECMPDKANVYHVVSLSFGALSDDTAFPTCDTAPRPFISPAVTKLLHLRTLFFYRC  710
             RWHGIECMPD  NVYHVVSLSFGALSDDTAFPTCD+    FISP+V KL HLR LFFYRC
Sbjct  82    RWHGIECMPDNDNVYHVVSLSFGALSDDTAFPTCDST-HSFISPSVRKLPHLRILFFYRC  140

Query  711   FTDNPQPIPTFlgqlgqtlqtlVLRENGHVGSIPNQLGNLTRLRVLDFHGNNLNGSIPVS  890
             F++NPQPIP FL QL  TLQTLVLRENG  G IPN+LGNLTRLRVLD H NNL+GSIP+S
Sbjct  141   FSNNPQPIPGFLAQLRPTLQTLVLRENGFTGPIPNELGNLTRLRVLDLHKNNLDGSIPIS  200

Query  891   LSRIDGLRSLDLSRNKLAASIPNLTFPLLQILDLNQNHLVGSIPTALINCHSLMKMDLSR  1070
             L RI GLRSLDLS NKL  SIP+LTFP L ILDLNQNHL  SIP+ L++CHSL+K+DLSR
Sbjct  201   LGRITGLRSLDLSDNKLTGSIPSLTFPQLNILDLNQNHLTSSIPSTLMSCHSLIKLDLSR  260

Query  1071  NRLSGRIPDSIDALNNIILMDLSYNSITGPIPTTLKNLDFLQALVLSGNPMLSDTLPEHI  1250
             NRLSG IPDSI  LNN+IL+DLSYNS+T P P +LK L+ LQ LVL+GNPM S TLP++ 
Sbjct  261   NRLSGSIPDSIHHLNNLILLDLSYNSLTSPFPMSLKKLNSLQTLVLNGNPMDSATLPDNT  320

Query  1251  FLDGFKDLMILALSNMNLQGSIPESLAKLPKIRVLHLDGNQLNGSIPASFGeldslselr  1430
             F DGF  LMIL LSNMNLQG +P SL +LPK+RVLHLDGN+LN SIP+SFG L ++SELR
Sbjct  321   F-DGFNSLMILGLSNMNLQGPMPNSLGRLPKLRVLHLDGNKLNSSIPSSFGNLRNISELR  379

Query  1431  ldsNQLTGAVPFKREMVWRMRRKLKLSNNSGLCYDAKTGLGDDLEAISDSGISHCGSQAT  1610
             L++N L+G +PFKR+MVWRMRRK+KLSNN GLCY+ + GLGDDLE + DSGI HCG   T
Sbjct  380   LNNNMLSGPIPFKRDMVWRMRRKMKLSNNDGLCYNKENGLGDDLETLLDSGIGHCGDSKT  439

Query  1611  EPTRTVEHISAVDESMLRSSVKSGGTVKELSPLSCLLLAV  1730
              P +TV+HIS ++ S          + K LS L C L + 
Sbjct  440   VPIKTVQHISTLNRS---------NSNKLLSSLGCFLWSA  470



>ref|XP_006346651.1| PREDICTED: protein TOO MANY MOUTHS-like [Solanum tuberosum]
Length=486

 Score =   610 bits (1572),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 327/460 (71%), Positives = 380/460 (83%), Gaps = 6/460 (1%)
 Frame = +3

Query  351   FTVIVSDSGAPSGLVDAPQTAYSLNNDHARTDAREQEAVYEVMRATGNDWATEIPDVCRG  530
             FTVI+SDSGAPS LVDAPQT +S+NN+ ARTD REQEAVY++MRATGNDWAT+IPDVCRG
Sbjct  24    FTVIMSDSGAPSALVDAPQTGFSMNNNRARTDPREQEAVYDIMRATGNDWATDIPDVCRG  83

Query  531   RWHGIECMPDKANVYHVVSLSFGALSDDTAFPTCDTAPRPFISPAVTKLLHLRTLFFYRC  710
             RWHGIECMPD  NVYHVVSLSFGALSDDTAFPTC ++   FISP+V KL HLRTLFFYRC
Sbjct  84    RWHGIECMPDNDNVYHVVSLSFGALSDDTAFPTCYSS-HSFISPSVRKLPHLRTLFFYRC  142

Query  711   FTDNPQPIPTFlgqlgqtlqtlVLRENGHVGSIPNQLGNLTRLRVLDFHGNNLNGSIPVS  890
             F++NPQPIP FL QLG TLQTLVLRENG  G+IPN+LGNLT LRVLD H NNLNGSIP+S
Sbjct  143   FSNNPQPIPGFLAQLGPTLQTLVLRENGFTGTIPNELGNLTHLRVLDLHKNNLNGSIPIS  202

Query  891   LSRIDGLRSLDLSRNKLAASIPNLTFPLLQILDLNQNHLVGSIPTALINCHSLMKMDLSR  1070
             L RI GL+SLDLS NKL  SIP+LTFP L ILDLNQNHL GSIP+ L++CHSL+K+DLSR
Sbjct  203   LGRIIGLKSLDLSDNKLTGSIPSLTFPQLNILDLNQNHLTGSIPSTLMSCHSLIKLDLSR  262

Query  1071  NRLSGRIPDSIDALNNIILMDLSYNSITGPIPTTLKNLDFLQALVLSGNPMLSDTLPEHI  1250
             N LSG IPDSI  LNN+IL+DLSYNS+T P  T LK L+ LQ LVL+GNPM S TL +++
Sbjct  263   NHLSGSIPDSIHNLNNLILLDLSYNSLTSPFQTLLKKLNSLQTLVLNGNPMDSATLSDNV  322

Query  1251  FLDGFKDLMILALSNMNLQGSIPESLAKLPKIRVLHLDGNQLNGSIPASFGeldslselr  1430
             F DGF +LMIL LSNMNLQG IP SL  LP +RVLHLDGN+LNGSIP+SFG L+++SELR
Sbjct  323   F-DGFNNLMILGLSNMNLQGPIPNSLGLLPMLRVLHLDGNKLNGSIPSSFGNLNNISELR  381

Query  1431  ldsNQLTGAVPFKREMVWRMRRKLKLSNNSGLCYDAKTGLGDDLEAISDSGISHCGSQAT  1610
             L++N L+G +PFKR+MVWRMRRK+KLSNN GLCY+ + GLGDDLE + DSGI HCG   T
Sbjct  382   LNNNMLSGPIPFKRDMVWRMRRKMKLSNNEGLCYNKENGLGDDLETLLDSGIGHCGDSKT  441

Query  1611  EPTRTVEHISAVDESMLRSSVKSGGTVKELSPLSCLLLAV  1730
             EP +TV+HIS ++    R+S     + K LS L CLL + 
Sbjct  442   EPIKTVQHISTLN----RASFVRSNSYKLLSSLGCLLWSA  477



>emb|CDP13043.1| unnamed protein product [Coffea canephora]
Length=523

 Score =   591 bits (1523),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 317/478 (66%), Positives = 380/478 (79%), Gaps = 12/478 (3%)
 Frame = +3

Query  336   PFGQCFTVIVSDSGAPSGLVDAPQTAYSLNNDHARTDAREQEAVYEVMRATGNDWATEIP  515
             P G+  TV V DS +PS LVD PQTA+++NN+ ARTD REQEAVY++MRATGNDWAT+IP
Sbjct  48    PLGRSLTVTVPDSSSPSALVDGPQTAFTVNNNGARTDIREQEAVYDIMRATGNDWATDIP  107

Query  516   DVCRGRWHGIECMPDKANVYHVVSLSFGALSDDTAFPTCDTAPRPFISPAVTKLLHLRTL  695
             D+CRGRWHGIECMPDK NVYHVVSLSFGALSDDTAFPTCD A +  ISP++TKL  LRTL
Sbjct  108   DICRGRWHGIECMPDKDNVYHVVSLSFGALSDDTAFPTCDIA-KSSISPSITKLPRLRTL  166

Query  696   FFYRCFTDNPQPIPTFlgqlgqtlqtlVLRENGHVGSIPNQLGNLTRLRVLDFHGNNLNG  875
             FFYRC T+NPQPIP+F G+LG++LQTLVLRENG VG IPN+LGNLTRL+VLD H N LNG
Sbjct  167   FFYRCLTNNPQPIPSFFGRLGKSLQTLVLRENGLVGPIPNELGNLTRLKVLDLHKNELNG  226

Query  876   SIPVSLSRIDGLRSLDLSRNKLAASIPNLTFPLLQILDLNQNHLVGSIPTALINCHSLMK  1055
             SIP SL RI GLRSLDLS N+L+  IP+L+FP L +LDLNQNHLVGSIPT L++C SL+K
Sbjct  227   SIPGSLRRITGLRSLDLSGNQLSGLIPDLSFPQLNVLDLNQNHLVGSIPTTLMSCPSLIK  286

Query  1056  MDLSRNRLSGRIPDSIDALNNIILMDLSYNSITGPIPTTLKNLDFLQALVLSGNPMLSDT  1235
             +D+SRN LSG IP+SI  L N+IL+DL YNS+ GP+P +LK L+ LQAL+L+GNP +S T
Sbjct  287   LDMSRNCLSGPIPESISGLENLILLDLGYNSLAGPLPASLKELNSLQALILNGNPTMSTT  346

Query  1236  LPEHIFLDGFKDLMILALSNMNLQGSIPESLAKLPKIRVLHLDGNQLNGSIPASFGelds  1415
             +P  IF DG KDL++L LS  NLQG IPESL +L KIRV+HLDGN+LNGSIPASFG+L+ 
Sbjct  347   IPSSIF-DGLKDLVVLILSENNLQGIIPESLGRLRKIRVIHLDGNKLNGSIPASFGDLND  405

Query  1416  lselrldsNQLTGAVPFKREMVWRMRRKLKLSNNSGLCYDAKTGLGDDLEAISDSGISHC  1595
             LSELRLD+N L G VPF R+MVWRMRRKL+L+NNSGLCYD K+GLGDDL  +SDS I  C
Sbjct  406   LSELRLDNNLLMGPVPFNRDMVWRMRRKLRLNNNSGLCYDTKSGLGDDLATLSDSVIGIC  465

Query  1596  -GSQATEPTRTVEHISAVDESMLRS-SVKSGGTVKE--------LSPLSCLLLAVYFL  1739
               S+    T+ V HIS +D + L     KS G V++        L  ++ LL AVY +
Sbjct  466   ETSKYGMATKAVRHISTIDGTELGPLGTKSAGRVQKPAVECFMLLQLVNFLLFAVYVM  523



>ref|XP_006369311.1| hypothetical protein POPTR_0001s20940g [Populus trichocarpa]
 gb|ERP65880.1| hypothetical protein POPTR_0001s20940g [Populus trichocarpa]
Length=472

 Score =   569 bits (1466),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 296/437 (68%), Positives = 354/437 (81%), Gaps = 3/437 (1%)
 Frame = +3

Query  351   FTVIVSDSGAPSGLVDAPQTAYSLNNDHARTDAREQEAVYEVMRATGNDWATEIPDVCRG  530
             FTVIVSDS   S LVD PQ+ +++N + ARTDAREQEAVY++MRATGNDWAT+IPDVCRG
Sbjct  27    FTVIVSDSSNQSALVDGPQSGFTMNKNGARTDAREQEAVYDIMRATGNDWATDIPDVCRG  86

Query  531   RWHGIECMPDKANVYHVVSLSFGALSDDTAFPTCDTAPRPFISPAVTKLLHLRTLFFYRC  710
             RWHGIECMPDK NVYHVVSLSFG LSDDTAFPTCD A R +IS ++ KL HL+TLFFYRC
Sbjct  87    RWHGIECMPDKDNVYHVVSLSFGTLSDDTAFPTCDPA-RSYISESIMKLPHLKTLFFYRC  145

Query  711   FTDNPQPIPTFlgqlgqtlqtlVLRENGHVGSIPNQLGNLTRLRVLDFHGNNLNGSIPVS  890
             F+DNPQPIP+FLGQL  TLQTLVLRENGHVG +P +LGNLTRL+VLD H NNLNGSIPVS
Sbjct  146   FSDNPQPIPSFLGQLSPTLQTLVLRENGHVGLVPAELGNLTRLKVLDLHKNNLNGSIPVS  205

Query  891   LSRIDGLRSLDLSRNKLAASIPNLTFPLLQILDLNQNHLVGSIPTALINCHSLMKMDLSR  1070
             L R+ GL+SLDLS NKL  SI +L+FP+L +LDL+QN L GSIP++L  CHSL+K+D SR
Sbjct  206   LGRLAGLKSLDLSGNKLTGSIFSLSFPVLNVLDLSQNMLTGSIPSSLGFCHSLIKIDFSR  265

Query  1071  NRLSGRIPDSIDALNNIILMDLSYNSITGPIPTTLKNLDFLQALVLSGNPMLSDTLPEHI  1250
             NRLSG IP+SI +L  +ILMDLSYN ++ P+PT++++L+ LQAL+L GNPM S TL    
Sbjct  266   NRLSGSIPESIGSLKELILMDLSYNRLSKPLPTSIRSLNSLQALILKGNPMGSTTLASKE  325

Query  1251  FLDGFKDLMILALSNMNLQGSIPESLAKLPKIRVLHLDGNQLNGSIPASFGeldslselr  1430
             F DG K LM+L LSN NL G IPESL +L  +RV+HLDGN LNGSIP +F +L +L ELR
Sbjct  326   F-DGMKSLMVLILSNTNLHGPIPESLGRLTNLRVIHLDGNHLNGSIPINFKDLKNLGELR  384

Query  1431  ldsNQLTGAVPFKREMVWRMRRKLKLSNNSGLCYDAKTGLGDDLEAISDSGISHCGSQAT  1610
             L+ NQLTG VPF REMVW+MRRKLKL NN+GLCYDA +G  D L++  DSGI  C +   
Sbjct  385   LNDNQLTGPVPFGREMVWKMRRKLKLYNNTGLCYDANSGFEDGLDSTFDSGIGLCNTPEP  444

Query  1611  EPTRTVEHISAVD-ESM  1658
                RTV+H+SA+D E+M
Sbjct  445   GSARTVQHLSAIDGETM  461



>ref|XP_006427297.1| hypothetical protein CICLE_v10025464mg [Citrus clementina]
 gb|ESR40537.1| hypothetical protein CICLE_v10025464mg [Citrus clementina]
Length=492

 Score =   565 bits (1455),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 296/456 (65%), Positives = 364/456 (80%), Gaps = 2/456 (0%)
 Frame = +3

Query  336   PFGQCFTVIVSDSGAPSGLVDAPQTAYSLNNDHARTDAREQEAVYEVMRATGNDWATEIP  515
             PF + FTVI+ DSG  SGLVD PQT +S+N D ART+ +EQEAVY++MRATGNDWATEIP
Sbjct  20    PFARPFTVIMQDSGGSSGLVDGPQTGFSMNKDGARTEPKEQEAVYDIMRATGNDWATEIP  79

Query  516   DVCRGRWHGIECMPDKANVYHVVSLSFGALSDDTAFPTCDTAPRPFISPAVTKLLHLRTL  695
             DVCRGRWHGIECMPDK NVYHVVSL FGALSDDTAFPTCD   R  IS ++TKL +LRTL
Sbjct  80    DVCRGRWHGIECMPDKENVYHVVSLMFGALSDDTAFPTCDPT-RSHISRSITKLPYLRTL  138

Query  696   FFYRCFTDNPQPIPTFlgqlgqtlqtlVLRENGHVGSIPNQLGNLTRLRVLDFHGNNLNG  875
             FFYRCFT NPQPIP FLGQLGQTLQTLVLRENG+VG IP++L NLTRL+VLD H NNLNG
Sbjct  139   FFYRCFTHNPQPIPAFLGQLGQTLQTLVLRENGNVGPIPSELANLTRLKVLDLHKNNLNG  198

Query  876   SIPVSLSRIDGLRSLDLSRNKLAASIPNLTFPLLQILDLNQNHLVGSIPTALINCHSLMK  1055
             SIPVSL RI+GLRSLDLS NKL  SIP+++FP+L +LDLNQN L+G IP++L  CHSL+K
Sbjct  199   SIPVSLGRINGLRSLDLSGNKLTGSIPSISFPVLNVLDLNQNLLMGLIPSSLGTCHSLIK  258

Query  1056  MDLSRNRLSGRIPDSIDALNNIILMDLSYNSITGPIPTTLKNLDFLQALVLSGNPMLSDT  1235
             +D S NRL+G IPDSI  L ++IL+DLSYN ++GP P +++NL+ LQAL+L  N M   T
Sbjct  259   IDFSHNRLTGSIPDSISNLRDLILLDLSYNHLSGPFPISIRNLNSLQALILKSNSMGPIT  318

Query  1236  LPEHIFLDGFKDLMILALSNMNLQGSIPESLAKLPKIRVLHLDGNQLNGSIPASFGelds  1415
             +P + F+ G ++LMIL LSNMNL+G IPESL +LP + VLHLD N LNGSIP+SF  L  
Sbjct  319   IPNYSFI-GVRNLMILILSNMNLRGPIPESLGQLPNLHVLHLDENHLNGSIPSSFKNLKH  377

Query  1416  lselrldsNQLTGAVPFKREMVWRMRRKLKLSNNSGLCYDAKTGLGDDLEAISDSGISHC  1595
             +SELRL++NQLTG +PF+REMVW+M+ KL+L+NNSGLCY+A +G  D L++  DSGI  C
Sbjct  378   VSELRLNNNQLTGPLPFEREMVWKMKSKLRLNNNSGLCYNAGSGFEDGLDSSIDSGIGLC  437

Query  1596  GSQATEPTRTVEHISAVDESMLRSSVKSGGTVKELS  1703
              S      R+V+H+  ++E++  +   S GTV + S
Sbjct  438   DSGKPGSARSVQHLGTLEENITGTINTSVGTVHDTS  473



>gb|EYU24634.1| hypothetical protein MIMGU_mgv11b004345mg [Erythranthe guttata]
Length=489

 Score =   561 bits (1447),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 294/445 (66%), Positives = 363/445 (82%), Gaps = 5/445 (1%)
 Frame = +3

Query  351   FTVIVSDSGAPSGLVDAPQTAYSLNNDHARTDAREQEAVYEVMRATGNDWATEIPDVCRG  530
             FTVI+SDSG PS L D PQ   S +++ ARTDA EQEAVY++MRATGN WAT+IPDVCRG
Sbjct  20    FTVIMSDSGGPSSLQDGPQPGLSASSNGARTDAGEQEAVYDIMRATGNVWATDIPDVCRG  79

Query  531   RWHGIECMPDKANVYHVVSLSFGALSDDTAFPTCDTAPRPFISPAVTKLLHLRTLFFYRC  710
             RWHGIECMPDK NV+HVVSLSFGALSDDTAFPTCD   R +ISP++TKL HLRTLFFYRC
Sbjct  80    RWHGIECMPDKDNVFHVVSLSFGALSDDTAFPTCDPT-RSYISPSITKLRHLRTLFFYRC  138

Query  711   FTDNPQPIPTFlgqlgqtlqtlVLRENGHVGSIPNQLGNLTRLRVLDFHGNNLNGSIPVS  890
             F+DN +PIP+FLGQLG +LQTLVLRENGH G IP++LGNLTRL VLD H NNLNGSIPVS
Sbjct  139   FSDNSRPIPSFLGQLGPSLQTLVLRENGHFGLIPHELGNLTRLTVLDLHRNNLNGSIPVS  198

Query  891   LSRIDGLRSLDLSRNKLAASIPNLTFPLLQILDLNQNHLVGSIPTALINCHSLMKMDLSR  1070
             L RI GLRSLDLS N+L+ SIPN++FP L +LDLNQNHL+G +P  L++  SLMK+DLSR
Sbjct  199   LGRITGLRSLDLSCNRLSGSIPNISFPSLNVLDLNQNHLMGPLPIPLLSTTSLMKIDLSR  258

Query  1071  NRLSGRIPDSIDALNNIILMDLSYNSITGPIPTTLKNLDFLQALVLSGNPMLSDTLPEHI  1250
             NR+SG+IP+ I  L +++L DLSYN++ GP P +L  L  LQAL+L+GNP +S  +P++ 
Sbjct  259   NRISGQIPN-IKNLEDLVLFDLSYNALAGPFPNSLNGLKSLQALILNGNPFVSTVIPDNA  317

Query  1251  FLDGFKDLMILALSNMNLQGSIPESLAKLPKIRVLHLDGNQLNGSIPASFGeldslselr  1430
             F +G  +LMIL LSNMNL G IPES+ +L ++R+LHL+GNQLNG+IP+SF  L+ LSEL+
Sbjct  318   F-EGLNNLMILGLSNMNLGGPIPESMGRLTRLRILHLNGNQLNGTIPSSFSNLNGLSELK  376

Query  1431  ldsNQLTGAVPFKREMVWRMRRKLKLSNNSGLCYDAKTGLGDDLEAISDSGISHCGSQAT  1610
             LD+N+LTG VPF+RE VWRM RKL L NN GLCYDAK+GLGDDL+ +S +GI HC S   
Sbjct  377   LDNNRLTGPVPFRRERVWRMGRKLSLGNNIGLCYDAKSGLGDDLDTLSSAGIGHCDSPKN  436

Query  1611  EPTRTVEHISAVDES--MLRSSVKS  1679
              PT +V+HI+ +D+   +L++S KS
Sbjct  437   VPTNSVQHITTLDDDDHVLKASTKS  461



>ref|XP_007023220.1| Leucine-rich repeat (LRR) family protein [Theobroma cacao]
 gb|EOY25842.1| Leucine-rich repeat (LRR) family protein [Theobroma cacao]
Length=493

 Score =   559 bits (1441),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 289/450 (64%), Positives = 357/450 (79%), Gaps = 3/450 (1%)
 Frame = +3

Query  351   FTVIVSDSGAPSGLVDAPQTAYSLNNDHARTDAREQEAVYEVMRATGNDWATEIPDVCRG  530
             FTVI+SDSG PS L+D PQT +S+N + ART+ REQEAVY++MRATGNDWAT IPDVCRG
Sbjct  25    FTVIMSDSGVPSTLIDGPQTGFSMNKNGARTNPREQEAVYDIMRATGNDWATSIPDVCRG  84

Query  531   RWHGIECMPDKANVYHVVSLSFGALSDDTAFPTCDTAPRPFISPAVTKLLHLRTLFFYRC  710
             RWHGIECMPDK NVYHVVSLSFGALSDDTAFPTCD   + +IS ++TKL H+RTLF YRC
Sbjct  85    RWHGIECMPDKDNVYHVVSLSFGALSDDTAFPTCDQK-KSYISESITKLPHIRTLFLYRC  143

Query  711   FTDNPQPIPTFlgqlgqtlqtlVLRENGHVGSIPNQLGNLTRLRVLDFHGNNLNGSIPVS  890
             F+ NPQPIPTFLG+LG TLQTLVLRENGHVG IP++L NLTRLRVLD H NNLNGSIPVS
Sbjct  144   FSYNPQPIPTFLGKLGSTLQTLVLRENGHVGPIPSELANLTRLRVLDLHKNNLNGSIPVS  203

Query  891   LSRIDGLRSLDLSRNKLAASIPNLTFPLLQILDLNQNHLVGSIPTALINCHSLMKMDLSR  1070
             L RI GLRSLDLS NKL ASIP  ++P+L +LDL+QN L+G IP++L +C SL+KMD S 
Sbjct  204   LGRITGLRSLDLSGNKLTASIPGFSYPVLNVLDLSQNLLMGPIPSSLGSCQSLVKMDFSH  263

Query  1071  NRLSGRIPDSIDALNNIILMDLSYNSITGPIPTTLKNLDFLQALVLSGNPMLSDTLPEHI  1250
             N L+G IPDS+  L +++L+D+S+N ++GP P +L++L  LQAL+L GN M S  +P   
Sbjct  264   NSLTGSIPDSVGGLKDLMLLDMSFNRLSGPFPISLRSLTSLQALILKGNQMGSTAIPSDC  323

Query  1251  FLDGFKDLMILALSNMNLQGSIPESLAKLPKIRVLHLDGNQLNGSIPASFGeldslselr  1430
             F DG K LMIL LSNMNL G IPES+ +LP +RV++LDGN+ NGSIP++F +L  +SELR
Sbjct  324   F-DGMKSLMILVLSNMNLHGPIPESIGRLPNLRVVYLDGNRFNGSIPSNFRDLKHVSELR  382

Query  1431  ldsNQLTGAVPFKREMVWRMRRKLKLSNNSGLCYDAKTGLGDDLEAISDSGISHCGSQAT  1610
             L+ N LTG VPF R+MVW+MRRKLKL+NNSGLCY+A +GL D L+   D+GI  C +   
Sbjct  383   LNDNYLTGPVPFGRQMVWKMRRKLKLNNNSGLCYNANSGLEDALDTSFDTGIGLCDTPKP  442

Query  1611  EPTRTVEHISAV-DESMLRSSVKSGGTVKE  1697
                RTV+H+S + +E M R++  S G V +
Sbjct  443   GSARTVQHLSTMNEEDMTRTTNVSSGAVHK  472



>ref|XP_006465479.1| PREDICTED: protein TOO MANY MOUTHS-like [Citrus sinensis]
Length=492

 Score =   559 bits (1440),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 297/462 (64%), Positives = 364/462 (79%), Gaps = 2/462 (0%)
 Frame = +3

Query  336   PFGQCFTVIVSDSGAPSGLVDAPQTAYSLNNDHARTDAREQEAVYEVMRATGNDWATEIP  515
             PF + FTVI+ DSG  SGLVD PQT +S++ D ARTD +EQEAVY++MRATGNDWATEIP
Sbjct  20    PFARPFTVIMQDSGGSSGLVDGPQTGFSMSKDGARTDPKEQEAVYDIMRATGNDWATEIP  79

Query  516   DVCRGRWHGIECMPDKANVYHVVSLSFGALSDDTAFPTCDTAPRPFISPAVTKLLHLRTL  695
             DVCRGRWHGIECMPDK NVYHVVSL FGALSDDTAFPTCD A R  IS ++TKL +LRTL
Sbjct  80    DVCRGRWHGIECMPDKENVYHVVSLMFGALSDDTAFPTCDPA-RSHISRSITKLPYLRTL  138

Query  696   FFYRCFTDNPQPIPTFlgqlgqtlqtlVLRENGHVGSIPNQLGNLTRLRVLDFHGNNLNG  875
             FFYRCFT NPQPIP FLGQLGQTLQTLVLRENG+VG IP++LGNLTRL+VLD H NNLNG
Sbjct  139   FFYRCFTHNPQPIPAFLGQLGQTLQTLVLRENGNVGPIPSELGNLTRLKVLDLHKNNLNG  198

Query  876   SIPVSLSRIDGLRSLDLSRNKLAASIPNLTFPLLQILDLNQNHLVGSIPTALINCHSLMK  1055
             SIPVSL RI+GLRSLDLS NKL  SIP+++FP+L +LDLNQN L+G IP++L +CHSL+K
Sbjct  199   SIPVSLGRINGLRSLDLSGNKLTGSIPSISFPVLNVLDLNQNLLMGPIPSSLGSCHSLIK  258

Query  1056  MDLSRNRLSGRIPDSIDALNNIILMDLSYNSITGPIPTTLKNLDFLQALVLSGNPMLSDT  1235
             +D S NRL+G IPDSI  L ++IL+DLSYN ++GP P +++NL+ LQAL+L  N M   T
Sbjct  259   IDFSHNRLTGSIPDSISNLRDLILLDLSYNHLSGPFPISIRNLNSLQALILKSNSMGPIT  318

Query  1236  LPEHIFLDGFKDLMILALSNMNLQGSIPESLAKLPKIRVLHLDGNQLNGSIPASFGelds  1415
             +P + F+ G ++LMIL LSNMNL+G IPESL +LP + VLHLD N LNGSIP SF  L  
Sbjct  319   IPNYSFI-GMRNLMILILSNMNLRGPIPESLGQLPNLHVLHLDENHLNGSIPNSFKNLKH  377

Query  1416  lselrldsNQLTGAVPFKREMVWRMRRKLKLSNNSGLCYDAKTGLGDDLEAISDSGISHC  1595
             +SELRL++N LTG +PF+REMVW+M+ KL+L NNSGLCY+A +   D L++  DSGI  C
Sbjct  378   VSELRLNNNGLTGPLPFEREMVWKMKSKLRLHNNSGLCYNAGSDFEDGLDSSIDSGIGLC  437

Query  1596  GSQATEPTRTVEHISAVDESMLRSSVKSGGTVKELSPLSCLL  1721
              S       +V+H+  ++E++  +   S GTV + S    LL
Sbjct  438   ESGKPGSANSVQHLGTLEENITGTINTSVGTVHDASNFVRLL  479



>ref|XP_011008000.1| PREDICTED: protein TOO MANY MOUTHS [Populus euphratica]
Length=496

 Score =   558 bits (1437),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 295/458 (64%), Positives = 355/458 (78%), Gaps = 4/458 (1%)
 Frame = +3

Query  351   FTVIVSDSGAPSGLVDAPQTAYSLNNDHARTDAREQEAVYEVMRATGNDWATEIPDVCRG  530
             FTVIVSDS   S LV+ PQ+ +++N + ARTDA EQEAVY++MRATGNDWAT IPDVCRG
Sbjct  27    FTVIVSDSSNQSALVEGPQSGFTMNTNGARTDAHEQEAVYDIMRATGNDWATNIPDVCRG  86

Query  531   RWHGIECMPDKANVYHVVSLSFGALSDDTAFPTCDTAPRPFISPAVTKLLHLRTLFFYRC  710
             RWHGIECMPDK NVYHVVSLSFGALSDDTAFPTCD     +IS ++ KL HL+TLFFYRC
Sbjct  87    RWHGIECMPDKDNVYHVVSLSFGALSDDTAFPTCDPTTS-YISESIMKLPHLKTLFFYRC  145

Query  711   FTDNPQPIPTFlgqlgqtlqtlVLRENGHVGSIPNQLGNLTRLRVLDFHGNNLNGSIPVS  890
             F+DNPQPIP+FLGQL  TLQTLVLRENGHVG +P +LGNLTRL+VLD H NNLNGSIPVS
Sbjct  146   FSDNPQPIPSFLGQLSPTLQTLVLRENGHVGLVPTELGNLTRLKVLDLHKNNLNGSIPVS  205

Query  891   LSRIDGLRSLDLSRNKLAASIPNLTFPLLQILDLNQNHLVGSIPTALINCHSLMKMDLSR  1070
             L R+  L+SLDLS NKL  SI +L+ P+L +LDL+QN L+GSIP+++  CHSL+K+D SR
Sbjct  206   LGRLADLKSLDLSGNKLTGSIFSLSLPVLNVLDLSQNMLMGSIPSSIGFCHSLIKIDFSR  265

Query  1071  NRLSGRIPDSIDALNNIILMDLSYNSITGPIPTTLKNLDFLQALVLSGNPMLSDTLPEHI  1250
             NRLSG IP+SI +LN +ILMDLSYN ++ P+PT+++NL  LQAL+L GNPM S    E  
Sbjct  266   NRLSGSIPESIGSLNELILMDLSYNRLSKPLPTSIRNLHSLQALILKGNPMGSTLASEE-  324

Query  1251  FLDGFKDLMILALSNMNLQGSIPESLAKLPKIRVLHLDGNQLNGSIPASFGeldslselr  1430
               DG K LM+L LS  NL G IPESL +L  +RV+HLDGN LNGSIP SF +L +L ELR
Sbjct  325   -FDGMKSLMVLILSYTNLHGPIPESLGRLTNLRVIHLDGNHLNGSIPTSFKDLKNLGELR  383

Query  1431  ldsNQLTGAVPFKREMVWRMRRKLKLSNNSGLCYDAKTGLGDDLEAISDSGISHCGSQAT  1610
             L+ NQLTG VPF REMVW+MRRKLKL NN+GLCYDA +G  D L++  DSGI  C +   
Sbjct  384   LNDNQLTGPVPFGREMVWKMRRKLKLYNNTGLCYDANSGFEDGLDSTFDSGIGLCTTPEP  443

Query  1611  EPTRTVEHISAVD-ESMLRSSVKSGGTVKELSPLSCLL  1721
                RTV+H+SA+D E M  ++ KS   + + S    LL
Sbjct  444   GSARTVQHLSAIDGEPMPSTTNKSSAALHKTSVFVRLL  481



>ref|XP_002265327.1| PREDICTED: protein TOO MANY MOUTHS [Vitis vinifera]
Length=490

 Score =   557 bits (1436),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 297/443 (67%), Positives = 351/443 (79%), Gaps = 5/443 (1%)
 Frame = +3

Query  336   PFGQCFTVIVSDSGAPSGLVDAPQTAYSLNNDHARTDAREQEAVYEVMRATGNDWATEIP  515
             P    FTVI+SDSGAPS LVD PQT +S+  + ARTDAREQEAVY++M+ TGN WAT+I 
Sbjct  19    PLAAPFTVIMSDSGAPSALVDGPQTGFSMTGNGARTDAREQEAVYDIMKGTGNPWATDIQ  78

Query  516   DVCRGRWHGIECMPDKANVYHVVSLSFGALSDDTAFPTCDTAPRPFISPAVTKLLHLRTL  695
             DVCR RWHGIECMPDK NVYHVVSLSFGALSDDTAFPTCD      ISP++TKL H+RTL
Sbjct  79    DVCRDRWHGIECMPDKDNVYHVVSLSFGALSDDTAFPTCDPL-HSSISPSITKLPHIRTL  137

Query  696   FFYRCFTDNPQPIPTFlgqlgqtlqtlVLRENGHVGSIPNQLGNLTRLRVLDFHGNNLNG  875
             FFYRCF+ NPQPIP FLGQLG TLQTLVLRENGHVG IP++LGNLTRL +LD H NNL+G
Sbjct  138   FFYRCFSYNPQPIPAFLGQLGSTLQTLVLRENGHVGPIPSELGNLTRLTILDLHKNNLSG  197

Query  876   SIPVSLSRIDGLRSLDLSRNKLAASIPNLTFPLLQILDLNQNHLVGSIPTALINCHSLMK  1055
             SIPVSL RI GLRSLDLS N+L  SIP LTFP+L +LDLNQN LVGSIPT+L  C+SL+K
Sbjct  198   SIPVSLGRISGLRSLDLSGNRLTGSIPGLTFPVLNVLDLNQNLLVGSIPTSLGTCYSLVK  257

Query  1056  MDLSRNRLSGRIPDSIDALNNIILMDLSYNSITGPIPTTLKNLDFLQALVLSGNPMLSDT  1235
             MD+S N LSG IPDSID L ++ILMDLSYN ++GP+PT+L++L+ LQAL+L GN M S  
Sbjct  258   MDISHNHLSGPIPDSIDGLKSLILMDLSYNHLSGPLPTSLRSLNSLQALILKGNSMGSTP  317

Query  1236  LPEHIFLDGFKDLMILALSNMNLQGSIPESLAKLPKIRVLHLDGNQLNGSIPASFGelds  1415
             +P   F DG KDLMIL LSN NL G IPESL +LP +RV+HLD N LNGSIP  F +L +
Sbjct  318   IPTDAF-DGMKDLMILILSNTNLHGPIPESLGRLPNLRVVHLDMNWLNGSIPVHFRDLKN  376

Query  1416  lselrldsNQLTGAVPFKREMVWRMRRKLKLSNNSGLCYDAKTGLGDDLEAISDSGISHC  1595
             LSELRL+ N+L G VPF REMVWRM++KL+L NNSGLC+DA  G GD+   + +SG  +C
Sbjct  377   LSELRLNDNRLIGPVPFGREMVWRMKKKLRLYNNSGLCFDASNGFGDE---VLESGTRYC  433

Query  1596  GSQATEPTRTVEHISAVDESMLR  1664
              +     TRTV+H SA++  + R
Sbjct  434   ETPKPGLTRTVQHYSAINGDVGR  456



>ref|XP_010250165.1| PREDICTED: protein TOO MANY MOUTHS [Nelumbo nucifera]
Length=492

 Score =   554 bits (1427),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 296/468 (63%), Positives = 364/468 (78%), Gaps = 7/468 (1%)
 Frame = +3

Query  336   PFGQCFTVIVSDSGAPSGLVDAPQTAYSLN-NDHARTDAREQEAVYEVMRATGNDWATEI  512
             P    FTVI+SDSG PS LVDAPQT +S+N N  ART+ +EQ+AVYE+M+ATGN WATEI
Sbjct  19    PLAMPFTVIMSDSGVPSALVDAPQTGFSMNKNGSARTNPQEQQAVYEIMKATGNGWATEI  78

Query  513   PDVCRGRWHGIECMPDKANVYHVVSLSFGALSDDTAFPTCDTAPRPFISPAVTKLLHLRT  692
             PDVCRGRWHGIECMPDK  V+HVVSLSFGALSDDTAFPTCD   + FISP++TKL ++RT
Sbjct  79    PDVCRGRWHGIECMPDKDEVFHVVSLSFGALSDDTAFPTCDQT-QSFISPSITKLPYIRT  137

Query  693   LFFYRCFTDNPQPIPTFlgqlgqtlqtlVLRENGHVGSIPNQLGNLTRLRVLDFHGNNLN  872
             LFFYRCF+ NPQPIP+FLGQLG TLQ+LVLR+NGHVG IP +LGNLTRLRVLD H NNLN
Sbjct  138   LFFYRCFSYNPQPIPSFLGQLGPTLQSLVLRDNGHVGPIPAELGNLTRLRVLDLHRNNLN  197

Query  873   GSIPVSLSRIDGLRSLDLSRNKLAASIPNLTFPLLQILDLNQNHLVGSIPTALINCHSLM  1052
             GSIPVSL RI GLRSLDLS N+L   IP+L+FP+L +LDL+QNHL+G IP++L NC SL+
Sbjct  198   GSIPVSLGRIAGLRSLDLSENRLTGPIPSLSFPVLNVLDLSQNHLMGPIPSSLGNCPSLI  257

Query  1053  KMDLSRNRLSGRIPDSIDALNNIILMDLSYNSITGPIPTTLKNLDFLQALVLSGNPMLSD  1232
             KMD+SRNRLSG IP SI AL ++ILMDLSYN ++GP+P ++++L+ LQAL+L GNPM S 
Sbjct  258   KMDMSRNRLSGPIPISIGALKSLILMDLSYNRLSGPLPISIRSLNSLQALILKGNPMDST  317

Query  1233  TLPEHIFLDGFKDLMILALSNMNLQGSIPESLAKLPKIRVLHLDGNQLNGSIPASFGeld  1412
             T+P   F +G K LMIL LS+M L+G IP++L +LP +RV+HLD N +NGSIP SF ++ 
Sbjct  318   TIPGDGF-EGLKGLMILVLSDMGLEGPIPDALGRLPSLRVVHLDRNNINGSIPLSFQDMK  376

Query  1413  slselrldsNQLTGAVPFKREMVWRMRRKLKLSNNSGLCYDAKTGL--GDDLEAISDSGI  1586
              LSELRL+ N+LTG VPF RE VWRM RKL+L NNSGLC D +TG+  G D+  +  SGI
Sbjct  377   DLSELRLNDNRLTGPVPFSRETVWRMGRKLRLYNNSGLCIDPRTGIEVGSDVSFL--SGI  434

Query  1587  SHCGSQATEPTRTVEHISAVDESMLRSSVKSGGTVKELSPLSCLLLAV  1730
             S C    + PTRT +H++++     R    S  T       + LLL +
Sbjct  435   SLCEMPKSTPTRTTQHLTSISGDTQRPVWSSNSTSSATKEATFLLLHI  482



>ref|XP_010097213.1| Protein TOO MANY MOUTHS [Morus notabilis]
 gb|EXB67280.1| Protein TOO MANY MOUTHS [Morus notabilis]
Length=484

 Score =   550 bits (1416),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 294/466 (63%), Positives = 356/466 (76%), Gaps = 2/466 (0%)
 Frame = +3

Query  336   PFGQCFTVIVSDSGAPSGLVDAPQTAYSLNNDHARTDAREQEAVYEVMRATGNDWATEIP  515
             P  + FTVI+SDS  PS LVD PQT +S+N + ARTD  EQEAVY++MRATGNDWAT+IP
Sbjct  13    PLSKPFTVIMSDSDVPSVLVDGPQTGFSMNTNGARTDPAEQEAVYDIMRATGNDWATDIP  72

Query  516   DVCRGRWHGIECMPDKANVYHVVSLSFGALSDDTAFPTCDTAPRPFISPAVTKLLHLRTL  695
             DVCRGRWHGIECMPDK NV+H+VSLSFGALSDDTAFPTCD   R +ISP++TKL HLRTL
Sbjct  73    DVCRGRWHGIECMPDKDNVFHIVSLSFGALSDDTAFPTCDPT-RSYISPSITKLPHLRTL  131

Query  696   FFYRCFTDNPQPIPTFlgqlgqtlqtlVLRENGHVGSIPNQLGNLTRLRVLDFHGNNLNG  875
             FFYRC T NPQPI +FLG+LG +LQTLVLRENGHVG +P +LGNLTRLRVLD H NNLNG
Sbjct  132   FFYRCLTHNPQPITSFLGRLGPSLQTLVLRENGHVGHVPTELGNLTRLRVLDLHNNNLNG  191

Query  876   SIPVSLSRIDGLRSLDLSRNKLAASIPNLTFPLLQILDLNQNHLVGSIPTALINCHSLMK  1055
             SIPVSL+RI GL SLDLS N+L  SIP L+ P+L I++L+QN L GSIP ++  C SL+K
Sbjct  192   SIPVSLNRITGLWSLDLSGNRLTGSIPGLSSPVLSIINLSQNLLTGSIPPSISTCSSLIK  251

Query  1056  MDLSRNRLSGRIPDSIDALNNIILMDLSYNSITGPIPTTLKNLDFLQALVLSGNPMLSDT  1235
             +DLSRN+L+G I DSI+ L ++ L+DLSYN ++GP+P +L++L  LQAL+L GNPM S T
Sbjct  252   IDLSRNQLTGSIHDSINGLKDLTLVDLSYNRLSGPLPGSLRSLTSLQALILKGNPMGSHT  311

Query  1236  LPEHIFLDGFKDLMILALSNMNLQGSIPESLAKLPKIRVLHLDGNQLNGSIPASFGelds  1415
             +P + F +  + LMIL LSNMNL G IP SL  +P +RVLHLDGN+LNGS+PASF EL +
Sbjct  312   IPSNAF-ENMRSLMILVLSNMNLHGPIPSSLGNIPNLRVLHLDGNRLNGSVPASFRELKN  370

Query  1416  lselrldsNQLTGAVPFKREMVWRMRRKLKLSNNSGLCYDAKTGLGDDLEAISDSGISHC  1595
             LSELRL+ N LTG VPF REMVWRMRRKL+L NNSGLC+ A +GL D L++   SGI  C
Sbjct  371   LSELRLNDNSLTGQVPFGREMVWRMRRKLRLYNNSGLCFGANSGLEDYLDSSFSSGIGLC  430

Query  1596  GSQATEPTRTVEHISAVDESMLRSSVKSGGTVKELSPLSCLLLAVY  1733
                     RTV+H+      M  S   S  +V   S    LLL ++
Sbjct  431   DMPKPASARTVQHVFVAKTDMTGSEKVSTNSVHNFSVSVNLLLLIF  476



>ref|XP_011081419.1| PREDICTED: protein TOO MANY MOUTHS [Sesamum indicum]
Length=464

 Score =   549 bits (1414),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 289/437 (66%), Positives = 354/437 (81%), Gaps = 6/437 (1%)
 Frame = +3

Query  384   SGLVDAPQTAYSLNNDHARTDAREQEAVYEVMRATGNDWATEIPDVCRGRWHGIECMPDK  563
             SGL+D P +A   +N+ A+TDAREQEAVY++MRATGNDWAT+IPDVCRGRWHGIECMPDK
Sbjct  4     SGLLDGPHSALPTSNNGAQTDAREQEAVYDIMRATGNDWATDIPDVCRGRWHGIECMPDK  63

Query  564   ANVYHVVSLSFGALSDDTAFPTCDTAPRPFISPAVTKLLHLRTLFFYRCFTDNPQPIPTF  743
              NV+HVVSLSFGALSDDTAFPTCD A R  ISP++TKL HLRTLFFYRCFT NPQPIP+F
Sbjct  64    DNVFHVVSLSFGALSDDTAFPTCDLA-RSSISPSITKLPHLRTLFFYRCFTSNPQPIPSF  122

Query  744   lgqlgqtlqtlVLRENGHVGSIPNQLGNLTRLRVLDFHGNNLNGSIPVSLSRIDGLRSLD  923
             LG LG +LQ+LVLRENGH+G IP +L NLTRL VLD H NNLNGSIPVSL RI GLRSLD
Sbjct  123   LGHLGSSLQSLVLRENGHIGPIPYELANLTRLTVLDLHRNNLNGSIPVSLGRITGLRSLD  182

Query  924   LSRNKLAASIPNLTFPLLQILDLNQNHLVGSIPTALINCHSLMKMDLSRNRLSGRIPDSI  1103
             LS N+L+ SIPN++FP L +L+LNQNHL G +PT L   +SL+K+DLSRNR+SG IP+ +
Sbjct  183   LSCNRLSGSIPNISFPALSVLNLNQNHLTGPLPTTLFTSNSLIKIDLSRNRISGPIPN-L  241

Query  1104  DALNNIILMDLSYNSITGPIPTTLKNLDFLQALVLSGNPMLSDTLPEHIFLDGFKDLMIL  1283
               L ++IL+D+SYN++TGP+P +L  L+ LQAL+L+GNP +S T+PE  F+ G  +LMIL
Sbjct  242   SNLKDLILLDISYNTLTGPLPQSLPGLESLQALILNGNPSMSTTIPETAFV-GLNNLMIL  300

Query  1284  ALSNMNLQGSIPESLAKLPKIRVLHLDGNQLNGSIPASFGeldslselrldsNQLTGAVP  1463
              LSNMNL+G IP SL +L  +R+LHLDGN+ NG+IP SF  LDSLSELRL++N+LTG +P
Sbjct  301   GLSNMNLEGPIPASLGRLTTLRMLHLDGNRFNGTIPVSFANLDSLSELRLENNRLTGPIP  360

Query  1464  FKREMVWRMRRKLKLSNNSGLCYDAKTGLGDDLEAISDSGISHCGSQATEPTRTVEHISA  1643
             FKRE VWRM RKL+L+NNSGLCYDAK+GLGDDL+ +S +GI HC +       +V+HIS 
Sbjct  361   FKRERVWRMGRKLRLNNNSGLCYDAKSGLGDDLDTLSCAGIGHCETANGGAGVSVQHIST  420

Query  1644  VDE---SMLRSSVKSGG  1685
              D+    +  SS KSG 
Sbjct  421   DDDGDHKLKHSSTKSGA  437



>ref|XP_008373971.1| PREDICTED: protein TOO MANY MOUTHS [Malus domestica]
Length=442

 Score =   545 bits (1404),  Expect = 3e-180, Method: Compositional matrix adjust.
 Identities = 287/417 (69%), Positives = 334/417 (80%), Gaps = 2/417 (0%)
 Frame = +3

Query  351   FTVIVSDSGAPSGLVDAPQTAYSLNNDHARTDAREQEAVYEVMRATGNDWATEIPDVCRG  530
             FTVI+SDSG PS LVD PQ  +S+N D ARTDAREQEAVY++MRATGNDWATEIPDVCRG
Sbjct  25    FTVIMSDSGVPSDLVDGPQNGFSMNKDGARTDAREQEAVYDIMRATGNDWATEIPDVCRG  84

Query  531   RWHGIECMPDKANVYHVVSLSFGALSDDTAFPTCDTAPRPFISPAVTKLLHLRTLFFYRC  710
             RWHGIEC PDK NVYHVVSLSFGALSDDTAFPTCD   R  ISP++TKL +LRTLFFYRC
Sbjct  85    RWHGIECKPDKDNVYHVVSLSFGALSDDTAFPTCDPT-RSHISPSITKLPYLRTLFFYRC  143

Query  711   FTDNPQPIPTFlgqlgqtlqtlVLRENGHVGSIPNQLGNLTRLRVLDFHGNNLNGSIPVS  890
              T NPQPIP+FLG LG TLQTLVLRENGH+G IP +LGNLTRL VLD H NNLNGSIPVS
Sbjct  144   LTYNPQPIPSFLGHLGPTLQTLVLRENGHMGPIPIELGNLTRLSVLDLHKNNLNGSIPVS  203

Query  891   LSRIDGLRSLDLSRNKLAASIPNLTFPLLQILDLNQNHLVGSIPTALINCHSLMKMDLSR  1070
             L RI GLRSLDLS N L  SIPN TFP+L ILDLNQN L+GSIP+++  CH+L+KMDL  
Sbjct  204   LGRITGLRSLDLSGNTLTGSIPNFTFPILSILDLNQNLLMGSIPSSIGACHALIKMDLGH  263

Query  1071  NRLSGRIPDSIDALNNIILMDLSYNSITGPIPTTLKNLDFLQALVLSGNPMLSDTLPEHI  1250
             NRL+G +PDS+  L +++LMDLSYN + GP+P  +++L  LQ L+L GN M    +P  +
Sbjct  264   NRLAGPLPDSVGGLKSLMLMDLSYNRLKGPLPMWIRSLISLQTLILKGNQMGPTPIPSDL  323

Query  1251  FLDGFKDLMILALSNMNLQGSIPESLAKLPKIRVLHLDGNQLNGSIPASFGeldslselr  1430
             F DG K LM L LSNMNL G +P SL +LP +RVLHLDGN  NGSIPASF EL ++SELR
Sbjct  324   F-DGMKGLMTLILSNMNLHGPLPASLGRLPSLRVLHLDGNNFNGSIPASFRELKNVSELR  382

Query  1431  ldsNQLTGAVPFKREMVWRMRRKLKLSNNSGLCYDAKTGLGDDLEAISDSGISHCGS  1601
             L+ N L G +PF REMVWRMRRKL+L NNSGLCY + +GL D+L++  +SGI  CG+
Sbjct  383   LNDNVLMGPIPFGREMVWRMRRKLRLYNNSGLCYKSNSGLEDNLDSSFNSGIGTCGT  439



>ref|XP_007150758.1| hypothetical protein PHAVU_005G178400g [Phaseolus vulgaris]
 gb|ESW22752.1| hypothetical protein PHAVU_005G178400g [Phaseolus vulgaris]
Length=496

 Score =   545 bits (1405),  Expect = 1e-179, Method: Compositional matrix adjust.
 Identities = 289/442 (65%), Positives = 346/442 (78%), Gaps = 4/442 (1%)
 Frame = +3

Query  336   PFGQCFTVIVSDSGAPSGLVDAPQTAYSLNNDHARTDAREQEAVYEVMRATGNDWATEIP  515
             P    FTVI+SDSG PS LVD PQT +S+N+D ARTD REQEAVY++MRATGNDWAT+IP
Sbjct  20    PHVTAFTVIMSDSGVPSTLVDGPQTGFSMNHDGARTDKREQEAVYDIMRATGNDWATDIP  79

Query  516   DVCRGRWHGIECMPDKANVYHVVSLSFGALSDDTAFPTCDTAPRPFISPAVTKLLHLRTL  695
             DVCRGRWHGIECMPDKANV+HVVSLSFGALSDDTAFPTCD   R  ISP++T L HL+TL
Sbjct  80    DVCRGRWHGIECMPDKANVFHVVSLSFGALSDDTAFPTCDPT-RSVISPSITHLPHLKTL  138

Query  696   FFYRCFTDNPQPIPTFlgqlgqtlqtlVLRENGHVGSIPNQLGNLTRLRVLDFHGNNLNG  875
             FFYRCFT NPQPIP FLG LG TLQTLVLRENGHVG IP +LGNLTRL+V D H NNLNG
Sbjct  139   FFYRCFTYNPQPIPPFLGLLGPTLQTLVLRENGHVGPIPVELGNLTRLKVFDLHKNNLNG  198

Query  876   SIPVSLSRIDGLRSLDLSRNKLAASIPNLTFPLLQILDLNQNHLVGSIPTALINCHSLMK  1055
             SIP+SL RI  LRSLDLS NKL   IP   FP L +LDL+QN L+G IP+++ NC+ L+K
Sbjct  199   SIPISLGRITNLRSLDLSANKLTGPIPGFAFPSLNVLDLSQNLLMGPIPSSIWNCYFLIK  258

Query  1056  MDLSRNRLSGRIPDSIDALNNIILMDLSYNSITGPIPTTLKNLDFLQALVLSGNPMLSDT  1235
             +D SRNRL G +P+   ++  ++L+DLSYN I GP P ++K+L  LQAL+L GNPM S  
Sbjct  259   LDFSRNRLVGPLPEKPISMKELMLLDLSYNRIQGPFPVSIKSLSSLQALILKGNPMGSSM  318

Query  1236  LPEHIFLDGFKDLMILALSNMNLQGSIPESLAKLPKIRVLHLDGNQLNGSIPASFGelds  1415
             +P   F DG K LMI+ LSNMNL G +PESL KL  +RVLHLDGN  NG IP SFG+L +
Sbjct  319   IPGDGF-DGMKALMIVVLSNMNLHGPVPESLGKLQNLRVLHLDGNHFNGPIPKSFGDLRN  377

Query  1416  lselrldsNQLTGAVPFKREMVWRMRRKLKLSNNSGLCYDAKTGLGDDLEAISDSGISHC  1595
             LSELRL+ N L+G VPF REMVWRMRRKL+L+NNSGLCY A++GLGD +++  D GI  C
Sbjct  378   LSELRLNDNGLSGLVPFGREMVWRMRRKLRLNNNSGLCYGARSGLGDTMDSTFDLGIPSC  437

Query  1596  GSQ-ATEPT-RTVEHISAVDES  1655
              +   T P+ RT +H+S++ ++
Sbjct  438   DTYPPTIPSLRTHQHLSSLTQN  459



>ref|XP_002517648.1| serine-threonine protein kinase, plant-type, putative [Ricinus 
communis]
 gb|EEF44812.1| serine-threonine protein kinase, plant-type, putative [Ricinus 
communis]
Length=465

 Score =   533 bits (1373),  Expect = 3e-175, Method: Compositional matrix adjust.
 Identities = 280/447 (63%), Positives = 349/447 (78%), Gaps = 6/447 (1%)
 Frame = +3

Query  351   FTVIVSDSGAPSGLVDAPQTAYSLNNDHARTDAREQEAVYEVMRATGNDWATEIPDVCRG  530
             FTVIVSDS   S LVD  +  +S+N   ART+A EQEAVY++M+ATGNDWAT+IPDVCRG
Sbjct  3     FTVIVSDSSNQSALVDGLRNGFSMNMSGARTEAHEQEAVYDIMKATGNDWATDIPDVCRG  62

Query  531   RWHGIECMPDKANVYHVVSLSFGALSDDTAFPTCDTAPRPFISPAVTKLLHLRTLFFYRC  710
             RWHGIECM DK ++YHVVSLSFGALSDDTAFPTCDT  + +IS ++TKL H+RTLFFYRC
Sbjct  63    RWHGIECMLDKDDIYHVVSLSFGALSDDTAFPTCDTT-KSYISQSITKLPHIRTLFFYRC  121

Query  711   FTDNPQPIPTFlgqlgqtlqtlVLRENGHVGSIPNQLGNLTRLRVLDFHGNNLNGSIPVS  890
              ++NPQPIP+FLG+LG TLQTLVLRENGHVGSIP++LGNLTRL+VLD H N LN SIPVS
Sbjct  122   LSNNPQPIPSFLGKLGSTLQTLVLRENGHVGSIPSELGNLTRLKVLDLHKNRLNSSIPVS  181

Query  891   LSRIDGLRSLDLSRNKLAASIPNLTFPLLQILDLNQNHLVGSIPTALINCHSLMKMDLSR  1070
             L R+ GLRSLDLS N L  SIP+L+FP+L ++DL++N L G IP++L +C SL+K+D S 
Sbjct  182   LGRLVGLRSLDLSGNILTGSIPSLSFPVLNVMDLSRNFLTGPIPSSLGSCQSLLKLDFSH  241

Query  1071  NRLSGRIPDSIDALNNIILMDLSYNSITGPIPTTLKNLDFLQALVLSGNPMLSDTLPEHI  1250
             NR +G IPDS   L  +ILMDLSYN ++ P+P T+++L+ LQA +L GNPM S TL    
Sbjct  242   NRFTGSIPDSFSGLRELILMDLSYNHLSKPLPKTIRSLNSLQAFILEGNPM-SVTLASDE  300

Query  1251  FLDGFKDLMILALSNMNLQGSIPESLAKLPKIRVLHLDGNQLNGSIPASFGeldslselr  1430
             F DG K LM+L LSNMNLQG IP+SL +L  +RV+HLDGN+LNGSIP +F  L +L EL+
Sbjct  301   F-DGMKSLMVLILSNMNLQGLIPDSLGRLINLRVIHLDGNRLNGSIPLTFRNLKNLGELK  359

Query  1431  ldsNQLTGAVPFKREMVWRMRRKLKLSNNSGLCYDAKTGLGDDLEAISDSGISHCGSQAT  1610
             L+ NQL+G VPF REMVW+MRRKL+L NN+GLCYDA +G GD L++   SGI  C +   
Sbjct  360   LNDNQLSGPVPFGREMVWKMRRKLRLHNNTGLCYDANSGFGDGLDS---SGIGVCNTPRP  416

Query  1611  EPTRTVEHISAVDESMLRSSVKSGGTV  1691
               +RTV+H+S +++ M     KS G V
Sbjct  417   GSSRTVQHLSTLEKEMPAIVNKSSGAV  443



>gb|KHN44184.1| Protein TOO MANY MOUTHS [Glycine soja]
Length=481

 Score =   530 bits (1366),  Expect = 7e-174, Method: Compositional matrix adjust.
 Identities = 277/420 (66%), Positives = 330/420 (79%), Gaps = 2/420 (0%)
 Frame = +3

Query  399   APQTAYSLNNDHARTDAREQEAVYEVMRATGNDWATEIPDVCRGRWHGIECMPDKANVYH  578
              PQT +S+N D +RTD REQEAVY++MRATGN WAT+IPDVCRGRWHGIECMPDK +V+H
Sbjct  28    GPQTGFSMNQDGSRTDKREQEAVYDIMRATGNAWATDIPDVCRGRWHGIECMPDKDDVFH  87

Query  579   VVSLSFGALSDDTAFPTCDTAPRPFISPAVTKLLHLRTLFFYRCFTDNPQPIPTFlgqlg  758
             VVSLSFGALSDDTAFPTCD   R FIS ++  L HL+TLFFYRCF+ NPQPIP+FLG LG
Sbjct  88    VVSLSFGALSDDTAFPTCDPT-RSFISASIANLPHLKTLFFYRCFSYNPQPIPSFLGLLG  146

Query  759   qtlqtlVLRENGHVGSIPNQLGNLTRLRVLDFHGNNLNGSIPVSLSRIDGLRSLDLSRNK  938
              +LQTLVLRENGHVG IP +LGNLTRLRVLD H NNLNGSIP+SL RI GLRSLDLS NK
Sbjct  147   PSLQTLVLRENGHVGPIPVELGNLTRLRVLDLHKNNLNGSIPISLGRITGLRSLDLSGNK  206

Query  939   LAASIPNLTFPLLQILDLNQNHLVGSIPTALINCHSLMKMDLSRNRLSGRIPDSIDALNN  1118
             +  SIP   FP L +LDL+QN L+GSIP+   +C+SL+K+D SRNRL G +P+    L +
Sbjct  207   ITGSIPGFAFPSLNVLDLSQNLLMGSIPSTFWDCYSLIKLDFSRNRLVGPLPEKPMGLKD  266

Query  1119  IILMDLSYNSITGPIPTTLKNLDFLQALVLSGNPMLSDTLPEHIFLDGFKDLMILALSNM  1298
             ++L+DLSYN I GP P +LK+L  LQAL+L GNPM S ++P+  F DG K LMIL LSNM
Sbjct  267   LMLLDLSYNRIQGPFPGSLKSLSSLQALILKGNPMGSTSIPDDGF-DGMKALMILVLSNM  325

Query  1299  NLQGSIPESLAKLPKIRVLHLDGNQLNGSIPASFGeldslselrldsNQLTGAVPFKREM  1478
             N  G +PESL KL  +RVLHLDGN  NGSIP SF +L SLSELRL+ N L G+VPF REM
Sbjct  326   NWHGPVPESLGKLRNLRVLHLDGNHFNGSIPKSFRDLRSLSELRLNDNGLIGSVPFDREM  385

Query  1479  VWRMRRKLKLSNNSGLCYDAKTGLGDDLEAISDSGISHCGSQATEPTRTVEHISAVDESM  1658
             VWRM+RKL+L+NNSGLCYDA +GLGD +++  D GIS C +      RTV+H+SA  + M
Sbjct  386   VWRMKRKLRLNNNSGLCYDASSGLGDSMDSTFDLGISLCDTSNPGSVRTVQHLSATQKLM  445



>ref|XP_003597912.1| Leucine-rich repeat receptor-like protein kinase [Medicago truncatula]
 gb|AES68163.1| TOO MANY mouths protein [Medicago truncatula]
Length=499

 Score =   529 bits (1363),  Expect = 3e-173, Method: Compositional matrix adjust.
 Identities = 300/472 (64%), Positives = 356/472 (75%), Gaps = 17/472 (4%)
 Frame = +3

Query  351   FTVIVSDSGA---PSG---LVDAPQTAYSLNNDHARTDAREQEAVYEVMRATGNDWATEI  512
             +TV +SDS +   PSG   L+D      S   D+ARTD REQ AVY++MRATGNDWAT+I
Sbjct  36    YTVEISDSNSSTVPSGSTPLIDG----ISPKQDNARTDPREQHAVYDIMRATGNDWATDI  91

Query  513   PDVCRGRWHGIECMPDKANVYHVVSLSFGALSDDTAFPTCDTAPRPFISPAVTKLLHLRT  692
             PDVCRGRWHGIECMPDK NVYH+VSLSFGALSDDTAFPTCD      ISP++  L HL+T
Sbjct  92    PDVCRGRWHGIECMPDKDNVYHIVSLSFGALSDDTAFPTCDPTSST-ISPSILNLPHLKT  150

Query  693   LFFYRCFTDNPQPIPTFlgqlgqtlqtlVLRENGHVGSIPNQLGNLTRLRVLDFHGNNLN  872
             LFFYRCF+ NP PIP+FLG+LG +LQTLVLRENGH+G IPN+LGNLT L+VLD H NNLN
Sbjct  151   LFFYRCFSYNPHPIPSFLGRLGPSLQTLVLRENGHIGRIPNELGNLTCLKVLDLHKNNLN  210

Query  873   GSIPVSLSRIDGLRSLDLSRNKLAASIPNLTFPLLQILDLNQNHLVGSIPTALINCHSLM  1052
             GSIPVSL+RI GL+SLDLS NKL   IPNLTF  L +LDLNQN L  SIP+ L  C SL+
Sbjct  211   GSIPVSLNRITGLKSLDLSVNKLTGPIPNLTFLNLNVLDLNQNRLTDSIPSTLWECQSLI  270

Query  1053  KMDLSRNRLSGRIPDSIDALNNIILMDLSYNSITGPIPTTLKNLDFLQALVLSGNPMLSD  1232
             K+DLSRNRLSG IPD +  L +++LMDLS+N I GP P +LK+L  LQAL+L GNPM S 
Sbjct  271   KLDLSRNRLSGPIPDKLMGLKDLMLMDLSFNCIQGPFPKSLKSLSSLQALMLKGNPMGST  330

Query  1233  TLPEHIFLDGFKDLMILALSNMNLQGSIPESLAKLPKIRVLHLDGNQLNGSIPASFGeld  1412
              LP + F DG KDL IL +SNMNL G IPESL KLP +RVLHLDGN  NGSIP SF +L 
Sbjct  331   ILPNNGF-DGMKDLTILVMSNMNLLGPIPESLGKLPNLRVLHLDGNHFNGSIPKSFRDLR  389

Query  1413  slselrldsNQLTGAVPFKREMVWRMRRKLKLSNNSGLCYDAKTGLGDDLEAISDSGISH  1592
             SLSELRL+ N LTG VPF+REMVWRM+RKL+L+NNSGLCYDA +GLGD ++  SD GI  
Sbjct  390   SLSELRLNDNGLTGPVPFEREMVWRMKRKLRLNNNSGLCYDASSGLGDSVD--SDLGIGL  447

Query  1593  CGSQATEPTRTVEHISAVDESMLRSSV--KSGGTV-KELSPLSCLLLAVYFL  1739
             C S +    RTV+H+S  ++  L   V   S  T+ + L  ++ +L A+ FL
Sbjct  448   CESSSPGSVRTVQHVSDREKPALLDYVPISSDATLTRSLRLVTFVLFALIFL  499



>ref|XP_004303296.1| PREDICTED: protein TOO MANY MOUTHS-like [Fragaria vesca subsp. 
vesca]
Length=429

 Score =   526 bits (1355),  Expect = 4e-173, Method: Compositional matrix adjust.
 Identities = 282/424 (67%), Positives = 334/424 (79%), Gaps = 7/424 (2%)
 Frame = +3

Query  351   FTVIVSDSGAPSGLVDAPQTAYSLNNDHARTDAREQEAVYEVMRATGNDWATEIPDVCRG  530
             FTVI+SDS  P+ LVD PQT +S+N D ARTDAREQEAVY++MRATGNDWAT+IPDVCRG
Sbjct  10    FTVIMSDSDPPNALVDGPQTGFSINKDGARTDAREQEAVYDIMRATGNDWATDIPDVCRG  69

Query  531   RWHGIECMPDKANVYHVVSLSFGALSDDTAFPTCDTAPRPFISPAVTKLLHLRTLFFYRC  710
             RWHGIECMPDK +V+HVVSLSFGALSDDTAFPTCD   R  IS ++T+L +LRTLFFYRC
Sbjct  70    RWHGIECMPDKDDVFHVVSLSFGALSDDTAFPTCDPT-RSHISESITRLPYLRTLFFYRC  128

Query  711   FTDNPQPIPTFlgqlgqtlqtlVLRENGHVGSIPNQLGNLTRLRVLDFHGNNLNGSIPVS  890
             F+ NPQPIP+FLG+LG TLQTLVLR+NGHVG IP +LGNLTRL+VLD H NNLN SIPVS
Sbjct  129   FSYNPQPIPSFLGRLGPTLQTLVLRDNGHVGPIPVELGNLTRLKVLDLHKNNLNSSIPVS  188

Query  891   LSRIDGLRSLDLSRNKLAASIPNLTFPLLQILDLNQNHLVGSIPTALINCHSLMKMDLSR  1070
             L+RI GLRSLDLS N L  SIPN +FP+L ILD++QN L  SIP+++ +C +L+KMDLS 
Sbjct  189   LNRITGLRSLDLSSNSLTGSIPNFSFPILSILDMSQNLLASSIPSSIGSCLALLKMDLSH  248

Query  1071  NRLSGRIPDSIDALNNIILMDLSYNSITGPIPTTLKNLDFLQALVLSGNPMLSDTLPEHI  1250
             NRL+G +PDS+  L +++LMDLSYN + GP+P     L  LQ L L GNPM    +P   
Sbjct  249   NRLTGLLPDSMGGLKDLMLMDLSYNRLKGPLPMWFGTLVSLQTLNLKGNPMGPTQIPSEG  308

Query  1251  FLDGFKDLMILALSNMNLQGSIPESLAKLPKIRVLHLDGNQLNGSIPASFGeldslselr  1430
             F +G K LMIL LSNMNL G IP SL  LP +RVLHLDGN LNGSIP SF EL S++ELR
Sbjct  309   F-EGMKGLMILILSNMNLHGPIPPSLGNLPSLRVLHLDGNHLNGSIPNSFRELKSVAELR  367

Query  1431  ldsNQLTGAVPFKREMVWRMRRKLKLSNNSGLCYDAKTGLGDDLEAISDSGISHCGSQAT  1610
             L+ N L G++PF REMVWRMRRKL+L NNSGLCY+A +G  D+L++ S SGI  C     
Sbjct  368   LNDNGLVGSIPFGREMVWRMRRKLRLYNNSGLCYNANSGFEDNLDSSSSSGIGPC-----  422

Query  1611  EPTR  1622
             EP R
Sbjct  423   EPPR  426



>ref|XP_004486661.1| PREDICTED: protein TOO MANY MOUTHS-like [Cicer arietinum]
Length=500

 Score =   523 bits (1348),  Expect = 5e-171, Method: Compositional matrix adjust.
 Identities = 285/450 (63%), Positives = 343/450 (76%), Gaps = 11/450 (2%)
 Frame = +3

Query  411   AYSLNNDHARTDAREQEAVYEVMRATGNDWATEIPDVCRGRWHGIECMPDKANVYHVVSL  590
               S   D A TD++EQ+AVY++M+ATGNDWA +IPDVCRGRWHGIECMPDK NVYH+VSL
Sbjct  55    GISTKQDSAITDSQEQQAVYDIMKATGNDWAIDIPDVCRGRWHGIECMPDKHNVYHIVSL  114

Query  591   SFGALSDDTAFPTCDTAPRPFISPAVTKLLHLRTLFFYRCFTDNPQPIPTFlgqlgqtlq  770
             SFGALSDDTAFPTCD   R  ISP++TKL HL+TLFFYRCFT NPQPIP+FLG LG +LQ
Sbjct  115   SFGALSDDTAFPTCDPT-RSSISPSITKLPHLKTLFFYRCFTYNPQPIPSFLGLLGPSLQ  173

Query  771   tlVLRENGHVGSIPNQLGNLTRLRVLDFHGNNLNGSIPVSLSRIDGLRSLDLSRNKLAAS  950
             TLVLRENGH+G IPNQLGNLTRL+VLD H NNLN SIP+SL+RI GLRSLDLS NKL  S
Sbjct  174   TLVLRENGHIGPIPNQLGNLTRLKVLDLHKNNLNSSIPLSLNRITGLRSLDLSANKLTDS  233

Query  951   IPNLTFPLLQILDLNQNHLVGSIPTALINCHSLMKMDLSRNRLSGRIPDSIDALNNIILM  1130
             IP+L FP L +LDL+ N L G IP+ L +CHSL+K D+SRNRL+G IPD +  LN+++LM
Sbjct  234   IPDLIFPSLNVLDLSMNRLSGPIPSTLWDCHSLIKFDVSRNRLTGPIPDKLKGLNDLMLM  293

Query  1131  DLSYNSITGPIPTTLKNLDFLQALVLSGNPMLSDTLPEHIFLDGFKDLMILALSNMNLQG  1310
             DLS+N I GP P +LK L+ LQAL+L GNP+ S  +P  +F DG   LMIL +SNMNLQG
Sbjct  294   DLSFNRIQGPFPISLKKLNSLQALILKGNPIGSTIVPNDLF-DGMNGLMILIMSNMNLQG  352

Query  1311  SIPESLAKLPKIRVLHLDGNQLNGSIPASFGeldslselrldsNQLTGAVPFKREMVWRM  1490
              IPESL KLP +RVLHLDGN LNGSIP SF EL SLSELRL+ N L G VPF+R+MVWRM
Sbjct  353   PIPESLGKLPNLRVLHLDGNHLNGSIPKSFRELRSLSELRLNDNGLIGPVPFERDMVWRM  412

Query  1491  RRKLKLSNNSGLCYDAKTGLGDDLEAISDSGISHCGSQATEPTRTVEHISAVDES-----  1655
             +RKL+L NN GLCYD+ +G+GD ++  SD GIS C S +    RTV H+    +      
Sbjct  413   KRKLRLYNNLGLCYDSNSGIGDSVD--SDFGISLCESSSPGSVRTVHHVLDTQKPGPTTT  470

Query  1656  -MLRSSVKSGGTV-KELSPLSCLLLAVYFL  1739
              M   S+ S  T+ + L  ++ LL ++ FL
Sbjct  471   FMDHVSISSDSTLTRSLGLVTFLLFSLVFL  500



>ref|XP_007217237.1| hypothetical protein PRUPE_ppa006269mg [Prunus persica]
 gb|EMJ18436.1| hypothetical protein PRUPE_ppa006269mg [Prunus persica]
Length=420

 Score =   520 bits (1339),  Expect = 8e-171, Method: Compositional matrix adjust.
 Identities = 282/415 (68%), Positives = 327/415 (79%), Gaps = 10/415 (2%)
 Frame = +3

Query  351   FTVIVSDSGAPSGLVDAPQTAYSLNNDHARTDAREQEAVYEVMRATGNDWATEIPDVCRG  530
             FTVI+SDSG PS LVD PQT +S+N D ARTD REQEAVY++MRATGNDWAT+IPDVCRG
Sbjct  11    FTVIMSDSGVPSALVDGPQTGFSMNKDGARTDTREQEAVYDIMRATGNDWATDIPDVCRG  70

Query  531   RWHGIECMPDKANVYHVVSLSFGALSDDTAFPTCDTAPRPFISPAVTKLLHLRTLFFYRC  710
             RWHGIECMPD  +VYHVVSLSFGALSDDTAFPTCD   R  ISP++TKL +LRTLFFYRC
Sbjct  71    RWHGIECMPDNNDVYHVVSLSFGALSDDTAFPTCDPT-RSHISPSITKLPYLRTLFFYRC  129

Query  711   FTDNPQPIPTFlgqlgqtlqtlVLRENGHVGSIPNQLGNLTRLRVLDFHGNNLNGSIPVS  890
             F+ NPQPIP+ LGQLG TLQTLVLRENGHVG IP +LGNLTRL+VLD H NNLNGSIPV 
Sbjct  130   FSYNPQPIPSLLGQLGATLQTLVLRENGHVGPIPIELGNLTRLKVLDLHKNNLNGSIPVC  189

Query  891   LSRIDGLRSLDLSRNKLAASIPNLTFPLLQILDLNQNHLVGSIPTALINCHSLMKMDLSR  1070
             L+R+ GLRSLDLS NKL  SIPN +FP+L I DL+QN L+GSIP+++  C  L+KMDL  
Sbjct  190   LARMTGLRSLDLSGNKL-TSIPNFSFPILSIFDLSQNLLMGSIPSSIGACPGLIKMDLGH  248

Query  1071  NRLSGRIPDSIDALNNIILMDLSYNSITGPIPTTLKNLDFLQALVLSGNPMLSDTLPEHI  1250
             N+L+G +P SI  L N++LMDLSYN + GP+P  +++L  LQ L+L GNPM    +P   
Sbjct  249   NQLTGPLPYSIGTLKNLMLMDLSYNRLKGPLPMWIRSLISLQTLILKGNPMGPTPIPSDG  308

Query  1251  FLDGFKDLMILALSNMNLQGSIPESLAKLPKIRVLHLDGNQLNGSIPASFGeldslselr  1430
             F DG K LM L LSNMNL G IP SL KLP +RVLHLDGN  NGSIP SF EL+S+SELR
Sbjct  309   F-DGMKGLMTLILSNMNLHGPIPSSLGKLPGLRVLHLDGNNFNGSIPTSFRELESVSELR  367

Query  1431  ldsNQLTGAVPFKREMVWRMRRKLKLSNNSGLCYDAKTGLGDDLEAISDSGISHC  1595
             L+ N L G +PF REMVWRMRRKL++ NNSGLCY+A +GL        DSGI  C
Sbjct  368   LNDNWLRGPIPFGREMVWRMRRKLRVHNNSGLCYNANSGL-------EDSGIGPC  415



>ref|XP_008228729.1| PREDICTED: protein TOO MANY MOUTHS [Prunus mume]
Length=434

 Score =   516 bits (1328),  Expect = 6e-169, Method: Compositional matrix adjust.
 Identities = 278/415 (67%), Positives = 325/415 (78%), Gaps = 10/415 (2%)
 Frame = +3

Query  351   FTVIVSDSGAPSGLVDAPQTAYSLNNDHARTDAREQEAVYEVMRATGNDWATEIPDVCRG  530
             FTVI+SDSG PS LVD PQT +S+N D ARTD  EQEAVY++MRATGNDWA +IPDVCRG
Sbjct  25    FTVIMSDSGVPSALVDGPQTGFSMNKDGARTDTHEQEAVYDIMRATGNDWAIDIPDVCRG  84

Query  531   RWHGIECMPDKANVYHVVSLSFGALSDDTAFPTCDTAPRPFISPAVTKLLHLRTLFFYRC  710
             RWHGIECMPD+ +VYH+VSLSFGALSDDTAFPTC    R  ISP++TKL +LRTLFFYRC
Sbjct  85    RWHGIECMPDRDDVYHIVSLSFGALSDDTAFPTCHPT-RSHISPSITKLPYLRTLFFYRC  143

Query  711   FTDNPQPIPTFlgqlgqtlqtlVLRENGHVGSIPNQLGNLTRLRVLDFHGNNLNGSIPVS  890
             F+ NPQPIP+ LGQLG TLQTLVLRENGHVG IP +LGNLT L+VLD H NNLNGSIPVS
Sbjct  144   FSYNPQPIPSLLGQLGATLQTLVLRENGHVGPIPIELGNLTHLKVLDLHKNNLNGSIPVS  203

Query  891   LSRIDGLRSLDLSRNKLAASIPNLTFPLLQILDLNQNHLVGSIPTALINCHSLMKMDLSR  1070
             L R+ GLRSLDLS NKL  SIPN +FP+L I DL+QN L+GSIP+++  CH+L+KMDL  
Sbjct  204   LGRMTGLRSLDLSGNKL-TSIPNFSFPILSIFDLSQNLLMGSIPSSIGACHALIKMDLGH  262

Query  1071  NRLSGRIPDSIDALNNIILMDLSYNSITGPIPTTLKNLDFLQALVLSGNPMLSDTLPEHI  1250
             N+L+G +PDSI  L N++LMDLSYN + GP+P  +++L  LQ L+L GNPM    +P   
Sbjct  263   NQLTGLLPDSIGTLKNLMLMDLSYNRLKGPLPMWIRSLISLQTLILKGNPMGPTPIPSDG  322

Query  1251  FLDGFKDLMILALSNMNLQGSIPESLAKLPKIRVLHLDGNQLNGSIPASFGeldslselr  1430
             F D  K LM L LS+MNL G IP SL KLP +RVLHLDGN  NGSIP SF EL S+SELR
Sbjct  323   F-DNMKGLMTLILSSMNLHGPIPSSLGKLPGLRVLHLDGNNFNGSIPISFRELKSVSELR  381

Query  1431  ldsNQLTGAVPFKREMVWRMRRKLKLSNNSGLCYDAKTGLGDDLEAISDSGISHC  1595
             L+ N L G +PF REMVWRMRRKL++ NNSGLCY+A +GL        DSGI  C
Sbjct  382   LNDNWLRGPIPFGREMVWRMRRKLRVHNNSGLCYNANSGL-------EDSGIGPC  429



>ref|XP_010417752.1| PREDICTED: protein TOO MANY MOUTHS [Camelina sativa]
Length=489

 Score =   506 bits (1303),  Expect = 2e-164, Method: Compositional matrix adjust.
 Identities = 274/472 (58%), Positives = 337/472 (71%), Gaps = 6/472 (1%)
 Frame = +3

Query  336   PFGQCFTVIVSDSGAPSGLVDAPQTAYSLNNDHARTDAREQEAVYEVMRATGNDWATEIP  515
             P    FTVI SDS APS L+D PQT +++ ND ART+  EQ+AVY++MRATGNDWA  IP
Sbjct  16    PLVTSFTVITSDSTAPSALIDGPQTGFTMTNDGARTEPDEQDAVYDIMRATGNDWAAAIP  75

Query  516   DVCRGRWHGIECMPDKANVYHVVSLSFGALSDDTAFPTCDTAPRPFISPAVTKLLHLRTL  695
             DVCRGRWHGIECMPD+ NVYHVVSLSFGALSDDTAFPTCD   R ++S ++T+L HL+ L
Sbjct  76    DVCRGRWHGIECMPDQDNVYHVVSLSFGALSDDTAFPTCDPE-RSYVSESLTRLKHLKAL  134

Query  696   FFYRCFTDNPQPIPTFlgqlgqtlqtlVLRENGHVGSIPNQLGNLTRLRVLDFHGNNLNG  875
             FFYRC    PQ IP FLG+LG +LQTLVLRENG +G IP++LGNLT L+VLD H NNLNG
Sbjct  135   FFYRCLGRAPQRIPAFLGRLGSSLQTLVLRENGFLGPIPHELGNLTNLKVLDLHRNNLNG  194

Query  876   SIPVSLSRIDGLRSLDLSRNKLAASIPNLTFPLLQILDLNQNHLVGSIPTALINCHSLMK  1055
             SIP S +R  GL SLDLS N+L  SIP    P L +LDLN N L G +P+   +C SL+K
Sbjct  195   SIPSSFNRFSGLTSLDLSGNRLTGSIPGFLLPQLNVLDLNHNLLTGPVPSTFESCGSLIK  254

Query  1056  MDLSRNRLSGRIPDSIDALNNIILMDLSYNSITGPIPTTLKNLDFLQALVLSGNPMLSDT  1235
             +DLSRNR++G IPDSI+ LN ++L+DLSYN ++GP P +L+ L  LQAL+L GN   S T
Sbjct  255   IDLSRNRVTGPIPDSINRLNQLVLLDLSYNRLSGPFPPSLQGLSSLQALMLKGNTKFSAT  314

Query  1236  LPEHIFLDGFKDLMILALSNMNLQGSIPESLAKLPKIRVLHLDGNQLNGSIPASFGelds  1415
             +PE+ F  G K+LMIL LSNMNLQGSIP+SL +L  +RVLHL+GN L G IP  F +   
Sbjct  315   IPENAF-KGLKNLMILVLSNMNLQGSIPKSLTRLNSLRVLHLEGNNLTGEIPLEFRDAKH  373

Query  1416  lselrldsNQLTGAVPFKREMVWRMRRKLKLSNNSGLCYDAKTGLGDDLEAISDSGISHC  1595
             LSELRL+ N LTG VPF+R+ VWRMRRKL+L NN+GLC +  + L D   + SDS +S C
Sbjct  374   LSELRLNDNSLTGPVPFERDTVWRMRRKLRLYNNAGLCVNRDSDLDDAFGSTSDSSLSTC  433

Query  1596  GSQA--TEPTRTVEHISAVDESMLR--SSVKSGGTVKELSPLSCLLLAVYFL  1739
               +   T P+ TV+H+S  D  M    + V SG      S L    L   F+
Sbjct  434   DGETPRTGPSGTVQHLSRDDGDMPDGVTGVSSGSKSLGFSYLPAFFLLFNFI  485



>emb|CDY57686.1| BnaA07g38270D [Brassica napus]
Length=497

 Score =   505 bits (1301),  Expect = 4e-164, Method: Compositional matrix adjust.
 Identities = 262/439 (60%), Positives = 332/439 (76%), Gaps = 4/439 (1%)
 Frame = +3

Query  336   PFGQCFTVIVSDSGAPSGLVDAPQTAYSLNNDHARTDAREQEAVYEVMRATGNDWATEIP  515
             PF   FTVI SD+ APS L+D PQT +++  D A T+  EQ+AVY++MRATGNDWA  IP
Sbjct  19    PFTSSFTVITSDTVAPSALIDGPQTGFTMTRDGAHTEPDEQDAVYDIMRATGNDWAAAIP  78

Query  516   DVCRGRWHGIECMPDKANVYHVVSLSFGALSDDTAFPTCDTAPRPFISPAVTKLLHLRTL  695
             DVCRGRWHGIECMPD+ NVYHVVSLSFGALSDDTAFPTCD   R +IS ++T+L HL+ L
Sbjct  79    DVCRGRWHGIECMPDQDNVYHVVSLSFGALSDDTAFPTCD-PKRSYISESLTRLKHLKAL  137

Query  696   FFYRCFTDNPQPIPTFlgqlgqtlqtlVLRENGHVGSIPNQLGNLTRLRVLDFHGNNLNG  875
             FFYRC +  PQ IP+FLG+LG +LQTLVLRENG  GSIP++LGNLT L+VLD H NNLNG
Sbjct  138   FFYRCLSRAPQQIPSFLGRLGSSLQTLVLRENGLFGSIPDELGNLTSLKVLDLHKNNLNG  197

Query  876   SIPVSLSRIDGLRSLDLSRNKLAASIPNLTFPLLQILDLNQNHLVGSIPTALINCHSLMK  1055
             SIP+SL+R+ GLRSLDLS N+L  SIP L  P L +LDLN N L G +P+ L  C SL+K
Sbjct  198   SIPLSLNRLSGLRSLDLSVNRLTGSIPGLLLPDLNVLDLNHNLLTGPVPSTLSTCGSLIK  257

Query  1056  MDLSRNRLSGRIPDSIDALNNIILMDLSYNSITGPIPTTLKNLDFLQALVLSGNPMLSDT  1235
             +DLS NR++G IPDS++ LN ++L+DLSYN ++GP P++L+ L+ LQA VL GN   +  
Sbjct  258   IDLSHNRVTGPIPDSVNRLNQLVLLDLSYNRLSGPFPSSLQGLNSLQAFVLKGNTNFASA  317

Query  1236  LPEHIFLDGFKDLMILALSNMNLQGSIPESLAKLPKIRVLHLDGNQLNGSIPASFGelds  1415
             +PE++F  G K+LMIL LSNMNL GSIP SL +L  +RVLHL+GN L GSIP  F  +  
Sbjct  318   IPENVF-KGLKNLMILVLSNMNLHGSIPGSLTRLTSLRVLHLEGNNLTGSIPMEFRGVKD  376

Query  1416  lselrldsNQLTGAVPFKREMVWRMRRKLKLSNNSGLCYDAKTGLGDDLEAISDSGISHC  1595
             LSELRL+ N+LTG VPF+++ VWRMRRKL+L NN+GLC ++++ L D   + S SG+  C
Sbjct  377   LSELRLNDNRLTGPVPFEKDTVWRMRRKLRLYNNAGLCVNSESNLDDVFGSTSGSGVRLC  436

Query  1596  GSQATE--PTRTVEHISAV  1646
               +     P+ TV+H+S  
Sbjct  437   EGETKRPGPSGTVQHLSGA  455



>ref|NP_178125.1| transmembrane leucine-repeat containing receptor-like protein 
TMM [Arabidopsis thaliana]
 sp|Q9SSD1.1|TMM_ARATH RecName: Full=Protein TOO MANY MOUTHS; AltName: Full=Receptor-like 
protein 17; Short=AtRLP17; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AAD55468.1|AC009322_8 Hypothetical protein [Arabidopsis thaliana]
 gb|AEE36354.1| transmembrane leucine-repeat containing receptor-like protein 
TMM [Arabidopsis thaliana]
Length=496

 Score =   504 bits (1297),  Expect = 2e-163, Method: Compositional matrix adjust.
 Identities = 262/444 (59%), Positives = 334/444 (75%), Gaps = 4/444 (1%)
 Frame = +3

Query  336   PFGQCFTVIVSDSGAPSGLVDAPQTAYSLNNDHARTDAREQEAVYEVMRATGNDWATEIP  515
             P  + FTVI SDS APS L+D PQT +++ ND ART+  EQ+AVY++MRATGNDWA  IP
Sbjct  19    PLVRSFTVITSDSTAPSALIDGPQTGFTMTNDGARTEPDEQDAVYDIMRATGNDWAAAIP  78

Query  516   DVCRGRWHGIECMPDKANVYHVVSLSFGALSDDTAFPTCDTAPRPFISPAVTKLLHLRTL  695
             DVCRGRWHGIECMPD+ NVYHVVSLSFGALSDDTAFPTCD   R ++S ++T+L HL+ L
Sbjct  79    DVCRGRWHGIECMPDQDNVYHVVSLSFGALSDDTAFPTCDPQ-RSYVSESLTRLKHLKAL  137

Query  696   FFYRCFTDNPQPIPTFlgqlgqtlqtlVLRENGHVGSIPNQLGNLTRLRVLDFHGNNLNG  875
             FFYRC    PQ IP FLG+LG +LQTLVLRENG +G IP++LGNLT L+VLD H N+LNG
Sbjct  138   FFYRCLGRAPQRIPAFLGRLGSSLQTLVLRENGFLGPIPDELGNLTNLKVLDLHKNHLNG  197

Query  876   SIPVSLSRIDGLRSLDLSRNKLAASIPNLTFPLLQILDLNQNHLVGSIPTALINCHSLMK  1055
             SIP+S +R  GLRSLDLS N+L  SIP    P L +LDLNQN L G +P  L +C SL+K
Sbjct  198   SIPLSFNRFSGLRSLDLSGNRLTGSIPGFVLPALSVLDLNQNLLTGPVPPTLTSCGSLIK  257

Query  1056  MDLSRNRLSGRIPDSIDALNNIILMDLSYNSITGPIPTTLKNLDFLQALVLSGNPMLSDT  1235
             +DLSRNR++G IP+SI+ LN ++L+DLSYN ++GP P++L+ L+ LQAL+L GN   S T
Sbjct  258   IDLSRNRVTGPIPESINRLNQLVLLDLSYNRLSGPFPSSLQGLNSLQALMLKGNTKFSTT  317

Query  1236  LPEHIFLDGFKDLMILALSNMNLQGSIPESLAKLPKIRVLHLDGNQLNGSIPASFGelds  1415
             +PE+ F  G K+LMIL LSN N+QGSIP+SL +L  +RVLHL+GN L G IP  F ++  
Sbjct  318   IPENAF-KGLKNLMILVLSNTNIQGSIPKSLTRLNSLRVLHLEGNNLTGEIPLEFRDVKH  376

Query  1416  lselrldsNQLTGAVPFKREMVWRMRRKLKLSNNSGLCYDAKTGLGDDLEAISDSGISHC  1595
             LSELRL+ N LTG VPF+R+ VWRMRRKL+L NN+GLC +  + L D   + S S +  C
Sbjct  377   LSELRLNDNSLTGPVPFERDTVWRMRRKLRLYNNAGLCVNRDSDLDDAFGSKSGSTVRLC  436

Query  1596  GSQATE--PTRTVEHISAVDESML  1661
              ++ +   P+ TV+H+S  ++  L
Sbjct  437   DAETSRPAPSGTVQHLSREEDGAL  460



>ref|XP_002887846.1| hypothetical protein ARALYDRAFT_895990 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH64105.1| hypothetical protein ARALYDRAFT_895990 [Arabidopsis lyrata subsp. 
lyrata]
Length=485

 Score =   503 bits (1295),  Expect = 2e-163, Method: Compositional matrix adjust.
 Identities = 263/441 (60%), Positives = 331/441 (75%), Gaps = 4/441 (1%)
 Frame = +3

Query  336   PFGQCFTVIVSDSGAPSGLVDAPQTAYSLNNDHARTDAREQEAVYEVMRATGNDWATEIP  515
             P  + FTVI SDS APS L+D PQT +++ ND ART+  EQ+AVY++MRATGNDWA  IP
Sbjct  19    PLVRSFTVITSDSTAPSALIDGPQTGFTMTNDGARTEPDEQDAVYDIMRATGNDWAAAIP  78

Query  516   DVCRGRWHGIECMPDKANVYHVVSLSFGALSDDTAFPTCDTAPRPFISPAVTKLLHLRTL  695
             DVCRGRWHGIECMPD+ NVYHVVSLSFGALSDDTAFPTCD   R ++S ++T+L HL+ L
Sbjct  79    DVCRGRWHGIECMPDQDNVYHVVSLSFGALSDDTAFPTCDPQ-RSYVSESLTRLKHLKAL  137

Query  696   FFYRCFTDNPQPIPTFlgqlgqtlqtlVLRENGHVGSIPNQLGNLTRLRVLDFHGNNLNG  875
             FFYRC   +PQ IP FLG+LG +LQTLVLRENG +G IP++LGNLT L+VLD H N LNG
Sbjct  138   FFYRCLGRSPQRIPAFLGRLGSSLQTLVLRENGFLGPIPDELGNLTNLKVLDLHKNYLNG  197

Query  876   SIPVSLSRIDGLRSLDLSRNKLAASIPNLTFPLLQILDLNQNHLVGSIPTALINCHSLMK  1055
             SIP+S +R  GLRSLDLS N+L  SIP    P L +LDLNQN L G +P+ L  C SL+K
Sbjct  198   SIPLSFNRFSGLRSLDLSGNRLTGSIPGFLLPELNVLDLNQNLLTGPVPSTLSTCGSLIK  257

Query  1056  MDLSRNRLSGRIPDSIDALNNIILMDLSYNSITGPIPTTLKNLDFLQALVLSGNPMLSDT  1235
             +DLSRNR++G IPDSI+ LN ++L+DLSYN + GP P +L+ L+ LQAL+L GN   S T
Sbjct  258   IDLSRNRVTGPIPDSINRLNQLVLLDLSYNRLAGPFPPSLQGLNSLQALMLKGNTKFSTT  317

Query  1236  LPEHIFLDGFKDLMILALSNMNLQGSIPESLAKLPKIRVLHLDGNQLNGSIPASFGelds  1415
             +PE+ F  G K+LM+L LSNMNLQGSIP+SL +L  +RVLHL+GN L G IP  F ++  
Sbjct  318   IPENAF-KGLKNLMVLVLSNMNLQGSIPKSLTRLNSLRVLHLEGNNLTGEIPLEFRDVKH  376

Query  1416  lselrldsNQLTGAVPFKREMVWRMRRKLKLSNNSGLCYDAKTGLGDDLEAISDSGISHC  1595
             LSELRL+ N LTG VPF+R+ VWRMRRKL+L NN+GLC +  + L D   + S S +S C
Sbjct  377   LSELRLNDNSLTGPVPFERDTVWRMRRKLRLYNNAGLCVNRDSDLDDAFGSTSGSSVSLC  436

Query  1596  GSQATE--PTRTVEHISAVDE  1652
               +     P+ +V+H+S  ++
Sbjct  437   VGETPRPGPSGSVQHLSREED  457



>ref|XP_010691095.1| PREDICTED: protein TOO MANY MOUTHS [Beta vulgaris subsp. vulgaris]
Length=495

 Score =   503 bits (1294),  Expect = 4e-163, Method: Compositional matrix adjust.
 Identities = 270/430 (63%), Positives = 330/430 (77%), Gaps = 4/430 (1%)
 Frame = +3

Query  351   FTVIVSDSGAPSGLVDAPQTAYSLNNDHARTDAREQEAVYEVMRATGNDWATEIPDVCRG  530
             FTVI+SDS  PS LVDAPQ  Y++N + ARTD REQ+AVY++M ATGN WA EIPDVCRG
Sbjct  26    FTVIMSDSTTPSALVDAPQMGYTMNKNGARTDTREQKAVYDIMLATGNPWAIEIPDVCRG  85

Query  531   RWHGIECMPDKANVYHVVSLSFGALSDDTAFPTCDTAPRPFISPAVTKLLHLRTLFFYRC  710
             RWHGIECMPDK NV+HVVSLSFGALSDDTAFPTCD   R +IS +VTKL +LRTLFFYRC
Sbjct  86    RWHGIECMPDKNNVFHVVSLSFGALSDDTAFPTCDPT-RSYISESVTKLPYLRTLFFYRC  144

Query  711   FTDNPQPIPTFlgqlgqtlqtlVLRENGHVGSIPNQLGNLTRLRVLDFHGNNLNGSIPVS  890
              T+ PQPIP+FLG LG +LQTLVLRENG VG IPN+LGNLT+L++LD   NNLNGSIP+S
Sbjct  145   LTNTPQPIPSFLGHLGPSLQTLVLRENGLVGPIPNELGNLTKLKILDLSRNNLNGSIPMS  204

Query  891   LSRIDGLRSLDLSRNKLAASIPNLTFPLLQILDLNQNHLVGSIPTALINCHSLMKMDLSR  1070
             L RI+GLRSLDLS N+L   +PN  FP L +LDLNQN L G IP ++    SL+KMDLSR
Sbjct  205   LGRINGLRSLDLSGNRLMGQVPNFAFPSLHVLDLNQNLLTGPIPKSIGLSQSLLKMDLSR  264

Query  1071  NRLSGRIPDSIDALNNIILMDLSYNSITGPIPTTLKNLDFLQALVLSGNPMLSDTLPEHI  1250
             NRLS  IP+SI  L ++ LMDLS+N +TGP P + KNL+ LQAL L GN M+S T+P++ 
Sbjct  265   NRLSSPIPNSILGLKDLTLMDLSFNRLTGPFPNSFKNLESLQALNLKGNQMMSTTIPDN-  323

Query  1251  FLDGFKDLMILALSNMNLQGSIPESLAKLPKIRVLHLDGNQLNGSIPASFGeldslselr  1430
              L+G K+L+ L LSNM LQGSIP SL +LPKIRV+H+D N+LNGSIP SF  L  LSELR
Sbjct  324   SLEGMKNLVTLILSNMKLQGSIPSSLTRLPKIRVIHIDENRLNGSIPESFRGLKFLSELR  383

Query  1431  ldsNQLTGAVPFKREMVWRMRRKLKLSNNSGLCYD-AKTG-LGDDLEAISDSGISHCGSQ  1604
             ++ N L+GA+P  ++++W+M RKL+L NNSGLC+  A  G    D + + + GI +C   
Sbjct  384   INDNFLSGALPLDKDILWKMGRKLRLHNNSGLCFKYANDGDFAGDSDLLMEWGIGNCNVH  443

Query  1605  ATEPTRTVEH  1634
                  R+VEH
Sbjct  444   RPSLGRSVEH  453



>ref|XP_010538000.1| PREDICTED: protein TOO MANY MOUTHS [Tarenaya hassleriana]
Length=479

 Score =   501 bits (1290),  Expect = 1e-162, Method: Compositional matrix adjust.
 Identities = 261/431 (61%), Positives = 329/431 (76%), Gaps = 9/431 (2%)
 Frame = +3

Query  351   FTVIVSDSGAPSGLVDAPQTAYSLNNDHARTDAREQEAVYEVMRATGNDWATEIPDVCRG  530
             FTVI SDS APS L++ PQT +++ ND ARTD  EQ+AVY++MRATGNDWA+ IPDVCRG
Sbjct  25    FTVIASDSTAPSALIEGPQTGFTMTNDGARTDPDEQDAVYDIMRATGNDWASSIPDVCRG  84

Query  531   RWHGIECMPDKANVYHVVSLSFGALSDDTAFPTCDTAPRPFISPAVTKLLHLRTLFFYRC  710
             RWHGIECMPD+ NV+HVVSLSFGALSDDTAFPTCD   R ++S ++T+L H++ LFFYRC
Sbjct  85    RWHGIECMPDQDNVFHVVSLSFGALSDDTAFPTCD-PERSYVSESLTRLKHIKALFFYRC  143

Query  711   FTDNPQPIPTFlgqlgqtlqtlVLRENGHVGSIPNQLGNLTRLRVLDFHGNNLNGSIPVS  890
             FT  PQ IP+FLG LG +LQTLVLR+NG +G IP++LGNLT LRVLD H NNLNGSIP+S
Sbjct  144   FTRAPQRIPSFLGLLGSSLQTLVLRDNGLLGPIPDELGNLTSLRVLDLHRNNLNGSIPLS  203

Query  891   LSRIDGLRSLDLSRNKLAASIPNLTFPLLQILDLNQNHLVGSIPTALINCHSLMKMDLSR  1070
               R+  L SLDLS NKL   +P  + PLL ILDLN+N L+G++P++L +C SL+K+D SR
Sbjct  204   FHRLTRLSSLDLSGNKLTGYVPGFSLPLLNILDLNRNLLIGTVPSSLSSCRSLIKIDFSR  263

Query  1071  NRLSGRIPDSIDALNNIILMDLSYNSITGPIPTTLKNLDFLQALVLSGNPMLSDTLPEHI  1250
             NRL+G IP+ ID L  +IL+DLSYN ++GP P++L+ L  LQAL+L GN     TL E +
Sbjct  264   NRLTGPIPELIDRLKELILLDLSYNRLSGPFPSSLQGLTSLQALILKGNRRFRTTLAEDM  323

Query  1251  FLDGFKDLMILALSNMNLQGSIPESLAKLPKIRVLHLDGNQLNGSIPASFGeldslselr  1430
             F  G K LMIL LS+MNLQGSIP+S+A +  +RV+HLDGN L GSIP   G +  LSEL 
Sbjct  324   F-RGLKSLMILVLSDMNLQGSIPKSIAGMSSLRVVHLDGNNLTGSIPMELGNVKHLSELS  382

Query  1431  ldsNQLTGAVPFKREMVWRMRRKLKLSNNSGLCYDAKTGLGDDLEAISDSGISHCGSQAT  1610
             LD+N+LTG +PF+REMVWRMRRKL+L NNSGLC +  +GL D+L      G+  C  +  
Sbjct  383   LDNNRLTGQIPFEREMVWRMRRKLRLYNNSGLCSNRDSGLEDEL------GVRPCEWREG  436

Query  1611  EPTRTVEHISA  1643
               +R V+H+S 
Sbjct  437   S-SRMVQHLST  446



>ref|XP_009104444.1| PREDICTED: protein TOO MANY MOUTHS isoform X1 [Brassica rapa]
 ref|XP_009104445.1| PREDICTED: protein TOO MANY MOUTHS isoform X2 [Brassica rapa]
Length=497

 Score =   502 bits (1292),  Expect = 1e-162, Method: Compositional matrix adjust.
 Identities = 261/438 (60%), Positives = 330/438 (75%), Gaps = 4/438 (1%)
 Frame = +3

Query  336   PFGQCFTVIVSDSGAPSGLVDAPQTAYSLNNDHARTDAREQEAVYEVMRATGNDWATEIP  515
             PF   FTVI SD+ APS L+D PQT +++  D A T+  EQ+AVY++MRATGNDWA  IP
Sbjct  19    PFTSSFTVITSDTVAPSALIDGPQTGFTMTRDGAHTEPDEQDAVYDIMRATGNDWAAAIP  78

Query  516   DVCRGRWHGIECMPDKANVYHVVSLSFGALSDDTAFPTCDTAPRPFISPAVTKLLHLRTL  695
             DVCRGRWHGIECMPD+ NVYHVVSLSFGALSDDTAFPTCD   R +IS ++T+L HL+ L
Sbjct  79    DVCRGRWHGIECMPDQDNVYHVVSLSFGALSDDTAFPTCD-PKRSYISESLTRLKHLKAL  137

Query  696   FFYRCFTDNPQPIPTFlgqlgqtlqtlVLRENGHVGSIPNQLGNLTRLRVLDFHGNNLNG  875
             FFYRC +  PQ IP+FLG+LG +LQTLVLRENG  GSIP++LGNLT L+VLD H NNLNG
Sbjct  138   FFYRCLSRAPQQIPSFLGRLGSSLQTLVLRENGLFGSIPDELGNLTSLKVLDLHKNNLNG  197

Query  876   SIPVSLSRIDGLRSLDLSRNKLAASIPNLTFPLLQILDLNQNHLVGSIPTALINCHSLMK  1055
             SIP+SL+R+ GLRSLDLS N+L  SIP L  P L +LDLN N L G +P  L  C SL+K
Sbjct  198   SIPLSLNRLSGLRSLDLSVNRLTGSIPGLLLPDLNVLDLNHNLLTGPVPATLSTCGSLIK  257

Query  1056  MDLSRNRLSGRIPDSIDALNNIILMDLSYNSITGPIPTTLKNLDFLQALVLSGNPMLSDT  1235
             +DLS NR++G IPDS++ LN ++L+DLSYN ++GP P++L+ L+ LQALVL GN   +  
Sbjct  258   IDLSHNRVTGPIPDSVNRLNQLVLLDLSYNRLSGPFPSSLQGLNSLQALVLKGNTNFASA  317

Query  1236  LPEHIFLDGFKDLMILALSNMNLQGSIPESLAKLPKIRVLHLDGNQLNGSIPASFGelds  1415
             +PE++F  G  +LMIL LSNMNL GSIP SL +L  +RVLHL+GN L GSIP  F  +  
Sbjct  318   IPENVF-KGLNNLMILVLSNMNLHGSIPGSLTRLTSLRVLHLEGNNLTGSIPMEFRGVKD  376

Query  1416  lselrldsNQLTGAVPFKREMVWRMRRKLKLSNNSGLCYDAKTGLGDDLEAISDSGISHC  1595
             LSELRL+ N+LTG VPF+++ VWRMRRKL+L NN+GLC ++++ L     + S SG+  C
Sbjct  377   LSELRLNDNRLTGPVPFEKDTVWRMRRKLRLYNNAGLCVNSESNLDGVFGSTSGSGVRLC  436

Query  1596  GSQATE--PTRTVEHISA  1643
               +     P+ TV+H+S 
Sbjct  437   EGETKRPGPSGTVQHLSG  454



>emb|CDY54307.1| BnaC06g43050D [Brassica napus]
Length=492

 Score =   501 bits (1289),  Expect = 2e-162, Method: Compositional matrix adjust.
 Identities = 264/437 (60%), Positives = 330/437 (76%), Gaps = 4/437 (1%)
 Frame = +3

Query  336   PFGQCFTVIVSDSGAPSGLVDAPQTAYSLNNDHARTDAREQEAVYEVMRATGNDWATEIP  515
             PF   FTVI SD+ APS L+D PQ  +++ ND + T+  EQ+AVY++MRATGNDWA  IP
Sbjct  19    PFISSFTVITSDAVAPSALIDGPQAGFTMTNDGSHTEPDEQDAVYDIMRATGNDWAAAIP  78

Query  516   DVCRGRWHGIECMPDKANVYHVVSLSFGALSDDTAFPTCDTAPRPFISPAVTKLLHLRTL  695
             DVCRGRWHGIECMPD+ NVYHVVSLSFGALSDDTAFPTCD   R +IS ++T+L HLR L
Sbjct  79    DVCRGRWHGIECMPDQDNVYHVVSLSFGALSDDTAFPTCDPK-RSYISESLTRLKHLRAL  137

Query  696   FFYRCFTDNPQPIPTFlgqlgqtlqtlVLRENGHVGSIPNQLGNLTRLRVLDFHGNNLNG  875
             FFYRC +  PQ IP+FLG+LG +LQTLVLRENG  GSIPN+LGNLT L+VLD H NNLNG
Sbjct  138   FFYRCLSRAPQLIPSFLGRLGSSLQTLVLRENGLFGSIPNELGNLTNLKVLDLHKNNLNG  197

Query  876   SIPVSLSRIDGLRSLDLSRNKLAASIPNLTFPLLQILDLNQNHLVGSIPTALINCHSLMK  1055
             SIP+SL+R+ GLRSLDLS N+L  SIP L  P L +LDLN N L G +P  L  C SL+K
Sbjct  198   SIPLSLNRLSGLRSLDLSVNRLTGSIPGLLLPDLNVLDLNHNLLTGPVPATLSTCGSLIK  257

Query  1056  MDLSRNRLSGRIPDSIDALNNIILMDLSYNSITGPIPTTLKNLDFLQALVLSGNPMLSDT  1235
             +DLS NR++G IPDSI+ LN ++L+DLSYN ++GP P++L+ L+ LQALVL GN   +  
Sbjct  258   IDLSHNRVTGPIPDSINRLNQLVLLDLSYNRLSGPFPSSLQGLNSLQALVLKGNTNFASA  317

Query  1236  LPEHIFLDGFKDLMILALSNMNLQGSIPESLAKLPKIRVLHLDGNQLNGSIPASFGelds  1415
             +PE+ F  G K+LMIL LSNMNL GSIP SL +L  +RVLHL+GN L GSIP  F  +  
Sbjct  318   IPENAF-KGLKNLMILVLSNMNLHGSIPGSLTRLTSLRVLHLEGNNLTGSIPMEFRGVKD  376

Query  1416  lselrldsNQLTGAVPFKREMVWRMRRKLKLSNNSGLCYDAKTGLGDDLEAISDSGISHC  1595
             LSELRL+ N+LTG VPF+R++VWRMRRKL+L NN+GLC ++++ L D     S  G+   
Sbjct  377   LSELRLNDNRLTGPVPFERDIVWRMRRKLRLYNNAGLCVNSESNLDDVFG--SSVGLCEG  434

Query  1596  GSQATEPTRTVEHISAV  1646
              ++   P+ TV+H+S  
Sbjct  435   ETKRPGPSGTVQHLSGA  451



>gb|KFK42412.1| hypothetical protein AALP_AA2G252800 [Arabis alpina]
Length=488

 Score =   501 bits (1289),  Expect = 2e-162, Method: Compositional matrix adjust.
 Identities = 270/473 (57%), Positives = 341/473 (72%), Gaps = 17/473 (4%)
 Frame = +3

Query  336   PFGQCFTVIVSDSGAPSGLVDAPQTAYSLNNDHARTDAREQEAVYEVMRATGNDWATEIP  515
             P  + FTVI SD+ APS L+D PQT +++ ND ART+  EQ+AVY++MRATGNDWA  IP
Sbjct  19    PLVRSFTVITSDTTAPSALIDGPQTGFTMTNDGARTEPDEQDAVYDIMRATGNDWAASIP  78

Query  516   DVCRGRWHGIECMPDKANVYHVVSLSFGALSDDTAFPTCDTAPRPFISPAVTKLLHLRTL  695
             DVCRGRWHGIECMPD+ NVYHVVSLSFGALSDDTAFPTCD   R ++S +VT+L HL+ L
Sbjct  79    DVCRGRWHGIECMPDQDNVYHVVSLSFGALSDDTAFPTCDPE-RSYVSESVTRLKHLKAL  137

Query  696   FFYRCFTDNPQPIPTFlgqlgqtlqtlVLRENGHVGSIPNQLGNLTRLRVLDFHGNNLNG  875
             FFYRC    PQ IP FLG+LG +LQTLVLRENG +G IP +LGNLT L+VLD H NNLNG
Sbjct  138   FFYRCLGRAPQRIPAFLGRLGSSLQTLVLRENGFLGPIPEELGNLTNLKVLDLHRNNLNG  197

Query  876   SIPVSLSRIDGLRSLDLSRNKLAASIPNLTFPLLQILDLNQNHLVGSIPTALINCHSLMK  1055
             SIP+S +R  GLRSLDLS N+L  SIP    P L +LDLNQN L G +P+ L  C SL+K
Sbjct  198   SIPLSFNRFSGLRSLDLSGNRLTGSIPGFHLPDLNVLDLNQNLLTGPVPSTLSTCSSLIK  257

Query  1056  MDLSRNRLSGRIPDSIDALNNIILMDLSYNSITGPIPTTLKNLDFLQALVLSGNPMLSDT  1235
             +DLSRNR++G IPDSI+ LN ++L+DLSYN ++GP P +L+ L+ LQAL+L GN   S  
Sbjct  258   IDLSRNRVTGTIPDSINRLNQLVLLDLSYNRLSGPFPPSLQGLNSLQALMLKGNTKFSAM  317

Query  1236  LPEHIFLDGFKDLMILALSNMNLQGSIPESLAKLPKIRVLHLDGNQLNGSIPASFGelds  1415
             +PE++F  G K+LMIL LSNM+LQGS+P SL +L  +RVLHL+ N LNGSIP  F ++  
Sbjct  318   IPENVF-KGLKNLMILVLSNMSLQGSVPGSLTRLTSLRVLHLEDNNLNGSIPLEFRDVKH  376

Query  1416  lselrldsNQLTGAVPFKREMVWRMRRKLKLSNNSGLCYDAKTGLGDDLEAISDSGISHC  1595
             LSELRL+ N+LTG VPF+R+ VWRMRRKL+L NN+GLC +      +D++ +  S +  C
Sbjct  377   LSELRLNDNRLTGPVPFERDTVWRMRRKLRLYNNAGLCVNHD----NDMDDVFGSSVKLC  432

Query  1596  GSQATE--PTRTVEHISAVDESMLRSSVKSGGTVKELS---PLSCLLLAVYFL  1739
               +     P+ TV+H+S  D       V +G   +  S   PL    L  +FL
Sbjct  433   DEEMQRPGPSSTVQHLSRED------GVTTGAATEVSSGSRPLGFFSLFAFFL  479



>dbj|BAC43164.1| GPI-anchored protein [Arabidopsis thaliana]
 gb|AAO64827.1| At1g80080 [Arabidopsis thaliana]
Length=496

 Score =   500 bits (1288),  Expect = 3e-162, Method: Compositional matrix adjust.
 Identities = 260/444 (59%), Positives = 333/444 (75%), Gaps = 4/444 (1%)
 Frame = +3

Query  336   PFGQCFTVIVSDSGAPSGLVDAPQTAYSLNNDHARTDAREQEAVYEVMRATGNDWATEIP  515
             P  + FTVI SDS APS L+D PQT +++ ND ART+  EQ+AVY++MRATGNDWA  IP
Sbjct  19    PLVRSFTVITSDSTAPSALIDGPQTGFTMTNDGARTEPDEQDAVYDIMRATGNDWAAAIP  78

Query  516   DVCRGRWHGIECMPDKANVYHVVSLSFGALSDDTAFPTCDTAPRPFISPAVTKLLHLRTL  695
             DVCRGRWHGIECMPD+ NVYHVVSLSFGALSDDTAFPTCD   R ++S ++T+L HL+ L
Sbjct  79    DVCRGRWHGIECMPDQDNVYHVVSLSFGALSDDTAFPTCDPQ-RSYVSESLTRLKHLKAL  137

Query  696   FFYRCFTDNPQPIPTFlgqlgqtlqtlVLRENGHVGSIPNQLGNLTRLRVLDFHGNNLNG  875
             FFYRC    PQ IP FLG+LG +LQTLVLRENG +G IP++LGNLT L+VLD H N+LNG
Sbjct  138   FFYRCLGRAPQRIPAFLGRLGSSLQTLVLRENGFLGPIPDELGNLTNLKVLDLHKNHLNG  197

Query  876   SIPVSLSRIDGLRSLDLSRNKLAASIPNLTFPLLQILDLNQNHLVGSIPTALINCHSLMK  1055
             SIP+S +R  GLRSLDLS N+L  SIP    P L +LDLNQN L G +P  L +C SL+K
Sbjct  198   SIPLSFNRFSGLRSLDLSGNRLTGSIPGFVLPALSVLDLNQNLLTGPVPPTLTSCGSLIK  257

Query  1056  MDLSRNRLSGRIPDSIDALNNIILMDLSYNSITGPIPTTLKNLDFLQALVLSGNPMLSDT  1235
             +DLSRNR++G IP+SI+  N ++L+DLSYN ++GP P++L+ L+ LQAL+L GN   S T
Sbjct  258   IDLSRNRVTGPIPESINRFNQLVLLDLSYNRLSGPFPSSLQGLNSLQALMLKGNTKFSTT  317

Query  1236  LPEHIFLDGFKDLMILALSNMNLQGSIPESLAKLPKIRVLHLDGNQLNGSIPASFGelds  1415
             +PE+ F  G K+LMIL LSN N+QGSIP+SL +L  +RVLHL+GN L G IP  F ++  
Sbjct  318   IPENAF-KGLKNLMILVLSNTNIQGSIPKSLTRLNSLRVLHLEGNNLTGEIPLEFRDVKH  376

Query  1416  lselrldsNQLTGAVPFKREMVWRMRRKLKLSNNSGLCYDAKTGLGDDLEAISDSGISHC  1595
             LSELRL+ + LTG VPF+R+ VWRMRRKL+L NN+GLC +  + L D   + S S +  C
Sbjct  377   LSELRLNDSSLTGPVPFERDTVWRMRRKLRLYNNAGLCVNRDSDLDDAFGSKSGSTVRLC  436

Query  1596  GSQATE--PTRTVEHISAVDESML  1661
              ++ +   P+ TV+H+S  ++  L
Sbjct  437   DAETSRPAPSGTVQHLSREEDGAL  460



>ref|XP_006301858.1| hypothetical protein CARUB_v10022328mg [Capsella rubella]
 gb|EOA34756.1| hypothetical protein CARUB_v10022328mg [Capsella rubella]
Length=492

 Score =   495 bits (1275),  Expect = 3e-160, Method: Compositional matrix adjust.
 Identities = 264/442 (60%), Positives = 327/442 (74%), Gaps = 6/442 (1%)
 Frame = +3

Query  336   PFGQCFTVIVSDSGAPSGLVDAPQTAYSLNNDHARTDAREQEAVYEVMRATGNDWATEIP  515
             P    FTVI SDS APS L+D PQT +++ ND ART+  EQ+AVY++MRATGNDWA  IP
Sbjct  16    PLVTSFTVITSDSTAPSALIDGPQTGFTMTNDGARTEPDEQDAVYDIMRATGNDWAAAIP  75

Query  516   DVCRGRWHGIECMPDKANVYHVVSLSFGALSDDTAFPTCDTAPRPFISPAVTKLLHLRTL  695
             DVCRGRWHGIECMPD+ NVYHVVSLSFGALSDDTAFPTCD   R ++S ++T+L HL+ L
Sbjct  76    DVCRGRWHGIECMPDQENVYHVVSLSFGALSDDTAFPTCDPE-RSYVSESLTRLKHLKAL  134

Query  696   FFYRCFTDNPQPIPTFlgqlgqtlqtlVLRENGHVGSIPNQLGNLTRLRVLDFHGNNLNG  875
             FFYRC   +PQ IP FLG+LG +LQTLVLRENG  G IP++LGNLT L+VLD H NNLNG
Sbjct  135   FFYRCLGRSPQRIPAFLGRLGSSLQTLVLRENGFFGPIPDELGNLTSLKVLDLHYNNLNG  194

Query  876   SIPVSLSRIDGLRSLDLSRNKLAASIPNLTFPLLQILDLNQNHLVGSIPTALINCHSLMK  1055
             SIP+S +R   L SLDLS N+L  SIP    P L +LDLNQN L G +P+ L  C SL+K
Sbjct  195   SIPLSFNRFSRLTSLDLSANRLTGSIPGFLLPGLNVLDLNQNLLTGPVPSTLAACGSLIK  254

Query  1056  MDLSRNRLSGRIPDSIDALNNIILMDLSYNSITGPIPTTLKNLDFLQALVLSGNPMLSDT  1235
             +DLSRNR+SG IPDS + LN ++L+DLSYN ++GP P +L+ L+ LQAL+L GN   S T
Sbjct  255   IDLSRNRVSGPIPDSFNRLNQLVLLDLSYNRLSGPFPPSLQGLNSLQALMLKGNTKFSAT  314

Query  1236  LPEHIFLDGFKDLMILALSNMNLQGSIPESLAKLPKIRVLHLDGNQLNGSIPASFGelds  1415
             +PE+ F  G ++LMIL LSNMNLQGSIP+SL++L  +RVLHL+GN L G IP  F +   
Sbjct  315   IPENAF-KGLQNLMILVLSNMNLQGSIPKSLSRLNSLRVLHLEGNNLTGEIPLEFRDAKH  373

Query  1416  lselrldsNQLTGAVPFKREMVWRMRRKLKLSNNSGLCYDAKTGLGDDLEAISDSGISHC  1595
             LSELRL+ N LTG VPF+R+ VWRMRRKL+L NN+GLC    + L D   + S S ++ C
Sbjct  374   LSELRLNDNSLTGPVPFERDTVWRMRRKLRLYNNAGLCVGRDSDLDDAFGSTSGSSVTLC  433

Query  1596  GSQATEPT--RTVEHIS--AVD  1649
               +   P    TV+H++  AVD
Sbjct  434   EGETPTPGPPGTVQHLTREAVD  455



>ref|XP_006389750.1| hypothetical protein EUTSA_v10019584mg [Eutrema salsugineum]
 gb|ESQ27036.1| hypothetical protein EUTSA_v10019584mg [Eutrema salsugineum]
Length=493

 Score =   490 bits (1261),  Expect = 3e-158, Method: Compositional matrix adjust.
 Identities = 271/470 (58%), Positives = 335/470 (71%), Gaps = 5/470 (1%)
 Frame = +3

Query  336   PFGQCFTVIVSDSGAPSGLVDAPQTAYSLNNDHARTDAREQEAVYEVMRATGNDWATEIP  515
             P    FTVI SDS APS L+D PQT +++ ND A T+  EQ+AVY++MRATGNDWA  IP
Sbjct  19    PLVLSFTVITSDSTAPSALIDGPQTGFTMTNDGAHTEPDEQDAVYDIMRATGNDWAAAIP  78

Query  516   DVCRGRWHGIECMPDKANVYHVVSLSFGALSDDTAFPTCDTAPRPFISPAVTKLLHLRTL  695
             DVCRGRWHGIECMPD+ NVYHVVSLSFGALSDDTAFPTCD   R ++S ++T+L HL+ L
Sbjct  79    DVCRGRWHGIECMPDQDNVYHVVSLSFGALSDDTAFPTCDPE-RSYVSESLTRLKHLKAL  137

Query  696   FFYRCFTDNPQPIPTFlgqlgqtlqtlVLRENGHVGSIPNQLGNLTRLRVLDFHGNNLNG  875
             FFYRC    PQ IP FLG+LG +LQTLVLRENG  G IP++LGNLT LRVLD H NNLNG
Sbjct  138   FFYRCLGRAPQRIPPFLGRLGSSLQTLVLRENGLFGPIPDELGNLTNLRVLDLHHNNLNG  197

Query  876   SIPVSLSRIDGLRSLDLSRNKLAASIPNLTFPLLQILDLNQNHLVGSIPTALINCHSLMK  1055
             SIP+S +R  GLRSLDLS N+L+ S+P    P L +LDLN N L G +P+ L  C SL+K
Sbjct  198   SIPLSFNRFSGLRSLDLSANRLSGSVPGFFLPDLNVLDLNHNLLTGPVPSTLSACASLIK  257

Query  1056  MDLSRNRLSGRIPDSIDALNNIILMDLSYNSITGPIPTTLKNLDFLQALVLSGNPMLSDT  1235
             +DLSRNR++G IPDSI+ LN ++L+DLSYN ++GP P++L+ L  LQALVL GN   S  
Sbjct  258   VDLSRNRVTGTIPDSINRLNQLVLLDLSYNRLSGPFPSSLQGLHSLQALVLKGNTEFSVA  317

Query  1236  LPEHIFLDGFKDLMILALSNMNLQGSIPESLAKLPKIRVLHLDGNQLNGSIPASFGelds  1415
             +PE+  L G  +LM+L LSNMNLQGSIP SL +L  +RVLHL+GN L G IP  F  +  
Sbjct  318   IPENS-LKGLNNLMVLVLSNMNLQGSIPGSLTRLTSLRVLHLEGNNLTGPIPIEFRGVKY  376

Query  1416  lselrldsNQLTGAVPFKREMVWRMRRKLKLSNNSGLCYDAKTGLGDDLEAISDSGISHC  1595
             LSELRL+ N+LTG VPF+R+ VWRMRRKL+L NN+GLC +    L D   + S S +  C
Sbjct  377   LSELRLNDNRLTGPVPFERDTVWRMRRKLRLYNNAGLCVNRGNDLDDVFGSSSGSSVRLC  436

Query  1596  --GSQATEPTRTVEHISAVDESMLRSS-VKSGGTVKELSPLSCLLLAVYF  1736
                +Q   P+ TV+H+S  D     ++ V SG        LS  LL + F
Sbjct  437   EGETQRPGPSGTVQHLSKGDGVTDETTDVSSGSKSLGFFRLSAFLLVLSF  486



>emb|CDO98162.1| unnamed protein product [Coffea canephora]
Length=374

 Score =   483 bits (1244),  Expect = 2e-157, Method: Compositional matrix adjust.
 Identities = 229/305 (75%), Positives = 266/305 (87%), Gaps = 1/305 (0%)
 Frame = -2

Query  3198  YWGQLWDGSQIAVKRLKEWSNTAEVEFAAEVEILARARHKNLLALRGYCSEGQEHVLVYD  3019
             YWGQLWDGSQIAVKRLK WSN AE+EFA EVEILAR RH+NLL+LRGYC+EGQE ++VYD
Sbjct  54    YWGQLWDGSQIAVKRLKVWSNKAEMEFAVEVEILARVRHENLLSLRGYCAEGQERLIVYD  113

Query  3018  YVPNFSLLSHLHGQYSADTLLDWKKRISIAVGSAEGIAYLHHDATPHIIHGDIKAGNVLL  2839
             Y+PN SLLSHLHGQ+SA+ LLDW +R++IA+GSAEGIAYLHH ATPHIIH D+KA NVLL
Sbjct  114   YMPNLSLLSHLHGQHSAECLLDWNRRMNIAIGSAEGIAYLHHHATPHIIHRDVKASNVLL  173

Query  2838  DSNFQAQLAGFGIANFFPDDATRVTTRSKGTLGYLAPEYVMLGKESKSCDVYSFGILLLE  2659
             DS+FQA++A FG A F PD AT VTTR KGTLGYLAPEY MLGK S+SCDVYSFGILLLE
Sbjct  174   DSDFQARVADFGFAKFIPDGATHVTTRVKGTLGYLAPEYAMLGKASESCDVYSFGILLLE  233

Query  2658  LASGKKPIKKVSASKNWTITDWALPLACEGKFSELADPTLNGNYVEEELKRIVYVALICA  2479
             LASGKKPI+K++A+   TITDWALPLACE KF ELADP L GNYVEEELKR+V+VALICA
Sbjct  234   LASGKKPIEKLNATTKRTITDWALPLACESKFGELADPKLKGNYVEEELKRVVFVALICA  293

Query  2478  QNQPEKRPTMLEVVELLKGESKEKLAALENNEMFKNLKAATHKDGCA-HEDSQEFISEKQ  2302
             QN+PEKRPTMLEVV+LLKG+S+EK  ALEN+EMFKN + A + DG +  EDS +FISE++
Sbjct  294   QNRPEKRPTMLEVVDLLKGDSEEKFVALENDEMFKNTRPADYNDGLSGAEDSSDFISEEK  353

Query  2301  VLEPE  2287
              ++ E
Sbjct  354   DVKQE  358



>ref|XP_010033969.1| PREDICTED: protein TOO MANY MOUTHS [Eucalyptus grandis]
Length=487

 Score =   483 bits (1243),  Expect = 1e-155, Method: Compositional matrix adjust.
 Identities = 284/453 (63%), Positives = 330/453 (73%), Gaps = 14/453 (3%)
 Frame = +3

Query  336   PFGQCFTVIVSDSGAPSGLVDAPQTAYSLNNDHARTDAREQEAVYEVMRATGNDWATEIP  515
             P    FTVI SDSG    LVD PQ       + ARTD REQEAVY+VMRATGN+WA  I 
Sbjct  16    PLAAPFTVIPSDSG----LVDTPQNG---PKNGARTDPREQEAVYDVMRATGNEWAAGIV  68

Query  516   DVCRGRWHGIECMPDKANVYHVVSLSFGALSDDTAFPTCDTAPRPFISPAVTKLLHLRTL  695
             DVCRGRWHGIECMPDK  VYHVVSLSFG LSDDTAFPTCD A   +ISPAVT+L HLRTL
Sbjct  69    DVCRGRWHGIECMPDKHGVYHVVSLSFGELSDDTAFPTCDPA-WSYISPAVTRLPHLRTL  127

Query  696   FFYRCFTDNPQPIPTFlgqlgqtlqtlVLRENGHVGSIPNQLGNLTRLRVLDFHGNNLNG  875
             FFYRCF+ NPQPIP FLG+LG TLQTLVLRENGHVG IP ++GNLTRLRVLD H N+LNG
Sbjct  128   FFYRCFSYNPQPIPAFLGKLGSTLQTLVLRENGHVGPIPIEIGNLTRLRVLDLHKNDLNG  187

Query  876   SIPVSLSRIDGLRSLDLSRNKLAASIPNLTFPLLQILDLNQNHLVGSIPTALINCHSLMK  1055
             SIP SL R+ GLRSLDLS NKL  SIP   FP L +LDLNQN L G IP +L  C SL+K
Sbjct  188   SIPGSLGRVAGLRSLDLSGNKLTGSIPGFGFPSLSVLDLNQNLLTGLIPPSLGTCLSLIK  247

Query  1056  MDLSRNRLSGRIPDSIDALNNIILMDLSYNSITGPIPTTLKNLDFLQALVLSGNPMLSDT  1235
             +DLS N L+G IP+SI+ L ++IL+DLSYN ++GP P +LK++  L+ALVL GNPM S T
Sbjct  248   IDLSHNHLTGPIPESINRLRDLILLDLSYNGLSGPFPESLKDMTSLEALVLKGNPMESVT  307

Query  1236  LPEHIFLDGFKDLMILALSNMNLQGSIPESLAKLPKIRVLHLDGNQLNGSIPASFGelds  1415
             +P+  F  G   L IL LS+MNL G IPESL +LP +RVLHLD N+L+GSIP SF  L S
Sbjct  308   IPDDAF-AGMNVLTILVLSDMNLHGPIPESLGRLPSLRVLHLDRNRLSGSIPESFWNLRS  366

Query  1416  lselrldsNQLTGAVPFKREMVWRMRRKLKLSNNSGLCYDAKTGLGDDLEAISDSGISHC  1595
             ++ELRL+ NQLTG +PF +E VWRM+RKL+L NNSGLCYDA  G  D   +  D GI  C
Sbjct  367   IAELRLNDNQLTGPIPFGKETVWRMKRKLRLYNNSGLCYDAGGGFEDGSGSSHDLGIGLC  426

Query  1596  --GSQATEPTRTVEHISA---VDESMLRSSVKS  1679
                +  +   RTV H S     D  M R++  S
Sbjct  427   DAAAARSGSARTVRHTSEGNDADGDMTRTAQAS  459



>ref|XP_009350764.1| PREDICTED: protein TOO MANY MOUTHS-like, partial [Pyrus x bretschneideri]
Length=355

 Score =   478 bits (1229),  Expect = 1e-155, Method: Compositional matrix adjust.
 Identities = 246/350 (70%), Positives = 284/350 (81%), Gaps = 2/350 (1%)
 Frame = +3

Query  351   FTVIVSDSGAPSGLVDAPQTAYSLNNDHARTDAREQEAVYEVMRATGNDWATEIPDVCRG  530
             FTVI+SDSG PS LVD PQ  +S+N D A+TDAREQEAVY++MRATGNDWATEIPDVCRG
Sbjct  3     FTVIMSDSGVPSDLVDGPQNGFSMNKDGAQTDAREQEAVYDIMRATGNDWATEIPDVCRG  62

Query  531   RWHGIECMPDKANVYHVVSLSFGALSDDTAFPTCDTAPRPFISPAVTKLLHLRTLFFYRC  710
             RWHGIEC PDK NVYH+VSLSFGALSDDTAFPTCD   R  ISP++TKL +LRTLFFYRC
Sbjct  63    RWHGIECKPDKNNVYHIVSLSFGALSDDTAFPTCDPT-RSHISPSITKLPYLRTLFFYRC  121

Query  711   FTDNPQPIPTFlgqlgqtlqtlVLRENGHVGSIPNQLGNLTRLRVLDFHGNNLNGSIPVS  890
             FT NPQPIP+FLG+LG TLQTLVLREN HVG IP +LGNLTRL VLD H NNLNGSIPVS
Sbjct  122   FTYNPQPIPSFLGRLGPTLQTLVLRENEHVGPIPIELGNLTRLSVLDLHKNNLNGSIPVS  181

Query  891   LSRIDGLRSLDLSRNKLAASIPNLTFPLLQILDLNQNHLVGSIPTALINCHSLMKMDLSR  1070
             LSRI GLRSLDLS N+L  SIPN TFP+L ILDLNQN L+GSIP+++  CH+L+KMDL  
Sbjct  182   LSRITGLRSLDLSGNRLTGSIPNFTFPILSILDLNQNLLMGSIPSSIGACHALIKMDLGH  241

Query  1071  NRLSGRIPDSIDALNNIILMDLSYNSITGPIPTTLKNLDFLQALVLSGNPMLSDTLPEHI  1250
             N L+G +PDS+  L +++LMDLSYN + GP+P  +++L  LQ L+L GN M    +P  +
Sbjct  242   NHLAGPLPDSVGGLKSLMLMDLSYNRLKGPLPMWIRSLISLQTLILKGNQMGPTPIPSDL  301

Query  1251  FLDGFKDLMILALSNMNLQGSIPESLAKLPKIRVLHLDGNQLNGSIPASF  1400
             F DG K LM L LSNMNL G +P SL +LP +RVLHLDGN  NGSIPASF
Sbjct  302   F-DGMKGLMTLILSNMNLHGPLPASLGRLPSLRVLHLDGNNFNGSIPASF  350



>ref|XP_009347412.1| PREDICTED: protein TOO MANY MOUTHS-like, partial [Pyrus x bretschneideri]
 ref|XP_009350765.1| PREDICTED: protein TOO MANY MOUTHS-like, partial [Pyrus x bretschneideri]
Length=384

 Score =   479 bits (1232),  Expect = 1e-155, Method: Compositional matrix adjust.
 Identities = 246/350 (70%), Positives = 284/350 (81%), Gaps = 2/350 (1%)
 Frame = +3

Query  351   FTVIVSDSGAPSGLVDAPQTAYSLNNDHARTDAREQEAVYEVMRATGNDWATEIPDVCRG  530
             FTVI+SDSG PS LVD PQ  +S+N D A+TDAREQEAVY++MRATGNDWATEIPDVCRG
Sbjct  25    FTVIMSDSGVPSDLVDGPQNGFSMNKDGAQTDAREQEAVYDIMRATGNDWATEIPDVCRG  84

Query  531   RWHGIECMPDKANVYHVVSLSFGALSDDTAFPTCDTAPRPFISPAVTKLLHLRTLFFYRC  710
             RWHGIEC PDK NVYH+VSLSFGALSDDTAFPTCD   R  ISP++TKL +LRTLFFYRC
Sbjct  85    RWHGIECKPDKNNVYHIVSLSFGALSDDTAFPTCDPT-RSHISPSITKLPYLRTLFFYRC  143

Query  711   FTDNPQPIPTFlgqlgqtlqtlVLRENGHVGSIPNQLGNLTRLRVLDFHGNNLNGSIPVS  890
             FT NPQPIP+FLG+LG TLQTLVLREN HVG IP +LGNLTRL VLD H NNLNGSIPVS
Sbjct  144   FTYNPQPIPSFLGRLGPTLQTLVLRENEHVGPIPIELGNLTRLSVLDLHKNNLNGSIPVS  203

Query  891   LSRIDGLRSLDLSRNKLAASIPNLTFPLLQILDLNQNHLVGSIPTALINCHSLMKMDLSR  1070
             LSRI GLRSLDLS N+L  SIPN TFP+L ILDLNQN L+GSIP+++  CH+L+KMDL  
Sbjct  204   LSRITGLRSLDLSGNRLTGSIPNFTFPILSILDLNQNLLMGSIPSSIGACHALIKMDLGH  263

Query  1071  NRLSGRIPDSIDALNNIILMDLSYNSITGPIPTTLKNLDFLQALVLSGNPMLSDTLPEHI  1250
             N L+G +PDS+  L +++LMDLSYN + GP+P  +++L  LQ L+L GN M    +P  +
Sbjct  264   NHLAGPLPDSVGGLKSLMLMDLSYNRLKGPLPMWIRSLISLQTLILKGNQMGPTPIPSDL  323

Query  1251  FLDGFKDLMILALSNMNLQGSIPESLAKLPKIRVLHLDGNQLNGSIPASF  1400
             F DG K LM L LSNMNL G +P SL +LP +RVLHLDGN  NGSIPASF
Sbjct  324   F-DGMKGLMTLILSNMNLHGPLPASLGRLPSLRVLHLDGNNFNGSIPASF  372



>ref|XP_004303295.1| PREDICTED: PTI1-like tyrosine-protein kinase At3g15890-like [Fragaria 
vesca subsp. vesca]
Length=371

 Score =   476 bits (1226),  Expect = 7e-155, Method: Compositional matrix adjust.
 Identities = 228/300 (76%), Positives = 261/300 (87%), Gaps = 1/300 (0%)
 Frame = -2

Query  3198  YWGQLWDGSQIAVKRLKEWSNTAEVEFAAEVEILARARHKNLLALRGYCSEGQEHVLVYD  3019
             YWGQLWDGSQIAVKRLK WSN AE+EFA EVEILAR RHKNLL+LRGYC+EGQE ++VYD
Sbjct  55    YWGQLWDGSQIAVKRLKVWSNKAEMEFAVEVEILARVRHKNLLSLRGYCAEGQERLIVYD  114

Query  3018  YVPNFSLLSHLHGQYSADTLLDWKKRISIAVGSAEGIAYLHHDATPHIIHGDIKAGNVLL  2839
             Y+PN SLLSHLHGQ+SA+ LLDW +R++IA+GSAEGIAYLHH ATPHIIH DIKA NVL+
Sbjct  115   YMPNLSLLSHLHGQHSAECLLDWTRRMNIAIGSAEGIAYLHHHATPHIIHRDIKASNVLV  174

Query  2838  DSNFQAQLAGFGIANFFPDDATRVTTRSKGTLGYLAPEYVMLGKESKSCDVYSFGILLLE  2659
             DS+FQAQ+A FG A   PD AT VTTR KGTLGYLAPEY MLGK S+SCDVYSFGILLLE
Sbjct  175   DSDFQAQVADFGFAKLIPDGATHVTTRVKGTLGYLAPEYAMLGKASESCDVYSFGILLLE  234

Query  2658  LASGKKPIKKVSASKNWTITDWALPLACEGKFSELADPTLNGNYVEEELKRIVYVALICA  2479
             LASGKKPI+K+SA+   TITDWALPLACE KF E+ADP LNG YVE+ELKR+V+VAL+CA
Sbjct  235   LASGKKPIEKLSATMKRTITDWALPLACERKFDEIADPKLNGKYVEDELKRVVFVALLCA  294

Query  2478  QNQPEKRPTMLEVVELLKGESKEKLAALENNEMFKNLKAATHKDGCA-HEDSQEFISEKQ  2302
              NQPE+RPT+LEVVELLKGESKEKLA LE +E+FKN +AA   DG +  EDS +FISE++
Sbjct  295   HNQPERRPTILEVVELLKGESKEKLAKLETDELFKNHQAADLNDGTSGAEDSSDFISEEK  354



>ref|XP_008454210.1| PREDICTED: protein TOO MANY MOUTHS [Cucumis melo]
Length=439

 Score =   476 bits (1224),  Expect = 2e-153, Method: Compositional matrix adjust.
 Identities = 253/417 (61%), Positives = 317/417 (76%), Gaps = 5/417 (1%)
 Frame = +3

Query  351   FTVIV--SDSGAPSGLVDAPQTAYSLNNDHARTDAREQEAVYEVMRATGNDWATEIPDVC  524
             FTVI+  SDSGAPS L+D PQ+ +SL+N   RTD  EQ AVY++M ATGN WAT+IPDVC
Sbjct  23    FTVIMPDSDSGAPSALIDGPQSGFSLHNAAVRTDPAEQSAVYDIMSATGNYWATQIPDVC  82

Query  525   RGRWHGIECMPDKANVYHVVSLSFGALSDDTAFPTCDTAPRPFISPAVTKLLHLRTLFFY  704
              GRWHGIECMPD  N++H+VSLSFG+LSDDTAFPTCD A R  ISP++TKL HL+TLFFY
Sbjct  83    GGRWHGIECMPDNHNLFHIVSLSFGSLSDDTAFPTCD-ATRSTISPSLTKLPHLKTLFFY  141

Query  705   RCFTDNPQPIPTFlgqlgqtlqtlVLRENGHVGSIPNQLGNLTRLRVLDFHGNNLNGSIP  884
             RCF++NPQ IP+FLGQLG +LQTLVLR+NG +G IP +L NLTRL+VLD HGNNLNGSIP
Sbjct  142   RCFSNNPQFIPSFLGQLGSSLQTLVLRDNGLIGPIPTELTNLTRLKVLDLHGNNLNGSIP  201

Query  885   VSLSRIDGLRSLDLSRNKLAASIPNLTFPLLQILDLNQNHLVGSIPTALINCHSLMKMDL  1064
               L+R+ GLRSLDLSRNKL   +P+L    L+ILD++QN L+GSIP  ++ C SL+K+DL
Sbjct  202   AGLNRLLGLRSLDLSRNKLTGLLPSLGLSNLRILDVSQNLLMGSIPIGIVRCQSLIKLDL  261

Query  1065  SRNRLSGRIPDSIDALNNIILMDLSYNSITGPIPTTLKNLDFLQALVLSGNPMLSDTLPE  1244
             SRNRL+G IP+SI  L  ++L+DLSYN I+ P+PT+   L  L+AL+L GN M  D +  
Sbjct  262   SRNRLTGVIPESISGLTQLVLLDLSYNQISTPLPTSFPLLSSLEALILKGNAM--DCVLS  319

Query  1245  HIFLDGFKDLMILALSNMNLQGSIPESLAKLPKIRVLHLDGNQLNGSIPASFGeldslse  1424
                 DG   LM L LSNM   G IP SL +LP +RVLHLD N  NGSIP SF  L +LS+
Sbjct  320   SDLFDGMMSLMTLILSNMGFHGPIPNSLGRLPNLRVLHLDANHFNGSIPLSFQGLTNLSD  379

Query  1425  lrldsNQLTGAVPFKREMVWRMRRKLKLSNNSGLCYDAKTGLGDDLEAISDSGISHC  1595
             LRL+ N+LTG +P +++ +WRM+RKL+L NNSGLCY++K G+ D   +  + GI  C
Sbjct  380   LRLNDNELTGPIPLRKDTIWRMKRKLRLYNNSGLCYNSKGGVVDVSGSPYNIGIGPC  436



>ref|XP_009772957.1| PREDICTED: PTI1-like tyrosine-protein kinase At3g15890 [Nicotiana 
sylvestris]
Length=365

 Score =   470 bits (1210),  Expect = 2e-152, Method: Compositional matrix adjust.
 Identities = 232/307 (76%), Positives = 259/307 (84%), Gaps = 3/307 (1%)
 Frame = -2

Query  3198  YWGQLWDGSQIAVKRLKEWSNTAEVEFAAEVEILARARHKNLLALRGYCSEGQEHVLVYD  3019
             YWGQLWDGSQIAVKRLK WSN AE+EFA EVEILAR RHKNLL+LRGYC+EGQE ++VYD
Sbjct  55    YWGQLWDGSQIAVKRLKVWSNKAEMEFAVEVEILARVRHKNLLSLRGYCAEGQERLIVYD  114

Query  3018  YVPNFSLLSHLHGQYSADTLLDWKKRISIAVGSAEGIAYLHHDATPHIIHGDIKAGNVLL  2839
             Y+PN SLLSHLHGQ+SA++LLDWK+R++IA+GSAEGI YLHH ATPHIIH DIKA NVLL
Sbjct  115   YMPNLSLLSHLHGQHSAESLLDWKRRMNIAIGSAEGIVYLHHHATPHIIHRDIKASNVLL  174

Query  2838  DSNFQAQLAGFGIANFFPDDATRVTTRSKGTLGYLAPEYVMLGKESKSCDVYSFGILLLE  2659
             DS+FQAQ+A FG A F PD AT VTTR KGTLGYLAPEY MLGK S+SCDVYSFGILLLE
Sbjct  175   DSDFQAQVADFGFAKFIPDGATHVTTRVKGTLGYLAPEYAMLGKASESCDVYSFGILLLE  234

Query  2658  LASGKKPIKKVSASKNWTITDWALPLACEGKFSELADPTLNGNYVEEELKRIVYVALICA  2479
             LASGKKPI+K+S +   TITDWALPLACEGKFSELADP LN NYVEEE KR+V VALICA
Sbjct  235   LASGKKPIEKLSPTVKRTITDWALPLACEGKFSELADPRLNRNYVEEEFKRLVLVALICA  294

Query  2478  QNQPEKRPTMLEVVELLKGESKEKLAALENNEMFKNLKAATHKDGC--AHEDSQEFISEK  2305
              N+PEKRPTMLEVVELLKGESKEK  ALEN+EMFK +  AT  D    A  ++    SE 
Sbjct  295   HNRPEKRPTMLEVVELLKGESKEKFEALENDEMFK-IPPATDDDMLTGAEGNADAAASEL  353

Query  2304  QVLEPEI  2284
             +  +PEI
Sbjct  354   KEPKPEI  360



>ref|XP_008228699.1| PREDICTED: PTI1-like tyrosine-protein kinase At3g15890 [Prunus 
mume]
Length=364

 Score =   468 bits (1205),  Expect = 9e-152, Method: Compositional matrix adjust.
 Identities = 222/303 (73%), Positives = 260/303 (86%), Gaps = 4/303 (1%)
 Frame = -2

Query  3198  YWGQLWDGSQIAVKRLKEWSNTAEVEFAAEVEILARARHKNLLALRGYCSEGQEHVLVYD  3019
             YWGQLWDGSQIAVKRLK WSN A++EFA EVEILAR RHKNLL+LRGYC+EGQE ++VYD
Sbjct  55    YWGQLWDGSQIAVKRLKVWSNKADMEFAVEVEILARVRHKNLLSLRGYCAEGQERLIVYD  114

Query  3018  YVPNFSLLSHLHGQYSADTLLDWKKRISIAVGSAEGIAYLHHDATPHIIHGDIKAGNVLL  2839
             Y+PN SLLSHLHGQ+SA+ LLDW +R++IA+GSAEGIAYLHH ATPHIIH DIKA NVL+
Sbjct  115   YMPNLSLLSHLHGQHSAECLLDWNRRMNIAIGSAEGIAYLHHHATPHIIHRDIKASNVLV  174

Query  2838  DSNFQAQLAGFGIANFFPDDATRVTTRSKGTLGYLAPEYVMLGKESKSCDVYSFGILLLE  2659
             DS+FQAQ+A FG A   PD AT VTTR KGTLGYLAPEY MLGK S+SCDVYSFGILLLE
Sbjct  175   DSDFQAQVADFGFAKLIPDGATHVTTRVKGTLGYLAPEYAMLGKASESCDVYSFGILLLE  234

Query  2658  LASGKKPIKKVSASKNWTITDWALPLACEGKFSELADPTLNGNYVEEELKRIVYVALICA  2479
             LASGKKPI+K+S++   T+T+WALPLACE KF ELADP LNG Y E+ELKR+++VAL+CA
Sbjct  235   LASGKKPIEKLSSTMKRTVTEWALPLACERKFDELADPKLNGKYAEDELKRVIFVALLCA  294

Query  2478  QNQPEKRPTMLEVVELLKGESKEKLAALENNEMFKNLKAATHKDG----CAHEDSQEFIS  2311
              ++PE+RPTMLEVVELLKGESKEKLA LEN+E+FK  +A  + DG     A EDS +FIS
Sbjct  295   HSRPERRPTMLEVVELLKGESKEKLAQLENDELFKTSQAPEYNDGNDGTSAAEDSSDFIS  354

Query  2310  EKQ  2302
             E++
Sbjct  355   EEK  357



>ref|XP_007215581.1| hypothetical protein PRUPE_ppa007548mg [Prunus persica]
 gb|EMJ16780.1| hypothetical protein PRUPE_ppa007548mg [Prunus persica]
Length=364

 Score =   468 bits (1203),  Expect = 2e-151, Method: Compositional matrix adjust.
 Identities = 222/303 (73%), Positives = 259/303 (85%), Gaps = 4/303 (1%)
 Frame = -2

Query  3198  YWGQLWDGSQIAVKRLKEWSNTAEVEFAAEVEILARARHKNLLALRGYCSEGQEHVLVYD  3019
             YWGQLWDGSQIAVKRLK WSN A++EFA EVEILAR RHKNLL+LRGYC+EGQE ++VYD
Sbjct  55    YWGQLWDGSQIAVKRLKVWSNKADMEFAVEVEILARVRHKNLLSLRGYCAEGQERLIVYD  114

Query  3018  YVPNFSLLSHLHGQYSADTLLDWKKRISIAVGSAEGIAYLHHDATPHIIHGDIKAGNVLL  2839
             Y+PN SLLSHLHGQ+SA+ LLDW +R++IA+GSAEGIAYLHH ATPHIIH DIKA NVL+
Sbjct  115   YMPNLSLLSHLHGQHSAECLLDWNRRMNIAIGSAEGIAYLHHHATPHIIHRDIKASNVLV  174

Query  2838  DSNFQAQLAGFGIANFFPDDATRVTTRSKGTLGYLAPEYVMLGKESKSCDVYSFGILLLE  2659
             DS+FQAQ+A FG A   PD AT VTTR KGTLGYLAPEY MLGK S+SCDVYSFGILLLE
Sbjct  175   DSDFQAQVADFGFAKLIPDGATHVTTRVKGTLGYLAPEYAMLGKASESCDVYSFGILLLE  234

Query  2658  LASGKKPIKKVSASKNWTITDWALPLACEGKFSELADPTLNGNYVEEELKRIVYVALICA  2479
             LASGKKPI+K+S++   T+TDWALPLACE KF ELADP LNG Y  +ELKR+++VAL+CA
Sbjct  235   LASGKKPIEKLSSTMKRTVTDWALPLACERKFDELADPKLNGKYAVDELKRVIFVALLCA  294

Query  2478  QNQPEKRPTMLEVVELLKGESKEKLAALENNEMFKNLKAATHKDG----CAHEDSQEFIS  2311
              ++PE+RPTMLEVVELLKGESKEKLA LEN+E+FK  +A  + DG     A EDS +FIS
Sbjct  295   HSRPERRPTMLEVVELLKGESKEKLAQLENDELFKTSQAPEYNDGNDGTSAAEDSSDFIS  354

Query  2310  EKQ  2302
             E++
Sbjct  355   EEK  357



>gb|KCW53833.1| hypothetical protein EUGRSUZ_J03069 [Eucalyptus grandis]
Length=366

 Score =   468 bits (1203),  Expect = 2e-151, Method: Compositional matrix adjust.
 Identities = 223/306 (73%), Positives = 262/306 (86%), Gaps = 1/306 (0%)
 Frame = -2

Query  3198  YWGQLWDGSQIAVKRLKEWSNTAEVEFAAEVEILARARHKNLLALRGYCSEGQEHVLVYD  3019
             YWGQLWDGSQIAVKRLK WS+ AE+EFA EVEILAR RH NLL+LRGYC+EGQE ++VYD
Sbjct  48    YWGQLWDGSQIAVKRLKVWSDKAEMEFAVEVEILARVRHGNLLSLRGYCAEGQERLIVYD  107

Query  3018  YVPNFSLLSHLHGQYSADTLLDWKKRISIAVGSAEGIAYLHHDATPHIIHGDIKAGNVLL  2839
             Y+PN SLLSHLHGQ+S++ LLDW +R++IA+GSAEGIAYLHH A PHIIH DIKA NVLL
Sbjct  108   YMPNLSLLSHLHGQHSSECLLDWNRRMNIAIGSAEGIAYLHHRAIPHIIHRDIKASNVLL  167

Query  2838  DSNFQAQLAGFGIANFFPDDATRVTTRSKGTLGYLAPEYVMLGKESKSCDVYSFGILLLE  2659
             DS+F+A++A FG A F PD AT VTTR KGTLGYLAPEY MLGK S+SCDVYSFGILLLE
Sbjct  168   DSDFKARVADFGFAKFIPDGATHVTTRVKGTLGYLAPEYAMLGKASESCDVYSFGILLLE  227

Query  2658  LASGKKPIKKVSASKNWTITDWALPLACEGKFSELADPTLNGNYVEEELKRIVYVALICA  2479
             LASGKKP++K++A+   TITDWALPLACE KFS+LADP +NGNYVEEELKR+V VALICA
Sbjct  228   LASGKKPLEKLNATTKRTITDWALPLACEQKFSDLADPRINGNYVEEELKRVVLVALICA  287

Query  2478  QNQPEKRPTMLEVVELLKGESKEKLAALENNEMFKNLKAATHKDGCA-HEDSQEFISEKQ  2302
             Q+QPEKRPTMLEV+ELLKGE+K+K+A LEN+E+F   KA  + DG +  EDS +FISE +
Sbjct  288   QSQPEKRPTMLEVLELLKGEAKDKVAELENHELFNGPKAGEYNDGLSVAEDSSDFISEDK  347

Query  2301  VLEPEI  2284
                 E+
Sbjct  348   DKNKEV  353



>ref|XP_009607610.1| PREDICTED: PTI1-like tyrosine-protein kinase At3g15890 isoform 
X1 [Nicotiana tomentosiformis]
Length=365

 Score =   467 bits (1202),  Expect = 2e-151, Method: Compositional matrix adjust.
 Identities = 224/284 (79%), Positives = 249/284 (88%), Gaps = 1/284 (0%)
 Frame = -2

Query  3198  YWGQLWDGSQIAVKRLKEWSNTAEVEFAAEVEILARARHKNLLALRGYCSEGQEHVLVYD  3019
             YWGQLWDGSQIAVKRLK WSN AE+EFA EVEILAR RHKNLL+LRGYC+EGQE ++VYD
Sbjct  55    YWGQLWDGSQIAVKRLKVWSNKAEMEFAVEVEILARVRHKNLLSLRGYCAEGQERLIVYD  114

Query  3018  YVPNFSLLSHLHGQYSADTLLDWKKRISIAVGSAEGIAYLHHDATPHIIHGDIKAGNVLL  2839
             Y+PN SLLSHLHGQ+SA++LLDWK+R++IA+GSAEGI YLHH ATPHIIH DIKA NVLL
Sbjct  115   YMPNLSLLSHLHGQHSAESLLDWKRRMNIAIGSAEGIVYLHHHATPHIIHRDIKASNVLL  174

Query  2838  DSNFQAQLAGFGIANFFPDDATRVTTRSKGTLGYLAPEYVMLGKESKSCDVYSFGILLLE  2659
             DS+FQAQ+A FG A F PD AT VTTR KGTLGYLAPEY MLGK S+SCDVYSFGILLLE
Sbjct  175   DSDFQAQVADFGFAKFIPDGATHVTTRVKGTLGYLAPEYAMLGKASESCDVYSFGILLLE  234

Query  2658  LASGKKPIKKVSASKNWTITDWALPLACEGKFSELADPTLNGNYVEEELKRIVYVALICA  2479
             LASGKKPI+K++ +   TITDWALPLACEGKFSELADP LN NYVEEE KR+V +ALICA
Sbjct  235   LASGKKPIEKLNPTVKRTITDWALPLACEGKFSELADPRLNRNYVEEEFKRLVLIALICA  294

Query  2478  QNQPEKRPTMLEVVELLKGESKEKLAALENNEMFKNLKAATHKD  2347
              N+PEKRPTMLEVVELLKGESKEK  ALEN+EMFK +  AT  D
Sbjct  295   HNRPEKRPTMLEVVELLKGESKEKFEALENDEMFK-IPPATDDD  337



>ref|XP_006364223.1| PREDICTED: PTI1-like tyrosine-protein kinase At3g15890-like [Solanum 
tuberosum]
Length=367

 Score =   467 bits (1202),  Expect = 2e-151, Method: Compositional matrix adjust.
 Identities = 219/275 (80%), Positives = 246/275 (89%), Gaps = 0/275 (0%)
 Frame = -2

Query  3198  YWGQLWDGSQIAVKRLKEWSNTAEVEFAAEVEILARARHKNLLALRGYCSEGQEHVLVYD  3019
             YWGQLWDGSQIAVKRLK WSN AE+EFA EVEILAR RHKNLL+LRGYC+EGQE ++VYD
Sbjct  55    YWGQLWDGSQIAVKRLKVWSNKAEMEFAVEVEILARVRHKNLLSLRGYCAEGQERLIVYD  114

Query  3018  YVPNFSLLSHLHGQYSADTLLDWKKRISIAVGSAEGIAYLHHDATPHIIHGDIKAGNVLL  2839
             Y+PN SLLSHLHGQ+SA++LLDWK+R+++A+GSAEGIAYLHH ATPHIIH DIKA NVLL
Sbjct  115   YMPNLSLLSHLHGQHSAESLLDWKRRMNVAIGSAEGIAYLHHHATPHIIHRDIKASNVLL  174

Query  2838  DSNFQAQLAGFGIANFFPDDATRVTTRSKGTLGYLAPEYVMLGKESKSCDVYSFGILLLE  2659
             DS+FQAQ+A FG A F PD AT VTTR KGTLGYLAPEY MLGK S+SCDVYSFGILLLE
Sbjct  175   DSDFQAQVADFGFAKFIPDGATHVTTRVKGTLGYLAPEYAMLGKASESCDVYSFGILLLE  234

Query  2658  LASGKKPIKKVSASKNWTITDWALPLACEGKFSELADPTLNGNYVEEELKRIVYVALICA  2479
             LASGKKPI+KV  +   TITDWALPL CEGK SELADP L+GNYVEEELKR+V VAL+CA
Sbjct  235   LASGKKPIEKVDLTVKRTITDWALPLVCEGKLSELADPRLSGNYVEEELKRLVLVALVCA  294

Query  2478  QNQPEKRPTMLEVVELLKGESKEKLAALENNEMFK  2374
             QN+PEKRPTML+V+ELLKGE+KEK  ALEN+EMFK
Sbjct  295   QNRPEKRPTMLDVIELLKGEAKEKFTALENDEMFK  329



>gb|KDP37071.1| hypothetical protein JCGZ_06127 [Jatropha curcas]
Length=371

 Score =   467 bits (1202),  Expect = 3e-151, Method: Compositional matrix adjust.
 Identities = 222/306 (73%), Positives = 261/306 (85%), Gaps = 1/306 (0%)
 Frame = -2

Query  3198  YWGQLWDGSQIAVKRLKEWSNTAEVEFAAEVEILARARHKNLLALRGYCSEGQEHVLVYD  3019
             YWGQLWDGSQIAVKRLK WSN A++EFA EVEILAR RHKNLL+LRGYC+EGQE ++VYD
Sbjct  55    YWGQLWDGSQIAVKRLKVWSNKADMEFAVEVEILARVRHKNLLSLRGYCAEGQERLIVYD  114

Query  3018  YVPNFSLLSHLHGQYSADTLLDWKKRISIAVGSAEGIAYLHHDATPHIIHGDIKAGNVLL  2839
             Y+PN SLLSHLHG +SA+ LLDWK+R++IA+GSAEGIAYLHH ATPHIIH DIKA NVLL
Sbjct  115   YMPNLSLLSHLHGHHSAECLLDWKRRMNIAIGSAEGIAYLHHHATPHIIHRDIKASNVLL  174

Query  2838  DSNFQAQLAGFGIANFFPDDATRVTTRSKGTLGYLAPEYVMLGKESKSCDVYSFGILLLE  2659
             DS+FQAQ+A FG A   PD AT VTTR KGTLGYLAPEY MLGK S+SCDVYSFGILLLE
Sbjct  175   DSDFQAQVADFGFAKLIPDGATHVTTRVKGTLGYLAPEYAMLGKASESCDVYSFGILLLE  234

Query  2658  LASGKKPIKKVSASKNWTITDWALPLACEGKFSELADPTLNGNYVEEELKRIVYVALICA  2479
             LASG+KP++K++ +   TI DWALP ACEGKF+ELADP LNGN+ EEE+KR+V VAL+CA
Sbjct  235   LASGRKPLEKMNPTVKRTIVDWALPSACEGKFNELADPKLNGNFEEEEMKRVVLVALMCA  294

Query  2478  QNQPEKRPTMLEVVELLKGESKEKLAALENNEMFKNLKAATHKDGCAH-EDSQEFISEKQ  2302
              N+PEKRPTMLEV+ELLKGESKEK A LEN+E+FK+ + A + DG +  ED  +FISE++
Sbjct  295   HNKPEKRPTMLEVLELLKGESKEKFAELENDELFKSPQPADYNDGVSKDEDGSDFISEEK  354

Query  2301  VLEPEI  2284
              L  E+
Sbjct  355   DLRQEV  360



>ref|XP_010033970.1| PREDICTED: PTI1-like tyrosine-protein kinase At3g15890 [Eucalyptus 
grandis]
 gb|KCW53832.1| hypothetical protein EUGRSUZ_J03069 [Eucalyptus grandis]
Length=373

 Score =   466 bits (1199),  Expect = 7e-151, Method: Compositional matrix adjust.
 Identities = 223/306 (73%), Positives = 262/306 (86%), Gaps = 1/306 (0%)
 Frame = -2

Query  3198  YWGQLWDGSQIAVKRLKEWSNTAEVEFAAEVEILARARHKNLLALRGYCSEGQEHVLVYD  3019
             YWGQLWDGSQIAVKRLK WS+ AE+EFA EVEILAR RH NLL+LRGYC+EGQE ++VYD
Sbjct  55    YWGQLWDGSQIAVKRLKVWSDKAEMEFAVEVEILARVRHGNLLSLRGYCAEGQERLIVYD  114

Query  3018  YVPNFSLLSHLHGQYSADTLLDWKKRISIAVGSAEGIAYLHHDATPHIIHGDIKAGNVLL  2839
             Y+PN SLLSHLHGQ+S++ LLDW +R++IA+GSAEGIAYLHH A PHIIH DIKA NVLL
Sbjct  115   YMPNLSLLSHLHGQHSSECLLDWNRRMNIAIGSAEGIAYLHHRAIPHIIHRDIKASNVLL  174

Query  2838  DSNFQAQLAGFGIANFFPDDATRVTTRSKGTLGYLAPEYVMLGKESKSCDVYSFGILLLE  2659
             DS+F+A++A FG A F PD AT VTTR KGTLGYLAPEY MLGK S+SCDVYSFGILLLE
Sbjct  175   DSDFKARVADFGFAKFIPDGATHVTTRVKGTLGYLAPEYAMLGKASESCDVYSFGILLLE  234

Query  2658  LASGKKPIKKVSASKNWTITDWALPLACEGKFSELADPTLNGNYVEEELKRIVYVALICA  2479
             LASGKKP++K++A+   TITDWALPLACE KFS+LADP +NGNYVEEELKR+V VALICA
Sbjct  235   LASGKKPLEKLNATTKRTITDWALPLACEQKFSDLADPRINGNYVEEELKRVVLVALICA  294

Query  2478  QNQPEKRPTMLEVVELLKGESKEKLAALENNEMFKNLKAATHKDGCA-HEDSQEFISEKQ  2302
             Q+QPEKRPTMLEV+ELLKGE+K+K+A LEN+E+F   KA  + DG +  EDS +FISE +
Sbjct  295   QSQPEKRPTMLEVLELLKGEAKDKVAELENHELFNGPKAGEYNDGLSVAEDSSDFISEDK  354

Query  2301  VLEPEI  2284
                 E+
Sbjct  355   DKNKEV  360



>ref|XP_004235951.1| PREDICTED: PTI1-like tyrosine-protein kinase At3g15890 [Solanum 
lycopersicum]
Length=367

 Score =   466 bits (1198),  Expect = 1e-150, Method: Compositional matrix adjust.
 Identities = 217/275 (79%), Positives = 246/275 (89%), Gaps = 0/275 (0%)
 Frame = -2

Query  3198  YWGQLWDGSQIAVKRLKEWSNTAEVEFAAEVEILARARHKNLLALRGYCSEGQEHVLVYD  3019
             YWGQLWDGSQIAVKRLK WSN AE+EFA EVEILAR RHKNLL+LRGYC+EGQE ++VYD
Sbjct  55    YWGQLWDGSQIAVKRLKVWSNKAEMEFAVEVEILARVRHKNLLSLRGYCAEGQERLIVYD  114

Query  3018  YVPNFSLLSHLHGQYSADTLLDWKKRISIAVGSAEGIAYLHHDATPHIIHGDIKAGNVLL  2839
             Y+PN SLLSHLHGQ+SA++LLDWK+R+++A+GSAEGIAYLHH ATPHIIH DIKA NVLL
Sbjct  115   YMPNLSLLSHLHGQHSAESLLDWKRRMNVAIGSAEGIAYLHHHATPHIIHRDIKASNVLL  174

Query  2838  DSNFQAQLAGFGIANFFPDDATRVTTRSKGTLGYLAPEYVMLGKESKSCDVYSFGILLLE  2659
             DS+FQAQ+A FG A F PD AT VTTR KGTLGYLAPEY MLGK S+SCDVYSFGILLLE
Sbjct  175   DSDFQAQVADFGFAKFIPDGATHVTTRVKGTLGYLAPEYAMLGKASESCDVYSFGILLLE  234

Query  2658  LASGKKPIKKVSASKNWTITDWALPLACEGKFSELADPTLNGNYVEEELKRIVYVALICA  2479
             LASGKKPI+KV+ +   TITDWALPL CEGK SELADP L+GNYVEEE KR+V VAL+CA
Sbjct  235   LASGKKPIEKVNLTVKRTITDWALPLVCEGKLSELADPRLSGNYVEEEFKRVVLVALVCA  294

Query  2478  QNQPEKRPTMLEVVELLKGESKEKLAALENNEMFK  2374
             QN+PEKRPTML+V+ELLKGE+KEK  ALEN++MFK
Sbjct  295   QNRPEKRPTMLDVIELLKGEAKEKFTALENDDMFK  329



>ref|XP_011044847.1| PREDICTED: PTI1-like tyrosine-protein kinase At3g15890 [Populus 
euphratica]
Length=371

 Score =   464 bits (1193),  Expect = 6e-150, Method: Compositional matrix adjust.
 Identities = 220/306 (72%), Positives = 261/306 (85%), Gaps = 1/306 (0%)
 Frame = -2

Query  3198  YWGQLWDGSQIAVKRLKEWSNTAEVEFAAEVEILARARHKNLLALRGYCSEGQEHVLVYD  3019
             YWGQLWDGSQIAVKRLK WSN A++EFA EVEILAR RHKNLL+LRGYC+EGQE ++VYD
Sbjct  55    YWGQLWDGSQIAVKRLKVWSNKADMEFAVEVEILARVRHKNLLSLRGYCAEGQERLIVYD  114

Query  3018  YVPNFSLLSHLHGQYSADTLLDWKKRISIAVGSAEGIAYLHHDATPHIIHGDIKAGNVLL  2839
             Y+PN SLLSHLHGQ+S++ LLDWK+R++IA+GSAEGI YLHH ATPHIIH DIKA NVLL
Sbjct  115   YMPNLSLLSHLHGQHSSECLLDWKRRMNIAIGSAEGIVYLHHHATPHIIHRDIKASNVLL  174

Query  2838  DSNFQAQLAGFGIANFFPDDATRVTTRSKGTLGYLAPEYVMLGKESKSCDVYSFGILLLE  2659
             DS+FQAQ+A FG A   P+ AT VTTR KGTLGYLAPEY MLGK S+SCDVYSFGILLLE
Sbjct  175   DSDFQAQVADFGFAKLIPEGATHVTTRVKGTLGYLAPEYAMLGKASESCDVYSFGILLLE  234

Query  2658  LASGKKPIKKVSASKNWTITDWALPLACEGKFSELADPTLNGNYVEEELKRIVYVALICA  2479
             LA+GKKP++K+S++   TIT+WA PLACE KFSELADP LNG Y EEELKR+V V+L+CA
Sbjct  235   LATGKKPLEKLSSTVKRTITEWAQPLACERKFSELADPRLNGKYDEEELKRVVLVSLVCA  294

Query  2478  QNQPEKRPTMLEVVELLKGESKEKLAALENNEMFKNLKAATHKDGCA-HEDSQEFISEKQ  2302
             QNQPE+RPTML+VVELLKGESKE+L+ LE++E+FK  +A  + DG +  EDS +FISE +
Sbjct  295   QNQPERRPTMLDVVELLKGESKERLSELEDDELFKAPQAVDYNDGISVAEDSSDFISEDK  354

Query  2301  VLEPEI  2284
                 E+
Sbjct  355   DANREV  360



>ref|XP_003545853.1| PREDICTED: PTI1-like tyrosine-protein kinase At3g15890-like [Glycine 
max]
 gb|KHN22437.1| PTI1-like tyrosine-protein kinase [Glycine soja]
Length=367

 Score =   463 bits (1191),  Expect = 1e-149, Method: Compositional matrix adjust.
 Identities = 222/307 (72%), Positives = 258/307 (84%), Gaps = 2/307 (1%)
 Frame = -2

Query  3198  YWGQLWDGSQIAVKRLKEWSNTAEVEFAAEVEILARARHKNLLALRGYCSEGQEHVLVYD  3019
             YWGQLWDGSQIAVKRLK WSN A++EFA EVEILAR RHKNLL+LRGYC+EGQE ++VYD
Sbjct  55    YWGQLWDGSQIAVKRLKVWSNKADMEFAVEVEILARVRHKNLLSLRGYCAEGQERLIVYD  114

Query  3018  YVPNFSLLSHLHGQYSADTLLDWKKRISIAVGSAEGIAYLHHDATPHIIHGDIKAGNVLL  2839
             Y+PN SLLSHLHGQ+SA++LLDW +R++IA+GSAEGI YLH+ + PHIIH DIKA NVLL
Sbjct  115   YMPNLSLLSHLHGQHSAESLLDWNRRMNIAIGSAEGIGYLHNQSMPHIIHRDIKASNVLL  174

Query  2838  DSNFQAQLAGFGIANFFPDDATRVTTRSKGTLGYLAPEYVMLGKESKSCDVYSFGILLLE  2659
             DS+FQAQ+A FG A   PD AT VTTR KGTLGYLAPEY MLGK ++SCDVYSFGILLLE
Sbjct  175   DSDFQAQVADFGFAKLIPDGATHVTTRVKGTLGYLAPEYAMLGKANESCDVYSFGILLLE  234

Query  2658  LASGKKPIKKVSASKNWTITDWALPLACEGKFSELADPTLNGNYVEEELKRIVYVALICA  2479
             LASGKKP++K+S++   +I DWALPLACE KFSELADP L GNY EEELKR+V  AL+C 
Sbjct  235   LASGKKPLEKLSSAVKRSINDWALPLACEKKFSELADPKLEGNYAEEELKRVVLTALLCV  294

Query  2478  QNQPEKRPTMLEVVELLKGESKEKLAALENNEMFKNLKAATHKDG--CAHEDSQEFISEK  2305
             Q+QPEKRPT+LEVVELLKGESK+KLA LENNE+FKN  A  H D    A E S +FISE 
Sbjct  295   QSQPEKRPTILEVVELLKGESKDKLAQLENNELFKNPPAVGHTDDGTVAAEGSSDFISED  354

Query  2304  QVLEPEI  2284
             +  +PE+
Sbjct  355   KESKPEL  361



>ref|XP_010097212.1| PTI1-like tyrosine-protein kinase [Morus notabilis]
 gb|EXB67279.1| PTI1-like tyrosine-protein kinase [Morus notabilis]
Length=369

 Score =   463 bits (1191),  Expect = 1e-149, Method: Compositional matrix adjust.
 Identities = 219/305 (72%), Positives = 259/305 (85%), Gaps = 0/305 (0%)
 Frame = -2

Query  3198  YWGQLWDGSQIAVKRLKEWSNTAEVEFAAEVEILARARHKNLLALRGYCSEGQEHVLVYD  3019
             YWGQLWDGSQIA KRLK WSN A++EF+ EVEILAR RHKNLL+LRGYC+EGQE ++VYD
Sbjct  53    YWGQLWDGSQIAAKRLKVWSNKADMEFSVEVEILARVRHKNLLSLRGYCAEGQERLIVYD  112

Query  3018  YVPNFSLLSHLHGQYSADTLLDWKKRISIAVGSAEGIAYLHHDATPHIIHGDIKAGNVLL  2839
             Y+PN SLLSHLHGQ+SA+  LDW +R++I +GSAEGIAYLHH +TPHIIH DIKA NVLL
Sbjct  113   YMPNLSLLSHLHGQHSAECQLDWNRRMNIVIGSAEGIAYLHHHSTPHIIHRDIKASNVLL  172

Query  2838  DSNFQAQLAGFGIANFFPDDATRVTTRSKGTLGYLAPEYVMLGKESKSCDVYSFGILLLE  2659
             DSNF AQ+A FG A   PD AT VTTR KGTLGYLAPEY MLGK S+SCDVYSFGILLLE
Sbjct  173   DSNFVAQVADFGFAKLIPDGATHVTTRVKGTLGYLAPEYAMLGKASESCDVYSFGILLLE  232

Query  2658  LASGKKPIKKVSASKNWTITDWALPLACEGKFSELADPTLNGNYVEEELKRIVYVALICA  2479
             LASG+KPI+K+SA+   TI+DWALPLACE KF ELADP LNG+YVE+ELKR++ V L+CA
Sbjct  233   LASGRKPIEKLSATLKRTISDWALPLACEKKFEELADPKLNGSYVEDELKRVILVGLLCA  292

Query  2478  QNQPEKRPTMLEVVELLKGESKEKLAALENNEMFKNLKAATHKDGCAHEDSQEFISEKQV  2299
              ++PEKRPTMLEVVELLKGESKEKLA LE++E+FKN + A HK+G A E+  + ISE++ 
Sbjct  293   HSRPEKRPTMLEVVELLKGESKEKLAKLEDDELFKNPQPADHKNGAAMEEISDSISEEKS  352

Query  2298  LEPEI  2284
              + E+
Sbjct  353   SKEEL  357



>ref|XP_007023226.1| Brassinosteroid insensitive 1-associated receptor kinase 1 isoform 
2, partial [Theobroma cacao]
 gb|EOY25848.1| Brassinosteroid insensitive 1-associated receptor kinase 1 isoform 
2, partial [Theobroma cacao]
Length=347

 Score =   460 bits (1184),  Expect = 5e-149, Method: Compositional matrix adjust.
 Identities = 221/305 (72%), Positives = 258/305 (85%), Gaps = 2/305 (1%)
 Frame = -2

Query  3198  YWGQLWDGSQIAVKRLKEWSNTAEVEFAAEVEILARARHKNLLALRGYCSEGQEHVLVYD  3019
             YWGQLWDGSQIAVKRLK WSN AEVEF+ EVEILAR RHKNLL+LRGYC+EGQE ++VYD
Sbjct  31    YWGQLWDGSQIAVKRLKVWSNKAEVEFSVEVEILARVRHKNLLSLRGYCAEGQERLIVYD  90

Query  3018  YVPNFSLLSHLHGQYSADTLLDWKKRISIAVGSAEGIAYLHHDATPHIIHGDIKAGNVLL  2839
             Y+PN SLLSHLHGQ+S D  L+W +R++IA+GSAEGIAYLHH +TPHIIH DIKA NVLL
Sbjct  91    YMPNLSLLSHLHGQHSTDCQLEWTRRMNIAIGSAEGIAYLHHHSTPHIIHRDIKASNVLL  150

Query  2838  DSNFQAQLAGFGIANFFPDDATRVTTRSKGTLGYLAPEYVMLGKESKSCDVYSFGILLLE  2659
             DS+FQ Q+A FG A F PD AT VTTR KGTLGYLAPEY MLGK S+SCDVYSFGILLLE
Sbjct  151   DSDFQPQVADFGFAKFIPDGATHVTTRVKGTLGYLAPEYAMLGKASESCDVYSFGILLLE  210

Query  2658  LASGKKPIKKVSASKNWTITDWALPLACEGKFSELADPTLNGNYVEEELKRIVYVALICA  2479
             LASG+KP++K+SA+   +I +WALPLACEGKFSE+ADP LNG YVEEELKR+V +AL+CA
Sbjct  211   LASGRKPLEKLSATSKRSIAEWALPLACEGKFSEVADPRLNGKYVEEELKRLVLIALVCA  270

Query  2478  QNQPEKRPTMLEVVELLKGESKEKLAALENNEMFKNLKAAT-HKDGC-AHEDSQEFISEK  2305
              N+PEKRPTMLEV+ELL GESKEKL  LENNE+FKN ++A  + DG  A E+S + I E+
Sbjct  271   DNRPEKRPTMLEVLELLDGESKEKLVELENNEVFKNPQSAVCYDDGTPAAEESSDIIKEE  330

Query  2304  QVLEP  2290
                +P
Sbjct  331   NDPKP  335



>ref|XP_002517653.1| ATP binding protein, putative [Ricinus communis]
 gb|EEF44817.1| ATP binding protein, putative [Ricinus communis]
Length=365

 Score =   461 bits (1186),  Expect = 5e-149, Method: Compositional matrix adjust.
 Identities = 220/300 (73%), Positives = 257/300 (86%), Gaps = 1/300 (0%)
 Frame = -2

Query  3198  YWGQLWDGSQIAVKRLKEWSNTAEVEFAAEVEILARARHKNLLALRGYCSEGQEHVLVYD  3019
             YWGQLWDGSQIAVKRLK WSN A++EFA EVEILAR RHKNLL+LRGYC+EGQE ++VYD
Sbjct  55    YWGQLWDGSQIAVKRLKVWSNKADMEFAVEVEILARVRHKNLLSLRGYCAEGQERLIVYD  114

Query  3018  YVPNFSLLSHLHGQYSADTLLDWKKRISIAVGSAEGIAYLHHDATPHIIHGDIKAGNVLL  2839
             Y+PN SLLSHLHGQ+SA+ LLDWK+R++IA+GSAEGI YLHH ATPHIIH DIKA NVLL
Sbjct  115   YMPNLSLLSHLHGQHSAECLLDWKRRMNIAIGSAEGIVYLHHHATPHIIHRDIKASNVLL  174

Query  2838  DSNFQAQLAGFGIANFFPDDATRVTTRSKGTLGYLAPEYVMLGKESKSCDVYSFGILLLE  2659
             DS+FQAQ+A FG A   PD AT VTTR KGTLGYLAPEY MLGK S+SCDVYSFGILLLE
Sbjct  175   DSDFQAQVADFGFAKLIPDGATHVTTRVKGTLGYLAPEYAMLGKASESCDVYSFGILLLE  234

Query  2658  LASGKKPIKKVSASKNWTITDWALPLACEGKFSELADPTLNGNYVEEELKRIVYVALICA  2479
             LASGKKP++K++A+   TI DWALPLACE KFSELADP LNG + E+ELKR+V VAL+CA
Sbjct  235   LASGKKPLEKLNATMKRTIIDWALPLACERKFSELADPKLNGKFEEQELKRVVLVALMCA  294

Query  2478  QNQPEKRPTMLEVVELLKGESKEKLAALENNEMFKNLKAATHKDGCA-HEDSQEFISEKQ  2302
              +QPEKRPTML+VVELLKGESK+K + LE++E+FK    A + DG +  EDS +FISE++
Sbjct  295   HSQPEKRPTMLDVVELLKGESKDKFSELESDELFKAPLPAGYNDGASVAEDSSDFISEEK  354



>ref|XP_003543684.1| PREDICTED: PTI1-like tyrosine-protein kinase At3g15890-like [Glycine 
max]
 gb|KHN44185.1| PTI1-like tyrosine-protein kinase [Glycine soja]
Length=367

 Score =   461 bits (1186),  Expect = 6e-149, Method: Compositional matrix adjust.
 Identities = 220/301 (73%), Positives = 258/301 (86%), Gaps = 2/301 (1%)
 Frame = -2

Query  3198  YWGQLWDGSQIAVKRLKEWSNTAEVEFAAEVEILARARHKNLLALRGYCSEGQEHVLVYD  3019
             YWGQLWDGSQIAVKRLK WSN A++EFA EVE+LAR RHKNLL+LRGYC+EGQE ++VYD
Sbjct  55    YWGQLWDGSQIAVKRLKVWSNKADMEFAVEVEMLARVRHKNLLSLRGYCAEGQERLIVYD  114

Query  3018  YVPNFSLLSHLHGQYSADTLLDWKKRISIAVGSAEGIAYLHHDATPHIIHGDIKAGNVLL  2839
             Y+PN SLLSHLHGQ+SA++LLDW +R++IA+GSAEGIAYLHH +TPHIIH DIKA NVLL
Sbjct  115   YMPNLSLLSHLHGQHSAESLLDWNRRMNIAIGSAEGIAYLHHQSTPHIIHRDIKASNVLL  174

Query  2838  DSNFQAQLAGFGIANFFPDDATRVTTRSKGTLGYLAPEYVMLGKESKSCDVYSFGILLLE  2659
             DS+FQA++A FG A   PD AT VTTR KGTLGYLAPEY MLGK ++SCDVYSFGILLLE
Sbjct  175   DSDFQARVADFGFAKLIPDGATHVTTRVKGTLGYLAPEYAMLGKANESCDVYSFGILLLE  234

Query  2658  LASGKKPIKKVSASKNWTITDWALPLACEGKFSELADPTLNGNYVEEELKRIVYVALICA  2479
             LASGKKP++K+S++   +I DWALPLACE KFSELADP L GNY EEELKR+V +AL+CA
Sbjct  235   LASGKKPLEKLSSAVKRSINDWALPLACEKKFSELADPKLEGNYAEEELKRVVLIALLCA  294

Query  2478  QNQPEKRPTMLEVVELLKGESKEKLAALENNEMFKNLKAATHKDG--CAHEDSQEFISEK  2305
             Q+Q EKRPT+LEVVELLKGESK+KLA LENNE+F+N  A  H D    A E S +FISE+
Sbjct  295   QSQAEKRPTILEVVELLKGESKDKLAQLENNELFQNPPAVGHTDDGTVAAEGSSDFISEE  354

Query  2304  Q  2302
             +
Sbjct  355   K  355



>ref|XP_011009892.1| PREDICTED: PTI1-like tyrosine-protein kinase At3g15890 [Populus 
euphratica]
Length=372

 Score =   461 bits (1186),  Expect = 7e-149, Method: Compositional matrix adjust.
 Identities = 221/307 (72%), Positives = 256/307 (83%), Gaps = 2/307 (1%)
 Frame = -2

Query  3198  YWGQLWDGSQIAVKRLKEWSNTAEVEFAAEVEILARARHKNLLALRGYCSEGQEHVLVYD  3019
             YWGQLWDGSQIAVKRLK WSN  ++EFA EVEILAR RHKNLL+LRGYC+EGQE ++VYD
Sbjct  55    YWGQLWDGSQIAVKRLKVWSNKGDMEFAVEVEILARVRHKNLLSLRGYCAEGQERLIVYD  114

Query  3018  YVPNFSLLSHLHGQYSADTLLDWKKRISIAVGSAEGIAYLHHDATPHIIHGDIKAGNVLL  2839
             Y+PN SLLSHLHG +SA+ LLDWK+R++IA+GSA GI YLHH ATPHIIH DIKA NVLL
Sbjct  115   YMPNLSLLSHLHGHHSAECLLDWKRRMNIAIGSAAGITYLHHHATPHIIHRDIKASNVLL  174

Query  2838  DSNFQAQLAGFGIANFFPDDATRVTTRSKGTLGYLAPEYVMLGKESKSCDVYSFGILLLE  2659
             DS+FQAQ+A FG A   PD AT VTTR KGTLGYLAPEY MLGK S+SCDVYSFGILLLE
Sbjct  175   DSDFQAQVADFGFAKLIPDGATHVTTRVKGTLGYLAPEYAMLGKASESCDVYSFGILLLE  234

Query  2658  LASGKKPIKKVSASKNWTITDWALPLACEGKFSELADPTLNGNYVEEELKRIVYVALICA  2479
             LA+GK+P++K+S +   TITDWALPLACE KFSELADP LNG Y EEELKR+V V+L+CA
Sbjct  235   LATGKRPLEKMSPTVKRTITDWALPLACERKFSELADPKLNGKYDEEELKRVVLVSLVCA  294

Query  2478  QNQPEKRPTMLEVVELLKGESKEKLAALENNEMFKNLKAATHKD--GCAHEDSQEFISEK  2305
               QPE+RPTML+VVELLKGESKEKL+ LEN+EMFK  +AA   D      E+S EFISE+
Sbjct  295   HTQPERRPTMLDVVELLKGESKEKLSKLENDEMFKAPQAADFDDEERSIAENSSEFISEE  354

Query  2304  QVLEPEI  2284
             + +  E+
Sbjct  355   KDVNREV  361



>ref|XP_007150759.1| hypothetical protein PHAVU_005G178500g [Phaseolus vulgaris]
 gb|ESW22753.1| hypothetical protein PHAVU_005G178500g [Phaseolus vulgaris]
Length=366

 Score =   461 bits (1185),  Expect = 9e-149, Method: Compositional matrix adjust.
 Identities = 223/306 (73%), Positives = 261/306 (85%), Gaps = 1/306 (0%)
 Frame = -2

Query  3198  YWGQLWDGSQIAVKRLKEWSNTAEVEFAAEVEILARARHKNLLALRGYCSEGQEHVLVYD  3019
             YWGQLWDGSQIAVKRLK WSN A++EFA EVEILAR RHKNLL+LRGYC+EGQE ++VY+
Sbjct  55    YWGQLWDGSQIAVKRLKVWSNKADMEFAVEVEILARVRHKNLLSLRGYCAEGQERLIVYN  114

Query  3018  YVPNFSLLSHLHGQYSADTLLDWKKRISIAVGSAEGIAYLHHDATPHIIHGDIKAGNVLL  2839
             Y+PN SLLSHLHGQ+SA++LLDW +R+ IA+GSAEGIAYLH  ATPHIIH DIKA NVLL
Sbjct  115   YMPNLSLLSHLHGQHSAESLLDWNRRMIIAIGSAEGIAYLHLQATPHIIHRDIKASNVLL  174

Query  2838  DSNFQAQLAGFGIANFFPDDATRVTTRSKGTLGYLAPEYVMLGKESKSCDVYSFGILLLE  2659
             DS+FQA++A FG A   PD AT VTTR KGTLGYLAPEY MLGK ++SCDVYSFGILLLE
Sbjct  175   DSDFQARVADFGFAKLIPDGATHVTTRVKGTLGYLAPEYAMLGKANESCDVYSFGILLLE  234

Query  2658  LASGKKPIKKVSASKNWTITDWALPLACEGKFSELADPTLNGNYVEEELKRIVYVALICA  2479
             LASGKKP++K+S++   +I DWALPLACE KFSELADP L GNYVEEELKR+V +AL+CA
Sbjct  235   LASGKKPLEKLSSTVKRSINDWALPLACEKKFSELADPKLEGNYVEEELKRVVLIALLCA  294

Query  2478  QNQPEKRPTMLEVVELLKGESKEKLAALENNEMFKNLKAA-THKDGCAHEDSQEFISEKQ  2302
             Q+Q EKRPT+LEVVELLKGESK+KL  LENNE+FKN  AA T  +  A E S +FISE++
Sbjct  295   QSQAEKRPTILEVVELLKGESKDKLVQLENNEIFKNPPAAHTDDENFAAEGSSDFISEEK  354

Query  2301  VLEPEI  2284
               +PE+
Sbjct  355   ESKPEV  360



>ref|XP_004486660.1| PREDICTED: PTI1-like tyrosine-protein kinase At3g15890-like [Cicer 
arietinum]
Length=367

 Score =   460 bits (1184),  Expect = 1e-148, Method: Compositional matrix adjust.
 Identities = 222/301 (74%), Positives = 260/301 (86%), Gaps = 2/301 (1%)
 Frame = -2

Query  3198  YWGQLWDGSQIAVKRLKEWSNTAEVEFAAEVEILARARHKNLLALRGYCSEGQEHVLVYD  3019
             YWGQLWDGSQIAVKRLK WSN A++EFA EVEILAR RHKNLL+LRGYC+EGQE ++VYD
Sbjct  55    YWGQLWDGSQIAVKRLKVWSNKADMEFAVEVEILARVRHKNLLSLRGYCAEGQERLIVYD  114

Query  3018  YVPNFSLLSHLHGQYSADTLLDWKKRISIAVGSAEGIAYLHHDATPHIIHGDIKAGNVLL  2839
             Y+PN SLLSHLHGQ+SA++LLDW +RI+IA+GSAEGI YLH+ ATPHIIH D+KA NVLL
Sbjct  115   YMPNLSLLSHLHGQHSAESLLDWNRRINIAIGSAEGIVYLHNQATPHIIHRDVKASNVLL  174

Query  2838  DSNFQAQLAGFGIANFFPDDATRVTTRSKGTLGYLAPEYVMLGKESKSCDVYSFGILLLE  2659
             DS FQA++A FG A   PD AT VTTR KGTLGYLAPEY MLGK ++SCDVYSFGILLLE
Sbjct  175   DSEFQARVADFGFAKLIPDGATHVTTRVKGTLGYLAPEYAMLGKANESCDVYSFGILLLE  234

Query  2658  LASGKKPIKKVSASKNWTITDWALPLACEGKFSELADPTLNGNYVEEELKRIVYVALICA  2479
             LASGKKP++K+S+S   +I DWALPLACE KFSE+ADP LNG+YVEEELKR+V VALICA
Sbjct  235   LASGKKPLEKLSSSVKRSINDWALPLACEQKFSEIADPRLNGDYVEEELKRVVLVALICA  294

Query  2478  QNQPEKRPTMLEVVELLKGESKEKLAALENNEMFKNLKAATHK-DG-CAHEDSQEFISEK  2305
             Q+QPEKRP M+EVVELLKGESK+K++ LENNE+FK+  A  +K DG  A E S +FISE+
Sbjct  295   QSQPEKRPNMVEVVELLKGESKDKVSQLENNELFKSPLAVGNKNDGISAAEGSSDFISEE  354

Query  2304  Q  2302
             +
Sbjct  355   K  355



>ref|XP_006427299.1| hypothetical protein CICLE_v10025774mg [Citrus clementina]
 gb|ESR40539.1| hypothetical protein CICLE_v10025774mg [Citrus clementina]
Length=400

 Score =   461 bits (1187),  Expect = 1e-148, Method: Compositional matrix adjust.
 Identities = 221/298 (74%), Positives = 256/298 (86%), Gaps = 1/298 (0%)
 Frame = -2

Query  3198  YWGQLWDGSQIAVKRLKEWSNTAEVEFAAEVEILARARHKNLLALRGYCSEGQEHVLVYD  3019
             YWGQLWDGSQIAVKRLK WSN AE+EFA EVEILAR RHKNLL+LRGYC+EGQE ++VYD
Sbjct  55    YWGQLWDGSQIAVKRLKVWSNKAEMEFAVEVEILARVRHKNLLSLRGYCAEGQERLIVYD  114

Query  3018  YVPNFSLLSHLHGQYSADTLLDWKKRISIAVGSAEGIAYLHHDATPHIIHGDIKAGNVLL  2839
             Y+PN SLLSHLHGQ+S++ LL+W +R+ IA+GSAEGI YLHH ATPHIIH DIKA NVLL
Sbjct  115   YMPNLSLLSHLHGQHSSECLLNWNRRMDIAIGSAEGIVYLHHHATPHIIHRDIKASNVLL  174

Query  2838  DSNFQAQLAGFGIANFFPDDATRVTTRSKGTLGYLAPEYVMLGKESKSCDVYSFGILLLE  2659
             D++F+AQ+A FG A   PD AT VTTR KGTLGYLAPEY MLGK S+SCDVYSFGILLLE
Sbjct  175   DADFKAQVADFGFAKLIPDGATHVTTRVKGTLGYLAPEYAMLGKASESCDVYSFGILLLE  234

Query  2658  LASGKKPIKKVSASKNWTITDWALPLACEGKFSELADPTLNGNYVEEELKRIVYVALICA  2479
             LASGKKPI+KV+++   TITDWALPLACE KFSELADP LNGN+VEEELKR+V VAL CA
Sbjct  235   LASGKKPIEKVNSAIKRTITDWALPLACERKFSELADPRLNGNFVEEELKRVVLVALTCA  294

Query  2478  QNQPEKRPTMLEVVELLKGESKEKLAALENNEMFKNLKAATHKDGCA-HEDSQEFISE  2308
              ++PEKRPTMLEV++LLKGESKEKL  LEN+E+FK+ + A + DG A  EDS E ++E
Sbjct  295   HSKPEKRPTMLEVLDLLKGESKEKLTELENDELFKSHQVADYNDGKAVAEDSTEKLAE  352



>ref|XP_006465319.1| PREDICTED: PTI1-like tyrosine-protein kinase At3g15890-like [Citrus 
sinensis]
 gb|KDO48607.1| hypothetical protein CISIN_1g015797mg [Citrus sinensis]
Length=400

 Score =   461 bits (1187),  Expect = 1e-148, Method: Compositional matrix adjust.
 Identities = 221/298 (74%), Positives = 256/298 (86%), Gaps = 1/298 (0%)
 Frame = -2

Query  3198  YWGQLWDGSQIAVKRLKEWSNTAEVEFAAEVEILARARHKNLLALRGYCSEGQEHVLVYD  3019
             YWGQLWDGSQIAVKRLK WSN AE+EFA EVEILAR RHKNLL+LRGYC+EGQE ++VYD
Sbjct  55    YWGQLWDGSQIAVKRLKVWSNKAEMEFAVEVEILARVRHKNLLSLRGYCAEGQERLIVYD  114

Query  3018  YVPNFSLLSHLHGQYSADTLLDWKKRISIAVGSAEGIAYLHHDATPHIIHGDIKAGNVLL  2839
             Y+PN SLLSHLHGQ+S++ LL+W +R+ IA+GSAEGI YLHH ATPHIIH DIKA NVLL
Sbjct  115   YMPNLSLLSHLHGQHSSECLLNWNRRMDIAIGSAEGIVYLHHHATPHIIHRDIKASNVLL  174

Query  2838  DSNFQAQLAGFGIANFFPDDATRVTTRSKGTLGYLAPEYVMLGKESKSCDVYSFGILLLE  2659
             D++F+AQ+A FG A   PD AT VTTR KGTLGYLAPEY MLGK S+SCDVYSFGILLLE
Sbjct  175   DADFKAQVADFGFAKLIPDGATHVTTRVKGTLGYLAPEYAMLGKASESCDVYSFGILLLE  234

Query  2658  LASGKKPIKKVSASKNWTITDWALPLACEGKFSELADPTLNGNYVEEELKRIVYVALICA  2479
             LASGKKPI+KV+++   TITDWALPLACE KFSELADP LNGN+VEEELKR+V VAL CA
Sbjct  235   LASGKKPIEKVNSAIKRTITDWALPLACERKFSELADPRLNGNFVEEELKRVVLVALTCA  294

Query  2478  QNQPEKRPTMLEVVELLKGESKEKLAALENNEMFKNLKAATHKDGCA-HEDSQEFISE  2308
              ++PEKRPTMLEV++LLKGESKEKL  LEN+E+FK+ + A + DG A  EDS E ++E
Sbjct  295   HSKPEKRPTMLEVLDLLKGESKEKLTELENDELFKSHQVADYNDGKAVAEDSAEKLAE  352



>ref|XP_003597913.1| Somatic embryogenesis receptor kinase [Medicago truncatula]
 gb|AES68164.1| Pti1-like kinase [Medicago truncatula]
Length=367

 Score =   460 bits (1183),  Expect = 2e-148, Method: Compositional matrix adjust.
 Identities = 221/298 (74%), Positives = 254/298 (85%), Gaps = 2/298 (1%)
 Frame = -2

Query  3198  YWGQLWDGSQIAVKRLKEWSNTAEVEFAAEVEILARARHKNLLALRGYCSEGQEHVLVYD  3019
             YWGQLWDGSQIAVKRLK WSN A++EFA EVEILAR RHKNLL+LRGYC+EGQE ++VYD
Sbjct  55    YWGQLWDGSQIAVKRLKVWSNKADMEFAVEVEILARVRHKNLLSLRGYCAEGQERLIVYD  114

Query  3018  YVPNFSLLSHLHGQYSADTLLDWKKRISIAVGSAEGIAYLHHDATPHIIHGDIKAGNVLL  2839
             Y+PN SLLSHLHGQ+S ++LLDW +R++IA+GSAEGI YLH  ATPHIIH D+KA NVLL
Sbjct  115   YMPNLSLLSHLHGQHSTESLLDWNRRMNIAIGSAEGIVYLHVQATPHIIHRDVKASNVLL  174

Query  2838  DSNFQAQLAGFGIANFFPDDATRVTTRSKGTLGYLAPEYVMLGKESKSCDVYSFGILLLE  2659
             DS+FQA++A FG A   PD AT VTTR KGTLGYLAPEY MLGK ++SCDVYSFGILLLE
Sbjct  175   DSDFQARVADFGFAKLIPDGATHVTTRVKGTLGYLAPEYAMLGKANESCDVYSFGILLLE  234

Query  2658  LASGKKPIKKVSASKNWTITDWALPLACEGKFSELADPTLNGNYVEEELKRIVYVALICA  2479
             LASGKKP++K+S+S    I DWALPLACE KFSELADP LNG+YVEEELKR++ VALICA
Sbjct  235   LASGKKPLEKLSSSVKRAINDWALPLACEKKFSELADPRLNGDYVEEELKRVILVALICA  294

Query  2478  QNQPEKRPTMLEVVELLKGESKEKLAALENNEMFKNLKAA--THKDGCAHEDSQEFIS  2311
             QNQPEKRPTM+EVVELLKGESKEK+  LENNE+FKN  A   T+ +  A E S +FIS
Sbjct  295   QNQPEKRPTMVEVVELLKGESKEKVLQLENNELFKNPLAVGNTNDEISAAEGSSDFIS  352



>ref|XP_007023225.1| Brassinosteroid insensitive 1-associated receptor kinase 1 isoform 
1 [Theobroma cacao]
 gb|EOY25847.1| Brassinosteroid insensitive 1-associated receptor kinase 1 isoform 
1 [Theobroma cacao]
Length=371

 Score =   460 bits (1183),  Expect = 2e-148, Method: Compositional matrix adjust.
 Identities = 221/305 (72%), Positives = 258/305 (85%), Gaps = 2/305 (1%)
 Frame = -2

Query  3198  YWGQLWDGSQIAVKRLKEWSNTAEVEFAAEVEILARARHKNLLALRGYCSEGQEHVLVYD  3019
             YWGQLWDGSQIAVKRLK WSN AEVEF+ EVEILAR RHKNLL+LRGYC+EGQE ++VYD
Sbjct  55    YWGQLWDGSQIAVKRLKVWSNKAEVEFSVEVEILARVRHKNLLSLRGYCAEGQERLIVYD  114

Query  3018  YVPNFSLLSHLHGQYSADTLLDWKKRISIAVGSAEGIAYLHHDATPHIIHGDIKAGNVLL  2839
             Y+PN SLLSHLHGQ+S D  L+W +R++IA+GSAEGIAYLHH +TPHIIH DIKA NVLL
Sbjct  115   YMPNLSLLSHLHGQHSTDCQLEWTRRMNIAIGSAEGIAYLHHHSTPHIIHRDIKASNVLL  174

Query  2838  DSNFQAQLAGFGIANFFPDDATRVTTRSKGTLGYLAPEYVMLGKESKSCDVYSFGILLLE  2659
             DS+FQ Q+A FG A F PD AT VTTR KGTLGYLAPEY MLGK S+SCDVYSFGILLLE
Sbjct  175   DSDFQPQVADFGFAKFIPDGATHVTTRVKGTLGYLAPEYAMLGKASESCDVYSFGILLLE  234

Query  2658  LASGKKPIKKVSASKNWTITDWALPLACEGKFSELADPTLNGNYVEEELKRIVYVALICA  2479
             LASG+KP++K+SA+   +I +WALPLACEGKFSE+ADP LNG YVEEELKR+V +AL+CA
Sbjct  235   LASGRKPLEKLSATSKRSIAEWALPLACEGKFSEVADPRLNGKYVEEELKRLVLIALVCA  294

Query  2478  QNQPEKRPTMLEVVELLKGESKEKLAALENNEMFKNLKAAT-HKDGC-AHEDSQEFISEK  2305
              N+PEKRPTMLEV+ELL GESKEKL  LENNE+FKN ++A  + DG  A E+S + I E+
Sbjct  295   DNRPEKRPTMLEVLELLDGESKEKLVELENNEVFKNPQSAVCYDDGTPAAEESSDIIKEE  354

Query  2304  QVLEP  2290
                +P
Sbjct  355   NDPKP  359



>ref|XP_011013943.1| PREDICTED: PTI1-like tyrosine-protein kinase At3g15890 [Populus 
euphratica]
Length=372

 Score =   459 bits (1182),  Expect = 3e-148, Method: Compositional matrix adjust.
 Identities = 220/307 (72%), Positives = 256/307 (83%), Gaps = 2/307 (1%)
 Frame = -2

Query  3198  YWGQLWDGSQIAVKRLKEWSNTAEVEFAAEVEILARARHKNLLALRGYCSEGQEHVLVYD  3019
             YWGQLWDGSQIAVKRLK WSN  ++EFA EVEILAR RHKNLL+LRGYC+EGQE ++VYD
Sbjct  55    YWGQLWDGSQIAVKRLKVWSNKGDMEFAVEVEILARVRHKNLLSLRGYCAEGQERLIVYD  114

Query  3018  YVPNFSLLSHLHGQYSADTLLDWKKRISIAVGSAEGIAYLHHDATPHIIHGDIKAGNVLL  2839
             Y+PN SLLSHLHG +SA+ LLDWK+R++IA+GSA GI YLHH ATPHIIH DIKA NVLL
Sbjct  115   YMPNLSLLSHLHGHHSAECLLDWKRRMNIAIGSAAGITYLHHHATPHIIHRDIKASNVLL  174

Query  2838  DSNFQAQLAGFGIANFFPDDATRVTTRSKGTLGYLAPEYVMLGKESKSCDVYSFGILLLE  2659
             DS+FQAQ+A FG A   PD AT VTTR KGTLGYLAPEY MLGK S+SCDVYSFGILLLE
Sbjct  175   DSDFQAQVADFGFAKLIPDGATHVTTRVKGTLGYLAPEYAMLGKASESCDVYSFGILLLE  234

Query  2658  LASGKKPIKKVSASKNWTITDWALPLACEGKFSELADPTLNGNYVEEELKRIVYVALICA  2479
             LA+GK+P++K+S +   TITDWALPLACE KFSELADP LNG Y EEELKR+V V+L+CA
Sbjct  235   LATGKRPLEKMSPTVKRTITDWALPLACERKFSELADPKLNGKYDEEELKRVVLVSLVCA  294

Query  2478  QNQPEKRPTMLEVVELLKGESKEKLAALENNEMFKNLKAATHKD--GCAHEDSQEFISEK  2305
               QPE+RPTML+VVELLKGESKEKL+ LEN+EMFK  +AA   D      E+S +FISE+
Sbjct  295   HTQPERRPTMLDVVELLKGESKEKLSKLENDEMFKAPQAADFDDEERSIAENSSDFISEE  354

Query  2304  QVLEPEI  2284
             + +  E+
Sbjct  355   KDVNREV  361



>ref|XP_008802099.1| PREDICTED: protein TOO MANY MOUTHS [Phoenix dactylifera]
Length=497

 Score =   463 bits (1192),  Expect = 5e-148, Method: Compositional matrix adjust.
 Identities = 255/422 (60%), Positives = 314/422 (74%), Gaps = 11/422 (3%)
 Frame = +3

Query  351   FTVIVSDSGAPSGLVDAPQTAYSLNNDHARTDAREQEAVYEVMRATGNDWATEIPDVCRG  530
             FTV++ DS   S LVDAPQ  +S   + ARTD  EQ AVYE+M ATGN WAT IPDVCRG
Sbjct  27    FTVVLPDS---SALVDAPQNGFS---NLARTDPAEQRAVYEIMAATGNAWATAIPDVCRG  80

Query  531   RWHGIECMPDKANVYHVVSLSFGALSDDTAFPTCDTAPRPFISPAVTKLLHLRTLFFYRC  710
             RWHGIECMPD+ +VYHVVSLSFGALSDDTAFPTCD A    +SPA+  L +LR+LF YRC
Sbjct  81    RWHGIECMPDRNDVYHVVSLSFGALSDDTAFPTCDPA-HATLSPALLHLPYLRSLFLYRC  139

Query  711   FT-DNPQPIPTFlgqlgqtlqtlVLRENGHVGSIPNQLGNLTRLRVLDFHGNNLNGSIPV  887
             F+ D+PQPIPTFLG L   L++LVLR NGHVG IP +LGNLT LRVLD HGN L+ SIP 
Sbjct  140   FSGDHPQPIPTFLGGLSPALRSLVLRGNGHVGPIPAELGNLTSLRVLDLHGNQLSSSIPE  199

Query  888   SLSRIDGLRSLDLSRNKLAASIPNLTFPLLQILDLNQNHLVGSIPTALINCHSLMKMDLS  1067
             SL R+  L  LD S N+L+  IP+L  P L +LDL+ N L G IP     C SL+K+DLS
Sbjct  200   SLQRLTHLLFLDFSYNQLSGPIPSLRNPTLNVLDLSHNFLHGQIPATFGQCDSLIKLDLS  259

Query  1068  RNRLSGRIPDSIDALNNIILMDLSYNSITGPIPTTLKNLDFLQALVLSGNPMLSDTLPEH  1247
             RNRL+G IPDS+  L ++IL+DLS+NS++GP+PT+L  L  L+AL+L+GN M S T+PE 
Sbjct  260   RNRLTGSIPDSLGNLASLILLDLSHNSLSGPLPTSLGKLISLRALILNGNYMSSATIPED  319

Query  1248  IFLDGFKDLMILALSNMNLQGSIPESLAKLPKIRVLHLDGNQLNGSIPASFGeldslsel  1427
              F  G K+L+ L LSNM LQG IPES+  L  +RVLHLDGN+LNGSIP SF  L+ LSEL
Sbjct  320   GF-AGLKELITLVLSNMGLQGPIPESIGGLLSLRVLHLDGNKLNGSIPQSFRRLEKLSEL  378

Query  1428  rldsNQLTGAVPFKREMVWRMRRKLKLSNNSGLCYDAKTGLGDDLEAISDSGISHCGSQA  1607
             +L+ N+L+G +PF REM+WRM  KLK+ NNSGLCYDA  G  + ++++  SGIS+C  Q 
Sbjct  379   KLNDNRLSGPIPFSREMLWRMGSKLKVYNNSGLCYDASNGRSEGIDSM--SGISYCEPQT  436

Query  1608  TE  1613
              +
Sbjct  437   KK  438



>ref|XP_008373969.1| PREDICTED: PTI1-like tyrosine-protein kinase At3g15890 [Malus 
domestica]
Length=376

 Score =   458 bits (1179),  Expect = 8e-148, Method: Compositional matrix adjust.
 Identities = 220/304 (72%), Positives = 255/304 (84%), Gaps = 5/304 (2%)
 Frame = -2

Query  3198  YWGQLWDGSQIAVKRLKEWSNTAEVEFAAEVEILARARHKNLLALRGYCSEGQEHVLVYD  3019
             YWGQLWDGSQIAVKRLK WSN A++EFA EVEILAR RHKNLL+LRGYC+EGQE ++VYD
Sbjct  55    YWGQLWDGSQIAVKRLKVWSNNADMEFAVEVEILARVRHKNLLSLRGYCAEGQERLIVYD  114

Query  3018  YVPNFSLLSHLHGQYSADTLLDWKKRISIAVGSAEGIAYLHHDATPHIIHGDIKAGNVLL  2839
             Y+PN SLLSHLHGQ+SA+ LLDW +R++I +GSAEG+AYLHH ATPHIIH DIKA NVL+
Sbjct  115   YMPNLSLLSHLHGQHSAECLLDWTRRMNIVIGSAEGVAYLHHHATPHIIHRDIKASNVLV  174

Query  2838  DSNFQAQLAGFGIANFFPDDATRVTTRSKGTLGYLAPEYVMLGKESKSCDVYSFGILLLE  2659
             DS+FQAQ+A FG A   PD AT VTTR KGTLGYLAPEY MLGK S+SCDVYSFGILLLE
Sbjct  175   DSDFQAQVADFGFAKLIPDGATHVTTRVKGTLGYLAPEYAMLGKASESCDVYSFGILLLE  234

Query  2658  LASGKKPIKKVSASKNWTITDWALPLACEGKFSELADPTLNGNYVEEELKRIVYVALICA  2479
             LASGKKPI+KVSA+   TITDWALPLACE KF E+ADP LNG YVE+ELKR+V+VAL+CA
Sbjct  235   LASGKKPIEKVSATMKRTITDWALPLACERKFDEIADPKLNGKYVEDELKRVVFVALLCA  294

Query  2478  QNQPEKRPTMLEVVELLKGESKEKLAALENNEMFKNLKAATHKDG-----CAHEDSQEFI  2314
              +QPE+R TMLE VELLKGESKEKL  LEN+E+FK  + A + +G      A E S + I
Sbjct  295   HSQPERRLTMLEAVELLKGESKEKLVQLENDELFKAPQVAEYNEGNDGTTAAEEHSSDVI  354

Query  2313  SEKQ  2302
             SE++
Sbjct  355   SEEK  358



>gb|AFK40964.1| unknown [Lotus japonicus]
Length=366

 Score =   457 bits (1175),  Expect = 3e-147, Method: Compositional matrix adjust.
 Identities = 217/300 (72%), Positives = 255/300 (85%), Gaps = 1/300 (0%)
 Frame = -2

Query  3198  YWGQLWDGSQIAVKRLKEWSNTAEVEFAAEVEILARARHKNLLALRGYCSEGQEHVLVYD  3019
             YWGQLWDGSQIAVKRLK WSN A++EFA EVEILAR RHKNLL+LRGYC+EGQE ++VYD
Sbjct  55    YWGQLWDGSQIAVKRLKVWSNKADMEFAVEVEILARVRHKNLLSLRGYCAEGQERLIVYD  114

Query  3018  YVPNFSLLSHLHGQYSADTLLDWKKRISIAVGSAEGIAYLHHDATPHIIHGDIKAGNVLL  2839
             Y+PN SLLSHLHGQ+S++ LLDW +R++IA+GSAEGI YLHH ATPHIIH DIKA NVLL
Sbjct  115   YMPNLSLLSHLHGQHSSECLLDWNRRMNIAIGSAEGIVYLHHQATPHIIHRDIKASNVLL  174

Query  2838  DSNFQAQLAGFGIANFFPDDATRVTTRSKGTLGYLAPEYVMLGKESKSCDVYSFGILLLE  2659
             DS+FQA++A FG A   PD AT VTTR KGTLGYLAPEY MLGK ++ CDV+SFGILLLE
Sbjct  175   DSDFQARVADFGFAKLIPDGATHVTTRVKGTLGYLAPEYAMLGKANECCDVFSFGILLLE  234

Query  2658  LASGKKPIKKVSASKNWTITDWALPLACEGKFSELADPTLNGNYVEEELKRIVYVALICA  2479
             LASGKKP++K+S++   +I DWALPLAC  KF+E ADP LNG YVEEELKRIV VALICA
Sbjct  235   LASGKKPLEKLSSTVKRSINDWALPLACAKKFTEFADPRLNGEYVEEELKRIVLVALICA  294

Query  2478  QNQPEKRPTMLEVVELLKGESKEKLAALENNEMFKNLKAATHKDGC-AHEDSQEFISEKQ  2302
             Q+QP+KRPTM+EVVELLKGESK+KL+ LEN+E+FKN     H +G  A E S +FISE++
Sbjct  295   QSQPDKRPTMIEVVELLKGESKDKLSQLENHELFKNPPGVGHDEGTSAAEGSSDFISEEK  354



>ref|XP_010241557.1| PREDICTED: PTI1-like tyrosine-protein kinase At3g15890 [Nelumbo 
nucifera]
Length=369

 Score =   456 bits (1172),  Expect = 8e-147, Method: Compositional matrix adjust.
 Identities = 218/297 (73%), Positives = 252/297 (85%), Gaps = 2/297 (1%)
 Frame = -2

Query  3198  YWGQLWDGSQIAVKRLKEWSNTAEVEFAAEVEILARARHKNLLALRGYCSEGQEHVLVYD  3019
             YWGQLWDGSQIAVKRLK WS+ A++EFA EVEIL R RHKNLL+LRGYC+EGQE ++VYD
Sbjct  55    YWGQLWDGSQIAVKRLKVWSDKADMEFAVEVEILGRVRHKNLLSLRGYCAEGQERLIVYD  114

Query  3018  YVPNFSLLSHLHGQYSADTLLDWKKRISIAVGSAEGIAYLHHDATPHIIHGDIKAGNVLL  2839
             Y+PN SLLSHLHG +SA+ LL W +R+ IA+GSAEGI YLHH ATPHIIH DIKA NVLL
Sbjct  115   YMPNLSLLSHLHGHHSAE-LLGWDRRMKIAIGSAEGITYLHHHATPHIIHRDIKASNVLL  173

Query  2838  DSNFQAQLAGFGIANFFPDDATRVTTRSKGTLGYLAPEYVMLGKESKSCDVYSFGILLLE  2659
             DS+F+AQ++ FG A   PD AT VTTR KGTLGYLAPEY MLGK S+SCDVYSFGILLLE
Sbjct  174   DSDFEAQVSDFGFAKLIPDGATHVTTRVKGTLGYLAPEYAMLGKASESCDVYSFGILLLE  233

Query  2658  LASGKKPIKKVSASKNWTITDWALPLACEGKFSELADPTLNGNYVEEELKRIVYVALICA  2479
             LASGKKPI+K+S +   T+T WALPL C+ KFSE+ADP LNG YVEEELKR++ VALICA
Sbjct  234   LASGKKPIEKLSPTMKRTLTGWALPLVCQNKFSEVADPKLNGKYVEEELKRVLLVALICA  293

Query  2478  QNQPEKRPTMLEVVELLKGESKEKLAALENNEMFKNLKAATHKDGCAH-EDSQEFIS  2311
             QNQPEKRPTMLEVVELLKG+SKEKLA LENNE+F   K+ +H++G +  EDS +FIS
Sbjct  294   QNQPEKRPTMLEVVELLKGDSKEKLANLENNELFNPTKSGSHQEGSSSAEDSTDFIS  350



>ref|XP_009351272.1| PREDICTED: PTI1-like tyrosine-protein kinase At3g15890 [Pyrus 
x bretschneideri]
Length=376

 Score =   456 bits (1172),  Expect = 1e-146, Method: Compositional matrix adjust.
 Identities = 215/304 (71%), Positives = 255/304 (84%), Gaps = 5/304 (2%)
 Frame = -2

Query  3198  YWGQLWDGSQIAVKRLKEWSNTAEVEFAAEVEILARARHKNLLALRGYCSEGQEHVLVYD  3019
             YWGQLWDGSQIAVKRLK WS+ A++EFA EVEILAR RHKNLL+LRGYC+EGQE ++VYD
Sbjct  55    YWGQLWDGSQIAVKRLKVWSDKADMEFAVEVEILARVRHKNLLSLRGYCAEGQERLIVYD  114

Query  3018  YVPNFSLLSHLHGQYSADTLLDWKKRISIAVGSAEGIAYLHHDATPHIIHGDIKAGNVLL  2839
             Y+PN SLLSHLHGQ+SA+ LLDW +R++IA+GSAEG+AYLHH ATPHIIH DIKA NVL+
Sbjct  115   YLPNLSLLSHLHGQHSAECLLDWTRRMNIAIGSAEGVAYLHHHATPHIIHRDIKASNVLV  174

Query  2838  DSNFQAQLAGFGIANFFPDDATRVTTRSKGTLGYLAPEYVMLGKESKSCDVYSFGILLLE  2659
             DS+FQAQ+A FG A   PD AT VTTR KGTLGYLAPEY MLGK S+SCDVYSFGILLLE
Sbjct  175   DSDFQAQVADFGFARLIPDGATHVTTRVKGTLGYLAPEYAMLGKASESCDVYSFGILLLE  234

Query  2658  LASGKKPIKKVSASKNWTITDWALPLACEGKFSELADPTLNGNYVEEELKRIVYVALICA  2479
             LASGKKPI+KV      T+TDWALPLACE KF E+ADP LNG Y+E+ELKR+V+V L+CA
Sbjct  235   LASGKKPIEKVGQGMKRTVTDWALPLACERKFDEIADPKLNGKYLEDELKRVVFVGLLCA  294

Query  2478  QNQPEKRPTMLEVVELLKGESKEKLAALENNEMFKNLKAATHKDG-----CAHEDSQEFI  2314
              ++PE+RPTMLEVV+LLKGESKEKLA LEN+E+FK  + A + +G         +S +FI
Sbjct  295   HSRPERRPTMLEVVDLLKGESKEKLAQLENDELFKTPQVAEYNEGNDGATAVEGESSDFI  354

Query  2313  SEKQ  2302
             SE++
Sbjct  355   SEEK  358



>ref|XP_008356531.1| PREDICTED: PTI1-like tyrosine-protein kinase At3g15890 [Malus 
domestica]
Length=380

 Score =   455 bits (1170),  Expect = 2e-146, Method: Compositional matrix adjust.
 Identities = 217/302 (72%), Positives = 254/302 (84%), Gaps = 5/302 (2%)
 Frame = -2

Query  3198  YWGQLWDGSQIAVKRLKEWSNTAEVEFAAEVEILARARHKNLLALRGYCSEGQEHVLVYD  3019
             YWGQLWDGSQIAVKRLK WS+ A++EFA EVEILAR RHKNLL+LRGYC+EGQE ++VYD
Sbjct  55    YWGQLWDGSQIAVKRLKVWSDKADMEFAVEVEILARVRHKNLLSLRGYCAEGQERLIVYD  114

Query  3018  YVPNFSLLSHLHGQYSADTLLDWKKRISIAVGSAEGIAYLHHDATPHIIHGDIKAGNVLL  2839
             Y+PN SLLSHLHGQ+SA+ LLDW +R++IA+GSAEG+AYLHH  TPHIIH DIKA NVL+
Sbjct  115   YMPNLSLLSHLHGQHSAECLLDWTRRMNIAIGSAEGVAYLHHHLTPHIIHRDIKASNVLV  174

Query  2838  DSNFQAQLAGFGIANFFPDDATRVTTRSKGTLGYLAPEYVMLGKESKSCDVYSFGILLLE  2659
             DS+FQAQ+A FG A   PD AT VTTR KGTLGYLAPEY MLGK S+SCDVYSFGILLLE
Sbjct  175   DSDFQAQVADFGFAKLIPDGATHVTTRVKGTLGYLAPEYAMLGKASESCDVYSFGILLLE  234

Query  2658  LASGKKPIKKVSASKNWTITDWALPLACEGKFSELADPTLNGNYVEEELKRIVYVALICA  2479
             LASGKKPI+KVS     T+TDWALPLACE KF E+ADP LNG Y+E+ELKR+V+VAL+CA
Sbjct  235   LASGKKPIEKVSRGMKRTVTDWALPLACERKFDEIADPKLNGKYLEDELKRVVFVALLCA  294

Query  2478  QNQPEKRPTMLEVVELLKGESKEKLAALENNEMFKNLKAATHKDG-----CAHEDSQEFI  2314
              + PE+RPTMLEVVELLKGESKEKLA LEN+E+FK  + A + +G      A  +S +FI
Sbjct  295   HSWPERRPTMLEVVELLKGESKEKLAQLENDELFKTPQVAEYNEGNDGATAAEGESSDFI  354

Query  2313  SE  2308
             S+
Sbjct  355   SD  356



>ref|XP_004152337.1| PREDICTED: protein TOO MANY MOUTHS-like [Cucumis sativus]
 ref|XP_004169832.1| PREDICTED: protein TOO MANY MOUTHS-like [Cucumis sativus]
 gb|KGN52912.1| hypothetical protein Csa_4G006190 [Cucumis sativus]
Length=444

 Score =   454 bits (1169),  Expect = 2e-145, Method: Compositional matrix adjust.
 Identities = 234/389 (60%), Positives = 302/389 (78%), Gaps = 2/389 (1%)
 Frame = +3

Query  390   LVDAPQTAYSLNNDHARTDAREQEAVYEVMRATGNDWATEIPDVCRGRWHGIECMPDKAN  569
             L+D PQ+ +SL+N   RTD  EQ AVY++M ATGN WAT+IPDVC GRWHGIECMPD  N
Sbjct  42    LIDGPQSGFSLHNAAVRTDPAEQSAVYDIMSATGNYWATQIPDVCGGRWHGIECMPDNHN  101

Query  570   VYHVVSLSFGALSDDTAFPTCDTAPRPFISPAVTKLLHLRTLFFYRCFTDNPQPIPTFlg  749
             ++H+VSLSFG+LSDDTAFPTCD A R  ISP++TKL HL+TLFFYRCF++NPQ IP+FLG
Sbjct  102   LFHIVSLSFGSLSDDTAFPTCD-ATRSTISPSLTKLPHLKTLFFYRCFSNNPQFIPSFLG  160

Query  750   qlgqtlqtlVLRENGHVGSIPNQLGNLTRLRVLDFHGNNLNGSIPVSLSRIDGLRSLDLS  929
             QLG +LQTLVLR+NG +G IP +L NLT L+VLD HGNNLNGSIPV  +R+ GLRSLDLS
Sbjct  161   QLGSSLQTLVLRDNGLIGPIPTELTNLTHLKVLDLHGNNLNGSIPVGFNRLLGLRSLDLS  220

Query  930   RNKLAASIPNLTFPLLQILDLNQNHLVGSIPTALINCHSLMKMDLSRNRLSGRIPDSIDA  1109
             +NKL   +P+L    L+ILD++QN L GSIP  ++ C SL+K+DLSRNRL+G IP SI  
Sbjct  221   QNKLMGLLPSLGLSNLRILDVSQNLLTGSIPIEIVTCQSLIKLDLSRNRLTGLIPKSIGG  280

Query  1110  LNNIILMDLSYNSITGPIPTTLKNLDFLQALVLSGNPMLSDTLPEHIFLDGFKDLMILAL  1289
             L  ++L+DLSYN I+ P+P++ + L  L+AL+L GNPM    +   +F  G   LM L L
Sbjct  281   LRQLVLLDLSYNQISSPLPSSFRLLSSLEALILKGNPM-DCVISNDLFDGGMMSLMTLIL  339

Query  1290  SNMNLQGSIPESLAKLPKIRVLHLDGNQLNGSIPASFGeldslselrldsNQLTGAVPFK  1469
             SNM   G +P SL +LP +RVLHLDGN  NGSIP+SF  L +L++LRL+ N+L+G +P  
Sbjct  340   SNMGFHGPVPNSLGRLPNLRVLHLDGNHFNGSIPSSFQALRNLNDLRLNDNELSGPIPLP  399

Query  1470  REMVWRMRRKLKLSNNSGLCYDAKTGLGD  1556
             ++ +WRM+RKL+L NNSGLCY++++G+GD
Sbjct  400   KDTIWRMKRKLRLYNNSGLCYNSQSGVGD  428



>ref|XP_008795870.1| PREDICTED: PTI1-like tyrosine-protein kinase At3g15890 [Phoenix 
dactylifera]
Length=357

 Score =   451 bits (1160),  Expect = 3e-145, Method: Compositional matrix adjust.
 Identities = 216/298 (72%), Positives = 249/298 (84%), Gaps = 0/298 (0%)
 Frame = -2

Query  3198  YWGQLWDGSQIAVKRLKEWSNTAEVEFAAEVEILARARHKNLLALRGYCSEGQEHVLVYD  3019
             YWGQLWDGSQIAVKRL+ WSN AE+EFA EVEILAR RHKNLL+LRGYC+EGQE ++VYD
Sbjct  56    YWGQLWDGSQIAVKRLRVWSNRAEMEFAVEVEILARVRHKNLLSLRGYCAEGQERLIVYD  115

Query  3018  YVPNFSLLSHLHGQYSADTLLDWKKRISIAVGSAEGIAYLHHDATPHIIHGDIKAGNVLL  2839
             Y+PN SLLSHLHGQ+SA+ LLDW +R+SIA+ SAEGIAYLHH ATPHIIH DIKA NVLL
Sbjct  116   YMPNLSLLSHLHGQHSAECLLDWGRRMSIAIESAEGIAYLHHHATPHIIHRDIKASNVLL  175

Query  2838  DSNFQAQLAGFGIANFFPDDATRVTTRSKGTLGYLAPEYVMLGKESKSCDVYSFGILLLE  2659
             DS+F A++A FG A   PD AT VTTR KGTLGYLAPEY MLGK S+SCDVYS GILLLE
Sbjct  176   DSDFHARVADFGFAKLIPDGATHVTTRVKGTLGYLAPEYAMLGKASESCDVYSLGILLLE  235

Query  2658  LASGKKPIKKVSASKNWTITDWALPLACEGKFSELADPTLNGNYVEEELKRIVYVALICA  2479
             LASGKKPI+K+S +   TITDWALPLA EG+  E+ADP LNGN+VE EL+R+V VAL+CA
Sbjct  236   LASGKKPIEKLSPTVKRTITDWALPLAREGRLKEVADPKLNGNFVEAELRRVVLVALVCA  295

Query  2478  QNQPEKRPTMLEVVELLKGESKEKLAALENNEMFKNLKAATHKDGCAHEDSQEFISEK  2305
             QN PEKRPTMLEVV+ LKGESKEKL +LEN+E+F+   A  ++     EDS + ISEK
Sbjct  296   QNMPEKRPTMLEVVDFLKGESKEKLLSLENDELFRPHLAGNYQGLSGPEDSSDCISEK  353



>ref|XP_010927378.1| PREDICTED: PTI1-like tyrosine-protein kinase At3g15890 [Elaeis 
guineensis]
Length=375

 Score =   451 bits (1161),  Expect = 3e-145, Method: Compositional matrix adjust.
 Identities = 215/300 (72%), Positives = 251/300 (84%), Gaps = 0/300 (0%)
 Frame = -2

Query  3198  YWGQLWDGSQIAVKRLKEWSNTAEVEFAAEVEILARARHKNLLALRGYCSEGQEHVLVYD  3019
             YWGQLWDGSQIAVKRLK WSN AE+EFA EVE+L R RHKNLL+LRGYC+EGQE ++VYD
Sbjct  56    YWGQLWDGSQIAVKRLKVWSNKAEMEFAVEVEVLGRVRHKNLLSLRGYCAEGQERLIVYD  115

Query  3018  YVPNFSLLSHLHGQYSADTLLDWKKRISIAVGSAEGIAYLHHDATPHIIHGDIKAGNVLL  2839
             Y+PN SLLSHLHGQ+SA+  LDW +R+SIA+GSAEGIAYLHH ATPHIIH DIKA NVLL
Sbjct  116   YMPNLSLLSHLHGQHSAECHLDWGRRMSIAIGSAEGIAYLHHHATPHIIHRDIKASNVLL  175

Query  2838  DSNFQAQLAGFGIANFFPDDATRVTTRSKGTLGYLAPEYVMLGKESKSCDVYSFGILLLE  2659
             DS+FQA++A FG A   PD AT VTT+ KGTLGYLAPEY M GK S+SCDVYSFGILLLE
Sbjct  176   DSDFQARVADFGFAKLIPDGATHVTTKVKGTLGYLAPEYAMFGKASESCDVYSFGILLLE  235

Query  2658  LASGKKPIKKVSASKNWTITDWALPLACEGKFSELADPTLNGNYVEEELKRIVYVALICA  2479
             LASGKKPI+K+S S   TITDWALPLA E +F E+ADP LNGNYVE EL+R+V VALICA
Sbjct  236   LASGKKPIEKISRSVKQTITDWALPLARERRFKEMADPRLNGNYVEAELERVVLVALICA  295

Query  2478  QNQPEKRPTMLEVVELLKGESKEKLAALENNEMFKNLKAATHKDGCAHEDSQEFISEKQV  2299
             Q++PEKRPTMLE+V+LLKGESKEK++ LEN+EMF+     +       +DS + I+E+QV
Sbjct  296   QSKPEKRPTMLELVDLLKGESKEKMSKLENDEMFRPEPTVSCHGLSGPDDSSDTITEEQV  355



>gb|ACU18280.1| unknown [Glycine max]
Length=333

 Score =   449 bits (1155),  Expect = 7e-145, Method: Compositional matrix adjust.
 Identities = 210/278 (76%), Positives = 246/278 (88%), Gaps = 0/278 (0%)
 Frame = -2

Query  3198  YWGQLWDGSQIAVKRLKEWSNTAEVEFAAEVEILARARHKNLLALRGYCSEGQEHVLVYD  3019
             YWGQLWDGSQIAVKRLK WSN A++EFA EVE+LAR RHKNLL+LRGYC+EGQE ++VYD
Sbjct  55    YWGQLWDGSQIAVKRLKVWSNKADMEFAVEVEMLARVRHKNLLSLRGYCAEGQERLIVYD  114

Query  3018  YVPNFSLLSHLHGQYSADTLLDWKKRISIAVGSAEGIAYLHHDATPHIIHGDIKAGNVLL  2839
             Y+PN SLLSHLHGQ+SA++LLDW +R++IA+GSAEGIAYLHH +TPHIIH DIKA NVLL
Sbjct  115   YMPNLSLLSHLHGQHSAESLLDWNRRMNIAIGSAEGIAYLHHQSTPHIIHRDIKASNVLL  174

Query  2838  DSNFQAQLAGFGIANFFPDDATRVTTRSKGTLGYLAPEYVMLGKESKSCDVYSFGILLLE  2659
             DS+FQA++A FG A   PD AT VTTR KGTLGYLAPEY MLGK ++SCDVYSFGILLLE
Sbjct  175   DSDFQARVADFGFAKLIPDGATHVTTRVKGTLGYLAPEYAMLGKANESCDVYSFGILLLE  234

Query  2658  LASGKKPIKKVSASKNWTITDWALPLACEGKFSELADPTLNGNYVEEELKRIVYVALICA  2479
             LASGKKP++K+S++   +I DWALPLACE KFSELADP L GNY EEELKR+V +AL+CA
Sbjct  235   LASGKKPLEKLSSAVKRSINDWALPLACEKKFSELADPKLEGNYAEEELKRVVLIALLCA  294

Query  2478  QNQPEKRPTMLEVVELLKGESKEKLAALENNEMFKNLK  2365
             Q+Q EKRPT+LEVVELLKGESK+KLA LENNE+F+ L+
Sbjct  295   QSQAEKRPTILEVVELLKGESKDKLAQLENNELFQTLQ  332



>gb|KHG17287.1| hypothetical protein F383_02161 [Gossypium arboreum]
Length=356

 Score =   449 bits (1155),  Expect = 2e-144, Method: Compositional matrix adjust.
 Identities = 216/300 (72%), Positives = 253/300 (84%), Gaps = 1/300 (0%)
 Frame = -2

Query  3198  YWGQLWDGSQIAVKRLKEWSNTAEVEFAAEVEILARARHKNLLALRGYCSEGQEHVLVYD  3019
             YWGQLWDGSQIAVKRLK WSN AEV+F+ EVEILAR RHKNLL+LRGYC+EGQE ++VYD
Sbjct  55    YWGQLWDGSQIAVKRLKVWSNKAEVQFSVEVEILARVRHKNLLSLRGYCAEGQERLIVYD  114

Query  3018  YVPNFSLLSHLHGQYSADTLLDWKKRISIAVGSAEGIAYLHHDATPHIIHGDIKAGNVLL  2839
             Y+PN SLLSHLHG +S++  LDW +R++IA+GSAEGIAYLHH +TPHIIH DIKA NVLL
Sbjct  115   YMPNLSLLSHLHGHHSSECHLDWSRRMNIAIGSAEGIAYLHHHSTPHIIHRDIKASNVLL  174

Query  2838  DSNFQAQLAGFGIANFFPDDATRVTTRSKGTLGYLAPEYVMLGKESKSCDVYSFGILLLE  2659
             DS+FQ Q+A FG A F PD AT VTTR KGTLGYLAPEY MLGK S+SCDVYSFGILLLE
Sbjct  175   DSDFQPQVADFGFAKFIPDGATHVTTRVKGTLGYLAPEYAMLGKASESCDVYSFGILLLE  234

Query  2658  LASGKKPIKKVSASKNWTITDWALPLACEGKFSELADPTLNGNYVEEELKRIVYVALICA  2479
             LASGKKP++K+S +    I +WALPLA EGKFSELADP LNG YVEEELKR+V VAL+CA
Sbjct  235   LASGKKPLEKLSPTVKRPIAEWALPLASEGKFSELADPRLNGKYVEEELKRVVLVALVCA  294

Query  2478  QNQPEKRPTMLEVVELLKGESKEKLAALENNEMFKNLKAATHKDGC-AHEDSQEFISEKQ  2302
               QPEKRPT+LEVV+LLKGESKEKL+ LEN+++FKN ++A   D   A E+S + I E++
Sbjct  295   DAQPEKRPTILEVVKLLKGESKEKLSELENSDLFKNPQSAVCNDEILASEESSDTIKEEK  354



>ref|XP_009607618.1| PREDICTED: PTI1-like tyrosine-protein kinase At3g15890 isoform 
X2 [Nicotiana tomentosiformis]
Length=319

 Score =   447 bits (1149),  Expect = 3e-144, Method: Compositional matrix adjust.
 Identities = 215/275 (78%), Positives = 240/275 (87%), Gaps = 1/275 (0%)
 Frame = -2

Query  3171  QIAVKRLKEWSNTAEVEFAAEVEILARARHKNLLALRGYCSEGQEHVLVYDYVPNFSLLS  2992
             QIAVKRLK WSN AE+EFA EVEILAR RHKNLL+LRGYC+EGQE ++VYDY+PN SLLS
Sbjct  18    QIAVKRLKVWSNKAEMEFAVEVEILARVRHKNLLSLRGYCAEGQERLIVYDYMPNLSLLS  77

Query  2991  HLHGQYSADTLLDWKKRISIAVGSAEGIAYLHHDATPHIIHGDIKAGNVLLDSNFQAQLA  2812
             HLHGQ+SA++LLDWK+R++IA+GSAEGI YLHH ATPHIIH DIKA NVLLDS+FQAQ+A
Sbjct  78    HLHGQHSAESLLDWKRRMNIAIGSAEGIVYLHHHATPHIIHRDIKASNVLLDSDFQAQVA  137

Query  2811  GFGIANFFPDDATRVTTRSKGTLGYLAPEYVMLGKESKSCDVYSFGILLLELASGKKPIK  2632
              FG A F PD AT VTTR KGTLGYLAPEY MLGK S+SCDVYSFGILLLELASGKKPI+
Sbjct  138   DFGFAKFIPDGATHVTTRVKGTLGYLAPEYAMLGKASESCDVYSFGILLLELASGKKPIE  197

Query  2631  KVSASKNWTITDWALPLACEGKFSELADPTLNGNYVEEELKRIVYVALICAQNQPEKRPT  2452
             K++ +   TITDWALPLACEGKFSELADP LN NYVEEE KR+V +ALICA N+PEKRPT
Sbjct  198   KLNPTVKRTITDWALPLACEGKFSELADPRLNRNYVEEEFKRLVLIALICAHNRPEKRPT  257

Query  2451  MLEVVELLKGESKEKLAALENNEMFKNLKAATHKD  2347
             MLEVVELLKGESKEK  ALEN+EMFK +  AT  D
Sbjct  258   MLEVVELLKGESKEKFEALENDEMFK-IPPATDDD  291



>ref|XP_010906578.1| PREDICTED: PTI1-like tyrosine-protein kinase At3g15890 [Elaeis 
guineensis]
Length=358

 Score =   448 bits (1152),  Expect = 4e-144, Method: Compositional matrix adjust.
 Identities = 218/299 (73%), Positives = 245/299 (82%), Gaps = 0/299 (0%)
 Frame = -2

Query  3198  YWGQLWDGSQIAVKRLKEWSNTAEVEFAAEVEILARARHKNLLALRGYCSEGQEHVLVYD  3019
             YWGQLWDGSQIAVKRLK WSN AE+EFA EVEILAR RHKNLL+LRGYC+EGQE ++VYD
Sbjct  56    YWGQLWDGSQIAVKRLKVWSNRAEMEFAVEVEILARVRHKNLLSLRGYCAEGQERLIVYD  115

Query  3018  YVPNFSLLSHLHGQYSADTLLDWKKRISIAVGSAEGIAYLHHDATPHIIHGDIKAGNVLL  2839
             Y+PN SLLSHLHGQ+SA+ LLDW +R+ IAV SAEGIAYLHH ATPHIIH DIKA NVLL
Sbjct  116   YMPNLSLLSHLHGQHSAECLLDWGRRLRIAVESAEGIAYLHHHATPHIIHRDIKASNVLL  175

Query  2838  DSNFQAQLAGFGIANFFPDDATRVTTRSKGTLGYLAPEYVMLGKESKSCDVYSFGILLLE  2659
             DS+FQA++A FG A   PD AT VTTR KGTLGYLAPEY MLGK S+SCDVYSFGI LLE
Sbjct  176   DSDFQARVADFGFAKLIPDGATHVTTRVKGTLGYLAPEYAMLGKASESCDVYSFGIFLLE  235

Query  2658  LASGKKPIKKVSASKNWTITDWALPLACEGKFSELADPTLNGNYVEEELKRIVYVALICA  2479
             L SGKKPI+K+SA    TI DWAL LA EGKF E+ADP LNGN+VE ELKR+V VAL+CA
Sbjct  236   LVSGKKPIEKLSAMMKRTIADWALLLAREGKFKEVADPKLNGNFVEAELKRVVLVALVCA  295

Query  2478  QNQPEKRPTMLEVVELLKGESKEKLAALENNEMFKNLKAATHKDGCAHEDSQEFISEKQ  2302
             QN P+KRPTMLE VE LKGESKEKL  LEN E+FK   A  ++     EDS + ISE++
Sbjct  296   QNLPDKRPTMLEAVEFLKGESKEKLVTLENAELFKADLAGNYQGLSGPEDSSDCISEEK  354



>ref|XP_009411217.1| PREDICTED: protein TOO MANY MOUTHS [Musa acuminata subsp. malaccensis]
Length=502

 Score =   452 bits (1164),  Expect = 9e-144, Method: Compositional matrix adjust.
 Identities = 256/450 (57%), Positives = 322/450 (72%), Gaps = 13/450 (3%)
 Frame = +3

Query  336   PFGQCFTVIVSDSGAPSGLVDAPQTAYSLNNDHARTDAREQEAVYEVMRATGNDWATEIP  515
             P    FTV++ DS   S LVDAPQT +S   D ARTD  EQ AVYE+M ATGN WAT IP
Sbjct  28    PSSSEFTVVMPDS---SALVDAPQTGFS---DSARTDPAEQRAVYEIMEATGNGWATSIP  81

Query  516   DVCRGRWHGIECMPDKANVYHVVSLSFGALSDDTAFPTCDTAPRPFISPAVTKLLHLRTL  695
             DVCRGRWHGIECMPD  +VYHVVSLSFGALSDDTAFPTCD A R  +SPA+  L HLR+L
Sbjct  82    DVCRGRWHGIECMPDTNDVYHVVSLSFGALSDDTAFPTCDPA-RSSLSPALLALPHLRSL  140

Query  696   FFYRCFTDNPQPIPTFlgqlgqtlqtlVLRENGHVGSIPNQLGNLTRLRVLDFHGNNLNG  875
             FFYRCFT +PQP+P FLG+LG TL++LVLREN + G IP +LGNLT LRVLD HGN+L+ 
Sbjct  141   FFYRCFTGSPQPVPAFLGRLGPTLRSLVLRENANTGPIPAELGNLTSLRVLDLHGNHLSS  200

Query  876   SIPVSLSRIDGLRSLDLSRNKLAASIPNLTFPLLQILDLNQNHLVGSIPTALINCHSLMK  1055
             S+P SL  +  L+ LDLS N+L   +P L  P L ++DL++N L G IPT+     SL+K
Sbjct  201   SVPPSLQLLRNLQLLDLSHNQLYGPVPELNLPSLTVMDLSRNLLHGRIPTSFGRWDSLVK  260

Query  1056  MDLSRNRLSGRIPDSIDALNNIILMDLSYNSITGPIPTTLKNLDFLQALVLSGNPMLSDT  1235
             MDLSRNR SG IPDS+  L N++L+DLS+N + GP+P +L  L  L AL+L+GNPM S  
Sbjct  261   MDLSRNRFSGSIPDSLCDLQNLVLLDLSHNRLAGPLPRSLGGLRSLTALILTGNPMSSAM  320

Query  1236  LPEHIFLDGFKDLMILALSNMNLQGSIPESLAKLPKIRVLHLDGNQLNGSIPASFGelds  1415
             +P+  F  G   L  L LSNM LQGSIPES+ +L  +RVLHLDGN+LNGSIP SF +L  
Sbjct  321   IPKDAF-AGLAALNTLILSNMGLQGSIPESIGELGSLRVLHLDGNKLNGSIPKSFQKLQK  379

Query  1416  lselrldsNQLTGAVPFKREMVWRMRRKLKLSNNSGLCYDAKTGLGDDLEAISDSGISHC  1595
             L+ELR++ NQL G +P  REM+W+M +KL+L NNSGLCYD   G  + +E++  SGIS+C
Sbjct  380   LTELRVNDNQLMGPIPIGREMLWKMGKKLRLYNNSGLCYDMSYGRYEGIESM--SGISYC  437

Query  1596  GSQATEPTRTVEHISAVDESMLRSSVKSGG  1685
              +++ +      H +   +  L S+ + GG
Sbjct  438   ETESKDAASARSHTT---KHYLSSTSRDGG  464



>ref|XP_010917496.1| PREDICTED: protein TOO MANY MOUTHS [Elaeis guineensis]
Length=477

 Score =   451 bits (1160),  Expect = 2e-143, Method: Compositional matrix adjust.
 Identities = 262/452 (58%), Positives = 324/452 (72%), Gaps = 22/452 (5%)
 Frame = +3

Query  351   FTVIVSDSGAPSGLVDAPQTAYSLNNDHARTDAREQEAVYEVMRATGNDWATEIPDVCRG  530
             F V++ DS   SGLVD PQ  +S   + ARTD  EQ AVYE M ATGN WAT IPDVCRG
Sbjct  7     FMVVLPDS---SGLVDRPQNGFS---NLARTDPAEQRAVYETMAATGNAWATAIPDVCRG  60

Query  531   RWHGIECMPDKANVYHVVSLSFGALSDDTAFPTCDTAPRPFISPAVTKLLHLRTLFFYRC  710
             RWHGIECMPD+ +VYHVVSLSFGALSDDTAFPTCD A    +SPA+  L +LR+LFFYRC
Sbjct  61    RWHGIECMPDRNDVYHVVSLSFGALSDDTAFPTCDPA-HATLSPALLHLPYLRSLFFYRC  119

Query  711   FT-DNPQPIPTFlgqlgqtlqtlVLRENGHVGSIPNQLGNLTRLRVLDFHGNNLNGSIPV  887
             F+ D+PQ IP FLG L  +L++L+LRENGHVG IP +LGNLT L VLD HGN L+ SIP 
Sbjct  120   FSGDHPQQIPAFLGGLSPSLRSLILRENGHVGPIPTELGNLTSLGVLDLHGNKLSSSIPQ  179

Query  888   SLSRIDGLRSLDLSRNKLAASIPNLTFPLLQILDLNQNHLVGSIPTALINCHSLMKMDLS  1067
             SL R+  L+ LDLS N+L   IP+LT P L +LDL+ N L G IP     C SL+KMDLS
Sbjct  180   SLQRLTRLQLLDLSYNQLTGPIPDLTNPTLNVLDLSHNFLHGQIPATFGQCDSLIKMDLS  239

Query  1068  RNRLSGRIPDSIDALNNIILMDLSYNSITGPIPTTLKNLDFLQALVLSGNPMLSDTLPEH  1247
             RNRL G IPDS+  L ++IL+DLS+NS++GP+P++L  L  L+AL+L+GN M S T+PE 
Sbjct  240   RNRLIGSIPDSLSNLKSLILLDLSHNSLSGPLPSSLGKLISLRALLLNGNYMSSATIPED  299

Query  1248  IFLDGFKDLMILALSNMNLQGSIPESLAKLPKIRVLHLDGNQLNGSIPASFGeldslsel  1427
              F  G K+L  L LSNM LQG IPES+ +LP +RVLHLDGN+ NGSIP SF  L+ LSEL
Sbjct  300   GF-AGLKELFTLVLSNMGLQGPIPESIGELPSLRVLHLDGNKFNGSIPQSFQRLEKLSEL  358

Query  1428  rldsNQLTGAVPFKREMVWRMRRKLKLSNNSGLCYDAKTGLGDDLEAISDSGISHCGSQA  1607
             RL+ N+L+G +PF +EM+WR+ RKL++ NN GLCYDA  G  + ++++  SGIS+C    
Sbjct  359   RLNDNRLSGPIPFSKEMLWRIGRKLRVYNNPGLCYDASNGRSEGIDSM--SGISYC---E  413

Query  1608  TEPTRTVEHISAVDESMLRSSVKSGGTVKELS  1703
             TE  R V  + A   S+      SG   K LS
Sbjct  414   TETKRVV--VGAASASI------SGHQTKHLS  437



>ref|XP_011073418.1| PREDICTED: PTI1-like tyrosine-protein kinase At3g15890 [Sesamum 
indicum]
Length=357

 Score =   445 bits (1144),  Expect = 7e-143, Method: Compositional matrix adjust.
 Identities = 216/308 (70%), Positives = 260/308 (84%), Gaps = 7/308 (2%)
 Frame = -2

Query  3198  YWGQLWDGSQIAVKRLKEWSNTAEVEFAAEVEILARARHKNLLALRGYCSEGQEHVLVYD  3019
             YWGQLWDGSQIAVKRLK WSN AE+EF+ EVEILAR RHKNLL LRGYC+EGQE ++VYD
Sbjct  55    YWGQLWDGSQIAVKRLKSWSNKAEMEFSIEVEILARVRHKNLLTLRGYCAEGQERLIVYD  114

Query  3018  YVPNFSLLSHLHGQYSADTLLDWKKRISIAVGSAEGIAYLHHDATPHIIHGDIKAGNVLL  2839
             Y+ N SLLSHLHGQ+SA+  LDW +R++IA+G+AEGIAYLHH ATPHIIH DIKA NVLL
Sbjct  115   YMTNLSLLSHLHGQHSAECHLDWTRRMNIAIGAAEGIAYLHHYATPHIIHRDIKASNVLL  174

Query  2838  DSNFQAQLAGFGIANFFPDDATRVTTRSKGTLGYLAPEYVMLGKESKSCDVYSFGILLLE  2659
             DS+F+AQ+A FG A F PD AT VTTR KGTLGYLAPEY MLGK S+SCDVYSFGILLLE
Sbjct  175   DSDFKAQVADFGFAKFIPDGATHVTTRVKGTLGYLAPEYAMLGKASESCDVYSFGILLLE  234

Query  2658  LASGKKPIKKVSASKNWTITDWALPLACEGKFSELADPTLNGNYVEEELKRIVYVALICA  2479
             LASGKKP++K+S++   TITDWALPLACE KF+ELADP L+G Y+EEELKR+++V LICA
Sbjct  235   LASGKKPLEKLSSTMKRTITDWALPLACERKFNELADPRLDGKYIEEELKRVIFVGLICA  294

Query  2478  QNQPEKRPTMLEVVELLKGESKEKLAALENNEMFKN-LKAATHKDGCAHEDSQEFISEKQ  2302
              N+PEKRPT+LEVV+LLKG+ +EK AA+E++EMFK+ L A + ++G       E IS+++
Sbjct  295   CNRPEKRPTILEVVDLLKGD-REKFAAVESDEMFKSTLVADSGENG-----RSELISDEK  348

Query  2301  VLEPEIGS  2278
               + EIGS
Sbjct  349   EKKQEIGS  356



>ref|XP_010250169.1| PREDICTED: PTI1-like tyrosine-protein kinase At3g15890 [Nelumbo 
nucifera]
Length=373

 Score =   445 bits (1145),  Expect = 9e-143, Method: Compositional matrix adjust.
 Identities = 211/300 (70%), Positives = 250/300 (83%), Gaps = 1/300 (0%)
 Frame = -2

Query  3198  YWGQLWDGSQIAVKRLKEWSNTAEVEFAAEVEILARARHKNLLALRGYCSEGQEHVLVYD  3019
             YWGQLWDGSQIAVKRLK WS  A++EF+ EVEIL R RHKNLL+LRGYC+EGQE ++VYD
Sbjct  55    YWGQLWDGSQIAVKRLKVWSEKADMEFSVEVEILGRVRHKNLLSLRGYCAEGQERLIVYD  114

Query  3018  YVPNFSLLSHLHGQYSADTLLDWKKRISIAVGSAEGIAYLHHDATPHIIHGDIKAGNVLL  2839
             Y+PN SL SHLHG +SA+ LLDW++R+ IA+GSAEGI YLHH ATPHIIH DIKA NVLL
Sbjct  115   YMPNLSLFSHLHGHHSAECLLDWERRMKIAIGSAEGIVYLHHHATPHIIHSDIKASNVLL  174

Query  2838  DSNFQAQLAGFGIANFFPDDATRVTTRSKGTLGYLAPEYVMLGKESKSCDVYSFGILLLE  2659
             DS+F+AQ+A FG+A    D  T VTT+ KGTLGYLAPEY  L K S+SCDVYSFGILLLE
Sbjct  175   DSDFEAQVADFGLAKLIXDGITHVTTKVKGTLGYLAPEYATLEKASESCDVYSFGILLLE  234

Query  2658  LASGKKPIKKVSASKNWTITDWALPLACEGKFSELADPTLNGNYVEEELKRIVYVALICA  2479
             LASGKKPI+K SA+    ITDWALPL CE KFSE+ADP LNG YVEEELKR++ +ALIC 
Sbjct  235   LASGKKPIEKPSATTMQIITDWALPLVCEKKFSEVADPKLNGKYVEEELKRVILIALICC  294

Query  2478  QNQPEKRPTMLEVVELLKGESKEKLAALENNEMFKNLKAATHKDGCAH-EDSQEFISEKQ  2302
             QN+PEKRPTMLE+V+LLKGESKEKLA LEN+EMFK+  + +H++  +  E S +FISE++
Sbjct  295   QNKPEKRPTMLEIVDLLKGESKEKLADLENDEMFKSTNSGSHQEELSTAEGSIDFISEEK  354



>ref|XP_006385306.1| hypothetical protein POPTR_0003s02650g, partial [Populus trichocarpa]
 gb|ERP63103.1| hypothetical protein POPTR_0003s02650g, partial [Populus trichocarpa]
Length=317

 Score =   442 bits (1137),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 211/290 (73%), Positives = 250/290 (86%), Gaps = 1/290 (0%)
 Frame = -2

Query  3168  IAVKRLKEWSNTAEVEFAAEVEILARARHKNLLALRGYCSEGQEHVLVYDYVPNFSLLSH  2989
             IAVKRLK WS+ A++EFA EVEILAR RHKNLL+LRGYC+EGQE ++VYDY+PN SLLSH
Sbjct  1     IAVKRLKVWSDKADMEFAVEVEILARVRHKNLLSLRGYCAEGQERLIVYDYMPNLSLLSH  60

Query  2988  LHGQYSADTLLDWKKRISIAVGSAEGIAYLHHDATPHIIHGDIKAGNVLLDSNFQAQLAG  2809
             LHGQ+S++ LLDWK+R++IA+GSAEGIAYLHH ATPHIIH DIKA NVLLDS+FQAQ+A 
Sbjct  61    LHGQHSSECLLDWKRRMNIAIGSAEGIAYLHHHATPHIIHRDIKASNVLLDSDFQAQVAD  120

Query  2808  FGIANFFPDDATRVTTRSKGTLGYLAPEYVMLGKESKSCDVYSFGILLLELASGKKPIKK  2629
             FG A   PD AT VTTR KGTLGYLAPEY MLGK S+SCDVYSFGILLLELA+GKKP++K
Sbjct  121   FGFAKLIPDGATHVTTRVKGTLGYLAPEYAMLGKASESCDVYSFGILLLELATGKKPLEK  180

Query  2628  VSASKNWTITDWALPLACEGKFSELADPTLNGNYVEEELKRIVYVALICAQNQPEKRPTM  2449
             +SA+    IT+WA PLACE KFSELADP LNG Y EEELKR+V V+L+CAQNQPE+RPTM
Sbjct  181   LSATVKRIITEWAQPLACERKFSELADPKLNGKYDEEELKRVVLVSLVCAQNQPERRPTM  240

Query  2448  LEVVELLKGESKEKLAALENNEMFKNLKAATHKDGCA-HEDSQEFISEKQ  2302
             L+VVELLKGESKE+L+ LEN+E+FK  +A  + DG +  EDS +FISE++
Sbjct  241   LDVVELLKGESKERLSELENDELFKPPQAVDYNDGISVAEDSSDFISEEK  290



>ref|XP_011081421.1| PREDICTED: PTI1-like tyrosine-protein kinase At3g15890 [Sesamum 
indicum]
Length=360

 Score =   444 bits (1141),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 220/305 (72%), Positives = 250/305 (82%), Gaps = 5/305 (2%)
 Frame = -2

Query  3198  YWGQLWDGSQIAVKRLKEWSNTAEVEFAAEVEILARARHKNLLALRGYCSEGQEHVLVYD  3019
             YWGQLWDGSQIAVKRLK WSN AEVEF+ EVEILAR RHKNLL LRGYC+EGQE ++VYD
Sbjct  56    YWGQLWDGSQIAVKRLKSWSNKAEVEFSVEVEILARVRHKNLLTLRGYCAEGQERLIVYD  115

Query  3018  YVPNFSLLSHLHGQYSADTLLDWKKRISIAVGSAEGIAYLHHDATPHIIHGDIKAGNVLL  2839
             Y+ N SLLSHLHGQ+SA+  LDW +R++IAVG+AEGIAYLHH ATPHIIH DIKA NVLL
Sbjct  116   YMTNLSLLSHLHGQHSAECHLDWPRRMNIAVGAAEGIAYLHHYATPHIIHRDIKASNVLL  175

Query  2838  DSNFQAQLAGFGIANFFPDDATRVTTRSKGTLGYLAPEYVMLGKESKSCDVYSFGILLLE  2659
             DS+F+AQ+A FG A F PD AT VTTR KGTLGYLAPEY MLGK S+SCDVYSFGILLLE
Sbjct  176   DSDFKAQVADFGFAKFIPDGATHVTTRVKGTLGYLAPEYAMLGKASESCDVYSFGILLLE  235

Query  2658  LASGKKPIKKVSASKNWTITDWALPLACEGKFSELADPTLNGNYVEEELKRIVYVALICA  2479
             LASGKKPI+K+S++    ITDWALPLA E  F ELAD  LNGNYVEEELKR+++V L+CA
Sbjct  236   LASGKKPIEKLSSTIKRPITDWALPLARERNFGELADQRLNGNYVEEELKRVIFVGLVCA  295

Query  2478  QNQPEKRPTMLEVVELLKGESKEKLAALENNEMFKNLKAATHKDGCAHEDSQEFISEKQV  2299
              N+PEKRPTMLEVVELLKG+ K K AALE++EMFK   AA        EDS E +SE + 
Sbjct  296   DNRPEKRPTMLEVVELLKGD-KAKFAALEDDEMFKGSVAAD----SGTEDSSEIMSEDKE  350

Query  2298  LEPEI  2284
              + EI
Sbjct  351   PKQEI  355



>ref|XP_008454209.1| PREDICTED: PTI1-like tyrosine-protein kinase At3g15890 [Cucumis 
melo]
Length=369

 Score =   441 bits (1135),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 212/300 (71%), Positives = 250/300 (83%), Gaps = 1/300 (0%)
 Frame = -2

Query  3198  YWGQLWDGSQIAVKRLKEWSNTAEVEFAAEVEILARARHKNLLALRGYCSEGQEHVLVYD  3019
             YWGQLWDGSQIAVKRLK WSN A++EF+ EVEILAR RHKNLL+LRGYC+EGQE ++VYD
Sbjct  55    YWGQLWDGSQIAVKRLKVWSNKADMEFSVEVEILARVRHKNLLSLRGYCAEGQERLIVYD  114

Query  3018  YVPNFSLLSHLHGQYSADTLLDWKKRISIAVGSAEGIAYLHHDATPHIIHGDIKAGNVLL  2839
             Y+PN SLLSHLHG +S++  LDWK+R+ IA+GSAEGIAYLHH ATPHIIH DIKA NVLL
Sbjct  115   YMPNLSLLSHLHGHHSSECHLDWKRRMKIAIGSAEGIAYLHHQATPHIIHRDIKASNVLL  174

Query  2838  DSNFQAQLAGFGIANFFPDDATRVTTRSKGTLGYLAPEYVMLGKESKSCDVYSFGILLLE  2659
             D +FQA++A FG A   PD AT VTTR KGTLGYLAPEY MLGK S+SCDVYSFGILLLE
Sbjct  175   DPDFQARVADFGFAKLIPDGATHVTTRVKGTLGYLAPEYAMLGKASESCDVYSFGILLLE  234

Query  2658  LASGKKPIKKVSASKNWTITDWALPLACEGKFSELADPTLNGNYVEEELKRIVYVALICA  2479
             LA+GKKP++K+SA+   TI DWALP+  E  F ELADP LNG+Y  +ELKR++ VAL C+
Sbjct  235   LATGKKPLEKLSATMKRTIIDWALPIVVEKNFEELADPKLNGDYNADELKRVILVALCCS  294

Query  2478  QNQPEKRPTMLEVVELLKGESKEKLAALENNEMFKNLK-AATHKDGCAHEDSQEFISEKQ  2302
              ++PEKRPTMLEVVELLKGESKEKLA LE +E+FK+ + AA   +  A EDS +FISE+Q
Sbjct  295   HSRPEKRPTMLEVVELLKGESKEKLAKLEGDELFKSHQVAAQTTEIKAGEDSSDFISEEQ  354



>ref|XP_004152193.1| PREDICTED: PTI1-like tyrosine-protein kinase At3g15890-like [Cucumis 
sativus]
 ref|XP_004171151.1| PREDICTED: PTI1-like tyrosine-protein kinase At3g15890-like [Cucumis 
sativus]
 gb|KGN52913.1| hypothetical protein Csa_4G006200 [Cucumis sativus]
Length=369

 Score =   441 bits (1134),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 211/300 (70%), Positives = 248/300 (83%), Gaps = 1/300 (0%)
 Frame = -2

Query  3198  YWGQLWDGSQIAVKRLKEWSNTAEVEFAAEVEILARARHKNLLALRGYCSEGQEHVLVYD  3019
             YWGQLWDGSQIAVKRLK WSN A++EF+ EVEILAR RHKNLL+LRGYC+EGQE ++VYD
Sbjct  55    YWGQLWDGSQIAVKRLKVWSNKADMEFSVEVEILARVRHKNLLSLRGYCAEGQERLIVYD  114

Query  3018  YVPNFSLLSHLHGQYSADTLLDWKKRISIAVGSAEGIAYLHHDATPHIIHGDIKAGNVLL  2839
             Y+PN SLLSHLHG +S++  LDWK+R+ IA+GSAEGIAYLHH ATPHIIH DIKA NVLL
Sbjct  115   YMPNLSLLSHLHGHHSSECHLDWKRRMKIAIGSAEGIAYLHHQATPHIIHRDIKASNVLL  174

Query  2838  DSNFQAQLAGFGIANFFPDDATRVTTRSKGTLGYLAPEYVMLGKESKSCDVYSFGILLLE  2659
             D +FQA++A FG A   PD AT VTTR KGTLGYLAPEY MLGK S+SCDVYSFGILLLE
Sbjct  175   DPDFQARVADFGFAKLIPDGATHVTTRVKGTLGYLAPEYAMLGKASESCDVYSFGILLLE  234

Query  2658  LASGKKPIKKVSASKNWTITDWALPLACEGKFSELADPTLNGNYVEEELKRIVYVALICA  2479
             L++GKKP++K+SA+   TI DWALP+  E  F ELADP LNG+Y  EELKR++ VAL C+
Sbjct  235   LSTGKKPLEKLSATMKRTIIDWALPIVVEKNFEELADPKLNGDYNAEELKRVILVALCCS  294

Query  2478  QNQPEKRPTMLEVVELLKGESKEKLAALENNEMFKNLKAATH-KDGCAHEDSQEFISEKQ  2302
               +PEKRPTMLEVVELLKGESKEKLA LE +E+FK+ + A    +  A EDS +FISE+Q
Sbjct  295   HARPEKRPTMLEVVELLKGESKEKLAKLEGDELFKSHQVAKQTTETQAGEDSSDFISEEQ  354



>ref|XP_002265603.1| PREDICTED: PTI1-like tyrosine-protein kinase At3g15890 [Vitis 
vinifera]
Length=375

 Score =   440 bits (1132),  Expect = 7e-141, Method: Compositional matrix adjust.
 Identities = 207/275 (75%), Positives = 238/275 (87%), Gaps = 0/275 (0%)
 Frame = -2

Query  3198  YWGQLWDGSQIAVKRLKEWSNTAEVEFAAEVEILARARHKNLLALRGYCSEGQEHVLVYD  3019
             YWGQLWDGSQIA+KRLK WSN A++EFA EVEILAR RHKNLL+LRGYC+EGQE ++VYD
Sbjct  55    YWGQLWDGSQIAIKRLKVWSNKADMEFAVEVEILARVRHKNLLSLRGYCAEGQERLIVYD  114

Query  3018  YVPNFSLLSHLHGQYSADTLLDWKKRISIAVGSAEGIAYLHHDATPHIIHGDIKAGNVLL  2839
             Y+PN SLLSHLHGQ+SA+  LDW +R++IA+GSAEGI YLHH ATPHIIH DIKA NVLL
Sbjct  115   YMPNLSLLSHLHGQHSAECHLDWNRRMNIAIGSAEGIVYLHHHATPHIIHRDIKASNVLL  174

Query  2838  DSNFQAQLAGFGIANFFPDDATRVTTRSKGTLGYLAPEYVMLGKESKSCDVYSFGILLLE  2659
             DS FQAQ+A FG A   PD AT VTTR KGTLGYLAPEY M GK S+SCDVYSFGILLLE
Sbjct  175   DSEFQAQVADFGFAKLIPDGATHVTTRVKGTLGYLAPEYAMFGKASESCDVYSFGILLLE  234

Query  2658  LASGKKPIKKVSASKNWTITDWALPLACEGKFSELADPTLNGNYVEEELKRIVYVALICA  2479
             L SGK+PI+K+S++   TITDWALPLACE KF++LADP LNG +VEEELKR+V VAL+ A
Sbjct  235   LVSGKRPIEKMSSTMKRTITDWALPLACEKKFNDLADPKLNGKFVEEELKRVVLVALVSA  294

Query  2478  QNQPEKRPTMLEVVELLKGESKEKLAALENNEMFK  2374
              ++PEKRPTMLEV+ELLKG SKEKLA LENN++FK
Sbjct  295   DSKPEKRPTMLEVLELLKGNSKEKLADLENNDLFK  329



>emb|CAN66493.1| hypothetical protein VITISV_019852 [Vitis vinifera]
Length=375

 Score =   439 bits (1129),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 206/275 (75%), Positives = 237/275 (86%), Gaps = 0/275 (0%)
 Frame = -2

Query  3198  YWGQLWDGSQIAVKRLKEWSNTAEVEFAAEVEILARARHKNLLALRGYCSEGQEHVLVYD  3019
             YWGQLWDGSQIA+KRLK WSN A++EFA EVEILAR RHKNLL+LRGYC+EGQE ++VYD
Sbjct  55    YWGQLWDGSQIAIKRLKVWSNKADMEFAVEVEILARVRHKNLLSLRGYCAEGQERLIVYD  114

Query  3018  YVPNFSLLSHLHGQYSADTLLDWKKRISIAVGSAEGIAYLHHDATPHIIHGDIKAGNVLL  2839
             Y+PN SLLSHLHGQ+SA+  LDW +R++IA+GSAEGI YLHH ATPHIIH DIKA NVLL
Sbjct  115   YMPNLSLLSHLHGQHSAECHLDWNRRMNIAIGSAEGIVYLHHHATPHIIHRDIKASNVLL  174

Query  2838  DSNFQAQLAGFGIANFFPDDATRVTTRSKGTLGYLAPEYVMLGKESKSCDVYSFGILLLE  2659
             DS FQAQ+A FG A   PD AT VTTR KGTLGYLAPEY M GK S+SCDVYSFGILLLE
Sbjct  175   DSEFQAQVADFGFAKLIPDGATHVTTRVKGTLGYLAPEYAMFGKASESCDVYSFGILLLE  234

Query  2658  LASGKKPIKKVSASKNWTITDWALPLACEGKFSELADPTLNGNYVEEELKRIVYVALICA  2479
             L SGK+PI+K+S++   TITDWALPLACE KF++LADP LNG +VEEELKR+V VAL+ A
Sbjct  235   LVSGKRPIEKMSSTMKRTITDWALPLACEKKFNDLADPKLNGKFVEEELKRVVLVALVSA  294

Query  2478  QNQPEKRPTMLEVVELLKGESKEKLAALENNEMFK  2374
              ++PEKRPTMLEV+ELLKG SKEK A LENN++FK
Sbjct  295   DSKPEKRPTMLEVLELLKGNSKEKXADLENNDLFK  329



>ref|XP_003566899.1| PREDICTED: protein TOO MANY MOUTHS [Brachypodium distachyon]
Length=492

 Score =   442 bits (1138),  Expect = 4e-140, Method: Compositional matrix adjust.
 Identities = 238/452 (53%), Positives = 315/452 (70%), Gaps = 20/452 (4%)
 Frame = +3

Query  351   FTVIVSDSGAPSGLVDAPQTAYSLNNDHARTDAREQEAVYEVMRATGNDWATEIPDVCRG  530
             FTV+V DS     LVDAPQT +S   D ARTD  EQ AV +VM ATGN WA+ I DVCRG
Sbjct  28    FTVVVPDSAVAGALVDAPQTGFS---DRARTDPAEQRAVQDVMAATGNGWASGIADVCRG  84

Query  531   RWHGIECMPDKANVYHVVSLSFGALSDDTAFPTCDTAPRPFISPAVTKLLHLRTLFFYRC  710
             RWHGIEC+PD+ +VYHVVSLSFGALSDDTAFP CD A    +SPAV  L HLR+LFFYRC
Sbjct  85    RWHGIECVPDRGDVYHVVSLSFGALSDDTAFPACDAA-HATLSPAVLALPHLRSLFFYRC  143

Query  711   FTDNPQPIPTFlgqlgqtlqtlVLRENGHVGSIPNQLGNLTRLRVLDFHGNNLNGSIPVS  890
             F+ NPQPIP FLG+LG   ++LVLR+NGHVG IP ++G+LT LRVLD HGN+L  +IP +
Sbjct  144   FSANPQPIPAFLGRLGPAFRSLVLRQNGHVGPIPMEIGSLTALRVLDLHGNHLTSAIPAT  203

Query  891   LSRIDGLRSLDLSRNKLAASIPNLTFPLLQILDLNQNHLVGSIPTALINCHSLMKMDLSR  1070
             L  +  L+ LDLS N+LA  +P+  F  L ILDL+ N+L G +P +   C SL+K+DL +
Sbjct  204   LQSLKHLQLLDLSYNRLAGQVPSFKFQHLSILDLSHNYLQGHVPASFGQCRSLLKLDLGQ  263

Query  1071  NRLSGRIPDSIDALNNIILMDLSYNSITGPIPTTLKNLDFLQALVLSGNPMLSDTLPEHI  1250
             NRL+G IPD++  L+ +IL+DLS+N+++GPIP  +  L  L++L+L  N M   T+PE +
Sbjct  264   NRLAGTIPDALGDLSELILLDLSHNALSGPIPAAIGRLSALRSLILGDNRMQFSTVPEDL  323

Query  1251  FLDGFKDLMILALSNMNLQGSIPESLAKLPKIRVLHLDGNQLNGSIPASFGeldslselr  1430
             F  G K L  L LS M L+G +PES+ +L ++RVL LDGN   G IPASF  L   SELR
Sbjct  324   F-TGLKALTTLVLSRMGLEGLLPESIGELSELRVLRLDGNGFTGVIPASFRRLGKASELR  382

Query  1431  ldsNQLTGAVPFKREMVWRMRRKLKLSNNSGLCYDAKTGLGDDLEA-ISDSGISHCGSQA  1607
             +D N+L G +PF ++M+WR+ +KL++  N GLCYDA+    + L+  ++ +G++ C S  
Sbjct  383   VDGNRLVGPIPFGKQMMWRLGKKLRVGGNEGLCYDARQ---EGLQGVVALAGVADCDSVR  439

Query  1608  TEPTRTVEHISAVDESMLRSSVKSGGTVKELS  1703
                +RT +H+S        S+ KSGGTV  +S
Sbjct  440   ---SRTTQHLS--------SNRKSGGTVANVS  460



>ref|XP_002298210.2| hypothetical protein POPTR_0001s21090g, partial [Populus trichocarpa]
 gb|EEE83015.2| hypothetical protein POPTR_0001s21090g, partial [Populus trichocarpa]
Length=345

 Score =   437 bits (1124),  Expect = 4e-140, Method: Compositional matrix adjust.
 Identities = 208/292 (71%), Positives = 245/292 (84%), Gaps = 2/292 (1%)
 Frame = -2

Query  3171  QIAVKRLKEWSNTAEVEFAAEVEILARARHKNLLALRGYCSEGQEHVLVYDYVPNFSLLS  2992
             QIAVKRLK WSN  ++EF+ EVEILAR RHKNLL+LRGYC+EGQE ++VYDY+PN SLLS
Sbjct  4     QIAVKRLKVWSNKGDMEFSVEVEILARVRHKNLLSLRGYCAEGQERLIVYDYMPNLSLLS  63

Query  2991  HLHGQYSADTLLDWKKRISIAVGSAEGIAYLHHDATPHIIHGDIKAGNVLLDSNFQAQLA  2812
             HLHGQ+SA+ LLDWK+R++IA+GSA GI YLHH ATPHIIH DIKA NVLLDS+FQAQ+A
Sbjct  64    HLHGQHSAECLLDWKRRMNIAIGSAAGITYLHHHATPHIIHRDIKASNVLLDSDFQAQVA  123

Query  2811  GFGIANFFPDDATRVTTRSKGTLGYLAPEYVMLGKESKSCDVYSFGILLLELASGKKPIK  2632
              FG A   PD AT VTTR KGTLGYLAPEY MLGK S+SCDVYSFGILLLELA+GK+P++
Sbjct  124   DFGFAKLIPDGATHVTTRVKGTLGYLAPEYAMLGKASESCDVYSFGILLLELATGKRPLE  183

Query  2631  KVSASKNWTITDWALPLACEGKFSELADPTLNGNYVEEELKRIVYVALICAQNQPEKRPT  2452
             K+S +   TITDWALPLACE KFSELADP LNG Y EEEL+R+V+V+L+C   QPE+RPT
Sbjct  184   KMSPTVKRTITDWALPLACERKFSELADPKLNGKYDEEELRRVVFVSLVCTHTQPERRPT  243

Query  2451  MLEVVELLKGESKEKLAALENNEMFKNLKAATHKDG--CAHEDSQEFISEKQ  2302
             ML+VVELLKGESKEKL+ LEN+EMFK  +AA   D      E+S +FISE++
Sbjct  244   MLDVVELLKGESKEKLSELENDEMFKAPQAADFDDEEISIAENSSDFISEEK  295



>ref|XP_006427300.1| hypothetical protein CICLE_v10025774mg [Citrus clementina]
 gb|ESR40540.1| hypothetical protein CICLE_v10025774mg [Citrus clementina]
Length=376

 Score =   428 bits (1101),  Expect = 3e-136, Method: Compositional matrix adjust.
 Identities = 210/298 (70%), Positives = 245/298 (82%), Gaps = 14/298 (5%)
 Frame = -2

Query  3198  YWGQLWDGSQIAVKRLKEWSNTAEVEFAAEVEILARARHKNLLALRGYCSEGQEHVLVYD  3019
             YWGQLWDGSQIAVKRLK WSN AE+EFA EVEILAR RHKNLL+LRGYC+EGQE ++VYD
Sbjct  44    YWGQLWDGSQIAVKRLKVWSNKAEMEFAVEVEILARVRHKNLLSLRGYCAEGQERLIVYD  103

Query  3018  YVPNFSLLSHLHGQYSADTLLDWKKRISIAVGSAEGIAYLHHDATPHIIHGDIKAGNVLL  2839
             Y+PN SLLSHLHGQ+S++ LL+W +R+ IA+GSAEGI              DIKA NVLL
Sbjct  104   YMPNLSLLSHLHGQHSSECLLNWNRRMDIAIGSAEGIV-------------DIKASNVLL  150

Query  2838  DSNFQAQLAGFGIANFFPDDATRVTTRSKGTLGYLAPEYVMLGKESKSCDVYSFGILLLE  2659
             D++F+AQ+A FG A   PD AT VTTR KGTLGYLAPEY MLGK S+SCDVYSFGILLLE
Sbjct  151   DADFKAQVADFGFAKLIPDGATHVTTRVKGTLGYLAPEYAMLGKASESCDVYSFGILLLE  210

Query  2658  LASGKKPIKKVSASKNWTITDWALPLACEGKFSELADPTLNGNYVEEELKRIVYVALICA  2479
             LASGKKPI+KV+++   TITDWALPLACE KFSELADP LNGN+VEEELKR+V VAL CA
Sbjct  211   LASGKKPIEKVNSAIKRTITDWALPLACERKFSELADPRLNGNFVEEELKRVVLVALTCA  270

Query  2478  QNQPEKRPTMLEVVELLKGESKEKLAALENNEMFKNLKAATHKDGCA-HEDSQEFISE  2308
              ++PEKRPTMLEV++LLKGESKEKL  LEN+E+FK+ + A + DG A  EDS E ++E
Sbjct  271   HSKPEKRPTMLEVLDLLKGESKEKLTELENDELFKSHQVADYNDGKAVAEDSTEKLAE  328



>gb|KCW53834.1| hypothetical protein EUGRSUZ_J03069 [Eucalyptus grandis]
Length=295

 Score =   423 bits (1088),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 201/276 (73%), Positives = 238/276 (86%), Gaps = 1/276 (0%)
 Frame = -2

Query  3126  VEFAAEVEILARARHKNLLALRGYCSEGQEHVLVYDYVPNFSLLSHLHGQYSADTLLDWK  2947
             +EFA EVEILAR RH NLL+LRGYC+EGQE ++VYDY+PN SLLSHLHGQ+S++ LLDW 
Sbjct  1     MEFAVEVEILARVRHGNLLSLRGYCAEGQERLIVYDYMPNLSLLSHLHGQHSSECLLDWN  60

Query  2946  KRISIAVGSAEGIAYLHHDATPHIIHGDIKAGNVLLDSNFQAQLAGFGIANFFPDDATRV  2767
             +R++IA+GSAEGIAYLHH A PHIIH DIKA NVLLDS+F+A++A FG A F PD AT V
Sbjct  61    RRMNIAIGSAEGIAYLHHRAIPHIIHRDIKASNVLLDSDFKARVADFGFAKFIPDGATHV  120

Query  2766  TTRSKGTLGYLAPEYVMLGKESKSCDVYSFGILLLELASGKKPIKKVSASKNWTITDWAL  2587
             TTR KGTLGYLAPEY MLGK S+SCDVYSFGILLLELASGKKP++K++A+   TITDWAL
Sbjct  121   TTRVKGTLGYLAPEYAMLGKASESCDVYSFGILLLELASGKKPLEKLNATTKRTITDWAL  180

Query  2586  PLACEGKFSELADPTLNGNYVEEELKRIVYVALICAQNQPEKRPTMLEVVELLKGESKEK  2407
             PLACE KFS+LADP +NGNYVEEELKR+V VALICAQ+QPEKRPTMLEV+ELLKGE+K+K
Sbjct  181   PLACEQKFSDLADPRINGNYVEEELKRVVLVALICAQSQPEKRPTMLEVLELLKGEAKDK  240

Query  2406  LAALENNEMFKNLKAATHKDGCA-HEDSQEFISEKQ  2302
             +A LEN+E+F   KA  + DG +  EDS +FISE +
Sbjct  241   VAELENHELFNGPKAGEYNDGLSVAEDSSDFISEDK  276



>ref|XP_009407376.1| PREDICTED: PTI1-like tyrosine-protein kinase At3g15890 [Musa 
acuminata subsp. malaccensis]
Length=365

 Score =   426 bits (1094),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 212/310 (68%), Positives = 245/310 (79%), Gaps = 3/310 (1%)
 Frame = -2

Query  3198  YWGQLWDGSQIAVKRLKEWSNTAEVEFAAEVEILARARHKNLLALRGYCSEGQEHVLVYD  3019
             YWGQLWDGSQIAVKRLK WSN AE++FA EVEIL + RHKNLL+LRGYC+EGQE ++V D
Sbjct  56    YWGQLWDGSQIAVKRLKVWSNKAELQFAVEVEILGKVRHKNLLSLRGYCAEGQERLIVCD  115

Query  3018  YVPNFSLLSHLHGQYSADTLLDWKKRISIAVGSAEGIAYLHHDATPHIIHGDIKAGNVLL  2839
             Y+PN SL+SHLHG  SA+ LLDW +R+SIA+GSAEGIAYLHH ATP IIH DIKA NVLL
Sbjct  116   YLPNLSLISHLHGHNSAECLLDWDRRMSIAIGSAEGIAYLHHHATPRIIHRDIKASNVLL  175

Query  2838  DSNFQAQLAGFGIANFFPDDATRVTTRSKGTLGYLAPEYVMLGKESKSCDVYSFGILLLE  2659
             DSNFQA++A FG A   PDDAT VTT+ KGTLGYLAPEY M GK S+SCDVYSFGI+LLE
Sbjct  176   DSNFQARVADFGFAKLIPDDATHVTTKVKGTLGYLAPEYAMYGKASESCDVYSFGIVLLE  235

Query  2658  LASGKKPIKKVSASKNWTITDWALPLACEGKFSELADPTLNGNYVEEELKRIVYVALICA  2479
             LASGKK I+K S +    IT+WALPLA E KF E+AD  L GNY E ELKR+V VALICA
Sbjct  236   LASGKKSIEKPSPTVKLPITEWALPLARERKFKEIADLKLKGNYAEAELKRMVLVALICA  295

Query  2478  QNQPEKRPTMLEVVELLKGESKEKLAALENNEMFKNLKAATHKDGCAHEDSQEFISEKQV  2299
             Q+ PEKRPTMLEVV+LLKGESKE L+ LEN+EMF+   A   +       S +FISE++ 
Sbjct  296   QSMPEKRPTMLEVVDLLKGESKENLSDLENDEMFRPEPAGISQVLSGPNGSSDFISEEKN  355

Query  2298  LEP---EIGS  2278
              E    E+GS
Sbjct  356   SEANANEMGS  365



>gb|EYU24637.1| hypothetical protein MIMGU_mgv1a009016mg [Erythranthe guttata]
Length=355

 Score =   424 bits (1091),  Expect = 4e-135, Method: Compositional matrix adjust.
 Identities = 206/306 (67%), Positives = 250/306 (82%), Gaps = 6/306 (2%)
 Frame = -2

Query  3198  YWGQLWDGSQIAVKRLKEWSNTAEVEFAAEVEILARARHKNLLALRGYCSEGQEHVLVYD  3019
             YWGQ WDGSQIAVKRLK WSN A++EF+ EVEILAR RHKNLL LRGYC+EGQE ++VYD
Sbjct  55    YWGQSWDGSQIAVKRLKSWSNKADMEFSIEVEILARVRHKNLLTLRGYCAEGQERLIVYD  114

Query  3018  YVPNFSLLSHLHGQYSADTLLDWKKRISIAVGSAEGIAYLHHDATPHIIHGDIKAGNVLL  2839
             Y+ N SLLSHLHGQ++A+  LDW +R++IA+G+AEGI YLH+ ATPHIIH DIKA NVLL
Sbjct  115   YMNNLSLLSHLHGQHAAECHLDWSRRMNIAIGAAEGIVYLHNHATPHIIHRDIKASNVLL  174

Query  2838  DSNFQAQLAGFGIANFFPDDATRVTTRSKGTLGYLAPEYVMLGKESKSCDVYSFGILLLE  2659
             DS F+AQ+A FG A   PD AT VTTR KGTLGYLAPEY MLGK S+SCDVYSFGILLLE
Sbjct  175   DSEFKAQVADFGFAKLIPDGATHVTTRVKGTLGYLAPEYAMLGKASESCDVYSFGILLLE  234

Query  2658  LASGKKPIKKVSASKNWTITDWALPLACEGKFSELADPTLNGNYVEEELKRIVYVALICA  2479
             LASG+KP++K+ ++   TIT+WALPLA E KF E+AD  +NG+YV EELKR+V+V L+CA
Sbjct  235   LASGRKPLEKLGSTMKRTITEWALPLARERKFDEIADKKMNGSYVVEELKRVVFVGLVCA  294

Query  2478  QNQPEKRPTMLEVVELLKGESKEKLAALENNEMFKNLKAATHKDGCAHEDSQEFIS-EKQ  2302
              N+PEKRPT+LEVV +LKG+ KEKLAALEN+E+FK           + EDS EF+S +K+
Sbjct  295   DNRPEKRPTILEVVAMLKGD-KEKLAALENDELFKRDSVVD----SSVEDSSEFVSVDKE  349

Query  2301  VLEPEI  2284
             V+E +I
Sbjct  350   VVERDI  355



>ref|XP_002458184.1| hypothetical protein SORBIDRAFT_03g028355 [Sorghum bicolor]
 gb|EES03304.1| hypothetical protein SORBIDRAFT_03g028355 [Sorghum bicolor]
Length=499

 Score =   429 bits (1102),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 235/453 (52%), Positives = 311/453 (69%), Gaps = 16/453 (4%)
 Frame = +3

Query  351   FTVIVSDSGAPSGLVDAPQTAYSLNNDHARTDAREQEAVYEVMRATGNDWATEIPDVCRG  530
             FTV+V D+ + + LV APQT +S   D ARTD  EQ AV EVM ATGN WA  IPDVCRG
Sbjct  31    FTVVVPDTSSAAALVHAPQTGFS---DRARTDPAEQRAVQEVMAATGNGWAWGIPDVCRG  87

Query  531   RWHGIECMPDKANVYHVVSLSFGALSDDTAFPTCDTAPRPFISPAVTKLLHLRTLFFYRC  710
             RWHGIEC+PD+ +VYHVVSL+FGALSDDTAFP CD A    +SPAV  L HLR+LFFYRC
Sbjct  88    RWHGIECVPDRHDVYHVVSLAFGALSDDTAFPACDAA-TATLSPAVLALPHLRSLFFYRC  146

Query  711   FTDNPQPIPTFlgqlg-qtlqtlVLRENGHVGSIPNQLGNLTRLRVLDFHGNNLNGSIPV  887
             FT NPQPI   LG+LG  + ++LVLR+NGHVG IP +LGNL  LRVLD HGN L  ++P 
Sbjct  147   FTGNPQPIAALLGRLGPASFRSLVLRQNGHVGPIPAELGNLRALRVLDLHGNQLTAAVPA  206

Query  888   SLSRIDGLRSLDLSRNKLAASIPNLTFPLLQILDLNQNHLVGSIPTALINCHSLMKMDLS  1067
             +L  +  LR LDLS N+L   +P   F  L ILDL+ N L G +P +L  C +L+K+DLS
Sbjct  207   TLQSLTHLRMLDLSYNRLDGPVPRFEFQRLSILDLSHNALQGGVPWSLGQCRALLKIDLS  266

Query  1068  RNRLSGRIPDSIDALNNIILMDLSYNSITGPIPTTLKNLDFLQALVLSGNPMLSDTLPEH  1247
             +NRL+G IPD++  L+ ++L+DLS+N+++GPIP  L  L  LQ+L+LS N M   T+P+ 
Sbjct  267   QNRLTGTIPDALGELSELMLLDLSHNALSGPIPAALSRLASLQSLILSDNRMQFSTVPDG  326

Query  1248  IFLDGFKDLMILALSNMNLQGSIPESLAKLPKIRVLHLDGNQLNGSIPASFGeldslsel  1427
              F  G K L  L LS M L G+IPES+ +L ++RVL LD NQ  G IPASF  L+  SEL
Sbjct  327   -FFAGLKALTTLVLSGMGLAGTIPESIGELGELRVLRLDNNQFTGVIPASFRRLERASEL  385

Query  1428  rldsNQLTGAVPFKREMVWRMRRKLKLSNNSGLCYDAKTGLGDDLEA-ISDSGISHCGSQ  1604
             R+D N+L G +PF +EM+WR+ +KL++  N GLCYD K    + LE  ++ +G++ C S 
Sbjct  386   RVDGNRLVGPIPFGKEMMWRLGKKLRVGGNEGLCYDTKQ---EGLEGVVALAGVADCDSV  442

Query  1605  ATEPTRTVEHISAVDESMLRSSVKSGGTVKELS  1703
                 +RT +H+   + +++    + GG V  ++
Sbjct  443   R---SRTTQHLVWSNATVVS---RRGGVVATVT  469



>ref|XP_009398667.1| PREDICTED: PTI1-like tyrosine-protein kinase At3g15890 [Musa 
acuminata subsp. malaccensis]
Length=342

 Score =   420 bits (1079),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 198/283 (70%), Positives = 237/283 (84%), Gaps = 0/283 (0%)
 Frame = -2

Query  3198  YWGQLWDGSQIAVKRLKEWSNTAEVEFAAEVEILARARHKNLLALRGYCSEGQEHVLVYD  3019
             YWGQLWDGSQIAVKRLK WS+ AE+EFA E+EILAR RH NLL LRGYC+EG+E ++VYD
Sbjct  56    YWGQLWDGSQIAVKRLKTWSSKAEMEFAVEIEILARVRHPNLLTLRGYCAEGKERLIVYD  115

Query  3018  YVPNFSLLSHLHGQYSADTLLDWKKRISIAVGSAEGIAYLHHDATPHIIHGDIKAGNVLL  2839
             Y+PN SLLSHLHGQ +A  LLDW +R+SIA+GSAEGIAYLHH ATPHIIH DIKA NVLL
Sbjct  116   YMPNLSLLSHLHGQQAAGCLLDWGRRMSIAIGSAEGIAYLHHHATPHIIHRDIKASNVLL  175

Query  2838  DSNFQAQLAGFGIANFFPDDATRVTTRSKGTLGYLAPEYVMLGKESKSCDVYSFGILLLE  2659
             DS FQA++A FG A   PD AT VTT  KGTLGYLAPEY MLGK  +SCDVYSFGILLLE
Sbjct  176   DSEFQARVADFGFAKLIPDGATHVTTGVKGTLGYLAPEYAMLGKAKESCDVYSFGILLLE  235

Query  2658  LASGKKPIKKVSASKNWTITDWALPLACEGKFSELADPTLNGNYVEEELKRIVYVALICA  2479
             LASG+KPI + S + N +I +WALPLA + +F E+ADP LNG++V+EEL+R+V  AL+CA
Sbjct  236   LASGRKPIDQSSLTSNHSIAEWALPLARKQRFKEIADPKLNGHFVKEELRRMVLTALVCA  295

Query  2478  QNQPEKRPTMLEVVELLKGESKEKLAALENNEMFKNLKAATHK  2350
             Q++PEKRP ML+VV+LLKG SKEKL +LE+NE+FK+  AA ++
Sbjct  296   QSKPEKRPIMLDVVDLLKGVSKEKLLSLEDNELFKSESAAGYQ  338



>ref|XP_008676352.1| PREDICTED: protein TOO MANY MOUTHS-like [Zea mays]
 tpg|DAA58509.1| TPA: hypothetical protein ZEAMMB73_146763 [Zea mays]
Length=506

 Score =   425 bits (1092),  Expect = 4e-133, Method: Compositional matrix adjust.
 Identities = 237/452 (52%), Positives = 312/452 (69%), Gaps = 17/452 (4%)
 Frame = +3

Query  351   FTVIVSDSGAPSGLVDAPQTAYSLNNDHARTDAREQEAVYEVMRATGNDWATEIPDVCRG  530
             FTV+V D+ A + LVDAPQT +S   D ARTD  EQ AV EVM ATGN WA  IPDVCRG
Sbjct  35    FTVVVPDTSA-AALVDAPQTGFS---DRARTDPAEQRAVQEVMAATGNGWAWAIPDVCRG  90

Query  531   RWHGIECMPDKANVYHVVSLSFGALSDDTAFPTCDTAPRPFISPAVTKLLHLRTLFFYRC  710
             RWHGIEC+PD+ + YHVVSL+FGALSDDTAFP C+ A    +SPAV  L HLR+LFFYRC
Sbjct  91    RWHGIECVPDRRDTYHVVSLAFGALSDDTAFPACEAA-SATLSPAVLALPHLRSLFFYRC  149

Query  711   FTDNPQPIPTFlgqlgqtlqtlVLRENGHVGSIPNQLGNLTRLRVLDFHGNNLNGSIPVS  890
             FT NPQP+   LG+LG   ++LVLR+NGHVG IP +LGNL  LRVLD HGN L  ++P +
Sbjct  150   FTGNPQPVAALLGRLGPAFRSLVLRQNGHVGPIPAELGNLKELRVLDLHGNQLTSAVPAT  209

Query  891   LSRIDGLRSLDLSRNKLAASIPNLTFPLLQILDLNQNHLVGSIPTALINCHSLMKMDLSR  1070
             L  +  L+ LDLS N+LA  +P   FP L ILDL+ N L G +P +L  C SL+K+DLS+
Sbjct  210   LQSLSHLQLLDLSYNRLAGPVPRFEFPRLSILDLSHNALQGGVPWSLGQCRSLLKIDLSQ  269

Query  1071  NRLSGRIPDSIDALNNIILMDLSYNSITGPIPTTLKNLDFLQALVLSGNPMLSDTLPEHI  1250
             NRL+G IPD++  L+ ++L+DLS+N+++GPIP  L  L  L++L+LS N M   TLP+  
Sbjct  270   NRLTGTIPDALGDLSQLMLLDLSHNALSGPIPAALSRLASLRSLILSDNRMQFSTLPDD-  328

Query  1251  FLDGFKDLMILALSNMNLQGSIPESLAKLPKIRVLHLDGNQLNGSIPASFGeldslselr  1430
             F  G K L  L LS M L G+IPES+ +L ++RVL LD NQ  G IPASF  L+ +SELR
Sbjct  329   FFAGLKALTTLVLSGMGLAGAIPESIGELSELRVLRLDNNQFTGVIPASFRRLERVSELR  388

Query  1431  ldsNQLTGAVPFKREMVWRMRRKLKLSNNSGLCYDAKTGLGDDLEA-ISDSGISHCGSQA  1607
             +D N+L G +PF +EM+WR+ +KL++ +N GLCYD K      LE  ++ +G++ C S  
Sbjct  389   VDGNRLVGPIPFGKEMMWRLGKKLRVGSNEGLCYDTKQ---QGLEGVVALAGVADCDSVR  445

Query  1608  TEPTRTVEHISAVDESMLRSSVKSGGTVKELS  1703
                +RT +H+   + ++    V  GG V  ++
Sbjct  446   ---SRTTQHLVWSNSTV----VSRGGGVYTVT  470



>gb|EAY75013.1| hypothetical protein OsI_02912 [Oryza sativa Indica Group]
Length=495

 Score =   424 bits (1089),  Expect = 9e-133, Method: Compositional matrix adjust.
 Identities = 237/432 (55%), Positives = 304/432 (70%), Gaps = 12/432 (3%)
 Frame = +3

Query  351   FTVIVSDSGAPSGLVDAPQTAYSLNNDHARTDAREQEAVYEVMRATGNDWATEIPDVCRG  530
             FTV+V DS + + LV+APQT  S   D ARTD  EQ AV EVM ATGN WA+ I DVCRG
Sbjct  31    FTVVVPDSSSSAALVNAPQTGLS---DRARTDPAEQRAVQEVMAATGNGWASGIADVCRG  87

Query  531   RWHGIECMPDKANVYHVVSLSFGALSDDTAFPTCDTAPRPFISPAVTKLLHLRTLFFYRC  710
             RWHGIEC+PD+  VYHVVSLSFGALSDDTAFP CD A R  +SPAV  L HLR+LFFYRC
Sbjct  88    RWHGIECVPDRGEVYHVVSLSFGALSDDTAFPACDAA-RATLSPAVLALPHLRSLFFYRC  146

Query  711   FTDNPQPIPTFlgqlgqtlqtlVLRENGHVGSIPNQLGNLTRLRVLDFHGNNLNGSIPVS  890
             FT NPQP+P FLG+LG   ++LVLRENGHVG+IP +LGNLT LRVLD HGNNL  +IP +
Sbjct  147   FTANPQPVPAFLGRLGPAFRSLVLRENGHVGAIPPELGNLTALRVLDLHGNNLTSAIPAT  206

Query  891   LSRIDGLRSLDLSRNKLAASIPNLTFPLLQILDLNQNHLVGSIPTALINCHSLMKMDLSR  1070
             +  +  L+ LDLS N+LA  +P   F  L ILDL+ N L G +P +L  C SL+K DLS+
Sbjct  207   VQSLAHLQLLDLSYNQLAGEVPPFKFQHLSILDLSHNALQGGVPASLGQCRSLLKFDLSQ  266

Query  1071  NRLSGRIPDSIDALNNIILMDLSYNSITGPIPTTLKNLDFLQALVLSGNPMLSDTLPEHI  1250
             NR +G IPD++  L+++IL+DLS+N+++GPIP  L  L  L++L+L  N M   T+P  I
Sbjct  267   NRFAGTIPDALGDLSDLILLDLSHNALSGPIPAALGRLSSLRSLILGDNRMQFTTVPGDI  326

Query  1251  FLDGFKDLMILALSNMNLQGSIPESLAKLPKIRVLHLDGNQLNGSIPASFGeldslselr  1430
             F  G + L  L LS M L+GS+PES+ +L  +RVL LD N+  G IPASF  L+  SELR
Sbjct  327   F-AGLRALTTLVLSGMGLEGSLPESIGELGHLRVLRLDNNEFTGVIPASFRRLERASELR  385

Query  1431  ldsNQLTGAVPFKREMVWRMRRKLKLSNNSGLCYDAKTGLGDDLEA-ISDSGISHCGSQA  1607
             +D N+L G +PF +EM+WR+ +KL++  N GLCYDAK      LE  ++ +G++ C S  
Sbjct  386   VDGNRLVGPIPFGKEMMWRLGKKLRVGGNEGLCYDAKQ---QGLEGVVALAGVADCDSVR  442

Query  1608  TEPTRTVEHISA  1643
                +RT +H+  
Sbjct  443   ---SRTTQHLGG  451



>ref|XP_004951644.1| PREDICTED: PTI1-like tyrosine-protein kinase At3g15890-like [Setaria 
italica]
Length=374

 Score =   419 bits (1076),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 197/299 (66%), Positives = 246/299 (82%), Gaps = 1/299 (0%)
 Frame = -2

Query  3198  YWGQLWDGSQIAVKRLKEWSNTAEVEFAAEVEILARARHKNLLALRGYCSEGQEHVLVYD  3019
             YWGQLWDGSQIAVKRLK WSN AE EFA EV+ILA+ RHK+LL+LRGYCSEGQE ++VYD
Sbjct  56    YWGQLWDGSQIAVKRLKSWSNKAETEFAVEVKILAQVRHKSLLSLRGYCSEGQERLIVYD  115

Query  3018  YVPNFSLLSHLHGQYSADTLLDWKKRISIAVGSAEGIAYLHHDATPHIIHGDIKAGNVLL  2839
             Y+PN S+ S LHGQ++A+  L W++R+ IA+ SAEGIAYLHH ATPHIIH D+KA NVLL
Sbjct  116   YMPNLSIHSQLHGQHAAECNLGWERRMKIAIDSAEGIAYLHHYATPHIIHRDVKASNVLL  175

Query  2838  DSNFQAQLAGFGIANFFPDDATRVTTRSKGTLGYLAPEYVMLGKESKSCDVYSFGILLLE  2659
             DSNFQA++A FG A   PD AT VTT+ KGTLGYLAPEY MLGK S+SCDV+SFGI+LLE
Sbjct  176   DSNFQARVADFGFAKLIPDGATHVTTKVKGTLGYLAPEYAMLGKASESCDVFSFGIMLLE  235

Query  2658  LASGKKPIKKVSASKNWTITDWALPLACEGKFSELADPTLNGNYVEEELKRIVYVALICA  2479
             LASGKKP++K++ +   TI +WALPLA + KF E+ADP LNGN++E+ELKR+V V L C+
Sbjct  236   LASGKKPVEKLNPTTKRTIAEWALPLARDKKFKEIADPKLNGNFIEDELKRMVLVGLACS  295

Query  2478  QNQPEKRPTMLEVVELLKGESKEKLAALENNEMFKNLKAATHKDGCAHEDSQEFISEKQ  2302
             QN+PE+RP M EVVELLKGES EKL+ LEN+E+FK  + ++ + G +  DS + I+E++
Sbjct  296   QNKPEQRPIMSEVVELLKGESAEKLSNLENDELFKPEQTSSFQ-GSSGPDSSDCITEEK  353



>ref|XP_006584559.1| PREDICTED: uncharacterized protein LOC100791193 isoform X1 [Glycine 
max]
Length=363

 Score =   417 bits (1073),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 209/304 (69%), Positives = 250/304 (82%), Gaps = 2/304 (1%)
 Frame = -2

Query  3198  YWGQLWDGSQIAVKRLKEWSNTAEVEFAAEVEILARARHKNLLALRGYCSEGQEHVLVYD  3019
             YWGQLWDGSQIAVKRLK WSN AE EF  E+EILAR RHKNLL+LRGYC+EGQE ++VY+
Sbjct  53    YWGQLWDGSQIAVKRLKVWSNIAETEFTVELEILARIRHKNLLSLRGYCAEGQERLIVYE  112

Query  3018  YVPNFSLLSHLHGQYSADTLLDWKKRISIAVGSAEGIAYLHHDATPHIIHGDIKAGNVLL  2839
             Y+ N SL SHLHG +S + LLDW +R++IA+GSAEGI YLHH ATPHIIH DIKA NVLL
Sbjct  113   YMQNLSLHSHLHGHHSFECLLDWNRRMNIAIGSAEGIVYLHHQATPHIIHRDIKASNVLL  172

Query  2838  DSNFQAQLAGFGIANFFPDDATRVTTRSKGTLGYLAPEYVMLGKESKSCDVYSFGILLLE  2659
             DS+F+A++A FG A   PD AT VTT+ KGTLGYLAPEY MLGK ++SCDVYSFGILLLE
Sbjct  173   DSDFRARVADFGFAKLIPDGATHVTTKVKGTLGYLAPEYAMLGKANESCDVYSFGILLLE  232

Query  2658  LASGKKPIKKVSASKNWTITDWALPLACEGKFSELADPTLNGNYVEEELKRIVYVALICA  2479
             LASGK+PI+K++++   +I DWALPL CE KFSE+ADP LNGNYVE ELKR+V VAL+CA
Sbjct  233   LASGKRPIEKLNSTVRRSIVDWALPLVCEKKFSEIADPRLNGNYVEGELKRVVLVALMCA  292

Query  2478  QNQPEKRPTMLEVVELLKGESKEKLAALENNEMFKNLKAATHKD--GCAHEDSQEFISEK  2305
             Q+ PEKRPTML+VVELLKGESK+K   +EN+EM ++L A    D    A EDS ++ISE+
Sbjct  293   QDLPEKRPTMLDVVELLKGESKDKFYHIENSEMLRSLLAVESNDETSVAEEDSLDYISEE  352

Query  2304  QVLE  2293
             + LE
Sbjct  353   KELE  356



>dbj|BAJ86094.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=493

 Score =   420 bits (1080),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 232/431 (54%), Positives = 308/431 (71%), Gaps = 14/431 (3%)
 Frame = +3

Query  351   FTVIVSDSGAPSGLVDAPQTAYSLNNDHARTDAREQEAVYEVMRATGNDWATEIPDVCRG  530
             FTV+V D+GA   LVDAPQT +S   D ARTD  EQ AV ++M ATGN WA+ I DVCRG
Sbjct  28    FTVVVPDAGA---LVDAPQTGFS---DRARTDPAEQRAVLDIMAATGNGWASGIADVCRG  81

Query  531   RWHGIECMPDKANVYHVVSLSFGALSDDTAFPTCDTAPRPFISPAVTKLLHLRTLFFYRC  710
             RWHGIEC+PD+ +VYHVVSLSFGALSDDTAFP CD A R  +SPAV  L HLR+LFFYRC
Sbjct  82    RWHGIECVPDRGDVYHVVSLSFGALSDDTAFPACD-ATRATLSPAVLALPHLRSLFFYRC  140

Query  711   FTDNPQPIPTFlgqlgqtlqtlVLRENGHVGSIPNQLGNLTRLRVLDFHGNNLNGSIPVS  890
             FT NPQP+P FLG+LG   ++LVLR+NGHVG IP ++G+L+ LRVLD HGN+L+ +IP +
Sbjct  141   FTANPQPVPPFLGRLGPAFRSLVLRQNGHVGPIPAEIGSLSGLRVLDLHGNHLSSAIPAT  200

Query  891   LSRIDGLRSLDLSRNKLAASIPNLTFPLLQILDLNQNHLVGSIPTALINCHSLMKMDLSR  1070
             +  +  L+ LDLS N+LA  +P+L F  L ILDL+ N L G +P +L  C SL+K+DLS+
Sbjct  201   VQSLVRLQLLDLSYNRLAGQVPDLRFQRLSILDLSHNALQGRVPASLGQCRSLLKVDLSQ  260

Query  1071  NRLSGRIPDSIDALNNIILMDLSYNSITGPIPTTLKNLDFLQALVLSGNPMLSDTLPEHI  1250
             NRL+G IPD++  L ++IL+DLS+N+++GPIP  +  L  L++L+L  N M S T+P   
Sbjct  261   NRLAGTIPDALGDLPDLILLDLSHNALSGPIPAAIGRLSTLRSLILGDNRMQSSTVPGD-  319

Query  1251  FLDGFKDLMILALSNMNLQGSIPESLAKLPKIRVLHLDGNQLNGSIPASFGeldslselr  1430
             F  G   L  L LS M L+GS+PES+  L ++RVL L+ N   G IPASF  L+  SELR
Sbjct  320   FFTGLGALTTLVLSGMGLEGSLPESIGGLTQLRVLRLESNAFTGVIPASFRRLEKASELR  379

Query  1431  ldsNQLTGAVPFKREMVWRMRRKLKLSNNSGLCYDAKTGLGDDLEA-ISDSGISHCGSQA  1607
             +D N+L G +PF ++M+WR+ +KL++  N GLCYDAK    + LE  ++ +G++ CGS  
Sbjct  380   VDGNRLVGPIPFGKQMMWRLGKKLRVGGNEGLCYDAKQ---EGLEGVVALAGVADCGS--  434

Query  1608  TEPTRTVEHIS  1640
                  T +H+S
Sbjct  435   VRSRTTTQHLS  445



>ref|XP_008793949.1| PREDICTED: PTI1-like tyrosine-protein kinase At3g15890 [Phoenix 
dactylifera]
Length=375

 Score =   416 bits (1068),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 212/300 (71%), Positives = 246/300 (82%), Gaps = 0/300 (0%)
 Frame = -2

Query  3198  YWGQLWDGSQIAVKRLKEWSNTAEVEFAAEVEILARARHKNLLALRGYCSEGQEHVLVYD  3019
             YWGQLWDGSQIAVKRLK WSN AE+EFA EVE+L R R+KNLL LRGYC+EGQE ++VYD
Sbjct  56    YWGQLWDGSQIAVKRLKVWSNKAEMEFAVEVEVLGRVRNKNLLNLRGYCAEGQERLIVYD  115

Query  3018  YVPNFSLLSHLHGQYSADTLLDWKKRISIAVGSAEGIAYLHHDATPHIIHGDIKAGNVLL  2839
             Y+PN SLLSHLHGQ+SA+  LDW +R+SIA+GSAEGIA LHH  TPHIIH DIKA NVLL
Sbjct  116   YMPNLSLLSHLHGQHSAECHLDWGRRMSIAIGSAEGIACLHHHTTPHIIHRDIKASNVLL  175

Query  2838  DSNFQAQLAGFGIANFFPDDATRVTTRSKGTLGYLAPEYVMLGKESKSCDVYSFGILLLE  2659
             DS+FQA++A FG A   PD AT VTT+ KGTLGYLAPEY M GK S+SCDVYSFGILLLE
Sbjct  176   DSDFQARVADFGFAKLIPDGATHVTTKVKGTLGYLAPEYAMFGKASESCDVYSFGILLLE  235

Query  2658  LASGKKPIKKVSASKNWTITDWALPLACEGKFSELADPTLNGNYVEEELKRIVYVALICA  2479
             LASGKKPI+K+S +   TITDWALPLA E +F E ADP LNG YVE EL+R+V VALICA
Sbjct  236   LASGKKPIEKISPTVKQTITDWALPLARERRFKETADPRLNGKYVEAELERVVLVALICA  295

Query  2478  QNQPEKRPTMLEVVELLKGESKEKLAALENNEMFKNLKAATHKDGCAHEDSQEFISEKQV  2299
             Q +PEKRPTMLEVV+LLKGESKEK++ LEN+EMF+    A+       +DS + I+E+QV
Sbjct  296   QRKPEKRPTMLEVVDLLKGESKEKMSNLENHEMFRPEPTASCHGLSGPDDSSDCITEEQV  355



>ref|NP_001242499.1| uncharacterized protein LOC100791193 [Glycine max]
 gb|ACU17795.1| unknown [Glycine max]
Length=362

 Score =   415 bits (1066),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 208/304 (68%), Positives = 249/304 (82%), Gaps = 2/304 (1%)
 Frame = -2

Query  3198  YWGQLWDGSQIAVKRLKEWSNTAEVEFAAEVEILARARHKNLLALRGYCSEGQEHVLVYD  3019
             YWGQLWDGSQIAVKRLK WSN AE EF  E+EILAR R KNLL+LRGYC+EGQE ++VY+
Sbjct  52    YWGQLWDGSQIAVKRLKVWSNIAETEFTVELEILARIRRKNLLSLRGYCAEGQERLIVYE  111

Query  3018  YVPNFSLLSHLHGQYSADTLLDWKKRISIAVGSAEGIAYLHHDATPHIIHGDIKAGNVLL  2839
             Y+ N SL SHLHG +S + LLDW +R++IA+GSAEGI YLHH ATPHIIH DIKA NVLL
Sbjct  112   YMQNLSLHSHLHGHHSFECLLDWNRRMNIAIGSAEGIVYLHHQATPHIIHRDIKASNVLL  171

Query  2838  DSNFQAQLAGFGIANFFPDDATRVTTRSKGTLGYLAPEYVMLGKESKSCDVYSFGILLLE  2659
             DS+F+A++A FG A   PD AT VTT+ KGTLGYLAPEY MLGK ++SCDVYSFGILLLE
Sbjct  172   DSDFRARVADFGFAKLIPDGATHVTTKVKGTLGYLAPEYAMLGKANESCDVYSFGILLLE  231

Query  2658  LASGKKPIKKVSASKNWTITDWALPLACEGKFSELADPTLNGNYVEEELKRIVYVALICA  2479
             LASGK+PI+K++++   +I DWALPL CE KFSE+ADP LNGNYVE ELKR+V VAL+CA
Sbjct  232   LASGKRPIEKLNSTVRRSIVDWALPLVCEKKFSEIADPRLNGNYVEGELKRVVLVALMCA  291

Query  2478  QNQPEKRPTMLEVVELLKGESKEKLAALENNEMFKNLKAATHKD--GCAHEDSQEFISEK  2305
             Q+ PEKRPTML+VVELLKGESK+K   +EN+EM ++L A    D    A EDS ++ISE+
Sbjct  292   QDLPEKRPTMLDVVELLKGESKDKFYHIENSEMLRSLLAVESNDETSVAEEDSLDYISEE  351

Query  2304  QVLE  2293
             + LE
Sbjct  352   KELE  355



>ref|XP_010911937.1| PREDICTED: PTI1-like tyrosine-protein kinase At3g15890 [Elaeis 
guineensis]
Length=375

 Score =   414 bits (1065),  Expect = 4e-131, Method: Compositional matrix adjust.
 Identities = 208/299 (70%), Positives = 245/299 (82%), Gaps = 0/299 (0%)
 Frame = -2

Query  3198  YWGQLWDGSQIAVKRLKEWSNTAEVEFAAEVEILARARHKNLLALRGYCSEGQEHVLVYD  3019
             YWGQLWDGSQIAVKRL+ WSN AE+EFA EVEIL R RHKNLLALRGYC+EGQE ++VYD
Sbjct  56    YWGQLWDGSQIAVKRLRVWSNKAEMEFAVEVEILGRVRHKNLLALRGYCAEGQERLIVYD  115

Query  3018  YVPNFSLLSHLHGQYSADTLLDWKKRISIAVGSAEGIAYLHHDATPHIIHGDIKAGNVLL  2839
             Y+PN SLLSHLHG +  + +LDW +R+SIA+GSAEGIAYLHH ATPHIIH DIKA NVLL
Sbjct  116   YMPNLSLLSHLHGHHLGECVLDWGRRMSIAIGSAEGIAYLHHHATPHIIHRDIKASNVLL  175

Query  2838  DSNFQAQLAGFGIANFFPDDATRVTTRSKGTLGYLAPEYVMLGKESKSCDVYSFGILLLE  2659
             DS+FQA++A FG A   PD AT V T+ KGTLGYLAPEY M GK S+SCDVYSFGILLLE
Sbjct  176   DSDFQARVADFGFAKLIPDGATHVNTKVKGTLGYLAPEYAMFGKASESCDVYSFGILLLE  235

Query  2658  LASGKKPIKKVSASKNWTITDWALPLACEGKFSELADPTLNGNYVEEELKRIVYVALICA  2479
             +ASGKKPI+K S +    ITDWALPLA E +F E+ADP LNG Y E ELKR+V VALICA
Sbjct  236   VASGKKPIEKPSPTVKQAITDWALPLARERRFEEIADPRLNGKYEEAELKRVVLVALICA  295

Query  2478  QNQPEKRPTMLEVVELLKGESKEKLAALENNEMFKNLKAATHKDGCAHEDSQEFISEKQ  2302
             Q++PEKRPTMLEVV LLKGESKEKL++LEN+EMF+   A + +     +D+ + I+E++
Sbjct  296   QSKPEKRPTMLEVVGLLKGESKEKLSSLENDEMFRPEPAMSCQGLSGPDDNSDSITEEK  354



>ref|XP_006646119.1| PREDICTED: protein TOO MANY MOUTHS-like [Oryza brachyantha]
Length=492

 Score =   418 bits (1075),  Expect = 7e-131, Method: Compositional matrix adjust.
 Identities = 240/435 (55%), Positives = 305/435 (70%), Gaps = 16/435 (4%)
 Frame = +3

Query  351   FTVIVSDSGAPSG----LVDAPQTAYSLNNDHARTDAREQEAVYEVMRATGNDWATEIPD  518
             FTV+V DS + S     LV+APQT  S   D ARTD  EQ AV EVM ATGN WA+ I D
Sbjct  26    FTVVVPDSSSSSSSAAALVNAPQTGLS---DRARTDPAEQRAVQEVMAATGNGWASGIAD  82

Query  519   VCRGRWHGIECMPDKANVYHVVSLSFGALSDDTAFPTCDTAPRPFISPAVTKLLHLRTLF  698
             VCRGRWHGIEC+PD+  VYHVVSLSFGALSDDTAFP CD A R  +S AV  L HLR+LF
Sbjct  83    VCRGRWHGIECVPDRGEVYHVVSLSFGALSDDTAFPACDAA-RATLSQAVLALPHLRSLF  141

Query  699   FYRCFTDNPQPIPTFlgqlgqtlqtlVLRENGHVGSIPNQLGNLTRLRVLDFHGNNLNGS  878
             FYRCFT NPQP+P FLG+LG   ++LVLRENGHVG+IP +LGNLT LRVLD HGN+L  +
Sbjct  142   FYRCFTANPQPVPAFLGRLGPAFRSLVLRENGHVGAIPPELGNLTALRVLDLHGNHLTSA  201

Query  879   IPVSLSRIDGLRSLDLSRNKLAASIPNLTFPLLQILDLNQNHLVGSIPTALINCHSLMKM  1058
             IP ++  ++ L+ LDLS N+LA  +P+  F  L ILDL+ N L G +P  L  C SL+KM
Sbjct  202   IPATIQSLEHLQLLDLSYNQLAGEVPHFKFQHLSILDLSHNALQGRVPATLGQCRSLLKM  261

Query  1059  DLSRNRLSGRIPDSIDALNNIILMDLSYNSITGPIPTTLKNLDFLQALVLSGNPMLSDTL  1238
             DLS+NRL+G IPD++  L ++IL+DLS NS++GPIP  L  L  L++L+L  N M   T+
Sbjct  262   DLSQNRLAGTIPDALGDLPDLILLDLSQNSLSGPIPAALGRLSSLRSLILGDNRMQFSTV  321

Query  1239  PEHIFLDGFKDLMILALSNMNLQGSIPESLAKLPKIRVLHLDGNQLNGSIPASFGeldsl  1418
             P+  F  G K L  L LS M L+GS+PES+ +L  +RVL LD N+  G IPASF  L+  
Sbjct  322   PDG-FFAGLKALTTLVLSGMGLEGSVPESIGELDHLRVLRLDNNEFTGVIPASFRRLERA  380

Query  1419  selrldsNQLTGAVPFKREMVWRMRRKLKLSNNSGLCYDAKTGLGDDLEA-ISDSGISHC  1595
             SELR+D N+L G +PF +EM+WR+ +KL++  N GLCYDAK      LE  ++ +G+S C
Sbjct  381   SELRVDGNRLVGPIPFGKEMMWRLGKKLRVGGNEGLCYDAKQ---QGLEGVVALAGVSDC  437

Query  1596  GSQATEPTRTVEHIS  1640
              S     +RT +H++
Sbjct  438   DSVR---SRTTQHLA  449



>ref|XP_006856498.1| hypothetical protein AMTR_s00046p00085030 [Amborella trichopoda]
 gb|ERN17965.1| hypothetical protein AMTR_s00046p00085030 [Amborella trichopoda]
Length=372

 Score =   413 bits (1061),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 211/304 (69%), Positives = 245/304 (81%), Gaps = 3/304 (1%)
 Frame = -2

Query  3198  YWGQLWDGSQIAVKRLKEWSNTAEVEFAAEVEILARARHKNLLALRGYCSEGQEHVLVYD  3019
             YWGQLWDGSQIAVKRLK WS  A++EFA EVEIL R RHKNLL+LRGYC+EGQE ++VYD
Sbjct  55    YWGQLWDGSQIAVKRLKVWSTKADMEFAVEVEILGRVRHKNLLSLRGYCAEGQERLIVYD  114

Query  3018  YVPNFSLLSHLHGQYSADTLLDWKKRISIAVGSAEGIAYLHHDATPHIIHGDIKAGNVLL  2839
             Y+PN SLLSHLHGQ+SA+ LLDW KR+ IA+G+AEGI YLHH ATPHIIH DIKA NVLL
Sbjct  115   YMPNLSLLSHLHGQHSAEGLLDWHKRMQIAIGAAEGIVYLHHHATPHIIHRDIKASNVLL  174

Query  2838  DSNFQAQLAGFGIANFFPDDATRVTTRSKGTLGYLAPEYVMLGKESKSCDVYSFGILLLE  2659
             DSNF+AQ+A FG A   PD AT VTTR KGTLGYLAPEY M GK S+SCDVYSFGILLLE
Sbjct  175   DSNFEAQVADFGFAKLIPDGATHVTTRVKGTLGYLAPEYAMFGKASESCDVYSFGILLLE  234

Query  2658  LASGKKPIKKVSASKNWTITDWALPLACEGKFSELADPTLNGNYVEEELKRIVYVALICA  2479
             LASGKKPI+K+ AS   TI DWALPLA E +F E+ D  LNG Y EEEL+R+V VAL+CA
Sbjct  235   LASGKKPIEKLGASMKRTIVDWALPLARERRFHEIVDHKLNGKYKEEELRRLVLVALLCA  294

Query  2478  QNQPEKRPTMLEVVELLKGESKEKLAALENNEMF--KNLKAATHKDGCAHED-SQEFISE  2308
             Q+  EKRPTMLE V+ LKGE+KEK A LEN+E+F  +N K+A + +G +  D S EFI +
Sbjct  295   QSGSEKRPTMLEAVDYLKGEAKEKFANLENHELFNPENQKSAGYAEGLSGTDESSEFILD  354

Query  2307  KQVL  2296
              + L
Sbjct  355   DKEL  358



>ref|XP_009413674.1| PREDICTED: PTI1-like tyrosine-protein kinase At3g15890 [Musa 
acuminata subsp. malaccensis]
Length=354

 Score =   412 bits (1058),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 196/300 (65%), Positives = 235/300 (78%), Gaps = 0/300 (0%)
 Frame = -2

Query  3198  YWGQLWDGSQIAVKRLKEWSNTAEVEFAAEVEILARARHKNLLALRGYCSEGQEHVLVYD  3019
             YWGQLWDGSQIAVKRLK WS+ AE EFA E+E+L R RHKNLL+LRGYC+EG+EH++VYD
Sbjct  54    YWGQLWDGSQIAVKRLKVWSHQAEQEFAVEIEVLGRVRHKNLLSLRGYCAEGKEHLIVYD  113

Query  3018  YVPNFSLLSHLHGQYSADTLLDWKKRISIAVGSAEGIAYLHHDATPHIIHGDIKAGNVLL  2839
             Y+PN SL SHLHG YSA+ +LDW +R+S A+GSAEGIAYLHH ATPHIIH DIKA NVLL
Sbjct  114   YMPNLSLHSHLHGHYSAECILDWGRRMSTAIGSAEGIAYLHHQATPHIIHQDIKASNVLL  173

Query  2838  DSNFQAQLAGFGIANFFPDDATRVTTRSKGTLGYLAPEYVMLGKESKSCDVYSFGILLLE  2659
             D +FQA+LA FG A   PD AT  TT  K  LGYLAPEYV  GK S+S DVYS G+LLLE
Sbjct  174   DMDFQARLADFGFAKLIPDGATDATTDVKSNLGYLAPEYVSSGKASESSDVYSLGVLLLE  233

Query  2658  LASGKKPIKKVSASKNWTITDWALPLACEGKFSELADPTLNGNYVEEELKRIVYVALICA  2479
             L  GK+P++K+SA+   +IT+WALPLA E KF+E+ADP LNGNYVE EL R+V VAL CA
Sbjct  234   LVCGKRPVEKLSATMKLSITEWALPLARERKFNEIADPKLNGNYVEAELTRVVLVALFCA  293

Query  2478  QNQPEKRPTMLEVVELLKGESKEKLAALENNEMFKNLKAATHKDGCAHEDSQEFISEKQV  2299
             QN PEKRPT+LEVV+LLKG SKEKL+ LEN++MF+       +     +   E I+++ V
Sbjct  294   QNSPEKRPTVLEVVDLLKGASKEKLSKLENDDMFRPEPPEASQGASTPDKGSEDIAQETV  353



>ref|XP_006855160.1| hypothetical protein AMTR_s00051p00071560 [Amborella trichopoda]
 gb|ERN16627.1| hypothetical protein AMTR_s00051p00071560 [Amborella trichopoda]
Length=488

 Score =   414 bits (1065),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 240/431 (56%), Positives = 309/431 (72%), Gaps = 7/431 (2%)
 Frame = +3

Query  351   FTVIVSDSGAPSGLVDAPQTAYSLNNDHARTDAREQEAVYEVMRATGNDWATEIPDVCRG  530
             +TVIV DS  PS LVD PQT  S+  D+A TD  EQ+AVY++M+ATGN WAT IPD+C+G
Sbjct  23    YTVIVPDS-VPSTLVDTPQTGLSIYTDNAHTDPNEQQAVYDIMKATGNGWATTIPDICKG  81

Query  531   RWHGIECMPDKANVYHVVSLSFGALSDDTAFPTCDTAPRPFISPAVTKLLHLRTLFFYRC  710
             RWHGIEC+PD   + HVVSLSFGALSDDTAFPTC+     +ISP++TKL H+R LFFY+C
Sbjct  82    RWHGIECVPDNNRILHVVSLSFGALSDDTAFPTCEEG--AYISPSLTKLPHIRRLFFYKC  139

Query  711   FTDNPQPIPTFlgqlgqtlqtlVLRENGHVGSIPNQLGNLTRLRVLDFHGNNLNGSIPVS  890
              TD PQPI +FLG+LG++L++LVLRENGHVG IP +LGNLT+L+VLD HGN L  SIP S
Sbjct  140   CTDGPQPILSFLGRLGKSLESLVLRENGHVGIIPEELGNLTQLKVLDLHGNGLVSSIPNS  199

Query  891   LSRIDGLRSLDLSRNKLAASIPNLTFPL--LQILDLNQNHLVGSIPTALINCHSLMKMDL  1064
             L  +  LR LDLS NKL   IP     L  L +L+LN+N   G IP  +  C SL+K+DL
Sbjct  200   LGSLSNLRLLDLSENKLEGQIPQSIKGLRKLNVLNLNKNLFHGPIPDQIGCCTSLIKLDL  259

Query  1065  SRNRLSGRIPDSIDALNNIILMDLSYNSITGPIPTTLKNLDFLQALVLSGNPMLSDTLPE  1244
             S N+L+G IPD +++L +++LMDLS+N ++GPIP+T+  L  L+ALVL GN M S  +PE
Sbjct  260   SSNQLTGPIPDKLESLKSLLLMDLSFNELSGPIPSTIGELGSLEALVLKGNQMGSSQIPE  319

Query  1245  HIFLDGFKDLMILALSNMNLQGSIPESLAKLPKIRVLHLDGNQLNGSIPASFGeldslse  1424
                    + LM + +SN+ L G IPESL KL K+RVLHLD N+LNG+IP S  EL  LSE
Sbjct  320   S--FGKLRSLMAMVMSNVGLSGPIPESLGKLSKLRVLHLDNNRLNGTIPKSLSELGDLSE  377

Query  1425  lrldsNQLTGAVPFKREMVWRMRRKLKLSNNSGLCYDAKTGLGDDLEAISDSGISHCGSQ  1604
             LRL+ N+LTG VPF +EM+WR+ R + LSNNSGLCY  +    +D  ++S  GI +C  +
Sbjct  378   LRLNQNKLTGPVPFTKEMLWRLGRNIHLSNNSGLCYSPEEEREEDDGSLSPLGIKYCKLK  437

Query  1605  ATEPTRTVEHI  1637
              T    +  H+
Sbjct  438   TTAHISSHRHL  448



>ref|NP_001148756.1| BRASSINOSTEROID INSENSITIVE 1-associated receptor kinase 1 [Zea 
mays]
 gb|ACG32782.1| BRASSINOSTEROID INSENSITIVE 1-associated receptor kinase 1 precursor 
[Zea mays]
 gb|ACR35399.1| unknown [Zea mays]
 gb|AFW70491.1| putative protein kinase superfamily protein [Zea mays]
Length=377

 Score =   409 bits (1052),  Expect = 4e-129, Method: Compositional matrix adjust.
 Identities = 192/299 (64%), Positives = 242/299 (81%), Gaps = 3/299 (1%)
 Frame = -2

Query  3198  YWGQLWDGSQIAVKRLKEWSNTAEVEFAAEVEILARARHKNLLALRGYCSEGQEHVLVYD  3019
             YWGQLWDGSQ+AVKRLK WSN AE EFA EVEILAR RHK+LL+LRGYC+EGQE ++VYD
Sbjct  61    YWGQLWDGSQVAVKRLKSWSNKAETEFAVEVEILARVRHKSLLSLRGYCAEGQERLIVYD  120

Query  3018  YVPNFSLLSHLHGQYSADTLLDWKKRISIAVGSAEGIAYLHHDATPHIIHGDIKAGNVLL  2839
             Y+PN S+ + LHGQ++A+  L W++R+ IAV SAEGIAYLHH ATPHIIH D+KA NVLL
Sbjct  121   YMPNLSIHAQLHGQHAAECNLSWERRMKIAVDSAEGIAYLHHHATPHIIHRDVKASNVLL  180

Query  2838  DSNFQAQLAGFGIANFFPDDATRVTTRSKGTLGYLAPEYVMLGKESKSCDVYSFGILLLE  2659
             DSNFQA++A FG A   PD AT VTTR KGTLGYLAPEY MLGK S+SCDV+S G++LLE
Sbjct  181   DSNFQARVADFGFAKLVPDGATHVTTRVKGTLGYLAPEYAMLGKASESCDVFSLGVMLLE  240

Query  2658  LASGKKPIKKVSASKNWTITDWALPLACEGKFSELADPTLNGNYVEEELKRIVYVALICA  2479
             LASGKKP++K++ +   TI +WALPLA + KF E+ADP LNG++VE+ELKR+V V L C+
Sbjct  241   LASGKKPVEKLNPTTKRTIAEWALPLARDRKFKEIADPKLNGSFVEDELKRMVLVGLACS  300

Query  2478  QNQPEKRPTMLEVVELLKGESKEKLAALENNEMFKNLKAATHKDGCAHEDSQEFISEKQ  2302
             Q++PE+RP M EVVELL+GES E+L+ LEN ++FK    + H  G +  DS + ++E++
Sbjct  301   QDKPEQRPVMSEVVELLRGESTERLSRLENGDLFKP-DISFH--GSSGPDSSDCVTEER  356



>ref|XP_010691096.1| PREDICTED: PTI1-like tyrosine-protein kinase At3g15890 [Beta 
vulgaris subsp. vulgaris]
Length=372

 Score =   409 bits (1050),  Expect = 8e-129, Method: Compositional matrix adjust.
 Identities = 201/300 (67%), Positives = 245/300 (82%), Gaps = 1/300 (0%)
 Frame = -2

Query  3198  YWGQLWDGSQIAVKRLKEWSNTAEVEFAAEVEILARARHKNLLALRGYCSEGQEHVLVYD  3019
             YWGQLWDGSQIAVKRLK WS+ AEVEF+ EVE+LAR RHKNLL LRGYC EGQE ++VYD
Sbjct  55    YWGQLWDGSQIAVKRLKVWSDKAEVEFSVEVEVLARVRHKNLLTLRGYCMEGQERLIVYD  114

Query  3018  YVPNFSLLSHLHGQYSADTLLDWKKRISIAVGSAEGIAYLHHDATPHIIHGDIKAGNVLL  2839
             ++PN SLLSHLHGQ+SA+ LLDWK+R++IA+GSAEGI YLHH ATPHIIH DIKA NVLL
Sbjct  115   FMPNSSLLSHLHGQHSAECLLDWKRRMNIAIGSAEGILYLHHHATPHIIHRDIKASNVLL  174

Query  2838  DSNFQAQLAGFGIANFFPDDATRVTTRSKGTLGYLAPEYVMLGKESKSCDVYSFGILLLE  2659
             DS+FQA++A FG A   PD AT VTT+ KGTLGYLAPEY MLGK S SCDVYS+GILLLE
Sbjct  175   DSDFQAKVADFGFAKLVPDGATHVTTKVKGTLGYLAPEYAMLGKASNSCDVYSYGILLLE  234

Query  2658  LASGKKPIKKVSASKNWTITDWALPLACEGKFSELADPTLNGNYVEEELKRIVYVALICA  2479
             +ASG++ +++++ +   +ITDWALPL  EG + ELADP LN N+VEEEL+R++ VAL CA
Sbjct  235   IASGRRALQRLNPTSRSSITDWALPLVREGNYRELADPKLNDNFVEEELRRLIVVALTCA  294

Query  2478  QNQPEKRPTMLEVVELLKGESKEKLAALENNEMFKNLKAATHKDGCAHEDSQEFISEKQV  2299
             Q QPEKRPTMLEVVELLKGE+K+KL  LE +++FK+ ++A  K     +++     EK V
Sbjct  295   QKQPEKRPTMLEVVELLKGEAKDKLTNLE-DKLFKSSQSADDKSEIKEDNADSISEEKSV  353



>gb|ABR17823.1| unknown [Picea sitchensis]
Length=350

 Score =   407 bits (1046),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 191/276 (69%), Positives = 226/276 (82%), Gaps = 0/276 (0%)
 Frame = -2

Query  3198  YWGQLWDGSQIAVKRLKEWSNTAEVEFAAEVEILARARHKNLLALRGYCSEGQEHVLVYD  3019
             YWGQLWDGSQIAVKRLK WS  AE+EFA EVEIL R RHKNLL+LRGYCSEGQE ++VYD
Sbjct  55    YWGQLWDGSQIAVKRLKVWSTKAEMEFAVEVEILGRVRHKNLLSLRGYCSEGQERLIVYD  114

Query  3018  YVPNFSLLSHLHGQYSADTLLDWKKRISIAVGSAEGIAYLHHDATPHIIHGDIKAGNVLL  2839
             Y+PN S+LSHLHGQ++A+ LLDW +R++IA+GSAEG+AYLHH ATPHIIH DIKA NVLL
Sbjct  115   YMPNLSILSHLHGQHAAECLLDWSRRMNIAIGSAEGLAYLHHHATPHIIHRDIKASNVLL  174

Query  2838  DSNFQAQLAGFGIANFFPDDATRVTTRSKGTLGYLAPEYVMLGKESKSCDVYSFGILLLE  2659
             DS+F+AQ+A FG A   P+  T VTT  KGT+GYLAPEY M  K S++CDVYSFGILLLE
Sbjct  175   DSDFKAQVADFGFAKLIPEGETHVTTGVKGTVGYLAPEYAMWRKASENCDVYSFGILLLE  234

Query  2658  LASGKKPIKKVSASKNWTITDWALPLACEGKFSELADPTLNGNYVEEELKRIVYVALICA  2479
             L SGKKP+ K+ ++   TI DWALPL  EGK+ +LADP  +G Y EEELKR+V+VA++CA
Sbjct  235   LVSGKKPVDKMDSNTKHTIVDWALPLVLEGKYDQLADPKFHGKYNEEELKRVVHVAIMCA  294

Query  2478  QNQPEKRPTMLEVVELLKGESKEKLAALENNEMFKN  2371
             QN PEKRPTMLEVV+ L GESKEKL  + N  + KN
Sbjct  295   QNAPEKRPTMLEVVDFLTGESKEKLFKMININIDKN  330



>ref|XP_009418509.1| PREDICTED: PTI1-like tyrosine-protein kinase At3g15890 [Musa 
acuminata subsp. malaccensis]
Length=373

 Score =   408 bits (1048),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 193/282 (68%), Positives = 231/282 (82%), Gaps = 0/282 (0%)
 Frame = -2

Query  3198  YWGQLWDGSQIAVKRLKEWSNTAEVEFAAEVEILARARHKNLLALRGYCSEGQEHVLVYD  3019
             Y G L DGSQIAVKRLK WSN AE+EFA EVE+LAR RHKNLL LRGYC+EG+E ++VYD
Sbjct  56    YCGHLRDGSQIAVKRLKVWSNKAEMEFAVEVEVLARIRHKNLLNLRGYCAEGKERLIVYD  115

Query  3018  YVPNFSLLSHLHGQYSADTLLDWKKRISIAVGSAEGIAYLHHDATPHIIHGDIKAGNVLL  2839
             Y+PN SL SHLHGQ++ + LL W +R++IA+GSAEGIAYLHH A PHIIH D+KA NVLL
Sbjct  116   YMPNLSLTSHLHGQHAREGLLGWGRRMNIAIGSAEGIAYLHHQAMPHIIHRDVKASNVLL  175

Query  2838  DSNFQAQLAGFGIANFFPDDATRVTTRSKGTLGYLAPEYVMLGKESKSCDVYSFGILLLE  2659
             DS FQA+++ FG A   PD AT VTTR KGTLGYLAPEY MLGK S+SCDVYSFGILLLE
Sbjct  176   DSEFQARVSDFGFAKLIPDGATHVTTRVKGTLGYLAPEYAMLGKASESCDVYSFGILLLE  235

Query  2658  LASGKKPIKKVSASKNWTITDWALPLACEGKFSELADPTLNGNYVEEELKRIVYVALICA  2479
             LA+GK+PI+K+S +    ITDWALPLA E +F E+ADP L G++VE EL+R+V V LICA
Sbjct  236   LATGKRPIEKLSLTVKRPITDWALPLARERRFKEMADPKLKGDFVESELRRMVLVGLICA  295

Query  2478  QNQPEKRPTMLEVVELLKGESKEKLAALENNEMFKNLKAATH  2353
             Q++PEKRPTML+V+ LLK ESK+KL  LEN+E+F+   AA H
Sbjct  296   QSKPEKRPTMLDVINLLKEESKDKLLNLENDELFRTDLAACH  337



>ref|XP_003528313.1| PREDICTED: PTI1-like tyrosine-protein kinase At3g15890-like isoform 
X1 [Glycine max]
Length=362

 Score =   407 bits (1046),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 203/303 (67%), Positives = 249/303 (82%), Gaps = 1/303 (0%)
 Frame = -2

Query  3198  YWGQLWDGSQIAVKRLKEWSNTAEVEFAAEVEILARARHKNLLALRGYCSEGQEHVLVYD  3019
             YWGQLWDGSQIAVKRLK WSN AE EF  E+EILAR RHKNLL+LRGYC+EGQE ++VY+
Sbjct  53    YWGQLWDGSQIAVKRLKVWSNRAETEFTVELEILARIRHKNLLSLRGYCAEGQERLIVYE  112

Query  3018  YVPNFSLLSHLHGQYSADTLLDWKKRISIAVGSAEGIAYLHHDATPHIIHGDIKAGNVLL  2839
             Y+ N SL SHLHG +S + LLDW +R++IA+GSAEGI YLHH ATPHIIH DIKA NVLL
Sbjct  113   YMQNLSLHSHLHGHHSFECLLDWNRRMNIAIGSAEGIVYLHHQATPHIIHRDIKASNVLL  172

Query  2838  DSNFQAQLAGFGIANFFPDDATRVTTRSKGTLGYLAPEYVMLGKESKSCDVYSFGILLLE  2659
             DS+F+A++A FG A   PD AT +TT+ KGTLGYLAPEY MLGK ++SCDVYSFGILLLE
Sbjct  173   DSDFRARVADFGFAKLMPDGATHMTTKVKGTLGYLAPEYAMLGKANESCDVYSFGILLLE  232

Query  2658  LASGKKPIKKVSASKNWTITDWALPLACEGKFSELADPTLNGNYVEEELKRIVYVALICA  2479
             L SGK+PI+K++++   +I DWAL L CE KFSE+ADP LNGNYVE ELKR+V VAL+CA
Sbjct  233   LTSGKRPIEKLNSTVRRSIVDWALHLVCEKKFSEIADPRLNGNYVEGELKRVVLVALMCA  292

Query  2478  QNQPEKRPTMLEVVELLKGESKEKLAALENNEMFKNLKAATHKDGCA-HEDSQEFISEKQ  2302
             Q+ PEKRPT+L+V+ELLKGESK+K   +EN+EMF++L A    D  +  EDS ++ISE++
Sbjct  293   QDLPEKRPTILDVIELLKGESKDKFYHIENSEMFRSLLAVESNDETSVAEDSLDYISEEK  352

Query  2301  VLE  2293
              L+
Sbjct  353   ELQ  355



>ref|XP_006583120.1| PREDICTED: PTI1-like tyrosine-protein kinase At3g15890-like isoform 
X2 [Glycine max]
Length=361

 Score =   407 bits (1046),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 203/303 (67%), Positives = 249/303 (82%), Gaps = 1/303 (0%)
 Frame = -2

Query  3198  YWGQLWDGSQIAVKRLKEWSNTAEVEFAAEVEILARARHKNLLALRGYCSEGQEHVLVYD  3019
             YWGQLWDGSQIAVKRLK WSN AE EF  E+EILAR RHKNLL+LRGYC+EGQE ++VY+
Sbjct  52    YWGQLWDGSQIAVKRLKVWSNRAETEFTVELEILARIRHKNLLSLRGYCAEGQERLIVYE  111

Query  3018  YVPNFSLLSHLHGQYSADTLLDWKKRISIAVGSAEGIAYLHHDATPHIIHGDIKAGNVLL  2839
             Y+ N SL SHLHG +S + LLDW +R++IA+GSAEGI YLHH ATPHIIH DIKA NVLL
Sbjct  112   YMQNLSLHSHLHGHHSFECLLDWNRRMNIAIGSAEGIVYLHHQATPHIIHRDIKASNVLL  171

Query  2838  DSNFQAQLAGFGIANFFPDDATRVTTRSKGTLGYLAPEYVMLGKESKSCDVYSFGILLLE  2659
             DS+F+A++A FG A   PD AT +TT+ KGTLGYLAPEY MLGK ++SCDVYSFGILLLE
Sbjct  172   DSDFRARVADFGFAKLMPDGATHMTTKVKGTLGYLAPEYAMLGKANESCDVYSFGILLLE  231

Query  2658  LASGKKPIKKVSASKNWTITDWALPLACEGKFSELADPTLNGNYVEEELKRIVYVALICA  2479
             L SGK+PI+K++++   +I DWAL L CE KFSE+ADP LNGNYVE ELKR+V VAL+CA
Sbjct  232   LTSGKRPIEKLNSTVRRSIVDWALHLVCEKKFSEIADPRLNGNYVEGELKRVVLVALMCA  291

Query  2478  QNQPEKRPTMLEVVELLKGESKEKLAALENNEMFKNLKAATHKDGCA-HEDSQEFISEKQ  2302
             Q+ PEKRPT+L+V+ELLKGESK+K   +EN+EMF++L A    D  +  EDS ++ISE++
Sbjct  292   QDLPEKRPTILDVIELLKGESKDKFYHIENSEMFRSLLAVESNDETSVAEDSLDYISEEK  351

Query  2301  VLE  2293
              L+
Sbjct  352   ELQ  354



>ref|XP_002453424.1| hypothetical protein SORBIDRAFT_04g005810 [Sorghum bicolor]
 gb|EES06400.1| hypothetical protein SORBIDRAFT_04g005810 [Sorghum bicolor]
Length=374

 Score =   406 bits (1044),  Expect = 5e-128, Method: Compositional matrix adjust.
 Identities = 193/299 (65%), Positives = 240/299 (80%), Gaps = 3/299 (1%)
 Frame = -2

Query  3198  YWGQLWDGSQIAVKRLKEWSNTAEVEFAAEVEILARARHKNLLALRGYCSEGQEHVLVYD  3019
             YWGQLWDGSQIAVKRLK WSN AE EFA EVEILAR RHK+LL+LRGYC+EGQE ++VYD
Sbjct  58    YWGQLWDGSQIAVKRLKSWSNKAEREFAVEVEILARVRHKSLLSLRGYCAEGQERLIVYD  117

Query  3018  YVPNFSLLSHLHGQYSADTLLDWKKRISIAVGSAEGIAYLHHDATPHIIHGDIKAGNVLL  2839
             Y+PN S+ S LHGQ++A+  L W++R+ IAV SAEGIAYLHH ATPHIIH D+KA NVLL
Sbjct  118   YMPNLSIHSQLHGQHAAECNLSWERRMKIAVDSAEGIAYLHHYATPHIIHRDVKASNVLL  177

Query  2838  DSNFQAQLAGFGIANFFPDDATRVTTRSKGTLGYLAPEYVMLGKESKSCDVYSFGILLLE  2659
             DSNFQA++A FG A   PD AT VTT+ KGTLGYLAPEY MLGK S+SCDV+SFGI+LLE
Sbjct  178   DSNFQARVADFGFAKLIPDGATHVTTKVKGTLGYLAPEYAMLGKASESCDVFSFGIMLLE  237

Query  2658  LASGKKPIKKVSASKNWTITDWALPLACEGKFSELADPTLNGNYVEEELKRIVYVALICA  2479
             LASGKKP++K++ +   TIT+WALPL  + KF E+ADP L  ++VE+ELKR+V V + C+
Sbjct  238   LASGKKPVEKLNPTTKKTITEWALPLVRDKKFKEIADPKLKDSFVEDELKRMVLVGIACS  297

Query  2478  QNQPEKRPTMLEVVELLKGESKEKLAALENNEMFKNLKAATHKDGCAHEDSQEFISEKQ  2302
             Q++PE+RP M EVVELLKGES EKL+ LEN+++FK   +     G    DS + ++E++
Sbjct  298   QDKPEQRPIMSEVVELLKGESTEKLSNLENDDLFKPDSSFQSSSG---PDSSDCVTEER  353



>gb|EPS59499.1| hypothetical protein M569_15303, partial [Genlisea aurea]
Length=334

 Score =   405 bits (1040),  Expect = 6e-128, Method: Compositional matrix adjust.
 Identities = 189/275 (69%), Positives = 226/275 (82%), Gaps = 0/275 (0%)
 Frame = -2

Query  3198  YWGQLWDGSQIAVKRLKEWSNTAEVEFAAEVEILARARHKNLLALRGYCSEGQEHVLVYD  3019
             YWGQLWDGSQIAVKRLK WS+ AE++F+ EVE LAR RH NLL LRGYC+EGQE ++VYD
Sbjct  47    YWGQLWDGSQIAVKRLKSWSDKAELQFSVEVETLARVRHTNLLTLRGYCAEGQERLIVYD  106

Query  3018  YVPNFSLLSHLHGQYSADTLLDWKKRISIAVGSAEGIAYLHHDATPHIIHGDIKAGNVLL  2839
             Y+PN SL SHLHG +S+++ LDW +R +IA+G A+GIAYLHH +TPHIIH DIKA NVLL
Sbjct  107   YMPNLSLQSHLHGHHSSESHLDWPRRFAIALGIADGIAYLHHSSTPHIIHRDIKASNVLL  166

Query  2838  DSNFQAQLAGFGIANFFPDDATRVTTRSKGTLGYLAPEYVMLGKESKSCDVYSFGILLLE  2659
             D  F+A++A FG A F P+ AT VTT  KGTLGYLAPEY MLGK S+SCDVYSFGILLLE
Sbjct  167   DDAFRARVADFGFAKFVPEGATHVTTVVKGTLGYLAPEYAMLGKASESCDVYSFGILLLE  226

Query  2658  LASGKKPIKKVSASKNWTITDWALPLACEGKFSELADPTLNGNYVEEELKRIVYVALICA  2479
             L +GK+P KK++++   TITDWALPL  E +F ELADP L G YVE+ELKR+V + LIC+
Sbjct  227   LCTGKRPSKKLNSALRQTITDWALPLVREKRFGELADPKLKGEYVEDELKRVVLIGLICS  286

Query  2478  QNQPEKRPTMLEVVELLKGESKEKLAALENNEMFK  2374
             QNQ EKRPT+L+VVELL+G  KEKLA LE +EMFK
Sbjct  287   QNQAEKRPTILQVVELLRGGDKEKLAVLERHEMFK  321



>ref|NP_001046121.1| Os02g0186500 [Oryza sativa Japonica Group]
 dbj|BAD15416.1| receptor protein kinase PERK1-like protein [Oryza sativa Japonica 
Group]
 dbj|BAD15446.1| receptor protein kinase PERK1-like protein [Oryza sativa Japonica 
Group]
 dbj|BAF08035.1| Os02g0186500 [Oryza sativa Japonica Group]
 dbj|BAG90735.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG93882.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC72639.1| hypothetical protein OsI_06147 [Oryza sativa Indica Group]
Length=377

 Score =   405 bits (1042),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 190/275 (69%), Positives = 227/275 (83%), Gaps = 0/275 (0%)
 Frame = -2

Query  3198  YWGQLWDGSQIAVKRLKEWSNTAEVEFAAEVEILARARHKNLLALRGYCSEGQEHVLVYD  3019
             YWGQLWDGSQIAVKRLK WSN AE EFA EVE+LA  RHK+LL+LRGYC+EGQE ++VYD
Sbjct  56    YWGQLWDGSQIAVKRLKSWSNKAETEFAIEVEVLATVRHKSLLSLRGYCAEGQERLIVYD  115

Query  3018  YVPNFSLLSHLHGQYSADTLLDWKKRISIAVGSAEGIAYLHHDATPHIIHGDIKAGNVLL  2839
             Y+PN SL SHLHGQ++A+  L W++R+ IA+ SAEGIAYLHH ATPHIIH DIK+ NVLL
Sbjct  116   YMPNLSLHSHLHGQHAAECHLGWERRMKIAIDSAEGIAYLHHQATPHIIHRDIKSSNVLL  175

Query  2838  DSNFQAQLAGFGIANFFPDDATRVTTRSKGTLGYLAPEYVMLGKESKSCDVYSFGILLLE  2659
             D NFQA++A FG A   PD AT VTT+ KGTLGYLAPEY MLGK S+SCDV+SFG+LLLE
Sbjct  176   DKNFQARVADFGFAKLIPDGATHVTTKVKGTLGYLAPEYAMLGKASESCDVFSFGVLLLE  235

Query  2658  LASGKKPIKKVSASKNWTITDWALPLACEGKFSELADPTLNGNYVEEELKRIVYVALICA  2479
             LASGK+P++K++ +   TIT+WALPLA + KF E+ADP L   +VE ELKR+V V L C+
Sbjct  236   LASGKRPVEKLNPTTKLTITEWALPLARDKKFKEIADPKLKDVFVEAELKRMVLVGLACS  295

Query  2478  QNQPEKRPTMLEVVELLKGESKEKLAALENNEMFK  2374
             QN+ E+RP M EVVELLKGES EKL+ LEN+EMFK
Sbjct  296   QNKQEQRPIMSEVVELLKGESAEKLSNLENDEMFK  330



>ref|XP_006647017.1| PREDICTED: PTI1-like tyrosine-protein kinase At3g15890-like [Oryza 
brachyantha]
Length=377

 Score =   404 bits (1038),  Expect = 4e-127, Method: Compositional matrix adjust.
 Identities = 191/275 (69%), Positives = 226/275 (82%), Gaps = 0/275 (0%)
 Frame = -2

Query  3198  YWGQLWDGSQIAVKRLKEWSNTAEVEFAAEVEILARARHKNLLALRGYCSEGQEHVLVYD  3019
             YWGQLWDGSQIAVKRLK WSN AE EFA EVE+LA  RHK+LL+LRGYC+EGQE ++VYD
Sbjct  56    YWGQLWDGSQIAVKRLKSWSNKAETEFAIEVEVLATVRHKSLLSLRGYCAEGQERLIVYD  115

Query  3018  YVPNFSLLSHLHGQYSADTLLDWKKRISIAVGSAEGIAYLHHDATPHIIHGDIKAGNVLL  2839
             Y+PN SL SHLHGQ++A+  L W++R+ IA+ SAEGIAYLHH ATPHIIH DIK+ NVLL
Sbjct  116   YMPNLSLHSHLHGQHAAECHLGWERRMKIAIDSAEGIAYLHHHATPHIIHRDIKSSNVLL  175

Query  2838  DSNFQAQLAGFGIANFFPDDATRVTTRSKGTLGYLAPEYVMLGKESKSCDVYSFGILLLE  2659
             DSNFQA++A FG A   PD AT VTT+ KGTLGYLAPEY MLGK S+SCDV+SFGILLLE
Sbjct  176   DSNFQARVADFGFAKLIPDGATHVTTKVKGTLGYLAPEYAMLGKASESCDVFSFGILLLE  235

Query  2658  LASGKKPIKKVSASKNWTITDWALPLACEGKFSELADPTLNGNYVEEELKRIVYVALICA  2479
             LASGK+P++K++ +   TIT+WALPLA + KF E+ADP L   + E ELKR+V V L C 
Sbjct  236   LASGKRPVEKLNPTTKLTITEWALPLARDKKFKEVADPKLKDVFEEAELKRMVLVGLACT  295

Query  2478  QNQPEKRPTMLEVVELLKGESKEKLAALENNEMFK  2374
             QN+ E+RP M EVVELLKGES EKL+ LEN+EMFK
Sbjct  296   QNKQEQRPVMSEVVELLKGESAEKLSNLENDEMFK  330



>ref|NP_001241751.1| BRASSINOSTEROID INSENSITIVE 1-associated receptor kinase 1 precursor 
[Zea mays]
 gb|ACG35003.1| BRASSINOSTEROID INSENSITIVE 1-associated receptor kinase 1 precursor 
[Zea mays]
Length=370

 Score =   402 bits (1034),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 189/291 (65%), Positives = 232/291 (80%), Gaps = 2/291 (1%)
 Frame = -2

Query  3198  YWGQLWDGSQIAVKRLKEWSNTAEVEFAAEVEILARARHKNLLALRGYCSEGQEHVLVYD  3019
             YWGQLWDGSQIAVKRLK WSN AE EFA EVE+LAR RH++LL+LRGYC+EGQE ++VYD
Sbjct  54    YWGQLWDGSQIAVKRLKSWSNKAETEFAVEVEVLARVRHRSLLSLRGYCAEGQERLIVYD  113

Query  3018  YVPNFSLLSHLHGQYSADTLLDWKKRISIAVGSAEGIAYLHHDATPHIIHGDIKAGNVLL  2839
             Y+PN S+ S LHGQ++A+  L W++R+ IAV SAEGIAYLHH ATPHIIH D+KA NVLL
Sbjct  114   YMPNLSIHSQLHGQHAAECNLSWERRMRIAVDSAEGIAYLHHSATPHIIHRDVKASNVLL  173

Query  2838  DSNFQAQLAGFGIANFFPDDATRVTTRSKGTLGYLAPEYVMLGKESKSCDVYSFGILLLE  2659
             D++FQA++A FG A   PD AT VTT+ KGTLGYLAPEY MLGK S+SCDV+SFG+ LLE
Sbjct  174   DADFQARVADFGFAKLVPDGATHVTTKVKGTLGYLAPEYAMLGKASESCDVFSFGVTLLE  233

Query  2658  LASGKKPIKKVS--ASKNWTITDWALPLACEGKFSELADPTLNGNYVEEELKRIVYVALI  2485
             LASG++P++K+S   S   T+T+WALPLA   +F E+ADP L G +VEEELKR+V V L+
Sbjct  234   LASGRRPVEKLSPTTSAKQTVTEWALPLARARRFGEIADPKLQGRFVEEELKRVVLVGLV  293

Query  2484  CAQNQPEKRPTMLEVVELLKGESKEKLAALENNEMFKNLKAATHKDGCAHE  2332
             CAQ++PE RPTM EVV+LLKGES EKL +LEN+ +FK    +     C  E
Sbjct  294   CAQDRPELRPTMSEVVQLLKGESAEKLDSLENDCLFKPGGGSFQGSDCVGE  344



>ref|XP_008676673.1| PREDICTED: uncharacterized LOC100216921 isoform X1 [Zea mays]
 gb|ACN33757.1| unknown [Zea mays]
 gb|AFW66263.1| putative protein kinase superfamily protein [Zea mays]
Length=377

 Score =   402 bits (1033),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 187/277 (68%), Positives = 230/277 (83%), Gaps = 2/277 (1%)
 Frame = -2

Query  3198  YWGQLWDGSQIAVKRLKEWSNTAEVEFAAEVEILARARHKNLLALRGYCSEGQEHVLVYD  3019
             YWGQLWDGSQIAVKRLK WSN AE EFA EVE+LAR RH++LL+LRGYC+EGQE ++VYD
Sbjct  57    YWGQLWDGSQIAVKRLKSWSNKAETEFAVEVEVLARVRHRSLLSLRGYCAEGQERLIVYD  116

Query  3018  YVPNFSLLSHLHGQYSADTLLDWKKRISIAVGSAEGIAYLHHDATPHIIHGDIKAGNVLL  2839
             Y+PN S+ S LHGQ++A+  L W++R+ IAV SAEGIAYLHH ATPHIIH D+KA NVLL
Sbjct  117   YMPNLSIHSQLHGQHAAECNLSWERRMRIAVDSAEGIAYLHHSATPHIIHRDVKASNVLL  176

Query  2838  DSNFQAQLAGFGIANFFPDDATRVTTRSKGTLGYLAPEYVMLGKESKSCDVYSFGILLLE  2659
             D++FQA++A FG A   PD AT VTT+ KGTLGYLAPEY MLGK S+SCDV+SFG+ LLE
Sbjct  177   DADFQARVADFGFAKLVPDGATHVTTKVKGTLGYLAPEYAMLGKASESCDVFSFGVTLLE  236

Query  2658  LASGKKPIKKVS--ASKNWTITDWALPLACEGKFSELADPTLNGNYVEEELKRIVYVALI  2485
             LASG++P++K+S  A+   T+T+WALPLA   +F E+ADP L G +VEEELKR+V V L+
Sbjct  237   LASGRRPVEKLSPTAAAKQTVTEWALPLARARRFGEIADPKLGGGFVEEELKRVVLVGLV  296

Query  2484  CAQNQPEKRPTMLEVVELLKGESKEKLAALENNEMFK  2374
             CAQ++PE RPTM EVV+LLKGES EKL +LEN+ +FK
Sbjct  297   CAQDRPELRPTMSEVVQLLKGESAEKLDSLENDCLFK  333



>gb|KHN37992.1| PTI1-like tyrosine-protein kinase [Glycine soja]
Length=347

 Score =   395 bits (1016),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 199/294 (68%), Positives = 240/294 (82%), Gaps = 2/294 (1%)
 Frame = -2

Query  3168  IAVKRLKEWSNTAEVEFAAEVEILARARHKNLLALRGYCSEGQEHVLVYDYVPNFSLLSH  2989
             IAVKRLK WSN AE EF  E+EILAR RHKNLL+LRGYC+EGQE ++VY+Y+ N SL SH
Sbjct  47    IAVKRLKVWSNIAETEFTVELEILARIRHKNLLSLRGYCAEGQERLIVYEYMQNLSLHSH  106

Query  2988  LHGQYSADTLLDWKKRISIAVGSAEGIAYLHHDATPHIIHGDIKAGNVLLDSNFQAQLAG  2809
             LHG +S + LLDW +R++IA+GSAEGI YLHH ATPHIIH DIKA NVLLDS+F+A++A 
Sbjct  107   LHGHHSFECLLDWNRRMNIAIGSAEGIVYLHHQATPHIIHRDIKASNVLLDSDFRARVAD  166

Query  2808  FGIANFFPDDATRVTTRSKGTLGYLAPEYVMLGKESKSCDVYSFGILLLELASGKKPIKK  2629
             FG A   PD AT VTT+ KGTLGYLAPEY MLGK ++SCDVYSFGILLLELASGK+PI+K
Sbjct  167   FGFAKLIPDGATHVTTKVKGTLGYLAPEYAMLGKANESCDVYSFGILLLELASGKRPIEK  226

Query  2628  VSASKNWTITDWALPLACEGKFSELADPTLNGNYVEEELKRIVYVALICAQNQPEKRPTM  2449
             ++++   +I DWALPL CE KFSE+ADP LNGNYVE ELKR+V VAL+CAQ+ PEKRPTM
Sbjct  227   LNSTVRRSIVDWALPLVCEKKFSEIADPRLNGNYVEGELKRVVLVALMCAQDLPEKRPTM  286

Query  2448  LEVVELLKGESKEKLAALENNEMFKNLKAATHKD--GCAHEDSQEFISEKQVLE  2293
             L+VVELLKGESK+K   +EN+EM ++L A    D    A EDS ++ISE++ LE
Sbjct  287   LDVVELLKGESKDKFYHIENSEMLRSLLAVESNDETSVAEEDSLDYISEEKELE  340



>ref|XP_007135761.1| hypothetical protein PHAVU_010G156500g [Phaseolus vulgaris]
 gb|ESW07755.1| hypothetical protein PHAVU_010G156500g [Phaseolus vulgaris]
Length=365

 Score =   394 bits (1013),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 199/304 (65%), Positives = 243/304 (80%), Gaps = 2/304 (1%)
 Frame = -2

Query  3198  YWGQLWDGSQIAVKRLKEWSNTAEVEFAAEVEILARARHKNLLALRGYCSEGQEHVLVYD  3019
             YWGQLWDGSQI VKRLK WSN  E EF  E+EILAR RHKNLL+ RG+C+EGQE ++VY+
Sbjct  53    YWGQLWDGSQIVVKRLKVWSNIDETEFTVELEILARIRHKNLLSFRGFCAEGQERLIVYE  112

Query  3018  YVPNFSLLSHLHGQYSADTLLDWKKRISIAVGSAEGIAYLHHDATPHIIHGDIKAGNVLL  2839
             Y+ N SL SHLHG +S ++ LDW +R+ IA+GSAEGI YLHH ATP IIH DIK+ NVLL
Sbjct  113   YMHNLSLHSHLHGHHSFESPLDWNRRMKIAIGSAEGIVYLHHQATPRIIHRDIKSSNVLL  172

Query  2838  DSNFQAQLAGFGIANFFPDDATRV-TTRSKGTLGYLAPEYVMLGKESKSCDVYSFGILLL  2662
             DS+F+A++A FG A   PD AT V TT+ KGTLGYLAPEY MLGK  +SCDVYSFG+LLL
Sbjct  173   DSDFRAKVADFGFARLIPDGATHVMTTKVKGTLGYLAPEYAMLGKAYESCDVYSFGVLLL  232

Query  2661  ELASGKKPIKKVSASKNWTITDWALPLACEGKFSELADPTLNGNYVEEELKRIVYVALIC  2482
             ELASG++P +K+S++   +I DWALPL CE KF E+ADP LNGNYVE ELKR+V VAL+ 
Sbjct  233   ELASGRRPTEKLSSTVRQSIVDWALPLVCEKKFGEIADPRLNGNYVEAELKRVVLVALMS  292

Query  2481  AQNQPEKRPTMLEVVELLKGESKEKLAALENNEMFKNLKAATHKDGCAH-EDSQEFISEK  2305
             AQ+ PEKRPTML+VVELLKGESK+K + +EN+EMF+N   A   DG +  EDS ++ISE+
Sbjct  293   AQDLPEKRPTMLDVVELLKGESKDKFSHIENSEMFRNPLDAETNDGTSETEDSFDYISEE  352

Query  2304  QVLE  2293
             + LE
Sbjct  353   KELE  356



>ref|XP_010545758.1| PREDICTED: PTI1-like tyrosine-protein kinase At3g15890 [Tarenaya 
hassleriana]
Length=356

 Score =   392 bits (1008),  Expect = 6e-123, Method: Compositional matrix adjust.
 Identities = 184/299 (62%), Positives = 234/299 (78%), Gaps = 3/299 (1%)
 Frame = -2

Query  3198  YWGQLWDGSQIAVKRLKEWSNTAEVEFAAEVEILARARHKNLLALRGYCSEGQEHVLVYD  3019
             YWGQLWDGSQIAVKRLK WSN  E++FA EVEILAR RHKNLL++RGYC+EGQE ++VYD
Sbjct  55    YWGQLWDGSQIAVKRLKAWSNREELDFAVEVEILARIRHKNLLSVRGYCAEGQERLIVYD  114

Query  3018  YVPNFSLLSHLHGQYSADTLLDWKKRISIAVGSAEGIAYLHHDATPHIIHGDIKAGNVLL  2839
             Y+PN SL+SHLHGQ+SA+ LLDW +R++IA+ S++ IAYLHH ATPHIIHGD++A NVLL
Sbjct  115   YMPNLSLVSHLHGQHSAECLLDWTRRMAIALSSSQAIAYLHHHATPHIIHGDVRASNVLL  174

Query  2838  DSNFQAQLAGFGIANFFPDDATRVTTRSKGTLGYLAPEYVMLGKESKSCDVYSFGILLLE  2659
             DS+F+A++  FG     PDDAT    ++KG LGYLAPE +  GKES+  DVYSFGILLLE
Sbjct  175   DSDFEARVTDFGYGKLIPDDATDGIAKTKGNLGYLAPECLAWGKESEKGDVYSFGILLLE  234

Query  2658  LASGKKPIKKVSASKNWTITDWALPLACEGKFSELADPTLNGNYVEEELKRIVYVALICA  2479
             L SGK+PI++V  +   TI +W LPLA E KF E+ D  LNG YVEEELK+ V V L+CA
Sbjct  235   LVSGKRPIERVDPATKRTIAEWVLPLARERKFGEIVDSRLNGKYVEEELKKTVLVGLVCA  294

Query  2478  QNQPEKRPTMLEVVELLKGESKEKLAALENNEMFKNLKAATHKDGCAHEDSQEFISEKQ  2302
             Q++PE+RPTM E VE+L  ESK+K+A LE + +FKNL+     +G   E++ + ISE++
Sbjct  295   QDKPEERPTMSEAVEMLMSESKQKMAELEAHPIFKNLQGG---NGIGAEENSDVISEEK  350



>gb|KDP37072.1| hypothetical protein JCGZ_06128 [Jatropha curcas]
Length=359

 Score =   392 bits (1007),  Expect = 8e-123, Method: Compositional matrix adjust.
 Identities = 204/306 (67%), Positives = 243/306 (79%), Gaps = 2/306 (1%)
 Frame = +3

Query  336   PFGQCFTVIVSDSGAPSGLVDAPQTAYSLNNDHARTDAREQEAVYEVMRATGNDWATEIP  515
             P  + F VIVSDS   S L+D  +  +  N   A+T+A EQ+AVYE+M+ATGNDWAT+IP
Sbjct  21    PIAKPFVVIVSDSSNQSALIDGLRNGFGTNMSGAQTEAHEQDAVYEIMKATGNDWATDIP  80

Query  516   DVCRGRWHGIECMPDKANVYHVVSLSFGALSDDTAFPTCDTAPRPFISPAVTKLLHLRTL  695
             DVCRGRWHGIECM DK NVYHVVSLSFGALSDDTAFP CD   + +IS A+TKL H+RTL
Sbjct  81    DVCRGRWHGIECMLDKDNVYHVVSLSFGALSDDTAFPACDPT-KSYISKAITKLPHIRTL  139

Query  696   FFYRCFTDNPQPIPTFlgqlgqtlqtlVLRENGHVGSIPNQLGNLTRLRVLDFHGNNLNG  875
             FFYRC + NPQPIP+FLGQLG TLQTLVLRENGHVG IP++LGNLTRL+VLD H NNLNG
Sbjct  140   FFYRCVSYNPQPIPSFLGQLGPTLQTLVLRENGHVGPIPSELGNLTRLKVLDLHKNNLNG  199

Query  876   SIPVSLSRIDGLRSLDLSRNKLAASIPNLTFPLLQILDLNQNHLVGSIPTALINCHSLMK  1055
             SIPVSL R+  LRSLDLS NKL  SIP+LTFP+L +LDLN+N L+GSIP++L +CHSL+K
Sbjct  200   SIPVSLGRLTSLRSLDLSGNKLTGSIPSLTFPVLNVLDLNRNFLMGSIPSSLGSCHSLIK  259

Query  1056  MDLSRNRLSGRIPDSIDALNNIILMDLSYNSITGPIPTTLKNLDFLQALVLSGNPMLSDT  1235
             MD S NRL+G IPDS   L  +ILMDLS+N ++  +P ++++L  LQALVL GNPM S T
Sbjct  260   MDFSHNRLTGSIPDSFSGLKELILMDLSHNRLSKSLPLSIRSLSSLQALVLEGNPM-STT  318

Query  1236  LPEHIF  1253
             L    F
Sbjct  319   LASDQF  324


 Score = 63.9 bits (154),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 55/166 (33%), Positives = 76/166 (46%), Gaps = 29/166 (17%)
 Frame = +3

Query  969   PLLQILDLNQNHLVGSIPTALINCHSLMKMDLSRNRLSGRIPDSIDALNNIILMDLSYNS  1148
             P LQ L L +N  VG IP+ L N   L  +DL +N L+G IP S+  L ++  +DLS N 
Sbjct  161   PTLQTLVLRENGHVGPIPSELGNLTRLKVLDLHKNNLNGSIPVSLGRLTSLRSLDLSGNK  220

Query  1149  ITGPIPTTLKNLDFLQALVLSGNPMLSDTLPEHIFLDGFKDLMILALSNMNLQGSIPESL  1328
             +TG IP+                               F  L +L L+   L GSIP SL
Sbjct  221   LTGSIPSLT-----------------------------FPVLNVLDLNRNFLMGSIPSSL  251

Query  1329  AKLPKIRVLHLDGNQLNGSIPASFGeldslselrldsNQLTGAVPF  1466
                  +  +    N+L GSIP SF  L  L  + L  N+L+ ++P 
Sbjct  252   GSCHSLIKMDFSHNRLTGSIPDSFSGLKELILMDLSHNRLSKSLPL  297



>gb|EPS62996.1| hypothetical protein M569_11790, partial [Genlisea aurea]
Length=397

 Score =   389 bits (999),  Expect = 4e-121, Method: Compositional matrix adjust.
 Identities = 228/403 (57%), Positives = 286/403 (71%), Gaps = 9/403 (2%)
 Frame = +3

Query  441   TDAREQEAVYEVMRATGNDWATEIPDVCRGRWHGIECMPDK--ANVYHVVSLSFGALSDD  614
             TD  E +AVY++MRATGN+WA  IPDVCR RWHGIEC+PD       HVVSLSFGALSDD
Sbjct  1     TDPLELQAVYDIMRATGNEWAESIPDVCRSRWHGIECLPDDDGGGALHVVSLSFGALSDD  60

Query  615   TAFPTCDTAPRPFISPAVTKLLHLRTLFFYRCFTDNPQPIPTFlgqlgqtlqtlVLRENG  794
             TAFPTC +   P IS AVTKL  LR+LFFYRC   NPQ IP FLG+LG  L+ LVLR NG
Sbjct  61    TAFPTCGSM-NPVISEAVTKLPRLRSLFFYRCLDGNPQEIPRFLGELGSGLRNLVLRGNG  119

Query  795   HVGSIPNQLGNLTRLRVLDFHGNNLNGSIPVSLSRIDGLRSLDLSRNKLAASIPNLTFPL  974
             HVG IP +LGNLT L VLD HGN+L+G++P SL RI GLRSLDLS N+L+ S+P++ FP+
Sbjct  120   HVGGIPEELGNLTGLEVLDLHGNDLSGAVPASLGRIRGLRSLDLSWNRLSGSVPSVDFPV  179

Query  975   LQILDLNQNHLVGSIPTALINC-HSLMKMDLSRNRLSGRIPDSIDALNNIILMDLSYNSI  1151
             +++LDLN N   G++P  +++   +L+K+DLS N  SG I   + AL N+IL+DLSYN +
Sbjct  180   IRVLDLNGNRFAGALPIRMLSSGDALLKVDLSGNEFSGGI-HGLSALKNLILLDLSYNEL  238

Query  1152  TGPIPTTLKNLDFLQALVLSGNPMLSDTLPEHIFLDGFKDLMILALSNMNLQGSIPESLA  1331
              G +P +L  L  LQAL+L+GNPM    LPE  F+     L++L LS+M+L+G IP S+ 
Sbjct  239   VGALPESLSGLASLQALILAGNPMAGAALPETAFVG-LSSLLVLVLSDMSLEGPIPRSIG  297

Query  1332  KLPKIRVLHLDGNQLNGSIPASFGeldslselrldsNQLTGAVPFKREMVWRMRRKLKLS  1511
             +L  +RVL LDGN+LNGSIP SF  L  LSELRLDS +LTG +PF  EM+ RM RKL+L 
Sbjct  298   ELKTLRVLRLDGNRLNGSIPESFSALSRLSELRLDSCRLTGPIPFTGEMISRMGRKLRLE  357

Query  1512  NNSGLCYDAKTGLGDDLEAISDSGISHCGSQATEPTRTVEHIS  1640
             NN GLCY    G+ DDL  I+D GI  C +    P   +E +S
Sbjct  358   NNLGLCY-GGGGIEDDL-MIAD-GIPRCDTLNGRPDVEIERLS  397



>ref|XP_003570874.1| PREDICTED: PTI1-like tyrosine-protein kinase At3g15890 [Brachypodium 
distachyon]
Length=369

 Score =   385 bits (988),  Expect = 7e-120, Method: Compositional matrix adjust.
 Identities = 191/299 (64%), Positives = 241/299 (81%), Gaps = 1/299 (0%)
 Frame = -2

Query  3198  YWGQLWDGSQIAVKRLKEWSNTAEVEFAAEVEILARARHKNLLALRGYCSEGQEHVLVYD  3019
             YWGQLWDGSQIAVKRLK WSN AE EFA EVE+LAR RHK+LL+LRGYC+EGQE ++VYD
Sbjct  51    YWGQLWDGSQIAVKRLKSWSNKAEKEFAIEVEVLARVRHKSLLSLRGYCAEGQERLIVYD  110

Query  3018  YVPNFSLLSHLHGQYSADTLLDWKKRISIAVGSAEGIAYLHHDATPHIIHGDIKAGNVLL  2839
             Y+ N SL SHLHGQ++A+  L W++R++IA+ SAEGIAYLHH A PHIIH D+KA NVLL
Sbjct  111   YMQNLSLHSHLHGQHAAECHLSWERRMNIAIDSAEGIAYLHHHAIPHIIHRDVKASNVLL  170

Query  2838  DSNFQAQLAGFGIANFFPDDATRVTTRSKGTLGYLAPEYVMLGKESKSCDVYSFGILLLE  2659
             D+NFQA++A FG A   P+  T VTT+ KGTLGYLAPEY MLGK  +SCDVYSFG+LLLE
Sbjct  171   DANFQARVADFGFAKLIPEGVTHVTTKVKGTLGYLAPEYAMLGKAKESCDVYSFGVLLLE  230

Query  2658  LASGKKPIKKVSASKNWTITDWALPLACEGKFSELADPTLNGNYVEEELKRIVYVALICA  2479
             LASGKKP++K++ +   TIT+WALPLAC+ KF E+ADP L  +++E E+KR+V V L C 
Sbjct  231   LASGKKPVEKINPTTKLTITEWALPLACDKKFKEMADPKLKDSFIEAEVKRMVLVGLACT  290

Query  2478  QNQPEKRPTMLEVVELLKGESKEKLAALENNEMFKNLKAATHKDGCAHEDSQEFISEKQ  2302
             Q +PE+RP M EVVELLKGES EKL+ LEN E+FK  +A++ + G +  +S + I+E++
Sbjct  291   QKKPEQRPIMSEVVELLKGESAEKLSNLENGELFKPEQASSCQ-GTSGPNSSDVITEEK  348



>ref|XP_002983581.1| hypothetical protein SELMODRAFT_118274, partial [Selaginella 
moellendorffii]
 gb|EFJ15482.1| hypothetical protein SELMODRAFT_118274, partial [Selaginella 
moellendorffii]
Length=338

 Score =   382 bits (982),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 187/307 (61%), Positives = 225/307 (73%), Gaps = 5/307 (2%)
 Frame = -2

Query  3198  YWGQLWDGSQIAVKRLKEWSNTAEVEFAAEVEILARARHKNLLALRGYCSEGQEHVLVYD  3019
             YWGQLWDGSQIAVKRLK WS  AE+EF+ EVEIL R RHKNLL+LRGYC+EGQE ++VYD
Sbjct  31    YWGQLWDGSQIAVKRLKVWSTKAEMEFSVEVEILGRVRHKNLLSLRGYCAEGQERLIVYD  90

Query  3018  YVPNFSLLSHLHGQYSADTLLDWKKRISIAVGSAEGIAYLHHDATPHIIHGDIKAGNVLL  2839
             Y+PN SLLSHLHGQ++ D  LDW KR++IA+GSAEG+ YLHH+ATPHIIH D+KA NVLL
Sbjct  91    YMPNLSLLSHLHGQFAPDNQLDWDKRMNIAIGSAEGLEYLHHNATPHIIHRDVKASNVLL  150

Query  2838  DSNFQAQLAGFGIANFFPDDATRVTTRSKGTLGYLAPEYVMLGKESKSCDVYSFGILLLE  2659
             +S+F+AQ+A FG A   P+ AT VTTR KGTLGYLAPEY M GK S+SCDVYSFGILLLE
Sbjct  151   NSDFEAQVADFGFAKLVPEGATHVTTRVKGTLGYLAPEYAMWGKVSESCDVYSFGILLLE  210

Query  2658  LASGKKPIKKVSASKNWTITDWALPLACEGKFSELADPTLNGNYVEEELKRIVYVALICA  2479
             L SGKKPI+K+      TI +WA PL  +G+ +EL DP L G +  EELK +V+VA +CA
Sbjct  211   LISGKKPIEKLGPGTKRTIVEWAAPLVFQGRLTELVDPKLQGKFNAEELKNVVHVATMCA  270

Query  2478  QNQPEKRPTMLEVVELL-KGESKEKLAALENNEMFKNLKAATHKDGCAHEDSQEFISEKQ  2302
             QN PE RPTM EVV++L KG   E   +LE+ +  K L    + D     D  E  +   
Sbjct  271   QNTPENRPTMHEVVQILRKGPRGE---SLESEKKLK-LDTVKYGDELLEADDSEVKTRTA  326

Query  2301  VLEPEIG  2281
                P  G
Sbjct  327   TTTPSSG  333



>ref|XP_002973814.1| hypothetical protein SELMODRAFT_149289 [Selaginella moellendorffii]
 gb|EFJ24769.1| hypothetical protein SELMODRAFT_149289 [Selaginella moellendorffii]
Length=360

 Score =   382 bits (982),  Expect = 4e-119, Method: Compositional matrix adjust.
 Identities = 187/307 (61%), Positives = 225/307 (73%), Gaps = 5/307 (2%)
 Frame = -2

Query  3198  YWGQLWDGSQIAVKRLKEWSNTAEVEFAAEVEILARARHKNLLALRGYCSEGQEHVLVYD  3019
             YWGQLWDGSQIAVKRLK WS  AE+EF+ EVEIL R RHKNLL+LRGYC+EGQE ++VYD
Sbjct  53    YWGQLWDGSQIAVKRLKVWSTKAEMEFSVEVEILGRVRHKNLLSLRGYCAEGQERLIVYD  112

Query  3018  YVPNFSLLSHLHGQYSADTLLDWKKRISIAVGSAEGIAYLHHDATPHIIHGDIKAGNVLL  2839
             Y+PN SLLSHLHGQ++ D  LDW KR++IA+GSAEG+ YLHH+ATPHIIH D+KA NVLL
Sbjct  113   YMPNLSLLSHLHGQFAPDNQLDWDKRMNIAIGSAEGLEYLHHNATPHIIHRDVKASNVLL  172

Query  2838  DSNFQAQLAGFGIANFFPDDATRVTTRSKGTLGYLAPEYVMLGKESKSCDVYSFGILLLE  2659
             +S+F+AQ+A FG A   P+ AT VTTR KGTLGYLAPEY M GK S+SCDVYSFGILLLE
Sbjct  173   NSDFEAQVADFGFAKLVPEGATHVTTRVKGTLGYLAPEYAMWGKVSESCDVYSFGILLLE  232

Query  2658  LASGKKPIKKVSASKNWTITDWALPLACEGKFSELADPTLNGNYVEEELKRIVYVALICA  2479
             L SGKKPI+K+      TI +WA PL  +G+ +EL DP L G +  EELK +V+VA +CA
Sbjct  233   LISGKKPIEKLGPGTKRTIVEWAAPLVFQGRLTELVDPKLQGKFNAEELKNVVHVATMCA  292

Query  2478  QNQPEKRPTMLEVVELL-KGESKEKLAALENNEMFKNLKAATHKDGCAHEDSQEFISEKQ  2302
             QN PE RPTM EVV++L KG   E   +LE+ +  K L    + D     D  E  +   
Sbjct  293   QNTPENRPTMHEVVQILRKGPRGE---SLESEKKLK-LDTVKYGDELLEADDSEVKTRTA  348

Query  2301  VLEPEIG  2281
                P  G
Sbjct  349   TTTPSSG  355



>gb|KHN01323.1| PTI1-like tyrosine-protein kinase [Glycine soja]
Length=408

 Score =   384 bits (985),  Expect = 7e-119, Method: Compositional matrix adjust.
 Identities = 193/293 (66%), Positives = 239/293 (82%), Gaps = 1/293 (0%)
 Frame = -2

Query  3168  IAVKRLKEWSNTAEVEFAAEVEILARARHKNLLALRGYCSEGQEHVLVYDYVPNFSLLSH  2989
             IAVKRLK WSN AE EF  E+EILAR RHKNLL+LRGYC+EGQE ++VY+Y+ N SL SH
Sbjct  109   IAVKRLKVWSNRAETEFTVELEILARIRHKNLLSLRGYCAEGQERLIVYEYMQNLSLHSH  168

Query  2988  LHGQYSADTLLDWKKRISIAVGSAEGIAYLHHDATPHIIHGDIKAGNVLLDSNFQAQLAG  2809
             LHG +S + LLDW +R++IA+GSAEGI YLHH ATPHIIH DIKA NVLLDS+F+A++A 
Sbjct  169   LHGHHSFECLLDWNRRMNIAIGSAEGIVYLHHQATPHIIHRDIKASNVLLDSDFRARVAD  228

Query  2808  FGIANFFPDDATRVTTRSKGTLGYLAPEYVMLGKESKSCDVYSFGILLLELASGKKPIKK  2629
             FG A   PD AT +TT+ KGTLGYLAPEY MLGK ++SCDVYSFGILLLEL SGK+PI+K
Sbjct  229   FGFAKLMPDGATHMTTKVKGTLGYLAPEYAMLGKANESCDVYSFGILLLELTSGKRPIEK  288

Query  2628  VSASKNWTITDWALPLACEGKFSELADPTLNGNYVEEELKRIVYVALICAQNQPEKRPTM  2449
             ++++   +I DWAL L CE KFSE+ADP LNGNYVE ELKR+V VAL+CAQ+ PEKRPT+
Sbjct  289   LNSTVRRSIVDWALHLVCEKKFSEIADPRLNGNYVEGELKRVVLVALMCAQDLPEKRPTI  348

Query  2448  LEVVELLKGESKEKLAALENNEMFKNLKAATHKDGCA-HEDSQEFISEKQVLE  2293
             L+V+ELLKGESK+K   +EN+EMF++L A    D  +  EDS ++ISE++ L+
Sbjct  349   LDVIELLKGESKDKFYHIENSEMFRSLLAVESNDETSVAEDSLDYISEEKELQ  401


 Score =   122 bits (306),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 70/167 (42%), Positives = 89/167 (53%), Gaps = 29/167 (17%)
 Frame = -2

Query  2940  ISIAVGSAEGIA-------------------YLHHDATPHIIHGDIKAGNVLLDSNFQAQ  2818
             ++IA+G AEGI                    YLHH ATPHIIH DIKA NV LDS+FQA+
Sbjct  1     MNIAIGYAEGIVSTNLIFRMSFFHYHCFTFRYLHHQATPHIIHRDIKANNVYLDSDFQAR  60

Query  2817  LAGFGIANFFPDDATRVTTRSKGTLGYLAPEYVMLGKESKSCDVYSFGILLLELASGKKP  2638
             + GF  A   PD A  V+T  KGTL YLAPEY MLGK ++ CDVYSFGI           
Sbjct  61    IGGFRFAKLIPDGAIHVSTEVKGTLSYLAPEYAMLGKANEGCDVYSFGI----------A  110

Query  2637  IKKVSASKNWTITDWALPLACEGKFSELADPTLNGNYVEEELKRIVY  2497
             +K++    N   T++ + L    +       +L G   E + + IVY
Sbjct  111   VKRLKVWSNRAETEFTVELEILARIRHKNLLSLRGYCAEGQERLIVY  157



>ref|XP_006406905.1| hypothetical protein EUTSA_v10020984mg [Eutrema salsugineum]
 gb|ESQ48358.1| hypothetical protein EUTSA_v10020984mg [Eutrema salsugineum]
Length=366

 Score =   378 bits (971),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 180/305 (59%), Positives = 229/305 (75%), Gaps = 6/305 (2%)
 Frame = -2

Query  3198  YWGQLWDGSQIAVKRLKEWSNTAEVEFAAEVEILARARHKNLLALRGYCSEGQEHVLVYD  3019
             YWGQLWDGSQ+AVKRLK WSN  E++F  EVEILAR RHKNLL++RGYC+EGQE +LVYD
Sbjct  54    YWGQLWDGSQVAVKRLKAWSNREEIDFVVEVEILARIRHKNLLSVRGYCAEGQERLLVYD  113

Query  3018  YVPNFSLLSHLHGQYSADTLLDWKKRISIAVGSAEGIAYLHHDATPHIIHGDIKAGNVLL  2839
             Y+PN SL+SHLHGQ+SA+ LLD  KRI IA+ SA+ IAYLHH ATPHI+HGD++A NVLL
Sbjct  114   YMPNLSLVSHLHGQHSAECLLDCTKRIKIAISSAQAIAYLHHHATPHIVHGDVRASNVLL  173

Query  2838  DSNFQAQLAGFGIANFFPDDATRVTTRSKGTLGYLAPEYVMLGKESKSCDVYSFGILLLE  2659
             DS F+AQ+  FG     PDD     T+ K   GYL+PE V  GKES++ DVYSFGILLLE
Sbjct  174   DSEFEAQVTDFGYGKLMPDDTEDGATKGKSNNGYLSPECVASGKESETGDVYSFGILLLE  233

Query  2658  LASGKKPIKKVSASKNWTITDWALPLACEGKFSELADPTLNGNYVEEELKRIVYVALICA  2479
             L SGK+PI++++ +    IT+W LPL  E KF E+ D  L+G +VEE+LK++V V L+CA
Sbjct  234   LVSGKRPIERLNTTTKRGITEWVLPLVYERKFGEIVDQRLSGEHVEEKLKKVVLVGLMCA  293

Query  2478  QNQPEKRPTMLEVVELLKGESKEKLAALENNEMFKNLKAA------THKDGCAHEDSQEF  2317
             Q +PEKRPTM EVVELL  ESKEK++ LE N +FKN  ++       +++    E+S + 
Sbjct  294   QTEPEKRPTMSEVVELLMNESKEKMSELEANPLFKNPYSSNENENENNREQQVAEESSDV  353

Query  2316  ISEKQ  2302
             ISE++
Sbjct  354   ISEEK  358



>ref|XP_006305213.1| hypothetical protein CARUB_v10009580mg [Capsella rubella]
 ref|XP_006305214.1| hypothetical protein CARUB_v10009580mg [Capsella rubella]
 gb|EOA38111.1| hypothetical protein CARUB_v10009580mg [Capsella rubella]
 gb|EOA38112.1| hypothetical protein CARUB_v10009580mg [Capsella rubella]
Length=353

 Score =   374 bits (960),  Expect = 4e-116, Method: Compositional matrix adjust.
 Identities = 178/301 (59%), Positives = 224/301 (74%), Gaps = 7/301 (2%)
 Frame = -2

Query  3198  YWGQLWDGSQIAVKRLKEWSNTAEVEFAAEVEILARARHKNLLALRGYCSEGQEHVLVYD  3019
             YWGQLWDGSQIAVKRLK WSN  E++FA EVEILAR RHKNLL++RGYC+EGQE ++VYD
Sbjct  55    YWGQLWDGSQIAVKRLKAWSNREEIDFAVEVEILARIRHKNLLSVRGYCAEGQERLIVYD  114

Query  3018  YVPNFSLLSHLHGQYSADTLLDWKKRISIAVGSAEGIAYLHHDATPHIIHGDIKAGNVLL  2839
             Y+PN SL+SHLHGQ+S+D+LLDW +R++IAV SA+ IAYLHH ATP I+HGD++A NVLL
Sbjct  115   YMPNLSLVSHLHGQHSSDSLLDWTRRMNIAVTSAQAIAYLHHFATPRIVHGDVRASNVLL  174

Query  2838  DSNFQAQLAGFGIANFFPDDATRVTTR--SKGTLGYLAPEYVMLGKESKSCDVYSFGILL  2665
             DS F+A++  FG     PDDA     +      +GYL+PE +  GKES   DVYSFGI+L
Sbjct  175   DSEFEARVTDFGYGKMMPDDARDGGNKIIKGNNIGYLSPECIESGKESDMGDVYSFGIVL  234

Query  2664  LELASGKKPIKKVSASKNWTITDWALPLACEGKFSELADPTLNGNYVEEELKRIVYVALI  2485
             LEL +GK+PI++ + +    IT+W LPL  E KF E+ D  LNG YVEEELKR++ V LI
Sbjct  235   LELVTGKRPIERANLTTKQGITEWVLPLVYERKFGEIVDQRLNGKYVEEELKRVILVGLI  294

Query  2484  CAQNQPEKRPTMLEVVELLKGESKEKLAALENNEMFKNLKAATHKDGCAHEDSQEFISEK  2305
             CAQ +PEKRPTM EVVE+L  ESKEK++ LE N +F       H +G    +S E ISE+
Sbjct  295   CAQREPEKRPTMSEVVEMLMNESKEKMSQLEANPLFNG-----HNEGEVINESSEIISEE  349

Query  2304  Q  2302
             +
Sbjct  350   R  350



>ref|XP_010465584.1| PREDICTED: PTI1-like tyrosine-protein kinase At3g15890 isoform 
X2 [Camelina sativa]
Length=349

 Score =   373 bits (958),  Expect = 7e-116, Method: Compositional matrix adjust.
 Identities = 175/297 (59%), Positives = 228/297 (77%), Gaps = 1/297 (0%)
 Frame = -2

Query  3198  YWGQLWDGSQIAVKRLKEWSNTAEVEFAAEVEILARARHKNLLALRGYCSEGQEHVLVYD  3019
             YWGQLWDGSQIAVKRLK WSN  E++FA EVEILAR RHKNLL++RGYC+EGQE +LVY+
Sbjct  53    YWGQLWDGSQIAVKRLKAWSNREEIDFAVEVEILARIRHKNLLSVRGYCAEGQERLLVYE  112

Query  3018  YVPNFSLLSHLHGQYSADTLLDWKKRISIAVGSAEGIAYLHHDATPHIIHGDIKAGNVLL  2839
             Y+PN SL+SHLHGQ+SA+ LLDW KR+ IA+ SA+ IAYLHH+ATP IIHGD++A NVLL
Sbjct  113   YMPNLSLVSHLHGQHSAECLLDWTKRMKIAISSAQAIAYLHHNATPQIIHGDVRASNVLL  172

Query  2838  DSNFQAQLAGFGIANFFPDDATRVTTRSKGTLGYLAPEYVMLGKESKSCDVYSFGILLLE  2659
             DS F+A++  FG     PDD     T++K + GY++PE V  GKES++ DVYSFGILLL 
Sbjct  173   DSEFEARVTDFGYGKLMPDDTGDGATKAKSSNGYISPECVASGKESEASDVYSFGILLLV  232

Query  2658  LASGKKPIKKVSASKNWTITDWALPLACEGKFSELADPTLNGNYVEEELKRIVYVALICA  2479
             L SGK+P+++++A+    IT+W LPL  E KF E+ D  L+  +VEE+LK++V V L+CA
Sbjct  233   LVSGKRPLERLNATTTRGITEWVLPLVYERKFVEIVDQRLSEEHVEEKLKKVVLVGLMCA  292

Query  2478  QNQPEKRPTMLEVVELLKGESKEKLAALENNEMFKNLKAATHKDG-CAHEDSQEFIS  2311
             Q +PEKRPTM +VVE+L  ESKEK++ LE+N +FKN  ++   D   A E+S +  S
Sbjct  293   QTEPEKRPTMSQVVEMLMNESKEKMSELEDNPLFKNPFSSNENDSEQAAEESSDVTS  349



>ref|XP_010465583.1| PREDICTED: PTI1-like tyrosine-protein kinase At3g15890 isoform 
X1 [Camelina sativa]
Length=350

 Score =   374 bits (959),  Expect = 7e-116, Method: Compositional matrix adjust.
 Identities = 175/297 (59%), Positives = 228/297 (77%), Gaps = 1/297 (0%)
 Frame = -2

Query  3198  YWGQLWDGSQIAVKRLKEWSNTAEVEFAAEVEILARARHKNLLALRGYCSEGQEHVLVYD  3019
             YWGQLWDGSQIAVKRLK WSN  E++FA EVEILAR RHKNLL++RGYC+EGQE +LVY+
Sbjct  54    YWGQLWDGSQIAVKRLKAWSNREEIDFAVEVEILARIRHKNLLSVRGYCAEGQERLLVYE  113

Query  3018  YVPNFSLLSHLHGQYSADTLLDWKKRISIAVGSAEGIAYLHHDATPHIIHGDIKAGNVLL  2839
             Y+PN SL+SHLHGQ+SA+ LLDW KR+ IA+ SA+ IAYLHH+ATP IIHGD++A NVLL
Sbjct  114   YMPNLSLVSHLHGQHSAECLLDWTKRMKIAISSAQAIAYLHHNATPQIIHGDVRASNVLL  173

Query  2838  DSNFQAQLAGFGIANFFPDDATRVTTRSKGTLGYLAPEYVMLGKESKSCDVYSFGILLLE  2659
             DS F+A++  FG     PDD     T++K + GY++PE V  GKES++ DVYSFGILLL 
Sbjct  174   DSEFEARVTDFGYGKLMPDDTGDGATKAKSSNGYISPECVASGKESEASDVYSFGILLLV  233

Query  2658  LASGKKPIKKVSASKNWTITDWALPLACEGKFSELADPTLNGNYVEEELKRIVYVALICA  2479
             L SGK+P+++++A+    IT+W LPL  E KF E+ D  L+  +VEE+LK++V V L+CA
Sbjct  234   LVSGKRPLERLNATTTRGITEWVLPLVYERKFVEIVDQRLSEEHVEEKLKKVVLVGLMCA  293

Query  2478  QNQPEKRPTMLEVVELLKGESKEKLAALENNEMFKNLKAATHKDG-CAHEDSQEFIS  2311
             Q +PEKRPTM +VVE+L  ESKEK++ LE+N +FKN  ++   D   A E+S +  S
Sbjct  294   QTEPEKRPTMSQVVEMLMNESKEKMSELEDNPLFKNPFSSNENDSEQAAEESSDVTS  350



>gb|AAD55610.1|AC008016_20 Contains PF|00069 Eukaryotic protein kinase domain. ESTs gb|W43822, 
gb|T20475 and gb|AA586152 come from this gene [Arabidopsis 
thaliana]
Length=347

 Score =   371 bits (952),  Expect = 5e-115, Method: Compositional matrix adjust.
 Identities = 177/297 (60%), Positives = 223/297 (75%), Gaps = 6/297 (2%)
 Frame = -2

Query  3198  YWGQLWDGSQIAVKRLKEWSNTAEVEFAAEVEILARARHKNLLALRGYCSEGQEHVLVYD  3019
             YWGQLWDGSQIAVKRLK WS+  E++FA EVEILAR RHKNLL++RGYC+EGQE ++VYD
Sbjct  52    YWGQLWDGSQIAVKRLKAWSSREEIDFAVEVEILARIRHKNLLSVRGYCAEGQERLIVYD  111

Query  3018  YVPNFSLLSHLHGQYSADTLLDWKKRISIAVGSAEGIAYLHHDATPHIIHGDIKAGNVLL  2839
             Y+PN SL+SHLHGQ+S+++LLDW +R++IAV SA+ IAYLHH ATP I+HGD++A NVLL
Sbjct  112   YMPNLSLVSHLHGQHSSESLLDWTRRMNIAVSSAQAIAYLHHFATPRIVHGDVRASNVLL  171

Query  2838  DSNFQAQLAGFGIANFFPDDATRVTTRSKGTLGYLAPEYVMLGKESKSCDVYSFGILLLE  2659
             DS F+A++  FG     PDD    +T+    +GYL+PE +  GKES   DVYSFG+LLLE
Sbjct  172   DSEFEARVTDFGYDKLMPDDGANKSTKG-NNIGYLSPECIESGKESDMGDVYSFGVLLLE  230

Query  2658  LASGKKPIKKVSASKNWTITDWALPLACEGKFSELADPTLNGNYVEEELKRIVYVALICA  2479
             L +GK+P ++V+ +    IT+W LPL  E KF E+ D  LNG YVEEELKRIV V L+CA
Sbjct  231   LVTGKRPTERVNLTTKRGITEWVLPLVYERKFGEIVDQRLNGKYVEEELKRIVLVGLMCA  290

Query  2478  QNQPEKRPTMLEVVELLKGESKEKLAALENNEMFKNLKAATHKDGCAHEDSQEFISE  2308
             Q + EKRPTM EVVE+L  ESKEK+A LE N +F       + DG   ++S E ISE
Sbjct  291   QRESEKRPTMSEVVEMLMIESKEKMAQLEANPLFNG-----NNDGEVIDESSEIISE  342



>ref|XP_002882968.1| hypothetical protein ARALYDRAFT_479045 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH59227.1| hypothetical protein ARALYDRAFT_479045 [Arabidopsis lyrata subsp. 
lyrata]
Length=359

 Score =   371 bits (952),  Expect = 9e-115, Method: Compositional matrix adjust.
 Identities = 170/276 (62%), Positives = 215/276 (78%), Gaps = 0/276 (0%)
 Frame = -2

Query  3198  YWGQLWDGSQIAVKRLKEWSNTAEVEFAAEVEILARARHKNLLALRGYCSEGQEHVLVYD  3019
             YWGQLWDGSQIAVKRLK WSN  E++FA EVEILAR RHKNLL++RGYC+EGQE +LVY+
Sbjct  54    YWGQLWDGSQIAVKRLKAWSNREEIDFAVEVEILARIRHKNLLSVRGYCAEGQERLLVYE  113

Query  3018  YVPNFSLLSHLHGQYSADTLLDWKKRISIAVGSAEGIAYLHHDATPHIIHGDIKAGNVLL  2839
             Y+PN SL+SHLHGQ+SA+ LLDW KR+ IA+ SA+ IAYLH  ATPHI+HGD++A NVLL
Sbjct  114   YMPNLSLVSHLHGQHSAECLLDWTKRMKIAISSAQAIAYLHDHATPHIVHGDVRASNVLL  173

Query  2838  DSNFQAQLAGFGIANFFPDDATRVTTRSKGTLGYLAPEYVMLGKESKSCDVYSFGILLLE  2659
             DS F+A++  FG     PDD     TR+K   GY++PEYV  GKES++ DVYSFGILLL 
Sbjct  174   DSEFEARVTDFGYGKLMPDDTGDGATRAKSNNGYISPEYVTSGKESETSDVYSFGILLLV  233

Query  2658  LASGKKPIKKVSASKNWTITDWALPLACEGKFSELADPTLNGNYVEEELKRIVYVALICA  2479
             L SGK+P+++++ +    IT+W LPL  E KF E+ D  L+  +VEE+LK++V V L+CA
Sbjct  234   LVSGKRPLERLNPTTTRGITEWVLPLVYERKFGEIVDKRLSEEHVEEKLKKVVLVGLMCA  293

Query  2478  QNQPEKRPTMLEVVELLKGESKEKLAALENNEMFKN  2371
             Q  P+KRPTM EVVE+L  ESKEK++ LE N +FKN
Sbjct  294   QTDPDKRPTMSEVVEMLVNESKEKMSELEANPLFKN  329



>ref|NP_564609.3| protein kinase superfamily protein [Arabidopsis thaliana]
 gb|AAM63304.1| somatic embryogenesis receptor-like kinase, putative [Arabidopsis 
thaliana]
 gb|AEE32820.1| protein kinase superfamily protein [Arabidopsis thaliana]
Length=350

 Score =   370 bits (951),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 177/297 (60%), Positives = 223/297 (75%), Gaps = 6/297 (2%)
 Frame = -2

Query  3198  YWGQLWDGSQIAVKRLKEWSNTAEVEFAAEVEILARARHKNLLALRGYCSEGQEHVLVYD  3019
             YWGQLWDGSQIAVKRLK WS+  E++FA EVEILAR RHKNLL++RGYC+EGQE ++VYD
Sbjct  55    YWGQLWDGSQIAVKRLKAWSSREEIDFAVEVEILARIRHKNLLSVRGYCAEGQERLIVYD  114

Query  3018  YVPNFSLLSHLHGQYSADTLLDWKKRISIAVGSAEGIAYLHHDATPHIIHGDIKAGNVLL  2839
             Y+PN SL+SHLHGQ+S+++LLDW +R++IAV SA+ IAYLHH ATP I+HGD++A NVLL
Sbjct  115   YMPNLSLVSHLHGQHSSESLLDWTRRMNIAVSSAQAIAYLHHFATPRIVHGDVRASNVLL  174

Query  2838  DSNFQAQLAGFGIANFFPDDATRVTTRSKGTLGYLAPEYVMLGKESKSCDVYSFGILLLE  2659
             DS F+A++  FG     PDD    +T+    +GYL+PE +  GKES   DVYSFG+LLLE
Sbjct  175   DSEFEARVTDFGYDKLMPDDGANKSTKGN-NIGYLSPECIESGKESDMGDVYSFGVLLLE  233

Query  2658  LASGKKPIKKVSASKNWTITDWALPLACEGKFSELADPTLNGNYVEEELKRIVYVALICA  2479
             L +GK+P ++V+ +    IT+W LPL  E KF E+ D  LNG YVEEELKRIV V L+CA
Sbjct  234   LVTGKRPTERVNLTTKRGITEWVLPLVYERKFGEIVDQRLNGKYVEEELKRIVLVGLMCA  293

Query  2478  QNQPEKRPTMLEVVELLKGESKEKLAALENNEMFKNLKAATHKDGCAHEDSQEFISE  2308
             Q + EKRPTM EVVE+L  ESKEK+A LE N +F       + DG   ++S E ISE
Sbjct  294   QRESEKRPTMSEVVEMLMIESKEKMAQLEANPLFNG-----NNDGEVIDESSEIISE  345



>ref|XP_002894383.1| hypothetical protein ARALYDRAFT_337406 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH70642.1| hypothetical protein ARALYDRAFT_337406 [Arabidopsis lyrata subsp. 
lyrata]
Length=350

 Score =   370 bits (950),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 175/298 (59%), Positives = 226/298 (76%), Gaps = 6/298 (2%)
 Frame = -2

Query  3198  YWGQLWDGSQIAVKRLKEWSNTAEVEFAAEVEILARARHKNLLALRGYCSEGQEHVLVYD  3019
             YWGQLWDGSQIAVKRLK WS+  +++FA EVEILAR RHKNLL++RGYC+EGQE ++VYD
Sbjct  55    YWGQLWDGSQIAVKRLKAWSSREDIDFAVEVEILARIRHKNLLSVRGYCAEGQERLIVYD  114

Query  3018  YVPNFSLLSHLHGQYSADTLLDWKKRISIAVGSAEGIAYLHHDATPHIIHGDIKAGNVLL  2839
             Y+PN SL+SHLHGQ+S+++LLDW +R++IAV SA+ I+YLHH ATP I+HGD++A NVLL
Sbjct  115   YMPNLSLVSHLHGQHSSESLLDWTRRMNIAVTSAQAISYLHHFATPRIVHGDVRASNVLL  174

Query  2838  DSNFQAQLAGFGIANFFPDDATRVTTRSKGTLGYLAPEYVMLGKESKSCDVYSFGILLLE  2659
             DS F+A++  FG     PDD    +T+    +GYL+PE +  GKES   DVYSFG+LLLE
Sbjct  175   DSEFEARVTDFGYDKLMPDDGANKSTKGN-NIGYLSPECIESGKESDMGDVYSFGVLLLE  233

Query  2658  LASGKKPIKKVSASKNWTITDWALPLACEGKFSELADPTLNGNYVEEELKRIVYVALICA  2479
             L +GK+PI+KV+ +    IT+W LPL  E KF E+ D  LNG YVEEELKR+V V L+CA
Sbjct  234   LVTGKRPIEKVNLTTKRGITEWVLPLVYERKFGEIVDQRLNGKYVEEELKRVVLVGLMCA  293

Query  2478  QNQPEKRPTMLEVVELLKGESKEKLAALENNEMFKNLKAATHKDGCAHEDSQEFISEK  2305
             + +PEKRPTM EVVE+L  ESKEK+A LE N +F       + +G   ++S E ISE+
Sbjct  294   RREPEKRPTMSEVVEMLMNESKEKMAQLEANPLFNG-----NNEGEIIDESSEIISEE  346



>gb|EMT24605.1| Somatic embryogenesis receptor kinase 2 [Aegilops tauschii]
Length=589

 Score =   378 bits (971),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 192/308 (62%), Positives = 235/308 (76%), Gaps = 0/308 (0%)
 Frame = -2

Query  3198  YWGQLWDGSQIAVKRLKEWSNTAEVEFAAEVEILARARHKNLLALRGYCSEGQEHVLVYD  3019
             YWGQLWDGSQIAVKRLK WSN AE EFA EVE+LAR RHK+LL+LRGYC+EGQE ++VYD
Sbjct  241   YWGQLWDGSQIAVKRLKSWSNKAEKEFAVEVEVLARVRHKSLLSLRGYCAEGQERLIVYD  300

Query  3018  YVPNFSLLSHLHGQYSADTLLDWKKRISIAVGSAEGIAYLHHDATPHIIHGDIKAGNVLL  2839
             Y+ N SL SHLHGQ++A+  L W++R++IA+ SAEGIAYLHH A PHIIH D+KA NVLL
Sbjct  301   YMQNLSLHSHLHGQHAAECHLGWERRMNIAIDSAEGIAYLHHHAIPHIIHRDVKASNVLL  360

Query  2838  DSNFQAQLAGFGIANFFPDDATRVTTRSKGTLGYLAPEYVMLGKESKSCDVYSFGILLLE  2659
             D+NFQA++A FG A   PD AT VTT+ KGTLGYLAPEY MLGK  +SCDVYSFG+LLLE
Sbjct  361   DANFQARVADFGFAKLIPDGATHVTTKVKGTLGYLAPEYAMLGKAKESCDVYSFGVLLLE  420

Query  2658  LASGKKPIKKVSASKNWTITDWALPLACEGKFSELADPTLNGNYVEEELKRIVYVALICA  2479
             LASGKKP++K++ +   TIT+WALPLA E KF E+ADP L  ++VE E+KR+V V L C 
Sbjct  421   LASGKKPVEKINPTTKLTITEWALPLAREQKFKEMADPKLGDSFVEAEVKRMVLVGLACT  480

Query  2478  QNQPEKRPTMLEVVELLKGESKEKLAALENNEMFKNLKAATHKDGCAHEDSQEFISEKQV  2299
             Q +PE+RP M EVVE+LKGES EK   LEN+++FK    ++ +       S     EK+ 
Sbjct  481   QTKPEQRPVMSEVVEMLKGESAEKFFILENDDLFKPQPTSSVQGTSGPCSSDAITEEKES  540

Query  2298  LEPEIGSA  2275
              E  I  A
Sbjct  541   KEDTIEEA  548



>gb|EAZ12736.1| hypothetical protein OsJ_02654 [Oryza sativa Japonica Group]
Length=477

 Score =   373 bits (957),  Expect = 8e-114, Method: Compositional matrix adjust.
 Identities = 222/432 (51%), Positives = 290/432 (67%), Gaps = 29/432 (7%)
 Frame = +3

Query  351   FTVIVSDSGAPSGLVDAPQTAYSLNNDHARTDAREQEAVYEVMRATGNDWATEIPDVCRG  530
             FTV+V DS + + LV+APQT  S   D ARTD  EQ AV EVM ATGN WA+ I      
Sbjct  30    FTVVVPDSSSSAALVNAPQTGLS---DRARTDPAEQRAVQEVMAATGNGWASGI------  80

Query  531   RWHGIECMPDKANVYHVVSLSFGALSDDTAFPTCDTAPRPFISPAVTKLLHLRTLFFYRC  710
                        A+VY+VVSLSFGALSDDTAFP CD A R  +SPAV  L HLR+LFFYRC
Sbjct  81    -----------ADVYNVVSLSFGALSDDTAFPACDAA-RATLSPAVLALPHLRSLFFYRC  128

Query  711   FTDNPQPIPTFlgqlgqtlqtlVLRENGHVGSIPNQLGNLTRLRVLDFHGNNLNGSIPVS  890
             FT NPQP+P FLG+LG   ++LVLRENGHVG+IP +LGNLT LRVLD HGNNL  +IP +
Sbjct  129   FTANPQPVPAFLGRLGPAFRSLVLRENGHVGAIPPELGNLTALRVLDLHGNNLTSAIPAT  188

Query  891   LSRIDGLRSLDLSRNKLAASIPNLTFPLLQILDLNQNHLVGSIPTALINCHSLMKMDLSR  1070
             +  +  L+ LDLS N+LA  +P   F  L ILDL+ N L G +P +L  C SL+K DLS+
Sbjct  189   VQSLAHLQLLDLSYNQLAGEVPPFKFQHLSILDLSHNALQGGVPASLGQCRSLLKFDLSQ  248

Query  1071  NRLSGRIPDSIDALNNIILMDLSYNSITGPIPTTLKNLDFLQALVLSGNPMLSDTLPEHI  1250
             NR +G IPD++  L+++IL+DLS+N+++GPIP  L  L  L++L+L  N M   T+P  I
Sbjct  249   NRFAGTIPDALGDLSDLILLDLSHNALSGPIPAALGRLSSLRSLILGDNRMQFTTVPGDI  308

Query  1251  FLDGFKDLMILALSNMNLQGSIPESLAKLPKIRVLHLDGNQLNGSIPASFGeldslselr  1430
             F  G + L  L LS M L+GS+PES+ +L  +RVL LD N+  G IPASF  L+  SELR
Sbjct  309   F-AGLRALTTLVLSGMGLEGSLPESIGELGHLRVLRLDNNEFTGVIPASFRRLERASELR  367

Query  1431  ldsNQLTGAVPFKREMVWRMRRKLKLSNNSGLCYDAKTGLGDDLEA-ISDSGISHCGSQA  1607
             +D N+L G +PF ++M+WR+ +KL++  N GLCYDAK      LE  ++ +G++ C S  
Sbjct  368   VDGNRLVGPIPFGKQMMWRLGKKLRVGGNEGLCYDAKQ---QGLEGVVALAGVADCDSVR  424

Query  1608  TEPTRTVEHISA  1643
                +RT +H+  
Sbjct  425   ---SRTTQHLGG  433



>ref|XP_010487434.1| PREDICTED: PTI1-like tyrosine-protein kinase At3g15890 isoform 
X2 [Camelina sativa]
Length=332

 Score =   366 bits (940),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 169/277 (61%), Positives = 217/277 (78%), Gaps = 1/277 (0%)
 Frame = -2

Query  3198  YWGQLWDGSQIAVKRLKEWSNTAEVEFAAEVEILARARHKNLLALRGYCSEGQEHVLVYD  3019
             YWGQLWDGSQIAVKRLK WSN  E++FA EVEILAR RHKNLL++RGYC+EGQE +LVY+
Sbjct  40    YWGQLWDGSQIAVKRLKAWSNREEIDFAVEVEILARIRHKNLLSVRGYCAEGQERLLVYE  99

Query  3018  YVPNFSLLSHLHGQYSADTLLDWKKRISIAVGSAEGIAYLHHDATPHIIHGDIKAGNVLL  2839
             Y+PN SL+SHLHGQ+SA+ LLDW KR+ IA+ SA+ IAYLHH+ATP IIHGD++A NVLL
Sbjct  100   YMPNLSLVSHLHGQHSAECLLDWSKRMKIAISSAQAIAYLHHNATPQIIHGDVRASNVLL  159

Query  2838  DSNFQAQLAGFGIANFFPDDATRVTTRSKGT-LGYLAPEYVMLGKESKSCDVYSFGILLL  2662
             DS F+A++  FG     PDD     T++K +  GY++PE V  GKES++ DVYSFGILLL
Sbjct  160   DSEFEARVTDFGYGKLMPDDTGDGATKAKSSNNGYISPECVASGKESETSDVYSFGILLL  219

Query  2661  ELASGKKPIKKVSASKNWTITDWALPLACEGKFSELADPTLNGNYVEEELKRIVYVALIC  2482
              L SGK+P+++++ +    IT+W LPL  E KF E+ D  L   +VEE+LK++V V L+C
Sbjct  220   VLVSGKRPLERLNPTTTRGITEWVLPLVYERKFGEIVDQRLGEEHVEEKLKKVVLVGLMC  279

Query  2481  AQNQPEKRPTMLEVVELLKGESKEKLAALENNEMFKN  2371
             AQ +PEKRPTM +VVE+L  ESKEK++ LE+N +FKN
Sbjct  280   AQTEPEKRPTMSQVVEMLMNESKEKMSELEDNPLFKN  316



>ref|XP_001782162.1| predicted protein [Physcomitrella patens]
 gb|EDQ53056.1| predicted protein [Physcomitrella patens]
Length=338

 Score =   366 bits (940),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 172/263 (65%), Positives = 206/263 (78%), Gaps = 1/263 (0%)
 Frame = -2

Query  3198  YWGQLWDGSQIAVKRLKEWSNTAEVEFAAEVEILARARHKNLLALRGYCSEGQEHVLVYD  3019
             YWGQL  G QIAVKRLK WS  AE+EFA EVEIL R RHKNLL+LRGYCSEGQE ++VYD
Sbjct  32    YWGQLASGDQIAVKRLKVWSTRAEMEFAVEVEILGRVRHKNLLSLRGYCSEGQERLIVYD  91

Query  3018  YVPNFSLLSHLHGQYSADTLLDWKKRISIAVGSAEGIAYLHHDATPHIIHGDIKAGNVLL  2839
             Y+P  SLL+HLHGQ++AD+ L W  R  IA+G+AEG+AYLHH ATPHIIH D+KA NVLL
Sbjct  92    YMPKLSLLTHLHGQFAADSTLTWPNRFKIAIGTAEGLAYLHHHATPHIIHRDVKASNVLL  151

Query  2838  DSNFQAQLAGFGIANFFPDDATRVTTRSKGTLGYLAPEYVMLGKESKSCDVYSFGILLLE  2659
             D NF+A +A FG A   PD AT VTT  KGTLGYLAPEY M GK S+SCDVYS+GIL LE
Sbjct  152   DENFEALVADFGFAKLIPDGATHVTTGVKGTLGYLAPEYAMWGKVSESCDVYSYGILTLE  211

Query  2658  LASGKKPIKKVSASKNWTITDWALPLACEGKFSELADPTLNGNYVEEELKRIVYVALICA  2479
             L SGKKPI++V  ++  TI +WA PL  +G++ +L DP L G + EEEL R+V VA +CA
Sbjct  212   LISGKKPIERVGLARR-TIVEWAGPLVLQGRYRDLVDPKLQGKFDEEELMRLVQVAALCA  270

Query  2478  QNQPEKRPTMLEVVELLKGESKE  2410
             QN P+ RPTMLEVVE+LKG++ +
Sbjct  271   QNSPDNRPTMLEVVEMLKGDATD  293



>ref|XP_010479762.1| PREDICTED: PTI1-like tyrosine-protein kinase At3g15890 isoform 
X1 [Camelina sativa]
 ref|XP_010479763.1| PREDICTED: PTI1-like tyrosine-protein kinase At3g15890 isoform 
X1 [Camelina sativa]
Length=353

 Score =   366 bits (940),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 176/301 (58%), Positives = 226/301 (75%), Gaps = 7/301 (2%)
 Frame = -2

Query  3198  YWGQLWDGSQIAVKRLKEWSNTAEVEFAAEVEILARARHKNLLALRGYCSEGQEHVLVYD  3019
             YWGQLWDGSQIAVKRLK WS+  E+ FA EVEILAR RHKNLL++RGYC+EGQE ++VYD
Sbjct  55    YWGQLWDGSQIAVKRLKAWSSREEITFAVEVEILARIRHKNLLSVRGYCAEGQERLIVYD  114

Query  3018  YVPNFSLLSHLHGQYSADTLLDWKKRISIAVGSAEGIAYLHHDATPHIIHGDIKAGNVLL  2839
             Y+PN SL+SHLHGQ+S+D+LLDW +R++IAV SA+ IAYLHH ATP I+HGD++A NVLL
Sbjct  115   YMPNLSLVSHLHGQHSSDSLLDWTRRMNIAVTSAQAIAYLHHFATPRIVHGDVRASNVLL  174

Query  2838  DSNFQAQLAGFGIANFFPDDATRVTTR-SKG-TLGYLAPEYVMLGKESKSCDVYSFGILL  2665
             DS F+A++  FG     PDDA     + +KG  +GYL+PE +  GKES   DVYSFG++L
Sbjct  175   DSEFEARVTDFGYGKMMPDDAGDGGNKITKGNNIGYLSPECIESGKESDMEDVYSFGVVL  234

Query  2664  LELASGKKPIKKVSASKNWTITDWALPLACEGKFSELADPTLNGNYVEEELKRIVYVALI  2485
             LEL +GK+PI++ S +    IT+W LPL  E KF E+ D  LNG YVE+ELKR+V + LI
Sbjct  235   LELVTGKRPIERASLTTKQGITEWVLPLVYERKFGEIVDHRLNGKYVEDELKRVVLIGLI  294

Query  2484  CAQNQPEKRPTMLEVVELLKGESKEKLAALENNEMFKNLKAATHKDGCAHEDSQEFISEK  2305
             CAQ +PEKRPTM EVVE+L  ESKEK++ LE N +F       +  G   ++S E I+E+
Sbjct  295   CAQKEPEKRPTMSEVVEMLMNESKEKMSQLEANPLFNG-----NNVGEVIDESSEIIAEE  349

Query  2304  Q  2302
             +
Sbjct  350   R  350



>ref|XP_010487433.1| PREDICTED: PTI1-like tyrosine-protein kinase At3g15890 isoform 
X1 [Camelina sativa]
Length=345

 Score =   365 bits (938),  Expect = 5e-113, Method: Compositional matrix adjust.
 Identities = 169/277 (61%), Positives = 217/277 (78%), Gaps = 1/277 (0%)
 Frame = -2

Query  3198  YWGQLWDGSQIAVKRLKEWSNTAEVEFAAEVEILARARHKNLLALRGYCSEGQEHVLVYD  3019
             YWGQLWDGSQIAVKRLK WSN  E++FA EVEILAR RHKNLL++RGYC+EGQE +LVY+
Sbjct  53    YWGQLWDGSQIAVKRLKAWSNREEIDFAVEVEILARIRHKNLLSVRGYCAEGQERLLVYE  112

Query  3018  YVPNFSLLSHLHGQYSADTLLDWKKRISIAVGSAEGIAYLHHDATPHIIHGDIKAGNVLL  2839
             Y+PN SL+SHLHGQ+SA+ LLDW KR+ IA+ SA+ IAYLHH+ATP IIHGD++A NVLL
Sbjct  113   YMPNLSLVSHLHGQHSAECLLDWSKRMKIAISSAQAIAYLHHNATPQIIHGDVRASNVLL  172

Query  2838  DSNFQAQLAGFGIANFFPDDATRVTTRSKGT-LGYLAPEYVMLGKESKSCDVYSFGILLL  2662
             DS F+A++  FG     PDD     T++K +  GY++PE V  GKES++ DVYSFGILLL
Sbjct  173   DSEFEARVTDFGYGKLMPDDTGDGATKAKSSNNGYISPECVASGKESETSDVYSFGILLL  232

Query  2661  ELASGKKPIKKVSASKNWTITDWALPLACEGKFSELADPTLNGNYVEEELKRIVYVALIC  2482
              L SGK+P+++++ +    IT+W LPL  E KF E+ D  L   +VEE+LK++V V L+C
Sbjct  233   VLVSGKRPLERLNPTTTRGITEWVLPLVYERKFGEIVDQRLGEEHVEEKLKKVVLVGLMC  292

Query  2481  AQNQPEKRPTMLEVVELLKGESKEKLAALENNEMFKN  2371
             AQ +PEKRPTM +VVE+L  ESKEK++ LE+N +FKN
Sbjct  293   AQTEPEKRPTMSQVVEMLMNESKEKMSELEDNPLFKN  329



>ref|XP_006584166.1| PREDICTED: PTI1-like tyrosine-protein kinase At3g15890-like [Glycine 
max]
Length=355

 Score =   365 bits (938),  Expect = 8e-113, Method: Compositional matrix adjust.
 Identities = 182/278 (65%), Positives = 219/278 (79%), Gaps = 2/278 (1%)
 Frame = -2

Query  3198  YWGQLWDGSQIAVKRLKEWSNTAEVEFAAEVEILARARHKNLLALRGYCSEGQEHVLVYD  3019
             YWGQLW+ SQIAVKRL+ WSN  E+EF  E+EI AR RHKNLL+ RGYC+EG E ++ Y+
Sbjct  53    YWGQLWNWSQIAVKRLEVWSNKVEMEFTVELEIFARIRHKNLLSFRGYCAEGHERLIAYE  112

Query  3018  YVPNFSLLSHLHGQYSADTLLDWKKRISIAVGSAEGIAYLHHDATPHIIHGDIKAGNVLL  2839
             Y+PN SL SHLHG +S   LLDW +R++IA+G AEGI YLHH ATPHIIH DIKA NV L
Sbjct  113   YMPNLSLHSHLHGHHSFKCLLDWNRRMNIAIGYAEGIVYLHHQATPHIIHRDIKANNVYL  172

Query  2838  DSNFQAQLAGFGIANFFPDDATRVTTRSKGTLGYLAPEYVMLGKESKSCDVYSFGILLLE  2659
             DS+FQA++ GF  A   PD A  V+T  KGTL YLAPEY MLGK ++ CDVYSFGIL LE
Sbjct  173   DSDFQARIGGFRFAKLIPDGAIHVSTEVKGTLSYLAPEYAMLGKANEGCDVYSFGILFLE  232

Query  2658  LASGKKPIKKVSASKNWTITDWALPLACEGKFSELADPTLNGNYVEEELKRIVYVALICA  2479
             LASG++P++K+S++    + D ALPL CE KFSELA P LNGNYVEEELKR+V+VALICA
Sbjct  233   LASGRRPVEKLSSTVKQAMVDLALPLVCEKKFSELAYPRLNGNYVEEELKRVVFVALICA  292

Query  2478  QNQPEKRPTMLEVVELLKGESKEKLAALE--NNEMFKN  2371
             Q  P KRPTML+VVELLKGESK+K + +E   NEMF++
Sbjct  293   QVLPGKRPTMLDVVELLKGESKDKFSHIEINENEMFRS  330



>ref|XP_010500854.1| PREDICTED: PTI1-like tyrosine-protein kinase At3g15890 [Camelina 
sativa]
 ref|XP_010500855.1| PREDICTED: PTI1-like tyrosine-protein kinase At3g15890 [Camelina 
sativa]
Length=353

 Score =   365 bits (936),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 175/301 (58%), Positives = 225/301 (75%), Gaps = 7/301 (2%)
 Frame = -2

Query  3198  YWGQLWDGSQIAVKRLKEWSNTAEVEFAAEVEILARARHKNLLALRGYCSEGQEHVLVYD  3019
             YWGQLWDGSQIAVKRLK WS+  E+ FA EVEILAR RHKNLL++RGYC+EGQE ++VYD
Sbjct  55    YWGQLWDGSQIAVKRLKAWSSREEITFAVEVEILARIRHKNLLSVRGYCAEGQERLIVYD  114

Query  3018  YVPNFSLLSHLHGQYSADTLLDWKKRISIAVGSAEGIAYLHHDATPHIIHGDIKAGNVLL  2839
             Y+PN SL+SHLHGQ+S+D+LLDW +R++IAV SA+ IAYLHH ATP I+HGD++A NVLL
Sbjct  115   YMPNLSLVSHLHGQHSSDSLLDWTRRMNIAVTSAQAIAYLHHFATPRIVHGDVRASNVLL  174

Query  2838  DSNFQAQLAGFGIANFFPDDATRVTTR-SKG-TLGYLAPEYVMLGKESKSCDVYSFGILL  2665
             DS  +A++  FG     PDDA     + +KG  +GYL+PE +  GKES   DVYSFG++L
Sbjct  175   DSELEARVTDFGYGKMMPDDAGDGGNKITKGNNIGYLSPECIESGKESDMGDVYSFGVVL  234

Query  2664  LELASGKKPIKKVSASKNWTITDWALPLACEGKFSELADPTLNGNYVEEELKRIVYVALI  2485
             LEL +GK+PI++ S +    IT+W LPL  E KF E+ D  LNG YVE+ELKR+ ++ LI
Sbjct  235   LELVTGKRPIERASLTTKQGITEWVLPLVYEKKFGEIVDQRLNGKYVEDELKRVAWIGLI  294

Query  2484  CAQNQPEKRPTMLEVVELLKGESKEKLAALENNEMFKNLKAATHKDGCAHEDSQEFISEK  2305
             CAQ +PEKRPTM EVVE+L  ESKEK++ LE N +F       +  G   ++S E ISE+
Sbjct  295   CAQREPEKRPTMSEVVEMLMNESKEKMSQLEANPLFNG-----NNVGEVIDESSEIISEE  349

Query  2304  Q  2302
             +
Sbjct  350   R  350



>ref|XP_002980938.1| hypothetical protein SELMODRAFT_113448, partial [Selaginella 
moellendorffii]
 gb|EFJ18123.1| hypothetical protein SELMODRAFT_113448, partial [Selaginella 
moellendorffii]
Length=335

 Score =   363 bits (932),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 170/271 (63%), Positives = 205/271 (76%), Gaps = 0/271 (0%)
 Frame = -2

Query  3198  YWGQLWDGSQIAVKRLKEWSNTAEVEFAAEVEILARARHKNLLALRGYCSEGQEHVLVYD  3019
             ++GQL D S+IAVKRLK  + T E+ FA EVE L R  HKNLL LRGYC+EG+E ++VYD
Sbjct  32    FYGQLGDKSEIAVKRLKVMNTTNEMSFAVEVETLGRLHHKNLLKLRGYCAEGEERLIVYD  91

Query  3018  YVPNFSLLSHLHGQYSADTLLDWKKRISIAVGSAEGIAYLHHDATPHIIHGDIKAGNVLL  2839
             Y+PN SLLSHLHG +S+D LLDW+KR+ IA+GSAEG+AYLHH A PHIIH D+KA N+L+
Sbjct  92    YMPNLSLLSHLHGHFSSDKLLDWRKRVEIAIGSAEGLAYLHHTANPHIIHRDVKASNILI  151

Query  2838  DSNFQAQLAGFGIANFFPDDATRVTTRSKGTLGYLAPEYVMLGKESKSCDVYSFGILLLE  2659
             DSNFQAQ+A FG A F PD  T +TTR KGTLGYLAPEY M GK S+SCDVYSFGILLLE
Sbjct  152   DSNFQAQVADFGFAKFIPDGVTHLTTRVKGTLGYLAPEYAMWGKVSESCDVYSFGILLLE  211

Query  2658  LASGKKPIKKVSASKNWTITDWALPLACEGKFSELADPTLNGNYVEEELKRIVYVALICA  2479
             L +G+KPI+K+   K  +I  WA PL  E +F ELADP L G Y  EEL R++ VA +CA
Sbjct  212   LVTGRKPIEKIGPGKKRSIIQWAAPLVMERRFDELADPKLEGKYDGEELTRMIQVAALCA  271

Query  2478  QNQPEKRPTMLEVVELLKGESKEKLAALENN  2386
             QN PE RPTM EVV +LK  S  +   +E +
Sbjct  272   QNLPEHRPTMHEVVAMLKSRSIPEEGTIEGD  302



>ref|XP_002989320.1| hypothetical protein SELMODRAFT_129596, partial [Selaginella 
moellendorffii]
 gb|EFJ09594.1| hypothetical protein SELMODRAFT_129596, partial [Selaginella 
moellendorffii]
Length=335

 Score =   363 bits (931),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 170/271 (63%), Positives = 205/271 (76%), Gaps = 0/271 (0%)
 Frame = -2

Query  3198  YWGQLWDGSQIAVKRLKEWSNTAEVEFAAEVEILARARHKNLLALRGYCSEGQEHVLVYD  3019
             ++GQL D S+IAVKRLK  + T E+ FA EVE L R  HKNLL LRGYC+EG+E ++VYD
Sbjct  32    FYGQLGDKSEIAVKRLKVMNTTNEMSFAVEVETLGRLHHKNLLKLRGYCAEGEERLIVYD  91

Query  3018  YVPNFSLLSHLHGQYSADTLLDWKKRISIAVGSAEGIAYLHHDATPHIIHGDIKAGNVLL  2839
             Y+PN SLLSHLHG +S+D LLDW+KR+ IA+GSAEG+AYLHH A PHIIH D+KA N+L+
Sbjct  92    YMPNLSLLSHLHGHFSSDKLLDWRKRVEIAIGSAEGLAYLHHTANPHIIHRDVKASNILI  151

Query  2838  DSNFQAQLAGFGIANFFPDDATRVTTRSKGTLGYLAPEYVMLGKESKSCDVYSFGILLLE  2659
             DSNFQAQ+A FG A F PD  T +TTR KGTLGYLAPEY M GK S+SCDVYSFGILLLE
Sbjct  152   DSNFQAQVADFGFAKFIPDGVTHLTTRVKGTLGYLAPEYAMWGKVSESCDVYSFGILLLE  211

Query  2658  LASGKKPIKKVSASKNWTITDWALPLACEGKFSELADPTLNGNYVEEELKRIVYVALICA  2479
             L +G+KPI+K+   K  +I  WA PL  E +F ELADP L G Y  EEL R++ VA +CA
Sbjct  212   LVTGRKPIEKIGPGKKRSIIQWAAPLVMERRFDELADPRLEGKYDGEELTRMIQVAALCA  271

Query  2478  QNQPEKRPTMLEVVELLKGESKEKLAALENN  2386
             QN PE RPTM EVV +LK  S  +   +E +
Sbjct  272   QNLPEHRPTMHEVVAMLKSRSIPEEGTIEGD  302



>ref|XP_010503560.1| PREDICTED: PTI1-like tyrosine-protein kinase At3g15890 isoform 
X2 [Camelina sativa]
Length=337

 Score =   362 bits (930),  Expect = 7e-112, Method: Compositional matrix adjust.
 Identities = 171/298 (57%), Positives = 225/298 (76%), Gaps = 2/298 (1%)
 Frame = -2

Query  3198  YWGQLWDGSQIAVKRLKEWSNTAEVEFAAEVEILARARHKNLLALRGYCSEGQEHVLVYD  3019
             YWGQLWDGSQIAVKRLK WSN  E++FA EVEILAR RHKNLL++RGYC+EGQE +LVY+
Sbjct  40    YWGQLWDGSQIAVKRLKAWSNREEIDFAVEVEILARIRHKNLLSVRGYCAEGQERLLVYE  99

Query  3018  YVPNFSLLSHLHGQYSADTLLDWKKRISIAVGSAEGIAYLHHDATPHIIHGDIKAGNVLL  2839
             Y+PN SL+SHLHGQ+SA+ L+DW KR+ IA+ SA+ IAYLHH+ATP IIHGD++A NVLL
Sbjct  100   YMPNLSLVSHLHGQHSAECLVDWSKRMKIAISSAQAIAYLHHNATPQIIHGDVRASNVLL  159

Query  2838  DSNFQAQLAGFGIANFFPDDATRVTTRSKGT-LGYLAPEYVMLGKESKSCDVYSFGILLL  2662
             DS F+A++  FG     PD      T++K +  GY++PE V  GKES++ DVYSFGILLL
Sbjct  160   DSEFEARVTDFGYGKLMPDGTGDGATKAKSSNNGYISPECVASGKESETSDVYSFGILLL  219

Query  2661  ELASGKKPIKKVSASKNWTITDWALPLACEGKFSELADPTLNGNYVEEELKRIVYVALIC  2482
              L SGK+P+++++ +    IT+W LPL  E KF E+ D  L   +VEE+LK++V V L+C
Sbjct  220   VLVSGKRPLERLNPTTTRGITEWVLPLVYERKFGEIVDQRLEEEHVEEKLKKVVLVGLMC  279

Query  2481  AQNQPEKRPTMLEVVELLKGESKEKLAALENNEMFKNLKAATHKDG-CAHEDSQEFIS  2311
             AQ +PEKRPTM +VVE+L  ESKEK++ LE+N +FKN  ++   +     E+S + IS
Sbjct  280   AQTEPEKRPTMSQVVEMLMNESKEKMSELEDNPLFKNPFSSNENNSEQVAEESSDVIS  337



>ref|XP_010503552.1| PREDICTED: PTI1-like tyrosine-protein kinase At3g15890 isoform 
X1 [Camelina sativa]
Length=350

 Score =   361 bits (927),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 167/277 (60%), Positives = 216/277 (78%), Gaps = 1/277 (0%)
 Frame = -2

Query  3198  YWGQLWDGSQIAVKRLKEWSNTAEVEFAAEVEILARARHKNLLALRGYCSEGQEHVLVYD  3019
             YWGQLWDGSQIAVKRLK WSN  E++FA EVEILAR RHKNLL++RGYC+EGQE +LVY+
Sbjct  53    YWGQLWDGSQIAVKRLKAWSNREEIDFAVEVEILARIRHKNLLSVRGYCAEGQERLLVYE  112

Query  3018  YVPNFSLLSHLHGQYSADTLLDWKKRISIAVGSAEGIAYLHHDATPHIIHGDIKAGNVLL  2839
             Y+PN SL+SHLHGQ+SA+ L+DW KR+ IA+ SA+ IAYLHH+ATP IIHGD++A NVLL
Sbjct  113   YMPNLSLVSHLHGQHSAECLVDWSKRMKIAISSAQAIAYLHHNATPQIIHGDVRASNVLL  172

Query  2838  DSNFQAQLAGFGIANFFPDDATRVTTRSKGT-LGYLAPEYVMLGKESKSCDVYSFGILLL  2662
             DS F+A++  FG     PD      T++K +  GY++PE V  GKES++ DVYSFGILLL
Sbjct  173   DSEFEARVTDFGYGKLMPDGTGDGATKAKSSNNGYISPECVASGKESETSDVYSFGILLL  232

Query  2661  ELASGKKPIKKVSASKNWTITDWALPLACEGKFSELADPTLNGNYVEEELKRIVYVALIC  2482
              L SGK+P+++++ +    IT+W LPL  E KF E+ D  L   +VEE+LK++V V L+C
Sbjct  233   VLVSGKRPLERLNPTTTRGITEWVLPLVYERKFGEIVDQRLEEEHVEEKLKKVVLVGLMC  292

Query  2481  AQNQPEKRPTMLEVVELLKGESKEKLAALENNEMFKN  2371
             AQ +PEKRPTM +VVE+L  ESKEK++ LE+N +FKN
Sbjct  293   AQTEPEKRPTMSQVVEMLMNESKEKMSELEDNPLFKN  329



>ref|XP_006392910.1| hypothetical protein EUTSA_v10011602mg [Eutrema salsugineum]
 gb|ESQ30196.1| hypothetical protein EUTSA_v10011602mg [Eutrema salsugineum]
Length=360

 Score =   362 bits (928),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 170/279 (61%), Positives = 217/279 (78%), Gaps = 5/279 (2%)
 Frame = -2

Query  3198  YWGQLWDGSQIAVKRLKEWSNTAEVEFAAEVEILARARHKNLLALRGYCSEGQEHVLVYD  3019
             YWGQLWDGSQIAVKRLK WS+  E++FA EVEILAR RH NLL++RGYC+EGQE ++VY+
Sbjct  55    YWGQLWDGSQIAVKRLKAWSSREEIDFAVEVEILARIRHNNLLSVRGYCAEGQERLIVYE  114

Query  3018  YVPNFSLLSHLHGQYSADTLLDWKKRISIAVGSAEGIAYLHHDATPHIIHGDIKAGNVLL  2839
             Y+PN SL+SHLHG +S+++LLDW +R++IAV SA+ IAYLHH ATP I+HGD++A NVLL
Sbjct  115   YMPNLSLVSHLHGLHSSESLLDWTRRMNIAVTSAQAIAYLHHHATPRIVHGDVRASNVLL  174

Query  2838  DSNFQAQLAGFGIANFFPDDA----TRVTTRSKGTLGYLAPEYVMLGKESKSCDVYSFGI  2671
             DS F+A++  FG      +DA    T+ TT+ K  LGYL+PE +  GKES   DVYSFGI
Sbjct  175   DSEFEARVTDFGYGKLMAEDAENGVTKTTTKGK-DLGYLSPECIESGKESDMGDVYSFGI  233

Query  2670  LLLELASGKKPIKKVSASKNWTITDWALPLACEGKFSELADPTLNGNYVEEELKRIVYVA  2491
             +LLEL +GK+PI+K++ +    IT+W LPL  E KF E+ D  L+G YVEEELKR+V V 
Sbjct  234   VLLELVTGKRPIEKLNQTTKQGITEWVLPLVYERKFGEIVDQRLDGKYVEEELKRVVLVG  293

Query  2490  LICAQNQPEKRPTMLEVVELLKGESKEKLAALENNEMFK  2374
             L+CAQ++PEKRPTM E VE+L  ESKEK+A LE N +FK
Sbjct  294   LMCAQSEPEKRPTMSEAVEMLMNESKEKMAQLEANPLFK  332



>gb|KFK35800.1| hypothetical protein AALP_AA4G038100 [Arabis alpina]
Length=336

 Score =   358 bits (918),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 166/277 (60%), Positives = 212/277 (77%), Gaps = 3/277 (1%)
 Frame = -2

Query  3198  YWGQLWDGSQIAVKRLKEWSNTAEVEFAAEVEILARARHKNLLALRGYCSEGQEHVLVYD  3019
             YWGQLWDGSQIAVKRLK WS+  E++FA EVEILAR RHKNLL++RGYC+EGQE ++VY+
Sbjct  55    YWGQLWDGSQIAVKRLKVWSSREEIDFAVEVEILARIRHKNLLSVRGYCAEGQERLIVYE  114

Query  3018  YVPNFSLLSHLHGQYSADTLLDWKKRISIAVGSAEGIAYLHHDATPHIIHGDIKAGNVLL  2839
             Y+ N SL+SHLHGQ+S+++LLDW +R++IAV SA+ IAYLH  ATP I+HGD++A NVLL
Sbjct  115   YMSNLSLVSHLHGQHSSESLLDWTRRMNIAVTSAQAIAYLHFHATPRIVHGDVRASNVLL  174

Query  2838  DSNFQAQLAGFGIANFFPDDA---TRVTTRSKGTLGYLAPEYVMLGKESKSCDVYSFGIL  2668
             DS F+A++  FG     PD+A      TT+    LGYL+PE +  GKES   DVYSFG++
Sbjct  175   DSEFEARVTDFGYGKLMPDNAENGANKTTKGNSNLGYLSPECIESGKESDMGDVYSFGVV  234

Query  2667  LLELASGKKPIKKVSASKNWTITDWALPLACEGKFSELADPTLNGNYVEEELKRIVYVAL  2488
             LLEL +GK+P +K++ +    IT+W LPL  + KF E+ D  LNG YVEEELKR+V V L
Sbjct  235   LLELVTGKRPTEKLNQTTKQGITEWVLPLVYDKKFGEIVDQRLNGKYVEEELKRVVLVGL  294

Query  2487  ICAQNQPEKRPTMLEVVELLKGESKEKLAALENNEMF  2377
             +CAQ +PEKRPTM EVVE+L  ESKEK+  LE N +F
Sbjct  295   MCAQTEPEKRPTMSEVVEMLMNESKEKMTQLEANPLF  331



>ref|XP_010462090.1| PREDICTED: PTI1-like tyrosine-protein kinase At3g15890 [Camelina 
sativa]
 ref|XP_010462091.1| PREDICTED: PTI1-like tyrosine-protein kinase At3g15890 [Camelina 
sativa]
Length=353

 Score =   358 bits (920),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 167/276 (61%), Positives = 213/276 (77%), Gaps = 2/276 (1%)
 Frame = -2

Query  3198  YWGQLWDGSQIAVKRLKEWSNTAEVEFAAEVEILARARHKNLLALRGYCSEGQEHVLVYD  3019
             YWGQLWDGSQIAVKRLK WS+  E+ FA EVEILAR RHKNLL++RGYC+EGQE ++VYD
Sbjct  55    YWGQLWDGSQIAVKRLKAWSSREEITFAVEVEILARIRHKNLLSVRGYCAEGQERLIVYD  114

Query  3018  YVPNFSLLSHLHGQYSADTLLDWKKRISIAVGSAEGIAYLHHDATPHIIHGDIKAGNVLL  2839
             Y+PN SL+SHLHGQ+S+D+LLDW +R++IAV SA+ IAYLHH ATP I+HGD++A NVLL
Sbjct  115   YMPNLSLVSHLHGQHSSDSLLDWTRRMNIAVTSAQAIAYLHHFATPRIVHGDVRASNVLL  174

Query  2838  DSNFQAQLAGFGIANFFPDDATRVTTR-SKG-TLGYLAPEYVMLGKESKSCDVYSFGILL  2665
             DS F+A++  FG     PDDA     + +KG  +GYL+PE +  G+ES   DVYSFG++L
Sbjct  175   DSEFEARVTDFGYGKMMPDDAGNGGNKITKGNNIGYLSPECIESGQESDMGDVYSFGVVL  234

Query  2664  LELASGKKPIKKVSASKNWTITDWALPLACEGKFSELADPTLNGNYVEEELKRIVYVALI  2485
             LEL +GK+PI++ S +    IT+W LPL  E KF E+ D  LNG Y E+ELKR+V + LI
Sbjct  235   LELVTGKRPIERASLTTKQGITEWVLPLVYEKKFGEIVDQRLNGKYEEDELKRVVLIGLI  294

Query  2484  CAQNQPEKRPTMLEVVELLKGESKEKLAALENNEMF  2377
             CAQ +PEKRPTM EVVE+L  E+KEK++  E N +F
Sbjct  295   CAQREPEKRPTMSEVVEMLMNETKEKMSQHEANPLF  330



>ref|XP_006297987.1| hypothetical protein CARUB_v10014029mg [Capsella rubella]
 gb|EOA30885.1| hypothetical protein CARUB_v10014029mg [Capsella rubella]
Length=363

 Score =   357 bits (915),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 163/276 (59%), Positives = 212/276 (77%), Gaps = 0/276 (0%)
 Frame = -2

Query  3198  YWGQLWDGSQIAVKRLKEWSNTAEVEFAAEVEILARARHKNLLALRGYCSEGQEHVLVYD  3019
             YWGQLWDGSQIAVKRLK WSN  E +FA E+EILAR RHKNLL++RGYC+EGQE +LVY+
Sbjct  54    YWGQLWDGSQIAVKRLKAWSNREETDFAVEIEILARIRHKNLLSVRGYCAEGQERLLVYE  113

Query  3018  YVPNFSLLSHLHGQYSADTLLDWKKRISIAVGSAEGIAYLHHDATPHIIHGDIKAGNVLL  2839
             Y+PN SL+SHLHGQ+SA+ LLDW KR+ IA+ SA+ IAYLH  ATPHIIHGD++A NVLL
Sbjct  114   YLPNLSLVSHLHGQHSAECLLDWNKRMKIAISSAQAIAYLHQHATPHIIHGDVRASNVLL  173

Query  2838  DSNFQAQLAGFGIANFFPDDATRVTTRSKGTLGYLAPEYVMLGKESKSCDVYSFGILLLE  2659
             DS ++A++  FG     PDD     T++K + GY++PE V  G ES++ DVYSFGILLL 
Sbjct  174   DSEYEARVTDFGYGKLMPDDTGDGATKAKSSNGYISPECVASGNESETSDVYSFGILLLV  233

Query  2658  LASGKKPIKKVSASKNWTITDWALPLACEGKFSELADPTLNGNYVEEELKRIVYVALICA  2479
             L SGK+P+++++ +   +IT+W LPL  E KF ++ D  L   +VEE+L+++V V L+CA
Sbjct  234   LVSGKRPLERLNPTTTRSITEWVLPLVYERKFVDIVDQRLGDEHVEEKLRKLVLVGLMCA  293

Query  2478  QNQPEKRPTMLEVVELLKGESKEKLAALENNEMFKN  2371
             Q + EKRPTM EVVE+L  ESKE++  LE N +FKN
Sbjct  294   QTETEKRPTMSEVVEMLMNESKEEMCELEANPLFKN  329



>ref|XP_006655827.1| PREDICTED: PTI1-like tyrosine-protein kinase At3g15890-like [Oryza 
brachyantha]
Length=367

 Score =   355 bits (912),  Expect = 6e-109, Method: Compositional matrix adjust.
 Identities = 161/275 (59%), Positives = 205/275 (75%), Gaps = 0/275 (0%)
 Frame = -2

Query  3198  YWGQLWDGSQIAVKRLKEWSNTAEVEFAAEVEILARARHKNLLALRGYCSEGQEHVLVYD  3019
             YWGQ+WDGSQIAVK+LK   N  E EFA++VEIL R RHKNLL+ RGYC++G E +LVYD
Sbjct  63    YWGQVWDGSQIAVKKLKCAKNGTETEFASDVEILGRVRHKNLLSFRGYCADGPERILVYD  122

Query  3018  YVPNFSLLSHLHGQYSADTLLDWKKRISIAVGSAEGIAYLHHDATPHIIHGDIKAGNVLL  2839
             Y+PN SL +HLHG +S + LLDW++R  IA+G+A  +AYLHH ATP IIHG IKA NVLL
Sbjct  123   YMPNSSLYAHLHGAHSTECLLDWRRRTFIAIGAARALAYLHHHATPQIIHGSIKATNVLL  182

Query  2838  DSNFQAQLAGFGIANFFPDDATRVTTRSKGTLGYLAPEYVMLGKESKSCDVYSFGILLLE  2659
             DSNFQA L  FG+  F PD        S+   GYLAPEYVM GK +  CDVYSFGI+LLE
Sbjct  183   DSNFQAHLGDFGLIKFIPDGVDHDKIISENQRGYLAPEYVMFGKPTTGCDVYSFGIILLE  242

Query  2658  LASGKKPIKKVSASKNWTITDWALPLACEGKFSELADPTLNGNYVEEELKRIVYVALICA  2479
             ++SG++P++K  ++K   + +W LPLA +G++ E+ D  LN  Y + ELKR+V V L C 
Sbjct  243   ISSGRRPVEKSGSAKMCGVRNWVLPLAKDGRYDEIVDSKLNDKYSDSELKRVVLVGLACT  302

Query  2478  QNQPEKRPTMLEVVELLKGESKEKLAALENNEMFK  2374
               +PEKRPTML+VV +LKGESKE L+ LEN+E+F+
Sbjct  303   HREPEKRPTMLQVVSMLKGESKEMLSRLENDELFR  337



>ref|NP_001056916.2| Os06g0166900 [Oryza sativa Japonica Group]
 dbj|BAD67605.1| putative receptor protein kinase PERK1 [Oryza sativa Japonica 
Group]
 dbj|BAD67868.1| putative receptor protein kinase PERK1 [Oryza sativa Japonica 
Group]
 dbj|BAG86712.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC80084.1| hypothetical protein OsI_21819 [Oryza sativa Indica Group]
 gb|EEE65157.1| hypothetical protein OsJ_20258 [Oryza sativa Japonica Group]
 dbj|BAF18830.2| Os06g0166900 [Oryza sativa Japonica Group]
Length=367

 Score =   355 bits (911),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 161/275 (59%), Positives = 205/275 (75%), Gaps = 0/275 (0%)
 Frame = -2

Query  3198  YWGQLWDGSQIAVKRLKEWSNTAEVEFAAEVEILARARHKNLLALRGYCSEGQEHVLVYD  3019
             YWGQ+WDGSQIAVK+LK   N  E EFA++VEIL R RHKNLL+ RGYC++G E VLVYD
Sbjct  63    YWGQVWDGSQIAVKKLKCAKNGTETEFASDVEILGRVRHKNLLSFRGYCADGPERVLVYD  122

Query  3018  YVPNFSLLSHLHGQYSADTLLDWKKRISIAVGSAEGIAYLHHDATPHIIHGDIKAGNVLL  2839
             ++PN SL +HLHG +S + LLDW++R  IA+G+A  +AYLHH ATP IIHG +KA NVLL
Sbjct  123   FMPNSSLYAHLHGTHSTECLLDWRRRTFIAIGAARALAYLHHHATPQIIHGSVKATNVLL  182

Query  2838  DSNFQAQLAGFGIANFFPDDATRVTTRSKGTLGYLAPEYVMLGKESKSCDVYSFGILLLE  2659
             DSNFQA L  FG+  F PD        S+   GYLAPEY+M GK +  CDVYSFGI+LLE
Sbjct  183   DSNFQAHLGDFGLIRFIPDGVDHDKIISENQRGYLAPEYIMFGKPTIGCDVYSFGIILLE  242

Query  2658  LASGKKPIKKVSASKNWTITDWALPLACEGKFSELADPTLNGNYVEEELKRIVYVALICA  2479
             L+SG++P+++  ++K   + +W LPLA +G++ E+ D  LN  Y E ELKR+V V L C 
Sbjct  243   LSSGRRPVERSGSAKMCGVRNWVLPLAKDGRYDEIVDSKLNDKYSESELKRVVLVGLACT  302

Query  2478  QNQPEKRPTMLEVVELLKGESKEKLAALENNEMFK  2374
               +PEKRPTMLEVV +LKGESKE L+ LEN+E+F+
Sbjct  303   HREPEKRPTMLEVVSMLKGESKEMLSRLENDELFR  337



>ref|XP_004964746.1| PREDICTED: PTI1-like tyrosine-protein kinase At3g15890-like isoform 
X1 [Setaria italica]
Length=369

 Score =   355 bits (910),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 166/275 (60%), Positives = 203/275 (74%), Gaps = 0/275 (0%)
 Frame = -2

Query  3198  YWGQLWDGSQIAVKRLKEWSNTAEVEFAAEVEILARARHKNLLALRGYCSEGQEHVLVYD  3019
             YWGQ+WDGSQIAVKRL    N  EVEFA+EVEIL R RHKNLL+ RGYC++G E +LVYD
Sbjct  63    YWGQVWDGSQIAVKRLMNTKNGTEVEFASEVEILGRIRHKNLLSFRGYCADGPERILVYD  122

Query  3018  YVPNFSLLSHLHGQYSADTLLDWKKRISIAVGSAEGIAYLHHDATPHIIHGDIKAGNVLL  2839
             Y+ N SL +HLHG  SA+ LLDW++R SIA+G+A  + YLHH ATP IIHG IKA NVLL
Sbjct  123   YMANSSLYAHLHGPLSAECLLDWRRRASIAIGAARALLYLHHHATPQIIHGSIKATNVLL  182

Query  2838  DSNFQAQLAGFGIANFFPDDATRVTTRSKGTLGYLAPEYVMLGKESKSCDVYSFGILLLE  2659
             DS+FQA +  FG+    PD        S+   GYLAPEY+M GK +  CDVYSFGI+LLE
Sbjct  183   DSDFQAHVGDFGLIRLIPDGMDHEKITSENQRGYLAPEYIMFGKPTAGCDVYSFGIILLE  242

Query  2658  LASGKKPIKKVSASKNWTITDWALPLACEGKFSELADPTLNGNYVEEELKRIVYVALICA  2479
             LASGK+PI+K  + K + I +W LPLA EG++ E+AD  L+  + E ELKR+V V L C 
Sbjct  243   LASGKRPIEKSGSVKTYGIRNWVLPLAKEGRYDEIADSKLSDKFSEPELKRMVLVGLACT  302

Query  2478  QNQPEKRPTMLEVVELLKGESKEKLAALENNEMFK  2374
              ++PEKRPTMLEVV LLKGESKE L  LE +E+F+
Sbjct  303   HSEPEKRPTMLEVVPLLKGESKETLLKLERDELFR  337



>ref|NP_566530.1| PTI1-like tyrosine-protein kinase [Arabidopsis thaliana]
 sp|Q9LSC2.1|Y3589_ARATH RecName: Full=PTI1-like tyrosine-protein kinase At3g15890 [Arabidopsis 
thaliana]
 dbj|BAB02873.1| protein kinase-like protein [Arabidopsis thaliana]
 gb|AEE75743.1| PTI1-like tyrosine-protein kinase [Arabidopsis thaliana]
Length=361

 Score =   354 bits (909),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 169/301 (56%), Positives = 223/301 (74%), Gaps = 3/301 (1%)
 Frame = -2

Query  3198  YWGQLWDGSQIAVKRLKEWSNTAEVEFAAEVEILARARHKNLLALRGYCSEGQEHVLVYD  3019
             YWGQLWDGSQIAVKRLKEWSN  E++FA EVEILAR RHKNLL++RGYC+EGQE +LVY+
Sbjct  54    YWGQLWDGSQIAVKRLKEWSNREEIDFAVEVEILARIRHKNLLSVRGYCAEGQERLLVYE  113

Query  3018  YVPNFSLLSHLHGQYSADTLLDWKKRISIAVGSAEGIAYLHHDATPHIIHGDIKAGNVLL  2839
             Y+ N SL+SHLHGQ+SA+ LLDW KR+ IA+ SA+ IAYLH  ATPHI+HGD++A NVLL
Sbjct  114   YMQNLSLVSHLHGQHSAECLLDWTKRMKIAISSAQAIAYLHDHATPHIVHGDVRASNVLL  173

Query  2838  DSNFQAQLAGFGIANFFPDDAT-RVTTRSKGTLGYLAPEYVMLGKESKSCDVYSFGILLL  2662
             DS F+A++  FG     PDD T    T++K   GY++PE    GKES++ DVYSFGILL+
Sbjct  174   DSEFEARVTDFGYGKLMPDDDTGDGATKAKSNNGYISPECDASGKESETSDVYSFGILLM  233

Query  2661  ELASGKKPIKKVSASKNWTITDWALPLACEGKFSELADPTLNGNYVEEELKRIVYVALIC  2482
              L SGK+P+++++ +    IT+W LPL  E  F E+ D  L+  +V E+LK++V V L+C
Sbjct  234   VLVSGKRPLERLNPTTTRCITEWVLPLVYERNFGEIVDKRLSEEHVAEKLKKVVLVGLMC  293

Query  2481  AQNQPEKRPTMLEVVELLKGESKEKLAALENNEMFKNLKAA--THKDGCAHEDSQEFISE  2308
             AQ  P+KRPTM EVVE+L  ESKEK++ LE N +FKN  ++   +++  A E S   + +
Sbjct  294   AQTDPDKRPTMSEVVEMLVNESKEKISELEANPLFKNPYSSNENNREHVAEESSDVILED  353

Query  2307  K  2305
             K
Sbjct  354   K  354



>gb|KFK38942.1| hypothetical protein AALP_AA3G180100 [Arabis alpina]
Length=363

 Score =   354 bits (908),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 169/284 (60%), Positives = 216/284 (76%), Gaps = 0/284 (0%)
 Frame = -2

Query  3198  YWGQLWDGSQIAVKRLKEWSNTAEVEFAAEVEILARARHKNLLALRGYCSEGQEHVLVYD  3019
             YWGQLWDGSQIAVKRLK WSN  E++FA EVEILAR RHKNLL++RGYC+EGQE +LVY+
Sbjct  54    YWGQLWDGSQIAVKRLKAWSNREEIDFAVEVEILARIRHKNLLSVRGYCAEGQERLLVYE  113

Query  3018  YVPNFSLLSHLHGQYSADTLLDWKKRISIAVGSAEGIAYLHHDATPHIIHGDIKAGNVLL  2839
             Y+PN SL+SHLHGQ+SA+ LLD  KR+ IA+  A+ IAYLHH ATPHI+HGD++A NVLL
Sbjct  114   YMPNLSLVSHLHGQHSAECLLDLTKRMKIAITCAQAIAYLHHHATPHIVHGDVRASNVLL  173

Query  2838  DSNFQAQLAGFGIANFFPDDATRVTTRSKGTLGYLAPEYVMLGKESKSCDVYSFGILLLE  2659
             DS  +A++  FG     PDDA     ++K    YL+PE V  GKES++ DVYSFGILLL 
Sbjct  174   DSELEARVTDFGYGKLMPDDAEDAAAKAKSINAYLSPECVASGKESETGDVYSFGILLLV  233

Query  2658  LASGKKPIKKVSASKNWTITDWALPLACEGKFSELADPTLNGNYVEEELKRIVYVALICA  2479
             L SGK+P+++++ +    IT+W LPL  E KF E+ D  L+G +VEE+LK++V V L+CA
Sbjct  234   LVSGKRPMERINPTTTRGITEWVLPLVYERKFGEIVDQRLSGEHVEEKLKKVVLVGLMCA  293

Query  2478  QNQPEKRPTMLEVVELLKGESKEKLAALENNEMFKNLKAATHKD  2347
             Q +PEKRPTM EVVE+L  ESKEK+  LE N +FKN  +++  D
Sbjct  294   QTEPEKRPTMSEVVEMLINESKEKITELEANPLFKNPNSSSEND  337



>gb|AAM65900.1| protein kinase, putative [Arabidopsis thaliana]
Length=361

 Score =   354 bits (908),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 169/301 (56%), Positives = 223/301 (74%), Gaps = 3/301 (1%)
 Frame = -2

Query  3198  YWGQLWDGSQIAVKRLKEWSNTAEVEFAAEVEILARARHKNLLALRGYCSEGQEHVLVYD  3019
             YWGQLWDGSQIAVKRLKEWSN  E++FA EVEILAR RHKNLL++RGYC+EGQE +LVY+
Sbjct  54    YWGQLWDGSQIAVKRLKEWSNREEIDFAVEVEILARIRHKNLLSVRGYCAEGQERLLVYE  113

Query  3018  YVPNFSLLSHLHGQYSADTLLDWKKRISIAVGSAEGIAYLHHDATPHIIHGDIKAGNVLL  2839
             Y+ N SL+SHLHGQ+SA+ LLDW KR+ IA+ SA+ IAYLH  ATPHI+HGD++A NVLL
Sbjct  114   YMQNLSLVSHLHGQHSAECLLDWTKRMKIAMSSAQAIAYLHDHATPHIVHGDVRASNVLL  173

Query  2838  DSNFQAQLAGFGIANFFPDDAT-RVTTRSKGTLGYLAPEYVMLGKESKSCDVYSFGILLL  2662
             DS F+A++  FG     PDD T    T++K   GY++PE    GKES++ DVYSFGILL+
Sbjct  174   DSEFEARVTDFGYGKLMPDDDTGDGATKAKSNNGYISPECDASGKESETSDVYSFGILLM  233

Query  2661  ELASGKKPIKKVSASKNWTITDWALPLACEGKFSELADPTLNGNYVEEELKRIVYVALIC  2482
              L SGK+P+++++ +    IT+W LPL  E  F E+ D  L+  +V E+LK++V V L+C
Sbjct  234   VLVSGKRPLERLNPTTTRCITEWVLPLVYERNFGEIVDKRLSEEHVAEKLKKVVLVGLMC  293

Query  2481  AQNQPEKRPTMLEVVELLKGESKEKLAALENNEMFKNLKAA--THKDGCAHEDSQEFISE  2308
             AQ  P+KRPTM EVVE+L  ESKEK++ LE N +FKN  ++   +++  A E S   + +
Sbjct  294   AQTDPDKRPTMSEVVEMLVNESKEKISELEANPLFKNPYSSNENNREHVAEESSDVILED  353

Query  2307  K  2305
             K
Sbjct  354   K  354



>ref|XP_002436553.1| hypothetical protein SORBIDRAFT_10g004600 [Sorghum bicolor]
 gb|EER87920.1| hypothetical protein SORBIDRAFT_10g004600 [Sorghum bicolor]
Length=367

 Score =   353 bits (906),  Expect = 5e-108, Method: Compositional matrix adjust.
 Identities = 163/276 (59%), Positives = 206/276 (75%), Gaps = 0/276 (0%)
 Frame = -2

Query  3198  YWGQLWDGSQIAVKRLKEWSNTAEVEFAAEVEILARARHKNLLALRGYCSEGQEHVLVYD  3019
             YWGQ+WDGSQIAVKRLK   N+ EVEFA+EVEIL R RHKNLL+ RGYC++G E +LVYD
Sbjct  63    YWGQVWDGSQIAVKRLKNAKNSTEVEFASEVEILGRIRHKNLLSFRGYCADGPERILVYD  122

Query  3018  YVPNFSLLSHLHGQYSADTLLDWKKRISIAVGSAEGIAYLHHDATPHIIHGDIKAGNVLL  2839
             ++ N SL +HLHG +SA+ LLDW++R SIA+G+A  + YLHH ATP IIHG IK  NVLL
Sbjct  123   FMANSSLYAHLHGPHSAECLLDWRRRASIAIGTARALLYLHHHATPKIIHGSIKTTNVLL  182

Query  2838  DSNFQAQLAGFGIANFFPDDATRVTTRSKGTLGYLAPEYVMLGKESKSCDVYSFGILLLE  2659
             DSNFQA +  FG+    PD   +    S+   GYLAPEY+M GK ++ CDVYSFGI+LLE
Sbjct  183   DSNFQAHVGDFGLIKLIPDGMDQEKITSESQRGYLAPEYIMFGKPTEGCDVYSFGIILLE  242

Query  2658  LASGKKPIKKVSASKNWTITDWALPLACEGKFSELADPTLNGNYVEEELKRIVYVALICA  2479
             LASGK+PI+K  + K + I +W LPLA +G++ E+AD  L+  + E EL+R+V V L C 
Sbjct  243   LASGKRPIEKSGSVKTYGIRNWVLPLARQGRYDEIADSKLSDKFSESELRRMVLVGLACT  302

Query  2478  QNQPEKRPTMLEVVELLKGESKEKLAALENNEMFKN  2371
              ++ EKRPTMLEVV LLKGESKE L  LE +E+F +
Sbjct  303   HSESEKRPTMLEVVPLLKGESKETLLKLERDELFSS  338



>ref|XP_004964747.1| PREDICTED: PTI1-like tyrosine-protein kinase At3g15890-like isoform 
X2 [Setaria italica]
Length=369

 Score =   352 bits (903),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 166/275 (60%), Positives = 203/275 (74%), Gaps = 0/275 (0%)
 Frame = -2

Query  3198  YWGQLWDGSQIAVKRLKEWSNTAEVEFAAEVEILARARHKNLLALRGYCSEGQEHVLVYD  3019
             YWGQ+WDGSQIAVKRL    N  EVEFA+EVEIL R RHKNLL+ RGYC++G E +LVYD
Sbjct  63    YWGQVWDGSQIAVKRLMNTKNGTEVEFASEVEILGRIRHKNLLSFRGYCADGPERILVYD  122

Query  3018  YVPNFSLLSHLHGQYSADTLLDWKKRISIAVGSAEGIAYLHHDATPHIIHGDIKAGNVLL  2839
             Y+ N SL +HLHG  SA+ LLDW++R SIA+G+A  + YLHH ATP IIHG IKA NVLL
Sbjct  123   YMANSSLYAHLHGPLSAECLLDWRRRASIAIGAARALLYLHHHATPQIIHGSIKATNVLL  182

Query  2838  DSNFQAQLAGFGIANFFPDDATRVTTRSKGTLGYLAPEYVMLGKESKSCDVYSFGILLLE  2659
             DS+FQA +  FG+    PD        S+   GYLAPEY+M GK +  CDVYSFGI+LLE
Sbjct  183   DSDFQAHVGDFGLIRLIPDGMDHEKITSENQRGYLAPEYIMFGKPTAGCDVYSFGIILLE  242

Query  2658  LASGKKPIKKVSASKNWTITDWALPLACEGKFSELADPTLNGNYVEEELKRIVYVALICA  2479
             LASGK+PI+K  + K + I +W LPLA EG++ E+AD  L+  + E ELKR+V V L C 
Sbjct  243   LASGKRPIEKSGSVKTYGIRNWVLPLAKEGRYDEIADSKLSDKFSEPELKRMVLVGLACT  302

Query  2478  QNQPEKRPTMLEVVELLKGESKEKLAALENNEMFK  2374
              ++PEKRPTMLEVV LLKGESKE L  LE +E+F+
Sbjct  303   HSEPEKRPTMLEVVPLLKGESKETLLKLERDELFR  337



>ref|XP_002975616.1| hypothetical protein SELMODRAFT_103981, partial [Selaginella 
moellendorffii]
 gb|EFJ23245.1| hypothetical protein SELMODRAFT_103981, partial [Selaginella 
moellendorffii]
Length=318

 Score =   349 bits (896),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 159/258 (62%), Positives = 197/258 (76%), Gaps = 0/258 (0%)
 Frame = -2

Query  3198  YWGQLWDGSQIAVKRLKEWSNTAEVEFAAEVEILARARHKNLLALRGYCSEGQEHVLVYD  3019
             +WGQL DG+QIAVKRLK  + T E+ FA EVE L R +H+NLL LRGYC++GQE ++VYD
Sbjct  34    FWGQLSDGTQIAVKRLKNLTTTNEMAFAVEVETLGRVQHRNLLKLRGYCTDGQERIIVYD  93

Query  3018  YVPNFSLLSHLHGQYSADTLLDWKKRISIAVGSAEGIAYLHHDATPHIIHGDIKAGNVLL  2839
             Y+PN SLLSHLHG+  +   L W KR+ IA+GSAE I YLHHDA PHIIH D+KA NVL+
Sbjct  94    YMPNLSLLSHLHGKLGSSACLSWPKRVKIAMGSAEAIEYLHHDANPHIIHRDVKASNVLI  153

Query  2838  DSNFQAQLAGFGIANFFPDDATRVTTRSKGTLGYLAPEYVMLGKESKSCDVYSFGILLLE  2659
             D+NF+AQ+A FG A F P+  T +TTR KGTLGYLAPEY M GK S+SCDVYSFGILLLE
Sbjct  154   DANFEAQIADFGFAKFVPEGVTHMTTRVKGTLGYLAPEYAMWGKVSESCDVYSFGILLLE  213

Query  2658  LASGKKPIKKVSASKNWTITDWALPLACEGKFSELADPTLNGNYVEEELKRIVYVALICA  2479
             L SG+KPI+K+ +    TI +WA PL  +GKF +L DP L G +   +LK++V+ A +CA
Sbjct  214   LISGRKPIEKMGSGMKRTIVEWAAPLVFQGKFEDLVDPKLQGKFSMLQLKKLVHAATLCA  273

Query  2478  QNQPEKRPTMLEVVELLK  2425
             Q+ PE RPTM EVV +LK
Sbjct  274   QSNPENRPTMREVVAILK  291



>ref|XP_002973593.1| hypothetical protein SELMODRAFT_99707, partial [Selaginella moellendorffii]
 gb|EFJ25253.1| hypothetical protein SELMODRAFT_99707, partial [Selaginella moellendorffii]
Length=317

 Score =   349 bits (895),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 159/258 (62%), Positives = 197/258 (76%), Gaps = 0/258 (0%)
 Frame = -2

Query  3198  YWGQLWDGSQIAVKRLKEWSNTAEVEFAAEVEILARARHKNLLALRGYCSEGQEHVLVYD  3019
             +WGQL DG+QIAVKRLK  + T E+ FA EVE L R +H+NLL LRGYC++GQE ++VYD
Sbjct  33    FWGQLSDGTQIAVKRLKNLTTTNEMAFAVEVETLGRVQHRNLLKLRGYCTDGQERIIVYD  92

Query  3018  YVPNFSLLSHLHGQYSADTLLDWKKRISIAVGSAEGIAYLHHDATPHIIHGDIKAGNVLL  2839
             Y+PN SLLSHLHG+  +   L W KR+ IA+GSAE I YLHHDA PHIIH D+KA NVL+
Sbjct  93    YMPNLSLLSHLHGKLGSSACLSWPKRVKIAMGSAEAIEYLHHDANPHIIHRDVKASNVLI  152

Query  2838  DSNFQAQLAGFGIANFFPDDATRVTTRSKGTLGYLAPEYVMLGKESKSCDVYSFGILLLE  2659
             D+NF+AQ+A FG A F P+  T +TTR KGTLGYLAPEY M GK S+SCDVYSFGILLLE
Sbjct  153   DANFEAQIADFGFAKFVPEGVTHMTTRVKGTLGYLAPEYAMWGKVSESCDVYSFGILLLE  212

Query  2658  LASGKKPIKKVSASKNWTITDWALPLACEGKFSELADPTLNGNYVEEELKRIVYVALICA  2479
             L SG+KPI+K+ +    TI +WA PL  +GKF +L DP L G +   +LK++V+ A +CA
Sbjct  213   LISGRKPIEKMGSGMKRTIVEWAAPLVFQGKFEDLVDPKLQGKFSMLQLKKLVHAATLCA  272

Query  2478  QNQPEKRPTMLEVVELLK  2425
             Q+ PE RPTM EVV +LK
Sbjct  273   QSNPENRPTMREVVAILK  290



>ref|XP_003564264.1| PREDICTED: PTI1-like tyrosine-protein kinase At3g15890 [Brachypodium 
distachyon]
Length=367

 Score =   349 bits (896),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 165/295 (56%), Positives = 207/295 (70%), Gaps = 0/295 (0%)
 Frame = -2

Query  3198  YWGQLWDGSQIAVKRLKEWSNTAEVEFAAEVEILARARHKNLLALRGYCSEGQEHVLVYD  3019
             YWGQ+W+GSQIAVK+LK+  N  EVEFA+EVE L R RHKNLL+LRGYC++G E VLVYD
Sbjct  63    YWGQVWEGSQIAVKKLKDARNGTEVEFASEVETLGRVRHKNLLSLRGYCADGAERVLVYD  122

Query  3018  YVPNFSLLSHLHGQYSADTLLDWKKRISIAVGSAEGIAYLHHDATPHIIHGDIKAGNVLL  2839
             Y+PN SL +HLHG +S++ LLDW++R  IA+G+A  + YLHH  TP IIHG IK  NVLL
Sbjct  123   YMPNSSLFAHLHGTHSSECLLDWRRRTFIAIGAARALTYLHHHVTPPIIHGSIKTTNVLL  182

Query  2838  DSNFQAQLAGFGIANFFPDDATRVTTRSKGTLGYLAPEYVMLGKESKSCDVYSFGILLLE  2659
             DS+FQA +  FG+     ++            GY APEY+M GK +  CDVYSFGI+LLE
Sbjct  183   DSDFQAHVGDFGLLRLISNEMDHDKIIGDNQRGYHAPEYIMFGKPTTGCDVYSFGIILLE  242

Query  2658  LASGKKPIKKVSASKNWTITDWALPLACEGKFSELADPTLNGNYVEEELKRIVYVALICA  2479
             L SG+KP++K  A K + I +W LPLA EG++ E+AD  LN  Y E ELKR+V + L C 
Sbjct  243   LTSGRKPVEKSGAQKLYGIRNWMLPLAKEGRYDEIADSKLNDKYSESELKRVVLIGLACT  302

Query  2478  QNQPEKRPTMLEVVELLKGESKEKLAALENNEMFKNLKAATHKDGCAHEDSQEFI  2314
             Q +PEKRPTMLEVV LLKGESKE L+ LEN E+F+    A+       E S + I
Sbjct  303   QREPEKRPTMLEVVSLLKGESKEMLSRLENEELFRPDSTASSLGMSTPEGSSDCI  357



>ref|XP_001781813.1| predicted protein [Physcomitrella patens]
 gb|EDQ53367.1| predicted protein [Physcomitrella patens]
Length=342

 Score =   348 bits (893),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 165/265 (62%), Positives = 202/265 (76%), Gaps = 1/265 (0%)
 Frame = -2

Query  3198  YWGQLWDGSQIAVKRLKEWSNTAEVEFAAEVEILARARHKNLLALRGYCSEGQEHVLVYD  3019
             YWGQL +G QIAVKRLK WS  AE+EFA EVEIL R RHKNLL+LRGYCSEG E ++VYD
Sbjct  36    YWGQLANGDQIAVKRLKVWSTKAEMEFAVEVEILGRVRHKNLLSLRGYCSEGHERLIVYD  95

Query  3018  YVPNFSLLSHLHGQYSADTLLDWKKRISIAVGSAEGIAYLHHDATPHIIHGDIKAGNVLL  2839
             Y+   SLLSHLHGQ++ D+ L+W  R+ IA+GSAEG+AYLHH ATPHIIH D+KA N+LL
Sbjct  96    YMSKLSLLSHLHGQFATDSTLNWHNRMKIAIGSAEGLAYLHHHATPHIIHRDVKASNILL  155

Query  2838  DSNFQAQLAGFGIANFFPDDATRVTTRSKGTLGYLAPEYVMLGKESKSCDVYSFGILLLE  2659
             D NF+AQ+A FG A   P+ AT +TT  KGTLGYLAPEY M GK S+SCDVYS+GI++LE
Sbjct  156   DENFEAQVADFGFAKLIPNGATHITTGVKGTLGYLAPEYAMWGKVSESCDVYSYGIVILE  215

Query  2658  LASGKKPIKKVSASKNWTITDWALPLACEGKFSELADPTLNGNYVEEELKRIVYVALICA  2479
             L SGKKPI++V  ++  TI +WA PL  +G+   L D  L  NY EEEL R++ VA +CA
Sbjct  216   LISGKKPIERVDTARR-TIVEWAGPLVLQGRCRNLVDHKLKDNYDEEELVRLIQVAALCA  274

Query  2478  QNQPEKRPTMLEVVELLKGESKEKL  2404
             QN PE RPTM EVV +L  +++  L
Sbjct  275   QNSPENRPTMQEVVGMLTEDTEGPL  299



>ref|XP_010479764.1| PREDICTED: PTI1-like tyrosine-protein kinase At3g15890 isoform 
X2 [Camelina sativa]
Length=292

 Score =   343 bits (881),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 166/292 (57%), Positives = 217/292 (74%), Gaps = 7/292 (2%)
 Frame = -2

Query  3171  QIAVKRLKEWSNTAEVEFAAEVEILARARHKNLLALRGYCSEGQEHVLVYDYVPNFSLLS  2992
             +IAVKRLK WS+  E+ FA EVEILAR RHKNLL++RGYC+EGQE ++VYDY+PN SL+S
Sbjct  3     RIAVKRLKAWSSREEITFAVEVEILARIRHKNLLSVRGYCAEGQERLIVYDYMPNLSLVS  62

Query  2991  HLHGQYSADTLLDWKKRISIAVGSAEGIAYLHHDATPHIIHGDIKAGNVLLDSNFQAQLA  2812
             HLHGQ+S+D+LLDW +R++IAV SA+ IAYLHH ATP I+HGD++A NVLLDS F+A++ 
Sbjct  63    HLHGQHSSDSLLDWTRRMNIAVTSAQAIAYLHHFATPRIVHGDVRASNVLLDSEFEARVT  122

Query  2811  GFGIANFFPDDATRVTTR-SKG-TLGYLAPEYVMLGKESKSCDVYSFGILLLELASGKKP  2638
              FG     PDDA     + +KG  +GYL+PE +  GKES   DVYSFG++LLEL +GK+P
Sbjct  123   DFGYGKMMPDDAGDGGNKITKGNNIGYLSPECIESGKESDMEDVYSFGVVLLELVTGKRP  182

Query  2637  IKKVSASKNWTITDWALPLACEGKFSELADPTLNGNYVEEELKRIVYVALICAQNQPEKR  2458
             I++ S +    IT+W LPL  E KF E+ D  LNG YVE+ELKR+V + LICAQ +PEKR
Sbjct  183   IERASLTTKQGITEWVLPLVYERKFGEIVDHRLNGKYVEDELKRVVLIGLICAQKEPEKR  242

Query  2457  PTMLEVVELLKGESKEKLAALENNEMFKNLKAATHKDGCAHEDSQEFISEKQ  2302
             PTM EVVE+L  ESKEK++ LE N +F       +  G   ++S E I+E++
Sbjct  243   PTMSEVVEMLMNESKEKMSQLEANPLFNG-----NNVGEVIDESSEIIAEER  289



>emb|CDY49913.1| BnaA05g14800D [Brassica napus]
Length=351

 Score =   346 bits (887),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 163/294 (55%), Positives = 214/294 (73%), Gaps = 3/294 (1%)
 Frame = -2

Query  3198  YWGQLWDGSQIAVKRLKEWSNTAEVEFAAEVEILARARHKNLLALRGYCSEGQEHVLVYD  3019
             YWGQL  GSQIAVKRLK WS+  E +FA EVEILAR RHKNLL+LRGYC+EGQE + VY+
Sbjct  55    YWGQLSSGSQIAVKRLKAWSSGEETDFAVEVEILARIRHKNLLSLRGYCAEGQERLFVYE  114

Query  3018  YVPNFSLLSHLHGQYSADTLLDWKKRISIAVGSAEGIAYLHHDATPHIIHGDIKAGNVLL  2839
             Y+PN SL+SHLHG +S+++LLDW +R+ IAV  A+ IAYLHH ATP I+HGD++A NVLL
Sbjct  115   YMPNLSLVSHLHGLHSSESLLDWTRRMKIAVSCAQAIAYLHHHATPRIVHGDVRASNVLL  174

Query  2838  DSNFQAQLAGFGIANFFPD-DATRVTTRSKGTLGYLAPEYVMLGKESKSCDVYSFGILLL  2662
             DS F+A++  FG     PD D    TT+    +GYL+PE +  G+ +   DVYSFG++LL
Sbjct  175   DSEFEARVTDFGYGKLMPDEDGATKTTKGGNNIGYLSPECIESGRGTYMGDVYSFGVVLL  234

Query  2661  ELASGKKPIKKVSASKNWTITDWALPLACEGKFSELADPTLNGNYVEEELKRIVYVALIC  2482
             EL +GK+PI++++ ++   IT+W LPL  E K+ ++ DP LNG YVEEELK++V VAL+C
Sbjct  235   ELVTGKRPIERLNQTRG--ITEWVLPLVYEKKYGDIVDPRLNGKYVEEELKKVVLVALMC  292

Query  2481  AQNQPEKRPTMLEVVELLKGESKEKLAALENNEMFKNLKAATHKDGCAHEDSQE  2320
             AQ++PEKRPTM EVVE+L  ESKEK+  LE   +F    A    D  + E   +
Sbjct  293   AQSEPEKRPTMSEVVEMLMNESKEKMTYLEGTPLFNRNNAGEAIDEISEEKQHQ  346



>ref|XP_008647456.1| PREDICTED: uncharacterized LOC100216997 isoform X1 [Zea mays]
Length=489

 Score =   350 bits (897),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 162/276 (59%), Positives = 203/276 (74%), Gaps = 0/276 (0%)
 Frame = -2

Query  3198  YWGQLWDGSQIAVKRLKEWSNTAEVEFAAEVEILARARHKNLLALRGYCSEGQEHVLVYD  3019
             YWGQ+WDGSQIAVKRLK   N  E EFA+EVEIL R RHKNLL+ RGYC++G E +LVYD
Sbjct  185   YWGQVWDGSQIAVKRLKSAKNGTEAEFASEVEILGRIRHKNLLSFRGYCADGPERILVYD  244

Query  3018  YVPNFSLLSHLHGQYSADTLLDWKKRISIAVGSAEGIAYLHHDATPHIIHGDIKAGNVLL  2839
             ++ N SL +HLHG +SA+ LLDW++RISIA+ +A  + YLHH ATP IIHG IK  NVLL
Sbjct  245   FMANSSLYAHLHGPHSAECLLDWRRRISIAINTARALLYLHHYATPKIIHGSIKTTNVLL  304

Query  2838  DSNFQAQLAGFGIANFFPDDATRVTTRSKGTLGYLAPEYVMLGKESKSCDVYSFGILLLE  2659
             DS+FQA +  FG+  F PD        S+   GYLAPEY+M GK +  CDVYSFGI+LLE
Sbjct  305   DSDFQAHVGDFGLIRFIPDGMDHEKITSESQRGYLAPEYIMFGKPTAGCDVYSFGIILLE  364

Query  2658  LASGKKPIKKVSASKNWTITDWALPLACEGKFSELADPTLNGNYVEEELKRIVYVALICA  2479
             LASGK+PI+K  + K + I +W LPLA +G++ E+AD  L+  + E EL+R+V V L C 
Sbjct  365   LASGKRPIEKSCSVKTYGIRNWVLPLARQGRYDEIADSKLSDKFSESELRRMVLVGLACT  424

Query  2478  QNQPEKRPTMLEVVELLKGESKEKLAALENNEMFKN  2371
              ++ EKRPTMLEVV LLKGESKE L  LE +E+F +
Sbjct  425   HSESEKRPTMLEVVPLLKGESKETLIKLERDELFSS  460



>ref|XP_009144835.1| PREDICTED: PTI1-like tyrosine-protein kinase At3g15890 [Brassica 
rapa]
Length=351

 Score =   345 bits (884),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 162/294 (55%), Positives = 214/294 (73%), Gaps = 3/294 (1%)
 Frame = -2

Query  3198  YWGQLWDGSQIAVKRLKEWSNTAEVEFAAEVEILARARHKNLLALRGYCSEGQEHVLVYD  3019
             YWGQL  GSQIAVKRLK W++  E +FA EVEILAR RHKNLL+LRGYC+EGQE + VY+
Sbjct  55    YWGQLSSGSQIAVKRLKAWNSGEETDFAVEVEILARIRHKNLLSLRGYCAEGQERLFVYE  114

Query  3018  YVPNFSLLSHLHGQYSADTLLDWKKRISIAVGSAEGIAYLHHDATPHIIHGDIKAGNVLL  2839
             Y+PN SL+SHLHG +S+++LLDW +R+ IAV  A+ IAYLHH ATP I+HGD++A NVLL
Sbjct  115   YMPNLSLVSHLHGLHSSESLLDWTRRMKIAVSCAQAIAYLHHHATPRIVHGDVRASNVLL  174

Query  2838  DSNFQAQLAGFGIANFFPD-DATRVTTRSKGTLGYLAPEYVMLGKESKSCDVYSFGILLL  2662
             DS F+A++  FG     PD D    TT+    +GYL+PE +  G+ +   DVYSFG++LL
Sbjct  175   DSEFEARVTDFGYGKLMPDEDGATKTTKGGNNIGYLSPECIESGRGTYMGDVYSFGVVLL  234

Query  2661  ELASGKKPIKKVSASKNWTITDWALPLACEGKFSELADPTLNGNYVEEELKRIVYVALIC  2482
             EL +GK+PI++++ ++   IT+W LPL  E K+ ++ DP LNG YVEEELK++V VAL+C
Sbjct  235   ELVTGKRPIERLNQTRG--ITEWVLPLVYEKKYGDIVDPRLNGKYVEEELKKVVLVALMC  292

Query  2481  AQNQPEKRPTMLEVVELLKGESKEKLAALENNEMFKNLKAATHKDGCAHEDSQE  2320
             AQ++PEKRPTM EVVE+L  ESKEK+  LE   +F    A    D  + E   +
Sbjct  293   AQSEPEKRPTMSEVVEMLMNESKEKMTYLEGTPLFNRNNAGEAIDEISEEKQHQ  346



>emb|CDX87914.1| BnaC06g09760D [Brassica napus]
Length=370

 Score =   345 bits (885),  Expect = 6e-105, Method: Compositional matrix adjust.
 Identities = 164/301 (54%), Positives = 214/301 (71%), Gaps = 1/301 (0%)
 Frame = -2

Query  3198  YWGQLWDGSQIAVKRLKEWSNTAEVEFAAEVEILARARHKNLLALRGYCSEGQEHVLVYD  3019
             YWGQL  GSQIAVKRLKEWS+  E +FA EVEILAR RHKNLL+LRGYC+EGQE + VY+
Sbjct  55    YWGQLSSGSQIAVKRLKEWSSGQETDFAVEVEILARIRHKNLLSLRGYCAEGQERLFVYE  114

Query  3018  YVPNFSLLSHLHGQYSADTLLDWKKRISIAVGSAEGIAYLHHDATPHIIHGDIKAGNVLL  2839
             Y+PN SL+SHLHG +S+++LLDW +R++IAV SA+ IAYLHH ATP I+HGD++A NVLL
Sbjct  115   YMPNLSLVSHLHGLHSSESLLDWTRRMNIAVSSAQAIAYLHHHATPRIVHGDVRASNVLL  174

Query  2838  DSNFQAQLAGFGIANFFPD-DATRVTTRSKGTLGYLAPEYVMLGKESKSCDVYSFGILLL  2662
             DS F+A++  FG     PD D    TT+    +GYL+PE +   + S   DVY FG++LL
Sbjct  175   DSEFEARVTDFGYCKLMPDEDGATKTTKGANNIGYLSPECIESVRGSYMGDVYCFGVVLL  234

Query  2661  ELASGKKPIKKVSASKNWTITDWALPLACEGKFSELADPTLNGNYVEEELKRIVYVALIC  2482
             EL +GK+PI++++      IT+W LPL  E K+ ++ D  L+G YVEEELKR+V VAL+C
Sbjct  235   ELVTGKRPIERLNQITKRGITEWVLPLVYEKKYGDIVDQRLSGKYVEEELKRVVLVALMC  294

Query  2481  AQNQPEKRPTMLEVVELLKGESKEKLAALENNEMFKNLKAATHKDGCAHEDSQEFISEKQ  2302
             AQN+PEKRPTM EVVE+L  ESKEK+  LE   +F         D    E   +   ++Q
Sbjct  295   AQNEPEKRPTMSEVVEMLMNESKEKMTYLEGTPLFNRNNGGEAIDEIPEEKEHQRQDQEQ  354

Query  2301  V  2299
             +
Sbjct  355   I  355



>ref|XP_007014100.1| LRR receptor-like serine/threonine-protein kinase [Theobroma 
cacao]
 gb|EOY31719.1| LRR receptor-like serine/threonine-protein kinase [Theobroma 
cacao]
Length=382

 Score =   345 bits (885),  Expect = 9e-105, Method: Compositional matrix adjust.
 Identities = 160/259 (62%), Positives = 198/259 (76%), Gaps = 0/259 (0%)
 Frame = -2

Query  3198  YWGQLWDGSQIAVKRLKEWSNTAEVEFAAEVEILARARHKNLLALRGYCSEGQEHVLVYD  3019
             Y G+  DG QIAVK+LK  ++ AE+EFA EVE+L R RHKNLL LRGYC    + ++VYD
Sbjct  57    YLGKTSDGLQIAVKKLKAMTSKAEMEFAVEVEVLGRVRHKNLLGLRGYCVGTDQRLIVYD  116

Query  3018  YVPNFSLLSHLHGQYSADTLLDWKKRISIAVGSAEGIAYLHHDATPHIIHGDIKAGNVLL  2839
             Y+PN SLLSHLHGQYS + LLDWK+R+ IA+GSAEGI YLHH+ TPHIIH DIKA NVLL
Sbjct  117   YMPNLSLLSHLHGQYSREVLLDWKRRMKIAIGSAEGILYLHHEVTPHIIHRDIKASNVLL  176

Query  2838  DSNFQAQLAGFGIANFFPDDATRVTTRSKGTLGYLAPEYVMLGKESKSCDVYSFGILLLE  2659
             DS+F+  +A FG A   P+  + +TTR KGTLGYLAPEY M GK S+SCDVYSFGILLLE
Sbjct  177   DSDFEPLVADFGFAKLIPEGVSHMTTRVKGTLGYLAPEYAMWGKVSESCDVYSFGILLLE  236

Query  2658  LASGKKPIKKVSASKNWTITDWALPLACEGKFSELADPTLNGNYVEEELKRIVYVALICA  2479
             L +G+KPI+K+      TIT+WA P   +G+F +L DP L GN+ E +LK+ + VA +C 
Sbjct  237   LLTGRKPIEKLPGGVKRTITEWAEPFIAKGRFKDLVDPKLRGNFDENQLKQAINVAALCV  296

Query  2478  QNQPEKRPTMLEVVELLKG  2422
             QN+PEKRP+M EVV +LKG
Sbjct  297   QNEPEKRPSMKEVVGMLKG  315



>gb|KCW53831.1| hypothetical protein EUGRSUZ_J03068 [Eucalyptus grandis]
Length=422

 Score =   346 bits (888),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 225/453 (50%), Positives = 265/453 (58%), Gaps = 79/453 (17%)
 Frame = +3

Query  336   PFGQCFTVIVSDSGAPSGLVDAPQTAYSLNNDHARTDAREQEAVYEVMRATGNDWATEIP  515
             P    FTVI SDSG    LVD PQ       + ARTD REQEAVY+VMRATGN+WA  I 
Sbjct  16    PLAAPFTVIPSDSG----LVDTPQNG---PKNGARTDPREQEAVYDVMRATGNEWAAGIV  68

Query  516   DVCRGRWHGIECMPDKANVYHVVSLSFGALSDDTAFPTCDTAPRPFISPAVTKLLHLRTL  695
             DVCRGRWHGIECMPDK  VYHVVSLSFG LSDDTAFPTCD        PA    LH    
Sbjct  69    DVCRGRWHGIECMPDKHGVYHVVSLSFGELSDDTAFPTCD--------PAWVLDLH----  116

Query  696   FFYRCFTDNPQPIPTFlgqlgqtlqtlVLRENGHVGSIPNQLGNLTRLRVLDFHGNNLNG  875
                                           +N   GSIP  LG +  LR LD  G     
Sbjct  117   ------------------------------KNDLNGSIPGSLGRVAGLRSLDLSG-----  141

Query  876   SIPVSLSRIDGLRSLDLSRNKLAASIPNLTFPLLQILDLNQNHLVGSIPTALINCHSLMK  1055
                                NKL  SIP   FP L +LDLNQN L G IP +L  C SL+K
Sbjct  142   -------------------NKLTGSIPGFGFPSLSVLDLNQNLLTGLIPPSLGTCLSLIK  182

Query  1056  MDLSRNRLSGRIPDSIDALNNIILMDLSYNSITGPIPTTLKNLDFLQALVLSGNPMLSDT  1235
             +DLS N L+G IP+SI+ L ++IL+DLSYN ++GP P +LK++  L+ALVL GNPM S T
Sbjct  183   IDLSHNHLTGPIPESINRLRDLILLDLSYNGLSGPFPESLKDMTSLEALVLKGNPMESVT  242

Query  1236  LPEHIFLDGFKDLMILALSNMNLQGSIPESLAKLPKIRVLHLDGNQLNGSIPASFGelds  1415
             +P+  F  G   L IL LS+MNL G IPESL +LP +RVLHLD N+L+GSIP SF  L S
Sbjct  243   IPDDAFA-GMNVLTILVLSDMNLHGPIPESLGRLPSLRVLHLDRNRLSGSIPESFWNLRS  301

Query  1416  lselrldsNQLTGAVPFKREMVWRMRRKLKLSNNSGLCYDAKTGLGDDLEAISDSGISHC  1595
             ++ELRL+ NQLTG +PF +E VWRM+RKL+L NNSGLCYDA  G  D   +  D GI  C
Sbjct  302   IAELRLNDNQLTGPIPFGKETVWRMKRKLRLYNNSGLCYDAGGGFEDGSGSSHDLGIGLC  361

Query  1596  --GSQATEPTRTVEHISA---VDESMLRSSVKS  1679
                +  +   RTV H S     D  M R++  S
Sbjct  362   DAAAARSGSARTVRHTSEGNDADGDMTRTAQAS  394



>ref|XP_011069876.1| PREDICTED: PTI1-like tyrosine-protein kinase At3g15890 [Sesamum 
indicum]
Length=380

 Score =   343 bits (880),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 158/260 (61%), Positives = 197/260 (76%), Gaps = 0/260 (0%)
 Frame = -2

Query  3198  YWGQLWDGSQIAVKRLKEWSNTAEVEFAAEVEILARARHKNLLALRGYCSEGQEHVLVYD  3019
             YWG+  DG QIAVK+LK  ++ AE+EFA EVE+L R RHKNLL LRGYC+   + ++VYD
Sbjct  58    YWGKTSDGLQIAVKKLKSMNSKAEMEFAVEVEVLGRVRHKNLLGLRGYCAGSDQRLIVYD  117

Query  3018  YVPNFSLLSHLHGQYSADTLLDWKKRISIAVGSAEGIAYLHHDATPHIIHGDIKAGNVLL  2839
             Y+PN SLLSHLHGQ++ +  LDWKKR+ IA+GSAEG+ YLHH+ TPHIIH DIKA NVLL
Sbjct  118   YMPNLSLLSHLHGQFAGEVQLDWKKRMKIALGSAEGLLYLHHEVTPHIIHRDIKASNVLL  177

Query  2838  DSNFQAQLAGFGIANFFPDDATRVTTRSKGTLGYLAPEYVMLGKESKSCDVYSFGILLLE  2659
             DSNF+  +A FG A   P+  + +TTR KGTLGYLAPEY M GK S+SCDVYSFGILLLE
Sbjct  178   DSNFEPLVADFGFAKLIPEGVSHMTTRVKGTLGYLAPEYAMWGKVSESCDVYSFGILLLE  237

Query  2658  LASGKKPIKKVSASKNWTITDWALPLACEGKFSELADPTLNGNYVEEELKRIVYVALICA  2479
             + +G+KPI+K+      TIT+WA P    G+F +L DP L GN+ E +L R +  A +C 
Sbjct  238   IITGRKPIEKLPGGIKRTITEWAEPHITRGRFKDLVDPKLRGNFDENQLIRTINAAALCV  297

Query  2478  QNQPEKRPTMLEVVELLKGE  2419
             QN+P+KRPTM EVV LLKG+
Sbjct  298   QNEPDKRPTMREVVALLKGQ  317



>ref|XP_008223625.1| PREDICTED: PTI1-like tyrosine-protein kinase At3g15890 [Prunus 
mume]
Length=391

 Score =   343 bits (881),  Expect = 5e-104, Method: Compositional matrix adjust.
 Identities = 161/269 (60%), Positives = 206/269 (77%), Gaps = 1/269 (0%)
 Frame = -2

Query  3198  YWGQLWDGSQIAVKRLKEWSNTAEVEFAAEVEILARARHKNLLALRGYCSEGQEHVLVYD  3019
             YWG+  DG QIAVK+LK  ++ AE+EFA EVE+L R RHKNLL LRGY +   + ++VYD
Sbjct  60    YWGKTSDGLQIAVKKLKAMNSKAEMEFAVEVEVLGRVRHKNLLGLRGYYAGADQRLIVYD  119

Query  3018  YVPNFSLLSHLHGQYSADTLLDWKKRISIAVGSAEGIAYLHHDATPHIIHGDIKAGNVLL  2839
             Y+PN SLLSHLHGQ++++  LDWK+R+ +A+GSAEG+ YLHH+ TPHIIH DIKA NVLL
Sbjct  120   YMPNLSLLSHLHGQFASEVQLDWKRRMKVAIGSAEGLLYLHHEVTPHIIHRDIKASNVLL  179

Query  2838  DSNFQAQLAGFGIANFFPDDATRVTTRSKGTLGYLAPEYVMLGKESKSCDVYSFGILLLE  2659
             DS+F+  +A FG A   P+  + +TTR KGTLGYLAPEY M GK S+SCDVYSFGILLLE
Sbjct  180   DSDFEPLVADFGFAKLIPEGVSHMTTRVKGTLGYLAPEYAMWGKVSESCDVYSFGILLLE  239

Query  2658  LASGKKPIKKVSASKNWTITDWALPLACEGKFSELADPTLNGNYVEEELKRIVYVALICA  2479
             L +G+KPI+K+      TIT+WA PL  +GK  ELADP L GN+ E +LK+ + VA +C 
Sbjct  240   LVTGRKPIEKLPGGVKRTITEWAEPLITKGKLKELADPKLRGNFDEAQLKQAINVAALCV  299

Query  2478  QNQPEKRPTMLEVVELLKG-ESKEKLAAL  2395
             ++QPEKRP M EVV++LKG E+K +L  L
Sbjct  300   KSQPEKRPKMKEVVDILKGYEAKARLTPL  328



>gb|KDP43800.1| hypothetical protein JCGZ_23008 [Jatropha curcas]
Length=386

 Score =   343 bits (880),  Expect = 5e-104, Method: Compositional matrix adjust.
 Identities = 156/259 (60%), Positives = 196/259 (76%), Gaps = 0/259 (0%)
 Frame = -2

Query  3198  YWGQLWDGSQIAVKRLKEWSNTAEVEFAAEVEILARARHKNLLALRGYCSEGQEHVLVYD  3019
             YWG+  DG QIAVK+LK  ++ AE+EFA EVE+L R RHKNLL LRGYC    + ++VYD
Sbjct  58    YWGKTSDGIQIAVKKLKAMNSKAEMEFAVEVEVLGRVRHKNLLGLRGYCVGTDQRLIVYD  117

Query  3018  YVPNFSLLSHLHGQYSADTLLDWKKRISIAVGSAEGIAYLHHDATPHIIHGDIKAGNVLL  2839
             Y+PN SLLSHLHGQ+S D  LDW++R+ + +GSAEGI YLHH+ TPHIIH DIKA NVLL
Sbjct  118   YMPNLSLLSHLHGQFSGDVQLDWRRRMKVTIGSAEGILYLHHEVTPHIIHRDIKASNVLL  177

Query  2838  DSNFQAQLAGFGIANFFPDDATRVTTRSKGTLGYLAPEYVMLGKESKSCDVYSFGILLLE  2659
             DS+F+  +A FG A   P+  + +TTR KGTLGYLAPEY M GK S+SCDVYSFGILLLE
Sbjct  178   DSDFEPLVADFGFAKLIPEGVSHMTTRVKGTLGYLAPEYAMWGKVSESCDVYSFGILLLE  237

Query  2658  LASGKKPIKKVSASKNWTITDWALPLACEGKFSELADPTLNGNYVEEELKRIVYVALICA  2479
             + +GKKPI+K+      TIT+WA PL  +G+F +L DP L GNY E +LK+ + VA +C 
Sbjct  238   ILTGKKPIEKLPGGVKRTITEWAEPLIVQGRFKDLVDPKLRGNYDENQLKQAINVAALCV  297

Query  2478  QNQPEKRPTMLEVVELLKG  2422
             QN P++RP M +VV +LKG
Sbjct  298   QNDPDRRPNMKQVVSMLKG  316



>ref|XP_003610194.1| Receptor-like kinase [Medicago truncatula]
 gb|AES92391.1| tyrosine kinase family protein [Medicago truncatula]
Length=373

 Score =   342 bits (878),  Expect = 7e-104, Method: Compositional matrix adjust.
 Identities = 158/264 (60%), Positives = 201/264 (76%), Gaps = 0/264 (0%)
 Frame = -2

Query  3198  YWGQLWDGSQIAVKRLKEWSNTAEVEFAAEVEILARARHKNLLALRGYCSEGQEHVLVYD  3019
             YWG+  DG QIAVK+LK  ++ AE+EFA EVE+L R RHKNLL LRGYC    + ++VYD
Sbjct  57    YWGRTSDGLQIAVKKLKAMNSKAEMEFAVEVEVLGRVRHKNLLGLRGYCVGDDQRLIVYD  116

Query  3018  YVPNFSLLSHLHGQYSADTLLDWKKRISIAVGSAEGIAYLHHDATPHIIHGDIKAGNVLL  2839
             Y+PN SLLSHLHGQY+ +  L+W+KR+SIA+GSAEGI YLHH+ TPHIIH DIKA NVLL
Sbjct  117   YMPNLSLLSHLHGQYAGEVQLNWQKRMSIAIGSAEGILYLHHEVTPHIIHRDIKASNVLL  176

Query  2838  DSNFQAQLAGFGIANFFPDDATRVTTRSKGTLGYLAPEYVMLGKESKSCDVYSFGILLLE  2659
             DS+F   +A FG A   P+  + +TTR KGTLGYLAPEY M GK S+SCDVYSFGILLLE
Sbjct  177   DSDFVPLVADFGFAKLIPEGVSHMTTRVKGTLGYLAPEYAMWGKVSESCDVYSFGILLLE  236

Query  2658  LASGKKPIKKVSASKNWTITDWALPLACEGKFSELADPTLNGNYVEEELKRIVYVALICA  2479
             L +G+KPI+K+      TIT+WA PL  +G+F ++ DP L GN+ E ++K+ V VA +C 
Sbjct  237   LVTGRKPIEKLPGGLKRTITEWAEPLITKGRFRDMVDPKLRGNFDENQVKQTVNVAALCV  296

Query  2478  QNQPEKRPTMLEVVELLKGESKEK  2407
             Q++PEKRP M +VV LLKG+  ++
Sbjct  297   QSEPEKRPNMKQVVSLLKGQEPDQ  320



>gb|KDO48605.1| hypothetical protein CISIN_1g0368652mg, partial [Citrus sinensis]
Length=243

 Score =   337 bits (865),  Expect = 7e-104, Method: Compositional matrix adjust.
 Identities = 173/225 (77%), Positives = 195/225 (87%), Gaps = 1/225 (0%)
 Frame = +3

Query  336   PFGQCFTVIVSDSGAPSGLVDAPQTAYSLNNDHARTDAREQEAVYEVMRATGNDWATEIP  515
             PF + FTVI+ DSG  SGLVD PQT +S+N D ART+ +EQEAVY++MRATGNDWATEIP
Sbjct  20    PFARPFTVIMQDSGGSSGLVDGPQTGFSMNKDGARTEPKEQEAVYDIMRATGNDWATEIP  79

Query  516   DVCRGRWHGIECMPDKANVYHVVSLSFGALSDDTAFPTCDTAPRPFISPAVTKLLHLRTL  695
             DVCRGRWHGIECMPDK NVYHVVSL FGALSDDTAFPTCD   R  IS ++TKL +LRTL
Sbjct  80    DVCRGRWHGIECMPDKENVYHVVSLMFGALSDDTAFPTCDPT-RSHISRSITKLPYLRTL  138

Query  696   FFYRCFTDNPQPIPTFlgqlgqtlqtlVLRENGHVGSIPNQLGNLTRLRVLDFHGNNLNG  875
             FFYRCFT NPQPIP FLGQLGQTLQTLVLRENG+VG IP++LGNLTRL+VLD H NNLNG
Sbjct  139   FFYRCFTHNPQPIPAFLGQLGQTLQTLVLRENGNVGPIPSELGNLTRLKVLDLHKNNLNG  198

Query  876   SIPVSLSRIDGLRSLDLSRNKLAASIPNLTFPLLQILDLNQNHLV  1010
             SIPVSL RI+GLRSLDLS NKL  SIP+++FP+L +LDLNQN L+
Sbjct  199   SIPVSLGRINGLRSLDLSGNKLTGSIPSISFPVLNVLDLNQNLLM  243



>gb|KDO62428.1| hypothetical protein CISIN_1g037869mg [Citrus sinensis]
Length=380

 Score =   342 bits (878),  Expect = 7e-104, Method: Compositional matrix adjust.
 Identities = 158/259 (61%), Positives = 198/259 (76%), Gaps = 0/259 (0%)
 Frame = -2

Query  3198  YWGQLWDGSQIAVKRLKEWSNTAEVEFAAEVEILARARHKNLLALRGYCSEGQEHVLVYD  3019
             YWG+  DG QIAVK+LK  ++ AE+EFA EVE+L R RHKNLL LRGYC+   + ++VYD
Sbjct  58    YWGRTSDGLQIAVKKLKAMNSKAEMEFAVEVEVLGRVRHKNLLGLRGYCAGTDQRLIVYD  117

Query  3018  YVPNFSLLSHLHGQYSADTLLDWKKRISIAVGSAEGIAYLHHDATPHIIHGDIKAGNVLL  2839
             Y+PN SLLSHLHGQY+ +  LDWK+R+ IA+GSAEGI YLHH+ TPHIIH DIKA NVLL
Sbjct  118   YMPNLSLLSHLHGQYAGEVQLDWKRRMKIAIGSAEGILYLHHEVTPHIIHRDIKASNVLL  177

Query  2838  DSNFQAQLAGFGIANFFPDDATRVTTRSKGTLGYLAPEYVMLGKESKSCDVYSFGILLLE  2659
             DS+F+  +A FG A   P+  + +TTR KGTLGYLAPEY M GK S+SCDVYSFGILLLE
Sbjct  178   DSDFEPLVADFGFAKLIPEGVSHMTTRVKGTLGYLAPEYAMWGKVSESCDVYSFGILLLE  237

Query  2658  LASGKKPIKKVSASKNWTITDWALPLACEGKFSELADPTLNGNYVEEELKRIVYVALICA  2479
             + +G+KPI+K+      TIT+WA PL  +GKF EL DP L G++ E +LK+ + VA++C 
Sbjct  238   ILTGRKPIEKLPGGVKRTITEWAEPLIVKGKFKELVDPKLRGDFDENQLKQAINVAVLCV  297

Query  2478  QNQPEKRPTMLEVVELLKG  2422
             Q++PEKRP M EVV  L G
Sbjct  298   QSEPEKRPNMKEVVNTLTG  316



>ref|XP_006474623.1| PREDICTED: PTI1-like tyrosine-protein kinase At3g15890-like [Citrus 
sinensis]
Length=380

 Score =   342 bits (878),  Expect = 8e-104, Method: Compositional matrix adjust.
 Identities = 158/259 (61%), Positives = 198/259 (76%), Gaps = 0/259 (0%)
 Frame = -2

Query  3198  YWGQLWDGSQIAVKRLKEWSNTAEVEFAAEVEILARARHKNLLALRGYCSEGQEHVLVYD  3019
             YWG+  DG QIAVK+LK  ++ AE+EFA EVE+L R RHKNLL LRGYC+   + ++VYD
Sbjct  58    YWGRTSDGLQIAVKKLKAMNSKAEMEFAVEVEVLGRVRHKNLLGLRGYCAGTDQRLIVYD  117

Query  3018  YVPNFSLLSHLHGQYSADTLLDWKKRISIAVGSAEGIAYLHHDATPHIIHGDIKAGNVLL  2839
             Y+PN SLLSHLHGQY+ +  LDWK+R+ IA+GSAEGI YLHH+ TPHIIH DIKA NVLL
Sbjct  118   YMPNLSLLSHLHGQYAGEVQLDWKRRMKIAIGSAEGILYLHHEVTPHIIHRDIKASNVLL  177

Query  2838  DSNFQAQLAGFGIANFFPDDATRVTTRSKGTLGYLAPEYVMLGKESKSCDVYSFGILLLE  2659
             DS+F+  +A FG A   P+  + +TTR KGTLGYLAPEY M GK S+SCDVYSFGILLLE
Sbjct  178   DSDFEPLVADFGFAKLIPEGVSHMTTRVKGTLGYLAPEYAMWGKVSESCDVYSFGILLLE  237

Query  2658  LASGKKPIKKVSASKNWTITDWALPLACEGKFSELADPTLNGNYVEEELKRIVYVALICA  2479
             + +G+KPI+K+      TIT+WA PL  +GKF EL DP L G++ E +LK+ + VA++C 
Sbjct  238   ILTGRKPIEKLPGGVKRTITEWAEPLIVKGKFKELVDPKLRGDFDENQLKQAINVAVLCV  297

Query  2478  QNQPEKRPTMLEVVELLKG  2422
             Q++PEKRP M EVV  L G
Sbjct  298   QSEPEKRPNMKEVVNTLTG  316



>gb|KHG24034.1| hypothetical protein F383_31684 [Gossypium arboreum]
Length=413

 Score =   343 bits (880),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 166/308 (54%), Positives = 213/308 (69%), Gaps = 6/308 (2%)
 Frame = -2

Query  3198  YWGQLWDGSQIAVKRLKEWSNTAEVEFAAEVEILARARHKNLLALRGYCSEGQEHVLVYD  3019
             YWG+  DG QIAVK+LK  ++ AE+EFA EVE+L R RHKNLL LRGYC    + ++VYD
Sbjct  91    YWGKTSDGLQIAVKKLKSMTSKAEMEFAVEVEVLGRVRHKNLLGLRGYCVGTDQRLIVYD  150

Query  3018  YVPNFSLLSHLHGQYSADTLLDWKKRISIAVGSAEGIAYLHHDATPHIIHGDIKAGNVLL  2839
             Y+PN SLLSHLHGQ++ +  LDWKKR+ IA+GSAEGI+YLHH+ TPHIIH DIKA NVLL
Sbjct  151   YMPNLSLLSHLHGQFAGEVQLDWKKRMKIAIGSAEGISYLHHEVTPHIIHRDIKASNVLL  210

Query  2838  DSNFQAQLAGFGIANFFPDDATRVTTRSKGTLGYLAPEYVMLGKESKSCDVYSFGILLLE  2659
             DS+F+  +A FG A   P+  + +TTR KGTLGYLAPEY M GK S  CDVYSFGILLLE
Sbjct  211   DSDFEPLVADFGFAKLIPEGVSHMTTRVKGTLGYLAPEYAMWGKVSNGCDVYSFGILLLE  270

Query  2658  LASGKKPIKKVSASKNWTITDWALPLACEGKFSELADPTLNGNYVEEELKRIVYVALICA  2479
             L +G+KPI+K+      TIT+WA PL   G+F +L+DP L GN+ E +LK+ + VA +C 
Sbjct  271   LLTGRKPIEKLPGGVKRTITEWAEPLVARGQFKDLSDPKLRGNFDENQLKQAISVACLCV  330

Query  2478  QNQPEKRPTMLEVVELLKGESKE------KLAALENNEMFKNLKAATHKDGCAHEDSQEF  2317
             Q++PEKRP M EVV  LKG   E      ++ +++  E    L   + +D    E+S   
Sbjct  331   QSEPEKRPNMKEVVYKLKGYGSEGKVLQARMDSVKYKEELLALDQTSDEDDGGPEESYGV  390

Query  2316  ISEKQVLE  2293
                 +V E
Sbjct  391   FGPMEVQE  398



>dbj|BAK03243.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=444

 Score =   343 bits (881),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 164/295 (56%), Positives = 205/295 (69%), Gaps = 0/295 (0%)
 Frame = -2

Query  3198  YWGQLWDGSQIAVKRLKEWSNTAEVEFAAEVEILARARHKNLLALRGYCSEGQEHVLVYD  3019
             YWGQ+WDGSQIAVK+LK   N  E+EFAAEVE L R RHKNLL+LRGYC++G E +LVYD
Sbjct  140   YWGQVWDGSQIAVKKLKNARNGTEMEFAAEVESLGRVRHKNLLSLRGYCADGPERILVYD  199

Query  3018  YVPNFSLLSHLHGQYSADTLLDWKKRISIAVGSAEGIAYLHHDATPHIIHGDIKAGNVLL  2839
             Y+PN SL +HLHG +S++ LLDW++R  IA+G+A  +AYLHH AT  IIHG IK+ NVLL
Sbjct  200   YMPNSSLFAHLHGTHSSECLLDWRRRTFIAIGAARALAYLHHHATSPIIHGSIKSTNVLL  259

Query  2838  DSNFQAQLAGFGIANFFPDDATRVTTRSKGTLGYLAPEYVMLGKESKSCDVYSFGILLLE  2659
             DS+FQA +  FG+     D+        +   GY APEYVM GK +  CDVYSFGI+LLE
Sbjct  260   DSDFQAHVGDFGLMKLISDEIDHDKIIGENQRGYHAPEYVMFGKPTTGCDVYSFGIILLE  319

Query  2658  LASGKKPIKKVSASKNWTITDWALPLACEGKFSELADPTLNGNYVEEELKRIVYVALICA  2479
             L SG+KP++K  + K   + +W LPLA EG++ E+AD  LN  Y E ELKR V + L C 
Sbjct  320   LTSGRKPVEKSGSQKMLGVRNWMLPLAKEGRYDEIADSKLNDKYSESELKRAVLIGLACT  379

Query  2478  QNQPEKRPTMLEVVELLKGESKEKLAALENNEMFKNLKAATHKDGCAHEDSQEFI  2314
               +PEKRPTMLEVV LLKGESKE L  LE  E+F+    A+       E S ++I
Sbjct  380   HREPEKRPTMLEVVSLLKGESKEMLLRLEKEELFRPDSKASSIGMSTPEGSTDYI  434



>ref|XP_007227655.1| hypothetical protein PRUPE_ppa015042mg [Prunus persica]
 gb|EMJ28854.1| hypothetical protein PRUPE_ppa015042mg [Prunus persica]
Length=388

 Score =   341 bits (875),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 160/269 (59%), Positives = 206/269 (77%), Gaps = 1/269 (0%)
 Frame = -2

Query  3198  YWGQLWDGSQIAVKRLKEWSNTAEVEFAAEVEILARARHKNLLALRGYCSEGQEHVLVYD  3019
             YWG+  DG QIAVK+LK  ++ AE+EFA EVE+L R RHKNLL LRGY +   + ++VYD
Sbjct  60    YWGKTSDGLQIAVKKLKAMNSKAEMEFAVEVEVLGRVRHKNLLGLRGYYAGADQRLIVYD  119

Query  3018  YVPNFSLLSHLHGQYSADTLLDWKKRISIAVGSAEGIAYLHHDATPHIIHGDIKAGNVLL  2839
             Y+PN SLLSHLHGQ++++  LDWK+R+ +A+GSAEG+ YLHH+ TPHIIH DIKA NVLL
Sbjct  120   YMPNLSLLSHLHGQFASEVQLDWKRRMKVALGSAEGLLYLHHEVTPHIIHRDIKASNVLL  179

Query  2838  DSNFQAQLAGFGIANFFPDDATRVTTRSKGTLGYLAPEYVMLGKESKSCDVYSFGILLLE  2659
             DS+F+  +A FG A   P+  + +TTR KGTLGYLAPEY M GK S+SCDVYSFGILLLE
Sbjct  180   DSDFEPLVADFGFAKLIPEGVSHMTTRVKGTLGYLAPEYAMWGKVSESCDVYSFGILLLE  239

Query  2658  LASGKKPIKKVSASKNWTITDWALPLACEGKFSELADPTLNGNYVEEELKRIVYVALICA  2479
             L +G+KPI+K+      TIT+WA PL  +GK  ELADP L GN+ E +LK+ + VA +C 
Sbjct  240   LVTGRKPIEKLPGGVKRTITEWAEPLITKGKLKELADPKLRGNFDEAQLKQAINVAALCV  299

Query  2478  QNQPEKRPTMLEVVELLKG-ESKEKLAAL  2395
             +++PEKRP M EVV++LKG E+K +L  L
Sbjct  300   KSEPEKRPKMKEVVDILKGFEAKARLTPL  328



>ref|XP_006381846.1| hypothetical protein POPTR_0006s18780g [Populus trichocarpa]
 gb|ERP59643.1| hypothetical protein POPTR_0006s18780g [Populus trichocarpa]
Length=378

 Score =   339 bits (870),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 155/259 (60%), Positives = 197/259 (76%), Gaps = 0/259 (0%)
 Frame = -2

Query  3198  YWGQLWDGSQIAVKRLKEWSNTAEVEFAAEVEILARARHKNLLALRGYCSEGQEHVLVYD  3019
             YWG+  DG QIAVK+LK  ++ AE+EFA EVE+L R RHKNLL LRGYC+   + ++VYD
Sbjct  50    YWGRTSDGLQIAVKKLKAMNSKAEMEFAVEVEVLGRVRHKNLLGLRGYCAGTDQRLIVYD  109

Query  3018  YVPNFSLLSHLHGQYSADTLLDWKKRISIAVGSAEGIAYLHHDATPHIIHGDIKAGNVLL  2839
             Y+PN SLLSHLHG ++ D  LDWKKR+ IA+GSAEG+ YLHH+ TPHIIH DIKA NVLL
Sbjct  110   YMPNLSLLSHLHGHFAGDVQLDWKKRMKIAIGSAEGLLYLHHEVTPHIIHRDIKASNVLL  169

Query  2838  DSNFQAQLAGFGIANFFPDDATRVTTRSKGTLGYLAPEYVMLGKESKSCDVYSFGILLLE  2659
             DS+F+  +A FG A   P+  + +TTR KGTLGYLAPEY M GK S+SCDVYSFGILLLE
Sbjct  170   DSDFEPLVADFGFAKLIPEGVSHMTTRVKGTLGYLAPEYAMWGKVSESCDVYSFGILLLE  229

Query  2658  LASGKKPIKKVSASKNWTITDWALPLACEGKFSELADPTLNGNYVEEELKRIVYVALICA  2479
             + +G+KPI+K+      T+T+WA PL  +G+F +LADP L GN+ E + K+ + VA +C 
Sbjct  230   IVTGRKPIEKLPGGVKRTVTEWAEPLITKGRFKDLADPKLRGNFDENQFKQSINVAALCV  289

Query  2478  QNQPEKRPTMLEVVELLKG  2422
             Q++PE RPTM  VV +LKG
Sbjct  290   QSEPENRPTMKVVVSMLKG  308



>ref|XP_009344789.1| PREDICTED: PTI1-like tyrosine-protein kinase At3g15890 [Pyrus 
x bretschneideri]
Length=386

 Score =   339 bits (870),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 159/269 (59%), Positives = 206/269 (77%), Gaps = 1/269 (0%)
 Frame = -2

Query  3198  YWGQLWDGSQIAVKRLKEWSNTAEVEFAAEVEILARARHKNLLALRGYCSEGQEHVLVYD  3019
             YWG+  DG QIAVK+LK  ++ AE+EFA EVE+L R RHKNLL LRGY +   + ++VYD
Sbjct  61    YWGKTNDGLQIAVKKLKAMNSKAEMEFAVEVEVLGRVRHKNLLGLRGYYAGADQRLIVYD  120

Query  3018  YVPNFSLLSHLHGQYSADTLLDWKKRISIAVGSAEGIAYLHHDATPHIIHGDIKAGNVLL  2839
             Y+PN SLLSHLHGQ++++  LDWK+R+ +A+GSAEG+ YLHH+ TPHIIH DIKA NVLL
Sbjct  121   YMPNLSLLSHLHGQFASEVQLDWKRRMKVAIGSAEGLLYLHHEVTPHIIHRDIKASNVLL  180

Query  2838  DSNFQAQLAGFGIANFFPDDATRVTTRSKGTLGYLAPEYVMLGKESKSCDVYSFGILLLE  2659
             DS+F+  +A FG A   P+  + +TTR KGTLGYLAPEY M GK S+SCDVYSFGILLLE
Sbjct  181   DSDFEPLVADFGFAKLIPEGVSHMTTRVKGTLGYLAPEYAMWGKVSESCDVYSFGILLLE  240

Query  2658  LASGKKPIKKVSASKNWTITDWALPLACEGKFSELADPTLNGNYVEEELKRIVYVALICA  2479
             L +G+KPI+K+      TIT+WA PL  +G+  ELADP L G++ E +LKR + VA +C 
Sbjct  241   LVTGRKPIEKLPGGVKRTITEWAEPLITKGRLKELADPKLIGDFDEGQLKRAINVAALCV  300

Query  2478  QNQPEKRPTMLEVVELLKG-ESKEKLAAL  2395
             +++PEKRP M EVV+LLKG E++ K+  L
Sbjct  301   KSEPEKRPKMKEVVDLLKGYEAQAKMTPL  329



>ref|XP_011012682.1| PREDICTED: PTI1-like tyrosine-protein kinase At3g15890 [Populus 
euphratica]
Length=386

 Score =   339 bits (869),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 156/259 (60%), Positives = 196/259 (76%), Gaps = 0/259 (0%)
 Frame = -2

Query  3198  YWGQLWDGSQIAVKRLKEWSNTAEVEFAAEVEILARARHKNLLALRGYCSEGQEHVLVYD  3019
             YWG+  DG QIAVK+LK  ++ AE+EFA EVE+L R RHKNLL LRGYC+   + ++VYD
Sbjct  58    YWGRTSDGLQIAVKKLKAMNSKAEMEFAVEVEVLGRVRHKNLLGLRGYCAGTDQRLIVYD  117

Query  3018  YVPNFSLLSHLHGQYSADTLLDWKKRISIAVGSAEGIAYLHHDATPHIIHGDIKAGNVLL  2839
             Y+PN SLLSHLHG  + D  LDWKKR+ IA+GSAEG+ YLHH+ TPHIIH DIKA NVLL
Sbjct  118   YMPNLSLLSHLHGHLAGDVQLDWKKRMKIAIGSAEGLLYLHHEVTPHIIHRDIKASNVLL  177

Query  2838  DSNFQAQLAGFGIANFFPDDATRVTTRSKGTLGYLAPEYVMLGKESKSCDVYSFGILLLE  2659
             DS+F+  +A FG A   P+  + +TTR KGTLGYLAPEY M GK S+SCDVYSFGILLLE
Sbjct  178   DSDFEPLVADFGFAKLIPEGVSHMTTRVKGTLGYLAPEYAMWGKVSESCDVYSFGILLLE  237

Query  2658  LASGKKPIKKVSASKNWTITDWALPLACEGKFSELADPTLNGNYVEEELKRIVYVALICA  2479
             + +G+KPI+K+      T+T+WA PL  +GKF +LADP L GN+ E + K+ + VA +C 
Sbjct  238   IVTGRKPIEKLPGGVKRTVTEWAEPLITKGKFKDLADPKLRGNFDENQFKQSINVAALCV  297

Query  2478  QNQPEKRPTMLEVVELLKG  2422
             Q++PE RPTM  VV +LKG
Sbjct  298   QSEPENRPTMKVVVSMLKG  316



>ref|XP_002534343.1| serine-threonine protein kinase, plant-type, putative [Ricinus 
communis]
 gb|EEF28041.1| serine-threonine protein kinase, plant-type, putative [Ricinus 
communis]
Length=389

 Score =   339 bits (869),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 153/259 (59%), Positives = 197/259 (76%), Gaps = 0/259 (0%)
 Frame = -2

Query  3198  YWGQLWDGSQIAVKRLKEWSNTAEVEFAAEVEILARARHKNLLALRGYCSEGQEHVLVYD  3019
             YWG+  DG QIAVK+LK  ++ AE+EFA EVE+L R RH+NLL LRGYC    + ++VYD
Sbjct  60    YWGKTTDGLQIAVKKLKAMNSKAEMEFAVEVEVLGRVRHRNLLGLRGYCVGTDQRLIVYD  119

Query  3018  YVPNFSLLSHLHGQYSADTLLDWKKRISIAVGSAEGIAYLHHDATPHIIHGDIKAGNVLL  2839
             Y+PN SLLSHLHGQ++ +  LDW++R+ I +GSAEG+ YLHH+ TPHIIH DIKA NVLL
Sbjct  120   YMPNLSLLSHLHGQFAGEVQLDWRRRMKIVIGSAEGLLYLHHEVTPHIIHRDIKASNVLL  179

Query  2838  DSNFQAQLAGFGIANFFPDDATRVTTRSKGTLGYLAPEYVMLGKESKSCDVYSFGILLLE  2659
             DS+F+  +A FG A   P+  + +TTR KGTLGYLAPEY M GK S+SCDVYSFGILLLE
Sbjct  180   DSDFEPLVADFGFAKLIPEGVSHMTTRVKGTLGYLAPEYAMWGKVSESCDVYSFGILLLE  239

Query  2658  LASGKKPIKKVSASKNWTITDWALPLACEGKFSELADPTLNGNYVEEELKRIVYVALICA  2479
             + +G+KPI+K+      TIT+WA PL  +G+  +L DP L GN+ E +LK+ + VA +C 
Sbjct  240   IITGRKPIEKLPVGVKRTITEWAEPLIIKGRIKDLVDPRLRGNFDETQLKQTINVAALCV  299

Query  2478  QNQPEKRPTMLEVVELLKG  2422
             QN+PEKRP+M EVV +LKG
Sbjct  300   QNEPEKRPSMKEVVSMLKG  318



>gb|KHN17562.1| PTI1-like tyrosine-protein kinase [Glycine soja]
Length=381

 Score =   338 bits (867),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 157/265 (59%), Positives = 201/265 (76%), Gaps = 1/265 (0%)
 Frame = -2

Query  3198  YWGQLWDGSQIAVKRLKEWSNTAEVEFAAEVEILARARHKNLLALRGYCSEGQEHVLVYD  3019
             YWG+  DG QIAVK+LK  ++ AE+EFA EVE+L R RH NLL LRGYC    + ++VYD
Sbjct  59    YWGRTSDGLQIAVKKLKAMNSKAEMEFAVEVEVLGRVRHNNLLGLRGYCVGDDQRLIVYD  118

Query  3018  YVPNFSLLSHLHGQYSADTLLDWKKRISIAVGSAEGIAYLHHDATPHIIHGDIKAGNVLL  2839
             Y+PN SLLSHLHGQ++ D  L+W++R+ IA+GSAEG+ YLH + TPHIIH DIKA NVLL
Sbjct  119   YMPNLSLLSHLHGQFAVDVQLNWQRRMKIAIGSAEGLLYLHREVTPHIIHRDIKASNVLL  178

Query  2838  DSNFQAQLAGFGIANFFPDDATRVTTRSKGTLGYLAPEYVMLGKESKSCDVYSFGILLLE  2659
             +S+F+  +A FG A   P+  + +TTR KGTLGYLAPEY M GK S+SCDVYSFGILLLE
Sbjct  179   NSDFEPLVADFGFAKLIPEGVSHMTTRVKGTLGYLAPEYAMWGKVSESCDVYSFGILLLE  238

Query  2658  LASGKKPIKKVSASKNWTITDWALPLACEGKFSELADPTLNGNYVEEELKRIVYVALICA  2479
             L +G+KPI+K++     TIT+WA PL   G+F +L DP L GN+ E ++K+ V VA +C 
Sbjct  239   LVTGRKPIEKLTGGLKRTITEWAEPLITNGRFKDLVDPKLRGNFDENQVKQTVNVAALCV  298

Query  2478  QNQPEKRPTMLEVVELLKG-ESKEK  2407
             Q++PEKRP M +VV LLKG ES+EK
Sbjct  299   QSEPEKRPNMKQVVNLLKGYESEEK  323



>ref|XP_004296427.1| PREDICTED: PTI1-like tyrosine-protein kinase At3g15890-like [Fragaria 
vesca subsp. vesca]
Length=385

 Score =   338 bits (867),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 157/259 (61%), Positives = 199/259 (77%), Gaps = 0/259 (0%)
 Frame = -2

Query  3198  YWGQLWDGSQIAVKRLKEWSNTAEVEFAAEVEILARARHKNLLALRGYCSEGQEHVLVYD  3019
             YWG+  DG QIAVK+LK  ++ AE+EFA EVE+L R RHKNLL LRGY +   + ++VYD
Sbjct  55    YWGKTSDGLQIAVKKLKAMNSKAEMEFAVEVEVLGRVRHKNLLGLRGYYAGADQRLIVYD  114

Query  3018  YVPNFSLLSHLHGQYSADTLLDWKKRISIAVGSAEGIAYLHHDATPHIIHGDIKAGNVLL  2839
             Y+PN SLLSHLHGQ++ +  LDWK+RI IA+GSAEG+ YLHH+ TPHIIH DIKA NVLL
Sbjct  115   YMPNLSLLSHLHGQFANEVHLDWKRRIKIAIGSAEGLVYLHHEVTPHIIHRDIKASNVLL  174

Query  2838  DSNFQAQLAGFGIANFFPDDATRVTTRSKGTLGYLAPEYVMLGKESKSCDVYSFGILLLE  2659
             DS+F+  +A FG A   P+  + +TTR KGTLGYLAPEY M GK S+ CDVYSFGILLLE
Sbjct  175   DSDFEPLVADFGFAKLIPEGVSHMTTRVKGTLGYLAPEYAMWGKVSEGCDVYSFGILLLE  234

Query  2658  LASGKKPIKKVSASKNWTITDWALPLACEGKFSELADPTLNGNYVEEELKRIVYVALICA  2479
             L +G+KPI+K+      TIT+WA PL  +GK+ EL+DP L GN+ E +LK  + VA +C 
Sbjct  235   LVTGRKPIEKLPGGIKRTITEWAEPLITKGKWKELSDPKLRGNFDEAQLKLAINVAAMCV  294

Query  2478  QNQPEKRPTMLEVVELLKG  2422
             +++PEKRP M+EVV+LLKG
Sbjct  295   KSEPEKRPNMMEVVDLLKG  313



>ref|XP_003550671.1| PREDICTED: PTI1-like tyrosine-protein kinase At3g15890-like [Glycine 
max]
Length=379

 Score =   337 bits (865),  Expect = 5e-102, Method: Compositional matrix adjust.
 Identities = 157/265 (59%), Positives = 201/265 (76%), Gaps = 1/265 (0%)
 Frame = -2

Query  3198  YWGQLWDGSQIAVKRLKEWSNTAEVEFAAEVEILARARHKNLLALRGYCSEGQEHVLVYD  3019
             YWG+  DG QIAVK+LK  ++ AE+EFA EVE+L R RH NLL LRGYC    + ++VYD
Sbjct  57    YWGRTSDGLQIAVKKLKAMNSKAEMEFAVEVEVLGRVRHNNLLGLRGYCVGDDQRLIVYD  116

Query  3018  YVPNFSLLSHLHGQYSADTLLDWKKRISIAVGSAEGIAYLHHDATPHIIHGDIKAGNVLL  2839
             Y+PN SLLSHLHGQ++ D  L+W++R+ IA+GSAEG+ YLH + TPHIIH DIKA NVLL
Sbjct  117   YMPNLSLLSHLHGQFAVDVQLNWQRRMKIAIGSAEGLLYLHREVTPHIIHRDIKASNVLL  176

Query  2838  DSNFQAQLAGFGIANFFPDDATRVTTRSKGTLGYLAPEYVMLGKESKSCDVYSFGILLLE  2659
             +S+F+  +A FG A   P+  + +TTR KGTLGYLAPEY M GK S+SCDVYSFGILLLE
Sbjct  177   NSDFEPLVADFGFAKLIPEGVSHMTTRVKGTLGYLAPEYAMWGKVSESCDVYSFGILLLE  236

Query  2658  LASGKKPIKKVSASKNWTITDWALPLACEGKFSELADPTLNGNYVEEELKRIVYVALICA  2479
             L +G+KPI+K++     TIT+WA PL   G+F +L DP L GN+ E ++K+ V VA +C 
Sbjct  237   LVTGRKPIEKLTGGLKRTITEWAEPLITNGRFKDLVDPKLRGNFDENQVKQTVNVAALCV  296

Query  2478  QNQPEKRPTMLEVVELLKG-ESKEK  2407
             Q++PEKRP M +VV LLKG ES+EK
Sbjct  297   QSEPEKRPNMKQVVNLLKGYESEEK  321



>ref|XP_007154803.1| hypothetical protein PHAVU_003G149200g [Phaseolus vulgaris]
 gb|ESW26797.1| hypothetical protein PHAVU_003G149200g [Phaseolus vulgaris]
Length=379

 Score =   337 bits (864),  Expect = 7e-102, Method: Compositional matrix adjust.
 Identities = 158/265 (60%), Positives = 202/265 (76%), Gaps = 1/265 (0%)
 Frame = -2

Query  3198  YWGQLWDGSQIAVKRLKEWSNTAEVEFAAEVEILARARHKNLLALRGYCSEGQEHVLVYD  3019
             YWG+  DG QIAVK+LK  ++ AE+EFA EVE+L R RHKNLL LRGYC    + ++VYD
Sbjct  57    YWGRTSDGLQIAVKKLKAMNSKAEMEFAVEVEVLGRVRHKNLLGLRGYCVGDDQRLIVYD  116

Query  3018  YVPNFSLLSHLHGQYSADTLLDWKKRISIAVGSAEGIAYLHHDATPHIIHGDIKAGNVLL  2839
             Y+PN SL+SHLHGQ++ +  L+W++R++IA+GSAEG+ YLH + TPHIIH D+KA NVLL
Sbjct  117   YMPNLSLISHLHGQFAVEVELNWQRRMNIAIGSAEGLLYLHREVTPHIIHRDVKASNVLL  176

Query  2838  DSNFQAQLAGFGIANFFPDDATRVTTRSKGTLGYLAPEYVMLGKESKSCDVYSFGILLLE  2659
             +S F+  +A FG A   P+  + +TTR KGTLGYLAPEY M GK S+SCDVYSFGILLLE
Sbjct  177   NSEFEPLVADFGFAKLIPEGVSHMTTRVKGTLGYLAPEYAMWGKVSESCDVYSFGILLLE  236

Query  2658  LASGKKPIKKVSASKNWTITDWALPLACEGKFSELADPTLNGNYVEEELKRIVYVALICA  2479
             L SG+KPI+K+      TIT+WA PL   GKF EL DP L GN+ E++LK+ + VA +C 
Sbjct  237   LISGRKPIEKLPGGLKRTITEWAEPLISRGKFRELVDPKLRGNFDEKQLKQAINVAALCV  296

Query  2478  QNQPEKRPTMLEVVELLKG-ESKEK  2407
             Q++PEKRP M +VV LLKG ES+EK
Sbjct  297   QSEPEKRPNMKQVVNLLKGYESEEK  321



>ref|XP_002271881.1| PREDICTED: PTI1-like tyrosine-protein kinase At3g15890 [Vitis 
vinifera]
Length=383

 Score =   337 bits (864),  Expect = 8e-102, Method: Compositional matrix adjust.
 Identities = 157/269 (58%), Positives = 202/269 (75%), Gaps = 1/269 (0%)
 Frame = -2

Query  3198  YWGQLWDGSQIAVKRLKEWSNTAEVEFAAEVEILARARHKNLLALRGYCSEGQEHVLVYD  3019
             YWG+  DG QIAVK+LK  ++ AE+EFA EVE+L R RHKNLL LRGYC    + ++VYD
Sbjct  56    YWGKTTDGLQIAVKKLKAMNSKAEMEFAVEVEVLGRVRHKNLLGLRGYCVGTDQRLIVYD  115

Query  3018  YVPNFSLLSHLHGQYSADTLLDWKKRISIAVGSAEGIAYLHHDATPHIIHGDIKAGNVLL  2839
             Y+PN SLLS+LHGQ+S+   LDW++R+ I +GSAEG+ YLHH+ TPHIIH DIKA NVLL
Sbjct  116   YMPNLSLLSYLHGQFSSQVQLDWRRRMKIIIGSAEGLLYLHHEVTPHIIHRDIKASNVLL  175

Query  2838  DSNFQAQLAGFGIANFFPDDATRVTTRSKGTLGYLAPEYVMLGKESKSCDVYSFGILLLE  2659
             DS+F+  +A FG A   P+  + +TTR KGTLGYLAPEY M GK S+SCDVYSFGILLLE
Sbjct  176   DSDFEPLVADFGFAKLIPEGVSHMTTRVKGTLGYLAPEYAMWGKVSESCDVYSFGILLLE  235

Query  2658  LASGKKPIKKVSASKNWTITDWALPLACEGKFSELADPTLNGNYVEEELKRIVYVALICA  2479
             + +GKKPI+K+      TIT+WA PL  +G+F +L DP L GN+ E +L++ + VA +C 
Sbjct  236   ILTGKKPIEKLPGGVKRTITEWAEPLIIKGRFKDLVDPRLRGNFDENQLRQAINVAALCV  295

Query  2478  QNQPEKRPTMLEVVELLKG-ESKEKLAAL  2395
             QN+ EKRP M EVV LLKG + K+K+  +
Sbjct  296   QNECEKRPNMKEVVSLLKGYQPKDKVTQM  324



>ref|XP_009608070.1| PREDICTED: PTI1-like tyrosine-protein kinase At3g15890 [Nicotiana 
tomentosiformis]
Length=383

 Score =   337 bits (863),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 155/260 (60%), Positives = 197/260 (76%), Gaps = 0/260 (0%)
 Frame = -2

Query  3198  YWGQLWDGSQIAVKRLKEWSNTAEVEFAAEVEILARARHKNLLALRGYCSEGQEHVLVYD  3019
             YWG+  DG QIAVK+LK  ++ AE+EFA EVE+L R RHKNLL LRGYC   ++ ++VYD
Sbjct  57    YWGKTSDGLQIAVKKLKSMNSKAEMEFAVEVEVLGRVRHKNLLGLRGYCVGNEQRLIVYD  116

Query  3018  YVPNFSLLSHLHGQYSADTLLDWKKRISIAVGSAEGIAYLHHDATPHIIHGDIKAGNVLL  2839
             Y+PN SLLSHLHG  S +  LDWKKR+ +A+GSAEG++YLHH+ TPHIIH DIKA NVLL
Sbjct  117   YMPNLSLLSHLHGHLSKEVQLDWKKRMKVAIGSAEGLSYLHHEVTPHIIHRDIKASNVLL  176

Query  2838  DSNFQAQLAGFGIANFFPDDATRVTTRSKGTLGYLAPEYVMLGKESKSCDVYSFGILLLE  2659
             DSNF+  +A FG A   P+  + +TTR KGTLGYLAPEY M GK S+SCDVYSFGILLLE
Sbjct  177   DSNFEPLVADFGFAKLIPEGVSHMTTRVKGTLGYLAPEYAMWGKVSESCDVYSFGILLLE  236

Query  2658  LASGKKPIKKVSASKNWTITDWALPLACEGKFSELADPTLNGNYVEEELKRIVYVALICA  2479
             L +G+KPI+K+      TIT+W  P+  + KF +L DP L GN+ E +L++ + VA +C 
Sbjct  237   LITGRKPIEKLPNGIKRTITEWVEPMIAKEKFKDLVDPKLKGNFDEFQLRQSIRVAALCV  296

Query  2478  QNQPEKRPTMLEVVELLKGE  2419
             Q++P+KRP M EVV +LKGE
Sbjct  297   QSEPDKRPMMKEVVSILKGE  316



>ref|XP_004242669.1| PREDICTED: PTI1-like tyrosine-protein kinase At3g15890 [Solanum 
lycopersicum]
Length=386

 Score =   337 bits (863),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 156/260 (60%), Positives = 198/260 (76%), Gaps = 0/260 (0%)
 Frame = -2

Query  3198  YWGQLWDGSQIAVKRLKEWSNTAEVEFAAEVEILARARHKNLLALRGYCSEGQEHVLVYD  3019
             YWG+  DG QIAVK+LK  ++ AE+EFA EVE+L R RHKNLL LRGYC+  ++ ++VYD
Sbjct  57    YWGKTSDGLQIAVKKLKSMNSKAEMEFAVEVEVLGRVRHKNLLGLRGYCAGNEQRLIVYD  116

Query  3018  YVPNFSLLSHLHGQYSADTLLDWKKRISIAVGSAEGIAYLHHDATPHIIHGDIKAGNVLL  2839
             Y+PN SLLSHLHG  S +  LDWKKR+ IA+GSAEG+ YLHH+ +PHIIH DIKA NVLL
Sbjct  117   YMPNLSLLSHLHGHLSREVQLDWKKRMKIAIGSAEGLLYLHHEVSPHIIHRDIKASNVLL  176

Query  2838  DSNFQAQLAGFGIANFFPDDATRVTTRSKGTLGYLAPEYVMLGKESKSCDVYSFGILLLE  2659
             DSNF+  +A FG A   P+  + +TTR KGTLGYLAPEY M GK S+SCDVYSFG+LLLE
Sbjct  177   DSNFEPLVADFGFAKLIPEGVSHMTTRVKGTLGYLAPEYAMWGKVSESCDVYSFGVLLLE  236

Query  2658  LASGKKPIKKVSASKNWTITDWALPLACEGKFSELADPTLNGNYVEEELKRIVYVALICA  2479
             L +G+KPI+K+      TIT+W  P+  + KF +L DP L GN+ E +LK+ + VA +C 
Sbjct  237   LITGRKPIEKLPNGVKRTITEWMEPMIAKEKFKDLVDPRLKGNFDEIQLKQSIRVAALCV  296

Query  2478  QNQPEKRPTMLEVVELLKGE  2419
             Q++P+KRPTM EVV +LKGE
Sbjct  297   QSEPDKRPTMKEVVCILKGE  316



>ref|XP_006343699.1| PREDICTED: PTI1-like tyrosine-protein kinase At3g15890-like [Solanum 
tuberosum]
Length=386

 Score =   337 bits (863),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 156/260 (60%), Positives = 198/260 (76%), Gaps = 0/260 (0%)
 Frame = -2

Query  3198  YWGQLWDGSQIAVKRLKEWSNTAEVEFAAEVEILARARHKNLLALRGYCSEGQEHVLVYD  3019
             YWG+  DG QIAVK+LK  ++ AE+EFA EVE+L R RHKNLL LRGYC+  ++ ++VYD
Sbjct  57    YWGKTSDGLQIAVKKLKSMNSKAEMEFAVEVEVLGRVRHKNLLGLRGYCAGNEQRLIVYD  116

Query  3018  YVPNFSLLSHLHGQYSADTLLDWKKRISIAVGSAEGIAYLHHDATPHIIHGDIKAGNVLL  2839
             Y+PN SLLSHLHG  S +  LDWKKR+ IA+GSAEG+ YLHH+ +PHIIH DIKA NVLL
Sbjct  117   YMPNLSLLSHLHGHLSREVQLDWKKRMKIAIGSAEGLLYLHHEVSPHIIHRDIKASNVLL  176

Query  2838  DSNFQAQLAGFGIANFFPDDATRVTTRSKGTLGYLAPEYVMLGKESKSCDVYSFGILLLE  2659
             DSNF+  +A FG A   P+  + +TTR KGTLGYLAPEY M GK S+SCDVYSFGILLLE
Sbjct  177   DSNFEPLVADFGFAKLIPEGVSHMTTRVKGTLGYLAPEYAMWGKVSESCDVYSFGILLLE  236

Query  2658  LASGKKPIKKVSASKNWTITDWALPLACEGKFSELADPTLNGNYVEEELKRIVYVALICA  2479
             L +G+KPI+K+      TIT+W  P+  + KF +L DP L GN+ E +LK+ + VA +C 
Sbjct  237   LITGRKPIEKLPNGVKRTITEWMEPMIAKEKFKDLVDPKLKGNFDEIQLKQSIRVAALCV  296

Query  2478  QNQPEKRPTMLEVVELLKGE  2419
             Q++P+KRPTM EVV +LKG+
Sbjct  297   QSEPDKRPTMKEVVCILKGQ  316



>ref|XP_009799766.1| PREDICTED: PTI1-like tyrosine-protein kinase At3g15890 [Nicotiana 
sylvestris]
Length=363

 Score =   335 bits (859),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 155/260 (60%), Positives = 197/260 (76%), Gaps = 0/260 (0%)
 Frame = -2

Query  3198  YWGQLWDGSQIAVKRLKEWSNTAEVEFAAEVEILARARHKNLLALRGYCSEGQEHVLVYD  3019
             YWG+  DG QIAVK+LK  ++ AE+EFA EVE+L R RH+NLL LRGYC+  ++ ++VYD
Sbjct  37    YWGKTSDGLQIAVKKLKSMNSKAEMEFAVEVEVLGRVRHENLLGLRGYCAGNEQRLIVYD  96

Query  3018  YVPNFSLLSHLHGQYSADTLLDWKKRISIAVGSAEGIAYLHHDATPHIIHGDIKAGNVLL  2839
             Y+PN SLLSHLHG  S +  LDWKKR+ +A+GSAEG+ YLHH+ TPHIIH DIKA NVLL
Sbjct  97    YMPNLSLLSHLHGHLSKEVQLDWKKRMKVAIGSAEGLLYLHHEVTPHIIHRDIKASNVLL  156

Query  2838  DSNFQAQLAGFGIANFFPDDATRVTTRSKGTLGYLAPEYVMLGKESKSCDVYSFGILLLE  2659
             DSNF+  +A FG A   P+  + +TTR KGTLGYLAPEY M GK S+SCDVYSFGILLLE
Sbjct  157   DSNFEPLVADFGFAKLIPEGVSHMTTRVKGTLGYLAPEYAMWGKVSESCDVYSFGILLLE  216

Query  2658  LASGKKPIKKVSASKNWTITDWALPLACEGKFSELADPTLNGNYVEEELKRIVYVALICA  2479
             L +G+KPI+K+      TIT+W   +  + KF +L DP L GN+ E +LK+ + VA +C 
Sbjct  217   LITGRKPIEKLPNGIKRTITEWVETMIAKEKFKDLVDPKLKGNFDEFQLKQSIRVAALCV  276

Query  2478  QNQPEKRPTMLEVVELLKGE  2419
             Q++P+KRPTM EVV +LKGE
Sbjct  277   QSEPDKRPTMKEVVSILKGE  296



>gb|KCW81052.1| hypothetical protein EUGRSUZ_C02427, partial [Eucalyptus grandis]
Length=376

 Score =   335 bits (860),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 155/260 (60%), Positives = 197/260 (76%), Gaps = 0/260 (0%)
 Frame = -2

Query  3198  YWGQLWDGSQIAVKRLKEWSNTAEVEFAAEVEILARARHKNLLALRGYCSEGQEHVLVYD  3019
             YWG+  DG QIAVK+LK  +  AE+EFA EVE+L R RHKNLL LRGYC    + ++VYD
Sbjct  57    YWGKTSDGLQIAVKKLKAMNLKAEMEFAVEVEVLGRVRHKNLLGLRGYCVGTDQRLIVYD  116

Query  3018  YVPNFSLLSHLHGQYSADTLLDWKKRISIAVGSAEGIAYLHHDATPHIIHGDIKAGNVLL  2839
             Y+PN SLLSHLHGQ+++D  LDWK+R+ I +GSAEG+ YLHH+ TPHIIH DIKA NVLL
Sbjct  117   YMPNLSLLSHLHGQFASDAHLDWKRRMKIVIGSAEGLVYLHHEVTPHIIHRDIKASNVLL  176

Query  2838  DSNFQAQLAGFGIANFFPDDATRVTTRSKGTLGYLAPEYVMLGKESKSCDVYSFGILLLE  2659
             DS+F+  +A FG A   P+  + +TTR KGTLGYLAPEY M GK S+SCDVYSFGILLLE
Sbjct  177   DSDFEPLVADFGFAKLIPEGVSHMTTRVKGTLGYLAPEYAMWGKVSESCDVYSFGILLLE  236

Query  2658  LASGKKPIKKVSASKNWTITDWALPLACEGKFSELADPTLNGNYVEEELKRIVYVALICA  2479
             + +G+KPI+K+      TIT+WA P   +G+F +LADP L G + E +LKR + VA +C 
Sbjct  237   ILTGRKPIEKLPGGIRRTITEWAEPYIVKGRFRDLADPKLRGIFDEAQLKRAINVAALCV  296

Query  2478  QNQPEKRPTMLEVVELLKGE  2419
             Q++ E+RPTM EVV +LKG+
Sbjct  297   QSEGERRPTMKEVVSILKGQ  316



>ref|XP_008782087.1| PREDICTED: PTI1-like tyrosine-protein kinase At3g15890 [Phoenix 
dactylifera]
Length=397

 Score =   336 bits (861),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 157/284 (55%), Positives = 203/284 (71%), Gaps = 13/284 (5%)
 Frame = -2

Query  3198  YWGQLWDGSQIAVKRLKEWSNTAEVEFAAEVEILARARHKNLLALRGYCSEGQEHVLVYD  3019
             YWG+  DG QIAVK+LK  ++ AE+EFA EVE+LAR RHKNLL LRGYC+  +  ++VYD
Sbjct  57    YWGKTTDGLQIAVKKLKAMNSKAEMEFAVEVEVLARVRHKNLLGLRGYCAGAEHRLIVYD  116

Query  3018  YVPNFSLLSHLHGQYSADTLLDWKKRISIAVGSAEGIAYLHHDATPHIIHGDIKAGNVLL  2839
             Y+PN SLLSHLHG++  +  LDWK+R++I +GSAEG+ YLHH+  PHIIH DIKA NVLL
Sbjct  117   YMPNLSLLSHLHGEFRGEAQLDWKRRMNIILGSAEGLVYLHHEVKPHIIHRDIKASNVLL  176

Query  2838  DSNFQAQLAGFGIANFFPDDATRVTTRSKGTLGYLAPEYVMLGKESKSCDVYSFGILLLE  2659
             DS F+  +A FG A   PD  + +TTR KGTLGYLAPEY M GK S+SCDVYSFGILLLE
Sbjct  177   DSEFEPLVADFGFAKLIPDGVSHMTTRVKGTLGYLAPEYAMWGKVSESCDVYSFGILLLE  236

Query  2658  LASGKKPIKKVSASKNWTITDWALPLACEGKFSELADPTLNGNYVEEELKRIVYVALICA  2479
             L SG+KPI+K+      TIT+WA PL  + +F +L DP L G++ E +L+R++  A +C 
Sbjct  237   LVSGRKPIEKLPGGLRRTITEWADPLISKARFRDLVDPRLRGDFNEAQLRRVIEAAALCV  296

Query  2478  QNQPEKRPTMLEVVELLKGES-------------KEKLAALENN  2386
             Q +PE+RP M EVV ++KG +             KE L A++ N
Sbjct  297   QGEPERRPDMREVVAIIKGTAAQGEGMRIESIRYKEDLMAMDQN  340



>ref|XP_010051007.1| PREDICTED: PTI1-like tyrosine-protein kinase At3g15890 [Eucalyptus 
grandis]
Length=385

 Score =   335 bits (860),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 155/260 (60%), Positives = 197/260 (76%), Gaps = 0/260 (0%)
 Frame = -2

Query  3198  YWGQLWDGSQIAVKRLKEWSNTAEVEFAAEVEILARARHKNLLALRGYCSEGQEHVLVYD  3019
             YWG+  DG QIAVK+LK  +  AE+EFA EVE+L R RHKNLL LRGYC    + ++VYD
Sbjct  57    YWGKTSDGLQIAVKKLKAMNLKAEMEFAVEVEVLGRVRHKNLLGLRGYCVGTDQRLIVYD  116

Query  3018  YVPNFSLLSHLHGQYSADTLLDWKKRISIAVGSAEGIAYLHHDATPHIIHGDIKAGNVLL  2839
             Y+PN SLLSHLHGQ+++D  LDWK+R+ I +GSAEG+ YLHH+ TPHIIH DIKA NVLL
Sbjct  117   YMPNLSLLSHLHGQFASDAHLDWKRRMKIVIGSAEGLVYLHHEVTPHIIHRDIKASNVLL  176

Query  2838  DSNFQAQLAGFGIANFFPDDATRVTTRSKGTLGYLAPEYVMLGKESKSCDVYSFGILLLE  2659
             DS+F+  +A FG A   P+  + +TTR KGTLGYLAPEY M GK S+SCDVYSFGILLLE
Sbjct  177   DSDFEPLVADFGFAKLIPEGVSHMTTRVKGTLGYLAPEYAMWGKVSESCDVYSFGILLLE  236

Query  2658  LASGKKPIKKVSASKNWTITDWALPLACEGKFSELADPTLNGNYVEEELKRIVYVALICA  2479
             + +G+KPI+K+      TIT+WA P   +G+F +LADP L G + E +LKR + VA +C 
Sbjct  237   ILTGRKPIEKLPGGIRRTITEWAEPYIVKGRFRDLADPKLRGIFDEAQLKRAINVAALCV  296

Query  2478  QNQPEKRPTMLEVVELLKGE  2419
             Q++ E+RPTM EVV +LKG+
Sbjct  297   QSEGERRPTMKEVVSILKGQ  316



>ref|XP_004508236.1| PREDICTED: PTI1-like tyrosine-protein kinase At3g15890-like [Cicer 
arietinum]
Length=378

 Score =   335 bits (858),  Expect = 7e-101, Method: Compositional matrix adjust.
 Identities = 154/259 (59%), Positives = 197/259 (76%), Gaps = 0/259 (0%)
 Frame = -2

Query  3198  YWGQLWDGSQIAVKRLKEWSNTAEVEFAAEVEILARARHKNLLALRGYCSEGQEHVLVYD  3019
             YWG+  DG QIAVK+LK  ++ AE+EFA EVE+L R RHKNLL LRGYC    + ++VYD
Sbjct  57    YWGRTTDGLQIAVKKLKAMNSKAEMEFAVEVEVLGRVRHKNLLGLRGYCVGDDQRLIVYD  116

Query  3018  YVPNFSLLSHLHGQYSADTLLDWKKRISIAVGSAEGIAYLHHDATPHIIHGDIKAGNVLL  2839
             Y+PN SLLSHLHGQ++ +  L+W++R++IA+GSAEGI YLH + TPHIIH DIKA NVLL
Sbjct  117   YMPNLSLLSHLHGQFAIEVQLNWQRRMNIAIGSAEGILYLHQEVTPHIIHRDIKASNVLL  176

Query  2838  DSNFQAQLAGFGIANFFPDDATRVTTRSKGTLGYLAPEYVMLGKESKSCDVYSFGILLLE  2659
             DS+F   +A FG A   P+  + +TTR KGTLGYLAPEY M GK S+SCDVYSFGILLLE
Sbjct  177   DSDFVPLVADFGFAKLIPEGVSHMTTRVKGTLGYLAPEYAMWGKVSESCDVYSFGILLLE  236

Query  2658  LASGKKPIKKVSASKNWTITDWALPLACEGKFSELADPTLNGNYVEEELKRIVYVALICA  2479
             L +G+KPI+K+      TIT+WA PL  +G+F +L DP L GN+ E ++K+ + VA +C 
Sbjct  237   LVTGRKPIEKLPGGLKRTITEWAEPLITKGRFRDLVDPKLRGNFDENQVKQTINVAALCV  296

Query  2478  QNQPEKRPTMLEVVELLKG  2422
             Q++PEKRP M +VV LLKG
Sbjct  297   QSEPEKRPNMKQVVNLLKG  315



>ref|XP_010913840.1| PREDICTED: PTI1-like tyrosine-protein kinase At3g15890 [Elaeis 
guineensis]
Length=383

 Score =   334 bits (856),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 155/267 (58%), Positives = 201/267 (75%), Gaps = 1/267 (0%)
 Frame = -2

Query  3198  YWGQLWDGSQIAVKRLKEWSNTAEVEFAAEVEILARARHKNLLALRGYCSEGQEHVLVYD  3019
             YWG+  DG QIAVK+LK  ++ AE+EFA EVE+LAR RHKNLL LRGYC+  +  ++VYD
Sbjct  57    YWGKTADGLQIAVKKLKAMNSKAEMEFAVEVEVLARVRHKNLLGLRGYCAGAEHRLIVYD  116

Query  3018  YVPNFSLLSHLHGQYSADTLLDWKKRISIAVGSAEGIAYLHHDATPHIIHGDIKAGNVLL  2839
             Y+PN SLLSHLHG   ++  LDWK R++I +GSAEG+ YLHH+ TPHIIH DIKA NVLL
Sbjct  117   YMPNLSLLSHLHGHLKSEGRLDWKTRMNIILGSAEGLVYLHHEVTPHIIHRDIKASNVLL  176

Query  2838  DSNFQAQLAGFGIANFFPDDATRVTTRSKGTLGYLAPEYVMLGKESKSCDVYSFGILLLE  2659
             DS+F+  +A FG A   P+  + +TTR KGTLGYLAPEY M GK S+SCDVYSFGILLLE
Sbjct  177   DSDFEPLVADFGFAKLIPEGVSHMTTRVKGTLGYLAPEYAMWGKVSESCDVYSFGILLLE  236

Query  2658  LASGKKPIKKVSASKNWTITDWALPLACEGKFSELADPTLNGNYVEEELKRIVYVALICA  2479
             L SG+KPI+K+      TIT+WA PL  + +F EL DP L G++ E +L+R++  A++C 
Sbjct  237   LVSGRKPIEKLPGGVKRTITEWAEPLISKARFRELVDPRLLGDFDEAQLRRVIEAAILCV  296

Query  2478  QNQPEKRPTMLEVVELLKGESKEKLAA  2398
             Q +PE+RP M EVV +++G S  ++AA
Sbjct  297   QGEPERRPDMREVVAIIQG-SDSRVAA  322



>ref|XP_008658224.1| PREDICTED: uncharacterized LOC100272420 isoform X1 [Zea mays]
Length=366

 Score =   333 bits (854),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 161/293 (55%), Positives = 200/293 (68%), Gaps = 3/293 (1%)
 Frame = -2

Query  3198  YWGQLWDGSQIAVKRLKEWSNTAEVEFAAEVEILARARHKNLLALRGYCSEGQEHVLVYD  3019
             YWGQ+WDGSQIAVKRL    N  E EFA+EVEIL R RHKNLL+ RGYC++G E VLVYD
Sbjct  56    YWGQVWDGSQIAVKRLNNAKNGTEAEFASEVEILGRIRHKNLLSFRGYCADGPERVLVYD  115

Query  3018  YVPNFSLLSHLHGQYSADTLLDWKKRISIAVGSAEGIAYLHHDATPHIIHGDIKAGNVLL  2839
             ++ N SL +HLHG +SA+ LLDW++R SIA+G+A  + YLH  ATP IIHG +KA NVLL
Sbjct  116   FMANSSLYAHLHGPHSAECLLDWRRRASIAMGTARALLYLHRHATPKIIHGSVKATNVLL  175

Query  2838  DSNFQAQLAGFGIANFFPDDAT--RVTTRSKGTLGYLAPEY-VMLGKESKSCDVYSFGIL  2668
             DS+F+A    FG+A   PDD T       S+   GYLAPEY  M GK +  CDVYSFGI+
Sbjct  176   DSDFRAHAGDFGLARLIPDDGTDHEKIASSESQRGYLAPEYAAMSGKPTAGCDVYSFGII  235

Query  2667  LLELASGKKPIKKVSASKNWTITDWALPLACEGKFSELADPTLNGNYVEEELKRIVYVAL  2488
             LLELASG++P++K  + K   I  W LPLA +G++ E+AD  L   +   EL+R+V V L
Sbjct  236   LLELASGRRPVEKSGSGKACGIRSWVLPLARQGRYDEIADSKLGDKFSGPELRRMVLVGL  295

Query  2487  ICAQNQPEKRPTMLEVVELLKGESKEKLAALENNEMFKNLKAATHKDGCAHED  2329
              C +++PEKRPTML+VV LLKGESKE L  LE  E+F          G    D
Sbjct  296   ACTRSEPEKRPTMLQVVPLLKGESKETLVKLEREELFSPDSTTVSSQGTPTPD  348



>ref|XP_008341188.1| PREDICTED: PTI1-like tyrosine-protein kinase At3g15890 [Malus 
domestica]
Length=386

 Score =   333 bits (855),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 157/269 (58%), Positives = 205/269 (76%), Gaps = 1/269 (0%)
 Frame = -2

Query  3198  YWGQLWDGSQIAVKRLKEWSNTAEVEFAAEVEILARARHKNLLALRGYCSEGQEHVLVYD  3019
             YWG+  DG QIAVK+LK  ++ AE+EFA EVE+L R RHKNLL LRGY +   + ++VYD
Sbjct  61    YWGKTSDGLQIAVKKLKAMNSKAEMEFAVEVEVLGRVRHKNLLGLRGYYAGADQRLIVYD  120

Query  3018  YVPNFSLLSHLHGQYSADTLLDWKKRISIAVGSAEGIAYLHHDATPHIIHGDIKAGNVLL  2839
             Y+PN SLLSHLHGQ++++  LDWK+R+ +A+GSAEG+ YLHH+ TPHIIH DIKA NVLL
Sbjct  121   YMPNLSLLSHLHGQFASEVRLDWKRRMKVAIGSAEGLLYLHHEVTPHIIHRDIKASNVLL  180

Query  2838  DSNFQAQLAGFGIANFFPDDATRVTTRSKGTLGYLAPEYVMLGKESKSCDVYSFGILLLE  2659
             DS+F+  +A FG A   P+  + +TTR KGTLGYLAPEY M GK S+SCDVYSFGILLLE
Sbjct  181   DSDFEPLVADFGFAKLIPEGVSHMTTRVKGTLGYLAPEYAMWGKVSESCDVYSFGILLLE  240

Query  2658  LASGKKPIKKVSASKNWTITDWALPLACEGKFSELADPTLNGNYVEEELKRIVYVALICA  2479
             L +G+KPI+K+      TIT+WA PL  +G+  ELADP L GN+ E +LK+ + VA +C 
Sbjct  241   LVTGRKPIEKLPGGVKRTITEWAEPLITKGRLKELADPRLRGNFDEGQLKQAINVAALCV  300

Query  2478  QNQPEKRPTMLEVVELLKG-ESKEKLAAL  2395
             +++PEKR  + EVV+LLKG E++ K+  L
Sbjct  301   KSEPEKRLKIKEVVDLLKGYEAQIKMKPL  329



>gb|ACG32332.1| BRASSINOSTEROID INSENSITIVE 1-associated receptor kinase 1 precursor 
[Zea mays]
Length=375

 Score =   333 bits (853),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 161/293 (55%), Positives = 200/293 (68%), Gaps = 3/293 (1%)
 Frame = -2

Query  3198  YWGQLWDGSQIAVKRLKEWSNTAEVEFAAEVEILARARHKNLLALRGYCSEGQEHVLVYD  3019
             YWGQ+WDGSQIAVKRL    N  E EFA+EVEIL R RHKNLL+ RGYC++G E VLVYD
Sbjct  65    YWGQVWDGSQIAVKRLNNAKNGTEAEFASEVEILGRIRHKNLLSFRGYCADGPERVLVYD  124

Query  3018  YVPNFSLLSHLHGQYSADTLLDWKKRISIAVGSAEGIAYLHHDATPHIIHGDIKAGNVLL  2839
             ++ N SL +HLHG +SA+ LLDW++R SIA+G+A  + YLH  ATP IIHG +KA NVLL
Sbjct  125   FMANSSLYAHLHGPHSAECLLDWRRRASIAMGTARALLYLHRHATPKIIHGSVKATNVLL  184

Query  2838  DSNFQAQLAGFGIANFFPDDAT--RVTTRSKGTLGYLAPEY-VMLGKESKSCDVYSFGIL  2668
             DS+F+A    FG+A   PDD T       S+   GYLAPEY  M GK +  CDVYSFGI+
Sbjct  185   DSDFRAHAGDFGLARLIPDDGTDHEKIASSESQRGYLAPEYAAMSGKPTAGCDVYSFGII  244

Query  2667  LLELASGKKPIKKVSASKNWTITDWALPLACEGKFSELADPTLNGNYVEEELKRIVYVAL  2488
             LLELASG++P++K  + K   I  W LPLA +G++ E+AD  L   +   EL+R+V V L
Sbjct  245   LLELASGRRPVEKSGSGKACGIRSWVLPLARQGRYDEIADSKLGDKFSGPELRRMVLVGL  304

Query  2487  ICAQNQPEKRPTMLEVVELLKGESKEKLAALENNEMFKNLKAATHKDGCAHED  2329
              C +++PEKRPTML+VV LLKGESKE L  LE  E+F          G    D
Sbjct  305   ACTRSEPEKRPTMLQVVPLLKGESKETLVKLEREELFSPDSTTVSSQGTPTPD  357



>ref|NP_001140369.1| uncharacterized LOC100272420 [Zea mays]
 gb|ACF83684.1| unknown [Zea mays]
 gb|AFW85668.1| putative protein kinase superfamily protein [Zea mays]
Length=375

 Score =   333 bits (853),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 161/293 (55%), Positives = 200/293 (68%), Gaps = 3/293 (1%)
 Frame = -2

Query  3198  YWGQLWDGSQIAVKRLKEWSNTAEVEFAAEVEILARARHKNLLALRGYCSEGQEHVLVYD  3019
             YWGQ+WDGSQIAVKRL    N  E EFA+EVEIL R RHKNLL+ RGYC++G E VLVYD
Sbjct  65    YWGQVWDGSQIAVKRLNNAKNGTEAEFASEVEILGRIRHKNLLSFRGYCADGPERVLVYD  124

Query  3018  YVPNFSLLSHLHGQYSADTLLDWKKRISIAVGSAEGIAYLHHDATPHIIHGDIKAGNVLL  2839
             ++ N SL +HLHG +SA+ LLDW++R SIA+G+A  + YLH  ATP IIHG +KA NVLL
Sbjct  125   FMANSSLYAHLHGPHSAECLLDWRRRASIAMGTARALLYLHRHATPKIIHGSVKATNVLL  184

Query  2838  DSNFQAQLAGFGIANFFPDDAT--RVTTRSKGTLGYLAPEY-VMLGKESKSCDVYSFGIL  2668
             DS+F+A    FG+A   PDD T       S+   GYLAPEY  M GK +  CDVYSFGI+
Sbjct  185   DSDFRAHAGDFGLARLIPDDGTDHEKIASSESQRGYLAPEYAAMSGKPTAGCDVYSFGII  244

Query  2667  LLELASGKKPIKKVSASKNWTITDWALPLACEGKFSELADPTLNGNYVEEELKRIVYVAL  2488
             LLELASG++P++K  + K   I  W LPLA +G++ E+AD  L   +   EL+R+V V L
Sbjct  245   LLELASGRRPVEKSGSGKACGIRSWVLPLARQGRYDEIADSKLGDKFSGPELRRMVLVGL  304

Query  2487  ICAQNQPEKRPTMLEVVELLKGESKEKLAALENNEMFKNLKAATHKDGCAHED  2329
              C +++PEKRPTML+VV LLKGESKE L  LE  E+F          G    D
Sbjct  305   ACTRSEPEKRPTMLQVVPLLKGESKETLVKLEREELFSPDSTTVSSQGTPTPD  357



>ref|XP_009379508.1| PREDICTED: PTI1-like tyrosine-protein kinase At3g15890 [Pyrus 
x bretschneideri]
Length=391

 Score =   333 bits (853),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 157/269 (58%), Positives = 204/269 (76%), Gaps = 1/269 (0%)
 Frame = -2

Query  3198  YWGQLWDGSQIAVKRLKEWSNTAEVEFAAEVEILARARHKNLLALRGYCSEGQEHVLVYD  3019
             YWG+  DG QIAVK+LK  ++ AE+EFA EVE+L R RHKNLL LRGY +   + ++VYD
Sbjct  61    YWGKTSDGLQIAVKKLKAMNSKAEMEFAVEVEVLGRVRHKNLLGLRGYYAGADQRLIVYD  120

Query  3018  YVPNFSLLSHLHGQYSADTLLDWKKRISIAVGSAEGIAYLHHDATPHIIHGDIKAGNVLL  2839
             Y+PN SLLSHLHGQ++++  LDWK+R+ +A+GSAEG+ YLHH+ TPHIIH DIKA NVLL
Sbjct  121   YMPNLSLLSHLHGQFASEVRLDWKRRMKVAIGSAEGLLYLHHEVTPHIIHRDIKASNVLL  180

Query  2838  DSNFQAQLAGFGIANFFPDDATRVTTRSKGTLGYLAPEYVMLGKESKSCDVYSFGILLLE  2659
             DS+F+  +A FG A   P+  + +TTR KGTLGYLAPEY M GK S+SCDVYSFGILLLE
Sbjct  181   DSDFEPLVADFGFAKLIPEGVSHMTTRVKGTLGYLAPEYAMWGKVSESCDVYSFGILLLE  240

Query  2658  LASGKKPIKKVSASKNWTITDWALPLACEGKFSELADPTLNGNYVEEELKRIVYVALICA  2479
             L +G+KPI+K+      TIT+WA PL  +G+  ELADP L GN+ E +LK+ + VA +C 
Sbjct  241   LVTGRKPIEKLPGGVKRTITEWAEPLITKGRLKELADPRLRGNFDEGQLKQAINVAALCV  300

Query  2478  QNQPEKRPTMLEVVELLKG-ESKEKLAAL  2395
             ++ PEKR  + EVV+LLKG E++ K+  L
Sbjct  301   KSDPEKRLKIKEVVDLLKGYEAQIKMKPL  329



>ref|XP_008785783.1| PREDICTED: PTI1-like tyrosine-protein kinase At3g15890 [Phoenix 
dactylifera]
Length=259

 Score =   327 bits (839),  Expect = 6e-100, Method: Compositional matrix adjust.
 Identities = 158/237 (67%), Positives = 190/237 (80%), Gaps = 0/237 (0%)
 Frame = -2

Query  3015  VPNFSLLSHLHGQYSADTLLDWKKRISIAVGSAEGIAYLHHDATPHIIHGDIKAGNVLLD  2836
             +PN SLLSHLHG++ A+ +LDW +R+SIA+GSAEGIAYLHH ATPHIIH DIKA NVLLD
Sbjct  1     MPNLSLLSHLHGRHLAECVLDWGRRMSIAIGSAEGIAYLHHHATPHIIHRDIKASNVLLD  60

Query  2835  SNFQAQLAGFGIANFFPDDATRVTTRSKGTLGYLAPEYVMLGKESKSCDVYSFGILLLEL  2656
             S+FQA++A FG A   PD A+ VTT+ KGTLGYLAPEY MLGK S+SCDVYSFGILLLEL
Sbjct  61    SDFQARVADFGFAKLIPDGASHVTTKVKGTLGYLAPEYAMLGKASESCDVYSFGILLLEL  120

Query  2655  ASGKKPIKKVSASKNWTITDWALPLACEGKFSELADPTLNGNYVEEELKRIVYVALICAQ  2476
              SGKKPI+  S +    ITDWALPLA E +F  +ADP LNGNY E ELKR+V VALICAQ
Sbjct  121   GSGKKPIEMRSPAVKQAITDWALPLARERRFGAIADPRLNGNYEEAELKRVVLVALICAQ  180

Query  2475  NQPEKRPTMLEVVELLKGESKEKLAALENNEMFKNLKAATHKDGCAHEDSQEFISEK  2305
             ++PEKRPTMLEVV+LLKGESKEKL+ LEN+EMF+     + +     +D+ + I+E+
Sbjct  181   SKPEKRPTMLEVVDLLKGESKEKLSNLENDEMFRPEPTMSCQGVSGPDDNSDCITEE  237



>gb|EYU42447.1| hypothetical protein MIMGU_mgv1a024689mg, partial [Erythranthe 
guttata]
Length=372

 Score =   332 bits (850),  Expect = 6e-100, Method: Compositional matrix adjust.
 Identities = 155/259 (60%), Positives = 194/259 (75%), Gaps = 0/259 (0%)
 Frame = -2

Query  3198  YWGQLWDGSQIAVKRLKEWSNTAEVEFAAEVEILARARHKNLLALRGYCSEGQEHVLVYD  3019
             YWG+  DG QIAVK+LK  ++ AE+EFA EVE+L R +HKNLL LRGYC+   + ++VYD
Sbjct  49    YWGKTSDGLQIAVKKLKSMNSKAEMEFAVEVEVLGRVKHKNLLGLRGYCAGNDQRLIVYD  108

Query  3018  YVPNFSLLSHLHGQYSADTLLDWKKRISIAVGSAEGIAYLHHDATPHIIHGDIKAGNVLL  2839
             Y+PN SLLSHLHGQ++    LDW KR++IA+GSA+G+ YLHH+ TPHIIH DIKA NVLL
Sbjct  109   YMPNLSLLSHLHGQFAGQVHLDWTKRMNIALGSAQGLLYLHHEVTPHIIHRDIKASNVLL  168

Query  2838  DSNFQAQLAGFGIANFFPDDATRVTTRSKGTLGYLAPEYVMLGKESKSCDVYSFGILLLE  2659
             DSNF+  +A FG A   P+  + +TTR KGTLGYLAPEY M GK S+SCDVYSFGILLLE
Sbjct  169   DSNFEPLVADFGFAKLIPEGVSHMTTRVKGTLGYLAPEYAMWGKVSESCDVYSFGILLLE  228

Query  2658  LASGKKPIKKVSASKNWTITDWALPLACEGKFSELADPTLNGNYVEEELKRIVYVALICA  2479
             + +G+KPI+K+      TIT+WA P    G+  +LADP L GN+ E +L   V VA +C 
Sbjct  229   IVTGRKPIEKLPGGLKRTITEWAEPHITRGRVKDLADPKLRGNFDERQLMEAVNVAALCV  288

Query  2478  QNQPEKRPTMLEVVELLKG  2422
             Q++ EKRPTM EVV LLKG
Sbjct  289   QSEAEKRPTMREVVGLLKG  307



>ref|XP_009386921.1| PREDICTED: PTI1-like tyrosine-protein kinase At3g15890 [Musa 
acuminata subsp. malaccensis]
Length=389

 Score =   332 bits (850),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 158/295 (54%), Positives = 207/295 (70%), Gaps = 4/295 (1%)
 Frame = -2

Query  3198  YWGQLWDGSQIAVKRLKEWSNTAEVEFAAEVEILARARHKNLLALRGYCSEGQEHVLVYD  3019
             YWG+  DG QIAVK+LK  ++ AE+EFA EVE+LAR RHKNLL LRGYC+   + ++VYD
Sbjct  56    YWGKTTDGLQIAVKKLKSMNSKAEMEFAVEVEVLARVRHKNLLGLRGYCAATDQRLIVYD  115

Query  3018  YVPNFSLLSHLHGQYSADTLLDWKKRISIAVGSAEGIAYLHHDATPHIIHGDIKAGNVLL  2839
             Y+PN SLLSHLHGQ++ +  LDW++R+++ +GSAE + YLHH+ TPHIIH DIKA NVLL
Sbjct  116   YMPNLSLLSHLHGQFAHEVRLDWRRRMNVILGSAEALVYLHHEVTPHIIHRDIKASNVLL  175

Query  2838  DSNFQAQLAGFGIANFFPDDATRVTTRSKGTLGYLAPEYVMLGKESKSCDVYSFGILLLE  2659
             D+NF+  +A FG A   P+  + +TTR KGTLGYLAPEY M G+ S SCDVYSFGILLLE
Sbjct  176   DANFEPLVADFGFAKLVPEGVSHMTTRVKGTLGYLAPEYAMWGRVSDSCDVYSFGILLLE  235

Query  2658  LASGKKPIKKVSASKNWTITDWALPLACEGKFSELADPTLNGNYVEEELKRIVYVALICA  2479
             L SG+KPI+K+      TI +WA PL  +G+F EL DP L GN+   EL+R+V  A++C 
Sbjct  236   LVSGRKPIEKLPGGMKRTIIEWAEPLISKGRFRELVDPRLRGNFDGAELRRVVEAAVLCI  295

Query  2478  QNQPEKRPTMLEVVELLKG----ESKEKLAALENNEMFKNLKAATHKDGCAHEDS  2326
             Q + E+RP M EVV +L G    E K ++  L++    ++L           EDS
Sbjct  296   QGEAEQRPDMKEVVGILGGREVREPKTEVVRLKSIRYGEHLMTMDQNSDEGFEDS  350



>ref|XP_008376715.1| PREDICTED: PTI1-like tyrosine-protein kinase At3g15890 isoform 
X1 [Malus domestica]
Length=340

 Score =   328 bits (841),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 155/275 (56%), Positives = 202/275 (73%), Gaps = 3/275 (1%)
 Frame = -2

Query  3198  YWGQLWDGSQIAVKRLKEWSNTAEVEFAAEVEILARARHKNLLALRGYCSEGQEHVLVYD  3019
             YWG+   G +IAVKRLK  S  AE+EFA EVEIL R RH+NLL LRG+ + G E ++VYD
Sbjct  60    YWGRTSKGVEIAVKRLKTMSPKAEMEFAVEVEILGRVRHRNLLGLRGFYAGGDERLIVYD  119

Query  3018  YVPNFSLLSHLHGQYSADTLLDWKKRISIAVGSAEGIAYLHHDATPHIIHGDIKAGNVLL  2839
             ++PN SL++HLHG+ +AD LLDW +R+SIA+GSAEG++YLHH+A+PHIIH DIKA NVLL
Sbjct  120   FMPNHSLITHLHGKLAADCLLDWPRRLSIAIGSAEGLSYLHHEASPHIIHRDIKASNVLL  179

Query  2838  DSNFQAQLAGFGIANFFPDDATRVTTRSKGTLGYLAPEYVMLGKESKSCDVYSFGILLLE  2659
             D+ F+A++A FG A   PD  T +TTR KGTLGYLAPEY M GK S+SCDVYSFGILLLE
Sbjct  180   DTEFEAKVADFGFAKLIPDGVTHLTTRVKGTLGYLAPEYAMWGKVSESCDVYSFGILLLE  239

Query  2658  LASGKKPIKKVSASKNWTITDWALPLACEGKFSELADPTLNGNYVEEELKRIVYVALICA  2479
             + SGKKPI+K+       I  W  P   +G F+++ DP L G + +E++K  V VA+ C 
Sbjct  240   IISGKKPIEKLPGGVKRDIVQWVTPYVEKGAFNQIVDPRLKGKFDKEQVKSTVIVAMKCT  299

Query  2478  QNQPEKRPTMLEVVELLK---GESKEKLAALENNE  2383
              N P+ RPTM+EVV+ LK   G  K+++  +E+ E
Sbjct  300   DNSPDNRPTMIEVVDWLKGGLGRRKKEIRKVEDTE  334



>gb|EMT07880.1| BRASSINOSTEROID INSENSITIVE 1-associated receptor kinase 1 [Aegilops 
tauschii]
Length=366

 Score =   329 bits (843),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 160/275 (58%), Positives = 199/275 (72%), Gaps = 0/275 (0%)
 Frame = -2

Query  3198  YWGQLWDGSQIAVKRLKEWSNTAEVEFAAEVEILARARHKNLLALRGYCSEGQEHVLVYD  3019
             YWGQ+WDGSQIAVK+LK   N  E+EFAAEVE L R RHKNLL+LRGYC++G E +LVYD
Sbjct  63    YWGQVWDGSQIAVKKLKNARNGTEMEFAAEVESLGRVRHKNLLSLRGYCADGPERILVYD  122

Query  3018  YVPNFSLLSHLHGQYSADTLLDWKKRISIAVGSAEGIAYLHHDATPHIIHGDIKAGNVLL  2839
             Y+PN SL +HLHG +S++ LLDW++R  IA+G+A  IAYLHH  TP IIHG IK+ NVLL
Sbjct  123   YMPNSSLFAHLHGTHSSECLLDWRRRTFIAIGAARAIAYLHHHETPPIIHGSIKSTNVLL  182

Query  2838  DSNFQAQLAGFGIANFFPDDATRVTTRSKGTLGYLAPEYVMLGKESKSCDVYSFGILLLE  2659
             DS+FQA +  FG+     D+        +   GY APEYVM GK +  CDVYSFGI+LLE
Sbjct  183   DSDFQAHVGDFGLMKLISDEIDHDKIIGENQRGYHAPEYVMFGKPTTGCDVYSFGIILLE  242

Query  2658  LASGKKPIKKVSASKNWTITDWALPLACEGKFSELADPTLNGNYVEEELKRIVYVALICA  2479
             L SG+KP++K  + K   + +W LPLA EG++ E+AD  LN  Y E ELKR+V + L C 
Sbjct  243   LTSGRKPVEKSGSQKMLGVRNWMLPLAKEGRYDEIADSKLNDKYSESELKRVVLIGLACT  302

Query  2478  QNQPEKRPTMLEVVELLKGESKEKLAALENNEMFK  2374
               +P+KRPTMLEVV LLKGESKE L  LE  E+F+
Sbjct  303   HREPDKRPTMLEVVSLLKGESKEMLLRLEKEELFR  337



>ref|XP_002437390.1| hypothetical protein SORBIDRAFT_10g026050 [Sorghum bicolor]
 gb|EER88757.1| hypothetical protein SORBIDRAFT_10g026050 [Sorghum bicolor]
Length=437

 Score =   331 bits (849),  Expect = 7e-99, Method: Compositional matrix adjust.
 Identities = 151/262 (58%), Positives = 196/262 (75%), Gaps = 1/262 (0%)
 Frame = -2

Query  3198  YWGQLWDGSQIAVKRLKEWSNT-AEVEFAAEVEILARARHKNLLALRGYCSEGQEHVLVY  3022
             YWG+  DG QIAVK+LK  +N+ AE+EFA EVE+LAR RH+NLL LRGYC+   + ++VY
Sbjct  58    YWGKTSDGLQIAVKKLKATNNSKAEMEFAVEVEVLARVRHRNLLGLRGYCAGADQRMIVY  117

Query  3021  DYVPNFSLLSHLHGQYSADTLLDWKKRISIAVGSAEGIAYLHHDATPHIIHGDIKAGNVL  2842
             DY+PN SLLSHLHGQ++ +  LDWK+R+++AVGSAEG+ YLHH+A PHIIH DIKA NVL
Sbjct  118   DYMPNLSLLSHLHGQFAGEVQLDWKRRVAVAVGSAEGLVYLHHEAAPHIIHRDIKASNVL  177

Query  2841  LDSNFQAQLAGFGIANFFPDDATRVTTRSKGTLGYLAPEYVMLGKESKSCDVYSFGILLL  2662
             LDS+F   +A FG A   P+  + +TTR KGTLGYLAPEY M GK S +CDVYSFGILLL
Sbjct  178   LDSDFAPLVADFGFAKLVPEGVSHMTTRVKGTLGYLAPEYAMWGKVSGACDVYSFGILLL  237

Query  2661  ELASGKKPIKKVSASKNWTITDWALPLACEGKFSELADPTLNGNYVEEELKRIVYVALIC  2482
             EL SG+KPI+++ +    TIT+WA PL   G+  +L DP L G +   +L R+V  A +C
Sbjct  238   ELVSGRKPIERLPSGAKRTITEWAEPLIARGRLGDLVDPRLRGAFDAAQLARVVECAALC  297

Query  2481  AQNQPEKRPTMLEVVELLKGES  2416
              Q +P++RP M  VV +L+GE+
Sbjct  298   VQGEPDRRPDMRTVVRILRGEN  319



>ref|XP_004965690.1| PREDICTED: PTI1-like tyrosine-protein kinase At3g15890-like [Setaria 
italica]
Length=420

 Score =   330 bits (847),  Expect = 8e-99, Method: Compositional matrix adjust.
 Identities = 154/267 (58%), Positives = 198/267 (74%), Gaps = 4/267 (1%)
 Frame = -2

Query  3198  YWGQLWDGSQIAVKRLKEWSNT-AEVEFAAEVEILARARHKNLLALRGYCSEG---QEHV  3031
             YWG+  DG QIAVKRLK  +N+ AE+EFA EVE+LAR RH+NLL LRGYC+ G      +
Sbjct  59    YWGKTPDGLQIAVKRLKATNNSKAEMEFAVEVEVLARVRHRNLLGLRGYCAGGPGTDHRM  118

Query  3030  LVYDYVPNFSLLSHLHGQYSADTLLDWKKRISIAVGSAEGIAYLHHDATPHIIHGDIKAG  2851
             +VYDY+PN SLLSHLHGQ++A+T LDW +R+++AVGSAEG+ YLHH+A PHIIH DIKA 
Sbjct  119   IVYDYMPNLSLLSHLHGQFAAETRLDWPRRVAVAVGSAEGLVYLHHEAAPHIIHRDIKAS  178

Query  2850  NVLLDSNFQAQLAGFGIANFFPDDATRVTTRSKGTLGYLAPEYVMLGKESKSCDVYSFGI  2671
             NVLLDS+F   +A FG A   P+  + +TTR KGTLGYLAPEY M GK S +CDVYSFGI
Sbjct  179   NVLLDSDFAPLVADFGFAKLVPEGVSHMTTRVKGTLGYLAPEYAMWGKVSGACDVYSFGI  238

Query  2670  LLLELASGKKPIKKVSASKNWTITDWALPLACEGKFSELADPTLNGNYVEEELKRIVYVA  2491
             LLLEL SG+KPI+++ +    TIT+WA PL   G+  +L DP L G +  ++L R+V  A
Sbjct  239   LLLELVSGRKPIERLPSGAKRTITEWAEPLIARGRLGDLVDPRLRGAFDADQLARVVECA  298

Query  2490  LICAQNQPEKRPTMLEVVELLKGESKE  2410
              +C Q +P++RP M  VV +L+GE  +
Sbjct  299   ALCVQGEPDRRPDMRTVVRILRGEDTD  325



>ref|XP_004972015.1| PREDICTED: protein TOO MANY MOUTHS-like [Setaria italica]
Length=347

 Score =   327 bits (839),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 180/318 (57%), Positives = 225/318 (71%), Gaps = 6/318 (2%)
 Frame = +3

Query  351   FTVIVSDSGAPSGLVDAPQTAYSLNNDHARTDAREQEAVYEVMRATGNDWATEIPDVCRG  530
             FTV+V D+ A + LVDAPQT +S   D ARTD  EQ AV EVM ATGN W   IPDVCRG
Sbjct  33    FTVVVPDTSA-AALVDAPQTGFS---DRARTDPAEQRAVQEVMAATGNGWVWGIPDVCRG  88

Query  531   RWHGIECMPDKANVYHVVSLSFGALSDDTAFPTCDTAPRPFISPAVTKLLHLRTLFFYRC  710
             RWHGIEC+PD+ +VYHVVSL+FGALSDDTAFP CD A    +SP+V  L HLR+LFFYRC
Sbjct  89    RWHGIECVPDRHDVYHVVSLAFGALSDDTAFPACDAA-TATLSPSVLALPHLRSLFFYRC  147

Query  711   FTDNPQPIPTFlgqlgqtlqtlVLRENGHVGSIPNQLGNLTRLRVLDFHGNNLNGSIPVS  890
             FT NPQPI   LG+LG   ++LVLR+NGHVG IP +LGNL  LRVLD HGN L  +IP +
Sbjct  148   FTGNPQPIAALLGRLGPAFRSLVLRQNGHVGPIPAELGNLRALRVLDLHGNQLTSAIPAT  207

Query  891   LSRIDGLRSLDLSRNKLAASIPNLTFPLLQILDLNQNHLVGSIPTALINCHSLMKMDLSR  1070
             L  +  L+ LDLS N+LA  +P+  F  L +LDL+ N + G +P +L  C SL+K+DLS+
Sbjct  208   LQSLSHLQMLDLSYNRLAGPVPHFKFQRLSVLDLSHNAVQGPVPASLGQCRSLLKIDLSQ  267

Query  1071  NRLSGRIPDSIDALNNIILMDLSYNSITGPIPTTLKNLDFLQALVLSGNPMLSDTLPEHI  1250
             NRL G IPD++  L+ ++L+DLS+N+++GPIP  L  L  L++L+LS N M   T+P   
Sbjct  268   NRLEGTIPDTLGDLSELMLLDLSHNALSGPIPAALSRLSSLRSLILSDNRMQFTTVPGD-  326

Query  1251  FLDGFKDLMILALSNMNL  1304
             F  G K L  L LS M L
Sbjct  327   FFSGLKALTTLVLSGMGL  344


 Score = 72.8 bits (177),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 53/165 (32%), Positives = 82/165 (50%), Gaps = 29/165 (18%)
 Frame = +3

Query  969   PLLQILDLNQNHLVGSIPTALINCHSLMKMDLSRNRLSGRIPDSIDALNNIILMDLSYNS  1148
             P  + L L QN  VG IP  L N  +L  +DL  N+L+  IP ++ +L+++ ++DLSYN 
Sbjct  164   PAFRSLVLRQNGHVGPIPAELGNLRALRVLDLHGNQLTSAIPATLQSLSHLQMLDLSYNR  223

Query  1149  ITGPIPTTLKNLDFLQALVLSGNPMLSDTLPEHIFLDGFKDLMILALSNMNLQGSIPESL  1328
             + GP+P                          H     F+ L +L LS+  +QG +P SL
Sbjct  224   LAGPVP--------------------------HF---KFQRLSVLDLSHNAVQGPVPASL  254

Query  1329  AKLPKIRVLHLDGNQLNGSIPASFGeldslselrldsNQLTGAVP  1463
              +   +  + L  N+L G+IP + G+L  L  L L  N L+G +P
Sbjct  255   GQCRSLLKIDLSQNRLEGTIPDTLGDLSELMLLDLSHNALSGPIP  299



>ref|XP_011076498.1| PREDICTED: PTI1-like tyrosine-protein kinase At3g15890 [Sesamum 
indicum]
Length=380

 Score =   328 bits (841),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 159/287 (55%), Positives = 201/287 (70%), Gaps = 13/287 (5%)
 Frame = -2

Query  3198  YWGQLWDGS----------QIAVKRLKEWSNTAEVEFAAEVEILARARHKNLLALRGYCS  3049
             YWG+   G           QIAVKRLK  +  AE+EFA EVEIL R RHKNLL LRG+ +
Sbjct  58    YWGRTSKGVEAILVFDRMLQIAVKRLKAMTAKAEMEFAVEVEILGRVRHKNLLGLRGFYA  117

Query  3048  EGQEHVLVYDYVPNFSLLSHLHGQYSADTLLDWKKRISIAVGSAEGIAYLHHDATPHIIH  2869
              G E ++VYDY+PN SL++HLHGQ +AD LLDW +R+ IA+GSAEG+AYLHH+A PHIIH
Sbjct  118   GGDERLIVYDYMPNHSLITHLHGQLAADCLLDWSRRMKIAIGSAEGLAYLHHEANPHIIH  177

Query  2868  GDIKAGNVLLDSNFQAQLAGFGIANFFPDDATRVTTRSKGTLGYLAPEYVMLGKESKSCD  2689
              DIKA NVLLDS FQA++A FG A   P+  T +TTR KGTLGYLAPEY M GK S+SCD
Sbjct  178   RDIKASNVLLDSEFQAKVADFGFAKLIPEGVTHLTTRVKGTLGYLAPEYAMWGKVSESCD  237

Query  2688  VYSFGILLLELASGKKPIKKVSASKNWTITDWALPLACEGKFSELADPTLNGNYVEEELK  2509
             VYSFGILLLE+ S +KP++K++      I  WA P   +G F  +ADP L G++  +ELK
Sbjct  238   VYSFGILLLEIISARKPLEKLAGGVKRDIVQWATPYVQKGAFDHIADPRLKGDFDRDELK  297

Query  2508  RIVYVALICAQNQPEKRPTMLEVVELLK---GESKEKLAALENNEMF  2377
             +++ +A+ C    PE RP+MLEVV  LK   G  K++L  ++NN M 
Sbjct  298   KVIMIAMKCTDGNPENRPSMLEVVGWLKGGVGSRKKELGIVKNNYMI  344



>gb|KHN34788.1| PTI1-like tyrosine-protein kinase, partial [Glycine soja]
Length=404

 Score =   329 bits (843),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 153/265 (58%), Positives = 198/265 (75%), Gaps = 1/265 (0%)
 Frame = -2

Query  3198  YWGQLWDGSQIAVKRLKEWSNTAEVEFAAEVEILARARHKNLLALRGYCSEGQEHVLVYD  3019
             YWG+  DG QIAVK+LK  ++ AE+EFA EVE+L R RHKNLL LRGYC    + ++VYD
Sbjct  81    YWGRTNDGLQIAVKKLKAMNSKAEMEFAVEVEVLGRVRHKNLLGLRGYCVGDDQRLIVYD  140

Query  3018  YVPNFSLLSHLHGQYSADTLLDWKKRISIAVGSAEGIAYLHHDATPHIIHGDIKAGNVLL  2839
             Y+PN SLLSHLHGQ++ +  L+W++R+ IA+GSAEG+ YLH +  PHIIH DIKA NVLL
Sbjct  141   YMPNLSLLSHLHGQFAVEVQLNWQRRMKIAIGSAEGLLYLHREVAPHIIHRDIKASNVLL  200

Query  2838  DSNFQAQLAGFGIANFFPDDATRVTTRSKGTLGYLAPEYVMLGKESKSCDVYSFGILLLE  2659
             +S+F+  +A FG A   P+  + +TTR KGTLGYLAPEY M GK S+SCDVYSFGILLLE
Sbjct  201   NSDFEPLVADFGFAKLIPEGVSHMTTRVKGTLGYLAPEYAMWGKVSESCDVYSFGILLLE  260

Query  2658  LASGKKPIKKVSASKNWTITDWALPLACEGKFSELADPTLNGNYVEEELKRIVYVALICA  2479
             L +G+KPI+K+      TIT+WA PL   G+  +L DP L GN+ E ++K+ + VA +C 
Sbjct  261   LVTGRKPIEKLPGGLKRTITEWAEPLITNGRLRDLVDPKLRGNFDENQVKQTINVAALCV  320

Query  2478  QNQPEKRPTMLEVVELLKG-ESKEK  2407
             Q++PEKRP M +VV LLKG E +EK
Sbjct  321   QSEPEKRPNMKQVVNLLKGYEFEEK  345



>ref|XP_009630948.1| PREDICTED: PTI1-like tyrosine-protein kinase At3g15890 [Nicotiana 
tomentosiformis]
Length=368

 Score =   327 bits (839),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 155/259 (60%), Positives = 190/259 (73%), Gaps = 0/259 (0%)
 Frame = -2

Query  3198  YWGQLWDGSQIAVKRLKEWSNTAEVEFAAEVEILARARHKNLLALRGYCSEGQEHVLVYD  3019
             YWG+   G +IAVKRLK  S  AE+EFA EVEIL R RHKNLL LRG+ +   E ++VYD
Sbjct  57    YWGRTSKGIEIAVKRLKAMSAKAEMEFAIEVEILGRVRHKNLLGLRGFYAGEDERLIVYD  116

Query  3018  YVPNFSLLSHLHGQYSADTLLDWKKRISIAVGSAEGIAYLHHDATPHIIHGDIKAGNVLL  2839
             Y+PN SL++HLHGQ +AD LLDW +RI IA+GSAEG+ YLHH+A PHIIH DIKA NVLL
Sbjct  117   YMPNHSLITHLHGQLAADCLLDWPRRIRIAIGSAEGLCYLHHEANPHIIHRDIKASNVLL  176

Query  2838  DSNFQAQLAGFGIANFFPDDATRVTTRSKGTLGYLAPEYVMLGKESKSCDVYSFGILLLE  2659
             DSNFQA++A FG A   PD  T +TTR KGTLGYLAPEY M GK S+SCDVYSFGILLLE
Sbjct  177   DSNFQAKVADFGFAKLIPDGVTHLTTRVKGTLGYLAPEYAMWGKVSESCDVYSFGILLLE  236

Query  2658  LASGKKPIKKVSASKNWTITDWALPLACEGKFSELADPTLNGNYVEEELKRIVYVALICA  2479
             + S +KP++K+       I  WALP   +G F+ +ADP L G +  ++LK  + +A+ C 
Sbjct  237   IISARKPLEKLPNGVKRDIVQWALPYLQKGDFNHIADPRLKGKFNRDQLKNTILIAMKCT  296

Query  2478  QNQPEKRPTMLEVVELLKG  2422
                PE RP+MLEVV+ LKG
Sbjct  297   DGNPENRPSMLEVVDWLKG  315



>ref|XP_008376494.1| PREDICTED: PTI1-like tyrosine-protein kinase At3g15890 isoform 
X1 [Malus domestica]
Length=347

 Score =   326 bits (836),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 155/275 (56%), Positives = 199/275 (72%), Gaps = 3/275 (1%)
 Frame = -2

Query  3198  YWGQLWDGSQIAVKRLKEWSNTAEVEFAAEVEILARARHKNLLALRGYCSEGQEHVLVYD  3019
             YWG+   G +IAVKRLK  S  AE+EFA EVEIL R RH+NLL LRG+ + G E ++VYD
Sbjct  60    YWGRTSKGVEIAVKRLKTMSPKAEMEFAVEVEILGRVRHRNLLGLRGFYAGGDERLIVYD  119

Query  3018  YVPNFSLLSHLHGQYSADTLLDWKKRISIAVGSAEGIAYLHHDATPHIIHGDIKAGNVLL  2839
             ++PN SL++HLHGQ +AD LLDW  R+SIA+GSAEG++YLHH+A PHIIH DIKA NVLL
Sbjct  120   FMPNHSLITHLHGQLAADCLLDWSTRLSIAIGSAEGLSYLHHEANPHIIHRDIKASNVLL  179

Query  2838  DSNFQAQLAGFGIANFFPDDATRVTTRSKGTLGYLAPEYVMLGKESKSCDVYSFGILLLE  2659
             DS F+A++A FG A   PD  T +TTR KGTLGYLAPEY M GK S+SCDVYSFGILLLE
Sbjct  180   DSEFEAKVADFGFAKLIPDGVTHLTTRVKGTLGYLAPEYAMWGKVSESCDVYSFGILLLE  239

Query  2658  LASGKKPIKKVSASKNWTITDWALPLACEGKFSELADPTLNGNYVEEELKRIVYVALICA  2479
             + SGKKPI+K+       I  W  P   +G F+++ADP L G + + ++K  V +A+ C 
Sbjct  240   IISGKKPIEKLPGGVKRDIVQWVTPYVQKGAFNQIADPRLKGKFDKVQVKSTVLIAMKCT  299

Query  2478  QNQPEKRPTMLEVVELLK---GESKEKLAALENNE  2383
              N P+ RP M+EVV+ LK   G  K+++  +E+ E
Sbjct  300   DNSPDNRPPMIEVVDWLKGGIGRRKKEITKVEDTE  334



>ref|XP_008376495.1| PREDICTED: PTI1-like tyrosine-protein kinase At3g15890 isoform 
X2 [Malus domestica]
Length=341

 Score =   326 bits (836),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 155/275 (56%), Positives = 199/275 (72%), Gaps = 3/275 (1%)
 Frame = -2

Query  3198  YWGQLWDGSQIAVKRLKEWSNTAEVEFAAEVEILARARHKNLLALRGYCSEGQEHVLVYD  3019
             YWG+   G +IAVKRLK  S  AE+EFA EVEIL R RH+NLL LRG+ + G E ++VYD
Sbjct  54    YWGRTSKGVEIAVKRLKTMSPKAEMEFAVEVEILGRVRHRNLLGLRGFYAGGDERLIVYD  113

Query  3018  YVPNFSLLSHLHGQYSADTLLDWKKRISIAVGSAEGIAYLHHDATPHIIHGDIKAGNVLL  2839
             ++PN SL++HLHGQ +AD LLDW  R+SIA+GSAEG++YLHH+A PHIIH DIKA NVLL
Sbjct  114   FMPNHSLITHLHGQLAADCLLDWSTRLSIAIGSAEGLSYLHHEANPHIIHRDIKASNVLL  173

Query  2838  DSNFQAQLAGFGIANFFPDDATRVTTRSKGTLGYLAPEYVMLGKESKSCDVYSFGILLLE  2659
             DS F+A++A FG A   PD  T +TTR KGTLGYLAPEY M GK S+SCDVYSFGILLLE
Sbjct  174   DSEFEAKVADFGFAKLIPDGVTHLTTRVKGTLGYLAPEYAMWGKVSESCDVYSFGILLLE  233

Query  2658  LASGKKPIKKVSASKNWTITDWALPLACEGKFSELADPTLNGNYVEEELKRIVYVALICA  2479
             + SGKKPI+K+       I  W  P   +G F+++ADP L G + + ++K  V +A+ C 
Sbjct  234   IISGKKPIEKLPGGVKRDIVQWVTPYVQKGAFNQIADPRLKGKFDKVQVKSTVLIAMKCT  293

Query  2478  QNQPEKRPTMLEVVELLK---GESKEKLAALENNE  2383
              N P+ RP M+EVV+ LK   G  K+++  +E+ E
Sbjct  294   DNSPDNRPPMIEVVDWLKGGIGRRKKEITKVEDTE  328



>ref|XP_008659880.1| PREDICTED: PTI1-like tyrosine-protein kinase At3g15890 [Zea mays]
Length=408

 Score =   328 bits (841),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 151/271 (56%), Positives = 198/271 (73%), Gaps = 1/271 (0%)
 Frame = -2

Query  3198  YWGQLWDGSQIAVKRLKEWSNT-AEVEFAAEVEILARARHKNLLALRGYCSEGQEHVLVY  3022
             YWG+  DG QIAVK+LK  +N+ AE+EFA EVE+LAR RHKNLL LRGYC+   + ++VY
Sbjct  59    YWGKTSDGLQIAVKKLKATNNSKAEMEFAVEVEVLARVRHKNLLGLRGYCAGADQRMIVY  118

Query  3021  DYVPNFSLLSHLHGQYSADTLLDWKKRISIAVGSAEGIAYLHHDATPHIIHGDIKAGNVL  2842
             DY+PN SLLSHLHGQ++ +  LDWK+R+++AVGSAEG+ YLHH+  PHIIH DIKA NVL
Sbjct  119   DYMPNLSLLSHLHGQFAGEVRLDWKRRVAVAVGSAEGLVYLHHEVAPHIIHRDIKASNVL  178

Query  2841  LDSNFQAQLAGFGIANFFPDDATRVTTRSKGTLGYLAPEYVMLGKESKSCDVYSFGILLL  2662
             LDS+F   +A FG A   P+  + +TTR KGTLGYLAPEY M GK S +CDVYSFGILLL
Sbjct  179   LDSDFAPLVADFGFAKLVPEGVSHMTTRVKGTLGYLAPEYAMWGKVSGACDVYSFGILLL  238

Query  2661  ELASGKKPIKKVSASKNWTITDWALPLACEGKFSELADPTLNGNYVEEELKRIVYVALIC  2482
             EL SG+KPI+++ +    TIT+WA PL   G+  +L DP L G +   +L R V  A +C
Sbjct  239   ELVSGRKPIERLPSGAKRTITEWAEPLIARGRLGDLVDPRLRGAFDAAQLARAVECAALC  298

Query  2481  AQNQPEKRPTMLEVVELLKGESKEKLAALEN  2389
              Q +P++RP M  VV +L+G++ +    +E+
Sbjct  299   VQGEPDRRPDMKTVVRILRGDNNQLPVRMES  329



>ref|XP_006595207.1| PREDICTED: PTI1-like tyrosine-protein kinase At3g15890-like [Glycine 
max]
Length=400

 Score =   328 bits (840),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 153/265 (58%), Positives = 198/265 (75%), Gaps = 1/265 (0%)
 Frame = -2

Query  3198  YWGQLWDGSQIAVKRLKEWSNTAEVEFAAEVEILARARHKNLLALRGYCSEGQEHVLVYD  3019
             YWG+  DG QIAVK+LK  ++ AE+EFA EVE+L R RHKNLL LRGYC    + ++VYD
Sbjct  77    YWGRTNDGLQIAVKKLKAMNSKAEMEFAVEVEVLGRVRHKNLLGLRGYCVGDDQRLIVYD  136

Query  3018  YVPNFSLLSHLHGQYSADTLLDWKKRISIAVGSAEGIAYLHHDATPHIIHGDIKAGNVLL  2839
             Y+PN SLLSHLHGQ++ +  L+W++R+ IA+GSAEG+ YLH +  PHIIH DIKA NVLL
Sbjct  137   YMPNLSLLSHLHGQFAVEVQLNWQRRMKIAIGSAEGLLYLHREVAPHIIHRDIKASNVLL  196

Query  2838  DSNFQAQLAGFGIANFFPDDATRVTTRSKGTLGYLAPEYVMLGKESKSCDVYSFGILLLE  2659
             +S+F+  +A FG A   P+  + +TTR KGTLGYLAPEY M GK S+SCDVYSFGILLLE
Sbjct  197   NSDFEPLVADFGFAKLIPEGVSHMTTRVKGTLGYLAPEYAMWGKVSESCDVYSFGILLLE  256

Query  2658  LASGKKPIKKVSASKNWTITDWALPLACEGKFSELADPTLNGNYVEEELKRIVYVALICA  2479
             L +G+KPI+K+      TIT+WA PL   G+  +L DP L GN+ E ++K+ + VA +C 
Sbjct  257   LVTGRKPIEKLPGGLKRTITEWAEPLITNGRLRDLVDPKLRGNFDENQVKQTINVAALCV  316

Query  2478  QNQPEKRPTMLEVVELLKG-ESKEK  2407
             Q++PEKRP M +VV LLKG E +EK
Sbjct  317   QSEPEKRPNMKQVVNLLKGYEFEEK  341



>gb|AFW87652.1| putative protein kinase superfamily protein [Zea mays]
Length=427

 Score =   328 bits (841),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 150/262 (57%), Positives = 194/262 (74%), Gaps = 1/262 (0%)
 Frame = -2

Query  3198  YWGQLWDGSQIAVKRLKEWSNT-AEVEFAAEVEILARARHKNLLALRGYCSEGQEHVLVY  3022
             YWG+  DG QIAVK+LK  +N+ AE+EFA EVE+LAR RHKNLL LRGYC+   + ++VY
Sbjct  59    YWGKTSDGLQIAVKKLKATNNSKAEMEFAVEVEVLARVRHKNLLGLRGYCAGADQRMIVY  118

Query  3021  DYVPNFSLLSHLHGQYSADTLLDWKKRISIAVGSAEGIAYLHHDATPHIIHGDIKAGNVL  2842
             DY+PN SLLSHLHGQ++ +  LDWK+R+++AVGSAEG+ YLHH+  PHIIH DIKA NVL
Sbjct  119   DYMPNLSLLSHLHGQFAGEVRLDWKRRVAVAVGSAEGLVYLHHEVAPHIIHRDIKASNVL  178

Query  2841  LDSNFQAQLAGFGIANFFPDDATRVTTRSKGTLGYLAPEYVMLGKESKSCDVYSFGILLL  2662
             LDS+F   +A FG A   P+  + +TTR KGTLGYLAPEY M GK S +CDVYSFGILLL
Sbjct  179   LDSDFAPLVADFGFAKLVPEGVSHMTTRVKGTLGYLAPEYAMWGKVSGACDVYSFGILLL  238

Query  2661  ELASGKKPIKKVSASKNWTITDWALPLACEGKFSELADPTLNGNYVEEELKRIVYVALIC  2482
             EL SG+KPI+++ +    TIT+WA PL   G+  +L DP L G +   +L R V  A +C
Sbjct  239   ELVSGRKPIERLPSGAKRTITEWAEPLIARGRLGDLVDPRLRGAFDAAQLARAVECAALC  298

Query  2481  AQNQPEKRPTMLEVVELLKGES  2416
              Q +P++RP M  VV +L+G++
Sbjct  299   VQGEPDRRPDMKTVVRILRGDN  320



>ref|XP_002981460.1| hypothetical protein SELMODRAFT_114199, partial [Selaginella 
moellendorffii]
 gb|EFJ17648.1| hypothetical protein SELMODRAFT_114199, partial [Selaginella 
moellendorffii]
Length=307

 Score =   323 bits (827),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 152/272 (56%), Positives = 207/272 (76%), Gaps = 9/272 (3%)
 Frame = -2

Query  3198  YWGQLWDGSQIAVKRLKEWSNTAEVEFAAEVEILARARHKNLLALRGYCSEGQEHVLVYD  3019
             YWGQLWDGSQIAVKRLK WS+  E++FA EVEIL R RHKNLL+LRGYC+EG+E +LVY+
Sbjct  35    YWGQLWDGSQIAVKRLKLWSSKREIDFAVEVEILGRVRHKNLLSLRGYCAEGKERLLVYN  94

Query  3018  YVPNFSLLSHLHGQYSADTLLDWKKRISIAVGSAEGIAYLHHDATPHIIHGDIKAGNVLL  2839
             Y+PN SL +HLHG  +A++ LDW++R++IA+GSAE +AYLHH ATPHIIHGD+K+ NVLL
Sbjct  95    YMPNLSLSAHLHGHLAAESNLDWERRMNIAIGSAEALAYLHHHATPHIIHGDLKSSNVLL  154

Query  2838  DSNFQAQLAGFGIANFFPDDATRVTTRSKGTLGYLAPEYVML--GKESKSCDVYSFGILL  2665
             ++ F+AQ+A FG A   P+     +T + G +GY  P++     GK S+  DVYSFG+LL
Sbjct  155   NAEFEAQVADFGFAELVPE----TSTVNAGAMGYFPPDHATPGDGKLSEKSDVYSFGVLL  210

Query  2664  LELASGKKPIKK---VSASKNWTITDWALPLACEGKFSELADPTLNGNYVEEELKRIVYV  2494
             LEL SG+KP++K    +++K+ +I +WA P+  EG+  ++ADP L+GN+ E ELK++V V
Sbjct  211   LELVSGRKPVEKQGFSASAKSQSIVEWATPMIYEGRLDDIADPKLSGNFNEVELKQVVQV  270

Query  2493  ALICAQNQPEKRPTMLEVVELLKGESKEKLAA  2398
             A  C+Q  PE RP+M++VVELLK    EK+ A
Sbjct  271   AQWCSQTSPENRPSMIKVVELLKKVRDEKIKA  302



>ref|XP_007143343.1| hypothetical protein PHAVU_007G064500g [Phaseolus vulgaris]
 gb|ESW15337.1| hypothetical protein PHAVU_007G064500g [Phaseolus vulgaris]
Length=359

 Score =   325 bits (832),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 151/259 (58%), Positives = 192/259 (74%), Gaps = 0/259 (0%)
 Frame = -2

Query  3198  YWGQLWDGSQIAVKRLKEWSNTAEVEFAAEVEILARARHKNLLALRGYCSEGQEHVLVYD  3019
             YWG+   G +IAVKRLK  +  AE+EFA EVE+L R RHKNLL LRG+ + G+E ++VYD
Sbjct  61    YWGRTSKGVEIAVKRLKTMTAKAEMEFAVEVEVLGRVRHKNLLGLRGFYAGGEERLIVYD  120

Query  3018  YVPNFSLLSHLHGQYSADTLLDWKKRISIAVGSAEGIAYLHHDATPHIIHGDIKAGNVLL  2839
             Y+PN SLL+HLHGQ + D+LLDW +R+SIA+G+AEG+ YLHH+A PHIIH DIKA NVLL
Sbjct  121   YMPNHSLLNHLHGQLATDSLLDWPRRMSIAIGAAEGLVYLHHEANPHIIHRDIKASNVLL  180

Query  2838  DSNFQAQLAGFGIANFFPDDATRVTTRSKGTLGYLAPEYVMLGKESKSCDVYSFGILLLE  2659
             DS F+A++A FG A   P+  + +TTR KGTLGYLAPEY M GK S+SCDVYSFGILLLE
Sbjct  181   DSEFEAKVADFGFAKLIPEGVSHLTTRVKGTLGYLAPEYAMWGKVSESCDVYSFGILLLE  240

Query  2658  LASGKKPIKKVSASKNWTITDWALPLACEGKFSELADPTLNGNYVEEELKRIVYVALICA  2479
             + S KKPI+K+       I  W  P   +G  + +AD  L G +  E+LKR++ +A+ C 
Sbjct  241   IVSSKKPIEKLPGGVKRDIVQWVTPHFQKGNITHIADSKLKGRFDLEQLKRVIMIAIRCT  300

Query  2478  QNQPEKRPTMLEVVELLKG  2422
              N PEKRP+M+EVVE LKG
Sbjct  301   DNSPEKRPSMVEVVEWLKG  319



>ref|XP_003535634.1| PREDICTED: PTI1-like tyrosine-protein kinase At3g15890-like [Glycine 
max]
Length=365

 Score =   325 bits (832),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 153/259 (59%), Positives = 189/259 (73%), Gaps = 0/259 (0%)
 Frame = -2

Query  3198  YWGQLWDGSQIAVKRLKEWSNTAEVEFAAEVEILARARHKNLLALRGYCSEGQEHVLVYD  3019
             YWG+   G +IAVKRLK  +  AE+EFA EVE+L R RHKNLL LRG+ + G E ++VYD
Sbjct  60    YWGRTSKGVEIAVKRLKTMTAKAEMEFAVEVEVLGRVRHKNLLGLRGFYAGGDERLIVYD  119

Query  3018  YVPNFSLLSHLHGQYSADTLLDWKKRISIAVGSAEGIAYLHHDATPHIIHGDIKAGNVLL  2839
             Y+PN SLL+HLHGQ + D LLDW +R+SIA+G+AEG+ YLHH+A PHIIH DIKA NVLL
Sbjct  120   YMPNHSLLTHLHGQLATDCLLDWPRRMSIAIGAAEGLVYLHHEANPHIIHRDIKASNVLL  179

Query  2838  DSNFQAQLAGFGIANFFPDDATRVTTRSKGTLGYLAPEYVMLGKESKSCDVYSFGILLLE  2659
             D+ F+A++A FG A   P+  + +TTR KGTLGYLAPEY M GK S SCDVYSFGILLLE
Sbjct  180   DTEFEAKVADFGFAKLIPEGVSHLTTRVKGTLGYLAPEYAMWGKVSGSCDVYSFGILLLE  239

Query  2658  LASGKKPIKKVSASKNWTITDWALPLACEGKFSELADPTLNGNYVEEELKRIVYVALICA  2479
             + S KKPI+K+       I  W  P   +G F  +ADP L G++  E+LK +V +A+ C 
Sbjct  240   IVSAKKPIEKLPGGVKRDIVQWVTPHVQKGNFIHIADPKLKGHFDLEQLKSVVMIAMRCT  299

Query  2478  QNQPEKRPTMLEVVELLKG  2422
              N PEKRPTM EVVE LKG
Sbjct  300   DNSPEKRPTMQEVVEWLKG  318



>ref|XP_002969992.1| hypothetical protein SELMODRAFT_146686 [Selaginella moellendorffii]
 gb|EFJ29116.1| hypothetical protein SELMODRAFT_146686 [Selaginella moellendorffii]
Length=324

 Score =   323 bits (828),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 152/272 (56%), Positives = 207/272 (76%), Gaps = 9/272 (3%)
 Frame = -2

Query  3198  YWGQLWDGSQIAVKRLKEWSNTAEVEFAAEVEILARARHKNLLALRGYCSEGQEHVLVYD  3019
             YWGQLWDGSQIAVKRLK WS+  E++FA EVEIL R RHKNLL+LRGYC+EG+E +LVY+
Sbjct  52    YWGQLWDGSQIAVKRLKLWSSKREIDFAVEVEILGRVRHKNLLSLRGYCAEGKERLLVYN  111

Query  3018  YVPNFSLLSHLHGQYSADTLLDWKKRISIAVGSAEGIAYLHHDATPHIIHGDIKAGNVLL  2839
             Y+PN SL +HLHG  +A++ LDW++R++IA+GSAE +AYLHH ATPHIIHGD+K+ NVLL
Sbjct  112   YMPNLSLSAHLHGHLAAESNLDWERRMNIAIGSAEALAYLHHHATPHIIHGDLKSSNVLL  171

Query  2838  DSNFQAQLAGFGIANFFPDDATRVTTRSKGTLGYLAPEYVML--GKESKSCDVYSFGILL  2665
             ++ F+AQ+A FG A   P+     +T + G +GY  P++     GK S+  DVYSFG+LL
Sbjct  172   NAEFEAQVADFGFAELVPE----TSTVNAGAMGYFPPDHATPGDGKLSEKSDVYSFGVLL  227

Query  2664  LELASGKKPIKK---VSASKNWTITDWALPLACEGKFSELADPTLNGNYVEEELKRIVYV  2494
             LEL SG+KP++K    +++K+ +I +WA P+  EG+  ++ADP L+GN+ E ELK++V V
Sbjct  228   LELVSGRKPVEKQGFSASAKSQSIVEWATPMIYEGRLDDIADPKLSGNFNEVELKQVVQV  287

Query  2493  ALICAQNQPEKRPTMLEVVELLKGESKEKLAA  2398
             A  C+Q  PE RP+M++VVELLK    EK+ A
Sbjct  288   AQWCSQTSPENRPSMIKVVELLKKVRDEKIKA  319



>ref|XP_009774043.1| PREDICTED: PTI1-like tyrosine-protein kinase At3g15890 [Nicotiana 
sylvestris]
Length=395

 Score =   326 bits (835),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 154/259 (59%), Positives = 190/259 (73%), Gaps = 0/259 (0%)
 Frame = -2

Query  3198  YWGQLWDGSQIAVKRLKEWSNTAEVEFAAEVEILARARHKNLLALRGYCSEGQEHVLVYD  3019
             YWG+   G +IAVKRLK  S  AE+EFA EVEIL R RH+NLL LRG+ +   E ++VYD
Sbjct  84    YWGRTIKGIEIAVKRLKAMSAKAEMEFAIEVEILGRVRHENLLGLRGFYAGEDERLIVYD  143

Query  3018  YVPNFSLLSHLHGQYSADTLLDWKKRISIAVGSAEGIAYLHHDATPHIIHGDIKAGNVLL  2839
             Y+PN SL++HLHGQ +AD LLDW +RI IA+GSAEG+ YLHH+A PHIIH DIKA NVL+
Sbjct  144   YMPNHSLITHLHGQLAADCLLDWPRRIRIAIGSAEGLCYLHHEANPHIIHRDIKASNVLI  203

Query  2838  DSNFQAQLAGFGIANFFPDDATRVTTRSKGTLGYLAPEYVMLGKESKSCDVYSFGILLLE  2659
             DSNFQA++A FG A   PD  T +TTR KGTLGYLAPEY M GK S+SCDVYSFGILLLE
Sbjct  204   DSNFQAKVADFGFAKLIPDGVTHLTTRVKGTLGYLAPEYAMWGKVSESCDVYSFGILLLE  263

Query  2658  LASGKKPIKKVSASKNWTITDWALPLACEGKFSELADPTLNGNYVEEELKRIVYVALICA  2479
             + S +KP++K+       I  WALP   +G F+ +ADP L G +  E+LK  + +A+ C 
Sbjct  264   IISARKPLEKLPNGVKRDIVQWALPYLQKGDFNHIADPRLKGKFNREQLKNTILIAMKCT  323

Query  2478  QNQPEKRPTMLEVVELLKG  2422
                PE RP+MLEVV+ LKG
Sbjct  324   DGNPENRPSMLEVVDWLKG  342



>ref|XP_002989166.1| hypothetical protein SELMODRAFT_129339 [Selaginella moellendorffii]
 gb|EFJ09760.1| hypothetical protein SELMODRAFT_129339 [Selaginella moellendorffii]
Length=427

 Score =   326 bits (836),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 199/421 (47%), Positives = 262/421 (62%), Gaps = 24/421 (6%)
 Frame = +3

Query  426   NDHARTDAREQEAVYEVMRATGNDWATEIPDVCRGRWHGIECMPDKA-NVYHVVSLSFGA  602
             N  ARTD RE  AVY+VM ATGN W T IPDVC GRWHGIEC  D + N+ HVVSLSFG 
Sbjct  4     NASARTDPREIRAVYDVMAATGNSWVTTIPDVCNGRWHGIECTLDTSTNLLHVVSLSFGV  63

Query  603   LSDDTAFPTCDTAPRPFISPAVTKLLHLRTLFFYRCFTDNPQPIPTFlgqlgqtlqtlVL  782
             LSDDTAFP C +     ISP++ KL+ LR LFFYRC + NP+PIP  +G+LG  L++LVL
Sbjct  64    LSDDTAFPACSSDST--ISPSIAKLVFLRRLFFYRCCSGNPRPIPPQIGRLGARLESLVL  121

Query  783   RENGHVGSIPNQLGNLTRLRVLDFHGNNLNGSIPVSLSRIDGLRSLDLSRNKLAASIPNL  962
             RENGHVG++P +L +L++L  LD HGNNL+ SIP SL  +  L+ LDLS N+L+  IP+ 
Sbjct  122   RENGHVGAVPAELASLSKLHTLDLHGNNLSSSIPPSLGNLSSLQRLDLSNNRLSGFIPSS  181

Query  963   TFPLLQ--ILDLNQNHLVGSIPTALINCHSLMKMDLSRNRLSGRIPDSIDALNNIILMDL  1136
                L    ILDL+ N L G IP  + +  SL K+DL  NRLSG +PD +    +++ MDL
Sbjct  182   LDKLASAIILDLSNNDLEGEIPGVISSLRSLKKLDLGNNRLSGSLPDELGRFESLLFMDL  241

Query  1137  SYNSITGPIPTTLKNLDFLQALVLSGNPMLSDTLPEHIFLDGFKDLMILALSNMNLQGSI  1316
             S N + G IP +   L  LQ L+L  N  LS T+PE   L     L +L LS+ N+ G I
Sbjct  242   SRNRLVGGIPESFGRLHTLQDLILRENS-LSFTIPES--LGNITSLQVLVLSSTNIAGKI  298

Query  1317  PESLAKLPKIRVLHLDGNQLNGSIPASFGeldslselrldsNQLTGAVPFKREMVWRMRR  1496
             P +L +L  ++VLHL+ N+L+GSIP     L  L EL L  N L+G VP  RE+  ++  
Sbjct  299   PTALGRLKSLKVLHLENNKLHGSIPREILALPQLCELNLARNSLSGPVPVSREVATKLGA  358

Query  1497  KLKLSNNSGLCYDAKTGLGDDLEAISDSGISHCG------SQATEP-TRTVEHISAVDES  1655
             +L+L NN+GLC   K+ L  D       G+  C       +  ++P T T   ++  DES
Sbjct  359   RLRLMNNTGLCL--KSPLKHD-------GVEQCAELEESFNNPSQPSTETSSSVAHTDES  409

Query  1656  M  1658
             +
Sbjct  410   I  410



>gb|AES62624.2| Pti1-like kinase [Medicago truncatula]
Length=369

 Score =   324 bits (830),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 158/275 (57%), Positives = 198/275 (72%), Gaps = 3/275 (1%)
 Frame = -2

Query  3198  YWGQLWDGSQIAVKRLKEWSNTAEVEFAAEVEILARARHKNLLALRGYCSEGQEHVLVYD  3019
             YWGQ   G +IAVKRLK  +  AE+EFA EVE+L R RHKNLL LRG+ + G E ++VYD
Sbjct  62    YWGQTSKGVEIAVKRLKTMTAKAEMEFAVEVEVLGRVRHKNLLGLRGFYAGGDERLIVYD  121

Query  3018  YVPNFSLLSHLHGQYSADTLLDWKKRISIAVGSAEGIAYLHHDATPHIIHGDIKAGNVLL  2839
             Y+ N SLL+HLHGQ ++D LLDW +R+SI VG+AEG+AYLHH+A PHIIH DIKA NVLL
Sbjct  122   YMSNHSLLTHLHGQLASDCLLDWPRRMSITVGAAEGLAYLHHEANPHIIHRDIKASNVLL  181

Query  2838  DSNFQAQLAGFGIANFFPDDATRVTTRSKGTLGYLAPEYVMLGKESKSCDVYSFGILLLE  2659
             D+ FQA++A FG A   P   + +TTR KGTLGYLAPEY M GK S+SCDVYSFGILLLE
Sbjct  182   DTEFQAKVADFGFAKLIPAGVSHLTTRVKGTLGYLAPEYAMWGKVSESCDVYSFGILLLE  241

Query  2658  LASGKKPIKKVSASKNWTITDWALPLACEGKFSELADPTLNGNYVEEELKRIVYVALICA  2479
             + S KKPI+K+       I  W  P   +G F  +ADP L GN+  E+LK ++ +A+ C 
Sbjct  242   IISAKKPIEKLPGGIKRDIVQWVTPYVQKGVFKHIADPKLKGNFDLEQLKSVIMIAVRCT  301

Query  2478  QNQPEKRPTMLEVVELLK-GESKEK--LAALENNE  2383
              + P+KRP+M+EVVE LK G SK K  +  L NN+
Sbjct  302   DSSPDKRPSMIEVVEWLKDGVSKRKKEIPNLSNNK  336



>ref|XP_006362706.1| PREDICTED: PTI1-like tyrosine-protein kinase At3g15890-like [Solanum 
tuberosum]
Length=378

 Score =   324 bits (830),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 153/258 (59%), Positives = 189/258 (73%), Gaps = 0/258 (0%)
 Frame = -2

Query  3198  YWGQLWDGSQIAVKRLKEWSNTAEVEFAAEVEILARARHKNLLALRGYCSEGQEHVLVYD  3019
             YWG+   G +IAVKRLK  S  AE+EFA EVEIL R RHKNLL LRG+ +   E ++VYD
Sbjct  58    YWGRTSKGIEIAVKRLKAMSAKAEMEFAIEVEILGRVRHKNLLGLRGFYAGEDERLIVYD  117

Query  3018  YVPNFSLLSHLHGQYSADTLLDWKKRISIAVGSAEGIAYLHHDATPHIIHGDIKAGNVLL  2839
             Y+PN SL++HLHG  SAD LLDW++R+ IA+GSA+G+ YLHH+A PHIIH DIKA NVLL
Sbjct  118   YMPNHSLITHLHGTLSADCLLDWQRRMKIAIGSADGLCYLHHEANPHIIHRDIKASNVLL  177

Query  2838  DSNFQAQLAGFGIANFFPDDATRVTTRSKGTLGYLAPEYVMLGKESKSCDVYSFGILLLE  2659
             DSNFQA++A FG A   PD  T +TTR KGTLGYLAPEY M GK S+SCDVYSFGILLLE
Sbjct  178   DSNFQAKVADFGFAKLIPDGVTHLTTRVKGTLGYLAPEYAMWGKVSESCDVYSFGILLLE  237

Query  2658  LASGKKPIKKVSASKNWTITDWALPLACEGKFSELADPTLNGNYVEEELKRIVYVALICA  2479
             + S +KP++K+       I  WALP   +G F+ +ADP L G +  E+LK  + +A+ C 
Sbjct  238   IISARKPLEKLPNGVKRDIVHWALPYIQKGDFNHIADPRLKGKFNREQLKNTILIAMKCT  297

Query  2478  QNQPEKRPTMLEVVELLK  2425
                PE RP+MLEVV+ LK
Sbjct  298   DGNPENRPSMLEVVDWLK  315



>ref|XP_006845569.1| hypothetical protein AMTR_s00019p00191440 [Amborella trichopoda]
 gb|ERN07244.1| hypothetical protein AMTR_s00019p00191440 [Amborella trichopoda]
Length=297

 Score =   321 bits (822),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 156/275 (57%), Positives = 196/275 (71%), Gaps = 5/275 (2%)
 Frame = -2

Query  3126  VEFAAEVEILARARHKNLLALRGYCSEGQEHVLVYDYVPNFSLLSHLHGQYSADTLLDWK  2947
             +EFA EVE+L R RHKNLL LRGYC    + ++VYDY+PN SLLSHLHGQ++ +  LDWK
Sbjct  1     MEFAVEVEVLGRVRHKNLLGLRGYCVGADQRLIVYDYMPNLSLLSHLHGQFAVEVQLDWK  60

Query  2946  KRISIAVGSAEGIAYLHHDATPHIIHGDIKAGNVLLDSNFQAQLAGFGIANFFPDDATRV  2767
             +R+++A+G+AEG+ YLH +A PHIIH DIKA NVLLDSN++AQ+A FG A   PD  + +
Sbjct  61    RRMNVAIGAAEGLLYLHQEAKPHIIHRDIKASNVLLDSNYEAQVADFGFAKLIPDGVSHM  120

Query  2766  TTRSKGTLGYLAPEYVMLGKESKSCDVYSFGILLLELASGKKPIKKVSASKNWTITDWAL  2587
             TTR KGTLGYLAPEY M GK S+SCDVYS+GILLLE+ +GKKPI+K+      TIT+WA 
Sbjct  121   TTRVKGTLGYLAPEYAMWGKVSESCDVYSYGILLLEIVTGKKPIEKLPGGLKKTITEWAE  180

Query  2586  PLACEGKFSELADPTLNGNYVEEELKRIVYVALICAQNQPEKRPTMLEVVELLKG---ES  2416
             PL  +GKF EL DP L GNY E EL+R ++VA +C Q  PEKRP M  VVE LKG   + 
Sbjct  181   PLIEKGKFHELVDPKLRGNYEESELRRAIHVAGLCVQGDPEKRPNMRVVVETLKGWGIKE  240

Query  2415  KEKLAALENNEMFKNLKAATH--KDGCAHEDSQEF  2317
             KE    +E+ +    L AA     D  A E+S  +
Sbjct  241   KEMSLRIESAKYVDELMAADQPSDDEVAGEESNTY  275



>ref|XP_002987334.1| hypothetical protein SELMODRAFT_125817 [Selaginella moellendorffii]
 gb|EFJ11649.1| hypothetical protein SELMODRAFT_125817 [Selaginella moellendorffii]
Length=428

 Score =   325 bits (834),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 199/422 (47%), Positives = 262/422 (62%), Gaps = 25/422 (6%)
 Frame = +3

Query  426   NDHARTDAREQEAVYEVMRATGNDWATEIPDVCRGRWHGIECMPDKA-NVYHVVSLSFGA  602
             N  ARTD RE  AVY+VM ATGN W T IPDVC GRWHGIEC  D + N+ HVVSLSFG 
Sbjct  4     NASARTDPREIRAVYDVMAATGNSWVTTIPDVCNGRWHGIECTLDTSTNLLHVVSLSFGV  63

Query  603   LSDDTAFPTCDTAPRPFISPAVTKLLHLRTLFFYRCFTDNPQPIPTFlgqlgqtlqtlVL  782
             LSDDTAFP C +     ISP++ KL+ LR LFFYRC + NP+PIP  +GQLG  L++LVL
Sbjct  64    LSDDTAFPACSSDST--ISPSIAKLVFLRRLFFYRCCSGNPRPIPPQIGQLGARLESLVL  121

Query  783   RENGHVGSIPNQLGNLTRLRVLDFHGNNLNGSIPVSLSRIDGLRSLDLSRNKLAASIPNL  962
             RENGH+G++P +L +L++L  LD HGNNL+ SIP SL  +  L+ LDLS N+L+  IP+ 
Sbjct  122   RENGHIGAVPAELASLSKLHTLDLHGNNLSSSIPPSLGNLSSLQRLDLSNNRLSGFIPSS  181

Query  963   TFPLLQ--ILDLNQNHLVGSIPTALINCHSLMKMDLSRNRLSGRIPDSIDALNNIILMDL  1136
                L    ILDL+ N L G IP  + +  SL K+DL  NRLSG +PD +    +++ MDL
Sbjct  182   LDKLASAIILDLSNNDLEGEIPGVISSLRSLKKLDLGNNRLSGSLPDELGRFESLLFMDL  241

Query  1137  SYNSITGPIPTTLKNLDFLQALVLSGNPMLSDTLPEHIFLDGFKDLMILALSNMNLQGSI  1316
             S N + G IP +   L  LQ L+L  N  LS T+PE   L     L +L LS+ N+ G I
Sbjct  242   SRNRLAGGIPESFGRLHTLQDLILRENS-LSFTIPES--LGNITSLQVLVLSSTNIAGKI  298

Query  1317  PESLAKLPKIRVLHLDGNQLNGSIPASFGeldslselrldsNQLTGAVPFKREMVWRMRR  1496
             P +L +L  ++VLHL+ N+L+GSIP     L  L EL L  N L+G VP  RE+  ++  
Sbjct  299   PTALGRLKSLKVLHLENNKLHGSIPREILALPQLCELNLARNSLSGPVPVSREVATKLGA  358

Query  1497  KLKLSNNSGLCYDAKTGLGDDLEAISDSGISHCG------SQATEP--TRTVEHISAVDE  1652
             +L+L NN+GLC   K+ L  D       G+  C       +  ++P  T T   ++  DE
Sbjct  359   RLRLMNNTGLCL--KSPLKHD-------GVEQCAELEEIFNNPSQPSSTETSSSVAHTDE  409

Query  1653  SM  1658
             S+
Sbjct  410   SI  411



>ref|XP_008234480.1| PREDICTED: PTI1-like tyrosine-protein kinase At3g15890 [Prunus 
mume]
Length=307

 Score =   320 bits (821),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 150/262 (57%), Positives = 192/262 (73%), Gaps = 0/262 (0%)
 Frame = -2

Query  3171  QIAVKRLKEWSNTAEVEFAAEVEILARARHKNLLALRGYCSEGQEHVLVYDYVPNFSLLS  2992
             QIAVKRLK  S  AE+EFA EVEIL R RH+NLL LRG+ + G+E ++VYDY+PN SL++
Sbjct  6     QIAVKRLKTMSAKAEMEFAVEVEILGRVRHRNLLGLRGFYAGGEERLIVYDYMPNHSLIT  65

Query  2991  HLHGQYSADTLLDWKKRISIAVGSAEGIAYLHHDATPHIIHGDIKAGNVLLDSNFQAQLA  2812
             HLHGQ +AD LLDW +R+SIA+GSAEG++YLHH+A PHIIH DIKA NVLLD+ F+A++A
Sbjct  66    HLHGQLAADCLLDWPRRMSIAIGSAEGLSYLHHEANPHIIHRDIKASNVLLDTEFEAKVA  125

Query  2811  GFGIANFFPDDATRVTTRSKGTLGYLAPEYVMLGKESKSCDVYSFGILLLELASGKKPIK  2632
              FG A   PD  + +TTR KGTLGYLAPEY M GK S+SCDVYSFGILLLE+ SGKKPI+
Sbjct  126   DFGFAKLIPDGVSHLTTRVKGTLGYLAPEYAMWGKVSESCDVYSFGILLLEIISGKKPIE  185

Query  2631  KVSASKNWTITDWALPLACEGKFSELADPTLNGNYVEEELKRIVYVALICAQNQPEKRPT  2452
             K+       I  W  P   +G F+++AD  L G +  E++K  V +A+ C  N P+ RPT
Sbjct  186   KLPGGVKRDIVQWVTPYVQKGLFNQIADSRLKGKFDREQVKSTVLIAMKCTDNSPDNRPT  245

Query  2451  MLEVVELLKGESKEKLAALENN  2386
             M+EVV  LKG  + +   + N+
Sbjct  246   MVEVVAWLKGGIRRRKKEITNH  267



>ref|XP_006490459.1| PREDICTED: PTI1-like tyrosine-protein kinase At3g15890-like [Citrus 
sinensis]
Length=365

 Score =   322 bits (826),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 151/259 (58%), Positives = 188/259 (73%), Gaps = 0/259 (0%)
 Frame = -2

Query  3198  YWGQLWDGSQIAVKRLKEWSNTAEVEFAAEVEILARARHKNLLALRGYCSEGQEHVLVYD  3019
             YWG+   G +IAVKRLK  +  AE+EFA EVEIL R RH+NLL LRG+ + G E ++VYD
Sbjct  60    YWGRTSKGDEIAVKRLKTLNAKAEMEFAVEVEILGRVRHRNLLGLRGFYAGGDERLIVYD  119

Query  3018  YVPNFSLLSHLHGQYSADTLLDWKKRISIAVGSAEGIAYLHHDATPHIIHGDIKAGNVLL  2839
             Y+PN SL++HLHG+ + D LLDW +R+SIA+GSAEGIAYLHH A PHIIH DIKA NVLL
Sbjct  120   YMPNHSLITHLHGRLAPDCLLDWHRRVSIAIGSAEGIAYLHHKANPHIIHRDIKASNVLL  179

Query  2838  DSNFQAQLAGFGIANFFPDDATRVTTRSKGTLGYLAPEYVMLGKESKSCDVYSFGILLLE  2659
             D++F+A++A FG A   PD  T +TTR KGTLGYLAPEY M GK S SCDVYSFG+LLLE
Sbjct  180   DTDFEAKVADFGFAKLIPDGVTHMTTRVKGTLGYLAPEYAMWGKVSDSCDVYSFGVLLLE  239

Query  2658  LASGKKPIKKVSASKNWTITDWALPLACEGKFSELADPTLNGNYVEEELKRIVYVALICA  2479
             L S KKP++K+       I  W  P   +G F  +ADP L G +  ++LK +V +AL C 
Sbjct  240   LISAKKPLEKLPGGVKRDIVQWVTPYVQKGAFEHIADPRLKGKFNRDQLKSMVLIALRCT  299

Query  2478  QNQPEKRPTMLEVVELLKG  2422
              + PE RPTM +VV+ LKG
Sbjct  300   DSNPENRPTMTDVVDWLKG  318



>ref|XP_003592373.1| Somatic embryogenesis receptor kinase [Medicago truncatula]
Length=410

 Score =   324 bits (831),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 158/275 (57%), Positives = 198/275 (72%), Gaps = 3/275 (1%)
 Frame = -2

Query  3198  YWGQLWDGSQIAVKRLKEWSNTAEVEFAAEVEILARARHKNLLALRGYCSEGQEHVLVYD  3019
             YWGQ   G +IAVKRLK  +  AE+EFA EVE+L R RHKNLL LRG+ + G E ++VYD
Sbjct  62    YWGQTSKGVEIAVKRLKTMTAKAEMEFAVEVEVLGRVRHKNLLGLRGFYAGGDERLIVYD  121

Query  3018  YVPNFSLLSHLHGQYSADTLLDWKKRISIAVGSAEGIAYLHHDATPHIIHGDIKAGNVLL  2839
             Y+ N SLL+HLHGQ ++D LLDW +R+SI VG+AEG+AYLHH+A PHIIH DIKA NVLL
Sbjct  122   YMSNHSLLTHLHGQLASDCLLDWPRRMSITVGAAEGLAYLHHEANPHIIHRDIKASNVLL  181

Query  2838  DSNFQAQLAGFGIANFFPDDATRVTTRSKGTLGYLAPEYVMLGKESKSCDVYSFGILLLE  2659
             D+ FQA++A FG A   P   + +TTR KGTLGYLAPEY M GK S+SCDVYSFGILLLE
Sbjct  182   DTEFQAKVADFGFAKLIPAGVSHLTTRVKGTLGYLAPEYAMWGKVSESCDVYSFGILLLE  241

Query  2658  LASGKKPIKKVSASKNWTITDWALPLACEGKFSELADPTLNGNYVEEELKRIVYVALICA  2479
             + S KKPI+K+       I  W  P   +G F  +ADP L GN+  E+LK ++ +A+ C 
Sbjct  242   IISAKKPIEKLPGGIKRDIVQWVTPYVQKGVFKHIADPKLKGNFDLEQLKSVIMIAVRCT  301

Query  2478  QNQPEKRPTMLEVVELLK-GESKEK--LAALENNE  2383
              + P+KRP+M+EVVE LK G SK K  +  L NN+
Sbjct  302   DSSPDKRPSMIEVVEWLKDGVSKRKKEIPNLSNNK  336



>ref|XP_011041654.1| PREDICTED: PTI1-like tyrosine-protein kinase At3g15890 isoform 
X2 [Populus euphratica]
Length=354

 Score =   321 bits (822),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 155/289 (54%), Positives = 201/289 (70%), Gaps = 6/289 (2%)
 Frame = -2

Query  3198  YWGQLWDGSQIAVKRLKEWSNTAEVEFAAEVEILARARHKNLLALRGYCSEGQEHVLVYD  3019
             YWG+   G +IAVKRLK  S  AE+EFA EVEIL R RHKNLL LRG+ + G E ++VYD
Sbjct  65    YWGRTSTGIEIAVKRLKAMSAKAEMEFAVEVEILGRVRHKNLLGLRGFYAGGDERLIVYD  124

Query  3018  YVPNFSLLSHLHGQYSADTLLDWKKRISIAVGSAEGIAYLHHDATPHIIHGDIKAGNVLL  2839
             Y+PN SL++HLHGQ + D LLDW +R++IA+GSAEGIAYLHH+A PHIIH DIKA NVLL
Sbjct  125   YMPNHSLIAHLHGQLAVDCLLDWHRRMNIAIGSAEGIAYLHHEANPHIIHRDIKASNVLL  184

Query  2838  DSNFQAQLAGFGIANFFPDDATRVTTRSKGTLGYLAPEYVMLGKESKSCDVYSFGILLLE  2659
             D+ FQA++A FG A   P+  T +TTR KGTLGYLAPEY M GK S+SCDVYSFGILLLE
Sbjct  185   DTEFQAKVADFGFAKLIPEGVTHMTTRVKGTLGYLAPEYAMWGKVSESCDVYSFGILLLE  244

Query  2658  LASGKKPIKKVSASKNWTITDWALPLACEGKFSELADPTLNGNYVEEELKRIVYVALICA  2479
             + S KKP++K+       I  W  P   +G F  +ADP L G Y   +L+  + +A+ C 
Sbjct  245   IISAKKPLEKLPGGVRRDIVQWVTPYVQKGAFDHIADPRLKGRYDRAQLETAIMIAMRCT  304

Query  2478  QNQPEKRPTMLEVVELLKG--ESKEKLAALEN----NEMFKNLKAATHK  2350
              + PE RP+M++VVE L G  E  + ++ +E+    +E F+  +   H+
Sbjct  305   DSNPENRPSMMKVVEWLNGGLEGTKGVSDVEDMVDEDEEFRERRTWQHR  353



>ref|XP_006829142.1| hypothetical protein AMTR_s00001p00269270 [Amborella trichopoda]
 gb|ERM96558.1| hypothetical protein AMTR_s00001p00269270 [Amborella trichopoda]
Length=337

 Score =   320 bits (819),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 156/305 (51%), Positives = 206/305 (68%), Gaps = 9/305 (3%)
 Frame = -2

Query  3198  YWGQLWDGSQIAVKRLKEWSNTAEVEFAAEVEILARARHKNLLALRGYCSEGQEHVLVYD  3019
             YWG+  DGS+IAVKRLK  +  AE+EFA EVEIL R RHKNLL L G+ + G+E ++VYD
Sbjct  37    YWGRTSDGSEIAVKRLKSMTAKAEMEFAVEVEILGRVRHKNLLGLLGFYAGGEERLIVYD  96

Query  3018  YVPNFSLLSHLHGQYSADTLLDWKKRISIAVGSAEGIAYLHHDATPHIIHGDIKAGNVLL  2839
             Y+PN SL++HLHG   A+ LLDW +R++IA+GSAEG+AYLHH+A PHIIH DIKA NVLL
Sbjct  97    YMPNHSLITHLHGPKGAEALLDWPRRMNIAIGSAEGLAYLHHEANPHIIHRDIKASNVLL  156

Query  2838  DSNFQAQLAGFGIANFFPDDATRVTTRSKGTLGYLAPEYVMLGKESKSCDVYSFGILLLE  2659
             DS+FQ ++A FG A   P+  + +TTR KGTLGYLAPEY MLGK S+SCDVYSFGILLLE
Sbjct  157   DSDFQPKVADFGFAKLIPEGVSHLTTRVKGTLGYLAPEYAMLGKVSESCDVYSFGILLLE  216

Query  2658  LASGKKPIKKVSASKNWTITDWALPLACEGKFSELADPTLNGNYVEEELKRIVYVALICA  2479
             + SG+KPI+K+       I  WA P   +G   ++ DP L  ++   +LK  + VA+ C 
Sbjct  217   IISGRKPIEKLPGGIKRDIGQWATPFYEKGDLHQIIDPRLRSSFDRAQLKVAIEVAMRCI  276

Query  2478  QNQPEKRPTMLEVVELLKGESKEKLAALENNEMFKNLKAATHKDGCAHEDSQEFISEKQV  2299
             ++ PE RPTM+E+V+ LKG  +         +M K +K     +    +D   +  E  V
Sbjct  277   ESTPELRPTMIEIVDTLKGGGE---------KMKKEIKIMELSNSTITDDDSYYYEENVV  327

Query  2298  LEPEI  2284
                E+
Sbjct  328   RRTEV  332



>gb|ACM89573.1| receptor protein kinase [Glycine max]
Length=227

 Score =   315 bits (806),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 153/215 (71%), Positives = 179/215 (83%), Gaps = 2/215 (1%)
 Frame = -2

Query  2940  ISIAVGSAEGIAYLHHDATPHIIHGDIKAGNVLLDSNFQAQLAGFGIANFFPDDATRVTT  2761
             ++IA+GSAEGIAYLHH +TPHIIH DIKA NVLLDS+FQA++A FG A   PD AT VTT
Sbjct  1     MNIAIGSAEGIAYLHHQSTPHIIHRDIKASNVLLDSDFQARVADFGFAKLIPDGATHVTT  60

Query  2760  RSKGTLGYLAPEYVMLGKESKSCDVYSFGILLLELASGKKPIKKVSASKNWTITDWALPL  2581
             R KGTLGYLAPEY MLGK ++SCDVYSFGILLLELASGKKP++K+S++   +I DWALPL
Sbjct  61    RVKGTLGYLAPEYAMLGKANESCDVYSFGILLLELASGKKPLEKLSSAVKRSINDWALPL  120

Query  2580  ACEGKFSELADPTLNGNYVEEELKRIVYVALICAQNQPEKRPTMLEVVELLKGESKEKLA  2401
             ACE KFSELADP L GNY EEELKR+V +AL+CAQ+Q EKRPT+LEVVELLKGESK+KLA
Sbjct  121   ACEKKFSELADPKLEGNYAEEELKRVVLIALLCAQSQAEKRPTILEVVELLKGESKDKLA  180

Query  2400  ALENNEMFKNLKAATHKDG--CAHEDSQEFISEKQ  2302
              LENNE+F+N  A  H D    A E S +FISE++
Sbjct  181   QLENNELFQNPPAVGHTDDGTVAAEGSSDFISEEK  215



>ref|XP_011041653.1| PREDICTED: PTI1-like tyrosine-protein kinase At3g15890 isoform 
X1 [Populus euphratica]
Length=376

 Score =   320 bits (820),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 155/294 (53%), Positives = 200/294 (68%), Gaps = 1/294 (0%)
 Frame = -2

Query  3198  YWGQLWDGSQIAVKRLKEWSNTAEVEFAAEVEILARARHKNLLALRGYCSEGQEHVLVYD  3019
             YWG+   G +IAVKRLK  S  AE+EFA EVEIL R RHKNLL LRG+ + G E ++VYD
Sbjct  65    YWGRTSTGIEIAVKRLKAMSAKAEMEFAVEVEILGRVRHKNLLGLRGFYAGGDERLIVYD  124

Query  3018  YVPNFSLLSHLHGQYSADTLLDWKKRISIAVGSAEGIAYLHHDATPHIIHGDIKAGNVLL  2839
             Y+PN SL++HLHGQ + D LLDW +R++IA+GSAEGIAYLHH+A PHIIH DIKA NVLL
Sbjct  125   YMPNHSLIAHLHGQLAVDCLLDWHRRMNIAIGSAEGIAYLHHEANPHIIHRDIKASNVLL  184

Query  2838  DSNFQAQLAGFGIANFFPDDATRVTTRSKGTLGYLAPEYVMLGKESKSCDVYSFGILLLE  2659
             D+ FQA++A FG A   P+  T +TTR KGTLGYLAPEY M GK S+SCDVYSFGILLLE
Sbjct  185   DTEFQAKVADFGFAKLIPEGVTHMTTRVKGTLGYLAPEYAMWGKVSESCDVYSFGILLLE  244

Query  2658  LASGKKPIKKVSASKNWTITDWALPLACEGKFSELADPTLNGNYVEEELKRIVYVALICA  2479
             + S KKP++K+       I  W  P   +G F  +ADP L G Y   +L+  + +A+ C 
Sbjct  245   IISAKKPLEKLPGGVRRDIVQWVTPYVQKGAFDHIADPRLKGRYDRAQLETAIMIAMRCT  304

Query  2478  QNQPEKRPTMLEVVELLKGESKEKLAALENNEMFKNLKAATHKDGCAHEDSQEF  2317
              + PE RP+M++VVE L G   E    + + E   +     + +G  +ED  ++
Sbjct  305   DSNPENRPSMMKVVEWLNG-GLEGTKGVSDVEDMVDEDEEQNYNGMEYEDDTDY  357



>ref|XP_004150305.1| PREDICTED: PTI1-like tyrosine-protein kinase At3g15890-like [Cucumis 
sativus]
Length=366

 Score =   319 bits (818),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 155/274 (57%), Positives = 200/274 (73%), Gaps = 2/274 (1%)
 Frame = -2

Query  3198  YWGQLWDGSQIAVKRLKEWSNTAEVEFAAEVEILARARHKNLLALRGYCSEGQEHVLVYD  3019
             YWG+   G  IAVKRLK  +  AE+EFA EVEILAR RH+NLL LRG+ + G+E ++VYD
Sbjct  58    YWGRTSKGVDIAVKRLKAMTAKAEMEFAVEVEILARVRHENLLGLRGFYAGGEERLIVYD  117

Query  3018  YVPNFSLLSHLHGQYSADTLLDWKKRISIAVGSAEGIAYLHHDATPHIIHGDIKAGNVLL  2839
             Y+PN SLLSHLHGQ +   LLDWK+R++IA+G+A+G++YLHH+A PHIIH DIKA NVLL
Sbjct  118   YMPNHSLLSHLHGQLADQCLLDWKRRVNIAIGAAKGLSYLHHEAQPHIIHRDIKASNVLL  177

Query  2838  DSNFQAQLAGFGIANFFPDDATRVTTRSKGTLGYLAPEYVMLGKESKSCDVYSFGILLLE  2659
             DS+F+A++A FG A   PD  + +TTR KGTLGYLAPEY M GK ++SCDVYSFGILLLE
Sbjct  178   DSHFEAKVADFGFAKLIPDGVSHLTTRVKGTLGYLAPEYAMWGKVAESCDVYSFGILLLE  237

Query  2658  LASGKKPIKKVSASKNWTITDWALPLACEGKFSELADPTLNGNYVEEELKRIVYVALICA  2479
             + SG+KP++K+       I  WA P A    F ++ADP LN NY   +LK IV +AL C 
Sbjct  238   IVSGRKPLEKLPNGTKRDIVQWATPYAQTEDFDQIADPRLNQNYDVNDLKSIVTIALRCT  297

Query  2478  QNQPEKRPTMLEVVELLKG--ESKEKLAALENNE  2383
                 E RP+M +VV  LK   ++K+++  L+NNE
Sbjct  298   DGNAESRPSMKQVVAWLKDGLDTKKEMPHLKNNE  331



>ref|XP_004496638.1| PREDICTED: PTI1-like tyrosine-protein kinase At3g15890-like [Cicer 
arietinum]
Length=367

 Score =   319 bits (817),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 148/258 (57%), Positives = 190/258 (74%), Gaps = 0/258 (0%)
 Frame = -2

Query  3198  YWGQLWDGSQIAVKRLKEWSNTAEVEFAAEVEILARARHKNLLALRGYCSEGQEHVLVYD  3019
             YWG+   G +IAVKRLK  +  AE+EFA EVE+L R RHKNLL LRG+ + G+E ++VYD
Sbjct  62    YWGRTSKGVEIAVKRLKTMTAKAEMEFAVEVEVLGRVRHKNLLGLRGFYAGGEERLIVYD  121

Query  3018  YVPNFSLLSHLHGQYSADTLLDWKKRISIAVGSAEGIAYLHHDATPHIIHGDIKAGNVLL  2839
             Y+PN SLL+HLHGQ ++D LLDW KR++I +G+AEG+ YLHH+A PHIIH DIKA NVLL
Sbjct  122   YMPNHSLLTHLHGQLASDCLLDWPKRMNITIGAAEGLEYLHHEANPHIIHRDIKASNVLL  181

Query  2838  DSNFQAQLAGFGIANFFPDDATRVTTRSKGTLGYLAPEYVMLGKESKSCDVYSFGILLLE  2659
             D+ F+A++A FG A   P+  + +TTR KGTLGYLAPEY M GK S+SCDVYSFGILLLE
Sbjct  182   DTEFEAKVADFGFAKLIPEGVSHLTTRVKGTLGYLAPEYAMWGKVSESCDVYSFGILLLE  241

Query  2658  LASGKKPIKKVSASKNWTITDWALPLACEGKFSELADPTLNGNYVEEELKRIVYVALICA  2479
             + S KKPI+K+       I  W  P   +G F  +ADP L GN+  E+LK ++ +A+ C 
Sbjct  242   IISAKKPIEKLPGGIKRDIVQWVTPYVQKGVFKHIADPKLKGNFDLEQLKSVIMIAMRCT  301

Query  2478  QNQPEKRPTMLEVVELLK  2425
              + P+KRP+M EVVE LK
Sbjct  302   DSSPDKRPSMEEVVEWLK  319



>ref|XP_009408721.1| PREDICTED: PTI1-like tyrosine-protein kinase At3g15890 [Musa 
acuminata subsp. malaccensis]
Length=317

 Score =   317 bits (811),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 151/260 (58%), Positives = 192/260 (74%), Gaps = 0/260 (0%)
 Frame = -2

Query  3198  YWGQLWDGSQIAVKRLKEWSNTAEVEFAAEVEILARARHKNLLALRGYCSEGQEHVLVYD  3019
             YWG+   G +IAVKRLK  +  AE+EFA EVEILAR RH+NLL+LRG+ +  +E ++VYD
Sbjct  58    YWGRTSKGVEIAVKRLKAMTAKAEMEFAIEVEILARVRHENLLSLRGFSAGRKERLIVYD  117

Query  3018  YVPNFSLLSHLHGQYSADTLLDWKKRISIAVGSAEGIAYLHHDATPHIIHGDIKAGNVLL  2839
             Y+PN SL  HLHG+ S + LLDW+ R+ IA+G+AEG+AYLHH+A+PHIIH DIKA NVLL
Sbjct  118   YMPNNSLHCHLHGRRSPEVLLDWRTRMRIAIGAAEGLAYLHHEASPHIIHRDIKASNVLL  177

Query  2838  DSNFQAQLAGFGIANFFPDDATRVTTRSKGTLGYLAPEYVMLGKESKSCDVYSFGILLLE  2659
             D++F  ++A FG A   P+  + +TTR KGTLGYLAPEY MLGK S+SCDVYSFGILLLE
Sbjct  178   DADFCPKVADFGFAKLIPEGVSHMTTRVKGTLGYLAPEYAMLGKVSESCDVYSFGILLLE  237

Query  2658  LASGKKPIKKVSASKNWTITDWALPLACEGKFSELADPTLNGNYVEEELKRIVYVALICA  2479
             + S +KPI+K+S      I  WA PLA  G +  +ADP L G + ++EL+  V +AL CA
Sbjct  238   IVSARKPIEKLSGGVMRDIVQWASPLAANGAWDRIADPRLGGRFKQDELQDAVVIALRCA  297

Query  2478  QNQPEKRPTMLEVVELLKGE  2419
                P+ RPTM EVV LLKG 
Sbjct  298   DINPDNRPTMKEVVALLKGR  317



>ref|XP_004234145.1| PREDICTED: PTI1-like tyrosine-protein kinase At3g15890 [Solanum 
lycopersicum]
Length=365

 Score =   318 bits (815),  Expect = 6e-95, Method: Compositional matrix adjust.
 Identities = 150/257 (58%), Positives = 188/257 (73%), Gaps = 0/257 (0%)
 Frame = -2

Query  3198  YWGQLWDGSQIAVKRLKEWSNTAEVEFAAEVEILARARHKNLLALRGYCSEGQEHVLVYD  3019
             YWG+   G +IAVKRLK  S  AE+EFA EVEIL R RHKNLL LRG+ +   E ++VYD
Sbjct  58    YWGRTSKGIEIAVKRLKAMSAKAEMEFAIEVEILGRVRHKNLLGLRGFYAGEDERLIVYD  117

Query  3018  YVPNFSLLSHLHGQYSADTLLDWKKRISIAVGSAEGIAYLHHDATPHIIHGDIKAGNVLL  2839
             Y+PN SL++HLHG  SAD LLDW +R+ IA+GSA+G+ YLHH+A PHIIH DIKA NVLL
Sbjct  118   YMPNHSLITHLHGTLSADCLLDWPRRMKIAMGSADGLCYLHHEANPHIIHRDIKASNVLL  177

Query  2838  DSNFQAQLAGFGIANFFPDDATRVTTRSKGTLGYLAPEYVMLGKESKSCDVYSFGILLLE  2659
             DSNFQA++A FG A   PD  T +TTR KGTLGYLAPEY M GK S+SCDVYSFGILLLE
Sbjct  178   DSNFQAKVADFGFAKLIPDGVTHLTTRVKGTLGYLAPEYAMWGKVSESCDVYSFGILLLE  237

Query  2658  LASGKKPIKKVSASKNWTITDWALPLACEGKFSELADPTLNGNYVEEELKRIVYVALICA  2479
             + S +KP++K++      I  WALP   +G F+ +ADP L G +  ++LK  + +A+ C 
Sbjct  238   IISARKPLEKLANGVKRDIVQWALPYIQKGDFNHIADPRLKGKFNLQQLKNTILIAIKCT  297

Query  2478  QNQPEKRPTMLEVVELL  2428
                PE RP+ML+VV+ L
Sbjct  298   DGNPENRPSMLQVVDWL  314



>gb|KHN02777.1| PTI1-like tyrosine-protein kinase [Glycine soja]
Length=370

 Score =   318 bits (815),  Expect = 6e-95, Method: Compositional matrix adjust.
 Identities = 154/265 (58%), Positives = 190/265 (72%), Gaps = 7/265 (3%)
 Frame = -2

Query  3198  YWGQL------WDGSQIAVKRLKEWSNTAEVEFAAEVEILARARHKNLLALRGYCSEGQE  3037
             YWG+       W+  QIAVKRLK  +  AE+EFA EVE+L R RHKNLL LRG+ + G E
Sbjct  60    YWGRTRLIYNEWN-LQIAVKRLKTMTAKAEMEFAVEVEVLGRVRHKNLLGLRGFYAGGDE  118

Query  3036  HVLVYDYVPNFSLLSHLHGQYSADTLLDWKKRISIAVGSAEGIAYLHHDATPHIIHGDIK  2857
              ++VYDY+PN SLL+HLHGQ + D LLDW +R+SIA+G+AEG+ YLHH+A PHIIH DIK
Sbjct  119   RLIVYDYMPNHSLLTHLHGQLATDCLLDWPRRMSIAIGAAEGLVYLHHEANPHIIHRDIK  178

Query  2856  AGNVLLDSNFQAQLAGFGIANFFPDDATRVTTRSKGTLGYLAPEYVMLGKESKSCDVYSF  2677
             A NVLLD+ F+A++A FG A   P+  + +TTR KGTLGYLAPEY M GK S SCDVYSF
Sbjct  179   ASNVLLDTEFEAKVADFGFAKLIPEGVSHLTTRVKGTLGYLAPEYAMWGKVSGSCDVYSF  238

Query  2676  GILLLELASGKKPIKKVSASKNWTITDWALPLACEGKFSELADPTLNGNYVEEELKRIVY  2497
             GILLLE+ S KKPI+K+       I  W  P   +G F  +ADP L G++  E+LK +V 
Sbjct  239   GILLLEIVSAKKPIEKLPGGVKRDIVQWVTPHVQKGNFIHIADPKLKGHFDLEQLKSVVM  298

Query  2496  VALICAQNQPEKRPTMLEVVELLKG  2422
             +A+ C  N PEKRPTM EVVE LKG
Sbjct  299   IAMRCTDNSPEKRPTMQEVVEWLKG  323



>ref|XP_004160904.1| PREDICTED: LOW QUALITY PROTEIN: PTI1-like tyrosine-protein kinase 
At3g15890-like [Cucumis sativus]
Length=347

 Score =   317 bits (812),  Expect = 7e-95, Method: Compositional matrix adjust.
 Identities = 154/274 (56%), Positives = 199/274 (73%), Gaps = 2/274 (1%)
 Frame = -2

Query  3198  YWGQLWDGSQIAVKRLKEWSNTAEVEFAAEVEILARARHKNLLALRGYCSEGQEHVLVYD  3019
             YWG+   G  IAVKRLK  +  AE+EFA EVEILAR RH+NLL LRG+ + G+E ++VYD
Sbjct  39    YWGRTSKGVDIAVKRLKAMTAKAEMEFAVEVEILARVRHENLLGLRGFYAGGEERLIVYD  98

Query  3018  YVPNFSLLSHLHGQYSADTLLDWKKRISIAVGSAEGIAYLHHDATPHIIHGDIKAGNVLL  2839
             Y+PN SLLSHLHGQ +   LLDWK+R++IA+G+A+G++YLHH+A PHIIH DIKA NVLL
Sbjct  99    YMPNHSLLSHLHGQLADQCLLDWKRRVNIAIGAAKGLSYLHHEAQPHIIHRDIKASNVLL  158

Query  2838  DSNFQAQLAGFGIANFFPDDATRVTTRSKGTLGYLAPEYVMLGKESKSCDVYSFGILLLE  2659
             DS+F+A++A FG A   PD  + +TTR KGTLGYLAPEY M  K ++SCDVYSFGILLLE
Sbjct  159   DSHFEAKVADFGFAKLIPDGVSHLTTRVKGTLGYLAPEYAMWXKVAESCDVYSFGILLLE  218

Query  2658  LASGKKPIKKVSASKNWTITDWALPLACEGKFSELADPTLNGNYVEEELKRIVYVALICA  2479
             + SG+KP++K+       I  WA P A    F ++ADP LN NY   +LK IV +AL C 
Sbjct  219   IVSGRKPLEKLPNGTKRDIVQWATPYAQTEDFDQIADPRLNQNYDVNDLKSIVTIALRCT  278

Query  2478  QNQPEKRPTMLEVVELLKG--ESKEKLAALENNE  2383
                 E RP+M +VV  LK   ++K+++  L+NNE
Sbjct  279   DGNAESRPSMKQVVAWLKDGLDTKKEMPHLKNNE  312



>ref|XP_008439143.1| PREDICTED: PTI1-like tyrosine-protein kinase At3g15890 [Cucumis 
melo]
Length=364

 Score =   317 bits (813),  Expect = 8e-95, Method: Compositional matrix adjust.
 Identities = 154/274 (56%), Positives = 199/274 (73%), Gaps = 2/274 (1%)
 Frame = -2

Query  3198  YWGQLWDGSQIAVKRLKEWSNTAEVEFAAEVEILARARHKNLLALRGYCSEGQEHVLVYD  3019
             YWG+   G  IAVKRLK  +  AE+EFA EVEILAR RH+NLL LRG+ + G+E ++VYD
Sbjct  58    YWGRTSKGVDIAVKRLKAMTAKAEMEFAVEVEILARVRHENLLGLRGFYAGGEERLIVYD  117

Query  3018  YVPNFSLLSHLHGQYSADTLLDWKKRISIAVGSAEGIAYLHHDATPHIIHGDIKAGNVLL  2839
             Y+PN SLLSHLHGQ +   LLDWK+R++IA+G+AEG++YLHH+A PHIIH DIKA NVLL
Sbjct  118   YMPNHSLLSHLHGQLADQCLLDWKRRVNIAIGAAEGLSYLHHEAQPHIIHRDIKASNVLL  177

Query  2838  DSNFQAQLAGFGIANFFPDDATRVTTRSKGTLGYLAPEYVMLGKESKSCDVYSFGILLLE  2659
             +S+F+A++A FG A   PD  + +TTR KGTLGYLAPEY M GK ++SCDVYSFGILLLE
Sbjct  178   NSDFEAKVADFGFAKLIPDGVSHLTTRVKGTLGYLAPEYAMWGKVAESCDVYSFGILLLE  237

Query  2658  LASGKKPIKKVSASKNWTITDWALPLACEGKFSELADPTLNGNYVEEELKRIVYVALICA  2479
             + SG+KP++K+       I  WA P A    F ++ADP LN N+   +LK IV +AL C 
Sbjct  238   IVSGRKPLEKLPNGTKRDIVQWATPYAQTEDFDQIADPRLNQNFDVHDLKSIVTIALRCT  297

Query  2478  QNQPEKRPTMLEVVELLKG--ESKEKLAALENNE  2383
                 E RP+M +VV  LK    +K+++  L+NNE
Sbjct  298   DGNAESRPSMKQVVAWLKDGLSTKKEMPHLKNNE  331



>gb|EYU25031.1| hypothetical protein MIMGU_mgv1a018166mg, partial [Erythranthe 
guttata]
Length=318

 Score =   316 bits (809),  Expect = 8e-95, Method: Compositional matrix adjust.
 Identities = 152/261 (58%), Positives = 187/261 (72%), Gaps = 3/261 (1%)
 Frame = -2

Query  3198  YWGQLWDGS---QIAVKRLKEWSNTAEVEFAAEVEILARARHKNLLALRGYCSEGQEHVL  3028
             YWG+        QIAVKRLK  +  AE+EFA EVEIL R RHKNLL LRG+ + G E ++
Sbjct  58    YWGRTKTRKMILQIAVKRLKAMTAKAEMEFAVEVEILGRVRHKNLLGLRGFYAGGDERLI  117

Query  3027  VYDYVPNFSLLSHLHGQYSADTLLDWKKRISIAVGSAEGIAYLHHDATPHIIHGDIKAGN  2848
             VYDY+PN SLL+HLHGQ + D LLDW +RI IA+GSAEG+ YLHH+A PHIIH DIKA N
Sbjct  118   VYDYMPNHSLLTHLHGQLAVDCLLDWPRRIKIAIGSAEGLVYLHHEANPHIIHRDIKASN  177

Query  2847  VLLDSNFQAQLAGFGIANFFPDDATRVTTRSKGTLGYLAPEYVMLGKESKSCDVYSFGIL  2668
             VLLDS F+A++A FG A   P+  T +TTR KGTLGYLAPEY M GK S+SCDVYSFGIL
Sbjct  178   VLLDSEFEAKVADFGFAKLIPEGVTHLTTRVKGTLGYLAPEYAMWGKVSESCDVYSFGIL  237

Query  2667  LLELASGKKPIKKVSASKNWTITDWALPLACEGKFSELADPTLNGNYVEEELKRIVYVAL  2488
             LLE++SG+KP++K++      I  WA P   +G F  + DP L G +   ELKR+V +A+
Sbjct  238   LLEISSGRKPLEKLAGGVRRDIVQWATPYVHKGDFDHIVDPRLKGCFDRSELKRVVSIAM  297

Query  2487  ICAQNQPEKRPTMLEVVELLK  2425
              C    PE RP+M+EVV  LK
Sbjct  298   RCTDGNPENRPSMVEVVGWLK  318



>ref|XP_004309246.1| PREDICTED: PTI1-like tyrosine-protein kinase At3g15890-like [Fragaria 
vesca subsp. vesca]
Length=369

 Score =   317 bits (812),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 155/298 (52%), Positives = 205/298 (69%), Gaps = 6/298 (2%)
 Frame = -2

Query  3198  YWGQLWDGSQIAVKRLKEWSNTAEVEFAAEVEILARARHKNLLALRGYCSEGQEHVLVYD  3019
             YWG+   G +IAVKRLK  S  AE+EFA EVEIL R RH+NLL LRG+ + G E ++VYD
Sbjct  60    YWGRTSKGVEIAVKRLKTMSPKAEMEFAVEVEILGRVRHRNLLGLRGFYAGGDERLIVYD  119

Query  3018  YVPNFSLLSHLHGQYSADTLLDWKKRISIAVGSAEGIAYLHHDATPHIIHGDIKAGNVLL  2839
             ++PN SL++HLHGQ + D LLDW +R+SI +GSA+G++YLHH+A PHIIH DIKA NVLL
Sbjct  120   FMPNHSLITHLHGQLANDCLLDWPRRLSIMIGSADGLSYLHHEANPHIIHRDIKASNVLL  179

Query  2838  DSNFQAQLAGFGIANFFPDDATRVTTRSKGTLGYLAPEYVMLGKESKSCDVYSFGILLLE  2659
             D++FQA++A FG A   P+  + +TTR KGTLGYLAPEY M GK S+SCDVYSFGILLLE
Sbjct  180   DNDFQAKVADFGFAKLIPEGVSHLTTRVKGTLGYLAPEYAMWGKVSESCDVYSFGILLLE  239

Query  2658  LASGKKPIKKVSASKNWTITDWALPLACEGKFSELADPTLNGNYVEEELKRIVYVALICA  2479
             + SG+KPI+K+       I  WA P   +G ++ +ADP L G +  E++K  + +A+ C 
Sbjct  240   IISGRKPIEKLPGGVKRDIVQWATPYVEKGAYNHIADPRLKGKFDREQVKFTITIAMKCT  299

Query  2478  QNQPEKRPTMLEVVELLKG----ESKE--KLAALENNEMFKNLKAATHKDGCAHEDSQ  2323
              N PE RPTM +V + LKG      KE   +  +E++E  +N    T  +G   E S 
Sbjct  300   DNSPENRPTMKQVADWLKGGMGTRKKEITNVGGMEDDENEENDGNDTDFEGYGMEVSD  357



>ref|XP_011030190.1| PREDICTED: PTI1-like tyrosine-protein kinase At3g15890 [Populus 
euphratica]
Length=343

 Score =   316 bits (809),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 148/259 (57%), Positives = 186/259 (72%), Gaps = 0/259 (0%)
 Frame = -2

Query  3198  YWGQLWDGSQIAVKRLKEWSNTAEVEFAAEVEILARARHKNLLALRGYCSEGQEHVLVYD  3019
             YWG+   G+++AVKRLK  S+ AE+EFA EVE+L R RHKNLL LRG+ + G E ++VYD
Sbjct  60    YWGRTSTGTEVAVKRLKAMSSKAEMEFAVEVEMLGRVRHKNLLGLRGFYAGGNERLIVYD  119

Query  3018  YVPNFSLLSHLHGQYSADTLLDWKKRISIAVGSAEGIAYLHHDATPHIIHGDIKAGNVLL  2839
             Y+PN SL++HLHGQ + D LLDW +R++I +GSAEGIAYLHH+A PHIIH DIKA NVLL
Sbjct  120   YMPNHSLIAHLHGQVAEDCLLDWNRRMNIMIGSAEGIAYLHHEANPHIIHRDIKASNVLL  179

Query  2838  DSNFQAQLAGFGIANFFPDDATRVTTRSKGTLGYLAPEYVMLGKESKSCDVYSFGILLLE  2659
             D  FQA++A FG A   PD  + +TTR KGTLGYLAPEY M GK S+SCDVYSFGILLLE
Sbjct  180   DVEFQAKVADFGFAKLIPDGVSHMTTRVKGTLGYLAPEYAMWGKVSESCDVYSFGILLLE  239

Query  2658  LASGKKPIKKVSASKNWTITDWALPLACEGKFSELADPTLNGNYVEEELKRIVYVALICA  2479
             + S KKP++K+       I  WA P   +G F  +ADP L G Y   +L   V +A+ C+
Sbjct  240   IISAKKPLEKLPGGLKRDIVQWATPYVQKGAFDHIADPRLKGRYDRAQLNLAVMIAMRCS  299

Query  2478  QNQPEKRPTMLEVVELLKG  2422
                 E RP+M++VVE L G
Sbjct  300   DTNVENRPSMMKVVEWLNG  318



>ref|XP_010035055.1| PREDICTED: PTI1-like tyrosine-protein kinase At3g15890 isoform 
X1 [Eucalyptus grandis]
Length=369

 Score =   317 bits (811),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 151/264 (57%), Positives = 190/264 (72%), Gaps = 0/264 (0%)
 Frame = -2

Query  3198  YWGQLWDGSQIAVKRLKEWSNTAEVEFAAEVEILARARHKNLLALRGYCSEGQEHVLVYD  3019
             YWG+   G +IAVKRLK  S  AE+EFA EVEIL R RH+NLL LRG+ + G E ++VYD
Sbjct  59    YWGRTSKGVEIAVKRLKAMSPKAEMEFAVEVEILGRVRHENLLGLRGFYAGGDERLIVYD  118

Query  3018  YVPNFSLLSHLHGQYSADTLLDWKKRISIAVGSAEGIAYLHHDATPHIIHGDIKAGNVLL  2839
             Y+PN SL +HLHGQ + D LLDW +R+SI +GSAEG+AYLHH+A PHIIH DIKA NVLL
Sbjct  119   YMPNHSLTTHLHGQLAEDCLLDWPRRMSIVLGSAEGLAYLHHEANPHIIHRDIKASNVLL  178

Query  2838  DSNFQAQLAGFGIANFFPDDATRVTTRSKGTLGYLAPEYVMLGKESKSCDVYSFGILLLE  2659
             D+ FQA++A FG A   PD  + +TT+ KGTLGYLAPEY M GK S+SCDVYSFGILLLE
Sbjct  179   DNQFQAKVADFGFAKLIPDGVSHLTTKVKGTLGYLAPEYAMWGKVSESCDVYSFGILLLE  238

Query  2658  LASGKKPIKKVSASKNWTITDWALPLACEGKFSELADPTLNGNYVEEELKRIVYVALICA  2479
             + S KKP++K+       I  W  P   +G F  +ADP L G+Y  +ELK  V +A+ C 
Sbjct  239   IISAKKPLEKLPGGVKRDIVQWVTPYVQKGAFDCIADPRLKGDYEPDELKLAVMIAMRCT  298

Query  2478  QNQPEKRPTMLEVVELLKGESKEK  2407
              + P+ RP+M+EVV+ LKG  + K
Sbjct  299   DHSPDNRPSMIEVVQWLKGGLRRK  322



>ref|XP_010035056.1| PREDICTED: PTI1-like tyrosine-protein kinase At3g15890 isoform 
X2 [Eucalyptus grandis]
Length=367

 Score =   316 bits (810),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 151/264 (57%), Positives = 190/264 (72%), Gaps = 0/264 (0%)
 Frame = -2

Query  3198  YWGQLWDGSQIAVKRLKEWSNTAEVEFAAEVEILARARHKNLLALRGYCSEGQEHVLVYD  3019
             YWG+   G +IAVKRLK  S  AE+EFA EVEIL R RH+NLL LRG+ + G E ++VYD
Sbjct  57    YWGRTSKGVEIAVKRLKAMSPKAEMEFAVEVEILGRVRHENLLGLRGFYAGGDERLIVYD  116

Query  3018  YVPNFSLLSHLHGQYSADTLLDWKKRISIAVGSAEGIAYLHHDATPHIIHGDIKAGNVLL  2839
             Y+PN SL +HLHGQ + D LLDW +R+SI +GSAEG+AYLHH+A PHIIH DIKA NVLL
Sbjct  117   YMPNHSLTTHLHGQLAEDCLLDWPRRMSIVLGSAEGLAYLHHEANPHIIHRDIKASNVLL  176

Query  2838  DSNFQAQLAGFGIANFFPDDATRVTTRSKGTLGYLAPEYVMLGKESKSCDVYSFGILLLE  2659
             D+ FQA++A FG A   PD  + +TT+ KGTLGYLAPEY M GK S+SCDVYSFGILLLE
Sbjct  177   DNQFQAKVADFGFAKLIPDGVSHLTTKVKGTLGYLAPEYAMWGKVSESCDVYSFGILLLE  236

Query  2658  LASGKKPIKKVSASKNWTITDWALPLACEGKFSELADPTLNGNYVEEELKRIVYVALICA  2479
             + S KKP++K+       I  W  P   +G F  +ADP L G+Y  +ELK  V +A+ C 
Sbjct  237   IISAKKPLEKLPGGVKRDIVQWVTPYVQKGAFDCIADPRLKGDYEPDELKLAVMIAMRCT  296

Query  2478  QNQPEKRPTMLEVVELLKGESKEK  2407
              + P+ RP+M+EVV+ LKG  + K
Sbjct  297   DHSPDNRPSMIEVVQWLKGGLRRK  320



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 10404358572504